data_5TXN
# 
_entry.id   5TXN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5TXN         
WWPDB D_1000224952 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5TXL unspecified 
PDB . 5TXM unspecified 
PDB . 5TXO unspecified 
PDB . 5TXP unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5TXN 
_pdbx_database_status.recvd_initial_deposition_date   2016-11-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Das, K.'        1 ? 
'Martinez, S.M.' 2 ? 
'Arnold, E.'     3 ? 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? US ? ? primary 'Antimicrob. Agents Chemother.' AMACCQ 0788 1098-6596 ? ? 61  ? ?     ? 
'Structural Insights into HIV Reverse Transcriptase Mutations Q151M and Q151M Complex That Confer Multinucleoside Drug Resistance.' 
2017 ? 10.1128/AAC.00224-17    28396546 ? 
? ? ? ? ? ? ? US ? ? 1       J.Biol.Chem.                    JBCHA3 0071 0021-9258 ? ? 284 ? 35092 ? 
;Structural Basis For The Role Of The K65R Mutation In Hiv-1 Reverse Transcriptase Polymerization, Excision Antagonism, And Tenofovir Resistance.
;
2009 ? 10.1074/JBC.M109.022525 19812032 ? 
? ? ? ? ? ? ? US ? ? 2       Nat.Struct.Mol.Biol.            ?      ?    1545-9993 ? ? 17  ? 1202  ? 
'Structural Basis Of Hiv-1 Resistance To Azt By Excision.' 2010 ? 10.1038/NSMB.1908       20852643 ? 
? ? ? ? ? ? ? US ? ? 3       Proc.Natl.Acad.Sci.Usa          PNASA6 0040 0027-8424 ? ? 105 ? 1466  ? 
;High-Resolution Structures Of Hiv-1 Reverse Transcriptase/Tmc278 Complexes: Strategic Flexibility Explains Potency Against Resistance Mutations.
;
2008 ? 10.1073/PNAS.0711209105 18230722 ? 
? ? ? ? ? ? ? US ? ? 4       J.Med.Chem.                     JMCMAR 0151 0022-2623 ? ? 47  ? 2550  ? 
;Roles Of Conformational And Positional Adaptability In Structure-Based Design Of Tmc125-R165335 (Etravirine) And Related Non-Nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent And Effective Against Wild-Type And Drug-Resistant Hiv-1 Variants.
;
2004 ? 10.1021/JM030558S       15115397 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Das, K.'            1  ? 
primary 'Martinez, S.E.'     2  ? 
primary 'Arnold, E.'         3  ? 
1       'Das, K.'            4  ? 
1       'Bandwar, R.P.'      5  ? 
1       'White, K.L.'        6  ? 
1       'Feng, J.Y.'         7  ? 
1       'Sarafianos, S.G.'   8  ? 
1       'Tuske, S.'          9  ? 
1       'Tu, X.'             10 ? 
1       'Clark, A.D.'        11 ? 
1       'Boyer, P.L.'        12 ? 
1       'Hou, X.'            13 ? 
1       'Gaffney, B.L.'      14 ? 
1       'Jones, R.A.'        15 ? 
1       'Miller, M.D.'       16 ? 
1       'Hughes, S.H.'       17 ? 
1       'Arnold, E.'         18 ? 
2       'Tu, X.'             19 ? 
2       'Das, K.'            20 ? 
2       'Han, Q.'            21 ? 
2       'Bauman, J.D.'       22 ? 
2       'Clark, A.D.'        23 ? 
2       'Hou, X.'            24 ? 
2       'Frenkel, Y.V.'      25 ? 
2       'Gaffney, B.L.'      26 ? 
2       'Jones, R.A.'        27 ? 
2       'Boyer, P.L.'        28 ? 
2       'Hughes, S.H.'       29 ? 
2       'Sarafianos, S.G.'   30 ? 
2       'Arnold, E.'         31 ? 
3       'Das, K.'            32 ? 
3       'Bauman, J.D.'       33 ? 
3       'Clark, A.D.'        34 ? 
3       'Frenkel, Y.V.'      35 ? 
3       'Lewi, P.J.'         36 ? 
3       'Shatkin, A.J.'      37 ? 
3       'Hughes, S.H.'       38 ? 
3       'Arnold, E.'         39 ? 
4       'Das, K.'            40 ? 
4       'Clark, A.D.'        41 ? 
4       'Lewi, P.J.'         42 ? 
4       'Heeres, J.'         43 ? 
4       'De Jonge, M.R.'     44 ? 
4       'Koymans, L.M.'      45 ? 
4       'Vinkers, H.M.'      46 ? 
4       'Daeyaert, F.'       47 ? 
4       'Ludovici, D.W.'     48 ? 
4       'Kukla, M.J.'        49 ? 
4       'De Corte, B.'       50 ? 
4       'Kavash, R.W.'       51 ? 
4       'Ho, C.Y.'           52 ? 
4       'Ye, H.'             53 ? 
4       'Lichtenstein, M.A.' 54 ? 
4       'Andries, K.'        55 ? 
4       'Pauwels, R.'        56 ? 
4       'De Bethune, M.P.'   57 ? 
4       'Boyer, P.L.'        58 ? 
4       'Clark, P.'          59 ? 
4       'Hughes, S.H.'       60 ? 
4       'Janssen, P.A.'      61 ? 
4       'Arnold, E.'         62 ? 
# 
_cell.entry_id           5TXN 
_cell.length_a           90.039 
_cell.length_b           133.634 
_cell.length_c           139.206 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.88 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5TXN 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT'                                                64025.477 2   
2.7.7.49,2.7.7.7 'Q151M, Q258C, C280S, D498N' ? ? 
2  polymer     man 'HIV-1 REVERSE TRANSCRIPTASE P51 SUBUNIT'                                                50039.488 2   
2.7.7.49,2.7.7.7 C280S                        ? ? 
3  polymer     syn 
;DNA (5'-D(*TP*GP*GP*TP*CP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*GP*AP*CP*TP*G)-3')
;
8383.385  2   ?                ?                            ? ? 
4  polymer     syn 
;DNA (5'-D(*CP*AP*GP*TP*CP*CP*CP*TP*GP*TP*TP*CP*GP*GP*(MRG)P*CP*GP*CP*CP*G)-3')
;
6490.267  2   ?                ?                            ? ? 
5  non-polymer syn 'MAGNESIUM ION'                                                                          24.305    4   ? ? ? ? 
6  non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   2   ?                ?                            ? ? 
7  non-polymer man SUCROSE                                                                                  342.296   2   ? ? ? ? 
8  non-polymer syn 1,2-ETHANEDIOL                                                                           62.068    2   ? ? ? ? 
9  non-polymer syn 'SULFATE ION'                                                                            96.063    1   ? ? ? ? 
10 water       nat water                                                                                    18.015    178 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Pr160Gag-Pol 
2 Pr160Gag-Pol 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPA
IFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDK
WTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVY
YDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETW
ETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTE
LQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
;
;MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPA
IFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDK
WTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVY
YDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETW
ETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTE
LQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
;
A,C ? 
2 'polypeptide(L)'        no no  
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
B,D ? 
3 polydeoxyribonucleotide no no  
;(DA)(DT)(DG)(DG)(DT)(DC)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DG)(DA)(DA)(DC)(DA)(DG)(DG)
(DG)(DA)(DC)(DT)(DG)(DT)(DG)
;
ATGGTCGGCGCCCGAACAGGGACTGTG T,E ? 
4 polydeoxyribonucleotide no yes 
;(DA)(DC)(DA)(DG)(DT)(DC)(DC)(DC)(DT)(DG)(DT)(DT)(DC)(DG)(DG)(MRG)(DC)(DG)(DC)
(DC)(DG)
;
ACAGTCCCTGTTCGGGCGCCG P,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   PRO n 
1 4   ILE n 
1 5   SER n 
1 6   PRO n 
1 7   ILE n 
1 8   GLU n 
1 9   THR n 
1 10  VAL n 
1 11  PRO n 
1 12  VAL n 
1 13  LYS n 
1 14  LEU n 
1 15  LYS n 
1 16  PRO n 
1 17  GLY n 
1 18  MET n 
1 19  ASP n 
1 20  GLY n 
1 21  PRO n 
1 22  LYS n 
1 23  VAL n 
1 24  LYS n 
1 25  GLN n 
1 26  TRP n 
1 27  PRO n 
1 28  LEU n 
1 29  THR n 
1 30  GLU n 
1 31  GLU n 
1 32  LYS n 
1 33  ILE n 
1 34  LYS n 
1 35  ALA n 
1 36  LEU n 
1 37  VAL n 
1 38  GLU n 
1 39  ILE n 
1 40  CYS n 
1 41  THR n 
1 42  GLU n 
1 43  MET n 
1 44  GLU n 
1 45  LYS n 
1 46  GLU n 
1 47  GLY n 
1 48  LYS n 
1 49  ILE n 
1 50  SER n 
1 51  LYS n 
1 52  ILE n 
1 53  GLY n 
1 54  PRO n 
1 55  GLU n 
1 56  ASN n 
1 57  PRO n 
1 58  TYR n 
1 59  ASN n 
1 60  THR n 
1 61  PRO n 
1 62  VAL n 
1 63  PHE n 
1 64  ALA n 
1 65  ILE n 
1 66  LYS n 
1 67  LYS n 
1 68  LYS n 
1 69  ASP n 
1 70  SER n 
1 71  THR n 
1 72  LYS n 
1 73  TRP n 
1 74  ARG n 
1 75  LYS n 
1 76  LEU n 
1 77  VAL n 
1 78  ASP n 
1 79  PHE n 
1 80  ARG n 
1 81  GLU n 
1 82  LEU n 
1 83  ASN n 
1 84  LYS n 
1 85  ARG n 
1 86  THR n 
1 87  GLN n 
1 88  ASP n 
1 89  PHE n 
1 90  TRP n 
1 91  GLU n 
1 92  VAL n 
1 93  GLN n 
1 94  LEU n 
1 95  GLY n 
1 96  ILE n 
1 97  PRO n 
1 98  HIS n 
1 99  PRO n 
1 100 ALA n 
1 101 GLY n 
1 102 LEU n 
1 103 LYS n 
1 104 LYS n 
1 105 LYS n 
1 106 LYS n 
1 107 SER n 
1 108 VAL n 
1 109 THR n 
1 110 VAL n 
1 111 LEU n 
1 112 ASP n 
1 113 VAL n 
1 114 GLY n 
1 115 ASP n 
1 116 ALA n 
1 117 TYR n 
1 118 PHE n 
1 119 SER n 
1 120 VAL n 
1 121 PRO n 
1 122 LEU n 
1 123 ASP n 
1 124 GLU n 
1 125 ASP n 
1 126 PHE n 
1 127 ARG n 
1 128 LYS n 
1 129 TYR n 
1 130 THR n 
1 131 ALA n 
1 132 PHE n 
1 133 THR n 
1 134 ILE n 
1 135 PRO n 
1 136 SER n 
1 137 ILE n 
1 138 ASN n 
1 139 ASN n 
1 140 GLU n 
1 141 THR n 
1 142 PRO n 
1 143 GLY n 
1 144 ILE n 
1 145 ARG n 
1 146 TYR n 
1 147 GLN n 
1 148 TYR n 
1 149 ASN n 
1 150 VAL n 
1 151 LEU n 
1 152 PRO n 
1 153 MET n 
1 154 GLY n 
1 155 TRP n 
1 156 LYS n 
1 157 GLY n 
1 158 SER n 
1 159 PRO n 
1 160 ALA n 
1 161 ILE n 
1 162 PHE n 
1 163 GLN n 
1 164 SER n 
1 165 SER n 
1 166 MET n 
1 167 THR n 
1 168 LYS n 
1 169 ILE n 
1 170 LEU n 
1 171 GLU n 
1 172 PRO n 
1 173 PHE n 
1 174 LYS n 
1 175 LYS n 
1 176 GLN n 
1 177 ASN n 
1 178 PRO n 
1 179 ASP n 
1 180 ILE n 
1 181 VAL n 
1 182 ILE n 
1 183 TYR n 
1 184 GLN n 
1 185 TYR n 
1 186 MET n 
1 187 ASP n 
1 188 ASP n 
1 189 LEU n 
1 190 TYR n 
1 191 VAL n 
1 192 GLY n 
1 193 SER n 
1 194 ASP n 
1 195 LEU n 
1 196 GLU n 
1 197 ILE n 
1 198 GLY n 
1 199 GLN n 
1 200 HIS n 
1 201 ARG n 
1 202 THR n 
1 203 LYS n 
1 204 ILE n 
1 205 GLU n 
1 206 GLU n 
1 207 LEU n 
1 208 ARG n 
1 209 GLN n 
1 210 HIS n 
1 211 LEU n 
1 212 LEU n 
1 213 ARG n 
1 214 TRP n 
1 215 GLY n 
1 216 LEU n 
1 217 THR n 
1 218 THR n 
1 219 PRO n 
1 220 ASP n 
1 221 LYS n 
1 222 LYS n 
1 223 HIS n 
1 224 GLN n 
1 225 LYS n 
1 226 GLU n 
1 227 PRO n 
1 228 PRO n 
1 229 PHE n 
1 230 LEU n 
1 231 TRP n 
1 232 MET n 
1 233 GLY n 
1 234 TYR n 
1 235 GLU n 
1 236 LEU n 
1 237 HIS n 
1 238 PRO n 
1 239 ASP n 
1 240 LYS n 
1 241 TRP n 
1 242 THR n 
1 243 VAL n 
1 244 GLN n 
1 245 PRO n 
1 246 ILE n 
1 247 VAL n 
1 248 LEU n 
1 249 PRO n 
1 250 GLU n 
1 251 LYS n 
1 252 ASP n 
1 253 SER n 
1 254 TRP n 
1 255 THR n 
1 256 VAL n 
1 257 ASN n 
1 258 ASP n 
1 259 ILE n 
1 260 CYS n 
1 261 LYS n 
1 262 LEU n 
1 263 VAL n 
1 264 GLY n 
1 265 LYS n 
1 266 LEU n 
1 267 ASN n 
1 268 TRP n 
1 269 ALA n 
1 270 SER n 
1 271 GLN n 
1 272 ILE n 
1 273 TYR n 
1 274 PRO n 
1 275 GLY n 
1 276 ILE n 
1 277 LYS n 
1 278 VAL n 
1 279 ARG n 
1 280 GLN n 
1 281 LEU n 
1 282 SER n 
1 283 LYS n 
1 284 LEU n 
1 285 LEU n 
1 286 ARG n 
1 287 GLY n 
1 288 THR n 
1 289 LYS n 
1 290 ALA n 
1 291 LEU n 
1 292 THR n 
1 293 GLU n 
1 294 VAL n 
1 295 ILE n 
1 296 PRO n 
1 297 LEU n 
1 298 THR n 
1 299 GLU n 
1 300 GLU n 
1 301 ALA n 
1 302 GLU n 
1 303 LEU n 
1 304 GLU n 
1 305 LEU n 
1 306 ALA n 
1 307 GLU n 
1 308 ASN n 
1 309 ARG n 
1 310 GLU n 
1 311 ILE n 
1 312 LEU n 
1 313 LYS n 
1 314 GLU n 
1 315 PRO n 
1 316 VAL n 
1 317 HIS n 
1 318 GLY n 
1 319 VAL n 
1 320 TYR n 
1 321 TYR n 
1 322 ASP n 
1 323 PRO n 
1 324 SER n 
1 325 LYS n 
1 326 ASP n 
1 327 LEU n 
1 328 ILE n 
1 329 ALA n 
1 330 GLU n 
1 331 ILE n 
1 332 GLN n 
1 333 LYS n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 GLY n 
1 338 GLN n 
1 339 TRP n 
1 340 THR n 
1 341 TYR n 
1 342 GLN n 
1 343 ILE n 
1 344 TYR n 
1 345 GLN n 
1 346 GLU n 
1 347 PRO n 
1 348 PHE n 
1 349 LYS n 
1 350 ASN n 
1 351 LEU n 
1 352 LYS n 
1 353 THR n 
1 354 GLY n 
1 355 LYS n 
1 356 TYR n 
1 357 ALA n 
1 358 ARG n 
1 359 MET n 
1 360 ARG n 
1 361 GLY n 
1 362 ALA n 
1 363 HIS n 
1 364 THR n 
1 365 ASN n 
1 366 ASP n 
1 367 VAL n 
1 368 LYS n 
1 369 GLN n 
1 370 LEU n 
1 371 THR n 
1 372 GLU n 
1 373 ALA n 
1 374 VAL n 
1 375 GLN n 
1 376 LYS n 
1 377 ILE n 
1 378 THR n 
1 379 THR n 
1 380 GLU n 
1 381 SER n 
1 382 ILE n 
1 383 VAL n 
1 384 ILE n 
1 385 TRP n 
1 386 GLY n 
1 387 LYS n 
1 388 THR n 
1 389 PRO n 
1 390 LYS n 
1 391 PHE n 
1 392 LYS n 
1 393 LEU n 
1 394 PRO n 
1 395 ILE n 
1 396 GLN n 
1 397 LYS n 
1 398 GLU n 
1 399 THR n 
1 400 TRP n 
1 401 GLU n 
1 402 THR n 
1 403 TRP n 
1 404 TRP n 
1 405 THR n 
1 406 GLU n 
1 407 TYR n 
1 408 TRP n 
1 409 GLN n 
1 410 ALA n 
1 411 THR n 
1 412 TRP n 
1 413 ILE n 
1 414 PRO n 
1 415 GLU n 
1 416 TRP n 
1 417 GLU n 
1 418 PHE n 
1 419 VAL n 
1 420 ASN n 
1 421 THR n 
1 422 PRO n 
1 423 PRO n 
1 424 LEU n 
1 425 VAL n 
1 426 LYS n 
1 427 LEU n 
1 428 TRP n 
1 429 TYR n 
1 430 GLN n 
1 431 LEU n 
1 432 GLU n 
1 433 LYS n 
1 434 GLU n 
1 435 PRO n 
1 436 ILE n 
1 437 VAL n 
1 438 GLY n 
1 439 ALA n 
1 440 GLU n 
1 441 THR n 
1 442 PHE n 
1 443 TYR n 
1 444 VAL n 
1 445 ASP n 
1 446 GLY n 
1 447 ALA n 
1 448 ALA n 
1 449 ASN n 
1 450 ARG n 
1 451 GLU n 
1 452 THR n 
1 453 LYS n 
1 454 LEU n 
1 455 GLY n 
1 456 LYS n 
1 457 ALA n 
1 458 GLY n 
1 459 TYR n 
1 460 VAL n 
1 461 THR n 
1 462 ASN n 
1 463 LYS n 
1 464 GLY n 
1 465 ARG n 
1 466 GLN n 
1 467 LYS n 
1 468 VAL n 
1 469 VAL n 
1 470 PRO n 
1 471 LEU n 
1 472 THR n 
1 473 ASN n 
1 474 THR n 
1 475 THR n 
1 476 ASN n 
1 477 GLN n 
1 478 LYS n 
1 479 THR n 
1 480 GLU n 
1 481 LEU n 
1 482 GLN n 
1 483 ALA n 
1 484 ILE n 
1 485 TYR n 
1 486 LEU n 
1 487 ALA n 
1 488 LEU n 
1 489 GLN n 
1 490 ASP n 
1 491 SER n 
1 492 GLY n 
1 493 LEU n 
1 494 GLU n 
1 495 VAL n 
1 496 ASN n 
1 497 ILE n 
1 498 VAL n 
1 499 THR n 
1 500 ASN n 
1 501 SER n 
1 502 GLN n 
1 503 TYR n 
1 504 ALA n 
1 505 LEU n 
1 506 GLY n 
1 507 ILE n 
1 508 ILE n 
1 509 GLN n 
1 510 ALA n 
1 511 GLN n 
1 512 PRO n 
1 513 ASP n 
1 514 LYS n 
1 515 SER n 
1 516 GLU n 
1 517 SER n 
1 518 GLU n 
1 519 LEU n 
1 520 VAL n 
1 521 ASN n 
1 522 GLN n 
1 523 ILE n 
1 524 ILE n 
1 525 GLU n 
1 526 GLN n 
1 527 LEU n 
1 528 ILE n 
1 529 LYS n 
1 530 LYS n 
1 531 GLU n 
1 532 LYS n 
1 533 VAL n 
1 534 TYR n 
1 535 LEU n 
1 536 ALA n 
1 537 TRP n 
1 538 VAL n 
1 539 PRO n 
1 540 ALA n 
1 541 HIS n 
1 542 LYS n 
1 543 GLY n 
1 544 ILE n 
1 545 GLY n 
1 546 GLY n 
1 547 ASN n 
1 548 GLU n 
1 549 GLN n 
1 550 VAL n 
1 551 ASP n 
1 552 LYS n 
1 553 LEU n 
1 554 VAL n 
1 555 SER n 
1 556 ALA n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 LYS n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 TYR n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 THR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 SER n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
2 428 GLN n 
3 1   DA  n 
3 2   DT  n 
3 3   DG  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DG  n 
3 8   DG  n 
3 9   DC  n 
3 10  DG  n 
3 11  DC  n 
3 12  DC  n 
3 13  DC  n 
3 14  DG  n 
3 15  DA  n 
3 16  DA  n 
3 17  DC  n 
3 18  DA  n 
3 19  DG  n 
3 20  DG  n 
3 21  DG  n 
3 22  DA  n 
3 23  DC  n 
3 24  DT  n 
3 25  DG  n 
3 26  DT  n 
3 27  DG  n 
4 1   DA  n 
4 2   DC  n 
4 3   DA  n 
4 4   DG  n 
4 5   DT  n 
4 6   DC  n 
4 7   DC  n 
4 8   DC  n 
4 9   DT  n 
4 10  DG  n 
4 11  DT  n 
4 12  DT  n 
4 13  DC  n 
4 14  DG  n 
4 15  DG  n 
4 16  MRG n 
4 17  DC  n 
4 18  DG  n 
4 19  DC  n 
4 20  DC  n 
4 21  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 556 HIV-1 ? gag-pol ? 'isolate BH10' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate BH10)' 11678 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 428 HIV-1 ? gag-pol ? 'isolate BH10' ? ? ? ? 
'Human immunodeficiency virus type 1 group M subtype B (isolate BH10)' 11678 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 27 'Human immunodeficiency virus 1' ? 11676 ? 
4 1 sample 1 21 'Human immunodeficiency virus 1' ? 11676 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_HV1B1 P03366 ? 1 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
;
600 
2 UNP POL_HV1B1 P03366 ? 2 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQ
;
600 
3 PDB 5TXN      5TXN   ? 3 ? 1   
4 PDB 5TXN      5TXN   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5TXN A 3 ? 556 ? P03366 600 ? 1153 ? 1   554 
2 2 5TXN B 1 ? 428 ? P03366 600 ? 1027 ? 1   428 
3 3 5TXN T 1 ? 27  ? 5TXN   701 ? 727  ? 701 727 
4 4 5TXN P 1 ? 21  ? 5TXN   802 ? 822  ? 802 822 
5 1 5TXN C 3 ? 556 ? P03366 600 ? 1153 ? 1   554 
6 2 5TXN D 1 ? 428 ? P03366 600 ? 1027 ? 1   428 
7 3 5TXN E 1 ? 27  ? 5TXN   701 ? 727  ? 701 727 
8 4 5TXN F 1 ? 21  ? 5TXN   802 ? 822  ? 802 822 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5TXN MET A 1   ? UNP P03366 ?   ?    'initiating methionine' -1  1  
1 5TXN VAL A 2   ? UNP P03366 ?   ?    'expression tag'        0   2  
1 5TXN MET A 153 ? UNP P03366 GLN 750  'engineered mutation'   151 3  
1 5TXN CYS A 260 ? UNP P03366 GLN 857  'engineered mutation'   258 4  
1 5TXN SER A 282 ? UNP P03366 CYS 879  'engineered mutation'   280 5  
1 5TXN ASN A 500 ? UNP P03366 ASP 1097 'engineered mutation'   498 6  
2 5TXN SER B 280 ? UNP P03366 CYS 879  'engineered mutation'   280 7  
5 5TXN MET C 1   ? UNP P03366 ?   ?    'initiating methionine' -1  8  
5 5TXN VAL C 2   ? UNP P03366 ?   ?    'expression tag'        0   9  
5 5TXN MET C 153 ? UNP P03366 GLN 750  'engineered mutation'   151 10 
5 5TXN CYS C 260 ? UNP P03366 GLN 857  'engineered mutation'   258 11 
5 5TXN SER C 282 ? UNP P03366 CYS 879  'engineered mutation'   280 12 
5 5TXN ASN C 500 ? UNP P03366 ASP 1097 'engineered mutation'   498 13 
6 5TXN SER D 280 ? UNP P03366 CYS 879  'engineered mutation'   280 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                    ?                 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                   ?                 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                 ?                 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                            ?                 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                   ?                 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                       ?                 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                        ?                 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                       ?                 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                               ?                 'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                 'C10 H16 N5 O12 P3' 491.182 
EDO non-polymer         . 1,2-ETHANEDIOL                                             'ETHYLENE GLYCOL' 'C2 H6 O2'          62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                  ?                 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                            ?                 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                    ?                 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                  ?                 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                      ?                 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                 ?                 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                    ?                 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                     ?                 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                 ?                 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                            ?                 'Mg 2'              24.305  
MRG 'DNA linking'       n "N2-(3-MERCAPTOPROPYL)-2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C13 H20 N5 O7 P S' 421.366 
PHE 'L-peptide linking' y PHENYLALANINE                                              ?                 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                    ?                 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                     ?                 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                              ?                 'O4 S -2'           96.063  
SUC saccharide          . SUCROSE                                                    ?                 'C12 H22 O11'       342.296 
THR 'L-peptide linking' y THREONINE                                                  ?                 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                 ?                 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                   ?                 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                     ?                 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5TXN 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.76 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 8000, AMMONIUM SULFATE, MGCL2,     GLYCEROL, SUCROSE' 
_exptl_crystal_grow.pdbx_pH_range   '6.8 - 7.2' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           104 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-03-30 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9191 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9191 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5TXN 
_reflns.observed_criterion_sigma_I   -1.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.550 
_reflns.number_obs                   106245 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.09500 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   97.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.10 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5TXN 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     104269 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.390 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             33.38 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    98.2 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.226 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.920 
_refine.ls_number_reflns_R_free                  3048 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3V4I 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.360 
_refine.pdbx_overall_phase_error                 25.330 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15820 
_refine_hist.pdbx_number_atoms_nucleic_acid   1802 
_refine_hist.pdbx_number_atoms_ligand         123 
_refine_hist.number_atoms_solvent             178 
_refine_hist.number_atoms_total               17923 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        33.38 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 18414 'X-RAY DIFFRACTION' ? 
f_angle_d          0.810  ? ? 25380 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.942 ? ? 10738 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.043  ? ? 2768  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 2874  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.5500 2.5898  4533 0.3331 97.00  0.3678 . . 122 . . 
'X-RAY DIFFRACTION' . 2.5898 2.6323  4565 0.3199 97.00  0.3195 . . 125 . . 
'X-RAY DIFFRACTION' . 2.6323 2.6777  4530 0.3081 97.00  0.3435 . . 133 . . 
'X-RAY DIFFRACTION' . 2.6777 2.7263  4612 0.2982 98.00  0.3390 . . 152 . . 
'X-RAY DIFFRACTION' . 2.7263 2.7787  4524 0.2865 98.00  0.3067 . . 115 . . 
'X-RAY DIFFRACTION' . 2.7787 2.8354  4594 0.2696 98.00  0.3527 . . 137 . . 
'X-RAY DIFFRACTION' . 2.8354 2.8970  4581 0.2585 98.00  0.2869 . . 123 . . 
'X-RAY DIFFRACTION' . 2.8970 2.9644  4578 0.2416 98.00  0.2820 . . 148 . . 
'X-RAY DIFFRACTION' . 2.9644 3.0385  4597 0.2343 98.00  0.2335 . . 136 . . 
'X-RAY DIFFRACTION' . 3.0385 3.1206  4586 0.2333 99.00  0.2695 . . 137 . . 
'X-RAY DIFFRACTION' . 3.1206 3.2123  4621 0.2204 99.00  0.2453 . . 164 . . 
'X-RAY DIFFRACTION' . 3.2123 3.3159  4609 0.2179 99.00  0.2759 . . 133 . . 
'X-RAY DIFFRACTION' . 3.3159 3.4343  4635 0.2193 99.00  0.2929 . . 142 . . 
'X-RAY DIFFRACTION' . 3.4343 3.5717  4639 0.2120 99.00  0.2409 . . 135 . . 
'X-RAY DIFFRACTION' . 3.5717 3.7340  4638 0.1950 99.00  0.2369 . . 156 . . 
'X-RAY DIFFRACTION' . 3.7340 3.9306  4658 0.1844 99.00  0.2347 . . 140 . . 
'X-RAY DIFFRACTION' . 3.9306 4.1764  4640 0.1664 99.00  0.1854 . . 159 . . 
'X-RAY DIFFRACTION' . 4.1764 4.4982  4652 0.1570 99.00  0.1864 . . 140 . . 
'X-RAY DIFFRACTION' . 4.4982 4.9496  4625 0.1526 99.00  0.1944 . . 161 . . 
'X-RAY DIFFRACTION' . 4.9496 5.6628  4690 0.1678 99.00  0.2035 . . 138 . . 
'X-RAY DIFFRACTION' . 5.6628 7.1231  4719 0.1868 100.00 0.2099 . . 130 . . 
'X-RAY DIFFRACTION' . 7.1231 33.3831 4395 0.1530 91.00  0.1450 . . 122 . . 
# 
_struct.entry_id                     5TXN 
_struct.title                        
'STRUCTURE OF Q151M MUTANT HIV-1 REVERSE TRANSCRIPTASE (RT) TERNARY COMPLEX WITH A DOUBLE STRANDED DNA AND AN INCOMING DATP' 
_struct.pdbx_descriptor              'HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT, HIV-1 REVERSE TRANSCRIPTASE P51 SUBUNIT/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5TXN 
_struct_keywords.text            
'RT, DNA, crosslink, N site complex, pyrophosphorolysis, P51, P66, TRANSFERASE, DRUG RESISTANCE, MUTATION, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 1  ? 
F  N N 2  ? 
G  N N 3  ? 
H  N N 4  ? 
I  N N 5  ? 
J  N N 5  ? 
K  N N 6  ? 
L  N N 7  ? 
M  N N 8  ? 
N  N N 6  ? 
O  N N 5  ? 
P  N N 5  ? 
Q  N N 7  ? 
R  N N 9  ? 
S  N N 8  ? 
T  N N 10 ? 
U  N N 10 ? 
V  N N 10 ? 
W  N N 10 ? 
X  N N 10 ? 
Y  N N 10 ? 
Z  N N 10 ? 
AA N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 29  ? GLY A 47  ? THR A 27  GLY A 45  1 ? 19 
HELX_P HELX_P2  AA2 PHE A 79  ? THR A 86  ? PHE A 77  THR A 84  1 ? 8  
HELX_P HELX_P3  AA3 HIS A 98  ? LEU A 102 ? HIS A 96  LEU A 100 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 116 ? VAL A 120 ? ALA A 114 VAL A 118 5 ? 5  
HELX_P HELX_P5  AA5 GLU A 124 ? ALA A 131 ? GLU A 122 ALA A 129 5 ? 8  
HELX_P HELX_P6  AA6 GLY A 157 ? ASN A 177 ? GLY A 155 ASN A 175 1 ? 21 
HELX_P HELX_P7  AA7 GLU A 196 ? TRP A 214 ? GLU A 194 TRP A 212 1 ? 19 
HELX_P HELX_P8  AA8 PRO A 219 ? LYS A 221 ? PRO A 217 LYS A 219 5 ? 3  
HELX_P HELX_P9  AA9 THR A 255 ? SER A 270 ? THR A 253 SER A 268 1 ? 16 
HELX_P HELX_P10 AB1 VAL A 278 ? LEU A 284 ? VAL A 276 LEU A 282 1 ? 7  
HELX_P HELX_P11 AB2 THR A 298 ? GLU A 314 ? THR A 296 GLU A 312 1 ? 17 
HELX_P HELX_P12 AB3 ASN A 365 ? GLY A 386 ? ASN A 363 GLY A 384 1 ? 22 
HELX_P HELX_P13 AB4 GLN A 396 ? TYR A 407 ? GLN A 394 TYR A 405 1 ? 12 
HELX_P HELX_P14 AB5 THR A 475 ? ASP A 490 ? THR A 473 ASP A 488 1 ? 16 
HELX_P HELX_P15 AB6 SER A 501 ? ALA A 510 ? SER A 499 ALA A 508 1 ? 10 
HELX_P HELX_P16 AB7 SER A 517 ? LYS A 530 ? SER A 515 LYS A 528 1 ? 14 
HELX_P HELX_P17 AB8 ILE A 544 ? ALA A 556 ? ILE A 542 ALA A 554 1 ? 13 
HELX_P HELX_P18 AB9 THR B 27  ? GLU B 44  ? THR B 27  GLU B 44  1 ? 18 
HELX_P HELX_P19 AC1 PHE B 77  ? THR B 84  ? PHE B 77  THR B 84  1 ? 8  
HELX_P HELX_P20 AC2 THR B 84  ? GLN B 91  ? THR B 84  GLN B 91  1 ? 8  
HELX_P HELX_P21 AC3 GLY B 99  ? LYS B 103 ? GLY B 99  LYS B 103 5 ? 5  
HELX_P HELX_P22 AC4 GLY B 112 ? SER B 117 ? GLY B 112 SER B 117 5 ? 6  
HELX_P HELX_P23 AC5 PHE B 124 ? ALA B 129 ? PHE B 124 ALA B 129 5 ? 6  
HELX_P HELX_P24 AC6 SER B 134 ? GLU B 138 ? SER B 134 GLU B 138 5 ? 5  
HELX_P HELX_P25 AC7 LYS B 154 ? ASN B 175 ? LYS B 154 ASN B 175 1 ? 22 
HELX_P HELX_P26 AC8 GLU B 194 ? GLY B 213 ? GLU B 194 GLY B 213 1 ? 20 
HELX_P HELX_P27 AC9 VAL B 254 ? SER B 268 ? VAL B 254 SER B 268 1 ? 15 
HELX_P HELX_P28 AD1 VAL B 276 ? LYS B 281 ? VAL B 276 LYS B 281 1 ? 6  
HELX_P HELX_P29 AD2 LEU B 282 ? ARG B 284 ? LEU B 282 ARG B 284 5 ? 3  
HELX_P HELX_P30 AD3 THR B 296 ? GLU B 312 ? THR B 296 GLU B 312 1 ? 17 
HELX_P HELX_P31 AD4 ASN B 363 ? GLY B 384 ? ASN B 363 GLY B 384 1 ? 22 
HELX_P HELX_P32 AD5 GLN B 394 ? TRP B 406 ? GLN B 394 TRP B 406 1 ? 13 
HELX_P HELX_P33 AD6 THR E 29  ? GLU E 46  ? THR C 27  GLU C 44  1 ? 18 
HELX_P HELX_P34 AD7 PHE E 79  ? THR E 86  ? PHE C 77  THR C 84  1 ? 8  
HELX_P HELX_P35 AD8 HIS E 98  ? LEU E 102 ? HIS C 96  LEU C 100 5 ? 5  
HELX_P HELX_P36 AD9 ALA E 116 ? VAL E 120 ? ALA C 114 VAL C 118 5 ? 5  
HELX_P HELX_P37 AE1 ASP E 125 ? ALA E 131 ? ASP C 123 ALA C 129 5 ? 7  
HELX_P HELX_P38 AE2 GLY E 157 ? ASN E 177 ? GLY C 155 ASN C 175 1 ? 21 
HELX_P HELX_P39 AE3 GLU E 196 ? TRP E 214 ? GLU C 194 TRP C 212 1 ? 19 
HELX_P HELX_P40 AE4 THR E 255 ? SER E 270 ? THR C 253 SER C 268 1 ? 16 
HELX_P HELX_P41 AE5 VAL E 278 ? LEU E 284 ? VAL C 276 LEU C 282 1 ? 7  
HELX_P HELX_P42 AE6 THR E 298 ? GLU E 314 ? THR C 296 GLU C 312 1 ? 17 
HELX_P HELX_P43 AE7 ASN E 365 ? GLY E 386 ? ASN C 363 GLY C 384 1 ? 22 
HELX_P HELX_P44 AE8 GLN E 396 ? TYR E 407 ? GLN C 394 TYR C 405 1 ? 12 
HELX_P HELX_P45 AE9 THR E 475 ? ASP E 490 ? THR C 473 ASP C 488 1 ? 16 
HELX_P HELX_P46 AF1 SER E 501 ? ALA E 510 ? SER C 499 ALA C 508 1 ? 10 
HELX_P HELX_P47 AF2 SER E 517 ? LYS E 530 ? SER C 515 LYS C 528 1 ? 14 
HELX_P HELX_P48 AF3 ILE E 544 ? ALA E 556 ? ILE C 542 ALA C 554 1 ? 13 
HELX_P HELX_P49 AF4 THR F 27  ? GLU F 44  ? THR D 27  GLU D 44  1 ? 18 
HELX_P HELX_P50 AF5 PHE F 77  ? THR F 84  ? PHE D 77  THR D 84  1 ? 8  
HELX_P HELX_P51 AF6 THR F 84  ? GLN F 91  ? THR D 84  GLN D 91  1 ? 8  
HELX_P HELX_P52 AF7 GLY F 99  ? LYS F 103 ? GLY D 99  LYS D 103 5 ? 5  
HELX_P HELX_P53 AF8 VAL F 111 ? VAL F 118 ? VAL D 111 VAL D 118 1 ? 8  
HELX_P HELX_P54 AF9 PHE F 124 ? ALA F 129 ? PHE D 124 ALA D 129 5 ? 6  
HELX_P HELX_P55 AG1 SER F 134 ? GLU F 138 ? SER D 134 GLU D 138 5 ? 5  
HELX_P HELX_P56 AG2 GLY F 155 ? PHE F 160 ? GLY D 155 PHE D 160 1 ? 6  
HELX_P HELX_P57 AG3 PHE F 160 ? ASN F 175 ? PHE D 160 ASN D 175 1 ? 16 
HELX_P HELX_P58 AG4 GLU F 194 ? ARG F 211 ? GLU D 194 ARG D 211 1 ? 18 
HELX_P HELX_P59 AG5 VAL F 254 ? SER F 268 ? VAL D 254 SER D 268 1 ? 15 
HELX_P HELX_P60 AG6 VAL F 276 ? LYS F 281 ? VAL D 276 LYS D 281 1 ? 6  
HELX_P HELX_P61 AG7 LEU F 282 ? ARG F 284 ? LEU D 282 ARG D 284 5 ? 3  
HELX_P HELX_P62 AG8 THR F 296 ? GLU F 312 ? THR D 296 GLU D 312 1 ? 17 
HELX_P HELX_P63 AG9 ASN F 363 ? GLY F 384 ? ASN D 363 GLY D 384 1 ? 22 
HELX_P HELX_P64 AH1 GLN F 394 ? TRP F 402 ? GLN D 394 TRP D 402 1 ? 9  
HELX_P HELX_P65 AH2 THR F 403 ? TRP F 406 ? THR D 403 TRP D 406 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ?    ? A ASP 112 OD1   ? ? ? 1_555 I MG  .  MG  ? ? A ASP 110 A MG  601 1_555 ? ? ? ? ? ? ?            2.064 ? 
metalc2   metalc ?    ? A ASP 112 OD2   ? ? ? 1_555 I MG  .  MG  ? ? A ASP 110 A MG  601 1_555 ? ? ? ? ? ? ?            2.853 ? 
metalc3   metalc ?    ? A VAL 113 O     ? ? ? 1_555 I MG  .  MG  ? ? A VAL 111 A MG  601 1_555 ? ? ? ? ? ? ?            2.275 ? 
metalc4   metalc ?    ? A ASP 187 OD2   ? ? ? 1_555 I MG  .  MG  ? ? A ASP 185 A MG  601 1_555 ? ? ? ? ? ? ?            2.272 ? 
covale1   covale none ? A CYS 260 SG    ? ? ? 1_555 D MRG 16 S24 ? ? A CYS 258 P MRG 817 1_555 ? ? ? ? ? ? ?            1.993 ? 
metalc5   metalc ?    ? A ASP 445 OD1   ? ? ? 1_555 J MG  .  MG  ? ? A ASP 443 A MG  602 1_555 ? ? ? ? ? ? ?            2.442 ? 
metalc6   metalc ?    ? A ASP 445 OD2   ? ? ? 1_555 J MG  .  MG  ? ? A ASP 443 A MG  602 1_555 ? ? ? ? ? ? ?            2.262 ? 
covale2   covale both ? D DG  15  "O3'" ? ? ? 1_555 D MRG 16 P   ? ? P DG  816 P MRG 817 1_555 ? ? ? ? ? ? ?            1.608 ? 
covale3   covale both ? D MRG 16  "O3'" ? ? ? 1_555 D DC  17 P   ? ? P MRG 817 P DC  818 1_555 ? ? ? ? ? ? ?            1.610 ? 
metalc7   metalc ?    ? E ASP 112 OD1   ? ? ? 1_555 O MG  .  MG  ? ? C ASP 110 C MG  602 1_555 ? ? ? ? ? ? ?            2.245 ? 
metalc8   metalc ?    ? E VAL 113 O     ? ? ? 1_555 O MG  .  MG  ? ? C VAL 111 C MG  602 1_555 ? ? ? ? ? ? ?            1.957 ? 
metalc9   metalc ?    ? E ASP 187 OD2   ? ? ? 1_555 O MG  .  MG  ? ? C ASP 185 C MG  602 1_555 ? ? ? ? ? ? ?            2.334 ? 
covale4   covale none ? E CYS 260 SG    ? ? ? 1_555 H MRG 16 S24 ? ? C CYS 258 F MRG 817 1_555 ? ? ? ? ? ? ?            1.984 ? 
metalc10  metalc ?    ? E ASP 445 OD1   ? ? ? 1_555 P MG  .  MG  ? ? C ASP 443 C MG  603 1_555 ? ? ? ? ? ? ?            2.046 ? 
metalc11  metalc ?    ? E ASP 445 OD2   ? ? ? 1_555 P MG  .  MG  ? ? C ASP 443 C MG  603 1_555 ? ? ? ? ? ? ?            2.064 ? 
covale5   covale both ? H DG  15  "O3'" ? ? ? 1_555 H MRG 16 P   ? ? F DG  816 F MRG 817 1_555 ? ? ? ? ? ? ?            1.610 ? 
covale6   covale both ? H MRG 16  "O3'" ? ? ? 1_555 H DC  17 P   ? ? F MRG 817 F DC  818 1_555 ? ? ? ? ? ? ?            1.608 ? 
metalc12  metalc ?    ? I MG  .   MG    ? ? ? 1_555 K DTP .  O2B ? ? A MG  601 A DTP 603 1_555 ? ? ? ? ? ? ?            2.098 ? 
metalc13  metalc ?    ? I MG  .   MG    ? ? ? 1_555 K DTP .  O2G ? ? A MG  601 A DTP 603 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc14  metalc ?    ? I MG  .   MG    ? ? ? 1_555 K DTP .  O1A ? ? A MG  601 A DTP 603 1_555 ? ? ? ? ? ? ?            2.394 ? 
metalc15  metalc ?    ? J MG  .   MG    ? ? ? 1_555 T HOH .  O   ? ? A MG  602 A HOH 713 1_555 ? ? ? ? ? ? ?            2.384 ? 
metalc16  metalc ?    ? N DTP .   O2G   ? ? ? 1_555 O MG  .  MG  ? ? C DTP 601 C MG  602 1_555 ? ? ? ? ? ? ?            2.462 ? 
metalc17  metalc ?    ? N DTP .   O2B   ? ? ? 1_555 O MG  .  MG  ? ? C DTP 601 C MG  602 1_555 ? ? ? ? ? ? ?            2.081 ? 
metalc18  metalc ?    ? N DTP .   O1A   ? ? ? 1_555 O MG  .  MG  ? ? C DTP 601 C MG  602 1_555 ? ? ? ? ? ? ?            2.316 ? 
metalc19  metalc ?    ? P MG  .   MG    ? ? ? 1_555 X HOH .  O   ? ? C MG  603 C HOH 712 1_555 ? ? ? ? ? ? ?            2.177 ? 
metalc20  metalc ?    ? P MG  .   MG    ? ? ? 1_555 X HOH .  O   ? ? C MG  603 C HOH 731 1_555 ? ? ? ? ? ? ?            2.392 ? 
hydrog1   hydrog ?    ? G DC  6   N3    ? ? ? 1_555 H DG  21 N1  ? ? E DC  706 F DG  822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ?    ? G DC  6   N4    ? ? ? 1_555 H DG  21 O6  ? ? E DC  706 F DG  822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ?    ? G DC  6   O2    ? ? ? 1_555 H DG  21 N2  ? ? E DC  706 F DG  822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ?    ? G DG  7   N1    ? ? ? 1_555 H DC  20 N3  ? ? E DG  707 F DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ?    ? G DG  7   N2    ? ? ? 1_555 H DC  20 O2  ? ? E DG  707 F DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ?    ? G DG  7   O6    ? ? ? 1_555 H DC  20 N4  ? ? E DG  707 F DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ?    ? G DG  8   N1    ? ? ? 1_555 H DC  19 N3  ? ? E DG  708 F DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ?    ? G DG  8   N2    ? ? ? 1_555 H DC  19 O2  ? ? E DG  708 F DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ?    ? G DG  8   O6    ? ? ? 1_555 H DC  19 N4  ? ? E DG  708 F DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ?    ? G DC  9   N3    ? ? ? 1_555 H DG  18 N1  ? ? E DC  709 F DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ?    ? G DC  9   N4    ? ? ? 1_555 H DG  18 O6  ? ? E DC  709 F DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ?    ? G DC  9   O2    ? ? ? 1_555 H DG  18 N2  ? ? E DC  709 F DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ?    ? G DG  10  N1    ? ? ? 1_555 H DC  17 N3  ? ? E DG  710 F DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ?    ? G DG  10  N2    ? ? ? 1_555 H DC  17 O2  ? ? E DG  710 F DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ?    ? G DG  10  O6    ? ? ? 1_555 H DC  17 N4  ? ? E DG  710 F DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ?    ? G DC  11  N3    ? ? ? 1_555 H MRG 16 N1  ? ? E DC  711 F MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ?    ? G DC  11  N4    ? ? ? 1_555 H MRG 16 O6  ? ? E DC  711 F MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ?    ? G DC  11  O2    ? ? ? 1_555 H MRG 16 N2  ? ? E DC  711 F MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ?    ? G DC  12  N3    ? ? ? 1_555 H DG  15 N1  ? ? E DC  712 F DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ?    ? G DC  12  N4    ? ? ? 1_555 H DG  15 O6  ? ? E DC  712 F DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ?    ? G DC  12  O2    ? ? ? 1_555 H DG  15 N2  ? ? E DC  712 F DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ?    ? G DC  13  N3    ? ? ? 1_555 H DG  14 N1  ? ? E DC  713 F DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ?    ? G DC  13  N4    ? ? ? 1_555 H DG  14 O6  ? ? E DC  713 F DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ?    ? G DC  13  O2    ? ? ? 1_555 H DG  14 N2  ? ? E DC  713 F DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ?    ? G DG  14  N1    ? ? ? 1_555 H DC  13 N3  ? ? E DG  714 F DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ?    ? G DG  14  N2    ? ? ? 1_555 H DC  13 O2  ? ? E DG  714 F DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ?    ? G DG  14  O6    ? ? ? 1_555 H DC  13 N4  ? ? E DG  714 F DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ?    ? G DA  15  N1    ? ? ? 1_555 H DT  12 N3  ? ? E DA  715 F DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ?    ? G DA  15  N6    ? ? ? 1_555 H DT  12 O4  ? ? E DA  715 F DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ?    ? G DA  16  N1    ? ? ? 1_555 H DT  11 N3  ? ? E DA  716 F DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ?    ? G DA  16  N6    ? ? ? 1_555 H DT  11 O4  ? ? E DA  716 F DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ?    ? G DC  17  N3    ? ? ? 1_555 H DG  10 N1  ? ? E DC  717 F DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ?    ? G DC  17  N4    ? ? ? 1_555 H DG  10 O6  ? ? E DC  717 F DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ?    ? G DC  17  O2    ? ? ? 1_555 H DG  10 N2  ? ? E DC  717 F DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ?    ? G DA  18  N1    ? ? ? 1_555 H DT  9  N3  ? ? E DA  718 F DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ?    ? G DA  18  N6    ? ? ? 1_555 H DT  9  O4  ? ? E DA  718 F DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ?    ? G DG  19  N1    ? ? ? 1_555 H DC  8  N3  ? ? E DG  719 F DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ?    ? G DG  19  N2    ? ? ? 1_555 H DC  8  O2  ? ? E DG  719 F DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ?    ? G DG  19  O6    ? ? ? 1_555 H DC  8  N4  ? ? E DG  719 F DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ?    ? G DG  20  N1    ? ? ? 1_555 H DC  7  N3  ? ? E DG  720 F DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ?    ? G DG  20  N2    ? ? ? 1_555 H DC  7  O2  ? ? E DG  720 F DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ?    ? G DG  20  O6    ? ? ? 1_555 H DC  7  N4  ? ? E DG  720 F DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ?    ? G DG  21  N1    ? ? ? 1_555 H DC  6  N3  ? ? E DG  721 F DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ?    ? G DG  21  N2    ? ? ? 1_555 H DC  6  O2  ? ? E DG  721 F DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ?    ? G DG  21  O6    ? ? ? 1_555 H DC  6  N4  ? ? E DG  721 F DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ?    ? G DA  22  N1    ? ? ? 1_555 H DT  5  N3  ? ? E DA  722 F DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ?    ? G DA  22  N6    ? ? ? 1_555 H DT  5  O4  ? ? E DA  722 F DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ?    ? G DC  23  N3    ? ? ? 1_555 H DG  4  N1  ? ? E DC  723 F DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ?    ? G DC  23  N4    ? ? ? 1_555 H DG  4  O6  ? ? E DC  723 F DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ?    ? G DC  23  O2    ? ? ? 1_555 H DG  4  N2  ? ? E DC  723 F DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ?    ? G DT  24  N3    ? ? ? 1_555 H DA  3  N1  ? ? E DT  724 F DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ?    ? G DT  24  O4    ? ? ? 1_555 H DA  3  N6  ? ? E DT  724 F DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ?    ? G DG  25  N2    ? ? ? 1_555 H DC  2  N3  ? ? E DG  725 F DC  803 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog54  hydrog ?    ? C DC  6   N3    ? ? ? 1_555 D DG  21 N1  ? ? T DC  706 P DG  822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ?    ? C DC  6   N4    ? ? ? 1_555 D DG  21 O6  ? ? T DC  706 P DG  822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ?    ? C DC  6   O2    ? ? ? 1_555 D DG  21 N2  ? ? T DC  706 P DG  822 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ?    ? C DG  7   N1    ? ? ? 1_555 D DC  20 N3  ? ? T DG  707 P DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ?    ? C DG  7   N2    ? ? ? 1_555 D DC  20 O2  ? ? T DG  707 P DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ?    ? C DG  7   O6    ? ? ? 1_555 D DC  20 N4  ? ? T DG  707 P DC  821 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ?    ? C DG  8   N1    ? ? ? 1_555 D DC  19 N3  ? ? T DG  708 P DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ?    ? C DG  8   N2    ? ? ? 1_555 D DC  19 O2  ? ? T DG  708 P DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ?    ? C DG  8   O6    ? ? ? 1_555 D DC  19 N4  ? ? T DG  708 P DC  820 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ?    ? C DC  9   N3    ? ? ? 1_555 D DG  18 N1  ? ? T DC  709 P DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ?    ? C DC  9   N4    ? ? ? 1_555 D DG  18 O6  ? ? T DC  709 P DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ?    ? C DC  9   O2    ? ? ? 1_555 D DG  18 N2  ? ? T DC  709 P DG  819 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D DC  17 N3  ? ? T DG  710 P DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D DC  17 O2  ? ? T DG  710 P DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D DC  17 N4  ? ? T DG  710 P DC  818 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ?    ? C DC  11  N3    ? ? ? 1_555 D MRG 16 N1  ? ? T DC  711 P MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ?    ? C DC  11  N4    ? ? ? 1_555 D MRG 16 O6  ? ? T DC  711 P MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ?    ? C DC  11  O2    ? ? ? 1_555 D MRG 16 N2  ? ? T DC  711 P MRG 817 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ?    ? C DC  12  N3    ? ? ? 1_555 D DG  15 N1  ? ? T DC  712 P DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ?    ? C DC  12  N4    ? ? ? 1_555 D DG  15 O6  ? ? T DC  712 P DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ?    ? C DC  12  O2    ? ? ? 1_555 D DG  15 N2  ? ? T DC  712 P DG  816 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ?    ? C DC  13  N3    ? ? ? 1_555 D DG  14 N1  ? ? T DC  713 P DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ?    ? C DC  13  N4    ? ? ? 1_555 D DG  14 O6  ? ? T DC  713 P DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ?    ? C DC  13  O2    ? ? ? 1_555 D DG  14 N2  ? ? T DC  713 P DG  815 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D DC  13 N3  ? ? T DG  714 P DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D DC  13 O2  ? ? T DG  714 P DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D DC  13 N4  ? ? T DG  714 P DC  814 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ?    ? C DA  15  N1    ? ? ? 1_555 D DT  12 N3  ? ? T DA  715 P DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ?    ? C DA  15  N6    ? ? ? 1_555 D DT  12 O4  ? ? T DA  715 P DT  813 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ?    ? C DA  16  N1    ? ? ? 1_555 D DT  11 N3  ? ? T DA  716 P DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ?    ? C DA  16  N6    ? ? ? 1_555 D DT  11 O4  ? ? T DA  716 P DT  812 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ?    ? C DC  17  N3    ? ? ? 1_555 D DG  10 N1  ? ? T DC  717 P DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ?    ? C DC  17  N4    ? ? ? 1_555 D DG  10 O6  ? ? T DC  717 P DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ?    ? C DC  17  O2    ? ? ? 1_555 D DG  10 N2  ? ? T DC  717 P DG  811 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ?    ? C DA  18  N1    ? ? ? 1_555 D DT  9  N3  ? ? T DA  718 P DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ?    ? C DA  18  N6    ? ? ? 1_555 D DT  9  O4  ? ? T DA  718 P DT  810 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ?    ? C DG  19  N1    ? ? ? 1_555 D DC  8  N3  ? ? T DG  719 P DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ?    ? C DG  19  N2    ? ? ? 1_555 D DC  8  O2  ? ? T DG  719 P DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ?    ? C DG  19  O6    ? ? ? 1_555 D DC  8  N4  ? ? T DG  719 P DC  809 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ?    ? C DG  20  N1    ? ? ? 1_555 D DC  7  N3  ? ? T DG  720 P DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ?    ? C DG  20  N2    ? ? ? 1_555 D DC  7  O2  ? ? T DG  720 P DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ?    ? C DG  20  O6    ? ? ? 1_555 D DC  7  N4  ? ? T DG  720 P DC  808 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ?    ? C DG  21  N1    ? ? ? 1_555 D DC  6  N3  ? ? T DG  721 P DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ?    ? C DG  21  N2    ? ? ? 1_555 D DC  6  O2  ? ? T DG  721 P DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ?    ? C DG  21  O6    ? ? ? 1_555 D DC  6  N4  ? ? T DG  721 P DC  807 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ?    ? C DA  22  N1    ? ? ? 1_555 D DT  5  N3  ? ? T DA  722 P DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ?    ? C DA  22  N6    ? ? ? 1_555 D DT  5  O4  ? ? T DA  722 P DT  806 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ?    ? C DC  23  N3    ? ? ? 1_555 D DG  4  N1  ? ? T DC  723 P DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ?    ? C DC  23  N4    ? ? ? 1_555 D DG  4  O6  ? ? T DC  723 P DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ?    ? C DC  23  O2    ? ? ? 1_555 D DG  4  N2  ? ? T DC  723 P DG  805 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ?    ? C DT  24  N3    ? ? ? 1_555 D DA  3  N1  ? ? T DT  724 P DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ?    ? C DT  24  O4    ? ? ? 1_555 D DA  3  N6  ? ? T DT  724 P DA  804 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ?    ? C DG  25  N1    ? ? ? 1_555 D DC  2  N3  ? ? T DG  725 P DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ?    ? C DG  25  N2    ? ? ? 1_555 D DC  2  O2  ? ? T DG  725 P DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ?    ? C DG  25  O6    ? ? ? 1_555 D DC  2  N4  ? ? T DG  725 P DC  803 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 227 A . ? PRO 225 A PRO 228 A ? PRO 226 A 1 12.10 
2 PRO 422 A . ? PRO 420 A PRO 423 A ? PRO 421 A 1 1.52  
3 PRO 227 E . ? PRO 225 C PRO 228 E ? PRO 226 C 1 1.64  
4 PRO 422 E . ? PRO 420 C PRO 423 E ? PRO 421 C 1 -4.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 4 ? 
AB2 ? 2 ? 
AB3 ? 5 ? 
AB4 ? 3 ? 
AB5 ? 2 ? 
AB6 ? 3 ? 
AB7 ? 3 ? 
AB8 ? 5 ? 
AB9 ? 2 ? 
AC1 ? 5 ? 
AC2 ? 3 ? 
AC3 ? 2 ? 
AC4 ? 4 ? 
AC5 ? 2 ? 
AC6 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? parallel      
AB8 4 5 ? parallel      
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC1 4 5 ? parallel      
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? parallel      
AC6 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 49  ? LYS A 51  ? ILE A 47  LYS A 49  
AA1 2 ARG A 145 ? TYR A 148 ? ARG A 143 TYR A 146 
AA1 3 PHE A 132 ? THR A 133 ? PHE A 130 THR A 131 
AA2 1 PHE A 63  ? LYS A 66  ? PHE A 61  LYS A 64  
AA2 2 TRP A 73  ? LEU A 76  ? TRP A 71  LEU A 74  
AA3 1 VAL A 181 ? TYR A 185 ? VAL A 179 TYR A 183 
AA3 2 ASP A 188 ? SER A 193 ? ASP A 186 SER A 191 
AA3 3 SER A 107 ? ASP A 112 ? SER A 105 ASP A 110 
AA3 4 HIS A 223 ? GLN A 224 ? HIS A 221 GLN A 222 
AA4 1 PHE A 229 ? TRP A 231 ? PHE A 227 TRP A 229 
AA4 2 TYR A 234 ? LEU A 236 ? TYR A 232 LEU A 234 
AA4 3 TRP A 241 ? VAL A 243 ? TRP A 239 VAL A 241 
AA5 1 LYS A 349 ? TYR A 356 ? LYS A 347 TYR A 354 
AA5 2 TRP A 339 ? GLU A 346 ? TRP A 337 GLU A 344 
AA5 3 ILE A 328 ? LYS A 333 ? ILE A 326 LYS A 331 
AA5 4 LYS A 390 ? LEU A 393 ? LYS A 388 LEU A 391 
AA5 5 TRP A 416 ? PHE A 418 ? TRP A 414 PHE A 416 
AA6 1 HIS A 363 ? THR A 364 ? HIS A 361 THR A 362 
AA6 2 LYS A 514 ? SER A 515 ? LYS A 512 SER A 513 
AA7 1 GLN A 466 ? THR A 472 ? GLN A 464 THR A 470 
AA7 2 LEU A 454 ? THR A 461 ? LEU A 452 THR A 459 
AA7 3 GLU A 440 ? ALA A 448 ? GLU A 438 ALA A 446 
AA7 4 GLU A 494 ? THR A 499 ? GLU A 492 THR A 497 
AA7 5 LYS A 532 ? TRP A 537 ? LYS A 530 TRP A 535 
AA8 1 ILE B 47  ? LYS B 49  ? ILE B 47  LYS B 49  
AA8 2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
AA8 3 PHE B 130 ? ILE B 132 ? PHE B 130 ILE B 132 
AA9 1 VAL B 60  ? LYS B 64  ? VAL B 60  LYS B 64  
AA9 2 TRP B 71  ? VAL B 75  ? TRP B 71  VAL B 75  
AB1 1 VAL B 179 ? TYR B 183 ? VAL B 179 TYR B 183 
AB1 2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
AB1 3 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
AB1 4 TYR B 232 ? LEU B 234 ? TYR B 232 LEU B 234 
AB2 1 TRP B 252 ? THR B 253 ? TRP B 252 THR B 253 
AB2 2 VAL B 292 ? ILE B 293 ? VAL B 292 ILE B 293 
AB3 1 LYS B 347 ? TYR B 354 ? LYS B 347 TYR B 354 
AB3 2 GLN B 336 ? GLU B 344 ? GLN B 336 GLU B 344 
AB3 3 ILE B 326 ? GLY B 333 ? ILE B 326 GLY B 333 
AB3 4 LYS B 388 ? LEU B 391 ? LYS B 388 LEU B 391 
AB3 5 GLU B 413 ? PHE B 416 ? GLU B 413 PHE B 416 
AB4 1 ILE E 49  ? LYS E 51  ? ILE C 47  LYS C 49  
AB4 2 ILE E 144 ? TYR E 148 ? ILE C 142 TYR C 146 
AB4 3 PHE E 132 ? ILE E 134 ? PHE C 130 ILE C 132 
AB5 1 VAL E 62  ? LYS E 66  ? VAL C 60  LYS C 64  
AB5 2 TRP E 73  ? VAL E 77  ? TRP C 71  VAL C 75  
AB6 1 SER E 107 ? ASP E 112 ? SER C 105 ASP C 110 
AB6 2 ASP E 188 ? SER E 193 ? ASP C 186 SER C 191 
AB6 3 VAL E 181 ? TYR E 185 ? VAL C 179 TYR C 183 
AB7 1 PHE E 229 ? TRP E 231 ? PHE C 227 TRP C 229 
AB7 2 TYR E 234 ? LEU E 236 ? TYR C 232 LEU C 234 
AB7 3 TRP E 241 ? VAL E 243 ? TRP C 239 VAL C 241 
AB8 1 ASN E 350 ? TYR E 356 ? ASN C 348 TYR C 354 
AB8 2 TRP E 339 ? TYR E 344 ? TRP C 337 TYR C 342 
AB8 3 ILE E 328 ? LYS E 333 ? ILE C 326 LYS C 331 
AB8 4 LYS E 390 ? LEU E 393 ? LYS C 388 LEU C 391 
AB8 5 TRP E 416 ? PHE E 418 ? TRP C 414 PHE C 416 
AB9 1 HIS E 363 ? THR E 364 ? HIS C 361 THR C 362 
AB9 2 LYS E 514 ? SER E 515 ? LYS C 512 SER C 513 
AC1 1 GLN E 466 ? LEU E 471 ? GLN C 464 LEU C 469 
AC1 2 GLY E 455 ? THR E 461 ? GLY C 453 THR C 459 
AC1 3 GLU E 440 ? ALA E 448 ? GLU C 438 ALA C 446 
AC1 4 GLU E 494 ? THR E 499 ? GLU C 492 THR C 497 
AC1 5 LYS E 532 ? TRP E 537 ? LYS C 530 TRP C 535 
AC2 1 ILE F 47  ? LYS F 49  ? ILE D 47  LYS D 49  
AC2 2 ILE F 142 ? TYR F 146 ? ILE D 142 TYR D 146 
AC2 3 PHE F 130 ? ILE F 132 ? PHE D 130 ILE D 132 
AC3 1 VAL F 60  ? ILE F 63  ? VAL D 60  ILE D 63  
AC3 2 ARG F 72  ? VAL F 75  ? ARG D 72  VAL D 75  
AC4 1 VAL F 179 ? TYR F 183 ? VAL D 179 TYR D 183 
AC4 2 ASP F 186 ? SER F 191 ? ASP D 186 SER D 191 
AC4 3 SER F 105 ? ASP F 110 ? SER D 105 ASP D 110 
AC4 4 TYR F 232 ? LEU F 234 ? TYR D 232 LEU D 234 
AC5 1 TRP F 252 ? THR F 253 ? TRP D 252 THR D 253 
AC5 2 VAL F 292 ? ILE F 293 ? VAL D 292 ILE D 293 
AC6 1 LYS F 347 ? ALA F 355 ? LYS D 347 ALA D 355 
AC6 2 GLN F 336 ? GLU F 344 ? GLN D 336 GLU D 344 
AC6 3 ILE F 326 ? GLY F 333 ? ILE D 326 GLY D 333 
AC6 4 LYS F 388 ? LEU F 391 ? LYS D 388 LEU D 391 
AC6 5 GLU F 413 ? PHE F 416 ? GLU D 413 PHE D 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 50  ? N SER A 48  O GLN A 147 ? O GLN A 145 
AA1 2 3 O TYR A 146 ? O TYR A 144 N PHE A 132 ? N PHE A 130 
AA2 1 2 N ILE A 65  ? N ILE A 63  O ARG A 74  ? O ARG A 72  
AA3 1 2 N VAL A 181 ? N VAL A 179 O GLY A 192 ? O GLY A 190 
AA3 2 3 O VAL A 191 ? O VAL A 189 N THR A 109 ? N THR A 107 
AA3 3 4 N VAL A 110 ? N VAL A 108 O GLN A 224 ? O GLN A 222 
AA4 1 2 N PHE A 229 ? N PHE A 227 O LEU A 236 ? O LEU A 234 
AA4 2 3 N GLU A 235 ? N GLU A 233 O THR A 242 ? O THR A 240 
AA5 1 2 O LEU A 351 ? O LEU A 349 N ILE A 343 ? N ILE A 341 
AA5 2 3 O GLN A 342 ? O GLN A 340 N GLU A 330 ? N GLU A 328 
AA5 3 4 N ALA A 329 ? N ALA A 327 O LYS A 390 ? O LYS A 388 
AA5 4 5 N LEU A 393 ? N LEU A 391 O GLU A 417 ? O GLU A 415 
AA6 1 2 N THR A 364 ? N THR A 362 O LYS A 514 ? O LYS A 512 
AA7 1 2 O LEU A 471 ? O LEU A 469 N GLY A 455 ? N GLY A 453 
AA7 2 3 O VAL A 460 ? O VAL A 458 N TYR A 443 ? N TYR A 441 
AA7 3 4 N PHE A 442 ? N PHE A 440 O ASN A 496 ? O ASN A 494 
AA7 4 5 N ILE A 497 ? N ILE A 495 O TYR A 534 ? O TYR A 532 
AA8 1 2 N SER B 48  ? N SER B 48  O GLN B 145 ? O GLN B 145 
AA8 2 3 O ILE B 142 ? O ILE B 142 N ILE B 132 ? N ILE B 132 
AA9 1 2 N PHE B 61  ? N PHE B 61  O LEU B 74  ? O LEU B 74  
AB1 1 2 N TYR B 181 ? N TYR B 181 O TYR B 188 ? O TYR B 188 
AB1 2 3 O VAL B 189 ? O VAL B 189 N THR B 107 ? N THR B 107 
AB1 3 4 N VAL B 106 ? N VAL B 106 O LEU B 234 ? O LEU B 234 
AB2 1 2 N TRP B 252 ? N TRP B 252 O ILE B 293 ? O ILE B 293 
AB3 1 2 O TYR B 354 ? O TYR B 354 N TRP B 337 ? N TRP B 337 
AB3 2 3 O TYR B 342 ? O TYR B 342 N ILE B 326 ? N ILE B 326 
AB3 3 4 N ALA B 327 ? N ALA B 327 O LYS B 390 ? O LYS B 390 
AB3 4 5 N LEU B 391 ? N LEU B 391 O GLU B 415 ? O GLU B 415 
AB4 1 2 N SER E 50  ? N SER C 48  O GLN E 147 ? O GLN C 145 
AB4 2 3 O ILE E 144 ? O ILE C 142 N ILE E 134 ? N ILE C 132 
AB5 1 2 N PHE E 63  ? N PHE C 61  O LEU E 76  ? O LEU C 74  
AB6 1 2 N THR E 109 ? N THR C 107 O VAL E 191 ? O VAL C 189 
AB6 2 3 O TYR E 190 ? O TYR C 188 N TYR E 183 ? N TYR C 181 
AB7 1 2 N TRP E 231 ? N TRP C 229 O TYR E 234 ? O TYR C 232 
AB7 2 3 N GLU E 235 ? N GLU C 233 O THR E 242 ? O THR C 240 
AB8 1 2 O LEU E 351 ? O LEU C 349 N ILE E 343 ? N ILE C 341 
AB8 2 3 O TYR E 344 ? O TYR C 342 N ILE E 328 ? N ILE C 326 
AB8 3 4 N ALA E 329 ? N ALA C 327 O LYS E 390 ? O LYS C 388 
AB8 4 5 N PHE E 391 ? N PHE C 389 O GLU E 417 ? O GLU C 415 
AB9 1 2 N THR E 364 ? N THR C 362 O LYS E 514 ? O LYS C 512 
AC1 1 2 O LEU E 471 ? O LEU C 469 N GLY E 455 ? N GLY C 453 
AC1 2 3 O VAL E 460 ? O VAL C 458 N TYR E 443 ? N TYR C 441 
AC1 3 4 N PHE E 442 ? N PHE C 440 O ASN E 496 ? O ASN C 494 
AC1 4 5 N ILE E 497 ? N ILE C 495 O TYR E 534 ? O TYR C 532 
AC2 1 2 N SER F 48  ? N SER D 48  O GLN F 145 ? O GLN D 145 
AC2 2 3 O TYR F 144 ? O TYR D 144 N PHE F 130 ? N PHE D 130 
AC3 1 2 N PHE F 61  ? N PHE D 61  O LEU F 74  ? O LEU D 74  
AC4 1 2 N TYR F 181 ? N TYR D 181 O TYR F 188 ? O TYR D 188 
AC4 2 3 O VAL F 189 ? O VAL D 189 N THR F 107 ? N THR D 107 
AC4 3 4 N VAL F 106 ? N VAL D 106 O LEU F 234 ? O LEU D 234 
AC5 1 2 N TRP F 252 ? N TRP D 252 O ILE F 293 ? O ILE D 293 
AC6 1 2 O TYR F 354 ? O TYR D 354 N TRP F 337 ? N TRP D 337 
AC6 2 3 O TYR F 342 ? O TYR D 342 N ILE F 326 ? N ILE D 326 
AC6 3 4 N ALA F 327 ? N ALA D 327 O LYS F 390 ? O LYS D 390 
AC6 4 5 N LEU F 391 ? N LEU D 391 O GLU F 415 ? O GLU D 415 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  601 ? 4  'binding site for residue MG A 601'                     
AC2 Software A MG  602 ? 3  'binding site for residue MG A 602'                     
AC3 Software A DTP 603 ? 15 'binding site for residue DTP A 603'                    
AC4 Software B SUC 501 ? 8  'binding site for residue SUC B 501'                    
AC5 Software B EDO 502 ? 5  'binding site for residue EDO B 502'                    
AC6 Software C DTP 601 ? 15 'binding site for residue DTP C 601'                    
AC7 Software C MG  602 ? 4  'binding site for residue MG C 602'                     
AC8 Software C MG  603 ? 6  'binding site for residue MG C 603'                     
AC9 Software D SUC 501 ? 8  'binding site for residue SUC D 501'                    
AD1 Software D SO4 502 ? 4  'binding site for residue SO4 D 502'                    
AD2 Software D EDO 503 ? 7  'binding site for residue EDO D 503'                    
AD3 Software F DG  816 ? 7  'binding site for Di-nucleotide DG F 816 and MRG F 817' 
AD4 Software F MRG 817 ? 13 'binding site for Di-peptide MRG F 817 and CYS C 258'   
AD5 Software F MRG 817 ? 7  'binding site for Di-nucleotide MRG F 817 and DC F 818' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  ASP A 112 ? ASP A 110 . ? 1_555 ? 
2   AC1 4  VAL A 113 ? VAL A 111 . ? 1_555 ? 
3   AC1 4  ASP A 187 ? ASP A 185 . ? 1_555 ? 
4   AC1 4  DTP K .   ? DTP A 603 . ? 1_555 ? 
5   AC2 3  ASP A 445 ? ASP A 443 . ? 1_555 ? 
6   AC2 3  ASN A 500 ? ASN A 498 . ? 1_555 ? 
7   AC2 3  HOH T .   ? HOH A 713 . ? 1_555 ? 
8   AC3 15 LYS A 67  ? LYS A 65  . ? 1_555 ? 
9   AC3 15 ARG A 74  ? ARG A 72  . ? 1_555 ? 
10  AC3 15 LEU A 76  ? LEU A 74  . ? 1_555 ? 
11  AC3 15 ASP A 112 ? ASP A 110 . ? 1_555 ? 
12  AC3 15 VAL A 113 ? VAL A 111 . ? 1_555 ? 
13  AC3 15 GLY A 114 ? GLY A 112 . ? 1_555 ? 
14  AC3 15 ASP A 115 ? ASP A 113 . ? 1_555 ? 
15  AC3 15 ALA A 116 ? ALA A 114 . ? 1_555 ? 
16  AC3 15 TYR A 117 ? TYR A 115 . ? 1_555 ? 
17  AC3 15 MET A 153 ? MET A 151 . ? 1_555 ? 
18  AC3 15 ASP A 187 ? ASP A 185 . ? 1_555 ? 
19  AC3 15 MG  I .   ? MG  A 601 . ? 1_555 ? 
20  AC3 15 DG  D 21  ? DG  P 822 . ? 1_555 ? 
21  AC3 15 DT  C 5   ? DT  T 705 . ? 1_555 ? 
22  AC3 15 DC  C 6   ? DC  T 706 . ? 1_555 ? 
23  AC4 8  TRP B 24  ? TRP B 24  . ? 1_555 ? 
24  AC4 8  ARG B 78  ? ARG B 78  . ? 1_555 ? 
25  AC4 8  GLU B 79  ? GLU B 79  . ? 1_555 ? 
26  AC4 8  LYS B 82  ? LYS B 82  . ? 1_555 ? 
27  AC4 8  GLU B 399 ? GLU B 399 . ? 1_555 ? 
28  AC4 8  GLU B 413 ? GLU B 413 . ? 1_555 ? 
29  AC4 8  TRP B 414 ? TRP B 414 . ? 1_555 ? 
30  AC4 8  HOH U .   ? HOH B 602 . ? 1_555 ? 
31  AC5 5  GLY B 316 ? GLY B 316 . ? 1_555 ? 
32  AC5 5  VAL B 317 ? VAL B 317 . ? 1_555 ? 
33  AC5 5  TYR B 318 ? TYR B 318 . ? 1_555 ? 
34  AC5 5  LYS B 323 ? LYS B 323 . ? 1_555 ? 
35  AC5 5  HOH U .   ? HOH B 609 . ? 1_555 ? 
36  AC6 15 LYS E 67  ? LYS C 65  . ? 1_555 ? 
37  AC6 15 ARG E 74  ? ARG C 72  . ? 1_555 ? 
38  AC6 15 ASP E 112 ? ASP C 110 . ? 1_555 ? 
39  AC6 15 VAL E 113 ? VAL C 111 . ? 1_555 ? 
40  AC6 15 GLY E 114 ? GLY C 112 . ? 1_555 ? 
41  AC6 15 ASP E 115 ? ASP C 113 . ? 1_555 ? 
42  AC6 15 ALA E 116 ? ALA C 114 . ? 1_555 ? 
43  AC6 15 TYR E 117 ? TYR C 115 . ? 1_555 ? 
44  AC6 15 MET E 153 ? MET C 151 . ? 1_555 ? 
45  AC6 15 ASP E 187 ? ASP C 185 . ? 1_555 ? 
46  AC6 15 LYS E 222 ? LYS C 220 . ? 1_555 ? 
47  AC6 15 MG  O .   ? MG  C 602 . ? 1_555 ? 
48  AC6 15 DT  G 5   ? DT  E 705 . ? 1_555 ? 
49  AC6 15 DC  G 6   ? DC  E 706 . ? 1_555 ? 
50  AC6 15 DG  H 21  ? DG  F 822 . ? 1_555 ? 
51  AC7 4  ASP E 112 ? ASP C 110 . ? 1_555 ? 
52  AC7 4  VAL E 113 ? VAL C 111 . ? 1_555 ? 
53  AC7 4  ASP E 187 ? ASP C 185 . ? 1_555 ? 
54  AC7 4  DTP N .   ? DTP C 601 . ? 1_555 ? 
55  AC8 6  ASP E 445 ? ASP C 443 . ? 1_555 ? 
56  AC8 6  GLY E 446 ? GLY C 444 . ? 1_555 ? 
57  AC8 6  ASN E 500 ? ASN C 498 . ? 1_555 ? 
58  AC8 6  ASP E 551 ? ASP C 549 . ? 1_555 ? 
59  AC8 6  HOH X .   ? HOH C 712 . ? 1_555 ? 
60  AC8 6  HOH X .   ? HOH C 731 . ? 1_555 ? 
61  AC9 8  ARG F 78  ? ARG D 78  . ? 1_555 ? 
62  AC9 8  GLU F 79  ? GLU D 79  . ? 1_555 ? 
63  AC9 8  LYS F 82  ? LYS D 82  . ? 1_555 ? 
64  AC9 8  GLU F 399 ? GLU D 399 . ? 1_555 ? 
65  AC9 8  GLU F 413 ? GLU D 413 . ? 1_555 ? 
66  AC9 8  TRP F 414 ? TRP D 414 . ? 1_555 ? 
67  AC9 8  HOH Y .   ? HOH D 611 . ? 1_555 ? 
68  AC9 8  DT  H 12  ? DT  F 813 . ? 1_555 ? 
69  AD1 4  GLU F 328 ? GLU D 328 . ? 1_555 ? 
70  AD1 4  TYR F 342 ? TYR D 342 . ? 1_555 ? 
71  AD1 4  PHE F 346 ? PHE D 346 . ? 1_555 ? 
72  AD1 4  ASN F 348 ? ASN D 348 . ? 1_555 ? 
73  AD2 7  GLU F 248 ? GLU D 248 . ? 1_555 ? 
74  AD2 7  LYS F 249 ? LYS D 249 . ? 1_555 ? 
75  AD2 7  TRP F 252 ? TRP D 252 . ? 1_555 ? 
76  AD2 7  GLU F 300 ? GLU D 300 . ? 1_555 ? 
77  AD2 7  LEU F 303 ? LEU D 303 . ? 1_555 ? 
78  AD2 7  ARG F 307 ? ARG D 307 . ? 1_555 ? 
79  AD2 7  HOH Y .   ? HOH D 601 . ? 1_555 ? 
80  AD3 7  CYS E 260 ? CYS C 258 . ? 1_555 ? 
81  AD3 7  LEU E 285 ? LEU C 283 . ? 1_555 ? 
82  AD3 7  DG  G 10  ? DG  E 710 . ? 1_555 ? 
83  AD3 7  DC  G 11  ? DC  E 711 . ? 1_555 ? 
84  AD3 7  DC  G 12  ? DC  E 712 . ? 1_555 ? 
85  AD3 7  DG  H 14  ? DG  F 815 . ? 1_555 ? 
86  AD3 7  DC  H 17  ? DC  F 818 . ? 1_555 ? 
87  AD4 13 VAL E 256 ? VAL C 254 . ? 1_555 ? 
88  AD4 13 ASN E 257 ? ASN C 255 . ? 1_555 ? 
89  AD4 13 ASP E 258 ? ASP C 256 . ? 1_555 ? 
90  AD4 13 ILE E 259 ? ILE C 257 . ? 1_555 ? 
91  AD4 13 LYS E 261 ? LYS C 259 . ? 1_555 ? 
92  AD4 13 LEU E 262 ? LEU C 260 . ? 1_555 ? 
93  AD4 13 VAL E 263 ? VAL C 261 . ? 1_555 ? 
94  AD4 13 GLY E 264 ? GLY C 262 . ? 1_555 ? 
95  AD4 13 LEU E 285 ? LEU C 283 . ? 1_555 ? 
96  AD4 13 DG  G 10  ? DG  E 710 . ? 1_555 ? 
97  AD4 13 DC  G 11  ? DC  E 711 . ? 1_555 ? 
98  AD4 13 DG  H 15  ? DG  F 816 . ? 1_555 ? 
99  AD4 13 DC  H 17  ? DC  F 818 . ? 1_555 ? 
100 AD5 7  ASN E 257 ? ASN C 255 . ? 1_555 ? 
101 AD5 7  CYS E 260 ? CYS C 258 . ? 1_555 ? 
102 AD5 7  LEU E 285 ? LEU C 283 . ? 1_555 ? 
103 AD5 7  DG  G 10  ? DG  E 710 . ? 1_555 ? 
104 AD5 7  DC  G 11  ? DC  E 711 . ? 1_555 ? 
105 AD5 7  DG  H 15  ? DG  F 816 . ? 1_555 ? 
106 AD5 7  DG  H 18  ? DG  F 819 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5TXN 
_atom_sites.fract_transf_matrix[1][1]   0.011106 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001537 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007483 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007252 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . VAL A  1  2   ? 0.772   21.330  7.633   1.00 109.32 ? 0   VAL A N     1 
ATOM   2     C  CA    . VAL A  1  2   ? 1.242   20.416  8.668   1.00 107.41 ? 0   VAL A CA    1 
ATOM   3     C  C     . VAL A  1  2   ? 1.422   21.132  10.003  1.00 119.10 ? 0   VAL A C     1 
ATOM   4     O  O     . VAL A  1  2   ? 2.115   22.143  10.076  1.00 125.26 ? 0   VAL A O     1 
ATOM   5     C  CB    . VAL A  1  2   ? 2.545   19.757  8.243   1.00 93.65  ? 0   VAL A CB    1 
ATOM   6     N  N     . PRO A  1  3   ? 0.776   20.623  11.056  1.00 125.89 ? 1   PRO A N     1 
ATOM   7     C  CA    . PRO A  1  3   ? 1.053   21.136  12.407  1.00 123.84 ? 1   PRO A CA    1 
ATOM   8     C  C     . PRO A  1  3   ? 2.175   20.350  13.074  1.00 122.49 ? 1   PRO A C     1 
ATOM   9     O  O     . PRO A  1  3   ? 2.808   19.517  12.418  1.00 127.22 ? 1   PRO A O     1 
ATOM   10    C  CB    . PRO A  1  3   ? -0.287  20.949  13.137  1.00 128.91 ? 1   PRO A CB    1 
ATOM   11    C  CG    . PRO A  1  3   ? -1.284  20.460  12.068  1.00 134.06 ? 1   PRO A CG    1 
ATOM   12    C  CD    . PRO A  1  3   ? -0.450  19.815  11.016  1.00 131.83 ? 1   PRO A CD    1 
ATOM   13    N  N     . ILE A  1  4   ? 2.436   20.588  14.363  1.00 114.64 ? 2   ILE A N     1 
ATOM   14    C  CA    . ILE A  1  4   ? 3.542   19.950  15.065  1.00 106.01 ? 2   ILE A CA    1 
ATOM   15    C  C     . ILE A  1  4   ? 3.011   19.249  16.310  1.00 119.14 ? 2   ILE A C     1 
ATOM   16    O  O     . ILE A  1  4   ? 1.929   19.558  16.812  1.00 128.53 ? 2   ILE A O     1 
ATOM   17    C  CB    . ILE A  1  4   ? 4.653   20.952  15.448  1.00 99.35  ? 2   ILE A CB    1 
ATOM   18    C  CG1   . ILE A  1  4   ? 4.529   22.246  14.641  1.00 91.78  ? 2   ILE A CG1   1 
ATOM   19    C  CG2   . ILE A  1  4   ? 5.997   20.336  15.213  1.00 100.06 ? 2   ILE A CG2   1 
ATOM   20    C  CD1   . ILE A  1  4   ? 3.784   23.340  15.371  1.00 91.19  ? 2   ILE A CD1   1 
ATOM   21    N  N     . SER A  1  5   ? 3.793   18.284  16.797  1.00 123.16 ? 3   SER A N     1 
ATOM   22    C  CA    . SER A  1  5   ? 3.432   17.373  17.875  1.00 124.07 ? 3   SER A CA    1 
ATOM   23    C  C     . SER A  1  5   ? 4.344   17.604  19.074  1.00 125.27 ? 3   SER A C     1 
ATOM   24    O  O     . SER A  1  5   ? 5.571   17.654  18.907  1.00 133.69 ? 3   SER A O     1 
ATOM   25    C  CB    . SER A  1  5   ? 3.534   15.914  17.413  1.00 120.77 ? 3   SER A CB    1 
ATOM   26    O  OG    . SER A  1  5   ? 4.708   15.720  16.645  1.00 111.39 ? 3   SER A OG    1 
ATOM   27    N  N     . PRO A  1  6   ? 3.805   17.754  20.283  1.00 109.61 ? 4   PRO A N     1 
ATOM   28    C  CA    . PRO A  1  6   ? 4.672   18.075  21.424  1.00 98.80  ? 4   PRO A CA    1 
ATOM   29    C  C     . PRO A  1  6   ? 4.849   16.957  22.443  1.00 100.69 ? 4   PRO A C     1 
ATOM   30    O  O     . PRO A  1  6   ? 5.984   16.604  22.779  1.00 101.62 ? 4   PRO A O     1 
ATOM   31    C  CB    . PRO A  1  6   ? 3.956   19.275  22.053  1.00 97.37  ? 4   PRO A CB    1 
ATOM   32    C  CG    . PRO A  1  6   ? 2.485   19.018  21.760  1.00 105.54 ? 4   PRO A CG    1 
ATOM   33    C  CD    . PRO A  1  6   ? 2.401   18.121  20.537  1.00 108.17 ? 4   PRO A CD    1 
ATOM   34    N  N     . ILE A  1  7   ? 3.752   16.393  22.950  1.00 105.06 ? 5   ILE A N     1 
ATOM   35    C  CA    . ILE A  1  7   ? 3.804   15.406  24.020  1.00 102.06 ? 5   ILE A CA    1 
ATOM   36    C  C     . ILE A  1  7   ? 2.881   14.246  23.669  1.00 104.47 ? 5   ILE A C     1 
ATOM   37    O  O     . ILE A  1  7   ? 1.953   14.381  22.869  1.00 115.33 ? 5   ILE A O     1 
ATOM   38    C  CB    . ILE A  1  7   ? 3.428   16.020  25.390  1.00 101.81 ? 5   ILE A CB    1 
ATOM   39    C  CG1   . ILE A  1  7   ? 1.915   16.028  25.601  1.00 93.05  ? 5   ILE A CG1   1 
ATOM   40    C  CG2   . ILE A  1  7   ? 3.940   17.447  25.495  1.00 102.99 ? 5   ILE A CG2   1 
ATOM   41    C  CD1   . ILE A  1  7   ? 1.460   16.969  26.713  1.00 88.73  ? 5   ILE A CD1   1 
ATOM   42    N  N     . GLU A  1  8   ? 3.176   13.083  24.249  1.00 94.47  ? 6   GLU A N     1 
ATOM   43    C  CA    . GLU A  1  8   ? 2.499   11.858  23.840  1.00 99.32  ? 6   GLU A CA    1 
ATOM   44    C  C     . GLU A  1  8   ? 0.992   11.979  24.037  1.00 104.62 ? 6   GLU A C     1 
ATOM   45    O  O     . GLU A  1  8   ? 0.518   12.504  25.047  1.00 111.23 ? 6   GLU A O     1 
ATOM   46    C  CB    . GLU A  1  8   ? 3.038   10.660  24.623  1.00 104.48 ? 6   GLU A CB    1 
ATOM   47    C  CG    . GLU A  1  8   ? 2.451   9.327   24.181  1.00 114.92 ? 6   GLU A CG    1 
ATOM   48    C  CD    . GLU A  1  8   ? 3.153   8.142   24.808  1.00 121.00 ? 6   GLU A CD    1 
ATOM   49    O  OE1   . GLU A  1  8   ? 3.614   8.263   25.962  1.00 122.55 ? 6   GLU A OE1   1 
ATOM   50    O  OE2   . GLU A  1  8   ? 3.250   7.090   24.141  1.00 120.24 ? 6   GLU A OE2   1 
ATOM   51    N  N     . THR A  1  9   ? 0.245   11.490  23.054  1.00 106.27 ? 7   THR A N     1 
ATOM   52    C  CA    . THR A  1  9   ? -1.205  11.586  23.016  1.00 107.39 ? 7   THR A CA    1 
ATOM   53    C  C     . THR A  1  9   ? -1.844  10.322  23.584  1.00 102.75 ? 7   THR A C     1 
ATOM   54    O  O     . THR A  1  9   ? -1.180  9.315   23.842  1.00 104.68 ? 7   THR A O     1 
ATOM   55    C  CB    . THR A  1  9   ? -1.690  11.828  21.584  1.00 112.65 ? 7   THR A CB    1 
ATOM   56    O  OG1   . THR A  1  9   ? -3.123  11.840  21.559  1.00 118.52 ? 7   THR A OG1   1 
ATOM   57    C  CG2   . THR A  1  9   ? -1.183  10.731  20.660  1.00 109.81 ? 7   THR A CG2   1 
ATOM   58    N  N     . VAL A  1  10  ? -3.155  10.390  23.781  1.00 96.61  ? 8   VAL A N     1 
ATOM   59    C  CA    . VAL A  1  10  ? -3.928  9.313   24.383  1.00 88.53  ? 8   VAL A CA    1 
ATOM   60    C  C     . VAL A  1  10  ? -4.948  8.843   23.352  1.00 84.89  ? 8   VAL A C     1 
ATOM   61    O  O     . VAL A  1  10  ? -5.819  9.620   22.951  1.00 82.06  ? 8   VAL A O     1 
ATOM   62    C  CB    . VAL A  1  10  ? -4.631  9.757   25.677  1.00 84.20  ? 8   VAL A CB    1 
ATOM   63    C  CG1   . VAL A  1  10  ? -5.607  8.688   26.143  1.00 76.80  ? 8   VAL A CG1   1 
ATOM   64    C  CG2   . VAL A  1  10  ? -3.607  10.059  26.759  1.00 75.57  ? 8   VAL A CG2   1 
ATOM   65    N  N     . PRO A  1  11  ? -4.861  7.604   22.868  1.00 87.52  ? 9   PRO A N     1 
ATOM   66    C  CA    . PRO A  1  11  ? -5.863  7.105   21.916  1.00 91.25  ? 9   PRO A CA    1 
ATOM   67    C  C     . PRO A  1  11  ? -7.271  7.199   22.486  1.00 96.33  ? 9   PRO A C     1 
ATOM   68    O  O     . PRO A  1  11  ? -7.520  6.830   23.635  1.00 97.54  ? 9   PRO A O     1 
ATOM   69    C  CB    . PRO A  1  11  ? -5.438  5.650   21.684  1.00 90.92  ? 9   PRO A CB    1 
ATOM   70    C  CG    . PRO A  1  11  ? -4.601  5.300   22.876  1.00 87.75  ? 9   PRO A CG    1 
ATOM   71    C  CD    . PRO A  1  11  ? -3.889  6.564   23.244  1.00 82.55  ? 9   PRO A CD    1 
ATOM   72    N  N     . VAL A  1  12  ? -8.195  7.706   21.671  1.00 98.83  ? 10  VAL A N     1 
ATOM   73    C  CA    . VAL A  1  12  ? -9.568  7.937   22.111  1.00 100.51 ? 10  VAL A CA    1 
ATOM   74    C  C     . VAL A  1  12  ? -10.532 7.530   21.006  1.00 102.29 ? 10  VAL A C     1 
ATOM   75    O  O     . VAL A  1  12  ? -10.791 8.300   20.073  1.00 105.97 ? 10  VAL A O     1 
ATOM   76    C  CB    . VAL A  1  12  ? -9.815  9.400   22.520  1.00 103.12 ? 10  VAL A CB    1 
ATOM   77    C  CG1   . VAL A  1  12  ? -11.282 9.590   22.862  1.00 109.06 ? 10  VAL A CG1   1 
ATOM   78    C  CG2   . VAL A  1  12  ? -8.949  9.794   23.705  1.00 99.38  ? 10  VAL A CG2   1 
ATOM   79    N  N     . LYS A  1  13  ? -11.038 6.306   21.084  1.00 102.90 ? 11  LYS A N     1 
ATOM   80    C  CA    . LYS A  1  13  ? -12.018 5.823   20.128  1.00 111.51 ? 11  LYS A CA    1 
ATOM   81    C  C     . LYS A  1  13  ? -13.402 6.378   20.457  1.00 114.43 ? 11  LYS A C     1 
ATOM   82    O  O     . LYS A  1  13  ? -13.691 6.768   21.591  1.00 115.96 ? 11  LYS A O     1 
ATOM   83    C  CB    . LYS A  1  13  ? -12.056 4.295   20.123  1.00 119.28 ? 11  LYS A CB    1 
ATOM   84    C  CG    . LYS A  1  13  ? -10.706 3.643   19.888  1.00 123.83 ? 11  LYS A CG    1 
ATOM   85    C  CD    . LYS A  1  13  ? -10.814 2.128   19.936  1.00 126.02 ? 11  LYS A CD    1 
ATOM   86    C  CE    . LYS A  1  13  ? -9.468  1.468   19.684  1.00 126.85 ? 11  LYS A CE    1 
ATOM   87    N  NZ    . LYS A  1  13  ? -8.454  1.853   20.705  1.00 123.61 ? 11  LYS A NZ    1 
ATOM   88    N  N     . LEU A  1  14  ? -14.259 6.420   19.443  1.00 118.10 ? 12  LEU A N     1 
ATOM   89    C  CA    . LEU A  1  14  ? -15.677 6.608   19.700  1.00 116.35 ? 12  LEU A CA    1 
ATOM   90    C  C     . LEU A  1  14  ? -16.296 5.302   20.186  1.00 116.08 ? 12  LEU A C     1 
ATOM   91    O  O     . LEU A  1  14  ? -15.736 4.216   20.010  1.00 116.03 ? 12  LEU A O     1 
ATOM   92    C  CB    . LEU A  1  14  ? -16.407 7.078   18.441  1.00 117.92 ? 12  LEU A CB    1 
ATOM   93    C  CG    . LEU A  1  14  ? -16.461 8.568   18.101  1.00 118.75 ? 12  LEU A CG    1 
ATOM   94    C  CD1   . LEU A  1  14  ? -17.229 8.765   16.805  1.00 121.22 ? 12  LEU A CD1   1 
ATOM   95    C  CD2   . LEU A  1  14  ? -17.106 9.359   19.226  1.00 116.49 ? 12  LEU A CD2   1 
ATOM   96    N  N     . LYS A  1  15  ? -17.457 5.419   20.819  1.00 116.49 ? 13  LYS A N     1 
ATOM   97    C  CA    . LYS A  1  15  ? -18.201 4.225   21.184  1.00 116.65 ? 13  LYS A CA    1 
ATOM   98    C  C     . LYS A  1  15  ? -18.568 3.464   19.912  1.00 122.65 ? 13  LYS A C     1 
ATOM   99    O  O     . LYS A  1  15  ? -18.912 4.085   18.898  1.00 123.29 ? 13  LYS A O     1 
ATOM   100   C  CB    . LYS A  1  15  ? -19.456 4.585   21.980  1.00 117.13 ? 13  LYS A CB    1 
ATOM   101   C  CG    . LYS A  1  15  ? -19.175 4.977   23.425  1.00 115.82 ? 13  LYS A CG    1 
ATOM   102   C  CD    . LYS A  1  15  ? -20.459 5.232   24.200  1.00 118.10 ? 13  LYS A CD    1 
ATOM   103   C  CE    . LYS A  1  15  ? -20.175 5.439   25.680  1.00 119.92 ? 13  LYS A CE    1 
ATOM   104   N  NZ    . LYS A  1  15  ? -21.406 5.771   26.447  1.00 121.86 ? 13  LYS A NZ    1 
ATOM   105   N  N     . PRO A  1  16  ? -18.490 2.133   19.920  1.00 122.42 ? 14  PRO A N     1 
ATOM   106   C  CA    . PRO A  1  16  ? -18.544 1.386   18.657  1.00 121.35 ? 14  PRO A CA    1 
ATOM   107   C  C     . PRO A  1  16  ? -19.853 1.610   17.914  1.00 118.78 ? 14  PRO A C     1 
ATOM   108   O  O     . PRO A  1  16  ? -20.918 1.770   18.514  1.00 117.08 ? 14  PRO A O     1 
ATOM   109   C  CB    . PRO A  1  16  ? -18.394 -0.075  19.101  1.00 118.33 ? 14  PRO A CB    1 
ATOM   110   C  CG    . PRO A  1  16  ? -18.814 -0.084  20.536  1.00 115.90 ? 14  PRO A CG    1 
ATOM   111   C  CD    . PRO A  1  16  ? -18.383 1.242   21.087  1.00 115.79 ? 14  PRO A CD    1 
ATOM   112   N  N     . GLY A  1  17  ? -19.757 1.608   16.585  1.00 117.90 ? 15  GLY A N     1 
ATOM   113   C  CA    . GLY A  1  17  ? -20.922 1.819   15.742  1.00 122.59 ? 15  GLY A CA    1 
ATOM   114   C  C     . GLY A  1  17  ? -21.624 3.141   15.958  1.00 125.24 ? 15  GLY A C     1 
ATOM   115   O  O     . GLY A  1  17  ? -22.844 3.222   15.784  1.00 127.55 ? 15  GLY A O     1 
ATOM   116   N  N     . MET A  1  18  ? -20.886 4.185   16.334  1.00 125.49 ? 16  MET A N     1 
ATOM   117   C  CA    . MET A  1  18  ? -21.456 5.508   16.550  1.00 129.62 ? 16  MET A CA    1 
ATOM   118   C  C     . MET A  1  18  ? -20.584 6.558   15.876  1.00 129.68 ? 16  MET A C     1 
ATOM   119   O  O     . MET A  1  18  ? -19.384 6.352   15.671  1.00 130.64 ? 16  MET A O     1 
ATOM   120   C  CB    . MET A  1  18  ? -21.602 5.816   18.047  1.00 136.07 ? 16  MET A CB    1 
ATOM   121   C  CG    . MET A  1  18  ? -22.922 6.478   18.408  1.00 144.41 ? 16  MET A CG    1 
ATOM   122   S  SD    . MET A  1  18  ? -23.355 6.299   20.150  1.00 148.43 ? 16  MET A SD    1 
ATOM   123   C  CE    . MET A  1  18  ? -24.996 7.017   20.166  1.00 148.44 ? 16  MET A CE    1 
ATOM   124   N  N     . ASP A  1  19  ? -21.199 7.691   15.536  1.00 131.05 ? 17  ASP A N     1 
ATOM   125   C  CA    . ASP A  1  19  ? -20.592 8.669   14.645  1.00 131.16 ? 17  ASP A CA    1 
ATOM   126   C  C     . ASP A  1  19  ? -20.594 10.049  15.293  1.00 135.31 ? 17  ASP A C     1 
ATOM   127   O  O     . ASP A  1  19  ? -21.317 10.309  16.257  1.00 133.68 ? 17  ASP A O     1 
ATOM   128   C  CB    . ASP A  1  19  ? -21.328 8.716   13.295  1.00 128.36 ? 17  ASP A CB    1 
ATOM   129   C  CG    . ASP A  1  19  ? -20.559 9.480   12.235  1.00 126.55 ? 17  ASP A CG    1 
ATOM   130   O  OD1   . ASP A  1  19  ? -21.204 10.109  11.370  1.00 125.73 ? 17  ASP A OD1   1 
ATOM   131   O  OD2   . ASP A  1  19  ? -19.311 9.454   12.270  1.00 124.32 ? 17  ASP A OD2   1 
ATOM   132   N  N     . GLY A  1  20  ? -19.765 10.930  14.738  1.00 135.33 ? 18  GLY A N     1 
ATOM   133   C  CA    . GLY A  1  20  ? -19.459 12.214  15.323  1.00 130.83 ? 18  GLY A CA    1 
ATOM   134   C  C     . GLY A  1  20  ? -20.633 13.158  15.485  1.00 134.38 ? 18  GLY A C     1 
ATOM   135   O  O     . GLY A  1  20  ? -21.682 13.016  14.848  1.00 141.24 ? 18  GLY A O     1 
ATOM   136   N  N     . PRO A  1  21  ? -20.469 14.143  16.367  1.00 133.10 ? 19  PRO A N     1 
ATOM   137   C  CA    . PRO A  1  21  ? -21.598 14.996  16.754  1.00 138.63 ? 19  PRO A CA    1 
ATOM   138   C  C     . PRO A  1  21  ? -22.036 15.902  15.612  1.00 147.09 ? 19  PRO A C     1 
ATOM   139   O  O     . PRO A  1  21  ? -21.210 16.437  14.870  1.00 151.91 ? 19  PRO A O     1 
ATOM   140   C  CB    . PRO A  1  21  ? -21.036 15.809  17.924  1.00 135.63 ? 19  PRO A CB    1 
ATOM   141   C  CG    . PRO A  1  21  ? -19.573 15.906  17.618  1.00 130.97 ? 19  PRO A CG    1 
ATOM   142   C  CD    . PRO A  1  21  ? -19.203 14.591  16.976  1.00 129.59 ? 19  PRO A CD    1 
ATOM   143   N  N     . LYS A  1  22  ? -23.352 16.070  15.476  1.00 146.96 ? 20  LYS A N     1 
ATOM   144   C  CA    . LYS A  1  22  ? -23.929 17.137  14.667  1.00 144.50 ? 20  LYS A CA    1 
ATOM   145   C  C     . LYS A  1  22  ? -25.056 17.788  15.455  1.00 148.74 ? 20  LYS A C     1 
ATOM   146   O  O     . LYS A  1  22  ? -25.980 17.100  15.900  1.00 154.44 ? 20  LYS A O     1 
ATOM   147   C  CB    . LYS A  1  22  ? -24.456 16.603  13.328  1.00 139.52 ? 20  LYS A CB    1 
ATOM   148   C  CG    . LYS A  1  22  ? -23.449 15.775  12.543  1.00 136.41 ? 20  LYS A CG    1 
ATOM   149   C  CD    . LYS A  1  22  ? -24.092 15.094  11.344  1.00 139.15 ? 20  LYS A CD    1 
ATOM   150   C  CE    . LYS A  1  22  ? -23.134 14.101  10.703  1.00 138.90 ? 20  LYS A CE    1 
ATOM   151   N  NZ    . LYS A  1  22  ? -23.718 13.437  9.505   1.00 139.38 ? 20  LYS A NZ    1 
ATOM   152   N  N     . VAL A  1  23  ? -24.993 19.118  15.587  1.00 147.22 ? 21  VAL A N     1 
ATOM   153   C  CA    . VAL A  1  23  ? -26.030 19.952  16.199  1.00 150.87 ? 21  VAL A CA    1 
ATOM   154   C  C     . VAL A  1  23  ? -25.712 21.413  15.901  1.00 153.85 ? 21  VAL A C     1 
ATOM   155   O  O     . VAL A  1  23  ? -24.543 21.814  15.897  1.00 153.69 ? 21  VAL A O     1 
ATOM   156   C  CB    . VAL A  1  23  ? -26.134 19.741  17.726  1.00 152.30 ? 21  VAL A CB    1 
ATOM   157   C  CG1   . VAL A  1  23  ? -27.279 18.798  18.087  1.00 154.50 ? 21  VAL A CG1   1 
ATOM   158   C  CG2   . VAL A  1  23  ? -24.805 19.259  18.313  1.00 148.89 ? 21  VAL A CG2   1 
ATOM   159   N  N     . LYS A  1  24  ? -26.743 22.218  15.658  1.00 154.87 ? 22  LYS A N     1 
ATOM   160   C  CA    . LYS A  1  24  ? -26.555 23.597  15.227  1.00 151.18 ? 22  LYS A CA    1 
ATOM   161   C  C     . LYS A  1  24  ? -26.159 24.510  16.386  1.00 150.80 ? 22  LYS A C     1 
ATOM   162   O  O     . LYS A  1  24  ? -26.477 24.253  17.550  1.00 150.95 ? 22  LYS A O     1 
ATOM   163   C  CB    . LYS A  1  24  ? -27.821 24.125  14.551  1.00 148.77 ? 22  LYS A CB    1 
ATOM   164   C  CG    . LYS A  1  24  ? -28.020 23.572  13.151  1.00 146.48 ? 22  LYS A CG    1 
ATOM   165   C  CD    . LYS A  1  24  ? -26.753 23.751  12.327  1.00 143.73 ? 22  LYS A CD    1 
ATOM   166   C  CE    . LYS A  1  24  ? -26.828 23.007  11.006  1.00 144.03 ? 22  LYS A CE    1 
ATOM   167   N  NZ    . LYS A  1  24  ? -25.537 23.078  10.267  1.00 142.64 ? 22  LYS A NZ    1 
ATOM   168   N  N     . GLN A  1  25  ? -25.452 25.587  16.043  1.00 148.19 ? 23  GLN A N     1 
ATOM   169   C  CA    . GLN A  1  25  ? -24.897 26.521  17.013  1.00 145.12 ? 23  GLN A CA    1 
ATOM   170   C  C     . GLN A  1  25  ? -25.995 27.324  17.713  1.00 148.31 ? 23  GLN A C     1 
ATOM   171   O  O     . GLN A  1  25  ? -27.152 27.369  17.285  1.00 146.83 ? 23  GLN A O     1 
ATOM   172   C  CB    . GLN A  1  25  ? -23.918 27.474  16.328  1.00 142.77 ? 23  GLN A CB    1 
ATOM   173   C  CG    . GLN A  1  25  ? -22.504 26.940  16.202  1.00 141.36 ? 23  GLN A CG    1 
ATOM   174   C  CD    . GLN A  1  25  ? -21.710 27.104  17.482  1.00 141.64 ? 23  GLN A CD    1 
ATOM   175   O  OE1   . GLN A  1  25  ? -22.178 27.716  18.442  1.00 138.75 ? 23  GLN A OE1   1 
ATOM   176   N  NE2   . GLN A  1  25  ? -20.499 26.561  17.501  1.00 143.64 ? 23  GLN A NE2   1 
ATOM   177   N  N     . TRP A  1  26  ? -25.601 27.969  18.824  1.00 154.17 ? 24  TRP A N     1 
ATOM   178   C  CA    . TRP A  1  26  ? -26.468 28.772  19.673  1.00 161.53 ? 24  TRP A CA    1 
ATOM   179   C  C     . TRP A  1  26  ? -26.693 30.161  19.076  1.00 161.47 ? 24  TRP A C     1 
ATOM   180   O  O     . TRP A  1  26  ? -25.817 30.703  18.396  1.00 157.02 ? 24  TRP A O     1 
ATOM   181   C  CB    . TRP A  1  26  ? -25.868 28.921  21.069  1.00 166.52 ? 24  TRP A CB    1 
ATOM   182   C  CG    . TRP A  1  26  ? -26.074 27.738  21.961  1.00 171.22 ? 24  TRP A CG    1 
ATOM   183   C  CD1   . TRP A  1  26  ? -25.108 26.950  22.513  1.00 169.17 ? 24  TRP A CD1   1 
ATOM   184   C  CD2   . TRP A  1  26  ? -27.328 27.209  22.410  1.00 175.32 ? 24  TRP A CD2   1 
ATOM   185   N  NE1   . TRP A  1  26  ? -25.681 25.961  23.275  1.00 169.68 ? 24  TRP A NE1   1 
ATOM   186   C  CE2   . TRP A  1  26  ? -27.044 26.099  23.228  1.00 173.75 ? 24  TRP A CE2   1 
ATOM   187   C  CE3   . TRP A  1  26  ? -28.663 27.567  22.198  1.00 177.67 ? 24  TRP A CE3   1 
ATOM   188   C  CZ2   . TRP A  1  26  ? -28.046 25.343  23.834  1.00 174.61 ? 24  TRP A CZ2   1 
ATOM   189   C  CZ3   . TRP A  1  26  ? -29.655 26.816  22.800  1.00 177.30 ? 24  TRP A CZ3   1 
ATOM   190   C  CH2   . TRP A  1  26  ? -29.342 25.716  23.607  1.00 175.97 ? 24  TRP A CH2   1 
ATOM   191   N  N     . PRO A  1  27  ? -27.865 30.757  19.316  1.00 166.25 ? 25  PRO A N     1 
ATOM   192   C  CA    . PRO A  1  27  ? -28.058 32.176  18.985  1.00 171.41 ? 25  PRO A CA    1 
ATOM   193   C  C     . PRO A  1  27  ? -27.252 33.087  19.900  1.00 175.51 ? 25  PRO A C     1 
ATOM   194   O  O     . PRO A  1  27  ? -27.804 33.712  20.811  1.00 177.48 ? 25  PRO A O     1 
ATOM   195   C  CB    . PRO A  1  27  ? -29.567 32.377  19.172  1.00 169.86 ? 25  PRO A CB    1 
ATOM   196   C  CG    . PRO A  1  27  ? -29.962 31.328  20.158  1.00 166.38 ? 25  PRO A CG    1 
ATOM   197   C  CD    . PRO A  1  27  ? -29.088 30.143  19.861  1.00 164.85 ? 25  PRO A CD    1 
ATOM   198   N  N     . LEU A  1  28  ? -25.945 33.170  19.662  1.00 174.93 ? 26  LEU A N     1 
ATOM   199   C  CA    . LEU A  1  28  ? -25.049 33.908  20.542  1.00 173.09 ? 26  LEU A CA    1 
ATOM   200   C  C     . LEU A  1  28  ? -25.188 35.411  20.324  1.00 176.70 ? 26  LEU A C     1 
ATOM   201   O  O     . LEU A  1  28  ? -25.207 35.886  19.184  1.00 178.09 ? 26  LEU A O     1 
ATOM   202   C  CB    . LEU A  1  28  ? -23.602 33.474  20.307  1.00 168.04 ? 26  LEU A CB    1 
ATOM   203   C  CG    . LEU A  1  28  ? -22.609 33.804  21.423  1.00 164.19 ? 26  LEU A CG    1 
ATOM   204   C  CD1   . LEU A  1  28  ? -22.970 33.041  22.687  1.00 161.94 ? 26  LEU A CD1   1 
ATOM   205   C  CD2   . LEU A  1  28  ? -21.184 33.491  20.994  1.00 163.14 ? 26  LEU A CD2   1 
ATOM   206   N  N     . THR A  1  29  ? -25.292 36.153  21.425  1.00 177.71 ? 27  THR A N     1 
ATOM   207   C  CA    . THR A  1  29  ? -25.331 37.608  21.361  1.00 177.37 ? 27  THR A CA    1 
ATOM   208   C  C     . THR A  1  29  ? -23.998 38.157  20.864  1.00 174.62 ? 27  THR A C     1 
ATOM   209   O  O     . THR A  1  29  ? -22.933 37.610  21.165  1.00 174.38 ? 27  THR A O     1 
ATOM   210   C  CB    . THR A  1  29  ? -25.656 38.190  22.738  1.00 174.38 ? 27  THR A CB    1 
ATOM   211   O  OG1   . THR A  1  29  ? -26.692 37.413  23.353  1.00 173.80 ? 27  THR A OG1   1 
ATOM   212   C  CG2   . THR A  1  29  ? -26.128 39.631  22.612  1.00 174.12 ? 27  THR A CG2   1 
ATOM   213   N  N     . GLU A  1  30  ? -24.066 39.248  20.091  1.00 202.23 ? 28  GLU A N     1 
ATOM   214   C  CA    . GLU A  1  30  ? -22.876 39.774  19.425  1.00 196.71 ? 28  GLU A CA    1 
ATOM   215   C  C     . GLU A  1  30  ? -21.784 40.147  20.421  1.00 191.48 ? 28  GLU A C     1 
ATOM   216   O  O     . GLU A  1  30  ? -20.594 40.053  20.097  1.00 190.28 ? 28  GLU A O     1 
ATOM   217   C  CB    . GLU A  1  30  ? -23.245 40.974  18.545  1.00 195.24 ? 28  GLU A CB    1 
ATOM   218   C  CG    . GLU A  1  30  ? -23.053 42.348  19.179  1.00 191.55 ? 28  GLU A CG    1 
ATOM   219   C  CD    . GLU A  1  30  ? -24.226 42.778  20.039  1.00 189.47 ? 28  GLU A CD    1 
ATOM   220   O  OE1   . GLU A  1  30  ? -25.026 41.911  20.447  1.00 188.71 ? 28  GLU A OE1   1 
ATOM   221   O  OE2   . GLU A  1  30  ? -24.351 43.993  20.302  1.00 188.52 ? 28  GLU A OE2   1 
ATOM   222   N  N     . GLU A  1  31  ? -22.162 40.589  21.625  1.00 187.99 ? 29  GLU A N     1 
ATOM   223   C  CA    . GLU A  1  31  ? -21.166 40.974  22.620  1.00 185.49 ? 29  GLU A CA    1 
ATOM   224   C  C     . GLU A  1  31  ? -20.264 39.798  22.975  1.00 178.29 ? 29  GLU A C     1 
ATOM   225   O  O     . GLU A  1  31  ? -19.040 39.948  23.072  1.00 173.73 ? 29  GLU A O     1 
ATOM   226   C  CB    . GLU A  1  31  ? -21.860 41.523  23.866  1.00 188.38 ? 29  GLU A CB    1 
ATOM   227   C  CG    . GLU A  1  31  ? -23.041 40.684  24.334  1.00 187.69 ? 29  GLU A CG    1 
ATOM   228   C  CD    . GLU A  1  31  ? -23.700 41.236  25.581  1.00 187.51 ? 29  GLU A CD    1 
ATOM   229   O  OE1   . GLU A  1  31  ? -23.133 42.162  26.198  1.00 189.11 ? 29  GLU A OE1   1 
ATOM   230   O  OE2   . GLU A  1  31  ? -24.789 40.742  25.945  1.00 185.48 ? 29  GLU A OE2   1 
ATOM   231   N  N     . LYS A  1  32  ? -20.856 38.620  23.184  1.00 176.59 ? 30  LYS A N     1 
ATOM   232   C  CA    . LYS A  1  32  ? -20.069 37.418  23.435  1.00 172.16 ? 30  LYS A CA    1 
ATOM   233   C  C     . LYS A  1  32  ? -19.227 37.050  22.218  1.00 172.61 ? 30  LYS A C     1 
ATOM   234   O  O     . LYS A  1  32  ? -18.103 36.552  22.359  1.00 168.19 ? 30  LYS A O     1 
ATOM   235   C  CB    . LYS A  1  32  ? -20.994 36.269  23.833  1.00 168.59 ? 30  LYS A CB    1 
ATOM   236   C  CG    . LYS A  1  32  ? -21.837 36.578  25.063  1.00 169.61 ? 30  LYS A CG    1 
ATOM   237   C  CD    . LYS A  1  32  ? -22.949 35.562  25.257  1.00 171.31 ? 30  LYS A CD    1 
ATOM   238   C  CE    . LYS A  1  32  ? -23.767 35.873  26.499  1.00 173.01 ? 30  LYS A CE    1 
ATOM   239   N  NZ    . LYS A  1  32  ? -24.323 37.255  26.469  1.00 176.73 ? 30  LYS A NZ    1 
ATOM   240   N  N     . ILE A  1  33  ? -19.768 37.269  21.015  1.00 175.73 ? 31  ILE A N     1 
ATOM   241   C  CA    . ILE A  1  33  ? -19.127 36.806  19.786  1.00 174.54 ? 31  ILE A CA    1 
ATOM   242   C  C     . ILE A  1  33  ? -17.741 37.420  19.627  1.00 170.17 ? 31  ILE A C     1 
ATOM   243   O  O     . ILE A  1  33  ? -16.825 36.776  19.101  1.00 167.05 ? 31  ILE A O     1 
ATOM   244   C  CB    . ILE A  1  33  ? -20.029 37.112  18.573  1.00 177.70 ? 31  ILE A CB    1 
ATOM   245   C  CG1   . ILE A  1  33  ? -21.360 36.372  18.702  1.00 176.89 ? 31  ILE A CG1   1 
ATOM   246   C  CG2   . ILE A  1  33  ? -19.341 36.730  17.269  1.00 178.30 ? 31  ILE A CG2   1 
ATOM   247   C  CD1   . ILE A  1  33  ? -22.314 36.620  17.558  1.00 179.08 ? 31  ILE A CD1   1 
ATOM   248   N  N     . LYS A  1  34  ? -17.561 38.662  20.085  1.00 168.68 ? 32  LYS A N     1 
ATOM   249   C  CA    . LYS A  1  34  ? -16.272 39.335  19.939  1.00 166.18 ? 32  LYS A CA    1 
ATOM   250   C  C     . LYS A  1  34  ? -15.155 38.555  20.621  1.00 161.68 ? 32  LYS A C     1 
ATOM   251   O  O     . LYS A  1  34  ? -14.053 38.428  20.074  1.00 157.01 ? 32  LYS A O     1 
ATOM   252   C  CB    . LYS A  1  34  ? -16.355 40.748  20.516  1.00 166.89 ? 32  LYS A CB    1 
ATOM   253   C  CG    . LYS A  1  34  ? -16.870 41.807  19.557  1.00 168.78 ? 32  LYS A CG    1 
ATOM   254   C  CD    . LYS A  1  34  ? -17.256 43.081  20.303  1.00 168.76 ? 32  LYS A CD    1 
ATOM   255   C  CE    . LYS A  1  34  ? -16.255 43.421  21.402  1.00 166.92 ? 32  LYS A CE    1 
ATOM   256   N  NZ    . LYS A  1  34  ? -14.879 43.650  20.882  1.00 167.05 ? 32  LYS A NZ    1 
ATOM   257   N  N     . ALA A  1  35  ? -15.417 38.041  21.825  1.00 163.22 ? 33  ALA A N     1 
ATOM   258   C  CA    . ALA A  1  35  ? -14.359 37.440  22.631  1.00 161.38 ? 33  ALA A CA    1 
ATOM   259   C  C     . ALA A  1  35  ? -13.773 36.205  21.957  1.00 166.78 ? 33  ALA A C     1 
ATOM   260   O  O     . ALA A  1  35  ? -12.551 36.020  21.936  1.00 170.74 ? 33  ALA A O     1 
ATOM   261   C  CB    . ALA A  1  35  ? -14.891 37.091  24.020  1.00 153.94 ? 33  ALA A CB    1 
ATOM   262   N  N     . LEU A  1  36  ? -14.633 35.344  21.406  1.00 166.55 ? 34  LEU A N     1 
ATOM   263   C  CA    . LEU A  1  36  ? -14.166 34.086  20.829  1.00 163.11 ? 34  LEU A CA    1 
ATOM   264   C  C     . LEU A  1  36  ? -13.265 34.318  19.621  1.00 158.41 ? 34  LEU A C     1 
ATOM   265   O  O     . LEU A  1  36  ? -12.236 33.648  19.472  1.00 152.43 ? 34  LEU A O     1 
ATOM   266   C  CB    . LEU A  1  36  ? -15.368 33.220  20.445  1.00 165.83 ? 34  LEU A CB    1 
ATOM   267   C  CG    . LEU A  1  36  ? -15.244 31.693  20.442  1.00 165.49 ? 34  LEU A CG    1 
ATOM   268   C  CD1   . LEU A  1  36  ? -16.619 31.077  20.271  1.00 166.31 ? 34  LEU A CD1   1 
ATOM   269   C  CD2   . LEU A  1  36  ? -14.308 31.188  19.355  1.00 165.31 ? 34  LEU A CD2   1 
ATOM   270   N  N     . VAL A  1  37  ? -13.631 35.263  18.749  1.00 161.99 ? 35  VAL A N     1 
ATOM   271   C  CA    . VAL A  1  37  ? -12.960 35.382  17.455  1.00 160.84 ? 35  VAL A CA    1 
ATOM   272   C  C     . VAL A  1  37  ? -11.483 35.707  17.639  1.00 164.87 ? 35  VAL A C     1 
ATOM   273   O  O     . VAL A  1  37  ? -10.621 35.163  16.937  1.00 164.67 ? 35  VAL A O     1 
ATOM   274   C  CB    . VAL A  1  37  ? -13.667 36.434  16.580  1.00 153.92 ? 35  VAL A CB    1 
ATOM   275   C  CG1   . VAL A  1  37  ? -13.003 36.524  15.214  1.00 154.10 ? 35  VAL A CG1   1 
ATOM   276   C  CG2   . VAL A  1  37  ? -15.142 36.097  16.435  1.00 150.62 ? 35  VAL A CG2   1 
ATOM   277   N  N     . GLU A  1  38  ? -11.164 36.598  18.581  1.00 169.41 ? 36  GLU A N     1 
ATOM   278   C  CA    . GLU A  1  38  ? -9.767  36.933  18.836  1.00 174.69 ? 36  GLU A CA    1 
ATOM   279   C  C     . GLU A  1  38  ? -8.993  35.723  19.343  1.00 172.66 ? 36  GLU A C     1 
ATOM   280   O  O     . GLU A  1  38  ? -7.892  35.428  18.865  1.00 171.26 ? 36  GLU A O     1 
ATOM   281   C  CB    . GLU A  1  38  ? -9.674  38.081  19.840  1.00 180.54 ? 36  GLU A CB    1 
ATOM   282   C  CG    . GLU A  1  38  ? -8.248  38.408  20.253  1.00 181.67 ? 36  GLU A CG    1 
ATOM   283   C  CD    . GLU A  1  38  ? -8.178  39.145  21.574  1.00 179.99 ? 36  GLU A CD    1 
ATOM   284   O  OE1   . GLU A  1  38  ? -7.063  39.538  21.976  1.00 177.87 ? 36  GLU A OE1   1 
ATOM   285   O  OE2   . GLU A  1  38  ? -9.236  39.326  22.211  1.00 179.19 ? 36  GLU A OE2   1 
ATOM   286   N  N     . ILE A  1  39  ? -9.561  35.006  20.315  1.00 171.49 ? 37  ILE A N     1 
ATOM   287   C  CA    . ILE A  1  39  ? -8.868  33.866  20.908  1.00 166.91 ? 37  ILE A CA    1 
ATOM   288   C  C     . ILE A  1  39  ? -8.703  32.744  19.891  1.00 166.27 ? 37  ILE A C     1 
ATOM   289   O  O     . ILE A  1  39  ? -7.629  32.139  19.784  1.00 164.23 ? 37  ILE A O     1 
ATOM   290   C  CB    . ILE A  1  39  ? -9.610  33.385  22.167  1.00 161.79 ? 37  ILE A CB    1 
ATOM   291   C  CG1   . ILE A  1  39  ? -9.933  34.569  23.081  1.00 162.25 ? 37  ILE A CG1   1 
ATOM   292   C  CG2   . ILE A  1  39  ? -8.774  32.361  22.916  1.00 155.32 ? 37  ILE A CG2   1 
ATOM   293   C  CD1   . ILE A  1  39  ? -8.713  35.309  23.580  1.00 160.94 ? 37  ILE A CD1   1 
ATOM   294   N  N     . CYS A  1  40  ? -9.762  32.441  19.135  1.00 167.90 ? 38  CYS A N     1 
ATOM   295   C  CA    . CYS A  1  40  ? -9.711  31.319  18.203  1.00 168.56 ? 38  CYS A CA    1 
ATOM   296   C  C     . CYS A  1  40  ? -8.666  31.547  17.117  1.00 165.18 ? 38  CYS A C     1 
ATOM   297   O  O     . CYS A  1  40  ? -7.934  30.621  16.747  1.00 164.25 ? 38  CYS A O     1 
ATOM   298   C  CB    . CYS A  1  40  ? -11.090 31.090  17.585  1.00 175.94 ? 38  CYS A CB    1 
ATOM   299   S  SG    . CYS A  1  40  ? -11.297 29.470  16.814  1.00 182.70 ? 38  CYS A SG    1 
ATOM   300   N  N     . THR A  1  41  ? -8.591  32.769  16.585  1.00 163.07 ? 39  THR A N     1 
ATOM   301   C  CA    . THR A  1  41  ? -7.548  33.087  15.614  1.00 161.17 ? 39  THR A CA    1 
ATOM   302   C  C     . THR A  1  41  ? -6.162  32.948  16.233  1.00 160.82 ? 39  THR A C     1 
ATOM   303   O  O     . THR A  1  41  ? -5.227  32.469  15.581  1.00 159.95 ? 39  THR A O     1 
ATOM   304   C  CB    . THR A  1  41  ? -7.755  34.500  15.065  1.00 155.88 ? 39  THR A CB    1 
ATOM   305   O  OG1   . THR A  1  41  ? -9.033  34.581  14.421  1.00 155.51 ? 39  THR A OG1   1 
ATOM   306   C  CG2   . THR A  1  41  ? -6.667  34.852  14.061  1.00 151.47 ? 39  THR A CG2   1 
ATOM   307   N  N     . GLU A  1  42  ? -6.013  33.360  17.495  1.00 161.45 ? 40  GLU A N     1 
ATOM   308   C  CA    . GLU A  1  42  ? -4.730  33.221  18.176  1.00 160.75 ? 40  GLU A CA    1 
ATOM   309   C  C     . GLU A  1  42  ? -4.313  31.759  18.285  1.00 153.42 ? 40  GLU A C     1 
ATOM   310   O  O     . GLU A  1  42  ? -3.128  31.434  18.144  1.00 152.34 ? 40  GLU A O     1 
ATOM   311   C  CB    . GLU A  1  42  ? -4.796  33.867  19.560  1.00 163.00 ? 40  GLU A CB    1 
ATOM   312   C  CG    . GLU A  1  42  ? -4.799  35.386  19.529  1.00 166.59 ? 40  GLU A CG    1 
ATOM   313   C  CD    . GLU A  1  42  ? -5.046  35.996  20.893  1.00 167.10 ? 40  GLU A CD    1 
ATOM   314   O  OE1   . GLU A  1  42  ? -5.306  35.234  21.848  1.00 166.68 ? 40  GLU A OE1   1 
ATOM   315   O  OE2   . GLU A  1  42  ? -4.980  37.238  21.011  1.00 167.18 ? 40  GLU A OE2   1 
ATOM   316   N  N     . MET A  1  43  ? -5.274  30.862  18.529  1.00 148.84 ? 41  MET A N     1 
ATOM   317   C  CA    . MET A  1  43  ? -4.947  29.448  18.690  1.00 149.18 ? 41  MET A CA    1 
ATOM   318   C  C     . MET A  1  43  ? -4.280  28.889  17.440  1.00 149.03 ? 41  MET A C     1 
ATOM   319   O  O     . MET A  1  43  ? -3.339  28.091  17.534  1.00 145.02 ? 41  MET A O     1 
ATOM   320   C  CB    . MET A  1  43  ? -6.206  28.648  19.026  1.00 150.48 ? 41  MET A CB    1 
ATOM   321   C  CG    . MET A  1  43  ? -6.729  28.863  20.438  1.00 151.30 ? 41  MET A CG    1 
ATOM   322   S  SD    . MET A  1  43  ? -8.185  27.860  20.794  1.00 152.62 ? 41  MET A SD    1 
ATOM   323   C  CE    . MET A  1  43  ? -9.356  29.125  21.276  1.00 151.54 ? 41  MET A CE    1 
ATOM   324   N  N     . GLU A  1  44  ? -4.767  29.283  16.261  1.00 149.82 ? 42  GLU A N     1 
ATOM   325   C  CA    . GLU A  1  44  ? -4.272  28.706  15.015  1.00 142.34 ? 42  GLU A CA    1 
ATOM   326   C  C     . GLU A  1  44  ? -2.788  28.997  14.822  1.00 141.67 ? 42  GLU A C     1 
ATOM   327   O  O     . GLU A  1  44  ? -2.039  28.142  14.335  1.00 139.60 ? 42  GLU A O     1 
ATOM   328   C  CB    . GLU A  1  44  ? -5.088  29.236  13.837  1.00 143.88 ? 42  GLU A CB    1 
ATOM   329   C  CG    . GLU A  1  44  ? -4.779  28.569  12.509  1.00 151.46 ? 42  GLU A CG    1 
ATOM   330   C  CD    . GLU A  1  44  ? -5.789  28.929  11.442  1.00 159.43 ? 42  GLU A CD    1 
ATOM   331   O  OE1   . GLU A  1  44  ? -6.787  29.600  11.779  1.00 163.88 ? 42  GLU A OE1   1 
ATOM   332   O  OE2   . GLU A  1  44  ? -5.589  28.545  10.271  1.00 160.84 ? 42  GLU A OE2   1 
ATOM   333   N  N     . LYS A  1  45  ? -2.347  30.203  15.192  1.00 145.25 ? 43  LYS A N     1 
ATOM   334   C  CA    . LYS A  1  45  ? -0.929  30.532  15.083  1.00 147.74 ? 43  LYS A CA    1 
ATOM   335   C  C     . LYS A  1  45  ? -0.087  29.628  15.975  1.00 148.96 ? 43  LYS A C     1 
ATOM   336   O  O     . LYS A  1  45  ? 0.993   29.178  15.574  1.00 144.23 ? 43  LYS A O     1 
ATOM   337   C  CB    . LYS A  1  45  ? -0.702  32.002  15.438  1.00 148.30 ? 43  LYS A CB    1 
ATOM   338   C  CG    . LYS A  1  45  ? 0.739   32.461  15.298  1.00 149.92 ? 43  LYS A CG    1 
ATOM   339   C  CD    . LYS A  1  45  ? 0.885   33.930  15.659  1.00 148.91 ? 43  LYS A CD    1 
ATOM   340   C  CE    . LYS A  1  45  ? 2.326   34.393  15.521  1.00 144.40 ? 43  LYS A CE    1 
ATOM   341   N  NZ    . LYS A  1  45  ? 2.486   35.826  15.890  1.00 143.87 ? 43  LYS A NZ    1 
ATOM   342   N  N     . GLU A  1  46  ? -0.565  29.351  17.191  1.00 152.48 ? 44  GLU A N     1 
ATOM   343   C  CA    . GLU A  1  46  ? 0.132   28.416  18.068  1.00 149.11 ? 44  GLU A CA    1 
ATOM   344   C  C     . GLU A  1  46  ? 0.126   27.008  17.485  1.00 145.57 ? 44  GLU A C     1 
ATOM   345   O  O     . GLU A  1  46  ? 1.109   26.269  17.615  1.00 142.60 ? 44  GLU A O     1 
ATOM   346   C  CB    . GLU A  1  46  ? -0.500  28.413  19.461  1.00 146.04 ? 44  GLU A CB    1 
ATOM   347   C  CG    . GLU A  1  46  ? -0.162  29.618  20.325  1.00 143.82 ? 44  GLU A CG    1 
ATOM   348   C  CD    . GLU A  1  46  ? -1.283  30.635  20.378  1.00 143.50 ? 44  GLU A CD    1 
ATOM   349   O  OE1   . GLU A  1  46  ? -1.047  31.802  20.003  1.00 149.91 ? 44  GLU A OE1   1 
ATOM   350   O  OE2   . GLU A  1  46  ? -2.404  30.266  20.789  1.00 139.25 ? 44  GLU A OE2   1 
ATOM   351   N  N     . GLY A  1  47  ? -0.970  26.626  16.839  1.00 144.95 ? 45  GLY A N     1 
ATOM   352   C  CA    . GLY A  1  47  ? -1.193  25.261  16.417  1.00 143.30 ? 45  GLY A CA    1 
ATOM   353   C  C     . GLY A  1  47  ? -2.177  24.505  17.278  1.00 142.65 ? 45  GLY A C     1 
ATOM   354   O  O     . GLY A  1  47  ? -2.352  23.298  17.077  1.00 143.15 ? 45  GLY A O     1 
ATOM   355   N  N     . LYS A  1  48  ? -2.819  25.182  18.234  1.00 140.73 ? 46  LYS A N     1 
ATOM   356   C  CA    . LYS A  1  48  ? -3.871  24.563  19.034  1.00 133.82 ? 46  LYS A CA    1 
ATOM   357   C  C     . LYS A  1  48  ? -5.075  24.181  18.181  1.00 132.36 ? 46  LYS A C     1 
ATOM   358   O  O     . LYS A  1  48  ? -5.741  23.176  18.454  1.00 131.45 ? 46  LYS A O     1 
ATOM   359   C  CB    . LYS A  1  48  ? -4.280  25.506  20.165  1.00 131.00 ? 46  LYS A CB    1 
ATOM   360   C  CG    . LYS A  1  48  ? -3.140  25.834  21.118  1.00 127.98 ? 46  LYS A CG    1 
ATOM   361   C  CD    . LYS A  1  48  ? -3.492  26.978  22.053  1.00 126.17 ? 46  LYS A CD    1 
ATOM   362   C  CE    . LYS A  1  48  ? -2.322  27.311  22.966  1.00 124.63 ? 46  LYS A CE    1 
ATOM   363   N  NZ    . LYS A  1  48  ? -2.593  28.498  23.821  1.00 125.53 ? 46  LYS A NZ    1 
ATOM   364   N  N     . ILE A  1  49  ? -5.402  24.992  17.173  1.00 135.49 ? 47  ILE A N     1 
ATOM   365   C  CA    . ILE A  1  49  ? -6.588  24.765  16.361  1.00 143.37 ? 47  ILE A CA    1 
ATOM   366   C  C     . ILE A  1  49  ? -6.201  24.791  14.886  1.00 153.69 ? 47  ILE A C     1 
ATOM   367   O  O     . ILE A  1  49  ? -5.195  25.386  14.491  1.00 160.08 ? 47  ILE A O     1 
ATOM   368   C  CB    . ILE A  1  49  ? -7.689  25.805  16.667  1.00 146.84 ? 47  ILE A CB    1 
ATOM   369   C  CG1   . ILE A  1  49  ? -9.079  25.204  16.454  1.00 149.41 ? 47  ILE A CG1   1 
ATOM   370   C  CG2   . ILE A  1  49  ? -7.495  27.067  15.834  1.00 151.19 ? 47  ILE A CG2   1 
ATOM   371   C  CD1   . ILE A  1  49  ? -10.149 25.859  17.301  1.00 150.47 ? 47  ILE A CD1   1 
ATOM   372   N  N     . SER A  1  50  ? -7.013  24.115  14.069  1.00 154.73 ? 48  SER A N     1 
ATOM   373   C  CA    . SER A  1  50  ? -6.827  24.074  12.625  1.00 152.78 ? 48  SER A CA    1 
ATOM   374   C  C     . SER A  1  50  ? -8.154  24.288  11.908  1.00 152.50 ? 48  SER A C     1 
ATOM   375   O  O     . SER A  1  50  ? -9.211  23.862  12.383  1.00 150.51 ? 48  SER A O     1 
ATOM   376   C  CB    . SER A  1  50  ? -6.209  22.742  12.176  1.00 149.26 ? 48  SER A CB    1 
ATOM   377   O  OG    . SER A  1  50  ? -4.908  22.578  12.711  1.00 147.27 ? 48  SER A OG    1 
ATOM   378   N  N     . LYS A  1  51  ? -8.087  24.956  10.759  1.00 154.96 ? 49  LYS A N     1 
ATOM   379   C  CA    . LYS A  1  51  ? -9.256  25.136  9.909   1.00 156.65 ? 49  LYS A CA    1 
ATOM   380   C  C     . LYS A  1  51  ? -9.583  23.848  9.162   1.00 160.51 ? 49  LYS A C     1 
ATOM   381   O  O     . LYS A  1  51  ? -8.701  23.040  8.856   1.00 160.89 ? 49  LYS A O     1 
ATOM   382   C  CB    . LYS A  1  51  ? -9.025  26.268  8.908   1.00 154.99 ? 49  LYS A CB    1 
ATOM   383   C  CG    . LYS A  1  51  ? -8.889  27.643  9.536   1.00 153.65 ? 49  LYS A CG    1 
ATOM   384   C  CD    . LYS A  1  51  ? -8.405  28.663  8.516   1.00 156.01 ? 49  LYS A CD    1 
ATOM   385   C  CE    . LYS A  1  51  ? -8.367  30.062  9.107   1.00 152.74 ? 49  LYS A CE    1 
ATOM   386   N  NZ    . LYS A  1  51  ? -7.592  31.009  8.259   1.00 152.08 ? 49  LYS A NZ    1 
ATOM   387   N  N     . ILE A  1  52  ? -10.868 23.663  8.866   1.00 164.02 ? 50  ILE A N     1 
ATOM   388   C  CA    . ILE A  1  52  ? -11.364 22.468  8.193   1.00 167.13 ? 50  ILE A CA    1 
ATOM   389   C  C     . ILE A  1  52  ? -12.280 22.875  7.048   1.00 172.15 ? 50  ILE A C     1 
ATOM   390   O  O     . ILE A  1  52  ? -13.135 23.753  7.210   1.00 174.32 ? 50  ILE A O     1 
ATOM   391   C  CB    . ILE A  1  52  ? -12.104 21.530  9.162   1.00 163.13 ? 50  ILE A CB    1 
ATOM   392   C  CG1   . ILE A  1  52  ? -13.004 22.344  10.084  1.00 163.45 ? 50  ILE A CG1   1 
ATOM   393   C  CG2   . ILE A  1  52  ? -11.116 20.700  9.957   1.00 157.60 ? 50  ILE A CG2   1 
ATOM   394   C  CD1   . ILE A  1  52  ? -13.639 21.540  11.161  1.00 160.13 ? 50  ILE A CD1   1 
ATOM   395   N  N     . GLY A  1  53  ? -12.093 22.242  5.894   1.00 172.94 ? 51  GLY A N     1 
ATOM   396   C  CA    . GLY A  1  53  ? -13.035 22.323  4.805   1.00 175.46 ? 51  GLY A CA    1 
ATOM   397   C  C     . GLY A  1  53  ? -14.316 21.591  5.147   1.00 174.13 ? 51  GLY A C     1 
ATOM   398   O  O     . GLY A  1  53  ? -14.322 20.663  5.963   1.00 170.16 ? 51  GLY A O     1 
ATOM   399   N  N     . PRO A  1  54  ? -15.442 22.012  4.546   1.00 175.27 ? 52  PRO A N     1 
ATOM   400   C  CA    . PRO A  1  54  ? -16.734 21.359  4.823   1.00 173.50 ? 52  PRO A CA    1 
ATOM   401   C  C     . PRO A  1  54  ? -16.736 19.843  4.657   1.00 173.37 ? 52  PRO A C     1 
ATOM   402   O  O     . PRO A  1  54  ? -17.745 19.191  4.948   1.00 176.16 ? 52  PRO A O     1 
ATOM   403   C  CB    . PRO A  1  54  ? -17.677 22.023  3.811   1.00 175.04 ? 52  PRO A CB    1 
ATOM   404   C  CG    . PRO A  1  54  ? -17.071 23.363  3.568   1.00 174.81 ? 52  PRO A CG    1 
ATOM   405   C  CD    . PRO A  1  54  ? -15.583 23.151  3.623   1.00 174.41 ? 52  PRO A CD    1 
ATOM   406   N  N     . GLU A  1  55  ? -15.623 19.271  4.185   1.00 171.32 ? 53  GLU A N     1 
ATOM   407   C  CA    . GLU A  1  55  ? -15.422 17.827  4.247   1.00 170.24 ? 53  GLU A CA    1 
ATOM   408   C  C     . GLU A  1  55  ? -15.601 17.276  5.658   1.00 168.54 ? 53  GLU A C     1 
ATOM   409   O  O     . GLU A  1  55  ? -15.776 16.064  5.822   1.00 167.68 ? 53  GLU A O     1 
ATOM   410   C  CB    . GLU A  1  55  ? -14.025 17.478  3.728   1.00 171.08 ? 53  GLU A CB    1 
ATOM   411   C  CG    . GLU A  1  55  ? -12.904 18.161  4.498   1.00 174.29 ? 53  GLU A CG    1 
ATOM   412   C  CD    . GLU A  1  55  ? -11.539 17.942  3.878   1.00 177.15 ? 53  GLU A CD    1 
ATOM   413   O  OE1   . GLU A  1  55  ? -11.380 16.971  3.109   1.00 178.04 ? 53  GLU A OE1   1 
ATOM   414   O  OE2   . GLU A  1  55  ? -10.625 18.746  4.157   1.00 177.70 ? 53  GLU A OE2   1 
ATOM   415   N  N     . ASN A  1  56  ? -15.543 18.139  6.677   1.00 167.14 ? 54  ASN A N     1 
ATOM   416   C  CA    . ASN A  1  56  ? -15.793 17.802  8.073   1.00 168.23 ? 54  ASN A CA    1 
ATOM   417   C  C     . ASN A  1  56  ? -17.262 18.066  8.382   1.00 166.42 ? 54  ASN A C     1 
ATOM   418   O  O     . ASN A  1  56  ? -17.657 19.222  8.583   1.00 167.03 ? 54  ASN A O     1 
ATOM   419   C  CB    . ASN A  1  56  ? -14.878 18.623  8.987   1.00 171.65 ? 54  ASN A CB    1 
ATOM   420   C  CG    . ASN A  1  56  ? -14.866 18.117  10.418  1.00 172.54 ? 54  ASN A CG    1 
ATOM   421   O  OD1   . ASN A  1  56  ? -15.892 17.708  10.958  1.00 175.57 ? 54  ASN A OD1   1 
ATOM   422   N  ND2   . ASN A  1  56  ? -13.694 18.148  11.042  1.00 171.52 ? 54  ASN A ND2   1 
ATOM   423   N  N     . PRO A  1  57  ? -18.104 17.026  8.431   1.00 163.35 ? 55  PRO A N     1 
ATOM   424   C  CA    . PRO A  1  57  ? -19.551 17.204  8.602   1.00 165.45 ? 55  PRO A CA    1 
ATOM   425   C  C     . PRO A  1  57  ? -20.019 17.135  10.056  1.00 168.78 ? 55  PRO A C     1 
ATOM   426   O  O     . PRO A  1  57  ? -20.940 16.384  10.396  1.00 170.30 ? 55  PRO A O     1 
ATOM   427   C  CB    . PRO A  1  57  ? -20.127 16.057  7.777   1.00 163.15 ? 55  PRO A CB    1 
ATOM   428   C  CG    . PRO A  1  57  ? -19.123 14.952  7.984   1.00 158.37 ? 55  PRO A CG    1 
ATOM   429   C  CD    . PRO A  1  57  ? -17.765 15.613  8.176   1.00 158.87 ? 55  PRO A CD    1 
ATOM   430   N  N     . TYR A  1  58  ? -19.399 17.926  10.929  1.00 168.45 ? 56  TYR A N     1 
ATOM   431   C  CA    . TYR A  1  58  ? -19.743 17.882  12.343  1.00 166.56 ? 56  TYR A CA    1 
ATOM   432   C  C     . TYR A  1  58  ? -19.865 19.292  12.903  1.00 168.39 ? 56  TYR A C     1 
ATOM   433   O  O     . TYR A  1  58  ? -19.027 20.156  12.628  1.00 169.70 ? 56  TYR A O     1 
ATOM   434   C  CB    . TYR A  1  58  ? -18.699 17.083  13.134  1.00 160.44 ? 56  TYR A CB    1 
ATOM   435   C  CG    . TYR A  1  58  ? -18.511 15.671  12.621  1.00 155.25 ? 56  TYR A CG    1 
ATOM   436   C  CD1   . TYR A  1  58  ? -19.567 14.770  12.612  1.00 151.32 ? 56  TYR A CD1   1 
ATOM   437   C  CD2   . TYR A  1  58  ? -17.279 15.240  12.147  1.00 152.32 ? 56  TYR A CD2   1 
ATOM   438   C  CE1   . TYR A  1  58  ? -19.404 13.482  12.138  1.00 147.36 ? 56  TYR A CE1   1 
ATOM   439   C  CE2   . TYR A  1  58  ? -17.105 13.952  11.675  1.00 147.76 ? 56  TYR A CE2   1 
ATOM   440   C  CZ    . TYR A  1  58  ? -18.170 13.077  11.675  1.00 143.78 ? 56  TYR A CZ    1 
ATOM   441   O  OH    . TYR A  1  58  ? -18.003 11.794  11.207  1.00 137.93 ? 56  TYR A OH    1 
ATOM   442   N  N     . ASN A  1  59  ? -20.926 19.517  13.678  1.00 166.16 ? 57  ASN A N     1 
ATOM   443   C  CA    . ASN A  1  59  ? -21.202 20.807  14.299  1.00 168.25 ? 57  ASN A CA    1 
ATOM   444   C  C     . ASN A  1  59  ? -21.675 20.590  15.730  1.00 166.39 ? 57  ASN A C     1 
ATOM   445   O  O     . ASN A  1  59  ? -22.568 19.772  15.968  1.00 166.20 ? 57  ASN A O     1 
ATOM   446   C  CB    . ASN A  1  59  ? -22.252 21.590  13.500  1.00 173.88 ? 57  ASN A CB    1 
ATOM   447   C  CG    . ASN A  1  59  ? -22.463 22.994  14.032  1.00 175.95 ? 57  ASN A CG    1 
ATOM   448   O  OD1   . ASN A  1  59  ? -21.657 23.506  14.808  1.00 170.80 ? 57  ASN A OD1   1 
ATOM   449   N  ND2   . ASN A  1  59  ? -23.553 23.626  13.613  1.00 181.94 ? 57  ASN A ND2   1 
ATOM   450   N  N     . THR A  1  60  ? -21.074 21.313  16.679  1.00 163.49 ? 58  THR A N     1 
ATOM   451   C  CA    . THR A  1  60  ? -21.475 21.257  18.085  1.00 158.90 ? 58  THR A CA    1 
ATOM   452   C  C     . THR A  1  60  ? -21.471 22.661  18.678  1.00 158.18 ? 58  THR A C     1 
ATOM   453   O  O     . THR A  1  60  ? -20.546 23.444  18.414  1.00 155.05 ? 58  THR A O     1 
ATOM   454   C  CB    . THR A  1  60  ? -20.562 20.344  18.918  1.00 152.45 ? 58  THR A CB    1 
ATOM   455   O  OG1   . THR A  1  60  ? -20.246 20.983  20.161  1.00 148.64 ? 58  THR A OG1   1 
ATOM   456   C  CG2   . THR A  1  60  ? -19.285 20.033  18.170  1.00 152.29 ? 58  THR A CG2   1 
ATOM   457   N  N     . PRO A  1  61  ? -22.495 23.008  19.461  1.00 160.18 ? 59  PRO A N     1 
ATOM   458   C  CA    . PRO A  1  61  ? -22.634 24.382  19.964  1.00 161.78 ? 59  PRO A CA    1 
ATOM   459   C  C     . PRO A  1  61  ? -21.448 24.819  20.812  1.00 160.98 ? 59  PRO A C     1 
ATOM   460   O  O     . PRO A  1  61  ? -20.622 24.020  21.261  1.00 160.29 ? 59  PRO A O     1 
ATOM   461   C  CB    . PRO A  1  61  ? -23.922 24.329  20.793  1.00 161.43 ? 59  PRO A CB    1 
ATOM   462   C  CG    . PRO A  1  61  ? -24.640 23.103  20.319  1.00 162.11 ? 59  PRO A CG    1 
ATOM   463   C  CD    . PRO A  1  61  ? -23.553 22.133  19.989  1.00 160.95 ? 59  PRO A CD    1 
ATOM   464   N  N     . VAL A  1  62  ? -21.394 26.130  21.053  1.00 160.73 ? 60  VAL A N     1 
ATOM   465   C  CA    . VAL A  1  62  ? -20.285 26.774  21.748  1.00 156.87 ? 60  VAL A CA    1 
ATOM   466   C  C     . VAL A  1  62  ? -20.840 27.985  22.490  1.00 158.54 ? 60  VAL A C     1 
ATOM   467   O  O     . VAL A  1  62  ? -21.827 28.593  22.069  1.00 163.50 ? 60  VAL A O     1 
ATOM   468   C  CB    . VAL A  1  62  ? -19.158 27.188  20.760  1.00 153.33 ? 60  VAL A CB    1 
ATOM   469   C  CG1   . VAL A  1  62  ? -18.118 28.061  21.435  1.00 150.63 ? 60  VAL A CG1   1 
ATOM   470   C  CG2   . VAL A  1  62  ? -18.474 25.970  20.151  1.00 150.29 ? 60  VAL A CG2   1 
ATOM   471   N  N     . PHE A  1  63  ? -20.198 28.331  23.603  1.00 153.43 ? 61  PHE A N     1 
ATOM   472   C  CA    . PHE A  1  63  ? -20.569 29.485  24.417  1.00 149.25 ? 61  PHE A CA    1 
ATOM   473   C  C     . PHE A  1  63  ? -19.341 29.887  25.228  1.00 142.65 ? 61  PHE A C     1 
ATOM   474   O  O     . PHE A  1  63  ? -18.250 29.339  25.036  1.00 141.49 ? 61  PHE A O     1 
ATOM   475   C  CB    . PHE A  1  63  ? -21.785 29.174  25.296  1.00 153.04 ? 61  PHE A CB    1 
ATOM   476   C  CG    . PHE A  1  63  ? -21.585 28.011  26.221  1.00 153.84 ? 61  PHE A CG    1 
ATOM   477   C  CD1   . PHE A  1  63  ? -21.171 28.213  27.526  1.00 153.89 ? 61  PHE A CD1   1 
ATOM   478   C  CD2   . PHE A  1  63  ? -21.814 26.716  25.787  1.00 153.64 ? 61  PHE A CD2   1 
ATOM   479   C  CE1   . PHE A  1  63  ? -20.988 27.146  28.379  1.00 151.61 ? 61  PHE A CE1   1 
ATOM   480   C  CE2   . PHE A  1  63  ? -21.630 25.646  26.635  1.00 150.79 ? 61  PHE A CE2   1 
ATOM   481   C  CZ    . PHE A  1  63  ? -21.217 25.862  27.933  1.00 150.29 ? 61  PHE A CZ    1 
ATOM   482   N  N     . ALA A  1  64  ? -19.514 30.835  26.149  1.00 140.34 ? 62  ALA A N     1 
ATOM   483   C  CA    . ALA A  1  64  ? -18.397 31.241  26.992  1.00 139.19 ? 62  ALA A CA    1 
ATOM   484   C  C     . ALA A  1  64  ? -18.898 31.968  28.233  1.00 144.59 ? 62  ALA A C     1 
ATOM   485   O  O     . ALA A  1  64  ? -19.956 32.602  28.216  1.00 147.41 ? 62  ALA A O     1 
ATOM   486   C  CB    . ALA A  1  64  ? -17.429 32.145  26.219  1.00 135.22 ? 62  ALA A CB    1 
ATOM   487   N  N     . ILE A  1  65  ? -18.113 31.865  29.308  1.00 144.24 ? 63  ILE A N     1 
ATOM   488   C  CA    . ILE A  1  65  ? -18.385 32.533  30.574  1.00 142.66 ? 63  ILE A CA    1 
ATOM   489   C  C     . ILE A  1  65  ? -17.156 33.331  30.988  1.00 143.75 ? 63  ILE A C     1 
ATOM   490   O  O     . ILE A  1  65  ? -16.016 32.934  30.724  1.00 142.67 ? 63  ILE A O     1 
ATOM   491   C  CB    . ILE A  1  65  ? -18.777 31.540  31.692  1.00 140.28 ? 63  ILE A CB    1 
ATOM   492   C  CG1   . ILE A  1  65  ? -17.716 30.448  31.842  1.00 137.17 ? 63  ILE A CG1   1 
ATOM   493   C  CG2   . ILE A  1  65  ? -20.141 30.940  31.418  1.00 140.27 ? 63  ILE A CG2   1 
ATOM   494   C  CD1   . ILE A  1  65  ? -18.004 29.468  32.959  1.00 134.24 ? 63  ILE A CD1   1 
ATOM   495   N  N     . LYS A  1  66  ? -17.394 34.471  31.633  1.00 148.53 ? 64  LYS A N     1 
ATOM   496   C  CA    . LYS A  1  66  ? -16.298 35.273  32.163  1.00 152.31 ? 64  LYS A CA    1 
ATOM   497   C  C     . LYS A  1  66  ? -15.558 34.518  33.262  1.00 152.97 ? 64  LYS A C     1 
ATOM   498   O  O     . LYS A  1  66  ? -16.177 33.947  34.165  1.00 153.72 ? 64  LYS A O     1 
ATOM   499   C  CB    . LYS A  1  66  ? -16.824 36.603  32.702  1.00 153.40 ? 64  LYS A CB    1 
ATOM   500   C  CG    . LYS A  1  66  ? -16.777 37.746  31.703  1.00 153.98 ? 64  LYS A CG    1 
ATOM   501   C  CD    . LYS A  1  66  ? -17.415 39.005  32.273  1.00 152.41 ? 64  LYS A CD    1 
ATOM   502   C  CE    . LYS A  1  66  ? -16.734 39.448  33.561  1.00 145.93 ? 64  LYS A CE    1 
ATOM   503   N  NZ    . LYS A  1  66  ? -15.325 39.877  33.340  1.00 139.65 ? 64  LYS A NZ    1 
ATOM   504   N  N     . LYS A  1  67  ? -14.229 34.509  33.171  1.00 151.95 ? 65  LYS A N     1 
ATOM   505   C  CA    . LYS A  1  67  ? -13.397 34.012  34.261  1.00 147.33 ? 65  LYS A CA    1 
ATOM   506   C  C     . LYS A  1  67  ? -13.692 34.768  35.550  1.00 150.54 ? 65  LYS A C     1 
ATOM   507   O  O     . LYS A  1  67  ? -13.633 36.001  35.587  1.00 154.32 ? 65  LYS A O     1 
ATOM   508   C  CB    . LYS A  1  67  ? -11.917 34.148  33.903  1.00 141.85 ? 65  LYS A CB    1 
ATOM   509   C  CG    . LYS A  1  67  ? -11.305 32.918  33.257  1.00 133.75 ? 65  LYS A CG    1 
ATOM   510   C  CD    . LYS A  1  67  ? -9.819  33.125  33.018  1.00 131.32 ? 65  LYS A CD    1 
ATOM   511   C  CE    . LYS A  1  67  ? -9.171  31.887  32.425  1.00 126.07 ? 65  LYS A CE    1 
ATOM   512   N  NZ    . LYS A  1  67  ? -7.746  32.133  32.073  1.00 127.09 ? 65  LYS A NZ    1 
ATOM   513   N  N     . LYS A  1  68  ? -14.026 34.026  36.604  1.00 151.21 ? 66  LYS A N     1 
ATOM   514   C  CA    . LYS A  1  68  ? -14.264 34.643  37.901  1.00 153.10 ? 66  LYS A CA    1 
ATOM   515   C  C     . LYS A  1  68  ? -13.002 35.344  38.392  1.00 155.36 ? 66  LYS A C     1 
ATOM   516   O  O     . LYS A  1  68  ? -11.886 34.850  38.207  1.00 150.60 ? 66  LYS A O     1 
ATOM   517   C  CB    . LYS A  1  68  ? -14.713 33.584  38.912  1.00 150.21 ? 66  LYS A CB    1 
ATOM   518   C  CG    . LYS A  1  68  ? -14.856 34.087  40.341  1.00 149.32 ? 66  LYS A CG    1 
ATOM   519   C  CD    . LYS A  1  68  ? -15.914 35.173  40.448  1.00 147.32 ? 66  LYS A CD    1 
ATOM   520   C  CE    . LYS A  1  68  ? -15.989 35.732  41.860  1.00 143.17 ? 66  LYS A CE    1 
ATOM   521   N  NZ    . LYS A  1  68  ? -14.708 36.367  42.276  1.00 141.24 ? 66  LYS A NZ    1 
ATOM   522   N  N     . ASP A  1  69  ? -13.190 36.505  39.023  1.00 161.44 ? 67  ASP A N     1 
ATOM   523   C  CA    . ASP A  1  69  ? -12.092 37.331  39.530  1.00 164.27 ? 67  ASP A CA    1 
ATOM   524   C  C     . ASP A  1  69  ? -11.106 37.698  38.422  1.00 165.07 ? 67  ASP A C     1 
ATOM   525   O  O     . ASP A  1  69  ? -9.899  37.805  38.656  1.00 167.33 ? 67  ASP A O     1 
ATOM   526   C  CB    . ASP A  1  69  ? -11.369 36.638  40.691  1.00 165.12 ? 67  ASP A CB    1 
ATOM   527   C  CG    . ASP A  1  69  ? -10.553 37.602  41.534  1.00 169.17 ? 67  ASP A CG    1 
ATOM   528   O  OD1   . ASP A  1  69  ? -11.150 38.304  42.375  1.00 173.73 ? 67  ASP A OD1   1 
ATOM   529   O  OD2   . ASP A  1  69  ? -9.317  37.650  41.361  1.00 167.83 ? 67  ASP A OD2   1 
ATOM   530   N  N     . SER A  1  70  ? -11.607 37.886  37.204  1.00 161.02 ? 68  SER A N     1 
ATOM   531   C  CA    . SER A  1  70  ? -10.755 38.270  36.088  1.00 156.46 ? 68  SER A CA    1 
ATOM   532   C  C     . SER A  1  70  ? -11.607 38.932  35.016  1.00 155.64 ? 68  SER A C     1 
ATOM   533   O  O     . SER A  1  70  ? -12.824 38.735  34.952  1.00 154.36 ? 68  SER A O     1 
ATOM   534   C  CB    . SER A  1  70  ? -10.003 37.065  35.512  1.00 152.41 ? 68  SER A CB    1 
ATOM   535   O  OG    . SER A  1  70  ? -9.123  37.461  34.475  1.00 152.58 ? 68  SER A OG    1 
ATOM   536   N  N     . THR A  1  71  ? -10.945 39.726  34.173  1.00 155.80 ? 69  THR A N     1 
ATOM   537   C  CA    . THR A  1  71  ? -11.586 40.258  32.978  1.00 156.55 ? 69  THR A CA    1 
ATOM   538   C  C     . THR A  1  71  ? -11.659 39.233  31.854  1.00 158.71 ? 69  THR A C     1 
ATOM   539   O  O     . THR A  1  71  ? -12.501 39.373  30.960  1.00 160.71 ? 69  THR A O     1 
ATOM   540   C  CB    . THR A  1  71  ? -10.847 41.506  32.487  1.00 157.01 ? 69  THR A CB    1 
ATOM   541   O  OG1   . THR A  1  71  ? -9.449  41.219  32.357  1.00 153.23 ? 69  THR A OG1   1 
ATOM   542   C  CG2   . THR A  1  71  ? -11.037 42.658  33.464  1.00 159.42 ? 69  THR A CG2   1 
ATOM   543   N  N     . LYS A  1  72  ? -10.792 38.222  31.874  1.00 159.64 ? 70  LYS A N     1 
ATOM   544   C  CA    . LYS A  1  72  ? -10.730 37.246  30.797  1.00 160.74 ? 70  LYS A CA    1 
ATOM   545   C  C     . LYS A  1  72  ? -12.028 36.448  30.707  1.00 160.43 ? 70  LYS A C     1 
ATOM   546   O  O     . LYS A  1  72  ? -12.832 36.399  31.642  1.00 161.93 ? 70  LYS A O     1 
ATOM   547   C  CB    . LYS A  1  72  ? -9.559  36.286  31.005  1.00 158.57 ? 70  LYS A CB    1 
ATOM   548   C  CG    . LYS A  1  72  ? -8.183  36.918  30.907  1.00 158.52 ? 70  LYS A CG    1 
ATOM   549   C  CD    . LYS A  1  72  ? -7.104  35.872  31.139  1.00 152.39 ? 70  LYS A CD    1 
ATOM   550   C  CE    . LYS A  1  72  ? -5.713  36.439  30.918  1.00 147.11 ? 70  LYS A CE    1 
ATOM   551   N  NZ    . LYS A  1  72  ? -4.661  35.406  31.138  1.00 142.49 ? 70  LYS A NZ    1 
ATOM   552   N  N     . TRP A  1  73  ? -12.223 35.814  29.554  1.00 157.83 ? 71  TRP A N     1 
ATOM   553   C  CA    . TRP A  1  73  ? -13.377 34.968  29.299  1.00 154.20 ? 71  TRP A CA    1 
ATOM   554   C  C     . TRP A  1  73  ? -12.913 33.530  29.106  1.00 147.26 ? 71  TRP A C     1 
ATOM   555   O  O     . TRP A  1  73  ? -11.808 33.278  28.616  1.00 140.19 ? 71  TRP A O     1 
ATOM   556   C  CB    . TRP A  1  73  ? -14.168 35.445  28.070  1.00 155.90 ? 71  TRP A CB    1 
ATOM   557   C  CG    . TRP A  1  73  ? -14.829 36.790  28.249  1.00 158.07 ? 71  TRP A CG    1 
ATOM   558   C  CD1   . TRP A  1  73  ? -14.332 37.869  28.923  1.00 160.41 ? 71  TRP A CD1   1 
ATOM   559   C  CD2   . TRP A  1  73  ? -16.114 37.187  27.753  1.00 161.32 ? 71  TRP A CD2   1 
ATOM   560   N  NE1   . TRP A  1  73  ? -15.223 38.913  28.872  1.00 164.88 ? 71  TRP A NE1   1 
ATOM   561   C  CE2   . TRP A  1  73  ? -16.326 38.519  28.160  1.00 165.44 ? 71  TRP A CE2   1 
ATOM   562   C  CE3   . TRP A  1  73  ? -17.104 36.546  27.003  1.00 162.82 ? 71  TRP A CE3   1 
ATOM   563   C  CZ2   . TRP A  1  73  ? -17.486 39.222  27.843  1.00 169.29 ? 71  TRP A CZ2   1 
ATOM   564   C  CZ3   . TRP A  1  73  ? -18.255 37.245  26.689  1.00 167.68 ? 71  TRP A CZ3   1 
ATOM   565   C  CH2   . TRP A  1  73  ? -18.437 38.568  27.108  1.00 170.40 ? 71  TRP A CH2   1 
ATOM   566   N  N     . ARG A  1  74  ? -13.765 32.587  29.495  1.00 148.59 ? 72  ARG A N     1 
ATOM   567   C  CA    . ARG A  1  74  ? -13.456 31.165  29.430  1.00 146.42 ? 72  ARG A CA    1 
ATOM   568   C  C     . ARG A  1  74  ? -14.239 30.531  28.290  1.00 147.35 ? 72  ARG A C     1 
ATOM   569   O  O     . ARG A  1  74  ? -15.450 30.738  28.174  1.00 153.46 ? 72  ARG A O     1 
ATOM   570   C  CB    . ARG A  1  74  ? -13.785 30.470  30.753  1.00 141.79 ? 72  ARG A CB    1 
ATOM   571   C  CG    . ARG A  1  74  ? -13.519 28.975  30.749  1.00 133.75 ? 72  ARG A CG    1 
ATOM   572   C  CD    . ARG A  1  74  ? -13.753 28.371  32.123  1.00 126.11 ? 72  ARG A CD    1 
ATOM   573   N  NE    . ARG A  1  74  ? -12.893 28.974  33.137  1.00 124.26 ? 72  ARG A NE    1 
ATOM   574   C  CZ    . ARG A  1  74  ? -11.640 28.601  33.370  1.00 118.31 ? 72  ARG A CZ    1 
ATOM   575   N  NH1   . ARG A  1  74  ? -11.093 27.624  32.659  1.00 113.66 ? 72  ARG A NH1   1 
ATOM   576   N  NH2   . ARG A  1  74  ? -10.930 29.204  34.314  1.00 113.15 ? 72  ARG A NH2   1 
ATOM   577   N  N     . LYS A  1  75  ? -13.552 29.741  27.469  1.00 142.60 ? 73  LYS A N     1 
ATOM   578   C  CA    . LYS A  1  75  ? -14.123 29.170  26.256  1.00 142.52 ? 73  LYS A CA    1 
ATOM   579   C  C     . LYS A  1  75  ? -14.572 27.718  26.151  1.00 141.10 ? 73  LYS A C     1 
ATOM   580   O  O     . LYS A  1  75  ? -13.745 26.822  25.946  1.00 142.10 ? 73  LYS A O     1 
ATOM   581   C  CB    . LYS A  1  75  ? -13.092 29.180  25.127  1.00 143.37 ? 73  LYS A CB    1 
ATOM   582   C  CG    . LYS A  1  75  ? -13.666 29.358  23.729  1.00 146.05 ? 73  LYS A CG    1 
ATOM   583   C  CD    . LYS A  1  75  ? -14.173 28.051  23.145  1.00 145.81 ? 73  LYS A CD    1 
ATOM   584   C  CE    . LYS A  1  75  ? -14.502 28.214  21.670  1.00 148.62 ? 73  LYS A CE    1 
ATOM   585   N  NZ    . LYS A  1  75  ? -14.980 26.949  21.051  1.00 151.37 ? 73  LYS A NZ    1 
ATOM   586   N  N     . LEU A  1  76  ? -15.876 27.490  26.292  1.00 138.39 ? 74  LEU A N     1 
ATOM   587   C  CA    . LEU A  1  76  ? -16.492 26.205  26.594  1.00 135.68 ? 74  LEU A CA    1 
ATOM   588   C  C     . LEU A  1  76  ? -17.238 25.698  25.369  1.00 137.08 ? 74  LEU A C     1 
ATOM   589   O  O     . LEU A  1  76  ? -18.069 26.415  24.802  1.00 141.85 ? 74  LEU A O     1 
ATOM   590   C  CB    . LEU A  1  76  ? -17.449 26.324  27.783  1.00 135.75 ? 74  LEU A CB    1 
ATOM   591   C  CG    . LEU A  1  76  ? -16.834 26.874  29.071  1.00 132.93 ? 74  LEU A CG    1 
ATOM   592   C  CD1   . LEU A  1  76  ? -17.918 27.208  30.075  1.00 131.80 ? 74  LEU A CD1   1 
ATOM   593   C  CD2   . LEU A  1  76  ? -15.844 25.880  29.657  1.00 129.35 ? 74  LEU A CD2   1 
ATOM   594   N  N     . VAL A  1  77  ? -16.939 24.468  24.969  1.00 136.17 ? 75  VAL A N     1 
ATOM   595   C  CA    . VAL A  1  77  ? -17.626 23.792  23.874  1.00 140.29 ? 75  VAL A CA    1 
ATOM   596   C  C     . VAL A  1  77  ? -18.595 22.782  24.473  1.00 145.85 ? 75  VAL A C     1 
ATOM   597   O  O     . VAL A  1  77  ? -18.174 21.764  25.034  1.00 147.68 ? 75  VAL A O     1 
ATOM   598   C  CB    . VAL A  1  77  ? -16.640 23.111  22.917  1.00 140.00 ? 75  VAL A CB    1 
ATOM   599   C  CG1   . VAL A  1  77  ? -17.374 22.604  21.688  1.00 138.68 ? 75  VAL A CG1   1 
ATOM   600   C  CG2   . VAL A  1  77  ? -15.533 24.070  22.525  1.00 143.94 ? 75  VAL A CG2   1 
ATOM   601   N  N     . ASP A  1  78  ? -19.895 23.064  24.376  1.00 147.49 ? 76  ASP A N     1 
ATOM   602   C  CA    . ASP A  1  78  ? -20.897 22.096  24.806  1.00 143.86 ? 76  ASP A CA    1 
ATOM   603   C  C     . ASP A  1  78  ? -20.745 20.824  23.982  1.00 144.17 ? 76  ASP A C     1 
ATOM   604   O  O     . ASP A  1  78  ? -20.993 20.824  22.772  1.00 146.41 ? 76  ASP A O     1 
ATOM   605   C  CB    . ASP A  1  78  ? -22.309 22.677  24.663  1.00 141.19 ? 76  ASP A CB    1 
ATOM   606   C  CG    . ASP A  1  78  ? -23.390 21.758  25.218  1.00 136.17 ? 76  ASP A CG    1 
ATOM   607   O  OD1   . ASP A  1  78  ? -24.137 22.200  26.116  1.00 136.70 ? 76  ASP A OD1   1 
ATOM   608   O  OD2   . ASP A  1  78  ? -23.513 20.606  24.750  1.00 132.43 ? 76  ASP A OD2   1 
ATOM   609   N  N     . PHE A  1  79  ? -20.334 19.737  24.633  1.00 140.64 ? 77  PHE A N     1 
ATOM   610   C  CA    . PHE A  1  79  ? -20.087 18.462  23.972  1.00 137.78 ? 77  PHE A CA    1 
ATOM   611   C  C     . PHE A  1  79  ? -21.027 17.375  24.479  1.00 133.15 ? 77  PHE A C     1 
ATOM   612   O  O     . PHE A  1  79  ? -20.680 16.192  24.456  1.00 134.60 ? 77  PHE A O     1 
ATOM   613   C  CB    . PHE A  1  79  ? -18.631 18.034  24.159  1.00 137.22 ? 77  PHE A CB    1 
ATOM   614   C  CG    . PHE A  1  79  ? -17.703 18.540  23.093  1.00 136.53 ? 77  PHE A CG    1 
ATOM   615   C  CD1   . PHE A  1  79  ? -18.123 18.636  21.777  1.00 136.67 ? 77  PHE A CD1   1 
ATOM   616   C  CD2   . PHE A  1  79  ? -16.408 18.919  23.406  1.00 133.43 ? 77  PHE A CD2   1 
ATOM   617   C  CE1   . PHE A  1  79  ? -17.267 19.095  20.795  1.00 136.31 ? 77  PHE A CE1   1 
ATOM   618   C  CE2   . PHE A  1  79  ? -15.548 19.382  22.428  1.00 129.15 ? 77  PHE A CE2   1 
ATOM   619   C  CZ    . PHE A  1  79  ? -15.979 19.469  21.120  1.00 131.19 ? 77  PHE A CZ    1 
ATOM   620   N  N     . ARG A  1  80  ? -22.216 17.768  24.946  1.00 132.20 ? 78  ARG A N     1 
ATOM   621   C  CA    . ARG A  1  80  ? -23.115 16.819  25.598  1.00 133.51 ? 78  ARG A CA    1 
ATOM   622   C  C     . ARG A  1  80  ? -23.427 15.634  24.691  1.00 133.23 ? 78  ARG A C     1 
ATOM   623   O  O     . ARG A  1  80  ? -23.443 14.483  25.145  1.00 127.16 ? 78  ARG A O     1 
ATOM   624   C  CB    . ARG A  1  80  ? -24.398 17.525  26.036  1.00 134.49 ? 78  ARG A CB    1 
ATOM   625   C  CG    . ARG A  1  80  ? -24.215 18.422  27.253  1.00 132.35 ? 78  ARG A CG    1 
ATOM   626   C  CD    . ARG A  1  80  ? -25.542 18.957  27.772  1.00 134.03 ? 78  ARG A CD    1 
ATOM   627   N  NE    . ARG A  1  80  ? -25.930 20.207  27.127  1.00 140.46 ? 78  ARG A NE    1 
ATOM   628   C  CZ    . ARG A  1  80  ? -27.043 20.877  27.408  1.00 143.06 ? 78  ARG A CZ    1 
ATOM   629   N  NH1   . ARG A  1  80  ? -27.883 20.414  28.323  1.00 141.48 ? 78  ARG A NH1   1 
ATOM   630   N  NH2   . ARG A  1  80  ? -27.317 22.010  26.775  1.00 144.89 ? 78  ARG A NH2   1 
ATOM   631   N  N     . GLU A  1  81  ? -23.673 15.893  23.405  1.00 141.39 ? 79  GLU A N     1 
ATOM   632   C  CA    . GLU A  1  81  ? -23.930 14.800  22.473  1.00 142.86 ? 79  GLU A CA    1 
ATOM   633   C  C     . GLU A  1  81  ? -22.654 14.050  22.111  1.00 145.02 ? 79  GLU A C     1 
ATOM   634   O  O     . GLU A  1  81  ? -22.706 12.847  21.833  1.00 147.03 ? 79  GLU A O     1 
ATOM   635   C  CB    . GLU A  1  81  ? -24.616 15.327  21.213  1.00 140.57 ? 79  GLU A CB    1 
ATOM   636   C  CG    . GLU A  1  81  ? -26.129 15.181  21.232  1.00 137.08 ? 79  GLU A CG    1 
ATOM   637   C  CD    . GLU A  1  81  ? -26.573 13.729  21.231  1.00 134.94 ? 79  GLU A CD    1 
ATOM   638   O  OE1   . GLU A  1  81  ? -25.852 12.883  20.661  1.00 132.37 ? 79  GLU A OE1   1 
ATOM   639   O  OE2   . GLU A  1  81  ? -27.643 13.432  21.804  1.00 136.13 ? 79  GLU A OE2   1 
ATOM   640   N  N     . LEU A  1  82  ? -21.504 14.732  22.106  1.00 140.94 ? 80  LEU A N     1 
ATOM   641   C  CA    . LEU A  1  82  ? -20.250 14.043  21.815  1.00 131.89 ? 80  LEU A CA    1 
ATOM   642   C  C     . LEU A  1  82  ? -19.821 13.162  22.980  1.00 127.67 ? 80  LEU A C     1 
ATOM   643   O  O     . LEU A  1  82  ? -19.340 12.042  22.773  1.00 126.43 ? 80  LEU A O     1 
ATOM   644   C  CB    . LEU A  1  82  ? -19.152 15.053  21.478  1.00 124.00 ? 80  LEU A CB    1 
ATOM   645   C  CG    . LEU A  1  82  ? -17.751 14.452  21.320  1.00 117.45 ? 80  LEU A CG    1 
ATOM   646   C  CD1   . LEU A  1  82  ? -17.716 13.457  20.168  1.00 116.57 ? 80  LEU A CD1   1 
ATOM   647   C  CD2   . LEU A  1  82  ? -16.694 15.530  21.132  1.00 119.93 ? 80  LEU A CD2   1 
ATOM   648   N  N     . ASN A  1  83  ? -19.984 13.653  24.212  1.00 124.00 ? 81  ASN A N     1 
ATOM   649   C  CA    . ASN A  1  83  ? -19.798 12.811  25.391  1.00 118.51 ? 81  ASN A CA    1 
ATOM   650   C  C     . ASN A  1  83  ? -20.619 11.531  25.286  1.00 125.94 ? 81  ASN A C     1 
ATOM   651   O  O     . ASN A  1  83  ? -20.091 10.426  25.457  1.00 129.69 ? 81  ASN A O     1 
ATOM   652   C  CB    . ASN A  1  83  ? -20.167 13.591  26.654  1.00 113.16 ? 81  ASN A CB    1 
ATOM   653   C  CG    . ASN A  1  83  ? -19.371 14.875  26.800  1.00 111.18 ? 81  ASN A CG    1 
ATOM   654   O  OD1   . ASN A  1  83  ? -18.257 14.993  26.288  1.00 111.87 ? 81  ASN A OD1   1 
ATOM   655   N  ND2   . ASN A  1  83  ? -19.944 15.846  27.500  1.00 110.62 ? 81  ASN A ND2   1 
ATOM   656   N  N     . LYS A  1  84  ? -21.928 11.673  25.044  1.00 127.13 ? 82  LYS A N     1 
ATOM   657   C  CA    . LYS A  1  84  ? -22.821 10.522  24.915  1.00 127.66 ? 82  LYS A CA    1 
ATOM   658   C  C     . LYS A  1  84  ? -22.239 9.437   24.015  1.00 130.00 ? 82  LYS A C     1 
ATOM   659   O  O     . LYS A  1  84  ? -22.386 8.242   24.297  1.00 131.78 ? 82  LYS A O     1 
ATOM   660   C  CB    . LYS A  1  84  ? -24.183 10.972  24.384  1.00 129.97 ? 82  LYS A CB    1 
ATOM   661   C  CG    . LYS A  1  84  ? -25.038 11.716  25.397  1.00 127.97 ? 82  LYS A CG    1 
ATOM   662   C  CD    . LYS A  1  84  ? -26.420 12.012  24.837  1.00 127.02 ? 82  LYS A CD    1 
ATOM   663   C  CE    . LYS A  1  84  ? -27.313 12.669  25.877  1.00 122.48 ? 82  LYS A CE    1 
ATOM   664   N  NZ    . LYS A  1  84  ? -28.695 12.883  25.365  1.00 123.45 ? 82  LYS A NZ    1 
ATOM   665   N  N     . ARG A  1  85  ? -21.577 9.829   22.927  1.00 132.29 ? 83  ARG A N     1 
ATOM   666   C  CA    . ARG A  1  85  ? -21.075 8.876   21.946  1.00 135.82 ? 83  ARG A CA    1 
ATOM   667   C  C     . ARG A  1  85  ? -19.579 8.613   22.069  1.00 137.66 ? 83  ARG A C     1 
ATOM   668   O  O     . ARG A  1  85  ? -19.049 7.791   21.315  1.00 137.80 ? 83  ARG A O     1 
ATOM   669   C  CB    . ARG A  1  85  ? -21.386 9.367   20.528  1.00 138.81 ? 83  ARG A CB    1 
ATOM   670   C  CG    . ARG A  1  85  ? -22.789 9.922   20.339  1.00 141.90 ? 83  ARG A CG    1 
ATOM   671   C  CD    . ARG A  1  85  ? -23.035 10.254  18.878  1.00 142.54 ? 83  ARG A CD    1 
ATOM   672   N  NE    . ARG A  1  85  ? -24.224 11.075  18.674  1.00 136.62 ? 83  ARG A NE    1 
ATOM   673   C  CZ    . ARG A  1  85  ? -24.614 11.536  17.490  1.00 133.97 ? 83  ARG A CZ    1 
ATOM   674   N  NH1   . ARG A  1  85  ? -23.908 11.257  16.403  1.00 130.17 ? 83  ARG A NH1   1 
ATOM   675   N  NH2   . ARG A  1  85  ? -25.709 12.279  17.392  1.00 138.95 ? 83  ARG A NH2   1 
ATOM   676   N  N     . THR A  1  86  ? -18.890 9.273   22.995  1.00 121.07 ? 84  THR A N     1 
ATOM   677   C  CA    . THR A  1  86  ? -17.467 9.048   23.198  1.00 118.17 ? 84  THR A CA    1 
ATOM   678   C  C     . THR A  1  86  ? -17.246 7.931   24.212  1.00 105.62 ? 84  THR A C     1 
ATOM   679   O  O     . THR A  1  86  ? -18.046 7.735   25.131  1.00 99.59  ? 84  THR A O     1 
ATOM   680   C  CB    . THR A  1  86  ? -16.777 10.331  23.672  1.00 123.62 ? 84  THR A CB    1 
ATOM   681   O  OG1   . THR A  1  86  ? -17.191 11.428  22.849  1.00 133.13 ? 84  THR A OG1   1 
ATOM   682   C  CG2   . THR A  1  86  ? -15.263 10.197  23.583  1.00 121.09 ? 84  THR A CG2   1 
