data_5TZ2
# 
_entry.id   5TZ2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5TZ2         
WWPDB D_1000225060 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5TZT PDB . 
unspecified 5TZU PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5TZ2 
_pdbx_database_status.recvd_initial_deposition_date   2016-11-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_audit_author.name           'Cardoso, R.M.F.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Blood Cancer J' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2044-5385 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                e536 
_citation.page_last                 e536 
_citation.title                     'Anti-leukemic activity and tolerability of anti-human CD47 monoclonal antibodies.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/bcj.2017.7 
_citation.pdbx_database_id_PubMed   28234345 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pietsch, E.C.'       1  ? 
primary 'Dong, J.'            2  ? 
primary 'Cardoso, R.'         3  ? 
primary 'Zhang, X.'           4  ? 
primary 'Chin, D.'            5  ? 
primary 'Hawkins, R.'         6  ? 
primary 'Dinh, T.'            7  ? 
primary 'Zhou, M.'            8  ? 
primary 'Strake, B.'          9  ? 
primary 'Feng, P.H.'          10 ? 
primary 'Rocca, M.'           11 ? 
primary 'Santos, C.D.'        12 ? 
primary 'Shan, X.'            13 ? 
primary 'Danet-Desnoyers, G.' 14 ? 
primary 'Shi, F.'             15 ? 
primary 'Kaiser, E.'          16 ? 
primary 'Millar, H.J.'        17 ? 
primary 'Fenton, S.'          18 ? 
primary 'Swanson, R.'         19 ? 
primary 'Nemeth, J.A.'        20 ? 
primary 'Attar, R.M.'         21 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   108.970 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5TZ2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     60.567 
_cell.length_a_esd                 ? 
_cell.length_b                     72.934 
_cell.length_b_esd                 ? 
_cell.length_c                     72.698 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5TZ2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'C47B222 Fab Heavy Chain'                                                                 24643.623 1   ? ?    ? 
? 
2 polymer     man 'C47B222 Fab Light Chain'                                                                 23406.055 1   ? ?    ? 
? 
3 polymer     man 'Leukocyte surface antigen CD47'                                                          14764.539 1   ? C15G 
'extracellular domain, UNP residues 19-141' ? 
4 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2   ? ?    ? 
? 
5 non-polymer syn GLYCEROL                                                                                  92.094    1   ? ?    ? 
? 
6 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   3   ? ?    ? 
? 
7 water       nat water                                                                                     18.015    105 ? ?    ? 
? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Antigenic surface determinant protein OA3,Integrin-associated protein,IAP,Protein MER6' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAY
LQWSSLKASDTAVYYCARVGRFASHQLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH
;
;EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAY
LQWSSLKASDTAVYYCARVGRFASHQLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH
;
H ? 
2 'polypeptide(L)' no no 
;EIVLTQSPATLSLSPGERATLSCRASQSVNNRLAWYQQKPGQAPRLLIHWASTRAIGIPARFSGSGSGTDFTLTISSLEP
EDFAVYYCQQGASWPFTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
;EIVLTQSPATLSLSPGERATLSCRASQSVNNRLAWYQQKPGQAPRLLIHWASTRAIGIPARFSGSGSGTDFTLTISSLEP
EDFAVYYCQQGASWPFTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
L ? 
3 'polypeptide(L)' no no 
;QLLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASL
KMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEHHHHHH
;
;QLLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASL
KMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEHHHHHH
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   VAL n 
1 3   GLN n 
1 4   LEU n 
1 5   VAL n 
1 6   GLN n 
1 7   SER n 
1 8   GLY n 
1 9   ALA n 
1 10  GLU n 
1 11  VAL n 
1 12  LYS n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  GLU n 
1 17  SER n 
1 18  LEU n 
1 19  LYS n 
1 20  ILE n 
1 21  SER n 
1 22  CYS n 
1 23  LYS n 
1 24  GLY n 
1 25  SER n 
1 26  GLY n 
1 27  TYR n 
1 28  SER n 
1 29  PHE n 
1 30  THR n 
1 31  ASP n 
1 32  TYR n 
1 33  TRP n 
1 34  ILE n 
1 35  GLY n 
1 36  TRP n 
1 37  VAL n 
1 38  ARG n 
1 39  GLN n 
1 40  MET n 
1 41  PRO n 
1 42  GLY n 
1 43  LYS n 
1 44  GLY n 
1 45  LEU n 
1 46  GLU n 
1 47  TRP n 
1 48  MET n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  TYR n 
1 53  PRO n 
1 54  GLY n 
1 55  ASP n 
1 56  SER n 
1 57  ASP n 
1 58  THR n 
1 59  ARG n 
1 60  TYR n 
1 61  SER n 
1 62  PRO n 
1 63  SER n 
1 64  PHE n 
1 65  GLN n 
1 66  GLY n 
1 67  GLN n 
1 68  VAL n 
1 69  THR n 
1 70  ILE n 
1 71  SER n 
1 72  ALA n 
1 73  ASP n 
1 74  LYS n 
1 75  SER n 
1 76  ILE n 
1 77  SER n 
1 78  THR n 
1 79  ALA n 
1 80  TYR n 
1 81  LEU n 
1 82  GLN n 
1 83  TRP n 
1 84  SER n 
1 85  SER n 
1 86  LEU n 
1 87  LYS n 
1 88  ALA n 
1 89  SER n 
1 90  ASP n 
1 91  THR n 
1 92  ALA n 
1 93  VAL n 
1 94  TYR n 
1 95  TYR n 
1 96  CYS n 
1 97  ALA n 
1 98  ARG n 
1 99  VAL n 
1 100 GLY n 
1 101 ARG n 
1 102 PHE n 
1 103 ALA n 
1 104 SER n 
1 105 HIS n 
1 106 GLN n 
1 107 LEU n 
1 108 ASP n 
1 109 TYR n 
1 110 TRP n 
1 111 GLY n 
1 112 GLN n 
1 113 GLY n 
1 114 THR n 
1 115 LEU n 
1 116 VAL n 
1 117 THR n 
1 118 VAL n 
1 119 SER n 
1 120 SER n 
1 121 ALA n 
1 122 SER n 
1 123 THR n 
1 124 LYS n 
1 125 GLY n 
1 126 PRO n 
1 127 SER n 
1 128 VAL n 
1 129 PHE n 
1 130 PRO n 
1 131 LEU n 
1 132 ALA n 
1 133 PRO n 
1 134 SER n 
1 135 SER n 
1 136 LYS n 
1 137 SER n 
1 138 THR n 
1 139 SER n 
1 140 GLY n 
1 141 GLY n 
1 142 THR n 
1 143 ALA n 
1 144 ALA n 
1 145 LEU n 
1 146 GLY n 
1 147 CYS n 
1 148 LEU n 
1 149 VAL n 
1 150 LYS n 
1 151 ASP n 
1 152 TYR n 
1 153 PHE n 
1 154 PRO n 
1 155 GLU n 
1 156 PRO n 
1 157 VAL n 
1 158 THR n 
1 159 VAL n 
1 160 SER n 
1 161 TRP n 
1 162 ASN n 
1 163 SER n 
1 164 GLY n 
1 165 ALA n 
1 166 LEU n 
1 167 THR n 
1 168 SER n 
1 169 GLY n 
1 170 VAL n 
1 171 HIS n 
1 172 THR n 
1 173 PHE n 
1 174 PRO n 
1 175 ALA n 
1 176 VAL n 
1 177 LEU n 
1 178 GLN n 
1 179 SER n 
1 180 SER n 
1 181 GLY n 
1 182 LEU n 
1 183 TYR n 
1 184 SER n 
1 185 LEU n 
1 186 SER n 
1 187 SER n 
1 188 VAL n 
1 189 VAL n 
1 190 THR n 
1 191 VAL n 
1 192 PRO n 
1 193 SER n 
1 194 SER n 
1 195 SER n 
1 196 LEU n 
1 197 GLY n 
1 198 THR n 
1 199 GLN n 
1 200 THR n 
1 201 TYR n 
1 202 ILE n 
1 203 CYS n 
1 204 ASN n 
1 205 VAL n 
1 206 ASN n 
1 207 HIS n 
1 208 LYS n 
1 209 PRO n 
1 210 SER n 
1 211 ASN n 
1 212 THR n 
1 213 LYS n 
1 214 VAL n 
1 215 ASP n 
1 216 LYS n 
1 217 LYS n 
1 218 VAL n 
1 219 GLU n 
1 220 PRO n 
1 221 LYS n 
1 222 SER n 
1 223 CYS n 
1 224 HIS n 
1 225 HIS n 
1 226 HIS n 
1 227 HIS n 
1 228 HIS n 
1 229 HIS n 
2 1   GLU n 
2 2   ILE n 
2 3   VAL n 
2 4   LEU n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   ALA n 
2 10  THR n 
2 11  LEU n 
2 12  SER n 
2 13  LEU n 
2 14  SER n 
2 15  PRO n 
2 16  GLY n 
2 17  GLU n 
2 18  ARG n 
2 19  ALA n 
2 20  THR n 
2 21  LEU n 
2 22  SER n 
2 23  CYS n 
2 24  ARG n 
2 25  ALA n 
2 26  SER n 
2 27  GLN n 
2 28  SER n 
2 29  VAL n 
2 30  ASN n 
2 31  ASN n 
2 32  ARG n 
2 33  LEU n 
2 34  ALA n 
2 35  TRP n 
2 36  TYR n 
2 37  GLN n 
2 38  GLN n 
2 39  LYS n 
2 40  PRO n 
2 41  GLY n 
2 42  GLN n 
2 43  ALA n 
2 44  PRO n 
2 45  ARG n 
2 46  LEU n 
2 47  LEU n 
2 48  ILE n 
2 49  HIS n 
2 50  TRP n 
2 51  ALA n 
2 52  SER n 
2 53  THR n 
2 54  ARG n 
2 55  ALA n 
2 56  ILE n 
2 57  GLY n 
2 58  ILE n 
2 59  PRO n 
2 60  ALA n 
2 61  ARG n 
2 62  PHE n 
2 63  SER n 
2 64  GLY n 
2 65  SER n 
2 66  GLY n 
2 67  SER n 
2 68  GLY n 
2 69  THR n 
2 70  ASP n 
2 71  PHE n 
2 72  THR n 
2 73  LEU n 
2 74  THR n 
2 75  ILE n 
2 76  SER n 
2 77  SER n 
2 78  LEU n 
2 79  GLU n 
2 80  PRO n 
2 81  GLU n 
2 82  ASP n 
2 83  PHE n 
2 84  ALA n 
2 85  VAL n 
2 86  TYR n 
2 87  TYR n 
2 88  CYS n 
2 89  GLN n 
2 90  GLN n 
2 91  GLY n 
2 92  ALA n 
2 93  SER n 
2 94  TRP n 
2 95  PRO n 
2 96  PHE n 
2 97  THR n 
2 98  PHE n 
2 99  GLY n 
2 100 GLN n 
2 101 GLY n 
2 102 THR n 
2 103 LYS n 
2 104 VAL n 
2 105 GLU n 
2 106 ILE n 
2 107 LYS n 
2 108 ARG n 
2 109 THR n 
2 110 VAL n 
2 111 ALA n 
2 112 ALA n 
2 113 PRO n 
2 114 SER n 
2 115 VAL n 
2 116 PHE n 
2 117 ILE n 
2 118 PHE n 
2 119 PRO n 
2 120 PRO n 
2 121 SER n 
2 122 ASP n 
2 123 GLU n 
2 124 GLN n 
2 125 LEU n 
2 126 LYS n 
2 127 SER n 
2 128 GLY n 
2 129 THR n 
2 130 ALA n 
2 131 SER n 
2 132 VAL n 
2 133 VAL n 
2 134 CYS n 
2 135 LEU n 
2 136 LEU n 
2 137 ASN n 
2 138 ASN n 
2 139 PHE n 
2 140 TYR n 
2 141 PRO n 
2 142 ARG n 
2 143 GLU n 
2 144 ALA n 
2 145 LYS n 
2 146 VAL n 
2 147 GLN n 
2 148 TRP n 
2 149 LYS n 
2 150 VAL n 
2 151 ASP n 
2 152 ASN n 
2 153 ALA n 
2 154 LEU n 
2 155 GLN n 
2 156 SER n 
2 157 GLY n 
2 158 ASN n 
2 159 SER n 
2 160 GLN n 
2 161 GLU n 
2 162 SER n 
2 163 VAL n 
2 164 THR n 
2 165 GLU n 
2 166 GLN n 
2 167 ASP n 
2 168 SER n 
2 169 LYS n 
2 170 ASP n 
2 171 SER n 
2 172 THR n 
2 173 TYR n 
2 174 SER n 
2 175 LEU n 
2 176 SER n 
2 177 SER n 
2 178 THR n 
2 179 LEU n 
2 180 THR n 
2 181 LEU n 
2 182 SER n 
2 183 LYS n 
2 184 ALA n 
2 185 ASP n 
2 186 TYR n 
2 187 GLU n 
2 188 LYS n 
2 189 HIS n 
2 190 LYS n 
2 191 VAL n 
2 192 TYR n 
2 193 ALA n 
2 194 CYS n 
2 195 GLU n 
2 196 VAL n 
2 197 THR n 
2 198 HIS n 
2 199 GLN n 
2 200 GLY n 
2 201 LEU n 
2 202 SER n 
2 203 SER n 
2 204 PRO n 
2 205 VAL n 
2 206 THR n 
2 207 LYS n 
2 208 SER n 
2 209 PHE n 
2 210 ASN n 
2 211 ARG n 
2 212 GLY n 
2 213 GLU n 
2 214 CYS n 
3 1   GLN n 
3 2   LEU n 
3 3   LEU n 
3 4   PHE n 
3 5   ASN n 
3 6   LYS n 
3 7   THR n 
3 8   LYS n 
3 9   SER n 
3 10  VAL n 
3 11  GLU n 
3 12  PHE n 
3 13  THR n 
3 14  PHE n 
3 15  GLY n 
3 16  ASN n 
3 17  ASP n 
3 18  THR n 
3 19  VAL n 
3 20  VAL n 
3 21  ILE n 
3 22  PRO n 
3 23  CYS n 
3 24  PHE n 
3 25  VAL n 
3 26  THR n 
3 27  ASN n 
3 28  MET n 
3 29  GLU n 
3 30  ALA n 
3 31  GLN n 
3 32  ASN n 
3 33  THR n 
3 34  THR n 
3 35  GLU n 
3 36  VAL n 
3 37  TYR n 
3 38  VAL n 
3 39  LYS n 
3 40  TRP n 
3 41  LYS n 
3 42  PHE n 
3 43  LYS n 
3 44  GLY n 
3 45  ARG n 
3 46  ASP n 
3 47  ILE n 
3 48  TYR n 
3 49  THR n 
3 50  PHE n 
3 51  ASP n 
3 52  GLY n 
3 53  ALA n 
3 54  LEU n 
3 55  ASN n 
3 56  LYS n 
3 57  SER n 
3 58  THR n 
3 59  VAL n 
3 60  PRO n 
3 61  THR n 
3 62  ASP n 
3 63  PHE n 
3 64  SER n 
3 65  SER n 
3 66  ALA n 
3 67  LYS n 
3 68  ILE n 
3 69  GLU n 
3 70  VAL n 
3 71  SER n 
3 72  GLN n 
3 73  LEU n 
3 74  LEU n 
3 75  LYS n 
3 76  GLY n 
3 77  ASP n 
3 78  ALA n 
3 79  SER n 
3 80  LEU n 
3 81  LYS n 
3 82  MET n 
3 83  ASP n 
3 84  LYS n 
3 85  SER n 
3 86  ASP n 
3 87  ALA n 
3 88  VAL n 
3 89  SER n 
3 90  HIS n 
3 91  THR n 
3 92  GLY n 
3 93  ASN n 
3 94  TYR n 
3 95  THR n 
3 96  CYS n 
3 97  GLU n 
3 98  VAL n 
3 99  THR n 
3 100 GLU n 
3 101 LEU n 
3 102 THR n 
3 103 ARG n 
3 104 GLU n 
3 105 GLY n 
3 106 GLU n 
3 107 THR n 
3 108 ILE n 
3 109 ILE n 
3 110 GLU n 
3 111 LEU n 
3 112 LYS n 
3 113 TYR n 
3 114 ARG n 
3 115 VAL n 
3 116 VAL n 
3 117 SER n 
3 118 TRP n 
3 119 PHE n 
3 120 SER n 
3 121 PRO n 
3 122 ASN n 
3 123 GLU n 
3 124 HIS n 
3 125 HIS n 
3 126 HIS n 
3 127 HIS n 
3 128 HIS n 
3 129 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 229 ?     ? ?            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? 
? ? ? ? ? ? ? HEK293          ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 214 ?     ? ?            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? 
? ? ? ? ? ? ? HEK293          ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 129 Human ? 'CD47, MER6' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? 
? ? ? ? ? ? ? 'HEK293(GnTI-)' ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5TZ2       5TZ2   ? 1 ? 1  
2 PDB 5TZ2       5TZ2   ? 2 ? 1  
3 UNP CD47_HUMAN Q08722 ? 3 
;QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASL
KMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
;
19 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5TZ2 H 1 ? 229 ? 5TZ2   1  ? 229 ? 1 229 
2 2 5TZ2 L 1 ? 214 ? 5TZ2   1  ? 214 ? 1 214 
3 3 5TZ2 C 1 ? 123 ? Q08722 19 ? 141 ? 1 123 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 5TZ2 GLY C 15  ? UNP Q08722 CYS 33 'engineered mutation' 15  1 
3 5TZ2 HIS C 124 ? UNP Q08722 ?   ?  'expression tag'      124 2 
3 5TZ2 HIS C 125 ? UNP Q08722 ?   ?  'expression tag'      125 3 
3 5TZ2 HIS C 126 ? UNP Q08722 ?   ?  'expression tag'      126 4 
3 5TZ2 HIS C 127 ? UNP Q08722 ?   ?  'expression tag'      127 5 
3 5TZ2 HIS C 128 ? UNP Q08722 ?   ?  'expression tag'      128 6 
3 5TZ2 HIS C 129 ? UNP Q08722 ?   ?  'expression tag'      129 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ?                               'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking'          y ARGININE                                 ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ?                               'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'     
133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ?                               'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ?                               'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'     
147.129 
GLY 'peptide linking'            y GLYCINE                                  ?                               'C2 H5 N O2'     
75.067  
GOL non-polymer                  . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       
92.094  
HIS 'L-peptide linking'          y HISTIDINE                                ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer                  . WATER                                    ?                               'H2 O'           
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ?                               'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ?                               'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking'          y LYSINE                                   ?                               'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking'          y METHIONINE                               ?                               'C5 H11 N O2 S'  
149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                               'C8 H15 N O6'    
221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ?                               'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking'          y PROLINE                                  ?                               'C5 H9 N O2'     
115.130 
SER 'L-peptide linking'          y SERINE                                   ?                               'C3 H7 N O3'     
105.093 
THR 'L-peptide linking'          y THREONINE                                ?                               'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ?                               'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking'          y VALINE                                   ?                               'C5 H11 N O2'    
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5TZ2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.42 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.12 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.923 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25% PEG 3000, 1M LiCl, 0.1M MES pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-02-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5TZ2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.300 
_reflns.d_resolution_low                 32.216 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       26271 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.100 
_reflns.pdbx_Rmerge_I_obs                0.083 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.083 
_reflns.pdbx_netI_over_av_sigmaI         12.794 
_reflns.pdbx_netI_over_sigmaI            8.700 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.300 
_reflns_shell.d_res_low                   2.340 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        97.000 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.432 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.800 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.841 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                146.200 
_refine.B_iso_mean                               66.5172 
_refine.B_iso_min                                30.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5TZ2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3020 
_refine.ls_d_res_low                             32.2160 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     26217 
_refine.ls_number_reflns_R_free                  1329 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.3200 
_refine.ls_percent_reflns_R_free                 5.0700 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2037 
_refine.ls_R_factor_R_free                       0.2553 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2008 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2JJS 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 33.2000 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3200 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.3020 
_refine_hist.d_res_low                        32.2160 
_refine_hist.pdbx_number_atoms_ligand         104 
_refine_hist.number_atoms_solvent             105 
_refine_hist.number_atoms_total               4197 
_refine_hist.pdbx_number_residues_total       539 
_refine_hist.pdbx_B_iso_mean_ligand           100.74 
_refine_hist.pdbx_B_iso_mean_solvent          66.22 
_refine_hist.pdbx_number_atoms_protein        3988 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
_struct.entry_id                     5TZ2 
_struct.title                        'Crystal structure of human CD47 ECD bound to Fab of C47B222' 
_struct.pdbx_descriptor              'C47B222 Fab Heavy Chain, C47B222 Fab Light Chain, Leukocyte surface antigen CD47' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5TZ2 
_struct_keywords.text            'antigen-Fab complex, immunoglobulin, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 28  ? TYR A 32  ? SER H 28  TYR H 32  5 ? 5 
HELX_P HELX_P2  AA2 LYS A 87  ? THR A 91  ? LYS H 87  THR H 91  5 ? 5 
HELX_P HELX_P3  AA3 SER A 194 ? LEU A 196 ? SER H 194 LEU H 196 5 ? 3 
HELX_P HELX_P4  AA4 LYS A 208 ? ASN A 211 ? LYS H 208 ASN H 211 5 ? 4 
HELX_P HELX_P5  AA5 GLU B 79  ? PHE B 83  ? GLU L 79  PHE L 83  5 ? 5 
HELX_P HELX_P6  AA6 SER B 121 ? LYS B 126 ? SER L 121 LYS L 126 1 ? 6 
HELX_P HELX_P7  AA7 LYS B 183 ? GLU B 187 ? LYS L 183 GLU L 187 1 ? 5 
HELX_P HELX_P8  AA8 ASN C 32  ? THR C 34  ? ASN C 32  THR C 34  5 ? 3 
HELX_P HELX_P9  AA9 PRO C 60  ? SER C 64  ? PRO C 60  SER C 64  5 ? 5 
HELX_P HELX_P10 AB1 VAL C 70  ? GLY C 76  ? VAL C 70  GLY C 76  5 ? 7 
HELX_P HELX_P11 AB2 LYS C 84  ? VAL C 88  ? LYS C 84  VAL C 88  1 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 22  SG  ? ? ? 1_555 A CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf2 disulf ?    ? A CYS 147 SG  ? ? ? 1_555 A CYS 203 SG ? ? H CYS 147 H CYS 203 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf3 disulf ?    ? B CYS 23  SG  ? ? ? 1_555 B CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf4 disulf ?    ? B CYS 134 SG  ? ? ? 1_555 B CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf5 disulf ?    ? C CYS 23  SG  ? ? ? 1_555 C CYS 96  SG ? ? C CYS 23  C CYS 96  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
covale1 covale one  ? C ASN 5   ND2 ? ? ? 1_555 G NAG .   C1 ? ? C ASN 5   C NAG 201 1_555 ? ? ? ? ? ? ? 1.380 ? N-Glycosylation 
covale2 covale one  ? C ASN 16  ND2 ? ? ? 1_555 H NAG .   C1 ? ? C ASN 16  C NAG 202 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale3 covale one  ? C ASN 32  ND2 ? ? ? 1_555 I NAG .   C1 ? ? C ASN 32  C NAG 203 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale4 covale one  ? C ASN 55  ND2 ? ? ? 1_555 D NAG .   C1 ? ? C ASN 55  A NAG 1   1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale5 covale one  ? C ASN 93  ND2 ? ? ? 1_555 E NAG .   C1 ? ? C ASN 93  B NAG 1   1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale6 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? A NAG 1   A NAG 2   1_555 ? ? ? ? ? ? ? 1.440 ? ?               
covale7 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.443 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 153 A . ? PHE 153 H PRO 154 A ? PRO 154 H 1 -4.35 
2 GLU 155 A . ? GLU 155 H PRO 156 A ? PRO 156 H 1 -3.40 
3 SER 7   B . ? SER 7   L PRO 8   B ? PRO 8   L 1 -1.70 
4 TRP 94  B . ? TRP 94  L PRO 95  B ? PRO 95  L 1 4.39  
5 TYR 140 B . ? TYR 140 L PRO 141 B ? PRO 141 L 1 4.02  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 3 ? 
AA7 ? 4 ? 
AA8 ? 6 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 3 ? 
AB3 ? 6 ? 
AB4 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 3   ? GLN A 6   ? GLN H 3   GLN H 6   