ATOM   683   N  N     . GLN A  1  87  ? -16.156 7.188   24.021  1.00 108.36 ? 85  GLN A N     1 
ATOM   684   C  CA    . GLN A  1  87  ? -15.841 6.062   24.890  1.00 107.17 ? 85  GLN A CA    1 
ATOM   685   C  C     . GLN A  1  87  ? -15.725 6.509   26.343  1.00 105.61 ? 85  GLN A C     1 
ATOM   686   O  O     . GLN A  1  87  ? -15.345 7.644   26.642  1.00 109.82 ? 85  GLN A O     1 
ATOM   687   C  CB    . GLN A  1  87  ? -14.530 5.403   24.461  1.00 107.88 ? 85  GLN A CB    1 
ATOM   688   C  CG    . GLN A  1  87  ? -13.309 6.294   24.658  1.00 100.62 ? 85  GLN A CG    1 
ATOM   689   C  CD    . GLN A  1  87  ? -12.030 5.509   24.864  1.00 97.31  ? 85  GLN A CD    1 
ATOM   690   O  OE1   . GLN A  1  87  ? -11.213 5.380   23.953  1.00 98.60  ? 85  GLN A OE1   1 
ATOM   691   N  NE2   . GLN A  1  87  ? -11.845 4.986   26.070  1.00 94.27  ? 85  GLN A NE2   1 
ATOM   692   N  N     . ASP A  1  88  ? -16.060 5.599   27.252  1.00 100.52 ? 86  ASP A N     1 
ATOM   693   C  CA    . ASP A  1  88  ? -15.936 5.882   28.672  1.00 98.10  ? 86  ASP A CA    1 
ATOM   694   C  C     . ASP A  1  88  ? -14.473 5.809   29.084  1.00 89.40  ? 86  ASP A C     1 
ATOM   695   O  O     . ASP A  1  88  ? -13.720 4.954   28.608  1.00 95.09  ? 86  ASP A O     1 
ATOM   696   C  CB    . ASP A  1  88  ? -16.764 4.896   29.496  1.00 102.14 ? 86  ASP A CB    1 
ATOM   697   C  CG    . ASP A  1  88  ? -18.254 5.121   29.346  1.00 107.38 ? 86  ASP A CG    1 
ATOM   698   O  OD1   . ASP A  1  88  ? -18.654 6.268   29.055  1.00 109.86 ? 86  ASP A OD1   1 
ATOM   699   O  OD2   . ASP A  1  88  ? -19.023 4.153   29.524  1.00 108.56 ? 86  ASP A OD2   1 
ATOM   700   N  N     . PHE A  1  89  ? -14.073 6.711   29.970  1.00 83.37  ? 87  PHE A N     1 
ATOM   701   C  CA    . PHE A  1  89  ? -12.767 6.654   30.605  1.00 85.65  ? 87  PHE A CA    1 
ATOM   702   C  C     . PHE A  1  89  ? -12.914 6.224   32.058  1.00 87.49  ? 87  PHE A C     1 
ATOM   703   O  O     . PHE A  1  89  ? -14.019 6.130   32.598  1.00 94.88  ? 87  PHE A O     1 
ATOM   704   C  CB    . PHE A  1  89  ? -12.065 8.015   30.527  1.00 82.46  ? 87  PHE A CB    1 
ATOM   705   C  CG    . PHE A  1  89  ? -11.871 8.523   29.127  1.00 93.76  ? 87  PHE A CG    1 
ATOM   706   C  CD1   . PHE A  1  89  ? -10.739 8.185   28.406  1.00 98.52  ? 87  PHE A CD1   1 
ATOM   707   C  CD2   . PHE A  1  89  ? -12.814 9.348   28.537  1.00 94.29  ? 87  PHE A CD2   1 
ATOM   708   C  CE1   . PHE A  1  89  ? -10.553 8.651   27.120  1.00 99.05  ? 87  PHE A CE1   1 
ATOM   709   C  CE2   . PHE A  1  89  ? -12.634 9.819   27.249  1.00 98.19  ? 87  PHE A CE2   1 
ATOM   710   C  CZ    . PHE A  1  89  ? -11.500 9.470   26.540  1.00 101.23 ? 87  PHE A CZ    1 
ATOM   711   N  N     . TRP A  1  90  ? -11.777 5.955   32.692  1.00 82.66  ? 88  TRP A N     1 
ATOM   712   C  CA    . TRP A  1  90  ? -11.720 5.741   34.133  1.00 86.99  ? 88  TRP A CA    1 
ATOM   713   C  C     . TRP A  1  90  ? -11.087 6.968   34.771  1.00 82.00  ? 88  TRP A C     1 
ATOM   714   O  O     . TRP A  1  90  ? -9.896  7.233   34.569  1.00 90.26  ? 88  TRP A O     1 
ATOM   715   C  CB    . TRP A  1  90  ? -10.948 4.481   34.509  1.00 85.98  ? 88  TRP A CB    1 
ATOM   716   C  CG    . TRP A  1  90  ? -11.057 4.236   35.977  1.00 78.27  ? 88  TRP A CG    1 
ATOM   717   C  CD1   . TRP A  1  90  ? -10.175 4.626   36.943  1.00 79.55  ? 88  TRP A CD1   1 
ATOM   718   C  CD2   . TRP A  1  90  ? -12.143 3.599   36.659  1.00 73.41  ? 88  TRP A CD2   1 
ATOM   719   N  NE1   . TRP A  1  90  ? -10.632 4.246   38.182  1.00 72.79  ? 88  TRP A NE1   1 
ATOM   720   C  CE2   . TRP A  1  90  ? -11.841 3.618   38.035  1.00 67.17  ? 88  TRP A CE2   1 
ATOM   721   C  CE3   . TRP A  1  90  ? -13.336 3.003   36.238  1.00 75.01  ? 88  TRP A CE3   1 
ATOM   722   C  CZ2   . TRP A  1  90  ? -12.686 3.060   38.992  1.00 65.95  ? 88  TRP A CZ2   1 
ATOM   723   C  CZ3   . TRP A  1  90  ? -14.174 2.452   37.189  1.00 69.11  ? 88  TRP A CZ3   1 
ATOM   724   C  CH2   . TRP A  1  90  ? -13.844 2.483   38.550  1.00 67.75  ? 88  TRP A CH2   1 
ATOM   725   N  N     . GLU A  1  91  ? -11.884 7.715   35.531  1.00 74.96  ? 89  GLU A N     1 
ATOM   726   C  CA    . GLU A  1  91  ? -11.391 8.917   36.188  1.00 75.24  ? 89  GLU A CA    1 
ATOM   727   C  C     . GLU A  1  91  ? -10.237 8.581   37.125  1.00 68.63  ? 89  GLU A C     1 
ATOM   728   O  O     . GLU A  1  91  ? -10.308 7.624   37.902  1.00 68.38  ? 89  GLU A O     1 
ATOM   729   C  CB    . GLU A  1  91  ? -12.521 9.591   36.968  1.00 70.94  ? 89  GLU A CB    1 
ATOM   730   C  CG    . GLU A  1  91  ? -13.818 9.747   36.188  1.00 79.11  ? 89  GLU A CG    1 
ATOM   731   C  CD    . GLU A  1  91  ? -13.670 10.638  34.969  1.00 83.41  ? 89  GLU A CD    1 
ATOM   732   O  OE1   . GLU A  1  91  ? -14.451 10.468  34.009  1.00 89.90  ? 89  GLU A OE1   1 
ATOM   733   O  OE2   . GLU A  1  91  ? -12.775 11.511  34.970  1.00 80.36  ? 89  GLU A OE2   1 
ATOM   734   N  N     . VAL A  1  92  ? -9.171  9.380   37.050  1.00 68.53  ? 90  VAL A N     1 
ATOM   735   C  CA    . VAL A  1  92  ? -8.004  9.198   37.904  1.00 69.68  ? 90  VAL A CA    1 
ATOM   736   C  C     . VAL A  1  92  ? -8.002  10.154  39.084  1.00 73.26  ? 90  VAL A C     1 
ATOM   737   O  O     . VAL A  1  92  ? -7.099  10.084  39.929  1.00 75.74  ? 90  VAL A O     1 
ATOM   738   C  CB    . VAL A  1  92  ? -6.697  9.344   37.099  1.00 75.69  ? 90  VAL A CB    1 
ATOM   739   C  CG1   . VAL A  1  92  ? -6.532  8.179   36.137  1.00 60.18  ? 90  VAL A CG1   1 
ATOM   740   C  CG2   . VAL A  1  92  ? -6.681  10.664  36.349  1.00 84.91  ? 90  VAL A CG2   1 
ATOM   741   N  N     . GLN A  1  93  ? -8.981  11.052  39.165  1.00 75.24  ? 91  GLN A N     1 
ATOM   742   C  CA    . GLN A  1  93  ? -9.121  11.966  40.296  1.00 67.17  ? 91  GLN A CA    1 
ATOM   743   C  C     . GLN A  1  93  ? -9.953  11.254  41.356  1.00 68.61  ? 91  GLN A C     1 
ATOM   744   O  O     . GLN A  1  93  ? -11.175 11.143  41.233  1.00 78.85  ? 91  GLN A O     1 
ATOM   745   C  CB    . GLN A  1  93  ? -9.766  13.275  39.856  1.00 72.21  ? 91  GLN A CB    1 
ATOM   746   C  CG    . GLN A  1  93  ? -9.554  14.434  40.819  1.00 77.33  ? 91  GLN A CG    1 
ATOM   747   C  CD    . GLN A  1  93  ? -8.123  14.940  40.823  1.00 76.43  ? 91  GLN A CD    1 
ATOM   748   O  OE1   . GLN A  1  93  ? -7.707  15.669  39.922  1.00 83.35  ? 91  GLN A OE1   1 
ATOM   749   N  NE2   . GLN A  1  93  ? -7.361  14.554  41.841  1.00 64.33  ? 91  GLN A NE2   1 
ATOM   750   N  N     . LEU A  1  94  ? -9.291  10.770  42.404  1.00 65.19  ? 92  LEU A N     1 
ATOM   751   C  CA    . LEU A  1  94  ? -9.930  9.927   43.405  1.00 64.44  ? 92  LEU A CA    1 
ATOM   752   C  C     . LEU A  1  94  ? -10.417 10.708  44.618  1.00 69.44  ? 92  LEU A C     1 
ATOM   753   O  O     . LEU A  1  94  ? -10.977 10.107  45.540  1.00 74.03  ? 92  LEU A O     1 
ATOM   754   C  CB    . LEU A  1  94  ? -8.969  8.821   43.856  1.00 57.59  ? 92  LEU A CB    1 
ATOM   755   C  CG    . LEU A  1  94  ? -8.330  7.952   42.768  1.00 55.48  ? 92  LEU A CG    1 
ATOM   756   C  CD1   . LEU A  1  94  ? -7.675  6.728   43.391  1.00 58.08  ? 92  LEU A CD1   1 
ATOM   757   C  CD2   . LEU A  1  94  ? -9.348  7.544   41.710  1.00 51.97  ? 92  LEU A CD2   1 
ATOM   758   N  N     . GLY A  1  95  ? -10.229 12.020  44.636  1.00 66.21  ? 93  GLY A N     1 
ATOM   759   C  CA    . GLY A  1  95  ? -10.719 12.835  45.726  1.00 63.40  ? 93  GLY A CA    1 
ATOM   760   C  C     . GLY A  1  95  ? -10.053 14.197  45.714  1.00 67.51  ? 93  GLY A C     1 
ATOM   761   O  O     . GLY A  1  95  ? -9.353  14.561  44.770  1.00 73.05  ? 93  GLY A O     1 
ATOM   762   N  N     . ILE A  1  96  ? -10.301 14.944  46.786  1.00 66.42  ? 94  ILE A N     1 
ATOM   763   C  CA    . ILE A  1  96  ? -9.803  16.312  46.907  1.00 69.72  ? 94  ILE A CA    1 
ATOM   764   C  C     . ILE A  1  96  ? -8.781  16.370  48.037  1.00 71.24  ? 94  ILE A C     1 
ATOM   765   O  O     . ILE A  1  96  ? -9.028  15.822  49.121  1.00 74.47  ? 94  ILE A O     1 
ATOM   766   C  CB    . ILE A  1  96  ? -10.957 17.297  47.157  1.00 71.24  ? 94  ILE A CB    1 
ATOM   767   C  CG1   . ILE A  1  96  ? -12.034 17.149  46.081  1.00 73.36  ? 94  ILE A CG1   1 
ATOM   768   C  CG2   . ILE A  1  96  ? -10.444 18.728  47.216  1.00 73.21  ? 94  ILE A CG2   1 
ATOM   769   C  CD1   . ILE A  1  96  ? -13.250 18.009  46.329  1.00 79.35  ? 94  ILE A CD1   1 
ATOM   770   N  N     . PRO A  1  97  ? -7.641  17.032  47.845  1.00 71.48  ? 95  PRO A N     1 
ATOM   771   C  CA    . PRO A  1  97  ? -6.662  17.134  48.932  1.00 70.18  ? 95  PRO A CA    1 
ATOM   772   C  C     . PRO A  1  97  ? -7.154  18.060  50.033  1.00 67.01  ? 95  PRO A C     1 
ATOM   773   O  O     . PRO A  1  97  ? -7.724  19.122  49.769  1.00 72.74  ? 95  PRO A O     1 
ATOM   774   C  CB    . PRO A  1  97  ? -5.415  17.698  48.237  1.00 66.81  ? 95  PRO A CB    1 
ATOM   775   C  CG    . PRO A  1  97  ? -5.625  17.420  46.777  1.00 70.00  ? 95  PRO A CG    1 
ATOM   776   C  CD    . PRO A  1  97  ? -7.102  17.530  46.570  1.00 71.41  ? 95  PRO A CD    1 
ATOM   777   N  N     . HIS A  1  98  ? -6.919  17.653  51.281  1.00 62.86  ? 96  HIS A N     1 
ATOM   778   C  CA    . HIS A  1  98  ? -7.266  18.549  52.371  1.00 52.84  ? 96  HIS A CA    1 
ATOM   779   C  C     . HIS A  1  98  ? -6.013  19.166  52.982  1.00 60.73  ? 96  HIS A C     1 
ATOM   780   O  O     . HIS A  1  98  ? -4.990  18.484  53.120  1.00 66.02  ? 96  HIS A O     1 
ATOM   781   C  CB    . HIS A  1  98  ? -8.065  17.825  53.464  1.00 51.90  ? 96  HIS A CB    1 
ATOM   782   C  CG    . HIS A  1  98  ? -8.810  18.750  54.377  1.00 59.98  ? 96  HIS A CG    1 
ATOM   783   N  ND1   . HIS A  1  98  ? -8.230  19.327  55.486  1.00 56.86  ? 96  HIS A ND1   1 
ATOM   784   C  CD2   . HIS A  1  98  ? -10.086 19.205  54.341  1.00 54.57  ? 96  HIS A CD2   1 
ATOM   785   C  CE1   . HIS A  1  98  ? -9.115  20.095  56.096  1.00 61.71  ? 96  HIS A CE1   1 
ATOM   786   N  NE2   . HIS A  1  98  ? -10.250 20.038  55.422  1.00 59.97  ? 96  HIS A NE2   1 
ATOM   787   N  N     . PRO A  1  99  ? -6.058  20.456  53.327  1.00 62.49  ? 97  PRO A N     1 
ATOM   788   C  CA    . PRO A  1  99  ? -4.877  21.102  53.922  1.00 60.07  ? 97  PRO A CA    1 
ATOM   789   C  C     . PRO A  1  99  ? -4.393  20.436  55.197  1.00 67.96  ? 97  PRO A C     1 
ATOM   790   O  O     . PRO A  1  99  ? -3.182  20.427  55.453  1.00 68.06  ? 97  PRO A O     1 
ATOM   791   C  CB    . PRO A  1  99  ? -5.357  22.538  54.181  1.00 55.26  ? 97  PRO A CB    1 
ATOM   792   C  CG    . PRO A  1  99  ? -6.854  22.461  54.161  1.00 55.91  ? 97  PRO A CG    1 
ATOM   793   C  CD    . PRO A  1  99  ? -7.178  21.394  53.170  1.00 59.43  ? 97  PRO A CD    1 
ATOM   794   N  N     . ALA A  1  100 ? -5.298  19.889  56.015  1.00 51.83  ? 98  ALA A N     1 
ATOM   795   C  CA    . ALA A  1  100 ? -4.875  19.211  57.236  1.00 50.95  ? 98  ALA A CA    1 
ATOM   796   C  C     . ALA A  1  100 ? -3.977  18.017  56.944  1.00 55.72  ? 98  ALA A C     1 
ATOM   797   O  O     . ALA A  1  100 ? -3.242  17.574  57.833  1.00 65.35  ? 98  ALA A O     1 
ATOM   798   C  CB    . ALA A  1  100 ? -6.095  18.763  58.042  1.00 50.05  ? 98  ALA A CB    1 
ATOM   799   N  N     . GLY A  1  101 ? -4.022  17.491  55.718  1.00 50.76  ? 99  GLY A N     1 
ATOM   800   C  CA    . GLY A  1  101 ? -3.091  16.451  55.321  1.00 60.49  ? 99  GLY A CA    1 
ATOM   801   C  C     . GLY A  1  101 ? -1.660  16.934  55.200  1.00 64.27  ? 99  GLY A C     1 
ATOM   802   O  O     . GLY A  1  101 ? -0.723  16.172  55.458  1.00 68.82  ? 99  GLY A O     1 
ATOM   803   N  N     . LEU A  1  102 ? -1.468  18.193  54.810  1.00 62.19  ? 100 LEU A N     1 
ATOM   804   C  CA    . LEU A  1  102 ? -0.134  18.700  54.515  1.00 64.38  ? 100 LEU A CA    1 
ATOM   805   C  C     . LEU A  1  102 ? 0.738   18.720  55.764  1.00 67.99  ? 100 LEU A C     1 
ATOM   806   O  O     . LEU A  1  102 ? 0.289   19.088  56.854  1.00 67.02  ? 100 LEU A O     1 
ATOM   807   C  CB    . LEU A  1  102 ? -0.224  20.115  53.936  1.00 54.73  ? 100 LEU A CB    1 
ATOM   808   C  CG    . LEU A  1  102 ? -1.194  20.382  52.783  1.00 55.94  ? 100 LEU A CG    1 
ATOM   809   C  CD1   . LEU A  1  102 ? -1.217  21.864  52.427  1.00 56.65  ? 100 LEU A CD1   1 
ATOM   810   C  CD2   . LEU A  1  102 ? -0.827  19.553  51.569  1.00 54.80  ? 100 LEU A CD2   1 
ATOM   811   N  N     . LYS A  1  103 ? 1.998   18.323  55.599  1.00 67.30  ? 101 LYS A N     1 
ATOM   812   C  CA    . LYS A  1  103 ? 3.003   18.565  56.619  1.00 70.15  ? 101 LYS A CA    1 
ATOM   813   C  C     . LYS A  1  103 ? 3.499   20.006  56.538  1.00 76.21  ? 101 LYS A C     1 
ATOM   814   O  O     . LYS A  1  103 ? 3.318   20.699  55.533  1.00 75.98  ? 101 LYS A O     1 
ATOM   815   C  CB    . LYS A  1  103 ? 4.181   17.597  56.468  1.00 61.80  ? 101 LYS A CB    1 
ATOM   816   C  CG    . LYS A  1  103 ? 3.876   16.141  56.815  1.00 63.59  ? 101 LYS A CG    1 
ATOM   817   C  CD    . LYS A  1  103 ? 3.203   15.406  55.662  1.00 72.76  ? 101 LYS A CD    1 
ATOM   818   C  CE    . LYS A  1  103 ? 3.020   13.930  55.977  1.00 79.42  ? 101 LYS A CE    1 
ATOM   819   N  NZ    . LYS A  1  103 ? 4.323   13.215  56.063  1.00 84.47  ? 101 LYS A NZ    1 
ATOM   820   N  N     . LYS A  1  104 ? 4.138   20.454  57.616  1.00 81.67  ? 102 LYS A N     1 
ATOM   821   C  CA    . LYS A  1  104 ? 4.752   21.775  57.614  1.00 84.97  ? 102 LYS A CA    1 
ATOM   822   C  C     . LYS A  1  104 ? 5.983   21.776  56.715  1.00 79.28  ? 102 LYS A C     1 
ATOM   823   O  O     . LYS A  1  104 ? 6.824   20.875  56.794  1.00 70.51  ? 102 LYS A O     1 
ATOM   824   C  CB    . LYS A  1  104 ? 5.120   22.192  59.037  1.00 89.76  ? 102 LYS A CB    1 
ATOM   825   C  CG    . LYS A  1  104 ? 5.483   23.665  59.187  1.00 95.82  ? 102 LYS A CG    1 
ATOM   826   C  CD    . LYS A  1  104 ? 6.989   23.880  59.181  1.00 99.11  ? 102 LYS A CD    1 
ATOM   827   C  CE    . LYS A  1  104 ? 7.337   25.354  59.314  1.00 97.48  ? 102 LYS A CE    1 
ATOM   828   N  NZ    . LYS A  1  104 ? 6.855   26.147  58.149  1.00 94.94  ? 102 LYS A NZ    1 
ATOM   829   N  N     . LYS A  1  105 ? 6.092   22.793  55.865  1.00 77.18  ? 103 LYS A N     1 
ATOM   830   C  CA    . LYS A  1  105 ? 7.222   22.935  54.958  1.00 77.97  ? 103 LYS A CA    1 
ATOM   831   C  C     . LYS A  1  105 ? 7.868   24.297  55.153  1.00 84.30  ? 103 LYS A C     1 
ATOM   832   O  O     . LYS A  1  105 ? 7.176   25.306  55.317  1.00 87.24  ? 103 LYS A O     1 
ATOM   833   C  CB    . LYS A  1  105 ? 6.797   22.752  53.496  1.00 72.74  ? 103 LYS A CB    1 
ATOM   834   C  CG    . LYS A  1  105 ? 6.509   21.307  53.123  1.00 67.85  ? 103 LYS A CG    1 
ATOM   835   C  CD    . LYS A  1  105 ? 7.637   20.396  53.591  1.00 73.45  ? 103 LYS A CD    1 
ATOM   836   C  CE    . LYS A  1  105 ? 7.338   18.934  53.299  1.00 78.85  ? 103 LYS A CE    1 
ATOM   837   N  NZ    . LYS A  1  105 ? 8.361   18.030  53.898  1.00 83.39  ? 103 LYS A NZ    1 
ATOM   838   N  N     . LYS A  1  106 ? 9.202   24.315  55.132  1.00 88.76  ? 104 LYS A N     1 
ATOM   839   C  CA    . LYS A  1  106 ? 9.933   25.571  55.266  1.00 89.43  ? 104 LYS A CA    1 
ATOM   840   C  C     . LYS A  1  106 ? 9.631   26.516  54.109  1.00 83.40  ? 104 LYS A C     1 
ATOM   841   O  O     . LYS A  1  106 ? 9.405   27.713  54.319  1.00 77.91  ? 104 LYS A O     1 
ATOM   842   C  CB    . LYS A  1  106 ? 11.432  25.287  55.351  1.00 93.64  ? 104 LYS A CB    1 
ATOM   843   C  CG    . LYS A  1  106 ? 12.286  26.485  55.725  1.00 96.99  ? 104 LYS A CG    1 
ATOM   844   C  CD    . LYS A  1  106 ? 13.757  26.105  55.740  1.00 106.09 ? 104 LYS A CD    1 
ATOM   845   C  CE    . LYS A  1  106 ? 14.008  24.927  56.668  1.00 109.00 ? 104 LYS A CE    1 
ATOM   846   N  NZ    . LYS A  1  106 ? 15.365  24.349  56.472  1.00 111.70 ? 104 LYS A NZ    1 
ATOM   847   N  N     . SER A  1  107 ? 9.617   25.996  52.884  1.00 90.16  ? 105 SER A N     1 
ATOM   848   C  CA    . SER A  1  107 ? 9.405   26.799  51.687  1.00 96.41  ? 105 SER A CA    1 
ATOM   849   C  C     . SER A  1  107 ? 8.293   26.177  50.857  1.00 91.98  ? 105 SER A C     1 
ATOM   850   O  O     . SER A  1  107 ? 8.306   24.968  50.605  1.00 84.73  ? 105 SER A O     1 
ATOM   851   C  CB    . SER A  1  107 ? 10.693  26.911  50.866  1.00 97.68  ? 105 SER A CB    1 
ATOM   852   O  OG    . SER A  1  107 ? 11.724  27.537  51.611  1.00 96.53  ? 105 SER A OG    1 
ATOM   853   N  N     . VAL A  1  108 ? 7.339   27.002  50.431  1.00 89.86  ? 106 VAL A N     1 
ATOM   854   C  CA    . VAL A  1  108 ? 6.168   26.551  49.689  1.00 79.25  ? 106 VAL A CA    1 
ATOM   855   C  C     . VAL A  1  108 ? 5.983   27.449  48.474  1.00 82.49  ? 106 VAL A C     1 
ATOM   856   O  O     . VAL A  1  108 ? 6.049   28.677  48.591  1.00 85.81  ? 106 VAL A O     1 
ATOM   857   C  CB    . VAL A  1  108 ? 4.902   26.563  50.568  1.00 75.49  ? 106 VAL A CB    1 
ATOM   858   C  CG1   . VAL A  1  108 ? 3.652   26.551  49.706  1.00 76.88  ? 106 VAL A CG1   1 
ATOM   859   C  CG2   . VAL A  1  108 ? 4.908   25.378  51.523  1.00 76.72  ? 106 VAL A CG2   1 
ATOM   860   N  N     . THR A  1  109 ? 5.795   26.840  47.304  1.00 86.10  ? 107 THR A N     1 
ATOM   861   C  CA    . THR A  1  109 ? 5.443   27.562  46.088  1.00 88.73  ? 107 THR A CA    1 
ATOM   862   C  C     . THR A  1  109 ? 4.150   27.006  45.505  1.00 100.81 ? 107 THR A C     1 
ATOM   863   O  O     . THR A  1  109 ? 3.995   25.786  45.380  1.00 108.58 ? 107 THR A O     1 
ATOM   864   C  CB    . THR A  1  109 ? 6.566   27.470  45.054  1.00 81.71  ? 107 THR A CB    1 
ATOM   865   O  OG1   . THR A  1  109 ? 7.764   28.043  45.594  1.00 88.22  ? 107 THR A OG1   1 
ATOM   866   C  CG2   . THR A  1  109 ? 6.187   28.209  43.784  1.00 83.86  ? 107 THR A CG2   1 
ATOM   867   N  N     . VAL A  1  110 ? 3.227   27.899  45.154  1.00 100.17 ? 108 VAL A N     1 
ATOM   868   C  CA    . VAL A  1  110 ? 1.979   27.551  44.479  1.00 98.20  ? 108 VAL A CA    1 
ATOM   869   C  C     . VAL A  1  110 ? 1.997   28.208  43.105  1.00 103.09 ? 108 VAL A C     1 
ATOM   870   O  O     . VAL A  1  110 ? 2.028   29.441  43.007  1.00 114.61 ? 108 VAL A O     1 
ATOM   871   C  CB    . VAL A  1  110 ? 0.747   27.994  45.284  1.00 96.17  ? 108 VAL A CB    1 
ATOM   872   C  CG1   . VAL A  1  110 ? -0.528  27.738  44.491  1.00 95.75  ? 108 VAL A CG1   1 
ATOM   873   C  CG2   . VAL A  1  110 ? 0.701   27.277  46.623  1.00 90.85  ? 108 VAL A CG2   1 
ATOM   874   N  N     . LEU A  1  111 ? 1.967   27.395  42.048  1.00 98.29  ? 109 LEU A N     1 
ATOM   875   C  CA    . LEU A  1  111 ? 2.030   27.917  40.689  1.00 102.54 ? 109 LEU A CA    1 
ATOM   876   C  C     . LEU A  1  111 ? 1.036   27.200  39.784  1.00 98.12  ? 109 LEU A C     1 
ATOM   877   O  O     . LEU A  1  111 ? 0.810   25.995  39.921  1.00 99.57  ? 109 LEU A O     1 
ATOM   878   C  CB    . LEU A  1  111 ? 3.453   27.807  40.115  1.00 105.69 ? 109 LEU A CB    1 
ATOM   879   C  CG    . LEU A  1  111 ? 4.324   26.598  40.471  1.00 104.53 ? 109 LEU A CG    1 
ATOM   880   C  CD1   . LEU A  1  111 ? 3.951   25.370  39.653  1.00 104.28 ? 109 LEU A CD1   1 
ATOM   881   C  CD2   . LEU A  1  111 ? 5.794   26.940  40.283  1.00 105.37 ? 109 LEU A CD2   1 
ATOM   882   N  N     . ASP A  1  112 ? 0.438   27.963  38.870  1.00 94.40  ? 110 ASP A N     1 
ATOM   883   C  CA    . ASP A  1  112 ? -0.619  27.507  37.979  1.00 92.26  ? 110 ASP A CA    1 
ATOM   884   C  C     . ASP A  1  112 ? -0.072  27.358  36.564  1.00 98.69  ? 110 ASP A C     1 
ATOM   885   O  O     . ASP A  1  112 ? 0.832   28.090  36.152  1.00 108.07 ? 110 ASP A O     1 
ATOM   886   C  CB    . ASP A  1  112 ? -1.798  28.489  37.982  1.00 98.80  ? 110 ASP A CB    1 
ATOM   887   C  CG    . ASP A  1  112 ? -2.988  27.989  37.179  1.00 105.60 ? 110 ASP A CG    1 
ATOM   888   O  OD1   . ASP A  1  112 ? -2.787  27.261  36.184  1.00 113.05 ? 110 ASP A OD1   1 
ATOM   889   O  OD2   . ASP A  1  112 ? -4.132  28.335  37.544  1.00 105.00 ? 110 ASP A OD2   1 
ATOM   890   N  N     . VAL A  1  113 ? -0.624  26.399  35.821  1.00 96.89  ? 111 VAL A N     1 
ATOM   891   C  CA    . VAL A  1  113 ? -0.251  26.189  34.426  1.00 96.19  ? 111 VAL A CA    1 
ATOM   892   C  C     . VAL A  1  113 ? -1.073  27.113  33.537  1.00 102.52 ? 111 VAL A C     1 
ATOM   893   O  O     . VAL A  1  113 ? -2.289  27.256  33.715  1.00 105.35 ? 111 VAL A O     1 
ATOM   894   C  CB    . VAL A  1  113 ? -0.442  24.711  34.030  1.00 88.51  ? 111 VAL A CB    1 
ATOM   895   C  CG1   . VAL A  1  113 ? -0.372  24.538  32.520  1.00 95.93  ? 111 VAL A CG1   1 
ATOM   896   C  CG2   . VAL A  1  113 ? 0.601   23.842  34.716  1.00 84.66  ? 111 VAL A CG2   1 
ATOM   897   N  N     . GLY A  1  114 ? -0.403  27.743  32.572  1.00 102.79 ? 112 GLY A N     1 
ATOM   898   C  CA    . GLY A  1  114 ? -1.086  28.586  31.600  1.00 98.86  ? 112 GLY A CA    1 
ATOM   899   C  C     . GLY A  1  114 ? -1.794  27.758  30.543  1.00 99.66  ? 112 GLY A C     1 
ATOM   900   O  O     . GLY A  1  114 ? -1.188  26.878  29.922  1.00 102.68 ? 112 GLY A O     1 
ATOM   901   N  N     . ASP A  1  115 ? -3.074  28.068  30.311  1.00 103.38 ? 113 ASP A N     1 
ATOM   902   C  CA    . ASP A  1  115 ? -3.910  27.359  29.343  1.00 110.99 ? 113 ASP A CA    1 
ATOM   903   C  C     . ASP A  1  115 ? -3.730  25.848  29.427  1.00 110.62 ? 113 ASP A C     1 
ATOM   904   O  O     . ASP A  1  115 ? -3.080  25.241  28.569  1.00 114.08 ? 113 ASP A O     1 
ATOM   905   C  CB    . ASP A  1  115 ? -3.614  27.848  27.923  1.00 119.76 ? 113 ASP A CB    1 
ATOM   906   C  CG    . ASP A  1  115 ? -4.374  29.112  27.573  1.00 127.55 ? 113 ASP A CG    1 
ATOM   907   O  OD1   . ASP A  1  115 ? -5.538  29.245  28.008  1.00 123.97 ? 113 ASP A OD1   1 
ATOM   908   O  OD2   . ASP A  1  115 ? -3.810  29.972  26.865  1.00 136.07 ? 113 ASP A OD2   1 
ATOM   909   N  N     . ALA A  1  116 ? -4.310  25.238  30.461  1.00 107.47 ? 114 ALA A N     1 
ATOM   910   C  CA    . ALA A  1  116 ? -3.959  23.869  30.823  1.00 102.68 ? 114 ALA A CA    1 
ATOM   911   C  C     . ALA A  1  116 ? -4.428  22.869  29.772  1.00 100.62 ? 114 ALA A C     1 
ATOM   912   O  O     . ALA A  1  116 ? -3.623  22.117  29.211  1.00 98.80  ? 114 ALA A O     1 
ATOM   913   C  CB    . ALA A  1  116 ? -4.558  23.533  32.188  1.00 100.20 ? 114 ALA A CB    1 
ATOM   914   N  N     . TYR A  1  117 ? -5.734  22.845  29.489  1.00 101.96 ? 115 TYR A N     1 
ATOM   915   C  CA    . TYR A  1  117 ? -6.254  21.903  28.501  1.00 105.06 ? 115 TYR A CA    1 
ATOM   916   C  C     . TYR A  1  117 ? -5.710  22.184  27.107  1.00 106.98 ? 115 TYR A C     1 
ATOM   917   O  O     . TYR A  1  117 ? -5.564  21.259  26.300  1.00 106.82 ? 115 TYR A O     1 
ATOM   918   C  CB    . TYR A  1  117 ? -7.783  21.947  28.476  1.00 103.05 ? 115 TYR A CB    1 
ATOM   919   C  CG    . TYR A  1  117 ? -8.460  21.255  29.639  1.00 101.90 ? 115 TYR A CG    1 
ATOM   920   C  CD1   . TYR A  1  117 ? -7.721  20.586  30.605  1.00 98.93  ? 115 TYR A CD1   1 
ATOM   921   C  CD2   . TYR A  1  117 ? -9.844  21.260  29.759  1.00 103.64 ? 115 TYR A CD2   1 
ATOM   922   C  CE1   . TYR A  1  117 ? -8.341  19.951  31.665  1.00 99.43  ? 115 TYR A CE1   1 
ATOM   923   C  CE2   . TYR A  1  117 ? -10.473 20.628  30.815  1.00 104.01 ? 115 TYR A CE2   1 
ATOM   924   C  CZ    . TYR A  1  117 ? -9.717  19.975  31.764  1.00 102.79 ? 115 TYR A CZ    1 
ATOM   925   O  OH    . TYR A  1  117 ? -10.338 19.344  32.816  1.00 95.39  ? 115 TYR A OH    1 
ATOM   926   N  N     . PHE A  1  118 ? -5.410  23.446  26.806  1.00 107.01 ? 116 PHE A N     1 
ATOM   927   C  CA    . PHE A  1  118 ? -5.004  23.843  25.465  1.00 109.15 ? 116 PHE A CA    1 
ATOM   928   C  C     . PHE A  1  118 ? -3.542  23.540  25.161  1.00 104.23 ? 116 PHE A C     1 
ATOM   929   O  O     . PHE A  1  118 ? -3.141  23.626  23.996  1.00 104.78 ? 116 PHE A O     1 
ATOM   930   C  CB    . PHE A  1  118 ? -5.277  25.337  25.264  1.00 111.63 ? 116 PHE A CB    1 
ATOM   931   C  CG    . PHE A  1  118 ? -6.725  25.712  25.420  1.00 114.27 ? 116 PHE A CG    1 
ATOM   932   C  CD1   . PHE A  1  118 ? -7.724  24.848  25.003  1.00 113.26 ? 116 PHE A CD1   1 
ATOM   933   C  CD2   . PHE A  1  118 ? -7.086  26.921  25.991  1.00 114.35 ? 116 PHE A CD2   1 
ATOM   934   C  CE1   . PHE A  1  118 ? -9.058  25.185  25.147  1.00 111.28 ? 116 PHE A CE1   1 
ATOM   935   C  CE2   . PHE A  1  118 ? -8.419  27.263  26.138  1.00 113.33 ? 116 PHE A CE2   1 
ATOM   936   C  CZ    . PHE A  1  118 ? -9.406  26.393  25.715  1.00 111.02 ? 116 PHE A CZ    1 
ATOM   937   N  N     . SER A  1  119 ? -2.741  23.195  26.166  1.00 99.70  ? 117 SER A N     1 
ATOM   938   C  CA    . SER A  1  119 ? -1.369  22.761  25.939  1.00 100.17 ? 117 SER A CA    1 
ATOM   939   C  C     . SER A  1  119 ? -1.225  21.253  25.759  1.00 104.14 ? 117 SER A C     1 
ATOM   940   O  O     . SER A  1  119 ? -0.095  20.773  25.620  1.00 109.89 ? 117 SER A O     1 
ATOM   941   C  CB    . SER A  1  119 ? -0.478  23.221  27.099  1.00 95.56  ? 117 SER A CB    1 
ATOM   942   O  OG    . SER A  1  119 ? -0.566  24.624  27.291  1.00 95.74  ? 117 SER A OG    1 
ATOM   943   N  N     . VAL A  1  120 ? -2.317  20.495  25.763  1.00 101.64 ? 118 VAL A N     1 
ATOM   944   C  CA    . VAL A  1  120 ? -2.256  19.040  25.742  1.00 96.50  ? 118 VAL A CA    1 
ATOM   945   C  C     . VAL A  1  120 ? -2.872  18.541  24.440  1.00 94.84  ? 118 VAL A C     1 
ATOM   946   O  O     . VAL A  1  120 ? -4.062  18.756  24.198  1.00 93.43  ? 118 VAL A O     1 
ATOM   947   C  CB    . VAL A  1  120 ? -2.963  18.406  26.951  1.00 87.21  ? 118 VAL A CB    1 
ATOM   948   C  CG1   . VAL A  1  120 ? -2.735  16.900  26.960  1.00 86.04  ? 118 VAL A CG1   1 
ATOM   949   C  CG2   . VAL A  1  120 ? -2.452  19.029  28.230  1.00 78.26  ? 118 VAL A CG2   1 
ATOM   950   N  N     . PRO A  1  121 ? -2.111  17.847  23.594  1.00 100.15 ? 119 PRO A N     1 
ATOM   951   C  CA    . PRO A  1  121 ? -2.624  17.430  22.281  1.00 101.78 ? 119 PRO A CA    1 
ATOM   952   C  C     . PRO A  1  121 ? -3.760  16.423  22.395  1.00 105.36 ? 119 PRO A C     1 
ATOM   953   O  O     . PRO A  1  121 ? -3.682  15.455  23.155  1.00 103.30 ? 119 PRO A O     1 
ATOM   954   C  CB    . PRO A  1  121 ? -1.396  16.810  21.605  1.00 106.24 ? 119 PRO A CB    1 
ATOM   955   C  CG    . PRO A  1  121 ? -0.541  16.362  22.743  1.00 106.49 ? 119 PRO A CG    1 
ATOM   956   C  CD    . PRO A  1  121 ? -0.733  17.389  23.818  1.00 104.57 ? 119 PRO A CD    1 
ATOM   957   N  N     . LEU A  1  122 ? -4.817  16.663  21.629  1.00 112.29 ? 120 LEU A N     1 
ATOM   958   C  CA    . LEU A  1  122 ? -5.889  15.698  21.463  1.00 114.18 ? 120 LEU A CA    1 
ATOM   959   C  C     . LEU A  1  122 ? -5.447  14.595  20.503  1.00 116.58 ? 120 LEU A C     1 
ATOM   960   O  O     . LEU A  1  122 ? -4.484  14.748  19.746  1.00 117.57 ? 120 LEU A O     1 
ATOM   961   C  CB    . LEU A  1  122 ? -7.147  16.398  20.946  1.00 109.76 ? 120 LEU A CB    1 
ATOM   962   C  CG    . LEU A  1  122 ? -8.409  15.580  20.676  1.00 108.25 ? 120 LEU A CG    1 
ATOM   963   C  CD1   . LEU A  1  122 ? -8.926  14.951  21.956  1.00 99.65  ? 120 LEU A CD1   1 
ATOM   964   C  CD2   . LEU A  1  122 ? -9.458  16.455  20.036  1.00 112.73 ? 120 LEU A CD2   1 
ATOM   965   N  N     . ASP A  1  123 ? -6.155  13.468  20.548  1.00 123.34 ? 121 ASP A N     1 
ATOM   966   C  CA    . ASP A  1  123 ? -5.815  12.343  19.687  1.00 126.66 ? 121 ASP A CA    1 
ATOM   967   C  C     . ASP A  1  123 ? -6.021  12.717  18.224  1.00 124.09 ? 121 ASP A C     1 
ATOM   968   O  O     . ASP A  1  123 ? -7.038  13.309  17.854  1.00 123.07 ? 121 ASP A O     1 
ATOM   969   C  CB    . ASP A  1  123 ? -6.666  11.126  20.050  1.00 130.57 ? 121 ASP A CB    1 
ATOM   970   C  CG    . ASP A  1  123 ? -6.176  9.857   19.389  1.00 131.40 ? 121 ASP A CG    1 
ATOM   971   O  OD1   . ASP A  1  123 ? -4.947  9.709   19.229  1.00 130.29 ? 121 ASP A OD1   1 
ATOM   972   O  OD2   . ASP A  1  123 ? -7.020  9.009   19.030  1.00 132.67 ? 121 ASP A OD2   1 
ATOM   973   N  N     . GLU A  1  124 ? -5.043  12.353  17.389  1.00 120.91 ? 122 GLU A N     1 
ATOM   974   C  CA    . GLU A  1  124 ? -5.029  12.792  15.994  1.00 123.68 ? 122 GLU A CA    1 
ATOM   975   C  C     . GLU A  1  124 ? -6.260  12.314  15.233  1.00 126.95 ? 122 GLU A C     1 
ATOM   976   O  O     . GLU A  1  124 ? -6.949  13.111  14.585  1.00 129.91 ? 122 GLU A O     1 
ATOM   977   C  CB    . GLU A  1  124 ? -3.753  12.306  15.304  1.00 129.17 ? 122 GLU A CB    1 
ATOM   978   C  CG    . GLU A  1  124 ? -3.696  12.653  13.824  1.00 137.10 ? 122 GLU A CG    1 
ATOM   979   C  CD    . GLU A  1  124 ? -2.351  13.210  13.404  1.00 141.98 ? 122 GLU A CD    1 
ATOM   980   O  OE1   . GLU A  1  124 ? -1.338  12.491  13.533  1.00 141.89 ? 122 GLU A OE1   1 
ATOM   981   O  OE2   . GLU A  1  124 ? -2.306  14.375  12.953  1.00 144.81 ? 122 GLU A OE2   1 
ATOM   982   N  N     . ASP A  1  125 ? -6.546  11.012  15.288  1.00 125.59 ? 123 ASP A N     1 
ATOM   983   C  CA    . ASP A  1  125 ? -7.732  10.491  14.615  1.00 128.10 ? 123 ASP A CA    1 
ATOM   984   C  C     . ASP A  1  125 ? -9.009  11.103  15.177  1.00 132.44 ? 123 ASP A C     1 
ATOM   985   O  O     . ASP A  1  125 ? -9.957  11.370  14.429  1.00 137.22 ? 123 ASP A O     1 
ATOM   986   C  CB    . ASP A  1  125 ? -7.767  8.966   14.726  1.00 125.55 ? 123 ASP A CB    1 
ATOM   987   C  CG    . ASP A  1  125 ? -6.699  8.296   13.884  1.00 127.35 ? 123 ASP A CG    1 
ATOM   988   O  OD1   . ASP A  1  125 ? -6.489  8.736   12.733  1.00 126.36 ? 123 ASP A OD1   1 
ATOM   989   O  OD2   . ASP A  1  125 ? -6.066  7.336   14.371  1.00 128.85 ? 123 ASP A OD2   1 
ATOM   990   N  N     . PHE A  1  126 ? -9.055  11.337  16.490  1.00 131.10 ? 124 PHE A N     1 
ATOM   991   C  CA    . PHE A  1  126 ? -10.261 11.873  17.109  1.00 130.32 ? 124 PHE A CA    1 
ATOM   992   C  C     . PHE A  1  126 ? -10.482 13.352  16.809  1.00 126.10 ? 124 PHE A C     1 
ATOM   993   O  O     . PHE A  1  126 ? -11.579 13.856  17.073  1.00 124.18 ? 124 PHE A O     1 
ATOM   994   C  CB    . PHE A  1  126 ? -10.216 11.650  18.622  1.00 128.75 ? 124 PHE A CB    1 
ATOM   995   C  CG    . PHE A  1  126 ? -11.559 11.747  19.288  1.00 128.68 ? 124 PHE A CG    1 
ATOM   996   C  CD1   . PHE A  1  126 ? -12.471 10.710  19.187  1.00 131.19 ? 124 PHE A CD1   1 
ATOM   997   C  CD2   . PHE A  1  126 ? -11.910 12.872  20.015  1.00 124.09 ? 124 PHE A CD2   1 
ATOM   998   C  CE1   . PHE A  1  126 ? -13.708 10.792  19.796  1.00 129.58 ? 124 PHE A CE1   1 
ATOM   999   C  CE2   . PHE A  1  126 ? -13.146 12.961  20.626  1.00 120.94 ? 124 PHE A CE2   1 
ATOM   1000  C  CZ    . PHE A  1  126 ? -14.046 11.919  20.517  1.00 123.87 ? 124 PHE A CZ    1 
ATOM   1001  N  N     . ARG A  1  127 ? -9.473  14.054  16.280  1.00 126.57 ? 125 ARG A N     1 
ATOM   1002  C  CA    . ARG A  1  127 ? -9.561  15.507  16.132  1.00 127.17 ? 125 ARG A CA    1 
ATOM   1003  C  C     . ARG A  1  127 ? -10.749 15.930  15.276  1.00 130.56 ? 125 ARG A C     1 
ATOM   1004  O  O     . ARG A  1  127 ? -11.296 17.020  15.474  1.00 129.71 ? 125 ARG A O     1 
ATOM   1005  C  CB    . ARG A  1  127 ? -8.268  16.060  15.531  1.00 123.56 ? 125 ARG A CB    1 
ATOM   1006  C  CG    . ARG A  1  127 ? -7.087  16.086  16.485  1.00 117.81 ? 125 ARG A CG    1 
ATOM   1007  C  CD    . ARG A  1  127 ? -5.954  16.941  15.942  1.00 117.17 ? 125 ARG A CD    1 
ATOM   1008  N  NE    . ARG A  1  127 ? -4.786  16.926  16.819  1.00 115.58 ? 125 ARG A NE    1 
ATOM   1009  C  CZ    . ARG A  1  127 ? -3.644  16.308  16.534  1.00 114.37 ? 125 ARG A CZ    1 
ATOM   1010  N  NH1   . ARG A  1  127 ? -3.508  15.662  15.385  1.00 119.48 ? 125 ARG A NH1   1 
ATOM   1011  N  NH2   . ARG A  1  127 ? -2.635  16.346  17.393  1.00 108.26 ? 125 ARG A NH2   1 
ATOM   1012  N  N     . LYS A  1  128 ? -11.147 15.095  14.312  1.00 136.18 ? 126 LYS A N     1 
ATOM   1013  C  CA    . LYS A  1  128 ? -12.190 15.485  13.367  1.00 138.51 ? 126 LYS A CA    1 
ATOM   1014  C  C     . LYS A  1  128 ? -13.509 15.790  14.071  1.00 137.23 ? 126 LYS A C     1 
ATOM   1015  O  O     . LYS A  1  128 ? -14.233 16.711  13.675  1.00 133.37 ? 126 LYS A O     1 
ATOM   1016  C  CB    . LYS A  1  128 ? -12.379 14.387  12.319  1.00 138.34 ? 126 LYS A CB    1 
ATOM   1017  C  CG    . LYS A  1  128 ? -12.579 12.993  12.899  1.00 135.85 ? 126 LYS A CG    1 
ATOM   1018  C  CD    . LYS A  1  128 ? -12.861 11.969  11.808  1.00 133.29 ? 126 LYS A CD    1 
ATOM   1019  C  CE    . LYS A  1  128 ? -11.664 11.787  10.888  1.00 130.33 ? 126 LYS A CE    1 
ATOM   1020  N  NZ    . LYS A  1  128 ? -10.497 11.197  11.600  1.00 123.70 ? 126 LYS A NZ    1 
ATOM   1021  N  N     . TYR A  1  129 ? -13.840 15.027  15.114  1.00 134.02 ? 127 TYR A N     1 
ATOM   1022  C  CA    . TYR A  1  129 ? -15.135 15.158  15.774  1.00 132.40 ? 127 TYR A CA    1 
ATOM   1023  C  C     . TYR A  1  129 ? -15.301 16.473  16.529  1.00 134.16 ? 127 TYR A C     1 
ATOM   1024  O  O     . TYR A  1  129 ? -16.430 16.813  16.900  1.00 131.68 ? 127 TYR A O     1 
ATOM   1025  C  CB    . TYR A  1  129 ? -15.341 13.970  16.712  1.00 126.67 ? 127 TYR A CB    1 
ATOM   1026  C  CG    . TYR A  1  129 ? -15.143 12.644  16.013  1.00 130.40 ? 127 TYR A CG    1 
ATOM   1027  C  CD1   . TYR A  1  129 ? -16.078 12.176  15.101  1.00 136.05 ? 127 TYR A CD1   1 
ATOM   1028  C  CD2   . TYR A  1  129 ? -14.015 11.869  16.250  1.00 128.44 ? 127 TYR A CD2   1 
ATOM   1029  C  CE1   . TYR A  1  129 ? -15.905 10.971  14.452  1.00 136.05 ? 127 TYR A CE1   1 
ATOM   1030  C  CE2   . TYR A  1  129 ? -13.833 10.659  15.605  1.00 130.64 ? 127 TYR A CE2   1 
ATOM   1031  C  CZ    . TYR A  1  129 ? -14.782 10.215  14.707  1.00 131.24 ? 127 TYR A CZ    1 
ATOM   1032  O  OH    . TYR A  1  129 ? -14.609 9.013   14.061  1.00 127.28 ? 127 TYR A OH    1 
ATOM   1033  N  N     . THR A  1  130 ? -14.214 17.209  16.767  1.00 139.74 ? 128 THR A N     1 
ATOM   1034  C  CA    . THR A  1  130 ? -14.273 18.464  17.512  1.00 146.25 ? 128 THR A CA    1 
ATOM   1035  C  C     . THR A  1  130 ? -15.142 19.514  16.830  1.00 158.82 ? 128 THR A C     1 
ATOM   1036  O  O     . THR A  1  130 ? -15.639 20.421  17.507  1.00 160.08 ? 128 THR A O     1 
ATOM   1037  C  CB    . THR A  1  130 ? -12.869 19.030  17.724  1.00 143.62 ? 128 THR A CB    1 
ATOM   1038  O  OG1   . THR A  1  130 ? -12.079 18.816  16.548  1.00 148.51 ? 128 THR A OG1   1 
ATOM   1039  C  CG2   . THR A  1  130 ? -12.206 18.366  18.912  1.00 136.62 ? 128 THR A CG2   1 
ATOM   1040  N  N     . ALA A  1  131 ? -15.325 19.407  15.513  1.00 166.00 ? 129 ALA A N     1 
ATOM   1041  C  CA    . ALA A  1  131 ? -15.653 20.547  14.664  1.00 170.60 ? 129 ALA A CA    1 
ATOM   1042  C  C     . ALA A  1  131 ? -16.859 21.338  15.159  1.00 168.98 ? 129 ALA A C     1 
ATOM   1043  O  O     . ALA A  1  131 ? -17.890 20.775  15.530  1.00 164.23 ? 129 ALA A O     1 
ATOM   1044  C  CB    . ALA A  1  131 ? -15.921 20.051  13.244  1.00 175.23 ? 129 ALA A CB    1 
ATOM   1045  N  N     . PHE A  1  132 ? -16.717 22.662  15.123  1.00 171.06 ? 130 PHE A N     1 
ATOM   1046  C  CA    . PHE A  1  132 ? -17.747 23.608  15.527  1.00 170.61 ? 130 PHE A CA    1 
ATOM   1047  C  C     . PHE A  1  132 ? -17.720 24.782  14.557  1.00 175.79 ? 130 PHE A C     1 
ATOM   1048  O  O     . PHE A  1  132 ? -16.711 25.036  13.894  1.00 176.02 ? 130 PHE A O     1 
ATOM   1049  C  CB    . PHE A  1  132 ? -17.553 24.088  16.973  1.00 164.65 ? 130 PHE A CB    1 
ATOM   1050  C  CG    . PHE A  1  132 ? -16.289 24.869  17.191  1.00 162.58 ? 130 PHE A CG    1 
ATOM   1051  C  CD1   . PHE A  1  132 ? -16.315 26.252  17.253  1.00 163.53 ? 130 PHE A CD1   1 
ATOM   1052  C  CD2   . PHE A  1  132 ? -15.075 24.219  17.336  1.00 157.70 ? 130 PHE A CD2   1 
ATOM   1053  C  CE1   . PHE A  1  132 ? -15.153 26.973  17.455  1.00 161.67 ? 130 PHE A CE1   1 
ATOM   1054  C  CE2   . PHE A  1  132 ? -13.910 24.933  17.536  1.00 154.63 ? 130 PHE A CE2   1 
ATOM   1055  C  CZ    . PHE A  1  132 ? -13.949 26.311  17.596  1.00 157.44 ? 130 PHE A CZ    1 
ATOM   1056  N  N     . THR A  1  133 ? -18.836 25.500  14.474  1.00 180.47 ? 131 THR A N     1 
ATOM   1057  C  CA    . THR A  1  133 ? -18.978 26.600  13.529  1.00 186.84 ? 131 THR A CA    1 
ATOM   1058  C  C     . THR A  1  133 ? -18.860 27.944  14.239  1.00 189.21 ? 131 THR A C     1 
ATOM   1059  O  O     . THR A  1  133 ? -19.542 28.189  15.240  1.00 185.61 ? 131 THR A O     1 
ATOM   1060  C  CB    . THR A  1  133 ? -20.317 26.514  12.795  1.00 186.57 ? 131 THR A CB    1 
ATOM   1061  O  OG1   . THR A  1  133 ? -20.488 25.194  12.264  1.00 185.48 ? 131 THR A OG1   1 
ATOM   1062  C  CG2   . THR A  1  133 ? -20.362 27.519  11.655  1.00 187.74 ? 131 THR A CG2   1 
ATOM   1063  N  N     . ILE A  1  134 ? -18.000 28.810  13.708  1.00 194.51 ? 132 ILE A N     1 
ATOM   1064  C  CA    . ILE A  1  134 ? -17.695 30.117  14.288  1.00 195.58 ? 132 ILE A CA    1 
ATOM   1065  C  C     . ILE A  1  134 ? -18.877 31.050  14.034  1.00 202.35 ? 132 ILE A C     1 
ATOM   1066  O  O     . ILE A  1  134 ? -19.644 30.823  13.087  1.00 208.34 ? 132 ILE A O     1 
ATOM   1067  C  CB    . ILE A  1  134 ? -16.376 30.660  13.700  1.00 191.73 ? 132 ILE A CB    1 
ATOM   1068  C  CG1   . ILE A  1  134 ? -15.176 30.134  14.490  1.00 179.71 ? 132 ILE A CG1   1 
ATOM   1069  C  CG2   . ILE A  1  134 ? -16.337 32.185  13.603  1.00 194.89 ? 132 ILE A CG2   1 
ATOM   1070  C  CD1   . ILE A  1  134 ? -15.005 30.790  15.835  1.00 171.03 ? 132 ILE A CD1   1 
ATOM   1071  N  N     . PRO A  1  135 ? -19.072 32.104  14.841  1.00 198.59 ? 133 PRO A N     1 
ATOM   1072  C  CA    . PRO A  1  135 ? -20.187 33.022  14.586  1.00 199.83 ? 133 PRO A CA    1 
ATOM   1073  C  C     . PRO A  1  135 ? -19.708 34.396  14.143  1.00 204.91 ? 133 PRO A C     1 
ATOM   1074  O  O     . PRO A  1  135 ? -18.540 34.749  14.333  1.00 204.86 ? 133 PRO A O     1 
ATOM   1075  C  CB    . PRO A  1  135 ? -20.884 33.085  15.946  1.00 193.52 ? 133 PRO A CB    1 
ATOM   1076  C  CG    . PRO A  1  135 ? -19.735 33.000  16.916  1.00 189.37 ? 133 PRO A CG    1 
ATOM   1077  C  CD    . PRO A  1  135 ? -18.644 32.166  16.251  1.00 190.24 ? 133 PRO A CD    1 
ATOM   1078  N  N     . SER A  1  136 ? -20.604 35.177  13.548  1.00 208.49 ? 134 SER A N     1 
ATOM   1079  C  CA    . SER A  1  136 ? -20.296 36.505  13.039  1.00 209.94 ? 134 SER A CA    1 
ATOM   1080  C  C     . SER A  1  136 ? -21.212 37.532  13.694  1.00 211.96 ? 134 SER A C     1 
ATOM   1081  O  O     . SER A  1  136 ? -22.197 37.192  14.354  1.00 209.89 ? 134 SER A O     1 
ATOM   1082  C  CB    . SER A  1  136 ? -20.433 36.557  11.513  1.00 209.70 ? 134 SER A CB    1 
ATOM   1083  O  OG    . SER A  1  136 ? -19.584 35.607  10.892  1.00 206.00 ? 134 SER A OG    1 
ATOM   1084  N  N     . ILE A  1  137 ? -20.872 38.810  13.505  1.00 215.59 ? 135 ILE A N     1 
ATOM   1085  C  CA    . ILE A  1  137 ? -21.713 39.882  14.031  1.00 218.81 ? 135 ILE A CA    1 
ATOM   1086  C  C     . ILE A  1  137 ? -23.078 39.867  13.351  1.00 224.95 ? 135 ILE A C     1 
ATOM   1087  O  O     . ILE A  1  137 ? -24.109 40.116  13.988  1.00 226.72 ? 135 ILE A O     1 
ATOM   1088  C  CB    . ILE A  1  137 ? -21.005 41.242  13.872  1.00 219.06 ? 135 ILE A CB    1 
ATOM   1089  C  CG1   . ILE A  1  137 ? -21.926 42.387  14.299  1.00 220.95 ? 135 ILE A CG1   1 
ATOM   1090  C  CG2   . ILE A  1  137 ? -20.511 41.437  12.442  1.00 221.50 ? 135 ILE A CG2   1 
ATOM   1091  C  CD1   . ILE A  1  137 ? -21.291 43.756  14.187  1.00 222.18 ? 135 ILE A CD1   1 
ATOM   1092  N  N     . ASN A  1  138 ? -23.107 39.568  12.058  1.00 227.09 ? 136 ASN A N     1 
ATOM   1093  C  CA    . ASN A  1  138 ? -24.337 39.347  11.313  1.00 228.53 ? 136 ASN A CA    1 
ATOM   1094  C  C     . ASN A  1  138 ? -24.468 37.869  10.967  1.00 226.88 ? 136 ASN A C     1 
ATOM   1095  O  O     . ASN A  1  138 ? -23.567 37.063  11.213  1.00 222.90 ? 136 ASN A O     1 
ATOM   1096  C  CB    . ASN A  1  138 ? -24.373 40.199  10.039  1.00 231.85 ? 136 ASN A CB    1 
ATOM   1097  C  CG    . ASN A  1  138 ? -24.605 41.669  10.325  1.00 233.51 ? 136 ASN A CG    1 
ATOM   1098  O  OD1   . ASN A  1  138 ? -25.135 42.033  11.374  1.00 232.45 ? 136 ASN A OD1   1 
ATOM   1099  N  ND2   . ASN A  1  138 ? -24.215 42.523  9.385   1.00 236.19 ? 136 ASN A ND2   1 
ATOM   1100  N  N     . ASN A  1  139 ? -25.612 37.518  10.389  1.00 229.24 ? 137 ASN A N     1 
ATOM   1101  C  CA    . ASN A  1  139 ? -25.825 36.176  9.868   1.00 226.62 ? 137 ASN A CA    1 
ATOM   1102  C  C     . ASN A  1  139 ? -25.366 36.040  8.423   1.00 229.21 ? 137 ASN A C     1 
ATOM   1103  O  O     . ASN A  1  139 ? -25.433 34.940  7.864   1.00 229.47 ? 137 ASN A O     1 
ATOM   1104  C  CB    . ASN A  1  139 ? -27.303 35.789  9.988   1.00 225.19 ? 137 ASN A CB    1 
ATOM   1105  C  CG    . ASN A  1  139 ? -28.234 36.895  9.534   1.00 227.93 ? 137 ASN A CG    1 
ATOM   1106  O  OD1   . ASN A  1  139 ? -27.935 38.078  9.694   1.00 229.08 ? 137 ASN A OD1   1 
ATOM   1107  N  ND2   . ASN A  1  139 ? -29.372 36.514  8.965   1.00 228.87 ? 137 ASN A ND2   1 
ATOM   1108  N  N     . GLU A  1  140 ? -24.904 37.133  7.814   1.00 229.58 ? 138 GLU A N     1 
ATOM   1109  C  CA    . GLU A  1  140 ? -24.407 37.086  6.444   1.00 229.42 ? 138 GLU A CA    1 
ATOM   1110  C  C     . GLU A  1  140 ? -23.053 36.388  6.369   1.00 229.97 ? 138 GLU A C     1 
ATOM   1111  O  O     . GLU A  1  140 ? -22.872 35.443  5.592   1.00 231.54 ? 138 GLU A O     1 
ATOM   1112  C  CB    . GLU A  1  140 ? -24.319 38.504  5.878   1.00 228.41 ? 138 GLU A CB    1 
ATOM   1113  C  CG    . GLU A  1  140 ? -23.938 38.576  4.409   1.00 228.65 ? 138 GLU A CG    1 
ATOM   1114  C  CD    . GLU A  1  140 ? -23.893 40.001  3.892   1.00 229.50 ? 138 GLU A CD    1 
ATOM   1115  O  OE1   . GLU A  1  140 ? -23.978 40.937  4.714   1.00 228.95 ? 138 GLU A OE1   1 
ATOM   1116  O  OE2   . GLU A  1  140 ? -23.774 40.185  2.662   1.00 231.25 ? 138 GLU A OE2   1 
ATOM   1117  N  N     . THR A  1  141 ? -22.093 36.838  7.170   1.00 229.02 ? 139 THR A N     1 
ATOM   1118  C  CA    . THR A  1  141 ? -20.768 36.226  7.168   1.00 226.15 ? 139 THR A CA    1 
ATOM   1119  C  C     . THR A  1  141 ? -20.833 34.830  7.782   1.00 223.86 ? 139 THR A C     1 
ATOM   1120  O  O     . THR A  1  141 ? -21.336 34.673  8.901   1.00 221.98 ? 139 THR A O     1 
ATOM   1121  C  CB    . THR A  1  141 ? -19.780 37.101  7.939   1.00 220.58 ? 139 THR A CB    1 
ATOM   1122  O  OG1   . THR A  1  141 ? -19.861 38.449  7.459   1.00 221.31 ? 139 THR A OG1   1 
ATOM   1123  C  CG2   . THR A  1  141 ? -18.357 36.594  7.758   1.00 217.09 ? 139 THR A CG2   1 
ATOM   1124  N  N     . PRO A  1  142 ? -20.344 33.797  7.083   1.00 222.58 ? 140 PRO A N     1 
ATOM   1125  C  CA    . PRO A  1  142 ? -20.516 32.416  7.564   1.00 220.68 ? 140 PRO A CA    1 
ATOM   1126  C  C     . PRO A  1  142 ? -19.761 32.087  8.845   1.00 217.66 ? 140 PRO A C     1 
ATOM   1127  O  O     . PRO A  1  142 ? -20.329 31.485  9.762   1.00 212.64 ? 140 PRO A O     1 
ATOM   1128  C  CB    . PRO A  1  142 ? -19.999 31.576  6.388   1.00 218.57 ? 140 PRO A CB    1 
ATOM   1129  C  CG    . PRO A  1  142 ? -19.056 32.478  5.665   1.00 218.43 ? 140 PRO A CG    1 
ATOM   1130  C  CD    . PRO A  1  142 ? -19.642 33.852  5.790   1.00 221.88 ? 140 PRO A CD    1 
ATOM   1131  N  N     . GLY A  1  143 ? -18.491 32.475  8.927   1.00 218.96 ? 141 GLY A N     1 
ATOM   1132  C  CA    . GLY A  1  143 ? -17.644 32.026  10.016  1.00 213.23 ? 141 GLY A CA    1 
ATOM   1133  C  C     . GLY A  1  143 ? -16.920 30.728  9.711   1.00 209.55 ? 141 GLY A C     1 
ATOM   1134  O  O     . GLY A  1  143 ? -17.479 29.833  9.070   1.00 211.82 ? 141 GLY A O     1 
ATOM   1135  N  N     . ILE A  1  144 ? -15.673 30.617  10.168  1.00 202.75 ? 142 ILE A N     1 
ATOM   1136  C  CA    . ILE A  1  144 ? -14.808 29.499  9.805   1.00 196.71 ? 142 ILE A CA    1 
ATOM   1137  C  C     . ILE A  1  144 ? -15.142 28.280  10.657  1.00 193.18 ? 142 ILE A C     1 
ATOM   1138  O  O     . ILE A  1  144 ? -15.655 28.392  11.774  1.00 192.93 ? 142 ILE A O     1 
ATOM   1139  C  CB    . ILE A  1  144 ? -13.328 29.910  9.957   1.00 190.02 ? 142 ILE A CB    1 
ATOM   1140  C  CG1   . ILE A  1  144 ? -13.076 31.254  9.274   1.00 188.08 ? 142 ILE A CG1   1 
ATOM   1141  C  CG2   . ILE A  1  144 ? -12.398 28.860  9.363   1.00 189.17 ? 142 ILE A CG2   1 
ATOM   1142  C  CD1   . ILE A  1  144 ? -13.211 31.205  7.769   1.00 186.86 ? 142 ILE A CD1   1 
ATOM   1143  N  N     . ARG A  1  145 ? -14.851 27.099  10.121  1.00 188.45 ? 143 ARG A N     1 
ATOM   1144  C  CA    . ARG A  1  145 ? -15.007 25.840  10.834  1.00 180.98 ? 143 ARG A CA    1 
ATOM   1145  C  C     . ARG A  1  145 ? -13.657 25.401  11.388  1.00 174.18 ? 143 ARG A C     1 
ATOM   1146  O  O     . ARG A  1  145 ? -12.634 25.497  10.703  1.00 170.74 ? 143 ARG A O     1 
ATOM   1147  C  CB    . ARG A  1  145 ? -15.591 24.765  9.916   1.00 181.67 ? 143 ARG A CB    1 
ATOM   1148  C  CG    . ARG A  1  145 ? -16.782 25.244  9.097   1.00 184.63 ? 143 ARG A CG    1 
ATOM   1149  C  CD    . ARG A  1  145 ? -17.485 24.098  8.385   1.00 185.53 ? 143 ARG A CD    1 
ATOM   1150  N  NE    . ARG A  1  145 ? -18.221 23.244  9.313   1.00 184.82 ? 143 ARG A NE    1 
ATOM   1151  C  CZ    . ARG A  1  145 ? -17.777 22.078  9.772   1.00 183.07 ? 143 ARG A CZ    1 
ATOM   1152  N  NH1   . ARG A  1  145 ? -16.595 21.617  9.386   1.00 183.64 ? 143 ARG A NH1   1 
ATOM   1153  N  NH2   . ARG A  1  145 ? -18.517 21.370  10.614  1.00 179.44 ? 143 ARG A NH2   1 
ATOM   1154  N  N     . TYR A  1  146 ? -13.654 24.924  12.633  1.00 169.13 ? 144 TYR A N     1 
ATOM   1155  C  CA    . TYR A  1  146 ? -12.422 24.684  13.374  1.00 165.71 ? 144 TYR A CA    1 
ATOM   1156  C  C     . TYR A  1  146 ? -12.443 23.318  14.046  1.00 163.46 ? 144 TYR A C     1 
ATOM   1157  O  O     . TYR A  1  146 ? -13.470 22.894  14.582  1.00 163.10 ? 144 TYR A O     1 
ATOM   1158  C  CB    . TYR A  1  146 ? -12.205 25.763  14.439  1.00 164.03 ? 144 TYR A CB    1 
ATOM   1159  C  CG    . TYR A  1  146 ? -11.572 27.033  13.924  1.00 165.66 ? 144 TYR A CG    1 
ATOM   1160  C  CD1   . TYR A  1  146 ? -10.215 27.086  13.640  1.00 166.51 ? 144 TYR A CD1   1 
ATOM   1161  C  CD2   . TYR A  1  146 ? -12.326 28.183  13.737  1.00 168.61 ? 144 TYR A CD2   1 
ATOM   1162  C  CE1   . TYR A  1  146 ? -9.626  28.244  13.176  1.00 169.94 ? 144 TYR A CE1   1 
ATOM   1163  C  CE2   . TYR A  1  146 ? -11.746 29.349  13.273  1.00 173.44 ? 144 TYR A CE2   1 
ATOM   1164  C  CZ    . TYR A  1  146 ? -10.395 29.373  12.994  1.00 173.87 ? 144 TYR A CZ    1 
ATOM   1165  O  OH    . TYR A  1  146 ? -9.809  30.528  12.531  1.00 177.33 ? 144 TYR A OH    1 
ATOM   1166  N  N     . GLN A  1  147 ? -11.296 22.639  14.018  1.00 160.33 ? 145 GLN A N     1 
ATOM   1167  C  CA    . GLN A  1  147 ? -11.077 21.397  14.751  1.00 152.95 ? 145 GLN A CA    1 
ATOM   1168  C  C     . GLN A  1  147 ? -9.934  21.589  15.740  1.00 151.97 ? 145 GLN A C     1 
ATOM   1169  O  O     . GLN A  1  147 ? -8.860  22.077  15.371  1.00 154.97 ? 145 GLN A O     1 
ATOM   1170  C  CB    . GLN A  1  147 ? -10.773 20.226  13.806  1.00 147.51 ? 145 GLN A CB    1 
ATOM   1171  C  CG    . GLN A  1  147 ? -9.454  20.336  13.054  1.00 141.92 ? 145 GLN A CG    1 
ATOM   1172  C  CD    . GLN A  1  147 ? -8.930  18.995  12.581  1.00 134.17 ? 145 GLN A CD    1 
ATOM   1173  O  OE1   . GLN A  1  147 ? -9.691  18.142  12.127  1.00 131.57 ? 145 GLN A OE1   1 
ATOM   1174  N  NE2   . GLN A  1  147 ? -7.621  18.801  12.693  1.00 130.72 ? 145 GLN A NE2   1 
ATOM   1175  N  N     . TYR A  1  148 ? -10.184 21.261  17.006  1.00 143.41 ? 146 TYR A N     1 
ATOM   1176  C  CA    . TYR A  1  148 ? -9.131  21.342  18.009  1.00 133.41 ? 146 TYR A CA    1 
ATOM   1177  C  C     . TYR A  1  148 ? -7.988  20.388  17.680  1.00 130.88 ? 146 TYR A C     1 
ATOM   1178  O  O     . TYR A  1  148 ? -8.205  19.260  17.228  1.00 127.80 ? 146 TYR A O     1 
ATOM   1179  C  CB    . TYR A  1  148 ? -9.689  20.999  19.391  1.00 128.17 ? 146 TYR A CB    1 
ATOM   1180  C  CG    . TYR A  1  148 ? -10.449 22.111  20.073  1.00 129.92 ? 146 TYR A CG    1 
ATOM   1181  C  CD1   . TYR A  1  148 ? -9.858  22.862  21.080  1.00 125.51 ? 146 TYR A CD1   1 
ATOM   1182  C  CD2   . TYR A  1  148 ? -11.761 22.401  19.723  1.00 132.08 ? 146 TYR A CD2   1 
ATOM   1183  C  CE1   . TYR A  1  148 ? -10.547 23.875  21.715  1.00 120.50 ? 146 TYR A CE1   1 
ATOM   1184  C  CE2   . TYR A  1  148 ? -12.459 23.414  20.352  1.00 127.74 ? 146 TYR A CE2   1 
ATOM   1185  C  CZ    . TYR A  1  148 ? -11.847 24.147  21.347  1.00 118.16 ? 146 TYR A CZ    1 
ATOM   1186  O  OH    . TYR A  1  148 ? -12.536 25.157  21.977  1.00 109.49 ? 146 TYR A OH    1 
ATOM   1187  N  N     . ASN A  1  149 ? -6.760  20.854  17.902  1.00 132.32 ? 147 ASN A N     1 
ATOM   1188  C  CA    . ASN A  1  149 ? -5.574  20.006  17.895  1.00 130.11 ? 147 ASN A CA    1 
ATOM   1189  C  C     . ASN A  1  149 ? -5.135  19.638  19.302  1.00 122.29 ? 147 ASN A C     1 
ATOM   1190  O  O     . ASN A  1  149 ? -4.144  18.920  19.467  1.00 114.79 ? 147 ASN A O     1 
ATOM   1191  C  CB    . ASN A  1  149 ? -4.421  20.692  17.159  1.00 137.28 ? 147 ASN A CB    1 
ATOM   1192  C  CG    . ASN A  1  149 ? -4.678  20.832  15.678  1.00 143.54 ? 147 ASN A CG    1 
ATOM   1193  O  OD1   . ASN A  1  149 ? -5.350  19.998  15.072  1.00 148.21 ? 147 ASN A OD1   1 
ATOM   1194  N  ND2   . ASN A  1  149 ? -4.146  21.892  15.083  1.00 142.22 ? 147 ASN A ND2   1 
ATOM   1195  N  N     . VAL A  1  150 ? -5.862  20.109  20.313  1.00 122.72 ? 148 VAL A N     1 
ATOM   1196  C  CA    . VAL A  1  150 ? -5.503  19.957  21.715  1.00 119.87 ? 148 VAL A CA    1 
ATOM   1197  C  C     . VAL A  1  150 ? -6.788  19.749  22.505  1.00 120.71 ? 148 VAL A C     1 
ATOM   1198  O  O     . VAL A  1  150 ? -7.892  19.941  21.993  1.00 123.17 ? 148 VAL A O     1 
ATOM   1199  C  CB    . VAL A  1  150 ? -4.733  21.181  22.268  1.00 117.53 ? 148 VAL A CB    1 
ATOM   1200  C  CG1   . VAL A  1  150 ? -3.371  21.338  21.597  1.00 114.17 ? 148 VAL A CG1   1 
ATOM   1201  C  CG2   . VAL A  1  150 ? -5.563  22.445  22.115  1.00 117.77 ? 148 VAL A CG2   1 
ATOM   1202  N  N     . LEU A  1  151 ? -6.628  19.307  23.752  1.00 121.01 ? 149 LEU A N     1 
ATOM   1203  C  CA    . LEU A  1  151 ? -7.771  18.957  24.583  1.00 118.48 ? 149 LEU A CA    1 
ATOM   1204  C  C     . LEU A  1  151 ? -8.697  20.157  24.739  1.00 120.85 ? 149 LEU A C     1 
ATOM   1205  O  O     . LEU A  1  151 ? -8.225  21.267  25.014  1.00 123.95 ? 149 LEU A O     1 
ATOM   1206  C  CB    . LEU A  1  151 ? -7.333  18.487  25.970  1.00 106.01 ? 149 LEU A CB    1 
ATOM   1207  C  CG    . LEU A  1  151 ? -6.505  17.223  26.155  1.00 103.31 ? 149 LEU A CG    1 
ATOM   1208  C  CD1   . LEU A  1  151 ? -6.310  16.993  27.645  1.00 102.79 ? 149 LEU A CD1   1 
ATOM   1209  C  CD2   . LEU A  1  151 ? -7.184  16.032  25.499  1.00 102.24 ? 149 LEU A CD2   1 
ATOM   1210  N  N     . PRO A  1  152 ? -9.999  19.980  24.589  1.00 116.23 ? 150 PRO A N     1 
ATOM   1211  C  CA    . PRO A  1  152 ? -10.911 21.124  24.686  1.00 114.40 ? 150 PRO A CA    1 
ATOM   1212  C  C     . PRO A  1  152 ? -11.798 21.093  25.920  1.00 114.77 ? 150 PRO A C     1 
ATOM   1213  O  O     . PRO A  1  152 ? -12.229 20.024  26.358  1.00 108.70 ? 150 PRO A O     1 
ATOM   1214  C  CB    . PRO A  1  152 ? -11.749 20.981  23.414  1.00 111.89 ? 150 PRO A CB    1 
ATOM   1215  C  CG    . PRO A  1  152 ? -11.829 19.470  23.219  1.00 107.97 ? 150 PRO A CG    1 
ATOM   1216  C  CD    . PRO A  1  152 ? -10.586 18.859  23.837  1.00 109.38 ? 150 PRO A CD    1 
ATOM   1217  N  N     . MET A  1  153 ? -12.072 22.263  26.496  1.00 115.29 ? 151 MET A N     1 
ATOM   1218  C  CA    . MET A  1  153 ? -12.945 22.332  27.661  1.00 107.25 ? 151 MET A CA    1 
ATOM   1219  C  C     . MET A  1  153 ? -14.404 22.000  27.365  1.00 113.51 ? 151 MET A C     1 
ATOM   1220  O  O     . MET A  1  153 ? -14.984 22.481  26.388  1.00 119.58 ? 151 MET A O     1 
ATOM   1221  C  CB    . MET A  1  153 ? -12.946 23.744  28.234  1.00 104.99 ? 151 MET A CB    1 
ATOM   1222  C  CG    . MET A  1  153 ? -11.546 24.244  28.541  1.00 108.43 ? 151 MET A CG    1 
ATOM   1223  S  SD    . MET A  1  153 ? -11.567 25.789  29.462  1.00 113.61 ? 151 MET A SD    1 
ATOM   1224  C  CE    . MET A  1  153 ? -9.830  26.227  29.455  1.00 119.28 ? 151 MET A CE    1 
ATOM   1225  N  N     . GLY A  1  154 ? -14.988 21.155  28.212  1.00 113.47 ? 152 GLY A N     1 
ATOM   1226  C  CA    . GLY A  1  154 ? -16.334 20.665  28.030  1.00 113.73 ? 152 GLY A CA    1 
ATOM   1227  C  C     . GLY A  1  154 ? -16.428 19.273  27.451  1.00 109.96 ? 152 GLY A C     1 
ATOM   1228  O  O     . GLY A  1  154 ? -17.528 18.710  27.413  1.00 100.16 ? 152 GLY A O     1 
ATOM   1229  N  N     . TRP A  1  155 ? -15.319 18.706  26.984  1.00 110.13 ? 153 TRP A N     1 
ATOM   1230  C  CA    . TRP A  1  155 ? -15.297 17.296  26.630  1.00 101.12 ? 153 TRP A CA    1 
ATOM   1231  C  C     . TRP A  1  155 ? -15.256 16.443  27.895  1.00 103.85 ? 153 TRP A C     1 
ATOM   1232  O  O     . TRP A  1  155 ? -14.728 16.855  28.931  1.00 104.28 ? 153 TRP A O     1 
ATOM   1233  C  CB    . TRP A  1  155 ? -14.101 16.992  25.734  1.00 98.60  ? 153 TRP A CB    1 
ATOM   1234  C  CG    . TRP A  1  155 ? -14.102 15.616  25.153  1.00 99.61  ? 153 TRP A CG    1 
ATOM   1235  C  CD1   . TRP A  1  155 ? -15.186 14.891  24.744  1.00 97.90  ? 153 TRP A CD1   1 
ATOM   1236  C  CD2   . TRP A  1  155 ? -12.958 14.794  24.922  1.00 101.85 ? 153 TRP A CD2   1 
ATOM   1237  N  NE1   . TRP A  1  155 ? -14.781 13.667  24.266  1.00 96.72  ? 153 TRP A NE1   1 
ATOM   1238  C  CE2   . TRP A  1  155 ? -13.416 13.584  24.366  1.00 96.67  ? 153 TRP A CE2   1 
ATOM   1239  C  CE3   . TRP A  1  155 ? -11.587 14.965  25.130  1.00 103.26 ? 153 TRP A CE3   1 
ATOM   1240  C  CZ2   . TRP A  1  155 ? -12.551 12.553  24.017  1.00 96.65  ? 153 TRP A CZ2   1 
ATOM   1241  C  CZ3   . TRP A  1  155 ? -10.731 13.942  24.784  1.00 103.38 ? 153 TRP A CZ3   1 
ATOM   1242  C  CH2   . TRP A  1  155 ? -11.213 12.751  24.233  1.00 99.97  ? 153 TRP A CH2   1 
ATOM   1243  N  N     . LYS A  1  156 ? -15.831 15.245  27.817  1.00 104.55 ? 154 LYS A N     1 
ATOM   1244  C  CA    . LYS A  1  156 ? -15.837 14.392  28.998  1.00 102.50 ? 154 LYS A CA    1 
ATOM   1245  C  C     . LYS A  1  156 ? -14.524 13.644  29.188  1.00 102.32 ? 154 LYS A C     1 
ATOM   1246  O  O     . LYS A  1  156 ? -14.369 12.943  30.193  1.00 109.59 ? 154 LYS A O     1 
ATOM   1247  C  CB    . LYS A  1  156 ? -16.999 13.399  28.941  1.00 103.90 ? 154 LYS A CB    1 
ATOM   1248  C  CG    . LYS A  1  156 ? -16.743 12.146  28.119  1.00 102.24 ? 154 LYS A CG    1 
ATOM   1249  C  CD    . LYS A  1  156 ? -17.829 11.107  28.370  1.00 95.30  ? 154 LYS A CD    1 
ATOM   1250  C  CE    . LYS A  1  156 ? -17.508 9.788   27.686  1.00 93.05  ? 154 LYS A CE    1 
ATOM   1251  N  NZ    . LYS A  1  156 ? -18.522 8.746   28.013  1.00 89.32  ? 154 LYS A NZ    1 
ATOM   1252  N  N     . GLY A  1  157 ? -13.580 13.789  28.263  1.00 98.01  ? 155 GLY A N     1 
ATOM   1253  C  CA    . GLY A  1  157 ? -12.299 13.130  28.363  1.00 94.12  ? 155 GLY A CA    1 
ATOM   1254  C  C     . GLY A  1  157 ? -11.175 14.068  28.765  1.00 99.40  ? 155 GLY A C     1 
ATOM   1255  O  O     . GLY A  1  157 ? -10.040 13.633  28.987  1.00 95.75  ? 155 GLY A O     1 
ATOM   1256  N  N     . SER A  1  158 ? -11.487 15.363  28.880  1.00 103.02 ? 156 SER A N     1 
ATOM   1257  C  CA    . SER A  1  158 ? -10.454 16.366  29.146  1.00 101.02 ? 156 SER A CA    1 
ATOM   1258  C  C     . SER A  1  158 ? -9.782  16.187  30.504  1.00 94.27  ? 156 SER A C     1 
ATOM   1259  O  O     . SER A  1  158 ? -8.544  16.083  30.549  1.00 93.15  ? 156 SER A O     1 
ATOM   1260  C  CB    . SER A  1  158 ? -11.051 17.767  28.977  1.00 107.66 ? 156 SER A CB    1 
ATOM   1261  O  OG    . SER A  1  158 ? -11.638 17.917  27.697  1.00 116.33 ? 156 SER A OG    1 
ATOM   1262  N  N     . PRO A  1  159 ? -10.506 16.156  31.634  1.00 86.34  ? 157 PRO A N     1 
ATOM   1263  C  CA    . PRO A  1  159 ? -9.803  16.117  32.932  1.00 89.32  ? 157 PRO A CA    1 
ATOM   1264  C  C     . PRO A  1  159 ? -8.884  14.917  33.094  1.00 81.54  ? 157 PRO A C     1 
ATOM   1265  O  O     . PRO A  1  159 ? -7.725  15.077  33.498  1.00 79.83  ? 157 PRO A O     1 
ATOM   1266  C  CB    . PRO A  1  159 ? -10.953 16.096  33.950  1.00 89.65  ? 157 PRO A CB    1 
ATOM   1267  C  CG    . PRO A  1  159 ? -12.118 16.651  33.226  1.00 88.96  ? 157 PRO A CG    1 
ATOM   1268  C  CD    . PRO A  1  159 ? -11.967 16.158  31.823  1.00 86.53  ? 157 PRO A CD    1 
ATOM   1269  N  N     . ALA A  1  160 ? -9.370  13.712  32.785  1.00 72.04  ? 158 ALA A N     1 
ATOM   1270  C  CA    . ALA A  1  160 ? -8.573  12.512  33.016  1.00 68.77  ? 158 ALA A CA    1 
ATOM   1271  C  C     . ALA A  1  160 ? -7.323  12.496  32.143  1.00 80.51  ? 158 ALA A C     1 
ATOM   1272  O  O     . ALA A  1  160 ? -6.244  12.104  32.602  1.00 85.11  ? 158 ALA A O     1 
ATOM   1273  C  CB    . ALA A  1  160 ? -9.424  11.268  32.766  1.00 66.50  ? 158 ALA A CB    1 
ATOM   1274  N  N     . ILE A  1  161 ? -7.448  12.912  30.881  1.00 85.49  ? 159 ILE A N     1 
ATOM   1275  C  CA    . ILE A  1  161 ? -6.288  12.937  29.993  1.00 91.19  ? 159 ILE A CA    1 
ATOM   1276  C  C     . ILE A  1  161 ? -5.248  13.930  30.500  1.00 94.50  ? 159 ILE A C     1 
ATOM   1277  O  O     . ILE A  1  161 ? -4.045  13.643  30.501  1.00 102.10 ? 159 ILE A O     1 
ATOM   1278  C  CB    . ILE A  1  161 ? -6.714  13.245  28.546  1.00 90.46  ? 159 ILE A CB    1 
ATOM   1279  C  CG1   . ILE A  1  161 ? -7.537  12.089  27.980  1.00 84.48  ? 159 ILE A CG1   1 
ATOM   1280  C  CG2   . ILE A  1  161 ? -5.494  13.477  27.670  1.00 88.53  ? 159 ILE A CG2   1 
ATOM   1281  C  CD1   . ILE A  1  161 ? -8.016  12.322  26.568  1.00 76.12  ? 159 ILE A CD1   1 
ATOM   1282  N  N     . PHE A  1  162 ? -5.691  15.113  30.934  1.00 88.02  ? 160 PHE A N     1 
ATOM   1283  C  CA    . PHE A  1  162 ? -4.753  16.113  31.440  1.00 89.01  ? 160 PHE A CA    1 
ATOM   1284  C  C     . PHE A  1  162 ? -4.055  15.618  32.700  1.00 87.88  ? 160 PHE A C     1 
ATOM   1285  O  O     . PHE A  1  162 ? -2.833  15.748  32.838  1.00 92.85  ? 160 PHE A O     1 
ATOM   1286  C  CB    . PHE A  1  162 ? -5.472  17.435  31.716  1.00 90.44  ? 160 PHE A CB    1 
ATOM   1287  C  CG    . PHE A  1  162 ? -4.553  18.534  32.185  1.00 87.98  ? 160 PHE A CG    1 
ATOM   1288  C  CD1   . PHE A  1  162 ? -4.265  18.696  33.531  1.00 80.97  ? 160 PHE A CD1   1 
ATOM   1289  C  CD2   . PHE A  1  162 ? -3.971  19.398  31.276  1.00 84.52  ? 160 PHE A CD2   1 
ATOM   1290  C  CE1   . PHE A  1  162 ? -3.416  19.699  33.959  1.00 82.98  ? 160 PHE A CE1   1 
ATOM   1291  C  CE2   . PHE A  1  162 ? -3.119  20.402  31.699  1.00 86.45  ? 160 PHE A CE2   1 
ATOM   1292  C  CZ    . PHE A  1  162 ? -2.844  20.554  33.042  1.00 86.16  ? 160 PHE A CZ    1 
ATOM   1293  N  N     . GLN A  1  163 ? -4.821  15.059  33.640  1.00 84.72  ? 161 GLN A N     1 
ATOM   1294  C  CA    . GLN A  1  163 ? -4.234  14.607  34.896  1.00 82.76  ? 161 GLN A CA    1 
ATOM   1295  C  C     . GLN A  1  163 ? -3.247  13.471  34.660  1.00 82.21  ? 161 GLN A C     1 
ATOM   1296  O  O     . GLN A  1  163 ? -2.164  13.446  35.258  1.00 84.89  ? 161 GLN A O     1 
ATOM   1297  C  CB    . GLN A  1  163 ? -5.337  14.175  35.862  1.00 83.22  ? 161 GLN A CB    1 
ATOM   1298  C  CG    . GLN A  1  163 ? -6.252  15.308  36.300  1.00 85.63  ? 161 GLN A CG    1 
ATOM   1299  C  CD    . GLN A  1  163 ? -7.625  14.824  36.730  1.00 89.41  ? 161 GLN A CD    1 
ATOM   1300  O  OE1   . GLN A  1  163 ? -7.852  13.626  36.893  1.00 89.98  ? 161 GLN A OE1   1 
ATOM   1301  N  NE2   . GLN A  1  163 ? -8.552  15.758  36.908  1.00 87.19  ? 161 GLN A NE2   1 
ATOM   1302  N  N     . SER A  1  164 ? -3.606  12.517  33.799  1.00 80.78  ? 162 SER A N     1 
ATOM   1303  C  CA    . SER A  1  164 ? -2.694  11.420  33.492  1.00 82.44  ? 162 SER A CA    1 
ATOM   1304  C  C     . SER A  1  164 ? -1.459  11.925  32.757  1.00 83.71  ? 162 SER A C     1 
ATOM   1305  O  O     . SER A  1  164 ? -0.338  11.485  33.039  1.00 81.83  ? 162 SER A O     1 
ATOM   1306  C  CB    . SER A  1  164 ? -3.414  10.353  32.670  1.00 84.80  ? 162 SER A CB    1 
ATOM   1307  O  OG    . SER A  1  164 ? -2.576  9.234   32.442  1.00 90.39  ? 162 SER A OG    1 
ATOM   1308  N  N     . SER A  1  165 ? -1.645  12.842  31.803  1.00 84.09  ? 163 SER A N     1 
ATOM   1309  C  CA    . SER A  1  165 ? -0.506  13.406  31.086  1.00 78.42  ? 163 SER A CA    1 
ATOM   1310  C  C     . SER A  1  165 ? 0.392   14.191  32.032  1.00 82.94  ? 163 SER A C     1 
ATOM   1311  O  O     . SER A  1  165 ? 1.623   14.090  31.961  1.00 84.24  ? 163 SER A O     1 
ATOM   1312  C  CB    . SER A  1  165 ? -0.985  14.295  29.938  1.00 73.93  ? 163 SER A CB    1 
ATOM   1313  O  OG    . SER A  1  165 ? -1.743  13.555  28.996  1.00 77.82  ? 163 SER A OG    1 
ATOM   1314  N  N     . MET A  1  166 ? -0.209  14.988  32.920  1.00 91.43  ? 164 MET A N     1 
ATOM   1315  C  CA    . MET A  1  166 ? 0.576   15.802  33.843  1.00 85.64  ? 164 MET A CA    1 
ATOM   1316  C  C     . MET A  1  166 ? 1.428   14.931  34.757  1.00 81.25  ? 164 MET A C     1 
ATOM   1317  O  O     . MET A  1  166 ? 2.593   15.250  35.022  1.00 86.72  ? 164 MET A O     1 
ATOM   1318  C  CB    . MET A  1  166 ? -0.350  16.692  34.672  1.00 73.72  ? 164 MET A CB    1 
ATOM   1319  C  CG    . MET A  1  166 ? 0.375   17.684  35.563  1.00 74.26  ? 164 MET A CG    1 
ATOM   1320  S  SD    . MET A  1  166 ? 0.890   19.156  34.661  1.00 87.81  ? 164 MET A SD    1 
ATOM   1321  C  CE    . MET A  1  166 ? 2.189   19.768  35.728  1.00 87.49  ? 164 MET A CE    1 
ATOM   1322  N  N     . THR A  1  167 ? 0.861   13.828  35.253  1.00 67.50  ? 165 THR A N     1 
ATOM   1323  C  CA    . THR A  1  167 ? 1.609   12.938  36.135  1.00 71.94  ? 165 THR A CA    1 
ATOM   1324  C  C     . THR A  1  167 ? 2.811   12.332  35.420  1.00 76.28  ? 165 THR A C     1 
ATOM   1325  O  O     . THR A  1  167 ? 3.892   12.202  36.008  1.00 81.70  ? 165 THR A O     1 
ATOM   1326  C  CB    . THR A  1  167 ? 0.690   11.839  36.671  1.00 67.69  ? 165 THR A CB    1 
ATOM   1327  O  OG1   . THR A  1  167 ? -0.393  12.433  37.397  1.00 63.39  ? 165 THR A OG1   1 
ATOM   1328  C  CG2   . THR A  1  167 ? 1.453   10.900  37.594  1.00 62.99  ? 165 THR A CG2   1 
ATOM   1329  N  N     . LYS A  1  168 ? 2.644   11.954  34.149  1.00 69.94  ? 166 LYS A N     1 
ATOM   1330  C  CA    . LYS A  1  168 ? 3.757   11.380  33.400  1.00 78.41  ? 166 LYS A CA    1 
ATOM   1331  C  C     . LYS A  1  168 ? 4.895   12.381  33.248  1.00 82.10  ? 166 LYS A C     1 
ATOM   1332  O  O     . LYS A  1  168 ? 6.070   12.020  33.370  1.00 85.41  ? 166 LYS A O     1 
ATOM   1333  C  CB    . LYS A  1  168 ? 3.285   10.907  32.025  1.00 89.81  ? 166 LYS A CB    1 
ATOM   1334  C  CG    . LYS A  1  168 ? 4.364   10.196  31.222  1.00 100.80 ? 166 LYS A CG    1 
ATOM   1335  C  CD    . LYS A  1  168 ? 4.048   10.199  29.736  1.00 110.25 ? 166 LYS A CD    1 
ATOM   1336  C  CE    . LYS A  1  168 ? 4.338   11.556  29.116  1.00 104.71 ? 166 LYS A CE    1 
ATOM   1337  N  NZ    . LYS A  1  168 ? 5.794   11.870  29.158  1.00 84.36  ? 166 LYS A NZ    1 
ATOM   1338  N  N     . ILE A  1  169 ? 4.563   13.642  32.962  1.00 76.38  ? 167 ILE A N     1 
ATOM   1339  C  CA    . ILE A  1  169 ? 5.582   14.682  32.865  1.00 80.46  ? 167 ILE A CA    1 
ATOM   1340  C  C     . ILE A  1  169 ? 6.243   14.920  34.217  1.00 85.00  ? 167 ILE A C     1 
ATOM   1341  O  O     . ILE A  1  169 ? 7.467   15.072  34.307  1.00 92.33  ? 167 ILE A O     1 
ATOM   1342  C  CB    . ILE A  1  169 ? 4.966   15.975  32.299  1.00 78.36  ? 167 ILE A CB    1 
ATOM   1343  C  CG1   . ILE A  1  169 ? 4.300   15.700  30.949  1.00 79.37  ? 167 ILE A CG1   1 
ATOM   1344  C  CG2   . ILE A  1  169 ? 6.029   17.058  32.169  1.00 83.61  ? 167 ILE A CG2   1 
ATOM   1345  C  CD1   . ILE A  1  169 ? 3.655   16.916  30.318  1.00 75.16  ? 167 ILE A CD1   1 
ATOM   1346  N  N     . LEU A  1  170 ? 5.434   14.982  35.262  1.00 77.33  ? 168 LEU A N     1 
ATOM   1347  C  CA    . LEU A  1  170 ? 5.927   15.224  36.609  1.00 75.06  ? 168 LEU A CA    1 
ATOM   1348  C  C     . LEU A  1  170 ? 6.834   14.133  37.156  1.00 82.55  ? 168 LEU A C     1 
ATOM   1349  O  O     . LEU A  1  170 ? 7.772   14.415  37.886  1.00 84.08  ? 168 LEU A O     1 
ATOM   1350  C  CB    . LEU A  1  170 ? 4.781   15.517  37.569  1.00 76.61  ? 168 LEU A CB    1 
ATOM   1351  C  CG    . LEU A  1  170 ? 4.172   16.898  37.356  1.00 76.23  ? 168 LEU A CG    1 
ATOM   1352  C  CD1   . LEU A  1  170 ? 3.202   17.247  38.471  1.00 67.86  ? 168 LEU A CD1   1 
ATOM   1353  C  CD2   . LEU A  1  170 ? 5.287   17.924  37.281  1.00 79.37  ? 168 LEU A CD2   1 
ATOM   1354  N  N     . GLU A  1  171 ? 6.544   12.887  36.817  1.00 90.93  ? 169 GLU A N     1 
ATOM   1355  C  CA    . GLU A  1  171 ? 7.177   11.750  37.470  1.00 93.64  ? 169 GLU A CA    1 
ATOM   1356  C  C     . GLU A  1  171 ? 8.686   11.775  37.317  1.00 100.54 ? 169 GLU A C     1 
ATOM   1357  O  O     . GLU A  1  171 ? 9.404   11.417  38.252  1.00 103.93 ? 169 GLU A O     1 
ATOM   1358  C  CB    . GLU A  1  171 ? 6.632   10.435  36.903  1.00 95.34  ? 169 GLU A CB    1 
ATOM   1359  C  CG    . GLU A  1  171 ? 7.448   9.205   37.281  1.00 104.28 ? 169 GLU A CG    1 
ATOM   1360  C  CD    . GLU A  1  171 ? 7.045   7.961   36.509  1.00 114.65 ? 169 GLU A CD    1 
ATOM   1361  O  OE1   . GLU A  1  171 ? 5.941   7.946   35.931  1.00 120.28 ? 169 GLU A OE1   1 
ATOM   1362  O  OE2   . GLU A  1  171 ? 7.832   6.993   36.481  1.00 113.90 ? 169 GLU A OE2   1 
ATOM   1363  N  N     . PRO A  1  172 ? 9.172   12.194  36.086  1.00 93.05  ? 170 PRO A N     1 
ATOM   1364  C  CA    . PRO A  1  172 ? 10.641  12.154  35.978  1.00 92.45  ? 170 PRO A CA    1 
ATOM   1365  C  C     . PRO A  1  172 ? 11.307  13.110  36.962  1.00 94.21  ? 170 PRO A C     1 
ATOM   1366  O  O     . PRO A  1  172 ? 12.314  12.773  37.575  1.00 96.25  ? 170 PRO A O     1 
ATOM   1367  C  CB    . PRO A  1  172 ? 10.916  12.602  34.540  1.00 95.73  ? 170 PRO A CB    1 
ATOM   1368  C  CG    . PRO A  1  172 ? 9.667   12.331  33.795  1.00 93.96  ? 170 PRO A CG    1 
ATOM   1369  C  CD    . PRO A  1  172 ? 8.633   12.756  34.771  1.00 90.49  ? 170 PRO A CD    1 
ATOM   1370  N  N     . PHE A  1  173 ? 10.740  14.301  37.101  1.00 91.27  ? 171 PHE A N     1 
ATOM   1371  C  CA    . PHE A  1  173 ? 11.275  15.300  38.009  1.00 90.39  ? 171 PHE A CA    1 
ATOM   1372  C  C     . PHE A  1  173 ? 11.210  14.842  39.456  1.00 93.06  ? 171 PHE A C     1 
ATOM   1373  O  O     . PHE A  1  173 ? 12.143  15.050  40.222  1.00 96.86  ? 171 PHE A O     1 
ATOM   1374  C  CB    . PHE A  1  173 ? 10.521  16.614  37.849  1.00 85.47  ? 171 PHE A CB    1 
ATOM   1375  C  CG    . PHE A  1  173 ? 11.023  17.708  38.737  1.00 83.02  ? 171 PHE A CG    1 
ATOM   1376  C  CD1   . PHE A  1  173 ? 12.261  18.275  38.521  1.00 84.73  ? 171 PHE A CD1   1 
ATOM   1377  C  CD2   . PHE A  1  173 ? 10.257  18.173  39.782  1.00 77.67  ? 171 PHE A CD2   1 
ATOM   1378  C  CE1   . PHE A  1  173 ? 12.728  19.283  39.334  1.00 82.84  ? 171 PHE A CE1   1 
ATOM   1379  C  CE2   . PHE A  1  173 ? 10.718  19.180  40.601  1.00 79.17  ? 171 PHE A CE2   1 
ATOM   1380  C  CZ    . PHE A  1  173 ? 11.956  19.736  40.376  1.00 79.49  ? 171 PHE A CZ    1 
ATOM   1381  N  N     . LYS A  1  174 ? 10.102  14.216  39.827  1.00 89.85  ? 172 LYS A N     1 
ATOM   1382  C  CA    . LYS A  1  174 ? 9.927   13.743  41.189  1.00 85.38  ? 172 LYS A CA    1 
ATOM   1383  C  C     . LYS A  1  174 ? 10.956  12.685  41.530  1.00 89.37  ? 172 LYS A C     1 
ATOM   1384  O  O     . LYS A  1  174 ? 11.481  12.661  42.632  1.00 100.05 ? 172 LYS A O     1 
ATOM   1385  C  CB    . LYS A  1  174 ? 8.519   13.200  41.403  1.00 78.27  ? 172 LYS A CB    1 
ATOM   1386  C  CG    . LYS A  1  174 ? 7.436   14.258  41.394  1.00 80.01  ? 172 LYS A CG    1 
ATOM   1387  C  CD    . LYS A  1  174 ? 6.116   13.673  41.859  1.00 84.06  ? 172 LYS A CD    1 
ATOM   1388  C  CE    . LYS A  1  174 ? 5.020   14.720  41.849  1.00 83.95  ? 172 LYS A CE    1 
ATOM   1389  N  NZ    . LYS A  1  174 ? 3.703   14.152  42.231  1.00 96.63  ? 172 LYS A NZ    1 
ATOM   1390  N  N     . LYS A  1  175 ? 11.243  11.804  40.583  1.00 93.86  ? 173 LYS A N     1 
ATOM   1391  C  CA    . LYS A  1  175 ? 12.240  10.772  40.815  1.00 105.34 ? 173 LYS A CA    1 
ATOM   1392  C  C     . LYS A  1  175 ? 13.595  11.416  41.058  1.00 105.56 ? 173 LYS A C     1 
ATOM   1393  O  O     . LYS A  1  175 ? 14.359  10.978  41.913  1.00 101.85 ? 173 LYS A O     1 
ATOM   1394  C  CB    . LYS A  1  175 ? 12.328  9.825   39.622  1.00 113.02 ? 173 LYS A CB    1 
ATOM   1395  C  CG    . LYS A  1  175 ? 13.389  8.748   39.782  1.00 119.26 ? 173 LYS A CG    1 
ATOM   1396  C  CD    . LYS A  1  175 ? 13.773  8.125   38.449  1.00 121.38 ? 173 LYS A CD    1 
ATOM   1397  C  CE    . LYS A  1  175 ? 14.871  7.089   38.627  1.00 119.10 ? 173 LYS A CE    1 
ATOM   1398  N  NZ    . LYS A  1  175 ? 15.438  6.644   37.326  1.00 118.08 ? 173 LYS A NZ    1 
ATOM   1399  N  N     . GLN A  1  176 ? 13.886  12.456  40.286  1.00 104.70 ? 174 GLN A N     1 
ATOM   1400  C  CA    . GLN A  1  176 ? 15.111  13.233  40.441  1.00 100.93 ? 174 GLN A CA    1 
ATOM   1401  C  C     . GLN A  1  176 ? 15.197  13.961  41.783  1.00 102.68 ? 174 GLN A C     1 
ATOM   1402  O  O     . GLN A  1  176 ? 16.277  14.105  42.346  1.00 105.66 ? 174 GLN A O     1 
ATOM   1403  C  CB    . GLN A  1  176 ? 15.340  14.172  39.256  1.00 99.22  ? 174 GLN A CB    1 
ATOM   1404  C  CG    . GLN A  1  176 ? 15.735  13.434  37.986  1.00 101.83 ? 174 GLN A CG    1 
ATOM   1405  C  CD    . GLN A  1  176 ? 16.428  14.318  36.970  1.00 107.88 ? 174 GLN A CD    1 
ATOM   1406  O  OE1   . GLN A  1  176 ? 16.125  14.266  35.782  1.00 116.02 ? 174 GLN A OE1   1 
ATOM   1407  N  NE2   . GLN A  1  176 ? 17.366  15.131  37.431  1.00 104.26 ? 174 GLN A NE2   1 
ATOM   1408  N  N     . ASN A  1  177 ? 14.059  14.428  42.285  1.00 97.86  ? 175 ASN A N     1 
ATOM   1409  C  CA    . ASN A  1  177 ? 14.029  15.179  43.533  1.00 91.37  ? 175 ASN A CA    1 
ATOM   1410  C  C     . ASN A  1  177 ? 13.064  14.547  44.523  1.00 90.24  ? 175 ASN A C     1 
ATOM   1411  O  O     . ASN A  1  177 ? 11.975  15.054  44.767  1.00 83.67  ? 175 ASN A O     1 
ATOM   1412  C  CB    . ASN A  1  177 ? 13.593  16.617  43.267  1.00 84.64  ? 175 ASN A CB    1 
ATOM   1413  C  CG    . ASN A  1  177 ? 14.461  17.310  42.244  1.00 88.83  ? 175 ASN A CG    1 
ATOM   1414  O  OD1   . ASN A  1  177 ? 13.968  17.833  41.250  1.00 86.00  ? 175 ASN A OD1   1 
ATOM   1415  N  ND2   . ASN A  1  177 ? 15.763  17.316  42.483  1.00 91.96  ? 175 ASN A ND2   1 
ATOM   1416  N  N     . PRO A  1  178 ? 13.489  13.432  45.099  1.00 90.69  ? 176 PRO A N     1 
ATOM   1417  C  CA    . PRO A  1  178 ? 12.643  12.645  46.011  1.00 87.49  ? 176 PRO A CA    1 
ATOM   1418  C  C     . PRO A  1  178 ? 12.107  13.400  47.220  1.00 88.55  ? 176 PRO A C     1 
ATOM   1419  O  O     . PRO A  1  178 ? 11.070  13.020  47.772  1.00 89.62  ? 176 PRO A O     1 
ATOM   1420  C  CB    . PRO A  1  178 ? 13.574  11.506  46.452  1.00 87.27  ? 176 PRO A CB    1 
ATOM   1421  C  CG    . PRO A  1  178 ? 14.636  11.445  45.408  1.00 89.48  ? 176 PRO A CG    1 
ATOM   1422  C  CD    . PRO A  1  178 ? 14.839  12.859  44.975  1.00 92.24  ? 176 PRO A CD    1 
ATOM   1423  N  N     . ASP A  1  179 ? 12.786  14.465  47.641  1.00 90.29  ? 177 ASP A N     1 
ATOM   1424  C  CA    . ASP A  1  179 ? 12.434  15.162  48.871  1.00 90.47  ? 177 ASP A CA    1 
ATOM   1425  C  C     . ASP A  1  179 ? 11.571  16.393  48.638  1.00 86.85  ? 177 ASP A C     1 
ATOM   1426  O  O     . ASP A  1  179 ? 11.262  17.106  49.598  1.00 90.00  ? 177 ASP A O     1 
ATOM   1427  C  CB    . ASP A  1  179 ? 13.700  15.563  49.636  1.00 100.64 ? 177 ASP A CB    1 
ATOM   1428  C  CG    . ASP A  1  179 ? 14.422  14.371  50.232  1.00 109.78 ? 177 ASP A CG    1 
ATOM   1429  O  OD1   . ASP A  1  179 ? 13.796  13.297  50.354  1.00 110.48 ? 177 ASP A OD1   1 
ATOM   1430  O  OD2   . ASP A  1  179 ? 15.612  14.510  50.586  1.00 115.77 ? 177 ASP A OD2   1 
ATOM   1431  N  N     . ILE A  1  180 ? 11.172  16.658  47.406  1.00 82.69  ? 178 ILE A N     1 
ATOM   1432  C  CA    . ILE A  1  180 ? 10.205  17.710  47.119  1.00 75.90  ? 178 ILE A CA    1 
ATOM   1433  C  C     . ILE A  1  180 ? 8.805   17.118  47.183  1.00 78.12  ? 178 ILE A C     1 
ATOM   1434  O  O     . ILE A  1  180 ? 8.564   16.002  46.707  1.00 80.58  ? 178 ILE A O     1 
ATOM   1435  C  CB    . ILE A  1  180 ? 10.487  18.344  45.744  1.00 70.62  ? 178 ILE A CB    1 
ATOM   1436  C  CG1   . ILE A  1  180 ? 11.948  18.786  45.650  1.00 75.45  ? 178 ILE A CG1   1 
ATOM   1437  C  CG2   . ILE A  1  180 ? 9.567   19.520  45.501  1.00 66.62  ? 178 ILE A CG2   1 
ATOM   1438  C  CD1   . ILE A  1  180 ? 12.358  19.772  46.714  1.00 72.89  ? 178 ILE A CD1   1 
ATOM   1439  N  N     . VAL A  1  181 ? 7.876   17.866  47.769  1.00 74.05  ? 179 VAL A N     1 
ATOM   1440  C  CA    . VAL A  1  181 ? 6.465   17.498  47.798  1.00 74.42  ? 179 VAL A CA    1 
ATOM   1441  C  C     . VAL A  1  181 ? 5.755   18.297  46.716  1.00 78.01  ? 179 VAL A C     1 
ATOM   1442  O  O     . VAL A  1  181 ? 5.772   19.533  46.736  1.00 83.41  ? 179 VAL A O     1 
ATOM   1443  C  CB    . VAL A  1  181 ? 5.844   17.755  49.179  1.00 70.58  ? 179 VAL A CB    1 
ATOM   1444  C  CG1   . VAL A  1  181 ? 4.350   17.478  49.147  1.00 67.03  ? 179 VAL A CG1   1 
ATOM   1445  C  CG2   . VAL A  1  181 ? 6.527   16.898  50.234  1.00 74.16  ? 179 VAL A CG2   1 
ATOM   1446  N  N     . ILE A  1  182 ? 5.129   17.600  45.772  1.00 78.93  ? 180 ILE A N     1 
ATOM   1447  C  CA    . ILE A  1  182 ? 4.313   18.233  44.743  1.00 72.20  ? 180 ILE A CA    1 
ATOM   1448  C  C     . ILE A  1  182 ? 2.900   17.677  44.849  1.00 67.19  ? 180 ILE A C     1 
ATOM   1449  O  O     . ILE A  1  182 ? 2.659   16.507  44.524  1.00 74.54  ? 180 ILE A O     1 
ATOM   1450  C  CB    . ILE A  1  182 ? 4.888   18.013  43.337  1.00 62.32  ? 180 ILE A CB    1 
ATOM   1451  C  CG1   . ILE A  1  182 ? 6.331   18.515  43.267  1.00 67.26  ? 180 ILE A CG1   1 
ATOM   1452  C  CG2   . ILE A  1  182 ? 4.036   18.722  42.297  1.00 63.18  ? 180 ILE A CG2   1 
ATOM   1453  C  CD1   . ILE A  1  182 ? 6.957   18.385  41.895  1.00 72.56  ? 180 ILE A CD1   1 
ATOM   1454  N  N     . TYR A  1  183 ? 1.966   18.513  45.300  1.00 62.34  ? 181 TYR A N     1 
ATOM   1455  C  CA    . TYR A  1  183 ? 0.543   18.200  45.242  1.00 71.39  ? 181 TYR A CA    1 
ATOM   1456  C  C     . TYR A  1  183 ? 0.017   18.647  43.883  1.00 71.84  ? 181 TYR A C     1 
ATOM   1457  O  O     . TYR A  1  183 ? -0.039  19.847  43.595  1.00 71.15  ? 181 TYR A O     1 
ATOM   1458  C  CB    . TYR A  1  183 ? -0.210  18.887  46.379  1.00 74.07  ? 181 TYR A CB    1 
ATOM   1459  C  CG    . TYR A  1  183 ? -0.296  18.063  47.642  1.00 75.29  ? 181 TYR A CG    1 
ATOM   1460  C  CD1   . TYR A  1  183 ? -1.500  17.495  48.039  1.00 73.44  ? 181 TYR A CD1   1 
ATOM   1461  C  CD2   . TYR A  1  183 ? 0.824   17.845  48.432  1.00 73.60  ? 181 TYR A CD2   1 
ATOM   1462  C  CE1   . TYR A  1  183 ? -1.586  16.737  49.190  1.00 70.09  ? 181 TYR A CE1   1 
ATOM   1463  C  CE2   . TYR A  1  183 ? 0.749   17.087  49.584  1.00 78.28  ? 181 TYR A CE2   1 
ATOM   1464  C  CZ    . TYR A  1  183 ? -0.459  16.536  49.958  1.00 75.36  ? 181 TYR A CZ    1 
ATOM   1465  O  OH    . TYR A  1  183 ? -0.542  15.781  51.105  1.00 66.65  ? 181 TYR A OH    1 
ATOM   1466  N  N     . GLN A  1  184 ? -0.370  17.684  43.050  1.00 65.47  ? 182 GLN A N     1 
ATOM   1467  C  CA    . GLN A  1  184 ? -0.842  17.943  41.693  1.00 68.72  ? 182 GLN A CA    1 
ATOM   1468  C  C     . GLN A  1  184 ? -2.354  17.764  41.649  1.00 67.96  ? 182 GLN A C     1 
ATOM   1469  O  O     . GLN A  1  184 ? -2.854  16.641  41.767  1.00 80.15  ? 182 GLN A O     1 
ATOM   1470  C  CB    . GLN A  1  184 ? -0.159  17.018  40.687  1.00 68.63  ? 182 GLN A CB    1 
ATOM   1471  C  CG    . GLN A  1  184 ? -0.692  17.155  39.267  1.00 66.20  ? 182 GLN A CG    1 
ATOM   1472  C  CD    . GLN A  1  184 ? -0.686  15.838  38.512  1.00 68.70  ? 182 GLN A CD    1 
ATOM   1473  O  OE1   . GLN A  1  184 ? 0.133   14.960  38.779  1.00 69.66  ? 182 GLN A OE1   1 
ATOM   1474  N  NE2   . GLN A  1  184 ? -1.612  15.690  37.572  1.00 62.23  ? 182 GLN A NE2   1 
ATOM   1475  N  N     . TYR A  1  185 ? -3.080  18.867  41.484  1.00 61.12  ? 183 TYR A N     1 
ATOM   1476  C  CA    . TYR A  1  185 ? -4.533  18.828  41.349  1.00 61.95  ? 183 TYR A CA    1 
ATOM   1477  C  C     . TYR A  1  185 ? -4.914  19.625  40.110  1.00 67.42  ? 183 TYR A C     1 
ATOM   1478  O  O     . TYR A  1  185 ? -4.853  20.859  40.120  1.00 74.97  ? 183 TYR A O     1 
ATOM   1479  C  CB    . TYR A  1  185 ? -5.231  19.386  42.590  1.00 59.35  ? 183 TYR A CB    1 
ATOM   1480  C  CG    . TYR A  1  185 ? -6.736  19.265  42.519  1.00 67.29  ? 183 TYR A CG    1 
ATOM   1481  C  CD1   . TYR A  1  185 ? -7.381  18.126  42.984  1.00 64.58  ? 183 TYR A CD1   1 
ATOM   1482  C  CD2   . TYR A  1  185 ? -7.511  20.280  41.972  1.00 71.15  ? 183 TYR A CD2   1 
ATOM   1483  C  CE1   . TYR A  1  185 ? -8.755  18.006  42.914  1.00 74.23  ? 183 TYR A CE1   1 
ATOM   1484  C  CE2   . TYR A  1  185 ? -8.883  20.169  41.898  1.00 71.62  ? 183 TYR A CE2   1 
ATOM   1485  C  CZ    . TYR A  1  185 ? -9.500  19.030  42.371  1.00 77.61  ? 183 TYR A CZ    1 
ATOM   1486  O  OH    . TYR A  1  185 ? -10.869 18.914  42.300  1.00 85.66  ? 183 TYR A OH    1 
ATOM   1487  N  N     . MET A  1  186 ? -5.293  18.916  39.045  1.00 77.87  ? 184 MET A N     1 
ATOM   1488  C  CA    . MET A  1  186 ? -5.576  19.506  37.732  1.00 79.43  ? 184 MET A CA    1 
ATOM   1489  C  C     . MET A  1  186 ? -4.309  20.212  37.261  1.00 79.91  ? 184 MET A C     1 
ATOM   1490  O  O     . MET A  1  186 ? -3.260  19.552  37.165  1.00 78.13  ? 184 MET A O     1 
ATOM   1491  C  CB    . MET A  1  186 ? -6.834  20.373  37.824  1.00 80.33  ? 184 MET A CB    1 
ATOM   1492  C  CG    . MET A  1  186 ? -7.501  20.673  36.486  1.00 91.16  ? 184 MET A CG    1 
ATOM   1493  S  SD    . MET A  1  186 ? -8.578  19.349  35.897  1.00 92.98  ? 184 MET A SD    1 
ATOM   1494  C  CE    . MET A  1  186 ? -7.458  18.426  34.849  1.00 81.96  ? 184 MET A CE    1 
ATOM   1495  N  N     . ASP A  1  187 ? -4.342  21.511  36.960  1.00 83.45  ? 185 ASP A N     1 
ATOM   1496  C  CA    . ASP A  1  187 ? -3.143  22.256  36.602  1.00 80.38  ? 185 ASP A CA    1 
ATOM   1497  C  C     . ASP A  1  187 ? -2.517  23.007  37.769  1.00 87.97  ? 185 ASP A C     1 
ATOM   1498  O  O     . ASP A  1  187 ? -1.433  23.577  37.602  1.00 92.63  ? 185 ASP A O     1 
ATOM   1499  C  CB    . ASP A  1  187 ? -3.455  23.252  35.481  1.00 81.88  ? 185 ASP A CB    1 
ATOM   1500  C  CG    . ASP A  1  187 ? -4.456  24.309  35.903  1.00 89.78  ? 185 ASP A CG    1 
ATOM   1501  O  OD1   . ASP A  1  187 ? -5.262  24.033  36.814  1.00 88.11  ? 185 ASP A OD1   1 
ATOM   1502  O  OD2   . ASP A  1  187 ? -4.438  25.415  35.324  1.00 103.97 ? 185 ASP A OD2   1 
ATOM   1503  N  N     . ASP A  1  188 ? -3.152  23.020  38.937  1.00 89.81  ? 186 ASP A N     1 
ATOM   1504  C  CA    . ASP A  1  188 ? -2.572  23.698  40.088  1.00 93.16  ? 186 ASP A CA    1 
ATOM   1505  C  C     . ASP A  1  188 ? -1.538  22.797  40.745  1.00 85.80  ? 186 ASP A C     1 
ATOM   1506  O  O     . ASP A  1  188 ? -1.825  21.642  41.076  1.00 72.82  ? 186 ASP A O     1 
ATOM   1507  C  CB    . ASP A  1  188 ? -3.654  24.086  41.094  1.00 94.71  ? 186 ASP A CB    1 
ATOM   1508  C  CG    . ASP A  1  188 ? -4.434  25.308  40.663  1.00 106.06 ? 186 ASP A CG    1 
ATOM   1509  O  OD1   . ASP A  1  188 ? -5.530  25.540  41.213  1.00 117.61 ? 186 ASP A OD1   1 
ATOM   1510  O  OD2   . ASP A  1  188 ? -3.952  26.036  39.771  1.00 101.97 ? 186 ASP A OD2   1 
ATOM   1511  N  N     . LEU A  1  189 ? -0.336  23.330  40.938  1.00 89.88  ? 187 LEU A N     1 
ATOM   1512  C  CA    . LEU A  1  189 ? 0.764   22.594  41.542  1.00 85.16  ? 187 LEU A CA    1 
ATOM   1513  C  C     . LEU A  1  189 ? 1.188   23.270  42.836  1.00 80.57  ? 187 LEU A C     1 
ATOM   1514  O  O     . LEU A  1  189 ? 1.426   24.482  42.864  1.00 90.90  ? 187 LEU A O     1 
ATOM   1515  C  CB    . LEU A  1  189 ? 1.956   22.489  40.585  1.00 83.12  ? 187 LEU A CB    1 
ATOM   1516  C  CG    . LEU A  1  189 ? 1.987   21.296  39.627  1.00 85.14  ? 187 LEU A CG    1 
ATOM   1517  C  CD1   . LEU A  1  189 ? 0.823   21.344  38.649  1.00 88.85  ? 187 LEU A CD1   1 
ATOM   1518  C  CD2   . LEU A  1  189 ? 3.315   21.244  38.888  1.00 87.90  ? 187 LEU A CD2   1 
ATOM   1519  N  N     . TYR A  1  190 ? 1.278   22.481  43.899  1.00 71.16  ? 188 TYR A N     1 
ATOM   1520  C  CA    . TYR A  1  190 ? 1.751   22.934  45.198  1.00 76.02  ? 188 TYR A CA    1 
ATOM   1521  C  C     . TYR A  1  190 ? 3.109   22.287  45.417  1.00 78.82  ? 188 TYR A C     1 
ATOM   1522  O  O     . TYR A  1  190 ? 3.216   21.057  45.411  1.00 76.95  ? 188 TYR A O     1 
ATOM   1523  C  CB    . TYR A  1  190 ? 0.767   22.544  46.304  1.00 74.85  ? 188 TYR A CB    1 
ATOM   1524  C  CG    . TYR A  1  190 ? 1.320   22.602  47.716  1.00 72.22  ? 188 TYR A CG    1 
ATOM   1525  C  CD1   . TYR A  1  190 ? 1.132   23.726  48.508  1.00 66.15  ? 188 TYR A CD1   1 
ATOM   1526  C  CD2   . TYR A  1  190 ? 2.005   21.522  48.266  1.00 70.68  ? 188 TYR A CD2   1 
ATOM   1527  C  CE1   . TYR A  1  190 ? 1.624   23.780  49.799  1.00 68.31  ? 188 TYR A CE1   1 
ATOM   1528  C  CE2   . TYR A  1  190 ? 2.506   21.571  49.555  1.00 72.55  ? 188 TYR A CE2   1 
ATOM   1529  C  CZ    . TYR A  1  190 ? 2.311   22.703  50.316  1.00 73.57  ? 188 TYR A CZ    1 
ATOM   1530  O  OH    . TYR A  1  190 ? 2.801   22.758  51.601  1.00 81.52  ? 188 TYR A OH    1 
ATOM   1531  N  N     . VAL A  1  191 ? 4.137   23.105  45.613  1.00 78.95  ? 189 VAL A N     1 
ATOM   1532  C  CA    . VAL A  1  191 ? 5.503   22.617  45.760  1.00 75.49  ? 189 VAL A CA    1 
ATOM   1533  C  C     . VAL A  1  191 ? 6.017   23.051  47.123  1.00 76.91  ? 189 VAL A C     1 
ATOM   1534  O  O     . VAL A  1  191 ? 6.004   24.245  47.447  1.00 72.44  ? 189 VAL A O     1 
ATOM   1535  C  CB    . VAL A  1  191 ? 6.422   23.130  44.641  1.00 71.12  ? 189 VAL A CB    1 
ATOM   1536  C  CG1   . VAL A  1  191 ? 7.772   22.446  44.723  1.00 75.24  ? 189 VAL A CG1   1 
ATOM   1537  C  CG2   . VAL A  1  191 ? 5.786   22.902  43.276  1.00 68.89  ? 189 VAL A CG2   1 
ATOM   1538  N  N     . GLY A  1  192 ? 6.464   22.090  47.913  1.00 79.83  ? 190 GLY A N     1 
ATOM   1539  C  CA    . GLY A  1  192 ? 6.958   22.370  49.251  1.00 77.79  ? 190 GLY A CA    1 
ATOM   1540  C  C     . GLY A  1  192 ? 8.250   21.633  49.520  1.00 72.60  ? 190 GLY A C     1 
ATOM   1541  O  O     . GLY A  1  192 ? 8.394   20.461  49.174  1.00 65.01  ? 190 GLY A O     1 
ATOM   1542  N  N     . SER A  1  193 ? 9.195   22.337  50.136  1.00 70.31  ? 191 SER A N     1 
ATOM   1543  C  CA    . SER A  1  193 ? 10.475  21.750  50.500  1.00 73.31  ? 191 SER A CA    1 
ATOM   1544  C  C     . SER A  1  193 ? 10.927  22.311  51.839  1.00 88.94  ? 191 SER A C     1 
ATOM   1545  O  O     . SER A  1  193 ? 10.489  23.380  52.270  1.00 99.89  ? 191 SER A O     1 
ATOM   1546  C  CB    . SER A  1  193 ? 11.546  22.015  49.435  1.00 78.00  ? 191 SER A CB    1 
ATOM   1547  O  OG    . SER A  1  193 ? 11.905  23.385  49.403  1.00 76.15  ? 191 SER A OG    1 
ATOM   1548  N  N     . ASP A  1  194 ? 11.818  21.571  52.492  1.00 93.00  ? 192 ASP A N     1 
ATOM   1549  C  CA    . ASP A  1  194 ? 12.558  22.090  53.631  1.00 97.34  ? 192 ASP A CA    1 
ATOM   1550  C  C     . ASP A  1  194 ? 13.843  22.787  53.207  1.00 93.74  ? 192 ASP A C     1 
ATOM   1551  O  O     . ASP A  1  194 ? 14.633  23.190  54.066  1.00 97.94  ? 192 ASP A O     1 
ATOM   1552  C  CB    . ASP A  1  194 ? 12.866  20.965  54.620  1.00 101.71 ? 192 ASP A CB    1 
ATOM   1553  C  CG    . ASP A  1  194 ? 11.622  20.447  55.312  1.00 101.31 ? 192 ASP A CG    1 
ATOM   1554  O  OD1   . ASP A  1  194 ? 10.678  21.242  55.502  1.00 96.19  ? 192 ASP A OD1   1 
ATOM   1555  O  OD2   . ASP A  1  194 ? 11.587  19.250  55.662  1.00 103.50 ? 192 ASP A OD2   1 
ATOM   1556  N  N     . LEU A  1  195 ? 14.068  22.922  51.902  1.00 92.90  ? 193 LEU A N     1 
ATOM   1557  C  CA    . LEU A  1  195 ? 15.185  23.704  51.395  1.00 94.85  ? 193 LEU A CA    1 
ATOM   1558  C  C     . LEU A  1  195 ? 15.030  25.165  51.798  1.00 100.33 ? 193 LEU A C     1 
ATOM   1559  O  O     . LEU A  1  195 ? 13.918  25.689  51.906  1.00 97.12  ? 193 LEU A O     1 
ATOM   1560  C  CB    . LEU A  1  195 ? 15.271  23.593  49.872  1.00 88.46  ? 193 LEU A CB    1 
ATOM   1561  C  CG    . LEU A  1  195 ? 15.575  22.224  49.265  1.00 86.95  ? 193 LEU A CG    1 
ATOM   1562  C  CD1   . LEU A  1  195 ? 15.526  22.302  47.747  1.00 86.45  ? 193 LEU A CD1   1 
ATOM   1563  C  CD2   . LEU A  1  195 ? 16.930  21.722  49.733  1.00 86.37  ? 193 LEU A CD2   1 
ATOM   1564  N  N     . GLU A  1  196 ? 16.160  25.825  52.027  1.00 103.99 ? 194 GLU A N     1 
ATOM   1565  C  CA    . GLU A  1  196 ? 16.125  27.245  52.334  1.00 101.69 ? 194 GLU A CA    1 
ATOM   1566  C  C     . GLU A  1  196 ? 15.695  28.025  51.097  1.00 101.71 ? 194 GLU A C     1 
ATOM   1567  O  O     . GLU A  1  196 ? 15.877  27.575  49.962  1.00 105.79 ? 194 GLU A O     1 
ATOM   1568  C  CB    . GLU A  1  196 ? 17.492  27.723  52.828  1.00 110.16 ? 194 GLU A CB    1 
ATOM   1569  C  CG    . GLU A  1  196 ? 17.490  29.115  53.449  1.00 122.55 ? 194 GLU A CG    1 
ATOM   1570  C  CD    . GLU A  1  196 ? 16.292  29.354  54.353  1.00 124.01 ? 194 GLU A CD    1 
ATOM   1571  O  OE1   . GLU A  1  196 ? 15.273  29.890  53.867  1.00 124.47 ? 194 GLU A OE1   1 
ATOM   1572  O  OE2   . GLU A  1  196 ? 16.365  29.000  55.549  1.00 120.52 ? 194 GLU A OE2   1 
ATOM   1573  N  N     . ILE A  1  197 ? 15.109  29.204  51.332  1.00 103.87 ? 195 ILE A N     1 
ATOM   1574  C  CA    . ILE A  1  197 ? 14.246  29.839  50.337  1.00 107.69 ? 195 ILE A CA    1 
ATOM   1575  C  C     . ILE A  1  197 ? 14.980  30.029  49.013  1.00 112.69 ? 195 ILE A C     1 
ATOM   1576  O  O     . ILE A  1  197 ? 14.400  29.841  47.937  1.00 115.73 ? 195 ILE A O     1 
ATOM   1577  C  CB    . ILE A  1  197 ? 13.691  31.170  50.884  1.00 109.01 ? 195 ILE A CB    1 
ATOM   1578  C  CG1   . ILE A  1  197 ? 12.805  31.851  49.838  1.00 114.09 ? 195 ILE A CG1   1 
ATOM   1579  C  CG2   . ILE A  1  197 ? 14.817  32.088  51.345  1.00 111.05 ? 195 ILE A CG2   1 
ATOM   1580  C  CD1   . ILE A  1  197 ? 11.564  31.058  49.483  1.00 114.31 ? 195 ILE A CD1   1 
ATOM   1581  N  N     . GLY A  1  198 ? 16.261  30.398  49.065  1.00 110.50 ? 196 GLY A N     1 
ATOM   1582  C  CA    . GLY A  1  198 ? 17.024  30.540  47.834  1.00 108.39 ? 196 GLY A CA    1 
ATOM   1583  C  C     . GLY A  1  198 ? 17.167  29.228  47.084  1.00 107.01 ? 196 GLY A C     1 
ATOM   1584  O  O     . GLY A  1  198 ? 16.971  29.167  45.868  1.00 108.14 ? 196 GLY A O     1 
ATOM   1585  N  N     . GLN A  1  199 ? 17.527  28.161  47.802  1.00 102.94 ? 197 GLN A N     1 
ATOM   1586  C  CA    . GLN A  1  199 ? 17.659  26.851  47.170  1.00 105.74 ? 197 GLN A CA    1 
ATOM   1587  C  C     . GLN A  1  199 ? 16.317  26.350  46.652  1.00 103.79 ? 197 GLN A C     1 
ATOM   1588  O  O     . GLN A  1  199 ? 16.249  25.710  45.596  1.00 102.29 ? 197 GLN A O     1 
ATOM   1589  C  CB    . GLN A  1  199 ? 18.266  25.850  48.152  1.00 109.85 ? 197 GLN A CB    1 
ATOM   1590  C  CG    . GLN A  1  199 ? 19.696  26.165  48.563  1.00 113.32 ? 197 GLN A CG    1 
ATOM   1591  C  CD    . GLN A  1  199 ? 20.302  25.079  49.429  1.00 119.98 ? 197 GLN A CD    1 
ATOM   1592  O  OE1   . GLN A  1  199 ? 19.620  24.136  49.829  1.00 119.57 ? 197 GLN A OE1   1 
ATOM   1593  N  NE2   . GLN A  1  199 ? 21.591  25.204  49.720  1.00 124.20 ? 197 GLN A NE2   1 
ATOM   1594  N  N     . HIS A  1  200 ? 15.240  26.614  47.396  1.00 100.59 ? 198 HIS A N     1 
ATOM   1595  C  CA    . HIS A  1  200 ? 13.910  26.179  46.980  1.00 93.44  ? 198 HIS A CA    1 
ATOM   1596  C  C     . HIS A  1  200 ? 13.515  26.798  45.645  1.00 89.77  ? 198 HIS A C     1 
ATOM   1597  O  O     . HIS A  1  200 ? 13.000  26.110  44.756  1.00 90.14  ? 198 HIS A O     1 
ATOM   1598  C  CB    . HIS A  1  200 ? 12.895  26.538  48.066  1.00 86.35  ? 198 HIS A CB    1 
ATOM   1599  C  CG    . HIS A  1  200 ? 11.467  26.461  47.621  1.00 84.28  ? 198 HIS A CG    1 
ATOM   1600  N  ND1   . HIS A  1  200 ? 10.698  25.329  47.779  1.00 76.84  ? 198 HIS A ND1   1 
ATOM   1601  C  CD2   . HIS A  1  200 ? 10.663  27.384  47.040  1.00 83.53  ? 198 HIS A CD2   1 
ATOM   1602  C  CE1   . HIS A  1  200 ? 9.484   25.554  47.307  1.00 77.04  ? 198 HIS A CE1   1 
ATOM   1603  N  NE2   . HIS A  1  200 ? 9.437   26.793  46.852  1.00 78.64  ? 198 HIS A NE2   1 
ATOM   1604  N  N     . ARG A  1  201 ? 13.744  28.104  45.488  1.00 92.79  ? 199 ARG A N     1 
ATOM   1605  C  CA    . ARG A  1  201 ? 13.440  28.766  44.223  1.00 92.48  ? 199 ARG A CA    1 
ATOM   1606  C  C     . ARG A  1  201 ? 14.287  28.220  43.081  1.00 95.05  ? 199 ARG A C     1 
ATOM   1607  O  O     . ARG A  1  201 ? 13.842  28.220  41.927  1.00 94.52  ? 199 ARG A O     1 
ATOM   1608  C  CB    . ARG A  1  201 ? 13.614  30.277  44.371  1.00 94.90  ? 199 ARG A CB    1 
ATOM   1609  C  CG    . ARG A  1  201 ? 12.743  30.846  45.477  1.00 100.42 ? 199 ARG A CG    1 
ATOM   1610  C  CD    . ARG A  1  201 ? 12.634  32.356  45.439  1.00 110.10 ? 199 ARG A CD    1 
ATOM   1611  N  NE    . ARG A  1  201 ? 11.774  32.834  46.519  1.00 117.74 ? 199 ARG A NE    1 
ATOM   1612  C  CZ    . ARG A  1  201 ? 11.281  34.065  46.599  1.00 128.65 ? 199 ARG A CZ    1 
ATOM   1613  N  NH1   . ARG A  1  201 ? 11.555  34.956  45.657  1.00 134.08 ? 199 ARG A NH1   1 
ATOM   1614  N  NH2   . ARG A  1  201 ? 10.508  34.403  47.622  1.00 131.71 ? 199 ARG A NH2   1 
ATOM   1615  N  N     . THR A  1  202 ? 15.509  27.770  43.375  1.00 95.45  ? 200 THR A N     1 
ATOM   1616  C  CA    . THR A  1  202 ? 16.329  27.131  42.350  1.00 97.39  ? 200 THR A CA    1 
ATOM   1617  C  C     . THR A  1  202 ? 15.624  25.903  41.786  1.00 93.06  ? 200 THR A C     1 
ATOM   1618  O  O     . THR A  1  202 ? 15.513  25.741  40.565  1.00 94.34  ? 200 THR A O     1 
ATOM   1619  C  CB    . THR A  1  202 ? 17.697  26.755  42.924  1.00 105.44 ? 200 THR A CB    1 
ATOM   1620  O  OG1   . THR A  1  202 ? 18.461  27.944  43.165  1.00 104.78 ? 200 THR A OG1   1 
ATOM   1621  C  CG2   . THR A  1  202 ? 18.456  25.853  41.960  1.00 106.68 ? 200 THR A CG2   1 
ATOM   1622  N  N     . LYS A  1  203 ? 15.141  25.024  42.667  1.00 92.34  ? 201 LYS A N     1 
ATOM   1623  C  CA    . LYS A  1  203 ? 14.338  23.888  42.224  1.00 88.30  ? 201 LYS A CA    1 
ATOM   1624  C  C     . LYS A  1  203 ? 13.048  24.349  41.554  1.00 87.86  ? 201 LYS A C     1 
ATOM   1625  O  O     . LYS A  1  203 ? 12.611  23.753  40.563  1.00 90.66  ? 201 LYS A O     1 
ATOM   1626  C  CB    . LYS A  1  203 ? 14.034  22.966  43.404  1.00 87.52  ? 201 LYS A CB    1 
ATOM   1627  C  CG    . LYS A  1  203 ? 15.256  22.239  43.943  1.00 95.44  ? 201 LYS A CG    1 
ATOM   1628  C  CD    . LYS A  1  203 ? 15.914  21.402  42.855  1.00 102.69 ? 201 LYS A CD    1 
ATOM   1629  C  CE    . LYS A  1  203 ? 17.253  20.844  43.310  1.00 110.45 ? 201 LYS A CE    1 
ATOM   1630  N  NZ    . LYS A  1  203 ? 17.919  20.062  42.230  1.00 112.73 ? 201 LYS A NZ    1 
ATOM   1631  N  N     . ILE A  1  204 ? 12.411  25.391  42.096  1.00 84.04  ? 202 ILE A N     1 
ATOM   1632  C  CA    . ILE A  1  204 ? 11.151  25.873  41.532  1.00 82.49  ? 202 ILE A CA    1 
ATOM   1633  C  C     . ILE A  1  204 ? 11.351  26.310  40.087  1.00 87.55  ? 202 ILE A C     1 
ATOM   1634  O  O     . ILE A  1  204 ? 10.582  25.936  39.193  1.00 85.83  ? 202 ILE A O     1 
ATOM   1635  C  CB    . ILE A  1  204 ? 10.576  27.008  42.397  1.00 83.96  ? 202 ILE A CB    1 
ATOM   1636  C  CG1   . ILE A  1  204 ? 9.845   26.416  43.597  1.00 85.63  ? 202 ILE A CG1   1 
ATOM   1637  C  CG2   . ILE A  1  204 ? 9.637   27.889  41.586  1.00 83.31  ? 202 ILE A CG2   1 
ATOM   1638  C  CD1   . ILE A  1  204 ? 8.780   25.436  43.197  1.00 90.22  ? 202 ILE A CD1   1 
ATOM   1639  N  N     . GLU A  1  205 ? 12.395  27.101  39.834  1.00 96.11  ? 203 GLU A N     1 
ATOM   1640  C  CA    . GLU A  1  205 ? 12.665  27.536  38.469  1.00 98.44  ? 203 GLU A CA    1 
ATOM   1641  C  C     . GLU A  1  205 ? 13.074  26.349  37.610  1.00 102.74 ? 203 GLU A C     1 
ATOM   1642  O  O     . GLU A  1  205 ? 12.678  26.248  36.443  1.00 108.66 ? 203 GLU A O     1 
ATOM   1643  C  CB    . GLU A  1  205 ? 13.739  28.622  38.458  1.00 105.96 ? 203 GLU A CB    1 
ATOM   1644  C  CG    . GLU A  1  205 ? 13.586  29.614  37.317  1.00 119.08 ? 203 GLU A CG    1 
ATOM   1645  C  CD    . GLU A  1  205 ? 12.215  30.266  37.295  1.00 123.36 ? 203 GLU A CD    1 
ATOM   1646  O  OE1   . GLU A  1  205 ? 11.669  30.550  38.383  1.00 114.19 ? 203 GLU A OE1   1 
ATOM   1647  O  OE2   . GLU A  1  205 ? 11.677  30.487  36.189  1.00 130.78 ? 203 GLU A OE2   1 
ATOM   1648  N  N     . GLU A  1  206 ? 13.891  25.455  38.171  1.00 101.24 ? 204 GLU A N     1 
ATOM   1649  C  CA    . GLU A  1  206 ? 14.325  24.270  37.441  1.00 98.94  ? 204 GLU A CA    1 
ATOM   1650  C  C     . GLU A  1  206 ? 13.132  23.390  37.083  1.00 92.08  ? 204 GLU A C     1 
ATOM   1651  O  O     . GLU A  1  206 ? 13.084  22.809  35.992  1.00 91.90  ? 204 GLU A O     1 
ATOM   1652  C  CB    . GLU A  1  206 ? 15.344  23.501  38.282  1.00 104.35 ? 204 GLU A CB    1 
ATOM   1653  C  CG    . GLU A  1  206 ? 16.114  22.415  37.554  1.00 122.95 ? 204 GLU A CG    1 
ATOM   1654  C  CD    . GLU A  1  206 ? 17.306  21.930  38.359  1.00 137.60 ? 204 GLU A CD    1 
ATOM   1655  O  OE1   . GLU A  1  206 ? 17.680  22.616  39.334  1.00 131.31 ? 204 GLU A OE1   1 
ATOM   1656  O  OE2   . GLU A  1  206 ? 17.868  20.867  38.022  1.00 150.88 ? 204 GLU A OE2   1 
ATOM   1657  N  N     . LEU A  1  207 ? 12.167  23.269  38.000  1.00 91.15  ? 205 LEU A N     1 
ATOM   1658  C  CA    . LEU A  1  207 ? 10.910  22.599  37.673  1.00 90.57  ? 205 LEU A CA    1 
ATOM   1659  C  C     . LEU A  1  207 ? 10.157  23.332  36.569  1.00 93.58  ? 205 LEU A C     1 
ATOM   1660  O  O     . LEU A  1  207 ? 9.542   22.698  35.703  1.00 93.22  ? 205 LEU A O     1 
ATOM   1661  C  CB    . LEU A  1  207 ? 10.037  22.482  38.924  1.00 83.22  ? 205 LEU A CB    1 
ATOM   1662  C  CG    . LEU A  1  207 ? 8.630   21.911  38.719  1.00 87.30  ? 205 LEU A CG    1 
ATOM   1663  C  CD1   . LEU A  1  207 ? 8.691   20.460  38.265  1.00 84.86  ? 205 LEU A CD1   1 
ATOM   1664  C  CD2   . LEU A  1  207 ? 7.793   22.049  39.982  1.00 84.43  ? 205 LEU A CD2   1 
ATOM   1665  N  N     . ARG A  1  208 ? 10.183  24.669  36.588  1.00 94.16  ? 206 ARG A N     1 
ATOM   1666  C  CA    . ARG A  1  208 ? 9.530   25.436  35.530  1.00 93.82  ? 206 ARG A CA    1 
ATOM   1667  C  C     . ARG A  1  208 ? 10.143  25.125  34.171  1.00 98.55  ? 206 ARG A C     1 
ATOM   1668  O  O     . ARG A  1  208 ? 9.431   25.045  33.163  1.00 93.80  ? 206 ARG A O     1 
ATOM   1669  C  CB    . ARG A  1  208 ? 9.616   26.933  35.831  1.00 87.31  ? 206 ARG A CB    1 
ATOM   1670  C  CG    . ARG A  1  208 ? 8.610   27.426  36.863  1.00 82.08  ? 206 ARG A CG    1 
ATOM   1671  C  CD    . ARG A  1  208 ? 8.989   28.805  37.384  1.00 93.00  ? 206 ARG A CD    1 
ATOM   1672  N  NE    . ARG A  1  208 ? 9.191   29.772  36.308  1.00 110.96 ? 206 ARG A NE    1 
ATOM   1673  C  CZ    . ARG A  1  208 ? 8.316   30.716  35.975  1.00 114.41 ? 206 ARG A CZ    1 
ATOM   1674  N  NH1   . ARG A  1  208 ? 8.588   31.553  34.983  1.00 113.76 ? 206 ARG A NH1   1 
ATOM   1675  N  NH2   . ARG A  1  208 ? 7.172   30.828  36.636  1.00 112.40 ? 206 ARG A NH2   1 
ATOM   1676  N  N     . GLN A  1  209 ? 11.468  24.965  34.123  1.00 103.38 ? 207 GLN A N     1 
ATOM   1677  C  CA    . GLN A  1  209 ? 12.125  24.585  32.877  1.00 104.81 ? 207 GLN A CA    1 
ATOM   1678  C  C     . GLN A  1  209 ? 11.651  23.216  32.409  1.00 101.54 ? 207 GLN A C     1 
ATOM   1679  O  O     . GLN A  1  209 ? 11.416  23.006  31.213  1.00 102.59 ? 207 GLN A O     1 
ATOM   1680  C  CB    . GLN A  1  209 ? 13.644  24.600  33.054  1.00 109.64 ? 207 GLN A CB    1 
ATOM   1681  C  CG    . GLN A  1  209 ? 14.192  25.892  33.643  1.00 116.22 ? 207 GLN A CG    1 
ATOM   1682  C  CD    . GLN A  1  209 ? 13.850  27.117  32.813  1.00 126.15 ? 207 GLN A CD    1 
ATOM   1683  O  OE1   . GLN A  1  209 ? 13.690  27.035  31.595  1.00 126.69 ? 207 GLN A OE1   1 
ATOM   1684  N  NE2   . GLN A  1  209 ? 13.736  28.263  33.473  1.00 131.88 ? 207 GLN A NE2   1 
ATOM   1685  N  N     . HIS A  1  210 ? 11.520  22.268  33.340  1.00 102.13 ? 208 HIS A N     1 
ATOM   1686  C  CA    . HIS A  1  210 ? 11.109  20.913  32.983  1.00 102.52 ? 208 HIS A CA    1 
ATOM   1687  C  C     . HIS A  1  210 ? 9.717   20.906  32.362  1.00 97.30  ? 208 HIS A C     1 
ATOM   1688  O  O     . HIS A  1  210 ? 9.485   20.249  31.342  1.00 93.84  ? 208 HIS A O     1 
ATOM   1689  C  CB    . HIS A  1  210 ? 11.152  20.019  34.223  1.00 100.40 ? 208 HIS A CB    1 
ATOM   1690  C  CG    . HIS A  1  210 ? 10.696  18.614  33.977  1.00 99.54  ? 208 HIS A CG    1 
ATOM   1691  N  ND1   . HIS A  1  210 ? 11.570  17.588  33.690  1.00 101.39 ? 208 HIS A ND1   1 
ATOM   1692  C  CD2   . HIS A  1  210 ? 9.458   18.063  33.983  1.00 97.04  ? 208 HIS A CD2   1 
ATOM   1693  C  CE1   . HIS A  1  210 ? 10.891  16.467  33.527  1.00 104.01 ? 208 HIS A CE1   1 
ATOM   1694  N  NE2   . HIS A  1  210 ? 9.608   16.728  33.699  1.00 99.96  ? 208 HIS A NE2   1 
ATOM   1695  N  N     . LEU A  1  211 ? 8.775   21.634  32.966  1.00 95.48  ? 209 LEU A N     1 
ATOM   1696  C  CA    . LEU A  1  211 ? 7.440   21.730  32.385  1.00 93.36  ? 209 LEU A CA    1 
ATOM   1697  C  C     . LEU A  1  211 ? 7.464   22.446  31.041  1.00 91.44  ? 209 LEU A C     1 
ATOM   1698  O  O     . LEU A  1  211 ? 6.651   22.137  30.161  1.00 85.93  ? 209 LEU A O     1 
ATOM   1699  C  CB    . LEU A  1  211 ? 6.491   22.436  33.353  1.00 92.97  ? 209 LEU A CB    1 
ATOM   1700  C  CG    . LEU A  1  211 ? 6.236   21.702  34.672  1.00 92.70  ? 209 LEU A CG    1 
ATOM   1701  C  CD1   . LEU A  1  211 ? 5.116   22.365  35.460  1.00 94.25  ? 209 LEU A CD1   1 
ATOM   1702  C  CD2   . LEU A  1  211 ? 5.924   20.236  34.412  1.00 87.22  ? 209 LEU A CD2   1 
ATOM   1703  N  N     . LEU A  1  212 ? 8.375   23.408  30.871  1.00 96.69  ? 210 LEU A N     1 
ATOM   1704  C  CA    . LEU A  1  212 ? 8.460   24.145  29.614  1.00 101.55 ? 210 LEU A CA    1 
ATOM   1705  C  C     . LEU A  1  212 ? 8.793   23.215  28.453  1.00 104.25 ? 210 LEU A C     1 
ATOM   1706  O  O     . LEU A  1  212 ? 8.283   23.392  27.340  1.00 96.46  ? 210 LEU A O     1 
ATOM   1707  C  CB    . LEU A  1  212 ? 9.497   25.262  29.730  1.00 102.30 ? 210 LEU A CB    1 
ATOM   1708  C  CG    . LEU A  1  212 ? 9.599   26.233  28.552  1.00 111.22 ? 210 LEU A CG    1 
ATOM   1709  C  CD1   . LEU A  1  212 ? 8.230   26.794  28.202  1.00 109.98 ? 210 LEU A CD1   1 
ATOM   1710  C  CD2   . LEU A  1  212 ? 10.571  27.357  28.875  1.00 120.57 ? 210 LEU A CD2   1 
ATOM   1711  N  N     . ARG A  1  213 ? 9.668   22.231  28.691  1.00 108.76 ? 211 ARG A N     1 
ATOM   1712  C  CA    . ARG A  1  213 ? 10.099  21.327  27.628  1.00 106.87 ? 211 ARG A CA    1 
ATOM   1713  C  C     . ARG A  1  213 ? 8.922   20.633  26.954  1.00 103.34 ? 211 ARG A C     1 
ATOM   1714  O  O     . ARG A  1  213 ? 8.983   20.330  25.757  1.00 116.12 ? 211 ARG A O     1 
ATOM   1715  C  CB    . ARG A  1  213 ? 11.056  20.275  28.188  1.00 108.58 ? 211 ARG A CB    1 
ATOM   1716  C  CG    . ARG A  1  213 ? 12.285  20.818  28.890  1.00 115.72 ? 211 ARG A CG    1 
ATOM   1717  C  CD    . ARG A  1  213 ? 13.173  19.668  29.336  1.00 120.32 ? 211 ARG A CD    1 
ATOM   1718  N  NE    . ARG A  1  213 ? 13.613  18.863  28.200  1.00 126.65 ? 211 ARG A NE    1 
ATOM   1719  C  CZ    . ARG A  1  213 ? 14.058  17.614  28.292  1.00 128.83 ? 211 ARG A CZ    1 
ATOM   1720  N  NH1   . ARG A  1  213 ? 14.116  17.011  29.471  1.00 127.40 ? 211 ARG A NH1   1 
ATOM   1721  N  NH2   . ARG A  1  213 ? 14.436  16.964  27.200  1.00 126.83 ? 211 ARG A NH2   1 
ATOM   1722  N  N     . TRP A  1  214 ? 7.849   20.377  27.696  1.00 96.71  ? 212 TRP A N     1 
ATOM   1723  C  CA    . TRP A  1  214 ? 6.649   19.756  27.154  1.00 96.84  ? 212 TRP A CA    1 
ATOM   1724  C  C     . TRP A  1  214 ? 5.592   20.772  26.735  1.00 91.34  ? 212 TRP A C     1 
ATOM   1725  O  O     . TRP A  1  214 ? 4.464   20.382  26.420  1.00 84.71  ? 212 TRP A O     1 
ATOM   1726  C  CB    . TRP A  1  214 ? 6.065   18.771  28.171  1.00 95.33  ? 212 TRP A CB    1 
ATOM   1727  C  CG    . TRP A  1  214 ? 6.764   17.442  28.182  1.00 95.87  ? 212 TRP A CG    1 
ATOM   1728  C  CD1   . TRP A  1  214 ? 6.417   16.328  27.474  1.00 94.05  ? 212 TRP A CD1   1 
ATOM   1729  C  CD2   . TRP A  1  214 ? 7.933   17.089  28.934  1.00 100.79 ? 212 TRP A CD2   1 
ATOM   1730  N  NE1   . TRP A  1  214 ? 7.295   15.305  27.740  1.00 92.07  ? 212 TRP A NE1   1 
ATOM   1731  C  CE2   . TRP A  1  214 ? 8.234   15.747  28.633  1.00 99.05  ? 212 TRP A CE2   1 
ATOM   1732  C  CE3   . TRP A  1  214 ? 8.752   17.777  29.832  1.00 108.32 ? 212 TRP A CE3   1 
ATOM   1733  C  CZ2   . TRP A  1  214 ? 9.320   15.079  29.199  1.00 104.33 ? 212 TRP A CZ2   1 
ATOM   1734  C  CZ3   . TRP A  1  214 ? 9.831   17.111  30.393  1.00 111.61 ? 212 TRP A CZ3   1 
ATOM   1735  C  CH2   . TRP A  1  214 ? 10.104  15.776  30.074  1.00 108.88 ? 212 TRP A CH2   1 
ATOM   1736  N  N     . GLY A  1  215 ? 5.933   22.057  26.714  1.00 94.98  ? 213 GLY A N     1 
ATOM   1737  C  CA    . GLY A  1  215 ? 4.997   23.088  26.319  1.00 100.50 ? 213 GLY A CA    1 
ATOM   1738  C  C     . GLY A  1  215 ? 4.075   23.570  27.413  1.00 105.24 ? 213 GLY A C     1 
ATOM   1739  O  O     . GLY A  1  215 ? 3.107   24.280  27.117  1.00 110.15 ? 213 GLY A O     1 
ATOM   1740  N  N     . LEU A  1  216 ? 4.348   23.219  28.665  1.00 105.52 ? 214 LEU A N     1 
ATOM   1741  C  CA    . LEU A  1  216 ? 3.558   23.686  29.795  1.00 107.83 ? 214 LEU A CA    1 
ATOM   1742  C  C     . LEU A  1  216 ? 4.187   24.963  30.338  1.00 111.02 ? 214 LEU A C     1 
ATOM   1743  O  O     . LEU A  1  216 ? 5.373   24.978  30.685  1.00 112.12 ? 214 LEU A O     1 
ATOM   1744  C  CB    . LEU A  1  216 ? 3.473   22.616  30.882  1.00 98.10  ? 214 LEU A CB    1 
ATOM   1745  C  CG    . LEU A  1  216 ? 2.593   21.409  30.555  1.00 88.57  ? 214 LEU A CG    1 
ATOM   1746  C  CD1   . LEU A  1  216 ? 2.684   20.363  31.653  1.00 84.58  ? 214 LEU A CD1   1 
ATOM   1747  C  CD2   . LEU A  1  216 ? 1.151   21.848  30.349  1.00 78.20  ? 214 LEU A CD2   1 
ATOM   1748  N  N     . THR A  1  217 ? 3.395   26.027  30.410  1.00 108.39 ? 215 THR A N     1 
ATOM   1749  C  CA    . THR A  1  217 ? 3.884   27.349  30.769  1.00 110.86 ? 215 THR A CA    1 
ATOM   1750  C  C     . THR A  1  217 ? 3.287   27.758  32.107  1.00 109.34 ? 215 THR A C     1 
ATOM   1751  O  O     . THR A  1  217 ? 2.065   27.713  32.287  1.00 109.88 ? 215 THR A O     1 
ATOM   1752  C  CB    . THR A  1  217 ? 3.524   28.379  29.696  1.00 117.46 ? 215 THR A CB    1 
ATOM   1753  O  OG1   . THR A  1  217 ? 2.102   28.544  29.647  1.00 120.21 ? 215 THR A OG1   1 
ATOM   1754  C  CG2   . THR A  1  217 ? 4.021   27.924  28.331  1.00 120.73 ? 215 THR A CG2   1 
ATOM   1755  N  N     . THR A  1  218 ? 4.151   28.151  33.040  1.00 103.70 ? 216 THR A N     1 
ATOM   1756  C  CA    . THR A  1  218 ? 3.719   28.679  34.329  1.00 103.57 ? 216 THR A CA    1 
ATOM   1757  C  C     . THR A  1  218 ? 3.985   30.177  34.351  1.00 110.07 ? 216 THR A C     1 
ATOM   1758  O  O     . THR A  1  218 ? 5.132   30.600  34.561  1.00 116.03 ? 216 THR A O     1 
ATOM   1759  C  CB    . THR A  1  218 ? 4.453   27.983  35.478  1.00 105.21 ? 216 THR A CB    1 
ATOM   1760  O  OG1   . THR A  1  218 ? 5.864   28.006  35.230  1.00 99.94  ? 216 THR A OG1   1 
ATOM   1761  C  CG2   . THR A  1  218 ? 3.986   26.539  35.614  1.00 100.99 ? 216 THR A CG2   1 
ATOM   1762  N  N     . PRO A  1  219 ? 2.976   31.016  34.128  1.00 108.57 ? 217 PRO A N     1 
ATOM   1763  C  CA    . PRO A  1  219 ? 3.203   32.463  34.159  1.00 111.26 ? 217 PRO A CA    1 
ATOM   1764  C  C     . PRO A  1  219 ? 3.532   32.951  35.560  1.00 117.57 ? 217 PRO A C     1 
ATOM   1765  O  O     . PRO A  1  219 ? 3.079   32.394  36.562  1.00 117.34 ? 217 PRO A O     1 
ATOM   1766  C  CB    . PRO A  1  219 ? 1.870   33.045  33.671  1.00 108.15 ? 217 PRO A CB    1 
ATOM   1767  C  CG    . PRO A  1  219 ? 1.178   31.912  32.976  1.00 104.95 ? 217 PRO A CG    1 
ATOM   1768  C  CD    . PRO A  1  219 ? 1.606   30.680  33.709  1.00 100.47 ? 217 PRO A CD    1 
ATOM   1769  N  N     . ASP A  1  220 ? 4.345   34.008  35.617  1.00 126.16 ? 218 ASP A N     1 
ATOM   1770  C  CA    . ASP A  1  220 ? 4.535   34.720  36.875  1.00 128.52 ? 218 ASP A CA    1 
ATOM   1771  C  C     . ASP A  1  220 ? 3.221   35.300  37.381  1.00 129.48 ? 218 ASP A C     1 
ATOM   1772  O  O     . ASP A  1  220 ? 3.062   35.518  38.588  1.00 125.78 ? 218 ASP A O     1 
ATOM   1773  C  CB    . ASP A  1  220 ? 5.577   35.824  36.704  1.00 131.69 ? 218 ASP A CB    1 
ATOM   1774  C  CG    . ASP A  1  220 ? 6.840   35.331  36.027  1.00 136.55 ? 218 ASP A CG    1 
ATOM   1775  O  OD1   . ASP A  1  220 ? 7.661   34.677  36.703  1.00 139.93 ? 218 ASP A OD1   1 
ATOM   1776  O  OD2   . ASP A  1  220 ? 7.012   35.599  34.819  1.00 135.40 ? 218 ASP A OD2   1 
ATOM   1777  N  N     . LYS A  1  221 ? 2.284   35.577  36.467  1.00 130.79 ? 219 LYS A N     1 
ATOM   1778  C  CA    . LYS A  1  221 ? 1.038   36.250  36.820  1.00 125.66 ? 219 LYS A CA    1 
ATOM   1779  C  C     . LYS A  1  221 ? 0.270   35.494  37.897  1.00 121.50 ? 219 LYS A C     1 
ATOM   1780  O  O     . LYS A  1  221 ? -0.394  36.114  38.736  1.00 127.23 ? 219 LYS A O     1 
ATOM   1781  C  CB    . LYS A  1  221 ? 0.177   36.429  35.571  1.00 124.44 ? 219 LYS A CB    1 
ATOM   1782  C  CG    . LYS A  1  221 ? 0.967   36.893  34.359  1.00 123.25 ? 219 LYS A CG    1 
ATOM   1783  C  CD    . LYS A  1  221 ? 0.059   37.286  33.209  1.00 123.78 ? 219 LYS A CD    1 
ATOM   1784  C  CE    . LYS A  1  221 ? 0.870   37.792  32.026  1.00 134.69 ? 219 LYS A CE    1 
ATOM   1785  N  NZ    . LYS A  1  221 ? 0.010   38.413  30.983  1.00 140.06 ? 219 LYS A NZ    1 
ATOM   1786  N  N     . LYS A  1  222 ? 0.347   34.163  37.893  1.00 113.55 ? 220 LYS A N     1 
ATOM   1787  C  CA    . LYS A  1  222 ? -0.244  33.338  38.943  1.00 106.14 ? 220 LYS A CA    1 
ATOM   1788  C  C     . LYS A  1  222 ? 0.831   32.395  39.486  1.00 103.48 ? 220 LYS A C     1 
ATOM   1789  O  O     . LYS A  1  222 ? 0.731   31.170  39.435  1.00 98.97  ? 220 LYS A O     1 
ATOM   1790  C  CB    . LYS A  1  222 ? -1.466  32.578  38.431  1.00 109.20 ? 220 LYS A CB    1 
ATOM   1791  C  CG    . LYS A  1  222 ? -2.579  33.492  37.943  1.00 114.46 ? 220 LYS A CG    1 
ATOM   1792  C  CD    . LYS A  1  222 ? -3.905  32.763  37.829  1.00 120.51 ? 220 LYS A CD    1 
ATOM   1793  C  CE    . LYS A  1  222 ? -5.025  33.735  37.495  1.00 122.40 ? 220 LYS A CE    1 
ATOM   1794  N  NZ    . LYS A  1  222 ? -6.363  33.087  37.547  1.00 122.09 ? 220 LYS A NZ    1 
ATOM   1795  N  N     . HIS A  1  223 ? 1.886   33.011  40.012  1.00 106.93 ? 221 HIS A N     1 
ATOM   1796  C  CA    . HIS A  1  223 ? 2.959   32.340  40.733  1.00 111.15 ? 221 HIS A CA    1 
ATOM   1797  C  C     . HIS A  1  223 ? 3.022   32.985  42.109  1.00 115.05 ? 221 HIS A C     1 
ATOM   1798  O  O     . HIS A  1  223 ? 3.206   34.203  42.214  1.00 127.38 ? 221 HIS A O     1 
ATOM   1799  C  CB    . HIS A  1  223 ? 4.283   32.488  39.976  1.00 111.40 ? 221 HIS A CB    1 
ATOM   1800  C  CG    . HIS A  1  223 ? 5.439   31.764  40.595  1.00 113.81 ? 221 HIS A CG    1 
ATOM   1801  N  ND1   . HIS A  1  223 ? 6.619   31.545  39.917  1.00 110.27 ? 221 HIS A ND1   1 
ATOM   1802  C  CD2   . HIS A  1  223 ? 5.607   31.219  41.824  1.00 117.37 ? 221 HIS A CD2   1 
ATOM   1803  C  CE1   . HIS A  1  223 ? 7.461   30.893  40.698  1.00 110.96 ? 221 HIS A CE1   1 
ATOM   1804  N  NE2   . HIS A  1  223 ? 6.872   30.685  41.862  1.00 114.20 ? 221 HIS A NE2   1 
ATOM   1805  N  N     . GLN A  1  224 ? 2.876   32.180  43.156  1.00 99.17  ? 222 GLN A N     1 
ATOM   1806  C  CA    . GLN A  1  224 ? 2.834   32.691  44.524  1.00 97.39  ? 222 GLN A CA    1 
ATOM   1807  C  C     . GLN A  1  224 ? 4.139   32.347  45.232  1.00 98.25  ? 222 GLN A C     1 
ATOM   1808  O  O     . GLN A  1  224 ? 4.316   31.232  45.730  1.00 97.48  ? 222 GLN A O     1 
ATOM   1809  C  CB    . GLN A  1  224 ? 1.626   32.123  45.264  1.00 97.43  ? 222 GLN A CB    1 
ATOM   1810  C  CG    . GLN A  1  224 ? 0.305   32.387  44.554  1.00 101.19 ? 222 GLN A CG    1 
ATOM   1811  C  CD    . GLN A  1  224 ? -0.857  31.623  45.157  1.00 103.76 ? 222 GLN A CD    1 
ATOM   1812  O  OE1   . GLN A  1  224 ? -0.963  31.488  46.375  1.00 100.75 ? 222 GLN A OE1   1 
ATOM   1813  N  NE2   . GLN A  1  224 ? -1.735  31.113  44.301  1.00 101.15 ? 222 GLN A NE2   1 
ATOM   1814  N  N     . LYS A  1  225 ? 5.051   33.319  45.271  1.00 101.93 ? 223 LYS A N     1 
ATOM   1815  C  CA    . LYS A  1  225 ? 6.285   33.179  46.033  1.00 100.78 ? 223 LYS A CA    1 
ATOM   1816  C  C     . LYS A  1  225 ? 6.058   33.362  47.529  1.00 102.85 ? 223 LYS A C     1 
ATOM   1817  O  O     . LYS A  1  225 ? 6.772   32.760  48.339  1.00 96.17  ? 223 LYS A O     1 
ATOM   1818  C  CB    . LYS A  1  225 ? 7.327   34.182  45.534  1.00 100.24 ? 223 LYS A CB    1 
ATOM   1819  C  CG    . LYS A  1  225 ? 7.829   33.913  44.121  1.00 109.88 ? 223 LYS A CG    1 
ATOM   1820  C  CD    . LYS A  1  225 ? 8.840   34.964  43.686  1.00 116.95 ? 223 LYS A CD    1 
ATOM   1821  C  CE    . LYS A  1  225 ? 9.626   34.524  42.457  1.00 114.49 ? 223 LYS A CE    1 
ATOM   1822  N  NZ    . LYS A  1  225 ? 8.774   34.427  41.240  1.00 114.05 ? 223 LYS A NZ    1 
ATOM   1823  N  N     . GLU A  1  226 ? 5.072   34.176  47.909  1.00 111.79 ? 224 GLU A N     1 
ATOM   1824  C  CA    . GLU A  1  226 ? 4.965   34.719  49.251  1.00 114.50 ? 224 GLU A CA    1 
ATOM   1825  C  C     . GLU A  1  226 ? 3.641   34.346  49.911  1.00 107.67 ? 224 GLU A C     1 
ATOM   1826  O  O     . GLU A  1  226 ? 2.584   34.433  49.276  1.00 105.19 ? 224 GLU A O     1 
ATOM   1827  C  CB    . GLU A  1  226 ? 5.103   36.250  49.202  1.00 118.79 ? 224 GLU A CB    1 
ATOM   1828  C  CG    . GLU A  1  226 ? 5.674   36.886  50.456  1.00 123.11 ? 224 GLU A CG    1 
ATOM   1829  C  CD    . GLU A  1  226 ? 6.191   38.289  50.203  1.00 136.22 ? 224 GLU A CD    1 
ATOM   1830  O  OE1   . GLU A  1  226 ? 6.400   38.641  49.022  1.00 142.80 ? 224 GLU A OE1   1 
ATOM   1831  O  OE2   . GLU A  1  226 ? 6.386   39.041  51.180  1.00 142.14 ? 224 GLU A OE2   1 
ATOM   1832  N  N     . PRO A  1  227 ? 3.666   33.920  51.187  1.00 103.30 ? 225 PRO A N     1 
ATOM   1833  C  CA    . PRO A  1  227 ? 2.489   33.630  52.019  1.00 98.76  ? 225 PRO A CA    1 
ATOM   1834  C  C     . PRO A  1  227 ? 1.679   34.891  52.333  1.00 102.32 ? 225 PRO A C     1 
ATOM   1835  O  O     . PRO A  1  227 ? 2.274   35.953  52.509  1.00 116.83 ? 225 PRO A O     1 
ATOM   1836  C  CB    . PRO A  1  227 ? 3.095   33.041  53.302  1.00 93.06  ? 225 PRO A CB    1 
ATOM   1837  C  CG    . PRO A  1  227 ? 4.483   32.630  52.932  1.00 94.90  ? 225 PRO A CG    1 
ATOM   1838  C  CD    . PRO A  1  227 ? 4.921   33.609  51.892  1.00 98.16  ? 225 PRO A CD    1 
ATOM   1839  N  N     . PRO A  1  228 ? 0.339   34.783  52.401  1.00 88.55  ? 226 PRO A N     1 
ATOM   1840  C  CA    . PRO A  1  228 ? -0.418  33.529  52.449  1.00 86.74  ? 226 PRO A CA    1 
ATOM   1841  C  C     . PRO A  1  228 ? -0.866  33.024  51.081  1.00 99.15  ? 226 PRO A C     1 
ATOM   1842  O  O     . PRO A  1  228 ? -1.473  33.756  50.299  1.00 109.44 ? 226 PRO A O     1 
ATOM   1843  C  CB    . PRO A  1  228 ? -1.628  33.898  53.307  1.00 78.43  ? 226 PRO A CB    1 
ATOM   1844  C  CG    . PRO A  1  228 ? -1.871  35.333  52.984  1.00 81.74  ? 226 PRO A CG    1 
ATOM   1845  C  CD    . PRO A  1  228 ? -0.526  35.949  52.655  1.00 84.23  ? 226 PRO A CD    1 
ATOM   1846  N  N     . PHE A  1  229 ? -0.551  31.764  50.806  1.00 99.46  ? 227 PHE A N     1 
ATOM   1847  C  CA    . PHE A  1  229 ? -0.927  31.146  49.546  1.00 97.29  ? 227 PHE A CA    1 
ATOM   1848  C  C     . PHE A  1  229 ? -2.424  30.865  49.497  1.00 100.33 ? 227 PHE A C     1 
ATOM   1849  O  O     . PHE A  1  229 ? -3.062  30.573  50.513  1.00 106.84 ? 227 PHE A O     1 
ATOM   1850  C  CB    . PHE A  1  229 ? -0.141  29.853  49.339  1.00 92.29  ? 227 PHE A CB    1 
ATOM   1851  C  CG    . PHE A  1  229 ? 1.330   30.008  49.566  1.00 96.42  ? 227 PHE A CG    1 
ATOM   1852  C  CD1   . PHE A  1  229 ? 2.158   30.448  48.548  1.00 91.30  ? 227 PHE A CD1   1 
ATOM   1853  C  CD2   . PHE A  1  229 ? 1.885   29.733  50.805  1.00 99.60  ? 227 PHE A CD2   1 
ATOM   1854  C  CE1   . PHE A  1  229 ? 3.512   30.601  48.759  1.00 94.69  ? 227 PHE A CE1   1 
ATOM   1855  C  CE2   . PHE A  1  229 ? 3.236   29.884  51.022  1.00 98.63  ? 227 PHE A CE2   1 
ATOM   1856  C  CZ    . PHE A  1  229 ? 4.050   30.321  50.001  1.00 99.85  ? 227 PHE A CZ    1 
ATOM   1857  N  N     . LEU A  1  230 ? -2.984  30.958  48.295  1.00 95.39  ? 228 LEU A N     1 
ATOM   1858  C  CA    . LEU A  1  230 ? -4.372  30.601  48.036  1.00 90.69  ? 228 LEU A CA    1 
ATOM   1859  C  C     . LEU A  1  230 ? -4.379  29.289  47.266  1.00 96.52  ? 228 LEU A C     1 
ATOM   1860  O  O     . LEU A  1  230 ? -3.848  29.217  46.152  1.00 98.85  ? 228 LEU A O     1 
ATOM   1861  C  CB    . LEU A  1  230 ? -5.101  31.696  47.258  1.00 87.85  ? 228 LEU A CB    1 
ATOM   1862  C  CG    . LEU A  1  230 ? -5.400  32.985  48.026  1.00 89.54  ? 228 LEU A CG    1 
ATOM   1863  C  CD1   . LEU A  1  230 ? -6.515  33.772  47.350  1.00 96.62  ? 228 LEU A CD1   1 
ATOM   1864  C  CD2   . LEU A  1  230 ? -5.751  32.684  49.476  1.00 82.97  ? 228 LEU A CD2   1 
ATOM   1865  N  N     . TRP A  1  231 ? -4.984  28.263  47.857  1.00 98.40  ? 229 TRP A N     1 
ATOM   1866  C  CA    . TRP A  1  231 ? -4.888  26.907  47.332  1.00 91.18  ? 229 TRP A CA    1 
ATOM   1867  C  C     . TRP A  1  231 ? -6.157  26.158  47.703  1.00 83.41  ? 229 TRP A C     1 
ATOM   1868  O  O     . TRP A  1  231 ? -6.496  26.061  48.887  1.00 84.68  ? 229 TRP A O     1 
ATOM   1869  C  CB    . TRP A  1  231 ? -3.649  26.204  47.890  1.00 91.36  ? 229 TRP A CB    1 
ATOM   1870  C  CG    . TRP A  1  231 ? -3.419  24.820  47.370  1.00 91.76  ? 229 TRP A CG    1 
ATOM   1871  C  CD1   . TRP A  1  231 ? -2.989  24.472  46.123  1.00 91.90  ? 229 TRP A CD1   1 
ATOM   1872  C  CD2   . TRP A  1  231 ? -3.576  23.597  48.097  1.00 83.53  ? 229 TRP A CD2   1 
ATOM   1873  N  NE1   . TRP A  1  231 ? -2.882  23.105  46.024  1.00 87.65  ? 229 TRP A NE1   1 
ATOM   1874  C  CE2   . TRP A  1  231 ? -3.236  22.545  47.224  1.00 80.13  ? 229 TRP A CE2   1 
ATOM   1875  C  CE3   . TRP A  1  231 ? -3.978  23.289  49.400  1.00 80.15  ? 229 TRP A CE3   1 
ATOM   1876  C  CZ2   . TRP A  1  231 ? -3.287  21.208  47.611  1.00 76.08  ? 229 TRP A CZ2   1 
ATOM   1877  C  CZ3   . TRP A  1  231 ? -4.027  21.961  49.782  1.00 78.26  ? 229 TRP A CZ3   1 
ATOM   1878  C  CH2   . TRP A  1  231 ? -3.683  20.937  48.891  1.00 80.91  ? 229 TRP A CH2   1 
ATOM   1879  N  N     . MET A  1  232 ? -6.830  25.618  46.687  1.00 80.92  ? 230 MET A N     1 
ATOM   1880  C  CA    . MET A  1  232 ? -8.033  24.800  46.850  1.00 79.61  ? 230 MET A CA    1 
ATOM   1881  C  C     . MET A  1  232 ? -9.046  25.452  47.791  1.00 81.11  ? 230 MET A C     1 
ATOM   1882  O  O     . MET A  1  232 ? -9.675  24.789  48.616  1.00 85.38  ? 230 MET A O     1 
ATOM   1883  C  CB    . MET A  1  232 ? -7.668  23.398  47.339  1.00 70.35  ? 230 MET A CB    1 
ATOM   1884  C  CG    . MET A  1  232 ? -6.608  22.708  46.498  1.00 73.71  ? 230 MET A CG    1 
ATOM   1885  S  SD    . MET A  1  232 ? -7.210  22.251  44.864  1.00 83.23  ? 230 MET A SD    1 
ATOM   1886  C  CE    . MET A  1  232 ? -8.506  21.100  45.307  1.00 81.16  ? 230 MET A CE    1 
ATOM   1887  N  N     . GLY A  1  233 ? -9.248  26.757  47.632  1.00 80.86  ? 231 GLY A N     1 
ATOM   1888  C  CA    . GLY A  1  233 ? -10.204 27.453  48.470  1.00 83.04  ? 231 GLY A CA    1 
ATOM   1889  C  C     . GLY A  1  233 ? -9.763  27.728  49.889  1.00 83.75  ? 231 GLY A C     1 
ATOM   1890  O  O     . GLY A  1  233 ? -10.590 28.157  50.702  1.00 78.10  ? 231 GLY A O     1 
ATOM   1891  N  N     . TYR A  1  234 ? -8.498  27.488  50.222  1.00 80.38  ? 232 TYR A N     1 
ATOM   1892  C  CA    . TYR A  1  234 ? -7.981  27.738  51.558  1.00 74.62  ? 232 TYR A CA    1 
ATOM   1893  C  C     . TYR A  1  234 ? -6.894  28.802  51.508  1.00 78.89  ? 232 TYR A C     1 
ATOM   1894  O  O     . TYR A  1  234 ? -6.291  29.063  50.463  1.00 87.91  ? 232 TYR A O     1 
ATOM   1895  C  CB    . TYR A  1  234 ? -7.417  26.459  52.195  1.00 76.99  ? 232 TYR A CB    1 
ATOM   1896  C  CG    . TYR A  1  234 ? -8.348  25.271  52.134  1.00 75.06  ? 232 TYR A CG    1 
ATOM   1897  C  CD1   . TYR A  1  234 ? -9.371  25.114  53.060  1.00 79.83  ? 232 TYR A CD1   1 
ATOM   1898  C  CD2   . TYR A  1  234 ? -8.196  24.299  51.156  1.00 73.78  ? 232 TYR A CD2   1 
ATOM   1899  C  CE1   . TYR A  1  234 ? -10.222 24.026  53.007  1.00 77.43  ? 232 TYR A CE1   1 
ATOM   1900  C  CE2   . TYR A  1  234 ? -9.045  23.210  51.091  1.00 80.19  ? 232 TYR A CE2   1 
ATOM   1901  C  CZ    . TYR A  1  234 ? -10.054 23.078  52.021  1.00 76.10  ? 232 TYR A CZ    1 
ATOM   1902  O  OH    . TYR A  1  234 ? -10.899 21.994  51.967  1.00 71.14  ? 232 TYR A OH    1 
ATOM   1903  N  N     . GLU A  1  235 ? -6.646  29.412  52.663  1.00 75.89  ? 233 GLU A N     1 
ATOM   1904  C  CA    . GLU A  1  235 ? -5.536  30.335  52.855  1.00 80.92  ? 233 GLU A CA    1 
ATOM   1905  C  C     . GLU A  1  235 ? -4.470  29.610  53.661  1.00 80.00  ? 233 GLU A C     1 
ATOM   1906  O  O     . GLU A  1  235 ? -4.724  29.191  54.795  1.00 82.50  ? 233 GLU A O     1 
ATOM   1907  C  CB    . GLU A  1  235 ? -5.989  31.604  53.578  1.00 86.29  ? 233 GLU A CB    1 
ATOM   1908  C  CG    . GLU A  1  235 ? -7.146  32.325  52.911  1.00 95.22  ? 233 GLU A CG    1 
ATOM   1909  C  CD    . GLU A  1  235 ? -7.594  33.548  53.687  1.00 106.60 ? 233 GLU A CD    1 
ATOM   1910  O  OE1   . GLU A  1  235 ? -7.087  33.762  54.808  1.00 106.70 ? 233 GLU A OE1   1 
ATOM   1911  O  OE2   . GLU A  1  235 ? -8.453  34.296  53.175  1.00 112.53 ? 233 GLU A OE2   1 
ATOM   1912  N  N     . LEU A  1  236 ? -3.283  29.466  53.082  1.00 74.05  ? 234 LEU A N     1 
ATOM   1913  C  CA    . LEU A  1  236 ? -2.206  28.707  53.702  1.00 67.75  ? 234 LEU A CA    1 
ATOM   1914  C  C     . LEU A  1  236 ? -1.163  29.661  54.267  1.00 75.57  ? 234 LEU A C     1 
ATOM   1915  O  O     . LEU A  1  236 ? -0.611  30.491  53.538  1.00 86.23  ? 234 LEU A O     1 
ATOM   1916  C  CB    . LEU A  1  236 ? -1.564  27.750  52.696  1.00 64.97  ? 234 LEU A CB    1 
ATOM   1917  C  CG    . LEU A  1  236 ? -2.476  26.711  52.039  1.00 74.07  ? 234 LEU A CG    1 
ATOM   1918  C  CD1   . LEU A  1  236 ? -1.659  25.678  51.273  1.00 67.75  ? 234 LEU A CD1   1 
ATOM   1919  C  CD2   . LEU A  1  236 ? -3.370  26.039  53.069  1.00 73.71  ? 234 LEU A CD2   1 
ATOM   1920  N  N     . HIS A  1  237 ? -0.897  29.532  55.556  1.00 74.42  ? 235 HIS A N     1 
ATOM   1921  C  CA    . HIS A  1  237 ? 0.103   30.296  56.276  1.00 77.56  ? 235 HIS A CA    1 
ATOM   1922  C  C     . HIS A  1  237 ? 1.222   29.361  56.717  1.00 80.68  ? 235 HIS A C     1 
ATOM   1923  O  O     . HIS A  1  237 ? 1.087   28.135  56.641  1.00 78.07  ? 235 HIS A O     1 
ATOM   1924  C  CB    . HIS A  1  237 ? -0.534  30.991  57.488  1.00 81.18  ? 235 HIS A CB    1 
ATOM   1925  C  CG    . HIS A  1  237 ? -1.586  31.993  57.126  1.00 88.23  ? 235 HIS A CG    1 
ATOM   1926  N  ND1   . HIS A  1  237 ? -2.737  31.653  56.447  1.00 88.81  ? 235 HIS A ND1   1 
ATOM   1927  C  CD2   . HIS A  1  237 ? -1.661  33.327  57.349  1.00 86.65  ? 235 HIS A CD2   1 
ATOM   1928  C  CE1   . HIS A  1  237 ? -3.475  32.734  56.267  1.00 91.08  ? 235 HIS A CE1   1 
ATOM   1929  N  NE2   . HIS A  1  237 ? -2.845  33.763  56.805  1.00 91.27  ? 235 HIS A NE2   1 
ATOM   1930  N  N     . PRO A  1  238 ? 2.360   29.904  57.166  1.00 85.52  ? 236 PRO A N     1 
ATOM   1931  C  CA    . PRO A  1  238 ? 3.481   29.018  57.523  1.00 84.04  ? 236 PRO A CA    1 
ATOM   1932  C  C     . PRO A  1  238 ? 3.144   27.970  58.573  1.00 82.85  ? 236 PRO A C     1 
ATOM   1933  O  O     . PRO A  1  238 ? 3.585   26.821  58.445  1.00 77.03  ? 236 PRO A O     1 
ATOM   1934  C  CB    . PRO A  1  238 ? 4.546   30.003  58.019  1.00 76.87  ? 236 PRO A CB    1 
ATOM   1935  C  CG    . PRO A  1  238 ? 4.281   31.235  57.237  1.00 78.57  ? 236 PRO A CG    1 
ATOM   1936  C  CD    . PRO A  1  238 ? 2.786   31.315  57.093  1.00 78.80  ? 236 PRO A CD    1 
ATOM   1937  N  N     . ASP A  1  239 ? 2.377   28.320  59.607  1.00 87.93  ? 237 ASP A N     1 
ATOM   1938  C  CA    . ASP A  1  239 ? 2.001   27.351  60.628  1.00 87.42  ? 237 ASP A CA    1 
ATOM   1939  C  C     . ASP A  1  239 ? 0.507   27.069  60.740  1.00 82.45  ? 237 ASP A C     1 
ATOM   1940  O  O     . ASP A  1  239 ? 0.121   26.226  61.560  1.00 81.43  ? 237 ASP A O     1 
ATOM   1941  C  CB    . ASP A  1  239 ? 2.528   27.801  61.998  1.00 96.02  ? 237 ASP A CB    1 
ATOM   1942  C  CG    . ASP A  1  239 ? 4.016   27.563  62.154  1.00 106.77 ? 237 ASP A CG    1 
ATOM   1943  O  OD1   . ASP A  1  239 ? 4.559   26.703  61.428  1.00 112.10 ? 237 ASP A OD1   1 
ATOM   1944  O  OD2   . ASP A  1  239 ? 4.642   28.228  63.006  1.00 111.54 ? 237 ASP A OD2   1 
ATOM   1945  N  N     . LYS A  1  240 ? -0.347  27.725  59.957  1.00 77.28  ? 238 LYS A N     1 
ATOM   1946  C  CA    . LYS A  1  240 ? -1.781  27.505  60.092  1.00 69.33  ? 238 LYS A CA    1 
ATOM   1947  C  C     . LYS A  1  240 ? -2.465  27.690  58.744  1.00 73.84  ? 238 LYS A C     1 
ATOM   1948  O  O     . LYS A  1  240 ? -1.875  28.189  57.784  1.00 82.42  ? 238 LYS A O     1 
ATOM   1949  C  CB    . LYS A  1  240 ? -2.399  28.434  61.144  1.00 68.30  ? 238 LYS A CB    1 
ATOM   1950  C  CG    . LYS A  1  240 ? -2.593  29.872  60.692  1.00 80.48  ? 238 LYS A CG    1 
ATOM   1951  C  CD    . LYS A  1  240 ? -3.282  30.687  61.778  1.00 96.03  ? 238 LYS A CD    1 
ATOM   1952  C  CE    . LYS A  1  240 ? -3.664  32.074  61.290  1.00 107.14 ? 238 LYS A CE    1 
ATOM   1953  N  NZ    . LYS A  1  240 ? -4.428  32.827  62.325  1.00 111.12 ? 238 LYS A NZ    1 
ATOM   1954  N  N     . TRP A  1  241 ? -3.725  27.264  58.686  1.00 70.79  ? 239 TRP A N     1 
ATOM   1955  C  CA    . TRP A  1  241 ? -4.541  27.391  57.488  1.00 71.28  ? 239 TRP A CA    1 
ATOM   1956  C  C     . TRP A  1  241 ? -5.980  27.671  57.897  1.00 74.11  ? 239 TRP A C     1 
ATOM   1957  O  O     . TRP A  1  241 ? -6.385  27.411  59.032  1.00 72.72  ? 239 TRP A O     1 
ATOM   1958  C  CB    . TRP A  1  241 ? -4.479  26.124  56.623  1.00 67.62  ? 239 TRP A CB    1 
ATOM   1959  C  CG    . TRP A  1  241 ? -5.137  24.934  57.264  1.00 59.57  ? 239 TRP A CG    1 
ATOM   1960  C  CD1   . TRP A  1  241 ? -4.548  24.010  58.077  1.00 58.31  ? 239 TRP A CD1   1 
ATOM   1961  C  CD2   . TRP A  1  241 ? -6.512  24.545  57.146  1.00 56.55  ? 239 TRP A CD2   1 
ATOM   1962  N  NE1   . TRP A  1  241 ? -5.470  23.070  58.472  1.00 56.74  ? 239 TRP A NE1   1 
ATOM   1963  C  CE2   . TRP A  1  241 ? -6.683  23.377  57.914  1.00 54.95  ? 239 TRP A CE2   1 
ATOM   1964  C  CE3   . TRP A  1  241 ? -7.614  25.071  56.465  1.00 59.18  ? 239 TRP A CE3   1 
ATOM   1965  C  CZ2   . TRP A  1  241 ? -7.911  22.727  58.019  1.00 58.70  ? 239 TRP A CZ2   1 
ATOM   1966  C  CZ3   . TRP A  1  241 ? -8.832  24.426  56.573  1.00 62.24  ? 239 TRP A CZ3   1 
ATOM   1967  C  CH2   . TRP A  1  241 ? -8.971  23.267  57.343  1.00 58.68  ? 239 TRP A CH2   1 
ATOM   1968  N  N     . THR A  1  242 ? -6.755  28.195  56.951  1.00 77.62  ? 240 THR A N     1 
ATOM   1969  C  CA    . THR A  1  242 ? -8.180  28.408  57.168  1.00 82.58  ? 240 THR A CA    1 
ATOM   1970  C  C     . THR A  1  242 ? -8.873  28.451  55.814  1.00 78.55  ? 240 THR A C     1 
ATOM   1971  O  O     . THR A  1  242 ? -8.232  28.575  54.768  1.00 77.90  ? 240 THR A O     1 
ATOM   1972  C  CB    . THR A  1  242 ? -8.448  29.694  57.956  1.00 87.03  ? 240 THR A CB    1 
ATOM   1973  O  OG1   . THR A  1  242 ? -9.829  29.745  58.334  1.00 93.34  ? 240 THR A OG1   1 
ATOM   1974  C  CG2   . THR A  1  242 ? -8.116  30.915  57.110  1.00 73.54  ? 240 THR A CG2   1 
ATOM   1975  N  N     . VAL A  1  243 ? -10.200 28.338  55.850  1.00 77.40  ? 241 VAL A N     1 
ATOM   1976  C  CA    . VAL A  1  243 ? -10.994 28.469  54.636  1.00 80.43  ? 241 VAL A CA    1 
ATOM   1977  C  C     . VAL A  1  243 ? -11.018 29.927  54.199  1.00 81.78  ? 241 VAL A C     1 
ATOM   1978  O  O     . VAL A  1  243 ? -11.018 30.846  55.030  1.00 85.31  ? 241 VAL A O     1 
ATOM   1979  C  CB    . VAL A  1  243 ? -12.416 27.925  54.857  1.00 77.79  ? 241 VAL A CB    1 
ATOM   1980  C  CG1   . VAL A  1  243 ? -12.378 26.419  55.065  1.00 83.70  ? 241 VAL A CG1   1 
ATOM   1981  C  CG2   . VAL A  1  243 ? -13.074 28.613  56.043  1.00 73.08  ? 241 VAL A CG2   1 
ATOM   1982  N  N     . GLN A  1  244 ? -11.014 30.147  52.890  1.00 84.77  ? 242 GLN A N     1 
ATOM   1983  C  CA    . GLN A  1  244 ? -11.227 31.488  52.373  1.00 89.37  ? 242 GLN A CA    1 
ATOM   1984  C  C     . GLN A  1  244 ? -12.614 31.979  52.785  1.00 93.42  ? 242 GLN A C     1 
ATOM   1985  O  O     . GLN A  1  244 ? -13.573 31.197  52.777  1.00 95.45  ? 242 GLN A O     1 
ATOM   1986  C  CB    . GLN A  1  244 ? -11.067 31.505  50.852  1.00 88.30  ? 242 GLN A CB    1 
ATOM   1987  C  CG    . GLN A  1  244 ? -9.628  31.270  50.413  1.00 91.00  ? 242 GLN A CG    1 
ATOM   1988  C  CD    . GLN A  1  244 ? -9.494  30.970  48.935  1.00 92.26  ? 242 GLN A CD    1 
ATOM   1989  O  OE1   . GLN A  1  244 ? -10.410 31.218  48.151  1.00 100.35 ? 242 GLN A OE1   1 
ATOM   1990  N  NE2   . GLN A  1  244 ? -8.346  30.426  48.546  1.00 83.11  ? 242 GLN A NE2   1 
ATOM   1991  N  N     . PRO A  1  245 ? -12.748 33.252  53.167  1.00 91.76  ? 243 PRO A N     1 
ATOM   1992  C  CA    . PRO A  1  245 ? -13.971 33.717  53.841  1.00 90.55  ? 243 PRO A CA    1 
ATOM   1993  C  C     . PRO A  1  245 ? -15.252 33.325  53.115  1.00 90.71  ? 243 PRO A C     1 