AA1 2 LEU A 18  ? SER A 25  ? LEU H 18  SER H 25  
AA1 3 THR A 78  ? TRP A 83  ? THR H 78  TRP H 83  
AA1 4 THR A 69  ? ASP A 73  ? THR H 69  ASP H 73  
AA2 1 GLU A 10  ? LYS A 12  ? GLU H 10  LYS H 12  
AA2 2 THR A 114 ? VAL A 118 ? THR H 114 VAL H 118 
AA2 3 ALA A 92  ? VAL A 99  ? ALA H 92  VAL H 99  
AA2 4 TRP A 33  ? GLN A 39  ? TRP H 33  GLN H 39  
AA2 5 GLU A 46  ? ILE A 51  ? GLU H 46  ILE H 51  
AA2 6 THR A 58  ? TYR A 60  ? THR H 58  TYR H 60  
AA3 1 GLU A 10  ? LYS A 12  ? GLU H 10  LYS H 12  
AA3 2 THR A 114 ? VAL A 118 ? THR H 114 VAL H 118 
AA3 3 ALA A 92  ? VAL A 99  ? ALA H 92  VAL H 99  
AA3 4 LEU A 107 ? TRP A 110 ? LEU H 107 TRP H 110 
AA4 1 SER A 127 ? LEU A 131 ? SER H 127 LEU H 131 
AA4 2 THR A 142 ? TYR A 152 ? THR H 142 TYR H 152 
AA4 3 TYR A 183 ? PRO A 192 ? TYR H 183 PRO H 192 
AA4 4 VAL A 170 ? THR A 172 ? VAL H 170 THR H 172 
AA5 1 SER A 127 ? LEU A 131 ? SER H 127 LEU H 131 
AA5 2 THR A 142 ? TYR A 152 ? THR H 142 TYR H 152 
AA5 3 TYR A 183 ? PRO A 192 ? TYR H 183 PRO H 192 
AA5 4 VAL A 176 ? LEU A 177 ? VAL H 176 LEU H 177 
AA6 1 THR A 158 ? TRP A 161 ? THR H 158 TRP H 161 
AA6 2 TYR A 201 ? HIS A 207 ? TYR H 201 HIS H 207 
AA6 3 THR A 212 ? VAL A 218 ? THR H 212 VAL H 218 
AA7 1 LEU B 4   ? SER B 7   ? LEU L 4   SER L 7   
AA7 2 ALA B 19  ? ALA B 25  ? ALA L 19  ALA L 25  
AA7 3 ASP B 70  ? ILE B 75  ? ASP L 70  ILE L 75  
AA7 4 PHE B 62  ? GLY B 66  ? PHE L 62  GLY L 66  
AA8 1 THR B 10  ? LEU B 13  ? THR L 10  LEU L 13  
AA8 2 THR B 102 ? ILE B 106 ? THR L 102 ILE L 106 
AA8 3 VAL B 85  ? GLN B 90  ? VAL L 85  GLN L 90  
AA8 4 LEU B 33  ? GLN B 38  ? LEU L 33  GLN L 38  
AA8 5 ARG B 45  ? HIS B 49  ? ARG L 45  HIS L 49  
AA8 6 THR B 53  ? ARG B 54  ? THR L 53  ARG L 54  
AA9 1 THR B 10  ? LEU B 13  ? THR L 10  LEU L 13  
AA9 2 THR B 102 ? ILE B 106 ? THR L 102 ILE L 106 
AA9 3 VAL B 85  ? GLN B 90  ? VAL L 85  GLN L 90  
AA9 4 THR B 97  ? PHE B 98  ? THR L 97  PHE L 98  
AB1 1 SER B 114 ? PHE B 118 ? SER L 114 PHE L 118 
AB1 2 THR B 129 ? PHE B 139 ? THR L 129 PHE L 139 
AB1 3 TYR B 173 ? SER B 182 ? TYR L 173 SER L 182 
AB1 4 SER B 159 ? VAL B 163 ? SER L 159 VAL L 163 
AB2 1 LYS B 145 ? VAL B 150 ? LYS L 145 VAL L 150 
AB2 2 VAL B 191 ? THR B 197 ? VAL L 191 THR L 197 
AB2 3 VAL B 205 ? ASN B 210 ? VAL L 205 ASN L 210 
AB3 1 SER C 9   ? PHE C 12  ? SER C 9   PHE C 12  
AB3 2 ARG C 103 ? TYR C 113 ? ARG C 103 TYR C 113 
AB3 3 GLY C 92  ? GLU C 100 ? GLY C 92  GLU C 100 
AB3 4 VAL C 36  ? PHE C 42  ? VAL C 36  PHE C 42  
AB3 5 ASP C 46  ? ASP C 51  ? ASP C 46  ASP C 51  
AB3 6 LYS C 56  ? THR C 58  ? LYS C 56  THR C 58  
AB4 1 THR C 18  ? ILE C 21  ? THR C 18  ILE C 21  
AB4 2 LEU C 80  ? ASP C 83  ? LEU C 80  ASP C 83  
AB4 3 LYS C 67  ? ILE C 68  ? LYS C 67  ILE C 68  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 5   ? N VAL H 5   O LYS A 23  ? O LYS H 23  
AA1 2 3 N LEU A 18  ? N LEU H 18  O TRP A 83  ? O TRP H 83  
AA1 3 4 O TYR A 80  ? O TYR H 80  N SER A 71  ? N SER H 71  
AA2 1 2 N GLU A 10  ? N GLU H 10  O THR A 117 ? O THR H 117 
AA2 2 3 O VAL A 116 ? O VAL H 116 N ALA A 92  ? N ALA H 92  
AA2 3 4 O TYR A 95  ? O TYR H 95  N VAL A 37  ? N VAL H 37  
AA2 4 5 N ARG A 38  ? N ARG H 38  O GLU A 46  ? O GLU H 46  
AA2 5 6 N ILE A 50  ? N ILE H 50  O ARG A 59  ? O ARG H 59  
AA3 1 2 N GLU A 10  ? N GLU H 10  O THR A 117 ? O THR H 117 
AA3 2 3 O VAL A 116 ? O VAL H 116 N ALA A 92  ? N ALA H 92  
AA3 3 4 N ARG A 98  ? N ARG H 98  O TYR A 109 ? O TYR H 109 
AA4 1 2 N PHE A 129 ? N PHE H 129 O LEU A 148 ? O LEU H 148 
AA4 2 3 N VAL A 149 ? N VAL H 149 O LEU A 185 ? O LEU H 185 
AA4 3 4 O VAL A 188 ? O VAL H 188 N HIS A 171 ? N HIS H 171 
AA5 1 2 N PHE A 129 ? N PHE H 129 O LEU A 148 ? O LEU H 148 
AA5 2 3 N VAL A 149 ? N VAL H 149 O LEU A 185 ? O LEU H 185 
AA5 3 4 O SER A 184 ? O SER H 184 N VAL A 176 ? N VAL H 176 
AA6 1 2 N THR A 158 ? N THR H 158 O ASN A 206 ? O ASN H 206 
AA6 2 3 N CYS A 203 ? N CYS H 203 O LYS A 216 ? O LYS H 216 
AA7 1 2 N THR B 5   ? N THR L 5   O ARG B 24  ? O ARG L 24  
AA7 2 3 N LEU B 21  ? N LEU L 21  O LEU B 73  ? O LEU L 73  
AA7 3 4 O THR B 74  ? O THR L 74  N SER B 63  ? N SER L 63  
AA8 1 2 N LEU B 11  ? N LEU L 11  O LYS B 103 ? O LYS L 103 
AA8 2 3 O THR B 102 ? O THR L 102 N TYR B 86  ? N TYR L 86  
AA8 3 4 O GLN B 89  ? O GLN L 89  N ALA B 34  ? N ALA L 34  
AA8 4 5 N TRP B 35  ? N TRP L 35  O LEU B 47  ? O LEU L 47  
AA8 5 6 N HIS B 49  ? N HIS L 49  O THR B 53  ? O THR L 53  
AA9 1 2 N LEU B 11  ? N LEU L 11  O LYS B 103 ? O LYS L 103 
AA9 2 3 O THR B 102 ? O THR L 102 N TYR B 86  ? N TYR L 86  
AA9 3 4 N GLN B 90  ? N GLN L 90  O THR B 97  ? O THR L 97  
AB1 1 2 N PHE B 116 ? N PHE L 116 O LEU B 135 ? O LEU L 135 
AB1 2 3 N VAL B 132 ? N VAL L 132 O LEU B 179 ? O LEU L 179 
AB1 3 4 O THR B 178 ? O THR L 178 N GLN B 160 ? N GLN L 160 
AB2 1 2 N GLN B 147 ? N GLN L 147 O GLU B 195 ? O GLU L 195 
AB2 2 3 N VAL B 196 ? N VAL L 196 O VAL B 205 ? O VAL L 205 
AB3 1 2 N VAL C 10  ? N VAL C 10  O GLU C 110 ? O GLU C 110 
AB3 2 3 O ILE C 109 ? O ILE C 109 N TYR C 94  ? N TYR C 94  
AB3 3 4 O THR C 99  ? O THR C 99  N TYR C 37  ? N TYR C 37  
AB3 4 5 N VAL C 38  ? N VAL C 38  O PHE C 50  ? O PHE C 50  
AB3 5 6 N THR C 49  ? N THR C 49  O THR C 58  ? O THR C 58  
AB4 1 2 N ILE C 21  ? N ILE C 21  O LEU C 80  ? O LEU C 80  
AB4 2 3 O LYS C 81  ? O LYS C 81  N LYS C 67  ? N LYS C 67  
# 
_atom_sites.entry_id                    5TZ2 
_atom_sites.fract_transf_matrix[1][1]   0.016511 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005674 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013711 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014545 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 19.525  2.303   40.113  1.00 101.09 ? 1   GLU H N   1 
ATOM   2    C CA  . GLU A 1 1   ? 19.104  1.902   38.776  1.00 101.48 ? 1   GLU H CA  1 
ATOM   3    C C   . GLU A 1 1   ? 19.569  0.486   38.452  1.00 99.98  ? 1   GLU H C   1 
ATOM   4    O O   . GLU A 1 1   ? 20.580  0.019   38.976  1.00 106.84 ? 1   GLU H O   1 
ATOM   5    C CB  . GLU A 1 1   ? 19.636  2.883   37.729  1.00 102.22 ? 1   GLU H CB  1 
ATOM   6    N N   . VAL A 1 2   ? 18.824  -0.190  37.583  1.00 91.09  ? 2   VAL H N   1 
ATOM   7    C CA  . VAL A 1 2   ? 19.140  -1.563  37.206  1.00 76.08  ? 2   VAL H CA  1 
ATOM   8    C C   . VAL A 1 2   ? 20.383  -1.627  36.326  1.00 76.62  ? 2   VAL H C   1 
ATOM   9    O O   . VAL A 1 2   ? 20.455  -0.971  35.288  1.00 80.41  ? 2   VAL H O   1 
ATOM   10   C CB  . VAL A 1 2   ? 17.964  -2.226  36.466  1.00 70.83  ? 2   VAL H CB  1 
ATOM   11   C CG1 . VAL A 1 2   ? 18.307  -3.663  36.104  1.00 67.17  ? 2   VAL H CG1 1 
ATOM   12   C CG2 . VAL A 1 2   ? 16.707  -2.172  37.318  1.00 73.61  ? 2   VAL H CG2 1 
ATOM   13   N N   . GLN A 1 3   ? 21.361  -2.421  36.750  1.00 75.50  ? 3   GLN H N   1 
ATOM   14   C CA  . GLN A 1 3   ? 22.604  -2.579  36.005  1.00 75.36  ? 3   GLN H CA  1 
ATOM   15   C C   . GLN A 1 3   ? 23.058  -4.034  35.977  1.00 68.39  ? 3   GLN H C   1 
ATOM   16   O O   . GLN A 1 3   ? 23.000  -4.734  36.988  1.00 69.94  ? 3   GLN H O   1 
ATOM   17   C CB  . GLN A 1 3   ? 23.705  -1.702  36.608  1.00 87.44  ? 3   GLN H CB  1 
ATOM   18   C CG  . GLN A 1 3   ? 23.668  -0.251  36.159  1.00 101.52 ? 3   GLN H CG  1 
ATOM   19   C CD  . GLN A 1 3   ? 24.043  -0.088  34.698  1.00 104.86 ? 3   GLN H CD  1 
ATOM   20   O OE1 . GLN A 1 3   ? 23.218  0.308   33.875  1.00 107.95 ? 3   GLN H OE1 1 
ATOM   21   N NE2 . GLN A 1 3   ? 25.293  -0.393  34.370  1.00 98.86  ? 3   GLN H NE2 1 
ATOM   22   N N   . LEU A 1 4   ? 23.499  -4.486  34.807  1.00 65.71  ? 4   LEU H N   1 
ATOM   23   C CA  . LEU A 1 4   ? 24.040  -5.831  34.657  1.00 59.68  ? 4   LEU H CA  1 
ATOM   24   C C   . LEU A 1 4   ? 25.451  -5.764  34.084  1.00 62.54  ? 4   LEU H C   1 
ATOM   25   O O   . LEU A 1 4   ? 25.637  -5.501  32.898  1.00 66.08  ? 4   LEU H O   1 
ATOM   26   C CB  . LEU A 1 4   ? 23.142  -6.688  33.760  1.00 60.49  ? 4   LEU H CB  1 
ATOM   27   C CG  . LEU A 1 4   ? 21.955  -7.409  34.411  1.00 63.26  ? 4   LEU H CG  1 
ATOM   28   C CD1 . LEU A 1 4   ? 20.873  -6.432  34.847  1.00 72.45  ? 4   LEU H CD1 1 
ATOM   29   C CD2 . LEU A 1 4   ? 21.381  -8.458  33.470  1.00 60.73  ? 4   LEU H CD2 1 
ATOM   30   N N   . VAL A 1 5   ? 26.443  -5.997  34.937  1.00 61.39  ? 5   VAL H N   1 
ATOM   31   C CA  . VAL A 1 5   ? 27.839  -5.924  34.524  1.00 51.44  ? 5   VAL H CA  1 
ATOM   32   C C   . VAL A 1 5   ? 28.421  -7.316  34.302  1.00 47.92  ? 5   VAL H C   1 
ATOM   33   O O   . VAL A 1 5   ? 28.400  -8.159  35.198  1.00 58.28  ? 5   VAL H O   1 
ATOM   34   C CB  . VAL A 1 5   ? 28.693  -5.175  35.564  1.00 58.85  ? 5   VAL H CB  1 
ATOM   35   C CG1 . VAL A 1 5   ? 30.141  -5.091  35.105  1.00 58.20  ? 5   VAL H CG1 1 
ATOM   36   C CG2 . VAL A 1 5   ? 28.127  -3.787  35.811  1.00 59.30  ? 5   VAL H CG2 1 
ATOM   37   N N   . GLN A 1 6   ? 28.937  -7.550  33.100  1.00 50.81  ? 6   GLN H N   1 
ATOM   38   C CA  . GLN A 1 6   ? 29.522  -8.839  32.758  1.00 47.26  ? 6   GLN H CA  1 
ATOM   39   C C   . GLN A 1 6   ? 31.042  -8.799  32.857  1.00 43.82  ? 6   GLN H C   1 
ATOM   40   O O   . GLN A 1 6   ? 31.645  -7.726  32.907  1.00 51.43  ? 6   GLN H O   1 
ATOM   41   C CB  . GLN A 1 6   ? 29.103  -9.262  31.349  1.00 41.20  ? 6   GLN H CB  1 
ATOM   42   C CG  . GLN A 1 6   ? 27.607  -9.186  31.095  1.00 42.58  ? 6   GLN H CG  1 
ATOM   43   C CD  . GLN A 1 6   ? 27.216  -9.763  29.747  1.00 45.34  ? 6   GLN H CD  1 
ATOM   44   O OE1 . GLN A 1 6   ? 26.318  -9.252  29.077  1.00 49.08  ? 6   GLN H OE1 1 
ATOM   45   N NE2 . GLN A 1 6   ? 27.886  -10.837 29.346  1.00 39.31  ? 6   GLN H NE2 1 
ATOM   46   N N   . SER A 1 7   ? 31.655  -9.977  32.884  1.00 48.29  ? 7   SER H N   1 
ATOM   47   C CA  . SER A 1 7   ? 33.106  -10.087 32.951  1.00 47.91  ? 7   SER H CA  1 
ATOM   48   C C   . SER A 1 7   ? 33.751  -9.644  31.640  1.00 62.15  ? 7   SER H C   1 
ATOM   49   O O   . SER A 1 7   ? 33.076  -9.515  30.617  1.00 66.92  ? 7   SER H O   1 
ATOM   50   C CB  . SER A 1 7   ? 33.516  -11.521 33.290  1.00 50.21  ? 7   SER H CB  1 
ATOM   51   O OG  . SER A 1 7   ? 32.866  -12.451 32.441  1.00 62.17  ? 7   SER H OG  1 
ATOM   52   N N   . GLY A 1 8   ? 35.060  -9.416  31.677  1.00 55.29  ? 8   GLY H N   1 
ATOM   53   C CA  . GLY A 1 8   ? 35.788  -8.931  30.518  1.00 58.67  ? 8   GLY H CA  1 
ATOM   54   C C   . GLY A 1 8   ? 35.912  -9.946  29.398  1.00 57.38  ? 8   GLY H C   1 
ATOM   55   O O   . GLY A 1 8   ? 35.485  -11.093 29.534  1.00 57.98  ? 8   GLY H O   1 
ATOM   56   N N   . ALA A 1 9   ? 36.503  -9.515  28.287  1.00 52.40  ? 9   ALA H N   1 
ATOM   57   C CA  . ALA A 1 9   ? 36.681  -10.371 27.120  1.00 49.19  ? 9   ALA H CA  1 
ATOM   58   C C   . ALA A 1 9   ? 37.600  -11.548 27.425  1.00 50.67  ? 9   ALA H C   1 
ATOM   59   O O   . ALA A 1 9   ? 38.551  -11.423 28.197  1.00 54.59  ? 9   ALA H O   1 
ATOM   60   C CB  . ALA A 1 9   ? 37.228  -9.564  25.954  1.00 41.50  ? 9   ALA H CB  1 
ATOM   61   N N   . GLU A 1 10  ? 37.312  -12.691 26.811  1.00 45.60  ? 10  GLU H N   1 
ATOM   62   C CA  . GLU A 1 10  ? 38.088  -13.902 27.043  1.00 35.05  ? 10  GLU H CA  1 
ATOM   63   C C   . GLU A 1 10  ? 38.695  -14.446 25.751  1.00 47.84  ? 10  GLU H C   1 
ATOM   64   O O   . GLU A 1 10  ? 38.019  -14.540 24.726  1.00 43.80  ? 10  GLU H O   1 
ATOM   65   C CB  . GLU A 1 10  ? 37.214  -14.974 27.700  1.00 42.34  ? 10  GLU H CB  1 
ATOM   66   C CG  . GLU A 1 10  ? 36.698  -14.600 29.083  1.00 58.21  ? 10  GLU H CG  1 
ATOM   67   C CD  . GLU A 1 10  ? 37.781  -14.638 30.146  1.00 73.51  ? 10  GLU H CD  1 
ATOM   68   O OE1 . GLU A 1 10  ? 38.824  -15.286 29.914  1.00 82.30  ? 10  GLU H OE1 1 
ATOM   69   O OE2 . GLU A 1 10  ? 37.590  -14.021 31.216  1.00 81.39  ? 10  GLU H OE2 1 
ATOM   70   N N   . VAL A 1 11  ? 39.975  -14.798 25.810  1.00 40.46  ? 11  VAL H N   1 
ATOM   71   C CA  . VAL A 1 11  ? 40.657  -15.423 24.683  1.00 48.91  ? 11  VAL H CA  1 
ATOM   72   C C   . VAL A 1 11  ? 41.173  -16.797 25.095  1.00 60.10  ? 11  VAL H C   1 
ATOM   73   O O   . VAL A 1 11  ? 42.151  -16.906 25.835  1.00 67.20  ? 11  VAL H O   1 
ATOM   74   C CB  . VAL A 1 11  ? 41.828  -14.565 24.172  1.00 51.02  ? 11  VAL H CB  1 
ATOM   75   C CG1 . VAL A 1 11  ? 42.533  -15.265 23.022  1.00 45.03  ? 11  VAL H CG1 1 
ATOM   76   C CG2 . VAL A 1 11  ? 41.333  -13.192 23.743  1.00 46.16  ? 11  VAL H CG2 1 
ATOM   77   N N   . LYS A 1 12  ? 40.507  -17.844 24.619  1.00 51.60  ? 12  LYS H N   1 
ATOM   78   C CA  . LYS A 1 12  ? 40.827  -19.205 25.036  1.00 44.79  ? 12  LYS H CA  1 
ATOM   79   C C   . LYS A 1 12  ? 41.193  -20.096 23.855  1.00 51.74  ? 12  LYS H C   1 
ATOM   80   O O   . LYS A 1 12  ? 41.048  -19.706 22.697  1.00 51.86  ? 12  LYS H O   1 
ATOM   81   C CB  . LYS A 1 12  ? 39.648  -19.819 25.796  1.00 52.11  ? 12  LYS H CB  1 
ATOM   82   C CG  . LYS A 1 12  ? 38.977  -18.877 26.784  1.00 52.13  ? 12  LYS H CG  1 
ATOM   83   C CD  . LYS A 1 12  ? 39.876  -18.571 27.971  1.00 50.53  ? 12  LYS H CD  1 
ATOM   84   C CE  . LYS A 1 12  ? 40.028  -19.784 28.873  1.00 62.42  ? 12  LYS H CE  1 
ATOM   85   N NZ  . LYS A 1 12  ? 40.827  -19.474 30.090  1.00 69.00  ? 12  LYS H NZ  1 
ATOM   86   N N   . LYS A 1 13  ? 41.669  -21.297 24.164  1.00 46.96  ? 13  LYS H N   1 
ATOM   87   C CA  . LYS A 1 13  ? 41.992  -22.291 23.149  1.00 50.89  ? 13  LYS H CA  1 
ATOM   88   C C   . LYS A 1 13  ? 40.982  -23.435 23.202  1.00 60.85  ? 13  LYS H C   1 
ATOM   89   O O   . LYS A 1 13  ? 40.393  -23.689 24.252  1.00 60.17  ? 13  LYS H O   1 
ATOM   90   C CB  . LYS A 1 13  ? 43.417  -22.815 23.348  1.00 52.64  ? 13  LYS H CB  1 
ATOM   91   C CG  . LYS A 1 13  ? 44.494  -21.859 22.862  1.00 60.37  ? 13  LYS H CG  1 
ATOM   92   C CD  . LYS A 1 13  ? 45.879  -22.469 22.991  1.00 66.17  ? 13  LYS H CD  1 
ATOM   93   C CE  . LYS A 1 13  ? 46.939  -21.547 22.410  1.00 67.38  ? 13  LYS H CE  1 
ATOM   94   N NZ  . LYS A 1 13  ? 46.985  -20.236 23.114  1.00 68.06  ? 13  LYS H NZ  1 
ATOM   95   N N   . PRO A 1 14  ? 40.764  -24.116 22.063  1.00 62.90  ? 14  PRO H N   1 
ATOM   96   C CA  . PRO A 1 14  ? 39.821  -25.239 22.001  1.00 55.02  ? 14  PRO H CA  1 
ATOM   97   C C   . PRO A 1 14  ? 40.139  -26.338 23.010  1.00 51.00  ? 14  PRO H C   1 
ATOM   98   O O   . PRO A 1 14  ? 41.281  -26.791 23.091  1.00 56.29  ? 14  PRO H O   1 
ATOM   99   C CB  . PRO A 1 14  ? 39.986  -25.755 20.568  1.00 60.34  ? 14  PRO H CB  1 
ATOM   100  C CG  . PRO A 1 14  ? 40.454  -24.572 19.798  1.00 59.85  ? 14  PRO H CG  1 
ATOM   101  C CD  . PRO A 1 14  ? 41.339  -23.810 20.741  1.00 59.34  ? 14  PRO H CD  1 
ATOM   102  N N   . GLY A 1 15  ? 39.133  -26.755 23.772  1.00 55.34  ? 15  GLY H N   1 
ATOM   103  C CA  . GLY A 1 15  ? 39.309  -27.801 24.762  1.00 53.22  ? 15  GLY H CA  1 
ATOM   104  C C   . GLY A 1 15  ? 39.418  -27.263 26.176  1.00 63.78  ? 15  GLY H C   1 
ATOM   105  O O   . GLY A 1 15  ? 39.395  -28.027 27.142  1.00 74.68  ? 15  GLY H O   1 
ATOM   106  N N   . GLU A 1 16  ? 39.534  -25.945 26.299  1.00 57.54  ? 16  GLU H N   1 
ATOM   107  C CA  . GLU A 1 16  ? 39.658  -25.309 27.606  1.00 64.92  ? 16  GLU H CA  1 
ATOM   108  C C   . GLU A 1 16  ? 38.296  -25.025 28.228  1.00 61.17  ? 16  GLU H C   1 
ATOM   109  O O   . GLU A 1 16  ? 37.288  -24.926 27.527  1.00 56.72  ? 16  GLU H O   1 
ATOM   110  C CB  . GLU A 1 16  ? 40.458  -24.008 27.496  1.00 55.52  ? 16  GLU H CB  1 
ATOM   111  C CG  . GLU A 1 16  ? 41.920  -24.203 27.136  1.00 56.63  ? 16  GLU H CG  1 
ATOM   112  C CD  . GLU A 1 16  ? 42.689  -22.897 27.107  1.00 65.95  ? 16  GLU H CD  1 
ATOM   113  O OE1 . GLU A 1 16  ? 42.070  -21.836 27.333  1.00 62.80  ? 16  GLU H OE1 1 
ATOM   114  O OE2 . GLU A 1 16  ? 43.913  -22.931 26.858  1.00 78.12  ? 16  GLU H OE2 1 
ATOM   115  N N   . SER A 1 17  ? 38.275  -24.897 29.551  1.00 50.69  ? 17  SER H N   1 
ATOM   116  C CA  . SER A 1 17  ? 37.055  -24.547 30.267  1.00 43.61  ? 17  SER H CA  1 
ATOM   117  C C   . SER A 1 17  ? 36.942  -23.033 30.399  1.00 45.38  ? 17  SER H C   1 
ATOM   118  O O   . SER A 1 17  ? 37.945  -22.321 30.334  1.00 51.52  ? 17  SER H O   1 
ATOM   119  C CB  . SER A 1 17  ? 37.029  -25.207 31.647  1.00 56.91  ? 17  SER H CB  1 
ATOM   120  O OG  . SER A 1 17  ? 38.107  -24.757 32.449  1.00 59.84  ? 17  SER H OG  1 
ATOM   121  N N   . LEU A 1 18  ? 35.720  -22.545 30.583  1.00 41.97  ? 18  LEU H N   1 
ATOM   122  C CA  . LEU A 1 18  ? 35.482  -21.110 30.685  1.00 43.49  ? 18  LEU H CA  1 
ATOM   123  C C   . LEU A 1 18  ? 34.244  -20.805 31.517  1.00 47.64  ? 18  LEU H C   1 
ATOM   124  O O   . LEU A 1 18  ? 33.225  -21.484 31.402  1.00 55.15  ? 18  LEU H O   1 
ATOM   125  C CB  . LEU A 1 18  ? 35.339  -20.492 29.293  1.00 47.70  ? 18  LEU H CB  1 
ATOM   126  C CG  . LEU A 1 18  ? 34.984  -19.004 29.246  1.00 39.32  ? 18  LEU H CG  1 
ATOM   127  C CD1 . LEU A 1 18  ? 36.074  -18.171 29.904  1.00 38.59  ? 18  LEU H CD1 1 
ATOM   128  C CD2 . LEU A 1 18  ? 34.744  -18.551 27.816  1.00 38.28  ? 18  LEU H CD2 1 
ATOM   129  N N   . LYS A 1 19  ? 34.339  -19.777 32.353  1.00 50.93  ? 19  LYS H N   1 
ATOM   130  C CA  . LYS A 1 19  ? 33.216  -19.353 33.175  1.00 50.13  ? 19  LYS H CA  1 
ATOM   131  C C   . LYS A 1 19  ? 33.095  -17.834 33.167  1.00 53.73  ? 19  LYS H C   1 
ATOM   132  O O   . LYS A 1 19  ? 33.898  -17.136 33.786  1.00 63.43  ? 19  LYS H O   1 
ATOM   133  C CB  . LYS A 1 19  ? 33.375  -19.870 34.606  1.00 62.08  ? 19  LYS H CB  1 
ATOM   134  C CG  . LYS A 1 19  ? 32.127  -19.746 35.464  1.00 61.10  ? 19  LYS H CG  1 
ATOM   135  C CD  . LYS A 1 19  ? 32.347  -20.375 36.831  1.00 65.74  ? 19  LYS H CD  1 
ATOM   136  C CE  . LYS A 1 19  ? 31.071  -20.381 37.654  1.00 75.86  ? 19  LYS H CE  1 
ATOM   137  N NZ  . LYS A 1 19  ? 31.281  -20.994 38.994  1.00 72.32  ? 19  LYS H NZ  1 
ATOM   138  N N   . ILE A 1 20  ? 32.096  -17.325 32.452  1.00 50.59  ? 20  ILE H N   1 
ATOM   139  C CA  . ILE A 1 20  ? 31.848  -15.889 32.405  1.00 52.49  ? 20  ILE H CA  1 
ATOM   140  C C   . ILE A 1 20  ? 30.705  -15.521 33.344  1.00 53.85  ? 20  ILE H C   1 
ATOM   141  O O   . ILE A 1 20  ? 29.794  -16.317 33.573  1.00 57.05  ? 20  ILE H O   1 
ATOM   142  C CB  . ILE A 1 20  ? 31.527  -15.409 30.976  1.00 45.76  ? 20  ILE H CB  1 
ATOM   143  C CG1 . ILE A 1 20  ? 30.304  -16.143 30.421  1.00 50.26  ? 20  ILE H CG1 1 
ATOM   144  C CG2 . ILE A 1 20  ? 32.731  -15.608 30.067  1.00 46.33  ? 20  ILE H CG2 1 
ATOM   145  C CD1 . ILE A 1 20  ? 29.942  -15.743 29.006  1.00 55.52  ? 20  ILE H CD1 1 
ATOM   146  N N   . SER A 1 21  ? 30.759  -14.311 33.889  1.00 56.57  ? 21  SER H N   1 
ATOM   147  C CA  . SER A 1 21  ? 29.822  -13.912 34.930  1.00 59.71  ? 21  SER H CA  1 
ATOM   148  C C   . SER A 1 21  ? 28.996  -12.690 34.550  1.00 57.15  ? 21  SER H C   1 
ATOM   149  O O   . SER A 1 21  ? 29.260  -12.028 33.547  1.00 44.90  ? 21  SER H O   1 
ATOM   150  C CB  . SER A 1 21  ? 30.575  -13.635 36.232  1.00 49.50  ? 21  SER H CB  1 
ATOM   151  O OG  . SER A 1 21  ? 31.426  -12.510 36.096  1.00 50.64  ? 21  SER H OG  1 
ATOM   152  N N   . CYS A 1 22  ? 27.992  -12.404 35.373  1.00 62.99  ? 22  CYS H N   1 
ATOM   153  C CA  . CYS A 1 22  ? 27.124  -11.250 35.181  1.00 61.51  ? 22  CYS H CA  1 