ATOM   1994  O  O     . PRO A  1  245 ? -15.344 33.386  51.887  1.00 92.24  ? 243 PRO A O     1 
ATOM   1995  C  CB    . PRO A  1  245 ? -13.793 35.241  53.883  1.00 87.56  ? 243 PRO A CB    1 
ATOM   1996  C  CG    . PRO A  1  245 ? -12.694 35.546  52.905  1.00 85.36  ? 243 PRO A CG    1 
ATOM   1997  C  CD    . PRO A  1  245 ? -11.801 34.352  52.929  1.00 85.94  ? 243 PRO A CD    1 
ATOM   1998  N  N     . ILE A  1  246 ? -16.247 32.916  53.900  1.00 93.70  ? 244 ILE A N     1 
ATOM   1999  C  CA    . ILE A  1  246 ? -17.536 32.453  53.399  1.00 97.28  ? 244 ILE A CA    1 
ATOM   2000  C  C     . ILE A  1  246 ? -18.574 33.520  53.715  1.00 95.85  ? 244 ILE A C     1 
ATOM   2001  O  O     . ILE A  1  246 ? -18.757 33.892  54.881  1.00 90.74  ? 244 ILE A O     1 
ATOM   2002  C  CB    . ILE A  1  246 ? -17.929 31.104  54.020  1.00 92.24  ? 244 ILE A CB    1 
ATOM   2003  C  CG1   . ILE A  1  246 ? -16.713 30.178  54.081  1.00 89.94  ? 244 ILE A CG1   1 
ATOM   2004  C  CG2   . ILE A  1  246 ? -19.055 30.460  53.225  1.00 87.90  ? 244 ILE A CG2   1 
ATOM   2005  C  CD1   . ILE A  1  246 ? -16.943 28.924  54.888  1.00 88.89  ? 244 ILE A CD1   1 
ATOM   2006  N  N     . VAL A  1  247 ? -19.255 34.008  52.683  1.00 97.06  ? 245 VAL A N     1 
ATOM   2007  C  CA    . VAL A  1  247 ? -20.353 34.956  52.833  1.00 100.38 ? 245 VAL A CA    1 
ATOM   2008  C  C     . VAL A  1  247 ? -21.669 34.188  52.825  1.00 111.67 ? 245 VAL A C     1 
ATOM   2009  O  O     . VAL A  1  247 ? -21.968 33.461  51.870  1.00 110.59 ? 245 VAL A O     1 
ATOM   2010  C  CB    . VAL A  1  247 ? -20.330 36.019  51.724  1.00 94.72  ? 245 VAL A CB    1 
ATOM   2011  C  CG1   . VAL A  1  247 ? -21.357 37.103  52.008  1.00 96.40  ? 245 VAL A CG1   1 
ATOM   2012  C  CG2   . VAL A  1  247 ? -18.935 36.613  51.590  1.00 89.86  ? 245 VAL A CG2   1 
ATOM   2013  N  N     . LEU A  1  248 ? -22.459 34.351  53.889  1.00 117.55 ? 246 LEU A N     1 
ATOM   2014  C  CA    . LEU A  1  248 ? -23.779 33.740  53.977  1.00 118.02 ? 246 LEU A CA    1 
ATOM   2015  C  C     . LEU A  1  248 ? -24.835 34.758  53.584  1.00 130.39 ? 246 LEU A C     1 
ATOM   2016  O  O     . LEU A  1  248 ? -24.868 35.851  54.173  1.00 132.78 ? 246 LEU A O     1 
ATOM   2017  C  CB    . LEU A  1  248 ? -24.047 33.225  55.387  1.00 108.04 ? 246 LEU A CB    1 
ATOM   2018  C  CG    . LEU A  1  248 ? -23.286 31.980  55.842  1.00 102.61 ? 246 LEU A CG    1 
ATOM   2019  C  CD1   . LEU A  1  248 ? -23.796 31.526  57.201  1.00 97.57  ? 246 LEU A CD1   1 
ATOM   2020  C  CD2   . LEU A  1  248 ? -23.413 30.862  54.818  1.00 103.56 ? 246 LEU A CD2   1 
ATOM   2021  N  N     . PRO A  1  249 ? -25.670 34.474  52.580  1.00 135.98 ? 247 PRO A N     1 
ATOM   2022  C  CA    . PRO A  1  249 ? -26.715 35.427  52.178  1.00 137.80 ? 247 PRO A CA    1 
ATOM   2023  C  C     . PRO A  1  249 ? -27.496 35.979  53.364  1.00 134.25 ? 247 PRO A C     1 
ATOM   2024  O  O     . PRO A  1  249 ? -27.740 35.286  54.355  1.00 126.13 ? 247 PRO A O     1 
ATOM   2025  C  CB    . PRO A  1  249 ? -27.612 34.594  51.256  1.00 140.82 ? 247 PRO A CB    1 
ATOM   2026  C  CG    . PRO A  1  249 ? -26.697 33.560  50.692  1.00 138.31 ? 247 PRO A CG    1 
ATOM   2027  C  CD    . PRO A  1  249 ? -25.717 33.232  51.788  1.00 134.28 ? 247 PRO A CD    1 
ATOM   2028  N  N     . GLU A  1  250 ? -27.898 37.243  53.243  1.00 140.51 ? 248 GLU A N     1 
ATOM   2029  C  CA    . GLU A  1  250 ? -28.573 37.973  54.307  1.00 145.54 ? 248 GLU A CA    1 
ATOM   2030  C  C     . GLU A  1  250 ? -30.086 38.034  54.138  1.00 146.92 ? 248 GLU A C     1 
ATOM   2031  O  O     . GLU A  1  250 ? -30.748 38.707  54.934  1.00 151.53 ? 248 GLU A O     1 
ATOM   2032  C  CB    . GLU A  1  250 ? -28.011 39.395  54.409  1.00 149.59 ? 248 GLU A CB    1 
ATOM   2033  C  CG    . GLU A  1  250 ? -26.603 39.459  54.977  1.00 151.55 ? 248 GLU A CG    1 
ATOM   2034  C  CD    . GLU A  1  250 ? -26.534 38.997  56.421  1.00 152.42 ? 248 GLU A CD    1 
ATOM   2035  O  OE1   . GLU A  1  250 ? -27.553 39.111  57.135  1.00 152.35 ? 248 GLU A OE1   1 
ATOM   2036  O  OE2   . GLU A  1  250 ? -25.462 38.516  56.842  1.00 151.29 ? 248 GLU A OE2   1 
ATOM   2037  N  N     . LYS A  1  251 ? -30.634 37.373  53.113  1.00 141.39 ? 249 LYS A N     1 
ATOM   2038  C  CA    . LYS A  1  251 ? -32.001 37.615  52.657  1.00 138.92 ? 249 LYS A CA    1 
ATOM   2039  C  C     . LYS A  1  251 ? -32.992 37.658  53.814  1.00 142.89 ? 249 LYS A C     1 
ATOM   2040  O  O     . LYS A  1  251 ? -32.919 36.856  54.749  1.00 143.44 ? 249 LYS A O     1 
ATOM   2041  C  CB    . LYS A  1  251 ? -32.424 36.524  51.670  1.00 131.51 ? 249 LYS A CB    1 
ATOM   2042  C  CG    . LYS A  1  251 ? -31.616 36.472  50.386  1.00 130.93 ? 249 LYS A CG    1 
ATOM   2043  C  CD    . LYS A  1  251 ? -31.951 37.636  49.471  1.00 137.18 ? 249 LYS A CD    1 
ATOM   2044  C  CE    . LYS A  1  251 ? -31.337 37.441  48.094  1.00 139.31 ? 249 LYS A CE    1 
ATOM   2045  N  NZ    . LYS A  1  251 ? -29.860 37.273  48.163  1.00 138.43 ? 249 LYS A NZ    1 
ATOM   2046  N  N     . ASP A  1  252 ? -33.929 38.607  53.740  1.00 146.67 ? 250 ASP A N     1 
ATOM   2047  C  CA    . ASP A  1  252 ? -35.014 38.664  54.712  1.00 149.71 ? 250 ASP A CA    1 
ATOM   2048  C  C     . ASP A  1  252 ? -36.107 37.650  54.399  1.00 153.55 ? 250 ASP A C     1 
ATOM   2049  O  O     . ASP A  1  252 ? -36.780 37.168  55.317  1.00 155.77 ? 250 ASP A O     1 
ATOM   2050  C  CB    . ASP A  1  252 ? -35.602 40.075  54.771  1.00 150.66 ? 250 ASP A CB    1 
ATOM   2051  C  CG    . ASP A  1  252 ? -36.223 40.504  53.458  1.00 151.54 ? 250 ASP A CG    1 
ATOM   2052  O  OD1   . ASP A  1  252 ? -37.309 41.119  53.489  1.00 152.75 ? 250 ASP A OD1   1 
ATOM   2053  O  OD2   . ASP A  1  252 ? -35.625 40.229  52.396  1.00 151.05 ? 250 ASP A OD2   1 
ATOM   2054  N  N     . SER A  1  253 ? -36.293 37.315  53.124  1.00 151.49 ? 251 SER A N     1 
ATOM   2055  C  CA    . SER A  1  253 ? -37.269 36.321  52.695  1.00 146.05 ? 251 SER A CA    1 
ATOM   2056  C  C     . SER A  1  253 ? -36.529 35.246  51.915  1.00 146.65 ? 251 SER A C     1 
ATOM   2057  O  O     . SER A  1  253 ? -35.835 35.549  50.939  1.00 146.66 ? 251 SER A O     1 
ATOM   2058  C  CB    . SER A  1  253 ? -38.368 36.957  51.840  1.00 138.19 ? 251 SER A CB    1 
ATOM   2059  O  OG    . SER A  1  253 ? -39.307 35.987  51.410  1.00 132.10 ? 251 SER A OG    1 
ATOM   2060  N  N     . TRP A  1  254 ? -36.677 33.998  52.346  1.00 143.31 ? 252 TRP A N     1 
ATOM   2061  C  CA    . TRP A  1  254 ? -35.918 32.880  51.802  1.00 137.72 ? 252 TRP A CA    1 
ATOM   2062  C  C     . TRP A  1  254 ? -36.765 32.074  50.829  1.00 133.65 ? 252 TRP A C     1 
ATOM   2063  O  O     . TRP A  1  254 ? -37.901 31.704  51.143  1.00 131.54 ? 252 TRP A O     1 
ATOM   2064  C  CB    . TRP A  1  254 ? -35.405 31.991  52.934  1.00 136.00 ? 252 TRP A CB    1 
ATOM   2065  C  CG    . TRP A  1  254 ? -34.609 32.759  53.939  1.00 135.58 ? 252 TRP A CG    1 
ATOM   2066  C  CD1   . TRP A  1  254 ? -35.093 33.473  54.995  1.00 137.14 ? 252 TRP A CD1   1 
ATOM   2067  C  CD2   . TRP A  1  254 ? -33.185 32.910  53.971  1.00 132.44 ? 252 TRP A CD2   1 
ATOM   2068  N  NE1   . TRP A  1  254 ? -34.059 34.052  55.690  1.00 135.56 ? 252 TRP A NE1   1 
ATOM   2069  C  CE2   . TRP A  1  254 ? -32.877 33.721  55.081  1.00 131.99 ? 252 TRP A CE2   1 
ATOM   2070  C  CE3   . TRP A  1  254 ? -32.142 32.435  53.172  1.00 129.47 ? 252 TRP A CE3   1 
ATOM   2071  C  CZ2   . TRP A  1  254 ? -31.569 34.066  55.413  1.00 128.78 ? 252 TRP A CZ2   1 
ATOM   2072  C  CZ3   . TRP A  1  254 ? -30.844 32.779  53.503  1.00 128.79 ? 252 TRP A CZ3   1 
ATOM   2073  C  CH2   . TRP A  1  254 ? -30.569 33.587  54.613  1.00 128.84 ? 252 TRP A CH2   1 
ATOM   2074  N  N     . THR A  1  255 ? -36.206 31.801  49.654  1.00 132.21 ? 253 THR A N     1 
ATOM   2075  C  CA    . THR A  1  255 ? -36.798 30.871  48.706  1.00 131.84 ? 253 THR A CA    1 
ATOM   2076  C  C     . THR A  1  255 ? -36.301 29.458  49.013  1.00 131.46 ? 253 THR A C     1 
ATOM   2077  O  O     . THR A  1  255 ? -35.667 29.209  50.042  1.00 130.17 ? 253 THR A O     1 
ATOM   2078  C  CB    . THR A  1  255 ? -36.469 31.287  47.273  1.00 130.03 ? 253 THR A CB    1 
ATOM   2079  O  OG1   . THR A  1  255 ? -35.134 30.877  46.950  1.00 125.36 ? 253 THR A OG1   1 
ATOM   2080  C  CG2   . THR A  1  255 ? -36.575 32.797  47.122  1.00 131.50 ? 253 THR A CG2   1 
ATOM   2081  N  N     . VAL A  1  256 ? -36.583 28.513  48.117  1.00 132.27 ? 254 VAL A N     1 
ATOM   2082  C  CA    . VAL A  1  256 ? -36.027 27.170  48.256  1.00 128.41 ? 254 VAL A CA    1 
ATOM   2083  C  C     . VAL A  1  256 ? -34.561 27.151  47.843  1.00 126.08 ? 254 VAL A C     1 
ATOM   2084  O  O     . VAL A  1  256 ? -33.705 26.635  48.571  1.00 127.40 ? 254 VAL A O     1 
ATOM   2085  C  CB    . VAL A  1  256 ? -36.860 26.159  47.445  1.00 127.39 ? 254 VAL A CB    1 
ATOM   2086  C  CG1   . VAL A  1  256 ? -36.091 24.859  47.265  1.00 117.58 ? 254 VAL A CG1   1 
ATOM   2087  C  CG2   . VAL A  1  256 ? -38.187 25.897  48.135  1.00 131.27 ? 254 VAL A CG2   1 
ATOM   2088  N  N     . ASN A  1  257 ? -34.254 27.698  46.661  1.00 123.94 ? 255 ASN A N     1 
ATOM   2089  C  CA    . ASN A  1  257 ? -32.865 27.813  46.221  1.00 120.69 ? 255 ASN A CA    1 
ATOM   2090  C  C     . ASN A  1  257 ? -31.998 28.525  47.252  1.00 118.39 ? 255 ASN A C     1 
ATOM   2091  O  O     . ASN A  1  257 ? -30.808 28.216  47.383  1.00 115.02 ? 255 ASN A O     1 
ATOM   2092  C  CB    . ASN A  1  257 ? -32.801 28.546  44.880  1.00 121.45 ? 255 ASN A CB    1 
ATOM   2093  C  CG    . ASN A  1  257 ? -31.435 28.451  44.228  1.00 118.41 ? 255 ASN A CG    1 
ATOM   2094  O  OD1   . ASN A  1  257 ? -31.142 27.492  43.514  1.00 115.78 ? 255 ASN A OD1   1 
ATOM   2095  N  ND2   . ASN A  1  257 ? -30.591 29.448  44.468  1.00 117.90 ? 255 ASN A ND2   1 
ATOM   2096  N  N     . ASP A  1  258 ? -32.570 29.493  47.973  1.00 119.14 ? 256 ASP A N     1 
ATOM   2097  C  CA    . ASP A  1  258 ? -31.833 30.191  49.022  1.00 117.30 ? 256 ASP A CA    1 
ATOM   2098  C  C     . ASP A  1  258 ? -31.278 29.215  50.053  1.00 110.97 ? 256 ASP A C     1 
ATOM   2099  O  O     . ASP A  1  258 ? -30.081 29.232  50.361  1.00 109.20 ? 256 ASP A O     1 
ATOM   2100  C  CB    . ASP A  1  258 ? -32.733 31.230  49.690  1.00 125.31 ? 256 ASP A CB    1 
ATOM   2101  C  CG    . ASP A  1  258 ? -33.105 32.364  48.757  1.00 127.57 ? 256 ASP A CG    1 
ATOM   2102  O  OD1   . ASP A  1  258 ? -33.371 33.480  49.251  1.00 126.63 ? 256 ASP A OD1   1 
ATOM   2103  O  OD2   . ASP A  1  258 ? -33.128 32.141  47.528  1.00 126.66 ? 256 ASP A OD2   1 
ATOM   2104  N  N     . ILE A  1  259 ? -32.143 28.361  50.605  1.00 106.70 ? 257 ILE A N     1 
ATOM   2105  C  CA    . ILE A  1  259 ? -31.730 27.464  51.682  1.00 107.33 ? 257 ILE A CA    1 
ATOM   2106  C  C     . ILE A  1  259 ? -30.679 26.476  51.191  1.00 109.16 ? 257 ILE A C     1 
ATOM   2107  O  O     . ILE A  1  259 ? -29.746 26.126  51.924  1.00 102.50 ? 257 ILE A O     1 
ATOM   2108  C  CB    . ILE A  1  259 ? -32.958 26.742  52.270  1.00 107.72 ? 257 ILE A CB    1 
ATOM   2109  C  CG1   . ILE A  1  259 ? -33.922 27.747  52.905  1.00 113.93 ? 257 ILE A CG1   1 
ATOM   2110  C  CG2   . ILE A  1  259 ? -32.533 25.699  53.293  1.00 100.00 ? 257 ILE A CG2   1 
ATOM   2111  C  CD1   . ILE A  1  259 ? -33.389 28.398  54.162  1.00 116.14 ? 257 ILE A CD1   1 
ATOM   2112  N  N     . CYS A  1  260 ? -30.800 26.023  49.939  1.00 116.25 ? 258 CYS A N     1 
ATOM   2113  C  CA    . CYS A  1  260 ? -29.842 25.059  49.402  1.00 114.30 ? 258 CYS A CA    1 
ATOM   2114  C  C     . CYS A  1  260 ? -28.429 25.629  49.393  1.00 107.96 ? 258 CYS A C     1 
ATOM   2115  O  O     . CYS A  1  260 ? -27.494 25.009  49.914  1.00 105.99 ? 258 CYS A O     1 
ATOM   2116  C  CB    . CYS A  1  260 ? -30.260 24.629  47.995  1.00 123.38 ? 258 CYS A CB    1 
ATOM   2117  S  SG    . CYS A  1  260 ? -31.734 23.585  47.937  1.00 132.47 ? 258 CYS A SG    1 
ATOM   2118  N  N     . LYS A  1  261 ? -28.253 26.805  48.785  1.00 106.20 ? 259 LYS A N     1 
ATOM   2119  C  CA    . LYS A  1  261 ? -26.969 27.498  48.831  1.00 105.40 ? 259 LYS A CA    1 
ATOM   2120  C  C     . LYS A  1  261 ? -26.483 27.657  50.269  1.00 106.90 ? 259 LYS A C     1 
ATOM   2121  O  O     . LYS A  1  261 ? -25.343 27.305  50.596  1.00 113.58 ? 259 LYS A O     1 
ATOM   2122  C  CB    . LYS A  1  261 ? -27.100 28.856  48.139  1.00 106.46 ? 259 LYS A CB    1 
ATOM   2123  C  CG    . LYS A  1  261 ? -25.807 29.636  47.984  1.00 108.84 ? 259 LYS A CG    1 
ATOM   2124  C  CD    . LYS A  1  261 ? -26.021 30.830  47.061  1.00 115.01 ? 259 LYS A CD    1 
ATOM   2125  C  CE    . LYS A  1  261 ? -24.911 31.859  47.194  1.00 117.15 ? 259 LYS A CE    1 
ATOM   2126  N  NZ    . LYS A  1  261 ? -23.581 31.319  46.802  1.00 117.09 ? 259 LYS A NZ    1 
ATOM   2127  N  N     . LEU A  1  262 ? -27.332 28.225  51.129  1.00 98.92  ? 260 LEU A N     1 
ATOM   2128  C  CA    . LEU A  1  262 ? -27.038 28.351  52.554  1.00 93.07  ? 260 LEU A CA    1 
ATOM   2129  C  C     . LEU A  1  262 ? -26.533 27.037  53.146  1.00 90.13  ? 260 LEU A C     1 
ATOM   2130  O  O     . LEU A  1  262 ? -25.430 26.969  53.701  1.00 84.37  ? 260 LEU A O     1 
ATOM   2131  C  CB    . LEU A  1  262 ? -28.284 28.836  53.298  1.00 89.89  ? 260 LEU A CB    1 
ATOM   2132  C  CG    . LEU A  1  262 ? -28.162 28.978  54.817  1.00 88.37  ? 260 LEU A CG    1 
ATOM   2133  C  CD1   . LEU A  1  262 ? -27.010 29.902  55.178  1.00 83.78  ? 260 LEU A CD1   1 
ATOM   2134  C  CD2   . LEU A  1  262 ? -29.465 29.485  55.415  1.00 97.16  ? 260 LEU A CD2   1 
ATOM   2135  N  N     . VAL A  1  263 ? -27.358 25.988  53.060  1.00 89.55  ? 261 VAL A N     1 
ATOM   2136  C  CA    . VAL A  1  263 ? -26.986 24.667  53.570  1.00 85.97  ? 261 VAL A CA    1 
ATOM   2137  C  C     . VAL A  1  263 ? -25.626 24.237  53.034  1.00 88.80  ? 261 VAL A C     1 
ATOM   2138  O  O     . VAL A  1  263 ? -24.740 23.827  53.793  1.00 89.46  ? 261 VAL A O     1 
ATOM   2139  C  CB    . VAL A  1  263 ? -28.073 23.634  53.217  1.00 83.71  ? 261 VAL A CB    1 
ATOM   2140  C  CG1   . VAL A  1  263 ? -27.543 22.218  53.400  1.00 73.59  ? 261 VAL A CG1   1 
ATOM   2141  C  CG2   . VAL A  1  263 ? -29.320 23.856  54.059  1.00 85.51  ? 261 VAL A CG2   1 
ATOM   2142  N  N     . GLY A  1  264 ? -25.441 24.322  51.715  1.00 90.49  ? 262 GLY A N     1 
ATOM   2143  C  CA    . GLY A  1  264 ? -24.203 23.850  51.120  1.00 90.19  ? 262 GLY A CA    1 
ATOM   2144  C  C     . GLY A  1  264 ? -22.982 24.640  51.547  1.00 92.46  ? 262 GLY A C     1 
ATOM   2145  O  O     . GLY A  1  264 ? -21.880 24.089  51.632  1.00 90.21  ? 262 GLY A O     1 
ATOM   2146  N  N     . LYS A  1  265 ? -23.153 25.934  51.823  1.00 94.86  ? 263 LYS A N     1 
ATOM   2147  C  CA    . LYS A  1  265 ? -22.063 26.720  52.392  1.00 98.32  ? 263 LYS A CA    1 
ATOM   2148  C  C     . LYS A  1  265 ? -21.739 26.267  53.810  1.00 97.47  ? 263 LYS A C     1 
ATOM   2149  O  O     . LYS A  1  265 ? -20.566 26.112  54.169  1.00 99.19  ? 263 LYS A O     1 
ATOM   2150  C  CB    . LYS A  1  265 ? -22.414 28.208  52.361  1.00 100.08 ? 263 LYS A CB    1 
ATOM   2151  C  CG    . LYS A  1  265 ? -22.139 28.873  51.022  1.00 101.55 ? 263 LYS A CG    1 
ATOM   2152  C  CD    . LYS A  1  265 ? -22.552 30.334  51.027  1.00 112.89 ? 263 LYS A CD    1 
ATOM   2153  C  CE    . LYS A  1  265 ? -22.076 31.043  49.768  1.00 116.43 ? 263 LYS A CE    1 
ATOM   2154  N  NZ    . LYS A  1  265 ? -20.590 31.144  49.713  1.00 114.57 ? 263 LYS A NZ    1 
ATOM   2155  N  N     . LEU A  1  266 ? -22.768 26.061  54.636  1.00 87.51  ? 264 LEU A N     1 
ATOM   2156  C  CA    . LEU A  1  266 ? -22.538 25.677  56.025  1.00 86.02  ? 264 LEU A CA    1 
ATOM   2157  C  C     . LEU A  1  266 ? -21.845 24.324  56.129  1.00 85.23  ? 264 LEU A C     1 
ATOM   2158  O  O     . LEU A  1  266 ? -21.093 24.085  57.081  1.00 88.01  ? 264 LEU A O     1 
ATOM   2159  C  CB    . LEU A  1  266 ? -23.859 25.666  56.794  1.00 85.40  ? 264 LEU A CB    1 
ATOM   2160  C  CG    . LEU A  1  266 ? -24.441 27.043  57.116  1.00 86.38  ? 264 LEU A CG    1 
ATOM   2161  C  CD1   . LEU A  1  266 ? -25.767 26.910  57.843  1.00 84.22  ? 264 LEU A CD1   1 
ATOM   2162  C  CD2   . LEU A  1  266 ? -23.456 27.856  57.943  1.00 85.89  ? 264 LEU A CD2   1 
ATOM   2163  N  N     . ASN A  1  267 ? -22.089 23.425  55.171  1.00 81.76  ? 265 ASN A N     1 
ATOM   2164  C  CA    . ASN A  1  267 ? -21.367 22.157  55.157  1.00 78.72  ? 265 ASN A CA    1 
ATOM   2165  C  C     . ASN A  1  267 ? -19.891 22.376  54.850  1.00 76.00  ? 265 ASN A C     1 
ATOM   2166  O  O     . ASN A  1  267 ? -19.020 21.749  55.466  1.00 75.02  ? 265 ASN A O     1 
ATOM   2167  C  CB    . ASN A  1  267 ? -21.991 21.204  54.135  1.00 78.29  ? 265 ASN A CB    1 
ATOM   2168  C  CG    . ASN A  1  267 ? -23.376 20.726  54.542  1.00 78.07  ? 265 ASN A CG    1 
ATOM   2169  O  OD1   . ASN A  1  267 ? -23.649 20.507  55.720  1.00 75.75  ? 265 ASN A OD1   1 
ATOM   2170  N  ND2   . ASN A  1  267 ? -24.254 20.555  53.560  1.00 75.99  ? 265 ASN A ND2   1 
ATOM   2171  N  N     . TRP A  1  268 ? -19.594 23.251  53.885  1.00 69.68  ? 266 TRP A N     1 
ATOM   2172  C  CA    . TRP A  1  268 ? -18.213 23.644  53.624  1.00 63.66  ? 266 TRP A CA    1 
ATOM   2173  C  C     . TRP A  1  268 ? -17.574 24.276  54.855  1.00 63.19  ? 266 TRP A C     1 
ATOM   2174  O  O     . TRP A  1  268 ? -16.404 24.018  55.158  1.00 71.90  ? 266 TRP A O     1 
ATOM   2175  C  CB    . TRP A  1  268 ? -18.164 24.601  52.433  1.00 68.27  ? 266 TRP A CB    1 
ATOM   2176  C  CG    . TRP A  1  268 ? -16.820 25.213  52.196  1.00 70.37  ? 266 TRP A CG    1 
ATOM   2177  C  CD1   . TRP A  1  268 ? -16.425 26.473  52.533  1.00 68.45  ? 266 TRP A CD1   1 
ATOM   2178  C  CD2   . TRP A  1  268 ? -15.691 24.592  51.569  1.00 70.53  ? 266 TRP A CD2   1 
ATOM   2179  N  NE1   . TRP A  1  268 ? -15.121 26.678  52.155  1.00 71.43  ? 266 TRP A NE1   1 
ATOM   2180  C  CE2   . TRP A  1  268 ? -14.647 25.538  51.560  1.00 74.25  ? 266 TRP A CE2   1 
ATOM   2181  C  CE3   . TRP A  1  268 ? -15.462 23.330  51.013  1.00 65.86  ? 266 TRP A CE3   1 
ATOM   2182  C  CZ2   . TRP A  1  268 ? -13.393 25.262  51.019  1.00 73.77  ? 266 TRP A CZ2   1 
ATOM   2183  C  CZ3   . TRP A  1  268 ? -14.217 23.057  50.476  1.00 64.47  ? 266 TRP A CZ3   1 
ATOM   2184  C  CH2   . TRP A  1  268 ? -13.199 24.018  50.483  1.00 67.45  ? 266 TRP A CH2   1 
ATOM   2185  N  N     . ALA A  1  269 ? -18.325 25.119  55.568  1.00 61.49  ? 267 ALA A N     1 
ATOM   2186  C  CA    . ALA A  1  269 ? -17.785 25.784  56.750  1.00 66.42  ? 267 ALA A CA    1 
ATOM   2187  C  C     . ALA A  1  269 ? -17.447 24.798  57.863  1.00 67.43  ? 267 ALA A C     1 
ATOM   2188  O  O     . ALA A  1  269 ? -16.481 25.014  58.605  1.00 65.27  ? 267 ALA A O     1 
ATOM   2189  C  CB    . ALA A  1  269 ? -18.775 26.833  57.257  1.00 64.93  ? 267 ALA A CB    1 
ATOM   2190  N  N     . SER A  1  270 ? -18.219 23.717  57.998  1.00 68.03  ? 268 SER A N     1 
ATOM   2191  C  CA    . SER A  1  270 ? -18.085 22.833  59.153  1.00 62.66  ? 268 SER A CA    1 
ATOM   2192  C  C     . SER A  1  270 ? -16.797 22.019  59.155  1.00 64.52  ? 268 SER A C     1 
ATOM   2193  O  O     . SER A  1  270 ? -16.566 21.278  60.119  1.00 66.37  ? 268 SER A O     1 
ATOM   2194  C  CB    . SER A  1  270 ? -19.285 21.886  59.225  1.00 58.75  ? 268 SER A CB    1 
ATOM   2195  O  OG    . SER A  1  270 ? -19.247 20.921  58.187  1.00 64.59  ? 268 SER A OG    1 
ATOM   2196  N  N     . GLN A  1  271 ? -15.952 22.131  58.126  1.00 63.79  ? 269 GLN A N     1 
ATOM   2197  C  CA    . GLN A  1  271 ? -14.685 21.410  58.139  1.00 55.59  ? 269 GLN A CA    1 
ATOM   2198  C  C     . GLN A  1  271 ? -13.675 22.035  59.091  1.00 59.68  ? 269 GLN A C     1 
ATOM   2199  O  O     . GLN A  1  271 ? -12.691 21.379  59.448  1.00 64.07  ? 269 GLN A O     1 
ATOM   2200  C  CB    . GLN A  1  271 ? -14.096 21.338  56.728  1.00 53.46  ? 269 GLN A CB    1 
ATOM   2201  C  CG    . GLN A  1  271 ? -13.732 22.688  56.125  1.00 63.84  ? 269 GLN A CG    1 
ATOM   2202  C  CD    . GLN A  1  271 ? -13.169 22.573  54.719  1.00 67.31  ? 269 GLN A CD    1 
ATOM   2203  O  OE1   . GLN A  1  271 ? -12.249 21.796  54.466  1.00 64.03  ? 269 GLN A OE1   1 
ATOM   2204  N  NE2   . GLN A  1  271 ? -13.725 23.348  53.795  1.00 71.22  ? 269 GLN A NE2   1 
ATOM   2205  N  N     . ILE A  1  272 ? -13.892 23.281  59.509  1.00 61.68  ? 270 ILE A N     1 
ATOM   2206  C  CA    . ILE A  1  272 ? -12.983 23.929  60.446  1.00 68.15  ? 270 ILE A CA    1 
ATOM   2207  C  C     . ILE A  1  272 ? -13.773 24.562  61.589  1.00 72.72  ? 270 ILE A C     1 
ATOM   2208  O  O     . ILE A  1  272 ? -13.430 24.378  62.761  1.00 71.03  ? 270 ILE A O     1 
ATOM   2209  C  CB    . ILE A  1  272 ? -12.066 24.946  59.733  1.00 66.51  ? 270 ILE A CB    1 
ATOM   2210  C  CG1   . ILE A  1  272 ? -11.007 25.473  60.702  1.00 69.27  ? 270 ILE A CG1   1 
ATOM   2211  C  CG2   . ILE A  1  272 ? -12.854 26.083  59.079  1.00 70.08  ? 270 ILE A CG2   1 
ATOM   2212  C  CD1   . ILE A  1  272 ? -10.162 24.380  61.325  1.00 69.00  ? 270 ILE A CD1   1 
ATOM   2213  N  N     . TYR A  1  273 ? -14.830 25.297  61.265  1.00 75.78  ? 271 TYR A N     1 
ATOM   2214  C  CA    . TYR A  1  273 ? -15.712 25.886  62.271  1.00 78.98  ? 271 TYR A CA    1 
ATOM   2215  C  C     . TYR A  1  273 ? -16.446 24.816  63.071  1.00 80.75  ? 271 TYR A C     1 
ATOM   2216  O  O     . TYR A  1  273 ? -17.314 24.131  62.514  1.00 79.46  ? 271 TYR A O     1 
ATOM   2217  C  CB    . TYR A  1  273 ? -16.709 26.826  61.598  1.00 78.56  ? 271 TYR A CB    1 
ATOM   2218  C  CG    . TYR A  1  273 ? -16.098 28.134  61.148  1.00 80.18  ? 271 TYR A CG    1 
ATOM   2219  C  CD1   . TYR A  1  273 ? -15.965 29.197  62.030  1.00 76.34  ? 271 TYR A CD1   1 
ATOM   2220  C  CD2   . TYR A  1  273 ? -15.655 28.306  59.842  1.00 84.16  ? 271 TYR A CD2   1 
ATOM   2221  C  CE1   . TYR A  1  273 ? -15.407 30.394  61.627  1.00 79.90  ? 271 TYR A CE1   1 
ATOM   2222  C  CE2   . TYR A  1  273 ? -15.097 29.500  59.430  1.00 86.61  ? 271 TYR A CE2   1 
ATOM   2223  C  CZ    . TYR A  1  273 ? -14.975 30.541  60.326  1.00 88.65  ? 271 TYR A CZ    1 
ATOM   2224  O  OH    . TYR A  1  273 ? -14.419 31.731  59.918  1.00 101.44 ? 271 TYR A OH    1 
ATOM   2225  N  N     . PRO A  1  274 ? -16.137 24.633  64.353  1.00 76.84  ? 272 PRO A N     1 
ATOM   2226  C  CA    . PRO A  1  274 ? -16.810 23.596  65.143  1.00 71.42  ? 272 PRO A CA    1 
ATOM   2227  C  C     . PRO A  1  274 ? -18.282 23.894  65.390  1.00 71.06  ? 272 PRO A C     1 
ATOM   2228  O  O     . PRO A  1  274 ? -18.697 25.047  65.538  1.00 74.26  ? 272 PRO A O     1 
ATOM   2229  C  CB    . PRO A  1  274 ? -16.026 23.586  66.463  1.00 73.50  ? 272 PRO A CB    1 
ATOM   2230  C  CG    . PRO A  1  274 ? -14.779 24.383  66.201  1.00 73.05  ? 272 PRO A CG    1 
ATOM   2231  C  CD    . PRO A  1  274 ? -15.160 25.381  65.159  1.00 75.78  ? 272 PRO A CD    1 
ATOM   2232  N  N     . GLY A  1  275 ? -19.074 22.823  65.431  1.00 69.48  ? 273 GLY A N     1 
ATOM   2233  C  CA    . GLY A  1  275 ? -20.448 22.905  65.892  1.00 74.32  ? 273 GLY A CA    1 
ATOM   2234  C  C     . GLY A  1  275 ? -21.482 23.432  64.925  1.00 75.28  ? 273 GLY A C     1 
ATOM   2235  O  O     . GLY A  1  275 ? -22.558 23.847  65.367  1.00 83.01  ? 273 GLY A O     1 
ATOM   2236  N  N     . ILE A  1  276 ? -21.200 23.448  63.622  1.00 78.07  ? 274 ILE A N     1 
ATOM   2237  C  CA    . ILE A  1  276 ? -22.215 23.863  62.662  1.00 85.77  ? 274 ILE A CA    1 
ATOM   2238  C  C     . ILE A  1  276 ? -23.343 22.838  62.638  1.00 87.67  ? 274 ILE A C     1 
ATOM   2239  O  O     . ILE A  1  276 ? -23.105 21.621  62.651  1.00 81.58  ? 274 ILE A O     1 
ATOM   2240  C  CB    . ILE A  1  276 ? -21.589 24.059  61.268  1.00 92.76  ? 274 ILE A CB    1 
ATOM   2241  C  CG1   . ILE A  1  276 ? -21.244 25.533  61.036  1.00 94.89  ? 274 ILE A CG1   1 
ATOM   2242  C  CG2   . ILE A  1  276 ? -22.518 23.560  60.168  1.00 94.07  ? 274 ILE A CG2   1 
ATOM   2243  C  CD1   . ILE A  1  276 ? -20.264 26.109  62.032  1.00 95.32  ? 274 ILE A CD1   1 
ATOM   2244  N  N     . LYS A  1  277 ? -24.583 23.327  62.606  1.00 93.37  ? 275 LYS A N     1 
ATOM   2245  C  CA    . LYS A  1  277 ? -25.770 22.479  62.612  1.00 90.84  ? 275 LYS A CA    1 
ATOM   2246  C  C     . LYS A  1  277 ? -26.671 22.889  61.456  1.00 89.52  ? 275 LYS A C     1 
ATOM   2247  O  O     . LYS A  1  277 ? -27.075 24.053  61.366  1.00 91.38  ? 275 LYS A O     1 
ATOM   2248  C  CB    . LYS A  1  277 ? -26.514 22.581  63.947  1.00 80.62  ? 275 LYS A CB    1 
ATOM   2249  C  CG    . LYS A  1  277 ? -25.769 21.943  65.109  1.00 72.45  ? 275 LYS A CG    1 
ATOM   2250  C  CD    . LYS A  1  277 ? -26.530 22.081  66.418  1.00 73.10  ? 275 LYS A CD    1 
ATOM   2251  C  CE    . LYS A  1  277 ? -26.529 23.518  66.912  1.00 79.63  ? 275 LYS A CE    1 
ATOM   2252  N  NZ    . LYS A  1  277 ? -27.164 23.638  68.254  1.00 78.74  ? 275 LYS A NZ    1 
ATOM   2253  N  N     . VAL A  1  278 ? -26.976 21.938  60.573  1.00 85.68  ? 276 VAL A N     1 
ATOM   2254  C  CA    . VAL A  1  278 ? -27.853 22.169  59.429  1.00 90.93  ? 276 VAL A CA    1 
ATOM   2255  C  C     . VAL A  1  278 ? -29.190 21.451  59.555  1.00 95.60  ? 276 VAL A C     1 
ATOM   2256  O  O     . VAL A  1  278 ? -30.011 21.535  58.630  1.00 97.16  ? 276 VAL A O     1 
ATOM   2257  C  CB    . VAL A  1  278 ? -27.155 21.783  58.112  1.00 96.25  ? 276 VAL A CB    1 
ATOM   2258  C  CG1   . VAL A  1  278 ? -27.718 22.582  56.956  1.00 104.45 ? 276 VAL A CG1   1 
ATOM   2259  C  CG2   . VAL A  1  278 ? -25.665 22.019  58.223  1.00 101.01 ? 276 VAL A CG2   1 
ATOM   2260  N  N     . ARG A  1  279 ? -29.429 20.735  60.658  1.00 97.05  ? 277 ARG A N     1 
ATOM   2261  C  CA    . ARG A  1  279 ? -30.618 19.892  60.785  1.00 94.28  ? 277 ARG A CA    1 
ATOM   2262  C  C     . ARG A  1  279 ? -31.897 20.668  60.481  1.00 96.97  ? 277 ARG A C     1 
ATOM   2263  O  O     . ARG A  1  279 ? -32.680 20.286  59.604  1.00 97.53  ? 277 ARG A O     1 
ATOM   2264  C  CB    . ARG A  1  279 ? -30.677 19.282  62.188  1.00 91.72  ? 277 ARG A CB    1 
ATOM   2265  C  CG    . ARG A  1  279 ? -32.056 18.785  62.602  1.00 92.25  ? 277 ARG A CG    1 
ATOM   2266  C  CD    . ARG A  1  279 ? -32.455 17.503  61.885  1.00 95.19  ? 277 ARG A CD    1 
ATOM   2267  N  NE    . ARG A  1  279 ? -31.760 16.335  62.419  1.00 97.34  ? 277 ARG A NE    1 
ATOM   2268  C  CZ    . ARG A  1  279 ? -30.797 15.679  61.780  1.00 96.72  ? 277 ARG A CZ    1 
ATOM   2269  N  NH1   . ARG A  1  279 ? -30.416 16.067  60.571  1.00 98.08  ? 277 ARG A NH1   1 
ATOM   2270  N  NH2   . ARG A  1  279 ? -30.222 14.627  62.347  1.00 89.91  ? 277 ARG A NH2   1 
ATOM   2271  N  N     . GLN A  1  280 ? -32.125 21.767  61.202  1.00 97.19  ? 278 GLN A N     1 
ATOM   2272  C  CA    . GLN A  1  280 ? -33.399 22.470  61.086  1.00 95.05  ? 278 GLN A CA    1 
ATOM   2273  C  C     . GLN A  1  280 ? -33.495 23.259  59.787  1.00 97.01  ? 278 GLN A C     1 
ATOM   2274  O  O     . GLN A  1  280 ? -34.594 23.424  59.246  1.00 99.89  ? 278 GLN A O     1 
ATOM   2275  C  CB    . GLN A  1  280 ? -33.600 23.392  62.288  1.00 94.49  ? 278 GLN A CB    1 
ATOM   2276  C  CG    . GLN A  1  280 ? -33.754 22.661  63.612  1.00 99.54  ? 278 GLN A CG    1 
ATOM   2277  C  CD    . GLN A  1  280 ? -35.038 21.859  63.690  1.00 108.70 ? 278 GLN A CD    1 
ATOM   2278  O  OE1   . GLN A  1  280 ? -36.001 22.133  62.974  1.00 116.67 ? 278 GLN A OE1   1 
ATOM   2279  N  NE2   . GLN A  1  280 ? -35.059 20.861  64.566  1.00 105.37 ? 278 GLN A NE2   1 
ATOM   2280  N  N     . LEU A  1  281 ? -32.366 23.751  59.270  1.00 97.92  ? 279 LEU A N     1 
ATOM   2281  C  CA    . LEU A  1  281 ? -32.377 24.392  57.959  1.00 95.69  ? 279 LEU A CA    1 
ATOM   2282  C  C     . LEU A  1  281 ? -32.726 23.405  56.852  1.00 99.01  ? 279 LEU A C     1 
ATOM   2283  O  O     . LEU A  1  281 ? -33.365 23.786  55.865  1.00 100.22 ? 279 LEU A O     1 
ATOM   2284  C  CB    . LEU A  1  281 ? -31.025 25.049  57.682  1.00 89.17  ? 279 LEU A CB    1 
ATOM   2285  C  CG    . LEU A  1  281 ? -30.810 26.415  58.336  1.00 86.07  ? 279 LEU A CG    1 
ATOM   2286  C  CD1   . LEU A  1  281 ? -29.342 26.790  58.314  1.00 89.40  ? 279 LEU A CD1   1 
ATOM   2287  C  CD2   . LEU A  1  281 ? -31.643 27.477  57.634  1.00 84.79  ? 279 LEU A CD2   1 
ATOM   2288  N  N     . SER A  1  282 ? -32.322 22.141  56.995  1.00 102.37 ? 280 SER A N     1 
ATOM   2289  C  CA    . SER A  1  282 ? -32.650 21.137  55.989  1.00 104.03 ? 280 SER A CA    1 
ATOM   2290  C  C     . SER A  1  282 ? -34.093 20.664  56.108  1.00 106.69 ? 280 SER A C     1 
ATOM   2291  O  O     . SER A  1  282 ? -34.689 20.257  55.104  1.00 109.61 ? 280 SER A O     1 
ATOM   2292  C  CB    . SER A  1  282 ? -31.695 19.948  56.101  1.00 104.91 ? 280 SER A CB    1 
ATOM   2293  O  OG    . SER A  1  282 ? -30.350 20.359  55.933  1.00 102.76 ? 280 SER A OG    1 
ATOM   2294  N  N     . LYS A  1  283 ? -34.654 20.684  57.322  1.00 107.88 ? 281 LYS A N     1 
ATOM   2295  C  CA    . LYS A  1  283 ? -36.072 20.389  57.512  1.00 108.17 ? 281 LYS A CA    1 
ATOM   2296  C  C     . LYS A  1  283 ? -36.963 21.199  56.579  1.00 103.08 ? 281 LYS A C     1 
ATOM   2297  O  O     . LYS A  1  283 ? -38.059 20.754  56.225  1.00 106.53 ? 281 LYS A O     1 
ATOM   2298  C  CB    . LYS A  1  283 ? -36.475 20.641  58.966  1.00 112.01 ? 281 LYS A CB    1 
ATOM   2299  C  CG    . LYS A  1  283 ? -36.423 19.404  59.847  1.00 111.69 ? 281 LYS A CG    1 
ATOM   2300  C  CD    . LYS A  1  283 ? -37.133 19.643  61.169  1.00 116.61 ? 281 LYS A CD    1 
ATOM   2301  C  CE    . LYS A  1  283 ? -37.246 18.361  61.977  1.00 117.19 ? 281 LYS A CE    1 
ATOM   2302  N  NZ    . LYS A  1  283 ? -37.979 18.575  63.255  1.00 116.51 ? 281 LYS A NZ    1 
ATOM   2303  N  N     . LEU A  1  284 ? -36.531 22.401  56.197  1.00 94.83  ? 282 LEU A N     1 
ATOM   2304  C  CA    . LEU A  1  284 ? -37.345 23.236  55.324  1.00 99.61  ? 282 LEU A CA    1 
ATOM   2305  C  C     . LEU A  1  284 ? -37.372 22.733  53.885  1.00 107.01 ? 282 LEU A C     1 
ATOM   2306  O  O     . LEU A  1  284 ? -38.260 23.129  53.123  1.00 118.34 ? 282 LEU A O     1 
ATOM   2307  C  CB    . LEU A  1  284 ? -36.836 24.678  55.364  1.00 99.38  ? 282 LEU A CB    1 
ATOM   2308  C  CG    . LEU A  1  284 ? -36.580 25.248  56.762  1.00 100.35 ? 282 LEU A CG    1 
ATOM   2309  C  CD1   . LEU A  1  284 ? -36.141 26.701  56.682  1.00 103.06 ? 282 LEU A CD1   1 
ATOM   2310  C  CD2   . LEU A  1  284 ? -37.810 25.104  57.647  1.00 98.95  ? 282 LEU A CD2   1 
ATOM   2311  N  N     . LEU A  1  285 ? -36.433 21.875  53.492  1.00 99.49  ? 283 LEU A N     1 
ATOM   2312  C  CA    . LEU A  1  285 ? -36.298 21.462  52.101  1.00 107.21 ? 283 LEU A CA    1 
ATOM   2313  C  C     . LEU A  1  285 ? -36.995 20.146  51.776  1.00 113.45 ? 283 LEU A C     1 
ATOM   2314  O  O     . LEU A  1  285 ? -36.973 19.725  50.616  1.00 116.28 ? 283 LEU A O     1 
ATOM   2315  C  CB    . LEU A  1  285 ? -34.816 21.354  51.730  1.00 107.29 ? 283 LEU A CB    1 
ATOM   2316  C  CG    . LEU A  1  285 ? -34.042 22.664  51.588  1.00 107.49 ? 283 LEU A CG    1 
ATOM   2317  C  CD1   . LEU A  1  285 ? -32.548 22.391  51.564  1.00 101.45 ? 283 LEU A CD1   1 
ATOM   2318  C  CD2   . LEU A  1  285 ? -34.471 23.400  50.329  1.00 113.90 ? 283 LEU A CD2   1 
ATOM   2319  N  N     . ARG A  1  286 ? -37.612 19.488  52.754  1.00 117.28 ? 284 ARG A N     1 
ATOM   2320  C  CA    . ARG A  1  286 ? -38.113 18.134  52.550  1.00 122.14 ? 284 ARG A CA    1 
ATOM   2321  C  C     . ARG A  1  286 ? -39.470 18.176  51.855  1.00 123.64 ? 284 ARG A C     1 
ATOM   2322  O  O     . ARG A  1  286 ? -40.405 18.825  52.338  1.00 120.37 ? 284 ARG A O     1 
ATOM   2323  C  CB    . ARG A  1  286 ? -38.192 17.376  53.874  1.00 126.52 ? 284 ARG A CB    1 
ATOM   2324  C  CG    . ARG A  1  286 ? -38.912 18.098  54.994  1.00 134.87 ? 284 ARG A CG    1 
ATOM   2325  C  CD    . ARG A  1  286 ? -38.604 17.446  56.332  1.00 137.04 ? 284 ARG A CD    1 
ATOM   2326  N  NE    . ARG A  1  286 ? -37.176 17.170  56.473  1.00 136.39 ? 284 ARG A NE    1 
ATOM   2327  C  CZ    . ARG A  1  286 ? -36.620 16.625  57.550  1.00 135.79 ? 284 ARG A CZ    1 
ATOM   2328  N  NH1   . ARG A  1  286 ? -37.370 16.296  58.593  1.00 134.29 ? 284 ARG A NH1   1 
ATOM   2329  N  NH2   . ARG A  1  286 ? -35.312 16.409  57.585  1.00 132.99 ? 284 ARG A NH2   1 
ATOM   2330  N  N     . GLY A  1  287 ? -39.573 17.489  50.722  1.00 128.66 ? 285 GLY A N     1 
ATOM   2331  C  CA    . GLY A  1  287 ? -40.833 17.374  50.009  1.00 135.66 ? 285 GLY A CA    1 
ATOM   2332  C  C     . GLY A  1  287 ? -41.355 18.661  49.409  1.00 144.25 ? 285 GLY A C     1 
ATOM   2333  O  O     . GLY A  1  287 ? -42.560 18.932  49.489  1.00 150.07 ? 285 GLY A O     1 
ATOM   2334  N  N     . THR A  1  288 ? -40.481 19.462  48.807  1.00 144.58 ? 286 THR A N     1 
ATOM   2335  C  CA    . THR A  1  288 ? -40.875 20.720  48.193  1.00 147.15 ? 286 THR A CA    1 
ATOM   2336  C  C     . THR A  1  288 ? -40.781 20.604  46.676  1.00 142.65 ? 286 THR A C     1 
ATOM   2337  O  O     . THR A  1  288 ? -39.936 19.880  46.141  1.00 137.84 ? 286 THR A O     1 
ATOM   2338  C  CB    . THR A  1  288 ? -39.998 21.875  48.689  1.00 148.73 ? 286 THR A CB    1 
ATOM   2339  O  OG1   . THR A  1  288 ? -39.820 21.765  50.107  1.00 149.17 ? 286 THR A OG1   1 
ATOM   2340  C  CG2   . THR A  1  288 ? -40.649 23.214  48.378  1.00 145.93 ? 286 THR A CG2   1 
ATOM   2341  N  N     . LYS A  1  289 ? -41.661 21.328  45.987  1.00 145.30 ? 287 LYS A N     1 
ATOM   2342  C  CA    . LYS A  1  289 ? -41.802 21.203  44.531  1.00 148.91 ? 287 LYS A CA    1 
ATOM   2343  C  C     . LYS A  1  289 ? -40.810 22.097  43.792  1.00 148.42 ? 287 LYS A C     1 
ATOM   2344  O  O     . LYS A  1  289 ? -39.899 21.606  43.118  1.00 146.21 ? 287 LYS A O     1 
ATOM   2345  C  CB    . LYS A  1  289 ? -43.247 21.511  44.132  1.00 150.94 ? 287 LYS A CB    1 
ATOM   2346  C  CG    . LYS A  1  289 ? -43.896 22.585  44.994  1.00 148.22 ? 287 LYS A CG    1 
ATOM   2347  C  CD    . LYS A  1  289 ? -45.409 22.465  45.015  1.00 147.96 ? 287 LYS A CD    1 
ATOM   2348  C  CE    . LYS A  1  289 ? -46.011 23.419  46.035  1.00 147.23 ? 287 LYS A CE    1 
ATOM   2349  N  NZ    . LYS A  1  289 ? -47.487 23.270  46.145  1.00 149.30 ? 287 LYS A NZ    1 
ATOM   2350  N  N     . ALA A  1  290 ? -40.982 23.411  43.909  1.00 148.24 ? 288 ALA A N     1 
ATOM   2351  C  CA    . ALA A  1  290 ? -40.257 24.370  43.088  1.00 143.78 ? 288 ALA A CA    1 
ATOM   2352  C  C     . ALA A  1  290 ? -38.989 24.838  43.791  1.00 136.28 ? 288 ALA A C     1 
ATOM   2353  O  O     . ALA A  1  290 ? -39.025 25.214  44.967  1.00 136.96 ? 288 ALA A O     1 
ATOM   2354  C  CB    . ALA A  1  290 ? -41.144 25.570  42.753  1.00 145.37 ? 288 ALA A CB    1 
ATOM   2355  N  N     . LEU A  1  291 ? -37.867 24.802  43.066  1.00 129.88 ? 289 LEU A N     1 
ATOM   2356  C  CA    . LEU A  1  291 ? -36.650 25.446  43.550  1.00 125.22 ? 289 LEU A CA    1 
ATOM   2357  C  C     . LEU A  1  291 ? -36.860 26.941  43.760  1.00 126.11 ? 289 LEU A C     1 
ATOM   2358  O  O     . LEU A  1  291 ? -36.171 27.559  44.579  1.00 124.76 ? 289 LEU A O     1 
ATOM   2359  C  CB    . LEU A  1  291 ? -35.508 25.201  42.560  1.00 124.58 ? 289 LEU A CB    1 
ATOM   2360  C  CG    . LEU A  1  291 ? -34.121 25.766  42.872  1.00 122.10 ? 289 LEU A CG    1 
ATOM   2361  C  CD1   . LEU A  1  291 ? -33.439 24.955  43.963  1.00 123.40 ? 289 LEU A CD1   1 
ATOM   2362  C  CD2   . LEU A  1  291 ? -33.266 25.813  41.613  1.00 120.07 ? 289 LEU A CD2   1 
ATOM   2363  N  N     . THR A  1  292 ? -37.808 27.534  43.031  1.00 130.12 ? 290 THR A N     1 
ATOM   2364  C  CA    . THR A  1  292 ? -38.072 28.964  43.132  1.00 130.16 ? 290 THR A CA    1 
ATOM   2365  C  C     . THR A  1  292 ? -38.969 29.299  44.318  1.00 129.51 ? 290 THR A C     1 
ATOM   2366  O  O     . THR A  1  292 ? -38.918 30.424  44.827  1.00 124.88 ? 290 THR A O     1 
ATOM   2367  C  CB    . THR A  1  292 ? -38.714 29.474  41.841  1.00 129.36 ? 290 THR A CB    1 
ATOM   2368  O  OG1   . THR A  1  292 ? -40.055 28.976  41.744  1.00 130.83 ? 290 THR A OG1   1 
ATOM   2369  C  CG2   . THR A  1  292 ? -37.921 28.998  40.632  1.00 126.64 ? 290 THR A CG2   1 
ATOM   2370  N  N     . GLU A  1  293 ? -39.801 28.347  44.743  1.00 134.94 ? 291 GLU A N     1 
ATOM   2371  C  CA    . GLU A  1  293 ? -40.786 28.576  45.795  1.00 137.90 ? 291 GLU A CA    1 
ATOM   2372  C  C     . GLU A  1  293 ? -40.166 29.214  47.033  1.00 136.03 ? 291 GLU A C     1 
ATOM   2373  O  O     . GLU A  1  293 ? -39.048 28.882  47.434  1.00 134.92 ? 291 GLU A O     1 
ATOM   2374  C  CB    . GLU A  1  293 ? -41.452 27.247  46.168  1.00 137.90 ? 291 GLU A CB    1 
ATOM   2375  C  CG    . GLU A  1  293 ? -42.401 27.315  47.353  1.00 140.19 ? 291 GLU A CG    1 
ATOM   2376  C  CD    . GLU A  1  293 ? -43.038 25.975  47.662  1.00 140.84 ? 291 GLU A CD    1 
ATOM   2377  O  OE1   . GLU A  1  293 ? -42.902 25.050  46.834  1.00 141.91 ? 291 GLU A OE1   1 
ATOM   2378  O  OE2   . GLU A  1  293 ? -43.671 25.845  48.730  1.00 140.40 ? 291 GLU A OE2   1 
ATOM   2379  N  N     . VAL A  1  294 ? -40.907 30.146  47.629  1.00 136.57 ? 292 VAL A N     1 
ATOM   2380  C  CA    . VAL A  1  294 ? -40.510 30.825  48.856  1.00 137.30 ? 292 VAL A CA    1 
ATOM   2381  C  C     . VAL A  1  294 ? -40.978 29.989  50.038  1.00 139.08 ? 292 VAL A C     1 
ATOM   2382  O  O     . VAL A  1  294 ? -42.060 29.390  50.001  1.00 141.63 ? 292 VAL A O     1 
ATOM   2383  C  CB    . VAL A  1  294 ? -41.091 32.253  48.901  1.00 137.98 ? 292 VAL A CB    1 
ATOM   2384  C  CG1   . VAL A  1  294 ? -42.600 32.225  48.686  1.00 143.16 ? 292 VAL A CG1   1 
ATOM   2385  C  CG2   . VAL A  1  294 ? -40.745 32.946  50.212  1.00 133.44 ? 292 VAL A CG2   1 
ATOM   2386  N  N     . ILE A  1  295 ? -40.164 29.929  51.088  1.00 137.15 ? 293 ILE A N     1 
ATOM   2387  C  CA    . ILE A  1  295 ? -40.537 29.162  52.273  1.00 136.65 ? 293 ILE A CA    1 
ATOM   2388  C  C     . ILE A  1  295 ? -40.191 29.936  53.541  1.00 134.40 ? 293 ILE A C     1 
ATOM   2389  O  O     . ILE A  1  295 ? -39.099 30.515  53.642  1.00 132.12 ? 293 ILE A O     1 
ATOM   2390  C  CB    . ILE A  1  295 ? -39.870 27.776  52.262  1.00 134.56 ? 293 ILE A CB    1 
ATOM   2391  C  CG1   . ILE A  1  295 ? -40.230 26.997  53.527  1.00 135.51 ? 293 ILE A CG1   1 
ATOM   2392  C  CG2   . ILE A  1  295 ? -38.359 27.900  52.104  1.00 130.01 ? 293 ILE A CG2   1 
ATOM   2393  C  CD1   . ILE A  1  295 ? -40.292 25.508  53.323  1.00 134.53 ? 293 ILE A CD1   1 
ATOM   2394  N  N     . PRO A  1  296 ? -41.091 29.987  54.519  1.00 134.29 ? 294 PRO A N     1 
ATOM   2395  C  CA    . PRO A  1  296 ? -40.797 30.697  55.766  1.00 134.75 ? 294 PRO A CA    1 
ATOM   2396  C  C     . PRO A  1  296 ? -39.993 29.836  56.726  1.00 131.72 ? 294 PRO A C     1 
ATOM   2397  O  O     . PRO A  1  296 ? -40.149 28.614  56.790  1.00 128.44 ? 294 PRO A O     1 
ATOM   2398  C  CB    . PRO A  1  296 ? -42.189 31.000  56.331  1.00 137.22 ? 294 PRO A CB    1 
ATOM   2399  C  CG    . PRO A  1  296 ? -43.033 29.884  55.820  1.00 137.39 ? 294 PRO A CG    1 
ATOM   2400  C  CD    . PRO A  1  296 ? -42.498 29.552  54.450  1.00 134.95 ? 294 PRO A CD    1 
ATOM   2401  N  N     . LEU A  1  297 ? -39.119 30.496  57.480  1.00 133.34 ? 295 LEU A N     1 
ATOM   2402  C  CA    . LEU A  1  297 ? -38.247 29.812  58.425  1.00 129.99 ? 295 LEU A CA    1 
ATOM   2403  C  C     . LEU A  1  297 ? -38.965 29.620  59.753  1.00 125.59 ? 295 LEU A C     1 
ATOM   2404  O  O     . LEU A  1  297 ? -39.485 30.581  60.329  1.00 125.64 ? 295 LEU A O     1 
ATOM   2405  C  CB    . LEU A  1  297 ? -36.959 30.601  58.656  1.00 128.49 ? 295 LEU A CB    1 
ATOM   2406  C  CG    . LEU A  1  297 ? -36.227 31.279  57.500  1.00 126.75 ? 295 LEU A CG    1 
ATOM   2407  C  CD1   . LEU A  1  297 ? -34.966 31.941  58.033  1.00 123.57 ? 295 LEU A CD1   1 
ATOM   2408  C  CD2   . LEU A  1  297 ? -35.894 30.292  56.398  1.00 125.32 ? 295 LEU A CD2   1 
ATOM   2409  N  N     . THR A  1  298 ? -38.993 28.381  60.233  1.00 122.19 ? 296 THR A N     1 
ATOM   2410  C  CA    . THR A  1  298 ? -39.498 28.116  61.569  1.00 128.65 ? 296 THR A CA    1 
ATOM   2411  C  C     . THR A  1  298 ? -38.573 28.745  62.609  1.00 131.86 ? 296 THR A C     1 
ATOM   2412  O  O     . THR A  1  298 ? -37.429 29.107  62.323  1.00 136.78 ? 296 THR A O     1 
ATOM   2413  C  CB    . THR A  1  298 ? -39.625 26.611  61.812  1.00 127.79 ? 296 THR A CB    1 
ATOM   2414  O  OG1   . THR A  1  298 ? -39.896 26.368  63.198  1.00 128.09 ? 296 THR A OG1   1 
ATOM   2415  C  CG2   . THR A  1  298 ? -38.344 25.895  61.413  1.00 122.71 ? 296 THR A CG2   1 
ATOM   2416  N  N     . GLU A  1  299 ? -39.082 28.872  63.835  1.00 130.01 ? 297 GLU A N     1 
ATOM   2417  C  CA    . GLU A  1  299 ? -38.239 29.363  64.918  1.00 128.47 ? 297 GLU A CA    1 
ATOM   2418  C  C     . GLU A  1  299 ? -37.120 28.391  65.270  1.00 122.83 ? 297 GLU A C     1 
ATOM   2419  O  O     . GLU A  1  299 ? -36.223 28.753  66.038  1.00 124.52 ? 297 GLU A O     1 
ATOM   2420  C  CB    . GLU A  1  299 ? -39.092 29.663  66.152  1.00 133.30 ? 297 GLU A CB    1 
ATOM   2421  C  CG    . GLU A  1  299 ? -38.479 30.698  67.082  1.00 137.26 ? 297 GLU A CG    1 
ATOM   2422  C  CD    . GLU A  1  299 ? -39.523 31.534  67.794  1.00 147.91 ? 297 GLU A CD    1 
ATOM   2423  O  OE1   . GLU A  1  299 ? -40.705 31.132  67.805  1.00 151.60 ? 297 GLU A OE1   1 
ATOM   2424  O  OE2   . GLU A  1  299 ? -39.161 32.599  68.336  1.00 150.82 ? 297 GLU A OE2   1 
ATOM   2425  N  N     . GLU A  1  300 ? -37.152 27.175  64.726  1.00 118.54 ? 298 GLU A N     1 
ATOM   2426  C  CA    . GLU A  1  300 ? -36.067 26.221  64.926  1.00 120.95 ? 298 GLU A CA    1 
ATOM   2427  C  C     . GLU A  1  300 ? -34.939 26.486  63.935  1.00 115.89 ? 298 GLU A C     1 
ATOM   2428  O  O     . GLU A  1  300 ? -33.781 26.670  64.325  1.00 112.58 ? 298 GLU A O     1 
ATOM   2429  C  CB    . GLU A  1  300 ? -36.592 24.790  64.784  1.00 127.68 ? 298 GLU A CB    1 
ATOM   2430  C  CG    . GLU A  1  300 ? -38.034 24.602  65.235  1.00 136.60 ? 298 GLU A CG    1 
ATOM   2431  C  CD    . GLU A  1  300 ? -38.251 24.963  66.692  1.00 143.39 ? 298 GLU A CD    1 
ATOM   2432  O  OE1   . GLU A  1  300 ? -37.347 24.705  67.513  1.00 144.53 ? 298 GLU A OE1   1 
ATOM   2433  O  OE2   . GLU A  1  300 ? -39.327 25.510  67.014  1.00 146.75 ? 298 GLU A OE2   1 
ATOM   2434  N  N     . ALA A  1  301 ? -35.268 26.498  62.639  1.00 116.93 ? 299 ALA A N     1 
ATOM   2435  C  CA    . ALA A  1  301 ? -34.291 26.845  61.611  1.00 113.68 ? 299 ALA A CA    1 
ATOM   2436  C  C     . ALA A  1  301 ? -33.733 28.251  61.797  1.00 113.18 ? 299 ALA A C     1 
ATOM   2437  O  O     . ALA A  1  301 ? -32.619 28.537  61.346  1.00 109.62 ? 299 ALA A O     1 
ATOM   2438  C  CB    . ALA A  1  301 ? -34.917 26.705  60.223  1.00 110.60 ? 299 ALA A CB    1 
ATOM   2439  N  N     . GLU A  1  302 ? -34.483 29.140  62.452  1.00 116.30 ? 300 GLU A N     1 
ATOM   2440  C  CA    . GLU A  1  302 ? -33.979 30.486  62.705  1.00 117.13 ? 300 GLU A CA    1 
ATOM   2441  C  C     . GLU A  1  302 ? -32.963 30.496  63.841  1.00 118.05 ? 300 GLU A C     1 
ATOM   2442  O  O     . GLU A  1  302 ? -31.868 31.051  63.696  1.00 122.76 ? 300 GLU A O     1 
ATOM   2443  C  CB    . GLU A  1  302 ? -35.138 31.438  63.007  1.00 119.93 ? 300 GLU A CB    1 
ATOM   2444  C  CG    . GLU A  1  302 ? -35.845 31.953  61.764  1.00 126.47 ? 300 GLU A CG    1 
ATOM   2445  C  CD    . GLU A  1  302 ? -37.025 32.849  62.085  1.00 134.65 ? 300 GLU A CD    1 
ATOM   2446  O  OE1   . GLU A  1  302 ? -37.464 32.864  63.254  1.00 137.17 ? 300 GLU A OE1   1 
ATOM   2447  O  OE2   . GLU A  1  302 ? -37.514 33.539  61.166  1.00 134.86 ? 300 GLU A OE2   1 
ATOM   2448  N  N     . LEU A  1  303 ? -33.318 29.905  64.986  1.00 113.51 ? 301 LEU A N     1 
ATOM   2449  C  CA    . LEU A  1  303 ? -32.377 29.810  66.100  1.00 116.06 ? 301 LEU A CA    1 
ATOM   2450  C  C     . LEU A  1  303 ? -31.093 29.110  65.669  1.00 119.73 ? 301 LEU A C     1 
ATOM   2451  O  O     . LEU A  1  303 ? -29.987 29.597  65.931  1.00 121.64 ? 301 LEU A O     1 
ATOM   2452  C  CB    . LEU A  1  303 ? -33.026 29.078  67.275  1.00 113.90 ? 301 LEU A CB    1 
ATOM   2453  C  CG    . LEU A  1  303 ? -32.128 28.820  68.487  1.00 112.96 ? 301 LEU A CG    1 
ATOM   2454  C  CD1   . LEU A  1  303 ? -31.536 30.122  69.003  1.00 111.13 ? 301 LEU A CD1   1 
ATOM   2455  C  CD2   . LEU A  1  303 ? -32.900 28.107  69.586  1.00 114.71 ? 301 LEU A CD2   1 
ATOM   2456  N  N     . GLU A  1  304 ? -31.229 27.938  65.043  1.00 113.79 ? 302 GLU A N     1 
ATOM   2457  C  CA    . GLU A  1  304 ? -30.092 27.236  64.455  1.00 107.03 ? 302 GLU A CA    1 
ATOM   2458  C  C     . GLU A  1  304 ? -29.229 28.173  63.613  1.00 108.10 ? 302 GLU A C     1 
ATOM   2459  O  O     . GLU A  1  304 ? -28.041 28.368  63.891  1.00 107.88 ? 302 GLU A O     1 
ATOM   2460  C  CB    . GLU A  1  304 ? -30.600 26.065  63.612  1.00 103.34 ? 302 GLU A CB    1 
ATOM   2461  C  CG    . GLU A  1  304 ? -29.518 25.121  63.128  1.00 103.98 ? 302 GLU A CG    1 
ATOM   2462  C  CD    . GLU A  1  304 ? -30.046 24.083  62.158  1.00 106.66 ? 302 GLU A CD    1 
ATOM   2463  O  OE1   . GLU A  1  304 ? -30.442 24.465  61.037  1.00 105.92 ? 302 GLU A OE1   1 
ATOM   2464  O  OE2   . GLU A  1  304 ? -30.071 22.888  62.519  1.00 106.02 ? 302 GLU A OE2   1 
ATOM   2465  N  N     . LEU A  1  305 ? -29.816 28.735  62.552  1.00 104.83 ? 303 LEU A N     1 
ATOM   2466  C  CA    . LEU A  1  305 ? -29.122 29.713  61.716  1.00 101.38 ? 303 LEU A CA    1 
ATOM   2467  C  C     . LEU A  1  305 ? -28.473 30.832  62.523  1.00 101.41 ? 303 LEU A C     1 
ATOM   2468  O  O     . LEU A  1  305 ? -27.418 31.346  62.131  1.00 97.90  ? 303 LEU A O     1 
ATOM   2469  C  CB    . LEU A  1  305 ? -30.096 30.306  60.693  1.00 103.21 ? 303 LEU A CB    1 
ATOM   2470  C  CG    . LEU A  1  305 ? -29.526 31.289  59.669  1.00 104.50 ? 303 LEU A CG    1 
ATOM   2471  C  CD1   . LEU A  1  305 ? -28.443 30.624  58.834  1.00 101.99 ? 303 LEU A CD1   1 
ATOM   2472  C  CD2   . LEU A  1  305 ? -30.632 31.839  58.782  1.00 107.08 ? 303 LEU A CD2   1 
ATOM   2473  N  N     . ALA A  1  306 ? -29.073 31.218  63.652  1.00 100.30 ? 304 ALA A N     1 
ATOM   2474  C  CA    . ALA A  1  306 ? -28.488 32.273  64.475  1.00 102.78 ? 304 ALA A CA    1 
ATOM   2475  C  C     . ALA A  1  306 ? -27.156 31.842  65.077  1.00 102.63 ? 304 ALA A C     1 
ATOM   2476  O  O     . ALA A  1  306 ? -26.138 32.523  64.905  1.00 98.86  ? 304 ALA A O     1 
ATOM   2477  C  CB    . ALA A  1  306 ? -29.467 32.690  65.573  1.00 106.50 ? 304 ALA A CB    1 
ATOM   2478  N  N     . GLU A  1  307 ? -27.137 30.711  65.788  1.00 107.26 ? 305 GLU A N     1 
ATOM   2479  C  CA    . GLU A  1  307 ? -25.882 30.236  66.363  1.00 109.97 ? 305 GLU A CA    1 
ATOM   2480  C  C     . GLU A  1  307 ? -24.888 29.816  65.288  1.00 108.19 ? 305 GLU A C     1 
ATOM   2481  O  O     . GLU A  1  307 ? -23.675 29.876  65.515  1.00 109.02 ? 305 GLU A O     1 
ATOM   2482  C  CB    . GLU A  1  307 ? -26.139 29.089  67.343  1.00 112.55 ? 305 GLU A CB    1 
ATOM   2483  C  CG    . GLU A  1  307 ? -27.181 28.081  66.899  1.00 116.40 ? 305 GLU A CG    1 
ATOM   2484  C  CD    . GLU A  1  307 ? -27.392 26.982  67.922  1.00 119.81 ? 305 GLU A CD    1 
ATOM   2485  O  OE1   . GLU A  1  307 ? -26.421 26.629  68.624  1.00 119.70 ? 305 GLU A OE1   1 
ATOM   2486  O  OE2   . GLU A  1  307 ? -28.529 26.477  68.032  1.00 120.53 ? 305 GLU A OE2   1 
ATOM   2487  N  N     . ASN A  1  308 ? -25.373 29.394  64.118  1.00 104.96 ? 306 ASN A N     1 
ATOM   2488  C  CA    . ASN A  1  308 ? -24.470 29.082  63.015  1.00 100.49 ? 306 ASN A CA    1 
ATOM   2489  C  C     . ASN A  1  308 ? -23.717 30.324  62.555  1.00 103.18 ? 306 ASN A C     1 
ATOM   2490  O  O     . ASN A  1  308 ? -22.498 30.288  62.350  1.00 100.43 ? 306 ASN A O     1 
ATOM   2491  C  CB    . ASN A  1  308 ? -25.250 28.466  61.852  1.00 99.15  ? 306 ASN A CB    1 
ATOM   2492  C  CG    . ASN A  1  308 ? -25.250 26.954  61.889  1.00 101.84 ? 306 ASN A CG    1 
ATOM   2493  O  OD1   . ASN A  1  308 ? -24.339 26.337  62.440  1.00 104.47 ? 306 ASN A OD1   1 
ATOM   2494  N  ND2   . ASN A  1  308 ? -26.270 26.346  61.296  1.00 100.43 ? 306 ASN A ND2   1 
ATOM   2495  N  N     . ARG A  1  309 ? -24.436 31.435  62.376  1.00 104.80 ? 307 ARG A N     1 
ATOM   2496  C  CA    . ARG A  1  309 ? -23.795 32.693  62.006  1.00 105.75 ? 307 ARG A CA    1 
ATOM   2497  C  C     . ARG A  1  309 ? -22.835 33.182  63.084  1.00 113.56 ? 307 ARG A C     1 
ATOM   2498  O  O     . ARG A  1  309 ? -21.749 33.686  62.773  1.00 124.12 ? 307 ARG A O     1 
ATOM   2499  C  CB    . ARG A  1  309 ? -24.857 33.753  61.717  1.00 106.24 ? 307 ARG A CB    1 
ATOM   2500  C  CG    . ARG A  1  309 ? -25.140 33.960  60.239  1.00 108.84 ? 307 ARG A CG    1 
ATOM   2501  C  CD    . ARG A  1  309 ? -26.445 34.709  60.032  1.00 114.11 ? 307 ARG A CD    1 
ATOM   2502  N  NE    . ARG A  1  309 ? -26.681 35.021  58.625  1.00 116.79 ? 307 ARG A NE    1 
ATOM   2503  C  CZ    . ARG A  1  309 ? -27.874 35.309  58.115  1.00 117.75 ? 307 ARG A CZ    1 
ATOM   2504  N  NH1   . ARG A  1  309 ? -28.946 35.314  58.895  1.00 116.69 ? 307 ARG A NH1   1 
ATOM   2505  N  NH2   . ARG A  1  309 ? -27.997 35.583  56.824  1.00 117.47 ? 307 ARG A NH2   1 
ATOM   2506  N  N     . GLU A  1  310 ? -23.210 33.040  64.358  1.00 109.55 ? 308 GLU A N     1 
ATOM   2507  C  CA    . GLU A  1  310 ? -22.337 33.515  65.428  1.00 113.19 ? 308 GLU A CA    1 
ATOM   2508  C  C     . GLU A  1  310 ? -21.048 32.707  65.517  1.00 106.88 ? 308 GLU A C     1 
ATOM   2509  O  O     . GLU A  1  310 ? -20.009 33.253  65.904  1.00 105.90 ? 308 GLU A O     1 
ATOM   2510  C  CB    . GLU A  1  310 ? -23.071 33.493  66.768  1.00 122.52 ? 308 GLU A CB    1 
ATOM   2511  C  CG    . GLU A  1  310 ? -22.401 34.353  67.832  1.00 131.83 ? 308 GLU A CG    1 
ATOM   2512  C  CD    . GLU A  1  310 ? -23.189 34.424  69.122  1.00 134.45 ? 308 GLU A CD    1 
ATOM   2513  O  OE1   . GLU A  1  310 ? -24.137 33.628  69.289  1.00 138.43 ? 308 GLU A OE1   1 
ATOM   2514  O  OE2   . GLU A  1  310 ? -22.858 35.279  69.970  1.00 132.63 ? 308 GLU A OE2   1 
ATOM   2515  N  N     . ILE A  1  311 ? -21.092 31.412  65.196  1.00 100.89 ? 309 ILE A N     1 
ATOM   2516  C  CA    . ILE A  1  311 ? -19.858 30.630  65.144  1.00 96.09  ? 309 ILE A CA    1 
ATOM   2517  C  C     . ILE A  1  311 ? -18.923 31.199  64.084  1.00 97.96  ? 309 ILE A C     1 
ATOM   2518  O  O     . ILE A  1  311 ? -17.705 31.288  64.288  1.00 91.71  ? 309 ILE A O     1 
ATOM   2519  C  CB    . ILE A  1  311 ? -20.174 29.145  64.883  1.00 94.62  ? 309 ILE A CB    1 
ATOM   2520  C  CG1   . ILE A  1  311 ? -20.911 28.532  66.074  1.00 94.74  ? 309 ILE A CG1   1 
ATOM   2521  C  CG2   . ILE A  1  311 ? -18.901 28.366  64.599  1.00 90.18  ? 309 ILE A CG2   1 
ATOM   2522  C  CD1   . ILE A  1  311 ? -21.447 27.134  65.814  1.00 91.92  ? 309 ILE A CD1   1 
ATOM   2523  N  N     . LEU A  1  312 ? -19.480 31.602  62.939  1.00 100.93 ? 310 LEU A N     1 
ATOM   2524  C  CA    . LEU A  1  312 ? -18.666 32.162  61.863  1.00 98.59  ? 310 LEU A CA    1 
ATOM   2525  C  C     . LEU A  1  312 ? -18.060 33.507  62.247  1.00 97.25  ? 310 LEU A C     1 
ATOM   2526  O  O     . LEU A  1  312 ? -17.040 33.907  61.673  1.00 96.70  ? 310 LEU A O     1 
ATOM   2527  C  CB    . LEU A  1  312 ? -19.499 32.297  60.586  1.00 94.95  ? 310 LEU A CB    1 
ATOM   2528  C  CG    . LEU A  1  312 ? -19.433 31.134  59.590  1.00 89.44  ? 310 LEU A CG    1 
ATOM   2529  C  CD1   . LEU A  1  312 ? -19.782 29.804  60.247  1.00 87.07  ? 310 LEU A CD1   1 
ATOM   2530  C  CD2   . LEU A  1  312 ? -20.351 31.403  58.411  1.00 91.79  ? 310 LEU A CD2   1 
ATOM   2531  N  N     . LYS A  1  313 ? -18.688 34.227  63.183  1.00 102.86 ? 311 LYS A N     1 
ATOM   2532  C  CA    . LYS A  1  313 ? -18.198 35.542  63.594  1.00 118.07 ? 311 LYS A CA    1 
ATOM   2533  C  C     . LYS A  1  313 ? -16.710 35.513  63.932  1.00 129.16 ? 311 LYS A C     1 
ATOM   2534  O  O     . LYS A  1  313 ? -15.920 36.287  63.378  1.00 135.89 ? 311 LYS A O     1 
ATOM   2535  C  CB    . LYS A  1  313 ? -19.004 36.053  64.788  1.00 116.14 ? 311 LYS A CB    1 
ATOM   2536  C  CG    . LYS A  1  313 ? -18.641 37.464  65.212  1.00 118.68 ? 311 LYS A CG    1 
ATOM   2537  C  CD    . LYS A  1  313 ? -19.361 37.867  66.484  1.00 120.24 ? 311 LYS A CD    1 
ATOM   2538  C  CE    . LYS A  1  313 ? -18.931 37.002  67.656  1.00 119.57 ? 311 LYS A CE    1 
ATOM   2539  N  NZ    . LYS A  1  313 ? -19.617 37.391  68.920  1.00 119.98 ? 311 LYS A NZ    1 
ATOM   2540  N  N     . GLU A  1  314 ? -16.309 34.620  64.830  1.00 127.04 ? 312 GLU A N     1 
ATOM   2541  C  CA    . GLU A  1  314 ? -14.913 34.595  65.245  1.00 124.35 ? 312 GLU A CA    1 
ATOM   2542  C  C     . GLU A  1  314 ? -14.076 33.808  64.237  1.00 113.22 ? 312 GLU A C     1 
ATOM   2543  O  O     . GLU A  1  314 ? -14.488 32.734  63.792  1.00 112.02 ? 312 GLU A O     1 
ATOM   2544  C  CB    . GLU A  1  314 ? -14.769 33.972  66.631  1.00 132.64 ? 312 GLU A CB    1 
ATOM   2545  C  CG    . GLU A  1  314 ? -14.966 34.946  67.778  1.00 141.72 ? 312 GLU A CG    1 
ATOM   2546  C  CD    . GLU A  1  314 ? -14.767 34.293  69.130  1.00 146.51 ? 312 GLU A CD    1 
ATOM   2547  O  OE1   . GLU A  1  314 ? -15.686 34.368  69.972  1.00 148.16 ? 312 GLU A OE1   1 
ATOM   2548  O  OE2   . GLU A  1  314 ? -13.693 33.693  69.346  1.00 147.07 ? 312 GLU A OE2   1 
ATOM   2549  N  N     . PRO A  1  315 ? -12.906 34.320  63.856  1.00 105.03 ? 313 PRO A N     1 
ATOM   2550  C  CA    . PRO A  1  315 ? -12.044 33.562  62.943  1.00 93.99  ? 313 PRO A CA    1 
ATOM   2551  C  C     . PRO A  1  315 ? -11.505 32.315  63.623  1.00 83.27  ? 313 PRO A C     1 
ATOM   2552  O  O     . PRO A  1  315 ? -11.124 32.337  64.796  1.00 88.55  ? 313 PRO A O     1 
ATOM   2553  C  CB    . PRO A  1  315 ? -10.922 34.551  62.610  1.00 97.27  ? 313 PRO A CB    1 
ATOM   2554  C  CG    . PRO A  1  315 ? -10.874 35.466  63.786  1.00 104.15 ? 313 PRO A CG    1 
ATOM   2555  C  CD    . PRO A  1  315 ? -12.295 35.596  64.268  1.00 106.92 ? 313 PRO A CD    1 
ATOM   2556  N  N     . VAL A  1  316 ? -11.476 31.215  62.872  1.00 74.05  ? 314 VAL A N     1 
ATOM   2557  C  CA    . VAL A  1  316 ? -10.865 29.979  63.336  1.00 72.64  ? 314 VAL A CA    1 
ATOM   2558  C  C     . VAL A  1  316 ? -9.864  29.507  62.293  1.00 81.43  ? 314 VAL A C     1 
ATOM   2559  O  O     . VAL A  1  316 ? -9.891  29.924  61.133  1.00 86.39  ? 314 VAL A O     1 
ATOM   2560  C  CB    . VAL A  1  316 ? -11.907 28.873  63.618  1.00 76.36  ? 314 VAL A CB    1 
ATOM   2561  C  CG1   . VAL A  1  316 ? -12.985 29.376  64.567  1.00 83.56  ? 314 VAL A CG1   1 
ATOM   2562  C  CG2   . VAL A  1  316 ? -12.517 28.372  62.319  1.00 84.17  ? 314 VAL A CG2   1 
ATOM   2563  N  N     . HIS A  1  317 ? -8.967  28.628  62.729  1.00 84.10  ? 315 HIS A N     1 
ATOM   2564  C  CA    . HIS A  1  317 ? -7.925  28.108  61.859  1.00 81.93  ? 315 HIS A CA    1 
ATOM   2565  C  C     . HIS A  1  317 ? -7.568  26.702  62.307  1.00 77.43  ? 315 HIS A C     1 
ATOM   2566  O  O     . HIS A  1  317 ? -7.720  26.348  63.480  1.00 76.81  ? 315 HIS A O     1 
ATOM   2567  C  CB    . HIS A  1  317 ? -6.675  28.998  61.861  1.00 91.77  ? 315 HIS A CB    1 
ATOM   2568  C  CG    . HIS A  1  317 ? -5.863  28.900  63.115  1.00 100.16 ? 315 HIS A CG    1 
ATOM   2569  N  ND1   . HIS A  1  317 ? -4.984  27.865  63.355  1.00 100.04 ? 315 HIS A ND1   1 
ATOM   2570  C  CD2   . HIS A  1  317 ? -5.792  29.712  64.196  1.00 102.49 ? 315 HIS A CD2   1 
ATOM   2571  C  CE1   . HIS A  1  317 ? -4.411  28.041  64.533  1.00 100.36 ? 315 HIS A CE1   1 
ATOM   2572  N  NE2   . HIS A  1  317 ? -4.884  29.155  65.063  1.00 99.70  ? 315 HIS A NE2   1 
ATOM   2573  N  N     . GLY A  1  318 ? -7.092  25.901  61.355  1.00 73.51  ? 316 GLY A N     1 
ATOM   2574  C  CA    . GLY A  1  318 ? -6.531  24.603  61.640  1.00 58.84  ? 316 GLY A CA    1 
ATOM   2575  C  C     . GLY A  1  318 ? -5.018  24.628  61.494  1.00 62.98  ? 316 GLY A C     1 
ATOM   2576  O  O     . GLY A  1  318 ? -4.429  25.559  60.947  1.00 65.38  ? 316 GLY A O     1 
ATOM   2577  N  N     . VAL A  1  319 ? -4.391  23.570  61.998  1.00 61.47  ? 317 VAL A N     1 
ATOM   2578  C  CA    . VAL A  1  319 ? -2.943  23.444  61.907  1.00 62.81  ? 317 VAL A CA    1 
ATOM   2579  C  C     . VAL A  1  319 ? -2.617  22.343  60.911  1.00 60.43  ? 317 VAL A C     1 
ATOM   2580  O  O     . VAL A  1  319 ? -3.510  21.821  60.233  1.00 62.13  ? 317 VAL A O     1 
ATOM   2581  C  CB    . VAL A  1  319 ? -2.314  23.164  63.284  1.00 59.91  ? 317 VAL A CB    1 
ATOM   2582  C  CG1   . VAL A  1  319 ? -2.570  24.331  64.225  1.00 57.96  ? 317 VAL A CG1   1 
ATOM   2583  C  CG2   . VAL A  1  319 ? -2.866  21.872  63.866  1.00 55.25  ? 317 VAL A CG2   1 
ATOM   2584  N  N     . TYR A  1  320 ? -1.345  21.981  60.816  1.00 56.16  ? 318 TYR A N     1 
ATOM   2585  C  CA    . TYR A  1  320 ? -0.892  20.974  59.871  1.00 56.22  ? 318 TYR A CA    1 
ATOM   2586  C  C     . TYR A  1  320 ? -0.558  19.683  60.609  1.00 60.55  ? 318 TYR A C     1 
ATOM   2587  O  O     . TYR A  1  320 ? -0.651  19.595  61.837  1.00 53.73  ? 318 TYR A O     1 
ATOM   2588  C  CB    . TYR A  1  320 ? 0.312   21.493  59.083  1.00 61.19  ? 318 TYR A CB    1 
ATOM   2589  C  CG    . TYR A  1  320 ? -0.002  22.699  58.229  1.00 64.46  ? 318 TYR A CG    1 
ATOM   2590  C  CD1   . TYR A  1  320 ? -1.123  22.720  57.409  1.00 56.78  ? 318 TYR A CD1   1 
ATOM   2591  C  CD2   . TYR A  1  320 ? 0.815   23.823  58.251  1.00 64.36  ? 318 TYR A CD2   1 
ATOM   2592  C  CE1   . TYR A  1  320 ? -1.416  23.820  56.628  1.00 56.87  ? 318 TYR A CE1   1 
ATOM   2593  C  CE2   . TYR A  1  320 ? 0.529   24.929  57.473  1.00 58.73  ? 318 TYR A CE2   1 
ATOM   2594  C  CZ    . TYR A  1  320 ? -0.587  24.922  56.665  1.00 58.76  ? 318 TYR A CZ    1 
ATOM   2595  O  OH    . TYR A  1  320 ? -0.872  26.023  55.891  1.00 65.00  ? 318 TYR A OH    1 
ATOM   2596  N  N     . TYR A  1  321 ? -0.148  18.678  59.845  1.00 53.14  ? 319 TYR A N     1 
ATOM   2597  C  CA    . TYR A  1  321 ? -0.051  17.311  60.337  1.00 58.62  ? 319 TYR A CA    1 
ATOM   2598  C  C     . TYR A  1  321 ? 1.388   17.001  60.722  1.00 63.91  ? 319 TYR A C     1 
ATOM   2599  O  O     . TYR A  1  321 ? 2.316   17.269  59.951  1.00 68.81  ? 319 TYR A O     1 
ATOM   2600  C  CB    . TYR A  1  321 ? -0.554  16.318  59.286  1.00 52.00  ? 319 TYR A CB    1 
ATOM   2601  C  CG    . TYR A  1  321 ? -0.371  14.866  59.667  1.00 51.10  ? 319 TYR A CG    1 
ATOM   2602  C  CD1   . TYR A  1  321 ? -0.837  14.382  60.882  1.00 50.70  ? 319 TYR A CD1   1 
ATOM   2603  C  CD2   . TYR A  1  321 ? 0.256   13.975  58.805  1.00 55.20  ? 319 TYR A CD2   1 
ATOM   2604  C  CE1   . TYR A  1  321 ? -0.672  13.055  61.234  1.00 71.25  ? 319 TYR A CE1   1 
ATOM   2605  C  CE2   . TYR A  1  321 ? 0.424   12.645  59.147  1.00 60.09  ? 319 TYR A CE2   1 
ATOM   2606  C  CZ    . TYR A  1  321 ? -0.043  12.191  60.363  1.00 64.56  ? 319 TYR A CZ    1 
ATOM   2607  O  OH    . TYR A  1  321 ? 0.119   10.870  60.711  1.00 62.18  ? 319 TYR A OH    1 
ATOM   2608  N  N     . ASP A  1  322 ? 1.567   16.440  61.918  1.00 59.34  ? 320 ASP A N     1 
ATOM   2609  C  CA    . ASP A  1  322 ? 2.874   16.070  62.454  1.00 57.49  ? 320 ASP A CA    1 
ATOM   2610  C  C     . ASP A  1  322 ? 2.911   14.552  62.556  1.00 63.98  ? 320 ASP A C     1 
ATOM   2611  O  O     . ASP A  1  322 ? 2.438   13.980  63.550  1.00 65.62  ? 320 ASP A O     1 
ATOM   2612  C  CB    . ASP A  1  322 ? 3.117   16.721  63.818  1.00 65.94  ? 320 ASP A CB    1 
ATOM   2613  C  CG    . ASP A  1  322 ? 4.486   16.393  64.394  1.00 72.22  ? 320 ASP A CG    1 
ATOM   2614  O  OD1   . ASP A  1  322 ? 5.325   15.809  63.675  1.00 63.97  ? 320 ASP A OD1   1 
ATOM   2615  O  OD2   . ASP A  1  322 ? 4.728   16.732  65.572  1.00 76.63  ? 320 ASP A OD2   1 
ATOM   2616  N  N     . PRO A  1  323 ? 3.442   13.851  61.540  1.00 70.26  ? 321 PRO A N     1 
ATOM   2617  C  CA    . PRO A  1  323 ? 3.480   12.379  61.571  1.00 62.64  ? 321 PRO A CA    1 
ATOM   2618  C  C     . PRO A  1  323 ? 4.055   11.784  62.848  1.00 58.50  ? 321 PRO A C     1 
ATOM   2619  O  O     . PRO A  1  323 ? 3.786   10.623  63.171  1.00 62.42  ? 321 PRO A O     1 
ATOM   2620  C  CB    . PRO A  1  323 ? 4.360   12.033  60.362  1.00 62.60  ? 321 PRO A CB    1 
ATOM   2621  C  CG    . PRO A  1  323 ? 4.221   13.205  59.446  1.00 64.30  ? 321 PRO A CG    1 
ATOM   2622  C  CD    . PRO A  1  323 ? 4.092   14.401  60.338  1.00 59.74  ? 321 PRO A CD    1 
ATOM   2623  N  N     . SER A  1  324 ? 4.851   12.568  63.579  1.00 65.13  ? 322 SER A N     1 
ATOM   2624  C  CA    . SER A  1  324 ? 5.462   12.063  64.803  1.00 71.74  ? 322 SER A CA    1 
ATOM   2625  C  C     . SER A  1  324 ? 4.432   11.902  65.915  1.00 74.32  ? 322 SER A C     1 
ATOM   2626  O  O     . SER A  1  324 ? 4.478   10.926  66.673  1.00 83.27  ? 322 SER A O     1 
ATOM   2627  C  CB    . SER A  1  324 ? 6.594   12.990  65.249  1.00 72.51  ? 322 SER A CB    1 
ATOM   2628  O  OG    . SER A  1  324 ? 6.096   14.244  65.676  1.00 74.92  ? 322 SER A OG    1 
ATOM   2629  N  N     . LYS A  1  325 ? 3.495   12.839  66.026  1.00 74.55  ? 323 LYS A N     1 
ATOM   2630  C  CA    . LYS A  1  325 ? 2.478   12.779  67.064  1.00 78.85  ? 323 LYS A CA    1 
ATOM   2631  C  C     . LYS A  1  325 ? 1.243   12.002  66.611  1.00 73.57  ? 323 LYS A C     1 
ATOM   2632  O  O     . LYS A  1  325 ? 0.949   11.877  65.420  1.00 67.46  ? 323 LYS A O     1 
ATOM   2633  C  CB    . LYS A  1  325 ? 2.080   14.191  67.497  1.00 80.29  ? 323 LYS A CB    1 
ATOM   2634  C  CG    . LYS A  1  325 ? 3.237   15.013  68.047  1.00 85.88  ? 323 LYS A CG    1 
ATOM   2635  C  CD    . LYS A  1  325 ? 2.743   16.297  68.692  1.00 96.48  ? 323 LYS A CD    1 
ATOM   2636  C  CE    . LYS A  1  325 ? 2.191   17.268  67.660  1.00 101.16 ? 323 LYS A CE    1 
ATOM   2637  N  NZ    . LYS A  1  325 ? 3.214   18.265  67.236  1.00 98.72  ? 323 LYS A NZ    1 
ATOM   2638  N  N     . ASP A  1  326 ? 0.524   11.473  67.600  1.00 77.86  ? 324 ASP A N     1 
ATOM   2639  C  CA    . ASP A  1  326 ? -0.719  10.741  67.393  1.00 81.15  ? 324 ASP A CA    1 
ATOM   2640  C  C     . ASP A  1  326 ? -1.812  11.621  66.787  1.00 64.22  ? 324 ASP A C     1 
ATOM   2641  O  O     . ASP A  1  326 ? -1.801  12.851  66.896  1.00 59.66  ? 324 ASP A O     1 
ATOM   2642  C  CB    . ASP A  1  326 ? -1.218  10.153  68.712  1.00 90.21  ? 324 ASP A CB    1 
ATOM   2643  C  CG    . ASP A  1  326 ? -0.772  8.718   68.919  1.00 100.32 ? 324 ASP A CG    1 
ATOM   2644  O  OD1   . ASP A  1  326 ? -0.697  7.965   67.925  1.00 106.18 ? 324 ASP A OD1   1 
ATOM   2645  O  OD2   . ASP A  1  326 ? -0.504  8.341   70.079  1.00 102.30 ? 324 ASP A OD2   1 
ATOM   2646  N  N     . LEU A  1  327 ? -2.769  10.956  66.141  1.00 49.74  ? 325 LEU A N     1 
ATOM   2647  C  CA    . LEU A  1  327 ? -4.021  11.554  65.697  1.00 49.42  ? 325 LEU A CA    1 
ATOM   2648  C  C     . LEU A  1  327 ? -5.123  11.227  66.699  1.00 56.03  ? 325 LEU A C     1 
ATOM   2649  O  O     . LEU A  1  327 ? -5.219  10.093  67.178  1.00 49.25  ? 325 LEU A O     1 
ATOM   2650  C  CB    . LEU A  1  327 ? -4.415  11.028  64.315  1.00 52.58  ? 325 LEU A CB    1 
ATOM   2651  C  CG    . LEU A  1  327 ? -4.010  11.820  63.074  1.00 59.16  ? 325 LEU A CG    1 
ATOM   2652  C  CD1   . LEU A  1  327 ? -4.403  11.066  61.814  1.00 61.04  ? 325 LEU A CD1   1 
ATOM   2653  C  CD2   . LEU A  1  327 ? -4.673  13.177  63.105  1.00 49.61  ? 325 LEU A CD2   1 
ATOM   2654  N  N     . ILE A  1  328 ? -5.941  12.226  67.034  1.00 38.36  ? 326 ILE A N     1 
ATOM   2655  C  CA    . ILE A  1  328 ? -6.988  12.071  68.039  1.00 47.68  ? 326 ILE A CA    1 
ATOM   2656  C  C     . ILE A  1  328 ? -8.286  12.664  67.509  1.00 49.85  ? 326 ILE A C     1 
ATOM   2657  O  O     . ILE A  1  328 ? -8.309  13.816  67.064  1.00 44.33  ? 326 ILE A O     1 
ATOM   2658  C  CB    . ILE A  1  328 ? -6.608  12.743  69.372  1.00 45.94  ? 326 ILE A CB    1 
ATOM   2659  C  CG1   . ILE A  1  328 ? -5.332  12.126  69.946  1.00 44.35  ? 326 ILE A CG1   1 
ATOM   2660  C  CG2   . ILE A  1  328 ? -7.755  12.636  70.368  1.00 38.58  ? 326 ILE A CG2   1 
ATOM   2661  C  CD1   . ILE A  1  328 ? -4.915  12.722  71.271  1.00 47.34  ? 326 ILE A CD1   1 
ATOM   2662  N  N     . ALA A  1  329 ? -9.368  11.891  67.591  1.00 51.37  ? 327 ALA A N     1 
ATOM   2663  C  CA    . ALA A  1  329 ? -10.708 12.332  67.219  1.00 41.52  ? 327 ALA A CA    1 
ATOM   2664  C  C     . ALA A  1  329 ? -11.585 12.358  68.466  1.00 47.30  ? 327 ALA A C     1 
ATOM   2665  O  O     . ALA A  1  329 ? -11.707 11.344  69.160  1.00 48.23  ? 327 ALA A O     1 
ATOM   2666  C  CB    . ALA A  1  329 ? -11.313 11.421  66.151  1.00 36.80  ? 327 ALA A CB    1 
ATOM   2667  N  N     . GLU A  1  330 ? -12.185 13.509  68.753  1.00 50.72  ? 328 GLU A N     1 
ATOM   2668  C  CA    . GLU A  1  330 ? -13.149 13.640  69.837  1.00 56.17  ? 328 GLU A CA    1 
ATOM   2669  C  C     . GLU A  1  330 ? -14.524 13.961  69.267  1.00 54.20  ? 328 GLU A C     1 
ATOM   2670  O  O     . GLU A  1  330 ? -14.648 14.781  68.355  1.00 54.45  ? 328 GLU A O     1 
ATOM   2671  C  CB    . GLU A  1  330 ? -12.723 14.728  70.826  1.00 53.24  ? 328 GLU A CB    1 
ATOM   2672  C  CG    . GLU A  1  330 ? -13.607 14.818  72.060  1.00 67.46  ? 328 GLU A CG    1 
ATOM   2673  C  CD    . GLU A  1  330 ? -12.991 15.665  73.155  1.00 75.67  ? 328 GLU A CD    1 
ATOM   2674  O  OE1   . GLU A  1  330 ? -11.892 16.216  72.935  1.00 75.66  ? 328 GLU A OE1   1 
ATOM   2675  O  OE2   . GLU A  1  330 ? -13.606 15.777  74.237  1.00 73.92  ? 328 GLU A OE2   1 
ATOM   2676  N  N     . ILE A  1  331 ? -15.556 13.321  69.818  1.00 50.15  ? 329 ILE A N     1 
ATOM   2677  C  CA    . ILE A  1  331 ? -16.927 13.445  69.336  1.00 48.51  ? 329 ILE A CA    1 
ATOM   2678  C  C     . ILE A  1  331 ? -17.819 13.932  70.471  1.00 53.34  ? 329 ILE A C     1 
ATOM   2679  O  O     . ILE A  1  331 ? -17.680 13.487  71.616  1.00 49.33  ? 329 ILE A O     1 
ATOM   2680  C  CB    . ILE A  1  331 ? -17.453 12.103  68.786  1.00 44.94  ? 329 ILE A CB    1 
ATOM   2681  C  CG1   . ILE A  1  331 ? -16.473 11.507  67.775  1.00 49.58  ? 329 ILE A CG1   1 
ATOM   2682  C  CG2   . ILE A  1  331 ? -18.835 12.279  68.163  1.00 36.01  ? 329 ILE A CG2   1 
ATOM   2683  C  CD1   . ILE A  1  331 ? -16.845 10.108  67.337  1.00 41.76  ? 329 ILE A CD1   1 
ATOM   2684  N  N     . GLN A  1  332 ? -18.736 14.844  70.152  1.00 49.83  ? 330 GLN A N     1 
ATOM   2685  C  CA    . GLN A  1  332 ? -19.773 15.275  71.080  1.00 50.22  ? 330 GLN A CA    1 
ATOM   2686  C  C     . GLN A  1  332 ? -21.151 15.031  70.479  1.00 56.50  ? 330 GLN A C     1 
ATOM   2687  O  O     . GLN A  1  332 ? -21.350 15.183  69.270  1.00 53.91  ? 330 GLN A O     1 
ATOM   2688  C  CB    . GLN A  1  332 ? -19.628 16.761  71.433  1.00 47.33  ? 330 GLN A CB    1 
ATOM   2689  C  CG    . GLN A  1  332 ? -18.263 17.153  71.973  1.00 54.59  ? 330 GLN A CG    1 
ATOM   2690  C  CD    . GLN A  1  332 ? -17.266 17.454  70.871  1.00 62.61  ? 330 GLN A CD    1 
ATOM   2691  O  OE1   . GLN A  1  332 ? -17.600 18.100  69.877  1.00 72.99  ? 330 GLN A OE1   1 
ATOM   2692  N  NE2   . GLN A  1  332 ? -16.037 16.982  71.040  1.00 66.08  ? 330 GLN A NE2   1 
ATOM   2693  N  N     . LYS A  1  333 ? -22.100 14.652  71.333  1.00 59.24  ? 331 LYS A N     1 
ATOM   2694  C  CA    . LYS A  1  333 ? -23.501 14.543  70.943  1.00 54.60  ? 331 LYS A CA    1 
ATOM   2695  C  C     . LYS A  1  333 ? -24.151 15.923  70.964  1.00 52.26  ? 331 LYS A C     1 
ATOM   2696  O  O     . LYS A  1  333 ? -24.117 16.612  71.989  1.00 51.42  ? 331 LYS A O     1 
ATOM   2697  C  CB    . LYS A  1  333 ? -24.239 13.587  71.878  1.00 58.28  ? 331 LYS A CB    1 
ATOM   2698  C  CG    . LYS A  1  333 ? -25.738 13.515  71.645  1.00 58.45  ? 331 LYS A CG    1 
ATOM   2699  C  CD    . LYS A  1  333 ? -26.406 12.625  72.680  1.00 63.00  ? 331 LYS A CD    1 
ATOM   2700  C  CE    . LYS A  1  333 ? -27.917 12.633  72.523  1.00 64.74  ? 331 LYS A CE    1 
ATOM   2701  N  NZ    . LYS A  1  333 ? -28.591 11.802  73.561  1.00 67.88  ? 331 LYS A NZ    1 
ATOM   2702  N  N     . GLN A  1  334 ? -24.740 16.328  69.839  1.00 53.51  ? 332 GLN A N     1 
ATOM   2703  C  CA    . GLN A  1  334 ? -25.359 17.642  69.718  1.00 61.65  ? 332 GLN A CA    1 
ATOM   2704  C  C     . GLN A  1  334 ? -26.880 17.603  69.794  1.00 74.30  ? 332 GLN A C     1 
ATOM   2705  O  O     . GLN A  1  334 ? -27.518 18.650  69.645  1.00 79.49  ? 332 GLN A O     1 
ATOM   2706  C  CB    . GLN A  1  334 ? -24.933 18.316  68.410  1.00 66.86  ? 332 GLN A CB    1 
ATOM   2707  C  CG    . GLN A  1  334 ? -23.658 19.135  68.514  1.00 77.95  ? 332 GLN A CG    1 
ATOM   2708  C  CD    . GLN A  1  334 ? -23.511 20.120  67.372  1.00 89.77  ? 332 GLN A CD    1 
ATOM   2709  O  OE1   . GLN A  1  334 ? -23.627 19.754  66.204  1.00 90.45  ? 332 GLN A OE1   1 
ATOM   2710  N  NE2   . GLN A  1  334 ? -23.270 21.382  67.706  1.00 94.74  ? 332 GLN A NE2   1 
ATOM   2711  N  N     . GLY A  1  335 ? -27.475 16.441  70.020  1.00 80.67  ? 333 GLY A N     1 
ATOM   2712  C  CA    . GLY A  1  335 ? -28.927 16.388  70.110  1.00 72.09  ? 333 GLY A CA    1 
ATOM   2713  C  C     . GLY A  1  335 ? -29.599 16.250  68.758  1.00 75.55  ? 333 GLY A C     1 
ATOM   2714  O  O     . GLY A  1  335 ? -29.108 16.717  67.732  1.00 72.07  ? 333 GLY A O     1 
ATOM   2715  N  N     . GLN A  1  336 ? -30.766 15.609  68.773  1.00 86.59  ? 334 GLN A N     1 
ATOM   2716  C  CA    . GLN A  1  336 ? -31.568 15.340  67.577  1.00 85.46  ? 334 GLN A CA    1 
ATOM   2717  C  C     . GLN A  1  336 ? -30.722 14.709  66.471  1.00 81.30  ? 334 GLN A C     1 
ATOM   2718  O  O     . GLN A  1  336 ? -30.656 15.197  65.341  1.00 81.46  ? 334 GLN A O     1 
ATOM   2719  C  CB    . GLN A  1  336 ? -32.254 16.614  67.076  1.00 89.06  ? 334 GLN A CB    1 
ATOM   2720  C  CG    . GLN A  1  336 ? -33.096 17.326  68.119  1.00 97.00  ? 334 GLN A CG    1 
ATOM   2721  C  CD    . GLN A  1  336 ? -32.282 18.277  68.974  1.00 101.23 ? 334 GLN A CD    1 
ATOM   2722  O  OE1   . GLN A  1  336 ? -31.466 19.044  68.464  1.00 101.35 ? 334 GLN A OE1   1 
ATOM   2723  N  NE2   . GLN A  1  336 ? -32.496 18.228  70.283  1.00 102.72 ? 334 GLN A NE2   1 
ATOM   2724  N  N     . GLY A  1  337 ? -30.089 13.595  66.820  1.00 72.62  ? 335 GLY A N     1 
ATOM   2725  C  CA    . GLY A  1  337 ? -29.217 12.899  65.878  1.00 71.02  ? 335 GLY A CA    1 
ATOM   2726  C  C     . GLY A  1  337 ? -28.184 13.782  65.216  1.00 72.33  ? 335 GLY A C     1 
ATOM   2727  O  O     . GLY A  1  337 ? -27.927 13.645  64.013  1.00 78.30  ? 335 GLY A O     1 
ATOM   2728  N  N     . GLN A  1  338 ? -27.578 14.689  65.977  1.00 63.85  ? 336 GLN A N     1 
ATOM   2729  C  CA    . GLN A  1  338 ? -26.530 15.566  65.472  1.00 66.89  ? 336 GLN A CA    1 
ATOM   2730  C  C     . GLN A  1  338 ? -25.254 15.326  66.259  1.00 58.44  ? 336 GLN A C     1 
ATOM   2731  O  O     . GLN A  1  338 ? -25.280 15.273  67.493  1.00 59.05  ? 336 GLN A O     1 
ATOM   2732  C  CB    . GLN A  1  338 ? -26.923 17.041  65.574  1.00 76.19  ? 336 GLN A CB    1 
ATOM   2733  C  CG    . GLN A  1  338 ? -28.056 17.471  64.666  1.00 73.11  ? 336 GLN A CG    1 
ATOM   2734  C  CD    . GLN A  1  338 ? -28.394 18.941  64.832  1.00 89.06  ? 336 GLN A CD    1 
ATOM   2735  O  OE1   . GLN A  1  338 ? -28.126 19.754  63.950  1.00 98.05  ? 336 GLN A OE1   1 
ATOM   2736  N  NE2   . GLN A  1  338 ? -28.981 19.288  65.971  1.00 94.97  ? 336 GLN A NE2   1 
ATOM   2737  N  N     . TRP A  1  339 ? -24.146 15.167  65.543  1.00 52.31  ? 337 TRP A N     1 
ATOM   2738  C  CA    . TRP A  1  339 ? -22.852 14.909  66.150  1.00 60.25  ? 337 TRP A CA    1 
ATOM   2739  C  C     . TRP A  1  339 ? -21.819 15.780  65.456  1.00 61.67  ? 337 TRP A C     1 
ATOM   2740  O  O     . TRP A  1  339 ? -21.844 15.921  64.232  1.00 67.13  ? 337 TRP A O     1 
ATOM   2741  C  CB    . TRP A  1  339 ? -22.461 13.427  66.036  1.00 57.65  ? 337 TRP A CB    1 
ATOM   2742  C  CG    . TRP A  1  339 ? -23.544 12.480  66.470  1.00 54.42  ? 337 TRP A CG    1 
ATOM   2743  C  CD1   . TRP A  1  339 ? -24.664 12.137  65.766  1.00 51.43  ? 337 TRP A CD1   1 
ATOM   2744  C  CD2   . TRP A  1  339 ? -23.605 11.744  67.699  1.00 52.72  ? 337 TRP A CD2   1 
ATOM   2745  N  NE1   . TRP A  1  339 ? -25.419 11.243  66.483  1.00 45.32  ? 337 TRP A NE1   1 
ATOM   2746  C  CE2   . TRP A  1  339 ? -24.791 10.984  67.673  1.00 52.22  ? 337 TRP A CE2   1 
ATOM   2747  C  CE3   . TRP A  1  339 ? -22.772 11.656  68.820  1.00 47.70  ? 337 TRP A CE3   1 
ATOM   2748  C  CZ2   . TRP A  1  339 ? -25.166 10.148  68.723  1.00 56.77  ? 337 TRP A CZ2   1 
ATOM   2749  C  CZ3   . TRP A  1  339 ? -23.147 10.825  69.862  1.00 49.79  ? 337 TRP A CZ3   1 
ATOM   2750  C  CH2   . TRP A  1  339 ? -24.333 10.082  69.805  1.00 55.31  ? 337 TRP A CH2   1 
ATOM   2751  N  N     . THR A  1  340 ? -20.916 16.365  66.235  1.00 53.54  ? 338 THR A N     1 
ATOM   2752  C  CA    . THR A  1  340 ? -19.755 17.047  65.690  1.00 58.61  ? 338 THR A CA    1 
ATOM   2753  C  C     . THR A  1  340 ? -18.497 16.438  66.290  1.00 58.76  ? 338 THR A C     1 
ATOM   2754  O  O     . THR A  1  340 ? -18.529 15.820  67.358  1.00 54.18  ? 338 THR A O     1 
ATOM   2755  C  CB    . THR A  1  340 ? -19.793 18.557  65.973  1.00 64.71  ? 338 THR A CB    1 
ATOM   2756  O  OG1   . THR A  1  340 ? -20.205 18.786  67.326  1.00 64.17  ? 338 THR A OG1   1 
ATOM   2757  C  CG2   . THR A  1  340 ? -20.748 19.260  65.020  1.00 78.89  ? 338 THR A CG2   1 
ATOM   2758  N  N     . TYR A  1  341 ? -17.380 16.624  65.594  1.00 52.09  ? 339 TYR A N     1 
ATOM   2759  C  CA    . TYR A  1  341 ? -16.125 16.032  66.021  1.00 51.47  ? 339 TYR A CA    1 
ATOM   2760  C  C     . TYR A  1  341 ? -14.970 16.966  65.700  1.00 53.62  ? 339 TYR A C     1 
ATOM   2761  O  O     . TYR A  1  341 ? -15.054 17.818  64.813  1.00 56.61  ? 339 TYR A O     1 
ATOM   2762  C  CB    . TYR A  1  341 ? -15.893 14.660  65.368  1.00 41.66  ? 339 TYR A CB    1 
ATOM   2763  C  CG    . TYR A  1  341 ? -15.878 14.678  63.854  1.00 40.67  ? 339 TYR A CG    1 
ATOM   2764  C  CD1   . TYR A  1  341 ? -14.701 14.912  63.151  1.00 40.68  ? 339 TYR A CD1   1 
ATOM   2765  C  CD2   . TYR A  1  341 ? -17.038 14.448  63.129  1.00 41.50  ? 339 TYR A CD2   1 
ATOM   2766  C  CE1   . TYR A  1  341 ? -14.685 14.924  61.769  1.00 50.34  ? 339 TYR A CE1   1 
ATOM   2767  C  CE2   . TYR A  1  341 ? -17.031 14.456  61.748  1.00 45.40  ? 339 TYR A CE2   1 
ATOM   2768  C  CZ    . TYR A  1  341 ? -15.852 14.696  61.073  1.00 50.17  ? 339 TYR A CZ    1 
ATOM   2769  O  OH    . TYR A  1  341 ? -15.841 14.707  59.695  1.00 61.18  ? 339 TYR A OH    1 
ATOM   2770  N  N     . GLN A  1  342 ? -13.882 16.784  66.441  1.00 50.41  ? 340 GLN A N     1 
ATOM   2771  C  CA    . GLN A  1  342 ? -12.644 17.516  66.227  1.00 48.76  ? 340 GLN A CA    1 
ATOM   2772  C  C     . GLN A  1  342 ? -11.526 16.497  66.100  1.00 53.62  ? 340 GLN A C     1 
ATOM   2773  O  O     . GLN A  1  342 ? -11.442 15.564  66.904  1.00 55.74  ? 340 GLN A O     1 
ATOM   2774  C  CB    . GLN A  1  342 ? -12.352 18.491  67.374  1.00 52.49  ? 340 GLN A CB    1 
ATOM   2775  C  CG    . GLN A  1  342 ? -13.426 19.546  67.604  1.00 60.43  ? 340 GLN A CG    1 
ATOM   2776  C  CD    . GLN A  1  342 ? -14.609 19.017  68.393  1.00 59.58  ? 340 GLN A CD    1 
ATOM   2777  O  OE1   . GLN A  1  342 ? -14.445 18.229  69.323  1.00 58.35  ? 340 GLN A OE1   1 
ATOM   2778  N  NE2   . GLN A  1  342 ? -15.810 19.444  68.018  1.00 58.93  ? 340 GLN A NE2   1 
ATOM   2779  N  N     . ILE A  1  343 ? -10.666 16.679  65.105  1.00 53.45  ? 341 ILE A N     1 
ATOM   2780  C  CA    . ILE A  1  343 ? -9.460  15.877  64.953  1.00 40.30  ? 341 ILE A CA    1 
ATOM   2781  C  C     . ILE A  1  343 ? -8.268  16.776  65.237  1.00 46.82  ? 341 ILE A C     1 
ATOM   2782  O  O     . ILE A  1  343 ? -8.131  17.846  64.631  1.00 57.18  ? 341 ILE A O     1 
ATOM   2783  C  CB    . ILE A  1  343 ? -9.372  15.249  63.552  1.00 38.74  ? 341 ILE A CB    1 
ATOM   2784  C  CG1   . ILE A  1  343 ? -10.624 14.415  63.267  1.00 37.51  ? 341 ILE A CG1   1 
ATOM   2785  C  CG2   . ILE A  1  343 ? -8.130  14.385  63.431  1.00 44.80  ? 341 ILE A CG2   1 
ATOM   2786  C  CD1   . ILE A  1  343 ? -10.619 13.738  61.911  1.00 37.09  ? 341 ILE A CD1   1 
ATOM   2787  N  N     . TYR A  1  344 ? -7.411  16.346  66.159  1.00 46.01  ? 342 TYR A N     1 
ATOM   2788  C  CA    . TYR A  1  344 ? -6.290  17.168  66.581  1.00 48.33  ? 342 TYR A CA    1 
ATOM   2789  C  C     . TYR A  1  344 ? -5.129  16.274  66.986  1.00 54.84  ? 342 TYR A C     1 
ATOM   2790  O  O     . TYR A  1  344 ? -5.250  15.048  67.066  1.00 57.55  ? 342 TYR A O     1 
ATOM   2791  C  CB    . TYR A  1  344 ? -6.680  18.092  67.741  1.00 46.99  ? 342 TYR A CB    1 
ATOM   2792  C  CG    . TYR A  1  344 ? -7.139  17.359  68.985  1.00 50.81  ? 342 TYR A CG    1 
ATOM   2793  C  CD1   . TYR A  1  344 ? -6.236  16.994  69.978  1.00 52.62  ? 342 TYR A CD1   1 
ATOM   2794  C  CD2   . TYR A  1  344 ? -8.477  17.034  69.169  1.00 52.65  ? 342 TYR A CD2   1 
ATOM   2795  C  CE1   . TYR A  1  344 ? -6.652  16.324  71.115  1.00 50.39  ? 342 TYR A CE1   1 
ATOM   2796  C  CE2   . TYR A  1  344 ? -8.903  16.365  70.302  1.00 50.38  ? 342 TYR A CE2   1 
ATOM   2797  C  CZ    . TYR A  1  344 ? -7.987  16.013  71.271  1.00 56.85  ? 342 TYR A CZ    1 
ATOM   2798  O  OH    . TYR A  1  344 ? -8.409  15.347  72.398  1.00 56.15  ? 342 TYR A OH    1 
ATOM   2799  N  N     . GLN A  1  345 ? -3.996  16.918  67.248  1.00 56.57  ? 343 GLN A N     1 
ATOM   2800  C  CA    . GLN A  1  345 ? -2.801  16.280  67.782  1.00 49.99  ? 343 GLN A CA    1 
ATOM   2801  C  C     . GLN A  1  345 ? -2.347  16.943  69.072  1.00 59.14  ? 343 GLN A C     1 
ATOM   2802  O  O     . GLN A  1  345 ? -2.185  16.263  70.092  1.00 68.88  ? 343 GLN A O     1 
ATOM   2803  C  CB    . GLN A  1  345 ? -1.676  16.303  66.736  1.00 45.15  ? 343 GLN A CB    1 
ATOM   2804  C  CG    . GLN A  1  345 ? -2.093  15.750  65.380  1.00 51.05  ? 343 GLN A CG    1 
ATOM   2805  C  CD    . GLN A  1  345 ? -0.920  15.537  64.447  1.00 56.51  ? 343 GLN A CD    1 
ATOM   2806  O  OE1   . GLN A  1  345 ? -0.556  16.423  63.675  1.00 72.18  ? 343 GLN A OE1   1 
ATOM   2807  N  NE2   . GLN A  1  345 ? -0.320  14.354  64.515  1.00 49.64  ? 343 GLN A NE2   1 
ATOM   2808  N  N     . GLU A  1  346 ? -2.130  18.260  69.051  1.00 65.29  ? 344 GLU A N     1 
ATOM   2809  C  CA    . GLU A  1  346 ? -1.961  19.040  70.271  1.00 78.88  ? 344 GLU A CA    1 
ATOM   2810  C  C     . GLU A  1  346 ? -3.327  19.490  70.774  1.00 78.52  ? 344 GLU A C     1 
ATOM   2811  O  O     . GLU A  1  346 ? -4.147  19.956  69.974  1.00 69.70  ? 344 GLU A O     1 
ATOM   2812  C  CB    . GLU A  1  346 ? -1.083  20.259  70.022  1.00 87.75  ? 344 GLU A CB    1 
ATOM   2813  C  CG    . GLU A  1  346 ? 0.207   19.973  69.269  1.00 98.53  ? 344 GLU A CG    1 
ATOM   2814  C  CD    . GLU A  1  346 ? 1.334   19.511  70.172  1.00 106.33 ? 344 GLU A CD    1 
ATOM   2815  O  OE1   . GLU A  1  346 ? 1.120   18.579  70.977  1.00 103.77 ? 344 GLU A OE1   1 
ATOM   2816  O  OE2   . GLU A  1  346 ? 2.437   20.087  70.078  1.00 112.55 ? 344 GLU A OE2   1 
ATOM   2817  N  N     . PRO A  1  347 ? -3.614  19.342  72.067  1.00 79.07  ? 345 PRO A N     1 
ATOM   2818  C  CA    . PRO A  1  347 ? -4.913  19.779  72.599  1.00 74.96  ? 345 PRO A CA    1 
ATOM   2819  C  C     . PRO A  1  347 ? -5.256  21.209  72.199  1.00 69.33  ? 345 PRO A C     1 
ATOM   2820  O  O     . PRO A  1  347 ? -4.411  22.107  72.243  1.00 57.84  ? 345 PRO A O     1 
ATOM   2821  C  CB    . PRO A  1  347 ? -4.740  19.637  74.118  1.00 79.59  ? 345 PRO A CB    1 
ATOM   2822  C  CG    . PRO A  1  347 ? -3.263  19.501  74.345  1.00 81.16  ? 345 PRO A CG    1 
ATOM   2823  C  CD    . PRO A  1  347 ? -2.730  18.829  73.124  1.00 81.16  ? 345 PRO A CD    1 
ATOM   2824  N  N     . PHE A  1  348 ? -6.503  21.399  71.762  1.00 73.38  ? 346 PHE A N     1 
ATOM   2825  C  CA    . PHE A  1  348 ? -7.112  22.668  71.363  1.00 86.37  ? 346 PHE A CA    1 
ATOM   2826  C  C     . PHE A  1  348 ? -6.568  23.223  70.053  1.00 86.85  ? 346 PHE A C     1 
ATOM   2827  O  O     . PHE A  1  348 ? -7.020  24.290  69.619  1.00 93.84  ? 346 PHE A O     1 
ATOM   2828  C  CB    . PHE A  1  348 ? -6.987  23.751  72.444  1.00 93.88  ? 346 PHE A CB    1 
ATOM   2829  C  CG    . PHE A  1  348 ? -7.969  23.598  73.566  1.00 105.02 ? 346 PHE A CG    1 
ATOM   2830  C  CD1   . PHE A  1  348 ? -9.214  24.207  73.505  1.00 113.99 ? 346 PHE A CD1   1 
ATOM   2831  C  CD2   . PHE A  1  348 ? -7.653  22.839  74.679  1.00 104.12 ? 346 PHE A CD2   1 
ATOM   2832  C  CE1   . PHE A  1  348 ? -10.123 24.065  74.537  1.00 113.42 ? 346 PHE A CE1   1 
ATOM   2833  C  CE2   . PHE A  1  348 ? -8.556  22.693  75.714  1.00 107.92 ? 346 PHE A CE2   1 
ATOM   2834  C  CZ    . PHE A  1  348 ? -9.793  23.306  75.643  1.00 111.85 ? 346 PHE A CZ    1 
ATOM   2835  N  N     . LYS A  1  349 ? -5.622  22.550  69.408  1.00 82.87  ? 347 LYS A N     1 
ATOM   2836  C  CA    . LYS A  1  349 ? -5.134  22.947  68.091  1.00 81.71  ? 347 LYS A CA    1 
ATOM   2837  C  C     . LYS A  1  349 ? -5.655  21.926  67.086  1.00 72.24  ? 347 LYS A C     1 
ATOM   2838  O  O     . LYS A  1  349 ? -5.080  20.846  66.923  1.00 75.47  ? 347 LYS A O     1 
ATOM   2839  C  CB    . LYS A  1  349 ? -3.611  23.047  68.080  1.00 84.66  ? 347 LYS A CB    1 
ATOM   2840  C  CG    . LYS A  1  349 ? -3.092  24.299  68.770  1.00 91.13  ? 347 LYS A CG    1 
ATOM   2841  C  CD    . LYS A  1  349 ? -1.853  24.020  69.606  1.00 99.56  ? 347 LYS A CD    1 
ATOM   2842  C  CE    . LYS A  1  349 ? -0.622  23.814  68.745  1.00 107.47 ? 347 LYS A CE    1 
ATOM   2843  N  NZ    . LYS A  1  349 ? 0.603   23.674  69.581  1.00 107.93 ? 347 LYS A NZ    1 
ATOM   2844  N  N     . ASN A  1  350 ? -6.748  22.278  66.416  1.00 61.44  ? 348 ASN A N     1 
ATOM   2845  C  CA    . ASN A  1  350 ? -7.459  21.342  65.561  1.00 52.93  ? 348 ASN A CA    1 
ATOM   2846  C  C     . ASN A  1  350 ? -6.795  21.225  64.198  1.00 57.90  ? 348 ASN A C     1 
ATOM   2847  O  O     . ASN A  1  350 ? -6.354  22.219  63.616  1.00 68.48  ? 348 ASN A O     1 
ATOM   2848  C  CB    . ASN A  1  350 ? -8.912  21.778  65.385  1.00 57.75  ? 348 ASN A CB    1 
ATOM   2849  C  CG    . ASN A  1  350 ? -9.752  21.491  66.602  1.00 66.32  ? 348 ASN A CG    1 
ATOM   2850  O  OD1   . ASN A  1  350 ? -9.407  20.639  67.420  1.00 62.59  ? 348 ASN A OD1   1 
ATOM   2851  N  ND2   . ASN A  1  350 ? -10.869 22.195  66.729  1.00 60.80  ? 348 ASN A ND2   1 
ATOM   2852  N  N     . LEU A  1  351 ? -6.726  19.995  63.690  1.00 54.95  ? 349 LEU A N     1 
ATOM   2853  C  CA    . LEU A  1  351 ? -6.456  19.805  62.270  1.00 50.34  ? 349 LEU A CA    1 
ATOM   2854  C  C     . LEU A  1  351 ? -7.680  20.153  61.431  1.00 52.49  ? 349 LEU A C     1 
ATOM   2855  O  O     . LEU A  1  351 ? -7.593  20.946  60.487  1.00 56.96  ? 349 LEU A O     1 
ATOM   2856  C  CB    . LEU A  1  351 ? -6.011  18.366  62.017  1.00 48.85  ? 349 LEU A CB    1 
ATOM   2857  C  CG    . LEU A  1  351 ? -4.543  18.113  62.351  1.00 55.77  ? 349 LEU A CG    1 
ATOM   2858  C  CD1   . LEU A  1  351 ? -4.277  16.643  62.579  1.00 64.93  ? 349 LEU A CD1   1 
ATOM   2859  C  CD2   . LEU A  1  351 ? -3.680  18.634  61.223  1.00 60.98  ? 349 LEU A CD2   1 
ATOM   2860  N  N     . LYS A  1  352 ? -8.830  19.575  61.767  1.00 56.85  ? 350 LYS A N     1 
ATOM   2861  C  CA    . LYS A  1  352 ? -10.086 19.886  61.099  1.00 54.99  ? 350 LYS A CA    1 
ATOM   2862  C  C     . LYS A  1  352 ? -11.225 19.477  62.021  1.00 54.28  ? 350 LYS A C     1 
ATOM   2863  O  O     . LYS A  1  352 ? -11.024 18.774  63.013  1.00 60.75  ? 350 LYS A O     1 
ATOM   2864  C  CB    . LYS A  1  352 ? -10.198 19.184  59.740  1.00 53.84  ? 350 LYS A CB    1 
ATOM   2865  C  CG    . LYS A  1  352 ? -10.479 17.691  59.826  1.00 56.44  ? 350 LYS A CG    1 
ATOM   2866  C  CD    . LYS A  1  352 ? -10.448 17.053  58.446  1.00 50.54  ? 350 LYS A CD    1 
ATOM   2867  C  CE    . LYS A  1  352 ? -11.456 17.704  57.510  1.00 46.49  ? 350 LYS A CE    1 
ATOM   2868  N  NZ    . LYS A  1  352 ? -12.857 17.417  57.919  1.00 56.87  ? 350 LYS A NZ    1 
ATOM   2869  N  N     . THR A  1  353 ? -12.427 19.922  61.676  1.00 50.98  ? 351 THR A N     1 
ATOM   2870  C  CA    . THR A  1  353 ? -13.649 19.521  62.360  1.00 50.94  ? 351 THR A CA    1 
ATOM   2871  C  C     . THR A  1  353 ? -14.615 18.915  61.346  1.00 55.31  ? 351 THR A C     1 
ATOM   2872  O  O     . THR A  1  353 ? -14.309 18.793  60.158  1.00 61.47  ? 351 THR A O     1 
ATOM   2873  C  CB    . THR A  1  353 ? -14.293 20.707  63.085  1.00 54.06  ? 351 THR A CB    1 
ATOM   2874  O  OG1   . THR A  1  353 ? -14.684 21.699  62.127  1.00 62.04  ? 351 THR A OG1   1 
ATOM   2875  C  CG2   . THR A  1  353 ? -13.318 21.324  64.077  1.00 45.76  ? 351 THR A CG2   1 
ATOM   2876  N  N     . GLY A  1  354 ? -15.790 18.534  61.827  1.00 52.37  ? 352 GLY A N     1 
ATOM   2877  C  CA    . GLY A  1  354 ? -16.809 17.980  60.953  1.00 45.16  ? 352 GLY A CA    1 
ATOM   2878  C  C     . GLY A  1  354 ? -18.017 17.570  61.765  1.00 53.01  ? 352 GLY A C     1 
ATOM   2879  O  O     . GLY A  1  354 ? -18.010 17.608  63.000  1.00 57.12  ? 352 GLY A O     1 
ATOM   2880  N  N     . LYS A  1  355 ? -19.066 17.178  61.045  1.00 57.45  ? 353 LYS A N     1 
ATOM   2881  C  CA    . LYS A  1  355 ? -20.319 16.778  61.667  1.00 62.21  ? 353 LYS A CA    1 
ATOM   2882  C  C     . LYS A  1  355 ? -20.868 15.523  61.005  1.00 62.73  ? 353 LYS A C     1 
ATOM   2883  O  O     . LYS A  1  355 ? -20.659 15.286  59.812  1.00 58.29  ? 353 LYS A O     1 
ATOM   2884  C  CB    . LYS A  1  355 ? -21.365 17.894  61.588  1.00 61.62  ? 353 LYS A CB    1 
ATOM   2885  C  CG    . LYS A  1  355 ? -21.560 18.428  60.188  1.00 55.85  ? 353 LYS A CG    1 
ATOM   2886  C  CD    . LYS A  1  355 ? -22.871 19.167  60.055  1.00 64.01  ? 353 LYS A CD    1 
ATOM   2887  C  CE    . LYS A  1  355 ? -22.953 19.852  58.709  1.00 86.00  ? 353 LYS A CE    1 
ATOM   2888  N  NZ    . LYS A  1  355 ? -22.697 18.914  57.580  1.00 98.41  ? 353 LYS A NZ    1 
ATOM   2889  N  N     . TYR A  1  356 ? -21.573 14.718  61.799  1.00 60.55  ? 354 TYR A N     1 
ATOM   2890  C  CA    . TYR A  1  356 ? -22.339 13.576  61.307  1.00 56.31  ? 354 TYR A CA    1 
ATOM   2891  C  C     . TYR A  1  356 ? -23.769 13.724  61.811  1.00 61.82  ? 354 TYR A C     1 
ATOM   2892  O  O     . TYR A  1  356 ? -24.027 13.560  63.008  1.00 69.64  ? 354 TYR A O     1 
ATOM   2893  C  CB    . TYR A  1  356 ? -21.731 12.249  61.759  1.00 48.58  ? 354 TYR A CB    1 
ATOM   2894  C  CG    . TYR A  1  356 ? -22.532 11.044  61.317  1.00 46.35  ? 354 TYR A CG    1 
ATOM   2895  C  CD1   . TYR A  1  356 ? -22.504 10.612  59.997  1.00 52.43  ? 354 TYR A CD1   1 
ATOM   2896  C  CD2   . TYR A  1  356 ? -23.321 10.343  62.218  1.00 50.28  ? 354 TYR A CD2   1 
ATOM   2897  C  CE1   . TYR A  1  356 ? -23.237 9.512   59.588  1.00 57.18  ? 354 TYR A CE1   1 
ATOM   2898  C  CE2   . TYR A  1  356 ? -24.057 9.244   61.819  1.00 47.69  ? 354 TYR A CE2   1 
ATOM   2899  C  CZ    . TYR A  1  356 ? -24.012 8.833   60.504  1.00 53.34  ? 354 TYR A CZ    1 
ATOM   2900  O  OH    . TYR A  1  356 ? -24.746 7.738   60.106  1.00 54.60  ? 354 TYR A OH    1 
ATOM   2901  N  N     . ALA A  1  357 ? -24.695 14.027  60.902  1.00 62.24  ? 355 ALA A N     1 
ATOM   2902  C  CA    . ALA A  1  357 ? -26.099 14.200  61.247  1.00 59.83  ? 355 ALA A CA    1 
ATOM   2903  C  C     . ALA A  1  357 ? -27.012 13.128  60.667  1.00 67.55  ? 355 ALA A C     1 
ATOM   2904  O  O     . ALA A  1  357 ? -28.220 13.162  60.930  1.00 84.13  ? 355 ALA A O     1 
ATOM   2905  C  CB    . ALA A  1  357 ? -26.583 15.582  60.790  1.00 55.11  ? 355 ALA A CB    1 
ATOM   2906  N  N     . ARG A  1  358 ? -26.479 12.189  59.887  1.00 69.20  ? 356 ARG A N     1 
ATOM   2907  C  CA    . ARG A  1  358 ? -27.322 11.297  59.097  1.00 69.34  ? 356 ARG A CA    1 
ATOM   2908  C  C     . ARG A  1  358 ? -28.221 10.442  59.983  1.00 70.72  ? 356 ARG A C     1 
ATOM   2909  O  O     . ARG A  1  358 ? -27.748 9.747   60.888  1.00 66.42  ? 356 ARG A O     1 
ATOM   2910  C  CB    . ARG A  1  358 ? -26.462 10.397  58.211  1.00 71.53  ? 356 ARG A CB    1 
ATOM   2911  C  CG    . ARG A  1  358 ? -27.279 9.378   57.432  1.00 85.80  ? 356 ARG A CG    1 
ATOM   2912  C  CD    . ARG A  1  358 ? -26.425 8.573   56.469  1.00 100.57 ? 356 ARG A CD    1 
ATOM   2913  N  NE    . ARG A  1  358 ? -27.243 7.938   55.439  1.00 112.91 ? 356 ARG A NE    1 
ATOM   2914  C  CZ    . ARG A  1  358 ? -26.757 7.207   54.441  1.00 110.97 ? 356 ARG A CZ    1 
ATOM   2915  N  NH1   . ARG A  1  358 ? -25.451 7.010   54.336  1.00 114.04 ? 356 ARG A NH1   1 
ATOM   2916  N  NH2   . ARG A  1  358 ? -27.578 6.671   53.548  1.00 100.94 ? 356 ARG A NH2   1 
ATOM   2917  N  N     . MET A  1  359 ? -29.524 10.500  59.718  1.00 76.02  ? 357 MET A N     1 
ATOM   2918  C  CA    . MET A  1  359 ? -30.503 9.651   60.387  1.00 87.37  ? 357 MET A CA    1 
ATOM   2919  C  C     . MET A  1  359 ? -30.641 8.364   59.582  1.00 74.93  ? 357 MET A C     1 
ATOM   2920  O  O     . MET A  1  359 ? -31.109 8.385   58.439  1.00 74.23  ? 357 MET A O     1 
ATOM   2921  C  CB    . MET A  1  359 ? -31.844 10.368  60.521  1.00 105.40 ? 357 MET A CB    1 
ATOM   2922  C  CG    . MET A  1  359 ? -32.963 9.496   61.067  1.00 116.76 ? 357 MET A CG    1 
ATOM   2923  S  SD    . MET A  1  359 ? -32.550 8.738   62.648  1.00 121.56 ? 357 MET A SD    1 
ATOM   2924  C  CE    . MET A  1  359 ? -34.116 7.984   63.082  1.00 111.91 ? 357 MET A CE    1 
ATOM   2925  N  N     . ARG A  1  360 ? -30.242 7.243   60.178  1.00 72.16  ? 358 ARG A N     1 
ATOM   2926  C  CA    . ARG A  1  360 ? -30.233 5.951   59.504  1.00 79.37  ? 358 ARG A CA    1 
ATOM   2927  C  C     . ARG A  1  360 ? -31.117 4.982   60.272  1.00 79.86  ? 358 ARG A C     1 
ATOM   2928  O  O     . ARG A  1  360 ? -30.827 4.651   61.427  1.00 80.07  ? 358 ARG A O     1 
ATOM   2929  C  CB    . ARG A  1  360 ? -28.807 5.406   59.396  1.00 86.87  ? 358 ARG A CB    1 
ATOM   2930  C  CG    . ARG A  1  360 ? -28.722 3.908   59.164  1.00 95.43  ? 358 ARG A CG    1 
ATOM   2931  C  CD    . ARG A  1  360 ? -27.278 3.458   59.036  1.00 96.23  ? 358 ARG A CD    1 
ATOM   2932  N  NE    . ARG A  1  360 ? -26.618 4.093   57.900  1.00 98.48  ? 358 ARG A NE    1 
ATOM   2933  C  CZ    . ARG A  1  360 ? -26.715 3.658   56.649  1.00 93.39  ? 358 ARG A CZ    1 
ATOM   2934  N  NH1   . ARG A  1  360 ? -27.446 2.587   56.373  1.00 93.77  ? 358 ARG A NH1   1 
ATOM   2935  N  NH2   . ARG A  1  360 ? -26.083 4.294   55.673  1.00 88.99  ? 358 ARG A NH2   1 
ATOM   2936  N  N     . GLY A  1  361 ? -32.191 4.544   59.639  1.00 81.19  ? 359 GLY A N     1 
ATOM   2937  C  CA    . GLY A  1  361 ? -33.116 3.625   60.266  1.00 63.67  ? 359 GLY A CA    1 
ATOM   2938  C  C     . GLY A  1  361 ? -34.387 4.321   60.709  1.00 62.21  ? 359 GLY A C     1 
ATOM   2939  O  O     . GLY A  1  361 ? -34.412 5.529   60.969  1.00 68.18  ? 359 GLY A O     1 
ATOM   2940  N  N     . ALA A  1  362 ? -35.470 3.549   60.795  1.00 56.22  ? 360 ALA A N     1 
ATOM   2941  C  CA    . ALA A  1  362 ? -36.702 4.085   61.357  1.00 45.69  ? 360 ALA A CA    1 
ATOM   2942  C  C     . ALA A  1  362 ? -36.651 4.104   62.879  1.00 45.62  ? 360 ALA A C     1 
ATOM   2943  O  O     . ALA A  1  362 ? -37.223 5.003   63.506  1.00 50.65  ? 360 ALA A O     1 
ATOM   2944  C  CB    . ALA A  1  362 ? -37.902 3.272   60.873  1.00 43.82  ? 360 ALA A CB    1 
ATOM   2945  N  N     . HIS A  1  363 ? -35.983 3.121   63.479  1.00 43.02  ? 361 HIS A N     1 
ATOM   2946  C  CA    . HIS A  1  363 ? -35.785 3.045   64.919  1.00 39.46  ? 361 HIS A CA    1 
ATOM   2947  C  C     . HIS A  1  363 ? -34.294 2.874   65.175  1.00 53.34  ? 361 HIS A C     1 
ATOM   2948  O  O     . HIS A  1  363 ? -33.648 2.040   64.534  1.00 70.14  ? 361 HIS A O     1 
ATOM   2949  C  CB    . HIS A  1  363 ? -36.581 1.885   65.527  1.00 39.37  ? 361 HIS A CB    1 
ATOM   2950  C  CG    . HIS A  1  363 ? -37.836 1.560   64.777  1.00 40.32  ? 361 HIS A CG    1 
ATOM   2951  N  ND1   . HIS A  1  363 ? -38.939 2.386   64.777  1.00 43.90  ? 361 HIS A ND1   1 
ATOM   2952  C  CD2   . HIS A  1  363 ? -38.159 0.501   63.998  1.00 40.55  ? 361 HIS A CD2   1 
ATOM   2953  C  CE1   . HIS A  1  363 ? -39.889 1.850   64.032  1.00 43.61  ? 361 HIS A CE1   1 
ATOM   2954  N  NE2   . HIS A  1  363 ? -39.441 0.705   63.547  1.00 42.60  ? 361 HIS A NE2   1 
ATOM   2955  N  N     . THR A  1  364 ? -33.753 3.652   66.110  1.00 49.55  ? 362 THR A N     1 
ATOM   2956  C  CA    . THR A  1  364 ? -32.317 3.660   66.362  1.00 52.86  ? 362 THR A CA    1 
ATOM   2957  C  C     . THR A  1  364 ? -32.071 4.096   67.802  1.00 53.36  ? 362 THR A C     1 
ATOM   2958  O  O     . THR A  1  364 ? -33.005 4.399   68.549  1.00 51.42  ? 362 THR A O     1 
ATOM   2959  C  CB    . THR A  1  364 ? -31.586 4.574   65.373  1.00 50.96  ? 362 THR A CB    1 
ATOM   2960  O  OG1   . THR A  1  364 ? -30.170 4.416   65.529  1.00 50.99  ? 362 THR A OG1   1 
ATOM   2961  C  CG2   . THR A  1  364 ? -31.955 6.030   65.621  1.00 50.30  ? 362 THR A CG2   1 
ATOM   2962  N  N     . ASN A  1  365 ? -30.794 4.134   68.187  1.00 40.28  ? 363 ASN A N     1 
ATOM   2963  C  CA    . ASN A  1  365 ? -30.389 4.699   69.467  1.00 44.39  ? 363 ASN A CA    1 
ATOM   2964  C  C     . ASN A  1  365 ? -29.078 5.456   69.289  1.00 46.11  ? 363 ASN A C     1 
ATOM   2965  O  O     . ASN A  1  365 ? -28.487 5.474   68.205  1.00 38.92  ? 363 ASN A O     1 
ATOM   2966  C  CB    . ASN A  1  365 ? -30.276 3.614   70.552  1.00 40.46  ? 363 ASN A CB    1 
ATOM   2967  C  CG    . ASN A  1  365 ? -29.264 2.525   70.211  1.00 43.71  ? 363 ASN A CG    1 
ATOM   2968  O  OD1   . ASN A  1  365 ? -28.194 2.791   69.665  1.00 43.75  ? 363 ASN A OD1   1 
ATOM   2969  N  ND2   . ASN A  1  365 ? -29.602 1.285   70.546  1.00 38.12  ? 363 ASN A ND2   1 
ATOM   2970  N  N     . ASP A  1  366 ? -28.632 6.098   70.372  1.00 43.97  ? 364 ASP A N     1 
ATOM   2971  C  CA    . ASP A  1  366 ? -27.436 6.931   70.308  1.00 36.66  ? 364 ASP A CA    1 
ATOM   2972  C  C     . ASP A  1  366 ? -26.179 6.098   70.104  1.00 44.33  ? 364 ASP A C     1 
ATOM   2973  O  O     . ASP A  1  366 ? -25.242 6.548   69.436  1.00 40.74  ? 364 ASP A O     1 
ATOM   2974  C  CB    . ASP A  1  366 ? -27.313 7.775   71.575  1.00 35.13  ? 364 ASP A CB    1 
ATOM   2975  C  CG    . ASP A  1  366 ? -28.209 8.993   71.551  1.00 39.35  ? 364 ASP A CG    1 
ATOM   2976  O  OD1   . ASP A  1  366 ? -28.500 9.496   70.444  1.00 56.07  ? 364 ASP A OD1   1 
ATOM   2977  O  OD2   . ASP A  1  366 ? -28.620 9.450   72.637  1.00 43.37  ? 364 ASP A OD2   1 
ATOM   2978  N  N     . VAL A  1  367 ? -26.142 4.887   70.664  1.00 46.45  ? 365 VAL A N     1 
ATOM   2979  C  CA    . VAL A  1  367 ? -24.962 4.037   70.531  1.00 39.34  ? 365 VAL A CA    1 
ATOM   2980  C  C     . VAL A  1  367 ? -24.744 3.645   69.074  1.00 37.45  ? 365 VAL A C     1 
ATOM   2981  O  O     . VAL A  1  367 ? -23.607 3.630   68.585  1.00 45.78  ? 365 VAL A O     1 
ATOM   2982  C  CB    . VAL A  1  367 ? -25.085 2.802   71.442  1.00 39.54  ? 365 VAL A CB    1 
ATOM   2983  C  CG1   . VAL A  1  367 ? -23.888 1.889   71.254  1.00 31.40  ? 365 VAL A CG1   1 
ATOM   2984  C  CG2   . VAL A  1  367 ? -25.204 3.226   72.899  1.00 38.97  ? 365 VAL A CG2   1 
ATOM   2985  N  N     . LYS A  1  368 ? -25.824 3.320   68.357  1.00 40.64  ? 366 LYS A N     1 
ATOM   2986  C  CA    . LYS A  1  368 ? -25.692 3.031   66.931  1.00 40.42  ? 366 LYS A CA    1 
ATOM   2987  C  C     . LYS A  1  368 ? -25.174 4.242   66.167  1.00 42.43  ? 366 LYS A C     1 
ATOM   2988  O  O     . LYS A  1  368 ? -24.305 4.113   65.296  1.00 37.45  ? 366 LYS A O     1 
ATOM   2989  C  CB    . LYS A  1  368 ? -27.040 2.611   66.348  1.00 38.67  ? 366 LYS A CB    1 
ATOM   2990  C  CG    . LYS A  1  368 ? -27.557 1.246   66.754  1.00 40.87  ? 366 LYS A CG    1 
ATOM   2991  C  CD    . LYS A  1  368 ? -28.889 1.000   66.062  1.00 52.71  ? 366 LYS A CD    1 
ATOM   2992  C  CE    . LYS A  1  368 ? -29.442 -0.383  66.339  1.00 55.61  ? 366 LYS A CE    1 
ATOM   2993  N  NZ    . LYS A  1  368 ? -30.712 -0.590  65.590  1.00 48.15  ? 366 LYS A NZ    1 
ATOM   2994  N  N     . GLN A  1  369 ? -25.706 5.427   66.472  1.00 38.00  ? 367 GLN A N     1 
ATOM   2995  C  CA    . GLN A  1  369 ? -25.307 6.628   65.747  1.00 45.50  ? 367 GLN A CA    1 
ATOM   2996  C  C     . GLN A  1  369 ? -23.857 6.992   66.039  1.00 42.56  ? 367 GLN A C     1 
ATOM   2997  O  O     . GLN A  1  369 ? -23.135 7.451   65.146  1.00 45.22  ? 367 GLN A O     1 
ATOM   2998  C  CB    . GLN A  1  369 ? -26.248 7.781   66.092  1.00 43.00  ? 367 GLN A CB    1 
ATOM   2999  C  CG    . GLN A  1  369 ? -27.694 7.514   65.704  1.00 45.48  ? 367 GLN A CG    1 
ATOM   3000  C  CD    . GLN A  1  369 ? -28.587 8.724   65.887  1.00 49.87  ? 367 GLN A CD    1 
ATOM   3001  O  OE1   . GLN A  1  369 ? -28.337 9.574   66.742  1.00 63.69  ? 367 GLN A OE1   1 
ATOM   3002  N  NE2   . GLN A  1  369 ? -29.637 8.810   65.078  1.00 67.77  ? 367 GLN A NE2   1 
ATOM   3003  N  N     . LEU A  1  370 ? -23.422 6.816   67.289  1.00 44.82  ? 368 LEU A N     1 
ATOM   3004  C  CA    . LEU A  1  370 ? -22.022 7.056   67.624  1.00 46.16  ? 368 LEU A CA    1 
ATOM   3005  C  C     . LEU A  1  370 ? -21.111 6.118   66.843  1.00 45.21  ? 368 LEU A C     1 
ATOM   3006  O  O     . LEU A  1  370 ? -20.048 6.527   66.362  1.00 51.91  ? 368 LEU A O     1 
ATOM   3007  C  CB    . LEU A  1  370 ? -21.803 6.894   69.128  1.00 39.02  ? 368 LEU A CB    1 
ATOM   3008  C  CG    . LEU A  1  370 ? -20.379 7.146   69.631  1.00 39.26  ? 368 LEU A CG    1 
ATOM   3009  C  CD1   . LEU A  1  370 ? -19.996 8.612   69.479  1.00 34.19  ? 368 LEU A CD1   1 
ATOM   3010  C  CD2   . LEU A  1  370 ? -20.233 6.695   71.072  1.00 31.15  ? 368 LEU A CD2   1 
ATOM   3011  N  N     . THR A  1  371 ? -21.514 4.850   66.714  1.00 40.81  ? 369 THR A N     1 
ATOM   3012  C  CA    . THR A  1  371 ? -20.746 3.896   65.919  1.00 38.15  ? 369 THR A CA    1 
ATOM   3013  C  C     . THR A  1  371 ? -20.666 4.331   64.461  1.00 45.54  ? 369 THR A C     1 
ATOM   3014  O  O     . THR A  1  371 ? -19.615 4.199   63.821  1.00 45.57  ? 369 THR A O     1 
ATOM   3015  C  CB    . THR A  1  371 ? -21.370 2.505   66.029  1.00 32.67  ? 369 THR A CB    1 
ATOM   3016  O  OG1   . THR A  1  371 ? -21.349 2.078   67.395  1.00 35.23  ? 369 THR A OG1   1 
ATOM   3017  C  CG2   . THR A  1  371 ? -20.607 1.502   65.179  1.00 37.58  ? 369 THR A CG2   1 
ATOM   3018  N  N     . GLU A  1  372 ? -21.765 4.862   63.921  1.00 49.21  ? 370 GLU A N     1 
ATOM   3019  C  CA    . GLU A  1  372 ? -21.747 5.365   62.552  1.00 48.10  ? 370 GLU A CA    1 
ATOM   3020  C  C     . GLU A  1  372 ? -20.792 6.544   62.409  1.00 53.69  ? 370 GLU A C     1 
ATOM   3021  O  O     . GLU A  1  372 ? -20.030 6.621   61.438  1.00 63.59  ? 370 GLU A O     1 
ATOM   3022  C  CB    . GLU A  1  372 ? -23.161 5.750   62.121  1.00 43.72  ? 370 GLU A CB    1 
ATOM   3023  C  CG    . GLU A  1  372 ? -24.080 4.552   61.958  1.00 50.06  ? 370 GLU A CG    1 
ATOM   3024  C  CD    . GLU A  1  372 ? -25.545 4.928   61.971  1.00 56.93  ? 370 GLU A CD    1 
ATOM   3025  O  OE1   . GLU A  1  372 ? -25.858 6.129   61.841  1.00 69.19  ? 370 GLU A OE1   1 
ATOM   3026  O  OE2   . GLU A  1  372 ? -26.387 4.017   62.120  1.00 59.26  ? 370 GLU A OE2   1 
ATOM   3027  N  N     . ALA A  1  373 ? -20.834 7.483   63.358  1.00 43.95  ? 371 ALA A N     1 
ATOM   3028  C  CA    . ALA A  1  373 ? -19.957 8.648   63.287  1.00 46.60  ? 371 ALA A CA    1 
ATOM   3029  C  C     . ALA A  1  373 ? -18.491 8.243   63.378  1.00 46.55  ? 371 ALA A C     1 
ATOM   3030  O  O     . ALA A  1  373 ? -17.640 8.801   62.676  1.00 45.74  ? 371 ALA A O     1 
ATOM   3031  C  CB    . ALA A  1  373 ? -20.313 9.640   64.395  1.00 38.38  ? 371 ALA A CB    1 
ATOM   3032  N  N     . VAL A  1  374 ? -18.178 7.274   64.242  1.00 34.20  ? 372 VAL A N     1 
ATOM   3033  C  CA    . VAL A  1  374 ? -16.809 6.776   64.356  1.00 32.78  ? 372 VAL A CA    1 
ATOM   3034  C  C     . VAL A  1  374 ? -16.330 6.213   63.023  1.00 37.75  ? 372 VAL A C     1 
ATOM   3035  O  O     . VAL A  1  374 ? -15.194 6.459   62.598  1.00 49.38  ? 372 VAL A O     1 
ATOM   3036  C  CB    . VAL A  1  374 ? -16.719 5.728   65.482  1.00 30.00  ? 372 VAL A CB    1 
ATOM   3037  C  CG1   . VAL A  1  374 ? -15.470 4.875   65.330  1.00 32.92  ? 372 VAL A CG1   1 
ATOM   3038  C  CG2   . VAL A  1  374 ? -16.734 6.410   66.841  1.00 30.32  ? 372 VAL A CG2   1 
ATOM   3039  N  N     . GLN A  1  375 ? -17.193 5.460   62.338  1.00 35.52  ? 373 GLN A N     1 
ATOM   3040  C  CA    . GLN A  1  375 ? -16.825 4.890   61.046  1.00 38.15  ? 373 GLN A CA    1 
ATOM   3041  C  C     . GLN A  1  375 ? -16.602 5.975   59.998  1.00 41.48  ? 373 GLN A C     1 
ATOM   3042  O  O     . GLN A  1  375 ? -15.659 5.888   59.203  1.00 48.28  ? 373 GLN A O     1 
ATOM   3043  C  CB    . GLN A  1  375 ? -17.894 3.895   60.597  1.00 30.40  ? 373 GLN A CB    1 
ATOM   3044  C  CG    . GLN A  1  375 ? -17.936 2.647   61.466  1.00 46.09  ? 373 GLN A CG    1 
ATOM   3045  C  CD    . GLN A  1  375 ? -19.226 1.866   61.324  1.00 44.70  ? 373 GLN A CD    1 
ATOM   3046  O  OE1   . GLN A  1  375 ? -20.100 2.224   60.536  1.00 41.99  ? 373 GLN A OE1   1 
ATOM   3047  N  NE2   . GLN A  1  375 ? -19.353 0.793   62.096  1.00 38.91  ? 373 GLN A NE2   1 
ATOM   3048  N  N     . LYS A  1  376 ? -17.479 6.982   59.951  1.00 34.44  ? 374 LYS A N     1 
ATOM   3049  C  CA    . LYS A  1  376 ? -17.297 8.069   58.993  1.00 39.84  ? 374 LYS A CA    1 
ATOM   3050  C  C     . LYS A  1  376 ? -15.990 8.811   59.245  1.00 46.12  ? 374 LYS A C     1 
ATOM   3051  O  O     . LYS A  1  376 ? -15.287 9.190   58.300  1.00 54.29  ? 374 LYS A O     1 
ATOM   3052  C  CB    . LYS A  1  376 ? -18.480 9.036   59.059  1.00 46.31  ? 374 LYS A CB    1 
ATOM   3053  C  CG    . LYS A  1  376 ? -18.198 10.395  58.433  1.00 66.49  ? 374 LYS A CG    1 
ATOM   3054  C  CD    . LYS A  1  376 ? -19.461 11.228  58.290  1.00 78.78  ? 374 LYS A CD    1 
ATOM   3055  C  CE    . LYS A  1  376 ? -19.150 12.615  57.746  1.00 85.12  ? 374 LYS A CE    1 
ATOM   3056  N  NZ    . LYS A  1  376 ? -18.338 13.421  58.700  1.00 90.70  ? 374 LYS A NZ    1 
ATOM   3057  N  N     . ILE A  1  377 ? -15.651 9.032   60.517  1.00 36.34  ? 375 ILE A N     1 
ATOM   3058  C  CA    . ILE A  1  377 ? -14.393 9.690   60.856  1.00 38.71  ? 375 ILE A CA    1 
ATOM   3059  C  C     . ILE A  1  377 ? -13.208 8.826   60.444  1.00 44.89  ? 375 ILE A C     1 
ATOM   3060  O  O     . ILE A  1  377 ? -12.213 9.330   59.908  1.00 47.10  ? 375 ILE A O     1 
ATOM   3061  C  CB    . ILE A  1  377 ? -14.361 10.030  62.356  1.00 38.92  ? 375 ILE A CB    1 
ATOM   3062  C  CG1   . ILE A  1  377 ? -15.426 11.076  62.683  1.00 41.40  ? 375 ILE A CG1   1 
ATOM   3063  C  CG2   . ILE A  1  377 ? -12.984 10.531  62.766  1.00 33.68  ? 375 ILE A CG2   1 
ATOM   3064  C  CD1   . ILE A  1  377 ? -15.646 11.258  64.154  1.00 41.45  ? 375 ILE A CD1   1 
ATOM   3065  N  N     . THR A  1  378 ? -13.291 7.517   60.696  1.00 32.32  ? 376 THR A N     1 
ATOM   3066  C  CA    . THR A  1  378 ? -12.179 6.625   60.381  1.00 32.31  ? 376 THR A CA    1 
ATOM   3067  C  C     . THR A  1  378 ? -11.870 6.637   58.888  1.00 33.01  ? 376 THR A C     1 
ATOM   3068  O  O     . THR A  1  378 ? -10.707 6.748   58.484  1.00 46.62  ? 376 THR A O     1 
ATOM   3069  C  CB    . THR A  1  378 ? -12.494 5.205   60.851  1.00 31.55  ? 376 THR A CB    1 
ATOM   3070  O  OG1   . THR A  1  378 ? -12.554 5.170   62.282  1.00 37.15  ? 376 THR A OG1   1 
ATOM   3071  C  CG2   . THR A  1  378 ? -11.420 4.245   60.375  1.00 31.85  ? 376 THR A CG2   1 
ATOM   3072  N  N     . THR A  1  379 ? -12.906 6.530   58.051  1.00 34.54  ? 377 THR A N     1 
ATOM   3073  C  CA    . THR A  1  379 ? -12.684 6.531   56.608  1.00 37.60  ? 377 THR A CA    1 
ATOM   3074  C  C     . THR A  1  379 ? -12.145 7.877   56.142  1.00 51.31  ? 377 THR A C     1 
ATOM   3075  O  O     . THR A  1  379 ? -11.248 7.934   55.293  1.00 50.47  ? 377 THR A O     1 
ATOM   3076  C  CB    . THR A  1  379 ? -13.980 6.189   55.870  1.00 39.60  ? 377 THR A CB    1 
ATOM   3077  O  OG1   . THR A  1  379 ? -14.451 4.905   56.295  1.00 60.85  ? 377 THR A OG1   1 
ATOM   3078  C  CG2   . THR A  1  379 ? -13.750 6.162   54.366  1.00 36.51  ? 377 THR A CG2   1 
ATOM   3079  N  N     . GLU A  1  380 ? -12.694 8.970   56.675  1.00 48.72  ? 378 GLU A N     1 
ATOM   3080  C  CA    . GLU A  1  380 ? -12.200 10.297  56.326  1.00 40.13  ? 378 GLU A CA    1 
ATOM   3081  C  C     . GLU A  1  380 ? -10.736 10.456  56.720  1.00 47.37  ? 378 GLU A C     1 
ATOM   3082  O  O     . GLU A  1  380 ? -9.941  11.033  55.969  1.00 53.47  ? 378 GLU A O     1 
ATOM   3083  C  CB    . GLU A  1  380 ? -13.065 11.359  57.003  1.00 46.53  ? 378 GLU A CB    1 
ATOM   3084  C  CG    . GLU A  1  380 ? -12.485 12.762  57.002  1.00 64.95  ? 378 GLU A CG    1 
ATOM   3085  C  CD    . GLU A  1  380 ? -13.393 13.757  57.703  1.00 81.10  ? 378 GLU A CD    1 
ATOM   3086  O  OE1   . GLU A  1  380 ? -14.561 13.406  57.977  1.00 90.09  ? 378 GLU A OE1   1 
ATOM   3087  O  OE2   . GLU A  1  380 ? -12.943 14.887  57.984  1.00 83.03  ? 378 GLU A OE2   1 
ATOM   3088  N  N     . SER A  1  381 ? -10.369 9.965   57.907  1.00 41.08  ? 379 SER A N     1 
ATOM   3089  C  CA    . SER A  1  381 ? -8.991  10.083  58.372  1.00 44.07  ? 379 SER A CA    1 
ATOM   3090  C  C     . SER A  1  381 ? -8.035  9.295   57.484  1.00 48.80  ? 379 SER A C     1 
ATOM   3091  O  O     . SER A  1  381 ? -6.934  9.765   57.175  1.00 48.82  ? 379 SER A O     1 
ATOM   3092  C  CB    . SER A  1  381 ? -8.882  9.619   59.823  1.00 44.01  ? 379 SER A CB    1 
ATOM   3093  O  OG    . SER A  1  381 ? -9.591  10.484  60.694  1.00 48.26  ? 379 SER A OG    1 
ATOM   3094  N  N     . ILE A  1  382 ? -8.438  8.090   57.069  1.00 35.87  ? 380 ILE A N     1 
ATOM   3095  C  CA    . ILE A  1  382 ? -7.575  7.251   56.239  1.00 37.41  ? 380 ILE A CA    1 
ATOM   3096  C  C     . ILE A  1  382 ? -7.310  7.922   54.896  1.00 46.00  ? 380 ILE A C     1 
ATOM   3097  O  O     . ILE A  1  382 ? -6.208  7.825   54.343  1.00 55.73  ? 380 ILE A O     1 
ATOM   3098  C  CB    . ILE A  1  382 ? -8.196  5.849   56.073  1.00 38.61  ? 380 ILE A CB    1 
ATOM   3099  C  CG1   . ILE A  1  382 ? -8.105  5.069   57.390  1.00 40.63  ? 380 ILE A CG1   1 
ATOM   3100  C  CG2   . ILE A  1  382 ? -7.527  5.077   54.941  1.00 36.65  ? 380 ILE A CG2   1 
ATOM   3101  C  CD1   . ILE A  1  382 ? -8.600  3.636   57.302  1.00 51.73  ? 380 ILE A CD1   1 
ATOM   3102  N  N     . VAL A  1  383 ? -8.311  8.610   54.348  1.00 42.00  ? 381 VAL A N     1 
ATOM   3103  C  CA    . VAL A  1  383 ? -8.107  9.351   53.106  1.00 45.45  ? 381 VAL A CA    1 
ATOM   3104  C  C     . VAL A  1  383 ? -7.075  10.455  53.310  1.00 51.00  ? 381 VAL A C     1 
ATOM   3105  O  O     . VAL A  1  383 ? -6.107  10.577  52.549  1.00 66.35  ? 381 VAL A O     1 
ATOM   3106  C  CB    . VAL A  1  383 ? -9.443  9.921   52.596  1.00 45.11  ? 381 VAL A CB    1 
ATOM   3107  C  CG1   . VAL A  1  383 ? -9.216  10.812  51.384  1.00 48.39  ? 381 VAL A CG1   1 
ATOM   3108  C  CG2   . VAL A  1  383 ? -10.408 8.799   52.263  1.00 42.42  ? 381 VAL A CG2   1 
ATOM   3109  N  N     . ILE A  1  384 ? -7.267  11.271  54.348  1.00 45.88  ? 382 ILE A N     1 
ATOM   3110  C  CA    . ILE A  1  384 ? -6.423  12.446  54.546  1.00 50.65  ? 382 ILE A CA    1 
ATOM   3111  C  C     . ILE A  1  384 ? -5.038  12.058  55.060  1.00 53.14  ? 382 ILE A C     1 
ATOM   3112  O  O     . ILE A  1  384 ? -4.021  12.561  54.568  1.00 58.42  ? 382 ILE A O     1 
ATOM   3113  C  CB    . ILE A  1  384 ? -7.125  13.443  55.485  1.00 49.63  ? 382 ILE A CB    1 
ATOM   3114  C  CG1   . ILE A  1  384 ? -8.432  13.932  54.853  1.00 41.84  ? 382 ILE A CG1   1 
ATOM   3115  C  CG2   . ILE A  1  384 ? -6.213  14.617  55.800  1.00 53.60  ? 382 ILE A CG2   1 
ATOM   3116  C  CD1   . ILE A  1  384 ? -9.208  14.910  55.711  1.00 45.14  ? 382 ILE A CD1   1 
ATOM   3117  N  N     . TRP A  1  385 ? -4.966  11.155  56.043  1.00 57.13  ? 383 TRP A N     1 
ATOM   3118  C  CA    . TRP A  1  385 ? -3.696  10.842  56.687  1.00 40.34  ? 383 TRP A CA    1 
ATOM   3119  C  C     . TRP A  1  385 ? -3.251  9.394   56.545  1.00 44.27  ? 383 TRP A C     1 
ATOM   3120  O  O     . TRP A  1  385 ? -2.105  9.088   56.894  1.00 52.99  ? 383 TRP A O     1 
ATOM   3121  C  CB    . TRP A  1  385 ? -3.747  11.178  58.188  1.00 49.89  ? 383 TRP A CB    1 
ATOM   3122  C  CG    . TRP A  1  385 ? -4.109  12.597  58.507  1.00 50.52  ? 383 TRP A CG    1 
ATOM   3123  C  CD1   . TRP A  1  385 ? -3.295  13.690  58.437  1.00 56.05  ? 383 TRP A CD1   1 
ATOM   3124  C  CD2   . TRP A  1  385 ? -5.378  13.071  58.970  1.00 48.71  ? 383 TRP A CD2   1 
ATOM   3125  N  NE1   . TRP A  1  385 ? -3.983  14.818  58.818  1.00 52.98  ? 383 TRP A NE1   1 
ATOM   3126  C  CE2   . TRP A  1  385 ? -5.264  14.464  59.151  1.00 48.60  ? 383 TRP A CE2   1 
ATOM   3127  C  CE3   . TRP A  1  385 ? -6.601  12.454  59.245  1.00 44.06  ? 383 TRP A CE3   1 
ATOM   3128  C  CZ2   . TRP A  1  385 ? -6.328  15.248  59.593  1.00 51.71  ? 383 TRP A CZ2   1 
ATOM   3129  C  CZ3   . TRP A  1  385 ? -7.655  13.234  59.683  1.00 51.48  ? 383 TRP A CZ3   1 
ATOM   3130  C  CH2   . TRP A  1  385 ? -7.512  14.616  59.853  1.00 54.93  ? 383 TRP A CH2   1 
ATOM   3131  N  N     . GLY A  1  386 ? -4.106  8.497   56.062  1.00 43.87  ? 384 GLY A N     1 
ATOM   3132  C  CA    . GLY A  1  386 ? -3.710  7.108   55.932  1.00 39.16  ? 384 GLY A CA    1 
ATOM   3133  C  C     . GLY A  1  386 ? -3.613  6.337   57.227  1.00 49.06  ? 384 GLY A C     1 
ATOM   3134  O  O     . GLY A  1  386 ? -2.971  5.285   57.260  1.00 53.54  ? 384 GLY A O     1 
ATOM   3135  N  N     . LYS A  1  387 ? -4.238  6.821   58.299  1.00 48.91  ? 385 LYS A N     1 
ATOM   3136  C  CA    . LYS A  1  387 ? -4.284  6.079   59.551  1.00 48.20  ? 385 LYS A CA    1 
ATOM   3137  C  C     . LYS A  1  387 ? -5.550  6.451   60.308  1.00 50.45  ? 385 LYS A C     1 
ATOM   3138  O  O     . LYS A  1  387 ? -6.214  7.445   60.004  1.00 51.97  ? 385 LYS A O     1 
ATOM   3139  C  CB    . LYS A  1  387 ? -3.044  6.354   60.412  1.00 49.09  ? 385 LYS A CB    1 
ATOM   3140  C  CG    . LYS A  1  387 ? -2.813  7.832   60.706  1.00 49.00  ? 385 LYS A CG    1 
ATOM   3141  C  CD    . LYS A  1  387 ? -1.690  8.055   61.712  1.00 64.79  ? 385 LYS A CD    1 
ATOM   3142  C  CE    . LYS A  1  387 ? -2.208  8.060   63.147  1.00 75.72  ? 385 LYS A CE    1 
ATOM   3143  N  NZ    . LYS A  1  387 ? -1.146  8.425   64.128  1.00 86.62  ? 385 LYS A NZ    1 
ATOM   3144  N  N     . THR A  1  388 ? -5.875  5.632   61.318  1.00 50.10  ? 386 THR A N     1 
ATOM   3145  C  CA    . THR A  1  388 ? -7.072  5.829   62.124  1.00 34.24  ? 386 THR A CA    1 
ATOM   3146  C  C     . THR A  1  388 ? -6.715  6.602   63.382  1.00 34.60  ? 386 THR A C     1 
ATOM   3147  O  O     . THR A  1  388 ? -5.765  6.223   64.082  1.00 51.86  ? 386 THR A O     1 
ATOM   3148  C  CB    . THR A  1  388 ? -7.693  4.484   62.499  1.00 35.23  ? 386 THR A CB    1 
ATOM   3149  O  OG1   . THR A  1  388 ? -8.108  3.801   61.309  1.00 43.90  ? 386 THR A OG1   1 
ATOM   3150  C  CG2   . THR A  1  388 ? -8.894  4.678   63.415  1.00 38.21  ? 386 THR A CG2   1 
ATOM   3151  N  N     . PRO A  1  389 ? -7.425  7.681   63.701  1.00 36.95  ? 387 PRO A N     1 
ATOM   3152  C  CA    . PRO A  1  389 ? -7.130  8.415   64.935  1.00 42.32  ? 387 PRO A CA    1 
ATOM   3153  C  C     . PRO A  1  389 ? -7.549  7.631   66.166  1.00 35.79  ? 387 PRO A C     1 
ATOM   3154  O  O     . PRO A  1  389 ? -8.452  6.792   66.123  1.00 41.12  ? 387 PRO A O     1 
ATOM   3155  C  CB    . PRO A  1  389 ? -7.956  9.695   64.786  1.00 37.52  ? 387 PRO A CB    1 
ATOM   3156  C  CG    . PRO A  1  389 ? -9.120  9.269   63.952  1.00 34.18  ? 387 PRO A CG    1 
ATOM   3157  C  CD    . PRO A  1  389 ? -8.591  8.236   62.993  1.00 34.02  ? 387 PRO A CD    1 
ATOM   3158  N  N     . LYS A  1  390 ? -6.880  7.918   67.278  1.00 38.02  ? 388 LYS A N     1 
ATOM   3159  C  CA    . LYS A  1  390 ? -7.383  7.474   68.568  1.00 39.41  ? 388 LYS A CA    1 
ATOM   3160  C  C     . LYS A  1  390 ? -8.637  8.269   68.909  1.00 46.03  ? 388 LYS A C     1 
ATOM   3161  O  O     . LYS A  1  390 ? -8.733  9.463   68.613  1.00 56.80  ? 388 LYS A O     1 
ATOM   3162  C  CB    . LYS A  1  390 ? -6.315  7.655   69.645  1.00 53.87  ? 388 LYS A CB    1 
ATOM   3163  C  CG    . LYS A  1  390 ? -6.175  6.475   70.592  1.00 79.66  ? 388 LYS A CG    1 
ATOM   3164  C  CD    . LYS A  1  390 ? -6.880  6.723   71.911  1.00 89.35  ? 388 LYS A CD    1 
ATOM   3165  C  CE    . LYS A  1  390 ? -6.554  5.631   72.918  1.00 93.52  ? 388 LYS A CE    1 
ATOM   3166  N  NZ    . LYS A  1  390 ? -7.214  5.882   74.225  1.00 96.45  ? 388 LYS A NZ    1 
ATOM   3167  N  N     . PHE A  1  391 ? -9.606  7.608   69.529  1.00 46.24  ? 389 PHE A N     1 
ATOM   3168  C  CA    . PHE A  1  391 ? -10.922 8.196   69.727  1.00 41.00  ? 389 PHE A CA    1 
ATOM   3169  C  C     . PHE A  1  391 ? -11.154 8.549   71.189  1.00 40.24  ? 389 PHE A C     1 
ATOM   3170  O  O     . PHE A  1  391 ? -10.802 7.783   72.091  1.00 43.42  ? 389 PHE A O     1 
ATOM   3171  C  CB    . PHE A  1  391 ? -12.020 7.246   69.238  1.00 32.49  ? 389 PHE A CB    1 
ATOM   3172  C  CG    . PHE A  1  391 ? -12.256 7.303   67.752  1.00 32.03  ? 389 PHE A CG    1 
ATOM   3173  C  CD1   . PHE A  1  391 ? -13.009 8.327   67.199  1.00 41.60  ? 389 PHE A CD1   1 
ATOM   3174  C  CD2   . PHE A  1  391 ? -11.733 6.333   66.908  1.00 37.21  ? 389 PHE A CD2   1 
ATOM   3175  C  CE1   . PHE A  1  391 ? -13.233 8.388   65.833  1.00 38.05  ? 389 PHE A CE1   1 
ATOM   3176  C  CE2   . PHE A  1  391 ? -11.955 6.388   65.539  1.00 31.51  ? 389 PHE A CE2   1 
ATOM   3177  C  CZ    . PHE A  1  391 ? -12.707 7.417   65.003  1.00 32.59  ? 389 PHE A CZ    1 
ATOM   3178  N  N     . LYS A  1  392 ? -11.734 9.723   71.413  1.00 39.58  ? 390 LYS A N     1 
ATOM   3179  C  CA    . LYS A  1  392 ? -12.245 10.134  72.715  1.00 48.68  ? 390 LYS A CA    1 
ATOM   3180  C  C     . LYS A  1  392 ? -13.760 10.219  72.612  1.00 45.28  ? 390 LYS A C     1 
ATOM   3181  O  O     . LYS A  1  392 ? -14.287 11.043  71.858  1.00 45.08  ? 390 LYS A O     1 
ATOM   3182  C  CB    . LYS A  1  392 ? -11.654 11.474  73.151  1.00 48.39  ? 390 LYS A CB    1 
ATOM   3183  C  CG    . LYS A  1  392 ? -10.162 11.438  73.427  1.00 51.32  ? 390 LYS A CG    1 
ATOM   3184  C  CD    . LYS A  1  392 ? -9.702  12.710  74.117  1.00 71.95  ? 390 LYS A CD    1 
ATOM   3185  C  CE    . LYS A  1  392 ? -8.197  12.708  74.345  1.00 83.37  ? 390 LYS A CE    1 
ATOM   3186  N  NZ    . LYS A  1  392 ? -7.754  11.551  75.171  1.00 83.99  ? 390 LYS A NZ    1 
ATOM   3187  N  N     . LEU A  1  393 ? -14.458 9.378   73.373  1.00 43.39  ? 391 LEU A N     1 
ATOM   3188  C  CA    . LEU A  1  393 ? -15.876 9.180   73.144  1.00 44.17  ? 391 LEU A CA    1 
ATOM   3189  C  C     . LEU A  1  393 ? -16.675 9.455   74.412  1.00 44.38  ? 391 LEU A C     1 
ATOM   3190  O  O     . LEU A  1  393 ? -16.271 9.038   75.504  1.00 42.34  ? 391 LEU A O     1 
ATOM   3191  C  CB    . LEU A  1  393 ? -16.151 7.740   72.677  1.00 39.74  ? 391 LEU A CB    1 
ATOM   3192  C  CG    . LEU A  1  393 ? -16.249 7.415   71.183  1.00 45.98  ? 391 LEU A CG    1 
ATOM   3193  C  CD1   . LEU A  1  393 ? -15.294 8.251   70.347  1.00 37.69  ? 391 LEU A CD1   1 
ATOM   3194  C  CD2   . LEU A  1  393 ? -16.010 5.928   70.958  1.00 40.83  ? 391 LEU A CD2   1 
ATOM   3195  N  N     . PRO A  1  394 ? -17.814 10.164  74.302  1.00 41.40  ? 392 PRO A N     1 
ATOM   3196  C  CA    . PRO A  1  394 ? -18.667 10.468  75.457  1.00 35.89  ? 392 PRO A CA    1 
ATOM   3197  C  C     . PRO A  1  394 ? -19.570 9.304   75.866  1.00 47.27  ? 392 PRO A C     1 
ATOM   3198  O  O     . PRO A  1  394 ? -20.772 9.471   76.081  1.00 60.74  ? 392 PRO A O     1 
ATOM   3199  C  CB    . PRO A  1  394 ? -19.477 11.672  74.969  1.00 37.13  ? 392 PRO A CB    1 
ATOM   3200  C  CG    . PRO A  1  394 ? -19.617 11.435  73.508  1.00 35.96  ? 392 PRO A CG    1 
ATOM   3201  C  CD    . PRO A  1  394 ? -18.347 10.748  73.058  1.00 44.92  ? 392 PRO A CD    1 
ATOM   3202  N  N     . ILE A  1  395 ? -18.985 8.113   75.967  1.00 41.36  ? 393 ILE A N     1 
ATOM   3203  C  CA    . ILE A  1  395 ? -19.713 6.903   76.335  1.00 41.91  ? 393 ILE A CA    1 
ATOM   3204  C  C     . ILE A  1  395 ? -18.860 6.105   77.312  1.00 36.53  ? 393 ILE A C     1 
ATOM   3205  O  O     . ILE A  1  395 ? -17.669 5.886   77.070  1.00 52.39  ? 393 ILE A O     1 
ATOM   3206  C  CB    . ILE A  1  395 ? -20.081 6.053   75.100  1.00 39.48  ? 393 ILE A CB    1 
ATOM   3207  C  CG1   . ILE A  1  395 ? -20.781 4.759   75.521  1.00 45.48  ? 393 ILE A CG1   1 
ATOM   3208  C  CG2   . ILE A  1  395 ? -18.849 5.754   74.249  1.00 35.37  ? 393 ILE A CG2   1 
ATOM   3209  C  CD1   . ILE A  1  395 ? -21.234 3.905   74.352  1.00 31.23  ? 393 ILE A CD1   1 
ATOM   3210  N  N     . GLN A  1  396 ? -19.462 5.697   78.427  1.00 41.79  ? 394 GLN A N     1 
ATOM   3211  C  CA    . GLN A  1  396 ? -18.751 4.890   79.410  1.00 48.07  ? 394 GLN A CA    1 
ATOM   3212  C  C     . GLN A  1  396 ? -18.244 3.593   78.784  1.00 45.55  ? 394 GLN A C     1 
ATOM   3213  O  O     . GLN A  1  396 ? -18.860 3.028   77.876  1.00 46.35  ? 394 GLN A O     1 
ATOM   3214  C  CB    . GLN A  1  396 ? -19.659 4.580   80.602  1.00 53.84  ? 394 GLN A CB    1 
ATOM   3215  C  CG    . GLN A  1  396 ? -18.949 4.606   81.953  1.00 65.88  ? 394 GLN A CG    1 
ATOM   3216  C  CD    . GLN A  1  396 ? -18.585 6.012   82.394  1.00 72.74  ? 394 GLN A CD    1 
ATOM   3217  O  OE1   . GLN A  1  396 ? -19.379 6.942   82.255  1.00 78.52  ? 394 GLN A OE1   1 
ATOM   3218  N  NE2   . GLN A  1  396 ? -17.376 6.175   82.921  1.00 70.07  ? 394 GLN A NE2   1 
ATOM   3219  N  N     . LYS A  1  397 ? -17.087 3.136   79.272  1.00 51.63  ? 395 LYS A N     1 
ATOM   3220  C  CA    . LYS A  1  397 ? -16.520 1.877   78.801  1.00 34.96  ? 395 LYS A CA    1 
ATOM   3221  C  C     . LYS A  1  397 ? -17.463 0.704   79.048  1.00 45.99  ? 395 LYS A C     1 
ATOM   3222  O  O     . LYS A  1  397 ? -17.489 -0.248  78.260  1.00 48.59  ? 395 LYS A O     1 
ATOM   3223  C  CB    . LYS A  1  397 ? -15.172 1.629   79.483  1.00 39.52  ? 395 LYS A CB    1 
ATOM   3224  C  CG    . LYS A  1  397 ? -14.120 0.970   78.605  1.00 55.68  ? 395 LYS A CG    1 
ATOM   3225  C  CD    . LYS A  1  397 ? -13.575 1.930   77.559  1.00 52.06  ? 395 LYS A CD    1 
ATOM   3226  C  CE    . LYS A  1  397 ? -12.527 1.256   76.688  1.00 53.80  ? 395 LYS A CE    1 
ATOM   3227  N  NZ    . LYS A  1  397 ? -12.069 2.139   75.581  1.00 53.19  ? 395 LYS A NZ    1 
ATOM   3228  N  N     . GLU A  1  398 ? -18.247 0.755   80.128  1.00 53.00  ? 396 GLU A N     1 
ATOM   3229  C  CA    . GLU A  1  398 ? -19.161 -0.341  80.439  1.00 46.56  ? 396 GLU A CA    1 
ATOM   3230  C  C     . GLU A  1  398 ? -20.430 -0.291  79.596  1.00 45.73  ? 396 GLU A C     1 
ATOM   3231  O  O     . GLU A  1  398 ? -20.963 -1.341  79.218  1.00 40.42  ? 396 GLU A O     1 
ATOM   3232  C  CB    . GLU A  1  398 ? -19.517 -0.326  81.925  1.00 51.20  ? 396 GLU A CB    1 
ATOM   3233  C  CG    . GLU A  1  398 ? -18.357 -0.655  82.851  1.00 83.96  ? 396 GLU A CG    1 
ATOM   3234  C  CD    . GLU A  1  398 ? -18.821 -1.049  84.239  1.00 104.81 ? 396 GLU A CD    1 
ATOM   3235  O  OE1   . GLU A  1  398 ? -20.048 -1.140  84.449  1.00 116.25 ? 396 GLU A OE1   1 
ATOM   3236  O  OE2   . GLU A  1  398 ? -17.959 -1.270  85.116  1.00 103.17 ? 396 GLU A OE2   1 
ATOM   3237  N  N     . THR A  1  399 ? -20.933 0.912   79.303  1.00 34.09  ? 397 THR A N     1 
ATOM   3238  C  CA    . THR A  1  399 ? -22.056 1.045   78.377  1.00 33.14  ? 397 THR A CA    1 
ATOM   3239  C  C     . THR A  1  399 ? -21.734 0.398   77.037  1.00 35.18  ? 397 THR A C     1 
ATOM   3240  O  O     . THR A  1  399 ? -22.519 -0.403  76.515  1.00 36.21  ? 397 THR A O     1 
ATOM   3241  C  CB    . THR A  1  399 ? -22.419 2.519   78.187  1.00 36.42  ? 397 THR A CB    1 
ATOM   3242  O  OG1   . THR A  1  399 ? -22.738 3.111   79.453  1.00 40.12  ? 397 THR A OG1   1 
ATOM   3243  C  CG2   . THR A  1  399 ? -23.611 2.649   77.250  1.00 34.68  ? 397 THR A CG2   1 
ATOM   3244  N  N     . TRP A  1  400 ? -20.593 0.763   76.449  1.00 37.18  ? 398 TRP A N     1 
ATOM   3245  C  CA    . TRP A  1  400 ? -20.192 0.179   75.174  1.00 38.41  ? 398 TRP A CA    1 
ATOM   3246  C  C     . TRP A  1  400 ? -20.027 -1.331  75.282  1.00 34.32  ? 398 TRP A C     1 
ATOM   3247  O  O     . TRP A  1  400 ? -20.458 -2.077  74.394  1.00 30.91  ? 398 TRP A O     1 
ATOM   3248  C  CB    . TRP A  1  400 ? -18.893 0.814   74.682  1.00 39.95  ? 398 TRP A CB    1 
ATOM   3249  C  CG    . TRP A  1  400 ? -18.378 0.135   73.461  1.00 39.98  ? 398 TRP A CG    1 
ATOM   3250  C  CD1   . TRP A  1  400 ? -17.255 -0.633  73.358  1.00 30.57  ? 398 TRP A CD1   1 
ATOM   3251  C  CD2   . TRP A  1  400 ? -18.988 0.130   72.167  1.00 33.10  ? 398 TRP A CD2   1 
ATOM   3252  N  NE1   . TRP A  1  400 ? -17.119 -1.100  72.074  1.00 49.33  ? 398 TRP A NE1   1 
ATOM   3253  C  CE2   . TRP A  1  400 ? -18.172 -0.646  71.323  1.00 33.63  ? 398 TRP A CE2   1 
ATOM   3254  C  CE3   . TRP A  1  400 ? -20.142 0.716   71.637  1.00 29.26  ? 398 TRP A CE3   1 
ATOM   3255  C  CZ2   . TRP A  1  400 ? -18.473 -0.854  69.980  1.00 36.49  ? 398 TRP A CZ2   1 
ATOM   3256  C  CZ3   . TRP A  1  400 ? -20.439 0.509   70.305  1.00 38.57  ? 398 TRP A CZ3   1 
ATOM   3257  C  CH2   . TRP A  1  400 ? -19.608 -0.269  69.491  1.00 34.95  ? 398 TRP A CH2   1 
ATOM   3258  N  N     . GLU A  1  401 ? -19.382 -1.796  76.355  1.00 35.72  ? 399 GLU A N     1 
ATOM   3259  C  CA    . GLU A  1  401 ? -19.223 -3.230  76.569  1.00 42.62  ? 399 GLU A CA    1 
ATOM   3260  C  C     . GLU A  1  401 ? -20.572 -3.932  76.661  1.00 49.91  ? 399 GLU A C     1 
ATOM   3261  O  O     . GLU A  1  401 ? -20.754 -5.020  76.103  1.00 43.58  ? 399 GLU A O     1 
ATOM   3262  C  CB    . GLU A  1  401 ? -18.409 -3.477  77.838  1.00 44.98  ? 399 GLU A CB    1 
ATOM   3263  C  CG    . GLU A  1  401 ? -18.180 -4.938  78.158  1.00 62.53  ? 399 GLU A CG    1 
ATOM   3264  C  CD    . GLU A  1  401 ? -16.950 -5.497  77.476  1.00 86.23  ? 399 GLU A CD    1 
ATOM   3265  O  OE1   . GLU A  1  401 ? -16.229 -4.721  76.814  1.00 91.00  ? 399 GLU A OE1   1 
ATOM   3266  O  OE2   . GLU A  1  401 ? -16.702 -6.713  77.610  1.00 90.17  ? 399 GLU A OE2   1 
ATOM   3267  N  N     . THR A  1  402 ? -21.535 -3.318  77.352  1.00 49.78  ? 400 THR A N     1 
ATOM   3268  C  CA    . THR A  1  402 ? -22.866 -3.909  77.462  1.00 36.91  ? 400 THR A CA    1 
ATOM   3269  C  C     . THR A  1  402 ? -23.554 -3.985  76.105  1.00 35.93  ? 400 THR A C     1 
ATOM   3270  O  O     . THR A  1  402 ? -24.144 -5.014  75.753  1.00 36.69  ? 400 THR A O     1 
ATOM   3271  C  CB    . THR A  1  402 ? -23.721 -3.109  78.446  1.00 44.77  ? 400 THR A CB    1 
ATOM   3272  O  OG1   . THR A  1  402 ? -23.235 -3.308  79.778  1.00 36.83  ? 400 THR A OG1   1 
ATOM   3273  C  CG2   . THR A  1  402 ? -25.178 -3.552  78.370  1.00 32.99  ? 400 THR A CG2   1 
ATOM   3274  N  N     . TRP A  1  403 ? -23.500 -2.898  75.332  1.00 30.82  ? 401 TRP A N     1 
ATOM   3275  C  CA    . TRP A  1  403 ? -24.111 -2.891  74.005  1.00 30.16  ? 401 TRP A CA    1 
ATOM   3276  C  C     . TRP A  1  403 ? -23.516 -3.957  73.092  1.00 42.80  ? 401 TRP A C     1 
ATOM   3277  O  O     . TRP A  1  403 ? -24.228 -4.847  72.614  1.00 38.11  ? 401 TRP A O     1 
ATOM   3278  C  CB    . TRP A  1  403 ? -23.973 -1.512  73.361  1.00 29.83  ? 401 TRP A CB    1 
ATOM   3279  C  CG    . TRP A  1  403 ? -24.353 -1.527  71.907  1.00 33.07  ? 401 TRP A CG    1 
ATOM   3280  C  CD1   . TRP A  1  403 ? -23.509 -1.465  70.835  1.00 35.65  ? 401 TRP A CD1   1 
ATOM   3281  C  CD2   . TRP A  1  403 ? -25.677 -1.644  71.369  1.00 39.25  ? 401 TRP A CD2   1 
ATOM   3282  N  NE1   . TRP A  1  403 ? -24.228 -1.518  69.664  1.00 38.34  ? 401 TRP A NE1   1 
ATOM   3283  C  CE2   . TRP A  1  403 ? -25.560 -1.629  69.965  1.00 37.06  ? 401 TRP A CE2   1 
ATOM   3284  C  CE3   . TRP A  1  403 ? -26.949 -1.751  71.939  1.00 31.37  ? 401 TRP A CE3   1 
ATOM   3285  C  CZ2   . TRP A  1  403 ? -26.670 -1.718  69.122  1.00 42.90  ? 401 TRP A CZ2   1 
ATOM   3286  C  CZ3   . TRP A  1  403 ? -28.049 -1.840  71.100  1.00 33.70  ? 401 TRP A CZ3   1 
ATOM   3287  C  CH2   . TRP A  1  403 ? -27.902 -1.823  69.709  1.00 42.92  ? 401 TRP A CH2   1 
ATOM   3288  N  N     . TRP A  1  404 ? -22.209 -3.879  72.824  1.00 41.30  ? 402 TRP A N     1 
ATOM   3289  C  CA    . TRP A  1  404 ? -21.647 -4.682  71.741  1.00 37.17  ? 402 TRP A CA    1 
ATOM   3290  C  C     . TRP A  1  404 ? -21.659 -6.170  72.072  1.00 34.96  ? 402 TRP A C     1 
ATOM   3291  O  O     . TRP A  1  404 ? -21.891 -7.000  71.186  1.00 30.18  ? 402 TRP A O     1 
ATOM   3292  C  CB    . TRP A  1  404 ? -20.239 -4.190  71.375  1.00 39.27  ? 402 TRP A CB    1 
ATOM   3293  C  CG    . TRP A  1  404 ? -19.083 -4.724  72.175  1.00 33.43  ? 402 TRP A CG    1 
ATOM   3294  C  CD1   . TRP A  1  404 ? -18.408 -4.078  73.169  1.00 40.46  ? 402 TRP A CD1   1 
ATOM   3295  C  CD2   . TRP A  1  404 ? -18.433 -5.989  72.008  1.00 36.43  ? 402 TRP A CD2   1 
ATOM   3296  N  NE1   . TRP A  1  404 ? -17.393 -4.869  73.645  1.00 36.28  ? 402 TRP A NE1   1 
ATOM   3297  C  CE2   . TRP A  1  404 ? -17.388 -6.049  72.950  1.00 31.68  ? 402 TRP A CE2   1 
ATOM   3298  C  CE3   . TRP A  1  404 ? -18.640 -7.081  71.162  1.00 34.35  ? 402 TRP A CE3   1 
ATOM   3299  C  CZ2   . TRP A  1  404 ? -16.555 -7.158  73.070  1.00 32.70  ? 402 TRP A CZ2   1 
ATOM   3300  C  CZ3   . TRP A  1  404 ? -17.814 -8.181  71.284  1.00 31.91  ? 402 TRP A CZ3   1 
ATOM   3301  C  CH2   . TRP A  1  404 ? -16.784 -8.211  72.230  1.00 39.31  ? 402 TRP A CH2   1 
ATOM   3302  N  N     . THR A  1  405 ? -21.414 -6.534  73.333  1.00 37.49  ? 403 THR A N     1 
ATOM   3303  C  CA    . THR A  1  405 ? -21.456 -7.949  73.693  1.00 35.19  ? 403 THR A CA    1 
ATOM   3304  C  C     . THR A  1  405 ? -22.856 -8.526  73.507  1.00 38.46  ? 403 THR A C     1 
ATOM   3305  O  O     . THR A  1  405 ? -23.008 -9.677  73.080  1.00 45.47  ? 403 THR A O     1 
ATOM   3306  C  CB    . THR A  1  405 ? -20.986 -8.143  75.135  1.00 37.66  ? 403 THR A CB    1 
ATOM   3307  O  OG1   . THR A  1  405 ? -21.765 -7.318  76.012  1.00 39.39  ? 403 THR A OG1   1 
ATOM   3308  C  CG2   . THR A  1  405 ? -19.510 -7.784  75.269  1.00 33.04  ? 403 THR A CG2   1 
ATOM   3309  N  N     . GLU A  1  406 ? -23.891 -7.738  73.799  1.00 48.68  ? 404 GLU A N     1 
ATOM   3310  C  CA    . GLU A  1  406 ? -25.259 -8.243  73.776  1.00 45.07  ? 404 GLU A CA    1 
ATOM   3311  C  C     . GLU A  1  406 ? -25.915 -8.156  72.403  1.00 45.21  ? 404 GLU A C     1 
ATOM   3312  O  O     . GLU A  1  406 ? -26.767 -8.994  72.083  1.00 56.58  ? 404 GLU A O     1 
ATOM   3313  C  CB    . GLU A  1  406 ? -26.118 -7.494  74.800  1.00 44.13  ? 404 GLU A CB    1 
ATOM   3314  C  CG    . GLU A  1  406 ? -25.717 -7.741  76.248  1.00 57.26  ? 404 GLU A CG    1 
ATOM   3315  C  CD    . GLU A  1  406 ? -25.834 -9.199  76.654  1.00 68.63  ? 404 GLU A CD    1 
ATOM   3316  O  OE1   . GLU A  1  406 ? -26.634 -9.934  76.036  1.00 82.33  ? 404 GLU A OE1   1 
ATOM   3317  O  OE2   . GLU A  1  406 ? -25.122 -9.612  77.593  1.00 69.42  ? 404 GLU A OE2   1 
ATOM   3318  N  N     . TYR A  1  407 ? -25.539 -7.170  71.589  1.00 33.42  ? 405 TYR A N     1 
ATOM   3319  C  CA    . TYR A  1  407 ? -26.118 -7.023  70.259  1.00 39.25  ? 405 TYR A CA    1 
ATOM   3320  C  C     . TYR A  1  407 ? -25.901 -8.287  69.435  1.00 44.76  ? 405 TYR A C     1 
ATOM   3321  O  O     . TYR A  1  407 ? -24.902 -8.994  69.590  1.00 41.24  ? 405 TYR A O     1 
ATOM   3322  C  CB    . TYR A  1  407 ? -25.496 -5.823  69.543  1.00 34.23  ? 405 TYR A CB    1 
ATOM   3323  C  CG    . TYR A  1  407 ? -26.357 -5.241  68.445  1.00 42.37  ? 405 TYR A CG    1 
ATOM   3324  C  CD1   . TYR A  1  407 ? -27.742 -5.346  68.491  1.00 52.48  ? 405 TYR A CD1   1 
ATOM   3325  C  CD2   . TYR A  1  407 ? -25.785 -4.588  67.360  1.00 31.86  ? 405 TYR A CD2   1 
ATOM   3326  C  CE1   . TYR A  1  407 ? -28.533 -4.812  67.491  1.00 48.25  ? 405 TYR A CE1   1 
ATOM   3327  C  CE2   . TYR A  1  407 ? -26.567 -4.052  66.355  1.00 38.37  ? 405 TYR A CE2   1 
ATOM   3328  C  CZ    . TYR A  1  407 ? -27.942 -4.168  66.425  1.00 52.97  ? 405 TYR A CZ    1 
ATOM   3329  O  OH    . TYR A  1  407 ? -28.731 -3.638  65.430  1.00 66.52  ? 405 TYR A OH    1 
ATOM   3330  N  N     . TRP A  1  408 ? -26.856 -8.573  68.550  1.00 53.27  ? 406 TRP A N     1 
ATOM   3331  C  CA    . TRP A  1  408 ? -26.782 -9.758  67.706  1.00 54.88  ? 406 TRP A CA    1 
ATOM   3332  C  C     . TRP A  1  408 ? -25.970 -9.532  66.441  1.00 49.05  ? 406 TRP A C     1 
ATOM   3333  O  O     . TRP A  1  408 ? -25.639 -10.505 65.755  1.00 50.44  ? 406 TRP A O     1 
ATOM   3334  C  CB    . TRP A  1  408 ? -28.189 -10.236 67.323  1.00 52.76  ? 406 TRP A CB    1 
ATOM   3335  C  CG    . TRP A  1  408 ? -28.990 -9.218  66.569  1.00 52.91  ? 406 TRP A CG    1 
ATOM   3336  C  CD1   . TRP A  1  408 ? -28.925 -8.944  65.233  1.00 52.70  ? 406 TRP A CD1   1 
ATOM   3337  C  CD2   . TRP A  1  408 ? -29.985 -8.342  67.109  1.00 63.86  ? 406 TRP A CD2   1 
ATOM   3338  N  NE1   . TRP A  1  408 ? -29.814 -7.947  64.910  1.00 60.20  ? 406 TRP A NE1   1 
ATOM   3339  C  CE2   . TRP A  1  408 ? -30.477 -7.560  66.044  1.00 69.62  ? 406 TRP A CE2   1 
ATOM   3340  C  CE3   . TRP A  1  408 ? -30.507 -8.141  68.390  1.00 64.03  ? 406 TRP A CE3   1 
ATOM   3341  C  CZ2   . TRP A  1  408 ? -31.465 -6.592  66.224  1.00 80.11  ? 406 TRP A CZ2   1 
ATOM   3342  C  CZ3   . TRP A  1  408 ? -31.488 -7.181  68.565  1.00 64.54  ? 406 TRP A CZ3   1 
ATOM   3343  C  CH2   . TRP A  1  408 ? -31.958 -6.421  67.488  1.00 72.42  ? 406 TRP A CH2   1 
ATOM   3344  N  N     . GLN A  1  409 ? -25.653 -8.284  66.113  1.00 43.22  ? 407 GLN A N     1 
ATOM   3345  C  CA    . GLN A  1  409 ? -24.814 -7.959  64.971  1.00 46.59  ? 407 GLN A CA    1 
ATOM   3346  C  C     . GLN A  1  409 ? -23.382 -7.700  65.420  1.00 47.56  ? 407 GLN A C     1 
ATOM   3347  O  O     . GLN A  1  409 ? -23.139 -7.195  66.519  1.00 55.79  ? 407 GLN A O     1 
ATOM   3348  C  CB    . GLN A  1  409 ? -25.345 -6.724  64.238  1.00 40.99  ? 407 GLN A CB    1 
ATOM   3349  C  CG    . GLN A  1  409 ? -26.754 -6.861  63.697  1.00 52.10  ? 407 GLN A CG    1 
ATOM   3350  C  CD    . GLN A  1  409 ? -26.827 -6.627  62.201  1.00 67.18  ? 407 GLN A CD    1 
ATOM   3351  O  OE1   . GLN A  1  409 ? -26.651 -5.505  61.724  1.00 70.19  ? 407 GLN A OE1   1 
ATOM   3352  N  NE2   . GLN A  1  409 ? -27.083 -7.690  61.451  1.00 61.98  ? 407 GLN A NE2   1 
ATOM   3353  N  N     . ALA A  1  410 ? -22.432 -8.061  64.559  1.00 42.92  ? 408 ALA A N     1 
ATOM   3354  C  CA    . ALA A  1  410 ? -21.046 -7.680  64.792  1.00 42.22  ? 408 ALA A CA    1 
ATOM   3355  C  C     . ALA A  1  410 ? -20.920 -6.163  64.758  1.00 41.19  ? 408 ALA A C     1 
ATOM   3356  O  O     . ALA A  1  410 ? -21.326 -5.516  63.788  1.00 42.59  ? 408 ALA A O     1 
ATOM   3357  C  CB    . ALA A  1  410 ? -20.133 -8.320  63.746  1.00 33.95  ? 408 ALA A CB    1 
ATOM   3358  N  N     . THR A  1  411 ? -20.348 -5.596  65.816  1.00 40.74  ? 409 THR A N     1 
ATOM   3359  C  CA    . THR A  1  411 ? -20.071 -4.168  65.856  1.00 37.75  ? 409 THR A CA    1 
ATOM   3360  C  C     . THR A  1  411 ? -18.781 -3.949  66.630  1.00 42.35  ? 409 THR A C     1 
ATOM   3361  O  O     . THR A  1  411 ? -18.451 -4.712  67.544  1.00 48.33  ? 409 THR A O     1 
ATOM   3362  C  CB    . THR A  1  411 ? -21.232 -3.384  66.486  1.00 34.99  ? 409 THR A CB    1 
ATOM   3363  O  OG1   . THR A  1  411 ? -21.003 -1.976  66.337  1.00 42.38  ? 409 THR A OG1   1 
ATOM   3364  C  CG2   . THR A  1  411 ? -21.373 -3.721  67.963  1.00 28.59  ? 409 THR A CG2   1 
ATOM   3365  N  N     . TRP A  1  412 ? -18.050 -2.903  66.255  1.00 37.54  ? 410 TRP A N     1 
ATOM   3366  C  CA    . TRP A  1  412 ? -16.755 -2.654  66.867  1.00 36.34  ? 410 TRP A CA    1 
ATOM   3367  C  C     . TRP A  1  412 ? -16.391 -1.185  66.715  1.00 36.57  ? 410 TRP A C     1 
ATOM   3368  O  O     . TRP A  1  412 ? -16.754 -0.538  65.730  1.00 40.55  ? 410 TRP A O     1 
ATOM   3369  C  CB    . TRP A  1  412 ? -15.681 -3.547  66.232  1.00 37.19  ? 410 TRP A CB    1 
ATOM   3370  C  CG    . TRP A  1  412 ? -14.341 -3.472  66.889  1.00 34.97  ? 410 TRP A CG    1 
ATOM   3371  C  CD1   . TRP A  1  412 ? -14.008 -3.944  68.124  1.00 33.51  ? 410 TRP A CD1   1 
ATOM   3372  C  CD2   . TRP A  1  412 ? -13.144 -2.909  66.339  1.00 39.13  ? 410 TRP A CD2   1 
ATOM   3373  N  NE1   . TRP A  1  412 ? -12.682 -3.702  68.382  1.00 35.29  ? 410 TRP A NE1   1 
ATOM   3374  C  CE2   . TRP A  1  412 ? -12.129 -3.067  67.302  1.00 44.24  ? 410 TRP A CE2   1 
ATOM   3375  C  CE3   . TRP A  1  412 ? -12.834 -2.282  65.128  1.00 40.00  ? 410 TRP A CE3   1 
ATOM   3376  C  CZ2   . TRP A  1  412 ? -10.826 -2.622  67.092  1.00 40.08  ? 410 TRP A CZ2   1 
ATOM   3377  C  CZ3   . TRP A  1  412 ? -11.541 -1.840  64.922  1.00 33.30  ? 410 TRP A CZ3   1 
ATOM   3378  C  CH2   . TRP A  1  412 ? -10.552 -2.015  65.897  1.00 40.22  ? 410 TRP A CH2   1 
ATOM   3379  N  N     . ILE A  1  413 ? -15.665 -0.677  67.705  1.00 35.16  ? 411 ILE A N     1 
ATOM   3380  C  CA    . ILE A  1  413 ? -15.071 0.658   67.678  1.00 37.40  ? 411 ILE A CA    1 
ATOM   3381  C  C     . ILE A  1  413 ? -13.565 0.489   67.834  1.00 42.54  ? 411 ILE A C     1 
ATOM   3382  O  O     . ILE A  1  413 ? -13.123 -0.316  68.667  1.00 35.71  ? 411 ILE A O     1 
ATOM   3383  C  CB    . ILE A  1  413 ? -15.662 1.559   68.776  1.00 43.46  ? 411 ILE A CB    1 
ATOM   3384  C  CG1   . ILE A  1  413 ? -17.092 1.972   68.420  1.00 49.40  ? 411 ILE A CG1   1 
ATOM   3385  C  CG2   . ILE A  1  413 ? -14.798 2.794   69.000  1.00 44.92  ? 411 ILE A CG2   1 
ATOM   3386  C  CD1   . ILE A  1  413 ? -17.765 2.826   69.479  1.00 44.23  ? 411 ILE A CD1   1 
ATOM   3387  N  N     . PRO A  1  414 ? -12.739 1.200   67.062  1.00 41.40  ? 412 PRO A N     1 
ATOM   3388  C  CA    . PRO A  1  414 ? -11.288 1.071   67.247  1.00 35.64  ? 412 PRO A CA    1 
ATOM   3389  C  C     . PRO A  1  414 ? -10.822 1.697   68.550  1.00 42.56  ? 412 PRO A C     1 
ATOM   3390  O  O     . PRO A  1  414 ? -11.638 2.211   69.321  1.00 48.50  ? 412 PRO A O     1 
ATOM   3391  C  CB    . PRO A  1  414 ? -10.715 1.808   66.031  1.00 35.38  ? 412 PRO A CB    1 
ATOM   3392  C  CG    . PRO A  1  414 ? -11.762 2.812   65.690  1.00 48.05  ? 412 PRO A CG    1 
ATOM   3393  C  CD    . PRO A  1  414 ? -13.073 2.130   65.970  1.00 35.95  ? 412 PRO A CD    1 
ATOM   3394  N  N     . GLU A  1  415 ? -9.516  1.622   68.807  1.00 43.08  ? 413 GLU A N     1 
ATOM   3395  C  CA    . GLU A  1  415 ? -8.951  2.028   70.089  1.00 42.46  ? 413 GLU A CA    1 
ATOM   3396  C  C     . GLU A  1  415 ? -9.471  3.396   70.516  1.00 47.93  ? 413 GLU A C     1 
ATOM   3397  O  O     . GLU A  1  415 ? -9.410  4.367   69.757  1.00 44.80  ? 413 GLU A O     1 
ATOM   3398  C  CB    . GLU A  1  415 ? -7.423  2.039   69.994  1.00 39.00  ? 413 GLU A CB    1 
ATOM   3399  C  CG    . GLU A  1  415 ? -6.706  1.944   71.333  1.00 57.82  ? 413 GLU A CG    1 
ATOM   3400  C  CD    . GLU A  1  415 ? -5.205  1.759   71.181  1.00 61.91  ? 413 GLU A CD    1 
ATOM   3401  O  OE1   . GLU A  1  415 ? -4.780  1.055   70.240  1.00 54.32  ? 413 GLU A OE1   1 
ATOM   3402  O  OE2   . GLU A  1  415 ? -4.449  2.322   72.002  1.00 64.26  ? 413 GLU A OE2   1 
ATOM   3403  N  N     . TRP A  1  416 ? -9.981  3.465   71.742  1.00 44.87  ? 414 TRP A N     1 
ATOM   3404  C  CA    . TRP A  1  416 ? -10.681 4.654   72.206  1.00 33.65  ? 414 TRP A CA    1 
ATOM   3405  C  C     . TRP A  1  416 ? -10.614 4.701   73.723  1.00 38.78  ? 414 TRP A C     1 
ATOM   3406  O  O     . TRP A  1  416 ? -10.350 3.692   74.383  1.00 56.84  ? 414 TRP A O     1 
ATOM   3407  C  CB    . TRP A  1  416 ? -12.137 4.676   71.729  1.00 36.45  ? 414 TRP A CB    1 
ATOM   3408  C  CG    . TRP A  1  416 ? -13.014 3.631   72.363  1.00 39.25  ? 414 TRP A CG    1 
ATOM   3409  C  CD1   . TRP A  1  416 ? -13.094 2.310   72.027  1.00 34.01  ? 414 TRP A CD1   1 
ATOM   3410  C  CD2   . TRP A  1  416 ? -13.949 3.830   73.430  1.00 37.61  ? 414 TRP A CD2   1 
ATOM   3411  N  NE1   . TRP A  1  416 ? -14.015 1.674   72.825  1.00 31.65  ? 414 TRP A NE1   1 
ATOM   3412  C  CE2   . TRP A  1  416 ? -14.555 2.585   73.694  1.00 41.06  ? 414 TRP A CE2   1 
ATOM   3413  C  CE3   . TRP A  1  416 ? -14.330 4.940   74.191  1.00 44.28  ? 414 TRP A CE3   1 
ATOM   3414  C  CZ2   . TRP A  1  416 ? -15.520 2.421   74.687  1.00 32.16  ? 414 TRP A CZ2   1 
ATOM   3415  C  CZ3   . TRP A  1  416 ? -15.288 4.774   75.176  1.00 49.89  ? 414 TRP A CZ3   1 
ATOM   3416  C  CH2   . TRP A  1  416 ? -15.872 3.525   75.415  1.00 40.51  ? 414 TRP A CH2   1 
ATOM   3417  N  N     . GLU A  1  417 ? -10.853 5.892   74.268  1.00 35.16  ? 415 GLU A N     1 
ATOM   3418  C  CA    . GLU A  1  417 ? -11.002 6.069   75.703  1.00 47.55  ? 415 GLU A CA    1 
ATOM   3419  C  C     . GLU A  1  417 ? -12.222 6.932   75.998  1.00 53.50  ? 415 GLU A C     1 
ATOM   3420  O  O     . GLU A  1  417 ? -12.706 7.680   75.144  1.00 48.59  ? 415 GLU A O     1 
ATOM   3421  C  CB    . GLU A  1  417 ? -9.750  6.708   76.322  1.00 48.52  ? 415 GLU A CB    1 
ATOM   3422  C  CG    . GLU A  1  417 ? -9.399  8.071   75.748  1.00 64.44  ? 415 GLU A CG    1 
ATOM   3423  C  CD    . GLU A  1  417 ? -8.158  8.664   76.384  1.00 84.15  ? 415 GLU A CD    1 
ATOM   3424  O  OE1   . GLU A  1  417 ? -8.205  9.000   77.586  1.00 83.15  ? 415 GLU A OE1   1 
ATOM   3425  O  OE2   . GLU A  1  417 ? -7.131  8.784   75.685  1.00 89.33  ? 415 GLU A OE2   1 
ATOM   3426  N  N     . PHE A  1  418 ? -12.708 6.815   77.231  1.00 45.03  ? 416 PHE A N     1 
ATOM   3427  C  CA    . PHE A  1  418 ? -13.858 7.582   77.692  1.00 47.02  ? 416 PHE A CA    1 
ATOM   3428  C  C     . PHE A  1  418 ? -13.454 9.014   78.020  1.00 49.87  ? 416 PHE A C     1 
ATOM   3429  O  O     . PHE A  1  418 ? -12.466 9.243   78.725  1.00 55.59  ? 416 PHE A O     1 
ATOM   3430  C  CB    . PHE A  1  418 ? -14.484 6.908   78.914  1.00 49.63  ? 416 PHE A CB    1 
ATOM   3431  C  CG    . PHE A  1  418 ? -15.510 7.752   79.619  1.00 48.37  ? 416 PHE A CG    1 
ATOM   3432  C  CD1   . PHE A  1  418 ? -16.685 8.117   78.984  1.00 53.99  ? 416 PHE A CD1   1 
ATOM   3433  C  CD2   . PHE A  1  418 ? -15.305 8.165   80.926  1.00 49.16  ? 416 PHE A CD2   1 
ATOM   3434  C  CE1   . PHE A  1  418 ? -17.632 8.887   79.634  1.00 54.06  ? 416 PHE A CE1   1 
ATOM   3435  C  CE2   . PHE A  1  418 ? -16.249 8.934   81.583  1.00 49.38  ? 416 PHE A CE2   1 
ATOM   3436  C  CZ    . PHE A  1  418 ? -17.414 9.294   80.936  1.00 55.42  ? 416 PHE A CZ    1 
ATOM   3437  N  N     . VAL A  1  419 ? -14.218 9.977   77.508  1.00 45.91  ? 417 VAL A N     1 
ATOM   3438  C  CA    . VAL A  1  419 ? -14.127 11.373  77.924  1.00 52.24  ? 417 VAL A CA    1 
ATOM   3439  C  C     . VAL A  1  419 ? -15.439 11.756  78.598  1.00 57.83  ? 417 VAL A C     1 
ATOM   3440  O  O     . VAL A  1  419 ? -16.522 11.502  78.057  1.00 63.01  ? 417 VAL A O     1 
ATOM   3441  C  CB    . VAL A  1  419 ? -13.809 12.301  76.738  1.00 48.79  ? 417 VAL A CB    1 
ATOM   3442  C  CG1   . VAL A  1  419 ? -14.748 12.039  75.573  1.00 41.17  ? 417 VAL A CG1   1 
ATOM   3443  C  CG2   . VAL A  1  419 ? -13.877 13.759  77.167  1.00 54.34  ? 417 VAL A CG2   1 
ATOM   3444  N  N     . ASN A  1  420 ? -15.340 12.360  79.781  1.00 64.25  ? 418 ASN A N     1 
ATOM   3445  C  CA    . ASN A  1  420 ? -16.500 12.640  80.628  1.00 57.83  ? 418 ASN A CA    1 
ATOM   3446  C  C     . ASN A  1  420 ? -17.174 13.965  80.292  1.00 67.39  ? 418 ASN A C     1 
ATOM   3447  O  O     . ASN A  1  420 ? -17.643 14.670  81.190  1.00 80.51  ? 418 ASN A O     1 
ATOM   3448  C  CB    . ASN A  1  420 ? -16.077 12.605  82.093  1.00 67.23  ? 418 ASN A CB    1 
ATOM   3449  C  CG    . ASN A  1  420 ? -17.232 12.303  83.027  1.00 70.73  ? 418 ASN A CG    1 
ATOM   3450  O  OD1   . ASN A  1  420 ? -18.399 12.467  82.668  1.00 68.97  ? 418 ASN A OD1   1 
ATOM   3451  N  ND2   . ASN A  1  420 ? -16.912 11.858  84.237  1.00 71.82  ? 418 ASN A ND2   1 
ATOM   3452  N  N     . THR A  1  421 ? -17.234 14.339  79.015  1.00 64.85  ? 419 THR A N     1 
ATOM   3453  C  CA    . THR A  1  421 ? -17.929 15.551  78.605  1.00 71.88  ? 419 THR A CA    1 
ATOM   3454  C  C     . THR A  1  421 ? -19.392 15.222  78.336  1.00 67.70  ? 419 THR A C     1 
ATOM   3455  O  O     . THR A  1  421 ? -19.683 14.503  77.368  1.00 70.53  ? 419 THR A O     1 
ATOM   3456  C  CB    . THR A  1  421 ? -17.285 16.148  77.362  1.00 78.60  ? 419 THR A CB    1 
ATOM   3457  O  OG1   . THR A  1  421 ? -15.894 16.387  77.610  1.00 84.05  ? 419 THR A OG1   1 
ATOM   3458  C  CG2   . THR A  1  421 ? -17.962 17.460  76.992  1.00 84.23  ? 419 THR A CG2   1 
ATOM   3459  N  N     . PRO A  1  422 ? -20.341 15.706  79.154  1.00 66.87  ? 420 PRO A N     1 
ATOM   3460  C  CA    . PRO A  1  422 ? -21.768 15.467  78.911  1.00 61.10  ? 420 PRO A CA    1 
ATOM   3461  C  C     . PRO A  1  422 ? -22.269 16.218  77.677  1.00 58.18  ? 420 PRO A C     1 
ATOM   3462  O  O     . PRO A  1  422 ? -21.638 17.196  77.277  1.00 71.34  ? 420 PRO A O     1 
ATOM   3463  C  CB    . PRO A  1  422 ? -22.438 16.003  80.187  1.00 53.68  ? 420 PRO A CB    1 
ATOM   3464  C  CG    . PRO A  1  422 ? -21.343 16.084  81.204  1.00 51.52  ? 420 PRO A CG    1 
ATOM   3465  C  CD    . PRO A  1  422 ? -20.116 16.419  80.420  1.00 63.16  ? 420 PRO A CD    1 
ATOM   3466  N  N     . PRO A  1  423 ? -23.390 15.774  77.081  1.00 52.63  ? 421 PRO A N     1 
ATOM   3467  C  CA    . PRO A  1  423 ? -24.231 14.644  77.499  1.00 56.31  ? 421 PRO A CA    1 
ATOM   3468  C  C     . PRO A  1  423 ? -23.621 13.282  77.163  1.00 52.34  ? 421 PRO A C     1 
ATOM   3469  O  O     . PRO A  1  423 ? -23.246 13.036  76.017  1.00 61.45  ? 421 PRO A O     1 
ATOM   3470  C  CB    . PRO A  1  423 ? -25.526 14.867  76.716  1.00 48.93  ? 421 PRO A CB    1 
ATOM   3471  C  CG    . PRO A  1  423 ? -25.098 15.595  75.494  1.00 43.02  ? 421 PRO A CG    1 
ATOM   3472  C  CD    . PRO A  1  423 ? -23.956 16.477  75.915  1.00 43.94  ? 421 PRO A CD    1 
ATOM   3473  N  N     . LEU A  1  424 ? -23.522 12.413  78.165  1.00 56.46  ? 422 LEU A N     1 
ATOM   3474  C  CA    . LEU A  1  424 ? -22.993 11.074  77.950  1.00 51.04  ? 422 LEU A CA    1 
ATOM   3475  C  C     . LEU A  1  424 ? -23.990 10.210  77.187  1.00 55.44  ? 422 LEU A C     1 
ATOM   3476  O  O     . LEU A  1  424 ? -25.208 10.390  77.280  1.00 73.61  ? 422 LEU A O     1 
ATOM   3477  C  CB    . LEU A  1  424 ? -22.649 10.412  79.284  1.00 50.04  ? 422 LEU A CB    1 
ATOM   3478  C  CG    . LEU A  1  424 ? -21.616 11.128  80.157  1.00 51.40  ? 422 LEU A CG    1 
ATOM   3479  C  CD1   . LEU A  1  424 ? -21.204 10.256  81.334  1.00 55.64  ? 422 LEU A CD1   1 
ATOM   3480  C  CD2   . LEU A  1  424 ? -20.406 11.534  79.333  1.00 58.21  ? 422 LEU A CD2   1 
ATOM   3481  N  N     . VAL A  1  425 ? -23.458 9.268   76.416  1.00 56.99  ? 423 VAL A N     1 
ATOM   3482  C  CA    . VAL A  1  425 ? -24.271 8.335   75.645  1.00 42.89  ? 423 VAL A CA    1 
ATOM   3483  C  C     . VAL A  1  425 ? -24.465 7.068   76.466  1.00 42.82  ? 423 VAL A C     1 
ATOM   3484  O  O     . VAL A  1  425 ? -23.496 6.490   76.971  1.00 46.13  ? 423 VAL A O     1 
ATOM   3485  C  CB    . VAL A  1  425 ? -23.609 8.022   74.293  1.00 48.43  ? 423 VAL A CB    1 
ATOM   3486  C  CG1   . VAL A  1  425 ? -24.396 6.959   73.545  1.00 40.85  ? 423 VAL A CG1   1 
ATOM   3487  C  CG2   . VAL A  1  425 ? -23.481 9.291   73.462  1.00 51.18  ? 423 VAL A CG2   1 
ATOM   3488  N  N     . LYS A  1  426 ? -25.717 6.641   76.614  1.00 50.75  ? 424 LYS A N     1 
ATOM   3489  C  CA    . LYS A  1  426 ? -26.023 5.471   77.424  1.00 50.39  ? 424 LYS A CA    1 
ATOM   3490  C  C     . LYS A  1  426 ? -27.201 4.732   76.812  1.00 43.87  ? 424 LYS A C     1 
ATOM   3491  O  O     . LYS A  1  426 ? -27.919 5.262   75.960  1.00 49.93  ? 424 LYS A O     1 
ATOM   3492  C  CB    . LYS A  1  426 ? -26.321 5.838   78.883  1.00 52.15  ? 424 LYS A CB    1 
ATOM   3493  C  CG    . LYS A  1  426 ? -27.545 6.716   79.090  1.00 48.82  ? 424 LYS A CG    1 
ATOM   3494  C  CD    . LYS A  1  426 ? -27.928 6.750   80.563  1.00 70.15  ? 424 LYS A CD    1 
ATOM   3495  C  CE    . LYS A  1  426 ? -29.090 7.689   80.818  1.00 80.82  ? 424 LYS A CE    1 
ATOM   3496  N  NZ    . LYS A  1  426 ? -29.570 7.601   82.224  1.00 87.18  ? 424 LYS A NZ    1 
ATOM   3497  N  N     . LEU A  1  427 ? -27.390 3.493   77.258  1.00 40.43  ? 425 LEU A N     1 
ATOM   3498  C  CA    . LEU A  1  427 ? -28.616 2.762   76.973  1.00 40.48  ? 425 LEU A CA    1 
ATOM   3499  C  C     . LEU A  1  427 ? -29.686 3.128   77.995  1.00 36.57  ? 425 LEU A C     1 
ATOM   3500  O  O     . LEU A  1  427 ? -29.479 2.997   79.205  1.00 42.43  ? 425 LEU A O     1 
ATOM   3501  C  CB    . LEU A  1  427 ? -28.341 1.261   76.979  1.00 42.64  ? 425 LEU A CB    1 
ATOM   3502  C  CG    . LEU A  1  427 ? -27.213 0.879   76.018  1.00 45.91  ? 425 LEU A CG    1 
ATOM   3503  C  CD1   . LEU A  1  427 ? -26.659 -0.497  76.341  1.00 40.50  ? 425 LEU A CD1   1 
ATOM   3504  C  CD2   . LEU A  1  427 ? -27.699 0.945   74.578  1.00 34.02  ? 425 LEU A CD2   1 
ATOM   3505  N  N     . TRP A  1  428 ? -30.839 3.569   77.494  1.00 42.87  ? 426 TRP A N     1 
ATOM   3506  C  CA    . TRP A  1  428 ? -31.916 4.034   78.360  1.00 46.01  ? 426 TRP A CA    1 
ATOM   3507  C  C     . TRP A  1  428 ? -32.602 2.902   79.117  1.00 51.66  ? 426 TRP A C     1 
ATOM   3508  O  O     . TRP A  1  428 ? -33.092 3.119   80.231  1.00 56.49  ? 426 TRP A O     1 
ATOM   3509  C  CB    . TRP A  1  428 ? -32.895 4.858   77.532  1.00 39.35  ? 426 TRP A CB    1 
ATOM   3510  C  CG    . TRP A  1  428 ? -32.222 6.119   77.092  1.00 55.07  ? 426 TRP A CG    1 
ATOM   3511  C  CD1   . TRP A  1  428 ? -31.605 6.352   75.897  1.00 55.74  ? 426 TRP A CD1   1 
ATOM   3512  C  CD2   . TRP A  1  428 ? -32.030 7.298   77.879  1.00 61.18  ? 426 TRP A CD2   1 
ATOM   3513  N  NE1   . TRP A  1  428 ? -31.069 7.617   75.880  1.00 62.10  ? 426 TRP A NE1   1 
ATOM   3514  C  CE2   . TRP A  1  428 ? -31.316 8.218   77.087  1.00 60.20  ? 426 TRP A CE2   1 
ATOM   3515  C  CE3   . TRP A  1  428 ? -32.408 7.671   79.172  1.00 63.45  ? 426 TRP A CE3   1 
ATOM   3516  C  CZ2   . TRP A  1  428 ? -30.974 9.488   77.545  1.00 66.26  ? 426 TRP A CZ2   1 
ATOM   3517  C  CZ3   . TRP A  1  428 ? -32.069 8.932   79.624  1.00 63.54  ? 426 TRP A CZ3   1 
ATOM   3518  C  CH2   . TRP A  1  428 ? -31.357 9.825   78.814  1.00 68.09  ? 426 TRP A CH2   1 
ATOM   3519  N  N     . TYR A  1  429 ? -32.650 1.700   78.550  1.00 49.30  ? 427 TYR A N     1 
ATOM   3520  C  CA    . TYR A  1  429 ? -33.259 0.583   79.256  1.00 45.48  ? 427 TYR A CA    1 
ATOM   3521  C  C     . TYR A  1  429 ? -32.557 -0.706  78.859  1.00 41.99  ? 427 TYR A C     1 
ATOM   3522  O  O     . TYR A  1  429 ? -31.903 -0.787  77.816  1.00 44.44  ? 427 TYR A O     1 
ATOM   3523  C  CB    . TYR A  1  429 ? -34.762 0.487   78.969  1.00 31.30  ? 427 TYR A CB    1 
ATOM   3524  C  CG    . TYR A  1  429 ? -35.100 0.402   77.498  1.00 37.50  ? 427 TYR A CG    1 
ATOM   3525  C  CD1   . TYR A  1  429 ? -35.281 -0.827  76.875  1.00 30.82  ? 427 TYR A CD1   1 
ATOM   3526  C  CD2   . TYR A  1  429 ? -35.236 1.552   76.730  1.00 38.22  ? 427 TYR A CD2   1 
ATOM   3527  C  CE1   . TYR A  1  429 ? -35.587 -0.907  75.532  1.00 35.18  ? 427 TYR A CE1   1 
ATOM   3528  C  CE2   . TYR A  1  429 ? -35.541 1.481   75.386  1.00 31.83  ? 427 TYR A CE2   1 
ATOM   3529  C  CZ    . TYR A  1  429 ? -35.716 0.249   74.794  1.00 34.94  ? 427 TYR A CZ    1 
ATOM   3530  O  OH    . TYR A  1  429 ? -36.021 0.170   73.459  1.00 38.37  ? 427 TYR A OH    1 
ATOM   3531  N  N     . GLN A  1  430 ? -32.712 -1.720  79.710  1.00 54.27  ? 428 GLN A N     1 
ATOM   3532  C  CA    . GLN A  1  430 ? -32.167 -3.051  79.475  1.00 54.64  ? 428 GLN A CA    1 
ATOM   3533  C  C     . GLN A  1  430 ? -33.265 -4.091  79.645  1.00 59.37  ? 428 GLN A C     1 
ATOM   3534  O  O     . GLN A  1  430 ? -33.954 -4.109  80.670  1.00 61.20  ? 428 GLN A O     1 
ATOM   3535  C  CB    . GLN A  1  430 ? -31.013 -3.347  80.439  1.00 52.11  ? 428 GLN A CB    1 
ATOM   3536  C  CG    . GLN A  1  430 ? -30.086 -4.463  79.985  1.00 68.84  ? 428 GLN A CG    1 
ATOM   3537  C  CD    . GLN A  1  430 ? -28.883 -3.940  79.224  1.00 79.68  ? 428 GLN A CD    1 
ATOM   3538  O  OE1   . GLN A  1  430 ? -28.465 -2.798  79.413  1.00 76.16  ? 428 GLN A OE1   1 
ATOM   3539  N  NE2   . GLN A  1  430 ? -28.321 -4.774  78.357  1.00 88.24  ? 428 GLN A NE2   1 
ATOM   3540  N  N     . LEU A  1  431 ? -33.433 -4.945  78.640  1.00 42.11  ? 429 LEU A N     1 
ATOM   3541  C  CA    . LEU A  1  431 ? -34.324 -6.091  78.757  1.00 32.26  ? 429 LEU A CA    1 
ATOM   3542  C  C     . LEU A  1  431 ? -33.672 -7.183  79.600  1.00 44.71  ? 429 LEU A C     1 
ATOM   3543  O  O     . LEU A  1  431 ? -32.472 -7.448  79.478  1.00 58.46  ? 429 LEU A O     1 
ATOM   3544  C  CB    . LEU A  1  431 ? -34.683 -6.627  77.371  1.00 28.96  ? 429 LEU A CB    1 
ATOM   3545  C  CG    . LEU A  1  431 ? -35.346 -5.611  76.437  1.00 30.05  ? 429 LEU A CG    1 
ATOM   3546  C  CD1   . LEU A  1  431 ? -35.577 -6.212  75.059  1.00 34.96  ? 429 LEU A CD1   1 
ATOM   3547  C  CD2   . LEU A  1  431 ? -36.653 -5.107  77.031  1.00 35.63  ? 429 LEU A CD2   1 
ATOM   3548  N  N     . GLU A  1  432 ? -34.468 -7.812  80.464  1.00 46.26  ? 430 GLU A N     1 
ATOM   3549  C  CA    . GLU A  1  432 ? -33.971 -8.916  81.272  1.00 41.98  ? 430 GLU A CA    1 
ATOM   3550  C  C     . GLU A  1  432 ? -33.649 -10.126 80.401  1.00 46.79  ? 430 GLU A C     1 
ATOM   3551  O  O     . GLU A  1  432 ? -34.328 -10.407 79.410  1.00 54.32  ? 430 GLU A O     1 
ATOM   3552  C  CB    . GLU A  1  432 ? -34.996 -9.300  82.341  1.00 42.26  ? 430 GLU A CB    1 
ATOM   3553  C  CG    . GLU A  1  432 ? -35.325 -8.197  83.340  1.00 53.66  ? 430 GLU A CG    1 
ATOM   3554  C  CD    . GLU A  1  432 ? -34.156 -7.844  84.241  1.00 56.94  ? 430 GLU A CD    1 
ATOM   3555  O  OE1   . GLU A  1  432 ? -33.512 -6.802  84.000  1.00 60.82  ? 430 GLU A OE1   1 
ATOM   3556  O  OE2   . GLU A  1  432 ? -33.881 -8.609  85.190  1.00 61.23  ? 430 GLU A OE2   1 
ATOM   3557  N  N     . LYS A  1  433 ? -32.605 -10.861 80.793  1.00 51.81  ? 431 LYS A N     1 
ATOM   3558  C  CA    . LYS A  1  433 ? -32.279 -12.119 80.126  1.00 48.80  ? 431 LYS A CA    1 
ATOM   3559  C  C     . LYS A  1  433 ? -33.222 -13.256 80.505  1.00 43.88  ? 431 LYS A C     1 
ATOM   3560  O  O     . LYS A  1  433 ? -33.472 -14.143 79.681  1.00 54.40  ? 431 LYS A O     1 
ATOM   3561  C  CB    . LYS A  1  433 ? -30.833 -12.514 80.431  1.00 40.51  ? 431 LYS A CB    1 
ATOM   3562  C  CG    . LYS A  1  433 ? -29.803 -11.582 79.813  1.00 51.93  ? 431 LYS A CG    1 
ATOM   3563  C  CD    . LYS A  1  433 ? -28.393 -11.912 80.270  1.00 72.14  ? 431 LYS A CD    1 
ATOM   3564  C  CE    . LYS A  1  433 ? -27.370 -11.025 79.574  1.00 78.66  ? 431 LYS A CE    1 
ATOM   3565  N  NZ    . LYS A  1  433 ? -27.674 -9.580  79.764  1.00 91.54  ? 431 LYS A NZ    1 
ATOM   3566  N  N     . GLU A  1  434 ? -33.752 -13.251 81.721  1.00 45.32  ? 432 GLU A N     1 
ATOM   3567  C  CA    . GLU A  1  434 ? -34.576 -14.330 82.241  1.00 41.46  ? 432 GLU A CA    1 
ATOM   3568  C  C     . GLU A  1  434 ? -35.900 -13.793 82.761  1.00 52.23  ? 432 GLU A C     1 
ATOM   3569  O  O     . GLU A  1  434 ? -36.010 -12.609 83.099  1.00 56.79  ? 432 GLU A O     1 
ATOM   3570  C  CB    . GLU A  1  434 ? -33.839 -15.081 83.362  1.00 53.72  ? 432 GLU A CB    1 
ATOM   3571  C  CG    . GLU A  1  434 ? -32.854 -16.124 82.857  1.00 67.90  ? 432 GLU A CG    1 
ATOM   3572  C  CD    . GLU A  1  434 ? -33.547 -17.305 82.203  1.00 82.41  ? 432 GLU A CD    1 
ATOM   3573  O  OE1   . GLU A  1  434 ? -34.122 -18.139 82.934  1.00 91.50  ? 432 GLU A OE1   1 
ATOM   3574  O  OE2   . GLU A  1  434 ? -33.533 -17.391 80.957  1.00 82.08  ? 432 GLU A OE2   1 
ATOM   3575  N  N     . PRO A  1  435 ? -36.936 -14.636 82.811  1.00 49.34  ? 433 PRO A N     1 
ATOM   3576  C  CA    . PRO A  1  435 ? -38.237 -14.181 83.318  1.00 39.58  ? 433 PRO A CA    1 
ATOM   3577  C  C     . PRO A  1  435 ? -38.153 -13.727 84.767  1.00 47.66  ? 433 PRO A C     1 
ATOM   3578  O  O     . PRO A  1  435 ? -37.413 -14.285 85.579  1.00 50.73  ? 433 PRO A O     1 
ATOM   3579  C  CB    . PRO A  1  435 ? -39.133 -15.417 83.168  1.00 42.06  ? 433 PRO A CB    1 
ATOM   3580  C  CG    . PRO A  1  435 ? -38.187 -16.571 83.038  1.00 52.40  ? 433 PRO A CG    1 
ATOM   3581  C  CD    . PRO A  1  435 ? -36.989 -16.027 82.332  1.00 48.72  ? 433 PRO A CD    1 
ATOM   3582  N  N     . ILE A  1  436 ? -38.947 -12.713 85.091  1.00 48.04  ? 434 ILE A N     1 
ATOM   3583  C  CA    . ILE A  1  436 ? -38.907 -12.073 86.400  1.00 37.18  ? 434 ILE A CA    1 
ATOM   3584  C  C     . ILE A  1  436 ? -39.854 -12.799 87.347  1.00 51.98  ? 434 ILE A C     1 
ATOM   3585  O  O     . ILE A  1  436 ? -41.050 -12.931 87.066  1.00 59.21  ? 434 ILE A O     1 
ATOM   3586  C  CB    . ILE A  1  436 ? -39.273 -10.586 86.296  1.00 39.59  ? 434 ILE A CB    1 
ATOM   3587  C  CG1   . ILE A  1  436 ? -38.461 -9.923  85.185  1.00 38.93  ? 434 ILE A CG1   1 
ATOM   3588  C  CG2   . ILE A  1  436 ? -39.036 -9.883  87.621  1.00 42.96  ? 434 ILE A CG2   1 
ATOM   3589  C  CD1   . ILE A  1  436 ? -39.165 -8.760  84.537  1.00 46.94  ? 434 ILE A CD1   1 
ATOM   3590  N  N     . VAL A  1  437 ? -39.310 -13.287 88.462  1.00 51.70  ? 435 VAL A N     1 
ATOM   3591  C  CA    . VAL A  1  437 ? -40.108 -14.020 89.438  1.00 48.10  ? 435 VAL A CA    1 
ATOM   3592  C  C     . VAL A  1  437 ? -41.004 -13.042 90.185  1.00 43.38  ? 435 VAL A C     1 
ATOM   3593  O  O     . VAL A  1  437 ? -40.551 -11.982 90.637  1.00 53.41  ? 435 VAL A O     1 
ATOM   3594  C  CB    . VAL A  1  437 ? -39.203 -14.795 90.408  1.00 50.47  ? 435 VAL A CB    1 
ATOM   3595  C  CG1   . VAL A  1  437 ? -40.013 -15.310 91.590  1.00 48.15  ? 435 VAL A CG1   1 
ATOM   3596  C  CG2   . VAL A  1  437 ? -38.520 -15.951 89.694  1.00 56.67  ? 435 VAL A CG2   1 
ATOM   3597  N  N     . GLY A  1  438 ? -42.282 -13.389 90.314  1.00 49.42  ? 436 GLY A N     1 
ATOM   3598  C  CA    . GLY A  1  438 ? -43.227 -12.540 91.004  1.00 53.41  ? 436 GLY A CA    1 
ATOM   3599  C  C     . GLY A  1  438 ? -43.742 -11.360 90.214  1.00 57.56  ? 436 GLY A C     1 
ATOM   3600  O  O     . GLY A  1  438 ? -44.534 -10.575 90.752  1.00 72.47  ? 436 GLY A O     1 
ATOM   3601  N  N     . ALA A  1  439 ? -43.333 -11.209 88.958  1.00 48.88  ? 437 ALA A N     1 
ATOM   3602  C  CA    . ALA A  1  439 ? -43.864 -10.160 88.101  1.00 44.40  ? 437 ALA A CA    1 
ATOM   3603  C  C     . ALA A  1  439 ? -45.013 -10.709 87.267  1.00 48.38  ? 437 ALA A C     1 
ATOM   3604  O  O     . ALA A  1  439 ? -44.985 -11.863 86.829  1.00 47.66  ? 437 ALA A O     1 
ATOM   3605  C  CB    . ALA A  1  439 ? -42.772 -9.599  87.191  1.00 45.14  ? 437 ALA A CB    1 
ATOM   3606  N  N     . GLU A  1  440 ? -46.026 -9.873  87.058  1.00 47.99  ? 438 GLU A N     1 
ATOM   3607  C  CA    . GLU A  1  440 ? -47.195 -10.300 86.304  1.00 46.32  ? 438 GLU A CA    1 
ATOM   3608  C  C     . GLU A  1  440 ? -46.804 -10.603 84.864  1.00 41.49  ? 438 GLU A C     1 
ATOM   3609  O  O     . GLU A  1  440 ? -45.991 -9.897  84.260  1.00 43.67  ? 438 GLU A O     1 
ATOM   3610  C  CB    . GLU A  1  440 ? -48.273 -9.215  86.353  1.00 47.40  ? 438 GLU A CB    1 
ATOM   3611  C  CG    . GLU A  1  440 ? -49.655 -9.666  85.912  1.00 45.60  ? 438 GLU A CG    1 
ATOM   3612  C  CD    . GLU A  1  440 ? -50.707 -8.590  86.118  1.00 51.09  ? 438 GLU A CD    1 
ATOM   3613  O  OE1   . GLU A  1  440 ? -50.370 -7.522  86.673  1.00 53.73  ? 438 GLU A OE1   1 
ATOM   3614  O  OE2   . GLU A  1  440 ? -51.873 -8.811  85.728  1.00 42.95  ? 438 GLU A OE2   1 
ATOM   3615  N  N     . THR A  1  441 ? -47.400 -11.650 84.306  1.00 42.66  ? 439 THR A N     1 
ATOM   3616  C  CA    . THR A  1  441 ? -47.126 -12.061 82.936  1.00 47.20  ? 439 THR A CA    1 
ATOM   3617  C  C     . THR A  1  441 ? -48.276 -11.606 82.049  1.00 51.18  ? 439 THR A C     1 
ATOM   3618  O  O     . THR A  1  441 ? -49.413 -12.051 82.227  1.00 51.08  ? 439 THR A O     1 
ATOM   3619  C  CB    . THR A  1  441 ? -46.945 -13.577 82.852  1.00 47.73  ? 439 THR A CB    1 
ATOM   3620  O  OG1   . THR A  1  441 ? -45.883 -13.981 83.724  1.00 46.29  ? 439 THR A OG1   1 
ATOM   3621  C  CG2   . THR A  1  441 ? -46.615 -13.994 81.428  1.00 44.01  ? 439 THR A CG2   1 
ATOM   3622  N  N     . PHE A  1  442 ? -47.974 -10.737 81.090  1.00 48.14  ? 440 PHE A N     1 
ATOM   3623  C  CA    . PHE A  1  442 ? -48.952 -10.272 80.116  1.00 35.90  ? 440 PHE A CA    1 
ATOM   3624  C  C     . PHE A  1  442 ? -48.734 -11.014 78.804  1.00 39.48  ? 440 PHE A C     1 
ATOM   3625  O  O     . PHE A  1  442 ? -47.689 -10.855 78.163  1.00 48.86  ? 440 PHE A O     1 
ATOM   3626  C  CB    . PHE A  1  442 ? -48.829 -8.762  79.907  1.00 32.40  ? 440 PHE A CB    1 
ATOM   3627  C  CG    . PHE A  1  442 ? -49.295 -7.939  81.079  1.00 35.57  ? 440 PHE A CG    1 
ATOM   3628  C  CD1   . PHE A  1  442 ? -50.376 -7.083  80.947  1.00 36.10  ? 440 PHE A CD1   1 
ATOM   3629  C  CD2   . PHE A  1  442 ? -48.654 -8.016  82.307  1.00 33.73  ? 440 PHE A CD2   1 
ATOM   3630  C  CE1   . PHE A  1  442 ? -50.813 -6.322  82.014  1.00 33.83  ? 440 PHE A CE1   1 
ATOM   3631  C  CE2   . PHE A  1  442 ? -49.083 -7.257  83.381  1.00 37.29  ? 440 PHE A CE2   1 
ATOM   3632  C  CZ    . PHE A  1  442 ? -50.167 -6.409  83.235  1.00 37.59  ? 440 PHE A CZ    1 
ATOM   3633  N  N     . TYR A  1  443 ? -49.714 -11.820 78.407  1.00 37.91  ? 441 TYR A N     1 
ATOM   3634  C  CA    . TYR A  1  443 ? -49.779 -12.344 77.050  1.00 42.33  ? 441 TYR A CA    1 
ATOM   3635  C  C     . TYR A  1  443 ? -50.479 -11.321 76.168  1.00 44.63  ? 441 TYR A C     1 
ATOM   3636  O  O     . TYR A  1  443 ? -51.644 -10.987 76.401  1.00 44.40  ? 441 TYR A O     1 
ATOM   3637  C  CB    . TYR A  1  443 ? -50.507 -13.685 77.025  1.00 35.16  ? 441 TYR A CB    1 
ATOM   3638  C  CG    . TYR A  1  443 ? -49.810 -14.745 77.844  1.00 45.48  ? 441 TYR A CG    1 
ATOM   3639  C  CD1   . TYR A  1  443 ? -48.898 -15.615 77.259  1.00 38.87  ? 441 TYR A CD1   1 
ATOM   3640  C  CD2   . TYR A  1  443 ? -50.055 -14.870 79.205  1.00 33.48  ? 441 TYR A CD2   1 
ATOM   3641  C  CE1   . TYR A  1  443 ? -48.254 -16.583 78.008  1.00 37.67  ? 441 TYR A CE1   1 
ATOM   3642  C  CE2   . TYR A  1  443 ? -49.417 -15.832 79.960  1.00 42.33  ? 441 TYR A CE2   1 
ATOM   3643  C  CZ    . TYR A  1  443 ? -48.518 -16.687 79.357  1.00 42.42  ? 441 TYR A CZ    1 
ATOM   3644  O  OH    . TYR A  1  443 ? -47.882 -17.648 80.109  1.00 40.63  ? 441 TYR A OH    1 
ATOM   3645  N  N     . VAL A  1  444 ? -49.772 -10.830 75.157  1.00 34.27  ? 442 VAL A N     1 
ATOM   3646  C  CA    . VAL A  1  444 ? -50.255 -9.726  74.342  1.00 36.09  ? 442 VAL A CA    1 
ATOM   3647  C  C     . VAL A  1  444 ? -50.410 -10.197 72.907  1.00 41.44  ? 442 VAL A C     1 
ATOM   3648  O  O     . VAL A  1  444 ? -49.637 -11.022 72.408  1.00 43.46  ? 442 VAL A O     1 
ATOM   3649  C  CB    . VAL A  1  444 ? -49.325 -8.497  74.416  1.00 33.11  ? 442 VAL A CB    1 
ATOM   3650  C  CG1   . VAL A  1  444 ? -49.201 -8.031  75.843  1.00 30.00  ? 442 VAL A CG1   1 
ATOM   3651  C  CG2   . VAL A  1  444 ? -47.952 -8.830  73.836  1.00 35.01  ? 442 VAL A CG2   1 
ATOM   3652  N  N     . ASP A  1  445 ? -51.426 -9.664  72.241  1.00 45.85  ? 443 ASP A N     1 
ATOM   3653  C  CA    . ASP A  1  445 ? -51.581 -9.894  70.815  1.00 43.22  ? 443 ASP A CA    1 
ATOM   3654  C  C     . ASP A  1  445 ? -52.450 -8.791  70.235  1.00 43.92  ? 443 ASP A C     1 
ATOM   3655  O  O     . ASP A  1  445 ? -53.136 -8.064  70.959  1.00 48.21  ? 443 ASP A O     1 
ATOM   3656  C  CB    . ASP A  1  445 ? -52.190 -11.272 70.530  1.00 46.51  ? 443 ASP A CB    1 
ATOM   3657  C  CG    . ASP A  1  445 ? -51.953 -11.726 69.107  1.00 59.46  ? 443 ASP A CG    1 
ATOM   3658  O  OD1   . ASP A  1  445 ? -51.519 -10.891 68.285  1.00 66.79  ? 443 ASP A OD1   1 
ATOM   3659  O  OD2   . ASP A  1  445 ? -52.204 -12.911 68.808  1.00 72.31  ? 443 ASP A OD2   1 
ATOM   3660  N  N     . GLY A  1  446 ? -52.404 -8.677  68.918  1.00 50.24  ? 444 GLY A N     1 
ATOM   3661  C  CA    . GLY A  1  446 ? -53.281 -7.771  68.201  1.00 42.65  ? 444 GLY A CA    1 
ATOM   3662  C  C     . GLY A  1  446 ? -53.478 -8.276  66.794  1.00 48.32  ? 444 GLY A C     1 
ATOM   3663  O  O     . GLY A  1  446 ? -52.598 -8.924  66.220  1.00 64.05  ? 444 GLY A O     1 
ATOM   3664  N  N     . ALA A  1  447 ? -54.634 -7.956  66.226  1.00 52.08  ? 445 ALA A N     1 
ATOM   3665  C  CA    . ALA A  1  447 ? -54.914 -8.279  64.839  1.00 47.86  ? 445 ALA A CA    1 
ATOM   3666  C  C     . ALA A  1  447 ? -55.710 -7.147  64.214  1.00 52.72  ? 445 ALA A C     1 
ATOM   3667  O  O     . ALA A  1  447 ? -56.280 -6.301  64.906  1.00 57.88  ? 445 ALA A O     1 
ATOM   3668  C  CB    . ALA A  1  447 ? -55.681 -9.601  64.709  1.00 44.32  ? 445 ALA A CB    1 
ATOM   3669  N  N     . ALA A  1  448 ? -55.728 -7.136  62.885  1.00 55.19  ? 446 ALA A N     1 
ATOM   3670  C  CA    . ALA A  1  448 ? -56.394 -6.084  62.139  1.00 53.68  ? 446 ALA A CA    1 
ATOM   3671  C  C     . ALA A  1  448 ? -56.864 -6.653  60.812  1.00 60.02  ? 446 ALA A C     1 
ATOM   3672  O  O     . ALA A  1  448 ? -56.286 -7.612  60.292  1.00 60.13  ? 446 ALA A O     1 
ATOM   3673  C  CB    . ALA A  1  448 ? -55.474 -4.878  61.914  1.00 52.93  ? 446 ALA A CB    1 
ATOM   3674  N  N     . ASN A  1  449 ? -57.919 -6.055  60.267  1.00 68.90  ? 447 ASN A N     1 
ATOM   3675  C  CA    . ASN A  1  449 ? -58.541 -6.554  59.049  1.00 72.89  ? 447 ASN A CA    1 
ATOM   3676  C  C     . ASN A  1  449 ? -57.956 -5.806  57.857  1.00 74.42  ? 447 ASN A C     1 
ATOM   3677  O  O     . ASN A  1  449 ? -58.031 -4.573  57.792  1.00 74.96  ? 447 ASN A O     1 
ATOM   3678  C  CB    . ASN A  1  449 ? -60.059 -6.393  59.107  1.00 70.38  ? 447 ASN A CB    1 
ATOM   3679  C  CG    . ASN A  1  449 ? -60.750 -6.925  57.867  1.00 77.03  ? 447 ASN A CG    1 
ATOM   3680  O  OD1   . ASN A  1  449 ? -60.950 -6.197  56.894  1.00 76.28  ? 447 ASN A OD1   1 
ATOM   3681  N  ND2   . ASN A  1  449 ? -61.121 -8.200  57.896  1.00 83.01  ? 447 ASN A ND2   1 
ATOM   3682  N  N     . ARG A  1  450 ? -57.352 -6.557  56.933  1.00 77.39  ? 448 ARG A N     1 
ATOM   3683  C  CA    . ARG A  1  450 ? -56.680 -5.955  55.785  1.00 89.20  ? 448 ARG A CA    1 
ATOM   3684  C  C     . ARG A  1  450 ? -57.610 -5.036  54.999  1.00 85.33  ? 448 ARG A C     1 
ATOM   3685  O  O     . ARG A  1  450 ? -57.180 -3.991  54.496  1.00 83.70  ? 448 ARG A O     1 
ATOM   3686  C  CB    . ARG A  1  450 ? -56.119 -7.054  54.880  1.00 101.57 ? 448 ARG A CB    1 
ATOM   3687  C  CG    . ARG A  1  450 ? -55.631 -6.568  53.523  1.00 114.87 ? 448 ARG A CG    1 
ATOM   3688  C  CD    . ARG A  1  450 ? -55.133 -7.718  52.660  1.00 124.92 ? 448 ARG A CD    1 
ATOM   3689  N  NE    . ARG A  1  450 ? -53.830 -8.215  53.093  1.00 127.10 ? 448 ARG A NE    1 
ATOM   3690  C  CZ    . ARG A  1  450 ? -53.162 -9.187  52.479  1.00 128.50 ? 448 ARG A CZ    1 
ATOM   3691  N  NH1   . ARG A  1  450 ? -53.674 -9.771  51.404  1.00 132.07 ? 448 ARG A NH1   1 
ATOM   3692  N  NH2   . ARG A  1  450 ? -51.980 -9.576  52.939  1.00 124.06 ? 448 ARG A NH2   1 
ATOM   3693  N  N     . GLU A  1  451 ? -58.891 -5.394  54.899  1.00 82.11  ? 449 GLU A N     1 
ATOM   3694  C  CA    . GLU A  1  451 ? -59.819 -4.590  54.110  1.00 94.90  ? 449 GLU A CA    1 
ATOM   3695  C  C     . GLU A  1  451 ? -60.367 -3.396  54.887  1.00 88.18  ? 449 GLU A C     1 
ATOM   3696  O  O     . GLU A  1  451 ? -60.283 -2.255  54.419  1.00 88.07  ? 449 GLU A O     1 
ATOM   3697  C  CB    . GLU A  1  451 ? -60.968 -5.467  53.606  1.00 111.27 ? 449 GLU A CB    1 
ATOM   3698  C  CG    . GLU A  1  451 ? -60.523 -6.658  52.771  1.00 125.02 ? 449 GLU A CG    1 
ATOM   3699  C  CD    . GLU A  1  451 ? -60.200 -7.878  53.613  1.00 135.91 ? 449 GLU A CD    1 
ATOM   3700  O  OE1   . GLU A  1  451 ? -60.908 -8.114  54.614  1.00 140.04 ? 449 GLU A OE1   1 
ATOM   3701  O  OE2   . GLU A  1  451 ? -59.239 -8.599  53.274  1.00 136.66 ? 449 GLU A OE2   1 
ATOM   3702  N  N     . THR A  1  452 ? -60.924 -3.632  56.077  1.00 85.53  ? 450 THR A N     1 
ATOM   3703  C  CA    . THR A  1  452 ? -61.547 -2.543  56.827  1.00 84.44  ? 450 THR A CA    1 
ATOM   3704  C  C     . THR A  1  452 ? -60.519 -1.601  57.440  1.00 75.81  ? 450 THR A C     1 
ATOM   3705  O  O     . THR A  1  452 ? -60.838 -0.437  57.710  1.00 72.37  ? 450 THR A O     1 
ATOM   3706  C  CB    . THR A  1  452 ? -62.462 -3.098  57.919  1.00 84.37  ? 450 THR A CB    1 
ATOM   3707  O  OG1   . THR A  1  452 ? -61.677 -3.764  58.913  1.00 89.56  ? 450 THR A OG1   1 
ATOM   3708  C  CG2   . THR A  1  452 ? -63.467 -4.078  57.330  1.00 86.15  ? 450 THR A CG2   1 
ATOM   3709  N  N     . LYS A  1  453 ? -59.302 -2.090  57.691  1.00 75.45  ? 451 LYS A N     1 
ATOM   3710  C  CA    . LYS A  1  453 ? -58.295 -1.394  58.498  1.00 74.68  ? 451 LYS A CA    1 
ATOM   3711  C  C     . LYS A  1  453 ? -58.750 -1.239  59.947  1.00 76.45  ? 451 LYS A C     1 
ATOM   3712  O  O     . LYS A  1  453 ? -58.347 -0.302  60.639  1.00 81.22  ? 451 LYS A O     1 
ATOM   3713  C  CB    . LYS A  1  453 ? -57.920 -0.027  57.911  1.00 77.06  ? 451 LYS A CB    1 
ATOM   3714  C  CG    . LYS A  1  453 ? -57.684 -0.012  56.410  1.00 84.50  ? 451 LYS A CG    1 
ATOM   3715  C  CD    . LYS A  1  453 ? -56.619 -1.005  55.983  1.00 82.58  ? 451 LYS A CD    1 
ATOM   3716  C  CE    . LYS A  1  453 ? -56.343 -0.880  54.494  1.00 83.02  ? 451 LYS A CE    1 
ATOM   3717  N  NZ    . LYS A  1  453 ? -55.567 -2.035  53.968  1.00 84.02  ? 451 LYS A NZ    1 
ATOM   3718  N  N     . LEU A  1  454 ? -59.588 -2.156  60.420  1.00 65.83  ? 452 LEU A N     1 
ATOM   3719  C  CA    . LEU A  1  454 ? -60.060 -2.152  61.795  1.00 58.28  ? 452 LEU A CA    1 
ATOM   3720  C  C     . LEU A  1  454 ? -59.360 -3.270  62.551  1.00 61.02  ? 452 LEU A C     1 
ATOM   3721  O  O     . LEU A  1  454 ? -59.022 -4.308  61.976  1.00 68.39  ? 452 LEU A O     1 
ATOM   3722  C  CB    . LEU A  1  454 ? -61.579 -2.349  61.868  1.00 67.60  ? 452 LEU A CB    1 
ATOM   3723  C  CG    . LEU A  1  454 ? -62.492 -1.237  61.350  1.00 70.78  ? 452 LEU A CG    1 
ATOM   3724  C  CD1   . LEU A  1  454 ? -63.927 -1.731  61.269  1.00 73.96  ? 452 LEU A CD1   1 
ATOM   3725  C  CD2   . LEU A  1  454 ? -62.401 -0.012  62.243  1.00 67.34  ? 452 LEU A CD2   1 
ATOM   3726  N  N     . GLY A  1  455 ? -59.155 -3.065  63.848  1.00 57.79  ? 453 GLY A N     1 
ATOM   3727  C  CA    . GLY A  1  455 ? -58.412 -4.062  64.595  1.00 54.74  ? 453 GLY A CA    1 
ATOM   3728  C  C     . GLY A  1  455 ? -58.627 -3.956  66.085  1.00 58.72  ? 453 GLY A C     1 
ATOM   3729  O  O     . GLY A  1  455 ? -59.271 -3.033  66.589  1.00 52.85  ? 453 GLY A O     1 
ATOM   3730  N  N     . LYS A  1  456 ? -58.069 -4.938  66.788  1.00 55.20  ? 454 LYS A N     1 
ATOM   3731  C  CA    . LYS A  1  456 ? -58.125 -5.005  68.238  1.00 49.06  ? 454 LYS A CA    1 
ATOM   3732  C  C     . LYS A  1  456 ? -56.731 -5.261  68.787  1.00 50.99  ? 454 LYS A C     1 
ATOM   3733  O  O     . LYS A  1  456 ? -55.939 -5.990  68.182  1.00 52.00  ? 454 LYS A O     1 
ATOM   3734  C  CB    . LYS A  1  456 ? -59.084 -6.104  68.710  1.00 52.80  ? 454 LYS A CB    1 
ATOM   3735  C  CG    . LYS A  1  456 ? -60.511 -5.930  68.222  1.00 55.85  ? 454 LYS A CG    1 
ATOM   3736  C  CD    . LYS A  1  456 ? -61.410 -7.048  68.722  1.00 54.75  ? 454 LYS A CD    1 
ATOM   3737  C  CE    . LYS A  1  456 ? -62.833 -6.861  68.225  1.00 62.72  ? 454 LYS A CE    1 
ATOM   3738  N  NZ    . LYS A  1  456 ? -63.750 -7.920  68.728  1.00 75.75  ? 454 LYS A NZ    1 
ATOM   3739  N  N     . ALA A  1  457 ? -56.437 -4.656  69.932  1.00 47.34  ? 455 ALA A N     1 
ATOM   3740  C  CA    . ALA A  1  457 ? -55.220 -4.924  70.681  1.00 48.36  ? 455 ALA A CA    1 
ATOM   3741  C  C     . ALA A  1  457 ? -55.600 -5.205  72.125  1.00 52.80  ? 455 ALA A C     1 
ATOM   3742  O  O     . ALA A  1  457 ? -56.441 -4.507  72.698  1.00 57.33  ? 455 ALA A O     1 
ATOM   3743  C  CB    . ALA A  1  457 ? -54.238 -3.749  70.606  1.00 46.24  ? 455 ALA A CB    1 
ATOM   3744  N  N     . GLY A  1  458 ? -54.983 -6.229  72.710  1.00 41.30  ? 456 GLY A N     1 
ATOM   3745  C  CA    . GLY A  1  458 ? -55.372 -6.642  74.045  1.00 39.79  ? 456 GLY A CA    1 
ATOM   3746  C  C     . GLY A  1  458 ? -54.326 -7.513  74.701  1.00 37.85  ? 456 GLY A C     1 
ATOM   3747  O  O     . GLY A  1  458 ? -53.340 -7.918  74.082  1.00 42.31  ? 456 GLY A O     1 
ATOM   3748  N  N     . TYR A  1  459 ? -54.562 -7.801  75.982  1.00 33.38  ? 457 TYR A N     1 
ATOM   3749  C  CA    . TYR A  1  459 ? -53.722 -8.724  76.730  1.00 34.33  ? 457 TYR A CA    1 
ATOM   3750  C  C     . TYR A  1  459 ? -54.561 -9.576  77.675  1.00 41.05  ? 457 TYR A C     1 
ATOM   3751  O  O     . TYR A  1  459 ? -55.709 -9.254  77.991  1.00 52.24  ? 457 TYR A O     1 
ATOM   3752  C  CB    . TYR A  1  459 ? -52.640 -7.977  77.530  1.00 33.58  ? 457 TYR A CB    1 
ATOM   3753  C  CG    . TYR A  1  459 ? -53.177 -6.950  78.513  1.00 36.93  ? 457 TYR A CG    1 
ATOM   3754  C  CD1   . TYR A  1  459 ? -53.743 -7.341  79.722  1.00 44.22  ? 457 TYR A CD1   1 
ATOM   3755  C  CD2   . TYR A  1  459 ? -53.098 -5.590  78.240  1.00 32.40  ? 457 TYR A CD2   1 
ATOM   3756  C  CE1   . TYR A  1  459 ? -54.230 -6.414  80.619  1.00 33.43  ? 457 TYR A CE1   1 
ATOM   3757  C  CE2   . TYR A  1  459 ? -53.581 -4.652  79.137  1.00 53.42  ? 457 TYR A CE2   1 
ATOM   3758  C  CZ    . TYR A  1  459 ? -54.146 -5.072  80.325  1.00 48.69  ? 457 TYR A CZ    1 
ATOM   3759  O  OH    . TYR A  1  459 ? -54.636 -4.155  81.227  1.00 49.95  ? 457 TYR A OH    1 
ATOM   3760  N  N     . VAL A  1  460 ? -53.952 -10.675 78.122  1.00 44.87  ? 458 VAL A N     1 
ATOM   3761  C  CA    . VAL A  1  460 ? -54.451 -11.535 79.188  1.00 39.00  ? 458 VAL A CA    1 
ATOM   3762  C  C     . VAL A  1  460 ? -53.277 -11.796 80.123  1.00 44.39  ? 458 VAL A C     1 
ATOM   3763  O  O     . VAL A  1  460 ? -52.124 -11.857 79.683  1.00 40.03  ? 458 VAL A O     1 
ATOM   3764  C  CB    . VAL A  1  460 ? -55.048 -12.852 78.632  1.00 46.58  ? 458 VAL A CB    1 
ATOM   3765  C  CG1   . VAL A  1  460 ? -55.310 -13.863 79.741  1.00 78.57  ? 458 VAL A CG1   1 
ATOM   3766  C  CG2   . VAL A  1  460 ? -56.333 -12.565 77.878  1.00 49.36  ? 458 VAL A CG2   1 
ATOM   3767  N  N     . THR A  1  461 ? -53.559 -11.948 81.419  1.00 34.54  ? 459 THR A N     1 
ATOM   3768  C  CA    . THR A  1  461 ? -52.493 -12.127 82.396  1.00 41.28  ? 459 THR A CA    1 
ATOM   3769  C  C     . THR A  1  461 ? -52.826 -13.261 83.357  1.00 41.92  ? 459 THR A C     1 
ATOM   3770  O  O     . THR A  1  461 ? -53.977 -13.685 83.487  1.00 47.52  ? 459 THR A O     1 
ATOM   3771  C  CB    . THR A  1  461 ? -52.238 -10.848 83.220  1.00 39.52  ? 459 THR A CB    1 
ATOM   3772  O  OG1   . THR A  1  461 ? -53.171 -10.780 84.305  1.00 45.51  ? 459 THR A OG1   1 
ATOM   3773  C  CG2   . THR A  1  461 ? -52.381 -9.596  82.364  1.00 38.61  ? 459 THR A CG2   1 
ATOM   3774  N  N     . ASN A  1  462 ? -51.775 -13.748 84.028  1.00 48.72  ? 460 ASN A N     1 
ATOM   3775  C  CA    . ASN A  1  462 ? -51.912 -14.850 84.976  1.00 43.24  ? 460 ASN A CA    1 
ATOM   3776  C  C     . ASN A  1  462 ? -52.765 -14.476 86.182  1.00 45.30  ? 460 ASN A C     1 
ATOM   3777  O  O     . ASN A  1  462 ? -53.418 -15.345 86.771  1.00 61.50  ? 460 ASN A O     1 
ATOM   3778  C  CB    . ASN A  1  462 ? -50.528 -15.315 85.431  1.00 35.38  ? 460 ASN A CB    1 
ATOM   3779  C  CG    . ASN A  1  462 ? -49.810 -14.275 86.269  1.00 42.63  ? 460 ASN A CG    1 
ATOM   3780  O  OD1   . ASN A  1  462 ? -49.514 -13.177 85.797  1.00 53.44  ? 460 ASN A OD1   1 
ATOM   3781  N  ND2   . ASN A  1  462 ? -49.522 -14.616 87.521  1.00 46.71  ? 460 ASN A ND2   1 
ATOM   3782  N  N     . LYS A  1  463 ? -52.774 -13.201 86.566  1.00 44.87  ? 461 LYS A N     1 
ATOM   3783  C  CA    . LYS A  1  463 ? -53.631 -12.744 87.652  1.00 42.41  ? 461 LYS A CA    1 
ATOM   3784  C  C     . LYS A  1  463 ? -55.092 -12.634 87.243  1.00 48.02  ? 461 LYS A C     1 
ATOM   3785  O  O     . LYS A  1  463 ? -55.949 -12.425 88.109  1.00 55.97  ? 461 LYS A O     1 
ATOM   3786  C  CB    . LYS A  1  463 ? -53.124 -11.402 88.194  1.00 42.48  ? 461 LYS A CB    1 
ATOM   3787  C  CG    . LYS A  1  463 ? -51.880 -11.540 89.072  1.00 49.26  ? 461 LYS A CG    1 
ATOM   3788  C  CD    . LYS A  1  463 ? -51.150 -10.217 89.270  1.00 66.30  ? 461 LYS A CD    1 
ATOM   3789  C  CE    . LYS A  1  463 ? -51.869 -9.300  90.246  1.00 81.50  ? 461 LYS A CE    1 
ATOM   3790  N  NZ    . LYS A  1  463 ? -51.090 -8.051  90.486  1.00 86.82  ? 461 LYS A NZ    1 
ATOM   3791  N  N     . GLY A  1  464 ? -55.396 -12.772 85.955  1.00 39.02  ? 462 GLY A N     1 
ATOM   3792  C  CA    . GLY A  1  464 ? -56.742 -12.599 85.460  1.00 40.62  ? 462 GLY A CA    1 
ATOM   3793  C  C     . GLY A  1  464 ? -57.038 -11.232 84.895  1.00 44.45  ? 462 GLY A C     1 
ATOM   3794  O  O     . GLY A  1  464 ? -58.158 -11.007 84.422  1.00 54.40  ? 462 GLY A O     1 
ATOM   3795  N  N     . ARG A  1  465 ? -56.080 -10.312 84.932  1.00 46.03  ? 463 ARG A N     1 
ATOM   3796  C  CA    . ARG A  1  465 ? -56.278 -9.017  84.300  1.00 45.55  ? 463 ARG A CA    1 
ATOM   3797  C  C     . ARG A  1  465 ? -56.428 -9.183  82.793  1.00 49.08  ? 463 ARG A C     1 
ATOM   3798  O  O     . ARG A  1  465 ? -55.723 -9.977  82.165  1.00 43.37  ? 463 ARG A O     1 
ATOM   3799  C  CB    . ARG A  1  465 ? -55.097 -8.101  84.612  1.00 48.16  ? 463 ARG A CB    1 
ATOM   3800  C  CG    . ARG A  1  465 ? -55.243 -6.692  84.072  1.00 51.35  ? 463 ARG A CG    1 
ATOM   3801  C  CD    . ARG A  1  465 ? -53.954 -5.912  84.246  1.00 48.41  ? 463 ARG A CD    1 
ATOM   3802  N  NE    . ARG A  1  465 ? -53.313 -6.220  85.520  1.00 54.51  ? 463 ARG A NE    1 
ATOM   3803  C  CZ    . ARG A  1  465 ? -53.634 -5.651  86.677  1.00 64.11  ? 463 ARG A CZ    1 
ATOM   3804  N  NH1   . ARG A  1  465 ? -54.595 -4.739  86.726  1.00 68.07  ? 463 ARG A NH1   1 
ATOM   3805  N  NH2   . ARG A  1  465 ? -52.997 -5.998  87.787  1.00 65.05  ? 463 ARG A NH2   1 
ATOM   3806  N  N     . GLN A  1  466 ? -57.350 -8.420  82.208  1.00 56.58  ? 464 GLN A N     1 
ATOM   3807  C  CA    . GLN A  1  466 ? -57.635 -8.526  80.785  1.00 43.67  ? 464 GLN A CA    1 
ATOM   3808  C  C     . GLN A  1  466 ? -57.975 -7.143  80.251  1.00 45.80  ? 464 GLN A C     1 
ATOM   3809  O  O     . GLN A  1  466 ? -58.493 -6.290  80.977  1.00 49.47  ? 464 GLN A O     1 
ATOM   3810  C  CB    . GLN A  1  466 ? -58.784 -9.515  80.507  1.00 56.83  ? 464 GLN A CB    1 
ATOM   3811  C  CG    . GLN A  1  466 ? -59.271 -9.551  79.048  1.00 75.38  ? 464 GLN A CG    1 
ATOM   3812  C  CD    . GLN A  1  466 ? -60.268 -10.672 78.760  1.00 88.92  ? 464 GLN A CD    1 
ATOM   3813  O  OE1   . GLN A  1  466 ? -60.172 -11.756 79.314  1.00 91.83  ? 464 GLN A OE1   1 
ATOM   3814  N  NE2   . GLN A  1  466 ? -61.218 -10.409 77.880  1.00 88.21  ? 464 GLN A NE2   1 
ATOM   3815  N  N     . LYS A  1  467 ? -57.674 -6.932  78.974  1.00 39.60  ? 465 LYS A N     1 
ATOM   3816  C  CA    . LYS A  1  467 ? -58.107 -5.741  78.265  1.00 38.78  ? 465 LYS A CA    1 
ATOM   3817  C  C     . LYS A  1  467 ? -58.182 -6.072  76.784  1.00 42.26  ? 465 LYS A C     1 
ATOM   3818  O  O     . LYS A  1  467 ? -57.405 -6.883  76.276  1.00 45.36  ? 465 LYS A O     1 
ATOM   3819  C  CB    . LYS A  1  467 ? -57.159 -4.558  78.511  1.00 36.41  ? 465 LYS A CB    1 
ATOM   3820  C  CG    . LYS A  1  467 ? -57.412 -3.355  77.610  1.00 37.26  ? 465 LYS A CG    1 
ATOM   3821  C  CD    . LYS A  1  467 ? -56.584 -2.152  78.019  1.00 40.10  ? 465 LYS A CD    1 
ATOM   3822  C  CE    . LYS A  1  467 ? -57.151 -1.515  79.277  1.00 41.30  ? 465 LYS A CE    1 
ATOM   3823  N  NZ    . LYS A  1  467 ? -56.461 -0.248  79.647  1.00 46.95  ? 465 LYS A NZ    1 
ATOM   3824  N  N     . VAL A  1  468 ? -59.146 -5.456  76.106  1.00 42.90  ? 466 VAL A N     1 
ATOM   3825  C  CA    . VAL A  1  468 ? -59.221 -5.445  74.651  1.00 45.85  ? 466 VAL A CA    1 
ATOM   3826  C  C     . VAL A  1  468 ? -59.637 -4.043  74.238  1.00 50.64  ? 466 VAL A C     1 
ATOM   3827  O  O     . VAL A  1  468 ? -60.528 -3.445  74.851  1.00 57.52  ? 466 VAL A O     1 
ATOM   3828  C  CB    . VAL A  1  468 ? -60.215 -6.495  74.106  1.00 45.49  ? 466 VAL A CB    1 
ATOM   3829  C  CG1   . VAL A  1  468 ? -60.352 -6.365  72.598  1.00 41.39  ? 466 VAL A CG1   1 
ATOM   3830  C  CG2   . VAL A  1  468 ? -59.780 -7.906  74.473  1.00 39.38  ? 466 VAL A CG2   1 
ATOM   3831  N  N     . VAL A  1  469 ? -58.995 -3.518  73.200  1.00 51.48  ? 467 VAL A N     1 
ATOM   3832  C  CA    . VAL A  1  469 ? -59.248 -2.150  72.760  1.00 48.26  ? 467 VAL A CA    1 
ATOM   3833  C  C     . VAL A  1  469 ? -59.491 -2.155  71.257  1.00 52.36  ? 467 VAL A C     1 
ATOM   3834  O  O     . VAL A  1  469 ? -58.721 -2.773  70.509  1.00 59.13  ? 467 VAL A O     1 
ATOM   3835  C  CB    . VAL A  1  469 ? -58.080 -1.220  73.126  1.00 54.59  ? 467 VAL A CB    1 
ATOM   3836  C  CG1   . VAL A  1  469 ? -58.309 0.173   72.560  1.00 62.45  ? 467 VAL A CG1   1 
ATOM   3837  C  CG2   . VAL A  1  469 ? -57.892 -1.158  74.635  1.00 56.29  ? 467 VAL A CG2   1 
ATOM   3838  N  N     . PRO A  1  470 ? -60.529 -1.484  70.771  1.00 53.45  ? 468 PRO A N     1 
ATOM   3839  C  CA    . PRO A  1  470 ? -60.745 -1.408  69.326  1.00 56.28  ? 468 PRO A CA    1 
ATOM   3840  C  C     . PRO A  1  470 ? -59.935 -0.271  68.731  1.00 59.24  ? 468 PRO A C     1 
ATOM   3841  O  O     . PRO A  1  470 ? -59.719 0.773   69.349  1.00 62.81  ? 468 PRO A O     1 
ATOM   3842  C  CB    . PRO A  1  470 ? -62.253 -1.130  69.208  1.00 50.63  ? 468 PRO A CB    1 
ATOM   3843  C  CG    . PRO A  1  470 ? -62.816 -1.316  70.600  1.00 50.07  ? 468 PRO A CG    1 
ATOM   3844  C  CD    . PRO A  1  470 ? -61.693 -0.997  71.523  1.00 49.75  ? 468 PRO A CD    1 
ATOM   3845  N  N     . LEU A  1  471 ? -59.478 -0.491  67.501  1.00 56.05  ? 469 LEU A N     1 
ATOM   3846  C  CA    . LEU A  1  471 ? -58.660 0.493   66.811  1.00 51.76  ? 469 LEU A CA    1 
ATOM   3847  C  C     . LEU A  1  471 ? -59.102 0.610   65.360  1.00 55.35  ? 469 LEU A C     1 
ATOM   3848  O  O     . LEU A  1  471 ? -59.615 -0.343  64.767  1.00 55.75  ? 469 LEU A O     1 
ATOM   3849  C  CB    . LEU A  1  471 ? -57.171 0.115   66.873  1.00 48.59  ? 469 LEU A CB    1 
ATOM   3850  C  CG    . LEU A  1  471 ? -56.590 -0.167  68.263  1.00 49.66  ? 469 LEU A CG    1 
ATOM   3851  C  CD1   . LEU A  1  471 ? -55.322 -1.001  68.172  1.00 40.93  ? 469 LEU A CD1   1 
ATOM   3852  C  CD2   . LEU A  1  471 ? -56.324 1.133   69.004  1.00 54.71  ? 469 LEU A CD2   1 
ATOM   3853  N  N     . THR A  1  472 ? -58.886 1.797   64.798  1.00 61.56  ? 470 THR A N     1 
ATOM   3854  C  CA    . THR A  1  472 ? -59.400 2.174   63.490  1.00 68.87  ? 470 THR A CA    1 
ATOM   3855  C  C     . THR A  1  472 ? -58.238 2.657   62.636  1.00 74.71  ? 470 THR A C     1 
ATOM   3856  O  O     . THR A  1  472 ? -57.391 3.420   63.110  1.00 72.43  ? 470 THR A O     1 
ATOM   3857  C  CB    . THR A  1  472 ? -60.464 3.273   63.593  1.00 66.59  ? 470 THR A CB    1 
ATOM   3858  O  OG1   . THR A  1  472 ? -59.882 4.445   64.176  1.00 71.33  ? 470 THR A OG1   1 
ATOM   3859  C  CG2   . THR A  1  472 ? -61.630 2.811   64.453  1.00 57.36  ? 470 THR A CG2   1 
ATOM   3860  N  N     . ASN A  1  473 ? -58.204 2.207   61.380  1.00 80.85  ? 471 ASN A N     1 
ATOM   3861  C  CA    . ASN A  1  473 ? -57.199 2.632   60.404  1.00 85.01  ? 471 ASN A CA    1 
ATOM   3862  C  C     . ASN A  1  473 ? -55.804 2.195   60.858  1.00 76.45  ? 471 ASN A C     1 
ATOM   3863  O  O     . ASN A  1  473 ? -54.890 3.001   61.042  1.00 76.07  ? 471 ASN A O     1 
ATOM   3864  C  CB    . ASN A  1  473 ? -57.264 4.145   60.162  1.00 99.14  ? 471 ASN A CB    1 
ATOM   3865  C  CG    . ASN A  1  473 ? -56.462 4.576   58.949  1.00 115.31 ? 471 ASN A CG    1 
ATOM   3866  O  OD1   . ASN A  1  473 ? -56.481 3.849   57.934  1.00 119.61 ? 471 ASN A OD1   1 
ATOM   3867  N  ND2   . ASN A  1  473 ? -55.813 5.641   59.011  1.00 121.19 ? 471 ASN A ND2   1 
ATOM   3868  N  N     . THR A  1  474 ? -55.660 0.883   61.039  1.00 68.35  ? 472 THR A N     1 
ATOM   3869  C  CA    . THR A  1  474 ? -54.427 0.314   61.568  1.00 59.46  ? 472 THR A CA    1 
ATOM   3870  C  C     . THR A  1  474 ? -53.950 -0.860  60.721  1.00 57.87  ? 472 THR A C     1 
ATOM   3871  O  O     . THR A  1  474 ? -54.518 -1.144  59.662  1.00 62.22  ? 472 THR A O     1 
ATOM   3872  C  CB    . THR A  1  474 ? -54.627 -0.129  63.019  1.00 58.22  ? 472 THR A CB    1 
ATOM   3873  O  OG1   . THR A  1  474 ? -53.383 -0.593  63.558  1.00 63.18  ? 472 THR A OG1   1 
ATOM   3874  C  CG2   . THR A  1  474 ? -55.659 -1.247  63.095  1.00 48.87  ? 472 THR A CG2   1 
ATOM   3875  N  N     . THR A  1  475 ? -52.907 -1.547  61.187  1.00 50.91  ? 473 THR A N     1 
ATOM   3876  C  CA    . THR A  1  475 ? -52.375 -2.733  60.529  1.00 48.71  ? 473 THR A CA    1 
ATOM   3877  C  C     . THR A  1  475 ? -52.073 -3.776  61.593  1.00 50.84  ? 473 THR A C     1 
ATOM   3878  O  O     . THR A  1  475 ? -52.075 -3.487  62.792  1.00 49.36  ? 473 THR A O     1 
ATOM   3879  C  CB    . THR A  1  475 ? -51.097 -2.436  59.724  1.00 55.87  ? 473 THR A CB    1 
ATOM   3880  O  OG1   . THR A  1  475 ? -49.989 -2.293  60.621  1.00 55.33  ? 473 THR A OG1   1 
ATOM   3881  C  CG2   . THR A  1  475 ? -51.238 -1.162  58.899  1.00 47.99  ? 473 THR A CG2   1 
ATOM   3882  N  N     . ASN A  1  476 ? -51.829 -5.010  61.145  1.00 55.09  ? 474 ASN A N     1 
ATOM   3883  C  CA    . ASN A  1  476 ? -51.451 -6.072  62.074  1.00 52.23  ? 474 ASN A CA    1 
ATOM   3884  C  C     . ASN A  1  476 ? -50.200 -5.688  62.857  1.00 47.24  ? 474 ASN A C     1 
ATOM   3885  O  O     . ASN A  1  476 ? -50.150 -5.843  64.083  1.00 50.21  ? 474 ASN A O     1 
ATOM   3886  C  CB    . ASN A  1  476 ? -51.242 -7.385  61.319  1.00 53.24  ? 474 ASN A CB    1 
ATOM   3887  C  CG    . ASN A  1  476 ? -52.547 -8.109  61.039  1.00 66.75  ? 474 ASN A CG    1 
ATOM   3888  O  OD1   . ASN A  1  476 ? -53.497 -8.022  61.818  1.00 79.21  ? 474 ASN A OD1   1 
ATOM   3889  N  ND2   . ASN A  1  476 ? -52.597 -8.833  59.926  1.00 77.27  ? 474 ASN A ND2   1 
ATOM   3890  N  N     . GLN A  1  477 ? -49.172 -5.203  62.157  1.00 45.32  ? 475 GLN A N     1 
ATOM   3891  C  CA    . GLN A  1  477 ? -47.953 -4.747  62.820  1.00 40.73  ? 475 GLN A CA    1 
ATOM   3892  C  C     . GLN A  1  477 ? -48.258 -3.704  63.890  1.00 39.68  ? 475 GLN A C     1 
ATOM   3893  O  O     . GLN A  1  477 ? -47.783 -3.804  65.027  1.00 39.23  ? 475 GLN A O     1 
ATOM   3894  C  CB    . GLN A  1  477 ? -46.973 -4.187  61.788  1.00 58.33  ? 475 GLN A CB    1 
ATOM   3895  C  CG    . GLN A  1  477 ? -46.418 -5.221  60.820  1.00 65.72  ? 475 GLN A CG    1 
ATOM   3896  C  CD    . GLN A  1  477 ? -47.263 -5.383  59.569  1.00 70.84  ? 475 GLN A CD    1 
ATOM   3897  O  OE1   . GLN A  1  477 ? -48.473 -5.151  59.582  1.00 69.68  ? 475 GLN A OE1   1 
ATOM   3898  N  NE2   . GLN A  1  477 ? -46.623 -5.778  58.475  1.00 69.73  ? 475 GLN A NE2   1 
ATOM   3899  N  N     . LYS A  1  478 ? -49.046 -2.683  63.534  1.00 41.27  ? 476 LYS A N     1 
ATOM   3900  C  CA    . LYS A  1  478 ? -49.340 -1.604  64.473  1.00 45.78  ? 476 LYS A CA    1 
ATOM   3901  C  C     . LYS A  1  478 ? -50.110 -2.099  65.691  1.00 47.43  ? 476 LYS A C     1 
ATOM   3902  O  O     . LYS A  1  478 ? -49.943 -1.556  66.788  1.00 47.69  ? 476 LYS A O     1 
ATOM   3903  C  CB    . LYS A  1  478 ? -50.109 -0.488  63.765  1.00 42.75  ? 476 LYS A CB    1 
ATOM   3904  C  CG    . LYS A  1  478 ? -49.235 0.369   62.864  1.00 43.09  ? 476 LYS A CG    1 
ATOM   3905  C  CD    . LYS A  1  478 ? -50.059 1.342   62.039  1.00 49.88  ? 476 LYS A CD    1 
ATOM   3906  C  CE    . LYS A  1  478 ? -49.165 2.183   61.140  1.00 55.79  ? 476 LYS A CE    1 
ATOM   3907  N  NZ    . LYS A  1  478 ? -49.949 3.013   60.187  1.00 72.68  ? 476 LYS A NZ    1 
ATOM   3908  N  N     . THR A  1  479 ? -50.973 -3.105  65.522  1.00 44.55  ? 477 THR A N     1 
ATOM   3909  C  CA    . THR A  1  479 ? -51.732 -3.598  66.665  1.00 43.97  ? 477 THR A CA    1 
ATOM   3910  C  C     . THR A  1  479 ? -50.871 -4.468  67.569  1.00 38.38  ? 477 THR A C     1 
ATOM   3911  O  O     . THR A  1  479 ? -51.091 -4.505  68.786  1.00 51.72  ? 477 THR A O     1 
ATOM   3912  C  CB    . THR A  1  479 ? -52.959 -4.388  66.204  1.00 50.42  ? 477 THR A CB    1 
ATOM   3913  O  OG1   . THR A  1  479 ? -52.544 -5.519  65.427  1.00 57.86  ? 477 THR A OG1   1 
ATOM   3914  C  CG2   . THR A  1  479 ? -53.881 -3.510  65.373  1.00 42.69  ? 477 THR A CG2   1 
ATOM   3915  N  N     . GLU A  1  480 ? -49.895 -5.175  66.996  1.00 39.91  ? 478 GLU A N     1 
ATOM   3916  C  CA    . GLU A  1  480 ? -48.992 -5.977  67.812  1.00 46.32  ? 478 GLU A CA    1 
ATOM   3917  C  C     . GLU A  1  480 ? -48.134 -5.085  68.699  1.00 43.52  ? 478 GLU A C     1 
ATOM   3918  O  O     . GLU A  1  480 ? -47.883 -5.411  69.865  1.00 38.60  ? 478 GLU A O     1 
ATOM   3919  C  CB    . GLU A  1  480 ? -48.134 -6.864  66.911  1.00 44.87  ? 478 GLU A CB    1 
ATOM   3920  C  CG    . GLU A  1  480 ? -48.936 -7.951  66.203  1.00 52.99  ? 478 GLU A CG    1 
ATOM   3921  C  CD    . GLU A  1  480 ? -48.183 -8.602  65.058  1.00 72.62  ? 478 GLU A CD    1 
ATOM   3922  O  OE1   . GLU A  1  480 ? -47.120 -8.080  64.661  1.00 78.50  ? 478 GLU A OE1   1 
ATOM   3923  O  OE2   . GLU A  1  480 ? -48.658 -9.640  64.552  1.00 78.94  ? 478 GLU A OE2   1 
ATOM   3924  N  N     . LEU A  1  481 ? -47.661 -3.963  68.155  1.00 38.36  ? 479 LEU A N     1 
ATOM   3925  C  CA    . LEU A  1  481 ? -46.995 -2.960  68.978  1.00 36.73  ? 479 LEU A CA    1 
ATOM   3926  C  C     . LEU A  1  481 ? -47.951 -2.416  70.033  1.00 43.58  ? 479 LEU A C     1 
ATOM   3927  O  O     . LEU A  1  481 ? -47.589 -2.276  71.207  1.00 45.85  ? 479 LEU A O     1 
ATOM   3928  C  CB    . LEU A  1  481 ? -46.457 -1.833  68.097  1.00 40.23  ? 479 LEU A CB    1 
ATOM   3929  C  CG    . LEU A  1  481 ? -45.165 -2.104  67.324  1.00 41.18  ? 479 LEU A CG    1 
ATOM   3930  C  CD1   . LEU A  1  481 ? -44.856 -0.946  66.392  1.00 38.47  ? 479 LEU A CD1   1 
ATOM   3931  C  CD2   . LEU A  1  481 ? -44.011 -2.336  68.285  1.00 34.28  ? 479 LEU A CD2   1 
ATOM   3932  N  N     . GLN A  1  482 ? -49.176 -2.082  69.616  1.00 51.06  ? 480 GLN A N     1 
ATOM   3933  C  CA    . GLN A  1  482 ? -50.174 -1.518  70.523  1.00 41.30  ? 480 GLN A CA    1 
ATOM   3934  C  C     . GLN A  1  482 ? -50.425 -2.438  71.712  1.00 39.22  ? 480 GLN A C     1 
ATOM   3935  O  O     . GLN A  1  482 ? -50.469 -1.987  72.863  1.00 38.45  ? 480 GLN A O     1 
ATOM   3936  C  CB    . GLN A  1  482 ? -51.475 -1.253  69.762  1.00 41.69  ? 480 GLN A CB    1 
ATOM   3937  C  CG    . GLN A  1  482 ? -52.409 -0.273  70.447  1.00 56.89  ? 480 GLN A CG    1 
ATOM   3938  C  CD    . GLN A  1  482 ? -51.934 1.160   70.315  1.00 57.18  ? 480 GLN A CD    1 
ATOM   3939  O  OE1   . GLN A  1  482 ? -51.674 1.639   69.212  1.00 55.92  ? 480 GLN A OE1   1 
ATOM   3940  N  NE2   . GLN A  1  482 ? -51.812 1.851   71.442  1.00 54.88  ? 480 GLN A NE2   1 
ATOM   3941  N  N     . ALA A  1  483 ? -50.635 -3.730  71.442  1.00 40.35  ? 481 ALA A N     1 
ATOM   3942  C  CA    . ALA A  1  483 ? -50.763 -4.723  72.506  1.00 43.32  ? 481 ALA A CA    1 
ATOM   3943  C  C     . ALA A  1  483 ? -49.628 -4.625  73.519  1.00 36.34  ? 481 ALA A C     1 
ATOM   3944  O  O     . ALA A  1  483 ? -49.857 -4.711  74.731  1.00 41.17  ? 481 ALA A O     1 
ATOM   3945  C  CB    . ALA A  1  483 ? -50.811 -6.125  71.899  1.00 31.91  ? 481 ALA A CB    1 
ATOM   3946  N  N     . ILE A  1  484 ? -48.393 -4.462  73.041  1.00 34.38  ? 482 ILE A N     1 
ATOM   3947  C  CA    . ILE A  1  484 ? -47.258 -4.355  73.952  1.00 29.45  ? 482 ILE A CA    1 
ATOM   3948  C  C     . ILE A  1  484 ? -47.336 -3.058  74.747  1.00 46.30  ? 482 ILE A C     1 
ATOM   3949  O  O     . ILE A  1  484 ? -47.118 -3.045  75.965  1.00 37.40  ? 482 ILE A O     1 
ATOM   3950  C  CB    . ILE A  1  484 ? -45.937 -4.468  73.169  1.00 41.81  ? 482 ILE A CB    1 
ATOM   3951  C  CG1   . ILE A  1  484 ? -45.815 -5.854  72.529  1.00 28.87  ? 482 ILE A CG1   1 
ATOM   3952  C  CG2   . ILE A  1  484 ? -44.751 -4.182  74.075  1.00 28.47  ? 482 ILE A CG2   1 
ATOM   3953  C  CD1   . ILE A  1  484 ? -44.568 -6.036  71.696  1.00 29.69  ? 482 ILE A CD1   1 
ATOM   3954  N  N     . TYR A  1  485 ? -47.642 -1.949  74.069  1.00 43.15  ? 483 TYR A N     1 
ATOM   3955  C  CA    . TYR A  1  485 ? -47.850 -0.672  74.748  1.00 40.22  ? 483 TYR A CA    1 
ATOM   3956  C  C     . TYR A  1  485 ? -48.885 -0.793  75.861  1.00 43.22  ? 483 TYR A C     1 
ATOM   3957  O  O     . TYR A  1  485 ? -48.718 -0.216  76.941  1.00 45.30  ? 483 TYR A O     1 
ATOM   3958  C  CB    . TYR A  1  485 ? -48.263 0.393   73.730  1.00 40.14  ? 483 TYR A CB    1 
ATOM   3959  C  CG    . TYR A  1  485 ? -48.412 1.783   74.304  1.00 44.14  ? 483 TYR A CG    1 
ATOM   3960  C  CD1   . TYR A  1  485 ? -47.410 2.345   75.085  1.00 45.21  ? 483 TYR A CD1   1 
ATOM   3961  C  CD2   . TYR A  1  485 ? -49.546 2.544   74.047  1.00 48.85  ? 483 TYR A CD2   1 
ATOM   3962  C  CE1   . TYR A  1  485 ? -47.541 3.618   75.607  1.00 47.68  ? 483 TYR A CE1   1 
ATOM   3963  C  CE2   . TYR A  1  485 ? -49.684 3.818   74.563  1.00 45.44  ? 483 TYR A CE2   1 
ATOM   3964  C  CZ    . TYR A  1  485 ? -48.678 4.350   75.341  1.00 47.51  ? 483 TYR A CZ    1 
ATOM   3965  O  OH    . TYR A  1  485 ? -48.812 5.618   75.858  1.00 52.17  ? 483 TYR A OH    1 
ATOM   3966  N  N     . LEU A  1  486 ? -49.973 -1.526  75.606  1.00 38.27  ? 484 LEU A N     1 
ATOM   3967  C  CA    . LEU A  1  486 ? -51.012 -1.700  76.617  1.00 37.41  ? 484 LEU A CA    1 
ATOM   3968  C  C     . LEU A  1  486 ? -50.473 -2.433  77.840  1.00 47.99  ? 484 LEU A C     1 
ATOM   3969  O  O     . LEU A  1  486 ? -50.716 -2.023  78.981  1.00 46.87  ? 484 LEU A O     1 
ATOM   3970  C  CB    . LEU A  1  486 ? -52.203 -2.452  76.019  1.00 41.19  ? 484 LEU A CB    1 
ATOM   3971  C  CG    . LEU A  1  486 ? -53.059 -1.685  75.008  1.00 42.40  ? 484 LEU A CG    1 
ATOM   3972  C  CD1   . LEU A  1  486 ? -54.125 -2.583  74.399  1.00 35.61  ? 484 LEU A CD1   1 
ATOM   3973  C  CD2   . LEU A  1  486 ? -53.692 -0.472  75.671  1.00 35.50  ? 484 LEU A CD2   1 
ATOM   3974  N  N     . ALA A  1  487 ? -49.738 -3.527  77.620  1.00 37.07  ? 485 ALA A N     1 
ATOM   3975  C  CA    . ALA A  1  487 ? -49.179 -4.285  78.736  1.00 34.48  ? 485 ALA A CA    1 
ATOM   3976  C  C     . ALA A  1  487 ? -48.250 -3.424  79.579  1.00 39.17  ? 485 ALA A C     1 
ATOM   3977  O  O     . ALA A  1  487 ? -48.220 -3.548  80.808  1.00 40.19  ? 485 ALA A O     1 
ATOM   3978  C  CB    . ALA A  1  487 ? -48.435 -5.515  78.220  1.00 29.53  ? 485 ALA A CB    1 
ATOM   3979  N  N     . LEU A  1  488 ? -47.482 -2.546  78.935  1.00 33.54  ? 486 LEU A N     1 
ATOM   3980  C  CA    . LEU A  1  488 ? -46.561 -1.684  79.668  1.00 37.62  ? 486 LEU A CA    1 
ATOM   3981  C  C     . LEU A  1  488 ? -47.316 -0.638  80.480  1.00 41.23  ? 486 LEU A C     1 
ATOM   3982  O  O     . LEU A  1  488 ? -46.992 -0.392  81.648  1.00 36.86  ? 486 LEU A O     1 
ATOM   3983  C  CB    . LEU A  1  488 ? -45.586 -1.021  78.695  1.00 34.06  ? 486 LEU A CB    1 
ATOM   3984  C  CG    . LEU A  1  488 ? -44.563 -1.955  78.047  1.00 34.58  ? 486 LEU A CG    1 
ATOM   3985  C  CD1   . LEU A  1  488 ? -43.813 -1.243  76.932  1.00 29.26  ? 486 LEU A CD1   1 
ATOM   3986  C  CD2   . LEU A  1  488 ? -43.592 -2.479  79.095  1.00 30.50  ? 486 LEU A CD2   1 
ATOM   3987  N  N     . GLN A  1  489 ? -48.312 0.005   79.865  1.00 37.47  ? 487 GLN A N     1 
ATOM   3988  C  CA    . GLN A  1  489 ? -49.144 0.968   80.581  1.00 44.67  ? 487 GLN A CA    1 
ATOM   3989  C  C     . GLN A  1  489 ? -49.784 0.351   81.820  1.00 41.09  ? 487 GLN A C     1 
ATOM   3990  O  O     . GLN A  1  489 ? -49.742 0.932   82.911  1.00 44.32  ? 487 GLN A O     1 
ATOM   3991  C  CB    . GLN A  1  489 ? -50.227 1.520   79.650  1.00 35.01  ? 487 GLN A CB    1 
ATOM   3992  C  CG    . GLN A  1  489 ? -49.745 2.546   78.637  1.00 44.22  ? 487 GLN A CG    1 
ATOM   3993  C  CD    . GLN A  1  489 ? -50.892 3.203   77.884  1.00 56.93  ? 487 GLN A CD    1 
ATOM   3994  O  OE1   . GLN A  1  489 ? -50.815 4.374   77.509  1.00 67.04  ? 487 GLN A OE1   1 
ATOM   3995  N  NE2   . GLN A  1  489 ? -51.964 2.449   77.660  1.00 57.67  ? 487 GLN A NE2   1 
ATOM   3996  N  N     . ASP A  1  490 ? -50.387 -0.825  81.670  1.00 40.40  ? 488 ASP A N     1 
ATOM   3997  C  CA    . ASP A  1  490 ? -51.229 -1.404  82.708  1.00 46.16  ? 488 ASP A CA    1 
ATOM   3998  C  C     . ASP A  1  490 ? -50.474 -2.299  83.688  1.00 46.08  ? 488 ASP A C     1 
ATOM   3999  O  O     . ASP A  1  490 ? -51.114 -3.044  84.437  1.00 54.96  ? 488 ASP A O     1 
ATOM   4000  C  CB    . ASP A  1  490 ? -52.377 -2.195  82.073  1.00 52.01  ? 488 ASP A CB    1 
ATOM   4001  C  CG    . ASP A  1  490 ? -53.294 -1.323  81.228  1.00 54.52  ? 488 ASP A CG    1 
ATOM   4002  O  OD1   . ASP A  1  490 ? -53.180 -0.082  81.305  1.00 43.30  ? 488 ASP A OD1   1 
ATOM   4003  O  OD2   . ASP A  1  490 ? -54.136 -1.883  80.494  1.00 43.59  ? 488 ASP A OD2   1 
ATOM   4004  N  N     . SER A  1  491 ? -49.144 -2.259  83.703  1.00 40.97  ? 489 SER A N     1 
ATOM   4005  C  CA    . SER A  1  491 ? -48.370 -3.156  84.547  1.00 39.86  ? 489 SER A CA    1 
ATOM   4006  C  C     . SER A  1  491 ? -47.597 -2.369  85.597  1.00 43.76  ? 489 SER A C     1 
ATOM   4007  O  O     . SER A  1  491 ? -47.411 -1.154  85.487  1.00 46.93  ? 489 SER A O     1 
ATOM   4008  C  CB    . SER A  1  491 ? -47.396 -4.010  83.725  1.00 43.37  ? 489 SER A CB    1 
ATOM   4009  O  OG    . SER A  1  491 ? -46.503 -3.201  82.979  1.00 43.93  ? 489 SER A OG    1 
ATOM   4010  N  N     . GLY A  1  492 ? -47.149 -3.087  86.620  1.00 39.86  ? 490 GLY A N     1 
ATOM   4011  C  CA    . GLY A  1  492 ? -46.235 -2.544  87.599  1.00 43.81  ? 490 GLY A CA    1 
ATOM   4012  C  C     . GLY A  1  492 ? -44.832 -2.355  87.045  1.00 42.68  ? 490 GLY A C     1 
ATOM   4013  O  O     . GLY A  1  492 ? -44.557 -2.503  85.853  1.00 43.56  ? 490 GLY A O     1 
ATOM   4014  N  N     . LEU A  1  493 ? -43.922 -2.013  87.960  1.00 38.44  ? 491 LEU A N     1 
ATOM   4015  C  CA    . LEU A  1  493 ? -42.554 -1.677  87.582  1.00 44.44  ? 491 LEU A CA    1 
ATOM   4016  C  C     . LEU A  1  493 ? -41.776 -2.875  87.049  1.00 43.10  ? 491 LEU A C     1 
ATOM   4017  O  O     . LEU A  1  493 ? -40.733 -2.685  86.416  1.00 50.76  ? 491 LEU A O     1 
ATOM   4018  C  CB    . LEU A  1  493 ? -41.817 -1.067  88.776  1.00 54.09  ? 491 LEU A CB    1 
ATOM   4019  C  CG    . LEU A  1  493 ? -42.429 0.207   89.361  1.00 50.66  ? 491 LEU A CG    1 
ATOM   4020  C  CD1   . LEU A  1  493 ? -41.583 0.731   90.512  1.00 56.54  ? 491 LEU A CD1   1 
ATOM   4021  C  CD2   . LEU A  1  493 ? -42.581 1.266   88.280  1.00 52.84  ? 491 LEU A CD2   1 
ATOM   4022  N  N     . GLU A  1  494 ? -42.247 -4.096  87.294  1.00 48.41  ? 492 GLU A N     1 
ATOM   4023  C  CA    . GLU A  1  494 ? -41.655 -5.300  86.724  1.00 39.27  ? 492 GLU A CA    1 
ATOM   4024  C  C     . GLU A  1  494 ? -42.749 -6.100  86.034  1.00 40.87  ? 492 GLU A C     1 
ATOM   4025  O  O     . GLU A  1  494 ? -43.824 -6.303  86.608  1.00 54.29  ? 492 GLU A O     1 
ATOM   4026  C  CB    . GLU A  1  494 ? -40.972 -6.140  87.809  1.00 35.61  ? 492 GLU A CB    1 
ATOM   4027  C  CG    . GLU A  1  494 ? -39.895 -5.390  88.583  1.00 49.48  ? 492 GLU A CG    1 
ATOM   4028  C  CD    . GLU A  1  494 ? -39.382 -6.168  89.779  1.00 64.26  ? 492 GLU A CD    1 
ATOM   4029  O  OE1   . GLU A  1  494 ? -40.065 -7.120  90.210  1.00 63.02  ? 492 GLU A OE1   1 
ATOM   4030  O  OE2   . GLU A  1  494 ? -38.293 -5.830  90.288  1.00 75.04  ? 492 GLU A OE2   1 
ATOM   4031  N  N     . VAL A  1  495 ? -42.479 -6.556  84.813  1.00 41.10  ? 493 VAL A N     1 
ATOM   4032  C  CA    . VAL A  1  495 ? -43.501 -7.221  84.010  1.00 47.39  ? 493 VAL A CA    1 
ATOM   4033  C  C     . VAL A  1  495 ? -42.838 -8.175  83.024  1.00 41.28  ? 493 VAL A C     1 
ATOM   4034  O  O     . VAL A  1  495 ? -41.796 -7.864  82.440  1.00 43.62  ? 493 VAL A O     1 
ATOM   4035  C  CB    . VAL A  1  495 ? -44.382 -6.183  83.278  1.00 38.42  ? 493 VAL A CB    1 
ATOM   4036  C  CG1   . VAL A  1  495 ? -43.518 -5.223  82.469  1.00 33.21  ? 493 VAL A CG1   1 
ATOM   4037  C  CG2   . VAL A  1  495 ? -45.397 -6.870  82.385  1.00 32.97  ? 493 VAL A CG2   1 
ATOM   4038  N  N     . ASN A  1  496 ? -43.443 -9.351  82.860  1.00 34.13  ? 494 ASN A N     1 
ATOM   4039  C  CA    . ASN A  1  496 ? -43.116 -10.278 81.784  1.00 33.92  ? 494 ASN A CA    1 
ATOM   4040  C  C     . ASN A  1  496 ? -44.150 -10.116 80.675  1.00 39.74  ? 494 ASN A C     1 
ATOM   4041  O  O     . ASN A  1  496 ? -45.356 -10.140 80.943  1.00 37.07  ? 494 ASN A O     1 
ATOM   4042  C  CB    . ASN A  1  496 ? -43.095 -11.722 82.290  1.00 42.14  ? 494 ASN A CB    1 
ATOM   4043  C  CG    . ASN A  1  496 ? -42.218 -11.902 83.517  1.00 53.06  ? 494 ASN A CG    1 
ATOM   4044  O  OD1   . ASN A  1  496 ? -40.992 -11.877 83.425  1.00 52.82  ? 494 ASN A OD1   1 
ATOM   4045  N  ND2   . ASN A  1  496 ? -42.844 -12.097 84.671  1.00 44.47  ? 494 ASN A ND2   1 
ATOM   4046  N  N     . ILE A  1  497 ? -43.686 -9.949  79.438  1.00 30.40  ? 495 ILE A N     1 
ATOM   4047  C  CA    . ILE A  1  497 ? -44.563 -9.814  78.278  1.00 30.82  ? 495 ILE A CA    1 
ATOM   4048  C  C     . ILE A  1  497 ? -44.253 -10.930 77.289  1.00 34.97  ? 495 ILE A C     1 
ATOM   4049  O  O     . ILE A  1  497 ? -43.092 -11.127 76.909  1.00 39.01  ? 495 ILE A O     1 
ATOM   4050  C  CB    . ILE A  1  497 ? -44.414 -8.433  77.613  1.00 29.47  ? 495 ILE A CB    1 
ATOM   4051  C  CG1   . ILE A  1  497 ? -44.737 -7.324  78.617  1.00 28.17  ? 495 ILE A CG1   1 
ATOM   4052  C  CG2   . ILE A  1  497 ? -45.318 -8.326  76.395  1.00 31.39  ? 495 ILE A CG2   1 
ATOM   4053  C  CD1   . ILE A  1  497 ? -44.589 -5.923  78.059  1.00 35.90  ? 495 ILE A CD1   1 
ATOM   4054  N  N     . VAL A  1  498 ? -45.289 -11.660 76.878  1.00 37.46  ? 496 VAL A N     1 
ATOM   4055  C  CA    . VAL A  1  498 ? -45.179 -12.709 75.870  1.00 35.85  ? 496 VAL A CA    1 
ATOM   4056  C  C     . VAL A  1  498 ? -45.917 -12.259 74.616  1.00 39.33  ? 496 VAL A C     1 
ATOM   4057  O  O     . VAL A  1  498 ? -47.135 -12.040 74.647  1.00 41.72  ? 496 VAL A O     1 
ATOM   4058  C  CB    . VAL A  1  498 ? -45.735 -14.045 76.387  1.00 36.91  ? 496 VAL A CB    1 
ATOM   4059  C  CG1   . VAL A  1  498 ? -45.542 -15.144 75.353  1.00 36.80  ? 496 VAL A CG1   1 
ATOM   4060  C  CG2   . VAL A  1  498 ? -45.069 -14.418 77.701  1.00 32.34  ? 496 VAL A CG2   1 
ATOM   4061  N  N     . THR A  1  499 ? -45.178 -12.104 73.520  1.00 33.24  ? 497 THR A N     1 
ATOM   4062  C  CA    . THR A  1  499 ? -45.730 -11.771 72.215  1.00 29.48  ? 497 THR A CA    1 
ATOM   4063  C  C     . THR A  1  499 ? -45.382 -12.867 71.215  1.00 38.07  ? 497 THR A C     1 
ATOM   4064  O  O     . THR A  1  499 ? -44.417 -13.614 71.395  1.00 55.28  ? 497 THR A O     1 
ATOM   4065  C  CB    . THR A  1  499 ? -45.208 -10.416 71.713  1.00 33.35  ? 497 THR A CB    1 
ATOM   4066  O  OG1   . THR A  1  499 ? -45.695 -10.173 70.387  1.00 46.23  ? 497 THR A OG1   1 
ATOM   4067  C  CG2   . THR A  1  499 ? -43.687 -10.402 71.699  1.00 28.69  ? 497 THR A CG2   1 
ATOM   4068  N  N     . ASN A  1  500 ? -46.185 -12.970 70.155  1.00 33.73  ? 498 ASN A N     1 
ATOM   4069  C  CA    . ASN A  1  500 ? -45.820 -13.766 68.989  1.00 41.98  ? 498 ASN A CA    1 
ATOM   4070  C  C     . ASN A  1  500 ? -45.422 -12.907 67.795  1.00 38.67  ? 498 ASN A C     1 
ATOM   4071  O  O     . ASN A  1  500 ? -45.218 -13.440 66.698  1.00 54.80  ? 498 ASN A O     1 
ATOM   4072  C  CB    . ASN A  1  500 ? -46.968 -14.707 68.605  1.00 51.37  ? 498 ASN A CB    1 
ATOM   4073  C  CG    . ASN A  1  500 ? -48.246 -13.966 68.260  1.00 58.75  ? 498 ASN A CG    1 
ATOM   4074  O  OD1   . ASN A  1  500 ? -48.395 -13.442 67.155  1.00 53.84  ? 498 ASN A OD1   1 
ATOM   4075  N  ND2   . ASN A  1  500 ? -49.184 -13.933 69.201  1.00 72.82  ? 498 ASN A ND2   1 
ATOM   4076  N  N     . SER A  1  501 ? -45.301 -11.595 67.982  1.00 38.18  ? 499 SER A N     1 
ATOM   4077  C  CA    . SER A  1  501 ? -44.928 -10.669 66.917  1.00 42.18  ? 499 SER A CA    1 
ATOM   4078  C  C     . SER A  1  501 ? -43.409 -10.583 66.802  1.00 45.31  ? 499 SER A C     1 
ATOM   4079  O  O     . SER A  1  501 ? -42.745 -10.041 67.693  1.00 45.02  ? 499 SER A O     1 
ATOM   4080  C  CB    . SER A  1  501 ? -45.524 -9.288  67.171  1.00 35.84  ? 499 SER A CB    1 
ATOM   4081  O  OG    . SER A  1  501 ? -45.051 -8.352  66.217  1.00 44.34  ? 499 SER A OG    1 
ATOM   4082  N  N     . GLN A  1  502 ? -42.851 -11.142 65.724  1.00 61.87  ? 500 GLN A N     1 
ATOM   4083  C  CA    . GLN A  1  502 ? -41.413 -11.005 65.502  1.00 55.01  ? 500 GLN A CA    1 
ATOM   4084  C  C     . GLN A  1  502 ? -41.055 -9.567  65.151  1.00 48.57  ? 500 GLN A C     1 
ATOM   4085  O  O     . GLN A  1  502 ? -40.003 -9.062  65.562  1.00 46.28  ? 500 GLN A O     1 
ATOM   4086  C  CB    . GLN A  1  502 ? -40.942 -11.933 64.383  1.00 43.33  ? 500 GLN A CB    1 
ATOM   4087  C  CG    . GLN A  1  502 ? -41.840 -13.109 64.059  1.00 71.10  ? 500 GLN A CG    1 
ATOM   4088  C  CD    . GLN A  1  502 ? -41.274 -13.943 62.921  1.00 84.99  ? 500 GLN A CD    1 
ATOM   4089  O  OE1   . GLN A  1  502 ? -40.399 -13.487 62.184  1.00 86.41  ? 500 GLN A OE1   1 
ATOM   4090  N  NE2   . GLN A  1  502 ? -41.760 -15.172 62.781  1.00 91.37  ? 500 GLN A NE2   1 
ATOM   4091  N  N     . TYR A  1  503 ? -41.912 -8.910  64.365  1.00 41.33  ? 501 TYR A N     1 
ATOM   4092  C  CA    . TYR A  1  503 ? -41.743 -7.503  64.017  1.00 39.97  ? 501 TYR A CA    1 
ATOM   4093  C  C     . TYR A  1  503 ? -41.494 -6.648  65.254  1.00 48.48  ? 501 TYR A C     1 
ATOM   4094  O  O     . TYR A  1  503 ? -40.483 -5.943  65.350  1.00 59.90  ? 501 TYR A O     1 
ATOM   4095  C  CB    . TYR A  1  503 ? -42.978 -7.023  63.252  1.00 35.08  ? 501 TYR A CB    1 
ATOM   4096  C  CG    . TYR A  1  503 ? -43.112 -5.524  63.137  1.00 43.24  ? 501 TYR A CG    1 
ATOM   4097  C  CD1   . TYR A  1  503 ? -42.332 -4.802  62.244  1.00 45.67  ? 501 TYR A CD1   1 
ATOM   4098  C  CD2   . TYR A  1  503 ? -44.035 -4.834  63.909  1.00 42.42  ? 501 TYR A CD2   1 
ATOM   4099  C  CE1   . TYR A  1  503 ? -42.460 -3.431  62.133  1.00 49.12  ? 501 TYR A CE1   1 
ATOM   4100  C  CE2   . TYR A  1  503 ? -44.170 -3.466  63.807  1.00 44.96  ? 501 TYR A CE2   1 
ATOM   4101  C  CZ    . TYR A  1  503 ? -43.383 -2.769  62.917  1.00 49.79  ? 501 TYR A CZ    1 
ATOM   4102  O  OH    . TYR A  1  503 ? -43.522 -1.404  62.819  1.00 56.88  ? 501 TYR A OH    1 
ATOM   4103  N  N     . ALA A  1  504 ? -42.425 -6.692  66.209  1.00 45.42  ? 502 ALA A N     1 
ATOM   4104  C  CA    . ALA A  1  504 ? -42.313 -5.860  67.403  1.00 46.16  ? 502 ALA A CA    1 
ATOM   4105  C  C     . ALA A  1  504 ? -41.100 -6.252  68.239  1.00 48.02  ? 502 ALA A C     1 
ATOM   4106  O  O     . ALA A  1  504 ? -40.346 -5.388  68.703  1.00 46.37  ? 502 ALA A O     1 
ATOM   4107  C  CB    . ALA A  1  504 ? -43.596 -5.963  68.229  1.00 40.50  ? 502 ALA A CB    1 
ATOM   4108  N  N     . LEU A  1  505 ? -40.903 -7.557  68.448  1.00 47.55  ? 503 LEU A N     1 
ATOM   4109  C  CA    . LEU A  1  505 ? -39.770 -8.030  69.241  1.00 46.17  ? 503 LEU A CA    1 
ATOM   4110  C  C     . LEU A  1  505 ? -38.440 -7.584  68.646  1.00 45.66  ? 503 LEU A C     1 
ATOM   4111  O  O     . LEU A  1  505 ? -37.508 -7.237  69.382  1.00 50.56  ? 503 LEU A O     1 
ATOM   4112  C  CB    . LEU A  1  505 ? -39.814 -9.554  69.357  1.00 55.99  ? 503 LEU A CB    1 
ATOM   4113  C  CG    . LEU A  1  505 ? -38.714 -10.208 70.196  1.00 71.08  ? 503 LEU A CG    1 
ATOM   4114  C  CD1   . LEU A  1  505 ? -39.110 -10.254 71.665  1.00 68.58  ? 503 LEU A CD1   1 
ATOM   4115  C  CD2   . LEU A  1  505 ? -38.386 -11.597 69.672  1.00 77.49  ? 503 LEU A CD2   1 
ATOM   4116  N  N     . GLY A  1  506 ? -38.333 -7.583  67.317  1.00 41.03  ? 504 GLY A N     1 
ATOM   4117  C  CA    . GLY A  1  506 ? -37.103 -7.134  66.685  1.00 45.35  ? 504 GLY A CA    1 
ATOM   4118  C  C     . GLY A  1  506 ? -36.813 -5.663  66.910  1.00 44.30  ? 504 GLY A C     1 
ATOM   4119  O  O     . GLY A  1  506 ? -35.672 -5.283  67.186  1.00 56.25  ? 504 GLY A O     1 
ATOM   4120  N  N     . ILE A  1  507 ? -37.836 -4.814  66.792  1.00 40.47  ? 505 ILE A N     1 
ATOM   4121  C  CA    . ILE A  1  507 ? -37.661 -3.393  67.082  1.00 38.76  ? 505 ILE A CA    1 
ATOM   4122  C  C     . ILE A  1  507 ? -37.184 -3.190  68.516  1.00 46.84  ? 505 ILE A C     1 
ATOM   4123  O  O     . ILE A  1  507 ? -36.199 -2.486  68.767  1.00 48.75  ? 505 ILE A O     1 
ATOM   4124  C  CB    . ILE A  1  507 ? -38.966 -2.625  66.809  1.00 43.20  ? 505 ILE A CB    1 
ATOM   4125  C  CG1   . ILE A  1  507 ? -39.356 -2.750  65.335  1.00 48.43  ? 505 ILE A CG1   1 
ATOM   4126  C  CG2   . ILE A  1  507 ? -38.819 -1.164  67.208  1.00 36.55  ? 505 ILE A CG2   1 
ATOM   4127  C  CD1   . ILE A  1  507 ? -40.669 -2.085  64.990  1.00 54.84  ? 505 ILE A CD1   1 
ATOM   4128  N  N     . ILE A  1  508 ? -37.852 -3.832  69.474  1.00 40.11  ? 506 ILE A N     1 
ATOM   4129  C  CA    . ILE A  1  508 ? -37.631 -3.496  70.877  1.00 39.37  ? 506 ILE A CA    1 
ATOM   4130  C  C     . ILE A  1  508 ? -36.317 -4.073  71.392  1.00 44.39  ? 506 ILE A C     1 
ATOM   4131  O  O     . ILE A  1  508 ? -35.656 -3.459  72.239  1.00 48.37  ? 506 ILE A O     1 
ATOM   4132  C  CB    . ILE A  1  508 ? -38.823 -3.969  71.727  1.00 42.40  ? 506 ILE A CB    1 
ATOM   4133  C  CG1   . ILE A  1  508 ? -40.096 -3.234  71.304  1.00 41.89  ? 506 ILE A CG1   1 
ATOM   4134  C  CG2   . ILE A  1  508 ? -38.550 -3.758  73.211  1.00 27.89  ? 506 ILE A CG2   1 
ATOM   4135  C  CD1   . ILE A  1  508 ? -41.330 -3.661  72.064  1.00 34.47  ? 506 ILE A CD1   1 
ATOM   4136  N  N     . GLN A  1  509 ? -35.907 -5.241  70.893  1.00 40.20  ? 507 GLN A N     1 
ATOM   4137  C  CA    . GLN A  1  509 ? -34.690 -5.868  71.393  1.00 46.67  ? 507 GLN A CA    1 
ATOM   4138  C  C     . GLN A  1  509 ? -33.437 -5.082  71.028  1.00 42.45  ? 507 GLN A C     1 
ATOM   4139  O  O     . GLN A  1  509 ? -32.416 -5.223  71.709  1.00 43.25  ? 507 GLN A O     1 
ATOM   4140  C  CB    . GLN A  1  509 ? -34.581 -7.304  70.876  1.00 45.55  ? 507 GLN A CB    1 
ATOM   4141  C  CG    . GLN A  1  509 ? -35.422 -8.307  71.652  1.00 60.51  ? 507 GLN A CG    1 
ATOM   4142  C  CD    . GLN A  1  509 ? -35.181 -9.737  71.206  1.00 78.50  ? 507 GLN A CD    1 
ATOM   4143  O  OE1   . GLN A  1  509 ? -34.786 -9.986  70.067  1.00 73.63  ? 507 GLN A OE1   1 
ATOM   4144  N  NE2   . GLN A  1  509 ? -35.411 -10.685 72.108  1.00 88.01  ? 507 GLN A NE2   1 
ATOM   4145  N  N     . ALA A  1  510 ? -33.484 -4.261  69.976  1.00 31.28  ? 508 ALA A N     1 
ATOM   4146  C  CA    . ALA A  1  510 ? -32.351 -3.426  69.598  1.00 34.74  ? 508 ALA A CA    1 
ATOM   4147  C  C     . ALA A  1  510 ? -32.245 -2.153  70.436  1.00 36.59  ? 508 ALA A C     1 
ATOM   4148  O  O     . ALA A  1  510 ? -31.502 -1.241  70.055  1.00 42.75  ? 508 ALA A O     1 
ATOM   4149  C  CB    . ALA A  1  510 ? -32.432 -3.062  68.113  1.00 34.27  ? 508 ALA A CB    1 
ATOM   4150  N  N     . GLN A  1  511 ? -32.954 -2.092  71.568  1.00 35.30  ? 509 GLN A N     1 
ATOM   4151  C  CA    . GLN A  1  511 ? -32.954 -0.990  72.527  1.00 42.04  ? 509 GLN A CA    1 
ATOM   4152  C  C     . GLN A  1  511 ? -33.002 0.392   71.874  1.00 50.20  ? 509 GLN A C     1 
ATOM   4153  O  O     . GLN A  1  511 ? -32.135 1.230   72.154  1.00 50.19  ? 509 GLN A O     1 
ATOM   4154  C  CB    . GLN A  1  511 ? -31.726 -1.096  73.432  1.00 35.23  ? 509 GLN A CB    1 
ATOM   4155  C  CG    . GLN A  1  511 ? -31.772 -2.282  74.380  1.00 37.05  ? 509 GLN A CG    1 
ATOM   4156  C  CD    . GLN A  1  511 ? -30.419 -2.605  74.983  1.00 47.84  ? 509 GLN A CD    1 
ATOM   4157  O  OE1   . GLN A  1  511 ? -29.591 -3.267  74.358  1.00 53.91  ? 509 GLN A OE1   1 
ATOM   4158  N  NE2   . GLN A  1  511 ? -30.188 -2.142  76.206  1.00 41.61  ? 509 GLN A NE2   1 
ATOM   4159  N  N     . PRO A  1  512 ? -33.971 0.670   70.998  1.00 47.30  ? 510 PRO A N     1 
ATOM   4160  C  CA    . PRO A  1  512 ? -34.062 2.015   70.417  1.00 34.70  ? 510 PRO A CA    1 
ATOM   4161  C  C     . PRO A  1  512 ? -34.418 3.052   71.472  1.00 37.98  ? 510 PRO A C     1 
ATOM   4162  O  O     . PRO A  1  512 ? -35.197 2.787   72.391  1.00 40.84  ? 510 PRO A O     1 
ATOM   4163  C  CB    . PRO A  1  512 ? -35.172 1.875   69.371  1.00 38.98  ? 510 PRO A CB    1 
ATOM   4164  C  CG    . PRO A  1  512 ? -36.031 0.786   69.899  1.00 37.27  ? 510 PRO A CG    1 
ATOM   4165  C  CD    . PRO A  1  512 ? -35.088 -0.185  70.554  1.00 45.73  ? 510 PRO A CD    1 
ATOM   4166  N  N     . ASP A  1  513 ? -33.834 4.241   71.337  1.00 36.90  ? 511 ASP A N     1 
ATOM   4167  C  CA    . ASP A  1  513 ? -34.257 5.396   72.118  1.00 39.54  ? 511 ASP A CA    1 
ATOM   4168  C  C     . ASP A  1  513 ? -34.967 6.450   71.281  1.00 38.61  ? 511 ASP A C     1 
ATOM   4169  O  O     . ASP A  1  513 ? -35.397 7.470   71.830  1.00 46.21  ? 511 ASP A O     1 
ATOM   4170  C  CB    . ASP A  1  513 ? -33.062 6.024   72.852  1.00 35.04  ? 511 ASP A CB    1 
ATOM   4171  C  CG    . ASP A  1  513 ? -31.937 6.442   71.917  1.00 44.77  ? 511 ASP A CG    1 
ATOM   4172  O  OD1   . ASP A  1  513 ? -32.213 6.876   70.780  1.00 48.27  ? 511 ASP A OD1   1 
ATOM   4173  O  OD2   . ASP A  1  513 ? -30.761 6.344   72.328  1.00 42.92  ? 511 ASP A OD2   1 
ATOM   4174  N  N     . LYS A  1  514 ? -35.107 6.231   69.974  1.00 47.28  ? 512 LYS A N     1 
ATOM   4175  C  CA    . LYS A  1  514 ? -35.684 7.214   69.068  1.00 48.08  ? 512 LYS A CA    1 
ATOM   4176  C  C     . LYS A  1  514 ? -36.352 6.470   67.923  1.00 45.79  ? 512 LYS A C     1 
ATOM   4177  O  O     . LYS A  1  514 ? -35.842 5.445   67.463  1.00 49.41  ? 512 LYS A O     1 
ATOM   4178  C  CB    . LYS A  1  514 ? -34.621 8.170   68.505  1.00 51.57  ? 512 LYS A CB    1 
ATOM   4179  C  CG    . LYS A  1  514 ? -34.008 9.141   69.504  1.00 81.23  ? 512 LYS A CG    1 
ATOM   4180  C  CD    . LYS A  1  514 ? -32.926 9.985   68.847  1.00 93.36  ? 512 LYS A CD    1 
ATOM   4181  C  CE    . LYS A  1  514 ? -31.785 9.123   68.322  1.00 78.97  ? 512 LYS A CE    1 
ATOM   4182  N  NZ    . LYS A  1  514 ? -30.994 8.519   69.430  1.00 68.67  ? 512 LYS A NZ    1 
ATOM   4183  N  N     . SER A  1  515 ? -37.488 6.990   67.463  1.00 45.44  ? 513 SER A N     1 
ATOM   4184  C  CA    . SER A  1  515 ? -38.218 6.347   66.381  1.00 48.24  ? 513 SER A CA    1 
ATOM   4185  C  C     . SER A  1  515 ? -38.962 7.391   65.565  1.00 53.80  ? 513 SER A C     1 
ATOM   4186  O  O     . SER A  1  515 ? -39.407 8.415   66.093  1.00 54.37  ? 513 SER A O     1 
ATOM   4187  C  CB    . SER A  1  515 ? -39.204 5.302   66.914  1.00 36.16  ? 513 SER A CB    1 
ATOM   4188  O  OG    . SER A  1  515 ? -39.797 4.572   65.854  1.00 55.23  ? 513 SER A OG    1 
ATOM   4189  N  N     . GLU A  1  516 ? -39.091 7.116   64.265  1.00 51.55  ? 514 GLU A N     1 
ATOM   4190  C  CA    . GLU A  1  516 ? -40.006 7.884   63.428  1.00 58.54  ? 514 GLU A CA    1 
ATOM   4191  C  C     . GLU A  1  516 ? -41.458 7.616   63.799  1.00 61.88  ? 514 GLU A C     1 
ATOM   4192  O  O     . GLU A  1  516 ? -42.319 8.484   63.609  1.00 59.69  ? 514 GLU A O     1 
ATOM   4193  C  CB    . GLU A  1  516 ? -39.764 7.553   61.955  1.00 71.24  ? 514 GLU A CB    1 
ATOM   4194  C  CG    . GLU A  1  516 ? -38.356 7.874   61.472  1.00 85.70  ? 514 GLU A CG    1 
ATOM   4195  C  CD    . GLU A  1  516 ? -38.031 7.224   60.140  1.00 93.75  ? 514 GLU A CD    1 
ATOM   4196  O  OE1   . GLU A  1  516 ? -38.834 6.389   59.671  1.00 93.17  ? 514 GLU A OE1   1 
ATOM   4197  O  OE2   . GLU A  1  516 ? -36.971 7.546   59.563  1.00 102.24 ? 514 GLU A OE2   1 
ATOM   4198  N  N     . SER A  1  517 ? -41.744 6.430   64.328  1.00 51.35  ? 515 SER A N     1 
ATOM   4199  C  CA    . SER A  1  517 ? -43.090 6.063   64.748  1.00 56.45  ? 515 SER A CA    1 
ATOM   4200  C  C     . SER A  1  517 ? -43.352 6.591   66.152  1.00 57.23  ? 515 SER A C     1 
ATOM   4201  O  O     . SER A  1  517 ? -42.596 6.294   67.084  1.00 59.93  ? 515 SER A O     1 
ATOM   4202  C  CB    . SER A  1  517 ? -43.267 4.547   64.699  1.00 48.18  ? 515 SER A CB    1 
ATOM   4203  O  OG    . SER A  1  517 ? -44.417 4.142   65.419  1.00 43.85  ? 515 SER A OG    1 
ATOM   4204  N  N     . GLU A  1  518 ? -44.410 7.390   66.299  1.00 66.37  ? 516 GLU A N     1 
ATOM   4205  C  CA    . GLU A  1  518 ? -44.748 7.921   67.614  1.00 69.01  ? 516 GLU A CA    1 
ATOM   4206  C  C     . GLU A  1  518 ? -45.154 6.803   68.567  1.00 60.68  ? 516 GLU A C     1 
ATOM   4207  O  O     . GLU A  1  518 ? -44.921 6.904   69.778  1.00 53.91  ? 516 GLU A O     1 
ATOM   4208  C  CB    . GLU A  1  518 ? -45.858 8.966   67.491  1.00 82.23  ? 516 GLU A CB    1 
ATOM   4209  C  CG    . GLU A  1  518 ? -46.325 9.537   68.820  1.00 99.91  ? 516 GLU A CG    1 
ATOM   4210  C  CD    . GLU A  1  518 ? -45.188 10.116  69.640  1.00 111.95 ? 516 GLU A CD    1 
ATOM   4211  O  OE1   . GLU A  1  518 ? -44.257 10.698  69.044  1.00 115.85 ? 516 GLU A OE1   1 
ATOM   4212  O  OE2   . GLU A  1  518 ? -45.222 9.985   70.882  1.00 109.22 ? 516 GLU A OE2   1 
ATOM   4213  N  N     . LEU A  1  519 ? -45.759 5.736   68.040  1.00 56.98  ? 517 LEU A N     1 
ATOM   4214  C  CA    . LEU A  1  519 ? -46.168 4.617   68.883  1.00 41.89  ? 517 LEU A CA    1 
ATOM   4215  C  C     . LEU A  1  519 ? -44.959 3.947   69.524  1.00 40.37  ? 517 LEU A C     1 
ATOM   4216  O  O     . LEU A  1  519 ? -44.993 3.580   70.704  1.00 48.57  ? 517 LEU A O     1 
ATOM   4217  C  CB    . LEU A  1  519 ? -46.972 3.610   68.057  1.00 42.03  ? 517 LEU A CB    1 
ATOM   4218  C  CG    . LEU A  1  519 ? -47.438 2.328   68.753  1.00 46.10  ? 517 LEU A CG    1 
ATOM   4219  C  CD1   . LEU A  1  519 ? -48.287 2.650   69.970  1.00 42.59  ? 517 LEU A CD1   1 
ATOM   4220  C  CD2   . LEU A  1  519 ? -48.206 1.435   67.786  1.00 49.22  ? 517 LEU A CD2   1 
ATOM   4221  N  N     . VAL A  1  520 ? -43.887 3.758   68.750  1.00 46.94  ? 518 VAL A N     1 
ATOM   4222  C  CA    . VAL A  1  520 ? -42.657 3.185   69.292  1.00 44.12  ? 518 VAL A CA    1 
ATOM   4223  C  C     . VAL A  1  520 ? -42.044 4.113   70.334  1.00 39.18  ? 518 VAL A C     1 
ATOM   4224  O  O     . VAL A  1  520 ? -41.554 3.661   71.377  1.00 37.95  ? 518 VAL A O     1 
ATOM   4225  C  CB    . VAL A  1  520 ? -41.666 2.879   68.154  1.00 39.91  ? 518 VAL A CB    1 
ATOM   4226  C  CG1   . VAL A  1  520 ? -40.338 2.391   68.719  1.00 38.76  ? 518 VAL A CG1   1 
ATOM   4227  C  CG2   . VAL A  1  520 ? -42.253 1.850   67.201  1.00 39.78  ? 518 VAL A CG2   1 
ATOM   4228  N  N     . ASN A  1  521 ? -42.051 5.425   70.065  1.00 40.83  ? 519 ASN A N     1 
ATOM   4229  C  CA    . ASN A  1  521 ? -41.575 6.391   71.053  1.00 48.48  ? 519 ASN A CA    1 
ATOM   4230  C  C     . ASN A  1  521 ? -42.312 6.246   72.378  1.00 47.15  ? 519 ASN A C     1 
ATOM   4231  O  O     . ASN A  1  521 ? -41.700 6.337   73.449  1.00 46.82  ? 519 ASN A O     1 
ATOM   4232  C  CB    . ASN A  1  521 ? -41.726 7.813   70.511  1.00 43.51  ? 519 ASN A CB    1 
ATOM   4233  C  CG    . ASN A  1  521 ? -40.680 8.158   69.467  1.00 52.56  ? 519 ASN A CG    1 
ATOM   4234  O  OD1   . ASN A  1  521 ? -39.544 7.692   69.536  1.00 50.21  ? 519 ASN A OD1   1 
ATOM   4235  N  ND2   . ASN A  1  521 ? -41.058 8.982   68.496  1.00 46.90  ? 519 ASN A ND2   1 
ATOM   4236  N  N     . GLN A  1  522 ? -43.628 6.023   72.328  1.00 44.95  ? 520 GLN A N     1 
ATOM   4237  C  CA    . GLN A  1  522 ? -44.398 5.854   73.556  1.00 47.01  ? 520 GLN A CA    1 
ATOM   4238  C  C     . GLN A  1  522 ? -44.026 4.553   74.259  1.00 50.77  ? 520 GLN A C     1 
ATOM   4239  O  O     . GLN A  1  522 ? -43.961 4.503   75.493  1.00 49.35  ? 520 GLN A O     1 
ATOM   4240  C  CB    . GLN A  1  522 ? -45.895 5.904   73.250  1.00 42.98  ? 520 GLN A CB    1 
ATOM   4241  C  CG    . GLN A  1  522 ? -46.385 7.274   72.796  1.00 52.93  ? 520 GLN A CG    1 
ATOM   4242  C  CD    . GLN A  1  522 ? -47.821 7.257   72.301  1.00 60.10  ? 520 GLN A CD    1 
ATOM   4243  O  OE1   . GLN A  1  522 ? -48.387 6.196   72.034  1.00 68.86  ? 520 GLN A OE1   1 
ATOM   4244  N  NE2   . GLN A  1  522 ? -48.418 8.437   72.174  1.00 66.92  ? 520 GLN A NE2   1 
ATOM   4245  N  N     . ILE A  1  523 ? -43.799 3.487   73.488  1.00 47.69  ? 521 ILE A N     1 
ATOM   4246  C  CA    . ILE A  1  523 ? -43.302 2.237   74.060  1.00 47.08  ? 521 ILE A CA    1 
ATOM   4247  C  C     . ILE A  1  523 ? -41.955 2.465   74.734  1.00 47.63  ? 521 ILE A C     1 
ATOM   4248  O  O     . ILE A  1  523 ? -41.711 1.994   75.851  1.00 52.90  ? 521 ILE A O     1 
ATOM   4249  C  CB    . ILE A  1  523 ? -43.220 1.147   72.977  1.00 47.56  ? 521 ILE A CB    1 
ATOM   4250  C  CG1   . ILE A  1  523 ? -44.626 0.723   72.548  1.00 35.24  ? 521 ILE A CG1   1 
ATOM   4251  C  CG2   . ILE A  1  523 ? -42.423 -0.049  73.477  1.00 33.70  ? 521 ILE A CG2   1 
ATOM   4252  C  CD1   . ILE A  1  523 ? -44.649 -0.280  71.420  1.00 35.26  ? 521 ILE A CD1   1 
ATOM   4253  N  N     . ILE A  1  524 ? -41.055 3.180   74.053  1.00 46.30  ? 522 ILE A N     1 
ATOM   4254  C  CA    . ILE A  1  524 ? -39.772 3.554   74.647  1.00 43.17  ? 522 ILE A CA    1 
ATOM   4255  C  C     . ILE A  1  524 ? -39.996 4.276   75.969  1.00 37.73  ? 522 ILE A C     1 
ATOM   4256  O  O     . ILE A  1  524 ? -39.380 3.950   76.991  1.00 37.75  ? 522 ILE A O     1 
ATOM   4257  C  CB    . ILE A  1  524 ? -38.955 4.414   73.667  1.00 39.68  ? 522 ILE A CB    1 
ATOM   4258  C  CG1   . ILE A  1  524 ? -38.537 3.582   72.455  1.00 40.88  ? 522 ILE A CG1   1 
ATOM   4259  C  CG2   . ILE A  1  524 ? -37.739 5.006   74.360  1.00 38.39  ? 522 ILE A CG2   1 
ATOM   4260  C  CD1   . ILE A  1  524 ? -37.887 4.391   71.358  1.00 39.23  ? 522 ILE A CD1   1 
ATOM   4261  N  N     . GLU A  1  525 ? -40.846 5.306   75.946  1.00 50.34  ? 523 GLU A N     1 
ATOM   4262  C  CA    . GLU A  1  525 ? -41.170 6.073   77.146  1.00 43.41  ? 523 GLU A CA    1 
ATOM   4263  C  C     . GLU A  1  525 ? -41.528 5.177   78.328  1.00 45.81  ? 523 GLU A C     1 
ATOM   4264  O  O     . GLU A  1  525 ? -41.114 5.437   79.464  1.00 48.78  ? 523 GLU A O     1 
ATOM   4265  C  CB    . GLU A  1  525 ? -42.336 7.016   76.845  1.00 55.28  ? 523 GLU A CB    1 
ATOM   4266  C  CG    . GLU A  1  525 ? -41.991 8.490   76.815  1.00 81.70  ? 523 GLU A CG    1 
ATOM   4267  C  CD    . GLU A  1  525 ? -43.194 9.353   76.475  1.00 99.02  ? 523 GLU A CD    1 
ATOM   4268  O  OE1   . GLU A  1  525 ? -43.489 9.525   75.274  1.00 104.08 ? 523 GLU A OE1   1 
ATOM   4269  O  OE2   . GLU A  1  525 ? -43.855 9.847   77.412  1.00 97.12  ? 523 GLU A OE2   1 
ATOM   4270  N  N     . GLN A  1  526 ? -42.302 4.117   78.081  1.00 40.72  ? 524 GLN A N     1 
ATOM   4271  C  CA    . GLN A  1  526 ? -42.699 3.208   79.152  1.00 46.93  ? 524 GLN A CA    1 
ATOM   4272  C  C     . GLN A  1  526 ? -41.561 2.283   79.570  1.00 45.23  ? 524 GLN A C     1 
ATOM   4273  O  O     . GLN A  1  526 ? -41.353 2.056   80.768  1.00 54.23  ? 524 GLN A O     1 
ATOM   4274  C  CB    . GLN A  1  526 ? -43.913 2.388   78.712  1.00 52.83  ? 524 GLN A CB    1 
ATOM   4275  C  CG    . GLN A  1  526 ? -45.171 3.213   78.481  1.00 54.95  ? 524 GLN A CG    1 
ATOM   4276  C  CD    . GLN A  1  526 ? -45.820 3.656   79.778  1.00 58.70  ? 524 GLN A CD    1 
ATOM   4277  O  OE1   . GLN A  1  526 ? -45.852 2.908   80.755  1.00 59.49  ? 524 GLN A OE1   1 
ATOM   4278  N  NE2   . GLN A  1  526 ? -46.340 4.879   79.795  1.00 61.07  ? 524 GLN A NE2   1 
ATOM   4279  N  N     . LEU A  1  527 ? -40.833 1.727   78.598  1.00 45.45  ? 525 LEU A N     1 
ATOM   4280  C  CA    . LEU A  1  527 ? -39.679 0.883   78.900  1.00 37.06  ? 525 LEU A CA    1 
ATOM   4281  C  C     . LEU A  1  527 ? -38.680 1.585   79.813  1.00 45.72  ? 525 LEU A C     1 
ATOM   4282  O  O     . LEU A  1  527 ? -38.115 0.967   80.723  1.00 42.83  ? 525 LEU A O     1 
ATOM   4283  C  CB    . LEU A  1  527 ? -39.007 0.438   77.601  1.00 32.84  ? 525 LEU A CB    1 
ATOM   4284  C  CG    . LEU A  1  527 ? -39.809 -0.581  76.792  1.00 38.88  ? 525 LEU A CG    1 
ATOM   4285  C  CD1   . LEU A  1  527 ? -39.163 -0.832  75.442  1.00 33.37  ? 525 LEU A CD1   1 
ATOM   4286  C  CD2   . LEU A  1  527 ? -39.953 -1.879  77.574  1.00 42.46  ? 525 LEU A CD2   1 
ATOM   4287  N  N     . ILE A  1  528 ? -38.424 2.872   79.564  1.00 41.51  ? 526 ILE A N     1 
ATOM   4288  C  CA    . ILE A  1  528 ? -37.516 3.633   80.417  1.00 39.77  ? 526 ILE A CA    1 
ATOM   4289  C  C     . ILE A  1  528 ? -38.041 3.727   81.846  1.00 43.95  ? 526 ILE A C     1 
ATOM   4290  O  O     . ILE A  1  528 ? -37.256 3.729   82.803  1.00 56.25  ? 526 ILE A O     1 
ATOM   4291  C  CB    . ILE A  1  528 ? -37.269 5.028   79.808  1.00 45.19  ? 526 ILE A CB    1 
ATOM   4292  C  CG1   . ILE A  1  528 ? -36.648 4.898   78.415  1.00 39.28  ? 526 ILE A CG1   1 
ATOM   4293  C  CG2   . ILE A  1  528 ? -36.366 5.856   80.704  1.00 48.85  ? 526 ILE A CG2   1 
ATOM   4294  C  CD1   . ILE A  1  528 ? -36.360 6.229   77.750  1.00 42.54  ? 526 ILE A CD1   1 
ATOM   4295  N  N     . LYS A  1  529 ? -39.364 3.787   82.025  1.00 47.22  ? 527 LYS A N     1 
ATOM   4296  C  CA    . LYS A  1  529 ? -39.913 3.919   83.370  1.00 45.15  ? 527 LYS A CA    1 
ATOM   4297  C  C     . LYS A  1  529 ? -39.930 2.606   84.138  1.00 44.98  ? 527 LYS A C     1 
ATOM   4298  O  O     . LYS A  1  529 ? -40.059 2.625   85.367  1.00 52.63  ? 527 LYS A O     1 
ATOM   4299  C  CB    . LYS A  1  529 ? -41.343 4.461   83.318  1.00 47.57  ? 527 LYS A CB    1 
ATOM   4300  C  CG    . LYS A  1  529 ? -41.503 5.838   82.703  1.00 62.21  ? 527 LYS A CG    1 
ATOM   4301  C  CD    . LYS A  1  529 ? -42.974 6.230   82.703  1.00 73.00  ? 527 LYS A CD    1 
ATOM   4302  C  CE    . LYS A  1  529 ? -43.219 7.545   81.987  1.00 84.75  ? 527 LYS A CE    1 
ATOM   4303  N  NZ    . LYS A  1  529 ? -44.677 7.849   81.924  1.00 89.90  ? 527 LYS A NZ    1 
ATOM   4304  N  N     . LYS A  1  530 ? -39.801 1.475   83.452  1.00 38.16  ? 528 LYS A N     1 
ATOM   4305  C  CA    . LYS A  1  530 ? -39.827 0.191   84.129  1.00 41.03  ? 528 LYS A CA    1 
ATOM   4306  C  C     . LYS A  1  530 ? -38.516 -0.064  84.869  1.00 42.95  ? 528 LYS A C     1 
ATOM   4307  O  O     . LYS A  1  530 ? -37.458 0.469   84.525  1.00 52.25  ? 528 LYS A O     1 
ATOM   4308  C  CB    . LYS A  1  530 ? -40.096 -0.933  83.131  1.00 38.42  ? 528 LYS A CB    1 
ATOM   4309  C  CG    . LYS A  1  530 ? -41.444 -0.832  82.438  1.00 38.48  ? 528 LYS A CG    1 
ATOM   4310  C  CD    . LYS A  1  530 ? -42.588 -1.034  83.420  1.00 42.83  ? 528 LYS A CD    1 
ATOM   4311  C  CE    . LYS A  1  530 ? -43.936 -0.855  82.742  1.00 43.80  ? 528 LYS A CE    1 
ATOM   4312  N  NZ    . LYS A  1  530 ? -45.070 -1.092  83.678  1.00 51.59  ? 528 LYS A NZ    1 
ATOM   4313  N  N     . GLU A  1  531 ? -38.603 -0.899  85.902  1.00 39.30  ? 529 GLU A N     1 
ATOM   4314  C  CA    . GLU A  1  531 ? -37.417 -1.452  86.542  1.00 40.47  ? 529 GLU A CA    1 
ATOM   4315  C  C     . GLU A  1  531 ? -36.929 -2.721  85.852  1.00 41.33  ? 529 GLU A C     1 
ATOM   4316  O  O     . GLU A  1  531 ? -35.719 -2.898  85.668  1.00 52.09  ? 529 GLU A O     1 
ATOM   4317  C  CB    . GLU A  1  531 ? -37.692 -1.712  88.025  1.00 44.18  ? 529 GLU A CB    1 
ATOM   4318  C  CG    . GLU A  1  531 ? -37.821 -0.432  88.840  1.00 56.19  ? 529 GLU A CG    1 
ATOM   4319  C  CD    . GLU A  1  531 ? -38.009 -0.690  90.320  1.00 81.47  ? 529 GLU A CD    1 
ATOM   4320  O  OE1   . GLU A  1  531 ? -38.243 -1.857  90.694  1.00 94.84  ? 529 GLU A OE1   1 
ATOM   4321  O  OE2   . GLU A  1  531 ? -37.921 0.275   91.109  1.00 83.82  ? 529 GLU A OE2   1 
ATOM   4322  N  N     . LYS A  1  532 ? -37.844 -3.603  85.448  1.00 36.19  ? 530 LYS A N     1 
ATOM   4323  C  CA    . LYS A  1  532 ? -37.477 -4.847  84.782  1.00 42.22  ? 530 LYS A CA    1 
ATOM   4324  C  C     . LYS A  1  532 ? -38.546 -5.208  83.761  1.00 44.85  ? 530 LYS A C     1 
ATOM   4325  O  O     . LYS A  1  532 ? -39.733 -5.249  84.095  1.00 51.71  ? 530 LYS A O     1 
ATOM   4326  C  CB    . LYS A  1  532 ? -37.326 -5.992  85.794  1.00 42.31  ? 530 LYS A CB    1 
ATOM   4327  C  CG    . LYS A  1  532 ? -36.178 -5.851  86.782  1.00 39.30  ? 530 LYS A CG    1 
ATOM   4328  C  CD    . LYS A  1  532 ? -36.113 -7.051  87.715  1.00 44.27  ? 530 LYS A CD    1 
ATOM   4329  C  CE    . LYS A  1  532 ? -34.907 -6.979  88.635  1.00 62.55  ? 530 LYS A CE    1 
ATOM   4330  N  NZ    . LYS A  1  532 ? -34.761 -8.223  89.440  1.00 66.04  ? 530 LYS A NZ    1 
ATOM   4331  N  N     . VAL A  1  533 ? -38.124 -5.468  82.523  1.00 42.52  ? 531 VAL A N     1 
ATOM   4332  C  CA    . VAL A  1  533 ? -38.990 -6.009  81.480  1.00 39.58  ? 531 VAL A CA    1 
ATOM   4333  C  C     . VAL A  1  533 ? -38.344 -7.272  80.928  1.00 46.55  ? 531 VAL A C     1 
ATOM   4334  O  O     . VAL A  1  533 ? -37.169 -7.252  80.545  1.00 46.50  ? 531 VAL A O     1 
ATOM   4335  C  CB    . VAL A  1  533 ? -39.236 -4.994  80.347  1.00 35.14  ? 531 VAL A CB    1 
ATOM   4336  C  CG1   . VAL A  1  533 ? -40.283 -5.523  79.376  1.00 29.82  ? 531 VAL A CG1   1 
ATOM   4337  C  CG2   . VAL A  1  533 ? -39.664 -3.656  80.913  1.00 34.84  ? 531 VAL A CG2   1 
ATOM   4338  N  N     . TYR A  1  534 ? -39.102 -8.363  80.888  1.00 41.73  ? 532 TYR A N     1 
ATOM   4339  C  CA    . TYR A  1  534 ? -38.713 -9.564  80.157  1.00 33.88  ? 532 TYR A CA    1 
ATOM   4340  C  C     . TYR A  1  534 ? -39.659 -9.759  78.980  1.00 41.36  ? 532 TYR A C     1 
ATOM   4341  O  O     . TYR A  1  534 ? -40.860 -9.973  79.175  1.00 52.87  ? 532 TYR A O     1 
ATOM   4342  C  CB    . TYR A  1  534 ? -38.729 -10.793 81.067  1.00 37.67  ? 532 TYR A CB    1 
ATOM   4343  C  CG    . TYR A  1  534 ? -38.385 -12.080 80.349  1.00 41.86  ? 532 TYR A CG    1 
ATOM   4344  C  CD1   . TYR A  1  534 ? -37.080 -12.351 79.961  1.00 44.24  ? 532 TYR A CD1   1 
ATOM   4345  C  CD2   . TYR A  1  534 ? -39.364 -13.023 80.061  1.00 39.80  ? 532 TYR A CD2   1 
ATOM   4346  C  CE1   . TYR A  1  534 ? -36.758 -13.524 79.305  1.00 34.04  ? 532 TYR A CE1   1 
ATOM   4347  C  CE2   . TYR A  1  534 ? -39.051 -14.200 79.406  1.00 45.98  ? 532 TYR A CE2   1 
ATOM   4348  C  CZ    . TYR A  1  534 ? -37.746 -14.444 79.029  1.00 45.85  ? 532 TYR A CZ    1 
ATOM   4349  O  OH    . TYR A  1  534 ? -37.425 -15.613 78.376  1.00 52.67  ? 532 TYR A OH    1 
ATOM   4350  N  N     . LEU A  1  535 ? -39.115 -9.694  77.768  1.00 44.15  ? 533 LEU A N     1 
ATOM   4351  C  CA    . LEU A  1  535 ? -39.861 -9.975  76.549  1.00 37.96  ? 533 LEU A CA    1 
ATOM   4352  C  C     . LEU A  1  535 ? -39.545 -11.388 76.079  1.00 49.60  ? 533 LEU A C     1 
ATOM   4353  O  O     . LEU A  1  535 ? -38.374 -11.775 76.007  1.00 60.39  ? 533 LEU A O     1 
ATOM   4354  C  CB    . LEU A  1  535 ? -39.523 -8.970  75.447  1.00 38.20  ? 533 LEU A CB    1 
ATOM   4355  C  CG    . LEU A  1  535 ? -40.463 -7.779  75.255  1.00 45.29  ? 533 LEU A CG    1 
ATOM   4356  C  CD1   . LEU A  1  535 ? -40.000 -6.914  74.094  1.00 56.15  ? 533 LEU A CD1   1 
ATOM   4357  C  CD2   . LEU A  1  535 ? -41.886 -8.253  75.028  1.00 49.52  ? 533 LEU A CD2   1 
ATOM   4358  N  N     . ALA A  1  536 ? -40.587 -12.148 75.754  1.00 41.67  ? 534 ALA A N     1 
ATOM   4359  C  CA    . ALA A  1  536 ? -40.423 -13.500 75.246  1.00 40.53  ? 534 ALA A CA    1 
ATOM   4360  C  C     . ALA A  1  536 ? -41.313 -13.698 74.029  1.00 38.15  ? 534 ALA A C     1 
ATOM   4361  O  O     . ALA A  1  536 ? -42.361 -13.061 73.893  1.00 45.10  ? 534 ALA A O     1 
ATOM   4362  C  CB    . ALA A  1  536 ? -40.765 -14.546 76.316  1.00 41.99  ? 534 ALA A CB    1 
ATOM   4363  N  N     . TRP A  1  537 ? -40.877 -14.589 73.142  1.00 45.70  ? 535 TRP A N     1 
ATOM   4364  C  CA    . TRP A  1  537 ? -41.566 -14.858 71.890  1.00 33.51  ? 535 TRP A CA    1 
ATOM   4365  C  C     . TRP A  1  537 ? -42.024 -16.308 71.853  1.00 39.25  ? 535 TRP A C     1 
ATOM   4366  O  O     . TRP A  1  537 ? -41.280 -17.216 72.237  1.00 38.67  ? 535 TRP A O     1 
ATOM   4367  C  CB    . TRP A  1  537 ? -40.664 -14.560 70.687  1.00 34.53  ? 535 TRP A CB    1 
ATOM   4368  C  CG    . TRP A  1  537 ? -41.313 -14.816 69.357  1.00 36.29  ? 535 TRP A CG    1 
ATOM   4369  C  CD1   . TRP A  1  537 ? -42.011 -13.920 68.601  1.00 38.63  ? 535 TRP A CD1   1 
ATOM   4370  C  CD2   . TRP A  1  537 ? -41.318 -16.049 68.625  1.00 36.34  ? 535 TRP A CD2   1 
ATOM   4371  N  NE1   . TRP A  1  537 ? -42.452 -14.518 67.445  1.00 43.32  ? 535 TRP A NE1   1 
ATOM   4372  C  CE2   . TRP A  1  537 ? -42.040 -15.825 67.436  1.00 37.46  ? 535 TRP A CE2   1 
ATOM   4373  C  CE3   . TRP A  1  537 ? -40.784 -17.320 68.861  1.00 36.89  ? 535 TRP A CE3   1 
ATOM   4374  C  CZ2   . TRP A  1  537 ? -42.241 -16.823 66.485  1.00 39.11  ? 535 TRP A CZ2   1 
ATOM   4375  C  CZ3   . TRP A  1  537 ? -40.985 -18.310 67.916  1.00 38.50  ? 535 TRP A CZ3   1 
ATOM   4376  C  CH2   . TRP A  1  537 ? -41.706 -18.055 66.743  1.00 39.60  ? 535 TRP A CH2   1 
ATOM   4377  N  N     . VAL A  1  538 ? -43.246 -16.517 71.373  1.00 35.52  ? 536 VAL A N     1 
ATOM   4378  C  CA    . VAL A  1  538 ? -43.761 -17.853 71.080  1.00 38.34  ? 536 VAL A CA    1 
ATOM   4379  C  C     . VAL A  1  538 ? -44.349 -17.829 69.677  1.00 38.79  ? 536 VAL A C     1 
ATOM   4380  O  O     . VAL A  1  538 ? -44.705 -16.760 69.158  1.00 43.64  ? 536 VAL A O     1 
ATOM   4381  C  CB    . VAL A  1  538 ? -44.818 -18.300 72.118  1.00 41.23  ? 536 VAL A CB    1 
ATOM   4382  C  CG1   . VAL A  1  538 ? -44.221 -18.332 73.518  1.00 40.14  ? 536 VAL A CG1   1 
ATOM   4383  C  CG2   . VAL A  1  538 ? -46.032 -17.384 72.070  1.00 37.46  ? 536 VAL A CG2   1 
ATOM   4384  N  N     . PRO A  1  539 ? -44.448 -18.984 69.022  1.00 39.82  ? 537 PRO A N     1 
ATOM   4385  C  CA    . PRO A  1  539 ? -45.062 -19.004 67.690  1.00 41.33  ? 537 PRO A CA    1 
ATOM   4386  C  C     . PRO A  1  539 ? -46.578 -18.935 67.783  1.00 47.36  ? 537 PRO A C     1 
ATOM   4387  O  O     . PRO A  1  539 ? -47.199 -19.549 68.654  1.00 56.25  ? 537 PRO A O     1 
ATOM   4388  C  CB    . PRO A  1  539 ? -44.599 -20.345 67.108  1.00 44.29  ? 537 PRO A CB    1 
ATOM   4389  C  CG    . PRO A  1  539 ? -44.370 -21.204 68.305  1.00 42.82  ? 537 PRO A CG    1 
ATOM   4390  C  CD    . PRO A  1  539 ? -43.862 -20.287 69.382  1.00 45.47  ? 537 PRO A CD    1 
ATOM   4391  N  N     . ALA A  1  540 ? -47.172 -18.175 66.869  1.00 45.85  ? 538 ALA A N     1 
ATOM   4392  C  CA    . ALA A  1  540 ? -48.619 -18.035 66.847  1.00 47.98  ? 538 ALA A CA    1 
ATOM   4393  C  C     . ALA A  1  540 ? -49.278 -19.331 66.383  1.00 57.09  ? 538 ALA A C     1 
ATOM   4394  O  O     . ALA A  1  540 ? -48.671 -20.159 65.697  1.00 66.87  ? 538 ALA A O     1 
ATOM   4395  C  CB    . ALA A  1  540 ? -49.036 -16.878 65.939  1.00 44.43  ? 538 ALA A CB    1 
ATOM   4396  N  N     . HIS A  1  541 ? -50.535 -19.501 66.775  1.00 53.10  ? 539 HIS A N     1 
ATOM   4397  C  CA    . HIS A  1  541 ? -51.364 -20.600 66.297  1.00 60.26  ? 539 HIS A CA    1 
ATOM   4398  C  C     . HIS A  1  541 ? -50.837 -21.963 66.718  1.00 58.36  ? 539 HIS A C     1 
ATOM   4399  O  O     . HIS A  1  541 ? -51.102 -22.966 66.063  1.00 68.43  ? 539 HIS A O     1 
ATOM   4400  C  CB    . HIS A  1  541 ? -51.501 -20.544 64.776  1.00 53.55  ? 539 HIS A CB    1 
ATOM   4401  C  CG    . HIS A  1  541 ? -51.918 -19.204 64.258  1.00 72.50  ? 539 HIS A CG    1 
ATOM   4402  N  ND1   . HIS A  1  541 ? -51.135 -18.460 63.404  1.00 79.22  ? 539 HIS A ND1   1 
ATOM   4403  C  CD2   . HIS A  1  541 ? -53.033 -18.469 64.483  1.00 82.84  ? 539 HIS A CD2   1 
ATOM   4404  C  CE1   . HIS A  1  541 ? -51.751 -17.327 63.119  1.00 86.59  ? 539 HIS A CE1   1 
ATOM   4405  N  NE2   . HIS A  1  541 ? -52.904 -17.308 63.762  1.00 88.81  ? 539 HIS A NE2   1 
ATOM   4406  N  N     . LYS A  1  542 ? -50.090 -21.996 67.813  1.00 60.49  ? 540 LYS A N     1 
ATOM   4407  C  CA    . LYS A  1  542 ? -49.594 -23.253 68.351  1.00 68.95  ? 540 LYS A CA    1 
ATOM   4408  C  C     . LYS A  1  542 ? -50.413 -23.704 69.551  1.00 76.47  ? 540 LYS A C     1 
ATOM   4409  O  O     . LYS A  1  542 ? -50.071 -24.680 70.216  1.00 80.96  ? 540 LYS A O     1 
ATOM   4410  C  CB    . LYS A  1  542 ? -48.111 -23.152 68.703  1.00 70.03  ? 540 LYS A CB    1 
ATOM   4411  C  CG    . LYS A  1  542 ? -47.215 -23.023 67.484  1.00 66.06  ? 540 LYS A CG    1 
ATOM   4412  C  CD    . LYS A  1  542 ? -47.573 -24.065 66.438  1.00 52.66  ? 540 LYS A CD    1 
ATOM   4413  C  CE    . LYS A  1  542 ? -46.883 -23.782 65.116  1.00 57.56  ? 540 LYS A CE    1 
ATOM   4414  N  NZ    . LYS A  1  542 ? -47.271 -24.763 64.067  1.00 77.38  ? 540 LYS A NZ    1 
ATOM   4415  N  N     . GLY A  1  543 ? -51.497 -22.987 69.824  1.00 69.07  ? 541 GLY A N     1 
ATOM   4416  C  CA    . GLY A  1  543 ? -52.342 -23.302 70.959  1.00 62.33  ? 541 GLY A CA    1 
ATOM   4417  C  C     . GLY A  1  543 ? -51.578 -23.298 72.266  1.00 65.05  ? 541 GLY A C     1 
ATOM   4418  O  O     . GLY A  1  543 ? -51.763 -24.179 73.102  1.00 70.89  ? 541 GLY A O     1 
ATOM   4419  N  N     . ILE A  1  544 ? -50.706 -22.310 72.442  1.00 64.61  ? 542 ILE A N     1 
ATOM   4420  C  CA    . ILE A  1  544 ? -49.886 -22.243 73.643  1.00 61.89  ? 542 ILE A CA    1 
ATOM   4421  C  C     . ILE A  1  544 ? -50.399 -21.239 74.665  1.00 69.69  ? 542 ILE A C     1 
ATOM   4422  O  O     . ILE A  1  544 ? -50.423 -20.036 74.411  1.00 77.98  ? 542 ILE A O     1 
ATOM   4423  C  CB    . ILE A  1  544 ? -48.448 -21.813 73.299  1.00 56.70  ? 542 ILE A CB    1 
ATOM   4424  C  CG1   . ILE A  1  544 ? -47.834 -22.747 72.259  1.00 54.55  ? 542 ILE A CG1   1 
ATOM   4425  C  CG2   . ILE A  1  544 ? -47.593 -21.759 74.554  1.00 46.99  ? 542 ILE A CG2   1 
ATOM   4426  C  CD1   . ILE A  1  544 ? -46.452 -22.322 71.816  1.00 55.00  ? 542 ILE A CD1   1 
ATOM   4427  N  N     . GLY A  1  545 ? -50.801 -21.743 75.826  1.00 69.73  ? 543 GLY A N     1 
ATOM   4428  C  CA    . GLY A  1  545 ? -50.974 -20.933 77.014  1.00 68.67  ? 543 GLY A CA    1 
ATOM   4429  C  C     . GLY A  1  545 ? -51.853 -19.709 76.875  1.00 76.77  ? 543 GLY A C     1 
ATOM   4430  O  O     . GLY A  1  545 ? -52.960 -19.758 76.342  1.00 95.23  ? 543 GLY A O     1 
ATOM   4431  N  N     . GLY A  1  546 ? -51.324 -18.595 77.369  1.00 69.60  ? 544 GLY A N     1 
ATOM   4432  C  CA    . GLY A  1  546 ? -51.967 -17.298 77.300  1.00 71.67  ? 544 GLY A CA    1 
ATOM   4433  C  C     . GLY A  1  546 ? -52.151 -16.801 75.884  1.00 59.76  ? 544 GLY A C     1 
ATOM   4434  O  O     . GLY A  1  546 ? -53.151 -16.165 75.561  1.00 60.96  ? 544 GLY A O     1 
ATOM   4435  N  N     . ASN A  1  547 ? -51.170 -17.086 75.036  1.00 51.96  ? 545 ASN A N     1 
ATOM   4436  C  CA    . ASN A  1  547 ? -51.129 -16.533 73.693  1.00 59.17  ? 545 ASN A CA    1 
ATOM   4437  C  C     . ASN A  1  547 ? -52.354 -16.932 72.889  1.00 59.37  ? 545 ASN A C     1 
ATOM   4438  O  O     . ASN A  1  547 ? -52.904 -16.124 72.144  1.00 69.90  ? 545 ASN A O     1 
ATOM   4439  C  CB    . ASN A  1  547 ? -49.866 -17.004 72.972  1.00 52.15  ? 545 ASN A CB    1 
ATOM   4440  C  CG    . ASN A  1  547 ? -49.876 -16.663 71.497  1.00 44.85  ? 545 ASN A CG    1 
ATOM   4441  O  OD1   . ASN A  1  547 ? -49.815 -15.497 71.117  1.00 51.28  ? 545 ASN A OD1   1 
ATOM   4442  N  ND2   . ASN A  1  547 ? -49.944 -17.685 70.657  1.00 42.39  ? 545 ASN A ND2   1 
ATOM   4443  N  N     . GLU A  1  548 ? -52.783 -18.177 73.041  1.00 52.78  ? 546 GLU A N     1 
ATOM   4444  C  CA    . GLU A  1  548 ? -53.984 -18.643 72.356  1.00 64.95  ? 546 GLU A CA    1 
ATOM   4445  C  C     . GLU A  1  548 ? -55.213 -17.850 72.788  1.00 69.35  ? 546 GLU A C     1 
ATOM   4446  O  O     . GLU A  1  548 ? -56.043 -17.473 71.952  1.00 70.42  ? 546 GLU A O     1 
ATOM   4447  C  CB    . GLU A  1  548 ? -54.186 -20.135 72.625  1.00 64.96  ? 546 GLU A CB    1 
ATOM   4448  C  CG    . GLU A  1  548 ? -55.273 -20.795 71.791  1.00 75.63  ? 546 GLU A CG    1 
ATOM   4449  C  CD    . GLU A  1  548 ? -55.369 -22.290 72.040  1.00 89.13  ? 546 GLU A CD    1 
ATOM   4450  O  OE1   . GLU A  1  548 ? -54.911 -22.746 73.109  1.00 87.47  ? 546 GLU A OE1   1 
ATOM   4451  O  OE2   . GLU A  1  548 ? -55.896 -23.010 71.167  1.00 96.75  ? 546 GLU A OE2   1 
ATOM   4452  N  N     . GLN A  1  549 ? -55.347 -17.588 74.091  1.00 68.03  ? 547 GLN A N     1 
ATOM   4453  C  CA    . GLN A  1  549 ? -56.532 -16.901 74.599  1.00 64.92  ? 547 GLN A CA    1 
ATOM   4454  C  C     . GLN A  1  549 ? -56.612 -15.465 74.093  1.00 58.45  ? 547 GLN A C     1 
ATOM   4455  O  O     . GLN A  1  549 ? -57.655 -15.034 73.586  1.00 65.65  ? 547 GLN A O     1 
ATOM   4456  C  CB    . GLN A  1  549 ? -56.548 -16.930 76.129  1.00 66.66  ? 547 GLN A CB    1 
ATOM   4457  C  CG    . GLN A  1  549 ? -57.075 -18.227 76.723  1.00 72.68  ? 547 GLN A CG    1 
ATOM   4458  C  CD    . GLN A  1  549 ? -56.055 -19.344 76.690  1.00 86.90  ? 547 GLN A CD    1 
ATOM   4459  O  OE1   . GLN A  1  549 ? -56.323 -20.432 76.179  1.00 94.77  ? 547 GLN A OE1   1 
ATOM   4460  N  NE2   . GLN A  1  549 ? -54.879 -19.086 77.248  1.00 92.89  ? 547 GLN A NE2   1 
ATOM   4461  N  N     . VAL A  1  550 ? -55.520 -14.706 74.221  1.00 56.35  ? 548 VAL A N     1 
ATOM   4462  C  CA    . VAL A  1  550 ? -55.512 -13.337 73.711  1.00 62.63  ? 548 VAL A CA    1 
ATOM   4463  C  C     . VAL A  1  550 ? -55.653 -13.314 72.194  1.00 62.46  ? 548 VAL A C     1 
ATOM   4464  O  O     . VAL A  1  550 ? -56.204 -12.360 71.631  1.00 67.22  ? 548 VAL A O     1 
ATOM   4465  C  CB    . VAL A  1  550 ? -54.240 -12.599 74.179  1.00 56.10  ? 548 VAL A CB    1 
ATOM   4466  C  CG1   . VAL A  1  550 ? -52.990 -13.221 73.570  1.00 42.42  ? 548 VAL A CG1   1 
ATOM   4467  C  CG2   . VAL A  1  550 ? -54.330 -11.116 73.851  1.00 48.12  ? 548 VAL A CG2   1 
ATOM   4468  N  N     . ASP A  1  551 ? -55.167 -14.353 71.508  1.00 48.70  ? 549 ASP A N     1 
ATOM   4469  C  CA    . ASP A  1  551 ? -55.347 -14.430 70.061  1.00 55.75  ? 549 ASP A CA    1 
ATOM   4470  C  C     . ASP A  1  551 ? -56.824 -14.475 69.695  1.00 60.62  ? 549 ASP A C     1 
ATOM   4471  O  O     . ASP A  1  551 ? -57.255 -13.835 68.729  1.00 59.52  ? 549 ASP A O     1 
ATOM   4472  C  CB    . ASP A  1  551 ? -54.617 -15.653 69.506  1.00 58.39  ? 549 ASP A CB    1 
ATOM   4473  C  CG    . ASP A  1  551 ? -55.005 -15.965 68.076  1.00 70.53  ? 549 ASP A CG    1 
ATOM   4474  O  OD1   . ASP A  1  551 ? -55.883 -16.831 67.873  1.00 77.02  ? 549 ASP A OD1   1 
ATOM   4475  O  OD2   . ASP A  1  551 ? -54.432 -15.347 67.156  1.00 70.96  ? 549 ASP A OD2   1 
ATOM   4476  N  N     . LYS A  1  552 ? -57.614 -15.229 70.461  1.00 60.42  ? 550 LYS A N     1 
ATOM   4477  C  CA    . LYS A  1  552 ? -59.052 -15.298 70.222  1.00 61.15  ? 550 LYS A CA    1 
ATOM   4478  C  C     . LYS A  1  552 ? -59.721 -13.946 70.449  1.00 65.07  ? 550 LYS A C     1 
ATOM   4479  O  O     . LYS A  1  552 ? -60.584 -13.535 69.664  1.00 70.06  ? 550 LYS A O     1 
ATOM   4480  C  CB    . LYS A  1  552 ? -59.671 -16.370 71.121  1.00 54.65  ? 550 LYS A CB    1 
ATOM   4481  C  CG    . LYS A  1  552 ? -61.039 -16.855 70.673  1.00 66.66  ? 550 LYS A CG    1 
ATOM   4482  C  CD    . LYS A  1  552 ? -61.558 -17.947 71.595  1.00 81.44  ? 550 LYS A CD    1 
ATOM   4483  C  CE    . LYS A  1  552 ? -62.911 -18.468 71.139  1.00 84.20  ? 550 LYS A CE    1 
ATOM   4484  N  NZ    . LYS A  1  552 ? -63.449 -19.494 72.077  1.00 83.54  ? 550 LYS A NZ    1 
ATOM   4485  N  N     . LEU A  1  553 ? -59.343 -13.247 71.523  1.00 51.22  ? 551 LEU A N     1 
ATOM   4486  C  CA    . LEU A  1  553 ? -59.971 -11.968 71.849  1.00 51.32  ? 551 LEU A CA    1 
ATOM   4487  C  C     . LEU A  1  553 ? -59.770 -10.939 70.741  1.00 58.27  ? 551 LEU A C     1 
ATOM   4488  O  O     . LEU A  1  553 ? -60.728 -10.293 70.299  1.00 70.78  ? 551 LEU A O     1 
ATOM   4489  C  CB    . LEU A  1  553 ? -59.413 -11.436 73.169  1.00 58.42  ? 551 LEU A CB    1 
ATOM   4490  C  CG    . LEU A  1  553 ? -59.653 -12.260 74.434  1.00 60.68  ? 551 LEU A CG    1 
ATOM   4491  C  CD1   . LEU A  1  553 ? -58.963 -11.606 75.617  1.00 58.78  ? 551 LEU A CD1   1 
ATOM   4492  C  CD2   . LEU A  1  553 ? -61.140 -12.411 74.700  1.00 52.31  ? 551 LEU A CD2   1 
ATOM   4493  N  N     . VAL A  1  554 ? -58.530 -10.770 70.277  1.00 57.45  ? 552 VAL A N     1 
ATOM   4494  C  CA    . VAL A  1  554 ? -58.262 -9.740  69.277  1.00 61.39  ? 552 VAL A CA    1 
ATOM   4495  C  C     . VAL A  1  554 ? -58.765 -10.155 67.897  1.00 65.69  ? 552 VAL A C     1 
ATOM   4496  O  O     . VAL A  1  554 ? -59.102 -9.294  67.075  1.00 75.98  ? 552 VAL A O     1 
ATOM   4497  C  CB    . VAL A  1  554 ? -56.762 -9.395  69.245  1.00 51.42  ? 552 VAL A CB    1 
ATOM   4498  C  CG1   . VAL A  1  554 ? -56.332 -8.764  70.565  1.00 44.86  ? 552 VAL A CG1   1 
ATOM   4499  C  CG2   . VAL A  1  554 ? -55.933 -10.630 68.941  1.00 46.69  ? 552 VAL A CG2   1 
ATOM   4500  N  N     . SER A  1  555 ? -58.816 -11.459 67.611  1.00 66.61  ? 553 SER A N     1 
ATOM   4501  C  CA    . SER A  1  555 ? -59.298 -11.910 66.308  1.00 86.91  ? 553 SER A CA    1 
ATOM   4502  C  C     . SER A  1  555 ? -60.758 -11.532 66.097  1.00 98.65  ? 553 SER A C     1 
ATOM   4503  O  O     . SER A  1  555 ? -61.157 -11.175 64.982  1.00 108.29 ? 553 SER A O     1 
ATOM   4504  C  CB    . SER A  1  555 ? -59.117 -13.422 66.175  1.00 95.07  ? 553 SER A CB    1 
ATOM   4505  O  OG    . SER A  1  555 ? -59.654 -13.893 64.951  1.00 103.89 ? 553 SER A OG    1 
ATOM   4506  N  N     . ALA A  1  556 ? -61.567 -11.632 67.151  1.00 103.07 ? 554 ALA A N     1 
ATOM   4507  C  CA    . ALA A  1  556 ? -63.012 -11.395 67.099  1.00 111.19 ? 554 ALA A CA    1 
ATOM   4508  C  C     . ALA A  1  556 ? -63.391 -10.160 66.285  1.00 112.38 ? 554 ALA A C     1 
ATOM   4509  O  O     . ALA A  1  556 ? -64.557 -9.961  65.946  1.00 112.73 ? 554 ALA A O     1 
ATOM   4510  C  CB    . ALA A  1  556 ? -63.567 -11.282 68.513  1.00 108.38 ? 554 ALA A CB    1 
ATOM   4511  N  N     . PRO B  2  4   ? 8.313   -15.607 24.758  1.00 153.12 ? 4   PRO B N     1 
ATOM   4512  C  CA    . PRO B  2  4   ? 7.837   -16.299 23.558  1.00 161.50 ? 4   PRO B CA    1 
ATOM   4513  C  C     . PRO B  2  4   ? 7.035   -17.555 23.877  1.00 168.32 ? 4   PRO B C     1 
ATOM   4514  O  O     . PRO B  2  4   ? 7.540   -18.670 23.747  1.00 172.40 ? 4   PRO B O     1 
ATOM   4515  C  CB    . PRO B  2  4   ? 9.133   -16.648 22.828  1.00 163.74 ? 4   PRO B CB    1 
ATOM   4516  C  CG    . PRO B  2  4   ? 10.055  -15.543 23.199  1.00 160.70 ? 4   PRO B CG    1 
ATOM   4517  C  CD    . PRO B  2  4   ? 9.717   -15.180 24.624  1.00 153.69 ? 4   PRO B CD    1 
ATOM   4518  N  N     . ILE B  2  5   ? 5.789   -17.361 24.299  1.00 169.03 ? 5   ILE B N     1 
ATOM   4519  C  CA    . ILE B  2  5   ? 4.863   -18.452 24.574  1.00 165.42 ? 5   ILE B CA    1 
ATOM   4520  C  C     . ILE B  2  5   ? 3.511   -18.058 24.001  1.00 161.67 ? 5   ILE B C     1 
ATOM   4521  O  O     . ILE B  2  5   ? 3.142   -16.878 24.016  1.00 162.66 ? 5   ILE B O     1 
ATOM   4522  C  CB    . ILE B  2  5   ? 4.739   -18.755 26.086  1.00 158.54 ? 5   ILE B CB    1 
ATOM   4523  C  CG1   . ILE B  2  5   ? 6.113   -18.918 26.739  1.00 155.27 ? 5   ILE B CG1   1 
ATOM   4524  C  CG2   . ILE B  2  5   ? 3.902   -20.006 26.321  1.00 158.70 ? 5   ILE B CG2   1 
ATOM   4525  C  CD1   . ILE B  2  5   ? 6.575   -17.691 27.495  1.00 144.98 ? 5   ILE B CD1   1 
ATOM   4526  N  N     . GLU B  2  6   ? 2.779   -19.040 23.482  1.00 152.89 ? 6   GLU B N     1 
ATOM   4527  C  CA    . GLU B  2  6   ? 1.431   -18.769 23.007  1.00 143.71 ? 6   GLU B CA    1 
ATOM   4528  C  C     . GLU B  2  6   ? 0.557   -18.314 24.168  1.00 135.04 ? 6   GLU B C     1 
ATOM   4529  O  O     . GLU B  2  6   ? 0.612   -18.873 25.267  1.00 132.22 ? 6   GLU B O     1 
ATOM   4530  C  CB    . GLU B  2  6   ? 0.837   -20.017 22.353  1.00 143.68 ? 6   GLU B CB    1 
ATOM   4531  C  CG    . GLU B  2  6   ? 1.487   -20.401 21.032  1.00 148.58 ? 6   GLU B CG    1 
ATOM   4532  C  CD    . GLU B  2  6   ? 0.957   -19.593 19.864  1.00 148.94 ? 6   GLU B CD    1 
ATOM   4533  O  OE1   . GLU B  2  6   ? 0.042   -20.082 19.167  1.00 147.99 ? 6   GLU B OE1   1 
ATOM   4534  O  OE2   . GLU B  2  6   ? 1.448   -18.465 19.648  1.00 148.58 ? 6   GLU B OE2   1 
ATOM   4535  N  N     . THR B  2  7   ? -0.256  -17.295 23.918  1.00 127.85 ? 7   THR B N     1 
ATOM   4536  C  CA    . THR B  2  7   ? -1.177  -16.769 24.914  1.00 119.25 ? 7   THR B CA    1 
ATOM   4537  C  C     . THR B  2  7   ? -2.564  -17.317 24.615  1.00 120.01 ? 7   THR B C     1 
ATOM   4538  O  O     . THR B  2  7   ? -3.134  -17.026 23.557  1.00 123.33 ? 7   THR B O     1 
ATOM   4539  C  CB    . THR B  2  7   ? -1.188  -15.240 24.906  1.00 113.26 ? 7   THR B CB    1 
ATOM   4540  O  OG1   . THR B  2  7   ? -1.754  -14.770 23.675  1.00 118.27 ? 7   THR B OG1   1 
ATOM   4541  C  CG2   . THR B  2  7   ? 0.226   -14.696 25.046  1.00 113.04 ? 7   THR B CG2   1 
ATOM   4542  N  N     . VAL B  2  8   ? -3.098  -18.113 25.536  1.00 115.19 ? 8   VAL B N     1 
ATOM   4543  C  CA    . VAL B  2  8   ? -4.448  -18.648 25.395  1.00 109.70 ? 8   VAL B CA    1 
ATOM   4544  C  C     . VAL B  2  8   ? -5.404  -17.466 25.315  1.00 111.56 ? 8   VAL B C     1 
ATOM   4545  O  O     . VAL B  2  8   ? -5.451  -16.647 26.244  1.00 109.70 ? 8   VAL B O     1 
ATOM   4546  C  CB    . VAL B  2  8   ? -4.809  -19.585 26.559  1.00 100.00 ? 8   VAL B CB    1 
ATOM   4547  C  CG1   . VAL B  2  8   ? -6.197  -20.175 26.356  1.00 104.57 ? 8   VAL B CG1   1 
ATOM   4548  C  CG2   . VAL B  2  8   ? -3.768  -20.685 26.698  1.00 99.26  ? 8   VAL B CG2   1 
ATOM   4549  N  N     . PRO B  2  9   ? -6.172  -17.328 24.237  1.00 113.13 ? 9   PRO B N     1 
ATOM   4550  C  CA    . PRO B  2  9   ? -7.132  -16.225 24.167  1.00 111.23 ? 9   PRO B CA    1 
ATOM   4551  C  C     . PRO B  2  9   ? -8.226  -16.399 25.204  1.00 104.24 ? 9   PRO B C     1 
ATOM   4552  O  O     . PRO B  2  9   ? -8.630  -17.516 25.537  1.00 101.63 ? 9   PRO B O     1 
ATOM   4553  C  CB    . PRO B  2  9   ? -7.688  -16.325 22.742  1.00 107.87 ? 9   PRO B CB    1 
ATOM   4554  C  CG    . PRO B  2  9   ? -7.487  -17.757 22.363  1.00 105.31 ? 9   PRO B CG    1 
ATOM   4555  C  CD    . PRO B  2  9   ? -6.216  -18.184 23.039  1.00 106.96 ? 9   PRO B CD    1 
ATOM   4556  N  N     . VAL B  2  10  ? -8.709  -15.272 25.717  1.00 101.99 ? 10  VAL B N     1 
ATOM   4557  C  CA    . VAL B  2  10  ? -9.692  -15.263 26.790  1.00 97.33  ? 10  VAL B CA    1 
ATOM   4558  C  C     . VAL B  2  10  ? -10.804 -14.303 26.400  1.00 94.29  ? 10  VAL B C     1 
ATOM   4559  O  O     . VAL B  2  10  ? -10.549 -13.249 25.808  1.00 92.18  ? 10  VAL B O     1 
ATOM   4560  C  CB    . VAL B  2  10  ? -9.071  -14.847 28.144  1.00 97.50  ? 10  VAL B CB    1 
ATOM   4561  C  CG1   . VAL B  2  10  ? -10.046 -15.104 29.286  1.00 101.68 ? 10  VAL B CG1   1 
ATOM   4562  C  CG2   . VAL B  2  10  ? -7.752  -15.569 28.391  1.00 97.77  ? 10  VAL B CG2   1 
ATOM   4563  N  N     . LYS B  2  11  ? -12.036 -14.671 26.734  1.00 97.44  ? 11  LYS B N     1 
ATOM   4564  C  CA    . LYS B  2  11  ? -13.206 -13.865 26.433  1.00 103.92 ? 11  LYS B CA    1 
ATOM   4565  C  C     . LYS B  2  11  ? -14.084 -13.768 27.669  1.00 103.80 ? 11  LYS B C     1 
ATOM   4566  O  O     . LYS B  2  11  ? -14.130 -14.687 28.492  1.00 105.67 ? 11  LYS B O     1 
ATOM   4567  C  CB    . LYS B  2  11  ? -14.017 -14.451 25.265  1.00 113.21 ? 11  LYS B CB    1 
ATOM   4568  C  CG    . LYS B  2  11  ? -13.927 -13.645 23.980  1.00 122.59 ? 11  LYS B CG    1 
ATOM   4569  C  CD    . LYS B  2  11  ? -12.536 -13.719 23.373  1.00 125.12 ? 11  LYS B CD    1 
ATOM   4570  C  CE    . LYS B  2  11  ? -12.332 -12.636 22.326  1.00 124.63 ? 11  LYS B CE    1 
ATOM   4571  N  NZ    . LYS B  2  11  ? -13.342 -12.713 21.236  1.00 128.32 ? 11  LYS B NZ    1 
ATOM   4572  N  N     . LEU B  2  12  ? -14.784 -12.647 27.790  1.00 101.55 ? 12  LEU B N     1 
ATOM   4573  C  CA    . LEU B  2  12  ? -15.775 -12.510 28.841  1.00 92.70  ? 12  LEU B CA    1 
ATOM   4574  C  C     . LEU B  2  12  ? -17.015 -13.323 28.486  1.00 93.38  ? 12  LEU B C     1 
ATOM   4575  O  O     . LEU B  2  12  ? -17.193 -13.768 27.348  1.00 102.57 ? 12  LEU B O     1 
ATOM   4576  C  CB    . LEU B  2  12  ? -16.148 -11.043 29.048  1.00 87.63  ? 12  LEU B CB    1 
ATOM   4577  C  CG    . LEU B  2  12  ? -15.006 -10.070 29.343  1.00 83.46  ? 12  LEU B CG    1 
ATOM   4578  C  CD1   . LEU B  2  12  ? -15.548 -8.662  29.518  1.00 81.19  ? 12  LEU B CD1   1 
ATOM   4579  C  CD2   . LEU B  2  12  ? -14.223 -10.505 30.573  1.00 78.65  ? 12  LEU B CD2   1 
ATOM   4580  N  N     . LYS B  2  13  ? -17.865 -13.543 29.485  1.00 91.34  ? 13  LYS B N     1 
ATOM   4581  C  CA    . LYS B  2  13  ? -19.160 -14.141 29.210  1.00 94.07  ? 13  LYS B CA    1 
ATOM   4582  C  C     . LYS B  2  13  ? -19.909 -13.277 28.196  1.00 96.92  ? 13  LYS B C     1 
ATOM   4583  O  O     . LYS B  2  13  ? -19.682 -12.066 28.115  1.00 97.75  ? 13  LYS B O     1 
ATOM   4584  C  CB    . LYS B  2  13  ? -19.967 -14.285 30.499  1.00 89.01  ? 13  LYS B CB    1 
ATOM   4585  C  CG    . LYS B  2  13  ? -19.249 -15.080 31.578  1.00 88.87  ? 13  LYS B CG    1 
ATOM   4586  C  CD    . LYS B  2  13  ? -20.140 -15.336 32.780  1.00 91.80  ? 13  LYS B CD    1 
ATOM   4587  C  CE    . LYS B  2  13  ? -21.198 -16.379 32.474  1.00 105.11 ? 13  LYS B CE    1 
ATOM   4588  N  NZ    . LYS B  2  13  ? -22.000 -16.712 33.682  1.00 105.26 ? 13  LYS B NZ    1 
ATOM   4589  N  N     . PRO B  2  14  ? -20.802 -13.869 27.406  1.00 100.00 ? 14  PRO B N     1 
ATOM   4590  C  CA    . PRO B  2  14  ? -21.416 -13.114 26.308  1.00 103.16 ? 14  PRO B CA    1 
ATOM   4591  C  C     . PRO B  2  14  ? -22.319 -12.004 26.821  1.00 101.38 ? 14  PRO B C     1 
ATOM   4592  O  O     . PRO B  2  14  ? -22.980 -12.130 27.854  1.00 100.41 ? 14  PRO B O     1 
ATOM   4593  C  CB    . PRO B  2  14  ? -22.220 -14.178 25.550  1.00 108.98 ? 14  PRO B CB    1 
ATOM   4594  C  CG    . PRO B  2  14  ? -21.576 -15.477 25.923  1.00 109.62 ? 14  PRO B CG    1 
ATOM   4595  C  CD    . PRO B  2  14  ? -21.134 -15.302 27.341  1.00 105.94 ? 14  PRO B CD    1 
ATOM   4596  N  N     . GLY B  2  15  ? -22.341 -10.904 26.070  1.00 102.13 ? 15  GLY B N     1 
ATOM   4597  C  CA    . GLY B  2  15  ? -23.151 -9.756  26.441  1.00 103.90 ? 15  GLY B CA    1 
ATOM   4598  C  C     . GLY B  2  15  ? -22.762 -9.130  27.761  1.00 102.43 ? 15  GLY B C     1 
ATOM   4599  O  O     . GLY B  2  15  ? -23.616 -8.554  28.442  1.00 103.16 ? 15  GLY B O     1 
ATOM   4600  N  N     . MET B  2  16  ? -21.489 -9.226  28.142  1.00 99.31  ? 16  MET B N     1 
ATOM   4601  C  CA    . MET B  2  16  ? -21.018 -8.777  29.444  1.00 91.72  ? 16  MET B CA    1 
ATOM   4602  C  C     . MET B  2  16  ? -19.773 -7.918  29.279  1.00 95.78  ? 16  MET B C     1 
ATOM   4603  O  O     . MET B  2  16  ? -18.887 -8.238  28.481  1.00 99.84  ? 16  MET B O     1 
ATOM   4604  C  CB    . MET B  2  16  ? -20.714 -9.967  30.364  1.00 89.49  ? 16  MET B CB    1 
ATOM   4605  C  CG    . MET B  2  16  ? -21.463 -9.934  31.688  1.00 96.05  ? 16  MET B CG    1 
ATOM   4606  S  SD    . MET B  2  16  ? -21.249 -11.443 32.653  1.00 102.98 ? 16  MET B SD    1 
ATOM   4607  C  CE    . MET B  2  16  ? -22.294 -11.097 34.066  1.00 105.37 ? 16  MET B CE    1 
ATOM   4608  N  N     . ASP B  2  17  ? -19.711 -6.828  30.039  1.00 93.68  ? 17  ASP B N     1 
ATOM   4609  C  CA    . ASP B  2  17  ? -18.648 -5.842  29.928  1.00 96.15  ? 17  ASP B CA    1 
ATOM   4610  C  C     . ASP B  2  17  ? -17.720 -5.944  31.132  1.00 95.11  ? 17  ASP B C     1 
ATOM   4611  O  O     . ASP B  2  17  ? -18.106 -6.421  32.201  1.00 93.86  ? 17  ASP B O     1 
ATOM   4612  C  CB    . ASP B  2  17  ? -19.228 -4.426  29.824  1.00 104.20 ? 17  ASP B CB    1 
ATOM   4613  C  CG    . ASP B  2  17  ? -18.177 -3.388  29.488  1.00 110.04 ? 17  ASP B CG    1 
ATOM   4614  O  OD1   . ASP B  2  17  ? -17.197 -3.740  28.799  1.00 104.45 ? 17  ASP B OD1   1 