ATOM   154  C C   . CYS A 1 22  ? 26.492  -10.844 36.508  1.00 55.53  ? 22  CYS H C   1 
ATOM   155  O O   . CYS A 1 22  ? 25.604  -11.528 37.016  1.00 60.13  ? 22  CYS H O   1 
ATOM   156  C CB  . CYS A 1 22  ? 26.040  -11.555 34.148  1.00 54.65  ? 22  CYS H CB  1 
ATOM   157  S SG  . CYS A 1 22  ? 24.710  -10.335 34.092  1.00 75.18  ? 22  CYS H SG  1 
ATOM   158  N N   . LYS A 1 23  ? 26.957  -9.733  37.068  1.00 59.14  ? 23  LYS H N   1 
ATOM   159  C CA  . LYS A 1 23  ? 26.468  -9.274  38.363  1.00 59.95  ? 23  LYS H CA  1 
ATOM   160  C C   . LYS A 1 23  ? 25.388  -8.209  38.209  1.00 63.69  ? 23  LYS H C   1 
ATOM   161  O O   . LYS A 1 23  ? 25.593  -7.193  37.545  1.00 70.15  ? 23  LYS H O   1 
ATOM   162  C CB  . LYS A 1 23  ? 27.622  -8.732  39.209  1.00 53.66  ? 23  LYS H CB  1 
ATOM   163  C CG  . LYS A 1 23  ? 27.233  -8.390  40.640  1.00 52.72  ? 23  LYS H CG  1 
ATOM   164  C CD  . LYS A 1 23  ? 28.430  -7.898  41.437  1.00 60.79  ? 23  LYS H CD  1 
ATOM   165  C CE  . LYS A 1 23  ? 28.043  -7.575  42.871  1.00 67.78  ? 23  LYS H CE  1 
ATOM   166  N N   . GLY A 1 24  ? 24.237  -8.450  38.828  1.00 66.76  ? 24  GLY H N   1 
ATOM   167  C CA  . GLY A 1 24  ? 23.135  -7.508  38.778  1.00 58.17  ? 24  GLY H CA  1 
ATOM   168  C C   . GLY A 1 24  ? 23.104  -6.607  39.996  1.00 65.69  ? 24  GLY H C   1 
ATOM   169  O O   . GLY A 1 24  ? 23.474  -7.021  41.094  1.00 75.61  ? 24  GLY H O   1 
ATOM   170  N N   . SER A 1 25  ? 22.663  -5.369  39.800  1.00 71.91  ? 25  SER H N   1 
ATOM   171  C CA  . SER A 1 25  ? 22.583  -4.404  40.891  1.00 74.95  ? 25  SER H CA  1 
ATOM   172  C C   . SER A 1 25  ? 21.484  -3.377  40.642  1.00 70.67  ? 25  SER H C   1 
ATOM   173  O O   . SER A 1 25  ? 21.078  -3.150  39.502  1.00 65.03  ? 25  SER H O   1 
ATOM   174  C CB  . SER A 1 25  ? 23.928  -3.699  41.081  1.00 73.03  ? 25  SER H CB  1 
ATOM   175  O OG  . SER A 1 25  ? 24.297  -2.981  39.916  1.00 80.57  ? 25  SER H OG  1 
ATOM   176  N N   . GLY A 1 26  ? 21.005  -2.759  41.717  1.00 77.76  ? 26  GLY H N   1 
ATOM   177  C CA  . GLY A 1 26  ? 19.966  -1.752  41.617  1.00 78.80  ? 26  GLY H CA  1 
ATOM   178  C C   . GLY A 1 26  ? 18.568  -2.337  41.663  1.00 78.72  ? 26  GLY H C   1 
ATOM   179  O O   . GLY A 1 26  ? 17.581  -1.617  41.516  1.00 82.01  ? 26  GLY H O   1 
ATOM   180  N N   . TYR A 1 27  ? 18.485  -3.648  41.867  1.00 76.98  ? 27  TYR H N   1 
ATOM   181  C CA  . TYR A 1 27  ? 17.198  -4.328  41.957  1.00 76.04  ? 27  TYR H CA  1 
ATOM   182  C C   . TYR A 1 27  ? 17.330  -5.652  42.706  1.00 75.16  ? 27  TYR H C   1 
ATOM   183  O O   . TYR A 1 27  ? 18.438  -6.139  42.931  1.00 71.50  ? 27  TYR H O   1 
ATOM   184  C CB  . TYR A 1 27  ? 16.615  -4.568  40.560  1.00 59.67  ? 27  TYR H CB  1 
ATOM   185  C CG  . TYR A 1 27  ? 17.201  -5.761  39.839  1.00 56.06  ? 27  TYR H CG  1 
ATOM   186  C CD1 . TYR A 1 27  ? 18.429  -5.677  39.195  1.00 59.43  ? 27  TYR H CD1 1 
ATOM   187  C CD2 . TYR A 1 27  ? 16.522  -6.972  39.795  1.00 67.02  ? 27  TYR H CD2 1 
ATOM   188  C CE1 . TYR A 1 27  ? 18.966  -6.767  38.534  1.00 58.09  ? 27  TYR H CE1 1 
ATOM   189  C CE2 . TYR A 1 27  ? 17.051  -8.066  39.139  1.00 59.31  ? 27  TYR H CE2 1 
ATOM   190  C CZ  . TYR A 1 27  ? 18.272  -7.959  38.509  1.00 55.70  ? 27  TYR H CZ  1 
ATOM   191  O OH  . TYR A 1 27  ? 18.798  -9.049  37.854  1.00 52.58  ? 27  TYR H OH  1 
ATOM   192  N N   . SER A 1 28  ? 16.196  -6.228  43.090  1.00 67.22  ? 28  SER H N   1 
ATOM   193  C CA  . SER A 1 28  ? 16.187  -7.527  43.753  1.00 69.98  ? 28  SER H CA  1 
ATOM   194  C C   . SER A 1 28  ? 16.570  -8.626  42.767  1.00 66.68  ? 28  SER H C   1 
ATOM   195  O O   . SER A 1 28  ? 15.732  -9.111  42.006  1.00 61.13  ? 28  SER H O   1 
ATOM   196  C CB  . SER A 1 28  ? 14.815  -7.813  44.364  1.00 79.76  ? 28  SER H CB  1 
ATOM   197  O OG  . SER A 1 28  ? 14.817  -9.048  45.057  1.00 89.08  ? 28  SER H OG  1 
ATOM   198  N N   . PHE A 1 29  ? 17.842  -9.012  42.794  1.00 68.51  ? 29  PHE H N   1 
ATOM   199  C CA  . PHE A 1 29  ? 18.396  -9.962  41.835  1.00 70.69  ? 29  PHE H CA  1 
ATOM   200  C C   . PHE A 1 29  ? 17.742  -11.340 41.909  1.00 74.97  ? 29  PHE H C   1 
ATOM   201  O O   . PHE A 1 29  ? 17.707  -12.074 40.921  1.00 84.47  ? 29  PHE H O   1 
ATOM   202  C CB  . PHE A 1 29  ? 19.906  -10.095 42.053  1.00 73.50  ? 29  PHE H CB  1 
ATOM   203  C CG  . PHE A 1 29  ? 20.586  -11.003 41.068  1.00 70.54  ? 29  PHE H CG  1 
ATOM   204  C CD1 . PHE A 1 29  ? 20.935  -10.544 39.809  1.00 62.98  ? 29  PHE H CD1 1 
ATOM   205  C CD2 . PHE A 1 29  ? 20.885  -12.314 41.404  1.00 68.85  ? 29  PHE H CD2 1 
ATOM   206  C CE1 . PHE A 1 29  ? 21.563  -11.376 38.902  1.00 65.08  ? 29  PHE H CE1 1 
ATOM   207  C CE2 . PHE A 1 29  ? 21.515  -13.150 40.502  1.00 71.85  ? 29  PHE H CE2 1 
ATOM   208  C CZ  . PHE A 1 29  ? 21.854  -12.681 39.249  1.00 64.36  ? 29  PHE H CZ  1 
ATOM   209  N N   . THR A 1 30  ? 17.220  -11.682 43.080  1.00 71.79  ? 30  THR H N   1 
ATOM   210  C CA  . THR A 1 30  ? 16.683  -13.015 43.323  1.00 78.38  ? 30  THR H CA  1 
ATOM   211  C C   . THR A 1 30  ? 15.216  -13.159 42.915  1.00 80.40  ? 30  THR H C   1 
ATOM   212  O O   . THR A 1 30  ? 14.603  -14.202 43.147  1.00 83.40  ? 30  THR H O   1 
ATOM   213  C CB  . THR A 1 30  ? 16.820  -13.397 44.809  1.00 82.59  ? 30  THR H CB  1 
ATOM   214  O OG1 . THR A 1 30  ? 16.433  -14.763 44.995  1.00 91.07  ? 30  THR H OG1 1 
ATOM   215  C CG2 . THR A 1 30  ? 15.944  -12.501 45.671  1.00 71.38  ? 30  THR H CG2 1 
ATOM   216  N N   . ASP A 1 31  ? 14.656  -12.119 42.304  1.00 62.24  ? 31  ASP H N   1 
ATOM   217  C CA  . ASP A 1 31  ? 13.234  -12.119 41.968  1.00 72.56  ? 31  ASP H CA  1 
ATOM   218  C C   . ASP A 1 31  ? 12.969  -11.962 40.471  1.00 69.50  ? 31  ASP H C   1 
ATOM   219  O O   . ASP A 1 31  ? 11.820  -11.825 40.052  1.00 68.09  ? 31  ASP H O   1 
ATOM   220  C CB  . ASP A 1 31  ? 12.511  -11.011 42.737  1.00 77.75  ? 31  ASP H CB  1 
ATOM   221  C CG  . ASP A 1 31  ? 12.399  -11.310 44.220  1.00 92.34  ? 31  ASP H CG  1 
ATOM   222  O OD1 . ASP A 1 31  ? 12.182  -12.488 44.575  1.00 95.78  ? 31  ASP H OD1 1 
ATOM   223  O OD2 . ASP A 1 31  ? 12.526  -10.368 45.031  1.00 91.39  ? 31  ASP H OD2 1 
ATOM   224  N N   . TYR A 1 32  ? 14.029  -11.985 39.671  1.00 63.08  ? 32  TYR H N   1 
ATOM   225  C CA  . TYR A 1 32  ? 13.893  -11.865 38.223  1.00 66.10  ? 32  TYR H CA  1 
ATOM   226  C C   . TYR A 1 32  ? 14.675  -12.951 37.495  1.00 58.67  ? 32  TYR H C   1 
ATOM   227  O O   . TYR A 1 32  ? 15.776  -13.313 37.905  1.00 54.61  ? 32  TYR H O   1 
ATOM   228  C CB  . TYR A 1 32  ? 14.365  -10.490 37.746  1.00 67.96  ? 32  TYR H CB  1 
ATOM   229  C CG  . TYR A 1 32  ? 13.437  -9.353  38.102  1.00 62.67  ? 32  TYR H CG  1 
ATOM   230  C CD1 . TYR A 1 32  ? 13.511  -8.733  39.342  1.00 54.57  ? 32  TYR H CD1 1 
ATOM   231  C CD2 . TYR A 1 32  ? 12.493  -8.893  37.194  1.00 54.73  ? 32  TYR H CD2 1 
ATOM   232  C CE1 . TYR A 1 32  ? 12.666  -7.689  39.670  1.00 67.29  ? 32  TYR H CE1 1 
ATOM   233  C CE2 . TYR A 1 32  ? 11.643  -7.850  37.512  1.00 53.35  ? 32  TYR H CE2 1 
ATOM   234  C CZ  . TYR A 1 32  ? 11.734  -7.252  38.752  1.00 56.15  ? 32  TYR H CZ  1 
ATOM   235  O OH  . TYR A 1 32  ? 10.891  -6.214  39.074  1.00 78.83  ? 32  TYR H OH  1 
ATOM   236  N N   . TRP A 1 33  ? 14.101  -13.464 36.412  1.00 46.94  ? 33  TRP H N   1 
ATOM   237  C CA  . TRP A 1 33  ? 14.795  -14.427 35.567  1.00 52.14  ? 33  TRP H CA  1 
ATOM   238  C C   . TRP A 1 33  ? 15.977  -13.769 34.860  1.00 54.62  ? 33  TRP H C   1 
ATOM   239  O O   . TRP A 1 33  ? 15.889  -12.621 34.424  1.00 62.84  ? 33  TRP H O   1 
ATOM   240  C CB  . TRP A 1 33  ? 13.844  -15.029 34.531  1.00 53.86  ? 33  TRP H CB  1 
ATOM   241  C CG  . TRP A 1 33  ? 12.871  -16.028 35.079  1.00 59.74  ? 33  TRP H CG  1 
ATOM   242  C CD1 . TRP A 1 33  ? 11.627  -15.774 35.578  1.00 55.17  ? 33  TRP H CD1 1 
ATOM   243  C CD2 . TRP A 1 33  ? 13.057  -17.446 35.167  1.00 57.84  ? 33  TRP H CD2 1 
ATOM   244  N NE1 . TRP A 1 33  ? 11.029  -16.945 35.978  1.00 54.55  ? 33  TRP H NE1 1 
ATOM   245  C CE2 . TRP A 1 33  ? 11.886  -17.986 35.736  1.00 56.44  ? 33  TRP H CE2 1 
ATOM   246  C CE3 . TRP A 1 33  ? 14.100  -18.311 34.824  1.00 60.25  ? 33  TRP H CE3 1 
ATOM   247  C CZ2 . TRP A 1 33  ? 11.730  -19.351 35.968  1.00 64.08  ? 33  TRP H CZ2 1 
ATOM   248  C CZ3 . TRP A 1 33  ? 13.943  -19.666 35.056  1.00 57.66  ? 33  TRP H CZ3 1 
ATOM   249  C CH2 . TRP A 1 33  ? 12.768  -20.172 35.623  1.00 62.67  ? 33  TRP H CH2 1 
ATOM   250  N N   . ILE A 1 34  ? 17.081  -14.500 34.751  1.00 48.48  ? 34  ILE H N   1 
ATOM   251  C CA  . ILE A 1 34  ? 18.243  -14.022 34.012  1.00 54.13  ? 34  ILE H CA  1 
ATOM   252  C C   . ILE A 1 34  ? 18.466  -14.876 32.770  1.00 56.86  ? 34  ILE H C   1 
ATOM   253  O O   . ILE A 1 34  ? 18.645  -16.089 32.865  1.00 67.69  ? 34  ILE H O   1 
ATOM   254  C CB  . ILE A 1 34  ? 19.518  -14.035 34.875  1.00 49.31  ? 34  ILE H CB  1 
ATOM   255  C CG1 . ILE A 1 34  ? 19.450  -12.942 35.942  1.00 56.34  ? 34  ILE H CG1 1 
ATOM   256  C CG2 . ILE A 1 34  ? 20.751  -13.839 34.006  1.00 54.82  ? 34  ILE H CG2 1 
ATOM   257  C CD1 . ILE A 1 34  ? 19.404  -11.539 35.375  1.00 50.31  ? 34  ILE H CD1 1 
ATOM   258  N N   . GLY A 1 35  ? 18.452  -14.237 31.606  1.00 44.75  ? 35  GLY H N   1 
ATOM   259  C CA  . GLY A 1 35  ? 18.632  -14.944 30.353  1.00 58.98  ? 35  GLY H CA  1 
ATOM   260  C C   . GLY A 1 35  ? 20.011  -14.752 29.755  1.00 56.41  ? 35  GLY H C   1 
ATOM   261  O O   . GLY A 1 35  ? 20.631  -13.701 29.919  1.00 45.40  ? 35  GLY H O   1 