ATOM   4615  O  OD2   . ASP B  2  17  ? -18.330 -2.223  29.910  1.00 117.05 ? 17  ASP B OD2   1 
ATOM   4616  N  N     . GLY B  2  18  ? -16.484 -5.483  30.943  1.00 90.29  ? 18  GLY B N     1 
ATOM   4617  C  CA    . GLY B  2  18  ? -15.453 -5.575  31.953  1.00 77.32  ? 18  GLY B CA    1 
ATOM   4618  C  C     . GLY B  2  18  ? -15.781 -4.930  33.287  1.00 72.00  ? 18  GLY B C     1 
ATOM   4619  O  O     . GLY B  2  18  ? -16.714 -4.131  33.415  1.00 74.97  ? 18  GLY B O     1 
ATOM   4620  N  N     . PRO B  2  19  ? -15.004 -5.279  34.314  1.00 64.73  ? 19  PRO B N     1 
ATOM   4621  C  CA    . PRO B  2  19  ? -15.227 -4.712  35.652  1.00 65.33  ? 19  PRO B CA    1 
ATOM   4622  C  C     . PRO B  2  19  ? -14.871 -3.232  35.696  1.00 62.20  ? 19  PRO B C     1 
ATOM   4623  O  O     . PRO B  2  19  ? -13.789 -2.826  35.264  1.00 64.75  ? 19  PRO B O     1 
ATOM   4624  C  CB    . PRO B  2  19  ? -14.302 -5.543  36.548  1.00 66.33  ? 19  PRO B CB    1 
ATOM   4625  C  CG    . PRO B  2  19  ? -13.215 -5.993  35.633  1.00 59.30  ? 19  PRO B CG    1 
ATOM   4626  C  CD    . PRO B  2  19  ? -13.867 -6.216  34.294  1.00 64.46  ? 19  PRO B CD    1 
ATOM   4627  N  N     . LYS B  2  20  ? -15.791 -2.425  36.224  1.00 61.01  ? 20  LYS B N     1 
ATOM   4628  C  CA    . LYS B  2  20  ? -15.524 -1.026  36.564  1.00 60.78  ? 20  LYS B CA    1 
ATOM   4629  C  C     . LYS B  2  20  ? -15.894 -0.804  38.030  1.00 62.18  ? 20  LYS B C     1 
ATOM   4630  O  O     . LYS B  2  20  ? -17.056 -0.543  38.351  1.00 58.62  ? 20  LYS B O     1 
ATOM   4631  C  CB    . LYS B  2  20  ? -16.302 -0.087  35.644  1.00 60.31  ? 20  LYS B CB    1 
ATOM   4632  C  CG    . LYS B  2  20  ? -16.166 -0.404  34.163  1.00 67.25  ? 20  LYS B CG    1 
ATOM   4633  C  CD    . LYS B  2  20  ? -17.132 0.425   33.334  1.00 74.68  ? 20  LYS B CD    1 
ATOM   4634  C  CE    . LYS B  2  20  ? -17.072 0.040   31.866  1.00 77.47  ? 20  LYS B CE    1 
ATOM   4635  N  NZ    . LYS B  2  20  ? -18.084 0.780   31.062  1.00 79.96  ? 20  LYS B NZ    1 
ATOM   4636  N  N     . VAL B  2  21  ? -14.909 -0.916  38.921  1.00 60.72  ? 21  VAL B N     1 
ATOM   4637  C  CA    . VAL B  2  21  ? -15.146 -0.908  40.362  1.00 51.82  ? 21  VAL B CA    1 
ATOM   4638  C  C     . VAL B  2  21  ? -14.172 0.076   40.999  1.00 52.99  ? 21  VAL B C     1 
ATOM   4639  O  O     . VAL B  2  21  ? -12.953 -0.069  40.849  1.00 58.66  ? 21  VAL B O     1 
ATOM   4640  C  CB    . VAL B  2  21  ? -14.989 -2.304  40.989  1.00 51.51  ? 21  VAL B CB    1 
ATOM   4641  C  CG1   . VAL B  2  21  ? -15.440 -2.280  42.441  1.00 41.82  ? 21  VAL B CG1   1 
ATOM   4642  C  CG2   . VAL B  2  21  ? -15.782 -3.338  40.204  1.00 44.20  ? 21  VAL B CG2   1 
ATOM   4643  N  N     . LYS B  2  22  ? -14.711 1.069   41.705  1.00 58.41  ? 22  LYS B N     1 
ATOM   4644  C  CA    . LYS B  2  22  ? -13.893 2.109   42.322  1.00 54.85  ? 22  LYS B CA    1 
ATOM   4645  C  C     . LYS B  2  22  ? -12.914 1.535   43.342  1.00 57.32  ? 22  LYS B C     1 
ATOM   4646  O  O     . LYS B  2  22  ? -13.229 0.591   44.072  1.00 59.82  ? 22  LYS B O     1 
ATOM   4647  C  CB    . LYS B  2  22  ? -14.787 3.147   43.001  1.00 52.03  ? 22  LYS B CB    1 
ATOM   4648  C  CG    . LYS B  2  22  ? -15.364 4.193   42.068  1.00 64.68  ? 22  LYS B CG    1 
ATOM   4649  C  CD    . LYS B  2  22  ? -16.160 5.218   42.854  1.00 74.78  ? 22  LYS B CD    1 
ATOM   4650  C  CE    . LYS B  2  22  ? -16.349 6.499   42.064  1.00 83.21  ? 22  LYS B CE    1 
ATOM   4651  N  NZ    . LYS B  2  22  ? -17.010 7.552   42.883  1.00 88.93  ? 22  LYS B NZ    1 
ATOM   4652  N  N     . GLN B  2  23  ? -11.714 2.113   43.379  1.00 52.22  ? 23  GLN B N     1 
ATOM   4653  C  CA    . GLN B  2  23  ? -10.728 1.788   44.401  1.00 45.89  ? 23  GLN B CA    1 
ATOM   4654  C  C     . GLN B  2  23  ? -11.107 2.441   45.726  1.00 46.54  ? 23  GLN B C     1 
ATOM   4655  O  O     . GLN B  2  23  ? -11.504 3.609   45.766  1.00 52.57  ? 23  GLN B O     1 
ATOM   4656  C  CB    . GLN B  2  23  ? -9.338  2.254   43.963  1.00 54.87  ? 23  GLN B CB    1 
ATOM   4657  C  CG    . GLN B  2  23  ? -8.277  2.206   45.051  1.00 41.28  ? 23  GLN B CG    1 
ATOM   4658  C  CD    . GLN B  2  23  ? -7.881  0.794   45.431  1.00 49.34  ? 23  GLN B CD    1 
ATOM   4659  O  OE1   . GLN B  2  23  ? -7.792  -0.092  44.581  1.00 40.46  ? 23  GLN B OE1   1 
ATOM   4660  N  NE2   . GLN B  2  23  ? -7.637  0.577   46.717  1.00 59.80  ? 23  GLN B NE2   1 
ATOM   4661  N  N     . TRP B  2  24  ? -10.981 1.684   46.815  1.00 41.90  ? 24  TRP B N     1 
ATOM   4662  C  CA    . TRP B  2  24  ? -11.293 2.250   48.118  1.00 41.98  ? 24  TRP B CA    1 
ATOM   4663  C  C     . TRP B  2  24  ? -10.044 2.810   48.789  1.00 48.09  ? 24  TRP B C     1 
ATOM   4664  O  O     . TRP B  2  24  ? -8.919  2.426   48.452  1.00 45.81  ? 24  TRP B O     1 
ATOM   4665  C  CB    . TRP B  2  24  ? -11.948 1.192   49.007  1.00 50.85  ? 24  TRP B CB    1 
ATOM   4666  C  CG    . TRP B  2  24  ? -11.137 -0.050  49.232  1.00 47.24  ? 24  TRP B CG    1 
ATOM   4667  C  CD1   . TRP B  2  24  ? -9.985  -0.161  49.958  1.00 47.23  ? 24  TRP B CD1   1 
ATOM   4668  C  CD2   . TRP B  2  24  ? -11.441 -1.366  48.759  1.00 40.84  ? 24  TRP B CD2   1 
ATOM   4669  N  NE1   . TRP B  2  24  ? -9.545  -1.463  49.949  1.00 54.06  ? 24  TRP B NE1   1 
ATOM   4670  C  CE2   . TRP B  2  24  ? -10.423 -2.223  49.222  1.00 44.81  ? 24  TRP B CE2   1 
ATOM   4671  C  CE3   . TRP B  2  24  ? -12.473 -1.903  47.983  1.00 41.66  ? 24  TRP B CE3   1 
ATOM   4672  C  CZ2   . TRP B  2  24  ? -10.407 -3.586  48.933  1.00 46.49  ? 24  TRP B CZ2   1 
ATOM   4673  C  CZ3   . TRP B  2  24  ? -12.454 -3.255  47.698  1.00 46.67  ? 24  TRP B CZ3   1 
ATOM   4674  C  CH2   . TRP B  2  24  ? -11.429 -4.081  48.171  1.00 47.37  ? 24  TRP B CH2   1 
ATOM   4675  N  N     . PRO B  2  25  ? -10.213 3.733   49.742  1.00 51.71  ? 25  PRO B N     1 
ATOM   4676  C  CA    . PRO B  2  25  ? -9.053  4.291   50.451  1.00 51.94  ? 25  PRO B CA    1 
ATOM   4677  C  C     . PRO B  2  25  ? -8.192  3.214   51.096  1.00 53.64  ? 25  PRO B C     1 
ATOM   4678  O  O     . PRO B  2  25  ? -8.693  2.206   51.600  1.00 55.59  ? 25  PRO B O     1 
ATOM   4679  C  CB    . PRO B  2  25  ? -9.689  5.201   51.507  1.00 51.37  ? 25  PRO B CB    1 
ATOM   4680  C  CG    . PRO B  2  25  ? -11.012 5.562   50.942  1.00 54.77  ? 25  PRO B CG    1 
ATOM   4681  C  CD    . PRO B  2  25  ? -11.474 4.367   50.167  1.00 53.78  ? 25  PRO B CD    1 
ATOM   4682  N  N     . LEU B  2  26  ? -6.881  3.438   51.069  1.00 45.45  ? 26  LEU B N     1 
ATOM   4683  C  CA    . LEU B  2  26  ? -5.912  2.535   51.670  1.00 44.99  ? 26  LEU B CA    1 
ATOM   4684  C  C     . LEU B  2  26  ? -5.137  3.256   52.766  1.00 45.11  ? 26  LEU B C     1 
ATOM   4685  O  O     . LEU B  2  26  ? -4.942  4.474   52.713  1.00 48.77  ? 26  LEU B O     1 
ATOM   4686  C  CB    . LEU B  2  26  ? -4.944  1.982   50.622  1.00 44.26  ? 26  LEU B CB    1 
ATOM   4687  C  CG    . LEU B  2  26  ? -5.587  1.245   49.446  1.00 45.83  ? 26  LEU B CG    1 
ATOM   4688  C  CD1   . LEU B  2  26  ? -4.532  0.752   48.471  1.00 51.83  ? 26  LEU B CD1   1 
ATOM   4689  C  CD2   . LEU B  2  26  ? -6.438  0.091   49.946  1.00 45.92  ? 26  LEU B CD2   1 
ATOM   4690  N  N     . THR B  2  27  ? -4.693  2.488   53.757  1.00 45.59  ? 27  THR B N     1 
ATOM   4691  C  CA    . THR B  2  27  ? -3.809  3.016   54.786  1.00 44.36  ? 27  THR B CA    1 
ATOM   4692  C  C     . THR B  2  27  ? -2.436  3.338   54.200  1.00 55.06  ? 27  THR B C     1 
ATOM   4693  O  O     . THR B  2  27  ? -2.086  2.919   53.093  1.00 67.99  ? 27  THR B O     1 
ATOM   4694  C  CB    . THR B  2  27  ? -3.665  2.023   55.941  1.00 42.26  ? 27  THR B CB    1 
ATOM   4695  O  OG1   . THR B  2  27  ? -3.085  0.804   55.460  1.00 53.26  ? 27  THR B OG1   1 
ATOM   4696  C  CG2   . THR B  2  27  ? -5.022  1.718   56.560  1.00 41.42  ? 27  THR B CG2   1 
ATOM   4697  N  N     . GLU B  2  28  ? -1.660  4.117   54.958  1.00 53.96  ? 28  GLU B N     1 
ATOM   4698  C  CA    . GLU B  2  28  ? -0.321  4.495   54.513  1.00 54.52  ? 28  GLU B CA    1 
ATOM   4699  C  C     . GLU B  2  28  ? 0.561   3.270   54.305  1.00 53.84  ? 28  GLU B C     1 
ATOM   4700  O  O     . GLU B  2  28  ? 1.280   3.171   53.304  1.00 68.19  ? 28  GLU B O     1 
ATOM   4701  C  CB    . GLU B  2  28  ? 0.322   5.452   55.517  1.00 61.63  ? 28  GLU B CB    1 
ATOM   4702  C  CG    . GLU B  2  28  ? 1.780   5.761   55.207  1.00 71.88  ? 28  GLU B CG    1 
ATOM   4703  C  CD    . GLU B  2  28  ? 2.234   7.095   55.768  1.00 91.01  ? 28  GLU B CD    1 
ATOM   4704  O  OE1   . GLU B  2  28  ? 1.723   7.502   56.831  1.00 95.38  ? 28  GLU B OE1   1 
ATOM   4705  O  OE2   . GLU B  2  28  ? 3.100   7.740   55.139  1.00 98.16  ? 28  GLU B OE2   1 
ATOM   4706  N  N     . GLU B  2  29  ? 0.533   2.334   55.256  1.00 54.98  ? 29  GLU B N     1 
ATOM   4707  C  CA    . GLU B  2  29  ? 1.367   1.142   55.140  1.00 51.37  ? 29  GLU B CA    1 
ATOM   4708  C  C     . GLU B  2  29  ? 0.993   0.319   53.913  1.00 55.01  ? 29  GLU B C     1 
ATOM   4709  O  O     . GLU B  2  29  ? 1.869   -0.243  53.245  1.00 70.33  ? 29  GLU B O     1 
ATOM   4710  C  CB    . GLU B  2  29  ? 1.251   0.301   56.410  1.00 60.97  ? 29  GLU B CB    1 
ATOM   4711  C  CG    . GLU B  2  29  ? -0.140  0.302   57.025  1.00 88.90  ? 29  GLU B CG    1 
ATOM   4712  C  CD    . GLU B  2  29  ? -0.374  -0.885  57.934  1.00 97.23  ? 29  GLU B CD    1 
ATOM   4713  O  OE1   . GLU B  2  29  ? -1.460  -1.494  57.847  1.00 98.90  ? 29  GLU B OE1   1 
ATOM   4714  O  OE2   . GLU B  2  29  ? 0.533   -1.214  58.727  1.00 91.12  ? 29  GLU B OE2   1 
ATOM   4715  N  N     . LYS B  2  30  ? -0.302  0.233   53.599  1.00 57.54  ? 30  LYS B N     1 
ATOM   4716  C  CA    . LYS B  2  30  ? -0.724  -0.545  52.438  1.00 55.38  ? 30  LYS B CA    1 
ATOM   4717  C  C     . LYS B  2  30  ? -0.348  0.155   51.137  1.00 51.50  ? 30  LYS B C     1 
ATOM   4718  O  O     . LYS B  2  30  ? -0.012  -0.505  50.147  1.00 60.23  ? 30  LYS B O     1 
ATOM   4719  C  CB    . LYS B  2  30  ? -2.227  -0.818  52.494  1.00 53.39  ? 30  LYS B CB    1 
ATOM   4720  C  CG    . LYS B  2  30  ? -2.642  -1.799  53.584  1.00 48.36  ? 30  LYS B CG    1 
ATOM   4721  C  CD    . LYS B  2  30  ? -4.112  -2.175  53.463  1.00 54.81  ? 30  LYS B CD    1 
ATOM   4722  C  CE    . LYS B  2  30  ? -4.619  -2.865  54.722  1.00 54.58  ? 30  LYS B CE    1 
ATOM   4723  N  NZ    . LYS B  2  30  ? -4.045  -4.227  54.902  1.00 65.38  ? 30  LYS B NZ    1 
ATOM   4724  N  N     . ILE B  2  31  ? -0.429  1.489   51.106  1.00 49.69  ? 31  ILE B N     1 
ATOM   4725  C  CA    . ILE B  2  31  ? -0.049  2.220   49.901  1.00 49.34  ? 31  ILE B CA    1 
ATOM   4726  C  C     . ILE B  2  31  ? 1.454   2.126   49.675  1.00 56.20  ? 31  ILE B C     1 
ATOM   4727  O  O     . ILE B  2  31  ? 1.915   1.926   48.545  1.00 63.68  ? 31  ILE B O     1 
ATOM   4728  C  CB    . ILE B  2  31  ? -0.513  3.686   49.986  1.00 47.98  ? 31  ILE B CB    1 
ATOM   4729  C  CG1   . ILE B  2  31  ? -2.032  3.781   49.840  1.00 44.38  ? 31  ILE B CG1   1 
ATOM   4730  C  CG2   . ILE B  2  31  ? 0.173   4.531   48.920  1.00 47.42  ? 31  ILE B CG2   1 
ATOM   4731  C  CD1   . ILE B  2  31  ? -2.562  5.201   49.845  1.00 46.71  ? 31  ILE B CD1   1 
ATOM   4732  N  N     . LYS B  2  32  ? 2.242   2.262   50.745  1.00 50.20  ? 32  LYS B N     1 
ATOM   4733  C  CA    . LYS B  2  32  ? 3.688   2.114   50.618  1.00 48.99  ? 32  LYS B CA    1 
ATOM   4734  C  C     . LYS B  2  32  ? 4.054   0.707   50.167  1.00 59.27  ? 32  LYS B C     1 
ATOM   4735  O  O     . LYS B  2  32  ? 4.963   0.524   49.349  1.00 64.93  ? 32  LYS B O     1 
ATOM   4736  C  CB    . LYS B  2  32  ? 4.371   2.455   51.942  1.00 50.18  ? 32  LYS B CB    1 
ATOM   4737  C  CG    . LYS B  2  32  ? 4.520   3.946   52.187  1.00 57.65  ? 32  LYS B CG    1 
ATOM   4738  C  CD    . LYS B  2  32  ? 5.103   4.226   53.562  1.00 72.32  ? 32  LYS B CD    1 
ATOM   4739  C  CE    . LYS B  2  32  ? 5.503   5.685   53.703  1.00 86.65  ? 32  LYS B CE    1 
ATOM   4740  N  NZ    . LYS B  2  32  ? 4.390   6.602   53.336  1.00 95.56  ? 32  LYS B NZ    1 
ATOM   4741  N  N     . ALA B  2  33  ? 3.372   -0.302  50.714  1.00 54.97  ? 33  ALA B N     1 
ATOM   4742  C  CA    . ALA B  2  33  ? 3.644   -1.679  50.322  1.00 51.46  ? 33  ALA B CA    1 
ATOM   4743  C  C     . ALA B  2  33  ? 3.319   -1.905  48.851  1.00 56.94  ? 33  ALA B C     1 
ATOM   4744  O  O     . ALA B  2  33  ? 4.088   -2.549  48.129  1.00 54.94  ? 33  ALA B O     1 
ATOM   4745  C  CB    . ALA B  2  33  ? 2.848   -2.640  51.201  1.00 44.87  ? 33  ALA B CB    1 
ATOM   4746  N  N     . LEU B  2  34  ? 2.174   -1.389  48.392  1.00 54.98  ? 34  LEU B N     1 
ATOM   4747  C  CA    . LEU B  2  34  ? 1.778   -1.585  47.000  1.00 52.96  ? 34  LEU B CA    1 
ATOM   4748  C  C     . LEU B  2  34  ? 2.727   -0.862  46.052  1.00 61.38  ? 34  LEU B C     1 
ATOM   4749  O  O     . LEU B  2  34  ? 3.087   -1.401  44.998  1.00 64.01  ? 34  LEU B O     1 
ATOM   4750  C  CB    . LEU B  2  34  ? 0.337   -1.120  46.792  1.00 52.84  ? 34  LEU B CB    1 
ATOM   4751  C  CG    . LEU B  2  34  ? -0.738  -2.069  47.327  1.00 51.39  ? 34  LEU B CG    1 
ATOM   4752  C  CD1   . LEU B  2  34  ? -2.125  -1.519  47.052  1.00 47.40  ? 34  LEU B CD1   1 
ATOM   4753  C  CD2   . LEU B  2  34  ? -0.579  -3.452  46.715  1.00 51.90  ? 34  LEU B CD2   1 
ATOM   4754  N  N     . VAL B  2  35  ? 3.133   0.361   46.405  1.00 63.19  ? 35  VAL B N     1 
ATOM   4755  C  CA    . VAL B  2  35  ? 4.016   1.134   45.534  1.00 61.76  ? 35  VAL B CA    1 
ATOM   4756  C  C     . VAL B  2  35  ? 5.341   0.406   45.357  1.00 56.17  ? 35  VAL B C     1 
ATOM   4757  O  O     . VAL B  2  35  ? 5.904   0.360   44.256  1.00 59.40  ? 35  VAL B O     1 
ATOM   4758  C  CB    . VAL B  2  35  ? 4.215   2.555   46.098  1.00 51.50  ? 35  VAL B CB    1 
ATOM   4759  C  CG1   . VAL B  2  35  ? 5.442   3.215   45.478  1.00 54.21  ? 35  VAL B CG1   1 
ATOM   4760  C  CG2   . VAL B  2  35  ? 2.977   3.402   45.851  1.00 50.73  ? 35  VAL B CG2   1 
ATOM   4761  N  N     . GLU B  2  36  ? 5.857   -0.179  46.440  1.00 51.68  ? 36  GLU B N     1 
ATOM   4762  C  CA    . GLU B  2  36  ? 7.083   -0.964  46.348  1.00 64.59  ? 36  GLU B CA    1 
ATOM   4763  C  C     . GLU B  2  36  ? 6.863   -2.247  45.554  1.00 65.91  ? 36  GLU B C     1 
ATOM   4764  O  O     . GLU B  2  36  ? 7.709   -2.627  44.736  1.00 71.01  ? 36  GLU B O     1 
ATOM   4765  C  CB    . GLU B  2  36  ? 7.608   -1.274  47.750  1.00 65.57  ? 36  GLU B CB    1 
ATOM   4766  C  CG    . GLU B  2  36  ? 8.863   -2.129  47.773  1.00 82.80  ? 36  GLU B CG    1 
ATOM   4767  C  CD    . GLU B  2  36  ? 9.456   -2.254  49.162  1.00 102.01 ? 36  GLU B CD    1 
ATOM   4768  O  OE1   . GLU B  2  36  ? 9.415   -1.260  49.918  1.00 110.06 ? 36  GLU B OE1   1 
ATOM   4769  O  OE2   . GLU B  2  36  ? 9.957   -3.347  49.498  1.00 107.51 ? 36  GLU B OE2   1 
ATOM   4770  N  N     . ILE B  2  37  ? 5.740   -2.933  45.787  1.00 64.27  ? 37  ILE B N     1 
ATOM   4771  C  CA    . ILE B  2  37  ? 5.461   -4.176  45.069  1.00 65.06  ? 37  ILE B CA    1 
ATOM   4772  C  C     . ILE B  2  37  ? 5.317   -3.907  43.576  1.00 63.26  ? 37  ILE B C     1 
ATOM   4773  O  O     . ILE B  2  37  ? 5.913   -4.597  42.740  1.00 59.19  ? 37  ILE B O     1 
ATOM   4774  C  CB    . ILE B  2  37  ? 4.204   -4.858  45.642  1.00 65.25  ? 37  ILE B CB    1 
ATOM   4775  C  CG1   . ILE B  2  37  ? 4.476   -5.404  47.044  1.00 70.15  ? 37  ILE B CG1   1 
ATOM   4776  C  CG2   . ILE B  2  37  ? 3.730   -5.971  44.720  1.00 52.39  ? 37  ILE B CG2   1 
ATOM   4777  C  CD1   . ILE B  2  37  ? 5.505   -6.506  47.082  1.00 84.01  ? 37  ILE B CD1   1 
ATOM   4778  N  N     . CYS B  2  38  ? 4.504   -2.910  43.220  1.00 59.92  ? 38  CYS B N     1 
ATOM   4779  C  CA    . CYS B  2  38  ? 4.221   -2.641  41.813  1.00 63.34  ? 38  CYS B CA    1 
ATOM   4780  C  C     . CYS B  2  38  ? 5.474   -2.196  41.068  1.00 77.27  ? 38  CYS B C     1 
ATOM   4781  O  O     . CYS B  2  38  ? 5.681   -2.574  39.908  1.00 90.91  ? 38  CYS B O     1 
ATOM   4782  C  CB    . CYS B  2  38  ? 3.111   -1.601  41.686  1.00 62.86  ? 38  CYS B CB    1 
ATOM   4783  S  SG    . CYS B  2  38  ? 1.469   -2.268  42.044  1.00 65.72  ? 38  CYS B SG    1 
ATOM   4784  N  N     . THR B  2  39  ? 6.308   -1.370  41.706  1.00 75.87  ? 39  THR B N     1 
ATOM   4785  C  CA    . THR B  2  39  ? 7.485   -0.841  41.023  1.00 73.77  ? 39  THR B CA    1 
ATOM   4786  C  C     . THR B  2  39  ? 8.419   -1.963  40.589  1.00 82.16  ? 39  THR B C     1 
ATOM   4787  O  O     . THR B  2  39  ? 8.921   -1.959  39.459  1.00 83.82  ? 39  THR B O     1 
ATOM   4788  C  CB    . THR B  2  39  ? 8.222   0.147   41.930  1.00 70.09  ? 39  THR B CB    1 
ATOM   4789  O  OG1   . THR B  2  39  ? 7.461   1.356   42.044  1.00 72.42  ? 39  THR B OG1   1 
ATOM   4790  C  CG2   . THR B  2  39  ? 9.604   0.470   41.374  1.00 62.17  ? 39  THR B CG2   1 
ATOM   4791  N  N     . GLU B  2  40  ? 8.664   -2.934  41.472  1.00 79.33  ? 40  GLU B N     1 
ATOM   4792  C  CA    . GLU B  2  40  ? 9.424   -4.114  41.071  1.00 76.96  ? 40  GLU B CA    1 
ATOM   4793  C  C     . GLU B  2  40  ? 8.673   -4.927  40.023  1.00 69.73  ? 40  GLU B C     1 
ATOM   4794  O  O     . GLU B  2  40  ? 9.287   -5.490  39.110  1.00 80.82  ? 40  GLU B O     1 
ATOM   4795  C  CB    . GLU B  2  40  ? 9.751   -4.977  42.290  1.00 77.73  ? 40  GLU B CB    1 
ATOM   4796  C  CG    . GLU B  2  40  ? 11.237  -5.280  42.437  1.00 105.91 ? 40  GLU B CG    1 
ATOM   4797  C  CD    . GLU B  2  40  ? 11.515  -6.736  42.753  1.00 121.93 ? 40  GLU B CD    1 
ATOM   4798  O  OE1   . GLU B  2  40  ? 10.863  -7.284  43.666  1.00 123.99 ? 40  GLU B OE1   1 
ATOM   4799  O  OE2   . GLU B  2  40  ? 12.380  -7.335  42.079  1.00 122.99 ? 40  GLU B OE2   1 
ATOM   4800  N  N     . MET B  2  41  ? 7.343   -4.990  40.129  1.00 67.64  ? 41  MET B N     1 
ATOM   4801  C  CA    . MET B  2  41  ? 6.561   -5.718  39.135  1.00 68.06  ? 41  MET B CA    1 
ATOM   4802  C  C     . MET B  2  41  ? 6.629   -5.043  37.770  1.00 76.20  ? 41  MET B C     1 
ATOM   4803  O  O     . MET B  2  41  ? 6.690   -5.724  36.740  1.00 78.51  ? 41  MET B O     1 
ATOM   4804  C  CB    . MET B  2  41  ? 5.111   -5.856  39.602  1.00 68.63  ? 41  MET B CB    1 
ATOM   4805  C  CG    . MET B  2  41  ? 4.871   -7.030  40.544  1.00 70.07  ? 41  MET B CG    1 
ATOM   4806  S  SD    . MET B  2  41  ? 3.187   -7.092  41.192  1.00 70.13  ? 41  MET B SD    1 
ATOM   4807  C  CE    . MET B  2  41  ? 2.243   -7.274  39.681  1.00 69.11  ? 41  MET B CE    1 
ATOM   4808  N  N     . GLU B  2  42  ? 6.610   -3.707  37.738  1.00 75.29  ? 42  GLU B N     1 
ATOM   4809  C  CA    . GLU B  2  42  ? 6.740   -3.005  36.464  1.00 70.15  ? 42  GLU B CA    1 
ATOM   4810  C  C     . GLU B  2  42  ? 8.107   -3.248  35.838  1.00 74.30  ? 42  GLU B C     1 
ATOM   4811  O  O     . GLU B  2  42  ? 8.211   -3.503  34.633  1.00 74.75  ? 42  GLU B O     1 
ATOM   4812  C  CB    . GLU B  2  42  ? 6.492   -1.507  36.642  1.00 66.89  ? 42  GLU B CB    1 
ATOM   4813  C  CG    . GLU B  2  42  ? 6.703   -0.716  35.355  1.00 84.55  ? 42  GLU B CG    1 
ATOM   4814  C  CD    . GLU B  2  42  ? 6.127   0.684   35.411  1.00 93.82  ? 42  GLU B CD    1 
ATOM   4815  O  OE1   . GLU B  2  42  ? 6.105   1.279   36.508  1.00 101.00 ? 42  GLU B OE1   1 
ATOM   4816  O  OE2   . GLU B  2  42  ? 5.693   1.185   34.352  1.00 89.89  ? 42  GLU B OE2   1 
ATOM   4817  N  N     . LYS B  2  43  ? 9.169   -3.166  36.643  1.00 65.66  ? 43  LYS B N     1 
ATOM   4818  C  CA    . LYS B  2  43  ? 10.514  -3.376  36.118  1.00 73.10  ? 43  LYS B CA    1 
ATOM   4819  C  C     . LYS B  2  43  ? 10.687  -4.808  35.625  1.00 80.84  ? 43  LYS B C     1 
ATOM   4820  O  O     . LYS B  2  43  ? 11.356  -5.049  34.614  1.00 86.04  ? 43  LYS B O     1 
ATOM   4821  C  CB    . LYS B  2  43  ? 11.549  -3.019  37.187  1.00 77.70  ? 43  LYS B CB    1 
ATOM   4822  C  CG    . LYS B  2  43  ? 12.504  -4.133  37.582  1.00 92.89  ? 43  LYS B CG    1 
ATOM   4823  C  CD    . LYS B  2  43  ? 13.436  -3.664  38.688  1.00 101.07 ? 43  LYS B CD    1 
ATOM   4824  C  CE    . LYS B  2  43  ? 14.415  -4.750  39.097  1.00 112.86 ? 43  LYS B CE    1 
ATOM   4825  N  NZ    . LYS B  2  43  ? 15.359  -4.269  40.145  1.00 116.92 ? 43  LYS B NZ    1 
ATOM   4826  N  N     . GLU B  2  44  ? 10.090  -5.773  36.328  1.00 78.95  ? 44  GLU B N     1 
ATOM   4827  C  CA    . GLU B  2  44  ? 10.117  -7.159  35.879  1.00 77.96  ? 44  GLU B CA    1 
ATOM   4828  C  C     . GLU B  2  44  ? 9.191   -7.413  34.696  1.00 76.76  ? 44  GLU B C     1 
ATOM   4829  O  O     . GLU B  2  44  ? 9.194   -8.525  34.157  1.00 72.74  ? 44  GLU B O     1 
ATOM   4830  C  CB    . GLU B  2  44  ? 9.754   -8.090  37.037  1.00 70.06  ? 44  GLU B CB    1 
ATOM   4831  C  CG    . GLU B  2  44  ? 10.769  -8.087  38.168  1.00 83.38  ? 44  GLU B CG    1 
ATOM   4832  C  CD    . GLU B  2  44  ? 10.268  -8.804  39.405  1.00 101.65 ? 44  GLU B CD    1 
ATOM   4833  O  OE1   . GLU B  2  44  ? 11.072  -9.502  40.058  1.00 109.48 ? 44  GLU B OE1   1 
ATOM   4834  O  OE2   . GLU B  2  44  ? 9.068   -8.672  39.724  1.00 104.83 ? 44  GLU B OE2   1 
ATOM   4835  N  N     . GLY B  2  45  ? 8.399   -6.423  34.287  1.00 75.30  ? 45  GLY B N     1 
ATOM   4836  C  CA    . GLY B  2  45  ? 7.518   -6.560  33.147  1.00 68.70  ? 45  GLY B CA    1 
ATOM   4837  C  C     . GLY B  2  45  ? 6.193   -7.234  33.424  1.00 74.56  ? 45  GLY B C     1 
ATOM   4838  O  O     . GLY B  2  45  ? 5.408   -7.421  32.486  1.00 78.61  ? 45  GLY B O     1 
ATOM   4839  N  N     . LYS B  2  46  ? 5.918   -7.616  34.673  1.00 68.13  ? 46  LYS B N     1 
ATOM   4840  C  CA    . LYS B  2  46  ? 4.651   -8.271  34.986  1.00 67.58  ? 46  LYS B CA    1 
ATOM   4841  C  C     . LYS B  2  46  ? 3.474   -7.328  34.765  1.00 72.48  ? 46  LYS B C     1 
ATOM   4842  O  O     . LYS B  2  46  ? 2.407   -7.749  34.302  1.00 70.38  ? 46  LYS B O     1 
ATOM   4843  C  CB    . LYS B  2  46  ? 4.678   -8.792  36.422  1.00 59.74  ? 46  LYS B CB    1 
ATOM   4844  C  CG    . LYS B  2  46  ? 5.809   -9.780  36.668  1.00 63.11  ? 46  LYS B CG    1 
ATOM   4845  C  CD    . LYS B  2  46  ? 5.913   -10.195 38.125  1.00 75.30  ? 46  LYS B CD    1 
ATOM   4846  C  CE    . LYS B  2  46  ? 7.070   -11.161 38.327  1.00 86.26  ? 46  LYS B CE    1 
ATOM   4847  N  NZ    . LYS B  2  46  ? 7.200   -11.596 39.744  1.00 92.85  ? 46  LYS B NZ    1 
ATOM   4848  N  N     . ILE B  2  47  ? 3.652   -6.046  35.087  1.00 68.46  ? 47  ILE B N     1 
ATOM   4849  C  CA    . ILE B  2  47  ? 2.640   -5.024  34.866  1.00 67.50  ? 47  ILE B CA    1 
ATOM   4850  C  C     . ILE B  2  47  ? 3.309   -3.818  34.224  1.00 70.14  ? 47  ILE B C     1 
ATOM   4851  O  O     . ILE B  2  47  ? 4.520   -3.615  34.336  1.00 80.24  ? 47  ILE B O     1 
ATOM   4852  C  CB    . ILE B  2  47  ? 1.918   -4.602  36.166  1.00 65.24  ? 47  ILE B CB    1 
ATOM   4853  C  CG1   . ILE B  2  47  ? 2.934   -4.173  37.231  1.00 55.69  ? 47  ILE B CG1   1 
ATOM   4854  C  CG2   . ILE B  2  47  ? 1.011   -5.715  36.663  1.00 70.07  ? 47  ILE B CG2   1 
ATOM   4855  C  CD1   . ILE B  2  47  ? 2.309   -3.650  38.511  1.00 60.88  ? 47  ILE B CD1   1 
ATOM   4856  N  N     . SER B  2  48  ? 2.501   -3.017  33.535  1.00 69.91  ? 48  SER B N     1 
ATOM   4857  C  CA    . SER B  2  48  ? 2.975   -1.774  32.950  1.00 74.30  ? 48  SER B CA    1 
ATOM   4858  C  C     . SER B  2  48  ? 1.902   -0.711  33.117  1.00 67.79  ? 48  SER B C     1 
ATOM   4859  O  O     . SER B  2  48  ? 0.707   -1.015  33.170  1.00 65.33  ? 48  SER B O     1 
ATOM   4860  C  CB    . SER B  2  48  ? 3.322   -1.943  31.464  1.00 73.30  ? 48  SER B CB    1 
ATOM   4861  O  OG    . SER B  2  48  ? 2.189   -2.360  30.723  1.00 70.49  ? 48  SER B OG    1 
ATOM   4862  N  N     . LYS B  2  49  ? 2.342   0.540   33.197  1.00 69.37  ? 49  LYS B N     1 
ATOM   4863  C  CA    . LYS B  2  49  ? 1.422   1.641   33.432  1.00 65.24  ? 49  LYS B CA    1 
ATOM   4864  C  C     . LYS B  2  49  ? 0.494   1.832   32.240  1.00 67.65  ? 49  LYS B C     1 
ATOM   4865  O  O     . LYS B  2  49  ? 0.822   1.484   31.103  1.00 83.63  ? 49  LYS B O     1 
ATOM   4866  C  CB    . LYS B  2  49  ? 2.191   2.929   33.725  1.00 63.72  ? 49  LYS B CB    1 
ATOM   4867  C  CG    . LYS B  2  49  ? 3.040   2.844   34.981  1.00 70.71  ? 49  LYS B CG    1 
ATOM   4868  C  CD    . LYS B  2  49  ? 3.507   4.208   35.453  1.00 78.43  ? 49  LYS B CD    1 
ATOM   4869  C  CE    . LYS B  2  49  ? 4.334   4.075   36.722  1.00 81.98  ? 49  LYS B CE    1 
ATOM   4870  N  NZ    . LYS B  2  49  ? 4.668   5.394   37.324  1.00 92.37  ? 49  LYS B NZ    1 
ATOM   4871  N  N     . ILE B  2  50  ? -0.680  2.397   32.515  1.00 63.64  ? 50  ILE B N     1 
ATOM   4872  C  CA    . ILE B  2  50  ? -1.714  2.609   31.507  1.00 69.73  ? 50  ILE B CA    1 
ATOM   4873  C  C     . ILE B  2  50  ? -2.361  3.958   31.780  1.00 73.66  ? 50  ILE B C     1 
ATOM   4874  O  O     . ILE B  2  50  ? -1.859  4.747   32.588  1.00 81.72  ? 50  ILE B O     1 
ATOM   4875  C  CB    . ILE B  2  50  ? -2.773  1.489   31.502  1.00 76.03  ? 50  ILE B CB    1 
ATOM   4876  C  CG1   . ILE B  2  50  ? -3.548  1.469   32.821  1.00 85.64  ? 50  ILE B CG1   1 
ATOM   4877  C  CG2   . ILE B  2  50  ? -2.144  0.132   31.219  1.00 72.94  ? 50  ILE B CG2   1 
ATOM   4878  C  CD1   . ILE B  2  50  ? -4.832  0.674   32.752  1.00 81.84  ? 50  ILE B CD1   1 
ATOM   4879  N  N     . GLY B  2  51  ? -3.472  4.237   31.106  1.00 73.36  ? 51  GLY B N     1 
ATOM   4880  C  CA    . GLY B  2  51  ? -4.053  5.555   31.128  1.00 77.49  ? 51  GLY B CA    1 
ATOM   4881  C  C     . GLY B  2  51  ? -5.566  5.518   31.161  1.00 89.21  ? 51  GLY B C     1 
ATOM   4882  O  O     . GLY B  2  51  ? -6.190  4.453   31.122  1.00 93.19  ? 51  GLY B O     1 
ATOM   4883  N  N     . PRO B  2  52  ? -6.185  6.699   31.231  1.00 89.29  ? 52  PRO B N     1 
ATOM   4884  C  CA    . PRO B  2  52  ? -7.643  6.757   31.422  1.00 81.37  ? 52  PRO B CA    1 
ATOM   4885  C  C     . PRO B  2  52  ? -8.449  6.199   30.263  1.00 86.32  ? 52  PRO B C     1 
ATOM   4886  O  O     . PRO B  2  52  ? -9.642  5.930   30.449  1.00 84.86  ? 52  PRO B O     1 
ATOM   4887  C  CB    . PRO B  2  52  ? -7.910  8.255   31.615  1.00 79.94  ? 52  PRO B CB    1 
ATOM   4888  C  CG    . PRO B  2  52  ? -6.777  8.929   30.920  1.00 87.20  ? 52  PRO B CG    1 
ATOM   4889  C  CD    . PRO B  2  52  ? -5.585  8.038   31.117  1.00 89.12  ? 52  PRO B CD    1 
ATOM   4890  N  N     . GLU B  2  53  ? -7.850  6.022   29.081  1.00 89.01  ? 53  GLU B N     1 
ATOM   4891  C  CA    . GLU B  2  53  ? -8.574  5.406   27.971  1.00 90.30  ? 53  GLU B CA    1 
ATOM   4892  C  C     . GLU B  2  53  ? -9.143  4.046   28.365  1.00 91.60  ? 53  GLU B C     1 
ATOM   4893  O  O     . GLU B  2  53  ? -10.257 3.693   27.961  1.00 98.89  ? 53  GLU B O     1 
ATOM   4894  C  CB    . GLU B  2  53  ? -7.672  5.291   26.737  1.00 88.16  ? 53  GLU B CB    1 
ATOM   4895  C  CG    . GLU B  2  53  ? -6.546  4.269   26.828  1.00 94.98  ? 53  GLU B CG    1 
ATOM   4896  C  CD    . GLU B  2  53  ? -5.269  4.846   27.403  1.00 103.93 ? 53  GLU B CD    1 
ATOM   4897  O  OE1   . GLU B  2  53  ? -5.313  5.960   27.965  1.00 106.32 ? 53  GLU B OE1   1 
ATOM   4898  O  OE2   . GLU B  2  53  ? -4.216  4.184   27.285  1.00 109.70 ? 53  GLU B OE2   1 
ATOM   4899  N  N     . ASN B  2  54  ? -8.399  3.276   29.147  1.00 77.29  ? 54  ASN B N     1 
ATOM   4900  C  CA    . ASN B  2  54  ? -8.876  2.011   29.695  1.00 73.68  ? 54  ASN B CA    1 
ATOM   4901  C  C     . ASN B  2  54  ? -10.004 2.262   30.688  1.00 79.52  ? 54  ASN B C     1 
ATOM   4902  O  O     . ASN B  2  54  ? -9.736  2.739   31.799  1.00 80.42  ? 54  ASN B O     1 
ATOM   4903  C  CB    . ASN B  2  54  ? -7.721  1.269   30.372  1.00 70.89  ? 54  ASN B CB    1 
ATOM   4904  C  CG    . ASN B  2  54  ? -8.067  -0.171  30.723  1.00 74.56  ? 54  ASN B CG    1 
ATOM   4905  O  OD1   . ASN B  2  54  ? -9.216  -0.500  31.015  1.00 72.95  ? 54  ASN B OD1   1 
ATOM   4906  N  ND2   . ASN B  2  54  ? -7.061  -1.037  30.700  1.00 78.97  ? 54  ASN B ND2   1 
ATOM   4907  N  N     . PRO B  2  55  ? -11.262 1.974   30.346  1.00 79.27  ? 55  PRO B N     1 
ATOM   4908  C  CA    . PRO B  2  55  ? -12.375 2.325   31.235  1.00 78.74  ? 55  PRO B CA    1 
ATOM   4909  C  C     . PRO B  2  55  ? -12.554 1.383   32.415  1.00 73.78  ? 55  PRO B C     1 
ATOM   4910  O  O     . PRO B  2  55  ? -13.413 1.641   33.265  1.00 75.74  ? 55  PRO B O     1 
ATOM   4911  C  CB    . PRO B  2  55  ? -13.583 2.254   30.294  1.00 76.56  ? 55  PRO B CB    1 
ATOM   4912  C  CG    . PRO B  2  55  ? -13.219 1.165   29.339  1.00 81.74  ? 55  PRO B CG    1 
ATOM   4913  C  CD    . PRO B  2  55  ? -11.721 1.240   29.152  1.00 79.67  ? 55  PRO B CD    1 
ATOM   4914  N  N     . TYR B  2  56  ? -11.773 0.312   32.491  1.00 68.64  ? 56  TYR B N     1 
ATOM   4915  C  CA    . TYR B  2  56  ? -11.971 -0.756  33.459  1.00 60.04  ? 56  TYR B CA    1 
ATOM   4916  C  C     . TYR B  2  56  ? -11.097 -0.532  34.687  1.00 62.45  ? 56  TYR B C     1 
ATOM   4917  O  O     . TYR B  2  56  ? -9.991  0.006   34.593  1.00 72.83  ? 56  TYR B O     1 
ATOM   4918  C  CB    . TYR B  2  56  ? -11.670 -2.111  32.819  1.00 56.13  ? 56  TYR B CB    1 
ATOM   4919  C  CG    . TYR B  2  56  ? -12.478 -2.339  31.562  1.00 75.66  ? 56  TYR B CG    1 
ATOM   4920  C  CD1   . TYR B  2  56  ? -13.861 -2.217  31.575  1.00 79.97  ? 56  TYR B CD1   1 
ATOM   4921  C  CD2   . TYR B  2  56  ? -11.858 -2.638  30.356  1.00 83.83  ? 56  TYR B CD2   1 
ATOM   4922  C  CE1   . TYR B  2  56  ? -14.608 -2.411  30.429  1.00 82.80  ? 56  TYR B CE1   1 
ATOM   4923  C  CE2   . TYR B  2  56  ? -12.596 -2.832  29.203  1.00 78.57  ? 56  TYR B CE2   1 
ATOM   4924  C  CZ    . TYR B  2  56  ? -13.971 -2.718  29.246  1.00 78.37  ? 56  TYR B CZ    1 
ATOM   4925  O  OH    . TYR B  2  56  ? -14.712 -2.910  28.102  1.00 79.73  ? 56  TYR B OH    1 
ATOM   4926  N  N     . ASN B  2  57  ? -11.619 -0.916  35.851  1.00 61.73  ? 57  ASN B N     1 
ATOM   4927  C  CA    . ASN B  2  57  ? -10.825 -0.883  37.070  1.00 66.84  ? 57  ASN B CA    1 
ATOM   4928  C  C     . ASN B  2  57  ? -11.312 -1.948  38.042  1.00 63.71  ? 57  ASN B C     1 
ATOM   4929  O  O     . ASN B  2  57  ? -12.514 -2.202  38.153  1.00 56.94  ? 57  ASN B O     1 
ATOM   4930  C  CB    . ASN B  2  57  ? -10.871 0.495   37.731  1.00 63.19  ? 57  ASN B CB    1 
ATOM   4931  C  CG    . ASN B  2  57  ? -9.868  0.635   38.857  1.00 72.83  ? 57  ASN B CG    1 
ATOM   4932  O  OD1   . ASN B  2  57  ? -8.683  0.867   38.622  1.00 74.10  ? 57  ASN B OD1   1 
ATOM   4933  N  ND2   . ASN B  2  57  ? -10.340 0.501   40.090  1.00 72.22  ? 57  ASN B ND2   1 
ATOM   4934  N  N     . THR B  2  58  ? -10.360 -2.566  38.740  1.00 56.18  ? 58  THR B N     1 
ATOM   4935  C  CA    . THR B  2  58  ? -10.593 -3.491  39.832  1.00 51.17  ? 58  THR B CA    1 
ATOM   4936  C  C     . THR B  2  58  ? -9.865  -3.018  41.087  1.00 51.85  ? 58  THR B C     1 
ATOM   4937  O  O     . THR B  2  58  ? -8.743  -2.510  40.991  1.00 54.87  ? 58  THR B O     1 
ATOM   4938  C  CB    . THR B  2  58  ? -10.114 -4.900  39.432  1.00 48.97  ? 58  THR B CB    1 
ATOM   4939  O  OG1   . THR B  2  58  ? -11.140 -5.562  38.680  1.00 60.84  ? 58  THR B OG1   1 
ATOM   4940  C  CG2   . THR B  2  58  ? -9.753  -5.733  40.637  1.00 57.26  ? 58  THR B CG2   1 
ATOM   4941  N  N     . PRO B  2  59  ? -10.472 -3.150  42.267  1.00 52.94  ? 59  PRO B N     1 
ATOM   4942  C  CA    . PRO B  2  59  ? -9.821  -2.650  43.483  1.00 47.00  ? 59  PRO B CA    1 
ATOM   4943  C  C     . PRO B  2  59  ? -8.622  -3.495  43.878  1.00 45.82  ? 59  PRO B C     1 
ATOM   4944  O  O     . PRO B  2  59  ? -8.574  -4.706  43.647  1.00 50.55  ? 59  PRO B O     1 
ATOM   4945  C  CB    . PRO B  2  59  ? -10.924 -2.740  44.546  1.00 40.25  ? 59  PRO B CB    1 
ATOM   4946  C  CG    . PRO B  2  59  ? -12.200 -2.890  43.787  1.00 39.87  ? 59  PRO B CG    1 
ATOM   4947  C  CD    . PRO B  2  59  ? -11.843 -3.617  42.531  1.00 53.32  ? 59  PRO B CD    1 
ATOM   4948  N  N     . VAL B  2  60  ? -7.643  -2.831  44.490  1.00 42.25  ? 60  VAL B N     1 
ATOM   4949  C  CA    . VAL B  2  60  ? -6.427  -3.475  44.963  1.00 47.64  ? 60  VAL B CA    1 
ATOM   4950  C  C     . VAL B  2  60  ? -6.160  -3.042  46.399  1.00 49.67  ? 60  VAL B C     1 
ATOM   4951  O  O     . VAL B  2  60  ? -6.525  -1.937  46.815  1.00 51.01  ? 60  VAL B O     1 
ATOM   4952  C  CB    . VAL B  2  60  ? -5.216  -3.153  44.052  1.00 50.47  ? 60  VAL B CB    1 
ATOM   4953  C  CG1   . VAL B  2  60  ? -4.778  -1.704  44.218  1.00 42.88  ? 60  VAL B CG1   1 
ATOM   4954  C  CG2   . VAL B  2  60  ? -4.061  -4.112  44.320  1.00 45.57  ? 60  VAL B CG2   1 
ATOM   4955  N  N     . PHE B  2  61  ? -5.534  -3.933  47.161  1.00 46.99  ? 61  PHE B N     1 
ATOM   4956  C  CA    . PHE B  2  61  ? -5.050  -3.632  48.504  1.00 38.51  ? 61  PHE B CA    1 
ATOM   4957  C  C     . PHE B  2  61  ? -3.997  -4.679  48.855  1.00 49.95  ? 61  PHE B C     1 
ATOM   4958  O  O     . PHE B  2  61  ? -3.625  -5.510  48.019  1.00 50.12  ? 61  PHE B O     1 
ATOM   4959  C  CB    . PHE B  2  61  ? -6.202  -3.562  49.516  1.00 44.16  ? 61  PHE B CB    1 
ATOM   4960  C  CG    . PHE B  2  61  ? -6.882  -4.879  49.787  1.00 44.52  ? 61  PHE B CG    1 
ATOM   4961  C  CD1   . PHE B  2  61  ? -6.817  -5.455  51.046  1.00 44.20  ? 61  PHE B CD1   1 
ATOM   4962  C  CD2   . PHE B  2  61  ? -7.612  -5.524  48.800  1.00 49.88  ? 61  PHE B CD2   1 
ATOM   4963  C  CE1   . PHE B  2  61  ? -7.452  -6.654  51.312  1.00 36.87  ? 61  PHE B CE1   1 
ATOM   4964  C  CE2   . PHE B  2  61  ? -8.247  -6.726  49.058  1.00 42.99  ? 61  PHE B CE2   1 
ATOM   4965  C  CZ    . PHE B  2  61  ? -8.167  -7.291  50.317  1.00 40.05  ? 61  PHE B CZ    1 
ATOM   4966  N  N     . ALA B  2  62  ? -3.516  -4.651  50.094  1.00 46.40  ? 62  ALA B N     1 
ATOM   4967  C  CA    . ALA B  2  62  ? -2.481  -5.578  50.524  1.00 48.12  ? 62  ALA B CA    1 
ATOM   4968  C  C     . ALA B  2  62  ? -2.897  -6.268  51.813  1.00 51.11  ? 62  ALA B C     1 
ATOM   4969  O  O     . ALA B  2  62  ? -3.684  -5.733  52.598  1.00 50.92  ? 62  ALA B O     1 
ATOM   4970  C  CB    . ALA B  2  62  ? -1.140  -4.860  50.735  1.00 43.23  ? 62  ALA B CB    1 
ATOM   4971  N  N     . ILE B  2  63  ? -2.353  -7.469  52.019  1.00 39.33  ? 63  ILE B N     1 
ATOM   4972  C  CA    . ILE B  2  63  ? -2.636  -8.276  53.199  1.00 45.37  ? 63  ILE B CA    1 
ATOM   4973  C  C     . ILE B  2  63  ? -1.341  -8.900  53.695  1.00 54.04  ? 63  ILE B C     1 
ATOM   4974  O  O     . ILE B  2  63  ? -0.346  -8.991  52.972  1.00 51.10  ? 63  ILE B O     1 
ATOM   4975  C  CB    . ILE B  2  63  ? -3.661  -9.402  52.931  1.00 40.89  ? 63  ILE B CB    1 
ATOM   4976  C  CG1   . ILE B  2  63  ? -3.049  -10.469 52.019  1.00 44.81  ? 63  ILE B CG1   1 
ATOM   4977  C  CG2   . ILE B  2  63  ? -4.942  -8.848  52.335  1.00 48.87  ? 63  ILE B CG2   1 
ATOM   4978  C  CD1   . ILE B  2  63  ? -3.364  -11.892 52.437  1.00 57.04  ? 63  ILE B CD1   1 
ATOM   4979  N  N     . LYS B  2  64  ? -1.364  -9.325  54.953  1.00 46.52  ? 64  LYS B N     1 
ATOM   4980  C  CA    . LYS B  2  64  ? -0.335  -10.187 55.512  1.00 42.04  ? 64  LYS B CA    1 
ATOM   4981  C  C     . LYS B  2  64  ? -0.959  -11.535 55.846  1.00 48.10  ? 64  LYS B C     1 
ATOM   4982  O  O     . LYS B  2  64  ? -1.993  -11.591 56.520  1.00 57.36  ? 64  LYS B O     1 
ATOM   4983  C  CB    . LYS B  2  64  ? 0.286   -9.569  56.765  1.00 49.82  ? 64  LYS B CB    1 
ATOM   4984  C  CG    . LYS B  2  64  ? 0.930   -8.214  56.545  1.00 64.00  ? 64  LYS B CG    1 
ATOM   4985  C  CD    . LYS B  2  64  ? 2.361   -8.224  57.046  1.00 70.76  ? 64  LYS B CD    1 
ATOM   4986  C  CE    . LYS B  2  64  ? 2.763   -6.879  57.621  1.00 67.34  ? 64  LYS B CE    1 
ATOM   4987  N  NZ    . LYS B  2  64  ? 3.504   -7.052  58.903  1.00 70.95  ? 64  LYS B NZ    1 
ATOM   4988  N  N     . LYS B  2  65  ? -0.339  -12.613 55.373  1.00 54.41  ? 65  LYS B N     1 
ATOM   4989  C  CA    . LYS B  2  65  ? -0.828  -13.940 55.707  1.00 52.41  ? 65  LYS B CA    1 
ATOM   4990  C  C     . LYS B  2  65  ? -0.522  -14.236 57.174  1.00 48.47  ? 65  LYS B C     1 
ATOM   4991  O  O     . LYS B  2  65  ? 0.246   -13.525 57.827  1.00 52.94  ? 65  LYS B O     1 
ATOM   4992  C  CB    . LYS B  2  65  ? -0.211  -14.995 54.787  1.00 48.73  ? 65  LYS B CB    1 
ATOM   4993  C  CG    . LYS B  2  65  ? -0.500  -14.764 53.309  1.00 54.84  ? 65  LYS B CG    1 
ATOM   4994  C  CD    . LYS B  2  65  ? -0.222  -16.002 52.470  1.00 70.67  ? 65  LYS B CD    1 
ATOM   4995  C  CE    . LYS B  2  65  ? -1.408  -16.954 52.466  1.00 89.73  ? 65  LYS B CE    1 
ATOM   4996  N  NZ    . LYS B  2  65  ? -1.200  -18.088 51.522  1.00 94.74  ? 65  LYS B NZ    1 
ATOM   4997  N  N     . LYS B  2  66  ? -1.149  -15.287 57.703  1.00 53.56  ? 66  LYS B N     1 
ATOM   4998  C  CA    . LYS B  2  66  ? -1.011  -15.582 59.125  1.00 55.15  ? 66  LYS B CA    1 
ATOM   4999  C  C     . LYS B  2  66  ? 0.455   -15.801 59.465  1.00 47.29  ? 66  LYS B C     1 
ATOM   5000  O  O     . LYS B  2  66  ? 1.095   -16.706 58.921  1.00 54.46  ? 66  LYS B O     1 
ATOM   5001  C  CB    . LYS B  2  66  ? -1.822  -16.826 59.495  1.00 59.41  ? 66  LYS B CB    1 
ATOM   5002  C  CG    . LYS B  2  66  ? -3.288  -16.580 59.828  1.00 57.78  ? 66  LYS B CG    1 
ATOM   5003  C  CD    . LYS B  2  66  ? -3.958  -17.863 60.319  1.00 57.81  ? 66  LYS B CD    1 
ATOM   5004  C  CE    . LYS B  2  66  ? -5.471  -17.715 60.446  1.00 62.90  ? 66  LYS B CE    1 
ATOM   5005  N  NZ    . LYS B  2  66  ? -5.877  -16.679 61.437  1.00 45.77  ? 66  LYS B NZ    1 
ATOM   5006  N  N     . ASP B  2  67  ? 0.990   -14.949 60.342  1.00 57.57  ? 67  ASP B N     1 
ATOM   5007  C  CA    . ASP B  2  67  ? 2.351   -14.999 60.874  1.00 63.51  ? 67  ASP B CA    1 
ATOM   5008  C  C     . ASP B  2  67  ? 3.370   -14.507 59.849  1.00 64.63  ? 67  ASP B C     1 
ATOM   5009  O  O     . ASP B  2  67  ? 4.574   -14.559 60.129  1.00 80.63  ? 67  ASP B O     1 
ATOM   5010  C  CB    . ASP B  2  67  ? 2.756   -16.397 61.370  1.00 62.60  ? 67  ASP B CB    1 
ATOM   5011  C  CG    . ASP B  2  67  ? 1.863   -16.896 62.488  1.00 66.63  ? 67  ASP B CG    1 
ATOM   5012  O  OD1   . ASP B  2  67  ? 1.492   -16.079 63.357  1.00 67.85  ? 67  ASP B OD1   1 
ATOM   5013  O  OD2   . ASP B  2  67  ? 1.522   -18.096 62.496  1.00 69.86  ? 67  ASP B OD2   1 
ATOM   5014  N  N     . SER B  2  68  ? 2.934   -14.034 58.678  1.00 64.49  ? 68  SER B N     1 
ATOM   5015  C  CA    . SER B  2  68  ? 3.846   -13.818 57.557  1.00 62.71  ? 68  SER B CA    1 
ATOM   5016  C  C     . SER B  2  68  ? 4.824   -12.678 57.822  1.00 73.98  ? 68  SER B C     1 
ATOM   5017  O  O     . SER B  2  68  ? 6.033   -12.832 57.615  1.00 100.43 ? 68  SER B O     1 
ATOM   5018  C  CB    . SER B  2  68  ? 3.043   -13.543 56.285  1.00 64.98  ? 68  SER B CB    1 
ATOM   5019  O  OG    . SER B  2  68  ? 3.824   -12.849 55.329  1.00 73.45  ? 68  SER B OG    1 
ATOM   5020  N  N     . THR B  2  69  ? 4.318   -11.523 58.258  1.00 60.97  ? 69  THR B N     1 
ATOM   5021  C  CA    . THR B  2  69  ? 5.053   -10.270 58.447  1.00 73.63  ? 69  THR B CA    1 
ATOM   5022  C  C     . THR B  2  69  ? 5.502   -9.626  57.137  1.00 63.26  ? 69  THR B C     1 
ATOM   5023  O  O     . THR B  2  69  ? 6.200   -8.605  57.179  1.00 60.52  ? 69  THR B O     1 
ATOM   5024  C  CB    . THR B  2  69  ? 6.281   -10.419 59.361  1.00 74.25  ? 69  THR B CB    1 
ATOM   5025  O  OG1   . THR B  2  69  ? 7.294   -11.183 58.694  1.00 85.91  ? 69  THR B OG1   1 
ATOM   5026  C  CG2   . THR B  2  69  ? 5.899   -11.112 60.659  1.00 78.95  ? 69  THR B CG2   1 
ATOM   5027  N  N     . LYS B  2  70  ? 5.129   -10.174 55.983  1.00 60.20  ? 70  LYS B N     1 
ATOM   5028  C  CA    . LYS B  2  70  ? 5.531   -9.644  54.686  1.00 60.47  ? 70  LYS B CA    1 
ATOM   5029  C  C     . LYS B  2  70  ? 4.288   -9.301  53.878  1.00 64.33  ? 70  LYS B C     1 
ATOM   5030  O  O     . LYS B  2  70  ? 3.366   -10.117 53.774  1.00 71.60  ? 70  LYS B O     1 
ATOM   5031  C  CB    . LYS B  2  70  ? 6.395   -10.643 53.912  1.00 65.91  ? 70  LYS B CB    1 
ATOM   5032  C  CG    . LYS B  2  70  ? 6.879   -10.105 52.576  1.00 79.52  ? 70  LYS B CG    1 
ATOM   5033  C  CD    . LYS B  2  70  ? 7.366   -11.209 51.656  1.00 84.21  ? 70  LYS B CD    1 
ATOM   5034  C  CE    . LYS B  2  70  ? 7.739   -10.650 50.289  1.00 84.73  ? 70  LYS B CE    1 
ATOM   5035  N  NZ    . LYS B  2  70  ? 8.048   -11.720 49.300  1.00 89.96  ? 70  LYS B NZ    1 
ATOM   5036  N  N     . TRP B  2  71  ? 4.268   -8.098  53.308  1.00 63.83  ? 71  TRP B N     1 
ATOM   5037  C  CA    . TRP B  2  71  ? 3.103   -7.639  52.568  1.00 53.10  ? 71  TRP B CA    1 
ATOM   5038  C  C     . TRP B  2  71  ? 2.914   -8.446  51.291  1.00 51.15  ? 71  TRP B C     1 
ATOM   5039  O  O     . TRP B  2  71  ? 3.876   -8.773  50.590  1.00 59.24  ? 71  TRP B O     1 
ATOM   5040  C  CB    . TRP B  2  71  ? 3.240   -6.157  52.226  1.00 51.33  ? 71  TRP B CB    1 
ATOM   5041  C  CG    . TRP B  2  71  ? 3.013   -5.257  53.392  1.00 53.90  ? 71  TRP B CG    1 
ATOM   5042  C  CD1   . TRP B  2  71  ? 3.936   -4.470  54.014  1.00 62.03  ? 71  TRP B CD1   1 
ATOM   5043  C  CD2   . TRP B  2  71  ? 1.777   -5.053  54.084  1.00 48.85  ? 71  TRP B CD2   1 
ATOM   5044  N  NE1   . TRP B  2  71  ? 3.349   -3.783  55.050  1.00 69.96  ? 71  TRP B NE1   1 
ATOM   5045  C  CE2   . TRP B  2  71  ? 2.023   -4.126  55.114  1.00 53.93  ? 71  TRP B CE2   1 
ATOM   5046  C  CE3   . TRP B  2  71  ? 0.485   -5.565  53.931  1.00 55.37  ? 71  TRP B CE3   1 
ATOM   5047  C  CZ2   . TRP B  2  71  ? 1.025   -3.699  55.989  1.00 63.44  ? 71  TRP B CZ2   1 
ATOM   5048  C  CZ3   . TRP B  2  71  ? -0.505  -5.140  54.800  1.00 66.44  ? 71  TRP B CZ3   1 
ATOM   5049  C  CH2   . TRP B  2  71  ? -0.230  -4.217  55.815  1.00 69.65  ? 71  TRP B CH2   1 
ATOM   5050  N  N     . ARG B  2  72  ? 1.657   -8.765  50.997  1.00 58.68  ? 72  ARG B N     1 
ATOM   5051  C  CA    . ARG B  2  72  ? 1.275   -9.509  49.807  1.00 50.54  ? 72  ARG B CA    1 
ATOM   5052  C  C     . ARG B  2  72  ? 0.227   -8.704  49.057  1.00 51.44  ? 72  ARG B C     1 
ATOM   5053  O  O     . ARG B  2  72  ? -0.755  -8.253  49.656  1.00 69.23  ? 72  ARG B O     1 
ATOM   5054  C  CB    . ARG B  2  72  ? 0.733   -10.892 50.186  1.00 48.09  ? 72  ARG B CB    1 
ATOM   5055  C  CG    . ARG B  2  72  ? 1.010   -11.995 49.181  1.00 55.49  ? 72  ARG B CG    1 
ATOM   5056  C  CD    . ARG B  2  72  ? -0.155  -12.179 48.226  1.00 55.30  ? 72  ARG B CD    1 
ATOM   5057  N  NE    . ARG B  2  72  ? -0.220  -13.544 47.714  1.00 57.86  ? 72  ARG B NE    1 
ATOM   5058  C  CZ    . ARG B  2  72  ? -1.030  -13.938 46.738  1.00 60.07  ? 72  ARG B CZ    1 
ATOM   5059  N  NH1   . ARG B  2  72  ? -1.843  -13.067 46.155  1.00 61.73  ? 72  ARG B NH1   1 
ATOM   5060  N  NH2   . ARG B  2  72  ? -1.024  -15.202 46.338  1.00 51.08  ? 72  ARG B NH2   1 
ATOM   5061  N  N     . LYS B  2  73  ? 0.434   -8.520  47.756  1.00 54.51  ? 73  LYS B N     1 
ATOM   5062  C  CA    . LYS B  2  73  ? -0.529  -7.781  46.953  1.00 45.26  ? 73  LYS B CA    1 
ATOM   5063  C  C     . LYS B  2  73  ? -1.761  -8.642  46.716  1.00 48.39  ? 73  LYS B C     1 
ATOM   5064  O  O     . LYS B  2  73  ? -1.651  -9.799  46.299  1.00 54.78  ? 73  LYS B O     1 
ATOM   5065  C  CB    . LYS B  2  73  ? 0.107   -7.373  45.623  1.00 44.84  ? 73  LYS B CB    1 
ATOM   5066  C  CG    . LYS B  2  73  ? -0.803  -6.628  44.651  1.00 44.40  ? 73  LYS B CG    1 
ATOM   5067  C  CD    . LYS B  2  73  ? -0.061  -6.338  43.347  1.00 55.53  ? 73  LYS B CD    1 
ATOM   5068  C  CE    . LYS B  2  73  ? -0.836  -5.403  42.426  1.00 58.91  ? 73  LYS B CE    1 
ATOM   5069  N  NZ    . LYS B  2  73  ? -1.990  -6.063  41.759  1.00 62.52  ? 73  LYS B NZ    1 
ATOM   5070  N  N     . LEU B  2  74  ? -2.938  -8.070  46.957  1.00 51.25  ? 74  LEU B N     1 
ATOM   5071  C  CA    . LEU B  2  74  ? -4.198  -8.773  46.753  1.00 42.97  ? 74  LEU B CA    1 
ATOM   5072  C  C     . LEU B  2  74  ? -5.114  -7.914  45.899  1.00 45.79  ? 74  LEU B C     1 
ATOM   5073  O  O     . LEU B  2  74  ? -5.388  -6.759  46.242  1.00 45.60  ? 74  LEU B O     1 
ATOM   5074  C  CB    . LEU B  2  74  ? -4.867  -9.111  48.089  1.00 40.37  ? 74  LEU B CB    1 
ATOM   5075  C  CG    . LEU B  2  74  ? -6.190  -9.872  47.991  1.00 53.31  ? 74  LEU B CG    1 
ATOM   5076  C  CD1   . LEU B  2  74  ? -6.040  -11.084 47.090  1.00 60.21  ? 74  LEU B CD1   1 
ATOM   5077  C  CD2   . LEU B  2  74  ? -6.671  -10.292 49.370  1.00 46.74  ? 74  LEU B CD2   1 
ATOM   5078  N  N     . VAL B  2  75  ? -5.582  -8.478  44.791  1.00 52.22  ? 75  VAL B N     1 
ATOM   5079  C  CA    . VAL B  2  75  ? -6.499  -7.807  43.879  1.00 59.30  ? 75  VAL B CA    1 
ATOM   5080  C  C     . VAL B  2  75  ? -7.878  -8.421  44.075  1.00 60.59  ? 75  VAL B C     1 
ATOM   5081  O  O     . VAL B  2  75  ? -8.011  -9.650  44.135  1.00 62.12  ? 75  VAL B O     1 
ATOM   5082  C  CB    . VAL B  2  75  ? -6.032  -7.938  42.420  1.00 59.01  ? 75  VAL B CB    1 
ATOM   5083  C  CG1   . VAL B  2  75  ? -6.542  -6.776  41.593  1.00 65.66  ? 75  VAL B CG1   1 
ATOM   5084  C  CG2   . VAL B  2  75  ? -4.515  -8.014  42.354  1.00 59.17  ? 75  VAL B CG2   1 
ATOM   5085  N  N     . ASP B  2  76  ? -8.903  -7.574  44.176  1.00 51.62  ? 76  ASP B N     1 
ATOM   5086  C  CA    . ASP B  2  76  ? -10.269 -8.056  44.379  1.00 56.53  ? 76  ASP B CA    1 
ATOM   5087  C  C     . ASP B  2  76  ? -10.893 -8.267  43.007  1.00 49.20  ? 76  ASP B C     1 
ATOM   5088  O  O     . ASP B  2  76  ? -11.530 -7.378  42.443  1.00 59.71  ? 76  ASP B O     1 
ATOM   5089  C  CB    . ASP B  2  76  ? -11.069 -7.069  45.224  1.00 58.95  ? 76  ASP B CB    1 
ATOM   5090  C  CG    . ASP B  2  76  ? -12.528 -7.474  45.389  1.00 55.96  ? 76  ASP B CG    1 
ATOM   5091  O  OD1   . ASP B  2  76  ? -12.843 -8.673  45.237  1.00 54.25  ? 76  ASP B OD1   1 
ATOM   5092  O  OD2   . ASP B  2  76  ? -13.362 -6.589  45.682  1.00 55.16  ? 76  ASP B OD2   1 
ATOM   5093  N  N     . PHE B  2  77  ? -10.745 -9.483  42.485  1.00 42.64  ? 77  PHE B N     1 
ATOM   5094  C  CA    . PHE B  2  77  ? -11.154 -9.813  41.128  1.00 46.40  ? 77  PHE B CA    1 
ATOM   5095  C  C     . PHE B  2  77  ? -12.551 -10.408 41.070  1.00 50.79  ? 77  PHE B C     1 
ATOM   5096  O  O     . PHE B  2  77  ? -12.938 -10.945 40.027  1.00 67.34  ? 77  PHE B O     1 
ATOM   5097  C  CB    . PHE B  2  77  ? -10.152 -10.782 40.496  1.00 50.65  ? 77  PHE B CB    1 
ATOM   5098  C  CG    . PHE B  2  77  ? -8.987  -10.106 39.833  1.00 52.03  ? 77  PHE B CG    1 
ATOM   5099  C  CD1   . PHE B  2  77  ? -9.180  -8.986  39.041  1.00 56.48  ? 77  PHE B CD1   1 
ATOM   5100  C  CD2   . PHE B  2  77  ? -7.699  -10.589 40.001  1.00 52.02  ? 77  PHE B CD2   1 
ATOM   5101  C  CE1   . PHE B  2  77  ? -8.111  -8.361  38.425  1.00 58.39  ? 77  PHE B CE1   1 
ATOM   5102  C  CE2   . PHE B  2  77  ? -6.624  -9.968  39.390  1.00 54.16  ? 77  PHE B CE2   1 
ATOM   5103  C  CZ    . PHE B  2  77  ? -6.831  -8.852  38.600  1.00 55.41  ? 77  PHE B CZ    1 
ATOM   5104  N  N     . ARG B  2  78  ? -13.296 -10.346 42.179  1.00 48.72  ? 78  ARG B N     1 
ATOM   5105  C  CA    . ARG B  2  78  ? -14.629 -10.938 42.246  1.00 50.83  ? 78  ARG B CA    1 
ATOM   5106  C  C     . ARG B  2  78  ? -15.493 -10.523 41.063  1.00 62.01  ? 78  ARG B C     1 
ATOM   5107  O  O     . ARG B  2  78  ? -16.207 -11.350 40.486  1.00 73.00  ? 78  ARG B O     1 
ATOM   5108  C  CB    . ARG B  2  78  ? -15.306 -10.558 43.563  1.00 43.52  ? 78  ARG B CB    1 
ATOM   5109  C  CG    . ARG B  2  78  ? -14.771 -11.303 44.773  1.00 50.01  ? 78  ARG B CG    1 
ATOM   5110  C  CD    . ARG B  2  78  ? -15.490 -10.875 46.042  1.00 44.63  ? 78  ARG B CD    1 
ATOM   5111  N  NE    . ARG B  2  78  ? -15.129 -9.521  46.445  1.00 45.95  ? 78  ARG B NE    1 
ATOM   5112  C  CZ    . ARG B  2  78  ? -15.567 -8.931  47.551  1.00 49.45  ? 78  ARG B CZ    1 
ATOM   5113  N  NH1   . ARG B  2  78  ? -16.386 -9.577  48.370  1.00 45.86  ? 78  ARG B NH1   1 
ATOM   5114  N  NH2   . ARG B  2  78  ? -15.185 -7.696  47.840  1.00 55.11  ? 78  ARG B NH2   1 
ATOM   5115  N  N     . GLU B  2  79  ? -15.443 -9.243  40.687  1.00 54.86  ? 79  GLU B N     1 
ATOM   5116  C  CA    . GLU B  2  79  ? -16.281 -8.778  39.587  1.00 62.81  ? 79  GLU B CA    1 
ATOM   5117  C  C     . GLU B  2  79  ? -15.765 -9.294  38.250  1.00 66.27  ? 79  GLU B C     1 
ATOM   5118  O  O     . GLU B  2  79  ? -16.553 -9.741  37.408  1.00 70.35  ? 79  GLU B O     1 
ATOM   5119  C  CB    . GLU B  2  79  ? -16.351 -7.251  39.585  1.00 64.97  ? 79  GLU B CB    1 
ATOM   5120  C  CG    . GLU B  2  79  ? -17.392 -6.690  38.631  1.00 77.54  ? 79  GLU B CG    1 
ATOM   5121  C  CD    . GLU B  2  79  ? -18.801 -7.138  38.977  1.00 84.81  ? 79  GLU B CD    1 
ATOM   5122  O  OE1   . GLU B  2  79  ? -19.125 -7.208  40.182  1.00 77.53  ? 79  GLU B OE1   1 
ATOM   5123  O  OE2   . GLU B  2  79  ? -19.584 -7.428  38.048  1.00 93.52  ? 79  GLU B OE2   1 
ATOM   5124  N  N     . LEU B  2  80  ? -14.451 -9.220  38.027  1.00 63.40  ? 80  LEU B N     1 
ATOM   5125  C  CA    . LEU B  2  80  ? -13.867 -9.798  36.820  1.00 61.82  ? 80  LEU B CA    1 
ATOM   5126  C  C     . LEU B  2  80  ? -14.155 -11.293 36.731  1.00 62.64  ? 80  LEU B C     1 
ATOM   5127  O  O     . LEU B  2  80  ? -14.525 -11.805 35.668  1.00 63.62  ? 80  LEU B O     1 
ATOM   5128  C  CB    . LEU B  2  80  ? -12.360 -9.543  36.787  1.00 61.27  ? 80  LEU B CB    1 
ATOM   5129  C  CG    . LEU B  2  80  ? -11.634 -10.151 35.585  1.00 61.82  ? 80  LEU B CG    1 
ATOM   5130  C  CD1   . LEU B  2  80  ? -12.035 -9.444  34.299  1.00 56.87  ? 80  LEU B CD1   1 
ATOM   5131  C  CD2   . LEU B  2  80  ? -10.127 -10.112 35.779  1.00 65.67  ? 80  LEU B CD2   1 
ATOM   5132  N  N     . ASN B  2  81  ? -13.970 -12.013 37.843  1.00 62.29  ? 81  ASN B N     1 
ATOM   5133  C  CA    . ASN B  2  81  ? -14.132 -13.465 37.833  1.00 65.46  ? 81  ASN B CA    1 
ATOM   5134  C  C     . ASN B  2  81  ? -15.548 -13.869 37.440  1.00 64.35  ? 81  ASN B C     1 
ATOM   5135  O  O     . ASN B  2  81  ? -15.738 -14.830 36.685  1.00 76.12  ? 81  ASN B O     1 
ATOM   5136  C  CB    . ASN B  2  81  ? -13.771 -14.045 39.201  1.00 63.12  ? 81  ASN B CB    1 
ATOM   5137  C  CG    . ASN B  2  81  ? -12.279 -14.026 39.469  1.00 67.17  ? 81  ASN B CG    1 
ATOM   5138  O  OD1   . ASN B  2  81  ? -11.471 -14.067 38.541  1.00 76.33  ? 81  ASN B OD1   1 
ATOM   5139  N  ND2   . ASN B  2  81  ? -11.905 -13.969 40.743  1.00 61.58  ? 81  ASN B ND2   1 
ATOM   5140  N  N     . LYS B  2  82  ? -16.555 -13.156 37.951  1.00 57.65  ? 82  LYS B N     1 
ATOM   5141  C  CA    . LYS B  2  82  ? -17.931 -13.447 37.561  1.00 61.71  ? 82  LYS B CA    1 
ATOM   5142  C  C     . LYS B  2  82  ? -18.161 -13.191 36.077  1.00 65.19  ? 82  LYS B C     1 
ATOM   5143  O  O     . LYS B  2  82  ? -18.974 -13.877 35.448  1.00 76.40  ? 82  LYS B O     1 
ATOM   5144  C  CB    . LYS B  2  82  ? -18.904 -12.619 38.401  1.00 64.88  ? 82  LYS B CB    1 
ATOM   5145  C  CG    . LYS B  2  82  ? -18.941 -13.014 39.869  1.00 69.94  ? 82  LYS B CG    1 
ATOM   5146  C  CD    . LYS B  2  82  ? -20.040 -12.277 40.618  1.00 73.04  ? 82  LYS B CD    1 
ATOM   5147  C  CE    . LYS B  2  82  ? -19.785 -10.778 40.640  1.00 72.57  ? 82  LYS B CE    1 
ATOM   5148  N  NZ    . LYS B  2  82  ? -20.851 -10.035 41.368  1.00 82.40  ? 82  LYS B NZ    1 
ATOM   5149  N  N     . ARG B  2  83  ? -17.466 -12.209 35.504  1.00 63.38  ? 83  ARG B N     1 
ATOM   5150  C  CA    . ARG B  2  83  ? -17.600 -11.901 34.086  1.00 66.76  ? 83  ARG B CA    1 
ATOM   5151  C  C     . ARG B  2  83  ? -16.817 -12.860 33.199  1.00 83.37  ? 83  ARG B C     1 
ATOM   5152  O  O     . ARG B  2  83  ? -17.011 -12.852 31.978  1.00 88.05  ? 83  ARG B O     1 
ATOM   5153  C  CB    . ARG B  2  83  ? -17.185 -10.449 33.839  1.00 61.06  ? 83  ARG B CB    1 
ATOM   5154  C  CG    . ARG B  2  83  ? -18.167 -9.470  34.471  1.00 57.24  ? 83  ARG B CG    1 
ATOM   5155  C  CD    . ARG B  2  83  ? -17.561 -8.109  34.755  1.00 69.82  ? 83  ARG B CD    1 
ATOM   5156  N  NE    . ARG B  2  83  ? -18.453 -7.304  35.587  1.00 74.15  ? 83  ARG B NE    1 
ATOM   5157  C  CZ    . ARG B  2  83  ? -19.480 -6.598  35.124  1.00 78.08  ? 83  ARG B CZ    1 
ATOM   5158  N  NH1   . ARG B  2  83  ? -19.754 -6.589  33.827  1.00 91.79  ? 83  ARG B NH1   1 
ATOM   5159  N  NH2   . ARG B  2  83  ? -20.238 -5.902  35.961  1.00 69.57  ? 83  ARG B NH2   1 
ATOM   5160  N  N     . THR B  2  84  ? -15.930 -13.666 33.780  1.00 90.12  ? 84  THR B N     1 
ATOM   5161  C  CA    . THR B  2  84  ? -15.250 -14.751 33.084  1.00 89.72  ? 84  THR B CA    1 
ATOM   5162  C  C     . THR B  2  84  ? -15.760 -16.114 33.539  1.00 102.29 ? 84  THR B C     1 
ATOM   5163  O  O     . THR B  2  84  ? -15.111 -17.133 33.280  1.00 95.44  ? 84  THR B O     1 
ATOM   5164  C  CB    . THR B  2  84  ? -13.736 -14.647 33.288  1.00 79.59  ? 84  THR B CB    1 
ATOM   5165  O  OG1   . THR B  2  84  ? -13.369 -13.270 33.432  1.00 77.72  ? 84  THR B OG1   1 
ATOM   5166  C  CG2   . THR B  2  84  ? -12.993 -15.219 32.088  1.00 88.84  ? 84  THR B CG2   1 
ATOM   5167  N  N     . GLN B  2  85  ? -16.907 -16.145 34.227  1.00 120.18 ? 85  GLN B N     1 
ATOM   5168  C  CA    . GLN B  2  85  ? -17.316 -17.320 34.994  1.00 129.21 ? 85  GLN B CA    1 
ATOM   5169  C  C     . GLN B  2  85  ? -17.460 -18.560 34.119  1.00 130.25 ? 85  GLN B C     1 
ATOM   5170  O  O     . GLN B  2  85  ? -17.075 -19.662 34.527  1.00 129.51 ? 85  GLN B O     1 
ATOM   5171  C  CB    . GLN B  2  85  ? -18.628 -17.024 35.720  1.00 132.12 ? 85  GLN B CB    1 
ATOM   5172  C  CG    . GLN B  2  85  ? -19.292 -18.233 36.346  1.00 133.78 ? 85  GLN B CG    1 
ATOM   5173  C  CD    . GLN B  2  85  ? -20.642 -17.899 36.942  1.00 132.52 ? 85  GLN B CD    1 
ATOM   5174  O  OE1   . GLN B  2  85  ? -20.991 -16.729 37.098  1.00 133.16 ? 85  GLN B OE1   1 
ATOM   5175  N  NE2   . GLN B  2  85  ? -21.413 -18.927 37.273  1.00 126.95 ? 85  GLN B NE2   1 
ATOM   5176  N  N     . ASP B  2  86  ? -18.002 -18.401 32.910  1.00 127.61 ? 86  ASP B N     1 
ATOM   5177  C  CA    . ASP B  2  86  ? -18.143 -19.541 32.007  1.00 121.36 ? 86  ASP B CA    1 
ATOM   5178  C  C     . ASP B  2  86  ? -16.790 -20.145 31.648  1.00 111.36 ? 86  ASP B C     1 
ATOM   5179  O  O     . ASP B  2  86  ? -16.665 -21.369 31.525  1.00 104.60 ? 86  ASP B O     1 
ATOM   5180  C  CB    . ASP B  2  86  ? -18.898 -19.122 30.744  1.00 124.63 ? 86  ASP B CB    1 
ATOM   5181  C  CG    . ASP B  2  86  ? -20.362 -19.515 30.781  1.00 131.82 ? 86  ASP B CG    1 
ATOM   5182  O  OD1   . ASP B  2  86  ? -20.677 -20.586 31.344  1.00 137.02 ? 86  ASP B OD1   1 
ATOM   5183  O  OD2   . ASP B  2  86  ? -21.197 -18.757 30.245  1.00 131.93 ? 86  ASP B OD2   1 
ATOM   5184  N  N     . PHE B  2  87  ? -15.768 -19.305 31.471  1.00 112.01 ? 87  PHE B N     1 
ATOM   5185  C  CA    . PHE B  2  87  ? -14.500 -19.770 30.913  1.00 122.33 ? 87  PHE B CA    1 
ATOM   5186  C  C     . PHE B  2  87  ? -13.857 -20.859 31.769  1.00 129.17 ? 87  PHE B C     1 
ATOM   5187  O  O     . PHE B  2  87  ? -13.491 -21.925 31.260  1.00 122.46 ? 87  PHE B O     1 
ATOM   5188  C  CB    . PHE B  2  87  ? -13.545 -18.586 30.744  1.00 121.38 ? 87  PHE B CB    1 
ATOM   5189  C  CG    . PHE B  2  87  ? -12.107 -18.983 30.554  1.00 126.44 ? 87  PHE B CG    1 
ATOM   5190  C  CD1   . PHE B  2  87  ? -11.637 -19.364 29.308  1.00 135.12 ? 87  PHE B CD1   1 
ATOM   5191  C  CD2   . PHE B  2  87  ? -11.221 -18.962 31.621  1.00 117.90 ? 87  PHE B CD2   1 
ATOM   5192  C  CE1   . PHE B  2  87  ? -10.314 -19.725 29.131  1.00 134.58 ? 87  PHE B CE1   1 
ATOM   5193  C  CE2   . PHE B  2  87  ? -9.897  -19.323 31.451  1.00 119.07 ? 87  PHE B CE2   1 
ATOM   5194  C  CZ    . PHE B  2  87  ? -9.443  -19.705 30.204  1.00 127.65 ? 87  PHE B CZ    1 
ATOM   5195  N  N     . TRP B  2  88  ? -13.697 -20.609 33.071  1.00 137.61 ? 88  TRP B N     1 
ATOM   5196  C  CA    . TRP B  2  88  ? -12.994 -21.578 33.909  1.00 143.82 ? 88  TRP B CA    1 
ATOM   5197  C  C     . TRP B  2  88  ? -13.834 -22.825 34.170  1.00 153.08 ? 88  TRP B C     1 
ATOM   5198  O  O     . TRP B  2  88  ? -13.337 -23.950 34.049  1.00 163.15 ? 88  TRP B O     1 
ATOM   5199  C  CB    . TRP B  2  88  ? -12.533 -20.942 35.225  1.00 137.76 ? 88  TRP B CB    1 
ATOM   5200  C  CG    . TRP B  2  88  ? -13.357 -19.812 35.762  1.00 137.57 ? 88  TRP B CG    1 
ATOM   5201  C  CD1   . TRP B  2  88  ? -13.358 -18.520 35.327  1.00 135.77 ? 88  TRP B CD1   1 
ATOM   5202  C  CD2   . TRP B  2  88  ? -14.253 -19.860 36.880  1.00 137.74 ? 88  TRP B CD2   1 
ATOM   5203  N  NE1   . TRP B  2  88  ? -14.220 -17.766 36.086  1.00 132.41 ? 88  TRP B NE1   1 
ATOM   5204  C  CE2   . TRP B  2  88  ? -14.782 -18.565 37.047  1.00 133.59 ? 88  TRP B CE2   1 
ATOM   5205  C  CE3   . TRP B  2  88  ? -14.669 -20.876 37.746  1.00 135.81 ? 88  TRP B CE3   1 
ATOM   5206  C  CZ2   . TRP B  2  88  ? -15.706 -18.259 38.044  1.00 127.54 ? 88  TRP B CZ2   1 
ATOM   5207  C  CZ3   . TRP B  2  88  ? -15.588 -20.570 38.735  1.00 129.11 ? 88  TRP B CZ3   1 
ATOM   5208  C  CH2   . TRP B  2  88  ? -16.096 -19.273 38.876  1.00 124.29 ? 88  TRP B CH2   1 
ATOM   5209  N  N     . GLU B  2  89  ? -15.111 -22.654 34.512  1.00 148.96 ? 89  GLU B N     1 
ATOM   5210  C  CA    . GLU B  2  89  ? -15.945 -23.807 34.843  1.00 148.41 ? 89  GLU B CA    1 
ATOM   5211  C  C     . GLU B  2  89  ? -16.196 -24.704 33.635  1.00 146.12 ? 89  GLU B C     1 
ATOM   5212  O  O     . GLU B  2  89  ? -16.060 -25.930 33.724  1.00 147.97 ? 89  GLU B O     1 
ATOM   5213  C  CB    . GLU B  2  89  ? -17.270 -23.340 35.447  1.00 151.75 ? 89  GLU B CB    1 
ATOM   5214  C  CG    . GLU B  2  89  ? -17.260 -23.261 36.964  1.00 152.15 ? 89  GLU B CG    1 
ATOM   5215  C  CD    . GLU B  2  89  ? -18.610 -22.886 37.540  1.00 152.55 ? 89  GLU B CD    1 
ATOM   5216  O  OE1   . GLU B  2  89  ? -19.368 -22.160 36.862  1.00 154.40 ? 89  GLU B OE1   1 
ATOM   5217  O  OE2   . GLU B  2  89  ? -18.917 -23.321 38.670  1.00 149.71 ? 89  GLU B OE2   1 
ATOM   5218  N  N     . VAL B  2  90  ? -16.568 -24.117 32.497  1.00 143.50 ? 90  VAL B N     1 
ATOM   5219  C  CA    . VAL B  2  90  ? -16.968 -24.924 31.346  1.00 135.09 ? 90  VAL B CA    1 
ATOM   5220  C  C     . VAL B  2  90  ? -15.781 -25.654 30.722  1.00 142.13 ? 90  VAL B C     1 
ATOM   5221  O  O     . VAL B  2  90  ? -15.874 -26.845 30.402  1.00 146.08 ? 90  VAL B O     1 
ATOM   5222  C  CB    . VAL B  2  90  ? -17.701 -24.047 30.314  1.00 113.19 ? 90  VAL B CB    1 
ATOM   5223  C  CG1   . VAL B  2  90  ? -17.555 -24.622 28.912  1.00 104.61 ? 90  VAL B CG1   1 
ATOM   5224  C  CG2   . VAL B  2  90  ? -19.171 -23.920 30.685  1.00 104.08 ? 90  VAL B CG2   1 
ATOM   5225  N  N     . GLN B  2  91  ? -14.645 -24.977 30.555  1.00 124.54 ? 91  GLN B N     1 
ATOM   5226  C  CA    . GLN B  2  91  ? -13.595 -25.491 29.681  1.00 128.81 ? 91  GLN B CA    1 
ATOM   5227  C  C     . GLN B  2  91  ? -12.383 -26.065 30.401  1.00 132.97 ? 91  GLN B C     1 
ATOM   5228  O  O     . GLN B  2  91  ? -12.005 -27.212 30.142  1.00 134.88 ? 91  GLN B O     1 
ATOM   5229  C  CB    . GLN B  2  91  ? -13.133 -24.378 28.727  1.00 123.27 ? 91  GLN B CB    1 
ATOM   5230  C  CG    . GLN B  2  91  ? -11.933 -24.757 27.873  1.00 126.02 ? 91  GLN B CG    1 
ATOM   5231  C  CD    . GLN B  2  91  ? -11.354 -23.578 27.115  1.00 133.13 ? 91  GLN B CD    1 
ATOM   5232  O  OE1   . GLN B  2  91  ? -11.982 -22.524 27.005  1.00 135.12 ? 91  GLN B OE1   1 
ATOM   5233  N  NE2   . GLN B  2  91  ? -10.147 -23.749 26.590  1.00 134.13 ? 91  GLN B NE2   1 
ATOM   5234  N  N     . LEU B  2  92  ? -11.757 -25.310 31.302  1.00 131.87 ? 92  LEU B N     1 
ATOM   5235  C  CA    . LEU B  2  92  ? -10.490 -25.719 31.898  1.00 133.20 ? 92  LEU B CA    1 
ATOM   5236  C  C     . LEU B  2  92  ? -10.575 -26.008 33.393  1.00 135.19 ? 92  LEU B C     1 
ATOM   5237  O  O     . LEU B  2  92  ? -9.533  -26.072 34.054  1.00 136.05 ? 92  LEU B O     1 
ATOM   5238  C  CB    . LEU B  2  92  ? -9.422  -24.657 31.627  1.00 125.26 ? 92  LEU B CB    1 
ATOM   5239  C  CG    . LEU B  2  92  ? -8.659  -24.795 30.308  1.00 113.17 ? 92  LEU B CG    1 
ATOM   5240  C  CD1   . LEU B  2  92  ? -8.058  -23.464 29.885  1.00 107.87 ? 92  LEU B CD1   1 
ATOM   5241  C  CD2   . LEU B  2  92  ? -7.574  -25.852 30.439  1.00 106.26 ? 92  LEU B CD2   1 
ATOM   5242  N  N     . GLY B  2  93  ? -11.775 -26.164 33.946  1.00 134.72 ? 93  GLY B N     1 
ATOM   5243  C  CA    . GLY B  2  93  ? -11.898 -26.302 35.388  1.00 131.17 ? 93  GLY B CA    1 
ATOM   5244  C  C     . GLY B  2  93  ? -11.169 -27.528 35.911  1.00 130.24 ? 93  GLY B C     1 
ATOM   5245  O  O     . GLY B  2  93  ? -11.175 -28.595 35.292  1.00 133.35 ? 93  GLY B O     1 
ATOM   5246  N  N     . ILE B  2  94  ? -10.534 -27.363 37.064  1.00 122.81 ? 94  ILE B N     1 
ATOM   5247  C  CA    . ILE B  2  94  ? -9.857  -28.470 37.751  1.00 116.59 ? 94  ILE B CA    1 
ATOM   5248  C  C     . ILE B  2  94  ? -10.900 -29.396 38.365  1.00 109.92 ? 94  ILE B C     1 
ATOM   5249  O  O     . ILE B  2  94  ? -11.925 -28.911 38.878  1.00 103.70 ? 94  ILE B O     1 
ATOM   5250  C  CB    . ILE B  2  94  ? -8.904  -27.924 38.821  1.00 109.77 ? 94  ILE B CB    1 
ATOM   5251  C  CG1   . ILE B  2  94  ? -7.896  -26.948 38.207  1.00 103.22 ? 94  ILE B CG1   1 
ATOM   5252  C  CG2   . ILE B  2  94  ? -8.172  -29.050 39.537  1.00 109.11 ? 94  ILE B CG2   1 
ATOM   5253  C  CD1   . ILE B  2  94  ? -8.257  -25.490 38.394  1.00 93.19  ? 94  ILE B CD1   1 
ATOM   5254  N  N     . PRO B  2  95  ? -10.704 -30.713 38.338  1.00 103.93 ? 95  PRO B N     1 
ATOM   5255  C  CA    . PRO B  2  95  ? -11.625 -31.607 39.048  1.00 96.93  ? 95  PRO B CA    1 
ATOM   5256  C  C     . PRO B  2  95  ? -11.395 -31.519 40.550  1.00 92.86  ? 95  PRO B C     1 
ATOM   5257  O  O     . PRO B  2  95  ? -10.317 -31.148 41.020  1.00 99.47  ? 95  PRO B O     1 
ATOM   5258  C  CB    . PRO B  2  95  ? -11.269 -32.994 38.505  1.00 91.98  ? 95  PRO B CB    1 
ATOM   5259  C  CG    . PRO B  2  95  ? -9.852  -32.863 38.052  1.00 92.78  ? 95  PRO B CG    1 
ATOM   5260  C  CD    . PRO B  2  95  ? -9.724  -31.460 37.530  1.00 93.85  ? 95  PRO B CD    1 
ATOM   5261  N  N     . HIS B  2  96  ? -12.427 -31.872 41.313  1.00 79.69  ? 96  HIS B N     1 
ATOM   5262  C  CA    . HIS B  2  96  ? -12.323 -31.795 42.767  1.00 72.60  ? 96  HIS B CA    1 
ATOM   5263  C  C     . HIS B  2  96  ? -12.162 -33.170 43.399  1.00 67.89  ? 96  HIS B C     1 
ATOM   5264  O  O     . HIS B  2  96  ? -13.083 -33.999 43.321  1.00 68.66  ? 96  HIS B O     1 
ATOM   5265  C  CB    . HIS B  2  96  ? -13.535 -31.084 43.367  1.00 66.83  ? 96  HIS B CB    1 
ATOM   5266  C  CG    . HIS B  2  96  ? -13.445 -30.921 44.852  1.00 54.76  ? 96  HIS B CG    1 
ATOM   5267  N  ND1   . HIS B  2  96  ? -12.604 -30.007 45.448  1.00 53.82  ? 96  HIS B ND1   1 
ATOM   5268  C  CD2   . HIS B  2  96  ? -14.062 -31.578 45.862  1.00 54.15  ? 96  HIS B CD2   1 
ATOM   5269  C  CE1   . HIS B  2  96  ? -12.719 -30.096 46.761  1.00 52.67  ? 96  HIS B CE1   1 
ATOM   5270  N  NE2   . HIS B  2  96  ? -13.598 -31.041 47.038  1.00 54.60  ? 96  HIS B NE2   1 
ATOM   5271  N  N     . PRO B  2  97  ? -11.017 -33.453 44.018  1.00 66.04  ? 97  PRO B N     1 
ATOM   5272  C  CA    . PRO B  2  97  ? -10.795 -34.761 44.650  1.00 64.62  ? 97  PRO B CA    1 
ATOM   5273  C  C     . PRO B  2  97  ? -11.616 -34.955 45.918  1.00 63.22  ? 97  PRO B C     1 
ATOM   5274  O  O     . PRO B  2  97  ? -11.231 -34.468 46.986  1.00 58.23  ? 97  PRO B O     1 
ATOM   5275  C  CB    . PRO B  2  97  ? -9.291  -34.747 44.949  1.00 63.56  ? 97  PRO B CB    1 
ATOM   5276  C  CG    . PRO B  2  97  ? -8.966  -33.298 45.127  1.00 60.56  ? 97  PRO B CG    1 
ATOM   5277  C  CD    . PRO B  2  97  ? -9.858  -32.556 44.169  1.00 62.22  ? 97  PRO B CD    1 
ATOM   5278  N  N     . ALA B  2  98  ? -12.756 -35.645 45.808  1.00 65.87  ? 98  ALA B N     1 
ATOM   5279  C  CA    . ALA B  2  98  ? -13.591 -35.954 46.969  1.00 62.34  ? 98  ALA B CA    1 
ATOM   5280  C  C     . ALA B  2  98  ? -12.816 -36.541 48.147  1.00 64.65  ? 98  ALA B C     1 
ATOM   5281  O  O     . ALA B  2  98  ? -13.324 -36.529 49.274  1.00 71.06  ? 98  ALA B O     1 
ATOM   5282  C  CB    . ALA B  2  98  ? -14.703 -36.925 46.564  1.00 62.08  ? 98  ALA B CB    1 
ATOM   5283  N  N     . GLY B  2  99  ? -11.607 -37.056 47.922  1.00 62.70  ? 99  GLY B N     1 
ATOM   5284  C  CA    . GLY B  2  99  ? -10.822 -37.630 49.000  1.00 64.58  ? 99  GLY B CA    1 
ATOM   5285  C  C     . GLY B  2  99  ? -10.051 -36.641 49.847  1.00 66.94  ? 99  GLY B C     1 
ATOM   5286  O  O     . GLY B  2  99  ? -9.502  -37.036 50.880  1.00 66.11  ? 99  GLY B O     1 
ATOM   5287  N  N     . LEU B  2  100 ? -9.979  -35.375 49.425  1.00 64.40  ? 100 LEU B N     1 
ATOM   5288  C  CA    . LEU B  2  100 ? -9.140  -34.401 50.120  1.00 66.92  ? 100 LEU B CA    1 
ATOM   5289  C  C     . LEU B  2  100 ? -9.588  -34.205 51.564  1.00 70.10  ? 100 LEU B C     1 
ATOM   5290  O  O     . LEU B  2  100 ? -8.754  -34.107 52.473  1.00 70.14  ? 100 LEU B O     1 
ATOM   5291  C  CB    . LEU B  2  100 ? -9.155  -33.071 49.367  1.00 62.14  ? 100 LEU B CB    1 
ATOM   5292  C  CG    . LEU B  2  100 ? -8.305  -31.931 49.934  1.00 56.32  ? 100 LEU B CG    1 
ATOM   5293  C  CD1   . LEU B  2  100 ? -6.834  -32.319 49.976  1.00 60.21  ? 100 LEU B CD1   1 
ATOM   5294  C  CD2   . LEU B  2  100 ? -8.502  -30.660 49.117  1.00 54.28  ? 100 LEU B CD2   1 
ATOM   5295  N  N     . LYS B  2  101 ? -10.902 -34.131 51.792  1.00 73.15  ? 101 LYS B N     1 
ATOM   5296  C  CA    . LYS B  2  101 ? -11.438 -33.926 53.135  1.00 69.04  ? 101 LYS B CA    1 
ATOM   5297  C  C     . LYS B  2  101 ? -11.153 -35.093 54.075  1.00 70.81  ? 101 LYS B C     1 
ATOM   5298  O  O     . LYS B  2  101 ? -11.279 -34.932 55.292  1.00 66.96  ? 101 LYS B O     1 
ATOM   5299  C  CB    . LYS B  2  101 ? -12.944 -33.671 53.070  1.00 63.18  ? 101 LYS B CB    1 
ATOM   5300  C  CG    . LYS B  2  101 ? -13.749 -34.833 52.521  1.00 69.23  ? 101 LYS B CG    1 
ATOM   5301  C  CD    . LYS B  2  101 ? -15.228 -34.496 52.468  1.00 62.38  ? 101 LYS B CD    1 
ATOM   5302  C  CE    . LYS B  2  101 ? -16.024 -35.613 51.815  1.00 64.05  ? 101 LYS B CE    1 
ATOM   5303  N  NZ    . LYS B  2  101 ? -15.537 -35.903 50.437  1.00 65.02  ? 101 LYS B NZ    1 
ATOM   5304  N  N     . LYS B  2  102 ? -10.808 -36.265 53.548  1.00 67.99  ? 102 LYS B N     1 
ATOM   5305  C  CA    . LYS B  2  102 ? -10.590 -37.434 54.390  1.00 67.50  ? 102 LYS B CA    1 
ATOM   5306  C  C     . LYS B  2  102 ? -9.160  -37.544 54.904  1.00 77.53  ? 102 LYS B C     1 
ATOM   5307  O  O     . LYS B  2  102 ? -8.902  -38.358 55.797  1.00 80.50  ? 102 LYS B O     1 
ATOM   5308  C  CB    . LYS B  2  102 ? -10.962 -38.708 53.625  1.00 60.61  ? 102 LYS B CB    1 
ATOM   5309  C  CG    . LYS B  2  102 ? -12.421 -38.758 53.204  1.00 65.50  ? 102 LYS B CG    1 
ATOM   5310  C  CD    . LYS B  2  102 ? -12.711 -39.961 52.327  1.00 75.73  ? 102 LYS B CD    1 
ATOM   5311  C  CE    . LYS B  2  102 ? -14.176 -40.002 51.922  1.00 81.51  ? 102 LYS B CE    1 
ATOM   5312  N  NZ    . LYS B  2  102 ? -14.464 -41.122 50.983  1.00 89.27  ? 102 LYS B NZ    1 
ATOM   5313  N  N     . LYS B  2  103 ? -8.233  -36.754 54.369  1.00 80.47  ? 103 LYS B N     1 
ATOM   5314  C  CA    . LYS B  2  103 ? -6.828  -36.898 54.724  1.00 77.35  ? 103 LYS B CA    1 
ATOM   5315  C  C     . LYS B  2  103 ? -6.571  -36.368 56.130  1.00 74.50  ? 103 LYS B C     1 
ATOM   5316  O  O     . LYS B  2  103 ? -7.169  -35.376 56.556  1.00 74.15  ? 103 LYS B O     1 
ATOM   5317  C  CB    . LYS B  2  103 ? -5.947  -36.170 53.710  1.00 70.82  ? 103 LYS B CB    1 
ATOM   5318  C  CG    . LYS B  2  103 ? -5.967  -36.804 52.328  1.00 82.10  ? 103 LYS B CG    1 
ATOM   5319  C  CD    . LYS B  2  103 ? -5.406  -38.217 52.372  1.00 93.82  ? 103 LYS B CD    1 
ATOM   5320  C  CE    . LYS B  2  103 ? -5.634  -38.955 51.063  1.00 97.28  ? 103 LYS B CE    1 
ATOM   5321  N  NZ    . LYS B  2  103 ? -7.074  -39.263 50.841  1.00 96.97  ? 103 LYS B NZ    1 
ATOM   5322  N  N     . LYS B  2  104 ? -5.672  -37.043 56.854  1.00 76.96  ? 104 LYS B N     1 
ATOM   5323  C  CA    . LYS B  2  104 ? -5.350  -36.634 58.219  1.00 76.19  ? 104 LYS B CA    1 
ATOM   5324  C  C     . LYS B  2  104 ? -4.681  -35.266 58.267  1.00 70.49  ? 104 LYS B C     1 
ATOM   5325  O  O     . LYS B  2  104 ? -4.758  -34.579 59.293  1.00 74.38  ? 104 LYS B O     1 
ATOM   5326  C  CB    . LYS B  2  104 ? -4.456  -37.681 58.886  1.00 82.09  ? 104 LYS B CB    1 
ATOM   5327  C  CG    . LYS B  2  104 ? -5.148  -39.008 59.154  1.00 95.49  ? 104 LYS B CG    1 
ATOM   5328  C  CD    . LYS B  2  104 ? -4.189  -40.029 59.751  1.00 101.10 ? 104 LYS B CD    1 
ATOM   5329  C  CE    . LYS B  2  104 ? -3.689  -39.603 61.123  1.00 98.61  ? 104 LYS B CE    1 
ATOM   5330  N  NZ    . LYS B  2  104 ? -2.838  -40.655 61.749  1.00 98.22  ? 104 LYS B NZ    1 
ATOM   5331  N  N     . SER B  2  105 ? -4.017  -34.855 57.190  1.00 63.11  ? 105 SER B N     1 
ATOM   5332  C  CA    . SER B  2  105 ? -3.407  -33.535 57.144  1.00 68.37  ? 105 SER B CA    1 
ATOM   5333  C  C     . SER B  2  105 ? -3.458  -33.002 55.722  1.00 70.96  ? 105 SER B C     1 
ATOM   5334  O  O     . SER B  2  105 ? -3.253  -33.750 54.763  1.00 71.88  ? 105 SER B O     1 
ATOM   5335  C  CB    . SER B  2  105 ? -1.956  -33.569 57.638  1.00 70.63  ? 105 SER B CB    1 
ATOM   5336  O  OG    . SER B  2  105 ? -1.888  -33.929 59.007  1.00 75.54  ? 105 SER B OG    1 
ATOM   5337  N  N     . VAL B  2  106 ? -3.723  -31.702 55.601  1.00 69.54  ? 106 VAL B N     1 
ATOM   5338  C  CA    . VAL B  2  106 ? -3.792  -31.006 54.321  1.00 62.46  ? 106 VAL B CA    1 
ATOM   5339  C  C     . VAL B  2  106 ? -3.051  -29.688 54.488  1.00 60.73  ? 106 VAL B C     1 
ATOM   5340  O  O     . VAL B  2  106 ? -3.424  -28.869 55.335  1.00 60.96  ? 106 VAL B O     1 
ATOM   5341  C  CB    . VAL B  2  106 ? -5.237  -30.754 53.855  1.00 62.76  ? 106 VAL B CB    1 
ATOM   5342  C  CG1   . VAL B  2  106 ? -5.244  -29.877 52.611  1.00 65.36  ? 106 VAL B CG1   1 
ATOM   5343  C  CG2   . VAL B  2  106 ? -5.948  -32.070 53.584  1.00 55.53  ? 106 VAL B CG2   1 
ATOM   5344  N  N     . THR B  2  107 ? -2.011  -29.479 53.689  1.00 68.90  ? 107 THR B N     1 
ATOM   5345  C  CA    . THR B  2  107 ? -1.258  -28.236 53.712  1.00 68.92  ? 107 THR B CA    1 
ATOM   5346  C  C     . THR B  2  107 ? -1.590  -27.396 52.487  1.00 65.46  ? 107 THR B C     1 
ATOM   5347  O  O     . THR B  2  107 ? -1.811  -27.927 51.394  1.00 72.35  ? 107 THR B O     1 
ATOM   5348  C  CB    . THR B  2  107 ? 0.245   -28.522 53.781  1.00 67.21  ? 107 THR B CB    1 
ATOM   5349  O  OG1   . THR B  2  107 ? 0.512   -29.331 54.932  1.00 70.44  ? 107 THR B OG1   1 
ATOM   5350  C  CG2   . THR B  2  107 ? 1.047   -27.232 53.891  1.00 58.07  ? 107 THR B CG2   1 
ATOM   5351  N  N     . VAL B  2  108 ? -1.621  -26.080 52.680  1.00 57.78  ? 108 VAL B N     1 
ATOM   5352  C  CA    . VAL B  2  108 ? -1.998  -25.127 51.646  1.00 64.98  ? 108 VAL B CA    1 
ATOM   5353  C  C     . VAL B  2  108 ? -0.768  -24.303 51.298  1.00 75.90  ? 108 VAL B C     1 
ATOM   5354  O  O     . VAL B  2  108 ? -0.136  -23.715 52.184  1.00 80.23  ? 108 VAL B O     1 
ATOM   5355  C  CB    . VAL B  2  108 ? -3.155  -24.224 52.108  1.00 57.54  ? 108 VAL B CB    1 
ATOM   5356  C  CG1   . VAL B  2  108 ? -3.784  -23.513 50.922  1.00 54.85  ? 108 VAL B CG1   1 
ATOM   5357  C  CG2   . VAL B  2  108 ? -4.190  -25.036 52.872  1.00 49.76  ? 108 VAL B CG2   1 
ATOM   5358  N  N     . LEU B  2  109 ? -0.430  -24.261 50.014  1.00 71.99  ? 109 LEU B N     1 
ATOM   5359  C  CA    . LEU B  2  109 ? 0.761   -23.580 49.532  1.00 66.48  ? 109 LEU B CA    1 
ATOM   5360  C  C     . LEU B  2  109 ? 0.353   -22.457 48.593  1.00 73.79  ? 109 LEU B C     1 
ATOM   5361  O  O     . LEU B  2  109 ? -0.588  -22.605 47.809  1.00 86.42  ? 109 LEU B O     1 
ATOM   5362  C  CB    . LEU B  2  109 ? 1.704   -24.548 48.808  1.00 61.24  ? 109 LEU B CB    1 
ATOM   5363  C  CG    . LEU B  2  109 ? 2.301   -25.683 49.641  1.00 68.73  ? 109 LEU B CG    1 
ATOM   5364  C  CD1   . LEU B  2  109 ? 3.237   -26.535 48.796  1.00 65.29  ? 109 LEU B CD1   1 
ATOM   5365  C  CD2   . LEU B  2  109 ? 3.027   -25.134 50.859  1.00 83.49  ? 109 LEU B CD2   1 
ATOM   5366  N  N     . ASP B  2  110 ? 1.068   -21.338 48.666  1.00 72.04  ? 110 ASP B N     1 
ATOM   5367  C  CA    . ASP B  2  110 ? 0.810   -20.202 47.787  1.00 67.45  ? 110 ASP B CA    1 
ATOM   5368  C  C     . ASP B  2  110 ? 1.703   -20.354 46.563  1.00 78.85  ? 110 ASP B C     1 
ATOM   5369  O  O     . ASP B  2  110 ? 2.908   -20.096 46.620  1.00 89.06  ? 110 ASP B O     1 
ATOM   5370  C  CB    . ASP B  2  110 ? 1.067   -18.886 48.514  1.00 61.88  ? 110 ASP B CB    1 
ATOM   5371  C  CG    . ASP B  2  110 ? 0.510   -17.683 47.771  1.00 71.36  ? 110 ASP B CG    1 
ATOM   5372  O  OD1   . ASP B  2  110 ? 0.511   -17.685 46.521  1.00 68.75  ? 110 ASP B OD1   1 
ATOM   5373  O  OD2   . ASP B  2  110 ? 0.067   -16.728 48.443  1.00 85.70  ? 110 ASP B OD2   1 
ATOM   5374  N  N     . VAL B  2  111 ? 1.108   -20.777 45.453  1.00 67.39  ? 111 VAL B N     1 
ATOM   5375  C  CA    . VAL B  2  111 ? 1.828   -20.963 44.203  1.00 64.09  ? 111 VAL B CA    1 
ATOM   5376  C  C     . VAL B  2  111 ? 1.489   -19.856 43.208  1.00 67.92  ? 111 VAL B C     1 
ATOM   5377  O  O     . VAL B  2  111 ? 1.729   -20.002 42.011  1.00 72.29  ? 111 VAL B O     1 
ATOM   5378  C  CB    . VAL B  2  111 ? 1.562   -22.355 43.607  1.00 70.15  ? 111 VAL B CB    1 
ATOM   5379  C  CG1   . VAL B  2  111 ? 2.037   -23.440 44.564  1.00 70.41  ? 111 VAL B CG1   1 
ATOM   5380  C  CG2   . VAL B  2  111 ? 0.084   -22.526 43.292  1.00 73.18  ? 111 VAL B CG2   1 
ATOM   5381  N  N     . GLY B  2  112 ? 0.925   -18.746 43.696  1.00 63.89  ? 112 GLY B N     1 
ATOM   5382  C  CA    . GLY B  2  112 ? 0.494   -17.682 42.806  1.00 64.69  ? 112 GLY B CA    1 
ATOM   5383  C  C     . GLY B  2  112 ? 1.629   -17.101 41.989  1.00 73.85  ? 112 GLY B C     1 
ATOM   5384  O  O     . GLY B  2  112 ? 1.416   -16.635 40.866  1.00 70.25  ? 112 GLY B O     1 
ATOM   5385  N  N     . ASP B  2  113 ? 2.841   -17.084 42.555  1.00 74.26  ? 113 ASP B N     1 
ATOM   5386  C  CA    . ASP B  2  113 ? 3.985   -16.488 41.873  1.00 80.30  ? 113 ASP B CA    1 
ATOM   5387  C  C     . ASP B  2  113 ? 4.228   -17.151 40.523  1.00 82.47  ? 113 ASP B C     1 
ATOM   5388  O  O     . ASP B  2  113 ? 4.699   -16.499 39.584  1.00 82.06  ? 113 ASP B O     1 
ATOM   5389  C  CB    . ASP B  2  113 ? 5.228   -16.589 42.759  1.00 92.66  ? 113 ASP B CB    1 
ATOM   5390  C  CG    . ASP B  2  113 ? 6.357   -15.693 42.291  1.00 109.96 ? 113 ASP B CG    1 
ATOM   5391  O  OD1   . ASP B  2  113 ? 6.082   -14.538 41.908  1.00 115.55 ? 113 ASP B OD1   1 
ATOM   5392  O  OD2   . ASP B  2  113 ? 7.521   -16.144 42.308  1.00 117.48 ? 113 ASP B OD2   1 
ATOM   5393  N  N     . ALA B  2  114 ? 3.936   -18.451 40.420  1.00 75.68  ? 114 ALA B N     1 
ATOM   5394  C  CA    . ALA B  2  114 ? 4.179   -19.190 39.185  1.00 75.10  ? 114 ALA B CA    1 
ATOM   5395  C  C     . ALA B  2  114 ? 3.424   -18.576 38.016  1.00 80.77  ? 114 ALA B C     1 
ATOM   5396  O  O     . ALA B  2  114 ? 3.944   -18.512 36.896  1.00 83.19  ? 114 ALA B O     1 
ATOM   5397  C  CB    . ALA B  2  114 ? 3.787   -20.656 39.361  1.00 66.59  ? 114 ALA B CB    1 
ATOM   5398  N  N     . TYR B  2  115 ? 2.180   -18.147 38.253  1.00 76.71  ? 115 TYR B N     1 
ATOM   5399  C  CA    . TYR B  2  115 ? 1.346   -17.607 37.183  1.00 80.04  ? 115 TYR B CA    1 
ATOM   5400  C  C     . TYR B  2  115 ? 2.029   -16.459 36.451  1.00 85.17  ? 115 TYR B C     1 
ATOM   5401  O  O     . TYR B  2  115 ? 1.714   -16.192 35.286  1.00 86.06  ? 115 TYR B O     1 
ATOM   5402  C  CB    . TYR B  2  115 ? 0.004   -17.145 37.757  1.00 66.41  ? 115 TYR B CB    1 
ATOM   5403  C  CG    . TYR B  2  115 ? -0.710  -18.193 38.586  1.00 68.60  ? 115 TYR B CG    1 
ATOM   5404  C  CD1   . TYR B  2  115 ? -1.540  -17.826 39.638  1.00 70.29  ? 115 TYR B CD1   1 
ATOM   5405  C  CD2   . TYR B  2  115 ? -0.559  -19.547 38.314  1.00 71.14  ? 115 TYR B CD2   1 
ATOM   5406  C  CE1   . TYR B  2  115 ? -2.196  -18.778 40.397  1.00 73.78  ? 115 TYR B CE1   1 
ATOM   5407  C  CE2   . TYR B  2  115 ? -1.209  -20.506 39.069  1.00 75.23  ? 115 TYR B CE2   1 
ATOM   5408  C  CZ    . TYR B  2  115 ? -2.027  -20.115 40.108  1.00 78.21  ? 115 TYR B CZ    1 
ATOM   5409  O  OH    . TYR B  2  115 ? -2.677  -21.065 40.861  1.00 83.72  ? 115 TYR B OH    1 
ATOM   5410  N  N     . PHE B  2  116 ? 2.958   -15.767 37.114  1.00 87.66  ? 116 PHE B N     1 
ATOM   5411  C  CA    . PHE B  2  116 ? 3.645   -14.645 36.488  1.00 86.66  ? 116 PHE B CA    1 
ATOM   5412  C  C     . PHE B  2  116 ? 4.528   -15.084 35.327  1.00 90.15  ? 116 PHE B C     1 
ATOM   5413  O  O     . PHE B  2  116 ? 4.825   -14.269 34.448  1.00 96.38  ? 116 PHE B O     1 
ATOM   5414  C  CB    . PHE B  2  116 ? 4.479   -13.894 37.531  1.00 89.87  ? 116 PHE B CB    1 
ATOM   5415  C  CG    . PHE B  2  116 ? 3.654   -13.232 38.600  1.00 83.64  ? 116 PHE B CG    1 
ATOM   5416  C  CD1   . PHE B  2  116 ? 2.392   -12.739 38.312  1.00 84.51  ? 116 PHE B CD1   1 
ATOM   5417  C  CD2   . PHE B  2  116 ? 4.137   -13.107 39.893  1.00 82.16  ? 116 PHE B CD2   1 
ATOM   5418  C  CE1   . PHE B  2  116 ? 1.627   -12.130 39.292  1.00 82.20  ? 116 PHE B CE1   1 
ATOM   5419  C  CE2   . PHE B  2  116 ? 3.377   -12.499 40.878  1.00 80.03  ? 116 PHE B CE2   1 
ATOM   5420  C  CZ    . PHE B  2  116 ? 2.121   -12.010 40.576  1.00 81.36  ? 116 PHE B CZ    1 
ATOM   5421  N  N     . SER B  2  117 ? 4.964   -16.345 35.317  1.00 91.68  ? 117 SER B N     1 
ATOM   5422  C  CA    . SER B  2  117 ? 5.660   -16.941 34.181  1.00 90.43  ? 117 SER B CA    1 
ATOM   5423  C  C     . SER B  2  117 ? 4.900   -16.759 32.872  1.00 94.10  ? 117 SER B C     1 
ATOM   5424  O  O     . SER B  2  117 ? 5.353   -16.034 31.980  1.00 105.77 ? 117 SER B O     1 
ATOM   5425  C  CB    . SER B  2  117 ? 5.907   -18.431 34.431  1.00 92.81  ? 117 SER B CB    1 
ATOM   5426  O  OG    . SER B  2  117 ? 6.577   -18.637 35.661  1.00 104.40 ? 117 SER B OG    1 
ATOM   5427  N  N     . VAL B  2  118 ? 3.750   -17.417 32.755  1.00 91.13  ? 118 VAL B N     1 
ATOM   5428  C  CA    . VAL B  2  118 ? 2.976   -17.401 31.508  1.00 91.51  ? 118 VAL B CA    1 
ATOM   5429  C  C     . VAL B  2  118 ? 2.539   -15.977 31.199  1.00 82.47  ? 118 VAL B C     1 
ATOM   5430  O  O     . VAL B  2  118 ? 2.225   -15.210 32.131  1.00 74.22  ? 118 VAL B O     1 
ATOM   5431  C  CB    . VAL B  2  118 ? 1.760   -18.337 31.623  1.00 72.75  ? 118 VAL B CB    1 
ATOM   5432  C  CG1   . VAL B  2  118 ? 1.082   -18.528 30.273  1.00 82.57  ? 118 VAL B CG1   1 
ATOM   5433  C  CG2   . VAL B  2  118 ? 2.180   -19.671 32.208  1.00 73.28  ? 118 VAL B CG2   1 
ATOM   5434  N  N     . PRO B  2  119 ? 2.500   -15.562 29.939  1.00 86.26  ? 119 PRO B N     1 
ATOM   5435  C  CA    . PRO B  2  119 ? 1.937   -14.256 29.590  1.00 87.52  ? 119 PRO B CA    1 
ATOM   5436  C  C     . PRO B  2  119 ? 0.422   -14.356 29.452  1.00 94.95  ? 119 PRO B C     1 
ATOM   5437  O  O     . PRO B  2  119 ? -0.172  -15.426 29.572  1.00 100.16 ? 119 PRO B O     1 
ATOM   5438  C  CB    . PRO B  2  119 ? 2.602   -13.924 28.247  1.00 84.37  ? 119 PRO B CB    1 
ATOM   5439  C  CG    . PRO B  2  119 ? 3.693   -14.947 28.065  1.00 83.51  ? 119 PRO B CG    1 
ATOM   5440  C  CD    . PRO B  2  119 ? 3.238   -16.152 28.813  1.00 80.48  ? 119 PRO B CD    1 
ATOM   5441  N  N     . LEU B  2  120 ? -0.200  -13.209 29.202  1.00 87.38  ? 120 LEU B N     1 
ATOM   5442  C  CA    . LEU B  2  120 ? -1.649  -13.080 29.184  1.00 78.14  ? 120 LEU B CA    1 
ATOM   5443  C  C     . LEU B  2  120 ? -2.090  -12.548 27.829  1.00 79.18  ? 120 LEU B C     1 
ATOM   5444  O  O     . LEU B  2  120 ? -1.375  -11.755 27.206  1.00 79.61  ? 120 LEU B O     1 
ATOM   5445  C  CB    . LEU B  2  120 ? -2.133  -12.145 30.300  1.00 72.38  ? 120 LEU B CB    1 
ATOM   5446  C  CG    . LEU B  2  120 ? -3.641  -11.915 30.415  1.00 67.81  ? 120 LEU B CG    1 
ATOM   5447  C  CD1   . LEU B  2  120 ? -4.349  -13.183 30.863  1.00 66.02  ? 120 LEU B CD1   1 
ATOM   5448  C  CD2   . LEU B  2  120 ? -3.943  -10.761 31.358  1.00 64.94  ? 120 LEU B CD2   1 
ATOM   5449  N  N     . ASP B  2  121 ? -3.246  -13.022 27.360  1.00 86.17  ? 121 ASP B N     1 
ATOM   5450  C  CA    . ASP B  2  121 ? -3.776  -12.605 26.067  1.00 91.64  ? 121 ASP B CA    1 
ATOM   5451  C  C     . ASP B  2  121 ? -3.786  -11.086 25.965  1.00 94.84  ? 121 ASP B C     1 
ATOM   5452  O  O     . ASP B  2  121 ? -4.334  -10.398 26.830  1.00 95.23  ? 121 ASP B O     1 
ATOM   5453  C  CB    . ASP B  2  121 ? -5.189  -13.161 25.877  1.00 94.76  ? 121 ASP B CB    1 
ATOM   5454  C  CG    . ASP B  2  121 ? -5.766  -12.839 24.511  1.00 105.29 ? 121 ASP B CG    1 
ATOM   5455  O  OD1   . ASP B  2  121 ? -5.001  -12.844 23.523  1.00 110.08 ? 121 ASP B OD1   1 
ATOM   5456  O  OD2   . ASP B  2  121 ? -6.986  -12.582 24.426  1.00 106.03 ? 121 ASP B OD2   1 
ATOM   5457  N  N     . GLU B  2  122 ? -3.163  -10.569 24.902  1.00 104.80 ? 122 GLU B N     1 
ATOM   5458  C  CA    . GLU B  2  122 ? -3.057  -9.123  24.727  1.00 109.13 ? 122 GLU B CA    1 
ATOM   5459  C  C     . GLU B  2  122 ? -4.426  -8.452  24.739  1.00 109.67 ? 122 GLU B C     1 
ATOM   5460  O  O     . GLU B  2  122 ? -4.571  -7.331  25.240  1.00 111.21 ? 122 GLU B O     1 
ATOM   5461  C  CB    . GLU B  2  122 ? -2.318  -8.811  23.426  1.00 112.32 ? 122 GLU B CB    1 
ATOM   5462  C  CG    . GLU B  2  122 ? -2.213  -7.329  23.104  1.00 119.07 ? 122 GLU B CG    1 
ATOM   5463  C  CD    . GLU B  2  122 ? -1.369  -6.570  24.109  1.00 125.60 ? 122 GLU B CD    1 
ATOM   5464  O  OE1   . GLU B  2  122 ? -0.429  -7.169  24.672  1.00 130.77 ? 122 GLU B OE1   1 
ATOM   5465  O  OE2   . GLU B  2  122 ? -1.647  -5.374  24.338  1.00 124.86 ? 122 GLU B OE2   1 
ATOM   5466  N  N     . ASP B  2  123 ? -5.444  -9.122  24.195  1.00 103.70 ? 123 ASP B N     1 
ATOM   5467  C  CA    . ASP B  2  123 ? -6.778  -8.536  24.166  1.00 100.32 ? 123 ASP B CA    1 
ATOM   5468  C  C     . ASP B  2  123 ? -7.450  -8.543  25.533  1.00 101.76 ? 123 ASP B C     1 
ATOM   5469  O  O     . ASP B  2  123 ? -8.395  -7.777  25.746  1.00 106.04 ? 123 ASP B O     1 
ATOM   5470  C  CB    . ASP B  2  123 ? -7.655  -9.275  23.154  1.00 110.00 ? 123 ASP B CB    1 
ATOM   5471  C  CG    . ASP B  2  123 ? -7.154  -9.128  21.731  1.00 127.38 ? 123 ASP B CG    1 
ATOM   5472  O  OD1   . ASP B  2  123 ? -7.587  -8.179  21.044  1.00 133.92 ? 123 ASP B OD1   1 
ATOM   5473  O  OD2   . ASP B  2  123 ? -6.327  -9.959  21.299  1.00 132.10 ? 123 ASP B OD2   1 
ATOM   5474  N  N     . PHE B  2  124 ? -6.999  -9.392  26.456  1.00 94.65  ? 124 PHE B N     1 
ATOM   5475  C  CA    . PHE B  2  124 ? -7.628  -9.489  27.768  1.00 85.66  ? 124 PHE B CA    1 
ATOM   5476  C  C     . PHE B  2  124 ? -7.079  -8.488  28.775  1.00 85.02  ? 124 PHE B C     1 
ATOM   5477  O  O     . PHE B  2  124 ? -7.799  -8.107  29.706  1.00 77.06  ? 124 PHE B O     1 
ATOM   5478  C  CB    . PHE B  2  124 ? -7.488  -10.904 28.332  1.00 82.63  ? 124 PHE B CB    1 
ATOM   5479  C  CG    . PHE B  2  124 ? -8.468  -11.207 29.429  1.00 76.09  ? 124 PHE B CG    1 
ATOM   5480  C  CD1   . PHE B  2  124 ? -9.819  -11.331 29.147  1.00 79.91  ? 124 PHE B CD1   1 
ATOM   5481  C  CD2   . PHE B  2  124 ? -8.046  -11.355 30.738  1.00 72.25  ? 124 PHE B CD2   1 
ATOM   5482  C  CE1   . PHE B  2  124 ? -10.731 -11.603 30.149  1.00 78.99  ? 124 PHE B CE1   1 
ATOM   5483  C  CE2   . PHE B  2  124 ? -8.954  -11.627 31.746  1.00 73.93  ? 124 PHE B CE2   1 
ATOM   5484  C  CZ    . PHE B  2  124 ? -10.297 -11.752 31.450  1.00 74.95  ? 124 PHE B CZ    1 
ATOM   5485  N  N     . ARG B  2  125 ? -5.819  -8.068  28.619  1.00 88.40  ? 125 ARG B N     1 
ATOM   5486  C  CA    . ARG B  2  125 ? -5.132  -7.295  29.651  1.00 82.69  ? 125 ARG B CA    1 
ATOM   5487  C  C     . ARG B  2  125 ? -5.870  -6.017  30.025  1.00 80.65  ? 125 ARG B C     1 
ATOM   5488  O  O     . ARG B  2  125 ? -5.677  -5.507  31.135  1.00 75.31  ? 125 ARG B O     1 
ATOM   5489  C  CB    . ARG B  2  125 ? -3.715  -6.962  29.184  1.00 88.98  ? 125 ARG B CB    1 
ATOM   5490  C  CG    . ARG B  2  125 ? -2.926  -8.178  28.732  1.00 90.14  ? 125 ARG B CG    1 
ATOM   5491  C  CD    . ARG B  2  125 ? -1.518  -7.813  28.296  1.00 86.99  ? 125 ARG B CD    1 
ATOM   5492  N  NE    . ARG B  2  125 ? -0.767  -8.991  27.875  1.00 94.54  ? 125 ARG B NE    1 
ATOM   5493  C  CZ    . ARG B  2  125 ? 0.495   -8.965  27.459  1.00 95.64  ? 125 ARG B CZ    1 
ATOM   5494  N  NH1   . ARG B  2  125 ? 1.155   -7.817  27.407  1.00 90.87  ? 125 ARG B NH1   1 
ATOM   5495  N  NH2   . ARG B  2  125 ? 1.098   -10.089 27.095  1.00 98.09  ? 125 ARG B NH2   1 
ATOM   5496  N  N     . LYS B  2  126 ? -6.699  -5.480  29.126  1.00 87.49  ? 126 LYS B N     1 
ATOM   5497  C  CA    . LYS B  2  126 ? -7.459  -4.273  29.432  1.00 88.51  ? 126 LYS B CA    1 
ATOM   5498  C  C     . LYS B  2  126 ? -8.372  -4.454  30.640  1.00 83.77  ? 126 LYS B C     1 
ATOM   5499  O  O     . LYS B  2  126 ? -8.769  -3.459  31.256  1.00 92.43  ? 126 LYS B O     1 
ATOM   5500  C  CB    . LYS B  2  126 ? -8.276  -3.845  28.211  1.00 95.33  ? 126 LYS B CB    1 
ATOM   5501  C  CG    . LYS B  2  126 ? -9.407  -4.793  27.847  1.00 101.66 ? 126 LYS B CG    1 
ATOM   5502  C  CD    . LYS B  2  126 ? -9.553  -4.923  26.339  1.00 106.06 ? 126 LYS B CD    1 
ATOM   5503  C  CE    . LYS B  2  126 ? -9.855  -3.589  25.680  1.00 106.90 ? 126 LYS B CE    1 
ATOM   5504  N  NZ    . LYS B  2  126 ? -11.226 -3.108  26.001  1.00 104.90 ? 126 LYS B NZ    1 
ATOM   5505  N  N     . TYR B  2  127 ? -8.720  -5.695  30.988  1.00 71.75  ? 127 TYR B N     1 
ATOM   5506  C  CA    . TYR B  2  127 ? -9.666  -5.964  32.063  1.00 70.59  ? 127 TYR B CA    1 
ATOM   5507  C  C     . TYR B  2  127 ? -9.007  -6.173  33.422  1.00 73.37  ? 127 TYR B C     1 
ATOM   5508  O  O     . TYR B  2  127 ? -9.721  -6.254  34.428  1.00 80.50  ? 127 TYR B O     1 
ATOM   5509  C  CB    . TYR B  2  127 ? -10.507 -7.205  31.734  1.00 76.93  ? 127 TYR B CB    1 
ATOM   5510  C  CG    . TYR B  2  127 ? -11.288 -7.127  30.440  1.00 76.52  ? 127 TYR B CG    1 
ATOM   5511  C  CD1   . TYR B  2  127 ? -12.355 -6.249  30.300  1.00 84.27  ? 127 TYR B CD1   1 
ATOM   5512  C  CD2   . TYR B  2  127 ? -10.975 -7.951  29.367  1.00 81.40  ? 127 TYR B CD2   1 
ATOM   5513  C  CE1   . TYR B  2  127 ? -13.076 -6.181  29.121  1.00 88.37  ? 127 TYR B CE1   1 
ATOM   5514  C  CE2   . TYR B  2  127 ? -11.690 -7.892  28.185  1.00 86.87  ? 127 TYR B CE2   1 
ATOM   5515  C  CZ    . TYR B  2  127 ? -12.739 -7.006  28.067  1.00 89.19  ? 127 TYR B CZ    1 
ATOM   5516  O  OH    . TYR B  2  127 ? -13.453 -6.947  26.891  1.00 86.40  ? 127 TYR B OH    1 
ATOM   5517  N  N     . THR B  2  128 ? -7.679  -6.264  33.486  1.00 72.81  ? 128 THR B N     1 
ATOM   5518  C  CA    . THR B  2  128 ? -6.969  -6.408  34.751  1.00 64.64  ? 128 THR B CA    1 
ATOM   5519  C  C     . THR B  2  128 ? -6.561  -5.073  35.365  1.00 57.48  ? 128 THR B C     1 
ATOM   5520  O  O     . THR B  2  128 ? -5.782  -5.057  36.324  1.00 62.17  ? 128 THR B O     1 
ATOM   5521  C  CB    . THR B  2  128 ? -5.729  -7.284  34.556  1.00 69.87  ? 128 THR B CB    1 
ATOM   5522  O  OG1   . THR B  2  128 ? -4.902  -6.720  33.530  1.00 62.44  ? 128 THR B OG1   1 
ATOM   5523  C  CG2   . THR B  2  128 ? -6.134  -8.690  34.153  1.00 68.29  ? 128 THR B CG2   1 
ATOM   5524  N  N     . ALA B  2  129 ? -7.060  -3.964  34.825  1.00 58.13  ? 129 ALA B N     1 
ATOM   5525  C  CA    . ALA B  2  129 ? -6.672  -2.633  35.277  1.00 60.39  ? 129 ALA B CA    1 
ATOM   5526  C  C     . ALA B  2  129 ? -6.989  -2.419  36.754  1.00 67.01  ? 129 ALA B C     1 
ATOM   5527  O  O     . ALA B  2  129 ? -8.079  -2.760  37.225  1.00 78.19  ? 129 ALA B O     1 
ATOM   5528  C  CB    . ALA B  2  129 ? -7.365  -1.575  34.425  1.00 59.06  ? 129 ALA B CB    1 
ATOM   5529  N  N     . PHE B  2  130 ? -6.028  -1.855  37.487  1.00 63.18  ? 130 PHE B N     1 
ATOM   5530  C  CA    . PHE B  2  130 ? -6.205  -1.513  38.892  1.00 65.75  ? 130 PHE B CA    1 
ATOM   5531  C  C     . PHE B  2  130 ? -5.482  -0.204  39.178  1.00 70.91  ? 130 PHE B C     1 
ATOM   5532  O  O     . PHE B  2  130 ? -4.385  0.033   38.664  1.00 83.17  ? 130 PHE B O     1 
ATOM   5533  C  CB    . PHE B  2  130 ? -5.685  -2.624  39.821  1.00 60.81  ? 130 PHE B CB    1 
ATOM   5534  C  CG    . PHE B  2  130 ? -4.202  -2.866  39.721  1.00 62.48  ? 130 PHE B CG    1 
ATOM   5535  C  CD1   . PHE B  2  130 ? -3.317  -2.197  40.554  1.00 59.99  ? 130 PHE B CD1   1 
ATOM   5536  C  CD2   . PHE B  2  130 ? -3.693  -3.773  38.807  1.00 70.64  ? 130 PHE B CD2   1 
ATOM   5537  C  CE1   . PHE B  2  130 ? -1.956  -2.418  40.468  1.00 59.16  ? 130 PHE B CE1   1 
ATOM   5538  C  CE2   . PHE B  2  130 ? -2.331  -3.999  38.718  1.00 75.20  ? 130 PHE B CE2   1 
ATOM   5539  C  CZ    . PHE B  2  130 ? -1.463  -3.321  39.550  1.00 68.23  ? 130 PHE B CZ    1 
ATOM   5540  N  N     . THR B  2  131 ? -6.106  0.643   39.995  1.00 65.62  ? 131 THR B N     1 
ATOM   5541  C  CA    . THR B  2  131 ? -5.559  1.943   40.362  1.00 61.35  ? 131 THR B CA    1 
ATOM   5542  C  C     . THR B  2  131 ? -4.997  1.928   41.781  1.00 61.83  ? 131 THR B C     1 
ATOM   5543  O  O     . THR B  2  131 ? -5.595  1.349   42.692  1.00 76.06  ? 131 THR B O     1 
ATOM   5544  C  CB    . THR B  2  131 ? -6.639  3.022   40.244  1.00 62.32  ? 131 THR B CB    1 
ATOM   5545  O  OG1   . THR B  2  131 ? -7.236  2.963   38.942  1.00 72.58  ? 131 THR B OG1   1 
ATOM   5546  C  CG2   . THR B  2  131 ? -6.050  4.399   40.455  1.00 58.67  ? 131 THR B CG2   1 
ATOM   5547  N  N     . ILE B  2  132 ? -3.842  2.560   41.956  1.00 60.94  ? 132 ILE B N     1 
ATOM   5548  C  CA    . ILE B  2  132 ? -3.216  2.742   43.264  1.00 58.23  ? 132 ILE B CA    1 
ATOM   5549  C  C     . ILE B  2  132 ? -3.519  4.155   43.751  1.00 51.42  ? 132 ILE B C     1 
ATOM   5550  O  O     . ILE B  2  132 ? -3.222  5.120   43.030  1.00 58.71  ? 132 ILE B O     1 
ATOM   5551  C  CB    . ILE B  2  132 ? -1.700  2.508   43.207  1.00 61.99  ? 132 ILE B CB    1 
ATOM   5552  C  CG1   . ILE B  2  132 ? -1.384  1.050   42.883  1.00 66.47  ? 132 ILE B CG1   1 
ATOM   5553  C  CG2   . ILE B  2  132 ? -1.049  2.917   44.521  1.00 51.39  ? 132 ILE B CG2   1 
ATOM   5554  C  CD1   . ILE B  2  132 ? 0.091   0.750   42.923  1.00 71.04  ? 132 ILE B CD1   1 
ATOM   5555  N  N     . PRO B  2  133 ? -4.104  4.328   44.931  1.00 54.70  ? 133 PRO B N     1 
ATOM   5556  C  CA    . PRO B  2  133 ? -4.437  5.673   45.408  1.00 59.53  ? 133 PRO B CA    1 
ATOM   5557  C  C     . PRO B  2  133 ? -3.228  6.327   46.067  1.00 62.88  ? 133 PRO B C     1 
ATOM   5558  O  O     . PRO B  2  133 ? -2.213  5.688   46.347  1.00 65.66  ? 133 PRO B O     1 
ATOM   5559  C  CB    . PRO B  2  133 ? -5.554  5.416   46.421  1.00 51.12  ? 133 PRO B CB    1 
ATOM   5560  C  CG    . PRO B  2  133 ? -5.217  4.072   46.978  1.00 47.54  ? 133 PRO B CG    1 
ATOM   5561  C  CD    . PRO B  2  133 ? -4.595  3.282   45.846  1.00 50.91  ? 133 PRO B CD    1 
ATOM   5562  N  N     . SER B  2  134 ? -3.355  7.628   46.320  1.00 60.20  ? 134 SER B N     1 
ATOM   5563  C  CA    . SER B  2  134 ? -2.364  8.374   47.082  1.00 62.68  ? 134 SER B CA    1 
ATOM   5564  C  C     . SER B  2  134 ? -2.980  8.934   48.358  1.00 58.14  ? 134 SER B C     1 
ATOM   5565  O  O     . SER B  2  134 ? -4.160  9.294   48.394  1.00 50.09  ? 134 SER B O     1 
ATOM   5566  C  CB    . SER B  2  134 ? -1.771  9.518   46.247  1.00 66.45  ? 134 SER B CB    1 
ATOM   5567  O  OG    . SER B  2  134 ? -2.780  10.421  45.830  1.00 69.64  ? 134 SER B OG    1 
ATOM   5568  N  N     . ILE B  2  135 ? -2.161  8.987   49.413  1.00 56.34  ? 135 ILE B N     1 
ATOM   5569  C  CA    . ILE B  2  135 ? -2.569  9.633   50.656  1.00 48.61  ? 135 ILE B CA    1 
ATOM   5570  C  C     . ILE B  2  135 ? -2.934  11.085  50.389  1.00 50.66  ? 135 ILE B C     1 
ATOM   5571  O  O     . ILE B  2  135 ? -2.205  11.810  49.700  1.00 58.67  ? 135 ILE B O     1 
ATOM   5572  C  CB    . ILE B  2  135 ? -1.453  9.527   51.706  1.00 48.20  ? 135 ILE B CB    1 
ATOM   5573  C  CG1   . ILE B  2  135 ? -1.070  8.064   51.931  1.00 47.31  ? 135 ILE B CG1   1 
ATOM   5574  C  CG2   . ILE B  2  135 ? -1.885  10.179  53.015  1.00 47.51  ? 135 ILE B CG2   1 
ATOM   5575  C  CD1   . ILE B  2  135 ? 0.091   7.881   52.872  1.00 47.13  ? 135 ILE B CD1   1 
ATOM   5576  N  N     . ASN B  2  136 ? -4.074  11.513  50.934  1.00 49.26  ? 136 ASN B N     1 
ATOM   5577  C  CA    . ASN B  2  136 ? -4.577  12.881  50.817  1.00 50.34  ? 136 ASN B CA    1 
ATOM   5578  C  C     . ASN B  2  136 ? -4.744  13.319  49.365  1.00 53.08  ? 136 ASN B C     1 
ATOM   5579  O  O     . ASN B  2  136 ? -4.846  14.518  49.086  1.00 65.89  ? 136 ASN B O     1 
ATOM   5580  C  CB    . ASN B  2  136 ? -3.670  13.866  51.567  1.00 57.18  ? 136 ASN B CB    1 
ATOM   5581  C  CG    . ASN B  2  136 ? -4.372  15.167  51.904  1.00 61.36  ? 136 ASN B CG    1 
ATOM   5582  O  OD1   . ASN B  2  136 ? -5.596  15.210  52.025  1.00 69.43  ? 136 ASN B OD1   1 
ATOM   5583  N  ND2   . ASN B  2  136 ? -3.599  16.235  52.054  1.00 60.36  ? 136 ASN B ND2   1 
ATOM   5584  N  N     . ASN B  2  137 ? -4.789  12.366  48.434  1.00 51.83  ? 137 ASN B N     1 
ATOM   5585  C  CA    . ASN B  2  137 ? -4.894  12.663  47.005  1.00 57.05  ? 137 ASN B CA    1 
ATOM   5586  C  C     . ASN B  2  137 ? -3.819  13.656  46.562  1.00 60.95  ? 137 ASN B C     1 
ATOM   5587  O  O     . ASN B  2  137 ? -4.084  14.603  45.820  1.00 59.08  ? 137 ASN B O     1 
ATOM   5588  C  CB    . ASN B  2  137 ? -6.292  13.172  46.651  1.00 63.25  ? 137 ASN B CB    1 
ATOM   5589  C  CG    . ASN B  2  137 ? -7.375  12.154  46.953  1.00 68.61  ? 137 ASN B CG    1 
ATOM   5590  O  OD1   . ASN B  2  137 ? -8.237  12.383  47.800  1.00 76.94  ? 137 ASN B OD1   1 
ATOM   5591  N  ND2   . ASN B  2  137 ? -7.334  11.022  46.259  1.00 64.83  ? 137 ASN B ND2   1 
ATOM   5592  N  N     . GLU B  2  138 ? -2.590  13.439  47.040  1.00 61.08  ? 138 GLU B N     1 
ATOM   5593  C  CA    . GLU B  2  138 ? -1.460  14.235  46.572  1.00 65.84  ? 138 GLU B CA    1 
ATOM   5594  C  C     . GLU B  2  138 ? -1.274  14.091  45.066  1.00 73.20  ? 138 GLU B C     1 
ATOM   5595  O  O     . GLU B  2  138 ? -1.058  15.083  44.358  1.00 76.24  ? 138 GLU B O     1 
ATOM   5596  C  CB    . GLU B  2  138 ? -0.192  13.820  47.318  1.00 73.46  ? 138 GLU B CB    1 
ATOM   5597  C  CG    . GLU B  2  138 ? 1.108   14.202  46.634  1.00 81.41  ? 138 GLU B CG    1 
ATOM   5598  C  CD    . GLU B  2  138 ? 2.318   13.605  47.326  1.00 91.47  ? 138 GLU B CD    1 
ATOM   5599  O  OE1   . GLU B  2  138 ? 2.577   13.963  48.494  1.00 88.21  ? 138 GLU B OE1   1 
ATOM   5600  O  OE2   . GLU B  2  138 ? 3.004   12.764  46.705  1.00 101.83 ? 138 GLU B OE2   1 
ATOM   5601  N  N     . THR B  2  139 ? -1.355  12.867  44.563  1.00 76.84  ? 139 THR B N     1 
ATOM   5602  C  CA    . THR B  2  139 ? -1.244  12.509  43.162  1.00 77.34  ? 139 THR B CA    1 
ATOM   5603  C  C     . THR B  2  139 ? -2.578  11.949  42.680  1.00 80.41  ? 139 THR B C     1 
ATOM   5604  O  O     . THR B  2  139 ? -3.358  11.429  43.485  1.00 86.26  ? 139 THR B O     1 
ATOM   5605  C  CB    . THR B  2  139 ? -0.142  11.463  42.949  1.00 73.89  ? 139 THR B CB    1 
ATOM   5606  O  OG1   . THR B  2  139 ? 0.914   11.686  43.891  1.00 82.07  ? 139 THR B OG1   1 
ATOM   5607  C  CG2   . THR B  2  139 ? 0.434   11.546  41.544  1.00 82.66  ? 139 THR B CG2   1 
ATOM   5608  N  N     . PRO B  2  140 ? -2.886  12.038  41.385  1.00 70.81  ? 140 PRO B N     1 
ATOM   5609  C  CA    . PRO B  2  140 ? -4.007  11.247  40.863  1.00 58.82  ? 140 PRO B CA    1 
ATOM   5610  C  C     . PRO B  2  140 ? -3.694  9.761   40.891  1.00 67.67  ? 140 PRO B C     1 
ATOM   5611  O  O     . PRO B  2  140 ? -2.589  9.359   41.270  1.00 67.46  ? 140 PRO B O     1 
ATOM   5612  C  CB    . PRO B  2  140 ? -4.171  11.768  39.430  1.00 63.89  ? 140 PRO B CB    1 
ATOM   5613  C  CG    . PRO B  2  140 ? -3.621  13.153  39.477  1.00 78.02  ? 140 PRO B CG    1 
ATOM   5614  C  CD    . PRO B  2  140 ? -2.471  13.090  40.441  1.00 81.23  ? 140 PRO B CD    1 
ATOM   5615  N  N     . GLY B  2  141 ? -4.656  8.935   40.489  1.00 74.71  ? 141 GLY B N     1 
ATOM   5616  C  CA    . GLY B  2  141 ? -4.462  7.497   40.565  1.00 67.61  ? 141 GLY B CA    1 
ATOM   5617  C  C     . GLY B  2  141 ? -3.399  7.028   39.590  1.00 74.14  ? 141 GLY B C     1 
ATOM   5618  O  O     . GLY B  2  141 ? -3.390  7.424   38.417  1.00 79.48  ? 141 GLY B O     1 
ATOM   5619  N  N     . ILE B  2  142 ? -2.498  6.177   40.069  1.00 65.73  ? 142 ILE B N     1 
ATOM   5620  C  CA    . ILE B  2  142 ? -1.490  5.549   39.223  1.00 68.80  ? 142 ILE B CA    1 
ATOM   5621  C  C     . ILE B  2  142 ? -2.065  4.221   38.745  1.00 69.16  ? 142 ILE B C     1 
ATOM   5622  O  O     . ILE B  2  142 ? -2.138  3.255   39.509  1.00 87.24  ? 142 ILE B O     1 
ATOM   5623  C  CB    . ILE B  2  142 ? -0.169  5.352   39.976  1.00 70.58  ? 142 ILE B CB    1 
ATOM   5624  C  CG1   . ILE B  2  142 ? 0.306   6.680   40.571  1.00 75.49  ? 142 ILE B CG1   1 
ATOM   5625  C  CG2   . ILE B  2  142 ? 0.892   4.772   39.053  1.00 66.63  ? 142 ILE B CG2   1 
ATOM   5626  C  CD1   . ILE B  2  142 ? 1.476   6.539   41.524  1.00 79.13  ? 142 ILE B CD1   1 
ATOM   5627  N  N     . ARG B  2  143 ? -2.470  4.172   37.481  1.00 59.16  ? 143 ARG B N     1 
ATOM   5628  C  CA    . ARG B  2  143 ? -3.104  2.992   36.914  1.00 64.32  ? 143 ARG B CA    1 
ATOM   5629  C  C     . ARG B  2  143 ? -2.069  2.028   36.343  1.00 66.17  ? 143 ARG B C     1 
ATOM   5630  O  O     . ARG B  2  143 ? -1.026  2.435   35.825  1.00 73.32  ? 143 ARG B O     1 
ATOM   5631  C  CB    . ARG B  2  143 ? -4.108  3.394   35.833  1.00 60.22  ? 143 ARG B CB    1 
ATOM   5632  C  CG    . ARG B  2  143 ? -5.246  4.246   36.365  1.00 62.57  ? 143 ARG B CG    1 
ATOM   5633  C  CD    . ARG B  2  143 ? -6.215  4.652   35.268  1.00 66.11  ? 143 ARG B CD    1 
ATOM   5634  N  NE    . ARG B  2  143 ? -6.659  3.516   34.467  1.00 78.78  ? 143 ARG B NE    1 
ATOM   5635  C  CZ    . ARG B  2  143 ? -7.517  2.590   34.886  1.00 77.36  ? 143 ARG B CZ    1 
ATOM   5636  N  NH1   . ARG B  2  143 ? -8.022  2.648   36.110  1.00 74.75  ? 143 ARG B NH1   1 
ATOM   5637  N  NH2   . ARG B  2  143 ? -7.865  1.599   34.078  1.00 79.64  ? 143 ARG B NH2   1 
ATOM   5638  N  N     . TYR B  2  144 ? -2.368  0.736   36.457  1.00 69.11  ? 144 TYR B N     1 
ATOM   5639  C  CA    . TYR B  2  144 ? -1.579  -0.327  35.852  1.00 72.41  ? 144 TYR B CA    1 
ATOM   5640  C  C     . TYR B  2  144 ? -2.504  -1.276  35.100  1.00 77.13  ? 144 TYR B C     1 
ATOM   5641  O  O     . TYR B  2  144 ? -3.730  -1.138  35.124  1.00 73.68  ? 144 TYR B O     1 
ATOM   5642  C  CB    . TYR B  2  144 ? -0.772  -1.098  36.903  1.00 70.72  ? 144 TYR B CB    1 
ATOM   5643  C  CG    . TYR B  2  144 ? 0.390   -0.333  37.487  1.00 77.47  ? 144 TYR B CG    1 
ATOM   5644  C  CD1   . TYR B  2  144 ? 1.669   -0.467  36.962  1.00 78.90  ? 144 TYR B CD1   1 
ATOM   5645  C  CD2   . TYR B  2  144 ? 0.212   0.518   38.569  1.00 75.79  ? 144 TYR B CD2   1 
ATOM   5646  C  CE1   . TYR B  2  144 ? 2.737   0.228   37.496  1.00 81.73  ? 144 TYR B CE1   1 
ATOM   5647  C  CE2   . TYR B  2  144 ? 1.273   1.217   39.110  1.00 75.59  ? 144 TYR B CE2   1 
ATOM   5648  C  CZ    . TYR B  2  144 ? 2.533   1.069   38.570  1.00 81.88  ? 144 TYR B CZ    1 
ATOM   5649  O  OH    . TYR B  2  144 ? 3.592   1.765   39.107  1.00 87.12  ? 144 TYR B OH    1 
ATOM   5650  N  N     . GLN B  2  145 ? -1.897  -2.261  34.441  1.00 80.11  ? 145 GLN B N     1 
ATOM   5651  C  CA    . GLN B  2  145 ? -2.607  -3.447  33.988  1.00 72.91  ? 145 GLN B CA    1 
ATOM   5652  C  C     . GLN B  2  145 ? -1.608  -4.588  33.879  1.00 62.37  ? 145 GLN B C     1 
ATOM   5653  O  O     . GLN B  2  145 ? -0.394  -4.373  33.839  1.00 69.52  ? 145 GLN B O     1 
ATOM   5654  C  CB    . GLN B  2  145 ? -3.298  -3.222  32.638  1.00 69.89  ? 145 GLN B CB    1 
ATOM   5655  C  CG    . GLN B  2  145 ? -2.394  -3.458  31.434  1.00 84.54  ? 145 GLN B CG    1 
ATOM   5656  C  CD    . GLN B  2  145 ? -3.059  -3.084  30.125  1.00 80.00  ? 145 GLN B CD    1 
ATOM   5657  O  OE1   . GLN B  2  145 ? -4.142  -2.499  30.113  1.00 83.99  ? 145 GLN B OE1   1 
ATOM   5658  N  NE2   . GLN B  2  145 ? -2.412  -3.419  29.013  1.00 70.46  ? 145 GLN B NE2   1 
ATOM   5659  N  N     . TYR B  2  146 ? -2.132  -5.810  33.841  1.00 62.06  ? 146 TYR B N     1 
ATOM   5660  C  CA    . TYR B  2  146 ? -1.299  -7.001  33.931  1.00 66.17  ? 146 TYR B CA    1 
ATOM   5661  C  C     . TYR B  2  146 ? -0.873  -7.468  32.546  1.00 71.60  ? 146 TYR B C     1 
ATOM   5662  O  O     . TYR B  2  146 ? -1.688  -7.538  31.623  1.00 70.45  ? 146 TYR B O     1 
ATOM   5663  C  CB    . TYR B  2  146 ? -2.036  -8.126  34.659  1.00 61.15  ? 146 TYR B CB    1 
ATOM   5664  C  CG    . TYR B  2  146 ? -1.801  -8.130  36.151  1.00 61.73  ? 146 TYR B CG    1 
ATOM   5665  C  CD1   . TYR B  2  146 ? -0.757  -8.858  36.705  1.00 62.53  ? 146 TYR B CD1   1 
ATOM   5666  C  CD2   . TYR B  2  146 ? -2.618  -7.401  37.005  1.00 60.47  ? 146 TYR B CD2   1 
ATOM   5667  C  CE1   . TYR B  2  146 ? -0.535  -8.864  38.066  1.00 61.75  ? 146 TYR B CE1   1 
ATOM   5668  C  CE2   . TYR B  2  146 ? -2.404  -7.401  38.368  1.00 62.35  ? 146 TYR B CE2   1 
ATOM   5669  C  CZ    . TYR B  2  146 ? -1.361  -8.134  38.893  1.00 62.62  ? 146 TYR B CZ    1 
ATOM   5670  O  OH    . TYR B  2  146 ? -1.143  -8.136  40.252  1.00 66.94  ? 146 TYR B OH    1 
ATOM   5671  N  N     . ASN B  2  147 ? 0.409   -7.809  32.416  1.00 69.02  ? 147 ASN B N     1 
ATOM   5672  C  CA    . ASN B  2  147 ? 0.922   -8.423  31.199  1.00 69.93  ? 147 ASN B CA    1 
ATOM   5673  C  C     . ASN B  2  147 ? 1.007   -9.939  31.285  1.00 76.06  ? 147 ASN B C     1 
ATOM   5674  O  O     . ASN B  2  147 ? 1.155   -10.595 30.248  1.00 89.42  ? 147 ASN B O     1 
ATOM   5675  C  CB    . ASN B  2  147 ? 2.309   -7.862  30.863  1.00 77.37  ? 147 ASN B CB    1 
ATOM   5676  C  CG    . ASN B  2  147 ? 2.284   -6.375  30.576  1.00 77.18  ? 147 ASN B CG    1 
ATOM   5677  O  OD1   . ASN B  2  147 ? 1.325   -5.856  30.003  1.00 79.95  ? 147 ASN B OD1   1 
ATOM   5678  N  ND2   . ASN B  2  147 ? 3.342   -5.680  30.973  1.00 70.57  ? 147 ASN B ND2   1 
ATOM   5679  N  N     . VAL B  2  148 ? 0.927   -10.504 32.487  1.00 79.61  ? 148 VAL B N     1 
ATOM   5680  C  CA    . VAL B  2  148 ? 1.022   -11.945 32.686  1.00 81.46  ? 148 VAL B CA    1 
ATOM   5681  C  C     . VAL B  2  148 ? -0.247  -12.427 33.375  1.00 85.38  ? 148 VAL B C     1 
ATOM   5682  O  O     . VAL B  2  148 ? -1.222  -11.676 33.491  1.00 94.63  ? 148 VAL B O     1 
ATOM   5683  C  CB    . VAL B  2  148 ? 2.276   -12.310 33.500  1.00 69.68  ? 148 VAL B CB    1 
ATOM   5684  C  CG1   . VAL B  2  148 ? 3.530   -11.911 32.738  1.00 69.67  ? 148 VAL B CG1   1 
ATOM   5685  C  CG2   . VAL B  2  148 ? 2.238   -11.634 34.861  1.00 67.82  ? 148 VAL B CG2   1 
ATOM   5686  N  N     . LEU B  2  149 ? -0.250  -13.674 33.831  1.00 70.79  ? 149 LEU B N     1 
ATOM   5687  C  CA    . LEU B  2  149 ? -1.419  -14.207 34.526  1.00 72.92  ? 149 LEU B CA    1 
ATOM   5688  C  C     . LEU B  2  149 ? -1.503  -13.608 35.924  1.00 77.83  ? 149 LEU B C     1 
ATOM   5689  O  O     . LEU B  2  149 ? -0.588  -13.815 36.733  1.00 80.97  ? 149 LEU B O     1 
ATOM   5690  C  CB    . LEU B  2  149 ? -1.356  -15.731 34.604  1.00 69.22  ? 149 LEU B CB    1 
ATOM   5691  C  CG    . LEU B  2  149 ? -1.554  -16.515 33.304  1.00 67.28  ? 149 LEU B CG    1 
ATOM   5692  C  CD1   . LEU B  2  149 ? -1.513  -18.015 33.562  1.00 67.13  ? 149 LEU B CD1   1 
ATOM   5693  C  CD2   . LEU B  2  149 ? -2.860  -16.122 32.633  1.00 65.72  ? 149 LEU B CD2   1 
ATOM   5694  N  N     . PRO B  2  150 ? -2.564  -12.875 36.254  1.00 71.74  ? 150 PRO B N     1 
ATOM   5695  C  CA    . PRO B  2  150 ? -2.625  -12.199 37.555  1.00 61.71  ? 150 PRO B CA    1 
ATOM   5696  C  C     . PRO B  2  150 ? -2.983  -13.156 38.682  1.00 60.09  ? 150 PRO B C     1 
ATOM   5697  O  O     . PRO B  2  150 ? -3.782  -14.081 38.513  1.00 64.03  ? 150 PRO B O     1 
ATOM   5698  C  CB    . PRO B  2  150 ? -3.728  -11.147 37.359  1.00 60.64  ? 150 PRO B CB    1 
ATOM   5699  C  CG    . PRO B  2  150 ? -4.032  -11.141 35.876  1.00 59.24  ? 150 PRO B CG    1 
ATOM   5700  C  CD    . PRO B  2  150 ? -3.699  -12.511 35.395  1.00 61.76  ? 150 PRO B CD    1 
ATOM   5701  N  N     . GLN B  2  151 ? -2.373  -12.926 39.841  1.00 66.47  ? 151 GLN B N     1 
ATOM   5702  C  CA    . GLN B  2  151 ? -2.763  -13.643 41.047  1.00 61.08  ? 151 GLN B CA    1 
ATOM   5703  C  C     . GLN B  2  151 ? -4.186  -13.267 41.440  1.00 54.65  ? 151 GLN B C     1 
ATOM   5704  O  O     . GLN B  2  151 ? -4.570  -12.095 41.393  1.00 51.90  ? 151 GLN B O     1 
ATOM   5705  C  CB    . GLN B  2  151 ? -1.800  -13.336 42.194  1.00 61.27  ? 151 GLN B CB    1 
ATOM   5706  C  CG    . GLN B  2  151 ? -0.502  -14.129 42.165  1.00 68.31  ? 151 GLN B CG    1 
ATOM   5707  C  CD    . GLN B  2  151 ? 0.386   -13.824 43.357  1.00 77.90  ? 151 GLN B CD    1 
ATOM   5708  O  OE1   . GLN B  2  151 ? 1.094   -14.696 43.860  1.00 77.20  ? 151 GLN B OE1   1 
ATOM   5709  N  NE2   . GLN B  2  151 ? 0.352   -12.578 43.815  1.00 77.75  ? 151 GLN B NE2   1 
ATOM   5710  N  N     . GLY B  2  152 ? -4.972  -14.269 41.828  1.00 54.47  ? 152 GLY B N     1 
ATOM   5711  C  CA    . GLY B  2  152 ? -6.334  -14.045 42.264  1.00 55.68  ? 152 GLY B CA    1 
ATOM   5712  C  C     . GLY B  2  152 ? -7.373  -13.980 41.166  1.00 50.96  ? 152 GLY B C     1 
ATOM   5713  O  O     . GLY B  2  152 ? -8.567  -13.870 41.477  1.00 64.82  ? 152 GLY B O     1 
ATOM   5714  N  N     . TRP B  2  153 ? -6.973  -14.015 39.899  1.00 66.70  ? 153 TRP B N     1 
ATOM   5715  C  CA    . TRP B  2  153 ? -7.926  -14.206 38.816  1.00 62.90  ? 153 TRP B CA    1 
ATOM   5716  C  C     . TRP B  2  153 ? -8.234  -15.692 38.652  1.00 68.27  ? 153 TRP B C     1 
ATOM   5717  O  O     . TRP B  2  153 ? -7.400  -16.555 38.941  1.00 71.66  ? 153 TRP B O     1 
ATOM   5718  C  CB    . TRP B  2  153 ? -7.371  -13.616 37.516  1.00 66.50  ? 153 TRP B CB    1 
ATOM   5719  C  CG    . TRP B  2  153 ? -8.216  -13.848 36.299  1.00 70.92  ? 153 TRP B CG    1 
ATOM   5720  C  CD1   . TRP B  2  153 ? -9.559  -13.641 36.178  1.00 69.14  ? 153 TRP B CD1   1 
ATOM   5721  C  CD2   . TRP B  2  153 ? -7.764  -14.306 35.018  1.00 72.51  ? 153 TRP B CD2   1 
ATOM   5722  N  NE1   . TRP B  2  153 ? -9.975  -13.958 34.907  1.00 67.50  ? 153 TRP B NE1   1 
ATOM   5723  C  CE2   . TRP B  2  153 ? -8.891  -14.367 34.175  1.00 67.76  ? 153 TRP B CE2   1 
ATOM   5724  C  CE3   . TRP B  2  153 ? -6.517  -14.676 34.504  1.00 76.64  ? 153 TRP B CE3   1 
ATOM   5725  C  CZ2   . TRP B  2  153 ? -8.810  -14.784 32.848  1.00 70.56  ? 153 TRP B CZ2   1 
ATOM   5726  C  CZ3   . TRP B  2  153 ? -6.438  -15.089 33.186  1.00 78.44  ? 153 TRP B CZ3   1 
ATOM   5727  C  CH2   . TRP B  2  153 ? -7.578  -15.138 32.373  1.00 76.33  ? 153 TRP B CH2   1 
ATOM   5728  N  N     . LYS B  2  154 ? -9.444  -15.990 38.175  1.00 73.02  ? 154 LYS B N     1 
ATOM   5729  C  CA    . LYS B  2  154 ? -9.856  -17.380 38.022  1.00 75.66  ? 154 LYS B CA    1 
ATOM   5730  C  C     . LYS B  2  154 ? -9.350  -18.011 36.733  1.00 75.64  ? 154 LYS B C     1 
ATOM   5731  O  O     . LYS B  2  154 ? -9.472  -19.230 36.568  1.00 76.37  ? 154 LYS B O     1 
ATOM   5732  C  CB    . LYS B  2  154 ? -11.383 -17.490 38.067  1.00 89.10  ? 154 LYS B CB    1 
ATOM   5733  C  CG    . LYS B  2  154 ? -11.989 -17.438 39.460  1.00 103.02 ? 154 LYS B CG    1 
ATOM   5734  C  CD    . LYS B  2  154 ? -12.571 -18.788 39.862  1.00 101.13 ? 154 LYS B CD    1 
ATOM   5735  C  CE    . LYS B  2  154 ? -13.240 -18.726 41.228  1.00 86.21  ? 154 LYS B CE    1 
ATOM   5736  N  NZ    . LYS B  2  154 ? -14.381 -17.770 41.243  1.00 81.79  ? 154 LYS B NZ    1 
ATOM   5737  N  N     . GLY B  2  155 ? -8.787  -17.215 35.821  1.00 74.83  ? 155 GLY B N     1 
ATOM   5738  C  CA    . GLY B  2  155 ? -8.137  -17.775 34.651  1.00 76.66  ? 155 GLY B CA    1 
ATOM   5739  C  C     . GLY B  2  155 ? -6.741  -18.289 34.918  1.00 80.47  ? 155 GLY B C     1 
ATOM   5740  O  O     . GLY B  2  155 ? -6.254  -19.164 34.194  1.00 86.25  ? 155 GLY B O     1 
ATOM   5741  N  N     . SER B  2  156 ? -6.073  -17.752 35.941  1.00 80.21  ? 156 SER B N     1 
ATOM   5742  C  CA    . SER B  2  156 ? -4.664  -18.078 36.160  1.00 77.10  ? 156 SER B CA    1 
ATOM   5743  C  C     . SER B  2  156 ? -4.438  -19.552 36.468  1.00 83.33  ? 156 SER B C     1 
ATOM   5744  O  O     . SER B  2  156 ? -3.532  -20.150 35.861  1.00 98.75  ? 156 SER B O     1 
ATOM   5745  C  CB    . SER B  2  156 ? -4.093  -17.180 37.263  1.00 71.82  ? 156 SER B CB    1 
ATOM   5746  O  OG    . SER B  2  156 ? -4.102  -15.818 36.873  1.00 76.12  ? 156 SER B OG    1 
ATOM   5747  N  N     . PRO B  2  157 ? -5.186  -20.201 37.370  1.00 79.30  ? 157 PRO B N     1 
ATOM   5748  C  CA    . PRO B  2  157 ? -4.973  -21.648 37.540  1.00 68.82  ? 157 PRO B CA    1 
ATOM   5749  C  C     . PRO B  2  157 ? -5.391  -22.451 36.323  1.00 74.86  ? 157 PRO B C     1 
ATOM   5750  O  O     . PRO B  2  157 ? -4.742  -23.451 35.994  1.00 78.31  ? 157 PRO B O     1 
ATOM   5751  C  CB    . PRO B  2  157 ? -5.822  -21.987 38.774  1.00 69.63  ? 157 PRO B CB    1 
ATOM   5752  C  CG    . PRO B  2  157 ? -6.866  -20.934 38.810  1.00 74.61  ? 157 PRO B CG    1 
ATOM   5753  C  CD    . PRO B  2  157 ? -6.190  -19.689 38.322  1.00 79.19  ? 157 PRO B CD    1 
ATOM   5754  N  N     . ALA B  2  158 ? -6.468  -22.042 35.646  1.00 72.09  ? 158 ALA B N     1 
ATOM   5755  C  CA    . ALA B  2  158 ? -6.983  -22.816 34.520  1.00 72.99  ? 158 ALA B CA    1 
ATOM   5756  C  C     . ALA B  2  158 ? -5.988  -22.845 33.365  1.00 77.68  ? 158 ALA B C     1 
ATOM   5757  O  O     . ALA B  2  158 ? -5.685  -23.914 32.822  1.00 88.18  ? 158 ALA B O     1 
ATOM   5758  C  CB    . ALA B  2  158 ? -8.327  -22.246 34.065  1.00 70.80  ? 158 ALA B CB    1 
ATOM   5759  N  N     . ILE B  2  159 ? -5.473  -21.677 32.973  1.00 72.96  ? 159 ILE B N     1 
ATOM   5760  C  CA    . ILE B  2  159 ? -4.504  -21.619 31.882  1.00 80.62  ? 159 ILE B CA    1 
ATOM   5761  C  C     . ILE B  2  159 ? -3.208  -22.315 32.279  1.00 85.03  ? 159 ILE B C     1 
ATOM   5762  O  O     . ILE B  2  159 ? -2.567  -22.980 31.456  1.00 97.65  ? 159 ILE B O     1 
ATOM   5763  C  CB    . ILE B  2  159 ? -4.262  -20.158 31.460  1.00 78.22  ? 159 ILE B CB    1 
ATOM   5764  C  CG1   . ILE B  2  159 ? -5.566  -19.526 30.968  1.00 76.51  ? 159 ILE B CG1   1 
ATOM   5765  C  CG2   . ILE B  2  159 ? -3.191  -20.077 30.380  1.00 75.92  ? 159 ILE B CG2   1 
ATOM   5766  C  CD1   . ILE B  2  159 ? -5.403  -18.122 30.434  1.00 67.95  ? 159 ILE B CD1   1 
ATOM   5767  N  N     . PHE B  2  160 ? -2.809  -22.188 33.543  1.00 72.49  ? 160 PHE B N     1 
ATOM   5768  C  CA    . PHE B  2  160 ? -1.561  -22.770 34.019  1.00 80.92  ? 160 PHE B CA    1 
ATOM   5769  C  C     . PHE B  2  160 ? -1.697  -24.248 34.366  1.00 85.33  ? 160 PHE B C     1 
ATOM   5770  O  O     . PHE B  2  160 ? -0.694  -24.879 34.713  1.00 87.80  ? 160 PHE B O     1 
ATOM   5771  C  CB    . PHE B  2  160 ? -1.069  -21.989 35.245  1.00 77.69  ? 160 PHE B CB    1 
ATOM   5772  C  CG    . PHE B  2  160 ? 0.365   -22.258 35.618  1.00 80.44  ? 160 PHE B CG    1 
ATOM   5773  C  CD1   . PHE B  2  160 ? 1.396   -21.627 34.946  1.00 80.91  ? 160 PHE B CD1   1 
ATOM   5774  C  CD2   . PHE B  2  160 ? 0.678   -23.117 36.659  1.00 80.97  ? 160 PHE B CD2   1 
ATOM   5775  C  CE1   . PHE B  2  160 ? 2.713   -21.862 35.288  1.00 81.65  ? 160 PHE B CE1   1 
ATOM   5776  C  CE2   . PHE B  2  160 ? 1.995   -23.359 37.004  1.00 83.15  ? 160 PHE B CE2   1 
ATOM   5777  C  CZ    . PHE B  2  160 ? 3.013   -22.728 36.318  1.00 80.52  ? 160 PHE B CZ    1 
ATOM   5778  N  N     . GLN B  2  161 ? -2.900  -24.819 34.252  1.00 85.71  ? 161 GLN B N     1 
ATOM   5779  C  CA    . GLN B  2  161 ? -3.096  -26.211 34.647  1.00 92.15  ? 161 GLN B CA    1 
ATOM   5780  C  C     . GLN B  2  161 ? -2.266  -27.149 33.780  1.00 104.48 ? 161 GLN B C     1 
ATOM   5781  O  O     . GLN B  2  161 ? -1.700  -28.130 34.278  1.00 111.11 ? 161 GLN B O     1 
ATOM   5782  C  CB    . GLN B  2  161 ? -4.577  -26.579 34.578  1.00 86.23  ? 161 GLN B CB    1 
ATOM   5783  C  CG    . GLN B  2  161 ? -4.907  -27.909 35.238  1.00 92.70  ? 161 GLN B CG    1 
ATOM   5784  C  CD    . GLN B  2  161 ? -6.391  -28.211 35.238  1.00 108.43 ? 161 GLN B CD    1 
ATOM   5785  O  OE1   . GLN B  2  161 ? -7.175  -27.523 34.588  1.00 115.44 ? 161 GLN B OE1   1 
ATOM   5786  N  NE2   . GLN B  2  161 ? -6.785  -29.245 35.974  1.00 111.63 ? 161 GLN B NE2   1 
ATOM   5787  N  N     . SER B  2  162 ? -2.202  -26.876 32.474  1.00 108.48 ? 162 SER B N     1 
ATOM   5788  C  CA    . SER B  2  162 ? -1.403  -27.707 31.578  1.00 110.37 ? 162 SER B CA    1 
ATOM   5789  C  C     . SER B  2  162 ? 0.060   -27.697 32.001  1.00 108.21 ? 162 SER B C     1 
ATOM   5790  O  O     . SER B  2  162 ? 0.712   -28.746 32.064  1.00 114.35 ? 162 SER B O     1 
ATOM   5791  C  CB    . SER B  2  162 ? -1.554  -27.222 30.135  1.00 119.23 ? 162 SER B CB    1 
ATOM   5792  O  OG    . SER B  2  162 ? -1.160  -25.867 30.006  1.00 127.54 ? 162 SER B OG    1 
ATOM   5793  N  N     . SER B  2  163 ? 0.598   -26.509 32.281  1.00 99.00  ? 163 SER B N     1 
ATOM   5794  C  CA    . SER B  2  163 ? 1.947   -26.415 32.827  1.00 96.78  ? 163 SER B CA    1 
ATOM   5795  C  C     . SER B  2  163 ? 2.021   -27.037 34.217  1.00 95.79  ? 163 SER B C     1 
ATOM   5796  O  O     . SER B  2  163 ? 3.001   -27.715 34.547  1.00 95.36  ? 163 SER B O     1 
ATOM   5797  C  CB    . SER B  2  163 ? 2.390   -24.952 32.870  1.00 98.05  ? 163 SER B CB    1 
ATOM   5798  O  OG    . SER B  2  163 ? 2.079   -24.288 31.657  1.00 105.99 ? 163 SER B OG    1 
ATOM   5799  N  N     . MET B  2  164 ? 0.997   -26.809 35.045  1.00 98.64  ? 164 MET B N     1 
ATOM   5800  C  CA    . MET B  2  164 ? 1.043   -27.242 36.439  1.00 95.25  ? 164 MET B CA    1 
ATOM   5801  C  C     . MET B  2  164 ? 1.163   -28.757 36.556  1.00 94.72  ? 164 MET B C     1 
ATOM   5802  O  O     . MET B  2  164 ? 1.959   -29.268 37.352  1.00 87.69  ? 164 MET B O     1 
ATOM   5803  C  CB    . MET B  2  164 ? -0.203  -26.750 37.178  1.00 86.99  ? 164 MET B CB    1 
ATOM   5804  C  CG    . MET B  2  164 ? -0.202  -27.056 38.664  1.00 87.95  ? 164 MET B CG    1 
ATOM   5805  S  SD    . MET B  2  164 ? 0.963   -26.013 39.558  1.00 102.20 ? 164 MET B SD    1 
ATOM   5806  C  CE    . MET B  2  164 ? 1.317   -27.045 40.976  1.00 98.40  ? 164 MET B CE    1 
ATOM   5807  N  N     . THR B  2  165 ? 0.367   -29.495 35.776  1.00 98.22  ? 165 THR B N     1 
ATOM   5808  C  CA    . THR B  2  165 ? 0.338   -30.949 35.918  1.00 100.42 ? 165 THR B CA    1 
ATOM   5809  C  C     . THR B  2  165 ? 1.682   -31.567 35.549  1.00 103.15 ? 165 THR B C     1 
ATOM   5810  O  O     . THR B  2  165 ? 2.111   -32.550 36.166  1.00 104.60 ? 165 THR B O     1 
ATOM   5811  C  CB    . THR B  2  165 ? -0.794  -31.551 35.081  1.00 99.95  ? 165 THR B CB    1 
ATOM   5812  O  OG1   . THR B  2  165 ? -0.798  -32.976 35.234  1.00 102.31 ? 165 THR B OG1   1 
ATOM   5813  C  CG2   . THR B  2  165 ? -0.645  -31.201 33.606  1.00 106.81 ? 165 THR B CG2   1 
ATOM   5814  N  N     . LYS B  2  166 ? 2.353   -31.017 34.534  1.00 100.88 ? 166 LYS B N     1 
ATOM   5815  C  CA    . LYS B  2  166 ? 3.660   -31.534 34.142  1.00 104.75 ? 166 LYS B CA    1 
ATOM   5816  C  C     . LYS B  2  166 ? 4.666   -31.393 35.278  1.00 106.83 ? 166 LYS B C     1 
ATOM   5817  O  O     . LYS B  2  166 ? 5.451   -32.311 35.539  1.00 114.12 ? 166 LYS B O     1 
ATOM   5818  C  CB    . LYS B  2  166 ? 4.147   -30.820 32.882  1.00 102.87 ? 166 LYS B CB    1 
ATOM   5819  C  CG    . LYS B  2  166 ? 3.157   -30.900 31.730  1.00 101.62 ? 166 LYS B CG    1 
ATOM   5820  C  CD    . LYS B  2  166 ? 3.750   -30.389 30.429  1.00 107.02 ? 166 LYS B CD    1 
ATOM   5821  C  CE    . LYS B  2  166 ? 2.743   -30.505 29.296  1.00 112.66 ? 166 LYS B CE    1 
ATOM   5822  N  NZ    . LYS B  2  166 ? 3.350   -30.196 27.971  1.00 114.74 ? 166 LYS B NZ    1 
ATOM   5823  N  N     . ILE B  2  167 ? 4.661   -30.245 35.961  1.00 100.59 ? 167 ILE B N     1 
ATOM   5824  C  CA    . ILE B  2  167 ? 5.521   -30.070 37.128  1.00 95.99  ? 167 ILE B CA    1 
ATOM   5825  C  C     . ILE B  2  167 ? 5.108   -31.031 38.234  1.00 94.44  ? 167 ILE B C     1 
ATOM   5826  O  O     . ILE B  2  167 ? 5.954   -31.611 38.926  1.00 89.58  ? 167 ILE B O     1 
ATOM   5827  C  CB    . ILE B  2  167 ? 5.475   -28.608 37.609  1.00 89.66  ? 167 ILE B CB    1 
ATOM   5828  C  CG1   . ILE B  2  167 ? 5.609   -27.649 36.425  1.00 93.22  ? 167 ILE B CG1   1 
ATOM   5829  C  CG2   . ILE B  2  167 ? 6.570   -28.348 38.632  1.00 88.97  ? 167 ILE B CG2   1 
ATOM   5830  C  CD1   . ILE B  2  167 ? 5.195   -26.228 36.746  1.00 95.84  ? 167 ILE B CD1   1 
ATOM   5831  N  N     . LEU B  2  168 ? 3.798   -31.208 38.421  1.00 98.66  ? 168 LEU B N     1 
ATOM   5832  C  CA    . LEU B  2  168 ? 3.293   -32.146 39.419  1.00 101.75 ? 168 LEU B CA    1 
ATOM   5833  C  C     . LEU B  2  168 ? 3.633   -33.589 39.070  1.00 102.67 ? 168 LEU B C     1 
ATOM   5834  O  O     . LEU B  2  168 ? 3.858   -34.402 39.975  1.00 99.81  ? 168 LEU B O     1 
ATOM   5835  C  CB    . LEU B  2  168 ? 1.783   -31.980 39.577  1.00 102.05 ? 168 LEU B CB    1 
ATOM   5836  C  CG    . LEU B  2  168 ? 1.342   -30.677 40.243  1.00 100.31 ? 168 LEU B CG    1 
ATOM   5837  C  CD1   . LEU B  2  168 ? -0.169  -30.534 40.200  1.00 100.11 ? 168 LEU B CD1   1 
ATOM   5838  C  CD2   . LEU B  2  168 ? 1.850   -30.621 41.675  1.00 94.98  ? 168 LEU B CD2   1 
ATOM   5839  N  N     . GLU B  2  169 ? 3.659   -33.925 37.779  1.00 111.77 ? 169 GLU B N     1 
ATOM   5840  C  CA    . GLU B  2  169 ? 3.620   -35.328 37.368  1.00 113.85 ? 169 GLU B CA    1 
ATOM   5841  C  C     . GLU B  2  169 ? 4.718   -36.192 37.983  1.00 114.42 ? 169 GLU B C     1 
ATOM   5842  O  O     . GLU B  2  169 ? 4.418   -37.343 38.344  1.00 115.67 ? 169 GLU B O     1 
ATOM   5843  C  CB    . GLU B  2  169 ? 3.659   -35.415 35.837  1.00 117.68 ? 169 GLU B CB    1 
ATOM   5844  C  CG    . GLU B  2  169 ? 3.436   -36.815 35.275  1.00 128.74 ? 169 GLU B CG    1 
ATOM   5845  C  CD    . GLU B  2  169 ? 2.048   -37.360 35.573  1.00 136.03 ? 169 GLU B CD    1 
ATOM   5846  O  OE1   . GLU B  2  169 ? 1.800   -37.790 36.720  1.00 131.69 ? 169 GLU B OE1   1 
ATOM   5847  O  OE2   . GLU B  2  169 ? 1.201   -37.357 34.656  1.00 143.53 ? 169 GLU B OE2   1 
ATOM   5848  N  N     . PRO B  2  170 ? 5.973   -35.742 38.127  1.00 115.02 ? 170 PRO B N     1 
ATOM   5849  C  CA    . PRO B  2  170 ? 6.959   -36.605 38.804  1.00 114.93 ? 170 PRO B CA    1 
ATOM   5850  C  C     . PRO B  2  170 ? 6.583   -36.897 40.247  1.00 110.43 ? 170 PRO B C     1 
ATOM   5851  O  O     . PRO B  2  170 ? 6.642   -38.054 40.684  1.00 113.10 ? 170 PRO B O     1 
ATOM   5852  C  CB    . PRO B  2  170 ? 8.262   -35.802 38.693  1.00 119.30 ? 170 PRO B CB    1 
ATOM   5853  C  CG    . PRO B  2  170 ? 8.068   -34.936 37.507  1.00 120.28 ? 170 PRO B CG    1 
ATOM   5854  C  CD    . PRO B  2  170 ? 6.619   -34.562 37.522  1.00 117.81 ? 170 PRO B CD    1 
ATOM   5855  N  N     . PHE B  2  171 ? 6.206   -35.865 41.006  1.00 110.88 ? 171 PHE B N     1 
ATOM   5856  C  CA    . PHE B  2  171 ? 5.891   -36.049 42.419  1.00 106.53 ? 171 PHE B CA    1 
ATOM   5857  C  C     . PHE B  2  171 ? 4.650   -36.916 42.602  1.00 100.60 ? 171 PHE B C     1 
ATOM   5858  O  O     . PHE B  2  171 ? 4.596   -37.748 43.515  1.00 92.89  ? 171 PHE B O     1 
ATOM   5859  C  CB    . PHE B  2  171 ? 5.703   -34.687 43.091  1.00 103.92 ? 171 PHE B CB    1 
ATOM   5860  C  CG    . PHE B  2  171 ? 5.551   -34.758 44.586  1.00 109.07 ? 171 PHE B CG    1 
ATOM   5861  C  CD1   . PHE B  2  171 ? 6.660   -34.677 45.412  1.00 117.46 ? 171 PHE B CD1   1 
ATOM   5862  C  CD2   . PHE B  2  171 ? 4.300   -34.895 45.165  1.00 105.68 ? 171 PHE B CD2   1 
ATOM   5863  C  CE1   . PHE B  2  171 ? 6.524   -34.738 46.788  1.00 117.72 ? 171 PHE B CE1   1 
ATOM   5864  C  CE2   . PHE B  2  171 ? 4.157   -34.957 46.539  1.00 106.42 ? 171 PHE B CE2   1 
ATOM   5865  C  CZ    . PHE B  2  171 ? 5.271   -34.878 47.351  1.00 112.37 ? 171 PHE B CZ    1 
ATOM   5866  N  N     . LYS B  2  172 ? 3.637   -36.722 41.752  1.00 100.93 ? 172 LYS B N     1 
ATOM   5867  C  CA    . LYS B  2  172 ? 2.435   -37.550 41.818  1.00 98.97  ? 172 LYS B CA    1 
ATOM   5868  C  C     . LYS B  2  172 ? 2.759   -39.030 41.648  1.00 100.35 ? 172 LYS B C     1 
ATOM   5869  O  O     . LYS B  2  172 ? 2.130   -39.885 42.283  1.00 93.47  ? 172 LYS B O     1 
ATOM   5870  C  CB    . LYS B  2  172 ? 1.426   -37.097 40.763  1.00 99.48  ? 172 LYS B CB    1 
ATOM   5871  C  CG    . LYS B  2  172 ? 0.563   -35.924 41.196  1.00 96.87  ? 172 LYS B CG    1 
ATOM   5872  C  CD    . LYS B  2  172 ? -0.285  -35.408 40.046  1.00 103.80 ? 172 LYS B CD    1 
ATOM   5873  C  CE    . LYS B  2  172 ? -1.213  -34.367 40.477  1.00 112.90 ? 172 LYS B CE    1 
ATOM   5874  N  NZ    . LYS B  2  172 ? -1.913  -33.604 39.645  1.00 117.23 ? 172 LYS B NZ    1 
ATOM   5875  N  N     . LYS B  2  173 ? 3.733   -39.355 40.797  1.00 102.57 ? 173 LYS B N     1 
ATOM   5876  C  CA    . LYS B  2  173 ? 4.074   -40.756 40.576  1.00 113.80 ? 173 LYS B CA    1 
ATOM   5877  C  C     . LYS B  2  173 ? 4.974   -41.309 41.674  1.00 110.68 ? 173 LYS B C     1 
ATOM   5878  O  O     . LYS B  2  173 ? 4.960   -42.519 41.928  1.00 108.21 ? 173 LYS B O     1 
ATOM   5879  C  CB    . LYS B  2  173 ? 4.739   -40.932 39.209  1.00 126.68 ? 173 LYS B CB    1 
ATOM   5880  C  CG    . LYS B  2  173 ? 3.895   -40.444 38.037  1.00 133.83 ? 173 LYS B CG    1 
ATOM   5881  C  CD    . LYS B  2  173 ? 2.481   -41.005 38.084  1.00 135.55 ? 173 LYS B CD    1 
ATOM   5882  C  CE    . LYS B  2  173 ? 2.464   -42.504 37.838  1.00 136.19 ? 173 LYS B CE    1 
ATOM   5883  N  NZ    . LYS B  2  173 ? 2.981   -42.838 36.484  1.00 133.90 ? 173 LYS B NZ    1 
ATOM   5884  N  N     . GLN B  2  174 ? 5.764   -40.454 42.327  1.00 110.15 ? 174 GLN B N     1 
ATOM   5885  C  CA    . GLN B  2  174 ? 6.582   -40.904 43.446  1.00 117.62 ? 174 GLN B CA    1 
ATOM   5886  C  C     . GLN B  2  174 ? 5.779   -41.054 44.730  1.00 120.31 ? 174 GLN B C     1 
ATOM   5887  O  O     . GLN B  2  174 ? 6.231   -41.742 45.652  1.00 116.80 ? 174 GLN B O     1 
ATOM   5888  C  CB    . GLN B  2  174 ? 7.737   -39.928 43.678  1.00 125.83 ? 174 GLN B CB    1 
ATOM   5889  C  CG    . GLN B  2  174 ? 8.676   -39.777 42.494  1.00 136.66 ? 174 GLN B CG    1 
ATOM   5890  C  CD    . GLN B  2  174 ? 9.655   -38.634 42.674  1.00 140.73 ? 174 GLN B CD    1 
ATOM   5891  O  OE1   . GLN B  2  174 ? 9.539   -37.844 43.611  1.00 138.46 ? 174 GLN B OE1   1 
ATOM   5892  N  NE2   . GLN B  2  174 ? 10.627  -38.540 41.775  1.00 141.14 ? 174 GLN B NE2   1 
ATOM   5893  N  N     . ASN B  2  175 ? 4.608   -40.426 44.807  1.00 108.32 ? 175 ASN B N     1 
ATOM   5894  C  CA    . ASN B  2  175 ? 3.723   -40.524 45.968  1.00 101.48 ? 175 ASN B CA    1 
ATOM   5895  C  C     . ASN B  2  175 ? 2.296   -40.652 45.458  1.00 97.18  ? 175 ASN B C     1 
ATOM   5896  O  O     . ASN B  2  175 ? 1.510   -39.697 45.504  1.00 101.22 ? 175 ASN B O     1 
ATOM   5897  C  CB    . ASN B  2  175 ? 3.886   -39.315 46.892  1.00 100.17 ? 175 ASN B CB    1 
ATOM   5898  C  CG    . ASN B  2  175 ? 5.294   -39.187 47.439  1.00 106.99 ? 175 ASN B CG    1 
ATOM   5899  O  OD1   . ASN B  2  175 ? 5.620   -39.748 48.485  1.00 112.68 ? 175 ASN B OD1   1 
ATOM   5900  N  ND2   . ASN B  2  175 ? 6.140   -38.449 46.730  1.00 97.85  ? 175 ASN B ND2   1 
ATOM   5901  N  N     . PRO B  2  176 ? 1.925   -41.832 44.951  1.00 91.13  ? 176 PRO B N     1 
ATOM   5902  C  CA    . PRO B  2  176 ? 0.638   -41.964 44.247  1.00 90.30  ? 176 PRO B CA    1 
ATOM   5903  C  C     . PRO B  2  176 ? -0.594  -41.785 45.122  1.00 97.18  ? 176 PRO B C     1 
ATOM   5904  O  O     . PRO B  2  176 ? -1.685  -41.583 44.572  1.00 93.56  ? 176 PRO B O     1 
ATOM   5905  C  CB    . PRO B  2  176 ? 0.703   -43.383 43.668  1.00 83.49  ? 176 PRO B CB    1 
ATOM   5906  C  CG    . PRO B  2  176 ? 1.621   -44.114 44.589  1.00 85.29  ? 176 PRO B CG    1 
ATOM   5907  C  CD    . PRO B  2  176 ? 2.652   -43.111 45.026  1.00 84.95  ? 176 PRO B CD    1 
ATOM   5908  N  N     . ASP B  2  177 ? -0.475  -41.848 46.447  1.00 95.63  ? 177 ASP B N     1 
ATOM   5909  C  CA    . ASP B  2  177 ? -1.634  -41.703 47.319  1.00 95.33  ? 177 ASP B CA    1 
ATOM   5910  C  C     . ASP B  2  177 ? -1.762  -40.319 47.945  1.00 92.74  ? 177 ASP B C     1 
ATOM   5911  O  O     . ASP B  2  177 ? -2.741  -40.068 48.656  1.00 89.63  ? 177 ASP B O     1 
ATOM   5912  C  CB    . ASP B  2  177 ? -1.596  -42.768 48.421  1.00 102.78 ? 177 ASP B CB    1 
ATOM   5913  C  CG    . ASP B  2  177 ? -0.294  -42.759 49.198  1.00 117.75 ? 177 ASP B CG    1 
ATOM   5914  O  OD1   . ASP B  2  177 ? 0.687   -42.156 48.715  1.00 118.03 ? 177 ASP B OD1   1 
ATOM   5915  O  OD2   . ASP B  2  177 ? -0.252  -43.364 50.291  1.00 127.12 ? 177 ASP B OD2   1 
ATOM   5916  N  N     . ILE B  2  178 ? -0.818  -39.417 47.699  1.00 89.99  ? 178 ILE B N     1 
ATOM   5917  C  CA    . ILE B  2  178 ? -0.931  -38.048 48.191  1.00 82.55  ? 178 ILE B CA    1 
ATOM   5918  C  C     . ILE B  2  178 ? -1.870  -37.279 47.269  1.00 80.32  ? 178 ILE B C     1 
ATOM   5919  O  O     . ILE B  2  178 ? -1.643  -37.206 46.057  1.00 91.42  ? 178 ILE B O     1 
ATOM   5920  C  CB    . ILE B  2  178 ? 0.443   -37.371 48.278  1.00 76.46  ? 178 ILE B CB    1 
ATOM   5921  C  CG1   . ILE B  2  178 ? 1.261   -37.977 49.421  1.00 81.48  ? 178 ILE B CG1   1 
ATOM   5922  C  CG2   . ILE B  2  178 ? 0.290   -35.869 48.469  1.00 68.56  ? 178 ILE B CG2   1 
ATOM   5923  C  CD1   . ILE B  2  178 ? 2.594   -37.297 49.650  1.00 92.10  ? 178 ILE B CD1   1 
ATOM   5924  N  N     . VAL B  2  179 ? -2.926  -36.706 47.839  1.00 74.69  ? 179 VAL B N     1 