ATOM   262  N N   . TRP A 1 36  ? 20.493  -15.778 29.062  1.00 61.58  ? 36  TRP H N   1 
ATOM   263  C CA  . TRP A 1 36  ? 21.770  -15.703 28.362  1.00 56.20  ? 36  TRP H CA  1 
ATOM   264  C C   . TRP A 1 36  ? 21.556  -15.758 26.854  1.00 56.65  ? 36  TRP H C   1 
ATOM   265  O O   . TRP A 1 36  ? 20.882  -16.654 26.345  1.00 53.97  ? 36  TRP H O   1 
ATOM   266  C CB  . TRP A 1 36  ? 22.699  -16.832 28.809  1.00 55.27  ? 36  TRP H CB  1 
ATOM   267  C CG  . TRP A 1 36  ? 23.301  -16.610 30.160  1.00 53.97  ? 36  TRP H CG  1 
ATOM   268  C CD1 . TRP A 1 36  ? 22.852  -17.105 31.349  1.00 56.97  ? 36  TRP H CD1 1 
ATOM   269  C CD2 . TRP A 1 36  ? 24.465  -15.832 30.463  1.00 52.89  ? 36  TRP H CD2 1 
ATOM   270  N NE1 . TRP A 1 36  ? 23.665  -16.685 32.374  1.00 56.51  ? 36  TRP H NE1 1 
ATOM   271  C CE2 . TRP A 1 36  ? 24.663  -15.901 31.856  1.00 62.32  ? 36  TRP H CE2 1 
ATOM   272  C CE3 . TRP A 1 36  ? 25.359  -15.084 29.691  1.00 48.77  ? 36  TRP H CE3 1 
ATOM   273  C CZ2 . TRP A 1 36  ? 25.718  -15.252 32.494  1.00 62.86  ? 36  TRP H CZ2 1 
ATOM   274  C CZ3 . TRP A 1 36  ? 26.406  -14.440 30.326  1.00 45.07  ? 36  TRP H CZ3 1 
ATOM   275  C CH2 . TRP A 1 36  ? 26.576  -14.528 31.713  1.00 59.44  ? 36  TRP H CH2 1 
ATOM   276  N N   . VAL A 1 37  ? 22.133  -14.795 26.144  1.00 54.63  ? 37  VAL H N   1 
ATOM   277  C CA  . VAL A 1 37  ? 21.949  -14.691 24.703  1.00 44.90  ? 37  VAL H CA  1 
ATOM   278  C C   . VAL A 1 37  ? 23.282  -14.758 23.964  1.00 53.46  ? 37  VAL H C   1 
ATOM   279  O O   . VAL A 1 37  ? 24.228  -14.050 24.309  1.00 51.77  ? 37  VAL H O   1 
ATOM   280  C CB  . VAL A 1 37  ? 21.226  -13.382 24.325  1.00 42.10  ? 37  VAL H CB  1 
ATOM   281  C CG1 . VAL A 1 37  ? 21.084  -13.264 22.815  1.00 52.04  ? 37  VAL H CG1 1 
ATOM   282  C CG2 . VAL A 1 37  ? 19.865  -13.315 24.998  1.00 39.11  ? 37  VAL H CG2 1 
ATOM   283  N N   . ARG A 1 38  ? 23.353  -15.617 22.951  1.00 46.99  ? 38  ARG H N   1 
ATOM   284  C CA  . ARG A 1 38  ? 24.554  -15.738 22.133  1.00 51.13  ? 38  ARG H CA  1 
ATOM   285  C C   . ARG A 1 38  ? 24.380  -15.035 20.793  1.00 53.17  ? 38  ARG H C   1 
ATOM   286  O O   . ARG A 1 38  ? 23.359  -15.198 20.125  1.00 52.59  ? 38  ARG H O   1 
ATOM   287  C CB  . ARG A 1 38  ? 24.911  -17.208 21.903  1.00 45.65  ? 38  ARG H CB  1 
ATOM   288  C CG  . ARG A 1 38  ? 26.186  -17.405 21.094  1.00 44.05  ? 38  ARG H CG  1 
ATOM   289  C CD  . ARG A 1 38  ? 26.495  -18.876 20.859  1.00 44.83  ? 38  ARG H CD  1 
ATOM   290  N NE  . ARG A 1 38  ? 25.668  -19.450 19.802  1.00 62.69  ? 38  ARG H NE  1 
ATOM   291  C CZ  . ARG A 1 38  ? 25.840  -20.668 19.298  1.00 68.20  ? 38  ARG H CZ  1 
ATOM   292  N NH1 . ARG A 1 38  ? 26.814  -21.445 19.753  1.00 73.70  ? 38  ARG H NH1 1 
ATOM   293  N NH2 . ARG A 1 38  ? 25.040  -21.108 18.336  1.00 63.90  ? 38  ARG H NH2 1 
ATOM   294  N N   . GLN A 1 39  ? 25.381  -14.250 20.405  1.00 51.30  ? 39  GLN H N   1 
ATOM   295  C CA  . GLN A 1 39  ? 25.373  -13.596 19.103  1.00 50.49  ? 39  GLN H CA  1 
ATOM   296  C C   . GLN A 1 39  ? 26.696  -13.813 18.378  1.00 58.78  ? 39  GLN H C   1 
ATOM   297  O O   . GLN A 1 39  ? 27.666  -13.088 18.599  1.00 57.93  ? 39  GLN H O   1 
ATOM   298  C CB  . GLN A 1 39  ? 25.093  -12.099 19.245  1.00 44.71  ? 39  GLN H CB  1 
ATOM   299  C CG  . GLN A 1 39  ? 24.957  -11.375 17.914  1.00 46.73  ? 39  GLN H CG  1 
ATOM   300  C CD  . GLN A 1 39  ? 24.540  -9.927  18.074  1.00 56.28  ? 39  GLN H CD  1 
ATOM   301  O OE1 . GLN A 1 39  ? 24.628  -9.359  19.162  1.00 64.82  ? 39  GLN H OE1 1 
ATOM   302  N NE2 . GLN A 1 39  ? 24.074  -9.323  16.987  1.00 57.76  ? 39  GLN H NE2 1 
ATOM   303  N N   . MET A 1 40  ? 26.726  -14.824 17.516  1.00 64.41  ? 40  MET H N   1 
ATOM   304  C CA  . MET A 1 40  ? 27.904  -15.111 16.709  1.00 62.82  ? 40  MET H CA  1 
ATOM   305  C C   . MET A 1 40  ? 28.151  -13.972 15.721  1.00 58.20  ? 40  MET H C   1 
ATOM   306  O O   . MET A 1 40  ? 27.204  -13.319 15.284  1.00 68.58  ? 40  MET H O   1 
ATOM   307  C CB  . MET A 1 40  ? 27.734  -16.446 15.980  1.00 66.55  ? 40  MET H CB  1 
ATOM   308  C CG  . MET A 1 40  ? 27.675  -17.645 16.917  1.00 63.69  ? 40  MET H CG  1 
ATOM   309  S SD  . MET A 1 40  ? 27.455  -19.215 16.061  1.00 89.70  ? 40  MET H SD  1 
ATOM   310  C CE  . MET A 1 40  ? 25.848  -18.972 15.308  1.00 67.97  ? 40  MET H CE  1 
ATOM   311  N N   . PRO A 1 41  ? 29.430  -13.721 15.385  1.00 57.88  ? 41  PRO H N   1 
ATOM   312  C CA  . PRO A 1 41  ? 29.835  -12.617 14.505  1.00 62.35  ? 41  PRO H CA  1 
ATOM   313  C C   . PRO A 1 41  ? 29.032  -12.531 13.209  1.00 66.08  ? 41  PRO H C   1 
ATOM   314  O O   . PRO A 1 41  ? 29.097  -13.435 12.376  1.00 61.01  ? 41  PRO H O   1 
ATOM   315  C CB  . PRO A 1 41  ? 31.301  -12.937 14.208  1.00 68.66  ? 41  PRO H CB  1 
ATOM   316  C CG  . PRO A 1 41  ? 31.766  -13.652 15.420  1.00 65.06  ? 41  PRO H CG  1 
ATOM   317  C CD  . PRO A 1 41  ? 30.595  -14.472 15.887  1.00 59.09  ? 41  PRO H CD  1 
ATOM   318  N N   . GLY A 1 42  ? 28.278  -11.447 13.054  1.00 70.99  ? 42  GLY H N   1 
ATOM   319  C CA  . GLY A 1 42  ? 27.489  -11.222 11.858  1.00 65.52  ? 42  GLY H CA  1 
ATOM   320  C C   . GLY A 1 42  ? 26.221  -12.053 11.804  1.00 74.24  ? 42  GLY H C   1 
ATOM   321  O O   . GLY A 1 42  ? 25.622  -12.214 10.741  1.00 72.72  ? 42  GLY H O   1 
ATOM   322  N N   . LYS A 1 43  ? 25.808  -12.580 12.952  1.00 66.50  ? 43  LYS H N   1 
ATOM   323  C CA  . LYS A 1 43  ? 24.615  -13.418 13.015  1.00 63.93  ? 43  LYS H CA  1 
ATOM   324  C C   . LYS A 1 43  ? 23.563  -12.827 13.949  1.00 65.26  ? 43  LYS H C   1 
ATOM   325  O O   . LYS A 1 43  ? 23.782  -11.785 14.567  1.00 63.32  ? 43  LYS H O   1 
ATOM   326  C CB  . LYS A 1 43  ? 24.982  -14.834 13.463  1.00 61.38  ? 43  LYS H CB  1 
ATOM   327  C CG  . LYS A 1 43  ? 26.028  -15.506 12.587  1.00 65.80  ? 43  LYS H CG  1 
ATOM   328  C CD  . LYS A 1 43  ? 25.557  -15.614 11.145  1.00 67.34  ? 43  LYS H CD  1 
ATOM   329  N N   . GLY A 1 44  ? 22.422  -13.501 14.047  1.00 54.93  ? 44  GLY H N   1 
ATOM   330  C CA  . GLY A 1 44  ? 21.318  -13.024 14.859  1.00 51.49  ? 44  GLY H CA  1 
ATOM   331  C C   . GLY A 1 44  ? 21.418  -13.432 16.316  1.00 50.94  ? 44  GLY H C   1 
ATOM   332  O O   . GLY A 1 44  ? 22.387  -14.068 16.730  1.00 52.59  ? 44  GLY H O   1 
ATOM   333  N N   . LEU A 1 45  ? 20.405  -13.064 17.095  1.00 50.09  ? 45  LEU H N   1 
ATOM   334  C CA  . LEU A 1 45  ? 20.381  -13.364 18.522  1.00 52.16  ? 45  LEU H CA  1 
ATOM   335  C C   . LEU A 1 45  ? 19.887  -14.783 18.786  1.00 54.77  ? 45  LEU H C   1 
ATOM   336  O O   . LEU A 1 45  ? 18.926  -15.243 18.167  1.00 64.67  ? 45  LEU H O   1 
ATOM   337  C CB  . LEU A 1 45  ? 19.499  -12.357 19.262  1.00 55.34  ? 45  LEU H CB  1 
ATOM   338  C CG  . LEU A 1 45  ? 19.886  -10.884 19.115  1.00 52.36  ? 45  LEU H CG  1 
ATOM   339  C CD1 . LEU A 1 45  ? 18.827  -9.988  19.736  1.00 47.19  ? 45  LEU H CD1 1 
ATOM   340  C CD2 . LEU A 1 45  ? 21.247  -10.622 19.738  1.00 50.81  ? 45  LEU H CD2 1 
ATOM   341  N N   . GLU A 1 46  ? 20.550  -15.471 19.710  1.00 56.09  ? 46  GLU H N   1 
ATOM   342  C CA  . GLU A 1 46  ? 20.178  -16.834 20.072  1.00 57.53  ? 46  GLU H CA  1 
ATOM   343  C C   . GLU A 1 46  ? 19.936  -16.958 21.572  1.00 53.21  ? 46  GLU H C   1 
ATOM   344  O O   . GLU A 1 46  ? 20.841  -16.736 22.376  1.00 55.06  ? 46  GLU H O   1 
ATOM   345  C CB  . GLU A 1 46  ? 21.264  -17.820 19.636  1.00 50.58  ? 46  GLU H CB  1 
ATOM   346  C CG  . GLU A 1 46  ? 21.443  -17.931 18.132  1.00 59.73  ? 46  GLU H CG  1 
ATOM   347  C CD  . GLU A 1 46  ? 22.718  -18.659 17.751  1.00 62.07  ? 46  GLU H CD  1 
ATOM   348  O OE1 . GLU A 1 46  ? 23.807  -18.219 18.178  1.00 57.79  ? 46  GLU H OE1 1 
ATOM   349  O OE2 . GLU A 1 46  ? 22.632  -19.675 17.030  1.00 81.75  ? 46  GLU H OE2 1 
ATOM   350  N N   . TRP A 1 47  ? 18.710  -17.313 21.945  1.00 52.79  ? 47  TRP H N   1 
ATOM   351  C CA  . TRP A 1 47  ? 18.362  -17.486 23.350  1.00 52.21  ? 47  TRP H CA  1 
ATOM   352  C C   . TRP A 1 47  ? 18.900  -18.815 23.868  1.00 56.91  ? 47  TRP H C   1 
ATOM   353  O O   . TRP A 1 47  ? 18.384  -19.878 23.526  1.00 55.46  ? 47  TRP H O   1 
ATOM   354  C CB  . TRP A 1 47  ? 16.846  -17.417 23.545  1.00 47.19  ? 47  TRP H CB  1 
ATOM   355  C CG  . TRP A 1 47  ? 16.443  -16.975 24.918  1.00 62.47  ? 47  TRP H CG  1 
ATOM   356  C CD1 . TRP A 1 47  ? 16.848  -17.514 26.104  1.00 63.23  ? 47  TRP H CD1 1 
ATOM   357  C CD2 . TRP A 1 47  ? 15.547  -15.905 25.249  1.00 65.26  ? 47  TRP H CD2 1 
ATOM   358  N NE1 . TRP A 1 47  ? 16.267  -16.843 27.151  1.00 65.80  ? 47  TRP H NE1 1 
ATOM   359  C CE2 . TRP A 1 47  ? 15.463  -15.853 26.654  1.00 63.76  ? 47  TRP H CE2 1 
ATOM   360  C CE3 . TRP A 1 47  ? 14.811  -14.988 24.493  1.00 64.03  ? 47  TRP H CE3 1 
ATOM   361  C CZ2 . TRP A 1 47  ? 14.671  -14.918 27.320  1.00 54.01  ? 47  TRP H CZ2 1 
ATOM   362  C CZ3 . TRP A 1 47  ? 14.026  -14.061 25.156  1.00 60.53  ? 47  TRP H CZ3 1 
ATOM   363  C CH2 . TRP A 1 47  ? 13.963  -14.033 26.555  1.00 63.81  ? 47  TRP H CH2 1 
ATOM   364  N N   . MET A 1 48  ? 19.939  -18.749 24.694  1.00 44.63  ? 48  MET H N   1 
ATOM   365  C CA  . MET A 1 48  ? 20.584  -19.953 25.208  1.00 53.15  ? 48  MET H CA  1 
ATOM   366  C C   . MET A 1 48  ? 19.783  -20.586 26.339  1.00 56.34  ? 48  MET H C   1 
ATOM   367  O O   . MET A 1 48  ? 19.577  -21.799 26.361  1.00 71.41  ? 48  MET H O   1 
ATOM   368  C CB  . MET A 1 48  ? 21.999  -19.635 25.690  1.00 57.66  ? 48  MET H CB  1 
ATOM   369  C CG  . MET A 1 48  ? 22.864  -18.944 24.655  1.00 67.03  ? 48  MET H CG  1 
ATOM   370  S SD  . MET A 1 48  ? 24.534  -18.645 25.258  1.00 61.58  ? 48  MET H SD  1 