ATOM   5925  C  CA    . VAL B  2  179 ? -3.934  -35.997 47.060  1.00 77.27  ? 179 VAL B CA    1 
ATOM   5926  C  C     . VAL B  2  179 ? -3.524  -34.538 46.936  1.00 77.75  ? 179 VAL B C     1 
ATOM   5927  O  O     . VAL B  2  179 ? -3.079  -33.913 47.907  1.00 71.07  ? 179 VAL B O     1 
ATOM   5928  C  CB    . VAL B  2  179 ? -5.325  -36.138 47.708  1.00 80.44  ? 179 VAL B CB    1 
ATOM   5929  C  CG1   . VAL B  2  179 ? -6.333  -35.223 47.029  1.00 75.96  ? 179 VAL B CG1   1 
ATOM   5930  C  CG2   . VAL B  2  179 ? -5.792  -37.584 47.644  1.00 82.87  ? 179 VAL B CG2   1 
ATOM   5931  N  N     . ILE B  2  180 ? -3.667  -33.993 45.729  1.00 77.05  ? 180 ILE B N     1 
ATOM   5932  C  CA    . ILE B  2  180 ? -3.256  -32.631 45.412  1.00 68.13  ? 180 ILE B CA    1 
ATOM   5933  C  C     . ILE B  2  180 ? -4.399  -31.943 44.681  1.00 69.11  ? 180 ILE B C     1 
ATOM   5934  O  O     . ILE B  2  180 ? -4.958  -32.500 43.730  1.00 76.89  ? 180 ILE B O     1 
ATOM   5935  C  CB    . ILE B  2  180 ? -1.972  -32.598 44.561  1.00 69.99  ? 180 ILE B CB    1 
ATOM   5936  C  CG1   . ILE B  2  180 ? -0.781  -33.124 45.367  1.00 61.51  ? 180 ILE B CG1   1 
ATOM   5937  C  CG2   . ILE B  2  180 ? -1.699  -31.189 44.057  1.00 77.41  ? 180 ILE B CG2   1 
ATOM   5938  C  CD1   . ILE B  2  180 ? 0.544   -33.010 44.645  1.00 64.21  ? 180 ILE B CD1   1 
ATOM   5939  N  N     . TYR B  2  181 ? -4.742  -30.734 45.120  1.00 67.51  ? 181 TYR B N     1 
ATOM   5940  C  CA    . TYR B  2  181 ? -5.847  -29.987 44.542  1.00 61.13  ? 181 TYR B CA    1 
ATOM   5941  C  C     . TYR B  2  181 ? -5.428  -28.532 44.402  1.00 67.95  ? 181 TYR B C     1 
ATOM   5942  O  O     . TYR B  2  181 ? -4.668  -28.007 45.220  1.00 80.35  ? 181 TYR B O     1 
ATOM   5943  C  CB    . TYR B  2  181 ? -7.118  -30.102 45.397  1.00 53.85  ? 181 TYR B CB    1 
ATOM   5944  C  CG    . TYR B  2  181 ? -8.256  -29.213 44.944  1.00 53.90  ? 181 TYR B CG    1 
ATOM   5945  C  CD1   . TYR B  2  181 ? -8.743  -29.281 43.646  1.00 49.40  ? 181 TYR B CD1   1 
ATOM   5946  C  CD2   . TYR B  2  181 ? -8.852  -28.316 45.821  1.00 50.78  ? 181 TYR B CD2   1 
ATOM   5947  C  CE1   . TYR B  2  181 ? -9.784  -28.472 43.230  1.00 57.59  ? 181 TYR B CE1   1 
ATOM   5948  C  CE2   . TYR B  2  181 ? -9.893  -27.506 45.416  1.00 57.21  ? 181 TYR B CE2   1 
ATOM   5949  C  CZ    . TYR B  2  181 ? -10.355 -27.587 44.121  1.00 60.86  ? 181 TYR B CZ    1 
ATOM   5950  O  OH    . TYR B  2  181 ? -11.393 -26.778 43.721  1.00 65.63  ? 181 TYR B OH    1 
ATOM   5951  N  N     . GLN B  2  182 ? -5.934  -27.886 43.355  1.00 61.89  ? 182 GLN B N     1 
ATOM   5952  C  CA    . GLN B  2  182 ? -5.576  -26.513 43.027  1.00 60.66  ? 182 GLN B CA    1 
ATOM   5953  C  C     . GLN B  2  182 ? -6.826  -25.646 43.066  1.00 63.23  ? 182 GLN B C     1 
ATOM   5954  O  O     . GLN B  2  182 ? -7.740  -25.835 42.256  1.00 64.11  ? 182 GLN B O     1 
ATOM   5955  C  CB    . GLN B  2  182 ? -4.914  -26.448 41.649  1.00 61.80  ? 182 GLN B CB    1 
ATOM   5956  C  CG    . GLN B  2  182 ? -4.162  -25.164 41.365  1.00 73.82  ? 182 GLN B CG    1 
ATOM   5957  C  CD    . GLN B  2  182 ? -3.462  -25.197 40.021  1.00 90.29  ? 182 GLN B CD    1 
ATOM   5958  O  OE1   . GLN B  2  182 ? -3.701  -26.090 39.207  1.00 91.29  ? 182 GLN B OE1   1 
ATOM   5959  N  NE2   . GLN B  2  182 ? -2.589  -24.226 39.783  1.00 96.35  ? 182 GLN B NE2   1 
ATOM   5960  N  N     . TYR B  2  183 ? -6.862  -24.697 43.998  1.00 56.95  ? 183 TYR B N     1 
ATOM   5961  C  CA    . TYR B  2  183 ? -7.881  -23.655 44.016  1.00 55.18  ? 183 TYR B CA    1 
ATOM   5962  C  C     . TYR B  2  183 ? -7.202  -22.294 44.004  1.00 57.44  ? 183 TYR B C     1 
ATOM   5963  O  O     . TYR B  2  183 ? -6.463  -21.959 44.937  1.00 61.34  ? 183 TYR B O     1 
ATOM   5964  C  CB    . TYR B  2  183 ? -8.811  -23.776 45.223  1.00 51.05  ? 183 TYR B CB    1 
ATOM   5965  C  CG    . TYR B  2  183 ? -10.019 -22.873 45.098  1.00 47.45  ? 183 TYR B CG    1 
ATOM   5966  C  CD1   . TYR B  2  183 ? -11.085 -23.222 44.280  1.00 49.67  ? 183 TYR B CD1   1 
ATOM   5967  C  CD2   . TYR B  2  183 ? -10.082 -21.661 45.773  1.00 58.32  ? 183 TYR B CD2   1 
ATOM   5968  C  CE1   . TYR B  2  183 ? -12.186 -22.399 44.148  1.00 53.07  ? 183 TYR B CE1   1 
ATOM   5969  C  CE2   . TYR B  2  183 ? -11.183 -20.831 45.650  1.00 64.30  ? 183 TYR B CE2   1 
ATOM   5970  C  CZ    . TYR B  2  183 ? -12.231 -21.205 44.833  1.00 59.21  ? 183 TYR B CZ    1 
ATOM   5971  O  OH    . TYR B  2  183 ? -13.328 -20.387 44.697  1.00 72.55  ? 183 TYR B OH    1 
ATOM   5972  N  N     . MET B  2  184 ? -7.475  -21.514 42.960  1.00 56.70  ? 184 MET B N     1 
ATOM   5973  C  CA    . MET B  2  184 ? -6.926  -20.169 42.742  1.00 64.71  ? 184 MET B CA    1 
ATOM   5974  C  C     . MET B  2  184 ? -5.414  -20.200 42.972  1.00 70.56  ? 184 MET B C     1 
ATOM   5975  O  O     . MET B  2  184 ? -4.741  -21.105 42.460  1.00 79.15  ? 184 MET B O     1 
ATOM   5976  C  CB    . MET B  2  184 ? -7.697  -19.201 43.628  1.00 63.43  ? 184 MET B CB    1 
ATOM   5977  C  CG    . MET B  2  184 ? -9.192  -19.201 43.389  1.00 74.35  ? 184 MET B CG    1 
ATOM   5978  S  SD    . MET B  2  184 ? -9.583  -18.570 41.757  1.00 92.21  ? 184 MET B SD    1 
ATOM   5979  C  CE    . MET B  2  184 ? -8.742  -16.997 41.835  1.00 101.59 ? 184 MET B CE    1 
ATOM   5980  N  N     . ASP B  2  185 ? -4.849  -19.256 43.726  1.00 66.59  ? 185 ASP B N     1 
ATOM   5981  C  CA    . ASP B  2  185 ? -3.415  -19.161 43.973  1.00 59.66  ? 185 ASP B CA    1 
ATOM   5982  C  C     . ASP B  2  185 ? -2.885  -20.240 44.907  1.00 65.65  ? 185 ASP B C     1 
ATOM   5983  O  O     . ASP B  2  185 ? -1.679  -20.248 45.179  1.00 73.02  ? 185 ASP B O     1 
ATOM   5984  C  CB    . ASP B  2  185 ? -3.070  -17.782 44.540  1.00 60.90  ? 185 ASP B CB    1 
ATOM   5985  C  CG    . ASP B  2  185 ? -3.601  -16.649 43.685  1.00 61.37  ? 185 ASP B CG    1 
ATOM   5986  O  OD1   . ASP B  2  185 ? -4.097  -16.923 42.572  1.00 61.07  ? 185 ASP B OD1   1 
ATOM   5987  O  OD2   . ASP B  2  185 ? -3.516  -15.482 44.123  1.00 62.47  ? 185 ASP B OD2   1 
ATOM   5988  N  N     . ASP B  2  186 ? -3.725  -21.145 45.402  1.00 57.13  ? 186 ASP B N     1 
ATOM   5989  C  CA    . ASP B  2  186 ? -3.312  -22.076 46.438  1.00 61.14  ? 186 ASP B CA    1 
ATOM   5990  C  C     . ASP B  2  186 ? -3.221  -23.500 45.904  1.00 63.46  ? 186 ASP B C     1 
ATOM   5991  O  O     . ASP B  2  186 ? -3.941  -23.889 44.980  1.00 63.52  ? 186 ASP B O     1 
ATOM   5992  C  CB    . ASP B  2  186 ? -4.290  -22.032 47.618  1.00 68.19  ? 186 ASP B CB    1 
ATOM   5993  C  CG    . ASP B  2  186 ? -4.397  -20.650 48.237  1.00 77.91  ? 186 ASP B CG    1 
ATOM   5994  O  OD1   . ASP B  2  186 ? -3.350  -19.990 48.401  1.00 76.47  ? 186 ASP B OD1   1 
ATOM   5995  O  OD2   . ASP B  2  186 ? -5.528  -20.226 48.557  1.00 80.10  ? 186 ASP B OD2   1 
ATOM   5996  N  N     . LEU B  2  187 ? -2.316  -24.272 46.505  1.00 69.01  ? 187 LEU B N     1 
ATOM   5997  C  CA    . LEU B  2  187 ? -2.177  -25.701 46.255  1.00 67.01  ? 187 LEU B CA    1 
ATOM   5998  C  C     . LEU B  2  187 ? -2.489  -26.445 47.546  1.00 73.01  ? 187 LEU B C     1 
ATOM   5999  O  O     . LEU B  2  187 ? -1.811  -26.241 48.559  1.00 81.07  ? 187 LEU B O     1 
ATOM   6000  C  CB    . LEU B  2  187 ? -0.765  -26.030 45.766  1.00 61.27  ? 187 LEU B CB    1 
ATOM   6001  C  CG    . LEU B  2  187 ? -0.600  -27.202 44.801  1.00 61.49  ? 187 LEU B CG    1 
ATOM   6002  C  CD1   . LEU B  2  187 ? -1.356  -26.935 43.509  1.00 60.77  ? 187 LEU B CD1   1 
ATOM   6003  C  CD2   . LEU B  2  187 ? 0.874   -27.441 44.527  1.00 64.54  ? 187 LEU B CD2   1 
ATOM   6004  N  N     . TYR B  2  188 ? -3.503  -27.304 47.511  1.00 64.51  ? 188 TYR B N     1 
ATOM   6005  C  CA    . TYR B  2  188 ? -3.888  -28.108 48.665  1.00 54.46  ? 188 TYR B CA    1 
ATOM   6006  C  C     . TYR B  2  188 ? -3.297  -29.508 48.533  1.00 58.40  ? 188 TYR B C     1 
ATOM   6007  O  O     . TYR B  2  188 ? -3.560  -30.208 47.550  1.00 65.03  ? 188 TYR B O     1 
ATOM   6008  C  CB    . TYR B  2  188 ? -5.409  -28.161 48.798  1.00 58.42  ? 188 TYR B CB    1 
ATOM   6009  C  CG    . TYR B  2  188 ? -6.033  -26.812 49.088  1.00 54.92  ? 188 TYR B CG    1 
ATOM   6010  C  CD1   . TYR B  2  188 ? -6.399  -26.458 50.380  1.00 52.33  ? 188 TYR B CD1   1 
ATOM   6011  C  CD2   . TYR B  2  188 ? -6.248  -25.888 48.071  1.00 58.35  ? 188 TYR B CD2   1 
ATOM   6012  C  CE1   . TYR B  2  188 ? -6.968  -25.227 50.651  1.00 55.09  ? 188 TYR B CE1   1 
ATOM   6013  C  CE2   . TYR B  2  188 ? -6.814  -24.653 48.333  1.00 59.79  ? 188 TYR B CE2   1 
ATOM   6014  C  CZ    . TYR B  2  188 ? -7.172  -24.328 49.625  1.00 62.24  ? 188 TYR B CZ    1 
ATOM   6015  O  OH    . TYR B  2  188 ? -7.736  -23.102 49.892  1.00 59.52  ? 188 TYR B OH    1 
ATOM   6016  N  N     . VAL B  2  189 ? -2.509  -29.912 49.528  1.00 58.40  ? 189 VAL B N     1 
ATOM   6017  C  CA    . VAL B  2  189 ? -1.728  -31.146 49.490  1.00 63.73  ? 189 VAL B CA    1 
ATOM   6018  C  C     . VAL B  2  189 ? -2.085  -31.950 50.734  1.00 66.45  ? 189 VAL B C     1 
ATOM   6019  O  O     . VAL B  2  189 ? -1.678  -31.591 51.846  1.00 70.49  ? 189 VAL B O     1 
ATOM   6020  C  CB    . VAL B  2  189 ? -0.219  -30.877 49.430  1.00 63.07  ? 189 VAL B CB    1 
ATOM   6021  C  CG1   . VAL B  2  189 ? 0.545   -32.172 49.197  1.00 63.08  ? 189 VAL B CG1   1 
ATOM   6022  C  CG2   . VAL B  2  189 ? 0.099   -29.856 48.348  1.00 62.28  ? 189 VAL B CG2   1 
ATOM   6023  N  N     . GLY B  2  190 ? -2.840  -33.032 50.553  1.00 64.25  ? 190 GLY B N     1 
ATOM   6024  C  CA    . GLY B  2  190 ? -3.271  -33.877 51.652  1.00 69.86  ? 190 GLY B CA    1 
ATOM   6025  C  C     . GLY B  2  190 ? -2.610  -35.244 51.653  1.00 69.29  ? 190 GLY B C     1 
ATOM   6026  O  O     . GLY B  2  190 ? -2.250  -35.776 50.601  1.00 74.28  ? 190 GLY B O     1 
ATOM   6027  N  N     . SER B  2  191 ? -2.443  -35.803 52.851  1.00 68.34  ? 191 SER B N     1 
ATOM   6028  C  CA    . SER B  2  191 ? -1.831  -37.114 53.034  1.00 72.55  ? 191 SER B CA    1 
ATOM   6029  C  C     . SER B  2  191 ? -2.263  -37.667 54.385  1.00 80.46  ? 191 SER B C     1 
ATOM   6030  O  O     . SER B  2  191 ? -2.645  -36.917 55.287  1.00 89.30  ? 191 SER B O     1 
ATOM   6031  C  CB    . SER B  2  191 ? -0.302  -37.047 52.945  1.00 81.40  ? 191 SER B CB    1 
ATOM   6032  O  OG    . SER B  2  191 ? 0.247   -36.388 54.074  1.00 77.77  ? 191 SER B OG    1 
ATOM   6033  N  N     . ASP B  2  192 ? -2.194  -38.993 54.515  1.00 84.80  ? 192 ASP B N     1 
ATOM   6034  C  CA    . ASP B  2  192 ? -2.438  -39.667 55.785  1.00 87.15  ? 192 ASP B CA    1 
ATOM   6035  C  C     . ASP B  2  192 ? -1.154  -40.006 56.532  1.00 91.16  ? 192 ASP B C     1 
ATOM   6036  O  O     . ASP B  2  192 ? -1.201  -40.752 57.516  1.00 96.17  ? 192 ASP B O     1 
ATOM   6037  C  CB    . ASP B  2  192 ? -3.251  -40.943 55.557  1.00 81.53  ? 192 ASP B CB    1 
ATOM   6038  C  CG    . ASP B  2  192 ? -4.639  -40.661 55.023  1.00 85.58  ? 192 ASP B CG    1 
ATOM   6039  O  OD1   . ASP B  2  192 ? -5.172  -39.572 55.313  1.00 85.06  ? 192 ASP B OD1   1 
ATOM   6040  O  OD2   . ASP B  2  192 ? -5.196  -41.528 54.318  1.00 88.42  ? 192 ASP B OD2   1 
ATOM   6041  N  N     . LEU B  2  193 ? -0.015  -39.485 56.084  1.00 91.71  ? 193 LEU B N     1 
ATOM   6042  C  CA    . LEU B  2  193 ? 1.262   -39.752 56.725  1.00 92.95  ? 193 LEU B CA    1 
ATOM   6043  C  C     . LEU B  2  193 ? 1.257   -39.259 58.173  1.00 99.68  ? 193 LEU B C     1 
ATOM   6044  O  O     . LEU B  2  193 ? 0.383   -38.505 58.606  1.00 97.56  ? 193 LEU B O     1 
ATOM   6045  C  CB    . LEU B  2  193 ? 2.399   -39.096 55.945  1.00 90.53  ? 193 LEU B CB    1 
ATOM   6046  C  CG    . LEU B  2  193 ? 2.711   -39.723 54.587  1.00 90.10  ? 193 LEU B CG    1 
ATOM   6047  C  CD1   . LEU B  2  193 ? 3.840   -38.978 53.907  1.00 83.34  ? 193 LEU B CD1   1 
ATOM   6048  C  CD2   . LEU B  2  193 ? 3.058   -41.195 54.748  1.00 93.77  ? 193 LEU B CD2   1 
ATOM   6049  N  N     . GLU B  2  194 ? 2.268   -39.689 58.921  1.00 113.53 ? 194 GLU B N     1 
ATOM   6050  C  CA    . GLU B  2  194 ? 2.527   -39.078 60.212  1.00 112.91 ? 194 GLU B CA    1 
ATOM   6051  C  C     . GLU B  2  194 ? 3.040   -37.655 60.003  1.00 107.76 ? 194 GLU B C     1 
ATOM   6052  O  O     . GLU B  2  194 ? 3.523   -37.297 58.924  1.00 108.57 ? 194 GLU B O     1 
ATOM   6053  C  CB    . GLU B  2  194 ? 3.537   -39.920 61.000  1.00 117.83 ? 194 GLU B CB    1 
ATOM   6054  C  CG    . GLU B  2  194 ? 3.759   -39.504 62.452  1.00 125.14 ? 194 GLU B CG    1 
ATOM   6055  C  CD    . GLU B  2  194 ? 4.872   -38.483 62.607  1.00 132.28 ? 194 GLU B CD    1 
ATOM   6056  O  OE1   . GLU B  2  194 ? 5.684   -38.340 61.669  1.00 133.79 ? 194 GLU B OE1   1 
ATOM   6057  O  OE2   . GLU B  2  194 ? 4.930   -37.818 63.663  1.00 131.87 ? 194 GLU B OE2   1 
ATOM   6058  N  N     . ILE B  2  195 ? 2.898   -36.833 61.049  1.00 104.73 ? 195 ILE B N     1 
ATOM   6059  C  CA    . ILE B  2  195 ? 3.176   -35.399 60.944  1.00 102.35 ? 195 ILE B CA    1 
ATOM   6060  C  C     . ILE B  2  195 ? 4.534   -35.158 60.295  1.00 102.00 ? 195 ILE B C     1 
ATOM   6061  O  O     . ILE B  2  195 ? 4.661   -34.371 59.349  1.00 95.40  ? 195 ILE B O     1 
ATOM   6062  C  CB    . ILE B  2  195 ? 3.091   -34.733 62.329  1.00 102.15 ? 195 ILE B CB    1 
ATOM   6063  C  CG1   . ILE B  2  195 ? 1.922   -35.307 63.132  1.00 101.58 ? 195 ILE B CG1   1 
ATOM   6064  C  CG2   . ILE B  2  195 ? 2.932   -33.228 62.183  1.00 98.55  ? 195 ILE B CG2   1 
ATOM   6065  C  CD1   . ILE B  2  195 ? 0.561   -34.966 62.564  1.00 101.93 ? 195 ILE B CD1   1 
ATOM   6066  N  N     . GLY B  2  196 ? 5.570   -35.837 60.795  1.00 102.53 ? 196 GLY B N     1 
ATOM   6067  C  CA    . GLY B  2  196 ? 6.915   -35.593 60.294  1.00 101.61 ? 196 GLY B CA    1 
ATOM   6068  C  C     . GLY B  2  196 ? 7.074   -35.944 58.827  1.00 100.07 ? 196 GLY B C     1 
ATOM   6069  O  O     . GLY B  2  196 ? 7.638   -35.171 58.049  1.00 90.85  ? 196 GLY B O     1 
ATOM   6070  N  N     . GLN B  2  197 ? 6.604   -37.134 58.435  1.00 105.45 ? 197 GLN B N     1 
ATOM   6071  C  CA    . GLN B  2  197 ? 6.637   -37.519 57.025  1.00 107.05 ? 197 GLN B CA    1 
ATOM   6072  C  C     . GLN B  2  197 ? 5.901   -36.507 56.157  1.00 99.14  ? 197 GLN B C     1 
ATOM   6073  O  O     . GLN B  2  197 ? 6.380   -36.139 55.077  1.00 95.93  ? 197 GLN B O     1 
ATOM   6074  C  CB    . GLN B  2  197 ? 6.042   -38.915 56.838  1.00 111.89 ? 197 GLN B CB    1 
ATOM   6075  C  CG    . GLN B  2  197 ? 7.043   -40.050 56.997  1.00 114.94 ? 197 GLN B CG    1 
ATOM   6076  C  CD    . GLN B  2  197 ? 7.284   -40.424 58.445  1.00 126.47 ? 197 GLN B CD    1 
ATOM   6077  O  OE1   . GLN B  2  197 ? 6.349   -40.494 59.243  1.00 131.48 ? 197 GLN B OE1   1 
ATOM   6078  N  NE2   . GLN B  2  197 ? 8.542   -40.667 58.794  1.00 132.12 ? 197 GLN B NE2   1 
ATOM   6079  N  N     . HIS B  2  198 ? 4.728   -36.060 56.608  1.00 94.04  ? 198 HIS B N     1 
ATOM   6080  C  CA    . HIS B  2  198 ? 3.922   -35.123 55.831  1.00 89.38  ? 198 HIS B CA    1 
ATOM   6081  C  C     . HIS B  2  198 ? 4.704   -33.850 55.524  1.00 89.21  ? 198 HIS B C     1 
ATOM   6082  O  O     . HIS B  2  198 ? 4.900   -33.493 54.357  1.00 90.27  ? 198 HIS B O     1 
ATOM   6083  C  CB    . HIS B  2  198 ? 2.630   -34.804 56.584  1.00 84.89  ? 198 HIS B CB    1 
ATOM   6084  C  CG    . HIS B  2  198 ? 1.721   -33.863 55.857  1.00 79.91  ? 198 HIS B CG    1 
ATOM   6085  N  ND1   . HIS B  2  198 ? 0.939   -34.255 54.792  1.00 78.24  ? 198 HIS B ND1   1 
ATOM   6086  C  CD2   . HIS B  2  198 ? 1.469   -32.546 56.043  1.00 73.83  ? 198 HIS B CD2   1 
ATOM   6087  C  CE1   . HIS B  2  198 ? 0.245   -33.220 54.353  1.00 76.33  ? 198 HIS B CE1   1 
ATOM   6088  N  NE2   . HIS B  2  198 ? 0.549   -32.170 55.094  1.00 72.09  ? 198 HIS B NE2   1 
ATOM   6089  N  N     . ARG B  2  199 ? 5.156   -33.151 56.570  1.00 85.14  ? 199 ARG B N     1 
ATOM   6090  C  CA    . ARG B  2  199 ? 5.938   -31.932 56.378  1.00 85.42  ? 199 ARG B CA    1 
ATOM   6091  C  C     . ARG B  2  199 ? 7.157   -32.184 55.497  1.00 94.62  ? 199 ARG B C     1 
ATOM   6092  O  O     . ARG B  2  199 ? 7.545   -31.322 54.699  1.00 95.32  ? 199 ARG B O     1 
ATOM   6093  C  CB    . ARG B  2  199 ? 6.357   -31.357 57.730  1.00 83.23  ? 199 ARG B CB    1 
ATOM   6094  C  CG    . ARG B  2  199 ? 5.227   -31.299 58.745  1.00 82.18  ? 199 ARG B CG    1 
ATOM   6095  C  CD    . ARG B  2  199 ? 5.460   -30.226 59.794  1.00 85.10  ? 199 ARG B CD    1 
ATOM   6096  N  NE    . ARG B  2  199 ? 4.632   -30.440 60.978  1.00 89.27  ? 199 ARG B NE    1 
ATOM   6097  C  CZ    . ARG B  2  199 ? 4.447   -29.537 61.935  1.00 100.91 ? 199 ARG B CZ    1 
ATOM   6098  N  NH1   . ARG B  2  199 ? 5.023   -28.346 61.847  1.00 104.76 ? 199 ARG B NH1   1 
ATOM   6099  N  NH2   . ARG B  2  199 ? 3.680   -29.823 62.978  1.00 105.72 ? 199 ARG B NH2   1 
ATOM   6100  N  N     . THR B  2  200 ? 7.787   -33.352 55.644  1.00 94.98  ? 200 THR B N     1 
ATOM   6101  C  CA    . THR B  2  200 ? 8.939   -33.689 54.815  1.00 100.53 ? 200 THR B CA    1 
ATOM   6102  C  C     . THR B  2  200 ? 8.544   -33.765 53.344  1.00 100.08 ? 200 THR B C     1 
ATOM   6103  O  O     . THR B  2  200 ? 9.139   -33.099 52.489  1.00 96.96  ? 200 THR B O     1 
ATOM   6104  C  CB    . THR B  2  200 ? 9.555   -35.010 55.281  1.00 103.87 ? 200 THR B CB    1 
ATOM   6105  O  OG1   . THR B  2  200 ? 10.221  -34.815 56.535  1.00 104.21 ? 200 THR B OG1   1 
ATOM   6106  C  CG2   . THR B  2  200 ? 10.553  -35.527 54.255  1.00 101.00 ? 200 THR B CG2   1 
ATOM   6107  N  N     . LYS B  2  201 ? 7.549   -34.603 53.031  1.00 101.93 ? 201 LYS B N     1 
ATOM   6108  C  CA    . LYS B  2  201 ? 7.013   -34.679 51.674  1.00 98.12  ? 201 LYS B CA    1 
ATOM   6109  C  C     . LYS B  2  201 ? 6.636   -33.310 51.122  1.00 91.09  ? 201 LYS B C     1 
ATOM   6110  O  O     . LYS B  2  201 ? 6.733   -33.082 49.911  1.00 90.02  ? 201 LYS B O     1 
ATOM   6111  C  CB    . LYS B  2  201 ? 5.802   -35.611 51.641  1.00 90.17  ? 201 LYS B CB    1 
ATOM   6112  C  CG    . LYS B  2  201 ? 6.115   -37.044 52.028  1.00 95.68  ? 201 LYS B CG    1 
ATOM   6113  C  CD    . LYS B  2  201 ? 7.042   -37.713 51.030  1.00 109.80 ? 201 LYS B CD    1 
ATOM   6114  C  CE    . LYS B  2  201 ? 7.316   -39.153 51.430  1.00 107.43 ? 201 LYS B CE    1 
ATOM   6115  N  NZ    . LYS B  2  201 ? 8.155   -39.865 50.429  1.00 106.12 ? 201 LYS B NZ    1 
ATOM   6116  N  N     . ILE B  2  202 ? 6.195   -32.391 51.987  1.00 83.94  ? 202 ILE B N     1 
ATOM   6117  C  CA    . ILE B  2  202 ? 5.857   -31.046 51.526  1.00 86.63  ? 202 ILE B CA    1 
ATOM   6118  C  C     . ILE B  2  202 ? 7.096   -30.351 50.983  1.00 98.48  ? 202 ILE B C     1 
ATOM   6119  O  O     . ILE B  2  202 ? 7.037   -29.642 49.971  1.00 96.57  ? 202 ILE B O     1 
ATOM   6120  C  CB    . ILE B  2  202 ? 5.219   -30.231 52.665  1.00 81.44  ? 202 ILE B CB    1 
ATOM   6121  C  CG1   . ILE B  2  202 ? 3.882   -30.834 53.084  1.00 83.21  ? 202 ILE B CG1   1 
ATOM   6122  C  CG2   . ILE B  2  202 ? 5.036   -28.777 52.252  1.00 75.34  ? 202 ILE B CG2   1 
ATOM   6123  C  CD1   . ILE B  2  202 ? 3.388   -30.287 54.391  1.00 92.25  ? 202 ILE B CD1   1 
ATOM   6124  N  N     . GLU B  2  203 ? 8.238   -30.548 51.644  1.00 108.24 ? 203 GLU B N     1 
ATOM   6125  C  CA    . GLU B  2  203 ? 9.470   -29.921 51.181  1.00 105.85 ? 203 GLU B CA    1 
ATOM   6126  C  C     . GLU B  2  203 ? 9.848   -30.431 49.799  1.00 107.82 ? 203 GLU B C     1 
ATOM   6127  O  O     . GLU B  2  203 ? 10.278  -29.653 48.940  1.00 112.83 ? 203 GLU B O     1 
ATOM   6128  C  CB    . GLU B  2  203 ? 10.599  -30.163 52.182  1.00 106.04 ? 203 GLU B CB    1 
ATOM   6129  C  CG    . GLU B  2  203 ? 11.712  -29.135 52.090  1.00 115.56 ? 203 GLU B CG    1 
ATOM   6130  C  CD    . GLU B  2  203 ? 11.201  -27.714 52.250  1.00 113.90 ? 203 GLU B CD    1 
ATOM   6131  O  OE1   . GLU B  2  203 ? 10.374  -27.476 53.155  1.00 112.17 ? 203 GLU B OE1   1 
ATOM   6132  O  OE2   . GLU B  2  203 ? 11.619  -26.838 51.464  1.00 117.16 ? 203 GLU B OE2   1 
ATOM   6133  N  N     . GLU B  2  204 ? 9.684   -31.737 49.562  1.00 106.09 ? 204 GLU B N     1 
ATOM   6134  C  CA    . GLU B  2  204 ? 10.027  -32.303 48.262  1.00 104.56 ? 204 GLU B CA    1 
ATOM   6135  C  C     . GLU B  2  204 ? 9.202   -31.664 47.153  1.00 104.11 ? 204 GLU B C     1 
ATOM   6136  O  O     . GLU B  2  204 ? 9.721   -31.379 46.067  1.00 102.47 ? 204 GLU B O     1 
ATOM   6137  C  CB    . GLU B  2  204 ? 9.812   -33.816 48.272  1.00 102.91 ? 204 GLU B CB    1 
ATOM   6138  C  CG    . GLU B  2  204 ? 10.459  -34.542 49.436  1.00 107.89 ? 204 GLU B CG    1 
ATOM   6139  C  CD    . GLU B  2  204 ? 10.128  -36.020 49.443  1.00 116.01 ? 204 GLU B CD    1 
ATOM   6140  O  OE1   . GLU B  2  204 ? 9.545   -36.501 48.448  1.00 113.60 ? 204 GLU B OE1   1 
ATOM   6141  O  OE2   . GLU B  2  204 ? 10.444  -36.701 50.440  1.00 121.63 ? 204 GLU B OE2   1 
ATOM   6142  N  N     . LEU B  2  205 ? 7.912   -31.432 47.410  1.00 105.27 ? 205 LEU B N     1 
ATOM   6143  C  CA    . LEU B  2  205 ? 7.081   -30.726 46.441  1.00 101.85 ? 205 LEU B CA    1 
ATOM   6144  C  C     . LEU B  2  205 ? 7.584   -29.304 46.226  1.00 104.04 ? 205 LEU B C     1 
ATOM   6145  O  O     . LEU B  2  205 ? 7.550   -28.788 45.103  1.00 106.61 ? 205 LEU B O     1 
ATOM   6146  C  CB    . LEU B  2  205 ? 5.624   -30.718 46.900  1.00 89.71  ? 205 LEU B CB    1 
ATOM   6147  C  CG    . LEU B  2  205 ? 4.618   -30.268 45.840  1.00 86.36  ? 205 LEU B CG    1 
ATOM   6148  C  CD1   . LEU B  2  205 ? 4.538   -31.288 44.713  1.00 84.95  ? 205 LEU B CD1   1 
ATOM   6149  C  CD2   . LEU B  2  205 ? 3.252   -30.035 46.459  1.00 81.09  ? 205 LEU B CD2   1 
ATOM   6150  N  N     . ARG B  2  206 ? 8.045   -28.652 47.298  1.00 105.14 ? 206 ARG B N     1 
ATOM   6151  C  CA    . ARG B  2  206 ? 8.623   -27.319 47.160  1.00 112.99 ? 206 ARG B CA    1 
ATOM   6152  C  C     . ARG B  2  206 ? 9.853   -27.347 46.261  1.00 118.12 ? 206 ARG B C     1 
ATOM   6153  O  O     . ARG B  2  206 ? 10.045  -26.448 45.434  1.00 116.56 ? 206 ARG B O     1 
ATOM   6154  C  CB    . ARG B  2  206 ? 8.973   -26.745 48.533  1.00 115.71 ? 206 ARG B CB    1 
ATOM   6155  C  CG    . ARG B  2  206 ? 7.881   -25.886 49.158  1.00 112.99 ? 206 ARG B CG    1 
ATOM   6156  C  CD    . ARG B  2  206 ? 8.384   -25.189 50.416  1.00 120.14 ? 206 ARG B CD    1 
ATOM   6157  N  NE    . ARG B  2  206 ? 7.496   -24.114 50.849  1.00 125.97 ? 206 ARG B NE    1 
ATOM   6158  C  CZ    . ARG B  2  206 ? 6.574   -24.237 51.799  1.00 127.51 ? 206 ARG B CZ    1 
ATOM   6159  N  NH1   . ARG B  2  206 ? 6.415   -25.394 52.427  1.00 126.44 ? 206 ARG B NH1   1 
ATOM   6160  N  NH2   . ARG B  2  206 ? 5.813   -23.201 52.124  1.00 131.39 ? 206 ARG B NH2   1 
ATOM   6161  N  N     . GLN B  2  207 ? 10.702  -28.370 46.409  1.00 122.17 ? 207 GLN B N     1 
ATOM   6162  C  CA    . GLN B  2  207 ? 11.878  -28.478 45.550  1.00 128.53 ? 207 GLN B CA    1 
ATOM   6163  C  C     . GLN B  2  207 ? 11.476  -28.611 44.087  1.00 129.99 ? 207 GLN B C     1 
ATOM   6164  O  O     . GLN B  2  207 ? 12.081  -27.979 43.213  1.00 134.76 ? 207 GLN B O     1 
ATOM   6165  C  CB    . GLN B  2  207 ? 12.749  -29.663 45.976  1.00 132.77 ? 207 GLN B CB    1 
ATOM   6166  C  CG    . GLN B  2  207 ? 12.935  -29.842 47.482  1.00 130.81 ? 207 GLN B CG    1 
ATOM   6167  C  CD    . GLN B  2  207 ? 13.796  -28.771 48.139  1.00 133.06 ? 207 GLN B CD    1 
ATOM   6168  O  OE1   . GLN B  2  207 ? 14.033  -27.701 47.577  1.00 135.16 ? 207 GLN B OE1   1 
ATOM   6169  N  NE2   . GLN B  2  207 ? 14.271  -29.063 49.345  1.00 132.43 ? 207 GLN B NE2   1 
ATOM   6170  N  N     . HIS B  2  208 ? 10.476  -29.453 43.798  1.00 123.88 ? 208 HIS B N     1 
ATOM   6171  C  CA    . HIS B  2  208 ? 10.000  -29.606 42.425  1.00 117.74 ? 208 HIS B CA    1 
ATOM   6172  C  C     . HIS B  2  208 ? 9.629   -28.257 41.822  1.00 116.58 ? 208 HIS B C     1 
ATOM   6173  O  O     . HIS B  2  208 ? 9.945   -27.974 40.661  1.00 119.78 ? 208 HIS B O     1 
ATOM   6174  C  CB    . HIS B  2  208 ? 8.804   -30.558 42.381  1.00 106.76 ? 208 HIS B CB    1 
ATOM   6175  C  CG    . HIS B  2  208 ? 9.181   -31.997 42.207  1.00 111.17 ? 208 HIS B CG    1 
ATOM   6176  N  ND1   . HIS B  2  208 ? 9.849   -32.715 43.174  1.00 112.69 ? 208 HIS B ND1   1 
ATOM   6177  C  CD2   . HIS B  2  208 ? 8.980   -32.851 41.175  1.00 116.60 ? 208 HIS B CD2   1 
ATOM   6178  C  CE1   . HIS B  2  208 ? 10.045  -33.950 42.747  1.00 116.45 ? 208 HIS B CE1   1 
ATOM   6179  N  NE2   . HIS B  2  208 ? 9.527   -34.058 41.536  1.00 118.53 ? 208 HIS B NE2   1 
ATOM   6180  N  N     . LEU B  2  209 ? 8.919   -27.426 42.586  1.00 109.54 ? 209 LEU B N     1 
ATOM   6181  C  CA    . LEU B  2  209 ? 8.590   -26.087 42.113  1.00 109.38 ? 209 LEU B CA    1 
ATOM   6182  C  C     . LEU B  2  209 ? 9.850   -25.248 41.937  1.00 115.59 ? 209 LEU B C     1 
ATOM   6183  O  O     . LEU B  2  209 ? 9.954   -24.458 40.991  1.00 119.04 ? 209 LEU B O     1 
ATOM   6184  C  CB    . LEU B  2  209 ? 7.611   -25.415 43.076  1.00 101.00 ? 209 LEU B CB    1 
ATOM   6185  C  CG    . LEU B  2  209 ? 6.233   -26.080 43.152  1.00 97.72  ? 209 LEU B CG    1 
ATOM   6186  C  CD1   . LEU B  2  209 ? 5.362   -25.421 44.210  1.00 101.34 ? 209 LEU B CD1   1 
ATOM   6187  C  CD2   . LEU B  2  209 ? 5.545   -26.054 41.792  1.00 99.23  ? 209 LEU B CD2   1 
ATOM   6188  N  N     . LEU B  2  210 ? 10.817  -25.404 42.847  1.00 118.14 ? 210 LEU B N     1 
ATOM   6189  C  CA    . LEU B  2  210 ? 12.038  -24.604 42.798  1.00 123.01 ? 210 LEU B CA    1 
ATOM   6190  C  C     . LEU B  2  210 ? 12.824  -24.854 41.516  1.00 125.64 ? 210 LEU B C     1 
ATOM   6191  O  O     . LEU B  2  210 ? 13.301  -23.908 40.878  1.00 129.12 ? 210 LEU B O     1 
ATOM   6192  C  CB    . LEU B  2  210 ? 12.902  -24.897 44.025  1.00 126.37 ? 210 LEU B CB    1 
ATOM   6193  C  CG    . LEU B  2  210 ? 12.837  -23.895 45.179  1.00 125.84 ? 210 LEU B CG    1 
ATOM   6194  C  CD1   . LEU B  2  210 ? 11.399  -23.551 45.537  1.00 114.98 ? 210 LEU B CD1   1 
ATOM   6195  C  CD2   . LEU B  2  210 ? 13.573  -24.443 46.391  1.00 129.92 ? 210 LEU B CD2   1 
ATOM   6196  N  N     . ARG B  2  211 ? 12.998  -26.123 41.135  1.00 128.71 ? 211 ARG B N     1 
ATOM   6197  C  CA    . ARG B  2  211 ? 13.732  -26.405 39.905  1.00 140.15 ? 211 ARG B CA    1 
ATOM   6198  C  C     . ARG B  2  211 ? 13.004  -25.840 38.692  1.00 141.91 ? 211 ARG B C     1 
ATOM   6199  O  O     . ARG B  2  211 ? 13.646  -25.401 37.730  1.00 150.02 ? 211 ARG B O     1 
ATOM   6200  C  CB    . ARG B  2  211 ? 13.991  -27.907 39.751  1.00 140.46 ? 211 ARG B CB    1 
ATOM   6201  C  CG    . ARG B  2  211 ? 12.833  -28.813 40.097  1.00 138.52 ? 211 ARG B CG    1 
ATOM   6202  C  CD    . ARG B  2  211 ? 13.300  -30.258 40.196  1.00 134.06 ? 211 ARG B CD    1 
ATOM   6203  N  NE    . ARG B  2  211 ? 14.339  -30.423 41.210  1.00 129.84 ? 211 ARG B NE    1 
ATOM   6204  C  CZ    . ARG B  2  211 ? 14.121  -30.880 42.439  1.00 125.95 ? 211 ARG B CZ    1 
ATOM   6205  N  NH1   . ARG B  2  211 ? 12.898  -31.231 42.811  1.00 120.44 ? 211 ARG B NH1   1 
ATOM   6206  N  NH2   . ARG B  2  211 ? 15.127  -30.994 43.295  1.00 128.46 ? 211 ARG B NH2   1 
ATOM   6207  N  N     . TRP B  2  212 ? 11.669  -25.851 38.711  1.00 131.23 ? 212 TRP B N     1 
ATOM   6208  C  CA    . TRP B  2  212 ? 10.906  -25.131 37.698  1.00 132.66 ? 212 TRP B CA    1 
ATOM   6209  C  C     . TRP B  2  212 ? 11.022  -23.619 37.851  1.00 141.49 ? 212 TRP B C     1 
ATOM   6210  O  O     . TRP B  2  212 ? 10.631  -22.892 36.933  1.00 145.38 ? 212 TRP B O     1 
ATOM   6211  C  CB    . TRP B  2  212 ? 9.433   -25.547 37.742  1.00 128.17 ? 212 TRP B CB    1 
ATOM   6212  C  CG    . TRP B  2  212 ? 8.713   -25.340 36.436  1.00 132.15 ? 212 TRP B CG    1 
ATOM   6213  C  CD1   . TRP B  2  212 ? 8.666   -26.206 35.382  1.00 137.09 ? 212 TRP B CD1   1 
ATOM   6214  C  CD2   . TRP B  2  212 ? 7.941   -24.195 36.048  1.00 130.91 ? 212 TRP B CD2   1 
ATOM   6215  N  NE1   . TRP B  2  212 ? 7.914   -25.673 34.363  1.00 136.73 ? 212 TRP B NE1   1 
ATOM   6216  C  CE2   . TRP B  2  212 ? 7.457   -24.439 34.746  1.00 132.21 ? 212 TRP B CE2   1 
ATOM   6217  C  CE3   . TRP B  2  212 ? 7.610   -22.990 36.674  1.00 125.77 ? 212 TRP B CE3   1 
ATOM   6218  C  CZ2   . TRP B  2  212 ? 6.663   -23.522 34.061  1.00 127.85 ? 212 TRP B CZ2   1 
ATOM   6219  C  CZ3   . TRP B  2  212 ? 6.822   -22.079 35.990  1.00 122.06 ? 212 TRP B CZ3   1 
ATOM   6220  C  CH2   . TRP B  2  212 ? 6.357   -22.351 34.698  1.00 124.43 ? 212 TRP B CH2   1 
ATOM   6221  N  N     . GLY B  2  213 ? 11.569  -23.132 38.963  1.00 147.26 ? 213 GLY B N     1 
ATOM   6222  C  CA    . GLY B  2  213 ? 11.809  -21.718 39.150  1.00 156.07 ? 213 GLY B CA    1 
ATOM   6223  C  C     . GLY B  2  213 ? 10.747  -20.944 39.900  1.00 163.43 ? 213 GLY B C     1 
ATOM   6224  O  O     . GLY B  2  213 ? 10.800  -19.709 39.905  1.00 167.04 ? 213 GLY B O     1 
ATOM   6225  N  N     . LEU B  2  214 ? 9.790   -21.618 40.533  1.00 163.43 ? 214 LEU B N     1 
ATOM   6226  C  CA    . LEU B  2  214 ? 8.753   -20.955 41.315  1.00 162.49 ? 214 LEU B CA    1 
ATOM   6227  C  C     . LEU B  2  214 ? 9.128   -20.934 42.793  1.00 165.06 ? 214 LEU B C     1 
ATOM   6228  O  O     . LEU B  2  214 ? 9.330   -21.990 43.403  1.00 167.36 ? 214 LEU B O     1 
ATOM   6229  C  CB    . LEU B  2  214 ? 7.409   -21.660 41.124  1.00 155.29 ? 214 LEU B CB    1 
ATOM   6230  C  CG    . LEU B  2  214 ? 6.394   -21.490 42.257  1.00 148.05 ? 214 LEU B CG    1 
ATOM   6231  C  CD1   . LEU B  2  214 ? 5.907   -20.060 42.329  1.00 142.13 ? 214 LEU B CD1   1 
ATOM   6232  C  CD2   . LEU B  2  214 ? 5.228   -22.447 42.095  1.00 145.89 ? 214 LEU B CD2   1 
ATOM   6233  N  N     . THR B  2  215 ? 9.234   -19.733 43.356  1.00 162.37 ? 215 THR B N     1 
ATOM   6234  C  CA    . THR B  2  215 ? 9.476   -19.568 44.783  1.00 157.43 ? 215 THR B CA    1 
ATOM   6235  C  C     . THR B  2  215 ? 8.201   -19.859 45.566  1.00 156.40 ? 215 THR B C     1 
ATOM   6236  O  O     . THR B  2  215 ? 7.105   -19.463 45.159  1.00 155.95 ? 215 THR B O     1 
ATOM   6237  C  CB    . THR B  2  215 ? 9.968   -18.154 45.087  1.00 151.97 ? 215 THR B CB    1 
ATOM   6238  O  OG1   . THR B  2  215 ? 8.979   -17.204 44.671  1.00 150.94 ? 215 THR B OG1   1 
ATOM   6239  C  CG2   . THR B  2  215 ? 11.269  -17.878 44.349  1.00 148.64 ? 215 THR B CG2   1 
ATOM   6240  N  N     . THR B  2  216 ? 8.345   -20.538 46.702  1.00 154.46 ? 216 THR B N     1 
ATOM   6241  C  CA    . THR B  2  216 ? 7.218   -20.770 47.592  1.00 144.48 ? 216 THR B CA    1 
ATOM   6242  C  C     . THR B  2  216 ? 7.560   -20.263 48.988  1.00 145.69 ? 216 THR B C     1 
ATOM   6243  O  O     . THR B  2  216 ? 8.603   -20.644 49.547  1.00 147.80 ? 216 THR B O     1 
ATOM   6244  C  CB    . THR B  2  216 ? 6.848   -22.259 47.639  1.00 128.80 ? 216 THR B CB    1 
ATOM   6245  O  OG1   . THR B  2  216 ? 6.493   -22.706 46.324  1.00 121.38 ? 216 THR B OG1   1 
ATOM   6246  C  CG2   . THR B  2  216 ? 5.675   -22.485 48.579  1.00 113.58 ? 216 THR B CG2   1 
ATOM   6247  N  N     . PRO B  2  217 ? 6.722   -19.396 49.583  1.00 144.04 ? 217 PRO B N     1 
ATOM   6248  C  CA    . PRO B  2  217 ? 6.910   -18.862 50.938  1.00 143.95 ? 217 PRO B CA    1 
ATOM   6249  C  C     . PRO B  2  217 ? 6.752   -19.914 52.036  1.00 138.36 ? 217 PRO B C     1 
ATOM   6250  O  O     . PRO B  2  217 ? 7.089   -21.081 51.835  1.00 131.30 ? 217 PRO B O     1 
ATOM   6251  C  CB    . PRO B  2  217 ? 5.814   -17.797 51.047  1.00 136.87 ? 217 PRO B CB    1 
ATOM   6252  C  CG    . PRO B  2  217 ? 4.762   -18.249 50.099  1.00 129.78 ? 217 PRO B CG    1 
ATOM   6253  C  CD    . PRO B  2  217 ? 5.510   -18.853 48.947  1.00 136.72 ? 217 PRO B CD    1 
ATOM   6254  N  N     . GLY B  2  231 ? 3.407   -22.690 55.281  1.00 93.53  ? 231 GLY B N     1 
ATOM   6255  C  CA    . GLY B  2  231 ? 2.111   -23.053 54.738  1.00 87.95  ? 231 GLY B CA    1 
ATOM   6256  C  C     . GLY B  2  231 ? 1.099   -23.442 55.797  1.00 95.87  ? 231 GLY B C     1 
ATOM   6257  O  O     . GLY B  2  231 ? 1.460   -23.937 56.866  1.00 99.84  ? 231 GLY B O     1 
ATOM   6258  N  N     . TYR B  2  232 ? -0.179  -23.222 55.498  1.00 97.96  ? 232 TYR B N     1 
ATOM   6259  C  CA    . TYR B  2  232 ? -1.231  -23.541 56.451  1.00 92.27  ? 232 TYR B CA    1 
ATOM   6260  C  C     . TYR B  2  232 ? -1.413  -25.050 56.524  1.00 80.71  ? 232 TYR B C     1 
ATOM   6261  O  O     . TYR B  2  232 ? -1.461  -25.731 55.498  1.00 84.87  ? 232 TYR B O     1 
ATOM   6262  C  CB    . TYR B  2  232 ? -2.557  -22.897 56.040  1.00 100.30 ? 232 TYR B CB    1 
ATOM   6263  C  CG    . TYR B  2  232 ? -2.624  -21.382 56.067  1.00 111.45 ? 232 TYR B CG    1 
ATOM   6264  C  CD1   . TYR B  2  232 ? -3.853  -20.740 56.127  1.00 117.11 ? 232 TYR B CD1   1 
ATOM   6265  C  CD2   . TYR B  2  232 ? -1.478  -20.595 56.007  1.00 117.51 ? 232 TYR B CD2   1 
ATOM   6266  C  CE1   . TYR B  2  232 ? -3.945  -19.366 56.145  1.00 119.76 ? 232 TYR B CE1   1 
ATOM   6267  C  CE2   . TYR B  2  232 ? -1.560  -19.212 56.021  1.00 124.79 ? 232 TYR B CE2   1 
ATOM   6268  C  CZ    . TYR B  2  232 ? -2.799  -18.605 56.091  1.00 122.36 ? 232 TYR B CZ    1 
ATOM   6269  O  OH    . TYR B  2  232 ? -2.901  -17.232 56.108  1.00 108.45 ? 232 TYR B OH    1 
ATOM   6270  N  N     . GLU B  2  233 ? -1.524  -25.576 57.740  1.00 74.05  ? 233 GLU B N     1 
ATOM   6271  C  CA    . GLU B  2  233 ? -1.752  -27.000 57.951  1.00 74.94  ? 233 GLU B CA    1 
ATOM   6272  C  C     . GLU B  2  233 ? -3.173  -27.199 58.460  1.00 74.50  ? 233 GLU B C     1 
ATOM   6273  O  O     . GLU B  2  233 ? -3.531  -26.693 59.529  1.00 74.49  ? 233 GLU B O     1 
ATOM   6274  C  CB    . GLU B  2  233 ? -0.732  -27.584 58.929  1.00 83.57  ? 233 GLU B CB    1 
ATOM   6275  C  CG    . GLU B  2  233 ? 0.675   -27.665 58.358  1.00 93.41  ? 233 GLU B CG    1 
ATOM   6276  C  CD    . GLU B  2  233 ? 1.598   -28.530 59.192  1.00 98.62  ? 233 GLU B CD    1 
ATOM   6277  O  OE1   . GLU B  2  233 ? 1.331   -28.695 60.400  1.00 99.78  ? 233 GLU B OE1   1 
ATOM   6278  O  OE2   . GLU B  2  233 ? 2.588   -29.051 58.635  1.00 98.30  ? 233 GLU B OE2   1 
ATOM   6279  N  N     . LEU B  2  234 ? -3.969  -27.941 57.699  1.00 68.99  ? 234 LEU B N     1 
ATOM   6280  C  CA    . LEU B  2  234 ? -5.332  -28.289 58.065  1.00 57.83  ? 234 LEU B CA    1 
ATOM   6281  C  C     . LEU B  2  234 ? -5.413  -29.747 58.501  1.00 67.21  ? 234 LEU B C     1 
ATOM   6282  O  O     . LEU B  2  234 ? -4.463  -30.522 58.363  1.00 78.60  ? 234 LEU B O     1 
ATOM   6283  C  CB    . LEU B  2  234 ? -6.284  -28.033 56.890  1.00 53.21  ? 234 LEU B CB    1 
ATOM   6284  C  CG    . LEU B  2  234 ? -6.137  -26.682 56.185  1.00 58.71  ? 234 LEU B CG    1 
ATOM   6285  C  CD1   . LEU B  2  234 ? -6.955  -26.645 54.901  1.00 50.83  ? 234 LEU B CD1   1 
ATOM   6286  C  CD2   . LEU B  2  234 ? -6.542  -25.546 57.112  1.00 52.57  ? 234 LEU B CD2   1 
ATOM   6287  N  N     . HIS B  2  235 ? -6.581  -30.113 59.033  1.00 66.51  ? 235 HIS B N     1 
ATOM   6288  C  CA    . HIS B  2  235 ? -6.834  -31.471 59.522  1.00 64.98  ? 235 HIS B CA    1 
ATOM   6289  C  C     . HIS B  2  235 ? -8.310  -31.787 59.321  1.00 68.88  ? 235 HIS B C     1 
ATOM   6290  O  O     . HIS B  2  235 ? -9.080  -31.896 60.282  1.00 66.39  ? 235 HIS B O     1 
ATOM   6291  C  CB    . HIS B  2  235 ? -6.426  -31.610 60.988  1.00 60.79  ? 235 HIS B CB    1 
ATOM   6292  C  CG    . HIS B  2  235 ? -4.969  -31.373 61.233  1.00 70.23  ? 235 HIS B CG    1 
ATOM   6293  N  ND1   . HIS B  2  235 ? -3.993  -32.260 60.833  1.00 74.96  ? 235 HIS B ND1   1 
ATOM   6294  C  CD2   . HIS B  2  235 ? -4.320  -30.345 61.830  1.00 68.65  ? 235 HIS B CD2   1 
ATOM   6295  C  CE1   . HIS B  2  235 ? -2.806  -31.791 61.176  1.00 75.90  ? 235 HIS B CE1   1 
ATOM   6296  N  NE2   . HIS B  2  235 ? -2.977  -30.630 61.783  1.00 75.50  ? 235 HIS B NE2   1 
ATOM   6297  N  N     . PRO B  2  236 ? -8.744  -31.920 58.063  1.00 71.69  ? 236 PRO B N     1 
ATOM   6298  C  CA    . PRO B  2  236 ? -10.186 -32.048 57.780  1.00 76.30  ? 236 PRO B CA    1 
ATOM   6299  C  C     . PRO B  2  236 ? -10.875 -33.189 58.515  1.00 86.28  ? 236 PRO B C     1 
ATOM   6300  O  O     . PRO B  2  236 ? -12.104 -33.157 58.654  1.00 91.28  ? 236 PRO B O     1 
ATOM   6301  C  CB    . PRO B  2  236 ? -10.229 -32.251 56.259  1.00 68.57  ? 236 PRO B CB    1 
ATOM   6302  C  CG    . PRO B  2  236 ? -8.910  -31.753 55.759  1.00 66.32  ? 236 PRO B CG    1 
ATOM   6303  C  CD    . PRO B  2  236 ? -7.930  -32.054 56.844  1.00 66.54  ? 236 PRO B CD    1 
ATOM   6304  N  N     . ASP B  2  237 ? -10.136 -34.200 58.975  1.00 87.27  ? 237 ASP B N     1 
ATOM   6305  C  CA    . ASP B  2  237 ? -10.767 -35.286 59.719  1.00 82.04  ? 237 ASP B CA    1 
ATOM   6306  C  C     . ASP B  2  237 ? -11.144 -34.845 61.127  1.00 78.83  ? 237 ASP B C     1 
ATOM   6307  O  O     . ASP B  2  237 ? -12.145 -35.319 61.678  1.00 83.90  ? 237 ASP B O     1 
ATOM   6308  C  CB    . ASP B  2  237 ? -9.843  -36.504 59.771  1.00 91.34  ? 237 ASP B CB    1 
ATOM   6309  C  CG    . ASP B  2  237 ? -8.501  -36.196 60.407  1.00 93.88  ? 237 ASP B CG    1 
ATOM   6310  O  OD1   . ASP B  2  237 ? -7.953  -35.106 60.145  1.00 90.25  ? 237 ASP B OD1   1 
ATOM   6311  O  OD2   . ASP B  2  237 ? -7.994  -37.045 61.170  1.00 103.57 ? 237 ASP B OD2   1 
ATOM   6312  N  N     . LYS B  2  238 ? -10.357 -33.942 61.719  1.00 85.82  ? 238 LYS B N     1 
ATOM   6313  C  CA    . LYS B  2  238 ? -10.736 -33.325 62.988  1.00 84.11  ? 238 LYS B CA    1 
ATOM   6314  C  C     . LYS B  2  238 ? -12.069 -32.593 62.884  1.00 86.57  ? 238 LYS B C     1 
ATOM   6315  O  O     . LYS B  2  238 ? -12.846 -32.575 63.846  1.00 95.99  ? 238 LYS B O     1 
ATOM   6316  C  CB    . LYS B  2  238 ? -9.634  -32.371 63.451  1.00 83.33  ? 238 LYS B CB    1 
ATOM   6317  C  CG    . LYS B  2  238 ? -8.359  -33.070 63.890  1.00 88.96  ? 238 LYS B CG    1 
ATOM   6318  C  CD    . LYS B  2  238 ? -8.487  -33.586 65.314  1.00 92.83  ? 238 LYS B CD    1 
ATOM   6319  C  CE    . LYS B  2  238 ? -7.393  -34.586 65.644  1.00 94.51  ? 238 LYS B CE    1 
ATOM   6320  N  NZ    . LYS B  2  238 ? -7.574  -35.862 64.896  1.00 93.01  ? 238 LYS B NZ    1 
ATOM   6321  N  N     . TRP B  2  239 ? -12.337 -31.966 61.737  1.00 85.40  ? 239 TRP B N     1 
ATOM   6322  C  CA    . TRP B  2  239 ? -13.520 -31.125 61.571  1.00 84.73  ? 239 TRP B CA    1 
ATOM   6323  C  C     . TRP B  2  239 ? -14.788 -31.860 61.988  1.00 96.77  ? 239 TRP B C     1 
ATOM   6324  O  O     . TRP B  2  239 ? -15.020 -33.005 61.589  1.00 99.67  ? 239 TRP B O     1 
ATOM   6325  C  CB    . TRP B  2  239 ? -13.636 -30.673 60.113  1.00 67.49  ? 239 TRP B CB    1 
ATOM   6326  C  CG    . TRP B  2  239 ? -12.492 -29.829 59.633  1.00 65.36  ? 239 TRP B CG    1 
ATOM   6327  C  CD1   . TRP B  2  239 ? -11.461 -29.339 60.380  1.00 65.45  ? 239 TRP B CD1   1 
ATOM   6328  C  CD2   . TRP B  2  239 ? -12.266 -29.377 58.292  1.00 61.39  ? 239 TRP B CD2   1 
ATOM   6329  N  NE1   . TRP B  2  239 ? -10.606 -28.610 59.588  1.00 67.61  ? 239 TRP B NE1   1 
ATOM   6330  C  CE2   . TRP B  2  239 ? -11.078 -28.619 58.302  1.00 67.34  ? 239 TRP B CE2   1 
ATOM   6331  C  CE3   . TRP B  2  239 ? -12.951 -29.542 57.085  1.00 54.74  ? 239 TRP B CE3   1 
ATOM   6332  C  CZ2   . TRP B  2  239 ? -10.562 -28.026 57.151  1.00 66.03  ? 239 TRP B CZ2   1 
ATOM   6333  C  CZ3   . TRP B  2  239 ? -12.438 -28.953 55.945  1.00 51.65  ? 239 TRP B CZ3   1 
ATOM   6334  C  CH2   . TRP B  2  239 ? -11.255 -28.204 55.986  1.00 57.38  ? 239 TRP B CH2   1 
ATOM   6335  N  N     . THR B  2  240 ? -15.610 -31.191 62.790  1.00 97.37  ? 240 THR B N     1 
ATOM   6336  C  CA    . THR B  2  240 ? -16.826 -31.768 63.347  1.00 95.05  ? 240 THR B CA    1 
ATOM   6337  C  C     . THR B  2  240 ? -18.029 -30.902 62.986  1.00 87.08  ? 240 THR B C     1 
ATOM   6338  O  O     . THR B  2  240 ? -17.907 -29.859 62.338  1.00 86.08  ? 240 THR B O     1 
ATOM   6339  C  CB    . THR B  2  240 ? -16.714 -31.923 64.868  1.00 92.30  ? 240 THR B CB    1 
ATOM   6340  O  OG1   . THR B  2  240 ? -16.307 -30.677 65.449  1.00 89.34  ? 240 THR B OG1   1 
ATOM   6341  C  CG2   . THR B  2  240 ? -15.708 -33.006 65.228  1.00 84.94  ? 240 THR B CG2   1 
ATOM   6342  N  N     . VAL B  2  241 ? -19.203 -31.354 63.420  1.00 82.23  ? 241 VAL B N     1 
ATOM   6343  C  CA    . VAL B  2  241 ? -20.465 -30.680 63.154  1.00 77.63  ? 241 VAL B CA    1 
ATOM   6344  C  C     . VAL B  2  241 ? -21.077 -30.258 64.486  1.00 72.14  ? 241 VAL B C     1 
ATOM   6345  O  O     . VAL B  2  241 ? -20.651 -30.687 65.559  1.00 76.90  ? 241 VAL B O     1 
ATOM   6346  C  CB    . VAL B  2  241 ? -21.444 -31.559 62.352  1.00 71.17  ? 241 VAL B CB    1 
ATOM   6347  C  CG1   . VAL B  2  241 ? -20.901 -31.824 60.955  1.00 66.24  ? 241 VAL B CG1   1 
ATOM   6348  C  CG2   . VAL B  2  241 ? -21.704 -32.866 63.083  1.00 69.90  ? 241 VAL B CG2   1 
ATOM   6349  N  N     . GLN B  2  242 ? -22.088 -29.394 64.403  1.00 63.41  ? 242 GLN B N     1 
ATOM   6350  C  CA    . GLN B  2  242 ? -22.745 -28.824 65.577  1.00 74.42  ? 242 GLN B CA    1 
ATOM   6351  C  C     . GLN B  2  242 ? -24.237 -29.083 65.423  1.00 76.84  ? 242 GLN B C     1 
ATOM   6352  O  O     . GLN B  2  242 ? -24.959 -28.286 64.807  1.00 66.43  ? 242 GLN B O     1 
ATOM   6353  C  CB    . GLN B  2  242 ? -22.442 -27.333 65.717  1.00 73.33  ? 242 GLN B CB    1 
ATOM   6354  C  CG    . GLN B  2  242 ? -23.243 -26.606 66.798  1.00 75.71  ? 242 GLN B CG    1 
ATOM   6355  C  CD    . GLN B  2  242 ? -22.723 -26.858 68.202  1.00 87.98  ? 242 GLN B CD    1 
ATOM   6356  O  OE1   . GLN B  2  242 ? -21.866 -27.714 68.417  1.00 91.24  ? 242 GLN B OE1   1 
ATOM   6357  N  NE2   . GLN B  2  242 ? -23.239 -26.104 69.167  1.00 98.70  ? 242 GLN B NE2   1 
ATOM   6358  N  N     . PRO B  2  243 ? -24.731 -30.197 65.954  1.00 76.69  ? 243 PRO B N     1 
ATOM   6359  C  CA    . PRO B  2  243 ? -26.157 -30.505 65.823  1.00 72.54  ? 243 PRO B CA    1 
ATOM   6360  C  C     . PRO B  2  243 ? -27.010 -29.602 66.698  1.00 69.74  ? 243 PRO B C     1 
ATOM   6361  O  O     . PRO B  2  243 ? -26.536 -28.965 67.642  1.00 60.49  ? 243 PRO B O     1 
ATOM   6362  C  CB    . PRO B  2  243 ? -26.246 -31.964 66.282  1.00 70.07  ? 243 PRO B CB    1 
ATOM   6363  C  CG    . PRO B  2  243 ? -25.109 -32.115 67.237  1.00 68.90  ? 243 PRO B CG    1 
ATOM   6364  C  CD    . PRO B  2  243 ? -24.005 -31.232 66.711  1.00 74.22  ? 243 PRO B CD    1 
ATOM   6365  N  N     . ILE B  2  244 ? -28.300 -29.553 66.364  1.00 70.52  ? 244 ILE B N     1 
ATOM   6366  C  CA    . ILE B  2  244 ? -29.267 -28.910 67.240  1.00 62.32  ? 244 ILE B CA    1 
ATOM   6367  C  C     . ILE B  2  244 ? -29.414 -29.745 68.504  1.00 70.72  ? 244 ILE B C     1 
ATOM   6368  O  O     . ILE B  2  244 ? -29.518 -30.978 68.448  1.00 72.68  ? 244 ILE B O     1 
ATOM   6369  C  CB    . ILE B  2  244 ? -30.613 -28.732 66.518  1.00 55.32  ? 244 ILE B CB    1 
ATOM   6370  C  CG1   . ILE B  2  244 ? -30.412 -27.966 65.208  1.00 52.95  ? 244 ILE B CG1   1 
ATOM   6371  C  CG2   . ILE B  2  244 ? -31.610 -28.010 67.415  1.00 62.23  ? 244 ILE B CG2   1 
ATOM   6372  C  CD1   . ILE B  2  244 ? -31.667 -27.836 64.374  1.00 57.02  ? 244 ILE B CD1   1 
ATOM   6373  N  N     . VAL B  2  245 ? -29.425 -29.078 69.656  1.00 61.28  ? 245 VAL B N     1 
ATOM   6374  C  CA    . VAL B  2  245 ? -29.454 -29.750 70.949  1.00 71.99  ? 245 VAL B CA    1 
ATOM   6375  C  C     . VAL B  2  245 ? -30.508 -29.091 71.824  1.00 77.84  ? 245 VAL B C     1 
ATOM   6376  O  O     . VAL B  2  245 ? -30.622 -27.860 71.859  1.00 73.71  ? 245 VAL B O     1 
ATOM   6377  C  CB    . VAL B  2  245 ? -28.076 -29.710 71.648  1.00 70.85  ? 245 VAL B CB    1 
ATOM   6378  C  CG1   . VAL B  2  245 ? -28.114 -30.488 72.956  1.00 75.86  ? 245 VAL B CG1   1 
ATOM   6379  C  CG2   . VAL B  2  245 ? -26.987 -30.253 70.734  1.00 69.07  ? 245 VAL B CG2   1 
ATOM   6380  N  N     . LEU B  2  246 ? -31.270 -29.913 72.538  1.00 76.28  ? 246 LEU B N     1 
ATOM   6381  C  CA    . LEU B  2  246 ? -32.326 -29.596 73.485  1.00 69.58  ? 246 LEU B CA    1 
ATOM   6382  C  C     . LEU B  2  246 ? -31.773 -29.604 74.904  1.00 75.83  ? 246 LEU B C     1 
ATOM   6383  O  O     . LEU B  2  246 ? -31.004 -30.503 75.265  1.00 75.64  ? 246 LEU B O     1 
ATOM   6384  C  CB    . LEU B  2  246 ? -33.476 -30.596 73.368  1.00 62.12  ? 246 LEU B CB    1 
ATOM   6385  C  CG    . LEU B  2  246 ? -34.079 -30.686 71.962  1.00 53.23  ? 246 LEU B CG    1 
ATOM   6386  C  CD1   . LEU B  2  246 ? -35.255 -31.651 71.928  1.00 52.52  ? 246 LEU B CD1   1 
ATOM   6387  C  CD2   . LEU B  2  246 ? -34.492 -29.308 71.455  1.00 52.22  ? 246 LEU B CD2   1 
ATOM   6388  N  N     . PRO B  2  247 ? -32.139 -28.621 75.724  1.00 68.36  ? 247 PRO B N     1 
ATOM   6389  C  CA    . PRO B  2  247 ? -31.561 -28.521 77.070  1.00 68.98  ? 247 PRO B CA    1 
ATOM   6390  C  C     . PRO B  2  247 ? -31.914 -29.709 77.952  1.00 70.48  ? 247 PRO B C     1 
ATOM   6391  O  O     . PRO B  2  247 ? -32.746 -30.559 77.627  1.00 66.43  ? 247 PRO B O     1 
ATOM   6392  C  CB    . PRO B  2  247 ? -32.165 -27.222 77.617  1.00 64.95  ? 247 PRO B CB    1 
ATOM   6393  C  CG    . PRO B  2  247 ? -33.425 -27.035 76.837  1.00 52.53  ? 247 PRO B CG    1 
ATOM   6394  C  CD    . PRO B  2  247 ? -33.122 -27.555 75.463  1.00 57.34  ? 247 PRO B CD    1 
ATOM   6395  N  N     . GLU B  2  248 ? -31.234 -29.757 79.096  1.00 74.19  ? 248 GLU B N     1 
ATOM   6396  C  CA    . GLU B  2  248 ? -31.409 -30.801 80.101  1.00 83.33  ? 248 GLU B CA    1 
ATOM   6397  C  C     . GLU B  2  248 ? -31.643 -30.088 81.423  1.00 86.03  ? 248 GLU B C     1 
ATOM   6398  O  O     . GLU B  2  248 ? -30.744 -29.406 81.929  1.00 93.93  ? 248 GLU B O     1 
ATOM   6399  C  CB    . GLU B  2  248 ? -30.183 -31.712 80.181  1.00 94.67  ? 248 GLU B CB    1 
ATOM   6400  C  CG    . GLU B  2  248 ? -29.706 -32.250 78.843  1.00 108.62 ? 248 GLU B CG    1 
ATOM   6401  C  CD    . GLU B  2  248 ? -30.455 -33.492 78.411  1.00 120.18 ? 248 GLU B CD    1 
ATOM   6402  O  OE1   . GLU B  2  248 ? -30.252 -34.556 79.032  1.00 119.83 ? 248 GLU B OE1   1 
ATOM   6403  O  OE2   . GLU B  2  248 ? -31.249 -33.402 77.453  1.00 129.73 ? 248 GLU B OE2   1 
ATOM   6404  N  N     . LYS B  2  249 ? -32.840 -30.238 81.985  1.00 75.28  ? 249 LYS B N     1 
ATOM   6405  C  CA    . LYS B  2  249 ? -33.208 -29.503 83.185  1.00 81.63  ? 249 LYS B CA    1 
ATOM   6406  C  C     . LYS B  2  249 ? -33.895 -30.433 84.173  1.00 86.90  ? 249 LYS B C     1 
ATOM   6407  O  O     . LYS B  2  249 ? -34.598 -31.371 83.788  1.00 87.55  ? 249 LYS B O     1 
ATOM   6408  C  CB    . LYS B  2  249 ? -34.127 -28.312 82.860  1.00 86.72  ? 249 LYS B CB    1 
ATOM   6409  C  CG    . LYS B  2  249 ? -33.920 -27.721 81.469  1.00 79.24  ? 249 LYS B CG    1 
ATOM   6410  C  CD    . LYS B  2  249 ? -34.338 -26.261 81.389  1.00 71.26  ? 249 LYS B CD    1 
ATOM   6411  C  CE    . LYS B  2  249 ? -33.341 -25.365 82.106  1.00 70.16  ? 249 LYS B CE    1 
ATOM   6412  N  NZ    . LYS B  2  249 ? -33.604 -23.922 81.847  1.00 73.47  ? 249 LYS B NZ    1 
ATOM   6413  N  N     . ASP B  2  250 ? -33.686 -30.155 85.460  1.00 91.94  ? 250 ASP B N     1 
ATOM   6414  C  CA    . ASP B  2  250 ? -34.362 -30.918 86.503  1.00 97.65  ? 250 ASP B CA    1 
ATOM   6415  C  C     . ASP B  2  250 ? -35.824 -30.505 86.608  1.00 93.79  ? 250 ASP B C     1 
ATOM   6416  O  O     . ASP B  2  250 ? -36.717 -31.357 86.682  1.00 100.06 ? 250 ASP B O     1 
ATOM   6417  C  CB    . ASP B  2  250 ? -33.650 -30.733 87.844  1.00 110.60 ? 250 ASP B CB    1 
ATOM   6418  C  CG    . ASP B  2  250 ? -32.201 -31.179 87.801  1.00 127.64 ? 250 ASP B CG    1 
ATOM   6419  O  OD1   . ASP B  2  250 ? -31.420 -30.761 88.682  1.00 131.21 ? 250 ASP B OD1   1 
ATOM   6420  O  OD2   . ASP B  2  250 ? -31.842 -31.941 86.880  1.00 132.32 ? 250 ASP B OD2   1 
ATOM   6421  N  N     . SER B  2  251 ? -36.084 -29.201 86.616  1.00 83.01  ? 251 SER B N     1 
ATOM   6422  C  CA    . SER B  2  251 ? -37.434 -28.666 86.604  1.00 80.67  ? 251 SER B CA    1 
ATOM   6423  C  C     . SER B  2  251 ? -37.594 -27.726 85.417  1.00 81.72  ? 251 SER B C     1 
ATOM   6424  O  O     . SER B  2  251 ? -36.627 -27.111 84.956  1.00 84.68  ? 251 SER B O     1 
ATOM   6425  C  CB    . SER B  2  251 ? -37.749 -27.928 87.910  1.00 79.93  ? 251 SER B CB    1 
ATOM   6426  O  OG    . SER B  2  251 ? -36.750 -26.967 88.204  1.00 83.56  ? 251 SER B OG    1 
ATOM   6427  N  N     . TRP B  2  252 ? -38.827 -27.616 84.929  1.00 78.48  ? 252 TRP B N     1 
ATOM   6428  C  CA    . TRP B  2  252 ? -39.139 -26.845 83.732  1.00 64.03  ? 252 TRP B CA    1 
ATOM   6429  C  C     . TRP B  2  252 ? -40.175 -25.786 84.073  1.00 60.46  ? 252 TRP B C     1 
ATOM   6430  O  O     . TRP B  2  252 ? -41.304 -26.117 84.451  1.00 66.53  ? 252 TRP B O     1 
ATOM   6431  C  CB    . TRP B  2  252 ? -39.655 -27.752 82.613  1.00 58.64  ? 252 TRP B CB    1 
ATOM   6432  C  CG    . TRP B  2  252 ? -38.629 -28.698 82.069  1.00 65.87  ? 252 TRP B CG    1 
ATOM   6433  C  CD1   . TRP B  2  252 ? -38.224 -29.878 82.624  1.00 73.27  ? 252 TRP B CD1   1 
ATOM   6434  C  CD2   . TRP B  2  252 ? -37.887 -28.552 80.852  1.00 76.78  ? 252 TRP B CD2   1 
ATOM   6435  N  NE1   . TRP B  2  252 ? -37.271 -30.472 81.830  1.00 80.84  ? 252 TRP B NE1   1 
ATOM   6436  C  CE2   . TRP B  2  252 ? -37.047 -29.678 80.736  1.00 78.32  ? 252 TRP B CE2   1 
ATOM   6437  C  CE3   . TRP B  2  252 ? -37.849 -27.577 79.850  1.00 73.29  ? 252 TRP B CE3   1 
ATOM   6438  C  CZ2   . TRP B  2  252 ? -36.180 -29.856 79.659  1.00 74.11  ? 252 TRP B CZ2   1 
ATOM   6439  C  CZ3   . TRP B  2  252 ? -36.987 -27.756 78.781  1.00 62.36  ? 252 TRP B CZ3   1 
ATOM   6440  C  CH2   . TRP B  2  252 ? -36.164 -28.886 78.695  1.00 67.06  ? 252 TRP B CH2   1 
ATOM   6441  N  N     . THR B  2  253 ? -39.795 -24.519 83.932  1.00 52.61  ? 253 THR B N     1 
ATOM   6442  C  CA    . THR B  2  253 ? -40.748 -23.431 84.060  1.00 52.30  ? 253 THR B CA    1 
ATOM   6443  C  C     . THR B  2  253 ? -41.588 -23.312 82.790  1.00 52.25  ? 253 THR B C     1 
ATOM   6444  O  O     . THR B  2  253 ? -41.291 -23.916 81.756  1.00 57.11  ? 253 THR B O     1 
ATOM   6445  C  CB    . THR B  2  253 ? -40.028 -22.113 84.344  1.00 44.84  ? 253 THR B CB    1 
ATOM   6446  O  OG1   . THR B  2  253 ? -39.246 -21.739 83.201  1.00 43.83  ? 253 THR B OG1   1 
ATOM   6447  C  CG2   . THR B  2  253 ? -39.112 -22.256 85.552  1.00 44.12  ? 253 THR B CG2   1 
ATOM   6448  N  N     . VAL B  2  254 ? -42.673 -22.538 82.889  1.00 54.07  ? 254 VAL B N     1 
ATOM   6449  C  CA    . VAL B  2  254 ? -43.494 -22.244 81.715  1.00 53.17  ? 254 VAL B CA    1 
ATOM   6450  C  C     . VAL B  2  254 ? -42.637 -21.634 80.613  1.00 52.17  ? 254 VAL B C     1 
ATOM   6451  O  O     . VAL B  2  254 ? -42.719 -22.029 79.444  1.00 52.00  ? 254 VAL B O     1 
ATOM   6452  C  CB    . VAL B  2  254 ? -44.669 -21.325 82.097  1.00 53.84  ? 254 VAL B CB    1 
ATOM   6453  C  CG1   . VAL B  2  254 ? -45.371 -20.806 80.850  1.00 37.76  ? 254 VAL B CG1   1 
ATOM   6454  C  CG2   . VAL B  2  254 ? -45.649 -22.069 82.991  1.00 44.38  ? 254 VAL B CG2   1 
ATOM   6455  N  N     . ASN B  2  255 ? -41.817 -20.644 80.972  1.00 53.36  ? 255 ASN B N     1 
ATOM   6456  C  CA    . ASN B  2  255 ? -40.920 -20.017 80.006  1.00 45.15  ? 255 ASN B CA    1 
ATOM   6457  C  C     . ASN B  2  255 ? -40.005 -21.049 79.353  1.00 51.65  ? 255 ASN B C     1 
ATOM   6458  O  O     . ASN B  2  255 ? -39.804 -21.031 78.134  1.00 53.35  ? 255 ASN B O     1 
ATOM   6459  C  CB    . ASN B  2  255 ? -40.108 -18.917 80.688  1.00 44.18  ? 255 ASN B CB    1 
ATOM   6460  C  CG    . ASN B  2  255 ? -39.209 -18.172 79.723  1.00 50.45  ? 255 ASN B CG    1 
ATOM   6461  O  OD1   . ASN B  2  255 ? -37.992 -18.128 79.900  1.00 54.45  ? 255 ASN B OD1   1 
ATOM   6462  N  ND2   . ASN B  2  255 ? -39.805 -17.589 78.687  1.00 56.48  ? 255 ASN B ND2   1 
ATOM   6463  N  N     . ASP B  2  256 ? -39.415 -21.937 80.160  1.00 49.34  ? 256 ASP B N     1 
ATOM   6464  C  CA    . ASP B  2  256 ? -38.580 -23.011 79.625  1.00 43.63  ? 256 ASP B CA    1 
ATOM   6465  C  C     . ASP B  2  256 ? -39.305 -23.800 78.541  1.00 44.16  ? 256 ASP B C     1 
ATOM   6466  O  O     . ASP B  2  256 ? -38.774 -24.005 77.443  1.00 39.59  ? 256 ASP B O     1 
ATOM   6467  C  CB    . ASP B  2  256 ? -38.137 -23.949 80.751  1.00 54.87  ? 256 ASP B CB    1 
ATOM   6468  C  CG    . ASP B  2  256 ? -37.061 -23.344 81.624  1.00 61.30  ? 256 ASP B CG    1 
ATOM   6469  O  OD1   . ASP B  2  256 ? -36.394 -22.390 81.171  1.00 69.01  ? 256 ASP B OD1   1 
ATOM   6470  O  OD2   . ASP B  2  256 ? -36.876 -23.827 82.760  1.00 61.03  ? 256 ASP B OD2   1 
ATOM   6471  N  N     . ILE B  2  257 ? -40.523 -24.258 78.838  1.00 49.88  ? 257 ILE B N     1 
ATOM   6472  C  CA    . ILE B  2  257 ? -41.274 -25.054 77.872  1.00 48.46  ? 257 ILE B CA    1 
ATOM   6473  C  C     . ILE B  2  257 ? -41.705 -24.203 76.683  1.00 54.74  ? 257 ILE B C     1 
ATOM   6474  O  O     . ILE B  2  257 ? -41.811 -24.709 75.559  1.00 52.77  ? 257 ILE B O     1 
ATOM   6475  C  CB    . ILE B  2  257 ? -42.475 -25.725 78.564  1.00 42.88  ? 257 ILE B CB    1 
ATOM   6476  C  CG1   . ILE B  2  257 ? -42.002 -26.532 79.777  1.00 43.73  ? 257 ILE B CG1   1 
ATOM   6477  C  CG2   . ILE B  2  257 ? -43.222 -26.626 77.593  1.00 44.05  ? 257 ILE B CG2   1 
ATOM   6478  C  CD1   . ILE B  2  257 ? -43.121 -27.179 80.564  1.00 54.23  ? 257 ILE B CD1   1 
ATOM   6479  N  N     . GLN B  2  258 ? -41.948 -22.907 76.893  1.00 52.14  ? 258 GLN B N     1 
ATOM   6480  C  CA    . GLN B  2  258 ? -42.280 -22.035 75.770  1.00 48.60  ? 258 GLN B CA    1 
ATOM   6481  C  C     . GLN B  2  258 ? -41.089 -21.895 74.830  1.00 49.01  ? 258 GLN B C     1 
ATOM   6482  O  O     . GLN B  2  258 ? -41.235 -21.987 73.605  1.00 54.73  ? 258 GLN B O     1 
ATOM   6483  C  CB    . GLN B  2  258 ? -42.740 -20.667 76.276  1.00 57.63  ? 258 GLN B CB    1 
ATOM   6484  C  CG    . GLN B  2  258 ? -44.134 -20.660 76.887  1.00 63.45  ? 258 GLN B CG    1 
ATOM   6485  C  CD    . GLN B  2  258 ? -44.521 -19.299 77.435  1.00 58.04  ? 258 GLN B CD    1 
ATOM   6486  O  OE1   . GLN B  2  258 ? -43.724 -18.361 77.414  1.00 65.90  ? 258 GLN B OE1   1 
ATOM   6487  N  NE2   . GLN B  2  258 ? -45.750 -19.184 77.928  1.00 68.88  ? 258 GLN B NE2   1 
ATOM   6488  N  N     . LYS B  2  259 ? -39.901 -21.657 75.392  1.00 49.93  ? 259 LYS B N     1 
ATOM   6489  C  CA    . LYS B  2  259 ? -38.681 -21.645 74.591  1.00 40.60  ? 259 LYS B CA    1 
ATOM   6490  C  C     . LYS B  2  259 ? -38.517 -22.958 73.836  1.00 40.12  ? 259 LYS B C     1 
ATOM   6491  O  O     . LYS B  2  259 ? -38.178 -22.969 72.646  1.00 39.89  ? 259 LYS B O     1 
ATOM   6492  C  CB    . LYS B  2  259 ? -37.469 -21.383 75.486  1.00 34.58  ? 259 LYS B CB    1 
ATOM   6493  C  CG    . LYS B  2  259 ? -36.762 -20.070 75.205  1.00 45.88  ? 259 LYS B CG    1 
ATOM   6494  C  CD    . LYS B  2  259 ? -37.514 -18.896 75.806  1.00 46.78  ? 259 LYS B CD    1 
ATOM   6495  C  CE    . LYS B  2  259 ? -37.061 -17.582 75.192  1.00 63.54  ? 259 LYS B CE    1 
ATOM   6496  N  NZ    . LYS B  2  259 ? -37.438 -16.408 76.032  1.00 76.25  ? 259 LYS B NZ    1 
ATOM   6497  N  N     . LEU B  2  260 ? -38.732 -24.079 74.527  1.00 45.35  ? 260 LEU B N     1 
ATOM   6498  C  CA    . LEU B  2  260 ? -38.528 -25.388 73.916  1.00 45.56  ? 260 LEU B CA    1 
ATOM   6499  C  C     . LEU B  2  260 ? -39.491 -25.621 72.756  1.00 44.97  ? 260 LEU B C     1 
ATOM   6500  O  O     . LEU B  2  260 ? -39.099 -26.163 71.716  1.00 50.27  ? 260 LEU B O     1 
ATOM   6501  C  CB    . LEU B  2  260 ? -38.682 -26.480 74.975  1.00 44.92  ? 260 LEU B CB    1 
ATOM   6502  C  CG    . LEU B  2  260 ? -38.534 -27.937 74.531  1.00 48.89  ? 260 LEU B CG    1 
ATOM   6503  C  CD1   . LEU B  2  260 ? -37.183 -28.176 73.873  1.00 62.50  ? 260 LEU B CD1   1 
ATOM   6504  C  CD2   . LEU B  2  260 ? -38.727 -28.875 75.713  1.00 48.42  ? 260 LEU B CD2   1 
ATOM   6505  N  N     . VAL B  2  261 ? -40.753 -25.217 72.912  1.00 46.08  ? 261 VAL B N     1 
ATOM   6506  C  CA    . VAL B  2  261 ? -41.745 -25.468 71.869  1.00 46.37  ? 261 VAL B CA    1 
ATOM   6507  C  C     . VAL B  2  261 ? -41.443 -24.637 70.628  1.00 45.33  ? 261 VAL B C     1 
ATOM   6508  O  O     . VAL B  2  261 ? -41.597 -25.110 69.495  1.00 50.33  ? 261 VAL B O     1 
ATOM   6509  C  CB    . VAL B  2  261 ? -43.164 -25.202 72.408  1.00 48.25  ? 261 VAL B CB    1 
ATOM   6510  C  CG1   . VAL B  2  261 ? -44.179 -25.175 71.273  1.00 46.76  ? 261 VAL B CG1   1 
ATOM   6511  C  CG2   . VAL B  2  261 ? -43.548 -26.261 73.427  1.00 47.41  ? 261 VAL B CG2   1 
ATOM   6512  N  N     . GLY B  2  262 ? -40.994 -23.394 70.815  1.00 41.19  ? 262 GLY B N     1 
ATOM   6513  C  CA    . GLY B  2  262 ? -40.663 -22.563 69.668  1.00 49.25  ? 262 GLY B CA    1 
ATOM   6514  C  C     . GLY B  2  262 ? -39.459 -23.083 68.907  1.00 53.60  ? 262 GLY B C     1 
ATOM   6515  O  O     . GLY B  2  262 ? -39.456 -23.109 67.673  1.00 45.24  ? 262 GLY B O     1 
ATOM   6516  N  N     . LYS B  2  263 ? -38.412 -23.480 69.633  1.00 46.17  ? 263 LYS B N     1 
ATOM   6517  C  CA    . LYS B  2  263 ? -37.260 -24.127 69.012  1.00 39.97  ? 263 LYS B CA    1 
ATOM   6518  C  C     . LYS B  2  263 ? -37.691 -25.348 68.208  1.00 50.46  ? 263 LYS B C     1 
ATOM   6519  O  O     . LYS B  2  263 ? -37.424 -25.444 67.005  1.00 53.94  ? 263 LYS B O     1 
ATOM   6520  C  CB    . LYS B  2  263 ? -36.241 -24.508 70.088  1.00 42.65  ? 263 LYS B CB    1 
ATOM   6521  C  CG    . LYS B  2  263 ? -34.904 -24.984 69.548  1.00 52.53  ? 263 LYS B CG    1 
ATOM   6522  C  CD    . LYS B  2  263 ? -33.870 -25.066 70.662  1.00 51.07  ? 263 LYS B CD    1 
ATOM   6523  C  CE    . LYS B  2  263 ? -32.498 -25.439 70.129  1.00 52.31  ? 263 LYS B CE    1 
ATOM   6524  N  NZ    . LYS B  2  263 ? -31.459 -25.376 71.195  1.00 56.76  ? 263 LYS B NZ    1 
ATOM   6525  N  N     . LEU B  2  264 ? -38.350 -26.302 68.873  1.00 55.11  ? 264 LEU B N     1 
ATOM   6526  C  CA    . LEU B  2  264 ? -38.858 -27.495 68.199  1.00 55.34  ? 264 LEU B CA    1 
ATOM   6527  C  C     . LEU B  2  264 ? -39.722 -27.147 66.992  1.00 55.46  ? 264 LEU B C     1 
ATOM   6528  O  O     . LEU B  2  264 ? -39.596 -27.771 65.932  1.00 54.68  ? 264 LEU B O     1 
ATOM   6529  C  CB    . LEU B  2  264 ? -39.641 -28.358 69.188  1.00 51.82  ? 264 LEU B CB    1 
ATOM   6530  C  CG    . LEU B  2  264 ? -38.803 -29.035 70.273  1.00 49.11  ? 264 LEU B CG    1 
ATOM   6531  C  CD1   . LEU B  2  264 ? -39.695 -29.557 71.384  1.00 48.48  ? 264 LEU B CD1   1 
ATOM   6532  C  CD2   . LEU B  2  264 ? -37.970 -30.162 69.681  1.00 56.36  ? 264 LEU B CD2   1 
ATOM   6533  N  N     . ASN B  2  265 ? -40.617 -26.164 67.135  1.00 57.95  ? 265 ASN B N     1 
ATOM   6534  C  CA    . ASN B  2  265 ? -41.469 -25.783 66.011  1.00 57.35  ? 265 ASN B CA    1 
ATOM   6535  C  C     . ASN B  2  265 ? -40.638 -25.321 64.821  1.00 52.08  ? 265 ASN B C     1 
ATOM   6536  O  O     . ASN B  2  265 ? -40.940 -25.668 63.672  1.00 57.46  ? 265 ASN B O     1 
ATOM   6537  C  CB    . ASN B  2  265 ? -42.453 -24.694 66.434  1.00 62.46  ? 265 ASN B CB    1 
ATOM   6538  C  CG    . ASN B  2  265 ? -43.440 -24.353 65.339  1.00 61.79  ? 265 ASN B CG    1 
ATOM   6539  O  OD1   . ASN B  2  265 ? -44.228 -25.199 64.920  1.00 72.19  ? 265 ASN B OD1   1 
ATOM   6540  N  ND2   . ASN B  2  265 ? -43.402 -23.112 64.870  1.00 47.09  ? 265 ASN B ND2   1 
ATOM   6541  N  N     . TRP B  2  266 ? -39.593 -24.532 65.072  1.00 45.90  ? 266 TRP B N     1 
ATOM   6542  C  CA    . TRP B  2  266 ? -38.714 -24.116 63.985  1.00 53.63  ? 266 TRP B CA    1 
ATOM   6543  C  C     . TRP B  2  266 ? -37.910 -25.299 63.463  1.00 56.23  ? 266 TRP B C     1 
ATOM   6544  O  O     . TRP B  2  266 ? -37.741 -25.458 62.248  1.00 67.05  ? 266 TRP B O     1 
ATOM   6545  C  CB    . TRP B  2  266 ? -37.785 -22.996 64.449  1.00 61.16  ? 266 TRP B CB    1 
ATOM   6546  C  CG    . TRP B  2  266 ? -36.676 -22.707 63.482  1.00 83.03  ? 266 TRP B CG    1 
ATOM   6547  C  CD1   . TRP B  2  266 ? -35.471 -23.339 63.406  1.00 79.34  ? 266 TRP B CD1   1 
ATOM   6548  C  CD2   . TRP B  2  266 ? -36.670 -21.712 62.450  1.00 100.94 ? 266 TRP B CD2   1 
ATOM   6549  N  NE1   . TRP B  2  266 ? -34.716 -22.804 62.392  1.00 85.58  ? 266 TRP B NE1   1 
ATOM   6550  C  CE2   . TRP B  2  266 ? -35.428 -21.801 61.791  1.00 96.22  ? 266 TRP B CE2   1 
ATOM   6551  C  CE3   . TRP B  2  266 ? -37.593 -20.753 62.023  1.00 113.31 ? 266 TRP B CE3   1 
ATOM   6552  C  CZ2   . TRP B  2  266 ? -35.086 -20.970 60.726  1.00 104.46 ? 266 TRP B CZ2   1 
ATOM   6553  C  CZ3   . TRP B  2  266 ? -37.251 -19.929 60.963  1.00 112.91 ? 266 TRP B CZ3   1 
ATOM   6554  C  CH2   . TRP B  2  266 ? -36.009 -20.043 60.327  1.00 109.75 ? 266 TRP B CH2   1 
ATOM   6555  N  N     . ALA B  2  267 ? -37.383 -26.121 64.374  1.00 47.29  ? 267 ALA B N     1 
ATOM   6556  C  CA    . ALA B  2  267 ? -36.631 -27.306 63.978  1.00 50.49  ? 267 ALA B CA    1 
ATOM   6557  C  C     . ALA B  2  267 ? -37.452 -28.225 63.083  1.00 61.54  ? 267 ALA B C     1 
ATOM   6558  O  O     . ALA B  2  267 ? -36.887 -28.945 62.252  1.00 68.28  ? 267 ALA B O     1 
ATOM   6559  C  CB    . ALA B  2  267 ? -36.150 -28.058 65.219  1.00 41.79  ? 267 ALA B CB    1 
ATOM   6560  N  N     . SER B  2  268 ? -38.779 -28.231 63.246  1.00 66.36  ? 268 SER B N     1 
ATOM   6561  C  CA    . SER B  2  268 ? -39.623 -29.106 62.439  1.00 61.98  ? 268 SER B CA    1 
ATOM   6562  C  C     . SER B  2  268 ? -39.600 -28.733 60.962  1.00 59.64  ? 268 SER B C     1 
ATOM   6563  O  O     . SER B  2  268 ? -40.019 -29.542 60.127  1.00 71.98  ? 268 SER B O     1 
ATOM   6564  C  CB    . SER B  2  268 ? -41.062 -29.081 62.955  1.00 68.32  ? 268 SER B CB    1 
ATOM   6565  O  OG    . SER B  2  268 ? -41.664 -27.819 62.730  1.00 76.42  ? 268 SER B OG    1 
ATOM   6566  N  N     . GLN B  2  269 ? -39.128 -27.531 60.618  1.00 49.68  ? 269 GLN B N     1 
ATOM   6567  C  CA    . GLN B  2  269 ? -38.912 -27.192 59.217  1.00 55.92  ? 269 GLN B CA    1 
ATOM   6568  C  C     . GLN B  2  269 ? -37.750 -27.964 58.612  1.00 64.84  ? 269 GLN B C     1 
ATOM   6569  O  O     . GLN B  2  269 ? -37.583 -27.948 57.388  1.00 75.00  ? 269 GLN B O     1 
ATOM   6570  C  CB    . GLN B  2  269 ? -38.653 -25.693 59.065  1.00 50.24  ? 269 GLN B CB    1 
ATOM   6571  C  CG    . GLN B  2  269 ? -39.778 -24.800 59.549  1.00 47.88  ? 269 GLN B CG    1 
ATOM   6572  C  CD    . GLN B  2  269 ? -39.526 -23.340 59.229  1.00 59.64  ? 269 GLN B CD    1 
ATOM   6573  O  OE1   . GLN B  2  269 ? -38.842 -22.639 59.972  1.00 54.61  ? 269 GLN B OE1   1 
ATOM   6574  N  NE2   . GLN B  2  269 ? -40.071 -22.877 58.110  1.00 70.98  ? 269 GLN B NE2   1 
ATOM   6575  N  N     . ILE B  2  270 ? -36.950 -28.628 59.440  1.00 56.39  ? 270 ILE B N     1 
ATOM   6576  C  CA    . ILE B  2  270 ? -35.763 -29.353 59.001  1.00 56.61  ? 270 ILE B CA    1 
ATOM   6577  C  C     . ILE B  2  270 ? -35.963 -30.856 59.156  1.00 58.67  ? 270 ILE B C     1 
ATOM   6578  O  O     . ILE B  2  270 ? -35.885 -31.607 58.182  1.00 61.43  ? 270 ILE B O     1 
ATOM   6579  C  CB    . ILE B  2  270 ? -34.507 -28.872 59.762  1.00 53.35  ? 270 ILE B CB    1 
ATOM   6580  C  CG1   . ILE B  2  270 ? -34.284 -27.375 59.530  1.00 48.42  ? 270 ILE B CG1   1 
ATOM   6581  C  CG2   . ILE B  2  270 ? -33.288 -29.673 59.339  1.00 55.24  ? 270 ILE B CG2   1 
ATOM   6582  C  CD1   . ILE B  2  270 ? -33.272 -26.753 60.471  1.00 51.04  ? 270 ILE B CD1   1 
ATOM   6583  N  N     . TYR B  2  271 ? -36.223 -31.313 60.380  1.00 54.01  ? 271 TYR B N     1 
ATOM   6584  C  CA    . TYR B  2  271 ? -36.565 -32.700 60.644  1.00 65.70  ? 271 TYR B CA    1 
ATOM   6585  C  C     . TYR B  2  271 ? -38.078 -32.799 60.763  1.00 75.96  ? 271 TYR B C     1 
ATOM   6586  O  O     . TYR B  2  271 ? -38.635 -32.379 61.789  1.00 76.19  ? 271 TYR B O     1 
ATOM   6587  C  CB    . TYR B  2  271 ? -35.894 -33.187 61.929  1.00 72.80  ? 271 TYR B CB    1 
ATOM   6588  C  CG    . TYR B  2  271 ? -34.420 -32.847 62.038  1.00 72.49  ? 271 TYR B CG    1 
ATOM   6589  C  CD1   . TYR B  2  271 ? -33.445 -33.799 61.771  1.00 72.20  ? 271 TYR B CD1   1 
ATOM   6590  C  CD2   . TYR B  2  271 ? -34.004 -31.574 62.415  1.00 72.06  ? 271 TYR B CD2   1 
ATOM   6591  C  CE1   . TYR B  2  271 ? -32.099 -33.493 61.872  1.00 74.61  ? 271 TYR B CE1   1 
ATOM   6592  C  CE2   . TYR B  2  271 ? -32.662 -31.259 62.516  1.00 72.63  ? 271 TYR B CE2   1 
ATOM   6593  C  CZ    . TYR B  2  271 ? -31.714 -32.222 62.245  1.00 78.57  ? 271 TYR B CZ    1 
ATOM   6594  O  OH    . TYR B  2  271 ? -30.376 -31.914 62.346  1.00 85.42  ? 271 TYR B OH    1 
ATOM   6595  N  N     . PRO B  2  272 ? -38.784 -33.336 59.763  1.00 85.62  ? 272 PRO B N     1 
ATOM   6596  C  CA    . PRO B  2  272 ? -40.257 -33.303 59.796  1.00 93.30  ? 272 PRO B CA    1 
ATOM   6597  C  C     . PRO B  2  272 ? -40.876 -34.173 60.878  1.00 94.20  ? 272 PRO B C     1 
ATOM   6598  O  O     . PRO B  2  272 ? -42.077 -34.031 61.143  1.00 91.33  ? 272 PRO B O     1 
ATOM   6599  C  CB    . PRO B  2  272 ? -40.651 -33.806 58.399  1.00 98.50  ? 272 PRO B CB    1 
ATOM   6600  C  CG    . PRO B  2  272 ? -39.422 -33.629 57.557  1.00 98.41  ? 272 PRO B CG    1 
ATOM   6601  C  CD    . PRO B  2  272 ? -38.271 -33.853 58.485  1.00 92.46  ? 272 PRO B CD    1 
ATOM   6602  N  N     . GLY B  2  273 ? -40.110 -35.059 61.507  1.00 94.07  ? 273 GLY B N     1 
ATOM   6603  C  CA    . GLY B  2  273 ? -40.613 -35.923 62.556  1.00 90.86  ? 273 GLY B CA    1 
ATOM   6604  C  C     . GLY B  2  273 ? -40.805 -35.301 63.921  1.00 85.98  ? 273 GLY B C     1 
ATOM   6605  O  O     . GLY B  2  273 ? -41.251 -35.996 64.837  1.00 85.87  ? 273 GLY B O     1 
ATOM   6606  N  N     . ILE B  2  274 ? -40.476 -34.021 64.100  1.00 86.15  ? 274 ILE B N     1 
ATOM   6607  C  CA    . ILE B  2  274 ? -40.631 -33.385 65.404  1.00 79.79  ? 274 ILE B CA    1 
ATOM   6608  C  C     . ILE B  2  274 ? -42.108 -33.207 65.739  1.00 79.70  ? 274 ILE B C     1 
ATOM   6609  O  O     . ILE B  2  274 ? -42.918 -32.817 64.887  1.00 80.52  ? 274 ILE B O     1 
ATOM   6610  C  CB    . ILE B  2  274 ? -39.887 -32.038 65.423  1.00 78.96  ? 274 ILE B CB    1 
ATOM   6611  C  CG1   . ILE B  2  274 ? -38.403 -32.247 65.114  1.00 78.21  ? 274 ILE B CG1   1 
ATOM   6612  C  CG2   . ILE B  2  274 ? -40.057 -31.342 66.765  1.00 79.13  ? 274 ILE B CG2   1 
ATOM   6613  C  CD1   . ILE B  2  274 ? -37.681 -33.123 66.118  1.00 76.00  ? 274 ILE B CD1   1 
ATOM   6614  N  N     . LYS B  2  275 ? -42.462 -33.492 66.994  1.00 78.83  ? 275 LYS B N     1 
ATOM   6615  C  CA    . LYS B  2  275 ? -43.823 -33.351 67.501  1.00 85.63  ? 275 LYS B CA    1 
ATOM   6616  C  C     . LYS B  2  275 ? -43.789 -32.528 68.780  1.00 86.96  ? 275 LYS B C     1 
ATOM   6617  O  O     . LYS B  2  275 ? -42.945 -32.765 69.650  1.00 88.92  ? 275 LYS B O     1 
ATOM   6618  C  CB    . LYS B  2  275 ? -44.469 -34.717 67.746  1.00 92.29  ? 275 LYS B CB    1 
ATOM   6619  C  CG    . LYS B  2  275 ? -44.940 -35.386 66.469  1.00 101.46 ? 275 LYS B CG    1 
ATOM   6620  C  CD    . LYS B  2  275 ? -45.938 -34.497 65.742  1.00 103.35 ? 275 LYS B CD    1 
ATOM   6621  C  CE    . LYS B  2  275 ? -46.160 -34.961 64.315  1.00 102.13 ? 275 LYS B CE    1 
ATOM   6622  N  NZ    . LYS B  2  275 ? -44.916 -34.840 63.507  1.00 87.22  ? 275 LYS B NZ    1 
ATOM   6623  N  N     . VAL B  2  276 ? -44.704 -31.565 68.894  1.00 83.05  ? 276 VAL B N     1 
ATOM   6624  C  CA    . VAL B  2  276 ? -44.814 -30.730 70.089  1.00 78.75  ? 276 VAL B CA    1 
ATOM   6625  C  C     . VAL B  2  276 ? -46.082 -30.971 70.898  1.00 78.85  ? 276 VAL B C     1 
ATOM   6626  O  O     . VAL B  2  276 ? -46.197 -30.410 72.001  1.00 70.62  ? 276 VAL B O     1 
ATOM   6627  C  CB    . VAL B  2  276 ? -44.706 -29.231 69.737  1.00 77.77  ? 276 VAL B CB    1 
ATOM   6628  C  CG1   . VAL B  2  276 ? -43.275 -28.873 69.378  1.00 77.03  ? 276 VAL B CG1   1 
ATOM   6629  C  CG2   . VAL B  2  276 ? -45.647 -28.888 68.592  1.00 82.66  ? 276 VAL B CG2   1 
ATOM   6630  N  N     . ARG B  2  277 ? -47.043 -31.751 70.388  1.00 84.05  ? 277 ARG B N     1 
ATOM   6631  C  CA    . ARG B  2  277 ? -48.357 -31.856 71.027  1.00 84.32  ? 277 ARG B CA    1 
ATOM   6632  C  C     . ARG B  2  277 ? -48.262 -32.163 72.524  1.00 85.28  ? 277 ARG B C     1 
ATOM   6633  O  O     . ARG B  2  277 ? -48.846 -31.451 73.348  1.00 83.09  ? 277 ARG B O     1 
ATOM   6634  C  CB    . ARG B  2  277 ? -49.223 -32.894 70.298  1.00 94.11  ? 277 ARG B CB    1 
ATOM   6635  C  CG    . ARG B  2  277 ? -48.791 -34.349 70.417  1.00 108.57 ? 277 ARG B CG    1 
ATOM   6636  C  CD    . ARG B  2  277 ? -49.562 -35.224 69.451  1.00 121.45 ? 277 ARG B CD    1 
ATOM   6637  N  NE    . ARG B  2  277 ? -49.237 -34.885 68.070  1.00 128.02 ? 277 ARG B NE    1 
ATOM   6638  C  CZ    . ARG B  2  277 ? -49.639 -35.581 67.013  1.00 125.90 ? 277 ARG B CZ    1 
ATOM   6639  N  NH1   . ARG B  2  277 ? -50.388 -36.663 67.174  1.00 122.66 ? 277 ARG B NH1   1 
ATOM   6640  N  NH2   . ARG B  2  277 ? -49.290 -35.196 65.794  1.00 120.64 ? 277 ARG B NH2   1 
ATOM   6641  N  N     . GLN B  2  278 ? -47.538 -33.225 72.896  1.00 84.53  ? 278 GLN B N     1 
ATOM   6642  C  CA    . GLN B  2  278 ? -47.446 -33.599 74.306  1.00 81.64  ? 278 GLN B CA    1 
ATOM   6643  C  C     . GLN B  2  278 ? -46.760 -32.525 75.141  1.00 81.10  ? 278 GLN B C     1 
ATOM   6644  O  O     . GLN B  2  278 ? -47.040 -32.399 76.338  1.00 85.44  ? 278 GLN B O     1 
ATOM   6645  C  CB    . GLN B  2  278 ? -46.725 -34.938 74.455  1.00 86.75  ? 278 GLN B CB    1 
ATOM   6646  C  CG    . GLN B  2  278 ? -47.562 -36.119 74.006  1.00 95.98  ? 278 GLN B CG    1 
ATOM   6647  C  CD    . GLN B  2  278 ? -48.971 -36.071 74.568  1.00 98.82  ? 278 GLN B CD    1 
ATOM   6648  O  OE1   . GLN B  2  278 ? -49.167 -35.958 75.778  1.00 99.39  ? 278 GLN B OE1   1 
ATOM   6649  N  NE2   . GLN B  2  278 ? -49.962 -36.140 73.686  1.00 104.62 ? 278 GLN B NE2   1 
ATOM   6650  N  N     . LEU B  2  279 ? -45.864 -31.746 74.536  1.00 78.78  ? 279 LEU B N     1 
ATOM   6651  C  CA    . LEU B  2  279 ? -45.208 -30.671 75.271  1.00 71.65  ? 279 LEU B CA    1 
ATOM   6652  C  C     . LEU B  2  279 ? -46.100 -29.438 75.350  1.00 74.08  ? 279 LEU B C     1 
ATOM   6653  O  O     . LEU B  2  279 ? -46.091 -28.726 76.360  1.00 78.13  ? 279 LEU B O     1 
ATOM   6654  C  CB    . LEU B  2  279 ? -43.864 -30.338 74.625  1.00 64.62  ? 279 LEU B CB    1 
ATOM   6655  C  CG    . LEU B  2  279 ? -42.771 -31.376 74.894  1.00 69.06  ? 279 LEU B CG    1 
ATOM   6656  C  CD1   . LEU B  2  279 ? -41.658 -31.277 73.868  1.00 66.47  ? 279 LEU B CD1   1 
ATOM   6657  C  CD2   . LEU B  2  279 ? -42.219 -31.210 76.302  1.00 59.80  ? 279 LEU B CD2   1 
ATOM   6658  N  N     . SER B  2  280 ? -46.859 -29.164 74.286  1.00 72.72  ? 280 SER B N     1 
ATOM   6659  C  CA    . SER B  2  280 ? -47.816 -28.062 74.317  1.00 69.87  ? 280 SER B CA    1 
ATOM   6660  C  C     . SER B  2  280 ? -48.862 -28.274 75.405  1.00 78.20  ? 280 SER B C     1 
ATOM   6661  O  O     . SER B  2  280 ? -49.280 -27.318 76.069  1.00 74.62  ? 280 SER B O     1 
ATOM   6662  C  CB    . SER B  2  280 ? -48.484 -27.910 72.951  1.00 75.87  ? 280 SER B CB    1 
ATOM   6663  O  OG    . SER B  2  280 ? -47.518 -27.765 71.925  1.00 82.53  ? 280 SER B OG    1 
ATOM   6664  N  N     . LYS B  2  281 ? -49.316 -29.522 75.579  1.00 84.12  ? 281 LYS B N     1 
ATOM   6665  C  CA    . LYS B  2  281 ? -50.272 -29.862 76.632  1.00 81.62  ? 281 LYS B CA    1 
ATOM   6666  C  C     . LYS B  2  281 ? -49.886 -29.290 77.991  1.00 79.52  ? 281 LYS B C     1 
ATOM   6667  O  O     . LYS B  2  281 ? -50.762 -28.988 78.808  1.00 88.22  ? 281 LYS B O     1 
ATOM   6668  C  CB    . LYS B  2  281 ? -50.405 -31.383 76.740  1.00 80.00  ? 281 LYS B CB    1 
ATOM   6669  C  CG    . LYS B  2  281 ? -51.632 -31.974 76.069  1.00 82.70  ? 281 LYS B CG    1 
ATOM   6670  C  CD    . LYS B  2  281 ? -51.609 -33.493 76.163  1.00 93.32  ? 281 LYS B CD    1 
ATOM   6671  C  CE    . LYS B  2  281 ? -52.930 -34.105 75.731  1.00 101.22 ? 281 LYS B CE    1 
ATOM   6672  N  NZ    . LYS B  2  281 ? -53.987 -33.907 76.760  1.00 102.49 ? 281 LYS B NZ    1 
ATOM   6673  N  N     . LEU B  2  282 ? -48.587 -29.150 78.260  1.00 70.04  ? 282 LEU B N     1 
ATOM   6674  C  CA    . LEU B  2  282 ? -48.142 -28.605 79.537  1.00 70.67  ? 282 LEU B CA    1 
ATOM   6675  C  C     . LEU B  2  282 ? -48.463 -27.124 79.686  1.00 79.78  ? 282 LEU B C     1 
ATOM   6676  O  O     . LEU B  2  282 ? -48.513 -26.622 80.815  1.00 87.86  ? 282 LEU B O     1 
ATOM   6677  C  CB    . LEU B  2  282 ? -46.640 -28.835 79.695  1.00 69.34  ? 282 LEU B CB    1 
ATOM   6678  C  CG    . LEU B  2  282 ? -46.210 -30.284 79.457  1.00 74.97  ? 282 LEU B CG    1 
ATOM   6679  C  CD1   . LEU B  2  282 ? -44.702 -30.394 79.338  1.00 75.86  ? 282 LEU B CD1   1 
ATOM   6680  C  CD2   . LEU B  2  282 ? -46.732 -31.182 80.570  1.00 70.80  ? 282 LEU B CD2   1 
ATOM   6681  N  N     . LEU B  2  283 ? -48.673 -26.414 78.580  1.00 73.61  ? 283 LEU B N     1 
ATOM   6682  C  CA    . LEU B  2  283 ? -48.842 -24.968 78.581  1.00 74.55  ? 283 LEU B CA    1 
ATOM   6683  C  C     . LEU B  2  283 ? -50.304 -24.538 78.575  1.00 73.21  ? 283 LEU B C     1 
ATOM   6684  O  O     . LEU B  2  283 ? -50.579 -23.352 78.394  1.00 69.30  ? 283 LEU B O     1 
ATOM   6685  C  CB    . LEU B  2  283 ? -48.119 -24.356 77.379  1.00 78.11  ? 283 LEU B CB    1 
ATOM   6686  C  CG    . LEU B  2  283 ? -46.593 -24.455 77.361  1.00 73.19  ? 283 LEU B CG    1 
ATOM   6687  C  CD1   . LEU B  2  283 ? -46.033 -23.921 76.052  1.00 70.91  ? 283 LEU B CD1   1 
ATOM   6688  C  CD2   . LEU B  2  283 ? -46.004 -23.704 78.542  1.00 65.28  ? 283 LEU B CD2   1 
ATOM   6689  N  N     . ARG B  2  284 ? -51.240 -25.468 78.798  1.00 77.61  ? 284 ARG B N     1 
ATOM   6690  C  CA    . ARG B  2  284 ? -52.649 -25.237 78.475  1.00 74.32  ? 284 ARG B CA    1 
ATOM   6691  C  C     . ARG B  2  284 ? -53.218 -23.959 79.090  1.00 72.37  ? 284 ARG B C     1 
ATOM   6692  O  O     . ARG B  2  284 ? -53.971 -23.234 78.430  1.00 79.40  ? 284 ARG B O     1 
ATOM   6693  C  CB    . ARG B  2  284 ? -53.488 -26.439 78.915  1.00 78.00  ? 284 ARG B CB    1 
ATOM   6694  C  CG    . ARG B  2  284 ? -53.432 -27.617 77.962  1.00 84.16  ? 284 ARG B CG    1 
ATOM   6695  C  CD    . ARG B  2  284 ? -54.453 -28.681 78.335  1.00 99.05  ? 284 ARG B CD    1 
ATOM   6696  N  NE    . ARG B  2  284 ? -54.371 -29.845 77.457  1.00 112.46 ? 284 ARG B NE    1 
ATOM   6697  C  CZ    . ARG B  2  284 ? -54.931 -29.915 76.254  1.00 122.97 ? 284 ARG B CZ    1 
ATOM   6698  N  NH1   . ARG B  2  284 ? -55.615 -28.884 75.777  1.00 127.66 ? 284 ARG B NH1   1 
ATOM   6699  N  NH2   . ARG B  2  284 ? -54.804 -31.015 75.524  1.00 124.69 ? 284 ARG B NH2   1 
ATOM   6700  N  N     . GLY B  2  285 ? -52.886 -23.665 80.346  1.00 55.80  ? 285 GLY B N     1 
ATOM   6701  C  CA    . GLY B  2  285 ? -53.526 -22.539 81.010  1.00 67.08  ? 285 GLY B CA    1 
ATOM   6702  C  C     . GLY B  2  285 ? -53.099 -21.155 80.558  1.00 68.25  ? 285 GLY B C     1 
ATOM   6703  O  O     . GLY B  2  285 ? -52.608 -20.984 79.441  1.00 70.63  ? 285 GLY B O     1 
ATOM   6704  N  N     . THR B  2  286 ? -53.284 -20.155 81.418  1.00 65.11  ? 286 THR B N     1 
ATOM   6705  C  CA    . THR B  2  286 ? -52.639 -18.844 81.307  1.00 53.97  ? 286 THR B CA    1 
ATOM   6706  C  C     . THR B  2  286 ? -51.785 -18.654 82.557  1.00 60.50  ? 286 THR B C     1 
ATOM   6707  O  O     . THR B  2  286 ? -52.281 -18.214 83.597  1.00 71.90  ? 286 THR B O     1 
ATOM   6708  C  CB    . THR B  2  286 ? -53.670 -17.715 81.143  1.00 56.34  ? 286 THR B CB    1 
ATOM   6709  O  OG1   . THR B  2  286 ? -54.392 -17.899 79.921  1.00 67.05  ? 286 THR B OG1   1 
ATOM   6710  C  CG2   . THR B  2  286 ? -52.980 -16.357 81.108  1.00 53.99  ? 286 THR B CG2   1 
ATOM   6711  N  N     . LYS B  2  287 ? -50.503 -18.995 82.461  1.00 48.10  ? 287 LYS B N     1 
ATOM   6712  C  CA    . LYS B  2  287 ? -49.674 -19.191 83.640  1.00 44.38  ? 287 LYS B CA    1 
ATOM   6713  C  C     . LYS B  2  287 ? -48.513 -18.207 83.667  1.00 45.49  ? 287 LYS B C     1 
ATOM   6714  O  O     . LYS B  2  287 ? -48.080 -17.683 82.636  1.00 42.60  ? 287 LYS B O     1 
ATOM   6715  C  CB    . LYS B  2  287 ? -49.121 -20.620 83.687  1.00 48.50  ? 287 LYS B CB    1 
ATOM   6716  C  CG    . LYS B  2  287 ? -50.181 -21.702 83.684  1.00 53.24  ? 287 LYS B CG    1 
ATOM   6717  C  CD    . LYS B  2  287 ? -49.613 -23.014 83.174  1.00 67.46  ? 287 LYS B CD    1 
ATOM   6718  C  CE    . LYS B  2  287 ? -50.574 -24.161 83.424  1.00 78.80  ? 287 LYS B CE    1 
ATOM   6719  N  NZ    . LYS B  2  287 ? -50.702 -24.457 84.877  1.00 77.71  ? 287 LYS B NZ    1 
ATOM   6720  N  N     . ALA B  2  288 ? -48.018 -17.965 84.878  1.00 43.38  ? 288 ALA B N     1 
ATOM   6721  C  CA    . ALA B  2  288 ? -46.834 -17.142 85.067  1.00 47.49  ? 288 ALA B CA    1 
ATOM   6722  C  C     . ALA B  2  288 ? -45.610 -17.845 84.492  1.00 45.33  ? 288 ALA B C     1 
ATOM   6723  O  O     . ALA B  2  288 ? -45.488 -19.071 84.568  1.00 48.48  ? 288 ALA B O     1 
ATOM   6724  C  CB    . ALA B  2  288 ? -46.628 -16.837 86.550  1.00 36.47  ? 288 ALA B CB    1 
ATOM   6725  N  N     . LEU B  2  289 ? -44.707 -17.060 83.899  1.00 36.05  ? 289 LEU B N     1 
ATOM   6726  C  CA    . LEU B  2  289 ? -43.579 -17.645 83.181  1.00 42.66  ? 289 LEU B CA    1 
ATOM   6727  C  C     . LEU B  2  289 ? -42.698 -18.482 84.103  1.00 45.55  ? 289 LEU B C     1 
ATOM   6728  O  O     . LEU B  2  289 ? -42.199 -19.541 83.702  1.00 55.07  ? 289 LEU B O     1 
ATOM   6729  C  CB    . LEU B  2  289 ? -42.755 -16.546 82.509  1.00 45.87  ? 289 LEU B CB    1 
ATOM   6730  C  CG    . LEU B  2  289 ? -43.418 -15.787 81.358  1.00 45.01  ? 289 LEU B CG    1 
ATOM   6731  C  CD1   . LEU B  2  289 ? -42.400 -14.935 80.616  1.00 35.13  ? 289 LEU B CD1   1 
ATOM   6732  C  CD2   . LEU B  2  289 ? -44.114 -16.751 80.410  1.00 49.51  ? 289 LEU B CD2   1 
ATOM   6733  N  N     . THR B  2  290 ? -42.493 -18.027 85.337  1.00 40.87  ? 290 THR B N     1 
ATOM   6734  C  CA    . THR B  2  290 ? -41.618 -18.723 86.273  1.00 41.76  ? 290 THR B CA    1 
ATOM   6735  C  C     . THR B  2  290 ? -42.300 -19.870 87.010  1.00 44.35  ? 290 THR B C     1 
ATOM   6736  O  O     . THR B  2  290 ? -41.660 -20.500 87.859  1.00 54.70  ? 290 THR B O     1 
ATOM   6737  C  CB    . THR B  2  290 ? -41.050 -17.730 87.289  1.00 43.55  ? 290 THR B CB    1 
ATOM   6738  O  OG1   . THR B  2  290 ? -42.126 -17.117 88.010  1.00 61.64  ? 290 THR B OG1   1 
ATOM   6739  C  CG2   . THR B  2  290 ? -40.247 -16.654 86.578  1.00 34.27  ? 290 THR B CG2   1 
ATOM   6740  N  N     . GLU B  2  291 ? -43.572 -20.148 86.731  1.00 51.98  ? 291 GLU B N     1 
ATOM   6741  C  CA    . GLU B  2  291 ? -44.239 -21.276 87.369  1.00 58.22  ? 291 GLU B CA    1 
ATOM   6742  C  C     . GLU B  2  291 ? -43.612 -22.582 86.895  1.00 64.83  ? 291 GLU B C     1 
ATOM   6743  O  O     . GLU B  2  291 ? -43.450 -22.804 85.691  1.00 67.66  ? 291 GLU B O     1 
ATOM   6744  C  CB    . GLU B  2  291 ? -45.735 -21.253 87.062  1.00 52.01  ? 291 GLU B CB    1 
ATOM   6745  C  CG    . GLU B  2  291 ? -46.523 -22.380 87.710  1.00 62.03  ? 291 GLU B CG    1 
ATOM   6746  C  CD    . GLU B  2  291 ? -48.024 -22.182 87.600  1.00 73.53  ? 291 GLU B CD    1 
ATOM   6747  O  OE1   . GLU B  2  291 ? -48.484 -21.023 87.690  1.00 69.04  ? 291 GLU B OE1   1 
ATOM   6748  O  OE2   . GLU B  2  291 ? -48.745 -23.185 87.419  1.00 85.37  ? 291 GLU B OE2   1 
ATOM   6749  N  N     . VAL B  2  292 ? -43.285 -23.458 87.841  1.00 61.56  ? 292 VAL B N     1 
ATOM   6750  C  CA    . VAL B  2  292 ? -42.670 -24.741 87.518  1.00 63.97  ? 292 VAL B CA    1 
ATOM   6751  C  C     . VAL B  2  292 ? -43.742 -25.708 87.033  1.00 69.49  ? 292 VAL B C     1 
ATOM   6752  O  O     . VAL B  2  292 ? -44.818 -25.817 87.633  1.00 76.47  ? 292 VAL B O     1 
ATOM   6753  C  CB    . VAL B  2  292 ? -41.924 -25.304 88.739  1.00 58.16  ? 292 VAL B CB    1 
ATOM   6754  C  CG1   . VAL B  2  292 ? -41.419 -26.711 88.461  1.00 59.61  ? 292 VAL B CG1   1 
ATOM   6755  C  CG2   . VAL B  2  292 ? -40.773 -24.386 89.126  1.00 51.24  ? 292 VAL B CG2   1 
ATOM   6756  N  N     . ILE B  2  293 ? -43.450 -26.410 85.942  1.00 64.35  ? 293 ILE B N     1 
ATOM   6757  C  CA    . ILE B  2  293 ? -44.365 -27.398 85.376  1.00 64.00  ? 293 ILE B CA    1 
ATOM   6758  C  C     . ILE B  2  293 ? -43.681 -28.760 85.389  1.00 66.79  ? 293 ILE B C     1 
ATOM   6759  O  O     . ILE B  2  293 ? -42.683 -28.953 84.679  1.00 63.50  ? 293 ILE B O     1 
ATOM   6760  C  CB    . ILE B  2  293 ? -44.800 -27.009 83.954  1.00 64.69  ? 293 ILE B CB    1 
ATOM   6761  C  CG1   . ILE B  2  293 ? -45.433 -25.616 83.950  1.00 62.41  ? 293 ILE B CG1   1 
ATOM   6762  C  CG2   . ILE B  2  293 ? -45.765 -28.041 83.391  1.00 63.19  ? 293 ILE B CG2   1 
ATOM   6763  C  CD1   . ILE B  2  293 ? -46.640 -25.485 84.855  1.00 65.98  ? 293 ILE B CD1   1 
ATOM   6764  N  N     . PRO B  2  294 ? -44.159 -29.722 86.177  1.00 74.42  ? 294 PRO B N     1 
ATOM   6765  C  CA    . PRO B  2  294 ? -43.668 -31.096 86.026  1.00 74.62  ? 294 PRO B CA    1 
ATOM   6766  C  C     . PRO B  2  294 ? -43.990 -31.635 84.641  1.00 79.97  ? 294 PRO B C     1 
ATOM   6767  O  O     . PRO B  2  294 ? -45.058 -31.373 84.085  1.00 86.82  ? 294 PRO B O     1 
ATOM   6768  C  CB    . PRO B  2  294 ? -44.418 -31.862 87.121  1.00 76.21  ? 294 PRO B CB    1 
ATOM   6769  C  CG    . PRO B  2  294 ? -45.654 -31.057 87.356  1.00 75.59  ? 294 PRO B CG    1 
ATOM   6770  C  CD    . PRO B  2  294 ? -45.238 -29.626 87.174  1.00 72.90  ? 294 PRO B CD    1 
ATOM   6771  N  N     . LEU B  2  295 ? -43.053 -32.397 84.084  1.00 75.04  ? 295 LEU B N     1 
ATOM   6772  C  CA    . LEU B  2  295 ? -43.273 -33.024 82.790  1.00 74.12  ? 295 LEU B CA    1 
ATOM   6773  C  C     . LEU B  2  295 ? -44.041 -34.329 82.954  1.00 83.78  ? 295 LEU B C     1 
ATOM   6774  O  O     . LEU B  2  295 ? -43.737 -35.141 83.833  1.00 83.97  ? 295 LEU B O     1 
ATOM   6775  C  CB    . LEU B  2  295 ? -41.943 -33.290 82.084  1.00 75.74  ? 295 LEU B CB    1 
ATOM   6776  C  CG    . LEU B  2  295 ? -41.011 -32.103 81.823  1.00 83.84  ? 295 LEU B CG    1 
ATOM   6777  C  CD1   . LEU B  2  295 ? -39.927 -32.486 80.825  1.00 93.69  ? 295 LEU B CD1   1 
ATOM   6778  C  CD2   . LEU B  2  295 ? -41.783 -30.889 81.339  1.00 73.90  ? 295 LEU B CD2   1 
ATOM   6779  N  N     . THR B  2  296 ? -45.041 -34.525 82.099  1.00 90.64  ? 296 THR B N     1 
ATOM   6780  C  CA    . THR B  2  296 ? -45.770 -35.782 82.073  1.00 93.79  ? 296 THR B CA    1 
ATOM   6781  C  C     . THR B  2  296 ? -44.922 -36.874 81.426  1.00 102.79 ? 296 THR B C     1 
ATOM   6782  O  O     . THR B  2  296 ? -43.924 -36.605 80.751  1.00 101.57 ? 296 THR B O     1 
ATOM   6783  C  CB    . THR B  2  296 ? -47.091 -35.625 81.318  1.00 90.95  ? 296 THR B CB    1 
ATOM   6784  O  OG1   . THR B  2  296 ? -46.826 -35.253 79.959  1.00 97.58  ? 296 THR B OG1   1 
ATOM   6785  C  CG2   . THR B  2  296 ? -47.951 -34.552 81.969  1.00 79.17  ? 296 THR B CG2   1 
ATOM   6786  N  N     . GLU B  2  297 ? -45.337 -38.126 81.635  1.00 107.11 ? 297 GLU B N     1 
ATOM   6787  C  CA    . GLU B  2  297 ? -44.653 -39.240 80.984  1.00 99.86  ? 297 GLU B CA    1 
ATOM   6788  C  C     . GLU B  2  297 ? -44.740 -39.133 79.468  1.00 97.33  ? 297 GLU B C     1 
ATOM   6789  O  O     . GLU B  2  297 ? -43.777 -39.452 78.760  1.00 101.37 ? 297 GLU B O     1 
ATOM   6790  C  CB    . GLU B  2  297 ? -45.233 -40.572 81.458  1.00 110.58 ? 297 GLU B CB    1 
ATOM   6791  C  CG    . GLU B  2  297 ? -44.937 -40.903 82.909  1.00 122.68 ? 297 GLU B CG    1 
ATOM   6792  C  CD    . GLU B  2  297 ? -45.008 -42.390 83.185  1.00 132.74 ? 297 GLU B CD    1 
ATOM   6793  O  OE1   . GLU B  2  297 ? -44.351 -43.161 82.454  1.00 133.66 ? 297 GLU B OE1   1 
ATOM   6794  O  OE2   . GLU B  2  297 ? -45.725 -42.789 84.126  1.00 136.26 ? 297 GLU B OE2   1 
ATOM   6795  N  N     . GLU B  2  298 ? -45.886 -38.687 78.949  1.00 96.18  ? 298 GLU B N     1 
ATOM   6796  C  CA    . GLU B  2  298 ? -46.044 -38.572 77.503  1.00 98.22  ? 298 GLU B CA    1 
ATOM   6797  C  C     . GLU B  2  298 ? -45.144 -37.480 76.936  1.00 92.47  ? 298 GLU B C     1 
ATOM   6798  O  O     . GLU B  2  298 ? -44.608 -37.622 75.831  1.00 95.14  ? 298 GLU B O     1 
ATOM   6799  C  CB    . GLU B  2  298 ? -47.507 -38.304 77.149  1.00 104.11 ? 298 GLU B CB    1 
ATOM   6800  C  CG    . GLU B  2  298 ? -48.494 -39.258 77.805  1.00 117.33 ? 298 GLU B CG    1 
ATOM   6801  C  CD    . GLU B  2  298 ? -48.984 -38.756 79.149  1.00 125.16 ? 298 GLU B CD    1 
ATOM   6802  O  OE1   . GLU B  2  298 ? -50.081 -38.162 79.201  1.00 128.64 ? 298 GLU B OE1   1 
ATOM   6803  O  OE2   . GLU B  2  298 ? -48.264 -38.942 80.153  1.00 125.88 ? 298 GLU B OE2   1 
ATOM   6804  N  N     . ALA B  2  299 ? -44.972 -36.381 77.674  1.00 82.01  ? 299 ALA B N     1 
ATOM   6805  C  CA    . ALA B  2  299 ? -44.058 -35.334 77.230  1.00 81.10  ? 299 ALA B CA    1 
ATOM   6806  C  C     . ALA B  2  299 ? -42.607 -35.789 77.331  1.00 89.94  ? 299 ALA B C     1 
ATOM   6807  O  O     . ALA B  2  299 ? -41.798 -35.498 76.442  1.00 93.47  ? 299 ALA B O     1 
ATOM   6808  C  CB    . ALA B  2  299 ? -44.280 -34.061 78.046  1.00 74.82  ? 299 ALA B CB    1 
ATOM   6809  N  N     . GLU B  2  300 ? -42.255 -36.479 78.421  1.00 86.92  ? 300 GLU B N     1 
ATOM   6810  C  CA    . GLU B  2  300 ? -40.903 -37.012 78.574  1.00 82.75  ? 300 GLU B CA    1 
ATOM   6811  C  C     . GLU B  2  300 ? -40.501 -37.866 77.378  1.00 82.47  ? 300 GLU B C     1 
ATOM   6812  O  O     . GLU B  2  300 ? -39.374 -37.765 76.881  1.00 77.48  ? 300 GLU B O     1 
ATOM   6813  C  CB    . GLU B  2  300 ? -40.797 -37.819 79.870  1.00 90.60  ? 300 GLU B CB    1 
ATOM   6814  C  CG    . GLU B  2  300 ? -40.811 -36.977 81.141  1.00 98.10  ? 300 GLU B CG    1 
ATOM   6815  C  CD    . GLU B  2  300 ? -39.444 -36.423 81.504  1.00 104.58 ? 300 GLU B CD    1 
ATOM   6816  O  OE1   . GLU B  2  300 ? -39.127 -36.372 82.711  1.00 108.55 ? 300 GLU B OE1   1 
ATOM   6817  O  OE2   . GLU B  2  300 ? -38.685 -36.044 80.588  1.00 104.20 ? 300 GLU B OE2   1 
ATOM   6818  N  N     . LEU B  2  301 ? -41.412 -38.720 76.904  1.00 90.99  ? 301 LEU B N     1 
ATOM   6819  C  CA    . LEU B  2  301 ? -41.094 -39.582 75.771  1.00 96.32  ? 301 LEU B CA    1 
ATOM   6820  C  C     . LEU B  2  301 ? -41.080 -38.796 74.465  1.00 95.13  ? 301 LEU B C     1 
ATOM   6821  O  O     . LEU B  2  301 ? -40.213 -39.020 73.613  1.00 99.19  ? 301 LEU B O     1 
ATOM   6822  C  CB    . LEU B  2  301 ? -42.085 -40.743 75.702  1.00 103.53 ? 301 LEU B CB    1 
ATOM   6823  C  CG    . LEU B  2  301 ? -41.967 -41.742 76.855  1.00 114.62 ? 301 LEU B CG    1 
ATOM   6824  C  CD1   . LEU B  2  301 ? -42.966 -42.876 76.702  1.00 120.10 ? 301 LEU B CD1   1 
ATOM   6825  C  CD2   . LEU B  2  301 ? -40.546 -42.281 76.946  1.00 115.22 ? 301 LEU B CD2   1 
ATOM   6826  N  N     . GLU B  2  302 ? -42.047 -37.892 74.278  1.00 93.29  ? 302 GLU B N     1 
ATOM   6827  C  CA    . GLU B  2  302 ? -42.022 -37.019 73.107  1.00 91.07  ? 302 GLU B CA    1 
ATOM   6828  C  C     . GLU B  2  302 ? -40.719 -36.232 73.049  1.00 84.23  ? 302 GLU B C     1 
ATOM   6829  O  O     . GLU B  2  302 ? -40.115 -36.087 71.980  1.00 83.83  ? 302 GLU B O     1 
ATOM   6830  C  CB    . GLU B  2  302 ? -43.221 -36.070 73.125  1.00 92.03  ? 302 GLU B CB    1 
ATOM   6831  C  CG    . GLU B  2  302 ? -43.377 -35.252 71.851  1.00 97.18  ? 302 GLU B CG    1 
ATOM   6832  C  CD    . GLU B  2  302 ? -44.453 -34.188 71.959  1.00 96.95  ? 302 GLU B CD    1 
ATOM   6833  O  OE1   . GLU B  2  302 ? -44.386 -33.366 72.895  1.00 92.06  ? 302 GLU B OE1   1 
ATOM   6834  O  OE2   . GLU B  2  302 ? -45.369 -34.175 71.109  1.00 98.90  ? 302 GLU B OE2   1 
ATOM   6835  N  N     . LEU B  2  303 ? -40.278 -35.712 74.195  1.00 74.89  ? 303 LEU B N     1 
ATOM   6836  C  CA    . LEU B  2  303 ? -39.020 -34.978 74.253  1.00 66.51  ? 303 LEU B CA    1 
ATOM   6837  C  C     . LEU B  2  303 ? -37.834 -35.906 74.018  1.00 81.59  ? 303 LEU B C     1 
ATOM   6838  O  O     . LEU B  2  303 ? -36.845 -35.514 73.389  1.00 88.24  ? 303 LEU B O     1 
ATOM   6839  C  CB    . LEU B  2  303 ? -38.902 -34.275 75.605  1.00 67.57  ? 303 LEU B CB    1 
ATOM   6840  C  CG    . LEU B  2  303 ? -37.579 -33.628 76.013  1.00 69.12  ? 303 LEU B CG    1 
ATOM   6841  C  CD1   . LEU B  2  303 ? -37.303 -32.376 75.195  1.00 59.53  ? 303 LEU B CD1   1 
ATOM   6842  C  CD2   . LEU B  2  303 ? -37.593 -33.313 77.502  1.00 75.81  ? 303 LEU B CD2   1 
ATOM   6843  N  N     . ALA B  2  304 ? -37.917 -37.138 74.525  1.00 91.48  ? 304 ALA B N     1 
ATOM   6844  C  CA    . ALA B  2  304 ? -36.900 -38.146 74.241  1.00 85.47  ? 304 ALA B CA    1 
ATOM   6845  C  C     . ALA B  2  304 ? -36.797 -38.421 72.745  1.00 80.48  ? 304 ALA B C     1 
ATOM   6846  O  O     . ALA B  2  304 ? -35.713 -38.332 72.157  1.00 87.08  ? 304 ALA B O     1 
ATOM   6847  C  CB    . ALA B  2  304 ? -37.211 -39.432 75.010  1.00 83.43  ? 304 ALA B CB    1 
ATOM   6848  N  N     . GLU B  2  305 ? -37.920 -38.791 72.120  1.00 77.65  ? 305 GLU B N     1 
ATOM   6849  C  CA    . GLU B  2  305 ? -37.927 -39.089 70.689  1.00 89.09  ? 305 GLU B CA    1 
ATOM   6850  C  C     . GLU B  2  305 ? -37.344 -37.944 69.869  1.00 79.43  ? 305 GLU B C     1 
ATOM   6851  O  O     . GLU B  2  305 ? -36.603 -38.175 68.907  1.00 77.35  ? 305 GLU B O     1 
ATOM   6852  C  CB    . GLU B  2  305 ? -39.347 -39.413 70.222  1.00 97.39  ? 305 GLU B CB    1 
ATOM   6853  C  CG    . GLU B  2  305 ? -39.439 -39.763 68.741  1.00 107.15 ? 305 GLU B CG    1 
ATOM   6854  C  CD    . GLU B  2  305 ? -40.814 -40.255 68.336  1.00 114.16 ? 305 GLU B CD    1 
ATOM   6855  O  OE1   . GLU B  2  305 ? -41.708 -40.308 69.206  1.00 117.71 ? 305 GLU B OE1   1 
ATOM   6856  O  OE2   . GLU B  2  305 ? -40.999 -40.591 67.147  1.00 111.15 ? 305 GLU B OE2   1 
ATOM   6857  N  N     . ASN B  2  306 ? -37.672 -36.702 70.231  1.00 74.88  ? 306 ASN B N     1 
ATOM   6858  C  CA    . ASN B  2  306 ? -37.147 -35.555 69.495  1.00 76.06  ? 306 ASN B CA    1 
ATOM   6859  C  C     . ASN B  2  306 ? -35.630 -35.478 69.606  1.00 76.46  ? 306 ASN B C     1 
ATOM   6860  O  O     . ASN B  2  306 ? -34.934 -35.265 68.606  1.00 81.46  ? 306 ASN B O     1 
ATOM   6861  C  CB    . ASN B  2  306 ? -37.794 -34.267 70.003  1.00 74.26  ? 306 ASN B CB    1 
ATOM   6862  C  CG    . ASN B  2  306 ? -39.246 -34.144 69.590  1.00 72.88  ? 306 ASN B CG    1 
ATOM   6863  O  OD1   . ASN B  2  306 ? -39.658 -34.688 68.565  1.00 76.15  ? 306 ASN B OD1   1 
ATOM   6864  N  ND2   . ASN B  2  306 ? -40.029 -33.423 70.383  1.00 66.10  ? 306 ASN B ND2   1 
ATOM   6865  N  N     . ARG B  2  307 ? -35.100 -35.620 70.826  1.00 71.82  ? 307 ARG B N     1 
ATOM   6866  C  CA    . ARG B  2  307 ? -33.653 -35.608 71.025  1.00 75.86  ? 307 ARG B CA    1 
ATOM   6867  C  C     . ARG B  2  307 ? -32.941 -36.618 70.135  1.00 84.03  ? 307 ARG B C     1 
ATOM   6868  O  O     . ARG B  2  307 ? -31.822 -36.362 69.676  1.00 84.22  ? 307 ARG B O     1 
ATOM   6869  C  CB    . ARG B  2  307 ? -33.315 -35.869 72.493  1.00 84.04  ? 307 ARG B CB    1 
ATOM   6870  C  CG    . ARG B  2  307 ? -33.678 -34.722 73.416  1.00 89.71  ? 307 ARG B CG    1 
ATOM   6871  C  CD    . ARG B  2  307 ? -32.805 -34.718 74.656  1.00 92.34  ? 307 ARG B CD    1 
ATOM   6872  N  NE    . ARG B  2  307 ? -33.187 -33.658 75.583  1.00 94.32  ? 307 ARG B NE    1 
ATOM   6873  C  CZ    . ARG B  2  307 ? -34.064 -33.813 76.569  1.00 101.88 ? 307 ARG B CZ    1 
ATOM   6874  N  NH1   . ARG B  2  307 ? -34.646 -34.989 76.759  1.00 108.94 ? 307 ARG B NH1   1 
ATOM   6875  N  NH2   . ARG B  2  307 ? -34.352 -32.795 77.367  1.00 102.14 ? 307 ARG B NH2   1 
ATOM   6876  N  N     . GLU B  2  308 ? -33.567 -37.768 69.877  1.00 92.13  ? 308 GLU B N     1 
ATOM   6877  C  CA    . GLU B  2  308 ? -32.965 -38.742 68.972  1.00 99.24  ? 308 GLU B CA    1 
ATOM   6878  C  C     . GLU B  2  308 ? -33.030 -38.259 67.529  1.00 94.07  ? 308 GLU B C     1 
ATOM   6879  O  O     . GLU B  2  308 ? -32.034 -38.329 66.798  1.00 97.49  ? 308 GLU B O     1 
ATOM   6880  C  CB    . GLU B  2  308 ? -33.650 -40.101 69.121  1.00 106.60 ? 308 GLU B CB    1 
ATOM   6881  C  CG    . GLU B  2  308 ? -32.759 -41.166 69.742  1.00 120.47 ? 308 GLU B CG    1 
ATOM   6882  C  CD    . GLU B  2  308 ? -33.353 -42.556 69.648  1.00 141.66 ? 308 GLU B CD    1 
ATOM   6883  O  OE1   . GLU B  2  308 ? -34.497 -42.686 69.165  1.00 149.73 ? 308 GLU B OE1   1 
ATOM   6884  O  OE2   . GLU B  2  308 ? -32.672 -43.522 70.054  1.00 145.73 ? 308 GLU B OE2   1 
ATOM   6885  N  N     . ILE B  2  309 ? -34.204 -37.792 67.092  1.00 83.83  ? 309 ILE B N     1 
ATOM   6886  C  CA    . ILE B  2  309 ? -34.368 -37.336 65.713  1.00 83.23  ? 309 ILE B CA    1 
ATOM   6887  C  C     . ILE B  2  309 ? -33.347 -36.258 65.374  1.00 85.90  ? 309 ILE B C     1 
ATOM   6888  O  O     . ILE B  2  309 ? -32.866 -36.181 64.236  1.00 85.64  ? 309 ILE B O     1 
ATOM   6889  C  CB    . ILE B  2  309 ? -35.812 -36.841 65.485  1.00 76.76  ? 309 ILE B CB    1 
ATOM   6890  C  CG1   . ILE B  2  309 ? -36.813 -37.972 65.731  1.00 82.25  ? 309 ILE B CG1   1 
ATOM   6891  C  CG2   . ILE B  2  309 ? -35.984 -36.295 64.076  1.00 78.43  ? 309 ILE B CG2   1 
ATOM   6892  C  CD1   . ILE B  2  309 ? -38.258 -37.563 65.523  1.00 78.63  ? 309 ILE B CD1   1 
ATOM   6893  N  N     . LEU B  2  310 ? -32.991 -35.414 66.346  1.00 87.28  ? 310 LEU B N     1 
ATOM   6894  C  CA    . LEU B  2  310 ? -32.026 -34.353 66.082  1.00 89.65  ? 310 LEU B CA    1 
ATOM   6895  C  C     . LEU B  2  310 ? -30.606 -34.884 65.946  1.00 90.84  ? 310 LEU B C     1 
ATOM   6896  O  O     . LEU B  2  310 ? -29.769 -34.224 65.321  1.00 88.40  ? 310 LEU B O     1 
ATOM   6897  C  CB    . LEU B  2  310 ? -32.081 -33.298 67.187  1.00 83.54  ? 310 LEU B CB    1 
ATOM   6898  C  CG    . LEU B  2  310 ? -33.350 -32.448 67.245  1.00 77.62  ? 310 LEU B CG    1 
ATOM   6899  C  CD1   . LEU B  2  310 ? -33.242 -31.400 68.339  1.00 72.87  ? 310 LEU B CD1   1 
ATOM   6900  C  CD2   . LEU B  2  310 ? -33.616 -31.794 65.902  1.00 68.49  ? 310 LEU B CD2   1 
ATOM   6901  N  N     . LYS B  2  311 ? -30.313 -36.057 66.517  1.00 96.24  ? 311 LYS B N     1 
ATOM   6902  C  CA    . LYS B  2  311 ? -29.060 -36.735 66.200  1.00 105.64 ? 311 LYS B CA    1 
ATOM   6903  C  C     . LYS B  2  311 ? -29.031 -37.209 64.754  1.00 108.92 ? 311 LYS B C     1 
ATOM   6904  O  O     . LYS B  2  311 ? -27.957 -37.272 64.145  1.00 105.59 ? 311 LYS B O     1 
ATOM   6905  C  CB    . LYS B  2  311 ? -28.852 -37.924 67.139  1.00 108.13 ? 311 LYS B CB    1 
ATOM   6906  C  CG    . LYS B  2  311 ? -29.043 -37.613 68.614  1.00 106.05 ? 311 LYS B CG    1 
ATOM   6907  C  CD    . LYS B  2  311 ? -27.825 -36.929 69.207  1.00 105.96 ? 311 LYS B CD    1 
ATOM   6908  C  CE    . LYS B  2  311 ? -28.037 -36.629 70.681  1.00 108.87 ? 311 LYS B CE    1 
ATOM   6909  N  NZ    . LYS B  2  311 ? -28.364 -37.860 71.454  1.00 109.07 ? 311 LYS B NZ    1 
ATOM   6910  N  N     . GLU B  2  312 ? -30.192 -37.545 64.194  1.00 110.28 ? 312 GLU B N     1 
ATOM   6911  C  CA    . GLU B  2  312 ? -30.267 -38.202 62.903  1.00 107.11 ? 312 GLU B CA    1 
ATOM   6912  C  C     . GLU B  2  312 ? -29.870 -37.239 61.787  1.00 105.89 ? 312 GLU B C     1 
ATOM   6913  O  O     . GLU B  2  312 ? -29.788 -36.026 61.995  1.00 105.20 ? 312 GLU B O     1 
ATOM   6914  C  CB    . GLU B  2  312 ? -31.676 -38.749 62.678  1.00 107.42 ? 312 GLU B CB    1 
ATOM   6915  C  CG    . GLU B  2  312 ? -32.097 -39.788 63.704  1.00 115.50 ? 312 GLU B CG    1 
ATOM   6916  C  CD    . GLU B  2  312 ? -33.133 -40.752 63.166  1.00 123.96 ? 312 GLU B CD    1 
ATOM   6917  O  OE1   . GLU B  2  312 ? -34.300 -40.343 62.989  1.00 116.32 ? 312 GLU B OE1   1 
ATOM   6918  O  OE2   . GLU B  2  312 ? -32.774 -41.920 62.909  1.00 132.04 ? 312 GLU B OE2   1 
ATOM   6919  N  N     . PRO B  2  313 ? -29.619 -37.752 60.583  1.00 106.74 ? 313 PRO B N     1 
ATOM   6920  C  CA    . PRO B  2  313 ? -29.430 -36.871 59.429  1.00 100.84 ? 313 PRO B CA    1 
ATOM   6921  C  C     . PRO B  2  313 ? -30.757 -36.513 58.781  1.00 97.14  ? 313 PRO B C     1 
ATOM   6922  O  O     . PRO B  2  313 ? -31.748 -37.240 58.872  1.00 110.04 ? 313 PRO B O     1 
ATOM   6923  C  CB    . PRO B  2  313 ? -28.571 -37.724 58.485  1.00 97.87  ? 313 PRO B CB    1 
ATOM   6924  C  CG    . PRO B  2  313 ? -28.996 -39.114 58.781  1.00 102.38 ? 313 PRO B CG    1 
ATOM   6925  C  CD    . PRO B  2  313 ? -29.272 -39.150 60.265  1.00 105.95 ? 313 PRO B CD    1 
ATOM   6926  N  N     . VAL B  2  314 ? -30.763 -35.359 58.113  1.00 79.31  ? 314 VAL B N     1 
ATOM   6927  C  CA    . VAL B  2  314 ? -31.950 -34.945 57.379  1.00 82.79  ? 314 VAL B CA    1 
ATOM   6928  C  C     . VAL B  2  314 ? -32.097 -35.804 56.127  1.00 92.15  ? 314 VAL B C     1 
ATOM   6929  O  O     . VAL B  2  314 ? -31.110 -36.265 55.538  1.00 91.33  ? 314 VAL B O     1 
ATOM   6930  C  CB    . VAL B  2  314 ? -31.869 -33.447 57.027  1.00 79.87  ? 314 VAL B CB    1 
ATOM   6931  C  CG1   . VAL B  2  314 ? -33.207 -32.938 56.501  1.00 83.73  ? 314 VAL B CG1   1 
ATOM   6932  C  CG2   . VAL B  2  314 ? -31.426 -32.643 58.239  1.00 64.69  ? 314 VAL B CG2   1 
ATOM   6933  N  N     . HIS B  2  315 ? -33.343 -36.015 55.710  1.00 99.46  ? 315 HIS B N     1 
ATOM   6934  C  CA    . HIS B  2  315 ? -33.634 -36.887 54.582  1.00 101.17 ? 315 HIS B CA    1 
ATOM   6935  C  C     . HIS B  2  315 ? -33.308 -36.194 53.267  1.00 88.81  ? 315 HIS B C     1 
ATOM   6936  O  O     . HIS B  2  315 ? -33.802 -35.096 52.994  1.00 81.93  ? 315 HIS B O     1 
ATOM   6937  C  CB    . HIS B  2  315 ? -35.102 -37.311 54.595  1.00 109.61 ? 315 HIS B CB    1 
ATOM   6938  C  CG    . HIS B  2  315 ? -35.572 -37.889 53.296  1.00 118.31 ? 315 HIS B CG    1 
ATOM   6939  N  ND1   . HIS B  2  315 ? -35.084 -39.074 52.789  1.00 121.55 ? 315 HIS B ND1   1 
ATOM   6940  C  CD2   . HIS B  2  315 ? -36.476 -37.437 52.395  1.00 118.21 ? 315 HIS B CD2   1 
ATOM   6941  C  CE1   . HIS B  2  315 ? -35.672 -39.331 51.634  1.00 123.26 ? 315 HIS B CE1   1 
ATOM   6942  N  NE2   . HIS B  2  315 ? -36.521 -38.353 51.372  1.00 120.78 ? 315 HIS B NE2   1 
ATOM   6943  N  N     . GLY B  2  316 ? -32.486 -36.845 52.451  1.00 83.99  ? 316 GLY B N     1 
ATOM   6944  C  CA    . GLY B  2  316 ? -32.234 -36.352 51.107  1.00 79.65  ? 316 GLY B CA    1 
ATOM   6945  C  C     . GLY B  2  316 ? -31.539 -35.010 51.043  1.00 72.36  ? 316 GLY B C     1 
ATOM   6946  O  O     . GLY B  2  316 ? -31.919 -34.156 50.231  1.00 62.96  ? 316 GLY B O     1 
ATOM   6947  N  N     . VAL B  2  317 ? -30.524 -34.801 51.876  1.00 67.19  ? 317 VAL B N     1 
ATOM   6948  C  CA    . VAL B  2  317 ? -29.605 -33.684 51.705  1.00 63.80  ? 317 VAL B CA    1 
ATOM   6949  C  C     . VAL B  2  317 ? -28.335 -34.215 51.045  1.00 64.30  ? 317 VAL B C     1 
ATOM   6950  O  O     . VAL B  2  317 ? -27.665 -35.109 51.576  1.00 76.15  ? 317 VAL B O     1 
ATOM   6951  C  CB    . VAL B  2  317 ? -29.312 -32.977 53.043  1.00 66.54  ? 317 VAL B CB    1 
ATOM   6952  C  CG1   . VAL B  2  317 ? -30.600 -32.455 53.652  1.00 61.84  ? 317 VAL B CG1   1 
ATOM   6953  C  CG2   . VAL B  2  317 ? -28.621 -33.898 54.046  1.00 76.13  ? 317 VAL B CG2   1 
ATOM   6954  N  N     . TYR B  2  318 ? -28.040 -33.705 49.853  1.00 50.30  ? 318 TYR B N     1 
ATOM   6955  C  CA    . TYR B  2  318 ? -26.801 -34.013 49.157  1.00 50.92  ? 318 TYR B CA    1 
ATOM   6956  C  C     . TYR B  2  318 ? -26.345 -32.774 48.401  1.00 49.00  ? 318 TYR B C     1 
ATOM   6957  O  O     . TYR B  2  318 ? -27.143 -31.902 48.049  1.00 57.10  ? 318 TYR B O     1 
ATOM   6958  C  CB    . TYR B  2  318 ? -26.946 -35.219 48.216  1.00 53.42  ? 318 TYR B CB    1 
ATOM   6959  C  CG    . TYR B  2  318 ? -28.068 -35.109 47.213  1.00 56.82  ? 318 TYR B CG    1 
ATOM   6960  C  CD1   . TYR B  2  318 ? -27.859 -34.520 45.974  1.00 58.37  ? 318 TYR B CD1   1 
ATOM   6961  C  CD2   . TYR B  2  318 ? -29.332 -35.609 47.497  1.00 54.93  ? 318 TYR B CD2   1 
ATOM   6962  C  CE1   . TYR B  2  318 ? -28.878 -34.423 45.050  1.00 61.88  ? 318 TYR B CE1   1 
ATOM   6963  C  CE2   . TYR B  2  318 ? -30.359 -35.517 46.578  1.00 63.35  ? 318 TYR B CE2   1 
ATOM   6964  C  CZ    . TYR B  2  318 ? -30.126 -34.922 45.356  1.00 65.53  ? 318 TYR B CZ    1 
ATOM   6965  O  OH    . TYR B  2  318 ? -31.142 -34.824 44.434  1.00 68.51  ? 318 TYR B OH    1 
ATOM   6966  N  N     . TYR B  2  319 ? -25.044 -32.716 48.147  1.00 52.22  ? 319 TYR B N     1 
ATOM   6967  C  CA    . TYR B  2  319 ? -24.470 -31.618 47.384  1.00 50.00  ? 319 TYR B CA    1 
ATOM   6968  C  C     . TYR B  2  319 ? -24.886 -31.702 45.920  1.00 50.64  ? 319 TYR B C     1 
ATOM   6969  O  O     . TYR B  2  319 ? -24.898 -32.782 45.323  1.00 56.18  ? 319 TYR B O     1 
ATOM   6970  C  CB    . TYR B  2  319 ? -22.949 -31.652 47.514  1.00 47.75  ? 319 TYR B CB    1 
ATOM   6971  C  CG    . TYR B  2  319 ? -22.210 -30.659 46.653  1.00 49.15  ? 319 TYR B CG    1 
ATOM   6972  C  CD1   . TYR B  2  319 ? -22.275 -29.297 46.916  1.00 49.75  ? 319 TYR B CD1   1 
ATOM   6973  C  CD2   . TYR B  2  319 ? -21.423 -31.087 45.594  1.00 50.23  ? 319 TYR B CD2   1 
ATOM   6974  C  CE1   . TYR B  2  319 ? -21.589 -28.391 46.138  1.00 53.15  ? 319 TYR B CE1   1 
ATOM   6975  C  CE2   . TYR B  2  319 ? -20.734 -30.190 44.813  1.00 47.00  ? 319 TYR B CE2   1 
ATOM   6976  C  CZ    . TYR B  2  319 ? -20.821 -28.844 45.087  1.00 53.60  ? 319 TYR B CZ    1 
ATOM   6977  O  OH    . TYR B  2  319 ? -20.132 -27.951 44.304  1.00 52.46  ? 319 TYR B OH    1 
ATOM   6978  N  N     . ASP B  2  320 ? -25.267 -30.556 45.354  1.00 46.67  ? 320 ASP B N     1 
ATOM   6979  C  CA    . ASP B  2  320 ? -25.546 -30.433 43.926  1.00 51.67  ? 320 ASP B CA    1 
ATOM   6980  C  C     . ASP B  2  320 ? -24.496 -29.550 43.273  1.00 49.03  ? 320 ASP B C     1 
ATOM   6981  O  O     . ASP B  2  320 ? -24.478 -28.333 43.522  1.00 50.13  ? 320 ASP B O     1 
ATOM   6982  C  CB    . ASP B  2  320 ? -26.943 -29.850 43.692  1.00 51.71  ? 320 ASP B CB    1 
ATOM   6983  C  CG    . ASP B  2  320 ? -27.379 -29.928 42.231  1.00 52.21  ? 320 ASP B CG    1 
ATOM   6984  O  OD1   . ASP B  2  320 ? -26.512 -29.974 41.331  1.00 54.68  ? 320 ASP B OD1   1 
ATOM   6985  O  OD2   . ASP B  2  320 ? -28.602 -29.945 41.979  1.00 59.74  ? 320 ASP B OD2   1 
ATOM   6986  N  N     . PRO B  2  321 ? -23.612 -30.099 42.435  1.00 49.47  ? 321 PRO B N     1 
ATOM   6987  C  CA    . PRO B  2  321 ? -22.481 -29.299 41.941  1.00 54.89  ? 321 PRO B CA    1 
ATOM   6988  C  C     . PRO B  2  321 ? -22.908 -28.102 41.111  1.00 58.20  ? 321 PRO B C     1 
ATOM   6989  O  O     . PRO B  2  321 ? -22.104 -27.183 40.919  1.00 50.54  ? 321 PRO B O     1 
ATOM   6990  C  CB    . PRO B  2  321 ? -21.674 -30.304 41.103  1.00 48.88  ? 321 PRO B CB    1 
ATOM   6991  C  CG    . PRO B  2  321 ? -22.165 -31.662 41.522  1.00 57.48  ? 321 PRO B CG    1 
ATOM   6992  C  CD    . PRO B  2  321 ? -23.599 -31.470 41.903  1.00 58.47  ? 321 PRO B CD    1 
ATOM   6993  N  N     . SER B  2  322 ? -24.145 -28.085 40.607  1.00 52.76  ? 322 SER B N     1 
ATOM   6994  C  CA    . SER B  2  322 ? -24.620 -26.955 39.818  1.00 47.42  ? 322 SER B CA    1 
ATOM   6995  C  C     . SER B  2  322 ? -25.049 -25.775 40.682  1.00 50.51  ? 322 SER B C     1 
ATOM   6996  O  O     . SER B  2  322 ? -24.945 -24.624 40.244  1.00 70.28  ? 322 SER B O     1 
ATOM   6997  C  CB    . SER B  2  322 ? -25.781 -27.391 38.922  1.00 53.43  ? 322 SER B CB    1 
ATOM   6998  O  OG    . SER B  2  322 ? -26.886 -27.820 39.697  1.00 62.82  ? 322 SER B OG    1 
ATOM   6999  N  N     . LYS B  2  323 ? -25.520 -26.031 41.898  1.00 48.09  ? 323 LYS B N     1 
ATOM   7000  C  CA    . LYS B  2  323 ? -26.052 -24.983 42.755  1.00 45.01  ? 323 LYS B CA    1 
ATOM   7001  C  C     . LYS B  2  323 ? -24.946 -24.289 43.547  1.00 48.09  ? 323 LYS B C     1 
ATOM   7002  O  O     . LYS B  2  323 ? -23.874 -24.846 43.794  1.00 47.28  ? 323 LYS B O     1 
ATOM   7003  C  CB    . LYS B  2  323 ? -27.103 -25.555 43.709  1.00 44.42  ? 323 LYS B CB    1 
ATOM   7004  C  CG    . LYS B  2  323 ? -28.289 -26.195 43.004  1.00 47.92  ? 323 LYS B CG    1 
ATOM   7005  C  CD    . LYS B  2  323 ? -29.248 -26.832 43.994  1.00 53.16  ? 323 LYS B CD    1 
ATOM   7006  C  CE    . LYS B  2  323 ? -30.383 -27.540 43.272  1.00 53.73  ? 323 LYS B CE    1 
ATOM   7007  N  NZ    . LYS B  2  323 ? -31.243 -28.314 44.207  1.00 58.42  ? 323 LYS B NZ    1 
ATOM   7008  N  N     . ASP B  2  324 ? -25.230 -23.049 43.938  1.00 54.25  ? 324 ASP B N     1 
ATOM   7009  C  CA    . ASP B  2  324 ? -24.317 -22.258 44.751  1.00 53.17  ? 324 ASP B CA    1 
ATOM   7010  C  C     . ASP B  2  324 ? -24.406 -22.652 46.221  1.00 55.42  ? 324 ASP B C     1 
ATOM   7011  O  O     . ASP B  2  324 ? -25.475 -22.999 46.733  1.00 51.20  ? 324 ASP B O     1 
ATOM   7012  C  CB    . ASP B  2  324 ? -24.621 -20.767 44.604  1.00 60.62  ? 324 ASP B CB    1 
ATOM   7013  C  CG    . ASP B  2  324 ? -24.179 -20.210 43.268  1.00 74.20  ? 324 ASP B CG    1 
ATOM   7014  O  OD1   . ASP B  2  324 ? -23.346 -20.857 42.601  1.00 83.54  ? 324 ASP B OD1   1 
ATOM   7015  O  OD2   . ASP B  2  324 ? -24.656 -19.119 42.891  1.00 76.14  ? 324 ASP B OD2   1 
ATOM   7016  N  N     . LEU B  2  325 ? -23.263 -22.585 46.900  1.00 51.34  ? 325 LEU B N     1 
ATOM   7017  C  CA    . LEU B  2  325 ? -23.219 -22.708 48.351  1.00 45.44  ? 325 LEU B CA    1 
ATOM   7018  C  C     . LEU B  2  325 ? -23.574 -21.387 49.024  1.00 46.54  ? 325 LEU B C     1 
ATOM   7019  O  O     . LEU B  2  325 ? -23.109 -20.319 48.617  1.00 51.52  ? 325 LEU B O     1 
ATOM   7020  C  CB    . LEU B  2  325 ? -21.831 -23.168 48.800  1.00 42.98  ? 325 LEU B CB    1 
ATOM   7021  C  CG    . LEU B  2  325 ? -21.402 -24.567 48.348  1.00 41.67  ? 325 LEU B CG    1 
ATOM   7022  C  CD1   . LEU B  2  325 ? -19.936 -24.819 48.665  1.00 43.28  ? 325 LEU B CD1   1 
ATOM   7023  C  CD2   . LEU B  2  325 ? -22.281 -25.628 48.994  1.00 50.20  ? 325 LEU B CD2   1 
ATOM   7024  N  N     . ILE B  2  326 ? -24.398 -21.468 50.067  1.00 48.29  ? 326 ILE B N     1 
ATOM   7025  C  CA    . ILE B  2  326 ? -24.772 -20.316 50.878  1.00 43.14  ? 326 ILE B CA    1 
ATOM   7026  C  C     . ILE B  2  326 ? -24.337 -20.593 52.310  1.00 43.43  ? 326 ILE B C     1 
ATOM   7027  O  O     . ILE B  2  326 ? -24.639 -21.660 52.858  1.00 53.29  ? 326 ILE B O     1 
ATOM   7028  C  CB    . ILE B  2  326 ? -26.287 -20.044 50.814  1.00 48.47  ? 326 ILE B CB    1 
ATOM   7029  C  CG1   . ILE B  2  326 ? -26.760 -19.929 49.361  1.00 43.11  ? 326 ILE B CG1   1 
ATOM   7030  C  CG2   . ILE B  2  326 ? -26.639 -18.786 51.600  1.00 43.96  ? 326 ILE B CG2   1 
ATOM   7031  C  CD1   . ILE B  2  326 ? -26.706 -18.523 48.800  1.00 64.96  ? 326 ILE B CD1   1 
ATOM   7032  N  N     . ALA B  2  327 ? -23.625 -19.644 52.909  1.00 39.45  ? 327 ALA B N     1 
ATOM   7033  C  CA    . ALA B  2  327 ? -23.247 -19.727 54.312  1.00 45.08  ? 327 ALA B CA    1 
ATOM   7034  C  C     . ALA B  2  327 ? -23.944 -18.630 55.103  1.00 46.89  ? 327 ALA B C     1 
ATOM   7035  O  O     . ALA B  2  327 ? -23.910 -17.458 54.711  1.00 48.58  ? 327 ALA B O     1 
ATOM   7036  C  CB    . ALA B  2  327 ? -21.730 -19.614 54.476  1.00 30.89  ? 327 ALA B CB    1 
ATOM   7037  N  N     . GLU B  2  328 ? -24.564 -19.012 56.215  1.00 45.58  ? 328 GLU B N     1 
ATOM   7038  C  CA    . GLU B  2  328 ? -25.111 -18.078 57.187  1.00 39.14  ? 328 GLU B CA    1 
ATOM   7039  C  C     . GLU B  2  328 ? -24.312 -18.174 58.479  1.00 37.86  ? 328 GLU B C     1 
ATOM   7040  O  O     . GLU B  2  328 ? -23.883 -19.263 58.870  1.00 44.80  ? 328 GLU B O     1 
ATOM   7041  C  CB    . GLU B  2  328 ? -26.591 -18.358 57.457  1.00 34.04  ? 328 GLU B CB    1 
ATOM   7042  C  CG    . GLU B  2  328 ? -27.501 -18.009 56.292  1.00 58.98  ? 328 GLU B CG    1 
ATOM   7043  C  CD    . GLU B  2  328 ? -28.958 -18.331 56.567  1.00 66.77  ? 328 GLU B CD    1 
ATOM   7044  O  OE1   . GLU B  2  328 ? -29.803 -18.084 55.680  1.00 73.12  ? 328 GLU B OE1   1 
ATOM   7045  O  OE2   . GLU B  2  328 ? -29.259 -18.833 57.670  1.00 75.04  ? 328 GLU B OE2   1 
ATOM   7046  N  N     . ILE B  2  329 ? -24.119 -17.036 59.142  1.00 34.18  ? 329 ILE B N     1 
ATOM   7047  C  CA    . ILE B  2  329 ? -23.409 -16.970 60.414  1.00 41.61  ? 329 ILE B CA    1 
ATOM   7048  C  C     . ILE B  2  329 ? -24.301 -16.271 61.431  1.00 38.82  ? 329 ILE B C     1 
ATOM   7049  O  O     . ILE B  2  329 ? -24.989 -15.299 61.099  1.00 42.96  ? 329 ILE B O     1 
ATOM   7050  C  CB    . ILE B  2  329 ? -22.055 -16.243 60.272  1.00 35.02  ? 329 ILE B CB    1 
ATOM   7051  C  CG1   . ILE B  2  329 ? -21.242 -16.857 59.130  1.00 32.58  ? 329 ILE B CG1   1 
ATOM   7052  C  CG2   . ILE B  2  329 ? -21.267 -16.318 61.570  1.00 29.95  ? 329 ILE B CG2   1 
ATOM   7053  C  CD1   . ILE B  2  329 ? -19.931 -16.154 58.861  1.00 30.80  ? 329 ILE B CD1   1 
ATOM   7054  N  N     . GLN B  2  330 ? -24.289 -16.762 62.671  1.00 34.11  ? 330 GLN B N     1 
ATOM   7055  C  CA    . GLN B  2  330 ? -24.920 -16.078 63.792  1.00 40.62  ? 330 GLN B CA    1 
ATOM   7056  C  C     . GLN B  2  330 ? -23.900 -15.777 64.881  1.00 37.94  ? 330 GLN B C     1 
ATOM   7057  O  O     . GLN B  2  330 ? -23.026 -16.599 65.175  1.00 43.30  ? 330 GLN B O     1 
ATOM   7058  C  CB    . GLN B  2  330 ? -26.061 -16.913 64.387  1.00 42.06  ? 330 GLN B CB    1 
ATOM   7059  C  CG    . GLN B  2  330 ? -27.078 -17.409 63.373  1.00 43.96  ? 330 GLN B CG    1 
ATOM   7060  C  CD    . GLN B  2  330 ? -26.655 -18.703 62.705  1.00 43.13  ? 330 GLN B CD    1 
ATOM   7061  O  OE1   . GLN B  2  330 ? -26.053 -19.574 63.335  1.00 41.25  ? 330 GLN B OE1   1 
ATOM   7062  N  NE2   . GLN B  2  330 ? -26.965 -18.833 61.421  1.00 45.01  ? 330 GLN B NE2   1 
ATOM   7063  N  N     . LYS B  2  331 ? -24.022 -14.593 65.478  1.00 43.58  ? 331 LYS B N     1 
ATOM   7064  C  CA    . LYS B  2  331 ? -23.186 -14.190 66.607  1.00 40.40  ? 331 LYS B CA    1 
ATOM   7065  C  C     . LYS B  2  331 ? -23.879 -14.665 67.879  1.00 36.56  ? 331 LYS B C     1 
ATOM   7066  O  O     . LYS B  2  331 ? -24.856 -14.063 68.331  1.00 38.59  ? 331 LYS B O     1 
ATOM   7067  C  CB    . LYS B  2  331 ? -22.984 -12.679 66.595  1.00 36.94  ? 331 LYS B CB    1 
ATOM   7068  C  CG    . LYS B  2  331 ? -22.396 -12.088 67.860  1.00 41.79  ? 331 LYS B CG    1 
ATOM   7069  C  CD    . LYS B  2  331 ? -22.439 -10.571 67.791  1.00 42.69  ? 331 LYS B CD    1 
ATOM   7070  C  CE    . LYS B  2  331 ? -21.924 -9.941  69.068  1.00 38.35  ? 331 LYS B CE    1 
ATOM   7071  N  NZ    . LYS B  2  331 ? -22.081 -8.460  69.040  1.00 39.29  ? 331 LYS B NZ    1 
ATOM   7072  N  N     . GLN B  2  332 ? -23.360 -15.742 68.469  1.00 38.63  ? 332 GLN B N     1 
ATOM   7073  C  CA    . GLN B  2  332 ? -23.928 -16.271 69.702  1.00 38.30  ? 332 GLN B CA    1 
ATOM   7074  C  C     . GLN B  2  332 ? -23.507 -15.506 70.950  1.00 37.91  ? 332 GLN B C     1 
ATOM   7075  O  O     . GLN B  2  332 ? -24.157 -15.651 71.991  1.00 52.14  ? 332 GLN B O     1 
ATOM   7076  C  CB    . GLN B  2  332 ? -23.568 -17.749 69.844  1.00 37.37  ? 332 GLN B CB    1 
ATOM   7077  C  CG    . GLN B  2  332 ? -24.141 -18.610 68.729  1.00 52.37  ? 332 GLN B CG    1 
ATOM   7078  C  CD    . GLN B  2  332 ? -25.662 -18.552 68.663  1.00 54.28  ? 332 GLN B CD    1 
ATOM   7079  O  OE1   . GLN B  2  332 ? -26.328 -18.206 69.641  1.00 54.92  ? 332 GLN B OE1   1 
ATOM   7080  N  NE2   . GLN B  2  332 ? -26.218 -18.905 67.509  1.00 49.07  ? 332 GLN B NE2   1 
ATOM   7081  N  N     . GLY B  2  333 ? -22.452 -14.706 70.883  1.00 45.13  ? 333 GLY B N     1 
ATOM   7082  C  CA    . GLY B  2  333 ? -21.953 -14.047 72.071  1.00 36.59  ? 333 GLY B CA    1 
ATOM   7083  C  C     . GLY B  2  333 ? -20.861 -14.832 72.779  1.00 49.94  ? 333 GLY B C     1 
ATOM   7084  O  O     . GLY B  2  333 ? -20.709 -16.043 72.617  1.00 50.31  ? 333 GLY B O     1 
ATOM   7085  N  N     . GLN B  2  334 ? -20.104 -14.106 73.604  1.00 43.22  ? 334 GLN B N     1 
ATOM   7086  C  CA    . GLN B  2  334 ? -18.971 -14.652 74.357  1.00 50.25  ? 334 GLN B CA    1 
ATOM   7087  C  C     . GLN B  2  334 ? -17.972 -15.359 73.444  1.00 46.80  ? 334 GLN B C     1 
ATOM   7088  O  O     . GLN B  2  334 ? -17.441 -16.422 73.772  1.00 42.21  ? 334 GLN B O     1 
ATOM   7089  C  CB    . GLN B  2  334 ? -19.449 -15.596 75.463  1.00 39.35  ? 334 GLN B CB    1 
ATOM   7090  C  CG    . GLN B  2  334 ? -20.383 -14.949 76.468  1.00 60.63  ? 334 GLN B CG    1 
ATOM   7091  C  CD    . GLN B  2  334 ? -19.773 -13.726 77.119  1.00 83.16  ? 334 GLN B CD    1 
ATOM   7092  O  OE1   . GLN B  2  334 ? -18.715 -13.801 77.745  1.00 96.25  ? 334 GLN B OE1   1 
ATOM   7093  N  NE2   . GLN B  2  334 ? -20.435 -12.587 76.970  1.00 77.47  ? 334 GLN B NE2   1 
ATOM   7094  N  N     . GLY B  2  335 ? -17.716 -14.762 72.282  1.00 56.66  ? 335 GLY B N     1 
ATOM   7095  C  CA    . GLY B  2  335 ? -16.746 -15.298 71.350  1.00 33.12  ? 335 GLY B CA    1 
ATOM   7096  C  C     . GLY B  2  335 ? -17.193 -16.513 70.571  1.00 44.48  ? 335 GLY B C     1 
ATOM   7097  O  O     . GLY B  2  335 ? -16.355 -17.157 69.929  1.00 57.96  ? 335 GLY B O     1 
ATOM   7098  N  N     . GLN B  2  336 ? -18.481 -16.845 70.593  1.00 53.74  ? 336 GLN B N     1 
ATOM   7099  C  CA    . GLN B  2  336 ? -18.990 -18.058 69.971  1.00 46.08  ? 336 GLN B CA    1 
ATOM   7100  C  C     . GLN B  2  336 ? -19.796 -17.691 68.734  1.00 33.43  ? 336 GLN B C     1 
ATOM   7101  O  O     . GLN B  2  336 ? -20.665 -16.815 68.789  1.00 49.22  ? 336 GLN B O     1 
ATOM   7102  C  CB    . GLN B  2  336 ? -19.846 -18.860 70.953  1.00 41.63  ? 336 GLN B CB    1 
ATOM   7103  C  CG    . GLN B  2  336 ? -19.281 -20.234 71.267  1.00 54.03  ? 336 GLN B CG    1 
ATOM   7104  C  CD    . GLN B  2  336 ? -19.328 -20.553 72.745  1.00 68.27  ? 336 GLN B CD    1 
ATOM   7105  O  OE1   . GLN B  2  336 ? -20.212 -20.089 73.463  1.00 79.46  ? 336 GLN B OE1   1 
ATOM   7106  N  NE2   . GLN B  2  336 ? -18.366 -21.339 73.212  1.00 69.35  ? 336 GLN B NE2   1 
ATOM   7107  N  N     . TRP B  2  337 ? -19.501 -18.360 67.624  1.00 43.03  ? 337 TRP B N     1 
ATOM   7108  C  CA    . TRP B  2  337 ? -20.165 -18.112 66.355  1.00 37.29  ? 337 TRP B CA    1 
ATOM   7109  C  C     . TRP B  2  337 ? -20.582 -19.436 65.734  1.00 45.11  ? 337 TRP B C     1 
ATOM   7110  O  O     . TRP B  2  337 ? -19.813 -20.401 65.736  1.00 40.80  ? 337 TRP B O     1 
ATOM   7111  C  CB    . TRP B  2  337 ? -19.245 -17.339 65.395  1.00 33.60  ? 337 TRP B CB    1 
ATOM   7112  C  CG    . TRP B  2  337 ? -18.664 -16.084 65.998  1.00 40.05  ? 337 TRP B CG    1 
ATOM   7113  C  CD1   . TRP B  2  337 ? -17.705 -16.005 66.970  1.00 32.14  ? 337 TRP B CD1   1 
ATOM   7114  C  CD2   . TRP B  2  337 ? -19.001 -14.732 65.661  1.00 29.85  ? 337 TRP B CD2   1 
ATOM   7115  N  NE1   . TRP B  2  337 ? -17.433 -14.691 67.262  1.00 34.12  ? 337 TRP B NE1   1 
ATOM   7116  C  CE2   . TRP B  2  337 ? -18.213 -13.889 66.471  1.00 39.66  ? 337 TRP B CE2   1 
ATOM   7117  C  CE3   . TRP B  2  337 ? -19.894 -14.154 64.755  1.00 37.72  ? 337 TRP B CE3   1 
ATOM   7118  C  CZ2   . TRP B  2  337 ? -18.291 -12.499 66.401  1.00 36.41  ? 337 TRP B CZ2   1 
ATOM   7119  C  CZ3   . TRP B  2  337 ? -19.970 -12.775 64.686  1.00 31.31  ? 337 TRP B CZ3   1 
ATOM   7120  C  CH2   . TRP B  2  337 ? -19.174 -11.963 65.504  1.00 30.86  ? 337 TRP B CH2   1 
ATOM   7121  N  N     . THR B  2  338 ? -21.805 -19.479 65.221  1.00 47.48  ? 338 THR B N     1 
ATOM   7122  C  CA    . THR B  2  338 ? -22.349 -20.667 64.586  1.00 33.70  ? 338 THR B CA    1 
ATOM   7123  C  C     . THR B  2  338 ? -22.565 -20.381 63.108  1.00 36.40  ? 338 THR B C     1 
ATOM   7124  O  O     . THR B  2  338 ? -22.836 -19.243 62.715  1.00 48.87  ? 338 THR B O     1 
ATOM   7125  C  CB    . THR B  2  338 ? -23.666 -21.098 65.238  1.00 47.28  ? 338 THR B CB    1 
ATOM   7126  O  OG1   . THR B  2  338 ? -24.562 -19.981 65.298  1.00 38.11  ? 338 THR B OG1   1 
ATOM   7127  C  CG2   . THR B  2  338 ? -23.417 -21.620 66.641  1.00 36.68  ? 338 THR B CG2   1 
ATOM   7128  N  N     . TYR B  2  339 ? -22.467 -21.425 62.289  1.00 34.45  ? 339 TYR B N     1 
ATOM   7129  C  CA    . TYR B  2  339 ? -22.687 -21.272 60.861  1.00 34.58  ? 339 TYR B CA    1 
ATOM   7130  C  C     . TYR B  2  339 ? -23.373 -22.508 60.304  1.00 43.85  ? 339 TYR B C     1 
ATOM   7131  O  O     . TYR B  2  339 ? -23.302 -23.601 60.874  1.00 38.59  ? 339 TYR B O     1 
ATOM   7132  C  CB    . TYR B  2  339 ? -21.375 -21.020 60.107  1.00 31.28  ? 339 TYR B CB    1 
ATOM   7133  C  CG    . TYR B  2  339 ? -20.391 -22.162 60.195  1.00 36.46  ? 339 TYR B CG    1 
ATOM   7134  C  CD1   . TYR B  2  339 ? -20.300 -23.107 59.180  1.00 36.07  ? 339 TYR B CD1   1 
ATOM   7135  C  CD2   . TYR B  2  339 ? -19.556 -22.299 61.293  1.00 35.87  ? 339 TYR B CD2   1 
ATOM   7136  C  CE1   . TYR B  2  339 ? -19.401 -24.154 59.258  1.00 40.84  ? 339 TYR B CE1   1 
ATOM   7137  C  CE2   . TYR B  2  339 ? -18.656 -23.340 61.381  1.00 44.70  ? 339 TYR B CE2   1 
ATOM   7138  C  CZ    . TYR B  2  339 ? -18.581 -24.266 60.361  1.00 44.76  ? 339 TYR B CZ    1 
ATOM   7139  O  OH    . TYR B  2  339 ? -17.681 -25.306 60.446  1.00 51.08  ? 339 TYR B OH    1 
ATOM   7140  N  N     . GLN B  2  340 ? -24.055 -22.308 59.180  1.00 33.46  ? 340 GLN B N     1 
ATOM   7141  C  CA    . GLN B  2  340 ? -24.605 -23.389 58.381  1.00 34.30  ? 340 GLN B CA    1 
ATOM   7142  C  C     . GLN B  2  340 ? -24.277 -23.135 56.920  1.00 42.59  ? 340 GLN B C     1 
ATOM   7143  O  O     . GLN B  2  340 ? -24.408 -22.008 56.433  1.00 42.15  ? 340 GLN B O     1 
ATOM   7144  C  CB    . GLN B  2  340 ? -26.128 -23.497 58.549  1.00 39.80  ? 340 GLN B CB    1 
ATOM   7145  C  CG    . GLN B  2  340 ? -26.612 -23.578 59.991  1.00 40.87  ? 340 GLN B CG    1 
ATOM   7146  C  CD    . GLN B  2  340 ? -26.599 -22.233 60.699  1.00 45.45  ? 340 GLN B CD    1 
ATOM   7147  O  OE1   . GLN B  2  340 ? -26.969 -21.211 60.121  1.00 43.05  ? 340 GLN B OE1   1 
ATOM   7148  N  NE2   . GLN B  2  340 ? -26.159 -22.227 61.952  1.00 36.38  ? 340 GLN B NE2   1 
ATOM   7149  N  N     . ILE B  2  341 ? -23.886 -24.192 56.217  1.00 39.12  ? 341 ILE B N     1 
ATOM   7150  C  CA    . ILE B  2  341 ? -23.675 -24.155 54.776  1.00 38.69  ? 341 ILE B CA    1 
ATOM   7151  C  C     . ILE B  2  341 ? -24.797 -24.947 54.126  1.00 41.45  ? 341 ILE B C     1 
ATOM   7152  O  O     . ILE B  2  341 ? -25.099 -26.069 54.551  1.00 46.10  ? 341 ILE B O     1 
ATOM   7153  C  CB    . ILE B  2  341 ? -22.297 -24.718 54.390  1.00 39.85  ? 341 ILE B CB    1 
ATOM   7154  C  CG1   . ILE B  2  341 ? -21.191 -23.962 55.129  1.00 40.14  ? 341 ILE B CG1   1 
ATOM   7155  C  CG2   . ILE B  2  341 ? -22.086 -24.624 52.887  1.00 40.50  ? 341 ILE B CG2   1 
ATOM   7156  C  CD1   . ILE B  2  341 ? -19.796 -24.478 54.836  1.00 36.95  ? 341 ILE B CD1   1 
ATOM   7157  N  N     . TYR B  2  342 ? -25.412 -24.369 53.097  1.00 40.73  ? 342 TYR B N     1 
ATOM   7158  C  CA    . TYR B  2  342 ? -26.498 -25.045 52.405  1.00 40.30  ? 342 TYR B CA    1 
ATOM   7159  C  C     . TYR B  2  342 ? -26.597 -24.544 50.972  1.00 46.88  ? 342 TYR B C     1 
ATOM   7160  O  O     . TYR B  2  342 ? -25.922 -23.594 50.566  1.00 44.51  ? 342 TYR B O     1 
ATOM   7161  C  CB    . TYR B  2  342 ? -27.834 -24.830 53.128  1.00 37.69  ? 342 TYR B CB    1 
ATOM   7162  C  CG    . TYR B  2  342 ? -28.281 -23.380 53.181  1.00 44.61  ? 342 TYR B CG    1 
ATOM   7163  C  CD1   . TYR B  2  342 ? -29.059 -22.834 52.167  1.00 45.47  ? 342 TYR B CD1   1 
ATOM   7164  C  CD2   . TYR B  2  342 ? -27.925 -22.560 54.244  1.00 47.33  ? 342 TYR B CD2   1 
ATOM   7165  C  CE1   . TYR B  2  342 ? -29.467 -21.513 52.208  1.00 46.01  ? 342 TYR B CE1   1 
ATOM   7166  C  CE2   . TYR B  2  342 ? -28.331 -21.238 54.295  1.00 51.20  ? 342 TYR B CE2   1 
ATOM   7167  C  CZ    . TYR B  2  342 ? -29.102 -20.720 53.275  1.00 49.99  ? 342 TYR B CZ    1 
ATOM   7168  O  OH    . TYR B  2  342 ? -29.507 -19.405 53.323  1.00 53.39  ? 342 TYR B OH    1 
ATOM   7169  N  N     . GLN B  2  343 ? -27.464 -25.204 50.214  1.00 43.56  ? 343 GLN B N     1 
ATOM   7170  C  CA    . GLN B  2  343 ? -27.805 -24.857 48.842  1.00 42.75  ? 343 GLN B CA    1 
ATOM   7171  C  C     . GLN B  2  343 ? -29.287 -24.567 48.678  1.00 46.07  ? 343 GLN B C     1 
ATOM   7172  O  O     . GLN B  2  343 ? -29.655 -23.594 48.015  1.00 53.07  ? 343 GLN B O     1 
ATOM   7173  C  CB    . GLN B  2  343 ? -27.380 -25.979 47.885  1.00 49.30  ? 343 GLN B CB    1 
ATOM   7174  C  CG    . GLN B  2  343 ? -25.875 -26.179 47.832  1.00 39.25  ? 343 GLN B CG    1 
ATOM   7175  C  CD    . GLN B  2  343 ? -25.451 -27.238 46.835  1.00 49.41  ? 343 GLN B CD    1 
ATOM   7176  O  OE1   . GLN B  2  343 ? -25.958 -28.360 46.848  1.00 48.56  ? 343 GLN B OE1   1 
ATOM   7177  N  NE2   . GLN B  2  343 ? -24.514 -26.886 45.963  1.00 42.81  ? 343 GLN B NE2   1 
ATOM   7178  N  N     . GLU B  2  344 ? -30.148 -25.398 49.270  1.00 53.52  ? 344 GLU B N     1 
ATOM   7179  C  CA    . GLU B  2  344 ? -31.570 -25.159 49.430  1.00 64.69  ? 344 GLU B CA    1 
ATOM   7180  C  C     . GLU B  2  344 ? -31.876 -24.876 50.895  1.00 66.98  ? 344 GLU B C     1 
ATOM   7181  O  O     . GLU B  2  344 ? -31.231 -25.454 51.779  1.00 66.01  ? 344 GLU B O     1 
ATOM   7182  C  CB    . GLU B  2  344 ? -32.398 -26.362 48.961  1.00 65.45  ? 344 GLU B CB    1 
ATOM   7183  C  CG    . GLU B  2  344 ? -32.155 -26.767 47.514  1.00 72.71  ? 344 GLU B CG    1 
ATOM   7184  C  CD    . GLU B  2  344 ? -32.681 -25.749 46.521  1.00 89.58  ? 344 GLU B CD    1 
ATOM   7185  O  OE1   . GLU B  2  344 ? -33.517 -24.904 46.909  1.00 102.28 ? 344 GLU B OE1   1 
ATOM   7186  O  OE2   . GLU B  2  344 ? -32.258 -25.795 45.347  1.00 88.69  ? 344 GLU B OE2   1 
ATOM   7187  N  N     . PRO B  2  345 ? -32.815 -23.976 51.184  1.00 71.67  ? 345 PRO B N     1 
ATOM   7188  C  CA    . PRO B  2  345 ? -33.175 -23.703 52.582  1.00 63.57  ? 345 PRO B CA    1 
ATOM   7189  C  C     . PRO B  2  345 ? -33.540 -24.974 53.336  1.00 54.86  ? 345 PRO B C     1 
ATOM   7190  O  O     . PRO B  2  345 ? -34.231 -25.852 52.813  1.00 65.55  ? 345 PRO B O     1 
ATOM   7191  C  CB    . PRO B  2  345 ? -34.375 -22.759 52.458  1.00 67.90  ? 345 PRO B CB    1 
ATOM   7192  C  CG    . PRO B  2  345 ? -34.201 -22.106 51.130  1.00 70.30  ? 345 PRO B CG    1 
ATOM   7193  C  CD    . PRO B  2  345 ? -33.584 -23.146 50.241  1.00 75.87  ? 345 PRO B CD    1 
ATOM   7194  N  N     . PHE B  2  346 ? -33.055 -25.070 54.574  1.00 53.56  ? 346 PHE B N     1 
ATOM   7195  C  CA    . PHE B  2  346 ? -33.395 -26.102 55.551  1.00 58.34  ? 346 PHE B CA    1 
ATOM   7196  C  C     . PHE B  2  346 ? -32.764 -27.446 55.218  1.00 61.65  ? 346 PHE B C     1 
ATOM   7197  O  O     . PHE B  2  346 ? -32.932 -28.403 55.984  1.00 75.18  ? 346 PHE B O     1 
ATOM   7198  C  CB    . PHE B  2  346 ? -34.911 -26.261 55.730  1.00 61.94  ? 346 PHE B CB    1 
ATOM   7199  C  CG    . PHE B  2  346 ? -35.584 -25.015 56.226  1.00 70.19  ? 346 PHE B CG    1 
ATOM   7200  C  CD1   . PHE B  2  346 ? -35.325 -24.536 57.500  1.00 72.98  ? 346 PHE B CD1   1 
ATOM   7201  C  CD2   . PHE B  2  346 ? -36.466 -24.316 55.420  1.00 73.35  ? 346 PHE B CD2   1 
ATOM   7202  C  CE1   . PHE B  2  346 ? -35.937 -23.387 57.964  1.00 75.41  ? 346 PHE B CE1   1 
ATOM   7203  C  CE2   . PHE B  2  346 ? -37.082 -23.166 55.878  1.00 78.72  ? 346 PHE B CE2   1 
ATOM   7204  C  CZ    . PHE B  2  346 ? -36.817 -22.701 57.152  1.00 80.86  ? 346 PHE B CZ    1 
ATOM   7205  N  N     . LYS B  2  347 ? -32.049 -27.553 54.105  1.00 50.85  ? 347 LYS B N     1 
ATOM   7206  C  CA    . LYS B  2  347 ? -31.252 -28.726 53.765  1.00 54.40  ? 347 LYS B CA    1 
ATOM   7207  C  C     . LYS B  2  347 ? -29.793 -28.290 53.862  1.00 56.76  ? 347 LYS B C     1 
ATOM   7208  O  O     . LYS B  2  347 ? -29.231 -27.732 52.919  1.00 63.24  ? 347 LYS B O     1 
ATOM   7209  C  CB    . LYS B  2  347 ? -31.608 -29.245 52.374  1.00 56.12  ? 347 LYS B CB    1 
ATOM   7210  C  CG    . LYS B  2  347 ? -33.099 -29.477 52.172  1.00 54.81  ? 347 LYS B CG    1 
ATOM   7211  C  CD    . LYS B  2  347 ? -33.459 -30.947 52.292  1.00 70.08  ? 347 LYS B CD    1 
ATOM   7212  C  CE    . LYS B  2  347 ? -34.906 -31.137 52.711  1.00 81.91  ? 347 LYS B CE    1 
ATOM   7213  N  NZ    . LYS B  2  347 ? -35.102 -30.792 54.146  1.00 93.31  ? 347 LYS B NZ    1 
ATOM   7214  N  N     . ASN B  2  348 ? -29.193 -28.528 55.025  1.00 41.56  ? 348 ASN B N     1 
ATOM   7215  C  CA    . ASN B  2  348 ? -27.876 -27.999 55.359  1.00 40.41  ? 348 ASN B CA    1 
ATOM   7216  C  C     . ASN B  2  348 ? -26.825 -29.073 55.119  1.00 45.83  ? 348 ASN B C     1 
ATOM   7217  O  O     . ASN B  2  348 ? -26.910 -30.168 55.685  1.00 60.40  ? 348 ASN B O     1 
ATOM   7218  C  CB    . ASN B  2  348 ? -27.826 -27.526 56.811  1.00 44.35  ? 348 ASN B CB    1 
ATOM   7219  C  CG    . ASN B  2  348 ? -28.625 -26.264 57.039  1.00 52.01  ? 348 ASN B CG    1 
ATOM   7220  O  OD1   . ASN B  2  348 ? -28.758 -25.429 56.145  1.00 54.76  ? 348 ASN B OD1   1 
ATOM   7221  N  ND2   . ASN B  2  348 ? -29.161 -26.114 58.244  1.00 60.80  ? 348 ASN B ND2   1 
ATOM   7222  N  N     . LEU B  2  349 ? -25.838 -28.757 54.281  1.00 41.30  ? 349 LEU B N     1 
ATOM   7223  C  CA    . LEU B  2  349 ? -24.772 -29.712 54.016  1.00 40.69  ? 349 LEU B CA    1 
ATOM   7224  C  C     . LEU B  2  349 ? -23.785 -29.793 55.173  1.00 42.95  ? 349 LEU B C     1 
ATOM   7225  O  O     . LEU B  2  349 ? -23.158 -30.839 55.374  1.00 56.44  ? 349 LEU B O     1 
ATOM   7226  C  CB    . LEU B  2  349 ? -24.044 -29.335 52.724  1.00 44.18  ? 349 LEU B CB    1 
ATOM   7227  C  CG    . LEU B  2  349 ? -24.928 -29.093 51.497  1.00 40.18  ? 349 LEU B CG    1 
ATOM   7228  C  CD1   . LEU B  2  349 ? -24.088 -28.734 50.276  1.00 43.14  ? 349 LEU B CD1   1 
ATOM   7229  C  CD2   . LEU B  2  349 ? -25.804 -30.304 51.212  1.00 44.35  ? 349 LEU B CD2   1 
ATOM   7230  N  N     . LYS B  2  350 ? -23.635 -28.714 55.938  1.00 42.86  ? 350 LYS B N     1 
ATOM   7231  C  CA    . LYS B  2  350 ? -22.802 -28.723 57.131  1.00 49.34  ? 350 LYS B CA    1 
ATOM   7232  C  C     . LYS B  2  350 ? -23.274 -27.619 58.066  1.00 48.93  ? 350 LYS B C     1 
ATOM   7233  O  O     . LYS B  2  350 ? -23.753 -26.574 57.619  1.00 44.44  ? 350 LYS B O     1 
ATOM   7234  C  CB    . LYS B  2  350 ? -21.320 -28.543 56.776  1.00 51.59  ? 350 LYS B CB    1 
ATOM   7235  C  CG    . LYS B  2  350 ? -20.370 -28.540 57.964  1.00 56.85  ? 350 LYS B CG    1 
ATOM   7236  C  CD    . LYS B  2  350 ? -18.924 -28.483 57.503  1.00 63.41  ? 350 LYS B CD    1 
ATOM   7237  C  CE    . LYS B  2  350 ? -17.998 -28.025 58.616  1.00 63.32  ? 350 LYS B CE    1 
ATOM   7238  N  NZ    . LYS B  2  350 ? -17.954 -28.982 59.754  1.00 73.48  ? 350 LYS B NZ    1 
ATOM   7239  N  N     . THR B  2  351 ? -23.121 -27.859 59.367  1.00 46.47  ? 351 THR B N     1 
ATOM   7240  C  CA    . THR B  2  351 ? -23.410 -26.874 60.400  1.00 38.66  ? 351 THR B CA    1 
ATOM   7241  C  C     . THR B  2  351 ? -22.315 -26.971 61.449  1.00 44.35  ? 351 THR B C     1 
ATOM   7242  O  O     . THR B  2  351 ? -21.916 -28.073 61.832  1.00 55.48  ? 351 THR B O     1 
ATOM   7243  C  CB    . THR B  2  351 ? -24.781 -27.093 61.066  1.00 40.80  ? 351 THR B CB    1 
ATOM   7244  O  OG1   . THR B  2  351 ? -24.711 -28.213 61.957  1.00 48.06  ? 351 THR B OG1   1 
ATOM   7245  C  CG2   . THR B  2  351 ? -25.873 -27.343 60.029  1.00 48.31  ? 351 THR B CG2   1 
ATOM   7246  N  N     . GLY B  2  352 ? -21.821 -25.822 61.905  1.00 40.19  ? 352 GLY B N     1 
ATOM   7247  C  CA    . GLY B  2  352 ? -20.701 -25.825 62.819  1.00 35.63  ? 352 GLY B CA    1 
ATOM   7248  C  C     . GLY B  2  352 ? -20.734 -24.645 63.764  1.00 43.58  ? 352 GLY B C     1 
ATOM   7249  O  O     . GLY B  2  352 ? -21.590 -23.764 63.670  1.00 49.66  ? 352 GLY B O     1 
ATOM   7250  N  N     . LYS B  2  353 ? -19.782 -24.647 64.694  1.00 44.14  ? 353 LYS B N     1 
ATOM   7251  C  CA    . LYS B  2  353 ? -19.594 -23.560 65.641  1.00 43.03  ? 353 LYS B CA    1 
ATOM   7252  C  C     . LYS B  2  353 ? -18.106 -23.277 65.778  1.00 44.76  ? 353 LYS B C     1 
ATOM   7253  O  O     . LYS B  2  353 ? -17.289 -24.200 65.738  1.00 43.67  ? 353 LYS B O     1 
ATOM   7254  C  CB    . LYS B  2  353 ? -20.204 -23.903 67.009  1.00 41.57  ? 353 LYS B CB    1 
ATOM   7255  C  CG    . LYS B  2  353 ? -20.226 -22.746 67.995  1.00 44.22  ? 353 LYS B CG    1 
ATOM   7256  C  CD    . LYS B  2  353 ? -20.990 -23.107 69.258  1.00 55.40  ? 353 LYS B CD    1 
ATOM   7257  C  CE    . LYS B  2  353 ? -20.236 -24.127 70.096  1.00 63.63  ? 353 LYS B CE    1 
ATOM   7258  N  NZ    . LYS B  2  353 ? -19.002 -23.546 70.692  1.00 78.34  ? 353 LYS B NZ    1 
ATOM   7259  N  N     . TYR B  2  354 ? -17.757 -22.003 65.943  1.00 46.35  ? 354 TYR B N     1 
ATOM   7260  C  CA    . TYR B  2  354 ? -16.402 -21.608 66.298  1.00 37.27  ? 354 TYR B CA    1 
ATOM   7261  C  C     . TYR B  2  354 ? -16.405 -20.869 67.628  1.00 37.14  ? 354 TYR B C     1 
ATOM   7262  O  O     . TYR B  2  354 ? -17.395 -20.233 68.003  1.00 48.75  ? 354 TYR B O     1 
ATOM   7263  C  CB    . TYR B  2  354 ? -15.776 -20.695 65.236  1.00 31.37  ? 354 TYR B CB    1 
ATOM   7264  C  CG    . TYR B  2  354 ? -15.671 -21.292 63.855  1.00 36.44  ? 354 TYR B CG    1 
ATOM   7265  C  CD1   . TYR B  2  354 ? -15.425 -22.646 63.674  1.00 35.03  ? 354 TYR B CD1   1 
ATOM   7266  C  CD2   . TYR B  2  354 ? -15.815 -20.494 62.727  1.00 37.67  ? 354 TYR B CD2   1 
ATOM   7267  C  CE1   . TYR B  2  354 ? -15.326 -23.189 62.407  1.00 31.81  ? 354 TYR B CE1   1 
ATOM   7268  C  CE2   . TYR B  2  354 ? -15.720 -21.028 61.457  1.00 46.16  ? 354 TYR B CE2   1 
ATOM   7269  C  CZ    . TYR B  2  354 ? -15.474 -22.375 61.302  1.00 51.40  ? 354 TYR B CZ    1 
ATOM   7270  O  OH    . TYR B  2  354 ? -15.378 -22.911 60.037  1.00 54.37  ? 354 TYR B OH    1 
ATOM   7271  N  N     . ALA B  2  355 ? -15.285 -20.969 68.340  1.00 41.91  ? 355 ALA B N     1 
ATOM   7272  C  CA    . ALA B  2  355 ? -15.131 -20.324 69.634  1.00 42.87  ? 355 ALA B CA    1 
ATOM   7273  C  C     . ALA B  2  355 ? -13.668 -19.954 69.830  1.00 39.31  ? 355 ALA B C     1 
ATOM   7274  O  O     . ALA B  2  355 ? -12.770 -20.564 69.243  1.00 39.69  ? 355 ALA B O     1 
ATOM   7275  C  CB    . ALA B  2  355 ? -15.623 -21.221 70.777  1.00 36.26  ? 355 ALA B CB    1 
ATOM   7276  N  N     . ARG B  2  356 ? -13.441 -18.951 70.683  1.00 43.11  ? 356 ARG B N     1 
ATOM   7277  C  CA    . ARG B  2  356 ? -12.094 -18.532 71.086  1.00 41.17  ? 356 ARG B CA    1 
ATOM   7278  C  C     . ARG B  2  356 ? -11.189 -18.278 69.883  1.00 43.89  ? 356 ARG B C     1 
ATOM   7279  O  O     . ARG B  2  356 ? -9.987  -18.548 69.912  1.00 49.22  ? 356 ARG B O     1 
ATOM   7280  C  CB    . ARG B  2  356 ? -11.460 -19.552 72.033  1.00 44.55  ? 356 ARG B CB    1 
ATOM   7281  C  CG    . ARG B  2  356 ? -11.941 -19.443 73.469  1.00 57.92  ? 356 ARG B CG    1 
ATOM   7282  C  CD    . ARG B  2  356 ? -10.779 -19.545 74.442  1.00 65.64  ? 356 ARG B CD    1 
ATOM   7283  N  NE    . ARG B  2  356 ? -10.180 -20.876 74.436  1.00 72.43  ? 356 ARG B NE    1 
ATOM   7284  C  CZ    . ARG B  2  356 ? -10.404 -21.799 75.365  1.00 86.13  ? 356 ARG B CZ    1 
ATOM   7285  N  NH1   . ARG B  2  356 ? -11.207 -21.536 76.387  1.00 95.64  ? 356 ARG B NH1   1 
ATOM   7286  N  NH2   . ARG B  2  356 ? -9.820  -22.986 75.276  1.00 90.40  ? 356 ARG B NH2   1 
ATOM   7287  N  N     . MET B  2  357 ? -11.771 -17.747 68.811  1.00 49.97  ? 357 MET B N     1 
ATOM   7288  C  CA    . MET B  2  357 ? -10.954 -17.297 67.699  1.00 31.12  ? 357 MET B CA    1 
ATOM   7289  C  C     . MET B  2  357 ? -10.207 -16.024 68.083  1.00 42.55  ? 357 MET B C     1 
ATOM   7290  O  O     . MET B  2  357 ? -10.453 -15.416 69.128  1.00 49.66  ? 357 MET B O     1 
ATOM   7291  C  CB    . MET B  2  357 ? -11.812 -17.056 66.461  1.00 33.02  ? 357 MET B CB    1 
ATOM   7292  C  CG    . MET B  2  357 ? -12.483 -18.300 65.932  1.00 43.73  ? 357 MET B CG    1 
ATOM   7293  S  SD    . MET B  2  357 ? -13.584 -17.936 64.552  1.00 90.71  ? 357 MET B SD    1 
ATOM   7294  C  CE    . MET B  2  357 ? -14.741 -16.809 65.334  1.00 97.92  ? 357 MET B CE    1 
ATOM   7295  N  N     . ARG B  2  358 ? -9.252  -15.644 67.237  1.00 42.41  ? 358 ARG B N     1 
ATOM   7296  C  CA    . ARG B  2  358 ? -8.531  -14.396 67.445  1.00 37.26  ? 358 ARG B CA    1 
ATOM   7297  C  C     . ARG B  2  358 ? -9.501  -13.227 67.552  1.00 42.22  ? 358 ARG B C     1 
ATOM   7298  O  O     . ARG B  2  358 ? -10.527 -13.180 66.867  1.00 42.44  ? 358 ARG B O     1 
ATOM   7299  C  CB    . ARG B  2  358 ? -7.525  -14.163 66.314  1.00 32.93  ? 358 ARG B CB    1 
ATOM   7300  C  CG    . ARG B  2  358 ? -8.126  -13.874 64.948  1.00 38.73  ? 358 ARG B CG    1 
ATOM   7301  C  CD    . ARG B  2  358 ? -7.033  -13.862 63.891  1.00 43.94  ? 358 ARG B CD    1 
ATOM   7302  N  NE    . ARG B  2  358 ? -7.536  -13.557 62.556  1.00 62.20  ? 358 ARG B NE    1 
ATOM   7303  C  CZ    . ARG B  2  358 ? -7.238  -12.455 61.877  1.00 62.85  ? 358 ARG B CZ    1 
ATOM   7304  N  NH1   . ARG B  2  358 ? -6.426  -11.546 62.401  1.00 53.34  ? 358 ARG B NH1   1 
ATOM   7305  N  NH2   . ARG B  2  358 ? -7.744  -12.266 60.666  1.00 60.52  ? 358 ARG B NH2   1 
ATOM   7306  N  N     . GLY B  2  359 ? -9.179  -12.289 68.437  1.00 51.07  ? 359 GLY B N     1 
ATOM   7307  C  CA    . GLY B  2  359 ? -10.074 -11.185 68.703  1.00 44.75  ? 359 GLY B CA    1 
ATOM   7308  C  C     . GLY B  2  359 ? -11.303 -11.537 69.507  1.00 53.64  ? 359 GLY B C     1 
ATOM   7309  O  O     . GLY B  2  359 ? -12.265 -10.765 69.512  1.00 55.15  ? 359 GLY B O     1 
ATOM   7310  N  N     . ALA B  2  360 ? -11.316 -12.693 70.168  1.00 46.66  ? 360 ALA B N     1 
ATOM   7311  C  CA    . ALA B  2  360 ? -12.461 -13.054 70.990  1.00 39.22  ? 360 ALA B CA    1 
ATOM   7312  C  C     . ALA B  2  360 ? -12.521 -12.154 72.214  1.00 43.58  ? 360 ALA B C     1 
ATOM   7313  O  O     . ALA B  2  360 ? -11.493 -11.831 72.816  1.00 51.64  ? 360 ALA B O     1 
ATOM   7314  C  CB    . ALA B  2  360 ? -12.386 -14.519 71.417  1.00 36.79  ? 360 ALA B CB    1 
ATOM   7315  N  N     . HIS B  2  361 ? -13.737 -11.744 72.572  1.00 40.76  ? 361 HIS B N     1 
ATOM   7316  C  CA    . HIS B  2  361 ? -14.020 -10.883 73.717  1.00 33.14  ? 361 HIS B CA    1 
ATOM   7317  C  C     . HIS B  2  361 ? -13.481 -9.468  73.536  1.00 38.32  ? 361 HIS B C     1 
ATOM   7318  O  O     . HIS B  2  361 ? -13.545 -8.670  74.478  1.00 40.41  ? 361 HIS B O     1 
ATOM   7319  C  CB    . HIS B  2  361 ? -13.486 -11.472 75.032  1.00 34.43  ? 361 HIS B CB    1 
ATOM   7320  C  CG    . HIS B  2  361 ? -13.860 -12.907 75.256  1.00 44.44  ? 361 HIS B CG    1 
ATOM   7321  N  ND1   . HIS B  2  361 ? -15.108 -13.295 75.698  1.00 41.97  ? 361 HIS B ND1   1 
ATOM   7322  C  CD2   . HIS B  2  361 ? -13.145 -14.048 75.107  1.00 45.86  ? 361 HIS B CD2   1 
ATOM   7323  C  CE1   . HIS B  2  361 ? -15.146 -14.612 75.806  1.00 49.23  ? 361 HIS B CE1   1 
ATOM   7324  N  NE2   . HIS B  2  361 ? -13.967 -15.093 75.453  1.00 46.70  ? 361 HIS B NE2   1 
ATOM   7325  N  N     . THR B  2  362 ? -12.970 -9.119  72.351  1.00 44.40  ? 362 THR B N     1 
ATOM   7326  C  CA    . THR B  2  362 ? -12.545 -7.742  72.122  1.00 43.56  ? 362 THR B CA    1 
ATOM   7327  C  C     . THR B  2  362 ? -13.011 -7.167  70.781  1.00 30.49  ? 362 THR B C     1 
ATOM   7328  O  O     . THR B  2  362 ? -13.429 -6.006  70.732  1.00 35.50  ? 362 THR B O     1 
ATOM   7329  C  CB    . THR B  2  362 ? -11.015 -7.635  72.263  1.00 44.73  ? 362 THR B CB    1 
ATOM   7330  O  OG1   . THR B  2  362 ? -10.629 -6.255  72.318  1.00 39.52  ? 362 THR B OG1   1 
ATOM   7331  C  CG2   . THR B  2  362 ? -10.277 -8.327  71.114  1.00 42.40  ? 362 THR B CG2   1 
ATOM   7332  N  N     . ASN B  2  363 ? -12.963 -7.945  69.697  1.00 31.48  ? 363 ASN B N     1 
ATOM   7333  C  CA    . ASN B  2  363 ? -13.207 -7.427  68.350  1.00 31.75  ? 363 ASN B CA    1 
ATOM   7334  C  C     . ASN B  2  363 ? -14.162 -8.351  67.601  1.00 45.95  ? 363 ASN B C     1 
ATOM   7335  O  O     . ASN B  2  363 ? -13.801 -9.485  67.271  1.00 50.84  ? 363 ASN B O     1 
ATOM   7336  C  CB    . ASN B  2  363 ? -11.893 -7.267  67.582  1.00 36.51  ? 363 ASN B CB    1 
ATOM   7337  C  CG    . ASN B  2  363 ? -12.039 -6.412  66.332  1.00 48.48  ? 363 ASN B CG    1 
ATOM   7338  O  OD1   . ASN B  2  363 ? -13.090 -6.396  65.692  1.00 40.84  ? 363 ASN B OD1   1 
ATOM   7339  N  ND2   . ASN B  2  363 ? -10.978 -5.697  65.980  1.00 33.82  ? 363 ASN B ND2   1 
ATOM   7340  N  N     . ASP B  2  364 ? -15.379 -7.864  67.333  1.00 54.98  ? 364 ASP B N     1 
ATOM   7341  C  CA    . ASP B  2  364 ? -16.359 -8.659  66.594  1.00 47.15  ? 364 ASP B CA    1 
ATOM   7342  C  C     . ASP B  2  364 ? -15.993 -8.791  65.118  1.00 52.65  ? 364 ASP B C     1 
ATOM   7343  O  O     . ASP B  2  364 ? -16.153 -9.869  64.531  1.00 49.71  ? 364 ASP B O     1 
ATOM   7344  C  CB    . ASP B  2  364 ? -17.750 -8.041  66.732  1.00 56.78  ? 364 ASP B CB    1 
ATOM   7345  C  CG    . ASP B  2  364 ? -18.531 -8.612  67.895  1.00 49.26  ? 364 ASP B CG    1 
ATOM   7346  O  OD1   . ASP B  2  364 ? -18.156 -9.697  68.388  1.00 46.94  ? 364 ASP B OD1   1 
ATOM   7347  O  OD2   . ASP B  2  364 ? -19.527 -7.979  68.304  1.00 38.73  ? 364 ASP B OD2   1 
ATOM   7348  N  N     . VAL B  2  365 ? -15.506 -7.712  64.501  1.00 46.26  ? 365 VAL B N     1 
ATOM   7349  C  CA    . VAL B  2  365 ? -15.202 -7.748  63.071  1.00 42.47  ? 365 VAL B CA    1 
ATOM   7350  C  C     . VAL B  2  365 ? -14.030 -8.681  62.788  1.00 40.18  ? 365 VAL B C     1 
ATOM   7351  O  O     . VAL B  2  365 ? -14.054 -9.449  61.817  1.00 34.17  ? 365 VAL B O     1 
ATOM   7352  C  CB    . VAL B  2  365 ? -14.938 -6.325  62.547  1.00 35.79  ? 365 VAL B CB    1 
ATOM   7353  C  CG1   . VAL B  2  365 ? -14.639 -6.351  61.055  1.00 37.11  ? 365 VAL B CG1   1 
ATOM   7354  C  CG2   . VAL B  2  365 ? -16.132 -5.425  62.836  1.00 29.66  ? 365 VAL B CG2   1 
ATOM   7355  N  N     . LYS B  2  366 ? -12.983 -8.625  63.617  1.00 41.61  ? 366 LYS B N     1 
ATOM   7356  C  CA    . LYS B  2  366 ? -11.887 -9.581  63.484  1.00 40.91  ? 366 LYS B CA    1 
ATOM   7357  C  C     . LYS B  2  366 ? -12.386 -11.015 63.607  1.00 40.87  ? 366 LYS B C     1 
ATOM   7358  O  O     . LYS B  2  366 ? -11.957 -11.897 62.854  1.00 49.89  ? 366 LYS B O     1 
ATOM   7359  C  CB    . LYS B  2  366 ? -10.801 -9.302  64.523  1.00 40.33  ? 366 LYS B CB    1 
ATOM   7360  C  CG    . LYS B  2  366 ? -9.643  -10.291 64.455  1.00 53.32  ? 366 LYS B CG    1 
ATOM   7361  C  CD    . LYS B  2  366 ? -8.642  -10.105 65.587  1.00 52.00  ? 366 LYS B CD    1 
ATOM   7362  C  CE    . LYS B  2  366 ? -7.698  -8.945  65.311  1.00 39.67  ? 366 LYS B CE    1 
ATOM   7363  N  NZ    . LYS B  2  366 ? -6.659  -8.791  66.369  1.00 38.71  ? 366 LYS B NZ    1 
ATOM   7364  N  N     . GLN B  2  367 ? -13.286 -11.270 64.559  1.00 37.41  ? 367 GLN B N     1 
ATOM   7365  C  CA    . GLN B  2  367 ? -13.798 -12.624 64.732  1.00 35.55  ? 367 GLN B CA    1 
ATOM   7366  C  C     . GLN B  2  367 ? -14.650 -13.040 63.543  1.00 35.91  ? 367 GLN B C     1 
ATOM   7367  O  O     . GLN B  2  367 ? -14.551 -14.176 63.067  1.00 33.08  ? 367 GLN B O     1 
ATOM   7368  C  CB    . GLN B  2  367 ? -14.619 -12.723 66.013  1.00 30.29  ? 367 GLN B CB    1 
ATOM   7369  C  CG    . GLN B  2  367 ? -13.823 -12.702 67.293  1.00 39.79  ? 367 GLN B CG    1 
ATOM   7370  C  CD    . GLN B  2  367 ? -14.724 -12.774 68.502  1.00 42.15  ? 367 GLN B CD    1 
ATOM   7371  O  OE1   . GLN B  2  367 ? -15.059 -13.859 68.976  1.00 58.37  ? 367 GLN B OE1   1 
ATOM   7372  N  NE2   . GLN B  2  367 ? -15.135 -11.616 69.002  1.00 29.76  ? 367 GLN B NE2   1 
ATOM   7373  N  N     . LEU B  2  368 ? -15.486 -12.129 63.045  1.00 42.29  ? 368 LEU B N     1 
ATOM   7374  C  CA    . LEU B  2  368 ? -16.296 -12.443 61.875  1.00 42.98  ? 368 LEU B CA    1 
ATOM   7375  C  C     . LEU B  2  368 ? -15.413 -12.675 60.656  1.00 42.05  ? 368 LEU B C     1 
ATOM   7376  O  O     . LEU B  2  368 ? -15.684 -13.567 59.845  1.00 43.86  ? 368 LEU B O     1 
ATOM   7377  C  CB    . LEU B  2  368 ? -17.307 -11.328 61.618  1.00 28.02  ? 368 LEU B CB    1 
ATOM   7378  C  CG    . LEU B  2  368 ? -18.289 -11.568 60.471  1.00 28.32  ? 368 LEU B CG    1 
ATOM   7379  C  CD1   . LEU B  2  368 ? -19.049 -12.878 60.654  1.00 30.66  ? 368 LEU B CD1   1 
ATOM   7380  C  CD2   . LEU B  2  368 ? -19.251 -10.399 60.364  1.00 35.45  ? 368 LEU B CD2   1 
ATOM   7381  N  N     . THR B  2  369 ? -14.354 -11.875 60.511  1.00 42.01  ? 369 THR B N     1 
ATOM   7382  C  CA    . THR B  2  369 ? -13.419 -12.057 59.403  1.00 42.03  ? 369 THR B CA    1 
ATOM   7383  C  C     . THR B  2  369 ? -12.751 -13.425 59.471  1.00 47.71  ? 369 THR B C     1 
ATOM   7384  O  O     . THR B  2  369 ? -12.653 -14.132 58.461  1.00 38.86  ? 369 THR B O     1 
ATOM   7385  C  CB    . THR B  2  369 ? -12.368 -10.945 59.420  1.00 39.03  ? 369 THR B CB    1 
ATOM   7386  O  OG1   . THR B  2  369 ? -12.969 -9.712  59.007  1.00 57.02  ? 369 THR B OG1   1 
ATOM   7387  C  CG2   . THR B  2  369 ? -11.209 -11.274 58.490  1.00 35.26  ? 369 THR B CG2   1 
ATOM   7388  N  N     . GLU B  2  370 ? -12.265 -13.804 60.656  1.00 27.72  ? 370 GLU B N     1 
ATOM   7389  C  CA    . GLU B  2  370 ? -11.678 -15.129 60.841  1.00 36.90  ? 370 GLU B CA    1 
ATOM   7390  C  C     . GLU B  2  370 ? -12.666 -16.224 60.461  1.00 46.64  ? 370 GLU B C     1 
ATOM   7391  O  O     . GLU B  2  370 ? -12.312 -17.184 59.767  1.00 43.19  ? 370 GLU B O     1 
ATOM   7392  C  CB    . GLU B  2  370 ? -11.216 -15.298 62.291  1.00 28.24  ? 370 GLU B CB    1 
ATOM   7393  C  CG    . GLU B  2  370 ? -10.475 -16.601 62.572  1.00 51.22  ? 370 GLU B CG    1 
ATOM   7394  C  CD    . GLU B  2  370 ? -9.148  -16.693 61.840  1.00 54.20  ? 370 GLU B CD    1 
ATOM   7395  O  OE1   . GLU B  2  370 ? -8.613  -15.640 61.432  1.00 52.07  ? 370 GLU B OE1   1 
ATOM   7396  O  OE2   . GLU B  2  370 ? -8.639  -17.821 61.670  1.00 56.07  ? 370 GLU B OE2   1 
ATOM   7397  N  N     . ALA B  2  371 ? -13.916 -16.095 60.915  1.00 42.29  ? 371 ALA B N     1 
ATOM   7398  C  CA    . ALA B  2  371 ? -14.904 -17.143 60.683  1.00 40.30  ? 371 ALA B CA    1 
ATOM   7399  C  C     . ALA B  2  371 ? -15.187 -17.306 59.194  1.00 40.94  ? 371 ALA B C     1 
ATOM   7400  O  O     . ALA B  2  371 ? -15.245 -18.428 58.681  1.00 40.58  ? 371 ALA B O     1 
ATOM   7401  C  CB    . ALA B  2  371 ? -16.190 -16.829 61.449  1.00 34.50  ? 371 ALA B CB    1 
ATOM   7402  N  N     . VAL B  2  372 ? -15.378 -16.187 58.489  1.00 31.99  ? 372 VAL B N     1 
ATOM   7403  C  CA    . VAL B  2  372 ? -15.552 -16.221 57.036  1.00 37.72  ? 372 VAL B CA    1 
ATOM   7404  C  C     . VAL B  2  372 ? -14.400 -16.971 56.378  1.00 40.22  ? 372 VAL B C     1 
ATOM   7405  O  O     . VAL B  2  372 ? -14.603 -17.810 55.491  1.00 42.56  ? 372 VAL B O     1 
ATOM   7406  C  CB    . VAL B  2  372 ? -15.687 -14.794 56.477  1.00 40.75  ? 372 VAL B CB    1 
ATOM   7407  C  CG1   . VAL B  2  372 ? -15.690 -14.820 54.958  1.00 41.39  ? 372 VAL B CG1   1 
ATOM   7408  C  CG2   . VAL B  2  372 ? -16.954 -14.136 56.999  1.00 28.61  ? 372 VAL B CG2   1 
ATOM   7409  N  N     . GLN B  2  373 ? -13.172 -16.673 56.803  1.00 35.34  ? 373 GLN B N     1 
ATOM   7410  C  CA    . GLN B  2  373 ? -12.002 -17.344 56.245  1.00 38.18  ? 373 GLN B CA    1 
ATOM   7411  C  C     . GLN B  2  373 ? -12.039 -18.844 56.516  1.00 42.61  ? 373 GLN B C     1 
ATOM   7412  O  O     . GLN B  2  373 ? -11.839 -19.654 55.604  1.00 39.96  ? 373 GLN B O     1 
ATOM   7413  C  CB    . GLN B  2  373 ? -10.725 -16.718 56.804  1.00 34.06  ? 373 GLN B CB    1 
ATOM   7414  C  CG    . GLN B  2  373 ? -10.496 -15.292 56.334  1.00 46.75  ? 373 GLN B CG    1 
ATOM   7415  C  CD    . GLN B  2  373 ? -9.250  -14.668 56.928  1.00 66.25  ? 373 GLN B CD    1 
ATOM   7416  O  OE1   . GLN B  2  373 ? -8.882  -13.545 56.583  1.00 69.86  ? 373 GLN B OE1   1 
ATOM   7417  N  NE2   . GLN B  2  373 ? -8.594  -15.393 57.827  1.00 70.78  ? 373 GLN B NE2   1 
ATOM   7418  N  N     . LYS B  2  374 ? -12.277 -19.232 57.772  1.00 33.67  ? 374 LYS B N     1 
ATOM   7419  C  CA    . LYS B  2  374 ? -12.316 -20.652 58.113  1.00 32.95  ? 374 LYS B CA    1 
ATOM   7420  C  C     . LYS B  2  374 ? -13.393 -21.386 57.323  1.00 43.56  ? 374 LYS B C     1 
ATOM   7421  O  O     . LYS B  2  374 ? -13.162 -22.495 56.828  1.00 44.64  ? 374 LYS B O     1 
ATOM   7422  C  CB    . LYS B  2  374 ? -12.556 -20.826 59.613  1.00 37.49  ? 374 LYS B CB    1 
ATOM   7423  C  CG    . LYS B  2  374 ? -11.520 -20.161 60.503  1.00 37.63  ? 374 LYS B CG    1 
ATOM   7424  C  CD    . LYS B  2  374 ? -11.983 -20.135 61.951  1.00 44.16  ? 374 LYS B CD    1 
ATOM   7425  C  CE    . LYS B  2  374 ? -11.319 -21.228 62.778  1.00 52.18  ? 374 LYS B CE    1 
ATOM   7426  N  NZ    . LYS B  2  374 ? -9.873  -20.947 63.003  1.00 68.78  ? 374 LYS B NZ    1 
ATOM   7427  N  N     . ILE B  2  375 ? -14.575 -20.782 57.196  1.00 36.57  ? 375 ILE B N     1 
ATOM   7428  C  CA    . ILE B  2  375 ? -15.689 -21.443 56.521  1.00 37.46  ? 375 ILE B CA    1 
ATOM   7429  C  C     . ILE B  2  375 ? -15.386 -21.625 55.039  1.00 45.80  ? 375 ILE B C     1 
ATOM   7430  O  O     . ILE B  2  375 ? -15.594 -22.706 54.475  1.00 42.66  ? 375 ILE B O     1 
ATOM   7431  C  CB    . ILE B  2  375 ? -16.988 -20.648 56.738  1.00 38.99  ? 375 ILE B CB    1 
ATOM   7432  C  CG1   . ILE B  2  375 ? -17.398 -20.692 58.211  1.00 34.87  ? 375 ILE B CG1   1 
ATOM   7433  C  CG2   . ILE B  2  375 ? -18.100 -21.184 55.850  1.00 29.93  ? 375 ILE B CG2   1 
ATOM   7434  C  CD1   . ILE B  2  375 ? -18.431 -19.658 58.580  1.00 35.30  ? 375 ILE B CD1   1 
ATOM   7435  N  N     . THR B  2  376 ? -14.928 -20.557 54.380  1.00 39.09  ? 376 THR B N     1 
ATOM   7436  C  CA    . THR B  2  376 ? -14.512 -20.646 52.983  1.00 38.76  ? 376 THR B CA    1 
ATOM   7437  C  C     . THR B  2  376 ? -13.511 -21.774 52.768  1.00 39.88  ? 376 THR B C     1 
ATOM   7438  O  O     . THR B  2  376 ? -13.666 -22.594 51.855  1.00 54.39  ? 376 THR B O     1 
ATOM   7439  C  CB    . THR B  2  376 ? -13.913 -19.315 52.526  1.00 37.39  ? 376 THR B CB    1 
ATOM   7440  O  OG1   . THR B  2  376 ? -14.902 -18.283 52.623  1.00 37.00  ? 376 THR B OG1   1 
ATOM   7441  C  CG2   . THR B  2  376 ? -13.440 -19.421 51.088  1.00 33.98  ? 376 THR B CG2   1 
ATOM   7442  N  N     . THR B  2  377 ? -12.458 -21.811 53.590  1.00 31.47  ? 377 THR B N     1 
ATOM   7443  C  CA    . THR B  2  377 ? -11.450 -22.863 53.490  1.00 40.58  ? 377 THR B CA    1 
ATOM   7444  C  C     . THR B  2  377 ? -12.077 -24.250 53.550  1.00 47.02  ? 377 THR B C     1 
ATOM   7445  O  O     . THR B  2  377 ? -11.786 -25.112 52.712  1.00 64.58  ? 377 THR B O     1 
ATOM   7446  C  CB    . THR B  2  377 ? -10.412 -22.700 54.602  1.00 36.12  ? 377 THR B CB    1 
ATOM   7447  O  OG1   . THR B  2  377 ? -9.670  -21.493 54.391  1.00 42.71  ? 377 THR B OG1   1 
ATOM   7448  C  CG2   . THR B  2  377 ? -9.455  -23.885 54.614  1.00 33.92  ? 377 THR B CG2   1 
ATOM   7449  N  N     . GLU B  2  378 ? -12.928 -24.488 54.553  1.00 47.50  ? 378 GLU B N     1 
ATOM   7450  C  CA    . GLU B  2  378 ? -13.632 -25.764 54.655  1.00 50.91  ? 378 GLU B CA    1 
ATOM   7451  C  C     . GLU B  2  378 ? -14.389 -26.094 53.377  1.00 42.13  ? 378 GLU B C     1 
ATOM   7452  O  O     . GLU B  2  378 ? -14.400 -27.247 52.933  1.00 48.57  ? 378 GLU B O     1 
ATOM   7453  C  CB    . GLU B  2  378 ? -14.588 -25.742 55.847  1.00 49.32  ? 378 GLU B CB    1 
ATOM   7454  C  CG    . GLU B  2  378 ? -13.889 -25.836 57.190  1.00 54.44  ? 378 GLU B CG    1 
ATOM   7455  C  CD    . GLU B  2  378 ? -14.824 -25.592 58.352  1.00 59.94  ? 378 GLU B CD    1 
ATOM   7456  O  OE1   . GLU B  2  378 ? -14.330 -25.412 59.485  1.00 62.98  ? 378 GLU B OE1   1 
ATOM   7457  O  OE2   . GLU B  2  378 ? -16.052 -25.574 58.132  1.00 64.19  ? 378 GLU B OE2   1 
ATOM   7458  N  N     . SER B  2  379 ? -15.018 -25.092 52.764  1.00 39.94  ? 379 SER B N     1 
ATOM   7459  C  CA    . SER B  2  379 ? -15.831 -25.351 51.582  1.00 43.17  ? 379 SER B CA    1 
ATOM   7460  C  C     . SER B  2  379 ? -14.959 -25.689 50.379  1.00 50.11  ? 379 SER B C     1 
ATOM   7461  O  O     . SER B  2  379 ? -15.309 -26.563 49.576  1.00 48.56  ? 379 SER B O     1 
ATOM   7462  C  CB    . SER B  2  379 ? -16.710 -24.137 51.287  1.00 40.98  ? 379 SER B CB    1 
ATOM   7463  O  OG    . SER B  2  379 ? -17.292 -23.635 52.478  1.00 57.91  ? 379 SER B OG    1 
ATOM   7464  N  N     . ILE B  2  380 ? -13.827 -24.998 50.236  1.00 49.04  ? 380 ILE B N     1 
ATOM   7465  C  CA    . ILE B  2  380 ? -12.844 -25.343 49.209  1.00 40.00  ? 380 ILE B CA    1 
ATOM   7466  C  C     . ILE B  2  380 ? -12.398 -26.793 49.357  1.00 52.58  ? 380 ILE B C     1 
ATOM   7467  O  O     . ILE B  2  380 ? -12.394 -27.563 48.390  1.00 50.78  ? 380 ILE B O     1 
ATOM   7468  C  CB    . ILE B  2  380 ? -11.649 -24.377 49.271  1.00 48.45  ? 380 ILE B CB    1 
ATOM   7469  C  CG1   . ILE B  2  380 ? -12.106 -22.949 48.968  1.00 49.28  ? 380 ILE B CG1   1 
ATOM   7470  C  CG2   . ILE B  2  380 ? -10.557 -24.816 48.308  1.00 38.84  ? 380 ILE B CG2   1 
ATOM   7471  C  CD1   . ILE B  2  380 ? -11.026 -21.912 49.158  1.00 54.07  ? 380 ILE B CD1   1 
ATOM   7472  N  N     . VAL B  2  381 ? -11.981 -27.174 50.566  1.00 46.95  ? 381 VAL B N     1 
ATOM   7473  C  CA    . VAL B  2  381 ? -11.546 -28.546 50.820  1.00 44.13  ? 381 VAL B CA    1 
ATOM   7474  C  C     . VAL B  2  381 ? -12.651 -29.544 50.492  1.00 43.04  ? 381 VAL B C     1 
ATOM   7475  O  O     . VAL B  2  381 ? -12.399 -30.593 49.885  1.00 58.23  ? 381 VAL B O     1 
ATOM   7476  C  CB    . VAL B  2  381 ? -11.070 -28.685 52.277  1.00 43.50  ? 381 VAL B CB    1 
ATOM   7477  C  CG1   . VAL B  2  381 ? -10.888 -30.148 52.649  1.00 39.07  ? 381 VAL B CG1   1 
ATOM   7478  C  CG2   . VAL B  2  381 ? -9.776  -27.913 52.482  1.00 42.91  ? 381 VAL B CG2   1 
ATOM   7479  N  N     . ILE B  2  382 ? -13.889 -29.233 50.863  1.00 42.99  ? 382 ILE B N     1 
ATOM   7480  C  CA    . ILE B  2  382 ? -14.964 -30.219 50.790  1.00 45.61  ? 382 ILE B CA    1 
ATOM   7481  C  C     . ILE B  2  382 ? -15.633 -30.225 49.421  1.00 43.09  ? 382 ILE B C     1 
ATOM   7482  O  O     . ILE B  2  382 ? -15.749 -31.274 48.782  1.00 53.90  ? 382 ILE B O     1 
ATOM   7483  C  CB    . ILE B  2  382 ? -15.990 -29.967 51.918  1.00 50.34  ? 382 ILE B CB    1 
ATOM   7484  C  CG1   . ILE B  2  382 ? -15.345 -30.161 53.292  1.00 49.47  ? 382 ILE B CG1   1 
ATOM   7485  C  CG2   . ILE B  2  382 ? -17.178 -30.899 51.776  1.00 42.23  ? 382 ILE B CG2   1 
ATOM   7486  C  CD1   . ILE B  2  382 ? -16.203 -29.670 54.439  1.00 41.16  ? 382 ILE B CD1   1 
ATOM   7487  N  N     . TRP B  2  383 ? -16.047 -29.060 48.922  1.00 47.54  ? 383 TRP B N     1 
ATOM   7488  C  CA    . TRP B  2  383 ? -16.749 -28.980 47.647  1.00 46.38  ? 383 TRP B CA    1 
ATOM   7489  C  C     . TRP B  2  383 ? -15.956 -28.296 46.542  1.00 47.43  ? 383 TRP B C     1 
ATOM   7490  O  O     . TRP B  2  383 ? -16.432 -28.250 45.403  1.00 54.42  ? 383 TRP B O     1 
ATOM   7491  C  CB    . TRP B  2  383 ? -18.094 -28.268 47.834  1.00 48.61  ? 383 TRP B CB    1 
ATOM   7492  C  CG    . TRP B  2  383 ? -18.953 -28.921 48.870  1.00 50.89  ? 383 TRP B CG    1 
ATOM   7493  C  CD1   . TRP B  2  383 ? -19.628 -30.099 48.751  1.00 46.26  ? 383 TRP B CD1   1 
ATOM   7494  C  CD2   . TRP B  2  383 ? -19.222 -28.436 50.191  1.00 53.81  ? 383 TRP B CD2   1 
ATOM   7495  N  NE1   . TRP B  2  383 ? -20.305 -30.378 49.913  1.00 44.33  ? 383 TRP B NE1   1 
ATOM   7496  C  CE2   . TRP B  2  383 ? -20.072 -29.371 50.813  1.00 49.44  ? 383 TRP B CE2   1 
ATOM   7497  C  CE3   . TRP B  2  383 ? -18.828 -27.303 50.907  1.00 57.57  ? 383 TRP B CE3   1 
ATOM   7498  C  CZ2   . TRP B  2  383 ? -20.533 -29.208 52.118  1.00 43.35  ? 383 TRP B CZ2   1 
ATOM   7499  C  CZ3   . TRP B  2  383 ? -19.289 -27.141 52.201  1.00 50.31  ? 383 TRP B CZ3   1 
ATOM   7500  C  CH2   . TRP B  2  383 ? -20.133 -28.088 52.793  1.00 44.20  ? 383 TRP B CH2   1 
ATOM   7501  N  N     . GLY B  2  384 ? -14.769 -27.768 46.833  1.00 45.64  ? 384 GLY B N     1 
ATOM   7502  C  CA    . GLY B  2  384 ? -14.066 -26.968 45.843  1.00 38.44  ? 384 GLY B CA    1 
ATOM   7503  C  C     . GLY B  2  384 ? -14.798 -25.725 45.392  1.00 68.05  ? 384 GLY B C     1 
ATOM   7504  O  O     . GLY B  2  384 ? -14.634 -25.300 44.244  1.00 57.45  ? 384 GLY B O     1 
ATOM   7505  N  N     . LYS B  2  385 ? -15.606 -25.128 46.264  1.00 62.36  ? 385 LYS B N     1 
ATOM   7506  C  CA    . LYS B  2  385 ? -16.229 -23.846 45.978  1.00 50.22  ? 385 LYS B CA    1 
ATOM   7507  C  C     . LYS B  2  385 ? -16.184 -22.963 47.212  1.00 48.27  ? 385 LYS B C     1 
ATOM   7508  O  O     . LYS B  2  385 ? -16.039 -23.440 48.339  1.00 59.22  ? 385 LYS B O     1 
ATOM   7509  C  CB    . LYS B  2  385 ? -17.705 -23.986 45.582  1.00 40.52  ? 385 LYS B CB    1 
ATOM   7510  C  CG    . LYS B  2  385 ? -18.031 -24.645 44.264  1.00 44.25  ? 385 LYS B CG    1 
ATOM   7511  C  CD    . LYS B  2  385 ? -19.545 -24.796 44.203  1.00 39.98  ? 385 LYS B CD    1 
ATOM   7512  C  CE    . LYS B  2  385 ? -20.060 -25.164 42.827  1.00 50.14  ? 385 LYS B CE    1 
ATOM   7513  N  NZ    . LYS B  2  385 ? -21.528 -25.421 42.889  1.00 56.61  ? 385 LYS B NZ    1 
ATOM   7514  N  N     . THR B  2  386 ? -16.274 -21.671 46.979  1.00 44.36  ? 386 THR B N     1 
ATOM   7515  C  CA    . THR B  2  386 ? -16.452 -20.729 48.071  1.00 49.02  ? 386 THR B CA    1 
ATOM   7516  C  C     . THR B  2  386 ? -17.929 -20.370 48.186  1.00 48.47  ? 386 THR B C     1 
ATOM   7517  O  O     . THR B  2  386 ? -18.590 -20.144 47.166  1.00 47.84  ? 386 THR B O     1 
ATOM   7518  C  CB    . THR B  2  386 ? -15.637 -19.454 47.850  1.00 42.18  ? 386 THR B CB    1 
ATOM   7519  O  OG1   . THR B  2  386 ? -16.134 -18.757 46.702  1.00 48.56  ? 386 THR B OG1   1 
ATOM   7520  C  CG2   . THR B  2  386 ? -14.172 -19.795 47.635  1.00 40.76  ? 386 THR B CG2   1 
ATOM   7521  N  N     . PRO B  2  387 ? -18.499 -20.295 49.383  1.00 45.19  ? 387 PRO B N     1 
ATOM   7522  C  CA    . PRO B  2  387 ? -19.918 -19.950 49.499  1.00 41.57  ? 387 PRO B CA    1 
ATOM   7523  C  C     . PRO B  2  387 ? -20.136 -18.446 49.414  1.00 35.09  ? 387 PRO B C     1 
ATOM   7524  O  O     . PRO B  2  387 ? -19.212 -17.644 49.562  1.00 39.46  ? 387 PRO B O     1 
ATOM   7525  C  CB    . PRO B  2  387 ? -20.294 -20.483 50.885  1.00 39.72  ? 387 PRO B CB    1 
ATOM   7526  C  CG    . PRO B  2  387 ? -19.025 -20.373 51.662  1.00 37.86  ? 387 PRO B CG    1 
ATOM   7527  C  CD    . PRO B  2  387 ? -17.902 -20.635 50.686  1.00 43.46  ? 387 PRO B CD    1 
ATOM   7528  N  N     . LYS B  2  388 ? -21.391 -18.070 49.176  1.00 38.35  ? 388 LYS B N     1 
ATOM   7529  C  CA    . LYS B  2  388 ? -21.817 -16.688 49.357  1.00 44.73  ? 388 LYS B CA    1 
ATOM   7530  C  C     . LYS B  2  388 ? -22.286 -16.510 50.795  1.00 49.17  ? 388 LYS B C     1 
ATOM   7531  O  O     . LYS B  2  388 ? -23.217 -17.190 51.241  1.00 54.54  ? 388 LYS B O     1 
ATOM   7532  C  CB    . LYS B  2  388 ? -22.927 -16.309 48.377  1.00 41.78  ? 388 LYS B CB    1 
ATOM   7533  C  CG    . LYS B  2  388 ? -23.298 -14.836 48.457  1.00 59.51  ? 388 LYS B CG    1 
ATOM   7534  C  CD    . LYS B  2  388 ? -24.340 -14.440 47.429  1.00 74.10  ? 388 LYS B CD    1 
ATOM   7535  C  CE    . LYS B  2  388 ? -24.584 -12.939 47.472  1.00 72.02  ? 388 LYS B CE    1 
ATOM   7536  N  NZ    . LYS B  2  388 ? -25.637 -12.511 46.512  1.00 69.53  ? 388 LYS B NZ    1 
ATOM   7537  N  N     . PHE B  2  389 ? -21.647 -15.592 51.511  1.00 46.51  ? 389 PHE B N     1 
ATOM   7538  C  CA    . PHE B  2  389 ? -21.920 -15.384 52.925  1.00 54.81  ? 389 PHE B CA    1 
ATOM   7539  C  C     . PHE B  2  389 ? -23.062 -14.401 53.150  1.00 47.51  ? 389 PHE B C     1 
ATOM   7540  O  O     . PHE B  2  389 ? -23.181 -13.389 52.455  1.00 46.91  ? 389 PHE B O     1 
ATOM   7541  C  CB    . PHE B  2  389 ? -20.658 -14.897 53.638  1.00 30.51  ? 389 PHE B CB    1 
ATOM   7542  C  CG    . PHE B  2  389 ? -19.631 -15.972 53.842  1.00 32.92  ? 389 PHE B CG    1 
ATOM   7543  C  CD1   . PHE B  2  389 ? -19.596 -16.699 55.020  1.00 45.69  ? 389 PHE B CD1   1 
ATOM   7544  C  CD2   . PHE B  2  389 ? -18.711 -16.266 52.852  1.00 30.91  ? 389 PHE B CD2   1 
ATOM   7545  C  CE1   . PHE B  2  389 ? -18.655 -17.693 55.211  1.00 53.09  ? 389 PHE B CE1   1 
ATOM   7546  C  CE2   . PHE B  2  389 ? -17.769 -17.258 53.036  1.00 36.02  ? 389 PHE B CE2   1 
ATOM   7547  C  CZ    . PHE B  2  389 ? -17.740 -17.973 54.218  1.00 46.98  ? 389 PHE B CZ    1 
ATOM   7548  N  N     . LYS B  2  390 ? -23.912 -14.724 54.120  1.00 40.45  ? 390 LYS B N     1 
ATOM   7549  C  CA    . LYS B  2  390 ? -24.879 -13.787 54.676  1.00 33.04  ? 390 LYS B CA    1 
ATOM   7550  C  C     . LYS B  2  390 ? -24.303 -13.299 55.998  1.00 33.33  ? 390 LYS B C     1 
ATOM   7551  O  O     . LYS B  2  390 ? -24.254 -14.053 56.976  1.00 45.17  ? 390 LYS B O     1 
ATOM   7552  C  CB    . LYS B  2  390 ? -26.244 -14.444 54.865  1.00 34.08  ? 390 LYS B CB    1 
ATOM   7553  C  CG    . LYS B  2  390 ? -26.922 -14.845 53.565  1.00 42.25  ? 390 LYS B CG    1 
ATOM   7554  C  CD    . LYS B  2  390 ? -28.308 -15.413 53.818  1.00 49.61  ? 390 LYS B CD    1 
ATOM   7555  C  CE    . LYS B  2  390 ? -29.028 -15.734 52.516  1.00 61.90  ? 390 LYS B CE    1 
ATOM   7556  N  NZ    . LYS B  2  390 ? -29.261 -14.517 51.689  1.00 79.82  ? 390 LYS B NZ    1 
ATOM   7557  N  N     . LEU B  2  391 ? -23.871 -12.038 56.032  1.00 39.51  ? 391 LEU B N     1 
ATOM   7558  C  CA    . LEU B  2  391 ? -23.064 -11.611 57.170  1.00 36.60  ? 391 LEU B CA    1 
ATOM   7559  C  C     . LEU B  2  391 ? -23.908 -10.854 58.180  1.00 36.00  ? 391 LEU B C     1 
ATOM   7560  O  O     . LEU B  2  391 ? -24.616 -9.907  57.807  1.00 42.77  ? 391 LEU B O     1 
ATOM   7561  C  CB    . LEU B  2  391 ? -21.909 -10.728 56.701  1.00 37.98  ? 391 LEU B CB    1 
ATOM   7562  C  CG    . LEU B  2  391 ? -20.865 -11.388 55.798  1.00 30.55  ? 391 LEU B CG    1 
ATOM   7563  C  CD1   . LEU B  2  391 ? -19.742 -10.419 55.448  1.00 34.32  ? 391 LEU B CD1   1 
ATOM   7564  C  CD2   . LEU B  2  391 ? -20.311 -12.639 56.462  1.00 30.39  ? 391 LEU B CD2   1 
ATOM   7565  N  N     . PRO B  2  392 ? -23.862 -11.265 59.496  1.00 41.09  ? 392 PRO B N     1 
ATOM   7566  C  CA    . PRO B  2  392 ? -24.624 -10.588 60.564  1.00 39.70  ? 392 PRO B CA    1 
ATOM   7567  C  C     . PRO B  2  392 ? -23.948 -9.298  61.010  1.00 44.98  ? 392 PRO B C     1 
ATOM   7568  O  O     . PRO B  2  392 ? -23.498 -9.146  62.150  1.00 45.38  ? 392 PRO B O     1 
ATOM   7569  C  CB    . PRO B  2  392 ? -24.654 -11.653 61.664  1.00 35.46  ? 392 PRO B CB    1 
ATOM   7570  C  CG    . PRO B  2  392 ? -23.365 -12.380 61.493  1.00 41.80  ? 392 PRO B CG    1 
ATOM   7571  C  CD    . PRO B  2  392 ? -23.098 -12.416 60.009  1.00 40.94  ? 392 PRO B CD    1 
ATOM   7572  N  N     . ILE B  2  393 ? -23.878 -8.327  60.098  1.00 33.01  ? 393 ILE B N     1 
ATOM   7573  C  CA    . ILE B  2  393 ? -23.144 -7.094  60.352  1.00 37.05  ? 393 ILE B CA    1 
ATOM   7574  C  C     . ILE B  2  393 ? -23.708 -6.010  59.446  1.00 34.30  ? 393 ILE B C     1 
ATOM   7575  O  O     . ILE B  2  393 ? -24.241 -6.294  58.370  1.00 40.32  ? 393 ILE B O     1 
ATOM   7576  C  CB    . ILE B  2  393 ? -21.623 -7.301  60.129  1.00 38.50  ? 393 ILE B CB    1 
ATOM   7577  C  CG1   . ILE B  2  393 ? -20.819 -6.113  60.662  1.00 31.73  ? 393 ILE B CG1   1 
ATOM   7578  C  CG2   . ILE B  2  393 ? -21.316 -7.533  58.653  1.00 31.65  ? 393 ILE B CG2   1 
ATOM   7579  C  CD1   . ILE B  2  393 ? -19.319 -6.327  60.624  1.00 30.71  ? 393 ILE B CD1   1 
ATOM   7580  N  N     . GLN B  2  394 ? -23.594 -4.761  59.892  1.00 38.18  ? 394 GLN B N     1 
ATOM   7581  C  CA    . GLN B  2  394 ? -23.967 -3.626  59.060  1.00 42.85  ? 394 GLN B CA    1 
ATOM   7582  C  C     . GLN B  2  394 ? -22.938 -3.430  57.954  1.00 46.17  ? 394 GLN B C     1 
ATOM   7583  O  O     . GLN B  2  394 ? -21.739 -3.640  58.156  1.00 53.59  ? 394 GLN B O     1 
ATOM   7584  C  CB    . GLN B  2  394 ? -24.083 -2.357  59.906  1.00 45.39  ? 394 GLN B CB    1 
ATOM   7585  C  CG    . GLN B  2  394 ? -24.999 -1.289  59.312  1.00 56.69  ? 394 GLN B CG    1 
ATOM   7586  C  CD    . GLN B  2  394 ? -26.463 -1.694  59.338  1.00 81.73  ? 394 GLN B CD    1 
ATOM   7587  O  OE1   . GLN B  2  394 ? -26.854 -2.602  60.071  1.00 84.44  ? 394 GLN B OE1   1 
ATOM   7588  N  NE2   . GLN B  2  394 ? -27.280 -1.022  58.534  1.00 86.84  ? 394 GLN B NE2   1 
ATOM   7589  N  N     . LYS B  2  395 ? -23.419 -3.044  56.770  1.00 55.27  ? 395 LYS B N     1 
ATOM   7590  C  CA    . LYS B  2  395 ? -22.550 -2.978  55.598  1.00 56.09  ? 395 LYS B CA    1 
ATOM   7591  C  C     . LYS B  2  395 ? -21.404 -1.996  55.813  1.00 51.34  ? 395 LYS B C     1 
ATOM   7592  O  O     . LYS B  2  395 ? -20.257 -2.279  55.445  1.00 46.08  ? 395 LYS B O     1 
ATOM   7593  C  CB    . LYS B  2  395 ? -23.373 -2.586  54.371  1.00 55.08  ? 395 LYS B CB    1 
ATOM   7594  C  CG    . LYS B  2  395 ? -22.565 -2.302  53.115  1.00 50.23  ? 395 LYS B CG    1 
ATOM   7595  C  CD    . LYS B  2  395 ? -23.493 -1.948  51.957  1.00 57.23  ? 395 LYS B CD    1 
ATOM   7596  C  CE    . LYS B  2  395 ? -22.754 -1.868  50.626  1.00 56.92  ? 395 LYS B CE    1 
ATOM   7597  N  NZ    . LYS B  2  395 ? -21.800 -0.727  50.558  1.00 70.35  ? 395 LYS B NZ    1 
ATOM   7598  N  N     . GLU B  2  396 ? -21.700 -0.830  56.390  1.00 49.77  ? 396 GLU B N     1 
ATOM   7599  C  CA    . GLU B  2  396 ? -20.668 0.177   56.617  1.00 49.84  ? 396 GLU B CA    1 
ATOM   7600  C  C     . GLU B  2  396 ? -19.619 -0.317  57.607  1.00 44.46  ? 396 GLU B C     1 
ATOM   7601  O  O     . GLU B  2  396 ? -18.424 -0.042  57.447  1.00 56.25  ? 396 GLU B O     1 
ATOM   7602  C  CB    . GLU B  2  396 ? -21.299 1.477   57.114  1.00 60.73  ? 396 GLU B CB    1 
ATOM   7603  C  CG    . GLU B  2  396 ? -22.131 2.219   56.076  1.00 73.29  ? 396 GLU B CG    1 
ATOM   7604  C  CD    . GLU B  2  396 ? -23.452 1.536   55.777  1.00 93.56  ? 396 GLU B CD    1 
ATOM   7605  O  OE1   . GLU B  2  396 ? -23.852 1.502   54.594  1.00 96.45  ? 396 GLU B OE1   1 
ATOM   7606  O  OE2   . GLU B  2  396 ? -24.086 1.026   56.724  1.00 103.35 ? 396 GLU B OE2   1 
ATOM   7607  N  N     . THR B  2  397 ? -20.052 -1.039  58.644  1.00 45.88  ? 397 THR B N     1 
ATOM   7608  C  CA    . THR B  2  397 ? -19.121 -1.563  59.640  1.00 46.31  ? 397 THR B CA    1 
ATOM   7609  C  C     . THR B  2  397 ? -18.148 -2.559  59.022  1.00 35.33  ? 397 THR B C     1 
ATOM   7610  O  O     . THR B  2  397 ? -16.940 -2.507  59.281  1.00 41.62  ? 397 THR B O     1 
ATOM   7611  C  CB    . THR B  2  397 ? -19.896 -2.221  60.784  1.00 41.78  ? 397 THR B CB    1 
ATOM   7612  O  OG1   . THR B  2  397 ? -20.769 -1.260  61.388  1.00 44.67  ? 397 THR B OG1   1 
ATOM   7613  C  CG2   . THR B  2  397 ? -18.942 -2.767  61.840  1.00 36.35  ? 397 THR B CG2   1 
ATOM   7614  N  N     . TRP B  2  398 ? -18.661 -3.480  58.202  1.00 39.34  ? 398 TRP B N     1 
ATOM   7615  C  CA    . TRP B  2  398 ? -17.811 -4.507  57.607  1.00 43.58  ? 398 TRP B CA    1 
ATOM   7616  C  C     . TRP B  2  398 ? -16.791 -3.903  56.648  1.00 46.99  ? 398 TRP B C     1 
ATOM   7617  O  O     . TRP B  2  398 ? -15.606 -4.253  56.686  1.00 50.40  ? 398 TRP B O     1 
ATOM   7618  C  CB    . TRP B  2  398 ? -18.684 -5.543  56.894  1.00 39.10  ? 398 TRP B CB    1 
ATOM   7619  C  CG    . TRP B  2  398 ? -17.922 -6.600  56.146  1.00 38.04  ? 398 TRP B CG    1 
ATOM   7620  C  CD1   . TRP B  2  398 ? -17.695 -6.650  54.801  1.00 39.26  ? 398 TRP B CD1   1 
ATOM   7621  C  CD2   . TRP B  2  398 ? -17.297 -7.765  56.700  1.00 40.65  ? 398 TRP B CD2   1 
ATOM   7622  N  NE1   . TRP B  2  398 ? -16.965 -7.770  54.484  1.00 39.67  ? 398 TRP B NE1   1 
ATOM   7623  C  CE2   . TRP B  2  398 ? -16.707 -8.471  55.632  1.00 44.04  ? 398 TRP B CE2   1 
ATOM   7624  C  CE3   . TRP B  2  398 ? -17.177 -8.277  57.996  1.00 39.89  ? 398 TRP B CE3   1 
ATOM   7625  C  CZ2   . TRP B  2  398 ? -16.009 -9.663  55.821  1.00 41.86  ? 398 TRP B CZ2   1 
ATOM   7626  C  CZ3   . TRP B  2  398 ? -16.483 -9.459  58.181  1.00 40.56  ? 398 TRP B CZ3   1 
ATOM   7627  C  CH2   . TRP B  2  398 ? -15.909 -10.139 57.100  1.00 38.43  ? 398 TRP B CH2   1 
ATOM   7628  N  N     . GLU B  2  399 ? -17.239 -3.004  55.769  1.00 40.06  ? 399 GLU B N     1 
ATOM   7629  C  CA    . GLU B  2  399 ? -16.363 -2.456  54.737  1.00 52.81  ? 399 GLU B CA    1 
ATOM   7630  C  C     . GLU B  2  399 ? -15.241 -1.607  55.326  1.00 60.54  ? 399 GLU B C     1 
ATOM   7631  O  O     . GLU B  2  399 ? -14.139 -1.563  54.767  1.00 71.18  ? 399 GLU B O     1 
ATOM   7632  C  CB    . GLU B  2  399 ? -17.183 -1.650  53.727  1.00 37.57  ? 399 GLU B CB    1 
ATOM   7633  C  CG    . GLU B  2  399 ? -18.037 -2.520  52.817  1.00 41.91  ? 399 GLU B CG    1 
ATOM   7634  C  CD    . GLU B  2  399 ? -18.897 -1.718  51.858  1.00 55.71  ? 399 GLU B CD    1 
ATOM   7635  O  OE1   . GLU B  2  399 ? -18.885 -0.471  51.935  1.00 62.40  ? 399 GLU B OE1   1 
ATOM   7636  O  OE2   . GLU B  2  399 ? -19.589 -2.338  51.024  1.00 54.92  ? 399 GLU B OE2   1 
ATOM   7637  N  N     . THR B  2  400 ? -15.506 -0.917  56.437  1.00 52.61  ? 400 THR B N     1 
ATOM   7638  C  CA    . THR B  2  400 ? -14.465 -0.131  57.094  1.00 45.70  ? 400 THR B CA    1 
ATOM   7639  C  C     . THR B  2  400 ? -13.298 -0.992  57.574  1.00 37.86  ? 400 THR B C     1 
ATOM   7640  O  O     . THR B  2  400 ? -12.133 -0.625  57.378  1.00 44.83  ? 400 THR B O     1 
ATOM   7641  C  CB    . THR B  2  400 ? -15.065 0.653   58.266  1.00 47.43  ? 400 THR B CB    1 
ATOM   7642  O  OG1   . THR B  2  400 ? -16.132 1.487   57.797  1.00 53.49  ? 400 THR B OG1   1 
ATOM   7643  C  CG2   . THR B  2  400 ? -14.007 1.527   58.925  1.00 40.59  ? 400 THR B CG2   1 
ATOM   7644  N  N     . TRP B  2  401 ? -13.576 -2.150  58.181  1.00 41.28  ? 401 TRP B N     1 
ATOM   7645  C  CA    . TRP B  2  401 ? -12.532 -2.873  58.899  1.00 37.44  ? 401 TRP B CA    1 
ATOM   7646  C  C     . TRP B  2  401 ? -12.065 -4.189  58.288  1.00 39.45  ? 401 TRP B C     1 
ATOM   7647  O  O     . TRP B  2  401 ? -10.995 -4.665  58.677  1.00 38.64  ? 401 TRP B O     1 
ATOM   7648  C  CB    . TRP B  2  401 ? -12.995 -3.170  60.333  1.00 42.81  ? 401 TRP B CB    1 
ATOM   7649  C  CG    . TRP B  2  401 ? -13.570 -1.991  61.034  1.00 43.80  ? 401 TRP B CG    1 
ATOM   7650  C  CD1   . TRP B  2  401 ? -14.871 -1.809  61.405  1.00 46.85  ? 401 TRP B CD1   1 
ATOM   7651  C  CD2   . TRP B  2  401 ? -12.867 -0.817  61.445  1.00 33.94  ? 401 TRP B CD2   1 
ATOM   7652  N  NE1   . TRP B  2  401 ? -15.019 -0.594  62.027  1.00 45.07  ? 401 TRP B NE1   1 
ATOM   7653  C  CE2   . TRP B  2  401 ? -13.802 0.034   62.065  1.00 43.60  ? 401 TRP B CE2   1 
ATOM   7654  C  CE3   . TRP B  2  401 ? -11.535 -0.404  61.351  1.00 33.32  ? 401 TRP B CE3   1 
ATOM   7655  C  CZ2   . TRP B  2  401 ? -13.448 1.272   62.586  1.00 48.51  ? 401 TRP B CZ2   1 
ATOM   7656  C  CZ3   . TRP B  2  401 ? -11.187 0.823   61.869  1.00 65.42  ? 401 TRP B CZ3   1 
ATOM   7657  C  CH2   . TRP B  2  401 ? -12.138 1.647   62.480  1.00 62.09  ? 401 TRP B CH2   1 
ATOM   7658  N  N     . TRP B  2  402 ? -12.822 -4.802  57.374  1.00 39.80  ? 402 TRP B N     1 
ATOM   7659  C  CA    . TRP B  2  402 ? -12.549 -6.201  57.039  1.00 33.28  ? 402 TRP B CA    1 
ATOM   7660  C  C     . TRP B  2  402 ? -11.159 -6.388  56.433  1.00 33.11  ? 402 TRP B C     1 
ATOM   7661  O  O     . TRP B  2  402 ? -10.480 -7.380  56.725  1.00 40.09  ? 402 TRP B O     1 
ATOM   7662  C  CB    . TRP B  2  402 ? -13.638 -6.762  56.119  1.00 31.00  ? 402 TRP B CB    1 
ATOM   7663  C  CG    . TRP B  2  402 ? -13.592 -6.332  54.684  1.00 36.39  ? 402 TRP B CG    1 
ATOM   7664  C  CD1   . TRP B  2  402 ? -14.195 -5.240  54.135  1.00 34.48  ? 402 TRP B CD1   1 
ATOM   7665  C  CD2   . TRP B  2  402 ? -12.944 -7.017  53.605  1.00 41.34  ? 402 TRP B CD2   1 
ATOM   7666  N  NE1   . TRP B  2  402 ? -13.948 -5.191  52.784  1.00 42.43  ? 402 TRP B NE1   1 
ATOM   7667  C  CE2   . TRP B  2  402 ? -13.183 -6.272  52.434  1.00 44.18  ? 402 TRP B CE2   1 
ATOM   7668  C  CE3   . TRP B  2  402 ? -12.178 -8.183  53.518  1.00 40.74  ? 402 TRP B CE3   1 
ATOM   7669  C  CZ2   . TRP B  2  402 ? -12.679 -6.653  51.191  1.00 45.76  ? 402 TRP B CZ2   1 
ATOM   7670  C  CZ3   . TRP B  2  402 ? -11.681 -8.560  52.285  1.00 33.32  ? 402 TRP B CZ3   1 
ATOM   7671  C  CH2   . TRP B  2  402 ? -11.933 -7.798  51.138  1.00 42.03  ? 402 TRP B CH2   1 
ATOM   7672  N  N     . THR B  2  403 ? -10.726 -5.463  55.572  1.00 43.20  ? 403 THR B N     1 
ATOM   7673  C  CA    . THR B  2  403 ? -9.413  -5.597  54.942  1.00 42.34  ? 403 THR B CA    1 
ATOM   7674  C  C     . THR B  2  403 ? -8.279  -5.587  55.962  1.00 40.45  ? 403 THR B C     1 
ATOM   7675  O  O     . THR B  2  403 ? -7.214  -6.161  55.708  1.00 56.45  ? 403 THR B O     1 
ATOM   7676  C  CB    . THR B  2  403 ? -9.196  -4.479  53.922  1.00 47.49  ? 403 THR B CB    1 
ATOM   7677  O  OG1   . THR B  2  403 ? -9.258  -3.208  54.583  1.00 42.79  ? 403 THR B OG1   1 
ATOM   7678  C  CG2   . THR B  2  403 ? -10.256 -4.536  52.833  1.00 45.55  ? 403 THR B CG2   1 
ATOM   7679  N  N     . GLU B  2  404 ? -8.488  -4.951  57.117  1.00 46.88  ? 404 GLU B N     1 
ATOM   7680  C  CA    . GLU B  2  404 ? -7.473  -4.962  58.168  1.00 39.37  ? 404 GLU B CA    1 
ATOM   7681  C  C     . GLU B  2  404 ? -7.163  -6.372  58.660  1.00 41.98  ? 404 GLU B C     1 
ATOM   7682  O  O     . GLU B  2  404 ? -6.006  -6.690  58.957  1.00 56.33  ? 404 GLU B O     1 
ATOM   7683  C  CB    . GLU B  2  404 ? -7.928  -4.089  59.340  1.00 34.92  ? 404 GLU B CB    1 
ATOM   7684  C  CG    . GLU B  2  404 ? -7.731  -2.597  59.141  1.00 50.26  ? 404 GLU B CG    1 
ATOM   7685  C  CD    . GLU B  2  404 ? -6.269  -2.214  59.039  1.00 58.82  ? 404 GLU B CD    1 
ATOM   7686  O  OE1   . GLU B  2  404 ? -5.826  -1.850  57.930  1.00 72.92  ? 404 GLU B OE1   1 
ATOM   7687  O  OE2   . GLU B  2  404 ? -5.560  -2.287  60.066  1.00 63.21  ? 404 GLU B OE2   1 
ATOM   7688  N  N     . TYR B  2  405 ? -8.176  -7.230  58.752  1.00 51.62  ? 405 TYR B N     1 
ATOM   7689  C  CA    . TYR B  2  405 ? -8.013  -8.562  59.322  1.00 42.85  ? 405 TYR B CA    1 
ATOM   7690  C  C     . TYR B  2  405 ? -7.921  -9.681  58.289  1.00 35.47  ? 405 TYR B C     1 
ATOM   7691  O  O     . TYR B  2  405 ? -7.821  -10.850 58.678  1.00 48.06  ? 405 TYR B O     1 
ATOM   7692  C  CB    . TYR B  2  405 ? -9.152  -8.831  60.308  1.00 40.56  ? 405 TYR B CB    1 
ATOM   7693  C  CG    . TYR B  2  405 ? -9.341  -7.679  61.269  1.00 33.94  ? 405 TYR B CG    1 
ATOM   7694  C  CD1   . TYR B  2  405 ? -8.366  -7.371  62.209  1.00 30.00  ? 405 TYR B CD1   1 
ATOM   7695  C  CD2   . TYR B  2  405 ? -10.478 -6.884  61.220  1.00 29.26  ? 405 TYR B CD2   1 
ATOM   7696  C  CE1   . TYR B  2  405 ? -8.522  -6.314  63.082  1.00 35.59  ? 405 TYR B CE1   1 
ATOM   7697  C  CE2   . TYR B  2  405 ? -10.644 -5.822  62.091  1.00 31.64  ? 405 TYR B CE2   1 
ATOM   7698  C  CZ    . TYR B  2  405 ? -9.662  -5.543  63.020  1.00 42.54  ? 405 TYR B CZ    1 
ATOM   7699  O  OH    . TYR B  2  405 ? -9.818  -4.489  63.892  1.00 57.20  ? 405 TYR B OH    1 
ATOM   7700  N  N     . TRP B  2  406 ? -7.969  -9.369  56.996  1.00 45.51  ? 406 TRP B N     1 
ATOM   7701  C  CA    . TRP B  2  406 ? -8.025  -10.410 55.977  1.00 42.94  ? 406 TRP B CA    1 
ATOM   7702  C  C     . TRP B  2  406 ? -6.637  -11.002 55.761  1.00 43.96  ? 406 TRP B C     1 
ATOM   7703  O  O     . TRP B  2  406 ? -5.676  -10.275 55.488  1.00 50.81  ? 406 TRP B O     1 
ATOM   7704  C  CB    . TRP B  2  406 ? -8.578  -9.853  54.667  1.00 37.32  ? 406 TRP B CB    1 
ATOM   7705  C  CG    . TRP B  2  406 ? -9.088  -10.921 53.754  1.00 43.19  ? 406 TRP B CG    1 
ATOM   7706  C  CD1   . TRP B  2  406 ? -8.463  -11.429 52.653  1.00 40.44  ? 406 TRP B CD1   1 
ATOM   7707  C  CD2   . TRP B  2  406 ? -10.326 -11.629 53.876  1.00 45.83  ? 406 TRP B CD2   1 
ATOM   7708  N  NE1   . TRP B  2  406 ? -9.241  -12.404 52.076  1.00 39.27  ? 406 TRP B NE1   1 
ATOM   7709  C  CE2   . TRP B  2  406 ? -10.391 -12.546 52.809  1.00 41.18  ? 406 TRP B CE2   1 
ATOM   7710  C  CE3   . TRP B  2  406 ? -11.389 -11.573 54.783  1.00 47.52  ? 406 TRP B CE3   1 
ATOM   7711  C  CZ2   . TRP B  2  406 ? -11.476 -13.401 52.624  1.00 41.14  ? 406 TRP B CZ2   1 
ATOM   7712  C  CZ3   . TRP B  2  406 ? -12.466 -12.422 54.598  1.00 47.60  ? 406 TRP B CZ3   1 
ATOM   7713  C  CH2   . TRP B  2  406 ? -12.501 -13.323 53.527  1.00 47.01  ? 406 TRP B CH2   1 
ATOM   7714  N  N     . GLN B  2  407 ? -6.535  -12.327 55.882  1.00 48.25  ? 407 GLN B N     1 
ATOM   7715  C  CA    . GLN B  2  407 ? -5.265  -13.029 55.739  1.00 49.04  ? 407 GLN B CA    1 
ATOM   7716  C  C     . GLN B  2  407 ? -5.243  -14.031 54.589  1.00 46.11  ? 407 GLN B C     1 
ATOM   7717  O  O     . GLN B  2  407 ? -4.332  -14.865 54.533  1.00 53.61  ? 407 GLN B O     1 
ATOM   7718  C  CB    . GLN B  2  407 ? -4.916  -13.739 57.050  1.00 43.13  ? 407 GLN B CB    1 
ATOM   7719  C  CG    . GLN B  2  407 ? -4.747  -12.803 58.235  1.00 36.50  ? 407 GLN B CG    1 
ATOM   7720  C  CD    . GLN B  2  407 ? -4.830  -13.528 59.563  1.00 43.72  ? 407 GLN B CD    1 
ATOM   7721  O  OE1   . GLN B  2  407 ? -5.646  -14.434 59.738  1.00 52.69  ? 407 GLN B OE1   1 
ATOM   7722  N  NE2   . GLN B  2  407 ? -3.982  -13.136 60.507  1.00 41.68  ? 407 GLN B NE2   1 
ATOM   7723  N  N     . ALA B  2  408 ? -6.211  -13.984 53.677  1.00 37.44  ? 408 ALA B N     1 
ATOM   7724  C  CA    . ALA B  2  408 ? -6.353  -14.996 52.642  1.00 41.47  ? 408 ALA B CA    1 
ATOM   7725  C  C     . ALA B  2  408 ? -6.170  -14.372 51.265  1.00 41.23  ? 408 ALA B C     1 
ATOM   7726  O  O     . ALA B  2  408 ? -6.285  -13.156 51.088  1.00 48.78  ? 408 ALA B O     1 
ATOM   7727  C  CB    . ALA B  2  408 ? -7.719  -15.691 52.722  1.00 33.26  ? 408 ALA B CB    1 
ATOM   7728  N  N     . THR B  2  409 ? -5.888  -15.226 50.281  1.00 45.47  ? 409 THR B N     1 
ATOM   7729  C  CA    . THR B  2  409 ? -5.598  -14.762 48.931  1.00 45.18  ? 409 THR B CA    1 
ATOM   7730  C  C     . THR B  2  409 ? -6.823  -14.764 48.028  1.00 53.13  ? 409 THR B C     1 
ATOM   7731  O  O     . THR B  2  409 ? -6.754  -14.233 46.915  1.00 62.78  ? 409 THR B O     1 
ATOM   7732  C  CB    . THR B  2  409 ? -4.498  -15.622 48.299  1.00 51.95  ? 409 THR B CB    1 
ATOM   7733  O  OG1   . THR B  2  409 ? -4.950  -16.978 48.189  1.00 68.75  ? 409 THR B OG1   1 
ATOM   7734  C  CG2   . THR B  2  409 ? -3.238  -15.579 49.148  1.00 44.32  ? 409 THR B CG2   1 
ATOM   7735  N  N     . TRP B  2  410 ? -7.931  -15.346 48.472  1.00 48.09  ? 410 TRP B N     1 
ATOM   7736  C  CA    . TRP B  2  410 ? -9.206  -15.245 47.781  1.00 41.46  ? 410 TRP B CA    1 
ATOM   7737  C  C     . TRP B  2  410 ? -10.145 -14.343 48.574  1.00 49.41  ? 410 TRP B C     1 
ATOM   7738  O  O     . TRP B  2  410 ? -9.869  -13.970 49.718  1.00 59.21  ? 410 TRP B O     1 
ATOM   7739  C  CB    . TRP B  2  410 ? -9.827  -16.631 47.570  1.00 41.11  ? 410 TRP B CB    1 
ATOM   7740  C  CG    . TRP B  2  410 ? -9.446  -17.638 48.611  1.00 43.33  ? 410 TRP B CG    1 
ATOM   7741  C  CD1   . TRP B  2  410 ? -8.605  -18.701 48.453  1.00 36.45  ? 410 TRP B CD1   1 
ATOM   7742  C  CD2   . TRP B  2  410 ? -9.889  -17.676 49.972  1.00 45.27  ? 410 TRP B CD2   1 
ATOM   7743  N  NE1   . TRP B  2  410 ? -8.500  -19.400 49.631  1.00 41.12  ? 410 TRP B NE1   1 
ATOM   7744  C  CE2   . TRP B  2  410 ? -9.278  -18.790 50.580  1.00 45.02  ? 410 TRP B CE2   1 
ATOM   7745  C  CE3   . TRP B  2  410 ? -10.745 -16.876 50.736  1.00 44.87  ? 410 TRP B CE3   1 
ATOM   7746  C  CZ2   . TRP B  2  410 ? -9.496  -19.125 51.916  1.00 46.26  ? 410 TRP B CZ2   1 
ATOM   7747  C  CZ3   . TRP B  2  410 ? -10.959 -17.208 52.062  1.00 39.10  ? 410 TRP B CZ3   1 
ATOM   7748  C  CH2   . TRP B  2  410 ? -10.338 -18.324 52.638  1.00 39.62  ? 410 TRP B CH2   1 
ATOM   7749  N  N     . ILE B  2  411 ? -11.269 -13.997 47.953  1.00 50.75  ? 411 ILE B N     1 
ATOM   7750  C  CA    . ILE B  2  411 ? -12.290 -13.168 48.591  1.00 51.53  ? 411 ILE B CA    1 
ATOM   7751  C  C     . ILE B  2  411 ? -13.670 -13.679 48.195  1.00 47.93  ? 411 ILE B C     1 
ATOM   7752  O  O     . ILE B  2  411 ? -14.057 -13.560 47.023  1.00 45.62  ? 411 ILE B O     1 
ATOM   7753  C  CB    . ILE B  2  411 ? -12.150 -11.685 48.206  1.00 52.00  ? 411 ILE B CB    1 
ATOM   7754  C  CG1   . ILE B  2  411 ? -10.725 -11.172 48.427  1.00 42.49  ? 411 ILE B CG1   1 
ATOM   7755  C  CG2   . ILE B  2  411 ? -13.130 -10.842 49.002  1.00 43.73  ? 411 ILE B CG2   1 
ATOM   7756  C  CD1   . ILE B  2  411 ? -10.497 -9.774  47.902  1.00 37.93  ? 411 ILE B CD1   1 
ATOM   7757  N  N     . PRO B  2  412 ? -14.436 -14.261 49.113  1.00 51.11  ? 412 PRO B N     1 
ATOM   7758  C  CA    . PRO B  2  412 ? -15.737 -14.823 48.739  1.00 42.84  ? 412 PRO B CA    1 
ATOM   7759  C  C     . PRO B  2  412 ? -16.744 -13.718 48.458  1.00 46.94  ? 412 PRO B C     1 
ATOM   7760  O  O     . PRO B  2  412 ? -16.482 -12.527 48.641  1.00 49.98  ? 412 PRO B O     1 
ATOM   7761  C  CB    . PRO B  2  412 ? -16.136 -15.652 49.962  1.00 38.38  ? 412 PRO B CB    1 
ATOM   7762  C  CG    . PRO B  2  412 ? -15.351 -15.072 51.113  1.00 36.73  ? 412 PRO B CG    1 
ATOM   7763  C  CD    . PRO B  2  412 ? -14.282 -14.151 50.573  1.00 51.49  ? 412 PRO B CD    1 
ATOM   7764  N  N     . GLU B  2  413 ? -17.921 -14.133 48.004  1.00 48.33  ? 413 GLU B N     1 
ATOM   7765  C  CA    . GLU B  2  413 ? -19.041 -13.220 47.830  1.00 40.99  ? 413 GLU B CA    1 
ATOM   7766  C  C     . GLU B  2  413 ? -19.813 -13.141 49.140  1.00 46.75  ? 413 GLU B C     1 
ATOM   7767  O  O     . GLU B  2  413 ? -19.955 -14.142 49.846  1.00 53.53  ? 413 GLU B O     1 
ATOM   7768  C  CB    . GLU B  2  413 ? -19.958 -13.691 46.701  1.00 41.14  ? 413 GLU B CB    1 
ATOM   7769  C  CG    . GLU B  2  413 ? -19.345 -13.610 45.310  1.00 64.04  ? 413 GLU B CG    1 
ATOM   7770  C  CD    . GLU B  2  413 ? -19.717 -12.332 44.582  1.00 82.06  ? 413 GLU B CD    1 
ATOM   7771  O  OE1   . GLU B  2  413 ? -20.780 -11.758 44.897  1.00 87.14  ? 413 GLU B OE1   1 
ATOM   7772  O  OE2   . GLU B  2  413 ? -18.949 -11.902 43.695  1.00 90.23  ? 413 GLU B OE2   1 
ATOM   7773  N  N     . TRP B  2  414 ? -20.314 -11.951 49.464  1.00 45.48  ? 414 TRP B N     1 
ATOM   7774  C  CA    . TRP B  2  414 ? -21.084 -11.782 50.687  1.00 37.30  ? 414 TRP B CA    1 
ATOM   7775  C  C     . TRP B  2  414 ? -22.245 -10.826 50.463  1.00 47.64  ? 414 TRP B C     1 
ATOM   7776  O  O     . TRP B  2  414 ? -22.292 -10.078 49.483  1.00 52.93  ? 414 TRP B O     1 
ATOM   7777  C  CB    . TRP B  2  414 ? -20.212 -11.278 51.853  1.00 32.51  ? 414 TRP B CB    1 
ATOM   7778  C  CG    . TRP B  2  414 ? -19.377 -10.061 51.543  1.00 39.12  ? 414 TRP B CG    1 
ATOM   7779  C  CD1   . TRP B  2  414 ? -19.821 -8.847  51.098  1.00 40.27  ? 414 TRP B CD1   1 
ATOM   7780  C  CD2   . TRP B  2  414 ? -17.955 -9.938  51.684  1.00 37.86  ? 414 TRP B CD2   1 
ATOM   7781  N  NE1   . TRP B  2  414 ? -18.763 -7.985  50.938  1.00 47.22  ? 414 TRP B NE1   1 
ATOM   7782  C  CE2   . TRP B  2  414 ? -17.607 -8.629  51.292  1.00 41.73  ? 414 TRP B CE2   1 
ATOM   7783  C  CE3   . TRP B  2  414 ? -16.942 -10.809 52.096  1.00 31.70  ? 414 TRP B CE3   1 
ATOM   7784  C  CZ2   . TRP B  2  414 ? -16.290 -8.171  51.302  1.00 44.27  ? 414 TRP B CZ2   1 
ATOM   7785  C  CZ3   . TRP B  2  414 ? -15.633 -10.352 52.104  1.00 33.21  ? 414 TRP B CZ3   1 
ATOM   7786  C  CH2   . TRP B  2  414 ? -15.320 -9.046  51.710  1.00 36.61  ? 414 TRP B CH2   1 
ATOM   7787  N  N     . GLU B  2  415 ? -23.184 -10.871 51.404  1.00 53.02  ? 415 GLU B N     1 
ATOM   7788  C  CA    . GLU B  2  415 ? -24.253 -9.895  51.532  1.00 45.99  ? 415 GLU B CA    1 
ATOM   7789  C  C     . GLU B  2  415 ? -24.481 -9.667  53.018  1.00 43.04  ? 415 GLU B C     1 
ATOM   7790  O  O     . GLU B  2  415 ? -23.988 -10.418 53.864  1.00 41.53  ? 415 GLU B O     1 
ATOM   7791  C  CB    . GLU B  2  415 ? -25.542 -10.357 50.843  1.00 42.03  ? 415 GLU B CB    1 
ATOM   7792  C  CG    . GLU B  2  415 ? -26.303 -11.434 51.599  1.00 66.30  ? 415 GLU B CG    1 
ATOM   7793  C  CD    . GLU B  2  415 ? -27.556 -11.877 50.871  1.00 70.20  ? 415 GLU B CD    1 
ATOM   7794  O  OE1   . GLU B  2  415 ? -27.434 -12.429 49.757  1.00 62.05  ? 415 GLU B OE1   1 
ATOM   7795  O  OE2   . GLU B  2  415 ? -28.664 -11.664 51.406  1.00 83.04  ? 415 GLU B OE2   1 
ATOM   7796  N  N     . PHE B  2  416 ? -25.246 -8.632  53.339  1.00 46.90  ? 416 PHE B N     1 
ATOM   7797  C  CA    . PHE B  2  416 ? -25.445 -8.220  54.719  1.00 43.53  ? 416 PHE B CA    1 
ATOM   7798  C  C     . PHE B  2  416 ? -26.898 -8.416  55.126  1.00 37.29  ? 416 PHE B C     1 
ATOM   7799  O  O     . PHE B  2  416 ? -27.814 -8.071  54.372  1.00 58.02  ? 416 PHE B O     1 
ATOM   7800  C  CB    . PHE B  2  416 ? -25.006 -6.768  54.898  1.00 36.64  ? 416 PHE B CB    1 
ATOM   7801  C  CG    . PHE B  2  416 ? -23.636 -6.494  54.345  1.00 52.23  ? 416 PHE B CG    1 
ATOM   7802  C  CD1   . PHE B  2  416 ? -22.504 -6.817  55.075  1.00 44.18  ? 416 PHE B CD1   1 
ATOM   7803  C  CD2   . PHE B  2  416 ? -23.479 -5.947  53.082  1.00 54.54  ? 416 PHE B CD2   1 
ATOM   7804  C  CE1   . PHE B  2  416 ? -21.240 -6.582  54.566  1.00 40.83  ? 416 PHE B CE1   1 
ATOM   7805  C  CE2   . PHE B  2  416 ? -22.217 -5.710  52.567  1.00 47.66  ? 416 PHE B CE2   1 
ATOM   7806  C  CZ    . PHE B  2  416 ? -21.097 -6.027  53.311  1.00 49.67  ? 416 PHE B CZ    1 
ATOM   7807  N  N     . VAL B  2  417 ? -27.095 -8.984  56.314  1.00 49.01  ? 417 VAL B N     1 
ATOM   7808  C  CA    . VAL B  2  417 ? -28.411 -9.264  56.871  1.00 53.03  ? 417 VAL B CA    1 
ATOM   7809  C  C     . VAL B  2  417 ? -28.502 -8.619  58.245  1.00 60.30  ? 417 VAL B C     1 
ATOM   7810  O  O     . VAL B  2  417 ? -27.493 -8.436  58.935  1.00 60.41  ? 417 VAL B O     1 
ATOM   7811  C  CB    . VAL B  2  417 ? -28.700 -10.780 56.960  1.00 51.68  ? 417 VAL B CB    1 
ATOM   7812  C  CG1   . VAL B  2  417 ? -28.481 -11.442 55.609  1.00 61.15  ? 417 VAL B CG1   1 
ATOM   7813  C  CG2   . VAL B  2  417 ? -27.835 -11.431 58.029  1.00 43.07  ? 417 VAL B CG2   1 
ATOM   7814  N  N     . ASN B  2  418 ? -29.720 -8.246  58.632  1.00 75.53  ? 418 ASN B N     1 
ATOM   7815  C  CA    . ASN B  2  418 ? -30.047 -7.995  60.034  1.00 79.72  ? 418 ASN B CA    1 
ATOM   7816  C  C     . ASN B  2  418 ? -31.295 -8.796  60.394  1.00 78.73  ? 418 ASN B C     1 
ATOM   7817  O  O     . ASN B  2  418 ? -32.417 -8.392  60.077  1.00 75.13  ? 418 ASN B O     1 
ATOM   7818  C  CB    . ASN B  2  418 ? -30.248 -6.507  60.296  1.00 81.36  ? 418 ASN B CB    1 
ATOM   7819  C  CG    . ASN B  2  418 ? -30.305 -6.181  61.775  1.00 78.86  ? 418 ASN B CG    1 
ATOM   7820  O  OD1   . ASN B  2  418 ? -30.021 -7.030  62.620  1.00 73.73  ? 418 ASN B OD1   1 
ATOM   7821  N  ND2   . ASN B  2  418 ? -30.667 -4.945  62.096  1.00 84.25  ? 418 ASN B ND2   1 
ATOM   7822  N  N     . THR B  2  419 ? -31.092 -9.931  61.057  1.00 75.40  ? 419 THR B N     1 
ATOM   7823  C  CA    . THR B  2  419 ? -32.181 -10.794 61.510  1.00 72.68  ? 419 THR B CA    1 
ATOM   7824  C  C     . THR B  2  419 ? -31.977 -11.034 62.999  1.00 61.96  ? 419 THR B C     1 
ATOM   7825  O  O     . THR B  2  419 ? -31.076 -11.797 63.391  1.00 71.18  ? 419 THR B O     1 
ATOM   7826  C  CB    . THR B  2  419 ? -32.223 -12.108 60.737  1.00 89.27  ? 419 THR B CB    1 
ATOM   7827  O  OG1   . THR B  2  419 ? -32.547 -11.844 59.365  1.00 100.23 ? 419 THR B OG1   1 
ATOM   7828  C  CG2   . THR B  2  419 ? -33.271 -13.045 61.325  1.00 95.30  ? 419 THR B CG2   1 
ATOM   7829  N  N     . PRO B  2  420 ? -32.768 -10.391 63.860  1.00 64.09  ? 420 PRO B N     1 
ATOM   7830  C  CA    . PRO B  2  420 ? -32.573 -10.573 65.296  1.00 76.58  ? 420 PRO B CA    1 
ATOM   7831  C  C     . PRO B  2  420 ? -33.088 -11.931 65.745  1.00 93.00  ? 420 PRO B C     1 
ATOM   7832  O  O     . PRO B  2  420 ? -33.981 -12.513 65.107  1.00 90.35  ? 420 PRO B O     1 
ATOM   7833  C  CB    . PRO B  2  420 ? -33.393 -9.427  65.915  1.00 70.72  ? 420 PRO B CB    1 
ATOM   7834  C  CG    . PRO B  2  420 ? -34.373 -9.036  64.860  1.00 64.37  ? 420 PRO B CG    1 
ATOM   7835  C  CD    . PRO B  2  420 ? -33.678 -9.272  63.557  1.00 60.83  ? 420 PRO B CD    1 
ATOM   7836  N  N     . PRO B  2  421 ? -32.554 -12.470 66.846  1.00 95.64  ? 421 PRO B N     1 
ATOM   7837  C  CA    . PRO B  2  421 ? -32.741 -13.899 67.132  1.00 98.68  ? 421 PRO B CA    1 
ATOM   7838  C  C     . PRO B  2  421 ? -33.990 -14.190 67.949  1.00 102.53 ? 421 PRO B C     1 
ATOM   7839  O  O     . PRO B  2  421 ? -33.974 -14.110 69.182  1.00 102.29 ? 421 PRO B O     1 
ATOM   7840  C  CB    . PRO B  2  421 ? -31.468 -14.262 67.903  1.00 89.30  ? 421 PRO B CB    1 
ATOM   7841  C  CG    . PRO B  2  421 ? -31.107 -13.001 68.617  1.00 80.37  ? 421 PRO B CG    1 
ATOM   7842  C  CD    . PRO B  2  421 ? -31.550 -11.856 67.735  1.00 82.17  ? 421 PRO B CD    1 
ATOM   7843  N  N     . LEU B  2  422 ? -35.084 -14.527 67.264  1.00 103.91 ? 422 LEU B N     1 
ATOM   7844  C  CA    . LEU B  2  422 ? -36.295 -14.933 67.968  1.00 106.97 ? 422 LEU B CA    1 
ATOM   7845  C  C     . LEU B  2  422 ? -36.046 -16.176 68.807  1.00 100.56 ? 422 LEU B C     1 
ATOM   7846  O  O     . LEU B  2  422 ? -36.541 -16.288 69.934  1.00 84.49  ? 422 LEU B O     1 
ATOM   7847  C  CB    . LEU B  2  422 ? -37.415 -15.217 66.970  1.00 110.08 ? 422 LEU B CB    1 
ATOM   7848  C  CG    . LEU B  2  422 ? -38.130 -14.162 66.128  1.00 110.77 ? 422 LEU B CG    1 
ATOM   7849  C  CD1   . LEU B  2  422 ? -37.191 -13.222 65.387  1.00 109.90 ? 422 LEU B CD1   1 
ATOM   7850  C  CD2   . LEU B  2  422 ? -38.998 -14.916 65.152  1.00 105.98 ? 422 LEU B CD2   1 
ATOM   7851  N  N     . VAL B  2  423 ? -35.284 -17.121 68.267  1.00 109.00 ? 423 VAL B N     1 
ATOM   7852  C  CA    . VAL B  2  423 ? -34.965 -18.372 68.938  1.00 110.21 ? 423 VAL B CA    1 
ATOM   7853  C  C     . VAL B  2  423 ? -33.474 -18.631 68.777  1.00 107.88 ? 423 VAL B C     1 
ATOM   7854  O  O     . VAL B  2  423 ? -32.888 -18.312 67.737  1.00 110.42 ? 423 VAL B O     1 
ATOM   7855  C  CB    . VAL B  2  423 ? -35.803 -19.542 68.377  1.00 111.57 ? 423 VAL B CB    1 
ATOM   7856  C  CG1   . VAL B  2  423 ? -35.574 -19.701 66.882  1.00 114.49 ? 423 VAL B CG1   1 
ATOM   7857  C  CG2   . VAL B  2  423 ? -35.494 -20.833 69.117  1.00 102.11 ? 423 VAL B CG2   1 
ATOM   7858  N  N     . LYS B  2  424 ? -32.854 -19.190 69.817  1.00 105.96 ? 424 LYS B N     1 
ATOM   7859  C  CA    . LYS B  2  424 ? -31.488 -19.706 69.717  1.00 105.66 ? 424 LYS B CA    1 
ATOM   7860  C  C     . LYS B  2  424 ? -31.543 -21.174 69.301  1.00 93.39  ? 424 LYS B C     1 
ATOM   7861  O  O     . LYS B  2  424 ? -31.319 -22.091 70.095  1.00 90.40  ? 424 LYS B O     1 
ATOM   7862  C  CB    . LYS B  2  424 ? -30.750 -19.527 71.037  1.00 111.59 ? 424 LYS B CB    1 
ATOM   7863  C  CG    . LYS B  2  424 ? -30.770 -18.113 71.589  1.00 113.98 ? 424 LYS B CG    1 
ATOM   7864  C  CD    . LYS B  2  424 ? -30.002 -18.044 72.901  1.00 114.46 ? 424 LYS B CD    1 
ATOM   7865  C  CE    . LYS B  2  424 ? -30.048 -16.653 73.509  1.00 111.48 ? 424 LYS B CE    1 
ATOM   7866  N  NZ    . LYS B  2  424 ? -29.258 -16.572 74.770  1.00 107.11 ? 424 LYS B NZ    1 
ATOM   7867  N  N     . LEU B  2  425 ? -31.840 -21.397 68.020  1.00 80.37  ? 425 LEU B N     1 
ATOM   7868  C  CA    . LEU B  2  425 ? -31.898 -22.763 67.509  1.00 78.40  ? 425 LEU B CA    1 
ATOM   7869  C  C     . LEU B  2  425 ? -30.514 -23.398 67.442  1.00 64.39  ? 425 LEU B C     1 
ATOM   7870  O  O     . LEU B  2  425 ? -30.308 -24.518 67.924  1.00 73.20  ? 425 LEU B O     1 
ATOM   7871  C  CB    . LEU B  2  425 ? -32.545 -22.785 66.126  1.00 82.06  ? 425 LEU B CB    1 
ATOM   7872  C  CG    . LEU B  2  425 ? -32.463 -24.175 65.492  1.00 85.89  ? 425 LEU B CG    1 
ATOM   7873  C  CD1   . LEU B  2  425 ? -33.708 -24.982 65.819  1.00 76.37  ? 425 LEU B CD1   1 
ATOM   7874  C  CD2   . LEU B  2  425 ? -32.222 -24.103 63.994  1.00 84.45  ? 425 LEU B CD2   1 
ATOM   7875  N  N     . TRP B  2  426 ? -29.551 -22.695 66.847  1.00 56.98  ? 426 TRP B N     1 
ATOM   7876  C  CA    . TRP B  2  426 ? -28.272 -23.324 66.534  1.00 66.94  ? 426 TRP B CA    1 
ATOM   7877  C  C     . TRP B  2  426 ? -27.405 -23.522 67.772  1.00 77.84  ? 426 TRP B C     1 
ATOM   7878  O  O     . TRP B  2  426 ? -26.651 -24.499 67.843  1.00 78.23  ? 426 TRP B O     1 
ATOM   7879  C  CB    . TRP B  2  426 ? -27.549 -22.508 65.465  1.00 55.35  ? 426 TRP B CB    1 
ATOM   7880  C  CG    . TRP B  2  426 ? -28.313 -22.509 64.174  1.00 58.97  ? 426 TRP B CG    1 
ATOM   7881  C  CD1   . TRP B  2  426 ? -28.872 -21.435 63.543  1.00 60.92  ? 426 TRP B CD1   1 
ATOM   7882  C  CD2   . TRP B  2  426 ? -28.640 -23.656 63.380  1.00 53.71  ? 426 TRP B CD2   1 
ATOM   7883  N  NE1   . TRP B  2  426 ? -29.509 -21.841 62.393  1.00 59.41  ? 426 TRP B NE1   1 
ATOM   7884  C  CE2   . TRP B  2  426 ? -29.381 -23.201 62.272  1.00 54.36  ? 426 TRP B CE2   1 
ATOM   7885  C  CE3   . TRP B  2  426 ? -28.367 -25.023 63.493  1.00 51.13  ? 426 TRP B CE3   1 
ATOM   7886  C  CZ2   . TRP B  2  426 ? -29.855 -24.065 61.285  1.00 57.15  ? 426 TRP B CZ2   1 
ATOM   7887  C  CZ3   . TRP B  2  426 ? -28.837 -25.878 62.515  1.00 65.53  ? 426 TRP B CZ3   1 
ATOM   7888  C  CH2   . TRP B  2  426 ? -29.572 -25.397 61.425  1.00 68.66  ? 426 TRP B CH2   1 
ATOM   7889  N  N     . TYR B  2  427 ? -27.488 -22.623 68.747  1.00 77.46  ? 427 TYR B N     1 
ATOM   7890  C  CA    . TYR B  2  427 ? -26.647 -22.697 69.933  1.00 82.27  ? 427 TYR B CA    1 
ATOM   7891  C  C     . TYR B  2  427 ? -27.523 -22.660 71.174  1.00 94.31  ? 427 TYR B C     1 
ATOM   7892  O  O     . TYR B  2  427 ? -28.504 -21.912 71.229  1.00 103.20 ? 427 TYR B O     1 
ATOM   7893  C  CB    . TYR B  2  427 ? -25.624 -21.559 69.968  1.00 86.90  ? 427 TYR B CB    1 
ATOM   7894  C  CG    . TYR B  2  427 ? -24.599 -21.672 71.075  1.00 92.03  ? 427 TYR B CG    1 
ATOM   7895  C  CD1   . TYR B  2  427 ? -23.863 -22.836 71.247  1.00 94.77  ? 427 TYR B CD1   1 
ATOM   7896  C  CD2   . TYR B  2  427 ? -24.354 -20.609 71.936  1.00 90.56  ? 427 TYR B CD2   1 
ATOM   7897  C  CE1   . TYR B  2  427 ? -22.920 -22.945 72.254  1.00 94.69  ? 427 TYR B CE1   1 
ATOM   7898  C  CE2   . TYR B  2  427 ? -23.413 -20.708 72.945  1.00 89.13  ? 427 TYR B CE2   1 
ATOM   7899  C  CZ    . TYR B  2  427 ? -22.700 -21.878 73.099  1.00 93.58  ? 427 TYR B CZ    1 
ATOM   7900  O  OH    . TYR B  2  427 ? -21.763 -21.980 74.102  1.00 93.59  ? 427 TYR B OH    1 
ATOM   7901  N  N     . GLN B  2  428 ? -27.183 -23.498 72.151  1.00 105.02 ? 428 GLN B N     1 
ATOM   7902  C  CA    . GLN B  2  428 ? -27.872 -23.540 73.439  1.00 115.28 ? 428 GLN B CA    1 
ATOM   7903  C  C     . GLN B  2  428 ? -27.714 -22.232 74.219  1.00 122.29 ? 428 GLN B C     1 
ATOM   7904  O  O     . GLN B  2  428 ? -28.069 -21.149 73.755  1.00 121.43 ? 428 GLN B O     1 
ATOM   7905  C  CB    . GLN B  2  428 ? -27.352 -24.712 74.279  1.00 116.32 ? 428 GLN B CB    1 
ATOM   7906  C  CG    . GLN B  2  428 ? -28.275 -25.142 75.413  1.00 121.54 ? 428 GLN B CG    1 
ATOM   7907  C  CD    . GLN B  2  428 ? -29.292 -26.178 74.979  1.00 124.57 ? 428 GLN B CD    1 
ATOM   7908  O  OE1   . GLN B  2  428 ? -30.319 -25.850 74.384  1.00 127.68 ? 428 GLN B OE1   1 
ATOM   7909  N  NE2   . GLN B  2  428 ? -29.008 -27.441 75.272  1.00 124.14 ? 428 GLN B NE2   1 
ATOM   7910  O  OXT   . GLN B  2  428 ? -27.225 -22.223 75.349  1.00 128.34 ? 428 GLN B OXT   1 
ATOM   7911  O  "O5'" . DT  C  3  2   ? -25.372 37.981  29.413  1.00 233.57 ? 702 DT  T "O5'" 1 
ATOM   7912  C  "C5'" . DT  C  3  2   ? -25.982 36.694  29.411  1.00 235.23 ? 702 DT  T "C5'" 1 
ATOM   7913  C  "C4'" . DT  C  3  2   ? -27.489 36.814  29.273  1.00 245.46 ? 702 DT  T "C4'" 1 
ATOM   7914  O  "O4'" . DT  C  3  2   ? -27.862 36.646  27.894  1.00 249.15 ? 702 DT  T "O4'" 1 
ATOM   7915  C  "C3'" . DT  C  3  2   ? -28.285 35.753  30.008  1.00 248.46 ? 702 DT  T "C3'" 1 
ATOM   7916  O  "O3'" . DT  C  3  2   ? -28.512 36.166  31.352  1.00 254.09 ? 702 DT  T "O3'" 1 
ATOM   7917  C  "C2'" . DT  C  3  2   ? -29.595 35.689  29.212  1.00 251.83 ? 702 DT  T "C2'" 1 
ATOM   7918  C  "C1'" . DT  C  3  2   ? -29.218 36.256  27.834  1.00 253.25 ? 702 DT  T "C1'" 1 
ATOM   7919  N  N1    . DT  C  3  2   ? -29.392 35.286  26.704  1.00 252.90 ? 702 DT  T N1    1 
ATOM   7920  C  C2    . DT  C  3  2   ? -30.655 34.830  26.390  1.00 254.63 ? 702 DT  T C2    1 
ATOM   7921  O  O2    . DT  C  3  2   ? -31.660 35.167  26.991  1.00 257.17 ? 702 DT  T O2    1 
ATOM   7922  N  N3    . DT  C  3  2   ? -30.700 33.954  25.338  1.00 253.00 ? 702 DT  T N3    1 
ATOM   7923  C  C4    . DT  C  3  2   ? -29.637 33.498  24.581  1.00 248.94 ? 702 DT  T C4    1 
ATOM   7924  O  O4    . DT  C  3  2   ? -29.782 32.709  23.653  1.00 246.74 ? 702 DT  T O4    1 
ATOM   7925  C  C5    . DT  C  3  2   ? -28.343 34.018  24.959  1.00 247.64 ? 702 DT  T C5    1 
ATOM   7926  C  C7    . DT  C  3  2   ? -27.114 33.595  24.210  1.00 242.92 ? 702 DT  T C7    1 
ATOM   7927  C  C6    . DT  C  3  2   ? -28.284 34.877  25.988  1.00 249.91 ? 702 DT  T C6    1 
ATOM   7928  P  P     . DG  C  3  3   ? -29.001 35.106  32.457  1.00 254.55 ? 703 DG  T P     1 
ATOM   7929  O  OP1   . DG  C  3  3   ? -30.313 35.568  32.960  1.00 259.76 ? 703 DG  T OP1   1 
ATOM   7930  O  OP2   . DG  C  3  3   ? -27.885 34.887  33.404  1.00 250.73 ? 703 DG  T OP2   1 
ATOM   7931  O  "O5'" . DG  C  3  3   ? -29.249 33.765  31.623  1.00 248.78 ? 703 DG  T "O5'" 1 
ATOM   7932  C  "C5'" . DG  C  3  3   ? -28.881 32.510  32.168  1.00 238.21 ? 703 DG  T "C5'" 1 
ATOM   7933  C  "C4'" . DG  C  3  3   ? -29.883 31.440  31.779  1.00 234.50 ? 703 DG  T "C4'" 1 
ATOM   7934  O  "O4'" . DG  C  3  3   ? -30.505 31.786  30.513  1.00 237.69 ? 703 DG  T "O4'" 1 
ATOM   7935  C  "C3'" . DG  C  3  3   ? -29.290 30.065  31.547  1.00 228.02 ? 703 DG  T "C3'" 1 
ATOM   7936  O  "O3'" . DG  C  3  3   ? -29.156 29.370  32.776  1.00 225.61 ? 703 DG  T "O3'" 1 
ATOM   7937  C  "C2'" . DG  C  3  3   ? -30.343 29.433  30.652  1.00 230.12 ? 703 DG  T "C2'" 1 
ATOM   7938  C  "C1'" . DG  C  3  3   ? -30.697 30.609  29.742  1.00 235.46 ? 703 DG  T "C1'" 1 
ATOM   7939  N  N9    . DG  C  3  3   ? -29.858 30.696  28.546  1.00 235.32 ? 703 DG  T N9    1 
ATOM   7940  C  C8    . DG  C  3  3   ? -29.183 31.802  28.089  1.00 237.34 ? 703 DG  T C8    1 
ATOM   7941  N  N7    . DG  C  3  3   ? -28.510 31.585  26.993  1.00 235.41 ? 703 DG  T N7    1 
ATOM   7942  C  C5    . DG  C  3  3   ? -28.751 30.248  26.704  1.00 231.40 ? 703 DG  T C5    1 
ATOM   7943  C  C6    . DG  C  3  3   ? -28.287 29.449  25.631  1.00 226.23 ? 703 DG  T C6    1 
ATOM   7944  O  O6    . DG  C  3  3   ? -27.542 29.776  24.696  1.00 224.48 ? 703 DG  T O6    1 
ATOM   7945  N  N1    . DG  C  3  3   ? -28.769 28.144  25.715  1.00 222.33 ? 703 DG  T N1    1 
ATOM   7946  C  C2    . DG  C  3  3   ? -29.597 27.674  26.706  1.00 220.20 ? 703 DG  T C2    1 
ATOM   7947  N  N2    . DG  C  3  3   ? -29.959 26.386  26.620  1.00 214.34 ? 703 DG  T N2    1 
ATOM   7948  N  N3    . DG  C  3  3   ? -30.041 28.412  27.713  1.00 225.26 ? 703 DG  T N3    1 
ATOM   7949  C  C4    . DG  C  3  3   ? -29.579 29.685  27.650  1.00 231.06 ? 703 DG  T C4    1 
ATOM   7950  P  P     . DG  C  3  4   ? -27.868 28.444  33.028  1.00 220.54 ? 704 DG  T P     1 
ATOM   7951  O  OP1   . DG  C  3  4   ? -27.919 27.954  34.423  1.00 217.65 ? 704 DG  T OP1   1 
ATOM   7952  O  OP2   . DG  C  3  4   ? -26.684 29.193  32.552  1.00 220.99 ? 704 DG  T OP2   1 
ATOM   7953  O  "O5'" . DG  C  3  4   ? -28.085 27.213  32.032  1.00 215.16 ? 704 DG  T "O5'" 1 
ATOM   7954  C  "C5'" . DG  C  3  4   ? -27.011 26.328  31.760  1.00 205.06 ? 704 DG  T "C5'" 1 
ATOM   7955  C  "C4'" . DG  C  3  4   ? -26.980 25.950  30.291  1.00 198.75 ? 704 DG  T "C4'" 1 
ATOM   7956  O  "O4'" . DG  C  3  4   ? -27.110 27.139  29.483  1.00 201.50 ? 704 DG  T "O4'" 1 
ATOM   7957  C  "C3'" . DG  C  3  4   ? -25.686 25.312  29.828  1.00 186.80 ? 704 DG  T "C3'" 1 
ATOM   7958  O  "O3'" . DG  C  3  4   ? -25.722 23.915  30.085  1.00 172.68 ? 704 DG  T "O3'" 1 
ATOM   7959  C  "C2'" . DG  C  3  4   ? -25.691 25.611  28.329  1.00 191.54 ? 704 DG  T "C2'" 1 
ATOM   7960  C  "C1'" . DG  C  3  4   ? -26.435 26.952  28.252  1.00 199.74 ? 704 DG  T "C1'" 1 
ATOM   7961  N  N9    . DG  C  3  4   ? -25.562 28.102  28.017  1.00 203.19 ? 704 DG  T N9    1 
ATOM   7962  C  C8    . DG  C  3  4   ? -25.407 28.792  26.839  1.00 207.15 ? 704 DG  T C8    1 
ATOM   7963  N  N7    . DG  C  3  4   ? -24.563 29.782  26.922  1.00 208.43 ? 704 DG  T N7    1 
ATOM   7964  C  C5    . DG  C  3  4   ? -24.125 29.746  28.238  1.00 206.05 ? 704 DG  T C5    1 
ATOM   7965  C  C6    . DG  C  3  4   ? -23.200 30.575  28.912  1.00 205.31 ? 704 DG  T C6    1 
ATOM   7966  O  O6    . DG  C  3  4   ? -22.563 31.538  28.462  1.00 207.37 ? 704 DG  T O6    1 
ATOM   7967  N  N1    . DG  C  3  4   ? -23.043 30.197  30.242  1.00 200.77 ? 704 DG  T N1    1 
ATOM   7968  C  C2    . DG  C  3  4   ? -23.696 29.149  30.845  1.00 196.55 ? 704 DG  T C2    1 
ATOM   7969  N  N2    . DG  C  3  4   ? -23.413 28.937  32.138  1.00 190.33 ? 704 DG  T N2    1 
ATOM   7970  N  N3    . DG  C  3  4   ? -24.566 28.363  30.225  1.00 199.36 ? 704 DG  T N3    1 
ATOM   7971  C  C4    . DG  C  3  4   ? -24.731 28.718  28.928  1.00 203.04 ? 704 DG  T C4    1 
ATOM   7972  P  P     . DT  C  3  5   ? -24.822 23.285  31.259  1.00 156.90 ? 705 DT  T P     1 
ATOM   7973  O  OP1   . DT  C  3  5   ? -25.503 22.064  31.742  1.00 153.63 ? 705 DT  T OP1   1 
ATOM   7974  O  OP2   . DT  C  3  5   ? -24.491 24.370  32.208  1.00 156.52 ? 705 DT  T OP2   1 
ATOM   7975  O  "O5'" . DT  C  3  5   ? -23.482 22.840  30.514  1.00 148.24 ? 705 DT  T "O5'" 1 
ATOM   7976  C  "C5'" . DT  C  3  5   ? -23.560 22.154  29.276  1.00 143.55 ? 705 DT  T "C5'" 1 
ATOM   7977  C  "C4'" . DT  C  3  5   ? -22.183 21.726  28.809  1.00 137.09 ? 705 DT  T "C4'" 1 
ATOM   7978  O  "O4'" . DT  C  3  5   ? -21.334 22.892  28.659  1.00 137.27 ? 705 DT  T "O4'" 1 
ATOM   7979  C  "C3'" . DT  C  3  5   ? -21.430 20.832  29.773  1.00 129.75 ? 705 DT  T "C3'" 1 
ATOM   7980  O  "O3'" . DT  C  3  5   ? -21.820 19.478  29.594  1.00 123.31 ? 705 DT  T "O3'" 1 
ATOM   7981  C  "C2'" . DT  C  3  5   ? -19.991 21.067  29.337  1.00 127.22 ? 705 DT  T "C2'" 1 
ATOM   7982  C  "C1'" . DT  C  3  5   ? -20.006 22.566  29.041  1.00 129.54 ? 705 DT  T "C1'" 1 
ATOM   7983  N  N1    . DT  C  3  5   ? -19.626 23.404  30.215  1.00 124.56 ? 705 DT  T N1    1 
ATOM   7984  C  C2    . DT  C  3  5   ? -18.324 23.389  30.659  1.00 120.09 ? 705 DT  T C2    1 
ATOM   7985  O  O2    . DT  C  3  5   ? -17.447 22.725  30.139  1.00 117.52 ? 705 DT  T O2    1 
ATOM   7986  N  N3    . DT  C  3  5   ? -18.081 24.188  31.741  1.00 120.42 ? 705 DT  T N3    1 
ATOM   7987  C  C4    . DT  C  3  5   ? -18.987 24.983  32.416  1.00 124.44 ? 705 DT  T C4    1 
ATOM   7988  O  O4    . DT  C  3  5   ? -18.666 25.668  33.381  1.00 125.37 ? 705 DT  T O4    1 
ATOM   7989  C  C5    . DT  C  3  5   ? -20.335 24.954  31.901  1.00 128.00 ? 705 DT  T C5    1 
ATOM   7990  C  C7    . DT  C  3  5   ? -21.407 25.777  32.549  1.00 132.47 ? 705 DT  T C7    1 
ATOM   7991  C  C6    . DT  C  3  5   ? -20.587 24.174  30.839  1.00 127.65 ? 705 DT  T C6    1 
ATOM   7992  P  P     . DC  C  3  6   ? -21.809 18.469  30.844  1.00 111.43 ? 706 DC  T P     1 
ATOM   7993  O  OP1   . DC  C  3  6   ? -22.405 17.189  30.400  1.00 109.37 ? 706 DC  T OP1   1 
ATOM   7994  O  OP2   . DC  C  3  6   ? -22.388 19.187  32.000  1.00 112.93 ? 706 DC  T OP2   1 
ATOM   7995  O  "O5'" . DC  C  3  6   ? -20.254 18.240  31.136  1.00 106.87 ? 706 DC  T "O5'" 1 
ATOM   7996  C  "C5'" . DC  C  3  6   ? -19.413 17.710  30.119  1.00 112.01 ? 706 DC  T "C5'" 1 
ATOM   7997  C  "C4'" . DC  C  3  6   ? -17.992 17.554  30.623  1.00 110.49 ? 706 DC  T "C4'" 1 
ATOM   7998  O  "O4'" . DC  C  3  6   ? -17.377 18.859  30.771  1.00 116.17 ? 706 DC  T "O4'" 1 
ATOM   7999  C  "C3'" . DC  C  3  6   ? -17.873 16.924  31.994  1.00 107.50 ? 706 DC  T "C3'" 1 
ATOM   8000  O  "O3'" . DC  C  3  6   ? -17.932 15.509  31.891  1.00 103.37 ? 706 DC  T "O3'" 1 
ATOM   8001  C  "C2'" . DC  C  3  6   ? -16.497 17.411  32.430  1.00 108.56 ? 706 DC  T "C2'" 1 
ATOM   8002  C  "C1'" . DC  C  3  6   ? -16.495 18.842  31.884  1.00 112.51 ? 706 DC  T "C1'" 1 
ATOM   8003  N  N1    . DC  C  3  6   ? -16.955 19.862  32.879  1.00 109.76 ? 706 DC  T N1    1 
ATOM   8004  C  C2    . DC  C  3  6   ? -16.046 20.381  33.808  1.00 104.26 ? 706 DC  T C2    1 
ATOM   8005  O  O2    . DC  C  3  6   ? -14.873 19.988  33.788  1.00 100.85 ? 706 DC  T O2    1 
ATOM   8006  N  N3    . DC  C  3  6   ? -16.478 21.302  34.705  1.00 99.91  ? 706 DC  T N3    1 
ATOM   8007  C  C4    . DC  C  3  6   ? -17.751 21.699  34.695  1.00 104.08 ? 706 DC  T C4    1 
ATOM   8008  N  N4    . DC  C  3  6   ? -18.130 22.609  35.598  1.00 106.66 ? 706 DC  T N4    1 
ATOM   8009  C  C5    . DC  C  3  6   ? -18.692 21.182  33.757  1.00 108.53 ? 706 DC  T C5    1 
ATOM   8010  C  C6    . DC  C  3  6   ? -18.255 20.275  32.877  1.00 110.00 ? 706 DC  T C6    1 
ATOM   8011  P  P     . DG  C  3  7   ? -18.752 14.661  32.982  1.00 100.35 ? 707 DG  T P     1 
ATOM   8012  O  OP1   . DG  C  3  7   ? -19.124 13.368  32.368  1.00 102.62 ? 707 DG  T OP1   1 
ATOM   8013  O  OP2   . DG  C  3  7   ? -19.802 15.542  33.542  1.00 94.25  ? 707 DG  T OP2   1 
ATOM   8014  O  "O5'" . DG  C  3  7   ? -17.669 14.360  34.116  1.00 102.56 ? 707 DG  T "O5'" 1 
ATOM   8015  C  "C5'" . DG  C  3  7   ? -16.502 13.620  33.790  1.00 102.03 ? 707 DG  T "C5'" 1 
ATOM   8016  C  "C4'" . DG  C  3  7   ? -15.385 13.905  34.775  1.00 97.02  ? 707 DG  T "C4'" 1 
ATOM   8017  O  "O4'" . DG  C  3  7   ? -14.955 15.284  34.648  1.00 95.60  ? 707 DG  T "O4'" 1 
ATOM   8018  C  "C3'" . DG  C  3  7   ? -15.763 13.775  36.235  1.00 90.99  ? 707 DG  T "C3'" 1 
ATOM   8019  O  "O3'" . DG  C  3  7   ? -15.734 12.413  36.638  1.00 91.14  ? 707 DG  T "O3'" 1 
ATOM   8020  C  "C2'" . DG  C  3  7   ? -14.651 14.585  36.887  1.00 87.18  ? 707 DG  T "C2'" 1 
ATOM   8021  C  "C1'" . DG  C  3  7   ? -14.540 15.763  35.921  1.00 92.14  ? 707 DG  T "C1'" 1 
ATOM   8022  N  N9    . DG  C  3  7   ? -15.385 16.889  36.303  1.00 89.74  ? 707 DG  T N9    1 
ATOM   8023  C  C8    . DG  C  3  7   ? -16.656 17.162  35.857  1.00 91.64  ? 707 DG  T C8    1 
ATOM   8024  N  N7    . DG  C  3  7   ? -17.172 18.237  36.387  1.00 91.03  ? 707 DG  T N7    1 
ATOM   8025  C  C5    . DG  C  3  7   ? -16.185 18.702  37.246  1.00 89.13  ? 707 DG  T C5    1 
ATOM   8026  C  C6    . DG  C  3  7   ? -16.173 19.835  38.095  1.00 89.35  ? 707 DG  T C6    1 
ATOM   8027  O  O6    . DG  C  3  7   ? -17.064 20.680  38.260  1.00 94.60  ? 707 DG  T O6    1 
ATOM   8028  N  N1    . DG  C  3  7   ? -14.975 19.941  38.796  1.00 84.36  ? 707 DG  T N1    1 
ATOM   8029  C  C2    . DG  C  3  7   ? -13.922 19.064  38.691  1.00 79.64  ? 707 DG  T C2    1 
ATOM   8030  N  N2    . DG  C  3  7   ? -12.848 19.331  39.448  1.00 83.01  ? 707 DG  T N2    1 
ATOM   8031  N  N3    . DG  C  3  7   ? -13.920 17.999  37.900  1.00 79.01  ? 707 DG  T N3    1 
ATOM   8032  C  C4    . DG  C  3  7   ? -15.080 17.881  37.209  1.00 84.29  ? 707 DG  T C4    1 
ATOM   8033  P  P     . DG  C  3  8   ? -16.604 11.933  37.903  1.00 79.78  ? 708 DG  T P     1 
ATOM   8034  O  OP1   . DG  C  3  8   ? -16.582 10.454  37.937  1.00 85.07  ? 708 DG  T OP1   1 
ATOM   8035  O  OP2   . DG  C  3  8   ? -17.898 12.650  37.857  1.00 80.77  ? 708 DG  T OP2   1 
ATOM   8036  O  "O5'" . DG  C  3  8   ? -15.789 12.493  39.160  1.00 77.98  ? 708 DG  T "O5'" 1 
ATOM   8037  C  "C5'" . DG  C  3  8   ? -14.429 12.122  39.347  1.00 76.33  ? 708 DG  T "C5'" 1 
ATOM   8038  C  "C4'" . DG  C  3  8   ? -13.787 12.954  40.442  1.00 76.45  ? 708 DG  T "C4'" 1 
ATOM   8039  O  "O4'" . DG  C  3  8   ? -13.705 14.339  40.025  1.00 81.80  ? 708 DG  T "O4'" 1 
ATOM   8040  C  "C3'" . DG  C  3  8   ? -14.554 12.996  41.747  1.00 79.73  ? 708 DG  T "C3'" 1 
ATOM   8041  O  "O3'" . DG  C  3  8   ? -14.244 11.856  42.528  1.00 79.75  ? 708 DG  T "O3'" 1 
ATOM   8042  C  "C2'" . DG  C  3  8   ? -14.015 14.275  42.375  1.00 83.63  ? 708 DG  T "C2'" 1 
ATOM   8043  C  "C1'" . DG  C  3  8   ? -13.881 15.185  41.152  1.00 81.78  ? 708 DG  T "C1'" 1 
ATOM   8044  N  N9    . DG  C  3  8   ? -15.052 16.026  40.922  1.00 75.36  ? 708 DG  T N9    1 
ATOM   8045  C  C8    . DG  C  3  8   ? -16.051 15.818  40.001  1.00 82.40  ? 708 DG  T C8    1 
ATOM   8046  N  N7    . DG  C  3  8   ? -16.976 16.737  40.023  1.00 86.43  ? 708 DG  T N7    1 
ATOM   8047  C  C5    . DG  C  3  8   ? -16.568 17.610  41.022  1.00 79.36  ? 708 DG  T C5    1 
ATOM   8048  C  C6    . DG  C  3  8   ? -17.173 18.797  41.500  1.00 82.27  ? 708 DG  T C6    1 
ATOM   8049  O  O6    . DG  C  3  8   ? -18.226 19.328  41.119  1.00 90.44  ? 708 DG  T O6    1 
ATOM   8050  N  N1    . DG  C  3  8   ? -16.430 19.378  42.524  1.00 81.49  ? 708 DG  T N1    1 
ATOM   8051  C  C2    . DG  C  3  8   ? -15.251 18.877  43.023  1.00 77.78  ? 708 DG  T C2    1 
ATOM   8052  N  N2    . DG  C  3  8   ? -14.681 19.579  44.012  1.00 72.38  ? 708 DG  T N2    1 
ATOM   8053  N  N3    . DG  C  3  8   ? -14.672 17.765  42.585  1.00 78.10  ? 708 DG  T N3    1 
ATOM   8054  C  C4    . DG  C  3  8   ? -15.384 17.186  41.588  1.00 74.76  ? 708 DG  T C4    1 
ATOM   8055  P  P     . DC  C  3  9   ? -15.427 10.982  43.173  1.00 77.57  ? 709 DC  T P     1 
ATOM   8056  O  OP1   . DC  C  3  9   ? -14.904 9.616   43.400  1.00 80.25  ? 709 DC  T OP1   1 
ATOM   8057  O  OP2   . DC  C  3  9   ? -16.633 11.188  42.338  1.00 79.42  ? 709 DC  T OP2   1 
ATOM   8058  O  "O5'" . DC  C  3  9   ? -15.653 11.655  44.605  1.00 70.77  ? 709 DC  T "O5'" 1 
ATOM   8059  C  "C5'" . DC  C  3  9   ? -14.568 11.742  45.516  1.00 69.43  ? 709 DC  T "C5'" 1 
ATOM   8060  C  "C4'" . DC  C  3  9   ? -14.718 12.946  46.426  1.00 67.53  ? 709 DC  T "C4'" 1 
ATOM   8061  O  "O4'" . DC  C  3  9   ? -14.827 14.123  45.575  1.00 74.28  ? 709 DC  T "O4'" 1 
ATOM   8062  C  "C3'" . DC  C  3  9   ? -16.012 13.006  47.209  1.00 67.99  ? 709 DC  T "C3'" 1 
ATOM   8063  O  "O3'" . DC  C  3  9   ? -15.922 12.200  48.373  1.00 68.24  ? 709 DC  T "O3'" 1 
ATOM   8064  C  "C2'" . DC  C  3  9   ? -16.081 14.488  47.556  1.00 66.56  ? 709 DC  T "C2'" 1 
ATOM   8065  C  "C1'" . DC  C  3  9   ? -15.535 15.133  46.280  1.00 74.57  ? 709 DC  T "C1'" 1 
ATOM   8066  N  N1    . DC  C  3  9   ? -16.604 15.686  45.392  1.00 77.54  ? 709 DC  T N1    1 
ATOM   8067  C  C2    . DC  C  3  9   ? -17.169 16.934  45.684  1.00 83.86  ? 709 DC  T C2    1 
ATOM   8068  O  O2    . DC  C  3  9   ? -16.766 17.563  46.671  1.00 90.80  ? 709 DC  T O2    1 
ATOM   8069  N  N3    . DC  C  3  9   ? -18.142 17.421  44.873  1.00 85.69  ? 709 DC  T N3    1 
ATOM   8070  C  C4    . DC  C  3  9   ? -18.549 16.713  43.819  1.00 82.57  ? 709 DC  T C4    1 
ATOM   8071  N  N4    . DC  C  3  9   ? -19.511 17.233  43.048  1.00 75.25  ? 709 DC  T N4    1 
ATOM   8072  C  C5    . DC  C  3  9   ? -17.988 15.438  43.508  1.00 80.33  ? 709 DC  T C5    1 
ATOM   8073  C  C6    . DC  C  3  9   ? -17.029 14.968  44.314  1.00 76.02  ? 709 DC  T C6    1 
ATOM   8074  P  P     . DG  C  3  10  ? -17.258 11.600  49.035  1.00 77.23  ? 710 DG  T P     1 
ATOM   8075  O  OP1   . DG  C  3  10  ? -16.851 10.610  50.056  1.00 70.47  ? 710 DG  T OP1   1 
ATOM   8076  O  OP2   . DG  C  3  10  ? -18.160 11.197  47.933  1.00 77.31  ? 710 DG  T OP2   1 
ATOM   8077  O  "O5'" . DG  C  3  10  ? -17.903 12.851  49.796  1.00 85.07  ? 710 DG  T "O5'" 1 
ATOM   8078  C  "C5'" . DG  C  3  10  ? -17.172 13.513  50.822  1.00 77.90  ? 710 DG  T "C5'" 1 
ATOM   8079  C  "C4'" . DG  C  3  10  ? -17.883 14.781  51.260  1.00 75.37  ? 710 DG  T "C4'" 1 
ATOM   8080  O  "O4'" . DG  C  3  10  ? -17.852 15.750  50.184  1.00 73.63  ? 710 DG  T "O4'" 1 
ATOM   8081  C  "C3'" . DG  C  3  10  ? -19.354 14.608  51.592  1.00 76.82  ? 710 DG  T "C3'" 1 
ATOM   8082  O  "O3'" . DG  C  3  10  ? -19.502 14.221  52.955  1.00 76.06  ? 710 DG  T "O3'" 1 
ATOM   8083  C  "C2'" . DG  C  3  10  ? -19.907 16.007  51.343  1.00 78.78  ? 710 DG  T "C2'" 1 
ATOM   8084  C  "C1'" . DG  C  3  10  ? -19.070 16.476  50.152  1.00 80.19  ? 710 DG  T "C1'" 1 
ATOM   8085  N  N9    . DG  C  3  10  ? -19.711 16.252  48.858  1.00 81.39  ? 710 DG  T N9    1 
ATOM   8086  C  C8    . DG  C  3  10  ? -19.430 15.253  47.958  1.00 85.63  ? 710 DG  T C8    1 
ATOM   8087  N  N7    . DG  C  3  10  ? -20.163 15.303  46.880  1.00 89.65  ? 710 DG  T N7    1 
ATOM   8088  C  C5    . DG  C  3  10  ? -20.984 16.406  47.078  1.00 89.28  ? 710 DG  T C5    1 
ATOM   8089  C  C6    . DG  C  3  10  ? -21.989 16.956  46.246  1.00 92.56  ? 710 DG  T C6    1 
ATOM   8090  O  O6    . DG  C  3  10  ? -22.365 16.563  45.132  1.00 91.04  ? 710 DG  T O6    1 
ATOM   8091  N  N1    . DG  C  3  10  ? -22.580 18.076  46.825  1.00 90.03  ? 710 DG  T N1    1 
ATOM   8092  C  C2    . DG  C  3  10  ? -22.242 18.598  48.052  1.00 79.94  ? 710 DG  T C2    1 
ATOM   8093  N  N2    . DG  C  3  10  ? -22.924 19.685  48.444  1.00 83.53  ? 710 DG  T N2    1 
ATOM   8094  N  N3    . DG  C  3  10  ? -21.302 18.093  48.840  1.00 73.11  ? 710 DG  T N3    1 
ATOM   8095  C  C4    . DG  C  3  10  ? -20.717 17.001  48.291  1.00 79.39  ? 710 DG  T C4    1 
ATOM   8096  P  P     . DC  C  3  11  ? -20.738 13.298  53.402  1.00 79.04  ? 711 DC  T P     1 
ATOM   8097  O  OP1   . DC  C  3  11  ? -20.506 12.869  54.799  1.00 87.84  ? 711 DC  T OP1   1 
ATOM   8098  O  OP2   . DC  C  3  11  ? -20.955 12.286  52.344  1.00 75.40  ? 711 DC  T OP2   1 
ATOM   8099  O  "O5'" . DC  C  3  11  ? -21.981 14.302  53.411  1.00 77.50  ? 711 DC  T "O5'" 1 
ATOM   8100  C  "C5'" . DC  C  3  11  ? -22.084 15.291  54.424  1.00 74.47  ? 711 DC  T "C5'" 1 
ATOM   8101  C  "C4'" . DC  C  3  11  ? -23.299 16.167  54.194  1.00 75.04  ? 711 DC  T "C4'" 1 
ATOM   8102  O  "O4'" . DC  C  3  11  ? -23.121 16.920  52.968  1.00 76.34  ? 711 DC  T "O4'" 1 
ATOM   8103  C  "C3'" . DC  C  3  11  ? -24.601 15.413  53.993  1.00 86.19  ? 711 DC  T "C3'" 1 
ATOM   8104  O  "O3'" . DC  C  3  11  ? -25.194 15.053  55.268  1.00 94.95  ? 711 DC  T "O3'" 1 
ATOM   8105  C  "C2'" . DC  C  3  11  ? -25.430 16.421  53.203  1.00 86.59  ? 711 DC  T "C2'" 1 
ATOM   8106  C  "C1'" . DC  C  3  11  ? -24.370 17.072  52.311  1.00 84.27  ? 711 DC  T "C1'" 1 
ATOM   8107  N  N1    . DC  C  3  11  ? -24.279 16.455  50.954  1.00 84.13  ? 711 DC  T N1    1 
ATOM   8108  C  C2    . DC  C  3  11  ? -25.027 16.990  49.899  1.00 85.41  ? 711 DC  T C2    1 
ATOM   8109  O  O2    . DC  C  3  11  ? -25.747 17.974  50.108  1.00 88.64  ? 711 DC  T O2    1 
ATOM   8110  N  N3    . DC  C  3  11  ? -24.938 16.414  48.675  1.00 87.86  ? 711 DC  T N3    1 
ATOM   8111  C  C4    . DC  C  3  11  ? -24.149 15.353  48.491  1.00 79.85  ? 711 DC  T C4    1 
ATOM   8112  N  N4    . DC  C  3  11  ? -24.093 14.818  47.266  1.00 72.69  ? 711 DC  T N4    1 
ATOM   8113  C  C5    . DC  C  3  11  ? -23.383 14.793  49.554  1.00 77.13  ? 711 DC  T C5    1 
ATOM   8114  C  C6    . DC  C  3  11  ? -23.477 15.369  50.755  1.00 82.70  ? 711 DC  T C6    1 
ATOM   8115  P  P     . DC  C  3  12  ? -26.115 16.072  56.112  1.00 90.60  ? 712 DC  T P     1 
ATOM   8116  O  OP1   . DC  C  3  12  ? -25.517 17.425  56.105  1.00 89.34  ? 712 DC  T OP1   1 
ATOM   8117  O  OP2   . DC  C  3  12  ? -26.361 15.410  57.412  1.00 84.38  ? 712 DC  T OP2   1 
ATOM   8118  O  "O5'" . DC  C  3  12  ? -27.503 16.113  55.315  1.00 84.85  ? 712 DC  T "O5'" 1 
ATOM   8119  C  "C5'" . DC  C  3  12  ? -28.196 17.347  55.169  1.00 86.86  ? 712 DC  T "C5'" 1 
ATOM   8120  C  "C4'" . DC  C  3  12  ? -29.278 17.244  54.107  1.00 81.71  ? 712 DC  T "C4'" 1 
ATOM   8121  O  "O4'" . DC  C  3  12  ? -28.683 16.935  52.819  1.00 80.12  ? 712 DC  T "O4'" 1 
ATOM   8122  C  "C3'" . DC  C  3  12  ? -30.337 16.160  54.359  1.00 79.81  ? 712 DC  T "C3'" 1 
ATOM   8123  O  "O3'" . DC  C  3  12  ? -31.642 16.733  54.315  1.00 85.55  ? 712 DC  T "O3'" 1 
ATOM   8124  C  "C2'" . DC  C  3  12  ? -30.121 15.166  53.214  1.00 80.88  ? 712 DC  T "C2'" 1 
ATOM   8125  C  "C1'" . DC  C  3  12  ? -29.549 16.067  52.136  1.00 81.85  ? 712 DC  T "C1'" 1 
ATOM   8126  N  N1    . DC  C  3  12  ? -28.784 15.336  51.082  1.00 86.52  ? 712 DC  T N1    1 
ATOM   8127  C  C2    . DC  C  3  12  ? -29.086 15.558  49.734  1.00 87.53  ? 712 DC  T C2    1 
ATOM   8128  O  O2    . DC  C  3  12  ? -29.975 16.366  49.440  1.00 92.02  ? 712 DC  T O2    1 
ATOM   8129  N  N3    . DC  C  3  12  ? -28.390 14.883  48.785  1.00 88.74  ? 712 DC  T N3    1 
ATOM   8130  C  C4    . DC  C  3  12  ? -27.439 14.020  49.143  1.00 89.87  ? 712 DC  T C4    1 
ATOM   8131  N  N4    . DC  C  3  12  ? -26.780 13.378  48.171  1.00 95.42  ? 712 DC  T N4    1 
ATOM   8132  C  C5    . DC  C  3  12  ? -27.120 13.776  50.512  1.00 83.43  ? 712 DC  T C5    1 
ATOM   8133  C  C6    . DC  C  3  12  ? -27.813 14.447  51.439  1.00 83.70  ? 712 DC  T C6    1 
ATOM   8134  P  P     . DC  C  3  13  ? -32.913 15.903  54.846  1.00 92.62  ? 713 DC  T P     1 
ATOM   8135  O  OP1   . DC  C  3  13  ? -33.752 16.832  55.635  1.00 95.41  ? 713 DC  T OP1   1 
ATOM   8136  O  OP2   . DC  C  3  13  ? -32.417 14.655  55.468  1.00 89.09  ? 713 DC  T OP2   1 
ATOM   8137  O  "O5'" . DC  C  3  13  ? -33.704 15.513  53.510  1.00 96.70  ? 713 DC  T "O5'" 1 
ATOM   8138  C  "C5'" . DC  C  3  13  ? -34.348 16.529  52.745  1.00 96.37  ? 713 DC  T "C5'" 1 
ATOM   8139  C  "C4'" . DC  C  3  13  ? -34.557 16.083  51.307  1.00 100.10 ? 713 DC  T "C4'" 1 
ATOM   8140  O  "O4'" . DC  C  3  13  ? -33.289 15.731  50.723  1.00 105.72 ? 713 DC  T "O4'" 1 
ATOM   8141  C  "C3'" . DC  C  3  13  ? -35.410 14.840  51.132  1.00 101.22 ? 713 DC  T "C3'" 1 
ATOM   8142  O  "O3'" . DC  C  3  13  ? -36.790 15.199  51.073  1.00 105.99 ? 713 DC  T "O3'" 1 
ATOM   8143  C  "C2'" . DC  C  3  13  ? -34.926 14.277  49.791  1.00 101.88 ? 713 DC  T "C2'" 1 
ATOM   8144  C  "C1'" . DC  C  3  13  ? -33.511 14.852  49.639  1.00 103.10 ? 713 DC  T "C1'" 1 
ATOM   8145  N  N1    . DC  C  3  13  ? -32.441 13.809  49.634  1.00 101.20 ? 713 DC  T N1    1 
ATOM   8146  C  C2    . DC  C  3  13  ? -32.185 13.089  48.460  1.00 103.85 ? 713 DC  T C2    1 
ATOM   8147  O  O2    . DC  C  3  13  ? -32.849 13.334  47.445  1.00 102.84 ? 713 DC  T O2    1 
ATOM   8148  N  N3    . DC  C  3  13  ? -31.213 12.143  48.469  1.00 101.75 ? 713 DC  T N3    1 
ATOM   8149  C  C4    . DC  C  3  13  ? -30.519 11.909  49.585  1.00 88.93  ? 713 DC  T C4    1 
ATOM   8150  N  N4    . DC  C  3  13  ? -29.570 10.966  49.545  1.00 86.79  ? 713 DC  T N4    1 
ATOM   8151  C  C5    . DC  C  3  13  ? -30.767 12.630  50.790  1.00 80.01  ? 713 DC  T C5    1 
ATOM   8152  C  C6    . DC  C  3  13  ? -31.729 13.560  50.770  1.00 90.41  ? 713 DC  T C6    1 
ATOM   8153  P  P     . DG  C  3  14  ? -37.929 14.090  51.314  1.00 106.86 ? 714 DG  T P     1 
ATOM   8154  O  OP1   . DG  C  3  14  ? -38.784 14.562  52.425  1.00 104.63 ? 714 DG  T OP1   1 
ATOM   8155  O  OP2   . DG  C  3  14  ? -37.269 12.770  51.408  1.00 110.49 ? 714 DG  T OP2   1 
ATOM   8156  O  "O5'" . DG  C  3  14  ? -38.815 14.141  49.981  1.00 113.18 ? 714 DG  T "O5'" 1 
ATOM   8157  C  "C5'" . DG  C  3  14  ? -38.289 14.720  48.789  1.00 118.26 ? 714 DG  T "C5'" 1 
ATOM   8158  C  "C4'" . DG  C  3  14  ? -38.284 13.713  47.652  1.00 119.03 ? 714 DG  T "C4'" 1 
ATOM   8159  O  "O4'" . DG  C  3  14  ? -37.004 13.076  47.496  1.00 111.12 ? 714 DG  T "O4'" 1 
ATOM   8160  C  "C3'" . DG  C  3  14  ? -39.290 12.567  47.793  1.00 119.85 ? 714 DG  T "C3'" 1 
ATOM   8161  O  "O3'" . DG  C  3  14  ? -39.842 12.251  46.520  1.00 122.62 ? 714 DG  T "O3'" 1 
ATOM   8162  C  "C2'" . DG  C  3  14  ? -38.419 11.429  48.314  1.00 115.95 ? 714 DG  T "C2'" 1 
ATOM   8163  C  "C1'" . DG  C  3  14  ? -37.148 11.674  47.524  1.00 110.19 ? 714 DG  T "C1'" 1 
ATOM   8164  N  N9    . DG  C  3  14  ? -35.954 11.079  48.122  1.00 104.72 ? 714 DG  T N9    1 
ATOM   8165  C  C8    . DG  C  3  14  ? -35.615 11.057  49.453  1.00 100.06 ? 714 DG  T C8    1 
ATOM   8166  N  N7    . DG  C  3  14  ? -34.485 10.450  49.691  1.00 102.47 ? 714 DG  T N7    1 
ATOM   8167  C  C5    . DG  C  3  14  ? -34.046 10.039  48.439  1.00 106.24 ? 714 DG  T C5    1 
ATOM   8168  C  C6    . DG  C  3  14  ? -32.878 9.330   48.068  1.00 107.92 ? 714 DG  T C6    1 
ATOM   8169  O  O6    . DG  C  3  14  ? -31.969 8.911   48.799  1.00 104.88 ? 714 DG  T O6    1 
ATOM   8170  N  N1    . DG  C  3  14  ? -32.819 9.119   46.692  1.00 110.25 ? 714 DG  T N1    1 
ATOM   8171  C  C2    . DG  C  3  14  ? -33.767 9.538   45.790  1.00 112.95 ? 714 DG  T C2    1 
ATOM   8172  N  N2    . DG  C  3  14  ? -33.536 9.240   44.503  1.00 116.06 ? 714 DG  T N2    1 
ATOM   8173  N  N3    . DG  C  3  14  ? -34.867 10.203  46.124  1.00 112.42 ? 714 DG  T N3    1 
ATOM   8174  C  C4    . DG  C  3  14  ? -34.940 10.418  47.462  1.00 108.02 ? 714 DG  T C4    1 
ATOM   8175  P  P     . DA  C  3  15  ? -41.219 11.429  46.409  1.00 118.08 ? 715 DA  T P     1 
ATOM   8176  O  OP1   . DA  C  3  15  ? -42.310 12.410  46.217  1.00 114.83 ? 715 DA  T OP1   1 
ATOM   8177  O  OP2   . DA  C  3  15  ? -41.282 10.472  47.536  1.00 112.44 ? 715 DA  T OP2   1 
ATOM   8178  O  "O5'" . DA  C  3  15  ? -41.056 10.589  45.057  1.00 118.32 ? 715 DA  T "O5'" 1 
ATOM   8179  C  "C5'" . DA  C  3  15  ? -40.139 11.017  44.054  1.00 120.27 ? 715 DA  T "C5'" 1 
ATOM   8180  C  "C4'" . DA  C  3  15  ? -39.470 9.823   43.392  1.00 123.76 ? 715 DA  T "C4'" 1 
ATOM   8181  O  "O4'" . DA  C  3  15  ? -38.283 9.449   44.146  1.00 124.41 ? 715 DA  T "O4'" 1 
ATOM   8182  C  "C3'" . DA  C  3  15  ? -40.331 8.562   43.310  1.00 130.57 ? 715 DA  T "C3'" 1 
ATOM   8183  O  "O3'" . DA  C  3  15  ? -40.089 7.890   42.080  1.00 139.35 ? 715 DA  T "O3'" 1 
ATOM   8184  C  "C2'" . DA  C  3  15  ? -39.835 7.742   44.496  1.00 125.51 ? 715 DA  T "C2'" 1 
ATOM   8185  C  "C1'" . DA  C  3  15  ? -38.356 8.083   44.490  1.00 122.22 ? 715 DA  T "C1'" 1 
ATOM   8186  N  N9    . DA  C  3  15  ? -37.712 7.892   45.786  1.00 119.81 ? 715 DA  T N9    1 
ATOM   8187  C  C8    . DA  C  3  15  ? -38.170 8.314   47.001  1.00 119.83 ? 715 DA  T C8    1 
ATOM   8188  N  N7    . DA  C  3  15  ? -37.383 8.000   48.002  1.00 117.98 ? 715 DA  T N7    1 
ATOM   8189  C  C5    . DA  C  3  15  ? -36.336 7.323   47.402  1.00 114.75 ? 715 DA  T C5    1 
ATOM   8190  C  C6    . DA  C  3  15  ? -35.168 6.728   47.921  1.00 108.14 ? 715 DA  T C6    1 
ATOM   8191  N  N6    . DA  C  3  15  ? -34.859 6.726   49.221  1.00 107.17 ? 715 DA  T N6    1 
ATOM   8192  N  N1    . DA  C  3  15  ? -34.329 6.133   47.048  1.00 106.59 ? 715 DA  T N1    1 
ATOM   8193  C  C2    . DA  C  3  15  ? -34.643 6.137   45.747  1.00 113.70 ? 715 DA  T C2    1 
ATOM   8194  N  N3    . DA  C  3  15  ? -35.707 6.662   45.143  1.00 118.46 ? 715 DA  T N3    1 
ATOM   8195  C  C4    . DA  C  3  15  ? -36.522 7.246   46.035  1.00 118.58 ? 715 DA  T C4    1 
ATOM   8196  P  P     . DA  C  3  16  ? -41.125 6.788   41.534  1.00 145.55 ? 716 DA  T P     1 
ATOM   8197  O  OP1   . DA  C  3  16  ? -42.047 7.467   40.599  1.00 146.99 ? 716 DA  T OP1   1 
ATOM   8198  O  OP2   . DA  C  3  16  ? -41.673 6.039   42.687  1.00 142.56 ? 716 DA  T OP2   1 
ATOM   8199  O  "O5'" . DA  C  3  16  ? -40.206 5.796   40.683  1.00 141.69 ? 716 DA  T "O5'" 1 
ATOM   8200  C  "C5'" . DA  C  3  16  ? -38.806 6.029   40.589  1.00 131.44 ? 716 DA  T "C5'" 1 
ATOM   8201  C  "C4'" . DA  C  3  16  ? -38.030 4.743   40.814  1.00 125.59 ? 716 DA  T "C4'" 1 
ATOM   8202  O  "O4'" . DA  C  3  16  ? -37.522 4.815   42.155  1.00 124.97 ? 716 DA  T "O4'" 1 
ATOM   8203  C  "C3'" . DA  C  3  16  ? -38.858 3.460   40.709  1.00 124.07 ? 716 DA  T "C3'" 1 
ATOM   8204  O  "O3'" . DA  C  3  16  ? -38.155 2.494   39.935  1.00 126.41 ? 716 DA  T "O3'" 1 
ATOM   8205  C  "C2'" . DA  C  3  16  ? -39.018 3.018   42.164  1.00 122.88 ? 716 DA  T "C2'" 1 
ATOM   8206  C  "C1'" . DA  C  3  16  ? -37.770 3.593   42.811  1.00 123.30 ? 716 DA  T "C1'" 1 
ATOM   8207  N  N9    . DA  C  3  16  ? -37.930 3.862   44.237  1.00 124.45 ? 716 DA  T N9    1 
ATOM   8208  C  C8    . DA  C  3  16  ? -39.004 4.448   44.847  1.00 124.15 ? 716 DA  T C8    1 
ATOM   8209  N  N7    . DA  C  3  16  ? -38.876 4.563   46.149  1.00 115.12 ? 716 DA  T N7    1 
ATOM   8210  C  C5    . DA  C  3  16  ? -37.632 4.016   46.410  1.00 110.18 ? 716 DA  T C5    1 
ATOM   8211  C  C6    . DA  C  3  16  ? -36.906 3.837   47.604  1.00 102.18 ? 716 DA  T C6    1 
ATOM   8212  N  N6    . DA  C  3  16  ? -37.360 4.211   48.804  1.00 93.71  ? 716 DA  T N6    1 
ATOM   8213  N  N1    . DA  C  3  16  ? -35.692 3.255   47.515  1.00 106.62 ? 716 DA  T N1    1 
ATOM   8214  C  C2    . DA  C  3  16  ? -35.242 2.881   46.312  1.00 112.03 ? 716 DA  T C2    1 
ATOM   8215  N  N3    . DA  C  3  16  ? -35.831 2.996   45.123  1.00 115.58 ? 716 DA  T N3    1 
ATOM   8216  C  C4    . DA  C  3  16  ? -37.035 3.578   45.243  1.00 117.70 ? 716 DA  T C4    1 
ATOM   8217  P  P     . DC  C  3  17  ? -38.770 1.029   39.688  1.00 137.46 ? 717 DC  T P     1 
ATOM   8218  O  OP1   . DC  C  3  17  ? -38.441 0.649   38.298  1.00 143.50 ? 717 DC  T OP1   1 
ATOM   8219  O  OP2   . DC  C  3  17  ? -40.183 1.009   40.129  1.00 142.09 ? 717 DC  T OP2   1 
ATOM   8220  O  "O5'" . DC  C  3  17  ? -37.925 0.100   40.676  1.00 136.44 ? 717 DC  T "O5'" 1 
ATOM   8221  C  "C5'" . DC  C  3  17  ? -36.504 0.136   40.629  1.00 136.34 ? 717 DC  T "C5'" 1 
ATOM   8222  C  "C4'" . DC  C  3  17  ? -35.903 -0.736  41.715  1.00 132.37 ? 717 DC  T "C4'" 1 
ATOM   8223  O  "O4'" . DC  C  3  17  ? -36.070 -0.095  43.006  1.00 125.18 ? 717 DC  T "O4'" 1 
ATOM   8224  C  "C3'" . DC  C  3  17  ? -36.521 -2.132  41.842  1.00 130.30 ? 717 DC  T "C3'" 1 
ATOM   8225  O  "O3'" . DC  C  3  17  ? -35.491 -3.112  41.899  1.00 128.92 ? 717 DC  T "O3'" 1 
ATOM   8226  C  "C2'" . DC  C  3  17  ? -37.309 -2.058  43.151  1.00 125.49 ? 717 DC  T "C2'" 1 
ATOM   8227  C  "C1'" . DC  C  3  17  ? -36.499 -1.050  43.944  1.00 121.20 ? 717 DC  T "C1'" 1 
ATOM   8228  N  N1    . DC  C  3  17  ? -37.289 -0.358  44.998  1.00 116.40 ? 717 DC  T N1    1 
ATOM   8229  C  C2    . DC  C  3  17  ? -36.830 -0.355  46.319  1.00 111.21 ? 717 DC  T C2    1 
ATOM   8230  O  O2    . DC  C  3  17  ? -35.767 -0.927  46.590  1.00 116.57 ? 717 DC  T O2    1 
ATOM   8231  N  N3    . DC  C  3  17  ? -37.564 0.278   47.267  1.00 98.19  ? 717 DC  T N3    1 
ATOM   8232  C  C4    . DC  C  3  17  ? -38.706 0.883   46.934  1.00 96.94  ? 717 DC  T C4    1 
ATOM   8233  N  N4    . DC  C  3  17  ? -39.395 1.495   47.903  1.00 89.48  ? 717 DC  T N4    1 
ATOM   8234  C  C5    . DC  C  3  17  ? -39.190 0.889   45.593  1.00 106.78 ? 717 DC  T C5    1 
ATOM   8235  C  C6    . DC  C  3  17  ? -38.458 0.262   44.668  1.00 114.38 ? 717 DC  T C6    1 
ATOM   8236  P  P     . DA  C  3  18  ? -35.849 -4.678  41.978  1.00 133.22 ? 718 DA  T P     1 
ATOM   8237  O  OP1   . DA  C  3  18  ? -34.964 -5.381  41.025  1.00 140.53 ? 718 DA  T OP1   1 
ATOM   8238  O  OP2   . DA  C  3  18  ? -37.315 -4.846  41.864  1.00 130.50 ? 718 DA  T OP2   1 
ATOM   8239  O  "O5'" . DA  C  3  18  ? -35.417 -5.086  43.461  1.00 125.84 ? 718 DA  T "O5'" 1 
ATOM   8240  C  "C5'" . DA  C  3  18  ? -34.065 -4.925  43.874  1.00 121.30 ? 718 DA  T "C5'" 1 
ATOM   8241  C  "C4'" . DA  C  3  18  ? -33.834 -5.552  45.237  1.00 117.09 ? 718 DA  T "C4'" 1 
ATOM   8242  O  "O4'" . DA  C  3  18  ? -34.464 -4.695  46.239  1.00 117.48 ? 718 DA  T "O4'" 1 
ATOM   8243  C  "C3'" . DA  C  3  18  ? -34.429 -6.944  45.418  1.00 115.91 ? 718 DA  T "C3'" 1 
ATOM   8244  O  "O3'" . DA  C  3  18  ? -33.566 -7.743  46.214  1.00 113.75 ? 718 DA  T "O3'" 1 
ATOM   8245  C  "C2'" . DA  C  3  18  ? -35.755 -6.669  46.124  1.00 118.14 ? 718 DA  T "C2'" 1 
ATOM   8246  C  "C1'" . DA  C  3  18  ? -35.432 -5.432  46.956  1.00 114.96 ? 718 DA  T "C1'" 1 
ATOM   8247  N  N9    . DA  C  3  18  ? -36.586 -4.567  47.172  1.00 109.99 ? 718 DA  T N9    1 
ATOM   8248  C  C8    . DA  C  3  18  ? -37.490 -4.151  46.234  1.00 112.18 ? 718 DA  T C8    1 
ATOM   8249  N  N7    . DA  C  3  18  ? -38.429 -3.371  46.714  1.00 107.68 ? 718 DA  T N7    1 
ATOM   8250  C  C5    . DA  C  3  18  ? -38.118 -3.266  48.059  1.00 103.12 ? 718 DA  T C5    1 
ATOM   8251  C  C6    . DA  C  3  18  ? -38.728 -2.575  49.123  1.00 94.53  ? 718 DA  T C6    1 
ATOM   8252  N  N6    . DA  C  3  18  ? -39.830 -1.831  48.981  1.00 103.45 ? 718 DA  T N6    1 
ATOM   8253  N  N1    . DA  C  3  18  ? -38.164 -2.680  50.344  1.00 78.04  ? 718 DA  T N1    1 
ATOM   8254  C  C2    . DA  C  3  18  ? -37.062 -3.427  50.482  1.00 83.55  ? 718 DA  T C2    1 
ATOM   8255  N  N3    . DA  C  3  18  ? -36.398 -4.120  49.559  1.00 97.59  ? 718 DA  T N3    1 
ATOM   8256  C  C4    . DA  C  3  18  ? -36.984 -3.997  48.358  1.00 104.52 ? 718 DA  T C4    1 
ATOM   8257  P  P     . DG  C  3  19  ? -33.656 -9.346  46.150  1.00 128.60 ? 719 DG  T P     1 
ATOM   8258  O  OP1   . DG  C  3  19  ? -32.292 -9.872  45.922  1.00 138.48 ? 719 DG  T OP1   1 
ATOM   8259  O  OP2   . DG  C  3  19  ? -34.742 -9.699  45.209  1.00 136.69 ? 719 DG  T OP2   1 
ATOM   8260  O  "O5'" . DG  C  3  19  ? -34.134 -9.752  47.619  1.00 122.01 ? 719 DG  T "O5'" 1 
ATOM   8261  C  "C5'" . DG  C  3  19  ? -33.738 -8.964  48.732  1.00 111.59 ? 719 DG  T "C5'" 1 
ATOM   8262  C  "C4'" . DG  C  3  19  ? -34.695 -9.149  49.894  1.00 108.71 ? 719 DG  T "C4'" 1 
ATOM   8263  O  "O4'" . DG  C  3  19  ? -35.658 -8.057  49.926  1.00 106.53 ? 719 DG  T "O4'" 1 
ATOM   8264  C  "C3'" . DG  C  3  19  ? -35.534 -10.434 49.851  1.00 116.01 ? 719 DG  T "C3'" 1 
ATOM   8265  O  "O3'" . DG  C  3  19  ? -35.697 -10.926 51.164  1.00 116.81 ? 719 DG  T "O3'" 1 
ATOM   8266  C  "C2'" . DG  C  3  19  ? -36.864 -9.924  49.314  1.00 118.29 ? 719 DG  T "C2'" 1 
ATOM   8267  C  "C1'" . DG  C  3  19  ? -36.939 -8.618  50.074  1.00 108.69 ? 719 DG  T "C1'" 1 
ATOM   8268  N  N9    . DG  C  3  19  ? -37.950 -7.685  49.590  1.00 100.15 ? 719 DG  T N9    1 
ATOM   8269  C  C8    . DG  C  3  19  ? -38.361 -7.493  48.293  1.00 101.92 ? 719 DG  T C8    1 
ATOM   8270  N  N7    . DG  C  3  19  ? -39.296 -6.589  48.175  1.00 98.87  ? 719 DG  T N7    1 
ATOM   8271  C  C5    . DG  C  3  19  ? -39.521 -6.161  49.478  1.00 92.84  ? 719 DG  T C5    1 
ATOM   8272  C  C6    . DG  C  3  19  ? -40.423 -5.192  49.981  1.00 93.60  ? 719 DG  T C6    1 
ATOM   8273  O  O6    . DG  C  3  19  ? -41.230 -4.495  49.351  1.00 104.16 ? 719 DG  T O6    1 
ATOM   8274  N  N1    . DG  C  3  19  ? -40.326 -5.067  51.365  1.00 82.16  ? 719 DG  T N1    1 
ATOM   8275  C  C2    . DG  C  3  19  ? -39.467 -5.787  52.161  1.00 80.31  ? 719 DG  T C2    1 
ATOM   8276  N  N2    . DG  C  3  19  ? -39.517 -5.529  53.476  1.00 81.91  ? 719 DG  T N2    1 
ATOM   8277  N  N3    . DG  C  3  19  ? -38.620 -6.696  51.703  1.00 80.93  ? 719 DG  T N3    1 
ATOM   8278  C  C4    . DG  C  3  19  ? -38.701 -6.829  50.358  1.00 90.69  ? 719 DG  T C4    1 
ATOM   8279  P  P     . DG  C  3  20  ? -34.900 -12.224 51.668  1.00 114.96 ? 720 DG  T P     1 
ATOM   8280  O  OP1   . DG  C  3  20  ? -33.464 -11.873 51.738  1.00 116.58 ? 720 DG  T OP1   1 
ATOM   8281  O  OP2   . DG  C  3  20  ? -35.338 -13.379 50.853  1.00 114.29 ? 720 DG  T OP2   1 
ATOM   8282  O  "O5'" . DG  C  3  20  ? -35.423 -12.407 53.167  1.00 112.37 ? 720 DG  T "O5'" 1 
ATOM   8283  C  "C5'" . DG  C  3  20  ? -35.345 -11.314 54.076  1.00 111.01 ? 720 DG  T "C5'" 1 
ATOM   8284  C  "C4'" . DG  C  3  20  ? -36.634 -11.165 54.865  1.00 109.03 ? 720 DG  T "C4'" 1 
ATOM   8285  O  "O4'" . DG  C  3  20  ? -37.516 -10.220 54.205  1.00 112.76 ? 720 DG  T "O4'" 1 
ATOM   8286  C  "C3'" . DG  C  3  20  ? -37.442 -12.454 55.049  1.00 106.28 ? 720 DG  T "C3'" 1 
ATOM   8287  O  "O3'" . DG  C  3  20  ? -37.763 -12.614 56.425  1.00 111.64 ? 720 DG  T "O3'" 1 
ATOM   8288  C  "C2'" . DG  C  3  20  ? -38.697 -12.218 54.197  1.00 104.12 ? 720 DG  T "C2'" 1 
ATOM   8289  C  "C1'" . DG  C  3  20  ? -38.832 -10.706 54.272  1.00 108.63 ? 720 DG  T "C1'" 1 
ATOM   8290  N  N9    . DG  C  3  20  ? -39.603 -10.117 53.177  1.00 110.78 ? 720 DG  T N9    1 
ATOM   8291  C  C8    . DG  C  3  20  ? -39.461 -10.368 51.834  1.00 112.68 ? 720 DG  T C8    1 
ATOM   8292  N  N7    . DG  C  3  20  ? -40.288 -9.688  51.088  1.00 109.60 ? 720 DG  T N7    1 
ATOM   8293  C  C5    . DG  C  3  20  ? -41.024 -8.935  51.994  1.00 104.11 ? 720 DG  T C5    1 
ATOM   8294  C  C6    . DG  C  3  20  ? -42.068 -8.005  51.771  1.00 98.05  ? 720 DG  T C6    1 
ATOM   8295  O  O6    . DG  C  3  20  ? -42.568 -7.654  50.693  1.00 98.41  ? 720 DG  T O6    1 
ATOM   8296  N  N1    . DG  C  3  20  ? -42.541 -7.465  52.965  1.00 95.26  ? 720 DG  T N1    1 
ATOM   8297  C  C2    . DG  C  3  20  ? -42.064 -7.782  54.214  1.00 91.70  ? 720 DG  T C2    1 
ATOM   8298  N  N2    . DG  C  3  20  ? -42.645 -7.156  55.248  1.00 91.22  ? 720 DG  T N2    1 
ATOM   8299  N  N3    . DG  C  3  20  ? -41.085 -8.650  54.437  1.00 92.53  ? 720 DG  T N3    1 
ATOM   8300  C  C4    . DG  C  3  20  ? -40.614 -9.186  53.284  1.00 103.35 ? 720 DG  T C4    1 
ATOM   8301  P  P     . DG  C  3  21  ? -38.049 -14.070 57.040  1.00 127.49 ? 721 DG  T P     1 
ATOM   8302  O  OP1   . DG  C  3  21  ? -36.996 -14.354 58.039  1.00 125.47 ? 721 DG  T OP1   1 
ATOM   8303  O  OP2   . DG  C  3  21  ? -38.268 -15.008 55.917  1.00 131.47 ? 721 DG  T OP2   1 
ATOM   8304  O  "O5'" . DG  C  3  21  ? -39.434 -13.866 57.808  1.00 121.43 ? 721 DG  T "O5'" 1 
ATOM   8305  C  "C5'" . DG  C  3  21  ? -40.330 -12.865 57.354  1.00 112.66 ? 721 DG  T "C5'" 1 
ATOM   8306  C  "C4'" . DG  C  3  21  ? -41.343 -12.500 58.418  1.00 109.33 ? 721 DG  T "C4'" 1 
ATOM   8307  O  "O4'" . DG  C  3  21  ? -42.196 -11.453 57.909  1.00 108.86 ? 721 DG  T "O4'" 1 
ATOM   8308  C  "C3'" . DG  C  3  21  ? -42.300 -13.612 58.787  1.00 110.73 ? 721 DG  T "C3'" 1 
ATOM   8309  O  "O3'" . DG  C  3  21  ? -42.886 -13.348 60.057  1.00 112.43 ? 721 DG  T "O3'" 1 
ATOM   8310  C  "C2'" . DG  C  3  21  ? -43.330 -13.528 57.662  1.00 112.62 ? 721 DG  T "C2'" 1 
ATOM   8311  C  "C1'" . DG  C  3  21  ? -43.356 -12.028 57.335  1.00 112.26 ? 721 DG  T "C1'" 1 
ATOM   8312  N  N9    . DG  C  3  21  ? -43.353 -11.745 55.899  1.00 111.57 ? 721 DG  T N9    1 
ATOM   8313  C  C8    . DG  C  3  21  ? -42.552 -12.326 54.944  1.00 107.15 ? 721 DG  T C8    1 
ATOM   8314  N  N7    . DG  C  3  21  ? -42.770 -11.878 53.739  1.00 105.36 ? 721 DG  T N7    1 
ATOM   8315  C  C5    . DG  C  3  21  ? -43.781 -10.941 53.902  1.00 106.25 ? 721 DG  T C5    1 
ATOM   8316  C  C6    . DG  C  3  21  ? -44.432 -10.127 52.943  1.00 103.01 ? 721 DG  T C6    1 
ATOM   8317  O  O6    . DG  C  3  21  ? -44.236 -10.076 51.720  1.00 96.22  ? 721 DG  T O6    1 
ATOM   8318  N  N1    . DG  C  3  21  ? -45.400 -9.315  53.529  1.00 104.25 ? 721 DG  T N1    1 
ATOM   8319  C  C2    . DG  C  3  21  ? -45.701 -9.291  54.871  1.00 100.99 ? 721 DG  T C2    1 
ATOM   8320  N  N2    . DG  C  3  21  ? -46.667 -8.441  55.249  1.00 97.75  ? 721 DG  T N2    1 
ATOM   8321  N  N3    . DG  C  3  21  ? -45.098 -10.049 55.780  1.00 103.12 ? 721 DG  T N3    1 
ATOM   8322  C  C4    . DG  C  3  21  ? -44.152 -10.846 55.226  1.00 108.22 ? 721 DG  T C4    1 
ATOM   8323  P  P     . DA  C  3  22  ? -44.041 -14.308 60.629  1.00 127.34 ? 722 DA  T P     1 
ATOM   8324  O  OP1   . DA  C  3  22  ? -44.096 -14.146 62.096  1.00 127.57 ? 722 DA  T OP1   1 
ATOM   8325  O  OP2   . DA  C  3  22  ? -43.850 -15.653 60.043  1.00 129.59 ? 722 DA  T OP2   1 
ATOM   8326  O  "O5'" . DA  C  3  22  ? -45.382 -13.670 60.049  1.00 124.53 ? 722 DA  T "O5'" 1 
ATOM   8327  C  "C5'" . DA  C  3  22  ? -45.694 -12.313 60.324  1.00 106.73 ? 722 DA  T "C5'" 1 
ATOM   8328  C  "C4'" . DA  C  3  22  ? -47.125 -12.006 59.929  1.00 100.01 ? 722 DA  T "C4'" 1 
ATOM   8329  O  "O4'" . DA  C  3  22  ? -47.372 -11.597 58.530  1.00 102.00 ? 722 DA  T "O4'" 1 
ATOM   8330  C  "C3'" . DA  C  3  22  ? -48.108 -13.151 60.152  1.00 103.25 ? 722 DA  T "C3'" 1 
ATOM   8331  O  "O3'" . DA  C  3  22  ? -49.342 -12.645 60.639  1.00 105.23 ? 722 DA  T "O3'" 1 
ATOM   8332  C  "C2'" . DA  C  3  22  ? -48.252 -13.776 58.765  1.00 102.27 ? 722 DA  T "C2'" 1 
ATOM   8333  C  "C1'" . DA  C  3  22  ? -48.119 -12.575 57.837  1.00 108.49 ? 722 DA  T "C1'" 1 
ATOM   8334  N  N9    . DA  C  3  22  ? -47.411 -12.883 56.599  1.00 110.42 ? 722 DA  T N9    1 
ATOM   8335  C  C8    . DA  C  3  22  ? -46.355 -13.738 56.450  1.00 109.32 ? 722 DA  T C8    1 
ATOM   8336  N  N7    . DA  C  3  22  ? -45.909 -13.819 55.220  1.00 102.15 ? 722 DA  T N7    1 
ATOM   8337  C  C5    . DA  C  3  22  ? -46.728 -12.956 54.513  1.00 104.21 ? 722 DA  T C5    1 
ATOM   8338  C  C6    . DA  C  3  22  ? -46.773 -12.592 53.153  1.00 103.38 ? 722 DA  T C6    1 
ATOM   8339  N  N6    . DA  C  3  22  ? -45.935 -13.080 52.234  1.00 104.89 ? 722 DA  T N6    1 
ATOM   8340  N  N1    . DA  C  3  22  ? -47.716 -11.704 52.774  1.00 103.50 ? 722 DA  T N1    1 
ATOM   8341  C  C2    . DA  C  3  22  ? -48.554 -11.217 53.700  1.00 102.43 ? 722 DA  T C2    1 
ATOM   8342  N  N3    . DA  C  3  22  ? -48.608 -11.485 55.004  1.00 104.20 ? 722 DA  T N3    1 
ATOM   8343  C  C4    . DA  C  3  22  ? -47.660 -12.370 55.349  1.00 107.03 ? 722 DA  T C4    1 
ATOM   8344  P  P     . DC  C  3  23  ? -50.489 -13.648 61.150  1.00 121.40 ? 723 DC  T P     1 
ATOM   8345  O  OP1   . DC  C  3  23  ? -51.009 -13.119 62.430  1.00 124.85 ? 723 DC  T OP1   1 
ATOM   8346  O  OP2   . DC  C  3  23  ? -49.968 -15.032 61.090  1.00 127.71 ? 723 DC  T OP2   1 
ATOM   8347  O  "O5'" . DC  C  3  23  ? -51.636 -13.477 60.052  1.00 126.93 ? 723 DC  T "O5'" 1 
ATOM   8348  C  "C5'" . DC  C  3  23  ? -51.965 -12.177 59.587  1.00 122.01 ? 723 DC  T "C5'" 1 
ATOM   8349  C  "C4'" . DC  C  3  23  ? -52.454 -12.218 58.151  1.00 127.42 ? 723 DC  T "C4'" 1 
ATOM   8350  O  "O4'" . DC  C  3  23  ? -51.377 -12.600 57.269  1.00 125.56 ? 723 DC  T "O4'" 1 
ATOM   8351  C  "C3'" . DC  C  3  23  ? -53.588 -13.212 57.879  1.00 135.36 ? 723 DC  T "C3'" 1 
ATOM   8352  O  "O3'" . DC  C  3  23  ? -54.780 -12.504 57.574  1.00 147.18 ? 723 DC  T "O3'" 1 
ATOM   8353  C  "C2'" . DC  C  3  23  ? -53.095 -14.043 56.680  1.00 132.29 ? 723 DC  T "C2'" 1 
ATOM   8354  C  "C1'" . DC  C  3  23  ? -51.946 -13.204 56.141  1.00 127.36 ? 723 DC  T "C1'" 1 
ATOM   8355  N  N1    . DC  C  3  23  ? -50.900 -14.000 55.433  1.00 125.36 ? 723 DC  T N1    1 
ATOM   8356  C  C2    . DC  C  3  23  ? -50.661 -13.772 54.074  1.00 121.09 ? 723 DC  T C2    1 
ATOM   8357  O  O2    . DC  C  3  23  ? -51.321 -12.908 53.483  1.00 119.41 ? 723 DC  T O2    1 
ATOM   8358  N  N3    . DC  C  3  23  ? -49.710 -14.504 53.442  1.00 118.71 ? 723 DC  T N3    1 
ATOM   8359  C  C4    . DC  C  3  23  ? -49.020 -15.426 54.114  1.00 121.22 ? 723 DC  T C4    1 
ATOM   8360  N  N4    . DC  C  3  23  ? -48.092 -16.122 53.449  1.00 114.94 ? 723 DC  T N4    1 
ATOM   8361  C  C5    . DC  C  3  23  ? -49.251 -15.675 55.500  1.00 124.34 ? 723 DC  T C5    1 
ATOM   8362  C  C6    . DC  C  3  23  ? -50.192 -14.948 56.112  1.00 125.93 ? 723 DC  T C6    1 
ATOM   8363  P  P     . DT  C  3  24  ? -56.140 -13.295 57.250  1.00 167.40 ? 724 DT  T P     1 
ATOM   8364  O  OP1   . DT  C  3  24  ? -57.258 -12.476 57.767  1.00 170.71 ? 724 DT  T OP1   1 
ATOM   8365  O  OP2   . DT  C  3  24  ? -55.987 -14.696 57.702  1.00 167.63 ? 724 DT  T OP2   1 
ATOM   8366  O  "O5'" . DT  C  3  24  ? -56.204 -13.291 55.654  1.00 175.10 ? 724 DT  T "O5'" 1 
ATOM   8367  C  "C5'" . DT  C  3  24  ? -56.146 -12.058 54.946  1.00 173.30 ? 724 DT  T "C5'" 1 
ATOM   8368  C  "C4'" . DT  C  3  24  ? -56.391 -12.269 53.462  1.00 175.64 ? 724 DT  T "C4'" 1 
ATOM   8369  O  "O4'" . DT  C  3  24  ? -55.251 -12.946 52.872  1.00 170.85 ? 724 DT  T "O4'" 1 
ATOM   8370  C  "C3'" . DT  C  3  24  ? -57.613 -13.117 53.124  1.00 182.54 ? 724 DT  T "C3'" 1 
ATOM   8371  O  "O3'" . DT  C  3  24  ? -58.253 -12.609 51.960  1.00 188.08 ? 724 DT  T "O3'" 1 
ATOM   8372  C  "C2'" . DT  C  3  24  ? -57.020 -14.504 52.886  1.00 181.10 ? 724 DT  T "C2'" 1 
ATOM   8373  C  "C1'" . DT  C  3  24  ? -55.653 -14.174 52.300  1.00 173.23 ? 724 DT  T "C1'" 1 
ATOM   8374  N  N1    . DT  C  3  24  ? -54.617 -15.195 52.616  1.00 164.97 ? 724 DT  T N1    1 
ATOM   8375  C  C2    . DT  C  3  24  ? -53.657 -15.493 51.678  1.00 159.63 ? 724 DT  T C2    1 
ATOM   8376  O  O2    . DT  C  3  24  ? -53.603 -14.960 50.584  1.00 156.96 ? 724 DT  T O2    1 
ATOM   8377  N  N3    . DT  C  3  24  ? -52.752 -16.444 52.070  1.00 156.39 ? 724 DT  T N3    1 
ATOM   8378  C  C4    . DT  C  3  24  ? -52.713 -17.113 53.280  1.00 155.01 ? 724 DT  T C4    1 
ATOM   8379  O  O4    . DT  C  3  24  ? -51.857 -17.953 53.538  1.00 153.30 ? 724 DT  T O4    1 
ATOM   8380  C  C5    . DT  C  3  24  ? -53.749 -16.753 54.218  1.00 155.41 ? 724 DT  T C5    1 
ATOM   8381  C  C7    . DT  C  3  24  ? -53.811 -17.412 55.565  1.00 151.91 ? 724 DT  T C7    1 
ATOM   8382  C  C6    . DT  C  3  24  ? -54.641 -15.822 53.845  1.00 160.49 ? 724 DT  T C6    1 
ATOM   8383  P  P     . DG  C  3  25  ? -59.666 -13.211 51.488  1.00 196.54 ? 725 DG  T P     1 
ATOM   8384  O  OP1   . DG  C  3  25  ? -60.324 -12.205 50.624  1.00 199.05 ? 725 DG  T OP1   1 
ATOM   8385  O  OP2   . DG  C  3  25  ? -60.363 -13.713 52.692  1.00 195.70 ? 725 DG  T OP2   1 
ATOM   8386  O  "O5'" . DG  C  3  25  ? -59.257 -14.469 50.592  1.00 199.15 ? 725 DG  T "O5'" 1 
ATOM   8387  C  "C5'" . DG  C  3  25  ? -60.257 -15.308 50.035  1.00 203.18 ? 725 DG  T "C5'" 1 
ATOM   8388  C  "C4'" . DG  C  3  25  ? -59.684 -16.125 48.893  1.00 201.70 ? 725 DG  T "C4'" 1 
ATOM   8389  O  "O4'" . DG  C  3  25  ? -58.236 -16.110 48.975  1.00 193.77 ? 725 DG  T "O4'" 1 
ATOM   8390  C  "C3'" . DG  C  3  25  ? -60.075 -17.594 48.897  1.00 203.28 ? 725 DG  T "C3'" 1 
ATOM   8391  O  "O3'" . DG  C  3  25  ? -61.278 -17.776 48.161  1.00 205.46 ? 725 DG  T "O3'" 1 
ATOM   8392  C  "C2'" . DG  C  3  25  ? -58.888 -18.250 48.199  1.00 203.22 ? 725 DG  T "C2'" 1 
ATOM   8393  C  "C1'" . DG  C  3  25  ? -57.719 -17.396 48.687  1.00 195.19 ? 725 DG  T "C1'" 1 
ATOM   8394  N  N9    . DG  C  3  25  ? -57.072 -17.915 49.890  1.00 190.95 ? 725 DG  T N9    1 
ATOM   8395  C  C8    . DG  C  3  25  ? -57.521 -17.808 51.185  1.00 187.96 ? 725 DG  T C8    1 
ATOM   8396  N  N7    . DG  C  3  25  ? -56.731 -18.370 52.057  1.00 183.69 ? 725 DG  T N7    1 
ATOM   8397  C  C5    . DG  C  3  25  ? -55.689 -18.881 51.293  1.00 182.22 ? 725 DG  T C5    1 
ATOM   8398  C  C6    . DG  C  3  25  ? -54.534 -19.596 51.689  1.00 174.20 ? 725 DG  T C6    1 
ATOM   8399  O  O6    . DG  C  3  25  ? -54.192 -19.931 52.832  1.00 164.89 ? 725 DG  T O6    1 
ATOM   8400  N  N1    . DG  C  3  25  ? -53.734 -19.928 50.597  1.00 177.12 ? 725 DG  T N1    1 
ATOM   8401  C  C2    . DG  C  3  25  ? -54.016 -19.609 49.290  1.00 184.09 ? 725 DG  T C2    1 
ATOM   8402  N  N2    . DG  C  3  25  ? -53.124 -20.015 48.374  1.00 183.39 ? 725 DG  T N2    1 
ATOM   8403  N  N3    . DG  C  3  25  ? -55.095 -18.939 48.906  1.00 189.88 ? 725 DG  T N3    1 
ATOM   8404  C  C4    . DG  C  3  25  ? -55.884 -18.608 49.957  1.00 188.31 ? 725 DG  T C4    1 
ATOM   8405  O  "O5'" . DC  D  4  2   ? -46.810 -26.793 48.271  1.00 178.83 ? 803 DC  P "O5'" 1 
ATOM   8406  C  "C5'" . DC  D  4  2   ? -46.376 -25.795 47.354  1.00 179.67 ? 803 DC  P "C5'" 1 
ATOM   8407  C  "C4'" . DC  D  4  2   ? -47.553 -24.984 46.846  1.00 182.13 ? 803 DC  P "C4'" 1 
ATOM   8408  O  "O4'" . DC  D  4  2   ? -48.596 -24.992 47.835  1.00 182.98 ? 803 DC  P "O4'" 1 
ATOM   8409  C  "C3'" . DC  D  4  2   ? -47.243 -23.514 46.574  1.00 180.34 ? 803 DC  P "C3'" 1 
ATOM   8410  O  "O3'" . DC  D  4  2   ? -47.125 -23.294 45.170  1.00 186.42 ? 803 DC  P "O3'" 1 
ATOM   8411  C  "C2'" . DC  D  4  2   ? -48.428 -22.738 47.177  1.00 177.70 ? 803 DC  P "C2'" 1 
ATOM   8412  C  "C1'" . DC  D  4  2   ? -49.365 -23.827 47.704  1.00 183.29 ? 803 DC  P "C1'" 1 
ATOM   8413  N  N1    . DC  D  4  2   ? -49.947 -23.516 49.038  1.00 184.30 ? 803 DC  P N1    1 
ATOM   8414  C  C2    . DC  D  4  2   ? -50.877 -22.477 49.173  1.00 179.90 ? 803 DC  P C2    1 
ATOM   8415  O  O2    . DC  D  4  2   ? -51.208 -21.824 48.175  1.00 178.02 ? 803 DC  P O2    1 
ATOM   8416  N  N3    . DC  D  4  2   ? -51.391 -22.215 50.400  1.00 177.13 ? 803 DC  P N3    1 
ATOM   8417  C  C4    . DC  D  4  2   ? -51.012 -22.941 51.454  1.00 176.08 ? 803 DC  P C4    1 
ATOM   8418  N  N4    . DC  D  4  2   ? -51.548 -22.645 52.642  1.00 169.48 ? 803 DC  P N4    1 
ATOM   8419  C  C5    . DC  D  4  2   ? -50.068 -24.003 51.335  1.00 181.50 ? 803 DC  P C5    1 
ATOM   8420  C  C6    . DC  D  4  2   ? -49.567 -24.253 50.122  1.00 184.75 ? 803 DC  P C6    1 
ATOM   8421  P  P     . DA  D  4  3   ? -46.270 -22.052 44.613  1.00 184.58 ? 804 DA  P P     1 
ATOM   8422  O  OP1   . DA  D  4  3   ? -45.369 -22.544 43.547  1.00 188.18 ? 804 DA  P OP1   1 
ATOM   8423  O  OP2   . DA  D  4  3   ? -45.698 -21.352 45.785  1.00 180.69 ? 804 DA  P OP2   1 
ATOM   8424  O  "O5'" . DA  D  4  3   ? -47.369 -21.115 43.927  1.00 179.46 ? 804 DA  P "O5'" 1 
ATOM   8425  C  "C5'" . DA  D  4  3   ? -47.010 -19.829 43.443  1.00 171.08 ? 804 DA  P "C5'" 1 
ATOM   8426  C  "C4'" . DA  D  4  3   ? -48.248 -19.029 43.083  1.00 167.42 ? 804 DA  P "C4'" 1 
ATOM   8427  O  "O4'" . DA  D  4  3   ? -49.262 -19.012 44.094  1.00 163.36 ? 804 DA  P "O4'" 1 
ATOM   8428  C  "C3'" . DA  D  4  3   ? -48.002 -17.554 42.806  1.00 165.16 ? 804 DA  P "C3'" 1 
ATOM   8429  O  "O3'" . DA  D  4  3   ? -48.999 -17.053 41.921  1.00 167.77 ? 804 DA  P "O3'" 1 
ATOM   8430  C  "C2'" . DA  D  4  3   ? -48.135 -16.947 44.195  1.00 160.03 ? 804 DA  P "C2'" 1 
ATOM   8431  C  "C1'" . DA  D  4  3   ? -49.286 -17.766 44.766  1.00 158.98 ? 804 DA  P "C1'" 1 
ATOM   8432  N  N9    . DA  D  4  3   ? -49.171 -18.014 46.198  1.00 152.66 ? 804 DA  P N9    1 
ATOM   8433  C  C8    . DA  D  4  3   ? -48.208 -18.749 46.833  1.00 147.51 ? 804 DA  P C8    1 
ATOM   8434  N  N7    . DA  D  4  3   ? -48.360 -18.803 48.136  1.00 144.08 ? 804 DA  P N7    1 
ATOM   8435  C  C5    . DA  D  4  3   ? -49.501 -18.055 48.369  1.00 142.63 ? 804 DA  P C5    1 
ATOM   8436  C  C6    . DA  D  4  3   ? -50.195 -17.725 49.549  1.00 133.79 ? 804 DA  P C6    1 
ATOM   8437  N  N6    . DA  D  4  3   ? -49.815 -18.131 50.764  1.00 123.49 ? 804 DA  P N6    1 
ATOM   8438  N  N1    . DA  D  4  3   ? -51.301 -16.958 49.432  1.00 136.54 ? 804 DA  P N1    1 
ATOM   8439  C  C2    . DA  D  4  3   ? -51.679 -16.553 48.214  1.00 144.49 ? 804 DA  P C2    1 
ATOM   8440  N  N3    . DA  D  4  3   ? -51.108 -16.798 47.035  1.00 152.30 ? 804 DA  P N3    1 
ATOM   8441  C  C4    . DA  D  4  3   ? -50.014 -17.562 47.185  1.00 150.42 ? 804 DA  P C4    1 
ATOM   8442  P  P     . DG  D  4  4   ? -48.860 -15.582 41.288  1.00 165.60 ? 805 DG  P P     1 
ATOM   8443  O  OP1   . DG  D  4  4   ? -49.736 -15.523 40.098  1.00 169.29 ? 805 DG  P OP1   1 
ATOM   8444  O  OP2   . DG  D  4  4   ? -47.419 -15.274 41.155  1.00 164.36 ? 805 DG  P OP2   1 
ATOM   8445  O  "O5'" . DG  D  4  4   ? -49.492 -14.623 42.401  1.00 157.80 ? 805 DG  P "O5'" 1 
ATOM   8446  C  "C5'" . DG  D  4  4   ? -50.863 -14.757 42.759  1.00 153.67 ? 805 DG  P "C5'" 1 
ATOM   8447  C  "C4'" . DG  D  4  4   ? -51.253 -13.726 43.804  1.00 147.30 ? 805 DG  P "C4'" 1 
ATOM   8448  O  "O4'" . DG  D  4  4   ? -51.060 -14.052 45.233  1.00 144.68 ? 805 DG  P "O4'" 1 
ATOM   8449  C  "C3'" . DG  D  4  4   ? -50.569 -12.364 43.659  1.00 143.45 ? 805 DG  P "C3'" 1 
ATOM   8450  O  "O3'" . DG  D  4  4   ? -51.506 -11.325 43.906  1.00 142.33 ? 805 DG  P "O3'" 1 
ATOM   8451  C  "C2'" . DG  D  4  4   ? -49.493 -12.407 44.740  1.00 137.66 ? 805 DG  P "C2'" 1 
ATOM   8452  C  "C1'" . DG  D  4  4   ? -50.248 -13.091 45.864  1.00 136.16 ? 805 DG  P "C1'" 1 
ATOM   8453  N  N9    . DG  D  4  4   ? -49.389 -13.767 46.833  1.00 126.69 ? 805 DG  P N9    1 
ATOM   8454  C  C8    . DG  D  4  4   ? -48.268 -14.517 46.567  1.00 123.76 ? 805 DG  P C8    1 
ATOM   8455  N  N7    . DG  D  4  4   ? -47.704 -15.003 47.637  1.00 121.68 ? 805 DG  P N7    1 
ATOM   8456  C  C5    . DG  D  4  4   ? -48.500 -14.546 48.679  1.00 122.45 ? 805 DG  P C5    1 
ATOM   8457  C  C6    . DG  D  4  4   ? -48.382 -14.753 50.076  1.00 118.01 ? 805 DG  P C6    1 
ATOM   8458  O  O6    . DG  D  4  4   ? -47.521 -15.401 50.687  1.00 116.81 ? 805 DG  P O6    1 
ATOM   8459  N  N1    . DG  D  4  4   ? -49.401 -14.112 50.778  1.00 111.14 ? 805 DG  P N1    1 
ATOM   8460  C  C2    . DG  D  4  4   ? -50.405 -13.368 50.204  1.00 110.70 ? 805 DG  P C2    1 
ATOM   8461  N  N2    . DG  D  4  4   ? -51.299 -12.827 51.045  1.00 111.63 ? 805 DG  P N2    1 
ATOM   8462  N  N3    . DG  D  4  4   ? -50.527 -13.168 48.899  1.00 112.60 ? 805 DG  P N3    1 
ATOM   8463  C  C4    . DG  D  4  4   ? -49.542 -13.785 48.200  1.00 121.22 ? 805 DG  P C4    1 
ATOM   8464  P  P     . DT  D  4  5   ? -51.663 -10.110 42.866  1.00 148.50 ? 806 DT  P P     1 
ATOM   8465  O  OP1   . DT  D  4  5   ? -52.879 -10.363 42.063  1.00 156.49 ? 806 DT  P OP1   1 
ATOM   8466  O  OP2   . DT  D  4  5   ? -50.361 -9.924  42.188  1.00 149.30 ? 806 DT  P OP2   1 
ATOM   8467  O  "O5'" . DT  D  4  5   ? -51.916 -8.837  43.800  1.00 141.89 ? 806 DT  P "O5'" 1 
ATOM   8468  C  "C5'" . DT  D  4  5   ? -50.881 -8.365  44.652  1.00 135.68 ? 806 DT  P "C5'" 1 
ATOM   8469  C  "C4'" . DT  D  4  5   ? -51.368 -8.254  46.085  1.00 132.95 ? 806 DT  P "C4'" 1 
ATOM   8470  O  "O4'" . DT  D  4  5   ? -51.184 -9.520  46.758  1.00 131.78 ? 806 DT  P "O4'" 1 
ATOM   8471  C  "C3'" . DT  D  4  5   ? -50.613 -7.251  46.932  1.00 127.70 ? 806 DT  P "C3'" 1 
ATOM   8472  O  "O3'" . DT  D  4  5   ? -51.162 -5.928  46.739  1.00 124.01 ? 806 DT  P "O3'" 1 
ATOM   8473  C  "C2'" . DT  D  4  5   ? -50.817 -7.785  48.350  1.00 128.17 ? 806 DT  P "C2'" 1 
ATOM   8474  C  "C1'" . DT  D  4  5   ? -50.898 -9.300  48.130  1.00 129.02 ? 806 DT  P "C1'" 1 
ATOM   8475  N  N1    . DT  D  4  5   ? -49.641 -10.030 48.475  1.00 126.16 ? 806 DT  P N1    1 
ATOM   8476  C  C2    . DT  D  4  5   ? -49.431 -10.436 49.773  1.00 122.22 ? 806 DT  P C2    1 
ATOM   8477  O  O2    . DT  D  4  5   ? -50.221 -10.224 50.676  1.00 121.96 ? 806 DT  P O2    1 
ATOM   8478  N  N3    . DT  D  4  5   ? -48.252 -11.102 49.981  1.00 117.79 ? 806 DT  P N3    1 
ATOM   8479  C  C4    . DT  D  4  5   ? -47.283 -11.399 49.039  1.00 115.41 ? 806 DT  P C4    1 
ATOM   8480  O  O4    . DT  D  4  5   ? -46.254 -12.003 49.323  1.00 112.04 ? 806 DT  P O4    1 
ATOM   8481  C  C5    . DT  D  4  5   ? -47.568 -10.948 47.698  1.00 121.17 ? 806 DT  P C5    1 
ATOM   8482  C  C7    . DT  D  4  5   ? -46.590 -11.212 46.591  1.00 126.47 ? 806 DT  P C7    1 
ATOM   8483  C  C6    . DT  D  4  5   ? -48.720 -10.294 47.483  1.00 124.54 ? 806 DT  P C6    1 
ATOM   8484  P  P     . DC  D  4  6   ? -52.495 -5.431  47.496  1.00 123.11 ? 807 DC  P P     1 
ATOM   8485  O  OP1   . DC  D  4  6   ? -53.463 -6.535  47.681  1.00 122.84 ? 807 DC  P OP1   1 
ATOM   8486  O  OP2   . DC  D  4  6   ? -52.938 -4.218  46.775  1.00 128.14 ? 807 DC  P OP2   1 
ATOM   8487  O  "O5'" . DC  D  4  6   ? -51.964 -4.968  48.926  1.00 113.35 ? 807 DC  P "O5'" 1 
ATOM   8488  C  "C5'" . DC  D  4  6   ? -52.711 -5.245  50.099  1.00 105.96 ? 807 DC  P "C5'" 1 
ATOM   8489  C  "C4'" . DC  D  4  6   ? -51.853 -4.977  51.313  1.00 98.66  ? 807 DC  P "C4'" 1 
ATOM   8490  O  "O4'" . DC  D  4  6   ? -50.923 -6.066  51.470  1.00 90.69  ? 807 DC  P "O4'" 1 
ATOM   8491  C  "C3'" . DC  D  4  6   ? -51.008 -3.715  51.189  1.00 102.10 ? 807 DC  P "C3'" 1 
ATOM   8492  O  "O3'" . DC  D  4  6   ? -51.568 -2.606  51.957  1.00 109.00 ? 807 DC  P "O3'" 1 
ATOM   8493  C  "C2'" . DC  D  4  6   ? -49.594 -4.115  51.639  1.00 97.63  ? 807 DC  P "C2'" 1 
ATOM   8494  C  "C1'" . DC  D  4  6   ? -49.711 -5.596  52.006  1.00 95.71  ? 807 DC  P "C1'" 1 
ATOM   8495  N  N1    . DC  D  4  6   ? -48.605 -6.432  51.444  1.00 99.07  ? 807 DC  P N1    1 
ATOM   8496  C  C2    . DC  D  4  6   ? -47.961 -7.376  52.253  1.00 98.00  ? 807 DC  P C2    1 
ATOM   8497  O  O2    . DC  D  4  6   ? -48.315 -7.504  53.432  1.00 102.54 ? 807 DC  P O2    1 
ATOM   8498  N  N3    . DC  D  4  6   ? -46.964 -8.127  51.719  1.00 95.03  ? 807 DC  P N3    1 
ATOM   8499  C  C4    . DC  D  4  6   ? -46.611 -7.959  50.442  1.00 92.05  ? 807 DC  P C4    1 
ATOM   8500  N  N4    . DC  D  4  6   ? -45.623 -8.721  49.960  1.00 88.18  ? 807 DC  P N4    1 
ATOM   8501  C  C5    . DC  D  4  6   ? -47.256 -7.004  49.604  1.00 97.79  ? 807 DC  P C5    1 
ATOM   8502  C  C6    . DC  D  4  6   ? -48.236 -6.270  50.140  1.00 103.23 ? 807 DC  P C6    1 
ATOM   8503  P  P     . DC  D  4  7   ? -52.066 -2.749  53.486  1.00 110.98 ? 808 DC  P P     1 
ATOM   8504  O  OP1   . DC  D  4  7   ? -53.220 -3.667  53.607  1.00 124.57 ? 808 DC  P OP1   1 
ATOM   8505  O  OP2   . DC  D  4  7   ? -52.242 -1.357  53.951  1.00 99.34  ? 808 DC  P OP2   1 
ATOM   8506  O  "O5'" . DC  D  4  7   ? -50.800 -3.313  54.280  1.00 90.88  ? 808 DC  P "O5'" 1 
ATOM   8507  C  "C5'" . DC  D  4  7   ? -49.746 -2.426  54.638  1.00 83.31  ? 808 DC  P "C5'" 1 
ATOM   8508  C  "C4'" . DC  D  4  7   ? -48.912 -2.993  55.770  1.00 76.46  ? 808 DC  P "C4'" 1 
ATOM   8509  O  "O4'" . DC  D  4  7   ? -48.149 -4.133  55.293  1.00 77.33  ? 808 DC  P "O4'" 1 
ATOM   8510  C  "C3'" . DC  D  4  7   ? -47.903 -2.015  56.354  1.00 75.91  ? 808 DC  P "C3'" 1 
ATOM   8511  O  "O3'" . DC  D  4  7   ? -47.829 -2.156  57.764  1.00 65.63  ? 808 DC  P "O3'" 1 
ATOM   8512  C  "C2'" . DC  D  4  7   ? -46.592 -2.396  55.671  1.00 76.83  ? 808 DC  P "C2'" 1 
ATOM   8513  C  "C1'" . DC  D  4  7   ? -46.761 -3.888  55.411  1.00 77.64  ? 808 DC  P "C1'" 1 
ATOM   8514  N  N1    . DC  D  4  7   ? -46.099 -4.334  54.150  1.00 77.46  ? 808 DC  P N1    1 
ATOM   8515  C  C2    . DC  D  4  7   ? -45.048 -5.257  54.199  1.00 75.89  ? 808 DC  P C2    1 
ATOM   8516  O  O2    . DC  D  4  7   ? -44.683 -5.699  55.294  1.00 77.08  ? 808 DC  P O2    1 
ATOM   8517  N  N3    . DC  D  4  7   ? -44.461 -5.644  53.038  1.00 74.13  ? 808 DC  P N3    1 
ATOM   8518  C  C4    . DC  D  4  7   ? -44.885 -5.143  51.875  1.00 71.60  ? 808 DC  P C4    1 
ATOM   8519  N  N4    . DC  D  4  7   ? -44.277 -5.553  50.758  1.00 73.32  ? 808 DC  P N4    1 
ATOM   8520  C  C5    . DC  D  4  7   ? -45.951 -4.200  51.808  1.00 72.29  ? 808 DC  P C5    1 
ATOM   8521  C  C6    . DC  D  4  7   ? -46.518 -3.825  52.958  1.00 72.74  ? 808 DC  P C6    1 
ATOM   8522  P  P     . DC  D  4  8   ? -47.301 -0.931  58.658  1.00 77.37  ? 809 DC  P P     1 
ATOM   8523  O  OP1   . DC  D  4  8   ? -47.765 -1.137  60.048  1.00 78.67  ? 809 DC  P OP1   1 
ATOM   8524  O  OP2   . DC  D  4  8   ? -47.644 0.317   57.940  1.00 75.09  ? 809 DC  P OP2   1 
ATOM   8525  O  "O5'" . DC  D  4  8   ? -45.715 -1.102  58.623  1.00 76.00  ? 809 DC  P "O5'" 1 
ATOM   8526  C  "C5'" . DC  D  4  8   ? -45.144 -2.342  59.005  1.00 72.16  ? 809 DC  P "C5'" 1 
ATOM   8527  C  "C4'" . DC  D  4  8   ? -43.703 -2.448  58.543  1.00 65.77  ? 809 DC  P "C4'" 1 
ATOM   8528  O  "O4'" . DC  D  4  8   ? -43.652 -2.880  57.165  1.00 66.33  ? 809 DC  P "O4'" 1 
ATOM   8529  C  "C3'" . DC  D  4  8   ? -42.898 -1.146  58.611  1.00 61.41  ? 809 DC  P "C3'" 1 
ATOM   8530  O  "O3'" . DC  D  4  8   ? -41.845 -1.293  59.555  1.00 60.47  ? 809 DC  P "O3'" 1 
ATOM   8531  C  "C2'" . DC  D  4  8   ? -42.362 -0.956  57.179  1.00 62.41  ? 809 DC  P "C2'" 1 
ATOM   8532  C  "C1'" . DC  D  4  8   ? -42.484 -2.357  56.598  1.00 63.56  ? 809 DC  P "C1'" 1 
ATOM   8533  N  N1    . DC  D  4  8   ? -42.613 -2.389  55.109  1.00 65.04  ? 809 DC  P N1    1 
ATOM   8534  C  C2    . DC  D  4  8   ? -41.826 -3.276  54.365  1.00 71.78  ? 809 DC  P C2    1 
ATOM   8535  O  O2    . DC  D  4  8   ? -41.037 -4.023  54.956  1.00 74.09  ? 809 DC  P O2    1 
ATOM   8536  N  N3    . DC  D  4  8   ? -41.954 -3.293  53.014  1.00 73.05  ? 809 DC  P N3    1 
ATOM   8537  C  C4    . DC  D  4  8   ? -42.818 -2.471  52.415  1.00 71.20  ? 809 DC  P C4    1 
ATOM   8538  N  N4    . DC  D  4  8   ? -42.910 -2.521  51.082  1.00 73.71  ? 809 DC  P N4    1 
ATOM   8539  C  C5    . DC  D  4  8   ? -43.626 -1.560  53.157  1.00 67.85  ? 809 DC  P C5    1 
ATOM   8540  C  C6    . DC  D  4  8   ? -43.490 -1.551  54.487  1.00 67.70  ? 809 DC  P C6    1 
ATOM   8541  P  P     . DT  D  4  9   ? -41.078 -0.008  60.139  1.00 69.15  ? 810 DT  P P     1 
ATOM   8542  O  OP1   . DT  D  4  9   ? -41.043 -0.128  61.614  1.00 68.00  ? 810 DT  P OP1   1 
ATOM   8543  O  OP2   . DT  D  4  9   ? -41.671 1.197   59.517  1.00 68.43  ? 810 DT  P OP2   1 
ATOM   8544  O  "O5'" . DT  D  4  9   ? -39.584 -0.206  59.613  1.00 69.99  ? 810 DT  P "O5'" 1 
ATOM   8545  C  "C5'" . DT  D  4  9   ? -38.961 -1.478  59.744  1.00 68.15  ? 810 DT  P "C5'" 1 