ATOM   371  C CE  . MET A 1 48  ? 25.089  -20.320 25.561  1.00 44.33  ? 48  MET H CE  1 
ATOM   372  N N   . GLY A 1 49  ? 19.340  -19.760 27.281  1.00 56.16  ? 49  GLY H N   1 
ATOM   373  C CA  . GLY A 1 49  ? 18.563  -20.246 28.403  1.00 53.10  ? 49  GLY H CA  1 
ATOM   374  C C   . GLY A 1 49  ? 18.367  -19.212 29.493  1.00 55.87  ? 49  GLY H C   1 
ATOM   375  O O   . GLY A 1 49  ? 18.993  -18.152 29.479  1.00 50.31  ? 49  GLY H O   1 
ATOM   376  N N   . ILE A 1 50  ? 17.489  -19.524 30.440  1.00 51.36  ? 50  ILE H N   1 
ATOM   377  C CA  . ILE A 1 50  ? 17.207  -18.625 31.551  1.00 50.28  ? 50  ILE H CA  1 
ATOM   378  C C   . ILE A 1 50  ? 17.407  -19.320 32.889  1.00 58.24  ? 50  ILE H C   1 
ATOM   379  O O   . ILE A 1 50  ? 17.374  -20.548 32.975  1.00 54.87  ? 50  ILE H O   1 
ATOM   380  C CB  . ILE A 1 50  ? 15.769  -18.077 31.492  1.00 48.49  ? 50  ILE H CB  1 
ATOM   381  C CG1 . ILE A 1 50  ? 14.764  -19.226 31.386  1.00 58.50  ? 50  ILE H CG1 1 
ATOM   382  C CG2 . ILE A 1 50  ? 15.612  -17.113 30.330  1.00 45.92  ? 50  ILE H CG2 1 
ATOM   383  C CD1 . ILE A 1 50  ? 13.322  -18.774 31.340  1.00 57.55  ? 50  ILE H CD1 1 
ATOM   384  N N   . ILE A 1 51  ? 17.613  -18.526 33.933  1.00 57.27  ? 51  ILE H N   1 
ATOM   385  C CA  . ILE A 1 51  ? 17.756  -19.060 35.279  1.00 56.72  ? 51  ILE H CA  1 
ATOM   386  C C   . ILE A 1 51  ? 17.106  -18.131 36.301  1.00 62.16  ? 51  ILE H C   1 
ATOM   387  O O   . ILE A 1 51  ? 17.229  -16.909 36.214  1.00 61.33  ? 51  ILE H O   1 
ATOM   388  C CB  . ILE A 1 51  ? 19.242  -19.286 35.646  1.00 50.17  ? 51  ILE H CB  1 
ATOM   389  C CG1 . ILE A 1 51  ? 19.366  -19.828 37.071  1.00 50.10  ? 51  ILE H CG1 1 
ATOM   390  C CG2 . ILE A 1 51  ? 20.046  -18.003 35.483  1.00 48.46  ? 51  ILE H CG2 1 
ATOM   391  C CD1 . ILE A 1 51  ? 20.769  -20.216 37.452  1.00 55.55  ? 51  ILE H CD1 1 
ATOM   392  N N   . TYR A 1 52  ? 16.389  -18.719 37.253  1.00 55.43  ? 52  TYR H N   1 
ATOM   393  C CA  . TYR A 1 52  ? 15.798  -17.956 38.343  1.00 65.61  ? 52  TYR H CA  1 
ATOM   394  C C   . TYR A 1 52  ? 16.661  -18.098 39.591  1.00 63.20  ? 52  TYR H C   1 
ATOM   395  O O   . TYR A 1 52  ? 16.636  -19.136 40.251  1.00 64.62  ? 52  TYR H O   1 
ATOM   396  C CB  . TYR A 1 52  ? 14.368  -18.421 38.621  1.00 66.27  ? 52  TYR H CB  1 
ATOM   397  C CG  . TYR A 1 52  ? 13.589  -17.485 39.515  1.00 69.02  ? 52  TYR H CG  1 
ATOM   398  C CD1 . TYR A 1 52  ? 12.913  -16.393 38.987  1.00 72.34  ? 52  TYR H CD1 1 
ATOM   399  C CD2 . TYR A 1 52  ? 13.532  -17.690 40.887  1.00 81.93  ? 52  TYR H CD2 1 
ATOM   400  C CE1 . TYR A 1 52  ? 12.200  -15.532 39.801  1.00 83.61  ? 52  TYR H CE1 1 
ATOM   401  C CE2 . TYR A 1 52  ? 12.823  -16.835 41.709  1.00 83.72  ? 52  TYR H CE2 1 
ATOM   402  C CZ  . TYR A 1 52  ? 12.159  -15.759 41.160  1.00 80.07  ? 52  TYR H CZ  1 
ATOM   403  O OH  . TYR A 1 52  ? 11.452  -14.906 41.975  1.00 96.37  ? 52  TYR H OH  1 
ATOM   404  N N   . PRO A 1 53  ? 17.430  -17.046 39.918  1.00 65.16  ? 53  PRO H N   1 
ATOM   405  C CA  . PRO A 1 53  ? 18.406  -17.038 41.015  1.00 69.45  ? 53  PRO H CA  1 
ATOM   406  C C   . PRO A 1 53  ? 17.810  -17.386 42.379  1.00 74.58  ? 53  PRO H C   1 
ATOM   407  O O   . PRO A 1 53  ? 18.558  -17.714 43.299  1.00 82.09  ? 53  PRO H O   1 
ATOM   408  C CB  . PRO A 1 53  ? 18.922  -15.595 41.010  1.00 63.09  ? 53  PRO H CB  1 
ATOM   409  C CG  . PRO A 1 53  ? 18.688  -15.116 39.621  1.00 63.14  ? 53  PRO H CG  1 
ATOM   410  C CD  . PRO A 1 53  ? 17.406  -15.761 39.199  1.00 54.26  ? 53  PRO H CD  1 
ATOM   411  N N   . GLY A 1 54  ? 16.489  -17.313 42.503  1.00 80.04  ? 54  GLY H N   1 
ATOM   412  C CA  . GLY A 1 54  ? 15.819  -17.637 43.749  1.00 76.98  ? 54  GLY H CA  1 
ATOM   413  C C   . GLY A 1 54  ? 16.035  -19.074 44.180  1.00 74.09  ? 54  GLY H C   1 
ATOM   414  O O   . GLY A 1 54  ? 16.360  -19.343 45.337  1.00 82.01  ? 54  GLY H O   1 
ATOM   415  N N   . ASP A 1 55  ? 15.859  -20.001 43.245  1.00 70.70  ? 55  ASP H N   1 
ATOM   416  C CA  . ASP A 1 55  ? 16.007  -21.421 43.536  1.00 83.39  ? 55  ASP H CA  1 
ATOM   417  C C   . ASP A 1 55  ? 16.883  -22.112 42.497  1.00 77.39  ? 55  ASP H C   1 
ATOM   418  O O   . ASP A 1 55  ? 16.922  -23.341 42.427  1.00 78.25  ? 55  ASP H O   1 
ATOM   419  C CB  . ASP A 1 55  ? 14.636  -22.096 43.599  1.00 99.44  ? 55  ASP H CB  1 
ATOM   420  C CG  . ASP A 1 55  ? 13.829  -21.894 42.331  1.00 100.58 ? 55  ASP H CG  1 
ATOM   421  O OD1 . ASP A 1 55  ? 14.132  -20.945 41.577  1.00 91.36  ? 55  ASP H OD1 1 
ATOM   422  O OD2 . ASP A 1 55  ? 12.892  -22.683 42.089  1.00 105.45 ? 55  ASP H OD2 1 
ATOM   423  N N   . SER A 1 56  ? 17.579  -21.307 41.698  1.00 80.86  ? 56  SER H N   1 
ATOM   424  C CA  . SER A 1 56  ? 18.454  -21.797 40.633  1.00 78.46  ? 56  SER H CA  1 
ATOM   425  C C   . SER A 1 56  ? 17.704  -22.679 39.637  1.00 73.17  ? 56  SER H C   1 
ATOM   426  O O   . SER A 1 56  ? 18.253  -23.652 39.120  1.00 72.33  ? 56  SER H O   1 
ATOM   427  C CB  . SER A 1 56  ? 19.646  -22.558 41.220  1.00 77.06  ? 56  SER H CB  1 
ATOM   428  O OG  . SER A 1 56  ? 20.460  -21.703 42.003  1.00 75.37  ? 56  SER H OG  1 
ATOM   429  N N   . ASP A 1 57  ? 16.448  -22.331 39.376  1.00 69.30  ? 57  ASP H N   1 
ATOM   430  C CA  . ASP A 1 57  ? 15.651  -23.031 38.376  1.00 66.96  ? 57  ASP H CA  1 
ATOM   431  C C   . ASP A 1 57  ? 16.151  -22.663 36.983  1.00 65.60  ? 57  ASP H C   1 
ATOM   432  O O   . ASP A 1 57  ? 16.026  -21.517 36.553  1.00 64.43  ? 57  ASP H O   1 
ATOM   433  C CB  . ASP A 1 57  ? 14.168  -22.683 38.527  1.00 73.12  ? 57  ASP H CB  1 
ATOM   434  C CG  . ASP A 1 57  ? 13.258  -23.650 37.788  1.00 77.09  ? 57  ASP H CG  1 
ATOM   435  O OD1 . ASP A 1 57  ? 13.752  -24.409 36.927  1.00 75.26  ? 57  ASP H OD1 1 
ATOM   436  O OD2 . ASP A 1 57  ? 12.041  -23.651 38.071  1.00 76.69  ? 57  ASP H OD2 1 
ATOM   437  N N   . THR A 1 58  ? 16.720  -23.638 36.282  1.00 70.58  ? 58  THR H N   1 
ATOM   438  C CA  . THR A 1 58  ? 17.332  -23.383 34.983  1.00 67.92  ? 58  THR H CA  1 
ATOM   439  C C   . THR A 1 58  ? 16.561  -24.022 33.833  1.00 67.82  ? 58  THR H C   1 
ATOM   440  O O   . THR A 1 58  ? 16.185  -25.192 33.894  1.00 68.19  ? 58  THR H O   1 
ATOM   441  C CB  . THR A 1 58  ? 18.784  -23.895 34.939  1.00 74.73  ? 58  THR H CB  1 
ATOM   442  O OG1 . THR A 1 58  ? 18.789  -25.328 34.958  1.00 87.94  ? 58  THR H OG1 1 
ATOM   443  C CG2 . THR A 1 58  ? 19.570  -23.374 36.129  1.00 72.30  ? 58  THR H CG2 1 
ATOM   444  N N   . ARG A 1 59  ? 16.332  -23.239 32.784  1.00 67.84  ? 59  ARG H N   1 
ATOM   445  C CA  . ARG A 1 59  ? 15.708  -23.740 31.567  1.00 69.22  ? 59  ARG H CA  1 
ATOM   446  C C   . ARG A 1 59  ? 16.660  -23.543 30.393  1.00 70.70  ? 59  ARG H C   1 
ATOM   447  O O   . ARG A 1 59  ? 17.151  -22.438 30.167  1.00 65.94  ? 59  ARG H O   1 
ATOM   448  C CB  . ARG A 1 59  ? 14.379  -23.029 31.303  1.00 67.37  ? 59  ARG H CB  1 
ATOM   449  C CG  . ARG A 1 59  ? 13.501  -22.865 32.533  1.00 64.64  ? 59  ARG H CG  1 
ATOM   450  C CD  . ARG A 1 59  ? 12.925  -24.194 32.991  1.00 65.09  ? 59  ARG H CD  1 
ATOM   451  N NE  . ARG A 1 59  ? 12.330  -24.099 34.321  1.00 70.32  ? 59  ARG H NE  1 
ATOM   452  C CZ  . ARG A 1 59  ? 11.087  -23.693 34.559  1.00 74.68  ? 59  ARG H CZ  1 
ATOM   453  N NH1 . ARG A 1 59  ? 10.297  -23.344 33.553  1.00 71.72  ? 59  ARG H NH1 1 
ATOM   454  N NH2 . ARG A 1 59  ? 10.633  -23.638 35.803  1.00 82.21  ? 59  ARG H NH2 1 
ATOM   455  N N   . TYR A 1 60  ? 16.927  -24.613 29.652  1.00 66.02  ? 60  TYR H N   1 
ATOM   456  C CA  . TYR A 1 60  ? 17.854  -24.544 28.528  1.00 71.17  ? 60  TYR H CA  1 
ATOM   457  C C   . TYR A 1 60  ? 17.142  -24.654 27.186  1.00 70.44  ? 60  TYR H C   1 
ATOM   458  O O   . TYR A 1 60  ? 16.101  -25.301 27.073  1.00 69.14  ? 60  TYR H O   1 
ATOM   459  C CB  . TYR A 1 60  ? 18.908  -25.650 28.630  1.00 73.48  ? 60  TYR H CB  1 
ATOM   460  C CG  . TYR A 1 60  ? 19.814  -25.546 29.834  1.00 66.13  ? 60  TYR H CG  1 
ATOM   461  C CD1 . TYR A 1 60  ? 20.959  -24.761 29.800  1.00 61.87  ? 60  TYR H CD1 1 
ATOM   462  C CD2 . TYR A 1 60  ? 19.533  -26.244 31.001  1.00 65.58  ? 60  TYR H CD2 1 
ATOM   463  C CE1 . TYR A 1 60  ? 21.795  -24.667 30.897  1.00 70.81  ? 60  TYR H CE1 1 
ATOM   464  C CE2 . TYR A 1 60  ? 20.362  -26.157 32.103  1.00 70.13  ? 60  TYR H CE2 1 
ATOM   465  C CZ  . TYR A 1 60  ? 21.491  -25.367 32.045  1.00 73.34  ? 60  TYR H CZ  1 
ATOM   466  O OH  . TYR A 1 60  ? 22.320  -25.276 33.139  1.00 77.99  ? 60  TYR H OH  1 
ATOM   467  N N   . SER A 1 61  ? 17.712  -24.014 26.170  1.00 66.86  ? 61  SER H N   1 
ATOM   468  C CA  . SER A 1 61  ? 17.258  -24.208 24.801  1.00 75.25  ? 61  SER H CA  1 
ATOM   469  C C   . SER A 1 61  ? 17.773  -25.553 24.301  1.00 82.06  ? 61  SER H C   1 
ATOM   470  O O   . SER A 1 61  ? 18.888  -25.952 24.637  1.00 90.42  ? 61  SER H O   1 
ATOM   471  C CB  . SER A 1 61  ? 17.741  -23.073 23.895  1.00 72.53  ? 61  SER H CB  1 
ATOM   472  O OG  . SER A 1 61  ? 17.244  -21.821 24.334  1.00 77.36  ? 61  SER H OG  1 
ATOM   473  N N   . PRO A 1 62  ? 16.957  -26.260 23.504  1.00 76.99  ? 62  PRO H N   1 
ATOM   474  C CA  . PRO A 1 62  ? 17.310  -27.587 22.983  1.00 75.09  ? 62  PRO H CA  1 
ATOM   475  C C   . PRO A 1 62  ? 18.641  -27.603 22.234  1.00 68.03  ? 62  PRO H C   1 
ATOM   476  O O   . PRO A 1 62  ? 19.310  -28.635 22.194  1.00 80.80  ? 62  PRO H O   1 
ATOM   477  C CB  . PRO A 1 62  ? 16.151  -27.908 22.035  1.00 80.80  ? 62  PRO H CB  1 
ATOM   478  C CG  . PRO A 1 62  ? 15.006  -27.125 22.572  1.00 78.81  ? 62  PRO H CG  1 