ATOM   8546  C  "C4'" . DT  D  4  9   ? -38.046 -1.762  58.566  1.00 65.89  ? 810 DT  P "C4'" 1 
ATOM   8547  O  "O4'" . DT  D  4  9   ? -38.818 -1.859  57.355  1.00 67.36  ? 810 DT  P "O4'" 1 
ATOM   8548  C  "C3'" . DT  D  4  9   ? -37.008 -0.681  58.279  1.00 65.30  ? 810 DT  P "C3'" 1 
ATOM   8549  O  "O3'" . DT  D  4  9   ? -35.758 -1.027  58.870  1.00 69.92  ? 810 DT  P "O3'" 1 
ATOM   8550  C  "C2'" . DT  D  4  9   ? -36.912 -0.650  56.742  1.00 68.98  ? 810 DT  P "C2'" 1 
ATOM   8551  C  "C1'" . DT  D  4  9   ? -37.932 -1.688  56.282  1.00 69.67  ? 810 DT  P "C1'" 1 
ATOM   8552  N  N1    . DT  D  4  9   ? -38.692 -1.265  55.065  1.00 68.02  ? 810 DT  P N1    1 
ATOM   8553  C  C2    . DT  D  4  9   ? -38.469 -1.918  53.874  1.00 73.61  ? 810 DT  P C2    1 
ATOM   8554  O  O2    . DT  D  4  9   ? -37.690 -2.847  53.758  1.00 77.50  ? 810 DT  P O2    1 
ATOM   8555  N  N3    . DT  D  4  9   ? -39.200 -1.448  52.816  1.00 74.87  ? 810 DT  P N3    1 
ATOM   8556  C  C4    . DT  D  4  9   ? -40.109 -0.406  52.827  1.00 70.10  ? 810 DT  P C4    1 
ATOM   8557  O  O4    . DT  D  4  9   ? -40.719 -0.057  51.821  1.00 71.34  ? 810 DT  P O4    1 
ATOM   8558  C  C5    . DT  D  4  9   ? -40.290 0.241   54.105  1.00 65.89  ? 810 DT  P C5    1 
ATOM   8559  C  C7    . DT  D  4  9   ? -41.250 1.385   54.241  1.00 65.47  ? 810 DT  P C7    1 
ATOM   8560  C  C6    . DT  D  4  9   ? -39.577 -0.211  55.149  1.00 64.14  ? 810 DT  P C6    1 
ATOM   8561  P  P     . DG  D  4  10  ? -34.561 0.046   58.920  1.00 77.00  ? 811 DG  P P     1 
ATOM   8562  O  OP1   . DG  D  4  10  ? -34.067 0.093   60.313  1.00 93.47  ? 811 DG  P OP1   1 
ATOM   8563  O  OP2   . DG  D  4  10  ? -35.020 1.294   58.272  1.00 65.98  ? 811 DG  P OP2   1 
ATOM   8564  O  "O5'" . DG  D  4  10  ? -33.428 -0.591  57.985  1.00 73.42  ? 811 DG  P "O5'" 1 
ATOM   8565  C  "C5'" . DG  D  4  10  ? -33.657 -1.826  57.308  1.00 71.25  ? 811 DG  P "C5'" 1 
ATOM   8566  C  "C4'" . DG  D  4  10  ? -32.985 -1.823  55.946  1.00 76.05  ? 811 DG  P "C4'" 1 
ATOM   8567  O  "O4'" . DG  D  4  10  ? -34.057 -1.576  54.928  1.00 78.87  ? 811 DG  P "O4'" 1 
ATOM   8568  C  "C3'" . DG  D  4  10  ? -31.942 -0.721  55.748  1.00 79.50  ? 811 DG  P "C3'" 1 
ATOM   8569  O  "O3'" . DG  D  4  10  ? -30.795 -1.252  55.100  1.00 86.52  ? 811 DG  P "O3'" 1 
ATOM   8570  C  "C2'" . DG  D  4  10  ? -32.670 0.294   54.869  1.00 86.24  ? 811 DG  P "C2'" 1 
ATOM   8571  C  "C1'" . DG  D  4  10  ? -33.561 -0.606  54.034  1.00 84.72  ? 811 DG  P "C1'" 1 
ATOM   8572  N  N9    . DG  D  4  10  ? -34.693 0.096   53.433  1.00 79.22  ? 811 DG  P N9    1 
ATOM   8573  C  C8    . DG  D  4  10  ? -35.549 0.967   54.059  1.00 76.84  ? 811 DG  P C8    1 
ATOM   8574  N  N7    . DG  D  4  10  ? -36.476 1.444   53.277  1.00 87.05  ? 811 DG  P N7    1 
ATOM   8575  C  C5    . DG  D  4  10  ? -36.217 0.856   52.047  1.00 90.04  ? 811 DG  P C5    1 
ATOM   8576  C  C6    . DG  D  4  10  ? -36.890 0.997   50.810  1.00 93.82  ? 811 DG  P C6    1 
ATOM   8577  O  O6    . DG  D  4  10  ? -37.883 1.693   50.553  1.00 89.94  ? 811 DG  P O6    1 
ATOM   8578  N  N1    . DG  D  4  10  ? -36.303 0.224   49.812  1.00 97.83  ? 811 DG  P N1    1 
ATOM   8579  C  C2    . DG  D  4  10  ? -35.203 -0.583  49.987  1.00 86.70  ? 811 DG  P C2    1 
ATOM   8580  N  N2    . DG  D  4  10  ? -34.780 -1.253  48.905  1.00 78.92  ? 811 DG  P N2    1 
ATOM   8581  N  N3    . DG  D  4  10  ? -34.561 -0.724  51.141  1.00 83.20  ? 811 DG  P N3    1 
ATOM   8582  C  C4    . DG  D  4  10  ? -35.121 0.022   52.124  1.00 84.17  ? 811 DG  P C4    1 
ATOM   8583  P  P     . DT  D  4  11  ? -29.479 -0.351  54.894  1.00 91.54  ? 812 DT  P P     1 
ATOM   8584  O  OP1   . DT  D  4  11  ? -28.339 -1.095  55.472  1.00 87.27  ? 812 DT  P OP1   1 
ATOM   8585  O  OP2   . DT  D  4  11  ? -29.754 1.028   55.355  1.00 84.82  ? 812 DT  P OP2   1 
ATOM   8586  O  "O5'" . DT  D  4  11  ? -29.288 -0.343  53.309  1.00 92.69  ? 812 DT  P "O5'" 1 
ATOM   8587  C  "C5'" . DT  D  4  11  ? -29.348 -1.570  52.595  1.00 88.22  ? 812 DT  P "C5'" 1 
ATOM   8588  C  "C4'" . DT  D  4  11  ? -29.488 -1.325  51.105  1.00 87.73  ? 812 DT  P "C4'" 1 
ATOM   8589  O  "O4'" . DT  D  4  11  ? -30.797 -0.767  50.821  1.00 84.97  ? 812 DT  P "O4'" 1 
ATOM   8590  C  "C3'" . DT  D  4  11  ? -28.464 -0.352  50.512  1.00 89.23  ? 812 DT  P "C3'" 1 
ATOM   8591  O  "O3'" . DT  D  4  11  ? -27.875 -0.919  49.350  1.00 97.70  ? 812 DT  P "O3'" 1 
ATOM   8592  C  "C2'" . DT  D  4  11  ? -29.295 0.888   50.178  1.00 84.22  ? 812 DT  P "C2'" 1 
ATOM   8593  C  "C1'" . DT  D  4  11  ? -30.658 0.281   49.895  1.00 86.14  ? 812 DT  P "C1'" 1 
ATOM   8594  N  N1    . DT  D  4  11  ? -31.792 1.240   50.078  1.00 86.12  ? 812 DT  P N1    1 
ATOM   8595  C  C2    . DT  D  4  11  ? -32.583 1.559   48.998  1.00 92.03  ? 812 DT  P C2    1 
ATOM   8596  O  O2    . DT  D  4  11  ? -32.412 1.095   47.885  1.00 97.41  ? 812 DT  P O2    1 
ATOM   8597  N  N3    . DT  D  4  11  ? -33.591 2.447   49.269  1.00 90.41  ? 812 DT  P N3    1 
ATOM   8598  C  C4    . DT  D  4  11  ? -33.881 3.037   50.485  1.00 84.61  ? 812 DT  P C4    1 
ATOM   8599  O  O4    . DT  D  4  11  ? -34.812 3.825   50.629  1.00 77.39  ? 812 DT  P O4    1 
ATOM   8600  C  C5    . DT  D  4  11  ? -33.013 2.661   51.576  1.00 81.29  ? 812 DT  P C5    1 
ATOM   8601  C  C7    . DT  D  4  11  ? -33.230 3.239   52.943  1.00 70.02  ? 812 DT  P C7    1 
ATOM   8602  C  C6    . DT  D  4  11  ? -32.021 1.792   51.323  1.00 83.40  ? 812 DT  P C6    1 
ATOM   8603  P  P     . DT  D  4  12  ? -26.524 -0.299  48.741  1.00 98.66  ? 813 DT  P P     1 
ATOM   8604  O  OP1   . DT  D  4  12  ? -25.602 -1.419  48.443  1.00 101.71 ? 813 DT  P OP1   1 
ATOM   8605  O  OP2   . DT  D  4  12  ? -26.087 0.793   49.639  1.00 87.89  ? 813 DT  P OP2   1 
ATOM   8606  O  "O5'" . DT  D  4  12  ? -27.001 0.360   47.366  1.00 103.68 ? 813 DT  P "O5'" 1 
ATOM   8607  C  "C5'" . DT  D  4  12  ? -27.859 -0.368  46.495  1.00 100.82 ? 813 DT  P "C5'" 1 
ATOM   8608  C  "C4'" . DT  D  4  12  ? -28.511 0.556   45.483  1.00 101.71 ? 813 DT  P "C4'" 1 
ATOM   8609  O  "O4'" . DT  D  4  12  ? -29.607 1.281   46.108  1.00 102.59 ? 813 DT  P "O4'" 1 
ATOM   8610  C  "C3'" . DT  D  4  12  ? -27.584 1.621   44.888  1.00 103.25 ? 813 DT  P "C3'" 1 
ATOM   8611  O  "O3'" . DT  D  4  12  ? -27.805 1.715   43.490  1.00 114.80 ? 813 DT  P "O3'" 1 
ATOM   8612  C  "C2'" . DT  D  4  12  ? -28.023 2.895   45.607  1.00 98.36  ? 813 DT  P "C2'" 1 
ATOM   8613  C  "C1'" . DT  D  4  12  ? -29.511 2.638   45.747  1.00 102.49 ? 813 DT  P "C1'" 1 
ATOM   8614  N  N1    . DT  D  4  12  ? -30.183 3.474   46.789  1.00 100.11 ? 813 DT  P N1    1 
ATOM   8615  C  C2    . DT  D  4  12  ? -31.359 4.115   46.473  1.00 100.49 ? 813 DT  P C2    1 
ATOM   8616  O  O2    . DT  D  4  12  ? -31.890 4.033   45.380  1.00 103.36 ? 813 DT  P O2    1 
ATOM   8617  N  N3    . DT  D  4  12  ? -31.898 4.857   47.488  1.00 98.50  ? 813 DT  P N3    1 
ATOM   8618  C  C4    . DT  D  4  12  ? -31.391 5.024   48.763  1.00 94.04  ? 813 DT  P C4    1 
ATOM   8619  O  O4    . DT  D  4  12  ? -31.952 5.715   49.608  1.00 90.92  ? 813 DT  P O4    1 
ATOM   8620  C  C5    . DT  D  4  12  ? -30.154 4.329   49.030  1.00 92.92  ? 813 DT  P C5    1 
ATOM   8621  C  C7    . DT  D  4  12  ? -29.507 4.438   50.380  1.00 90.61  ? 813 DT  P C7    1 
ATOM   8622  C  C6    . DT  D  4  12  ? -29.614 3.597   48.040  1.00 96.26  ? 813 DT  P C6    1 
ATOM   8623  P  P     . DC  D  4  13  ? -26.636 2.224   42.511  1.00 115.62 ? 814 DC  P P     1 
ATOM   8624  O  OP1   . DC  D  4  13  ? -25.959 1.028   41.962  1.00 109.76 ? 814 DC  P OP1   1 
ATOM   8625  O  OP2   . DC  D  4  13  ? -25.850 3.246   43.236  1.00 113.60 ? 814 DC  P OP2   1 
ATOM   8626  O  "O5'" . DC  D  4  13  ? -27.432 2.933   41.320  1.00 118.26 ? 814 DC  P "O5'" 1 
ATOM   8627  C  "C5'" . DC  D  4  13  ? -28.850 3.049   41.390  1.00 121.32 ? 814 DC  P "C5'" 1 
ATOM   8628  C  "C4'" . DC  D  4  13  ? -29.285 4.490   41.192  1.00 123.95 ? 814 DC  P "C4'" 1 
ATOM   8629  O  "O4'" . DC  D  4  13  ? -29.833 5.017   42.432  1.00 122.17 ? 814 DC  P "O4'" 1 
ATOM   8630  C  "C3'" . DC  D  4  13  ? -28.168 5.455   40.778  1.00 122.72 ? 814 DC  P "C3'" 1 
ATOM   8631  O  "O3'" . DC  D  4  13  ? -28.618 6.272   39.710  1.00 130.21 ? 814 DC  P "O3'" 1 
ATOM   8632  C  "C2'" . DC  D  4  13  ? -27.931 6.278   42.045  1.00 116.34 ? 814 DC  P "C2'" 1 
ATOM   8633  C  "C1'" . DC  D  4  13  ? -29.329 6.314   42.629  1.00 121.11 ? 814 DC  P "C1'" 1 
ATOM   8634  N  N1    . DC  D  4  13  ? -29.365 6.637   44.082  1.00 116.99 ? 814 DC  P N1    1 
ATOM   8635  C  C2    . DC  D  4  13  ? -30.423 7.393   44.596  1.00 114.04 ? 814 DC  P C2    1 
ATOM   8636  O  O2    . DC  D  4  13  ? -31.320 7.772   43.832  1.00 113.58 ? 814 DC  P O2    1 
ATOM   8637  N  N3    . DC  D  4  13  ? -30.439 7.684   45.920  1.00 110.61 ? 814 DC  P N3    1 
ATOM   8638  C  C4    . DC  D  4  13  ? -29.452 7.255   46.710  1.00 103.43 ? 814 DC  P C4    1 
ATOM   8639  N  N4    . DC  D  4  13  ? -29.510 7.567   48.008  1.00 95.38  ? 814 DC  P N4    1 
ATOM   8640  C  C5    . DC  D  4  13  ? -28.363 6.488   46.202  1.00 107.93 ? 814 DC  P C5    1 
ATOM   8641  C  C6    . DC  D  4  13  ? -28.358 6.210   44.895  1.00 115.02 ? 814 DC  P C6    1 
ATOM   8642  P  P     . DG  D  4  14  ? -27.569 7.065   38.787  1.00 135.42 ? 815 DG  P P     1 
ATOM   8643  O  OP1   . DG  D  4  14  ? -26.936 6.085   37.875  1.00 134.30 ? 815 DG  P OP1   1 
ATOM   8644  O  OP2   . DG  D  4  14  ? -26.725 7.906   39.663  1.00 134.57 ? 815 DG  P OP2   1 
ATOM   8645  O  "O5'" . DG  D  4  14  ? -28.496 8.045   37.932  1.00 136.28 ? 815 DG  P "O5'" 1 
ATOM   8646  C  "C5'" . DG  D  4  14  ? -29.898 8.072   38.166  1.00 134.02 ? 815 DG  P "C5'" 1 
ATOM   8647  C  "C4'" . DG  D  4  14  ? -30.337 9.428   38.689  1.00 134.78 ? 815 DG  P "C4'" 1 
ATOM   8648  O  "O4'" . DG  D  4  14  ? -30.365 9.417   40.141  1.00 132.64 ? 815 DG  P "O4'" 1 
ATOM   8649  C  "C3'" . DG  D  4  14  ? -29.438 10.609  38.290  1.00 136.31 ? 815 DG  P "C3'" 1 
ATOM   8650  O  "O3'" . DG  D  4  14  ? -30.224 11.629  37.678  1.00 143.62 ? 815 DG  P "O3'" 1 
ATOM   8651  C  "C2'" . DG  D  4  14  ? -28.849 11.079  39.624  1.00 131.92 ? 815 DG  P "C2'" 1 
ATOM   8652  C  "C1'" . DG  D  4  14  ? -29.945 10.676  40.590  1.00 132.70 ? 815 DG  P "C1'" 1 
ATOM   8653  N  N9    . DG  D  4  14  ? -29.499 10.575  41.976  1.00 126.12 ? 815 DG  P N9    1 
ATOM   8654  C  C8    . DG  D  4  14  ? -28.342 9.993   42.437  1.00 117.96 ? 815 DG  P C8    1 
ATOM   8655  N  N7    . DG  D  4  14  ? -28.208 10.062  43.733  1.00 111.09 ? 815 DG  P N7    1 
ATOM   8656  C  C5    . DG  D  4  14  ? -29.345 10.737  44.158  1.00 114.64 ? 815 DG  P C5    1 
ATOM   8657  C  C6    . DG  D  4  14  ? -29.754 11.107  45.462  1.00 111.07 ? 815 DG  P C6    1 
ATOM   8658  O  O6    . DG  D  4  14  ? -29.170 10.904  46.535  1.00 109.17 ? 815 DG  P O6    1 
ATOM   8659  N  N1    . DG  D  4  14  ? -30.974 11.779  45.449  1.00 109.23 ? 815 DG  P N1    1 
ATOM   8660  C  C2    . DG  D  4  14  ? -31.706 12.058  44.319  1.00 116.35 ? 815 DG  P C2    1 
ATOM   8661  N  N2    . DG  D  4  14  ? -32.860 12.715  44.506  1.00 120.81 ? 815 DG  P N2    1 
ATOM   8662  N  N3    . DG  D  4  14  ? -31.334 11.717  43.092  1.00 123.05 ? 815 DG  P N3    1 
ATOM   8663  C  C4    . DG  D  4  14  ? -30.148 11.062  43.088  1.00 122.49 ? 815 DG  P C4    1 
ATOM   8664  P  P     . DG  D  4  15  ? -29.535 12.963  37.101  1.00 152.67 ? 816 DG  P P     1 
ATOM   8665  O  OP1   . DG  D  4  15  ? -30.101 13.190  35.753  1.00 159.23 ? 816 DG  P OP1   1 
ATOM   8666  O  OP2   . DG  D  4  15  ? -28.067 12.863  37.261  1.00 149.92 ? 816 DG  P OP2   1 
ATOM   8667  O  "O5'" . DG  D  4  15  ? -30.068 14.119  38.072  1.00 150.75 ? 816 DG  P "O5'" 1 
ATOM   8668  C  "C5'" . DG  D  4  15  ? -31.408 14.590  37.944  1.00 151.75 ? 816 DG  P "C5'" 1 
ATOM   8669  C  "C4'" . DG  D  4  15  ? -31.845 15.356  39.182  1.00 147.85 ? 816 DG  P "C4'" 1 
ATOM   8670  O  "O4'" . DG  D  4  15  ? -31.698 14.474  40.323  1.00 142.32 ? 816 DG  P "O4'" 1 
ATOM   8671  C  "C3'" . DG  D  4  15  ? -30.979 16.549  39.547  1.00 144.50 ? 816 DG  P "C3'" 1 
ATOM   8672  O  "O3'" . DG  D  4  15  ? -31.404 17.700  38.827  1.00 145.34 ? 816 DG  P "O3'" 1 
ATOM   8673  C  "C2'" . DG  D  4  15  ? -31.257 16.695  41.039  1.00 142.05 ? 816 DG  P "C2'" 1 
ATOM   8674  C  "C1'" . DG  D  4  15  ? -31.412 15.240  41.483  1.00 140.57 ? 816 DG  P "C1'" 1 
ATOM   8675  N  N9    . DG  D  4  15  ? -30.215 14.697  42.114  1.00 137.24 ? 816 DG  P N9    1 
ATOM   8676  C  C8    . DG  D  4  15  ? -29.200 14.008  41.500  1.00 136.78 ? 816 DG  P C8    1 
ATOM   8677  N  N7    . DG  D  4  15  ? -28.252 13.642  42.317  1.00 130.85 ? 816 DG  P N7    1 
ATOM   8678  C  C5    . DG  D  4  15  ? -28.664 14.123  43.552  1.00 127.67 ? 816 DG  P C5    1 
ATOM   8679  C  C6    . DG  D  4  15  ? -28.041 14.032  44.818  1.00 122.34 ? 816 DG  P C6    1 
ATOM   8680  O  O6    . DG  D  4  15  ? -26.965 13.489  45.107  1.00 117.22 ? 816 DG  P O6    1 
ATOM   8681  N  N1    . DG  D  4  15  ? -28.795 14.654  45.810  1.00 121.12 ? 816 DG  P N1    1 
ATOM   8682  C  C2    . DG  D  4  15  ? -29.999 15.286  45.603  1.00 122.88 ? 816 DG  P C2    1 
ATOM   8683  N  N2    . DG  D  4  15  ? -30.579 15.829  46.683  1.00 120.75 ? 816 DG  P N2    1 
ATOM   8684  N  N3    . DG  D  4  15  ? -30.595 15.379  44.420  1.00 126.69 ? 816 DG  P N3    1 
ATOM   8685  C  C4    . DG  D  4  15  ? -29.872 14.776  43.445  1.00 129.89 ? 816 DG  P C4    1 
HETATM 8686  P  P     . MRG D  4  16  ? -30.371 18.896  38.531  1.00 147.59 ? 817 MRG P P     1 
HETATM 8687  O  OP1   . MRG D  4  16  ? -30.979 19.853  37.525  1.00 155.36 ? 817 MRG P OP1   1 
HETATM 8688  O  OP2   . MRG D  4  16  ? -29.046 18.306  38.005  1.00 145.16 ? 817 MRG P OP2   1 
HETATM 8689  O  "O5'" . MRG D  4  16  ? -30.163 19.593  39.926  1.00 140.78 ? 817 MRG P "O5'" 1 
HETATM 8690  N  N9    . MRG D  4  16  ? -28.994 19.040  43.851  1.00 113.50 ? 817 MRG P N9    1 
HETATM 8691  C  C4    . MRG D  4  16  ? -28.310 18.650  44.951  1.00 105.03 ? 817 MRG P C4    1 
HETATM 8692  N  N3    . MRG D  4  16  ? -28.349 19.080  46.337  1.00 99.57  ? 817 MRG P N3    1 
HETATM 8693  C  C2    . MRG D  4  16  ? -27.485 18.469  47.321  1.00 99.38  ? 817 MRG P C2    1 
HETATM 8694  N  N1    . MRG D  4  16  ? -26.583 17.433  46.917  1.00 95.33  ? 817 MRG P N1    1 
HETATM 8695  C  C6    . MRG D  4  16  ? -26.541 17.012  45.565  1.00 96.06  ? 817 MRG P C6    1 
HETATM 8696  O  O6    . MRG D  4  16  ? -25.759 16.116  45.222  1.00 90.68  ? 817 MRG P O6    1 
HETATM 8697  C  C5    . MRG D  4  16  ? -27.434 17.644  44.560  1.00 103.16 ? 817 MRG P C5    1 
HETATM 8698  N  N7    . MRG D  4  16  ? -27.609 17.449  43.227  1.00 110.43 ? 817 MRG P N7    1 
HETATM 8699  C  C8    . MRG D  4  16  ? -28.559 18.303  42.804  1.00 115.49 ? 817 MRG P C8    1 
HETATM 8700  N  N2    . MRG D  4  16  ? -27.504 18.883  48.751  1.00 105.65 ? 817 MRG P N2    1 
HETATM 8701  C  C21   . MRG D  4  16  ? -28.723 19.178  49.493  1.00 107.04 ? 817 MRG P C21   1 
HETATM 8702  C  C22   . MRG D  4  16  ? -29.446 20.500  49.310  1.00 109.63 ? 817 MRG P C22   1 
HETATM 8703  C  C23   . MRG D  4  16  ? -29.672 20.968  47.877  1.00 114.99 ? 817 MRG P C23   1 
HETATM 8704  S  S24   . MRG D  4  16  ? -31.249 21.710  47.466  1.00 123.76 ? 817 MRG P S24   1 
HETATM 8705  C  "C2'" . MRG D  4  16  ? -29.457 21.407  43.516  1.00 121.78 ? 817 MRG P "C2'" 1 
HETATM 8706  C  "C5'" . MRG D  4  16  ? -31.167 20.383  40.459  1.00 135.77 ? 817 MRG P "C5'" 1 
HETATM 8707  C  "C4'" . MRG D  4  16  ? -31.002 20.904  41.881  1.00 130.40 ? 817 MRG P "C4'" 1 
HETATM 8708  O  "O4'" . MRG D  4  16  ? -31.038 19.848  42.781  1.00 127.10 ? 817 MRG P "O4'" 1 
HETATM 8709  C  "C1'" . MRG D  4  16  ? -30.030 20.087  43.802  1.00 119.39 ? 817 MRG P "C1'" 1 
HETATM 8710  C  "C3'" . MRG D  4  16  ? -29.706 21.610  42.115  1.00 124.45 ? 817 MRG P "C3'" 1 
HETATM 8711  O  "O3'" . MRG D  4  16  ? -29.779 22.963  41.885  1.00 125.61 ? 817 MRG P "O3'" 1 
ATOM   8712  P  P     . DC  D  4  17  ? -28.461 23.779  41.451  1.00 127.79 ? 818 DC  P P     1 
ATOM   8713  O  OP1   . DC  D  4  17  ? -28.891 25.129  41.024  1.00 127.71 ? 818 DC  P OP1   1 
ATOM   8714  O  OP2   . DC  D  4  17  ? -27.688 22.926  40.522  1.00 131.97 ? 818 DC  P OP2   1 
ATOM   8715  O  "O5'" . DC  D  4  17  ? -27.637 23.940  42.816  1.00 120.67 ? 818 DC  P "O5'" 1 
ATOM   8716  C  "C5'" . DC  D  4  17  ? -28.113 24.812  43.836  1.00 120.13 ? 818 DC  P "C5'" 1 
ATOM   8717  C  "C4'" . DC  D  4  17  ? -27.427 24.530  45.162  1.00 119.20 ? 818 DC  P "C4'" 1 
ATOM   8718  O  "O4'" . DC  D  4  17  ? -27.561 23.126  45.492  1.00 114.83 ? 818 DC  P "O4'" 1 
ATOM   8719  C  "C3'" . DC  D  4  17  ? -25.930 24.778  45.186  1.00 116.15 ? 818 DC  P "C3'" 1 
ATOM   8720  O  "O3'" . DC  D  4  17  ? -25.659 26.155  45.423  1.00 114.78 ? 818 DC  P "O3'" 1 
ATOM   8721  C  "C2'" . DC  D  4  17  ? -25.499 23.912  46.364  1.00 109.93 ? 818 DC  P "C2'" 1 
ATOM   8722  C  "C1'" . DC  D  4  17  ? -26.417 22.698  46.216  1.00 107.96 ? 818 DC  P "C1'" 1 
ATOM   8723  N  N1    . DC  D  4  17  ? -25.781 21.562  45.488  1.00 100.74 ? 818 DC  P N1    1 
ATOM   8724  C  C2    . DC  D  4  17  ? -24.921 20.697  46.174  1.00 101.30 ? 818 DC  P C2    1 
ATOM   8725  O  O2    . DC  D  4  17  ? -24.706 20.889  47.377  1.00 94.76  ? 818 DC  P O2    1 
ATOM   8726  N  N3    . DC  D  4  17  ? -24.347 19.671  45.499  1.00 104.29 ? 818 DC  P N3    1 
ATOM   8727  C  C4    . DC  D  4  17  ? -24.604 19.498  44.201  1.00 104.38 ? 818 DC  P C4    1 
ATOM   8728  N  N4    . DC  D  4  17  ? -24.016 18.472  43.578  1.00 102.55 ? 818 DC  P N4    1 
ATOM   8729  C  C5    . DC  D  4  17  ? -25.476 20.369  43.485  1.00 102.71 ? 818 DC  P C5    1 
ATOM   8730  C  C6    . DC  D  4  17  ? -26.036 21.378  44.161  1.00 97.45  ? 818 DC  P C6    1 
ATOM   8731  P  P     . DG  D  4  18  ? -24.237 26.780  45.009  1.00 111.24 ? 819 DG  P P     1 
ATOM   8732  O  OP1   . DG  D  4  18  ? -24.322 28.248  45.171  1.00 114.31 ? 819 DG  P OP1   1 
ATOM   8733  O  OP2   . DG  D  4  18  ? -23.857 26.205  43.700  1.00 110.42 ? 819 DG  P OP2   1 
ATOM   8734  O  "O5'" . DG  D  4  18  ? -23.224 26.198  46.103  1.00 105.44 ? 819 DG  P "O5'" 1 
ATOM   8735  C  "C5'" . DG  D  4  18  ? -23.351 26.585  47.465  1.00 101.15 ? 819 DG  P "C5'" 1 
ATOM   8736  C  "C4'" . DG  D  4  18  ? -22.361 25.834  48.337  1.00 99.89  ? 819 DG  P "C4'" 1 
ATOM   8737  O  "O4'" . DG  D  4  18  ? -22.697 24.425  48.356  1.00 99.12  ? 819 DG  P "O4'" 1 
ATOM   8738  C  "C3'" . DG  D  4  18  ? -20.921 25.878  47.862  1.00 99.93  ? 819 DG  P "C3'" 1 
ATOM   8739  O  "O3'" . DG  D  4  18  ? -20.286 27.062  48.326  1.00 97.93  ? 819 DG  P "O3'" 1 
ATOM   8740  C  "C2'" . DG  D  4  18  ? -20.344 24.634  48.525  1.00 93.25  ? 819 DG  P "C2'" 1 
ATOM   8741  C  "C1'" . DG  D  4  18  ? -21.507 23.651  48.389  1.00 96.23  ? 819 DG  P "C1'" 1 
ATOM   8742  N  N9    . DG  D  4  18  ? -21.444 22.848  47.174  1.00 100.48 ? 819 DG  P N9    1 
ATOM   8743  C  C8    . DG  D  4  18  ? -22.172 23.030  46.024  1.00 100.86 ? 819 DG  P C8    1 
ATOM   8744  N  N7    . DG  D  4  18  ? -21.903 22.156  45.095  1.00 97.25  ? 819 DG  P N7    1 
ATOM   8745  C  C5    . DG  D  4  18  ? -20.932 21.342  45.665  1.00 93.99  ? 819 DG  P C5    1 
ATOM   8746  C  C6    . DG  D  4  18  ? -20.254 20.223  45.130  1.00 91.74  ? 819 DG  P C6    1 
ATOM   8747  O  O6    . DG  D  4  18  ? -20.384 19.711  44.009  1.00 89.41  ? 819 DG  P O6    1 
ATOM   8748  N  N1    . DG  D  4  18  ? -19.345 19.687  46.039  1.00 97.14  ? 819 DG  P N1    1 
ATOM   8749  C  C2    . DG  D  4  18  ? -19.120 20.174  47.306  1.00 99.90  ? 819 DG  P C2    1 
ATOM   8750  N  N2    . DG  D  4  18  ? -18.203 19.525  48.038  1.00 100.30 ? 819 DG  P N2    1 
ATOM   8751  N  N3    . DG  D  4  18  ? -19.748 21.225  47.819  1.00 98.35  ? 819 DG  P N3    1 
ATOM   8752  C  C4    . DG  D  4  18  ? -20.637 21.757  46.944  1.00 97.97  ? 819 DG  P C4    1 
ATOM   8753  P  P     . DC  D  4  19  ? -19.227 27.826  47.390  1.00 94.95  ? 820 DC  P P     1 
ATOM   8754  O  OP1   . DC  D  4  19  ? -18.745 29.012  48.132  1.00 101.24 ? 820 DC  P OP1   1 
ATOM   8755  O  OP2   . DC  D  4  19  ? -19.846 27.997  46.057  1.00 96.33  ? 820 DC  P OP2   1 
ATOM   8756  O  "O5'" . DC  D  4  19  ? -18.008 26.797  47.271  1.00 91.23  ? 820 DC  P "O5'" 1 
ATOM   8757  C  "C5'" . DC  D  4  19  ? -17.184 26.553  48.400  1.00 83.79  ? 820 DC  P "C5'" 1 
ATOM   8758  C  "C4'" . DC  D  4  19  ? -16.266 25.364  48.174  1.00 84.99  ? 820 DC  P "C4'" 1 
ATOM   8759  O  "O4'" . DC  D  4  19  ? -17.099 24.205  47.822  1.00 86.04  ? 820 DC  P "O4'" 1 
ATOM   8760  C  "C3'" . DC  D  4  19  ? -15.376 25.439  46.953  1.00 85.65  ? 820 DC  P "C3'" 1 
ATOM   8761  O  "O3'" . DC  D  4  19  ? -14.265 26.289  47.180  1.00 86.30  ? 820 DC  P "O3'" 1 
ATOM   8762  C  "C2'" . DC  D  4  19  ? -14.959 23.981  46.837  1.00 86.49  ? 820 DC  P "C2'" 1 
ATOM   8763  C  "C1'" . DC  D  4  19  ? -16.293 23.281  47.096  1.00 87.30  ? 820 DC  P "C1'" 1 
ATOM   8764  N  N1    . DC  D  4  19  ? -16.993 22.907  45.836  1.00 92.45  ? 820 DC  P N1    1 
ATOM   8765  C  C2    . DC  D  4  19  ? -16.536 21.809  45.096  1.00 95.83  ? 820 DC  P C2    1 
ATOM   8766  O  O2    . DC  D  4  19  ? -15.570 21.159  45.515  1.00 94.41  ? 820 DC  P O2    1 
ATOM   8767  N  N3    . DC  D  4  19  ? -17.171 21.484  43.945  1.00 97.98  ? 820 DC  P N3    1 
ATOM   8768  C  C4    . DC  D  4  19  ? -18.210 22.208  43.528  1.00 95.74  ? 820 DC  P C4    1 
ATOM   8769  N  N4    . DC  D  4  19  ? -18.803 21.846  42.385  1.00 99.13  ? 820 DC  P N4    1 
ATOM   8770  C  C5    . DC  D  4  19  ? -18.685 23.335  44.261  1.00 94.27  ? 820 DC  P C5    1 
ATOM   8771  C  C6    . DC  D  4  19  ? -18.052 23.646  45.398  1.00 92.57  ? 820 DC  P C6    1 
ATOM   8772  P  P     . DC  D  4  20  ? -13.546 26.998  45.929  1.00 95.65  ? 821 DC  P P     1 
ATOM   8773  O  OP1   . DC  D  4  20  ? -12.582 27.990  46.452  1.00 95.28  ? 821 DC  P OP1   1 
ATOM   8774  O  OP2   . DC  D  4  20  ? -14.608 27.432  44.995  1.00 98.05  ? 821 DC  P OP2   1 
ATOM   8775  O  "O5'" . DC  D  4  20  ? -12.744 25.808  45.222  1.00 93.00  ? 821 DC  P "O5'" 1 
ATOM   8776  C  "C5'" . DC  D  4  20  ? -11.778 25.072  45.959  1.00 86.06  ? 821 DC  P "C5'" 1 
ATOM   8777  C  "C4'" . DC  D  4  20  ? -11.151 23.979  45.111  1.00 84.84  ? 821 DC  P "C4'" 1 
ATOM   8778  O  "O4'" . DC  D  4  20  ? -12.127 22.946  44.837  1.00 91.16  ? 821 DC  P "O4'" 1 
ATOM   8779  C  "C3'" . DC  D  4  20  ? -10.676 24.416  43.741  1.00 88.63  ? 821 DC  P "C3'" 1 
ATOM   8780  O  "O3'" . DC  D  4  20  ? -9.390  25.021  43.833  1.00 92.78  ? 821 DC  P "O3'" 1 
ATOM   8781  C  "C2'" . DC  D  4  20  ? -10.621 23.082  43.007  1.00 88.73  ? 821 DC  P "C2'" 1 
ATOM   8782  C  "C1'" . DC  D  4  20  ? -11.845 22.357  43.577  1.00 92.68  ? 821 DC  P "C1'" 1 
ATOM   8783  N  N1    . DC  D  4  20  ? -13.053 22.471  42.715  1.00 102.14 ? 821 DC  P N1    1 
ATOM   8784  C  C2    . DC  D  4  20  ? -13.235 21.571  41.660  1.00 104.22 ? 821 DC  P C2    1 
ATOM   8785  O  O2    . DC  D  4  20  ? -12.389 20.689  41.467  1.00 107.46 ? 821 DC  P O2    1 
ATOM   8786  N  N3    . DC  D  4  20  ? -14.337 21.690  40.880  1.00 101.72 ? 821 DC  P N3    1 
ATOM   8787  C  C4    . DC  D  4  20  ? -15.226 22.654  41.122  1.00 100.98 ? 821 DC  P C4    1 
ATOM   8788  N  N4    . DC  D  4  20  ? -16.297 22.732  40.326  1.00 101.73 ? 821 DC  P N4    1 
ATOM   8789  C  C5    . DC  D  4  20  ? -15.056 23.582  42.191  1.00 103.86 ? 821 DC  P C5    1 
ATOM   8790  C  C6    . DC  D  4  20  ? -13.966 23.455  42.954  1.00 103.24 ? 821 DC  P C6    1 
ATOM   8791  P  P     . DG  D  4  21  ? -9.036  26.301  42.927  1.00 98.49  ? 822 DG  P P     1 
ATOM   8792  O  OP1   . DG  D  4  21  ? -8.131  27.182  43.698  1.00 113.57 ? 822 DG  P OP1   1 
ATOM   8793  O  OP2   . DG  D  4  21  ? -10.313 26.838  42.408  1.00 94.36  ? 822 DG  P OP2   1 
ATOM   8794  O  "O5'" . DG  D  4  21  ? -8.242  25.686  41.682  1.00 93.10  ? 822 DG  P "O5'" 1 
ATOM   8795  C  "C5'" . DG  D  4  21  ? -8.961  25.158  40.575  1.00 90.13  ? 822 DG  P "C5'" 1 
ATOM   8796  C  "C4'" . DG  D  4  21  ? -8.412  23.803  40.165  1.00 91.95  ? 822 DG  P "C4'" 1 
ATOM   8797  O  "O4'" . DG  D  4  21  ? -9.510  22.882  39.981  1.00 99.16  ? 822 DG  P "O4'" 1 
ATOM   8798  C  "C3'" . DG  D  4  21  ? -7.684  23.792  38.839  1.00 94.55  ? 822 DG  P "C3'" 1 
ATOM   8799  C  "C2'" . DG  D  4  21  ? -8.840  23.689  37.851  1.00 96.22  ? 822 DG  P "C2'" 1 
ATOM   8800  C  "C1'" . DG  D  4  21  ? -9.830  22.795  38.603  1.00 101.74 ? 822 DG  P "C1'" 1 
ATOM   8801  N  N9    . DG  D  4  21  ? -11.222 23.199  38.431  1.00 108.54 ? 822 DG  P N9    1 
ATOM   8802  C  C8    . DG  D  4  21  ? -11.868 24.229  39.071  1.00 108.73 ? 822 DG  P C8    1 
ATOM   8803  N  N7    . DG  D  4  21  ? -13.115 24.361  38.717  1.00 108.14 ? 822 DG  P N7    1 
ATOM   8804  C  C5    . DG  D  4  21  ? -13.310 23.354  37.781  1.00 108.83 ? 822 DG  P C5    1 
ATOM   8805  C  C6    . DG  D  4  21  ? -14.468 23.005  37.048  1.00 109.95 ? 822 DG  P C6    1 
ATOM   8806  O  O6    . DG  D  4  21  ? -15.588 23.534  37.083  1.00 111.59 ? 822 DG  P O6    1 
ATOM   8807  N  N1    . DG  D  4  21  ? -14.237 21.920  36.205  1.00 111.02 ? 822 DG  P N1    1 
ATOM   8808  C  C2    . DG  D  4  21  ? -13.038 21.259  36.087  1.00 110.67 ? 822 DG  P C2    1 
ATOM   8809  N  N2    . DG  D  4  21  ? -13.007 20.235  35.221  1.00 118.85 ? 822 DG  P N2    1 
ATOM   8810  N  N3    . DG  D  4  21  ? -11.944 21.576  36.768  1.00 104.59 ? 822 DG  P N3    1 
ATOM   8811  C  C4    . DG  D  4  21  ? -12.154 22.630  37.593  1.00 108.16 ? 822 DG  P C4    1 
ATOM   8812  N  N     . VAL E  1  2   ? -11.076 -56.858 -30.598 1.00 127.53 ? 0   VAL C N     1 
ATOM   8813  C  CA    . VAL E  1  2   ? -10.258 -56.326 -29.511 1.00 118.01 ? 0   VAL C CA    1 
ATOM   8814  C  C     . VAL E  1  2   ? -10.963 -55.174 -28.810 1.00 125.89 ? 0   VAL C C     1 
ATOM   8815  O  O     . VAL E  1  2   ? -11.178 -54.119 -29.401 1.00 130.76 ? 0   VAL C O     1 
ATOM   8816  C  CB    . VAL E  1  2   ? -8.904  -55.876 -30.030 1.00 109.92 ? 0   VAL C CB    1 
ATOM   8817  N  N     . PRO E  1  3   ? -11.324 -55.376 -27.556 1.00 128.87 ? 1   PRO C N     1 
ATOM   8818  C  CA    . PRO E  1  3   ? -11.783 -54.256 -26.723 1.00 117.77 ? 1   PRO C CA    1 
ATOM   8819  C  C     . PRO E  1  3   ? -10.633 -53.662 -25.929 1.00 113.60 ? 1   PRO C C     1 
ATOM   8820  O  O     . PRO E  1  3   ? -9.465  -53.903 -26.250 1.00 118.13 ? 1   PRO C O     1 
ATOM   8821  C  CB    . PRO E  1  3   ? -12.822 -54.911 -25.814 1.00 113.67 ? 1   PRO C CB    1 
ATOM   8822  C  CG    . PRO E  1  3   ? -12.277 -56.285 -25.609 1.00 119.20 ? 1   PRO C CG    1 
ATOM   8823  C  CD    . PRO E  1  3   ? -11.554 -56.670 -26.888 1.00 127.97 ? 1   PRO C CD    1 
ATOM   8824  N  N     . ILE E  1  4   ? -10.941 -52.881 -24.902 1.00 114.01 ? 2   ILE C N     1 
ATOM   8825  C  CA    . ILE E  1  4   ? -9.935  -52.183 -24.118 1.00 116.22 ? 2   ILE C CA    1 
ATOM   8826  C  C     . ILE E  1  4   ? -10.187 -52.530 -22.652 1.00 119.16 ? 2   ILE C C     1 
ATOM   8827  O  O     . ILE E  1  4   ? -11.278 -52.962 -22.277 1.00 124.12 ? 2   ILE C O     1 
ATOM   8828  C  CB    . ILE E  1  4   ? -9.985  -50.660 -24.332 1.00 118.44 ? 2   ILE C CB    1 
ATOM   8829  C  CG1   . ILE E  1  4   ? -10.980 -50.284 -25.445 1.00 115.94 ? 2   ILE C CG1   1 
ATOM   8830  C  CG2   . ILE E  1  4   ? -8.603  -50.136 -24.628 1.00 120.63 ? 2   ILE C CG2   1 
ATOM   8831  C  CD1   . ILE E  1  4   ? -11.312 -48.812 -25.451 1.00 116.08 ? 2   ILE C CD1   1 
ATOM   8832  N  N     . SER E  1  5   ? -9.169  -52.337 -21.813 1.00 120.07 ? 3   SER C N     1 
ATOM   8833  C  CA    . SER E  1  5   ? -9.239  -52.677 -20.410 1.00 121.13 ? 3   SER C CA    1 
ATOM   8834  C  C     . SER E  1  5   ? -9.006  -51.394 -19.613 1.00 127.83 ? 3   SER C C     1 
ATOM   8835  O  O     . SER E  1  5   ? -8.151  -50.579 -20.005 1.00 134.00 ? 3   SER C O     1 
ATOM   8836  C  CB    . SER E  1  5   ? -8.179  -53.755 -20.072 1.00 121.95 ? 3   SER C CB    1 
ATOM   8837  O  OG    . SER E  1  5   ? -6.906  -53.339 -20.555 1.00 120.55 ? 3   SER C OG    1 
ATOM   8838  N  N     . PRO E  1  6   ? -9.701  -51.176 -18.505 1.00 122.33 ? 4   PRO C N     1 
ATOM   8839  C  CA    . PRO E  1  6   ? -9.529  -49.889 -17.791 1.00 112.84 ? 4   PRO C CA    1 
ATOM   8840  C  C     . PRO E  1  6   ? -8.787  -49.948 -16.454 1.00 119.37 ? 4   PRO C C     1 
ATOM   8841  O  O     . PRO E  1  6   ? -7.734  -49.325 -16.294 1.00 123.70 ? 4   PRO C O     1 
ATOM   8842  C  CB    . PRO E  1  6   ? -10.995 -49.438 -17.596 1.00 108.34 ? 4   PRO C CB    1 
ATOM   8843  C  CG    . PRO E  1  6   ? -11.795 -50.822 -17.458 1.00 111.91 ? 4   PRO C CG    1 
ATOM   8844  C  CD    . PRO E  1  6   ? -10.987 -51.843 -18.198 1.00 120.36 ? 4   PRO C CD    1 
ATOM   8845  N  N     . ILE E  1  7   ? -9.296  -50.728 -15.490 1.00 118.44 ? 5   ILE C N     1 
ATOM   8846  C  CA    . ILE E  1  7   ? -8.760  -50.752 -14.132 1.00 111.37 ? 5   ILE C CA    1 
ATOM   8847  C  C     . ILE E  1  7   ? -8.778  -52.185 -13.624 1.00 111.73 ? 5   ILE C C     1 
ATOM   8848  O  O     . ILE E  1  7   ? -9.517  -53.036 -14.125 1.00 122.85 ? 5   ILE C O     1 
ATOM   8849  C  CB    . ILE E  1  7   ? -9.507  -49.798 -13.174 1.00 115.52 ? 5   ILE C CB    1 
ATOM   8850  C  CG1   . ILE E  1  7   ? -10.956 -50.251 -12.951 1.00 104.74 ? 5   ILE C CG1   1 
ATOM   8851  C  CG2   . ILE E  1  7   ? -9.460  -48.369 -13.686 1.00 123.38 ? 5   ILE C CG2   1 
ATOM   8852  C  CD1   . ILE E  1  7   ? -11.795 -49.225 -12.259 1.00 86.15  ? 5   ILE C CD1   1 
ATOM   8853  N  N     . GLU E  1  8   ? -7.932  -52.451 -12.631 1.00 99.32  ? 6   GLU C N     1 
ATOM   8854  C  CA    . GLU E  1  8   ? -7.685  -53.837 -12.264 1.00 101.43 ? 6   GLU C CA    1 
ATOM   8855  C  C     . GLU E  1  8   ? -8.984  -54.494 -11.837 1.00 99.12  ? 6   GLU C C     1 
ATOM   8856  O  O     . GLU E  1  8   ? -9.717  -53.964 -11.001 1.00 103.30 ? 6   GLU C O     1 
ATOM   8857  C  CB    . GLU E  1  8   ? -6.642  -53.923 -11.141 1.00 109.68 ? 6   GLU C CB    1 
ATOM   8858  C  CG    . GLU E  1  8   ? -6.583  -55.304 -10.499 1.00 122.81 ? 6   GLU C CG    1 
ATOM   8859  C  CD    . GLU E  1  8   ? -5.700  -55.347 -9.273  1.00 136.50 ? 6   GLU C CD    1 
ATOM   8860  O  OE1   . GLU E  1  8   ? -4.619  -54.720 -9.286  1.00 141.37 ? 6   GLU C OE1   1 
ATOM   8861  O  OE2   . GLU E  1  8   ? -6.090  -56.011 -8.292  1.00 137.51 ? 6   GLU C OE2   1 
ATOM   8862  N  N     . THR E  1  9   ? -9.259  -55.645 -12.433 1.00 94.36  ? 7   THR C N     1 
ATOM   8863  C  CA    . THR E  1  9   ? -10.455 -56.405 -12.138 1.00 98.65  ? 7   THR C CA    1 
ATOM   8864  C  C     . THR E  1  9   ? -10.252 -57.195 -10.853 1.00 98.25  ? 7   THR C C     1 
ATOM   8865  O  O     . THR E  1  9   ? -9.125  -57.463 -10.430 1.00 96.57  ? 7   THR C O     1 
ATOM   8866  C  CB    . THR E  1  9   ? -10.802 -57.350 -13.298 1.00 101.89 ? 7   THR C CB    1 
ATOM   8867  O  OG1   . THR E  1  9   ? -11.974 -58.107 -12.973 1.00 105.23 ? 7   THR C OG1   1 
ATOM   8868  C  CG2   . THR E  1  9   ? -9.645  -58.289 -13.578 1.00 100.85 ? 7   THR C CG2   1 
ATOM   8869  N  N     . VAL E  1  10  ? -11.361 -57.557 -10.219 1.00 88.30  ? 8   VAL C N     1 
ATOM   8870  C  CA    . VAL E  1  10  ? -11.332 -58.297 -8.962  1.00 97.42  ? 8   VAL C CA    1 
ATOM   8871  C  C     . VAL E  1  10  ? -11.707 -59.747 -9.289  1.00 93.76  ? 8   VAL C C     1 
ATOM   8872  O  O     . VAL E  1  10  ? -12.839 -59.988 -9.728  1.00 91.66  ? 8   VAL C O     1 
ATOM   8873  C  CB    . VAL E  1  10  ? -12.291 -57.696 -7.928  1.00 94.34  ? 8   VAL C CB    1 
ATOM   8874  C  CG1   . VAL E  1  10  ? -12.443 -58.625 -6.726  1.00 86.15  ? 8   VAL C CG1   1 
ATOM   8875  C  CG2   . VAL E  1  10  ? -11.794 -56.325 -7.480  1.00 91.91  ? 8   VAL C CG2   1 
ATOM   8876  N  N     . PRO E  1  11  ? -10.790 -60.696 -9.142  1.00 91.04  ? 9   PRO C N     1 
ATOM   8877  C  CA    . PRO E  1  11  ? -11.134 -62.100 -9.409  1.00 94.14  ? 9   PRO C CA    1 
ATOM   8878  C  C     . PRO E  1  11  ? -12.337 -62.553 -8.597  1.00 101.08 ? 9   PRO C C     1 
ATOM   8879  O  O     . PRO E  1  11  ? -12.495 -62.195 -7.429  1.00 112.09 ? 9   PRO C O     1 
ATOM   8880  C  CB    . PRO E  1  11  ? -9.860  -62.853 -9.004  1.00 90.55  ? 9   PRO C CB    1 
ATOM   8881  C  CG    . PRO E  1  11  ? -8.768  -61.845 -9.142  1.00 89.39  ? 9   PRO C CG    1 
ATOM   8882  C  CD    . PRO E  1  11  ? -9.380  -60.536 -8.753  1.00 88.32  ? 9   PRO C CD    1 
ATOM   8883  N  N     . VAL E  1  12  ? -13.198 -63.345 -9.235  1.00 99.11  ? 10  VAL C N     1 
ATOM   8884  C  CA    . VAL E  1  12  ? -14.392 -63.886 -8.603  1.00 102.44 ? 10  VAL C CA    1 
ATOM   8885  C  C     . VAL E  1  12  ? -14.514 -65.340 -9.038  1.00 109.99 ? 10  VAL C C     1 
ATOM   8886  O  O     . VAL E  1  12  ? -13.866 -65.788 -9.987  1.00 110.38 ? 10  VAL C O     1 
ATOM   8887  C  CB    . VAL E  1  12  ? -15.684 -63.111 -8.971  1.00 103.66 ? 10  VAL C CB    1 
ATOM   8888  C  CG1   . VAL E  1  12  ? -16.765 -63.314 -7.910  1.00 104.66 ? 10  VAL C CG1   1 
ATOM   8889  C  CG2   . VAL E  1  12  ? -15.415 -61.630 -9.163  1.00 100.32 ? 10  VAL C CG2   1 
ATOM   8890  N  N     . LYS E  1  13  ? -15.389 -66.066 -8.350  1.00 113.38 ? 11  LYS C N     1 
ATOM   8891  C  CA    . LYS E  1  13  ? -15.618 -67.485 -8.581  1.00 111.10 ? 11  LYS C CA    1 
ATOM   8892  C  C     . LYS E  1  13  ? -16.998 -67.812 -8.036  1.00 107.27 ? 11  LYS C C     1 
ATOM   8893  O  O     . LYS E  1  13  ? -17.616 -67.010 -7.331  1.00 104.28 ? 11  LYS C O     1 
ATOM   8894  C  CB    . LYS E  1  13  ? -14.564 -68.370 -7.898  1.00 107.99 ? 11  LYS C CB    1 
ATOM   8895  C  CG    . LYS E  1  13  ? -13.170 -68.356 -8.507  1.00 112.70 ? 11  LYS C CG    1 
ATOM   8896  C  CD    . LYS E  1  13  ? -12.219 -67.508 -7.677  1.00 111.77 ? 11  LYS C CD    1 
ATOM   8897  C  CE    . LYS E  1  13  ? -10.825 -67.479 -8.282  1.00 111.77 ? 11  LYS C CE    1 
ATOM   8898  N  NZ    . LYS E  1  13  ? -9.879  -66.694 -7.441  1.00 108.41 ? 11  LYS C NZ    1 
ATOM   8899  N  N     . LEU E  1  14  ? -17.478 -68.997 -8.378  1.00 107.74 ? 12  LEU C N     1 
ATOM   8900  C  CA    . LEU E  1  14  ? -18.634 -69.562 -7.706  1.00 111.81 ? 12  LEU C CA    1 
ATOM   8901  C  C     . LEU E  1  14  ? -18.168 -70.555 -6.649  1.00 110.97 ? 12  LEU C C     1 
ATOM   8902  O  O     . LEU E  1  14  ? -16.980 -70.866 -6.529  1.00 106.51 ? 12  LEU C O     1 
ATOM   8903  C  CB    . LEU E  1  14  ? -19.569 -70.241 -8.712  1.00 117.97 ? 12  LEU C CB    1 
ATOM   8904  C  CG    . LEU E  1  14  ? -19.849 -69.479 -10.010 1.00 123.55 ? 12  LEU C CG    1 
ATOM   8905  C  CD1   . LEU E  1  14  ? -18.952 -69.988 -11.127 1.00 127.63 ? 12  LEU C CD1   1 
ATOM   8906  C  CD2   . LEU E  1  14  ? -21.317 -69.572 -10.403 1.00 127.69 ? 12  LEU C CD2   1 
ATOM   8907  N  N     . LYS E  1  15  ? -19.118 -71.049 -5.874  1.00 117.22 ? 13  LYS C N     1 
ATOM   8908  C  CA    . LYS E  1  15  ? -18.790 -71.993 -4.816  1.00 121.69 ? 13  LYS C CA    1 
ATOM   8909  C  C     . LYS E  1  15  ? -18.432 -73.324 -5.462  1.00 125.52 ? 13  LYS C C     1 
ATOM   8910  O  O     . LYS E  1  15  ? -19.280 -73.907 -6.150  1.00 124.80 ? 13  LYS C O     1 
ATOM   8911  C  CB    . LYS E  1  15  ? -19.955 -72.143 -3.845  1.00 119.40 ? 13  LYS C CB    1 
ATOM   8912  C  CG    . LYS E  1  15  ? -20.300 -70.849 -3.123  1.00 117.95 ? 13  LYS C CG    1 
ATOM   8913  C  CD    . LYS E  1  15  ? -21.317 -71.066 -2.018  1.00 118.99 ? 13  LYS C CD    1 
ATOM   8914  C  CE    . LYS E  1  15  ? -21.579 -69.771 -1.266  1.00 118.84 ? 13  LYS C CE    1 
ATOM   8915  N  NZ    . LYS E  1  15  ? -22.524 -69.960 -0.132  1.00 120.39 ? 13  LYS C NZ    1 
ATOM   8916  N  N     . PRO E  1  16  ? -17.205 -73.826 -5.286  1.00 124.73 ? 14  PRO C N     1 
ATOM   8917  C  CA    . PRO E  1  16  ? -16.620 -74.760 -6.261  1.00 128.44 ? 14  PRO C CA    1 
ATOM   8918  C  C     . PRO E  1  16  ? -17.549 -75.916 -6.610  1.00 134.45 ? 14  PRO C C     1 
ATOM   8919  O  O     . PRO E  1  16  ? -18.281 -76.433 -5.763  1.00 131.85 ? 14  PRO C O     1 
ATOM   8920  C  CB    . PRO E  1  16  ? -15.347 -75.253 -5.560  1.00 124.20 ? 14  PRO C CB    1 
ATOM   8921  C  CG    . PRO E  1  16  ? -15.522 -74.892 -4.112  1.00 117.55 ? 14  PRO C CG    1 
ATOM   8922  C  CD    . PRO E  1  16  ? -16.340 -73.642 -4.111  1.00 118.83 ? 14  PRO C CD    1 
ATOM   8923  N  N     . GLY E  1  17  ? -17.476 -76.343 -7.869  1.00 138.18 ? 15  GLY C N     1 
ATOM   8924  C  CA    . GLY E  1  17  ? -18.395 -77.332 -8.396  1.00 137.83 ? 15  GLY C CA    1 
ATOM   8925  C  C     . GLY E  1  17  ? -19.833 -76.863 -8.305  1.00 134.53 ? 15  GLY C C     1 
ATOM   8926  O  O     . GLY E  1  17  ? -20.680 -77.529 -7.702  1.00 131.08 ? 15  GLY C O     1 
ATOM   8927  N  N     . MET E  1  18  ? -20.114 -75.707 -8.904  1.00 133.88 ? 16  MET C N     1 
ATOM   8928  C  CA    . MET E  1  18  ? -21.473 -75.199 -9.024  1.00 132.41 ? 16  MET C CA    1 
ATOM   8929  C  C     . MET E  1  18  ? -21.553 -74.306 -10.254 1.00 127.74 ? 16  MET C C     1 
ATOM   8930  O  O     . MET E  1  18  ? -20.547 -73.756 -10.711 1.00 121.54 ? 16  MET C O     1 
ATOM   8931  C  CB    . MET E  1  18  ? -21.906 -74.435 -7.767  1.00 135.60 ? 16  MET C CB    1 
ATOM   8932  C  CG    . MET E  1  18  ? -23.381 -74.581 -7.426  1.00 140.06 ? 16  MET C CG    1 
ATOM   8933  S  SD    . MET E  1  18  ? -23.806 -73.846 -5.835  1.00 142.07 ? 16  MET C SD    1 
ATOM   8934  C  CE    . MET E  1  18  ? -25.467 -74.474 -5.601  1.00 142.01 ? 16  MET C CE    1 
ATOM   8935  N  N     . ASP E  1  19  ? -22.764 -74.167 -10.786 1.00 130.99 ? 17  ASP C N     1 
ATOM   8936  C  CA    . ASP E  1  19  ? -22.980 -73.572 -12.096 1.00 132.25 ? 17  ASP C CA    1 
ATOM   8937  C  C     . ASP E  1  19  ? -24.070 -72.511 -11.991 1.00 127.32 ? 17  ASP C C     1 
ATOM   8938  O  O     . ASP E  1  19  ? -24.773 -72.410 -10.984 1.00 116.29 ? 17  ASP C O     1 
ATOM   8939  C  CB    . ASP E  1  19  ? -23.351 -74.651 -13.125 1.00 135.62 ? 17  ASP C CB    1 
ATOM   8940  C  CG    . ASP E  1  19  ? -23.294 -74.147 -14.551 1.00 138.39 ? 17  ASP C CG    1 
ATOM   8941  O  OD1   . ASP E  1  19  ? -22.192 -73.787 -15.014 1.00 137.99 ? 17  ASP C OD1   1 
ATOM   8942  O  OD2   . ASP E  1  19  ? -24.353 -74.127 -15.211 1.00 142.67 ? 17  ASP C OD2   1 
ATOM   8943  N  N     . GLY E  1  20  ? -24.208 -71.714 -13.049 1.00 133.21 ? 18  GLY C N     1 
ATOM   8944  C  CA    . GLY E  1  20  ? -24.887 -70.442 -12.967 1.00 130.41 ? 18  GLY C CA    1 
ATOM   8945  C  C     . GLY E  1  20  ? -26.395 -70.535 -12.835 1.00 132.20 ? 18  GLY C C     1 
ATOM   8946  O  O     . GLY E  1  20  ? -26.965 -71.608 -12.615 1.00 134.58 ? 18  GLY C O     1 
ATOM   8947  N  N     . PRO E  1  21  ? -27.072 -69.388 -12.970 1.00 133.77 ? 19  PRO C N     1 
ATOM   8948  C  CA    . PRO E  1  21  ? -28.511 -69.332 -12.683 1.00 137.76 ? 19  PRO C CA    1 
ATOM   8949  C  C     . PRO E  1  21  ? -29.378 -69.451 -13.928 1.00 146.29 ? 19  PRO C C     1 
ATOM   8950  O  O     . PRO E  1  21  ? -29.328 -68.587 -14.810 1.00 150.48 ? 19  PRO C O     1 
ATOM   8951  C  CB    . PRO E  1  21  ? -28.668 -67.959 -12.022 1.00 132.32 ? 19  PRO C CB    1 
ATOM   8952  C  CG    . PRO E  1  21  ? -27.615 -67.115 -12.694 1.00 130.40 ? 19  PRO C CG    1 
ATOM   8953  C  CD    . PRO E  1  21  ? -26.486 -68.043 -13.112 1.00 131.57 ? 19  PRO C CD    1 
ATOM   8954  N  N     . LYS E  1  22  ? -30.187 -70.503 -14.013 1.00 147.17 ? 20  LYS C N     1 
ATOM   8955  C  CA    . LYS E  1  22  ? -31.173 -70.644 -15.083 1.00 147.88 ? 20  LYS C CA    1 
ATOM   8956  C  C     . LYS E  1  22  ? -32.565 -70.469 -14.480 1.00 149.28 ? 20  LYS C C     1 
ATOM   8957  O  O     . LYS E  1  22  ? -33.097 -71.382 -13.841 1.00 151.01 ? 20  LYS C O     1 
ATOM   8958  C  CB    . LYS E  1  22  ? -31.021 -71.990 -15.787 1.00 145.10 ? 20  LYS C CB    1 
ATOM   8959  C  CG    . LYS E  1  22  ? -29.668 -72.175 -16.465 1.00 142.10 ? 20  LYS C CG    1 
ATOM   8960  C  CD    . LYS E  1  22  ? -29.727 -73.210 -17.580 1.00 144.14 ? 20  LYS C CD    1 
ATOM   8961  C  CE    . LYS E  1  22  ? -29.812 -74.628 -17.040 1.00 142.82 ? 20  LYS C CE    1 
ATOM   8962  N  NZ    . LYS E  1  22  ? -28.539 -75.060 -16.398 1.00 139.75 ? 20  LYS C NZ    1 
ATOM   8963  N  N     . VAL E  1  23  ? -33.151 -69.296 -14.709 1.00 147.96 ? 21  VAL C N     1 
ATOM   8964  C  CA    . VAL E  1  23  ? -34.528 -68.981 -14.336 1.00 150.63 ? 21  VAL C CA    1 
ATOM   8965  C  C     . VAL E  1  23  ? -35.076 -68.002 -15.366 1.00 157.14 ? 21  VAL C C     1 
ATOM   8966  O  O     . VAL E  1  23  ? -34.365 -67.101 -15.818 1.00 161.04 ? 21  VAL C O     1 
ATOM   8967  C  CB    . VAL E  1  23  ? -34.624 -68.399 -12.908 1.00 147.37 ? 21  VAL C CB    1 
ATOM   8968  C  CG1   . VAL E  1  23  ? -34.662 -69.512 -11.871 1.00 146.34 ? 21  VAL C CG1   1 
ATOM   8969  C  CG2   . VAL E  1  23  ? -33.460 -67.458 -12.640 1.00 144.01 ? 21  VAL C CG2   1 
ATOM   8970  N  N     . LYS E  1  24  ? -36.340 -68.178 -15.739 1.00 158.55 ? 22  LYS C N     1 
ATOM   8971  C  CA    . LYS E  1  24  ? -36.917 -67.321 -16.764 1.00 156.02 ? 22  LYS C CA    1 
ATOM   8972  C  C     . LYS E  1  24  ? -37.317 -65.956 -16.200 1.00 153.74 ? 22  LYS C C     1 
ATOM   8973  O  O     . LYS E  1  24  ? -37.564 -65.786 -15.003 1.00 152.71 ? 22  LYS C O     1 
ATOM   8974  C  CB    . LYS E  1  24  ? -38.122 -68.004 -17.412 1.00 152.59 ? 22  LYS C CB    1 
ATOM   8975  C  CG    . LYS E  1  24  ? -37.837 -69.425 -17.885 1.00 150.42 ? 22  LYS C CG    1 
ATOM   8976  C  CD    . LYS E  1  24  ? -38.456 -69.708 -19.247 1.00 152.60 ? 22  LYS C CD    1 
ATOM   8977  C  CE    . LYS E  1  24  ? -37.724 -68.965 -20.355 1.00 149.09 ? 22  LYS C CE    1 
ATOM   8978  N  NZ    . LYS E  1  24  ? -38.259 -69.304 -21.704 1.00 148.67 ? 22  LYS C NZ    1 
ATOM   8979  N  N     . GLN E  1  25  ? -37.377 -64.980 -17.104 1.00 150.88 ? 23  GLN C N     1 
ATOM   8980  C  CA    . GLN E  1  25  ? -37.668 -63.585 -16.798 1.00 145.66 ? 23  GLN C CA    1 
ATOM   8981  C  C     . GLN E  1  25  ? -39.112 -63.381 -16.340 1.00 145.56 ? 23  GLN C C     1 
ATOM   8982  O  O     . GLN E  1  25  ? -40.008 -64.180 -16.627 1.00 141.74 ? 23  GLN C O     1 
ATOM   8983  C  CB    . GLN E  1  25  ? -37.389 -62.711 -18.020 1.00 144.77 ? 23  GLN C CB    1 
ATOM   8984  C  CG    . GLN E  1  25  ? -36.147 -61.850 -17.900 1.00 143.59 ? 23  GLN C CG    1 
ATOM   8985  C  CD    . GLN E  1  25  ? -36.471 -60.419 -17.525 1.00 143.59 ? 23  GLN C CD    1 
ATOM   8986  O  OE1   . GLN E  1  25  ? -37.620 -60.087 -17.234 1.00 142.09 ? 23  GLN C OE1   1 
ATOM   8987  N  NE2   . GLN E  1  25  ? -35.459 -59.560 -17.540 1.00 144.47 ? 23  GLN C NE2   1 
ATOM   8988  N  N     . TRP E  1  26  ? -39.324 -62.286 -15.605 1.00 150.53 ? 24  TRP C N     1 
ATOM   8989  C  CA    . TRP E  1  26  ? -40.664 -61.913 -15.175 1.00 154.10 ? 24  TRP C CA    1 
ATOM   8990  C  C     . TRP E  1  26  ? -41.520 -61.541 -16.384 1.00 155.70 ? 24  TRP C C     1 
ATOM   8991  O  O     . TRP E  1  26  ? -41.001 -61.075 -17.403 1.00 157.88 ? 24  TRP C O     1 
ATOM   8992  C  CB    . TRP E  1  26  ? -40.642 -60.705 -14.237 1.00 157.22 ? 24  TRP C CB    1 
ATOM   8993  C  CG    . TRP E  1  26  ? -39.870 -60.819 -12.963 1.00 160.20 ? 24  TRP C CG    1 
ATOM   8994  C  CD1   . TRP E  1  26  ? -38.559 -60.507 -12.775 1.00 159.07 ? 24  TRP C CD1   1 
ATOM   8995  C  CD2   . TRP E  1  26  ? -40.378 -61.204 -11.679 1.00 161.75 ? 24  TRP C CD2   1 
ATOM   8996  N  NE1   . TRP E  1  26  ? -38.205 -60.707 -11.462 1.00 157.91 ? 24  TRP C NE1   1 
ATOM   8997  C  CE2   . TRP E  1  26  ? -39.306 -61.133 -10.768 1.00 159.78 ? 24  TRP C CE2   1 
ATOM   8998  C  CE3   . TRP E  1  26  ? -41.631 -61.617 -11.215 1.00 162.01 ? 24  TRP C CE3   1 
ATOM   8999  C  CZ2   . TRP E  1  26  ? -39.447 -61.461 -9.420  1.00 158.11 ? 24  TRP C CZ2   1 
ATOM   9000  C  CZ3   . TRP E  1  26  ? -41.769 -61.942 -9.876  1.00 160.27 ? 24  TRP C CZ3   1 
ATOM   9001  C  CH2   . TRP E  1  26  ? -40.684 -61.862 -8.995  1.00 157.93 ? 24  TRP C CH2   1 
ATOM   9002  N  N     . PRO E  1  27  ? -42.905 -61.751 -16.297 1.00 157.54 ? 25  PRO C N     1 
ATOM   9003  C  CA    . PRO E  1  27  ? -43.803 -61.156 -17.310 1.00 162.31 ? 25  PRO C CA    1 
ATOM   9004  C  C     . PRO E  1  27  ? -44.108 -59.703 -16.962 1.00 166.15 ? 25  PRO C C     1 
ATOM   9005  O  O     . PRO E  1  27  ? -45.221 -59.325 -16.575 1.00 169.22 ? 25  PRO C O     1 
ATOM   9006  C  CB    . PRO E  1  27  ? -45.032 -62.065 -17.231 1.00 160.37 ? 25  PRO C CB    1 
ATOM   9007  C  CG    . PRO E  1  27  ? -45.065 -62.507 -15.803 1.00 156.95 ? 25  PRO C CG    1 
ATOM   9008  C  CD    . PRO E  1  27  ? -43.625 -62.638 -15.367 1.00 155.85 ? 25  PRO C CD    1 
ATOM   9009  N  N     . LEU E  1  28  ? -43.089 -58.857 -17.105 1.00 164.92 ? 26  LEU C N     1 
ATOM   9010  C  CA    . LEU E  1  28  ? -43.151 -57.487 -16.617 1.00 163.75 ? 26  LEU C CA    1 
ATOM   9011  C  C     . LEU E  1  28  ? -44.043 -56.604 -17.484 1.00 169.45 ? 26  LEU C C     1 
ATOM   9012  O  O     . LEU E  1  28  ? -44.419 -56.948 -18.608 1.00 173.38 ? 26  LEU C O     1 
ATOM   9013  C  CB    . LEU E  1  28  ? -41.757 -56.868 -16.562 1.00 159.93 ? 26  LEU C CB    1 
ATOM   9014  C  CG    . LEU E  1  28  ? -40.820 -57.284 -15.433 1.00 158.00 ? 26  LEU C CG    1 
ATOM   9015  C  CD1   . LEU E  1  28  ? -39.586 -56.409 -15.469 1.00 157.30 ? 26  LEU C CD1   1 
ATOM   9016  C  CD2   . LEU E  1  28  ? -41.516 -57.179 -14.088 1.00 158.09 ? 26  LEU C CD2   1 
ATOM   9017  N  N     . THR E  1  29  ? -44.385 -55.445 -16.920 1.00 169.78 ? 27  THR C N     1 
ATOM   9018  C  CA    . THR E  1  29  ? -45.237 -54.476 -17.594 1.00 170.99 ? 27  THR C CA    1 
ATOM   9019  C  C     . THR E  1  29  ? -44.569 -53.991 -18.876 1.00 170.52 ? 27  THR C C     1 
ATOM   9020  O  O     . THR E  1  29  ? -43.344 -53.852 -18.942 1.00 171.55 ? 27  THR C O     1 
ATOM   9021  C  CB    . THR E  1  29  ? -45.527 -53.294 -16.669 1.00 168.78 ? 27  THR C CB    1 
ATOM   9022  O  OG1   . THR E  1  29  ? -45.793 -53.777 -15.345 1.00 167.82 ? 27  THR C OG1   1 
ATOM   9023  C  CG2   . THR E  1  29  ? -46.735 -52.517 -17.164 1.00 169.89 ? 27  THR C CG2   1 
ATOM   9024  N  N     . GLU E  1  30  ? -45.384 -53.739 -19.902 1.00 169.69 ? 28  GLU C N     1 
ATOM   9025  C  CA    . GLU E  1  30  ? -44.849 -53.230 -21.162 1.00 171.95 ? 28  GLU C CA    1 
ATOM   9026  C  C     . GLU E  1  30  ? -44.181 -51.872 -20.981 1.00 171.36 ? 28  GLU C C     1 
ATOM   9027  O  O     . GLU E  1  30  ? -43.159 -51.590 -21.618 1.00 172.42 ? 28  GLU C O     1 
ATOM   9028  C  CB    . GLU E  1  30  ? -45.959 -53.153 -22.210 1.00 174.01 ? 28  GLU C CB    1 
ATOM   9029  C  CG    . GLU E  1  30  ? -47.367 -53.140 -21.633 1.00 173.71 ? 28  GLU C CG    1 
ATOM   9030  C  CD    . GLU E  1  30  ? -48.434 -53.250 -22.706 1.00 175.07 ? 28  GLU C CD    1 
ATOM   9031  O  OE1   . GLU E  1  30  ? -49.262 -52.321 -22.825 1.00 175.09 ? 28  GLU C OE1   1 
ATOM   9032  O  OE2   . GLU E  1  30  ? -48.440 -54.263 -23.437 1.00 175.53 ? 28  GLU C OE2   1 
ATOM   9033  N  N     . GLU E  1  31  ? -44.751 -51.007 -20.134 1.00 168.79 ? 29  GLU C N     1 
ATOM   9034  C  CA    . GLU E  1  31  ? -44.136 -49.701 -19.906 1.00 164.29 ? 29  GLU C CA    1 
ATOM   9035  C  C     . GLU E  1  31  ? -42.732 -49.851 -19.331 1.00 159.19 ? 29  GLU C C     1 
ATOM   9036  O  O     . GLU E  1  31  ? -41.830 -49.073 -19.661 1.00 155.05 ? 29  GLU C O     1 
ATOM   9037  C  CB    . GLU E  1  31  ? -45.013 -48.837 -18.993 1.00 163.34 ? 29  GLU C CB    1 
ATOM   9038  C  CG    . GLU E  1  31  ? -45.114 -49.299 -17.547 1.00 162.52 ? 29  GLU C CG    1 
ATOM   9039  C  CD    . GLU E  1  31  ? -45.420 -48.158 -16.593 1.00 161.85 ? 29  GLU C CD    1 
ATOM   9040  O  OE1   . GLU E  1  31  ? -44.601 -47.904 -15.685 1.00 155.58 ? 29  GLU C OE1   1 
ATOM   9041  O  OE2   . GLU E  1  31  ? -46.473 -47.507 -16.759 1.00 165.50 ? 29  GLU C OE2   1 
ATOM   9042  N  N     . LYS E  1  32  ? -42.532 -50.847 -18.463 1.00 159.27 ? 30  LYS C N     1 
ATOM   9043  C  CA    . LYS E  1  32  ? -41.193 -51.136 -17.960 1.00 155.08 ? 30  LYS C CA    1 
ATOM   9044  C  C     . LYS E  1  32  ? -40.277 -51.599 -19.084 1.00 158.68 ? 30  LYS C C     1 
ATOM   9045  O  O     . LYS E  1  32  ? -39.114 -51.184 -19.160 1.00 159.54 ? 30  LYS C O     1 
ATOM   9046  C  CB    . LYS E  1  32  ? -41.260 -52.199 -16.863 1.00 147.80 ? 30  LYS C CB    1 
ATOM   9047  C  CG    . LYS E  1  32  ? -42.039 -51.794 -15.624 1.00 144.07 ? 30  LYS C CG    1 
ATOM   9048  C  CD    . LYS E  1  32  ? -41.320 -50.706 -14.847 1.00 138.26 ? 30  LYS C CD    1 
ATOM   9049  C  CE    . LYS E  1  32  ? -41.843 -50.616 -13.423 1.00 133.74 ? 30  LYS C CE    1 
ATOM   9050  N  NZ    . LYS E  1  32  ? -41.590 -51.875 -12.669 1.00 130.56 ? 30  LYS C NZ    1 
ATOM   9051  N  N     . ILE E  1  33  ? -40.784 -52.467 -19.961 1.00 160.03 ? 31  ILE C N     1 
ATOM   9052  C  CA    . ILE E  1  33  ? -39.941 -53.087 -20.980 1.00 159.81 ? 31  ILE C CA    1 
ATOM   9053  C  C     . ILE E  1  33  ? -39.415 -52.043 -21.957 1.00 159.58 ? 31  ILE C C     1 
ATOM   9054  O  O     . ILE E  1  33  ? -38.223 -52.027 -22.286 1.00 156.10 ? 31  ILE C O     1 
ATOM   9055  C  CB    . ILE E  1  33  ? -40.715 -54.201 -21.705 1.00 161.32 ? 31  ILE C CB    1 
ATOM   9056  C  CG1   . ILE E  1  33  ? -41.071 -55.323 -20.727 1.00 158.82 ? 31  ILE C CG1   1 
ATOM   9057  C  CG2   . ILE E  1  33  ? -39.901 -54.740 -22.861 1.00 161.76 ? 31  ILE C CG2   1 
ATOM   9058  C  CD1   . ILE E  1  33  ? -41.885 -56.436 -21.343 1.00 159.16 ? 31  ILE C CD1   1 
ATOM   9059  N  N     . LYS E  1  34  ? -40.287 -51.145 -22.425 1.00 162.37 ? 32  LYS C N     1 
ATOM   9060  C  CA    . LYS E  1  34  ? -39.841 -50.115 -23.360 1.00 161.57 ? 32  LYS C CA    1 
ATOM   9061  C  C     . LYS E  1  34  ? -38.840 -49.175 -22.700 1.00 154.55 ? 32  LYS C C     1 
ATOM   9062  O  O     . LYS E  1  34  ? -37.866 -48.749 -23.333 1.00 154.98 ? 32  LYS C O     1 
ATOM   9063  C  CB    . LYS E  1  34  ? -41.038 -49.338 -23.907 1.00 163.86 ? 32  LYS C CB    1 
ATOM   9064  C  CG    . LYS E  1  34  ? -41.977 -50.174 -24.766 1.00 164.80 ? 32  LYS C CG    1 
ATOM   9065  C  CD    . LYS E  1  34  ? -43.034 -49.314 -25.444 1.00 162.82 ? 32  LYS C CD    1 
ATOM   9066  C  CE    . LYS E  1  34  ? -42.483 -48.616 -26.680 1.00 163.32 ? 32  LYS C CE    1 
ATOM   9067  N  NZ    . LYS E  1  34  ? -42.216 -49.571 -27.793 1.00 165.79 ? 32  LYS C NZ    1 
ATOM   9068  N  N     . ALA E  1  35  ? -39.073 -48.828 -21.432 1.00 147.03 ? 33  ALA C N     1 
ATOM   9069  C  CA    . ALA E  1  35  ? -38.086 -48.059 -20.682 1.00 144.14 ? 33  ALA C CA    1 
ATOM   9070  C  C     . ALA E  1  35  ? -36.771 -48.816 -20.557 1.00 144.01 ? 33  ALA C C     1 
ATOM   9071  O  O     . ALA E  1  35  ? -35.698 -48.203 -20.549 1.00 141.75 ? 33  ALA C O     1 
ATOM   9072  C  CB    . ALA E  1  35  ? -38.632 -47.709 -19.298 1.00 140.95 ? 33  ALA C CB    1 
ATOM   9073  N  N     . LEU E  1  36  ? -36.834 -50.144 -20.447 1.00 146.39 ? 34  LEU C N     1 
ATOM   9074  C  CA    . LEU E  1  36  ? -35.630 -50.938 -20.223 1.00 145.70 ? 34  LEU C CA    1 
ATOM   9075  C  C     . LEU E  1  36  ? -34.755 -50.972 -21.471 1.00 148.18 ? 34  LEU C C     1 
ATOM   9076  O  O     . LEU E  1  36  ? -33.576 -50.601 -21.425 1.00 144.05 ? 34  LEU C O     1 
ATOM   9077  C  CB    . LEU E  1  36  ? -36.008 -52.351 -19.775 1.00 145.32 ? 34  LEU C CB    1 
ATOM   9078  C  CG    . LEU E  1  36  ? -35.205 -52.891 -18.588 1.00 141.86 ? 34  LEU C CG    1 
ATOM   9079  C  CD1   . LEU E  1  36  ? -35.826 -54.171 -18.052 1.00 137.50 ? 34  LEU C CD1   1 
ATOM   9080  C  CD2   . LEU E  1  36  ? -33.751 -53.119 -18.971 1.00 146.27 ? 34  LEU C CD2   1 
ATOM   9081  N  N     . VAL E  1  37  ? -35.311 -51.442 -22.595 1.00 152.67 ? 35  VAL C N     1 
ATOM   9082  C  CA    . VAL E  1  37  ? -34.547 -51.528 -23.842 1.00 151.20 ? 35  VAL C CA    1 
ATOM   9083  C  C     . VAL E  1  37  ? -33.920 -50.188 -24.192 1.00 150.83 ? 35  VAL C C     1 
ATOM   9084  O  O     . VAL E  1  37  ? -32.866 -50.134 -24.838 1.00 150.51 ? 35  VAL C O     1 
ATOM   9085  C  CB    . VAL E  1  37  ? -35.446 -52.033 -24.991 1.00 147.66 ? 35  VAL C CB    1 
ATOM   9086  C  CG1   . VAL E  1  37  ? -34.598 -52.472 -26.177 1.00 145.95 ? 35  VAL C CG1   1 
ATOM   9087  C  CG2   . VAL E  1  37  ? -36.339 -53.161 -24.521 1.00 147.22 ? 35  VAL C CG2   1 
ATOM   9088  N  N     . GLU E  1  38  ? -34.554 -49.090 -23.782 1.00 149.45 ? 36  GLU C N     1 
ATOM   9089  C  CA    . GLU E  1  38  ? -33.967 -47.760 -23.878 1.00 149.87 ? 36  GLU C CA    1 
ATOM   9090  C  C     . GLU E  1  38  ? -32.583 -47.722 -23.242 1.00 149.68 ? 36  GLU C C     1 
ATOM   9091  O  O     . GLU E  1  38  ? -31.575 -47.614 -23.946 1.00 147.95 ? 36  GLU C O     1 
ATOM   9092  C  CB    . GLU E  1  38  ? -34.878 -46.721 -23.223 1.00 150.54 ? 36  GLU C CB    1 
ATOM   9093  C  CG    . GLU E  1  38  ? -34.341 -45.302 -23.289 1.00 151.47 ? 36  GLU C CG    1 
ATOM   9094  C  CD    . GLU E  1  38  ? -35.207 -44.320 -22.527 1.00 152.21 ? 36  GLU C CD    1 
ATOM   9095  O  OE1   . GLU E  1  38  ? -36.112 -44.769 -21.794 1.00 152.83 ? 36  GLU C OE1   1 
ATOM   9096  O  OE2   . GLU E  1  38  ? -34.982 -43.099 -22.662 1.00 150.78 ? 36  GLU C OE2   1 
ATOM   9097  N  N     . ILE E  1  39  ? -32.527 -47.839 -21.912 1.00 149.20 ? 37  ILE C N     1 
ATOM   9098  C  CA    . ILE E  1  39  ? -31.273 -47.624 -21.195 1.00 146.11 ? 37  ILE C CA    1 
ATOM   9099  C  C     . ILE E  1  39  ? -30.307 -48.785 -21.400 1.00 141.77 ? 37  ILE C C     1 
ATOM   9100  O  O     . ILE E  1  39  ? -29.085 -48.589 -21.395 1.00 140.20 ? 37  ILE C O     1 
ATOM   9101  C  CB    . ILE E  1  39  ? -31.558 -47.403 -19.697 1.00 144.33 ? 37  ILE C CB    1 
ATOM   9102  C  CG1   . ILE E  1  39  ? -32.732 -46.441 -19.501 1.00 145.05 ? 37  ILE C CG1   1 
ATOM   9103  C  CG2   . ILE E  1  39  ? -30.317 -46.876 -18.990 1.00 138.99 ? 37  ILE C CG2   1 
ATOM   9104  C  CD1   . ILE E  1  39  ? -32.367 -44.983 -19.662 1.00 143.80 ? 37  ILE C CD1   1 
ATOM   9105  N  N     . CYS E  1  40  ? -30.824 -50.003 -21.575 1.00 139.57 ? 38  CYS C N     1 
ATOM   9106  C  CA    . CYS E  1  40  ? -29.986 -51.126 -21.991 1.00 144.80 ? 38  CYS C CA    1 
ATOM   9107  C  C     . CYS E  1  40  ? -29.198 -50.809 -23.258 1.00 149.73 ? 38  CYS C C     1 
ATOM   9108  O  O     . CYS E  1  40  ? -27.974 -50.978 -23.300 1.00 152.67 ? 38  CYS C O     1 
ATOM   9109  C  CB    . CYS E  1  40  ? -30.836 -52.380 -22.192 1.00 150.12 ? 38  CYS C CB    1 
ATOM   9110  S  SG    . CYS E  1  40  ? -29.843 -53.875 -22.412 1.00 157.51 ? 38  CYS C SG    1 
ATOM   9111  N  N     . THR E  1  41  ? -29.892 -50.379 -24.315 1.00 146.44 ? 39  THR C N     1 
ATOM   9112  C  CA    . THR E  1  41  ? -29.233 -50.164 -25.600 1.00 141.79 ? 39  THR C CA    1 
ATOM   9113  C  C     . THR E  1  41  ? -28.108 -49.138 -25.498 1.00 138.62 ? 39  THR C C     1 
ATOM   9114  O  O     . THR E  1  41  ? -27.082 -49.268 -26.176 1.00 139.49 ? 39  THR C O     1 
ATOM   9115  C  CB    . THR E  1  41  ? -30.259 -49.730 -26.648 1.00 144.14 ? 39  THR C CB    1 
ATOM   9116  O  OG1   . THR E  1  41  ? -31.369 -50.635 -26.634 1.00 149.28 ? 39  THR C OG1   1 
ATOM   9117  C  CG2   . THR E  1  41  ? -29.637 -49.732 -28.036 1.00 139.50 ? 39  THR C CG2   1 
ATOM   9118  N  N     . GLU E  1  42  ? -28.276 -48.114 -24.656 1.00 138.48 ? 40  GLU C N     1 
ATOM   9119  C  CA    . GLU E  1  42  ? -27.177 -47.182 -24.417 1.00 138.66 ? 40  GLU C CA    1 
ATOM   9120  C  C     . GLU E  1  42  ? -25.966 -47.894 -23.825 1.00 140.08 ? 40  GLU C C     1 
ATOM   9121  O  O     . GLU E  1  42  ? -24.821 -47.546 -24.133 1.00 141.14 ? 40  GLU C O     1 
ATOM   9122  C  CB    . GLU E  1  42  ? -27.626 -46.043 -23.499 1.00 134.29 ? 40  GLU C CB    1 
ATOM   9123  C  CG    . GLU E  1  42  ? -29.132 -45.831 -23.403 1.00 138.49 ? 40  GLU C CG    1 
ATOM   9124  C  CD    . GLU E  1  42  ? -29.754 -45.206 -24.645 1.00 149.45 ? 40  GLU C CD    1 
ATOM   9125  O  OE1   . GLU E  1  42  ? -29.456 -45.652 -25.772 1.00 155.48 ? 40  GLU C OE1   1 
ATOM   9126  O  OE2   . GLU E  1  42  ? -30.557 -44.262 -24.487 1.00 151.08 ? 40  GLU C OE2   1 
ATOM   9127  N  N     . MET E  1  43  ? -26.201 -48.887 -22.962 1.00 138.73 ? 41  MET C N     1 
ATOM   9128  C  CA    . MET E  1  43  ? -25.094 -49.648 -22.389 1.00 134.64 ? 41  MET C CA    1 
ATOM   9129  C  C     . MET E  1  43  ? -24.302 -50.376 -23.470 1.00 138.10 ? 41  MET C C     1 
ATOM   9130  O  O     . MET E  1  43  ? -23.072 -50.475 -23.383 1.00 140.65 ? 41  MET C O     1 
ATOM   9131  C  CB    . MET E  1  43  ? -25.608 -50.622 -21.329 1.00 128.68 ? 41  MET C CB    1 
ATOM   9132  C  CG    . MET E  1  43  ? -26.026 -49.940 -20.034 1.00 120.48 ? 41  MET C CG    1 
ATOM   9133  S  SD    . MET E  1  43  ? -26.690 -51.079 -18.805 1.00 113.85 ? 41  MET C SD    1 
ATOM   9134  C  CE    . MET E  1  43  ? -28.291 -50.335 -18.498 1.00 110.49 ? 41  MET C CE    1 
ATOM   9135  N  N     . GLU E  1  44  ? -24.987 -50.909 -24.487 1.00 136.30 ? 42  GLU C N     1 
ATOM   9136  C  CA    . GLU E  1  44  ? -24.280 -51.619 -25.550 1.00 136.21 ? 42  GLU C CA    1 
ATOM   9137  C  C     . GLU E  1  44  ? -23.321 -50.690 -26.281 1.00 129.72 ? 42  GLU C C     1 
ATOM   9138  O  O     . GLU E  1  44  ? -22.184 -51.070 -26.585 1.00 125.28 ? 42  GLU C O     1 
ATOM   9139  C  CB    . GLU E  1  44  ? -25.269 -52.219 -26.549 1.00 146.00 ? 42  GLU C CB    1 
ATOM   9140  C  CG    . GLU E  1  44  ? -26.574 -52.720 -25.967 1.00 152.11 ? 42  GLU C CG    1 
ATOM   9141  C  CD    . GLU E  1  44  ? -27.581 -53.049 -27.051 1.00 157.83 ? 42  GLU C CD    1 
ATOM   9142  O  OE1   . GLU E  1  44  ? -27.222 -52.937 -28.242 1.00 152.51 ? 42  GLU C OE1   1 
ATOM   9143  O  OE2   . GLU E  1  44  ? -28.728 -53.412 -26.718 1.00 163.60 ? 42  GLU C OE2   1 
ATOM   9144  N  N     . LYS E  1  45  ? -23.772 -49.470 -26.585 1.00 130.56 ? 43  LYS C N     1 
ATOM   9145  C  CA    . LYS E  1  45  ? -22.937 -48.527 -27.321 1.00 132.55 ? 43  LYS C CA    1 
ATOM   9146  C  C     . LYS E  1  45  ? -21.675 -48.190 -26.538 1.00 127.54 ? 43  LYS C C     1 
ATOM   9147  O  O     . LYS E  1  45  ? -20.594 -48.032 -27.118 1.00 127.68 ? 43  LYS C O     1 
ATOM   9148  C  CB    . LYS E  1  45  ? -23.734 -47.261 -27.638 1.00 133.82 ? 43  LYS C CB    1 
ATOM   9149  C  CG    . LYS E  1  45  ? -23.002 -46.265 -28.518 1.00 136.38 ? 43  LYS C CG    1 
ATOM   9150  C  CD    . LYS E  1  45  ? -23.874 -45.058 -28.823 1.00 136.83 ? 43  LYS C CD    1 
ATOM   9151  C  CE    . LYS E  1  45  ? -23.148 -44.067 -29.717 1.00 132.99 ? 43  LYS C CE    1 
ATOM   9152  N  NZ    . LYS E  1  45  ? -23.980 -42.869 -30.012 1.00 128.83 ? 43  LYS C NZ    1 
ATOM   9153  N  N     . GLU E  1  46  ? -21.796 -48.076 -25.218 1.00 122.51 ? 44  GLU C N     1 
ATOM   9154  C  CA    . GLU E  1  46  ? -20.681 -47.737 -24.347 1.00 120.36 ? 44  GLU C CA    1 
ATOM   9155  C  C     . GLU E  1  46  ? -19.949 -48.967 -23.823 1.00 115.09 ? 44  GLU C C     1 
ATOM   9156  O  O     . GLU E  1  46  ? -18.979 -48.821 -23.073 1.00 107.41 ? 44  GLU C O     1 
ATOM   9157  C  CB    . GLU E  1  46  ? -21.180 -46.879 -23.179 1.00 125.43 ? 44  GLU C CB    1 
ATOM   9158  C  CG    . GLU E  1  46  ? -21.957 -45.649 -23.633 1.00 130.33 ? 44  GLU C CG    1 
ATOM   9159  C  CD    . GLU E  1  46  ? -22.429 -44.781 -22.483 1.00 136.69 ? 44  GLU C CD    1 
ATOM   9160  O  OE1   . GLU E  1  46  ? -22.711 -45.326 -21.396 1.00 137.85 ? 44  GLU C OE1   1 
ATOM   9161  O  OE2   . GLU E  1  46  ? -22.515 -43.549 -22.669 1.00 136.06 ? 44  GLU C OE2   1 
ATOM   9162  N  N     . GLY E  1  47  ? -20.391 -50.168 -24.195 1.00 121.36 ? 45  GLY C N     1 
ATOM   9163  C  CA    . GLY E  1  47  ? -19.691 -51.391 -23.865 1.00 122.04 ? 45  GLY C CA    1 
ATOM   9164  C  C     . GLY E  1  47  ? -19.993 -51.965 -22.499 1.00 123.68 ? 45  GLY C C     1 
ATOM   9165  O  O     . GLY E  1  47  ? -19.407 -52.993 -22.135 1.00 124.35 ? 45  GLY C O     1 
ATOM   9166  N  N     . LYS E  1  48  ? -20.881 -51.335 -21.728 1.00 121.55 ? 46  LYS C N     1 
ATOM   9167  C  CA    . LYS E  1  48  ? -21.233 -51.860 -20.413 1.00 117.43 ? 46  LYS C CA    1 
ATOM   9168  C  C     . LYS E  1  48  ? -21.939 -53.208 -20.517 1.00 120.28 ? 46  LYS C C     1 
ATOM   9169  O  O     . LYS E  1  48  ? -21.733 -54.090 -19.675 1.00 118.90 ? 46  LYS C O     1 
ATOM   9170  C  CB    . LYS E  1  48  ? -22.097 -50.843 -19.669 1.00 118.23 ? 46  LYS C CB    1 
ATOM   9171  C  CG    . LYS E  1  48  ? -21.410 -49.495 -19.495 1.00 116.99 ? 46  LYS C CG    1 
ATOM   9172  C  CD    . LYS E  1  48  ? -22.357 -48.422 -18.988 1.00 117.24 ? 46  LYS C CD    1 
ATOM   9173  C  CE    . LYS E  1  48  ? -21.646 -47.080 -18.882 1.00 114.62 ? 46  LYS C CE    1 
ATOM   9174  N  NZ    . LYS E  1  48  ? -22.558 -45.988 -18.444 1.00 112.97 ? 46  LYS C NZ    1 
ATOM   9175  N  N     . ILE E  1  49  ? -22.777 -53.387 -21.536 1.00 127.06 ? 47  ILE C N     1 
ATOM   9176  C  CA    . ILE E  1  49  ? -23.519 -54.625 -21.743 1.00 132.60 ? 47  ILE C CA    1 
ATOM   9177  C  C     . ILE E  1  49  ? -23.227 -55.149 -23.146 1.00 135.21 ? 47  ILE C C     1 
ATOM   9178  O  O     . ILE E  1  49  ? -23.108 -54.369 -24.098 1.00 137.31 ? 47  ILE C O     1 
ATOM   9179  C  CB    . ILE E  1  49  ? -25.032 -54.415 -21.501 1.00 135.02 ? 47  ILE C CB    1 
ATOM   9180  C  CG1   . ILE E  1  49  ? -25.613 -55.584 -20.709 1.00 133.35 ? 47  ILE C CG1   1 
ATOM   9181  C  CG2   . ILE E  1  49  ? -25.799 -54.218 -22.800 1.00 138.04 ? 47  ILE C CG2   1 
ATOM   9182  C  CD1   . ILE E  1  49  ? -26.902 -55.240 -20.014 1.00 131.06 ? 47  ILE C CD1   1 
ATOM   9183  N  N     . SER E  1  50  ? -23.046 -56.465 -23.258 1.00 134.94 ? 48  SER C N     1 
ATOM   9184  C  CA    . SER E  1  50  ? -22.680 -57.111 -24.512 1.00 134.48 ? 48  SER C CA    1 
ATOM   9185  C  C     . SER E  1  50  ? -23.671 -58.210 -24.875 1.00 134.17 ? 48  SER C C     1 
ATOM   9186  O  O     . SER E  1  50  ? -24.108 -58.978 -24.011 1.00 125.64 ? 48  SER C O     1 
ATOM   9187  C  CB    . SER E  1  50  ? -21.269 -57.702 -24.434 1.00 134.51 ? 48  SER C CB    1 
ATOM   9188  O  OG    . SER E  1  50  ? -20.897 -58.298 -25.664 1.00 144.23 ? 48  SER C OG    1 
ATOM   9189  N  N     . LYS E  1  51  ? -24.024 -58.273 -26.158 1.00 139.79 ? 49  LYS C N     1 
ATOM   9190  C  CA    . LYS E  1  51  ? -24.947 -59.287 -26.651 1.00 136.48 ? 49  LYS C CA    1 
ATOM   9191  C  C     . LYS E  1  51  ? -24.288 -60.663 -26.667 1.00 135.03 ? 49  LYS C C     1 
ATOM   9192  O  O     . LYS E  1  51  ? -23.090 -60.801 -26.929 1.00 130.85 ? 49  LYS C O     1 
ATOM   9193  C  CB    . LYS E  1  51  ? -25.429 -58.930 -28.056 1.00 137.17 ? 49  LYS C CB    1 
ATOM   9194  C  CG    . LYS E  1  51  ? -26.038 -57.544 -28.175 1.00 136.68 ? 49  LYS C CG    1 
ATOM   9195  C  CD    . LYS E  1  51  ? -26.303 -57.188 -29.628 1.00 140.54 ? 49  LYS C CD    1 
ATOM   9196  C  CE    . LYS E  1  51  ? -26.858 -55.781 -29.763 1.00 135.39 ? 49  LYS C CE    1 
ATOM   9197  N  NZ    . LYS E  1  51  ? -27.022 -55.385 -31.189 1.00 128.43 ? 49  LYS C NZ    1 
ATOM   9198  N  N     . ILE E  1  52  ? -25.088 -61.689 -26.382 1.00 140.39 ? 50  ILE C N     1 
ATOM   9199  C  CA    . ILE E  1  52  ? -24.613 -63.063 -26.268 1.00 145.28 ? 50  ILE C CA    1 
ATOM   9200  C  C     . ILE E  1  52  ? -25.340 -63.943 -27.274 1.00 144.76 ? 50  ILE C C     1 
ATOM   9201  O  O     . ILE E  1  52  ? -26.561 -63.841 -27.440 1.00 143.55 ? 50  ILE C O     1 
ATOM   9202  C  CB    . ILE E  1  52  ? -24.799 -63.612 -24.840 1.00 144.02 ? 50  ILE C CB    1 
ATOM   9203  C  CG1   . ILE E  1  52  ? -26.208 -63.300 -24.345 1.00 143.14 ? 50  ILE C CG1   1 
ATOM   9204  C  CG2   . ILE E  1  52  ? -23.749 -63.042 -23.911 1.00 139.38 ? 50  ILE C CG2   1 
ATOM   9205  C  CD1   . ILE E  1  52  ? -26.430 -63.613 -22.904 1.00 141.03 ? 50  ILE C CD1   1 
ATOM   9206  N  N     . GLY E  1  53  ? -24.579 -64.802 -27.955 1.00 144.76 ? 51  GLY C N     1 
ATOM   9207  C  CA    . GLY E  1  53  ? -25.149 -65.805 -28.806 1.00 151.06 ? 51  GLY C CA    1 
ATOM   9208  C  C     . GLY E  1  53  ? -25.818 -66.906 -27.998 1.00 155.95 ? 51  GLY C C     1 
ATOM   9209  O  O     . GLY E  1  53  ? -25.781 -66.910 -26.759 1.00 157.53 ? 51  GLY C O     1 
ATOM   9210  N  N     . PRO E  1  54  ? -26.447 -67.855 -28.698 1.00 155.47 ? 52  PRO C N     1 
ATOM   9211  C  CA    . PRO E  1  54  ? -27.133 -68.958 -27.998 1.00 150.05 ? 52  PRO C CA    1 
ATOM   9212  C  C     . PRO E  1  54  ? -26.210 -69.786 -27.114 1.00 142.31 ? 52  PRO C C     1 
ATOM   9213  O  O     . PRO E  1  54  ? -26.700 -70.643 -26.367 1.00 135.22 ? 52  PRO C O     1 
ATOM   9214  C  CB    . PRO E  1  54  ? -27.707 -69.800 -29.145 1.00 152.35 ? 52  PRO C CB    1 
ATOM   9215  C  CG    . PRO E  1  54  ? -26.825 -69.488 -30.315 1.00 152.57 ? 52  PRO C CG    1 
ATOM   9216  C  CD    . PRO E  1  54  ? -26.443 -68.043 -30.159 1.00 153.31 ? 52  PRO C CD    1 
ATOM   9217  N  N     . GLU E  1  55  ? -24.898 -69.559 -27.191 1.00 145.40 ? 53  GLU C N     1 
ATOM   9218  C  CA    . GLU E  1  55  ? -23.932 -70.297 -26.386 1.00 150.42 ? 53  GLU C CA    1 
ATOM   9219  C  C     . GLU E  1  55  ? -24.186 -70.142 -24.890 1.00 153.59 ? 53  GLU C C     1 
ATOM   9220  O  O     . GLU E  1  55  ? -23.909 -71.067 -24.117 1.00 154.92 ? 53  GLU C O     1 
ATOM   9221  C  CB    . GLU E  1  55  ? -22.522 -69.826 -26.741 1.00 150.67 ? 53  GLU C CB    1 
ATOM   9222  C  CG    . GLU E  1  55  ? -22.482 -68.359 -27.158 1.00 151.84 ? 53  GLU C CG    1 
ATOM   9223  C  CD    . GLU E  1  55  ? -21.145 -67.936 -27.730 1.00 152.98 ? 53  GLU C CD    1 
ATOM   9224  O  OE1   . GLU E  1  55  ? -20.139 -68.629 -27.475 1.00 157.55 ? 53  GLU C OE1   1 
ATOM   9225  O  OE2   . GLU E  1  55  ? -21.103 -66.908 -28.439 1.00 148.97 ? 53  GLU C OE2   1 
ATOM   9226  N  N     . ASN E  1  56  ? -24.706 -68.990 -24.462 1.00 153.40 ? 54  ASN C N     1 
ATOM   9227  C  CA    . ASN E  1  56  ? -24.878 -68.700 -23.043 1.00 150.21 ? 54  ASN C CA    1 
ATOM   9228  C  C     . ASN E  1  56  ? -26.213 -69.241 -22.542 1.00 150.18 ? 54  ASN C C     1 
ATOM   9229  O  O     . ASN E  1  56  ? -27.267 -68.706 -22.921 1.00 152.13 ? 54  ASN C O     1 
ATOM   9230  C  CB    . ASN E  1  56  ? -24.789 -67.201 -22.798 1.00 148.01 ? 54  ASN C CB    1 
ATOM   9231  C  CG    . ASN E  1  56  ? -24.442 -66.865 -21.363 1.00 146.68 ? 54  ASN C CG    1 
ATOM   9232  O  OD1   . ASN E  1  56  ? -24.859 -67.554 -20.433 1.00 146.56 ? 54  ASN C OD1   1 
ATOM   9233  N  ND2   . ASN E  1  56  ? -23.671 -65.801 -21.176 1.00 147.37 ? 54  ASN C ND2   1 
ATOM   9234  N  N     . PRO E  1  57  ? -26.224 -70.283 -21.704 1.00 146.05 ? 55  PRO C N     1 
ATOM   9235  C  CA    . PRO E  1  57  ? -27.510 -70.863 -21.279 1.00 147.11 ? 55  PRO C CA    1 
ATOM   9236  C  C     . PRO E  1  57  ? -28.269 -70.013 -20.272 1.00 149.54 ? 55  PRO C C     1 
ATOM   9237  O  O     . PRO E  1  57  ? -29.496 -69.887 -20.377 1.00 152.51 ? 55  PRO C O     1 
ATOM   9238  C  CB    . PRO E  1  57  ? -27.094 -72.215 -20.685 1.00 141.77 ? 55  PRO C CB    1 
ATOM   9239  C  CG    . PRO E  1  57  ? -25.711 -71.977 -20.171 1.00 137.18 ? 55  PRO C CG    1 
ATOM   9240  C  CD    . PRO E  1  57  ? -25.072 -70.993 -21.119 1.00 138.72 ? 55  PRO C CD    1 
ATOM   9241  N  N     . TYR E  1  58  ? -27.575 -69.432 -19.296 1.00 147.18 ? 56  TYR C N     1 
ATOM   9242  C  CA    . TYR E  1  58  ? -28.208 -68.918 -18.088 1.00 145.83 ? 56  TYR C CA    1 
ATOM   9243  C  C     . TYR E  1  58  ? -29.110 -67.722 -18.380 1.00 146.39 ? 56  TYR C C     1 
ATOM   9244  O  O     . TYR E  1  58  ? -28.843 -66.914 -19.272 1.00 145.91 ? 56  TYR C O     1 
ATOM   9245  C  CB    . TYR E  1  58  ? -27.141 -68.522 -17.068 1.00 139.85 ? 56  TYR C CB    1 
ATOM   9246  C  CG    . TYR E  1  58  ? -25.916 -69.405 -17.112 1.00 139.21 ? 56  TYR C CG    1 
ATOM   9247  C  CD1   . TYR E  1  58  ? -25.944 -70.689 -16.587 1.00 138.87 ? 56  TYR C CD1   1 
ATOM   9248  C  CD2   . TYR E  1  58  ? -24.733 -68.956 -17.682 1.00 137.93 ? 56  TYR C CD2   1 
ATOM   9249  C  CE1   . TYR E  1  58  ? -24.828 -71.500 -16.630 1.00 137.87 ? 56  TYR C CE1   1 
ATOM   9250  C  CE2   . TYR E  1  58  ? -23.611 -69.760 -17.729 1.00 136.65 ? 56  TYR C CE2   1 
ATOM   9251  C  CZ    . TYR E  1  58  ? -23.664 -71.032 -17.201 1.00 136.30 ? 56  TYR C CZ    1 
ATOM   9252  O  OH    . TYR E  1  58  ? -22.549 -71.838 -17.244 1.00 134.39 ? 56  TYR C OH    1 
ATOM   9253  N  N     . ASN E  1  59  ? -30.207 -67.631 -17.627 1.00 145.96 ? 57  ASN C N     1 
ATOM   9254  C  CA    . ASN E  1  59  ? -31.056 -66.447 -17.614 1.00 147.19 ? 57  ASN C CA    1 
ATOM   9255  C  C     . ASN E  1  59  ? -31.395 -66.067 -16.179 1.00 146.83 ? 57  ASN C C     1 
ATOM   9256  O  O     . ASN E  1  59  ? -31.661 -66.935 -15.343 1.00 144.18 ? 57  ASN C O     1 
ATOM   9257  C  CB    . ASN E  1  59  ? -32.343 -66.671 -18.413 1.00 148.61 ? 57  ASN C CB    1 
ATOM   9258  C  CG    . ASN E  1  59  ? -33.109 -65.385 -18.646 1.00 142.92 ? 57  ASN C CG    1 
ATOM   9259  O  OD1   . ASN E  1  59  ? -32.738 -64.577 -19.496 1.00 143.83 ? 57  ASN C OD1   1 
ATOM   9260  N  ND2   . ASN E  1  59  ? -34.183 -65.187 -17.891 1.00 136.34 ? 57  ASN C ND2   1 
ATOM   9261  N  N     . THR E  1  60  ? -31.369 -64.764 -15.897 1.00 147.06 ? 58  THR C N     1 
ATOM   9262  C  CA    . THR E  1  60  ? -31.769 -64.213 -14.611 1.00 145.25 ? 58  THR C CA    1 
ATOM   9263  C  C     . THR E  1  60  ? -32.708 -63.030 -14.808 1.00 143.34 ? 58  THR C C     1 
ATOM   9264  O  O     . THR E  1  60  ? -32.460 -62.177 -15.666 1.00 143.08 ? 58  THR C O     1 
ATOM   9265  C  CB    . THR E  1  60  ? -30.548 -63.771 -13.794 1.00 144.24 ? 58  THR C CB    1 
ATOM   9266  O  OG1   . THR E  1  60  ? -30.947 -62.793 -12.825 1.00 143.59 ? 58  THR C OG1   1 
ATOM   9267  C  CG2   . THR E  1  60  ? -29.492 -63.178 -14.707 1.00 143.88 ? 58  THR C CG2   1 
ATOM   9268  N  N     . PRO E  1  61  ? -33.794 -62.956 -14.042 1.00 139.98 ? 59  PRO C N     1 
ATOM   9269  C  CA    . PRO E  1  61  ? -34.788 -61.900 -14.268 1.00 140.50 ? 59  PRO C CA    1 
ATOM   9270  C  C     . PRO E  1  61  ? -34.233 -60.515 -13.959 1.00 142.42 ? 59  PRO C C     1 
ATOM   9271  O  O     . PRO E  1  61  ? -33.298 -60.345 -13.173 1.00 145.74 ? 59  PRO C O     1 
ATOM   9272  C  CB    . PRO E  1  61  ? -35.919 -62.271 -13.304 1.00 138.16 ? 59  PRO C CB    1 
ATOM   9273  C  CG    . PRO E  1  61  ? -35.711 -63.719 -12.995 1.00 137.75 ? 59  PRO C CG    1 
ATOM   9274  C  CD    . PRO E  1  61  ? -34.229 -63.911 -13.012 1.00 137.73 ? 59  PRO C CD    1 
ATOM   9275  N  N     . VAL E  1  62  ? -34.838 -59.508 -14.597 1.00 142.01 ? 60  VAL C N     1 
ATOM   9276  C  CA    . VAL E  1  62  ? -34.443 -58.111 -14.444 1.00 140.36 ? 60  VAL C CA    1 
ATOM   9277  C  C     . VAL E  1  62  ? -35.691 -57.237 -14.382 1.00 139.81 ? 60  VAL C C     1 
ATOM   9278  O  O     . VAL E  1  62  ? -36.741 -57.582 -14.931 1.00 141.40 ? 60  VAL C O     1 
ATOM   9279  C  CB    . VAL E  1  62  ? -33.518 -57.646 -15.602 1.00 138.21 ? 60  VAL C CB    1 
ATOM   9280  C  CG1   . VAL E  1  62  ? -32.985 -56.239 -15.359 1.00 136.18 ? 60  VAL C CG1   1 
ATOM   9281  C  CG2   . VAL E  1  62  ? -32.362 -58.610 -15.800 1.00 136.10 ? 60  VAL C CG2   1 
ATOM   9282  N  N     . PHE E  1  63  ? -35.566 -56.093 -13.707 1.00 137.55 ? 61  PHE C N     1 
ATOM   9283  C  CA    . PHE E  1  63  ? -36.647 -55.123 -13.571 1.00 137.27 ? 61  PHE C CA    1 
ATOM   9284  C  C     . PHE E  1  63  ? -36.026 -53.770 -13.243 1.00 134.84 ? 61  PHE C C     1 
ATOM   9285  O  O     . PHE E  1  63  ? -34.826 -53.665 -12.986 1.00 139.71 ? 61  PHE C O     1 
ATOM   9286  C  CB    . PHE E  1  63  ? -37.665 -55.547 -12.506 1.00 141.57 ? 61  PHE C CB    1 
ATOM   9287  C  CG    . PHE E  1  63  ? -37.067 -55.769 -11.147 1.00 143.36 ? 61  PHE C CG    1 
ATOM   9288  C  CD1   . PHE E  1  63  ? -37.011 -54.739 -10.223 1.00 141.48 ? 61  PHE C CD1   1 
ATOM   9289  C  CD2   . PHE E  1  63  ? -36.568 -57.011 -10.792 1.00 142.95 ? 61  PHE C CD2   1 
ATOM   9290  C  CE1   . PHE E  1  63  ? -36.464 -54.941 -8.971  1.00 136.75 ? 61  PHE C CE1   1 
ATOM   9291  C  CE2   . PHE E  1  63  ? -36.020 -57.219 -9.542  1.00 139.52 ? 61  PHE C CE2   1 
ATOM   9292  C  CZ    . PHE E  1  63  ? -35.968 -56.183 -8.630  1.00 136.15 ? 61  PHE C CZ    1 
ATOM   9293  N  N     . ALA E  1  64  ? -36.856 -52.727 -13.264 1.00 130.32 ? 62  ALA C N     1 
ATOM   9294  C  CA    . ALA E  1  64  ? -36.376 -51.384 -12.968 1.00 129.50 ? 62  ALA C CA    1 
ATOM   9295  C  C     . ALA E  1  64  ? -37.340 -50.665 -12.034 1.00 136.13 ? 62  ALA C C     1 
ATOM   9296  O  O     . ALA E  1  64  ? -38.498 -51.060 -11.875 1.00 136.82 ? 62  ALA C O     1 
ATOM   9297  C  CB    . ALA E  1  64  ? -36.188 -50.564 -14.252 1.00 126.81 ? 62  ALA C CB    1 
ATOM   9298  N  N     . ILE E  1  65  ? -36.841 -49.585 -11.426 1.00 139.31 ? 63  ILE C N     1 
ATOM   9299  C  CA    . ILE E  1  65  ? -37.614 -48.731 -10.531 1.00 135.39 ? 63  ILE C CA    1 
ATOM   9300  C  C     . ILE E  1  65  ? -37.157 -47.291 -10.717 1.00 136.11 ? 63  ILE C C     1 
ATOM   9301  O  O     . ILE E  1  65  ? -35.991 -47.024 -11.025 1.00 133.41 ? 63  ILE C O     1 
ATOM   9302  C  CB    . ILE E  1  65  ? -37.477 -49.133 -9.041  1.00 126.65 ? 63  ILE C CB    1 
ATOM   9303  C  CG1   . ILE E  1  65  ? -36.016 -49.056 -8.593  1.00 123.88 ? 63  ILE C CG1   1 
ATOM   9304  C  CG2   . ILE E  1  65  ? -38.067 -50.515 -8.778  1.00 123.56 ? 63  ILE C CG2   1 
ATOM   9305  C  CD1   . ILE E  1  65  ? -35.830 -49.150 -7.094  1.00 120.50 ? 63  ILE C CD1   1 
ATOM   9306  N  N     . LYS E  1  66  ? -38.092 -46.357 -10.546 1.00 140.21 ? 64  LYS C N     1 
ATOM   9307  C  CA    . LYS E  1  66  ? -37.770 -44.940 -10.670 1.00 141.21 ? 64  LYS C CA    1 
ATOM   9308  C  C     . LYS E  1  66  ? -36.772 -44.519 -9.599  1.00 137.62 ? 64  LYS C C     1 
ATOM   9309  O  O     . LYS E  1  66  ? -36.973 -44.781 -8.409  1.00 137.28 ? 64  LYS C O     1 
ATOM   9310  C  CB    . LYS E  1  66  ? -39.035 -44.087 -10.566 1.00 141.81 ? 64  LYS C CB    1 
ATOM   9311  C  CG    . LYS E  1  66  ? -39.894 -44.085 -11.814 1.00 142.29 ? 64  LYS C CG    1 
ATOM   9312  C  CD    . LYS E  1  66  ? -40.491 -42.710 -12.077 1.00 139.06 ? 64  LYS C CD    1 
ATOM   9313  C  CE    . LYS E  1  66  ? -39.422 -41.715 -12.509 1.00 134.82 ? 64  LYS C CE    1 
ATOM   9314  N  NZ    . LYS E  1  66  ? -40.003 -40.401 -12.906 1.00 133.15 ? 64  LYS C NZ    1 
ATOM   9315  N  N     . LYS E  1  67  ? -35.691 -43.871 -10.024 1.00 134.83 ? 65  LYS C N     1 
ATOM   9316  C  CA    . LYS E  1  67  ? -34.832 -43.160 -9.086  1.00 130.12 ? 65  LYS C CA    1 
ATOM   9317  C  C     . LYS E  1  67  ? -35.630 -42.066 -8.390  1.00 133.41 ? 65  LYS C C     1 
ATOM   9318  O  O     . LYS E  1  67  ? -36.184 -41.178 -9.046  1.00 133.18 ? 65  LYS C O     1 
ATOM   9319  C  CB    . LYS E  1  67  ? -33.627 -42.564 -9.812  1.00 122.97 ? 65  LYS C CB    1 
ATOM   9320  C  CG    . LYS E  1  67  ? -32.685 -43.596 -10.409 1.00 118.14 ? 65  LYS C CG    1 
ATOM   9321  C  CD    . LYS E  1  67  ? -31.355 -42.970 -10.797 1.00 118.65 ? 65  LYS C CD    1 
ATOM   9322  C  CE    . LYS E  1  67  ? -30.361 -44.025 -11.256 1.00 120.98 ? 65  LYS C CE    1 
ATOM   9323  N  NZ    . LYS E  1  67  ? -28.998 -43.459 -11.459 1.00 119.94 ? 65  LYS C NZ    1 
ATOM   9324  N  N     . LYS E  1  68  ? -35.700 -42.141 -7.062  1.00 137.50 ? 66  LYS C N     1 
ATOM   9325  C  CA    . LYS E  1  68  ? -36.480 -41.173 -6.302  1.00 140.46 ? 66  LYS C CA    1 
ATOM   9326  C  C     . LYS E  1  68  ? -35.936 -39.765 -6.510  1.00 140.13 ? 66  LYS C C     1 
ATOM   9327  O  O     . LYS E  1  68  ? -34.723 -39.554 -6.587  1.00 135.29 ? 66  LYS C O     1 
ATOM   9328  C  CB    . LYS E  1  68  ? -36.466 -41.529 -4.815  1.00 138.55 ? 66  LYS C CB    1 
ATOM   9329  C  CG    . LYS E  1  68  ? -37.843 -41.563 -4.172  1.00 134.12 ? 66  LYS C CG    1 
ATOM   9330  C  CD    . LYS E  1  68  ? -38.680 -42.702 -4.730  1.00 130.40 ? 66  LYS C CD    1 
ATOM   9331  C  CE    . LYS E  1  68  ? -40.037 -42.776 -4.052  1.00 123.50 ? 66  LYS C CE    1 
ATOM   9332  N  NZ    . LYS E  1  68  ? -40.878 -41.584 -4.347  1.00 119.17 ? 66  LYS C NZ    1 
ATOM   9333  N  N     . ASP E  1  69  ? -36.853 -38.799 -6.592  1.00 144.93 ? 67  ASP C N     1 
ATOM   9334  C  CA    . ASP E  1  69  ? -36.515 -37.394 -6.829  1.00 149.08 ? 67  ASP C CA    1 
ATOM   9335  C  C     . ASP E  1  69  ? -35.692 -37.235 -8.107  1.00 148.22 ? 67  ASP C C     1 
ATOM   9336  O  O     . ASP E  1  69  ? -34.787 -36.402 -8.188  1.00 147.97 ? 67  ASP C O     1 
ATOM   9337  C  CB    . ASP E  1  69  ? -35.786 -36.790 -5.626  1.00 150.70 ? 67  ASP C CB    1 
ATOM   9338  C  CG    . ASP E  1  69  ? -35.846 -35.276 -5.610  1.00 153.89 ? 67  ASP C CG    1 
ATOM   9339  O  OD1   . ASP E  1  69  ? -36.842 -34.717 -6.114  1.00 155.82 ? 67  ASP C OD1   1 
ATOM   9340  O  OD2   . ASP E  1  69  ? -34.900 -34.645 -5.092  1.00 154.04 ? 67  ASP C OD2   1 
ATOM   9341  N  N     . SER E  1  70  ? -36.012 -38.042 -9.116  1.00 146.51 ? 68  SER C N     1 
ATOM   9342  C  CA    . SER E  1  70  ? -35.378 -37.926 -10.422 1.00 143.72 ? 68  SER C CA    1 
ATOM   9343  C  C     . SER E  1  70  ? -36.310 -38.506 -11.476 1.00 138.55 ? 68  SER C C     1 
ATOM   9344  O  O     . SER E  1  70  ? -37.159 -39.352 -11.184 1.00 136.16 ? 68  SER C O     1 
ATOM   9345  C  CB    . SER E  1  70  ? -34.019 -38.634 -10.453 1.00 144.95 ? 68  SER C CB    1 
ATOM   9346  O  OG    . SER E  1  70  ? -33.384 -38.464 -11.709 1.00 147.23 ? 68  SER C OG    1 
ATOM   9347  N  N     . THR E  1  71  ? -36.135 -38.036 -12.712 1.00 135.72 ? 69  THR C N     1 
ATOM   9348  C  CA    . THR E  1  71  ? -36.882 -38.587 -13.837 1.00 138.09 ? 69  THR C CA    1 
ATOM   9349  C  C     . THR E  1  71  ? -36.256 -39.873 -14.361 1.00 144.10 ? 69  THR C C     1 
ATOM   9350  O  O     . THR E  1  71  ? -36.964 -40.719 -14.918 1.00 150.27 ? 69  THR C O     1 
ATOM   9351  C  CB    . THR E  1  71  ? -36.978 -37.559 -14.965 1.00 135.64 ? 69  THR C CB    1 
ATOM   9352  O  OG1   . THR E  1  71  ? -35.666 -37.265 -15.461 1.00 134.59 ? 69  THR C OG1   1 
ATOM   9353  C  CG2   . THR E  1  71  ? -37.622 -36.276 -14.461 1.00 132.34 ? 69  THR C CG2   1 
ATOM   9354  N  N     . LYS E  1  72  ? -34.945 -40.031 -14.198 1.00 140.96 ? 70  LYS C N     1 
ATOM   9355  C  CA    . LYS E  1  72  ? -34.234 -41.173 -14.750 1.00 135.95 ? 70  LYS C CA    1 
ATOM   9356  C  C     . LYS E  1  72  ? -34.637 -42.461 -14.034 1.00 137.49 ? 70  LYS C C     1 
ATOM   9357  O  O     . LYS E  1  72  ? -35.205 -42.447 -12.938 1.00 140.37 ? 70  LYS C O     1 
ATOM   9358  C  CB    . LYS E  1  72  ? -32.725 -40.952 -14.641 1.00 129.51 ? 70  LYS C CB    1 
ATOM   9359  C  CG    . LYS E  1  72  ? -32.283 -39.580 -15.129 1.00 129.40 ? 70  LYS C CG    1 
ATOM   9360  C  CD    . LYS E  1  72  ? -30.894 -39.221 -14.629 1.00 130.08 ? 70  LYS C CD    1 
ATOM   9361  C  CE    . LYS E  1  72  ? -30.559 -37.770 -14.939 1.00 132.44 ? 70  LYS C CE    1 
ATOM   9362  N  NZ    . LYS E  1  72  ? -29.235 -37.371 -14.385 1.00 132.40 ? 70  LYS C NZ    1 
ATOM   9363  N  N     . TRP E  1  73  ? -34.332 -43.587 -14.672 1.00 135.65 ? 71  TRP C N     1 
ATOM   9364  C  CA    . TRP E  1  73  ? -34.649 -44.907 -14.148 1.00 133.62 ? 71  TRP C CA    1 
ATOM   9365  C  C     . TRP E  1  73  ? -33.381 -45.680 -13.805 1.00 125.02 ? 71  TRP C C     1 
ATOM   9366  O  O     . TRP E  1  73  ? -32.330 -45.496 -14.426 1.00 121.58 ? 71  TRP C O     1 
ATOM   9367  C  CB    . TRP E  1  73  ? -35.486 -45.705 -15.151 1.00 142.28 ? 71  TRP C CB    1 
ATOM   9368  C  CG    . TRP E  1  73  ? -36.912 -45.257 -15.224 1.00 152.84 ? 71  TRP C CG    1 
ATOM   9369  C  CD1   . TRP E  1  73  ? -37.372 -44.047 -15.655 1.00 156.47 ? 71  TRP C CD1   1 
ATOM   9370  C  CD2   . TRP E  1  73  ? -38.069 -46.020 -14.861 1.00 158.13 ? 71  TRP C CD2   1 
ATOM   9371  N  NE1   . TRP E  1  73  ? -38.743 -44.007 -15.578 1.00 160.63 ? 71  TRP C NE1   1 
ATOM   9372  C  CE2   . TRP E  1  73  ? -39.196 -45.207 -15.095 1.00 160.35 ? 71  TRP C CE2   1 
ATOM   9373  C  CE3   . TRP E  1  73  ? -38.262 -47.311 -14.361 1.00 158.67 ? 71  TRP C CE3   1 
ATOM   9374  C  CZ2   . TRP E  1  73  ? -40.496 -45.643 -14.846 1.00 160.88 ? 71  TRP C CZ2   1 
ATOM   9375  C  CZ3   . TRP E  1  73  ? -39.552 -47.741 -14.113 1.00 159.62 ? 71  TRP C CZ3   1 
ATOM   9376  C  CH2   . TRP E  1  73  ? -40.652 -46.910 -14.355 1.00 161.32 ? 71  TRP C CH2   1 
ATOM   9377  N  N     . ARG E  1  74  ? -33.498 -46.551 -12.806 1.00 119.58 ? 72  ARG C N     1 
ATOM   9378  C  CA    . ARG E  1  74  ? -32.402 -47.379 -12.325 1.00 118.38 ? 72  ARG C CA    1 
ATOM   9379  C  C     . ARG E  1  74  ? -32.691 -48.845 -12.620 1.00 121.55 ? 72  ARG C C     1 
ATOM   9380  O  O     . ARG E  1  74  ? -33.813 -49.319 -12.413 1.00 127.80 ? 72  ARG C O     1 
ATOM   9381  C  CB    . ARG E  1  74  ? -32.190 -47.184 -10.820 1.00 116.75 ? 72  ARG C CB    1 
ATOM   9382  C  CG    . ARG E  1  74  ? -31.016 -47.958 -10.247 1.00 111.32 ? 72  ARG C CG    1 
ATOM   9383  C  CD    . ARG E  1  74  ? -31.034 -47.949 -8.726  1.00 102.95 ? 72  ARG C CD    1 
ATOM   9384  N  NE    . ARG E  1  74  ? -31.012 -46.595 -8.181  1.00 101.68 ? 72  ARG C NE    1 
ATOM   9385  C  CZ    . ARG E  1  74  ? -29.902 -45.900 -7.953  1.00 99.53  ? 72  ARG C CZ    1 
ATOM   9386  N  NH1   . ARG E  1  74  ? -28.718 -46.431 -8.226  1.00 103.24 ? 72  ARG C NH1   1 
ATOM   9387  N  NH2   . ARG E  1  74  ? -29.975 -44.673 -7.453  1.00 90.65  ? 72  ARG C NH2   1 
ATOM   9388  N  N     . LYS E  1  75  ? -31.676 -49.562 -13.094 1.00 115.94 ? 73  LYS C N     1 
ATOM   9389  C  CA    . LYS E  1  75  ? -31.823 -50.944 -13.534 1.00 119.13 ? 73  LYS C CA    1 
ATOM   9390  C  C     . LYS E  1  75  ? -31.368 -51.895 -12.434 1.00 120.68 ? 73  LYS C C     1 
ATOM   9391  O  O     . LYS E  1  75  ? -30.253 -51.765 -11.917 1.00 121.12 ? 73  LYS C O     1 
ATOM   9392  C  CB    . LYS E  1  75  ? -31.024 -51.194 -14.814 1.00 123.21 ? 73  LYS C CB    1 
ATOM   9393  C  CG    . LYS E  1  75  ? -31.146 -52.608 -15.356 1.00 126.06 ? 73  LYS C CG    1 
ATOM   9394  C  CD    . LYS E  1  75  ? -30.517 -52.721 -16.734 1.00 121.84 ? 73  LYS C CD    1 
ATOM   9395  C  CE    . LYS E  1  75  ? -30.660 -54.125 -17.295 1.00 121.38 ? 73  LYS C CE    1 
ATOM   9396  N  NZ    . LYS E  1  75  ? -30.184 -54.207 -18.703 1.00 132.75 ? 73  LYS C NZ    1 
ATOM   9397  N  N     . LEU E  1  76  ? -32.232 -52.846 -12.080 1.00 125.73 ? 74  LEU C N     1 
ATOM   9398  C  CA    . LEU E  1  76  ? -31.974 -53.797 -11.003 1.00 130.66 ? 74  LEU C CA    1 
ATOM   9399  C  C     . LEU E  1  76  ? -32.108 -55.213 -11.545 1.00 134.95 ? 74  LEU C C     1 
ATOM   9400  O  O     . LEU E  1  76  ? -33.153 -55.574 -12.097 1.00 139.81 ? 74  LEU C O     1 
ATOM   9401  C  CB    . LEU E  1  76  ? -32.944 -53.587 -9.839  1.00 130.46 ? 74  LEU C CB    1 
ATOM   9402  C  CG    . LEU E  1  76  ? -33.150 -52.166 -9.320  1.00 130.08 ? 74  LEU C CG    1 
ATOM   9403  C  CD1   . LEU E  1  76  ? -34.214 -52.176 -8.241  1.00 128.00 ? 74  LEU C CD1   1 
ATOM   9404  C  CD2   . LEU E  1  76  ? -31.851 -51.581 -8.792  1.00 127.67 ? 74  LEU C CD2   1 
ATOM   9405  N  N     . VAL E  1  77  ? -31.060 -56.012 -11.382 1.00 132.78 ? 75  VAL C N     1 
ATOM   9406  C  CA    . VAL E  1  77  ? -31.044 -57.400 -11.828 1.00 128.18 ? 75  VAL C CA    1 
ATOM   9407  C  C     . VAL E  1  77  ? -31.178 -58.289 -10.600 1.00 130.02 ? 75  VAL C C     1 
ATOM   9408  O  O     . VAL E  1  77  ? -30.254 -58.372 -9.780  1.00 129.96 ? 75  VAL C O     1 
ATOM   9409  C  CB    . VAL E  1  77  ? -29.774 -57.734 -12.620 1.00 117.77 ? 75  VAL C CB    1 
ATOM   9410  C  CG1   . VAL E  1  77  ? -29.867 -59.141 -13.187 1.00 109.47 ? 75  VAL C CG1   1 
ATOM   9411  C  CG2   . VAL E  1  77  ? -29.568 -56.719 -13.729 1.00 121.65 ? 75  VAL C CG2   1 
ATOM   9412  N  N     . ASP E  1  78  ? -32.328 -58.948 -10.462 1.00 130.09 ? 76  ASP C N     1 
ATOM   9413  C  CA    . ASP E  1  78  ? -32.519 -59.916 -9.389  1.00 128.32 ? 76  ASP C CA    1 
ATOM   9414  C  C     . ASP E  1  78  ? -31.545 -61.075 -9.560  1.00 132.11 ? 76  ASP C C     1 
ATOM   9415  O  O     . ASP E  1  78  ? -31.685 -61.882 -10.485 1.00 138.13 ? 76  ASP C O     1 
ATOM   9416  C  CB    . ASP E  1  78  ? -33.966 -60.418 -9.372  1.00 128.12 ? 76  ASP C CB    1 
ATOM   9417  C  CG    . ASP E  1  78  ? -34.194 -61.519 -8.351  1.00 129.96 ? 76  ASP C CG    1 
ATOM   9418  O  OD1   . ASP E  1  78  ? -35.068 -62.379 -8.591  1.00 129.51 ? 76  ASP C OD1   1 
ATOM   9419  O  OD2   . ASP E  1  78  ? -33.504 -61.525 -7.310  1.00 132.59 ? 76  ASP C OD2   1 
ATOM   9420  N  N     . PHE E  1  79  ? -30.554 -61.162 -8.672  1.00 129.91 ? 77  PHE C N     1 
ATOM   9421  C  CA    . PHE E  1  79  ? -29.502 -62.169 -8.746  1.00 131.04 ? 77  PHE C CA    1 
ATOM   9422  C  C     . PHE E  1  79  ? -29.565 -63.157 -7.585  1.00 129.33 ? 77  PHE C C     1 
ATOM   9423  O  O     . PHE E  1  79  ? -28.536 -63.701 -7.176  1.00 128.25 ? 77  PHE C O     1 
ATOM   9424  C  CB    . PHE E  1  79  ? -28.131 -61.497 -8.789  1.00 129.73 ? 77  PHE C CB    1 
ATOM   9425  C  CG    . PHE E  1  79  ? -27.644 -61.191 -10.175 1.00 129.83 ? 77  PHE C CG    1 
ATOM   9426  C  CD1   . PHE E  1  79  ? -27.736 -62.137 -11.180 1.00 130.12 ? 77  PHE C CD1   1 
ATOM   9427  C  CD2   . PHE E  1  79  ? -27.092 -59.956 -10.471 1.00 130.27 ? 77  PHE C CD2   1 
ATOM   9428  C  CE1   . PHE E  1  79  ? -27.282 -61.859 -12.454 1.00 132.49 ? 77  PHE C CE1   1 
ATOM   9429  C  CE2   . PHE E  1  79  ? -26.640 -59.671 -11.745 1.00 130.95 ? 77  PHE C CE2   1 
ATOM   9430  C  CZ    . PHE E  1  79  ? -26.735 -60.624 -12.738 1.00 133.28 ? 77  PHE C CZ    1 
ATOM   9431  N  N     . ARG E  1  80  ? -30.762 -63.377 -7.036  1.00 126.60 ? 78  ARG C N     1 
ATOM   9432  C  CA    . ARG E  1  80  ? -30.904 -64.201 -5.837  1.00 122.92 ? 78  ARG C CA    1 
ATOM   9433  C  C     . ARG E  1  80  ? -30.288 -65.585 -6.019  1.00 125.90 ? 78  ARG C C     1 
ATOM   9434  O  O     . ARG E  1  80  ? -29.606 -66.092 -5.121  1.00 127.29 ? 78  ARG C O     1 
ATOM   9435  C  CB    . ARG E  1  80  ? -32.378 -64.307 -5.444  1.00 122.19 ? 78  ARG C CB    1 
ATOM   9436  C  CG    . ARG E  1  80  ? -32.835 -63.181 -4.526  1.00 120.13 ? 78  ARG C CG    1 
ATOM   9437  C  CD    . ARG E  1  80  ? -34.316 -63.271 -4.192  1.00 124.36 ? 78  ARG C CD    1 
ATOM   9438  N  NE    . ARG E  1  80  ? -35.157 -62.776 -5.277  1.00 132.10 ? 78  ARG C NE    1 
ATOM   9439  C  CZ    . ARG E  1  80  ? -36.465 -62.562 -5.168  1.00 135.47 ? 78  ARG C CZ    1 
ATOM   9440  N  NH1   . ARG E  1  80  ? -37.082 -62.798 -4.018  1.00 135.84 ? 78  ARG C NH1   1 
ATOM   9441  N  NH2   . ARG E  1  80  ? -37.155 -62.109 -6.205  1.00 136.54 ? 78  ARG C NH2   1 
ATOM   9442  N  N     . GLU E  1  81  ? -30.517 -66.213 -7.174  1.00 129.19 ? 79  GLU C N     1 
ATOM   9443  C  CA    . GLU E  1  81  ? -29.958 -67.540 -7.408  1.00 129.79 ? 79  GLU C CA    1 
ATOM   9444  C  C     . GLU E  1  81  ? -28.469 -67.503 -7.727  1.00 125.28 ? 79  GLU C C     1 
ATOM   9445  O  O     . GLU E  1  81  ? -27.747 -68.442 -7.377  1.00 125.83 ? 79  GLU C O     1 
ATOM   9446  C  CB    . GLU E  1  81  ? -30.718 -68.243 -8.534  1.00 135.27 ? 79  GLU C CB    1 
ATOM   9447  C  CG    . GLU E  1  81  ? -32.055 -68.832 -8.105  1.00 137.74 ? 79  GLU C CG    1 
ATOM   9448  C  CD    . GLU E  1  81  ? -31.903 -69.981 -7.122  1.00 135.97 ? 79  GLU C CD    1 
ATOM   9449  O  OE1   . GLU E  1  81  ? -30.815 -70.594 -7.077  1.00 132.70 ? 79  GLU C OE1   1 
ATOM   9450  O  OE2   . GLU E  1  81  ? -32.873 -70.271 -6.391  1.00 136.48 ? 79  GLU C OE2   1 
ATOM   9451  N  N     . LEU E  1  82  ? -27.985 -66.446 -8.385  1.00 121.70 ? 80  LEU C N     1 
ATOM   9452  C  CA    . LEU E  1  82  ? -26.552 -66.353 -8.647  1.00 117.33 ? 80  LEU C CA    1 
ATOM   9453  C  C     . LEU E  1  82  ? -25.780 -66.014 -7.378  1.00 114.39 ? 80  LEU C C     1 
ATOM   9454  O  O     . LEU E  1  82  ? -24.694 -66.557 -7.141  1.00 113.27 ? 80  LEU C O     1 
ATOM   9455  C  CB    . LEU E  1  82  ? -26.278 -65.312 -9.733  1.00 111.61 ? 80  LEU C CB    1 
ATOM   9456  C  CG    . LEU E  1  82  ? -24.805 -64.950 -9.957  1.00 103.18 ? 80  LEU C CG    1 
ATOM   9457  C  CD1   . LEU E  1  82  ? -24.000 -66.171 -10.379 1.00 99.43  ? 80  LEU C CD1   1 
ATOM   9458  C  CD2   . LEU E  1  82  ? -24.662 -63.834 -10.980 1.00 98.75  ? 80  LEU C CD2   1 
ATOM   9459  N  N     . ASN E  1  83  ? -26.318 -65.104 -6.562  1.00 112.24 ? 81  ASN C N     1 
ATOM   9460  C  CA    . ASN E  1  83  ? -25.723 -64.798 -5.264  1.00 112.46 ? 81  ASN C CA    1 
ATOM   9461  C  C     . ASN E  1  83  ? -25.522 -66.057 -4.428  1.00 113.55 ? 81  ASN C C     1 
ATOM   9462  O  O     . ASN E  1  83  ? -24.432 -66.295 -3.895  1.00 116.42 ? 81  ASN C O     1 
ATOM   9463  C  CB    . ASN E  1  83  ? -26.591 -63.782 -4.520  1.00 111.56 ? 81  ASN C CB    1 
ATOM   9464  C  CG    . ASN E  1  83  ? -26.552 -62.407 -5.159  1.00 108.82 ? 81  ASN C CG    1 
ATOM   9465  O  OD1   . ASN E  1  83  ? -25.537 -62.003 -5.728  1.00 98.80  ? 81  ASN C OD1   1 
ATOM   9466  N  ND2   . ASN E  1  83  ? -27.660 -61.682 -5.070  1.00 114.35 ? 81  ASN C ND2   1 
ATOM   9467  N  N     . LYS E  1  84  ? -26.584 -66.858 -4.276  1.00 112.04 ? 82  LYS C N     1 
ATOM   9468  C  CA    . LYS E  1  84  ? -26.497 -68.118 -3.537  1.00 113.42 ? 82  LYS C CA    1 
ATOM   9469  C  C     . LYS E  1  84  ? -25.288 -68.947 -3.952  1.00 117.43 ? 82  LYS C C     1 
ATOM   9470  O  O     . LYS E  1  84  ? -24.650 -69.593 -3.112  1.00 117.41 ? 82  LYS C O     1 
ATOM   9471  C  CB    . LYS E  1  84  ? -27.781 -68.927 -3.731  1.00 110.42 ? 82  LYS C CB    1 
ATOM   9472  C  CG    . LYS E  1  84  ? -28.963 -68.430 -2.917  1.00 108.98 ? 82  LYS C CG    1 
ATOM   9473  C  CD    . LYS E  1  84  ? -30.232 -69.186 -3.272  1.00 113.24 ? 82  LYS C CD    1 
ATOM   9474  C  CE    . LYS E  1  84  ? -31.402 -68.729 -2.417  1.00 115.49 ? 82  LYS C CE    1 
ATOM   9475  N  NZ    . LYS E  1  84  ? -32.693 -69.298 -2.894  1.00 116.91 ? 82  LYS C NZ    1 
ATOM   9476  N  N     . ARG E  1  85  ? -24.956 -68.942 -5.239  1.00 118.89 ? 83  ARG C N     1 
ATOM   9477  C  CA    . ARG E  1  85  ? -23.901 -69.790 -5.774  1.00 120.25 ? 83  ARG C CA    1 
ATOM   9478  C  C     . ARG E  1  85  ? -22.581 -69.052 -5.952  1.00 113.00 ? 83  ARG C C     1 
ATOM   9479  O  O     . ARG E  1  85  ? -21.590 -69.672 -6.348  1.00 103.59 ? 83  ARG C O     1 
ATOM   9480  C  CB    . ARG E  1  85  ? -24.349 -70.398 -7.106  1.00 127.43 ? 83  ARG C CB    1 
ATOM   9481  C  CG    . ARG E  1  85  ? -25.784 -70.907 -7.081  1.00 131.94 ? 83  ARG C CG    1 
ATOM   9482  C  CD    . ARG E  1  85  ? -26.182 -71.531 -8.404  1.00 139.24 ? 83  ARG C CD    1 
ATOM   9483  N  NE    . ARG E  1  85  ? -27.627 -71.516 -8.614  1.00 144.50 ? 83  ARG C NE    1 
ATOM   9484  C  CZ    . ARG E  1  85  ? -28.456 -72.471 -8.204  1.00 147.88 ? 83  ARG C CZ    1 
ATOM   9485  N  NH1   . ARG E  1  85  ? -27.988 -73.526 -7.553  1.00 150.19 ? 83  ARG C NH1   1 
ATOM   9486  N  NH2   . ARG E  1  85  ? -29.756 -72.369 -8.444  1.00 147.73 ? 83  ARG C NH2   1 
ATOM   9487  N  N     . THR E  1  86  ? -22.541 -67.755 -5.661  1.00 110.21 ? 84  THR C N     1 
ATOM   9488  C  CA    . THR E  1  86  ? -21.331 -66.958 -5.803  1.00 113.27 ? 84  THR C CA    1 
ATOM   9489  C  C     . THR E  1  86  ? -20.498 -67.028 -4.527  1.00 112.93 ? 84  THR C C     1 
ATOM   9490  O  O     . THR E  1  86  ? -21.027 -67.189 -3.424  1.00 107.15 ? 84  THR C O     1 
ATOM   9491  C  CB    . THR E  1  86  ? -21.683 -65.503 -6.127  1.00 114.56 ? 84  THR C CB    1 
ATOM   9492  O  OG1   . THR E  1  86  ? -22.641 -65.469 -7.193  1.00 120.36 ? 84  THR C OG1   1 
ATOM   9493  C  CG2   . THR E  1  86  ? -20.446 -64.725 -6.558  1.00 113.92 ? 84  THR C CG2   1 
ATOM   9494  N  N     . GLN E  1  87  ? -19.179 -66.926 -4.695  1.00 115.22 ? 85  GLN C N     1 
ATOM   9495  C  CA    . GLN E  1  87  ? -18.259 -66.990 -3.567  1.00 111.99 ? 85  GLN C CA    1 
ATOM   9496  C  C     . GLN E  1  87  ? -18.558 -65.895 -2.548  1.00 112.04 ? 85  GLN C C     1 
ATOM   9497  O  O     . GLN E  1  87  ? -19.090 -64.832 -2.878  1.00 112.19 ? 85  GLN C O     1 
ATOM   9498  C  CB    . GLN E  1  87  ? -16.813 -66.853 -4.048  1.00 107.68 ? 85  GLN C CB    1 
ATOM   9499  C  CG    . GLN E  1  87  ? -16.493 -65.490 -4.646  1.00 103.81 ? 85  GLN C CG    1 
ATOM   9500  C  CD    . GLN E  1  87  ? -15.010 -65.171 -4.627  1.00 101.07 ? 85  GLN C CD    1 
ATOM   9501  O  OE1   . GLN E  1  87  ? -14.300 -65.399 -5.604  1.00 105.76 ? 85  GLN C OE1   1 
ATOM   9502  N  NE2   . GLN E  1  87  ? -14.536 -64.633 -3.509  1.00 86.78  ? 85  GLN C NE2   1 
ATOM   9503  N  N     . ASP E  1  88  ? -18.207 -66.169 -1.294  1.00 107.85 ? 86  ASP C N     1 
ATOM   9504  C  CA    . ASP E  1  88  ? -18.360 -65.188 -0.231  1.00 101.98 ? 86  ASP C CA    1 
ATOM   9505  C  C     . ASP E  1  88  ? -17.281 -64.119 -0.336  1.00 98.16  ? 86  ASP C C     1 
ATOM   9506  O  O     . ASP E  1  88  ? -16.122 -64.413 -0.643  1.00 96.33  ? 86  ASP C O     1 
ATOM   9507  C  CB    . ASP E  1  88  ? -18.286 -65.864 1.139   1.00 103.52 ? 86  ASP C CB    1 
ATOM   9508  C  CG    . ASP E  1  88  ? -19.398 -66.869 1.356   1.00 111.39 ? 86  ASP C CG    1 
ATOM   9509  O  OD1   . ASP E  1  88  ? -20.488 -66.688 0.773   1.00 116.21 ? 86  ASP C OD1   1 
ATOM   9510  O  OD2   . ASP E  1  88  ? -19.183 -67.839 2.114   1.00 112.00 ? 86  ASP C OD2   1 
ATOM   9511  N  N     . PHE E  1  89  ? -17.670 -62.875 -0.089  1.00 95.33  ? 87  PHE C N     1 
ATOM   9512  C  CA    . PHE E  1  89  ? -16.742 -61.762 0.036   1.00 88.03  ? 87  PHE C CA    1 
ATOM   9513  C  C     . PHE E  1  89  ? -16.612 -61.374 1.503   1.00 76.47  ? 87  PHE C C     1 
ATOM   9514  O  O     . PHE E  1  89  ? -17.369 -61.835 2.362   1.00 83.29  ? 87  PHE C O     1 
ATOM   9515  C  CB    . PHE E  1  89  ? -17.211 -60.562 -0.795  1.00 91.60  ? 87  PHE C CB    1 
ATOM   9516  C  CG    . PHE E  1  89  ? -17.391 -60.864 -2.256  1.00 93.66  ? 87  PHE C CG    1 
ATOM   9517  C  CD1   . PHE E  1  89  ? -16.395 -60.559 -3.167  1.00 85.99  ? 87  PHE C CD1   1 
ATOM   9518  C  CD2   . PHE E  1  89  ? -18.559 -61.449 -2.719  1.00 94.10  ? 87  PHE C CD2   1 
ATOM   9519  C  CE1   . PHE E  1  89  ? -16.559 -60.833 -4.511  1.00 90.19  ? 87  PHE C CE1   1 
ATOM   9520  C  CE2   . PHE E  1  89  ? -18.727 -61.729 -4.060  1.00 90.97  ? 87  PHE C CE2   1 
ATOM   9521  C  CZ    . PHE E  1  89  ? -17.727 -61.419 -4.958  1.00 93.39  ? 87  PHE C CZ    1 
ATOM   9522  N  N     . TRP E  1  90  ? -15.639 -60.515 1.792   1.00 74.75  ? 88  TRP C N     1 
ATOM   9523  C  CA    . TRP E  1  90  ? -15.554 -59.858 3.091   1.00 75.83  ? 88  TRP C CA    1 
ATOM   9524  C  C     . TRP E  1  90  ? -15.856 -58.377 2.905   1.00 78.41  ? 88  TRP C C     1 
ATOM   9525  O  O     . TRP E  1  90  ? -15.039 -57.636 2.347   1.00 87.93  ? 88  TRP C O     1 
ATOM   9526  C  CB    . TRP E  1  90  ? -14.196 -60.051 3.757   1.00 74.81  ? 88  TRP C CB    1 
ATOM   9527  C  CG    . TRP E  1  90  ? -14.226 -59.513 5.148   1.00 72.72  ? 88  TRP C CG    1 
ATOM   9528  C  CD1   . TRP E  1  90  ? -13.760 -58.305 5.573   1.00 71.46  ? 88  TRP C CD1   1 
ATOM   9529  C  CD2   . TRP E  1  90  ? -14.813 -60.142 6.293   1.00 74.54  ? 88  TRP C CD2   1 
ATOM   9530  N  NE1   . TRP E  1  90  ? -13.994 -58.154 6.918   1.00 66.12  ? 88  TRP C NE1   1 
ATOM   9531  C  CE2   . TRP E  1  90  ? -14.645 -59.266 7.382   1.00 72.67  ? 88  TRP C CE2   1 
ATOM   9532  C  CE3   . TRP E  1  90  ? -15.455 -61.367 6.504   1.00 78.30  ? 88  TRP C CE3   1 
ATOM   9533  C  CZ2   . TRP E  1  90  ? -15.089 -59.578 8.666   1.00 75.28  ? 88  TRP C CZ2   1 
ATOM   9534  C  CZ3   . TRP E  1  90  ? -15.897 -61.673 7.778   1.00 84.42  ? 88  TRP C CZ3   1 
ATOM   9535  C  CH2   . TRP E  1  90  ? -15.711 -60.784 8.842   1.00 79.40  ? 88  TRP C CH2   1 
ATOM   9536  N  N     . GLU E  1  91  ? -17.034 -57.959 3.360   1.00 72.64  ? 89  GLU C N     1 
ATOM   9537  C  CA    . GLU E  1  91  ? -17.471 -56.579 3.198   1.00 72.35  ? 89  GLU C CA    1 
ATOM   9538  C  C     . GLU E  1  91  ? -16.485 -55.617 3.849   1.00 70.24  ? 89  GLU C C     1 
ATOM   9539  O  O     . GLU E  1  91  ? -16.038 -55.835 4.979   1.00 70.30  ? 89  GLU C O     1 
ATOM   9540  C  CB    . GLU E  1  91  ? -18.864 -56.402 3.796   1.00 75.39  ? 89  GLU C CB    1 
ATOM   9541  C  CG    . GLU E  1  91  ? -19.921 -57.224 3.091   1.00 83.99  ? 89  GLU C CG    1 
ATOM   9542  C  CD    . GLU E  1  91  ? -20.127 -56.791 1.651   1.00 96.64  ? 89  GLU C CD    1 
ATOM   9543  O  OE1   . GLU E  1  91  ? -19.914 -55.597 1.350   1.00 100.84 ? 89  GLU C OE1   1 
ATOM   9544  O  OE2   . GLU E  1  91  ? -20.500 -57.645 0.819   1.00 103.19 ? 89  GLU C OE2   1 
ATOM   9545  N  N     . VAL E  1  92  ? -16.150 -54.545 3.127   1.00 73.18  ? 90  VAL C N     1 
ATOM   9546  C  CA    . VAL E  1  92  ? -15.179 -53.565 3.596   1.00 73.97  ? 90  VAL C CA    1 
ATOM   9547  C  C     . VAL E  1  92  ? -15.837 -52.324 4.177   1.00 70.89  ? 90  VAL C C     1 
ATOM   9548  O  O     . VAL E  1  92  ? -15.133 -51.443 4.690   1.00 64.74  ? 90  VAL C O     1 
ATOM   9549  C  CB    . VAL E  1  92  ? -14.206 -53.170 2.468   1.00 70.38  ? 90  VAL C CB    1 
ATOM   9550  C  CG1   . VAL E  1  92  ? -13.251 -54.312 2.169   1.00 70.09  ? 90  VAL C CG1   1 
ATOM   9551  C  CG2   . VAL E  1  92  ? -14.978 -52.783 1.219   1.00 73.01  ? 90  VAL C CG2   1 
ATOM   9552  N  N     . GLN E  1  93  ? -17.162 -52.218 4.108   1.00 73.13  ? 91  GLN C N     1 
ATOM   9553  C  CA    . GLN E  1  93  ? -17.880 -51.096 4.708   1.00 71.08  ? 91  GLN C CA    1 
ATOM   9554  C  C     . GLN E  1  93  ? -18.193 -51.480 6.149   1.00 73.79  ? 91  GLN C C     1 
ATOM   9555  O  O     . GLN E  1  93  ? -19.102 -52.271 6.412   1.00 76.59  ? 91  GLN C O     1 
ATOM   9556  C  CB    . GLN E  1  93  ? -19.146 -50.775 3.920   1.00 71.97  ? 91  GLN C CB    1 
ATOM   9557  C  CG    . GLN E  1  93  ? -19.775 -49.433 4.268   1.00 76.25  ? 91  GLN C CG    1 
ATOM   9558  C  CD    . GLN E  1  93  ? -18.949 -48.258 3.781   1.00 82.94  ? 91  GLN C CD    1 
ATOM   9559  O  OE1   . GLN E  1  93  ? -18.385 -48.292 2.687   1.00 97.36  ? 91  GLN C OE1   1 
ATOM   9560  N  NE2   . GLN E  1  93  ? -18.870 -47.212 4.596   1.00 75.06  ? 91  GLN C NE2   1 
ATOM   9561  N  N     . LEU E  1  94  ? -17.440 -50.911 7.087   1.00 71.96  ? 92  LEU C N     1 
ATOM   9562  C  CA    . LEU E  1  94  ? -17.505 -51.296 8.491   1.00 69.88  ? 92  LEU C CA    1 
ATOM   9563  C  C     . LEU E  1  94  ? -18.480 -50.451 9.301   1.00 66.39  ? 92  LEU C C     1 
ATOM   9564  O  O     . LEU E  1  94  ? -18.647 -50.702 10.499  1.00 67.71  ? 92  LEU C O     1 
ATOM   9565  C  CB    . LEU E  1  94  ? -16.110 -51.213 9.121   1.00 66.52  ? 92  LEU C CB    1 
ATOM   9566  C  CG    . LEU E  1  94  ? -14.957 -51.816 8.315   1.00 67.05  ? 92  LEU C CG    1 
ATOM   9567  C  CD1   . LEU E  1  94  ? -13.649 -51.700 9.082   1.00 63.63  ? 92  LEU C CD1   1 
ATOM   9568  C  CD2   . LEU E  1  94  ? -15.244 -53.266 7.950   1.00 67.81  ? 92  LEU C CD2   1 
ATOM   9569  N  N     . GLY E  1  95  ? -19.126 -49.473 8.684   1.00 70.56  ? 93  GLY C N     1 
ATOM   9570  C  CA    . GLY E  1  95  ? -20.113 -48.670 9.373   1.00 66.57  ? 93  GLY C CA    1 
ATOM   9571  C  C     . GLY E  1  95  ? -20.408 -47.409 8.586   1.00 68.12  ? 93  GLY C C     1 
ATOM   9572  O  O     . GLY E  1  95  ? -19.959 -47.240 7.452   1.00 64.45  ? 93  GLY C O     1 
ATOM   9573  N  N     . ILE E  1  96  ? -21.179 -46.528 9.216   1.00 63.34  ? 94  ILE C N     1 
ATOM   9574  C  CA    . ILE E  1  96  ? -21.704 -45.349 8.533   1.00 62.59  ? 94  ILE C CA    1 
ATOM   9575  C  C     . ILE E  1  96  ? -21.121 -44.080 9.147   1.00 62.20  ? 94  ILE C C     1 
ATOM   9576  O  O     . ILE E  1  96  ? -21.039 -43.966 10.379  1.00 62.00  ? 94  ILE C O     1 
ATOM   9577  C  CB    . ILE E  1  96  ? -23.240 -45.336 8.590   1.00 62.36  ? 94  ILE C CB    1 
ATOM   9578  C  CG1   . ILE E  1  96  ? -23.804 -46.616 7.972   1.00 66.34  ? 94  ILE C CG1   1 
ATOM   9579  C  CG2   . ILE E  1  96  ? -23.805 -44.115 7.890   1.00 56.99  ? 94  ILE C CG2   1 
ATOM   9580  C  CD1   . ILE E  1  96  ? -25.309 -46.681 7.995   1.00 80.38  ? 94  ILE C CD1   1 
ATOM   9581  N  N     . PRO E  1  97  ? -20.711 -43.105 8.335   1.00 66.81  ? 95  PRO C N     1 
ATOM   9582  C  CA    . PRO E  1  97  ? -20.118 -41.883 8.889   1.00 65.58  ? 95  PRO C CA    1 
ATOM   9583  C  C     . PRO E  1  97  ? -21.182 -40.986 9.503   1.00 65.99  ? 95  PRO C C     1 
ATOM   9584  O  O     . PRO E  1  97  ? -22.279 -40.835 8.962   1.00 66.75  ? 95  PRO C O     1 
ATOM   9585  C  CB    . PRO E  1  97  ? -19.460 -41.219 7.672   1.00 67.14  ? 95  PRO C CB    1 
ATOM   9586  C  CG    . PRO E  1  97  ? -19.344 -42.308 6.650   1.00 60.84  ? 95  PRO C CG    1 
ATOM   9587  C  CD    . PRO E  1  97  ? -20.518 -43.197 6.879   1.00 57.56  ? 95  PRO C CD    1 
ATOM   9588  N  N     . HIS E  1  98  ? -20.848 -40.390 10.648  1.00 61.83  ? 96  HIS C N     1 
ATOM   9589  C  CA    . HIS E  1  98  ? -21.798 -39.462 11.237  1.00 58.54  ? 96  HIS C CA    1 
ATOM   9590  C  C     . HIS E  1  98  ? -21.307 -38.026 11.090  1.00 62.69  ? 96  HIS C C     1 
ATOM   9591  O  O     . HIS E  1  98  ? -20.101 -37.771 11.188  1.00 67.46  ? 96  HIS C O     1 
ATOM   9592  C  CB    . HIS E  1  98  ? -22.030 -39.774 12.722  1.00 63.25  ? 96  HIS C CB    1 
ATOM   9593  C  CG    . HIS E  1  98  ? -23.359 -39.315 13.236  1.00 64.33  ? 96  HIS C CG    1 
ATOM   9594  N  ND1   . HIS E  1  98  ? -23.566 -38.050 13.742  1.00 69.60  ? 96  HIS C ND1   1 
ATOM   9595  C  CD2   . HIS E  1  98  ? -24.552 -39.952 13.317  1.00 55.19  ? 96  HIS C CD2   1 
ATOM   9596  C  CE1   . HIS E  1  98  ? -24.828 -37.927 14.114  1.00 75.36  ? 96  HIS C CE1   1 
ATOM   9597  N  NE2   . HIS E  1  98  ? -25.447 -39.067 13.868  1.00 65.01  ? 96  HIS C NE2   1 
ATOM   9598  N  N     . PRO E  1  99  ? -22.211 -37.077 10.830  1.00 68.07  ? 97  PRO C N     1 
ATOM   9599  C  CA    . PRO E  1  99  ? -21.798 -35.664 10.773  1.00 77.06  ? 97  PRO C CA    1 
ATOM   9600  C  C     . PRO E  1  99  ? -21.140 -35.170 12.048  1.00 79.69  ? 97  PRO C C     1 
ATOM   9601  O  O     . PRO E  1  99  ? -20.243 -34.320 11.978  1.00 78.14  ? 97  PRO C O     1 
ATOM   9602  C  CB    . PRO E  1  99  ? -23.116 -34.926 10.494  1.00 73.71  ? 97  PRO C CB    1 
ATOM   9603  C  CG    . PRO E  1  99  ? -24.195 -35.892 10.881  1.00 72.89  ? 97  PRO C CG    1 
ATOM   9604  C  CD    . PRO E  1  99  ? -23.647 -37.242 10.561  1.00 65.98  ? 97  PRO C CD    1 
ATOM   9605  N  N     . ALA E  1  100 ? -21.575 -35.655 13.214  1.00 73.13  ? 98  ALA C N     1 
ATOM   9606  C  CA    . ALA E  1  100 ? -20.965 -35.228 14.469  1.00 63.19  ? 98  ALA C CA    1 
ATOM   9607  C  C     . ALA E  1  100 ? -19.474 -35.538 14.504  1.00 63.85  ? 98  ALA C C     1 
ATOM   9608  O  O     . ALA E  1  100 ? -18.714 -34.856 15.201  1.00 61.71  ? 98  ALA C O     1 
ATOM   9609  C  CB    . ALA E  1  100 ? -21.672 -35.890 15.652  1.00 60.25  ? 98  ALA C CB    1 
ATOM   9610  N  N     . GLY E  1  101 ? -19.038 -36.556 13.760  1.00 59.28  ? 99  GLY C N     1 
ATOM   9611  C  CA    . GLY E  1  101 ? -17.615 -36.815 13.633  1.00 59.57  ? 99  GLY C CA    1 
ATOM   9612  C  C     . GLY E  1  101 ? -16.866 -35.744 12.865  1.00 74.19  ? 99  GLY C C     1 
ATOM   9613  O  O     . GLY E  1  101 ? -15.686 -35.501 13.131  1.00 87.35  ? 99  GLY C O     1 
ATOM   9614  N  N     . LEU E  1  102 ? -17.532 -35.090 11.912  1.00 72.60  ? 100 LEU C N     1 
ATOM   9615  C  CA    . LEU E  1  102 ? -16.855 -34.145 11.032  1.00 66.41  ? 100 LEU C CA    1 
ATOM   9616  C  C     . LEU E  1  102 ? -16.283 -32.965 11.809  1.00 73.16  ? 100 LEU C C     1 
ATOM   9617  O  O     . LEU E  1  102 ? -16.916 -32.432 12.725  1.00 74.45  ? 100 LEU C O     1 
ATOM   9618  C  CB    . LEU E  1  102 ? -17.820 -33.632 9.960   1.00 62.12  ? 100 LEU C CB    1 
ATOM   9619  C  CG    . LEU E  1  102 ? -18.450 -34.647 9.004   1.00 65.20  ? 100 LEU C CG    1 
ATOM   9620  C  CD1   . LEU E  1  102 ? -19.275 -33.935 7.942   1.00 67.67  ? 100 LEU C CD1   1 
ATOM   9621  C  CD2   . LEU E  1  102 ? -17.387 -35.517 8.359   1.00 66.71  ? 100 LEU C CD2   1 
ATOM   9622  N  N     . LYS E  1  103 ? -15.069 -32.565 11.438  1.00 85.38  ? 101 LYS C N     1 
ATOM   9623  C  CA    . LYS E  1  103 ? -14.475 -31.331 11.925  1.00 88.55  ? 101 LYS C CA    1 
ATOM   9624  C  C     . LYS E  1  103 ? -15.039 -30.130 11.170  1.00 92.53  ? 101 LYS C C     1 
ATOM   9625  O  O     . LYS E  1  103 ? -15.613 -30.256 10.084  1.00 92.44  ? 101 LYS C O     1 
ATOM   9626  C  CB    . LYS E  1  103 ? -12.951 -31.360 11.782  1.00 93.34  ? 101 LYS C CB    1 
ATOM   9627  C  CG    . LYS E  1  103 ? -12.226 -32.208 12.819  1.00 102.00 ? 101 LYS C CG    1 
ATOM   9628  C  CD    . LYS E  1  103 ? -12.179 -33.674 12.424  1.00 108.05 ? 101 LYS C CD    1 
ATOM   9629  C  CE    . LYS E  1  103 ? -11.354 -34.481 13.413  1.00 103.48 ? 101 LYS C CE    1 
ATOM   9630  N  NZ    . LYS E  1  103 ? -9.949  -33.989 13.482  1.00 106.13 ? 101 LYS C NZ    1 
ATOM   9631  N  N     . LYS E  1  104 ? -14.872 -28.953 11.766  1.00 98.35  ? 102 LYS C N     1 
ATOM   9632  C  CA    . LYS E  1  104 ? -15.235 -27.712 11.094  1.00 98.81  ? 102 LYS C CA    1 
ATOM   9633  C  C     . LYS E  1  104 ? -14.278 -27.450 9.937   1.00 96.25  ? 102 LYS C C     1 
ATOM   9634  O  O     . LYS E  1  104 ? -13.056 -27.474 10.111  1.00 90.70  ? 102 LYS C O     1 
ATOM   9635  C  CB    . LYS E  1  104 ? -15.203 -26.552 12.088  1.00 99.58  ? 102 LYS C CB    1 
ATOM   9636  C  CG    . LYS E  1  104 ? -15.338 -25.172 11.465  1.00 102.51 ? 102 LYS C CG    1 
ATOM   9637  C  CD    . LYS E  1  104 ? -16.747 -24.922 10.965  1.00 105.40 ? 102 LYS C CD    1 
ATOM   9638  C  CE    . LYS E  1  104 ? -16.914 -23.490 10.481  1.00 104.69 ? 102 LYS C CE    1 
ATOM   9639  N  NZ    . LYS E  1  104 ? -16.016 -23.182 9.335   1.00 100.36 ? 102 LYS C NZ    1 
ATOM   9640  N  N     . LYS E  1  105 ? -14.833 -27.192 8.754   1.00 97.55  ? 103 LYS C N     1 
ATOM   9641  C  CA    . LYS E  1  105 ? -14.047 -26.994 7.544   1.00 97.80  ? 103 LYS C CA    1 
ATOM   9642  C  C     . LYS E  1  105 ? -14.379 -25.650 6.912   1.00 96.89  ? 103 LYS C C     1 
ATOM   9643  O  O     . LYS E  1  105 ? -15.554 -25.295 6.772   1.00 91.09  ? 103 LYS C O     1 
ATOM   9644  C  CB    . LYS E  1  105 ? -14.279 -28.130 6.546   1.00 96.90  ? 103 LYS C CB    1 
ATOM   9645  C  CG    . LYS E  1  105 ? -13.530 -29.398 6.907   1.00 95.14  ? 103 LYS C CG    1 
ATOM   9646  C  CD    . LYS E  1  105 ? -12.044 -29.108 7.046   1.00 94.69  ? 103 LYS C CD    1 
ATOM   9647  C  CE    . LYS E  1  105 ? -11.327 -30.206 7.810   1.00 94.54  ? 103 LYS C CE    1 
ATOM   9648  N  NZ    . LYS E  1  105 ? -9.867  -29.936 7.926   1.00 103.46 ? 103 LYS C NZ    1 
ATOM   9649  N  N     . LYS E  1  106 ? -13.334 -24.908 6.538   1.00 100.73 ? 104 LYS C N     1 
ATOM   9650  C  CA    . LYS E  1  106 ? -13.521 -23.614 5.888   1.00 105.95 ? 104 LYS C CA    1 
ATOM   9651  C  C     . LYS E  1  106 ? -14.200 -23.754 4.529   1.00 108.62 ? 104 LYS C C     1 
ATOM   9652  O  O     . LYS E  1  106 ? -15.107 -22.981 4.200   1.00 113.71 ? 104 LYS C O     1 
ATOM   9653  C  CB    . LYS E  1  106 ? -12.172 -22.906 5.747   1.00 115.17 ? 104 LYS C CB    1 
ATOM   9654  C  CG    . LYS E  1  106 ? -12.271 -21.430 5.394   1.00 127.28 ? 104 LYS C CG    1 
ATOM   9655  C  CD    . LYS E  1  106 ? -10.895 -20.822 5.160   1.00 133.70 ? 104 LYS C CD    1 
ATOM   9656  C  CE    . LYS E  1  106 ? -10.034 -20.877 6.414   1.00 133.45 ? 104 LYS C CE    1 
ATOM   9657  N  NZ    . LYS E  1  106 ? -8.668  -20.331 6.173   1.00 133.13 ? 104 LYS C NZ    1 
ATOM   9658  N  N     . SER E  1  107 ? -13.775 -24.728 3.723   1.00 105.17 ? 105 SER C N     1 
ATOM   9659  C  CA    . SER E  1  107 ? -14.357 -24.970 2.407   1.00 100.31 ? 105 SER C CA    1 
ATOM   9660  C  C     . SER E  1  107 ? -14.750 -26.434 2.261   1.00 91.49  ? 105 SER C C     1 
ATOM   9661  O  O     . SER E  1  107 ? -13.946 -27.328 2.545   1.00 86.91  ? 105 SER C O     1 
ATOM   9662  C  CB    . SER E  1  107 ? -13.378 -24.571 1.298   1.00 109.43 ? 105 SER C CB    1 
ATOM   9663  O  OG    . SER E  1  107 ? -12.999 -23.210 1.415   1.00 110.37 ? 105 SER C OG    1 
ATOM   9664  N  N     . VAL E  1  108 ? -15.985 -26.673 1.820   1.00 91.21  ? 106 VAL C N     1 
ATOM   9665  C  CA    . VAL E  1  108 ? -16.571 -28.008 1.753   1.00 90.93  ? 106 VAL C CA    1 
ATOM   9666  C  C     . VAL E  1  108 ? -17.178 -28.217 0.371   1.00 94.63  ? 106 VAL C C     1 
ATOM   9667  O  O     . VAL E  1  108 ? -17.909 -27.352 -0.126  1.00 98.21  ? 106 VAL C O     1 
ATOM   9668  C  CB    . VAL E  1  108 ? -17.640 -28.210 2.846   1.00 94.65  ? 106 VAL C CB    1 
ATOM   9669  C  CG1   . VAL E  1  108 ? -18.496 -29.427 2.541   1.00 93.15  ? 106 VAL C CG1   1 
ATOM   9670  C  CG2   . VAL E  1  108 ? -16.986 -28.343 4.209   1.00 93.83  ? 106 VAL C CG2   1 
ATOM   9671  N  N     . THR E  1  109 ? -16.860 -29.352 -0.258  1.00 95.80  ? 107 THR C N     1 
ATOM   9672  C  CA    . THR E  1  109 ? -17.492 -29.769 -1.504  1.00 92.58  ? 107 THR C CA    1 
ATOM   9673  C  C     . THR E  1  109 ? -17.987 -31.206 -1.386  1.00 91.67  ? 107 THR C C     1 
ATOM   9674  O  O     . THR E  1  109 ? -17.303 -32.061 -0.815  1.00 94.18  ? 107 THR C O     1 
ATOM   9675  C  CB    . THR E  1  109 ? -16.523 -29.651 -2.687  1.00 92.19  ? 107 THR C CB    1 
ATOM   9676  O  OG1   . THR E  1  109 ? -15.851 -28.387 -2.633  1.00 102.92 ? 107 THR C OG1   1 
ATOM   9677  C  CG2   . THR E  1  109 ? -17.274 -29.755 -4.001  1.00 87.48  ? 107 THR C CG2   1 
ATOM   9678  N  N     . VAL E  1  110 ? -19.175 -31.468 -1.929  1.00 88.95  ? 108 VAL C N     1 
ATOM   9679  C  CA    . VAL E  1  110 ? -19.735 -32.814 -2.024  1.00 93.66  ? 108 VAL C CA    1 
ATOM   9680  C  C     . VAL E  1  110 ? -20.055 -33.105 -3.484  1.00 102.93 ? 108 VAL C C     1 
ATOM   9681  O  O     . VAL E  1  110 ? -20.770 -32.331 -4.131  1.00 112.24 ? 108 VAL C O     1 
ATOM   9682  C  CB    . VAL E  1  110 ? -20.993 -32.966 -1.148  1.00 97.43  ? 108 VAL C CB    1 
ATOM   9683  C  CG1   . VAL E  1  110 ? -21.777 -34.208 -1.546  1.00 100.19 ? 108 VAL C CG1   1 
ATOM   9684  C  CG2   . VAL E  1  110 ? -20.609 -33.023 0.322   1.00 91.64  ? 108 VAL C CG2   1 
ATOM   9685  N  N     . LEU E  1  111 ? -19.530 -34.218 -4.002  1.00 107.50 ? 109 LEU C N     1 
ATOM   9686  C  CA    . LEU E  1  111 ? -19.796 -34.629 -5.375  1.00 106.89 ? 109 LEU C CA    1 
ATOM   9687  C  C     . LEU E  1  111 ? -20.031 -36.133 -5.456  1.00 102.55 ? 109 LEU C C     1 
ATOM   9688  O  O     . LEU E  1  111 ? -19.407 -36.910 -4.727  1.00 96.75  ? 109 LEU C O     1 
ATOM   9689  C  CB    . LEU E  1  111 ? -18.646 -34.222 -6.308  1.00 100.49 ? 109 LEU C CB    1 
ATOM   9690  C  CG    . LEU E  1  111 ? -17.252 -34.058 -5.697  1.00 92.79  ? 109 LEU C CG    1 
ATOM   9691  C  CD1   . LEU E  1  111 ? -16.598 -35.404 -5.414  1.00 90.01  ? 109 LEU C CD1   1 
ATOM   9692  C  CD2   . LEU E  1  111 ? -16.379 -33.210 -6.607  1.00 96.97  ? 109 LEU C CD2   1 
ATOM   9693  N  N     . ASP E  1  112 ? -20.936 -36.529 -6.349  1.00 102.49 ? 110 ASP C N     1 
ATOM   9694  C  CA    . ASP E  1  112 ? -21.308 -37.919 -6.576  1.00 100.73 ? 110 ASP C CA    1 
ATOM   9695  C  C     . ASP E  1  112 ? -20.773 -38.381 -7.926  1.00 102.32 ? 110 ASP C C     1 
ATOM   9696  O  O     . ASP E  1  112 ? -20.700 -37.603 -8.882  1.00 110.52 ? 110 ASP C O     1 
ATOM   9697  C  CB    . ASP E  1  112 ? -22.831 -38.094 -6.518  1.00 102.25 ? 110 ASP C CB    1 
ATOM   9698  C  CG    . ASP E  1  112 ? -23.267 -39.540 -6.672  1.00 108.34 ? 110 ASP C CG    1 
ATOM   9699  O  OD1   . ASP E  1  112 ? -23.319 -40.029 -7.820  1.00 108.93 ? 110 ASP C OD1   1 
ATOM   9700  O  OD2   . ASP E  1  112 ? -23.576 -40.182 -5.646  1.00 109.73 ? 110 ASP C OD2   1 
ATOM   9701  N  N     . VAL E  1  113 ? -20.392 -39.657 -8.000  1.00 101.04 ? 111 VAL C N     1 
ATOM   9702  C  CA    . VAL E  1  113 ? -19.864 -40.226 -9.237  1.00 99.80  ? 111 VAL C CA    1 
ATOM   9703  C  C     . VAL E  1  113 ? -21.011 -40.673 -10.135 1.00 111.62 ? 111 VAL C C     1 
ATOM   9704  O  O     . VAL E  1  113 ? -21.974 -41.302 -9.679  1.00 132.74 ? 111 VAL C O     1 
ATOM   9705  C  CB    . VAL E  1  113 ? -18.915 -41.398 -8.920  1.00 88.78  ? 111 VAL C CB    1 
ATOM   9706  C  CG1   . VAL E  1  113 ? -18.584 -42.186 -10.179 1.00 83.17  ? 111 VAL C CG1   1 
ATOM   9707  C  CG2   . VAL E  1  113 ? -17.645 -40.891 -8.249  1.00 88.52  ? 111 VAL C CG2   1 
ATOM   9708  N  N     . GLY E  1  114 ? -20.905 -40.344 -11.422 1.00 107.34 ? 112 GLY C N     1 
ATOM   9709  C  CA    . GLY E  1  114 ? -21.900 -40.756 -12.404 1.00 99.77  ? 112 GLY C CA    1 
ATOM   9710  C  C     . GLY E  1  114 ? -21.739 -42.213 -12.812 1.00 100.48 ? 112 GLY C C     1 
ATOM   9711  O  O     . GLY E  1  114 ? -20.631 -42.660 -13.127 1.00 108.70 ? 112 GLY C O     1 
ATOM   9712  N  N     . ASP E  1  115 ? -22.853 -42.948 -12.830 1.00 97.61  ? 113 ASP C N     1 
ATOM   9713  C  CA    . ASP E  1  115 ? -22.901 -44.369 -13.199 1.00 103.96 ? 113 ASP C CA    1 
ATOM   9714  C  C     . ASP E  1  115 ? -21.779 -45.163 -12.524 1.00 106.13 ? 113 ASP C C     1 
ATOM   9715  O  O     . ASP E  1  115 ? -20.808 -45.598 -13.144 1.00 109.70 ? 113 ASP C O     1 
ATOM   9716  C  CB    . ASP E  1  115 ? -22.853 -44.544 -14.722 1.00 106.72 ? 113 ASP C CB    1 
ATOM   9717  C  CG    . ASP E  1  115 ? -24.232 -44.519 -15.358 1.00 114.33 ? 113 ASP C CG    1 
ATOM   9718  O  OD1   . ASP E  1  115 ? -25.183 -45.058 -14.751 1.00 117.47 ? 113 ASP C OD1   1 
ATOM   9719  O  OD2   . ASP E  1  115 ? -24.365 -43.960 -16.466 1.00 116.14 ? 113 ASP C OD2   1 
ATOM   9720  N  N     . ALA E  1  116 ? -21.951 -45.338 -11.213 1.00 105.78 ? 114 ALA C N     1 
ATOM   9721  C  CA    . ALA E  1  116 ? -20.848 -45.792 -10.374 1.00 100.91 ? 114 ALA C CA    1 
ATOM   9722  C  C     . ALA E  1  116 ? -20.509 -47.252 -10.653 1.00 100.41 ? 114 ALA C C     1 
ATOM   9723  O  O     . ALA E  1  116 ? -19.384 -47.574 -11.052 1.00 104.38 ? 114 ALA C O     1 
ATOM   9724  C  CB    . ALA E  1  116 ? -21.204 -45.586 -8.902  1.00 94.50  ? 114 ALA C CB    1 
ATOM   9725  N  N     . TYR E  1  117 ? -21.476 -48.156 -10.459 1.00 97.93  ? 115 TYR C N     1 
ATOM   9726  C  CA    . TYR E  1  117 ? -21.200 -49.577 -10.661 1.00 93.45  ? 115 TYR C CA    1 
ATOM   9727  C  C     . TYR E  1  117 ? -20.847 -49.887 -12.110 1.00 96.51  ? 115 TYR C C     1 
ATOM   9728  O  O     . TYR E  1  117 ? -20.050 -50.795 -12.374 1.00 98.46  ? 115 TYR C O     1 
ATOM   9729  C  CB    . TYR E  1  117 ? -22.404 -50.428 -10.252 1.00 92.42  ? 115 TYR C CB    1 
ATOM   9730  C  CG    . TYR E  1  117 ? -22.566 -50.668 -8.769  1.00 96.67  ? 115 TYR C CG    1 
ATOM   9731  C  CD1   . TYR E  1  117 ? -21.768 -50.014 -7.840  1.00 91.05  ? 115 TYR C CD1   1 
ATOM   9732  C  CD2   . TYR E  1  117 ? -23.516 -51.567 -8.299  1.00 100.32 ? 115 TYR C CD2   1 
ATOM   9733  C  CE1   . TYR E  1  117 ? -21.922 -50.240 -6.484  1.00 85.67  ? 115 TYR C CE1   1 
ATOM   9734  C  CE2   . TYR E  1  117 ? -23.676 -51.800 -6.950  1.00 96.62  ? 115 TYR C CE2   1 
ATOM   9735  C  CZ    . TYR E  1  117 ? -22.878 -51.135 -6.047  1.00 89.03  ? 115 TYR C CZ    1 
ATOM   9736  O  OH    . TYR E  1  117 ? -23.039 -51.366 -4.703  1.00 78.50  ? 115 TYR C OH    1 
ATOM   9737  N  N     . PHE E  1  118 ? -21.428 -49.151 -13.056 1.00 93.68  ? 116 PHE C N     1 
ATOM   9738  C  CA    . PHE E  1  118 ? -21.215 -49.404 -14.475 1.00 102.77 ? 116 PHE C CA    1 
ATOM   9739  C  C     . PHE E  1  118 ? -19.886 -48.874 -14.997 1.00 106.98 ? 116 PHE C C     1 
ATOM   9740  O  O     . PHE E  1  118 ? -19.514 -49.202 -16.129 1.00 118.73 ? 116 PHE C O     1 
ATOM   9741  C  CB    . PHE E  1  118 ? -22.362 -48.800 -15.293 1.00 109.63 ? 116 PHE C CB    1 
ATOM   9742  C  CG    . PHE E  1  118 ? -23.716 -49.367 -14.957 1.00 112.22 ? 116 PHE C CG    1 
ATOM   9743  C  CD1   . PHE E  1  118 ? -23.834 -50.596 -14.327 1.00 111.40 ? 116 PHE C CD1   1 
ATOM   9744  C  CD2   . PHE E  1  118 ? -24.871 -48.672 -15.275 1.00 112.35 ? 116 PHE C CD2   1 
ATOM   9745  C  CE1   . PHE E  1  118 ? -25.078 -51.118 -14.015 1.00 110.59 ? 116 PHE C CE1   1 
ATOM   9746  C  CE2   . PHE E  1  118 ? -26.117 -49.188 -14.969 1.00 111.53 ? 116 PHE C CE2   1 
ATOM   9747  C  CZ    . PHE E  1  118 ? -26.220 -50.413 -14.338 1.00 112.88 ? 116 PHE C CZ    1 
ATOM   9748  N  N     . SER E  1  119 ? -19.172 -48.063 -14.221 1.00 101.36 ? 117 SER C N     1 
ATOM   9749  C  CA    . SER E  1  119 ? -17.820 -47.654 -14.575 1.00 103.26 ? 117 SER C CA    1 
ATOM   9750  C  C     . SER E  1  119 ? -16.751 -48.608 -14.056 1.00 103.44 ? 117 SER C C     1 
ATOM   9751  O  O     . SER E  1  119 ? -15.562 -48.286 -14.143 1.00 103.62 ? 117 SER C O     1 
ATOM   9752  C  CB    . SER E  1  119 ? -17.544 -46.241 -14.053 1.00 103.05 ? 117 SER C CB    1 
ATOM   9753  O  OG    . SER E  1  119 ? -18.498 -45.315 -14.545 1.00 106.16 ? 117 SER C OG    1 
ATOM   9754  N  N     . VAL E  1  120 ? -17.135 -49.755 -13.505 1.00 103.15 ? 118 VAL C N     1 
ATOM   9755  C  CA    . VAL E  1  120 ? -16.205 -50.687 -12.881 1.00 97.73  ? 118 VAL C CA    1 
ATOM   9756  C  C     . VAL E  1  120 ? -16.229 -51.985 -13.676 1.00 98.44  ? 118 VAL C C     1 
ATOM   9757  O  O     . VAL E  1  120 ? -17.307 -52.526 -13.923 1.00 106.13 ? 118 VAL C O     1 
ATOM   9758  C  CB    . VAL E  1  120 ? -16.540 -50.960 -11.404 1.00 93.13  ? 118 VAL C CB    1 
ATOM   9759  C  CG1   . VAL E  1  120 ? -15.366 -51.640 -10.714 1.00 89.48  ? 118 VAL C CG1   1 
ATOM   9760  C  CG2   . VAL E  1  120 ? -16.885 -49.667 -10.707 1.00 88.33  ? 118 VAL C CG2   1 
ATOM   9761  N  N     . PRO E  1  121 ? -15.079 -52.519 -14.080 1.00 96.51  ? 119 PRO C N     1 
ATOM   9762  C  CA    . PRO E  1  121 ? -15.070 -53.758 -14.863 1.00 101.96 ? 119 PRO C CA    1 
ATOM   9763  C  C     . PRO E  1  121 ? -15.441 -54.966 -14.016 1.00 109.23 ? 119 PRO C C     1 
ATOM   9764  O  O     . PRO E  1  121 ? -14.972 -55.127 -12.887 1.00 113.07 ? 119 PRO C O     1 
ATOM   9765  C  CB    . PRO E  1  121 ? -13.623 -53.849 -15.358 1.00 95.06  ? 119 PRO C CB    1 
ATOM   9766  C  CG    . PRO E  1  121 ? -12.839 -53.120 -14.316 1.00 94.26  ? 119 PRO C CG    1 
ATOM   9767  C  CD    . PRO E  1  121 ? -13.723 -51.994 -13.860 1.00 91.03  ? 119 PRO C CD    1 
ATOM   9768  N  N     . LEU E  1  122 ? -16.290 -55.821 -14.579 1.00 108.98 ? 120 LEU C N     1 
ATOM   9769  C  CA    . LEU E  1  122 ? -16.541 -57.129 -14.001 1.00 104.86 ? 120 LEU C CA    1 
ATOM   9770  C  C     . LEU E  1  122 ? -15.394 -58.078 -14.347 1.00 109.03 ? 120 LEU C C     1 
ATOM   9771  O  O     . LEU E  1  122 ? -14.579 -57.810 -15.235 1.00 118.75 ? 120 LEU C O     1 
ATOM   9772  C  CB    . LEU E  1  122 ? -17.878 -57.683 -14.505 1.00 101.44 ? 120 LEU C CB    1 
ATOM   9773  C  CG    . LEU E  1  122 ? -18.474 -58.933 -13.853 1.00 98.15  ? 120 LEU C CG    1 
ATOM   9774  C  CD1   . LEU E  1  122 ? -18.548 -58.768 -12.345 1.00 94.35  ? 120 LEU C CD1   1 
ATOM   9775  C  CD2   . LEU E  1  122 ? -19.850 -59.230 -14.430 1.00 93.51  ? 120 LEU C CD2   1 
ATOM   9776  N  N     . ASP E  1  123 ? -15.335 -59.197 -13.630 1.00 109.97 ? 121 ASP C N     1 
ATOM   9777  C  CA    . ASP E  1  123 ? -14.331 -60.212 -13.916 1.00 118.96 ? 121 ASP C CA    1 
ATOM   9778  C  C     . ASP E  1  123 ? -14.577 -60.843 -15.282 1.00 125.43 ? 121 ASP C C     1 
ATOM   9779  O  O     . ASP E  1  123 ? -15.720 -61.095 -15.672 1.00 128.48 ? 121 ASP C O     1 
ATOM   9780  C  CB    . ASP E  1  123 ? -14.340 -61.288 -12.831 1.00 121.58 ? 121 ASP C CB    1 
ATOM   9781  C  CG    . ASP E  1  123 ? -13.307 -62.368 -13.075 1.00 125.34 ? 121 ASP C CG    1 
ATOM   9782  O  OD1   . ASP E  1  123 ? -12.171 -62.028 -13.468 1.00 128.55 ? 121 ASP C OD1   1 
ATOM   9783  O  OD2   . ASP E  1  123 ? -13.633 -63.557 -12.878 1.00 124.88 ? 121 ASP C OD2   1 
ATOM   9784  N  N     . GLU E  1  124 ? -13.487 -61.089 -16.013 1.00 127.27 ? 122 GLU C N     1 
ATOM   9785  C  CA    . GLU E  1  124 ? -13.598 -61.622 -17.367 1.00 133.47 ? 122 GLU C CA    1 
ATOM   9786  C  C     . GLU E  1  124 ? -14.228 -63.011 -17.368 1.00 129.66 ? 122 GLU C C     1 
ATOM   9787  O  O     . GLU E  1  124 ? -15.198 -63.265 -18.091 1.00 125.48 ? 122 GLU C O     1 
ATOM   9788  C  CB    . GLU E  1  124 ? -12.219 -61.658 -18.028 1.00 142.31 ? 122 GLU C CB    1 
ATOM   9789  C  CG    . GLU E  1  124 ? -12.232 -62.169 -19.460 1.00 150.68 ? 122 GLU C CG    1 
ATOM   9790  C  CD    . GLU E  1  124 ? -11.889 -61.091 -20.468 1.00 154.84 ? 122 GLU C CD    1 
ATOM   9791  O  OE1   . GLU E  1  124 ? -10.772 -60.536 -20.390 1.00 154.56 ? 122 GLU C OE1   1 
ATOM   9792  O  OE2   . GLU E  1  124 ? -12.740 -60.792 -21.332 1.00 158.55 ? 122 GLU C OE2   1 
ATOM   9793  N  N     . ASP E  1  125 ? -13.680 -63.927 -16.565 1.00 129.15 ? 123 ASP C N     1 
ATOM   9794  C  CA    . ASP E  1  125 ? -14.211 -65.287 -16.525 1.00 132.88 ? 123 ASP C CA    1 
ATOM   9795  C  C     . ASP E  1  125 ? -15.610 -65.326 -15.921 1.00 128.56 ? 123 ASP C C     1 
ATOM   9796  O  O     . ASP E  1  125 ? -16.460 -66.106 -16.365 1.00 127.24 ? 123 ASP C O     1 
ATOM   9797  C  CB    . ASP E  1  125 ? -13.263 -66.198 -15.746 1.00 136.77 ? 123 ASP C CB    1 
ATOM   9798  C  CG    . ASP E  1  125 ? -11.946 -66.418 -16.463 1.00 141.80 ? 123 ASP C CG    1 
ATOM   9799  O  OD1   . ASP E  1  125 ? -11.404 -67.541 -16.382 1.00 144.98 ? 123 ASP C OD1   1 
ATOM   9800  O  OD2   . ASP E  1  125 ? -11.452 -65.470 -17.109 1.00 144.03 ? 123 ASP C OD2   1 
ATOM   9801  N  N     . PHE E  1  126 ? -15.866 -64.500 -14.904 1.00 123.87 ? 124 PHE C N     1 
ATOM   9802  C  CA    . PHE E  1  126 ? -17.179 -64.496 -14.265 1.00 117.53 ? 124 PHE C CA    1 
ATOM   9803  C  C     . PHE E  1  126 ? -18.267 -64.034 -15.228 1.00 115.59 ? 124 PHE C C     1 
ATOM   9804  O  O     . PHE E  1  126 ? -19.402 -64.521 -15.169 1.00 112.67 ? 124 PHE C O     1 
ATOM   9805  C  CB    . PHE E  1  126 ? -17.157 -63.620 -13.013 1.00 115.17 ? 124 PHE C CB    1 
ATOM   9806  C  CG    . PHE E  1  126 ? -18.208 -63.984 -12.005 1.00 110.58 ? 124 PHE C CG    1 
ATOM   9807  C  CD1   . PHE E  1  126 ? -17.988 -65.008 -11.098 1.00 111.59 ? 124 PHE C CD1   1 
ATOM   9808  C  CD2   . PHE E  1  126 ? -19.417 -63.309 -11.967 1.00 108.60 ? 124 PHE C CD2   1 
ATOM   9809  C  CE1   . PHE E  1  126 ? -18.953 -65.350 -10.170 1.00 114.08 ? 124 PHE C CE1   1 
ATOM   9810  C  CE2   . PHE E  1  126 ? -20.386 -63.647 -11.041 1.00 109.18 ? 124 PHE C CE2   1 
ATOM   9811  C  CZ    . PHE E  1  126 ? -20.153 -64.668 -10.142 1.00 112.62 ? 124 PHE C CZ    1 
ATOM   9812  N  N     . ARG E  1  127 ? -17.941 -63.080 -16.105 1.00 117.81 ? 125 ARG C N     1 
ATOM   9813  C  CA    . ARG E  1  127 ? -18.895 -62.322 -16.915 1.00 117.49 ? 125 ARG C CA    1 
ATOM   9814  C  C     . ARG E  1  127 ? -20.047 -63.154 -17.472 1.00 123.84 ? 125 ARG C C     1 
ATOM   9815  O  O     . ARG E  1  127 ? -21.190 -62.687 -17.503 1.00 122.96 ? 125 ARG C O     1 
ATOM   9816  C  CB    . ARG E  1  127 ? -18.159 -61.640 -18.072 1.00 114.40 ? 125 ARG C CB    1 
ATOM   9817  C  CG    . ARG E  1  127 ? -17.886 -60.159 -17.862 1.00 109.73 ? 125 ARG C CG    1 
ATOM   9818  C  CD    . ARG E  1  127 ? -16.593 -59.739 -18.544 1.00 110.04 ? 125 ARG C CD    1 
ATOM   9819  N  NE    . ARG E  1  127 ? -16.474 -58.288 -18.663 1.00 113.81 ? 125 ARG C NE    1 
ATOM   9820  C  CZ    . ARG E  1  127 ? -15.334 -57.650 -18.907 1.00 120.50 ? 125 ARG C CZ    1 
ATOM   9821  N  NH1   . ARG E  1  127 ? -14.206 -58.334 -19.045 1.00 126.58 ? 125 ARG C NH1   1 
ATOM   9822  N  NH2   . ARG E  1  127 ? -15.319 -56.327 -19.004 1.00 121.65 ? 125 ARG C NH2   1 
ATOM   9823  N  N     . LYS E  1  128 ? -19.749 -64.375 -17.929 1.00 130.33 ? 126 LYS C N     1 
ATOM   9824  C  CA    . LYS E  1  128 ? -20.756 -65.204 -18.591 1.00 135.00 ? 126 LYS C CA    1 
ATOM   9825  C  C     . LYS E  1  128 ? -22.010 -65.392 -17.741 1.00 138.05 ? 126 LYS C C     1 
ATOM   9826  O  O     . LYS E  1  128 ? -23.130 -65.330 -18.260 1.00 140.70 ? 126 LYS C O     1 
ATOM   9827  C  CB    . LYS E  1  128 ? -20.162 -66.561 -18.981 1.00 131.39 ? 126 LYS C CB    1 
ATOM   9828  C  CG    . LYS E  1  128 ? -19.159 -67.154 -18.006 1.00 128.76 ? 126 LYS C CG    1 
ATOM   9829  C  CD    . LYS E  1  128 ? -18.674 -68.501 -18.533 1.00 127.00 ? 126 LYS C CD    1 
ATOM   9830  C  CE    . LYS E  1  128 ? -17.282 -68.856 -18.032 1.00 127.90 ? 126 LYS C CE    1 
ATOM   9831  N  NZ    . LYS E  1  128 ? -17.267 -69.251 -16.600 1.00 127.08 ? 126 LYS C NZ    1 
ATOM   9832  N  N     . TYR E  1  129 ? -21.848 -65.625 -16.436 1.00 136.09 ? 127 TYR C N     1 
ATOM   9833  C  CA    . TYR E  1  129 ? -22.986 -66.033 -15.615 1.00 131.84 ? 127 TYR C CA    1 
ATOM   9834  C  C     . TYR E  1  129 ? -24.033 -64.938 -15.423 1.00 124.99 ? 127 TYR C C     1 
ATOM   9835  O  O     . TYR E  1  129 ? -25.062 -65.206 -14.794 1.00 112.68 ? 127 TYR C O     1 
ATOM   9836  C  CB    . TYR E  1  129 ? -22.494 -66.513 -14.247 1.00 127.71 ? 127 TYR C CB    1 
ATOM   9837  C  CG    . TYR E  1  129 ? -21.446 -67.600 -14.319 1.00 133.93 ? 127 TYR C CG    1 
ATOM   9838  C  CD1   . TYR E  1  129 ? -21.806 -68.926 -14.517 1.00 133.93 ? 127 TYR C CD1   1 
ATOM   9839  C  CD2   . TYR E  1  129 ? -20.098 -67.301 -14.182 1.00 136.66 ? 127 TYR C CD2   1 
ATOM   9840  C  CE1   . TYR E  1  129 ? -20.851 -69.922 -14.582 1.00 135.41 ? 127 TYR C CE1   1 
ATOM   9841  C  CE2   . TYR E  1  129 ? -19.136 -68.288 -14.246 1.00 137.25 ? 127 TYR C CE2   1 
ATOM   9842  C  CZ    . TYR E  1  129 ? -19.518 -69.598 -14.447 1.00 136.16 ? 127 TYR C CZ    1 
ATOM   9843  O  OH    . TYR E  1  129 ? -18.562 -70.586 -14.509 1.00 134.77 ? 127 TYR C OH    1 
ATOM   9844  N  N     . THR E  1  130 ? -23.811 -63.730 -15.941 1.00 129.67 ? 128 THR C N     1 
ATOM   9845  C  CA    . THR E  1  130 ? -24.737 -62.616 -15.764 1.00 128.21 ? 128 THR C CA    1 
ATOM   9846  C  C     . THR E  1  130 ? -25.908 -62.654 -16.741 1.00 137.27 ? 128 THR C C     1 
ATOM   9847  O  O     . THR E  1  130 ? -26.796 -61.799 -16.649 1.00 135.07 ? 128 THR C O     1 
ATOM   9848  C  CB    . THR E  1  130 ? -23.997 -61.282 -15.903 1.00 123.51 ? 128 THR C CB    1 
ATOM   9849  O  OG1   . THR E  1  130 ? -23.084 -61.351 -17.006 1.00 126.11 ? 128 THR C OG1   1 
ATOM   9850  C  CG2   . THR E  1  130 ? -23.231 -60.963 -14.628 1.00 115.91 ? 128 THR C CG2   1 
ATOM   9851  N  N     . ALA E  1  131 ? -25.913 -63.611 -17.667 1.00 149.10 ? 129 ALA C N     1 
ATOM   9852  C  CA    . ALA E  1  131 ? -26.787 -63.581 -18.836 1.00 157.25 ? 129 ALA C CA    1 
ATOM   9853  C  C     . ALA E  1  131 ? -28.262 -63.446 -18.469 1.00 160.16 ? 129 ALA C C     1 
ATOM   9854  O  O     . ALA E  1  131 ? -28.777 -64.185 -17.626 1.00 161.84 ? 129 ALA C O     1 
ATOM   9855  C  CB    . ALA E  1  131 ? -26.572 -64.846 -19.661 1.00 159.08 ? 129 ALA C CB