ATOM   479  C CD  . PRO A 1 62  ? 15.602  -25.852 23.095  1.00 70.74  ? 62  PRO H CD  1 
ATOM   480  N N   . SER A 1 63  ? 19.017  -26.468 21.655  1.00 63.57  ? 63  SER H N   1 
ATOM   481  C CA  . SER A 1 63  ? 20.256  -26.370 20.894  1.00 72.20  ? 63  SER H CA  1 
ATOM   482  C C   . SER A 1 63  ? 21.466  -26.165 21.802  1.00 68.48  ? 63  SER H C   1 
ATOM   483  O O   . SER A 1 63  ? 22.608  -26.267 21.356  1.00 71.05  ? 63  SER H O   1 
ATOM   484  C CB  . SER A 1 63  ? 20.168  -25.228 19.879  1.00 77.01  ? 63  SER H CB  1 
ATOM   485  O OG  . SER A 1 63  ? 19.005  -25.344 19.078  1.00 86.71  ? 63  SER H OG  1 
ATOM   486  N N   . PHE A 1 64  ? 21.213  -25.878 23.075  1.00 71.11  ? 64  PHE H N   1 
ATOM   487  C CA  . PHE A 1 64  ? 22.292  -25.589 24.014  1.00 67.01  ? 64  PHE H CA  1 
ATOM   488  C C   . PHE A 1 64  ? 22.276  -26.509 25.232  1.00 70.04  ? 64  PHE H C   1 
ATOM   489  O O   . PHE A 1 64  ? 23.150  -26.418 26.094  1.00 74.53  ? 64  PHE H O   1 
ATOM   490  C CB  . PHE A 1 64  ? 22.220  -24.130 24.469  1.00 59.19  ? 64  PHE H CB  1 
ATOM   491  C CG  . PHE A 1 64  ? 22.532  -23.141 23.384  1.00 60.34  ? 64  PHE H CG  1 
ATOM   492  C CD1 . PHE A 1 64  ? 23.843  -22.798 23.098  1.00 60.02  ? 64  PHE H CD1 1 
ATOM   493  C CD2 . PHE A 1 64  ? 21.515  -22.554 22.649  1.00 67.08  ? 64  PHE H CD2 1 
ATOM   494  C CE1 . PHE A 1 64  ? 24.135  -21.888 22.100  1.00 65.73  ? 64  PHE H CE1 1 
ATOM   495  C CE2 . PHE A 1 64  ? 21.800  -21.643 21.649  1.00 59.04  ? 64  PHE H CE2 1 
ATOM   496  C CZ  . PHE A 1 64  ? 23.112  -21.310 21.375  1.00 65.00  ? 64  PHE H CZ  1 
ATOM   497  N N   . GLN A 1 65  ? 21.285  -27.392 25.301  1.00 66.45  ? 65  GLN H N   1 
ATOM   498  C CA  . GLN A 1 65  ? 21.177  -28.318 26.424  1.00 75.95  ? 65  GLN H CA  1 
ATOM   499  C C   . GLN A 1 65  ? 22.266  -29.384 26.365  1.00 76.15  ? 65  GLN H C   1 
ATOM   500  O O   . GLN A 1 65  ? 22.345  -30.151 25.405  1.00 80.46  ? 65  GLN H O   1 
ATOM   501  C CB  . GLN A 1 65  ? 19.796  -28.976 26.452  1.00 81.33  ? 65  GLN H CB  1 
ATOM   502  C CG  . GLN A 1 65  ? 19.526  -29.784 27.712  1.00 82.17  ? 65  GLN H CG  1 
ATOM   503  C CD  . GLN A 1 65  ? 18.098  -30.287 27.790  1.00 81.65  ? 65  GLN H CD  1 
ATOM   504  N N   . GLY A 1 66  ? 23.103  -29.425 27.396  1.00 74.94  ? 66  GLY H N   1 
ATOM   505  C CA  . GLY A 1 66  ? 24.204  -30.369 27.451  1.00 75.93  ? 66  GLY H CA  1 
ATOM   506  C C   . GLY A 1 66  ? 25.478  -29.788 26.868  1.00 69.74  ? 66  GLY H C   1 
ATOM   507  O O   . GLY A 1 66  ? 26.558  -30.359 27.015  1.00 78.68  ? 66  GLY H O   1 
ATOM   508  N N   . GLN A 1 67  ? 25.347  -28.644 26.205  1.00 67.62  ? 67  GLN H N   1 
ATOM   509  C CA  . GLN A 1 67  ? 26.485  -27.980 25.582  1.00 72.99  ? 67  GLN H CA  1 
ATOM   510  C C   . GLN A 1 67  ? 27.053  -26.896 26.490  1.00 71.87  ? 67  GLN H C   1 
ATOM   511  O O   . GLN A 1 67  ? 28.190  -26.458 26.315  1.00 68.09  ? 67  GLN H O   1 
ATOM   512  C CB  . GLN A 1 67  ? 26.082  -27.374 24.235  1.00 67.68  ? 67  GLN H CB  1 
ATOM   513  C CG  . GLN A 1 67  ? 25.564  -28.386 23.228  1.00 77.16  ? 67  GLN H CG  1 
ATOM   514  C CD  . GLN A 1 67  ? 26.554  -29.500 22.955  1.00 87.39  ? 67  GLN H CD  1 
ATOM   515  O OE1 . GLN A 1 67  ? 27.747  -29.256 22.780  1.00 90.36  ? 67  GLN H OE1 1 
ATOM   516  N NE2 . GLN A 1 67  ? 26.061  -30.733 22.919  1.00 92.56  ? 67  GLN H NE2 1 
ATOM   517  N N   . VAL A 1 68  ? 26.255  -26.469 27.463  1.00 76.02  ? 68  VAL H N   1 
ATOM   518  C CA  . VAL A 1 68  ? 26.657  -25.394 28.359  1.00 70.04  ? 68  VAL H CA  1 
ATOM   519  C C   . VAL A 1 68  ? 25.949  -25.528 29.707  1.00 72.61  ? 68  VAL H C   1 
ATOM   520  O O   . VAL A 1 68  ? 24.924  -26.203 29.816  1.00 76.33  ? 68  VAL H O   1 
ATOM   521  C CB  . VAL A 1 68  ? 26.356  -24.010 27.736  1.00 62.41  ? 68  VAL H CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 24.903  -23.614 27.973  1.00 44.19  ? 68  VAL H CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 27.302  -22.954 28.283  1.00 65.60  ? 68  VAL H CG2 1 
ATOM   524  N N   . THR A 1 69  ? 26.508  -24.894 30.733  1.00 62.54  ? 69  THR H N   1 
ATOM   525  C CA  . THR A 1 69  ? 25.926  -24.935 32.069  1.00 61.09  ? 69  THR H CA  1 
ATOM   526  C C   . THR A 1 69  ? 25.650  -23.528 32.587  1.00 59.84  ? 69  THR H C   1 
ATOM   527  O O   . THR A 1 69  ? 26.530  -22.666 32.568  1.00 56.68  ? 69  THR H O   1 
ATOM   528  C CB  . THR A 1 69  ? 26.846  -25.669 33.065  1.00 69.13  ? 69  THR H CB  1 
ATOM   529  O OG1 . THR A 1 69  ? 27.114  -26.994 32.588  1.00 73.48  ? 69  THR H OG1 1 
ATOM   530  C CG2 . THR A 1 69  ? 26.192  -25.752 34.437  1.00 70.37  ? 69  THR H CG2 1 
ATOM   531  N N   . ILE A 1 70  ? 24.423  -23.300 33.045  1.00 61.16  ? 70  ILE H N   1 
ATOM   532  C CA  . ILE A 1 70  ? 24.037  -22.009 33.603  1.00 50.94  ? 70  ILE H CA  1 
ATOM   533  C C   . ILE A 1 70  ? 23.783  -22.120 35.103  1.00 61.12  ? 70  ILE H C   1 
ATOM   534  O O   . ILE A 1 70  ? 23.005  -22.964 35.549  1.00 72.49  ? 70  ILE H O   1 
ATOM   535  C CB  . ILE A 1 70  ? 22.776  -21.447 32.918  1.00 51.52  ? 70  ILE H CB  1 
ATOM   536  C CG1 . ILE A 1 70  ? 22.990  -21.337 31.408  1.00 58.76  ? 70  ILE H CG1 1 
ATOM   537  C CG2 . ILE A 1 70  ? 22.412  -20.090 33.502  1.00 47.82  ? 70  ILE H CG2 1 
ATOM   538  C CD1 . ILE A 1 70  ? 21.777  -20.830 30.657  1.00 59.54  ? 70  ILE H CD1 1 
ATOM   539  N N   . SER A 1 71  ? 24.444  -21.264 35.876  1.00 56.47  ? 71  SER H N   1 
ATOM   540  C CA  . SER A 1 71  ? 24.280  -21.258 37.324  1.00 56.07  ? 71  SER H CA  1 
ATOM   541  C C   . SER A 1 71  ? 24.170  -19.833 37.858  1.00 65.78  ? 71  SER H C   1 
ATOM   542  O O   . SER A 1 71  ? 24.291  -18.867 37.104  1.00 62.18  ? 71  SER H O   1 
ATOM   543  C CB  . SER A 1 71  ? 25.444  -21.985 38.000  1.00 47.02  ? 71  SER H CB  1 
ATOM   544  O OG  . SER A 1 71  ? 26.669  -21.313 37.765  1.00 50.26  ? 71  SER H OG  1 
ATOM   545  N N   . ALA A 1 72  ? 23.934  -19.710 39.160  1.00 59.28  ? 72  ALA H N   1 
ATOM   546  C CA  . ALA A 1 72  ? 23.826  -18.404 39.801  1.00 59.79  ? 72  ALA H CA  1 
ATOM   547  C C   . ALA A 1 72  ? 24.233  -18.477 41.267  1.00 65.83  ? 72  ALA H C   1 
ATOM   548  O O   . ALA A 1 72  ? 24.136  -19.530 41.897  1.00 65.27  ? 72  ALA H O   1 
ATOM   549  C CB  . ALA A 1 72  ? 22.409  -17.864 39.672  1.00 54.48  ? 72  ALA H CB  1 
ATOM   550  N N   . ASP A 1 73  ? 24.690  -17.350 41.803  1.00 73.08  ? 73  ASP H N   1 
ATOM   551  C CA  . ASP A 1 73  ? 25.085  -17.272 43.203  1.00 70.54  ? 73  ASP H CA  1 
ATOM   552  C C   . ASP A 1 73  ? 24.363  -16.121 43.898  1.00 73.80  ? 73  ASP H C   1 
ATOM   553  O O   . ASP A 1 73  ? 24.637  -14.951 43.631  1.00 71.46  ? 73  ASP H O   1 
ATOM   554  C CB  . ASP A 1 73  ? 26.601  -17.105 43.325  1.00 77.44  ? 73  ASP H CB  1 
ATOM   555  C CG  . ASP A 1 73  ? 27.096  -17.303 44.744  1.00 95.23  ? 73  ASP H CG  1 
ATOM   556  O OD1 . ASP A 1 73  ? 27.194  -16.303 45.484  1.00 107.57 ? 73  ASP H OD1 1 
ATOM   557  O OD2 . ASP A 1 73  ? 27.389  -18.458 45.119  1.00 94.11  ? 73  ASP H OD2 1 
ATOM   558  N N   . LYS A 1 74  ? 23.439  -16.466 44.790  1.00 72.54  ? 74  LYS H N   1 
ATOM   559  C CA  . LYS A 1 74  ? 22.615  -15.479 45.481  1.00 81.83  ? 74  LYS H CA  1 
ATOM   560  C C   . LYS A 1 74  ? 23.434  -14.557 46.379  1.00 82.57  ? 74  LYS H C   1 
ATOM   561  O O   . LYS A 1 74  ? 23.081  -13.394 46.572  1.00 94.95  ? 74  LYS H O   1 
ATOM   562  C CB  . LYS A 1 74  ? 21.543  -16.180 46.318  1.00 88.35  ? 74  LYS H CB  1 
ATOM   563  C CG  . LYS A 1 74  ? 20.762  -17.244 45.568  1.00 87.47  ? 74  LYS H CG  1 
ATOM   564  C CD  . LYS A 1 74  ? 19.869  -18.036 46.510  1.00 92.13  ? 74  LYS H CD  1 
ATOM   565  C CE  . LYS A 1 74  ? 18.949  -17.120 47.302  1.00 91.05  ? 74  LYS H CE  1 
ATOM   566  N N   . SER A 1 75  ? 24.525  -15.085 46.924  1.00 77.56  ? 75  SER H N   1 
ATOM   567  C CA  . SER A 1 75  ? 25.332  -14.358 47.899  1.00 88.01  ? 75  SER H CA  1 
ATOM   568  C C   . SER A 1 75  ? 25.959  -13.091 47.324  1.00 85.77  ? 75  SER H C   1 
ATOM   569  O O   . SER A 1 75  ? 26.207  -12.130 48.053  1.00 87.43  ? 75  SER H O   1 
ATOM   570  C CB  . SER A 1 75  ? 26.430  -15.267 48.457  1.00 91.02  ? 75  SER H CB  1 
ATOM   571  N N   . ILE A 1 76  ? 26.215  -13.089 46.019  1.00 69.36  ? 76  ILE H N   1 
ATOM   572  C CA  . ILE A 1 76  ? 26.856  -11.947 45.376  1.00 72.47  ? 76  ILE H CA  1 
ATOM   573  C C   . ILE A 1 76  ? 26.078  -11.452 44.158  1.00 72.64  ? 76  ILE H C   1 
ATOM   574  O O   . ILE A 1 76  ? 26.584  -10.635 43.386  1.00 68.89  ? 76  ILE H O   1 
ATOM   575  C CB  . ILE A 1 76  ? 28.295  -12.284 44.943  1.00 74.70  ? 76  ILE H CB  1 
ATOM   576  C CG1 . ILE A 1 76  ? 28.311  -13.548 44.082  1.00 69.02  ? 76  ILE H CG1 1 
ATOM   577  C CG2 . ILE A 1 76  ? 29.191  -12.455 46.161  1.00 65.32  ? 76  ILE H CG2 1 
ATOM   578  C CD1 . ILE A 1 76  ? 29.691  -13.949 43.607  1.00 56.91  ? 76  ILE H CD1 1 
ATOM   579  N N   . SER A 1 77  ? 24.854  -11.950 43.999  1.00 63.58  ? 77  SER H N   1 
ATOM   580  C CA  . SER A 1 77  ? 23.964  -11.538 42.912  1.00 63.42  ? 77  SER H CA  1 
ATOM   581  C C   . SER A 1 77  ? 24.620  -11.664 41.538  1.00 65.97  ? 77  SER H C   1 
ATOM   582  O O   . SER A 1 77  ? 24.688  -10.695 40.781  1.00 57.93  ? 77  SER H O   1 
ATOM   583  C CB  . SER A 1 77  ? 23.491  -10.098 43.130  1.00 57.68  ? 77  SER H CB  1 
ATOM   584  O OG  . SER A 1 77  ? 22.794  -9.968  44.356  1.00 75.17  ? 77  SER H OG  1 
ATOM   585  N N   . THR A 1 78  ? 25.095  -12.863 41.220  1.00 55.61  ? 78  THR H N   1 
ATOM   586  C CA  . THR A 1 78  ? 25.826  -13.087 39.980  1.00 53.30  ? 78  THR H CA  1 
ATOM   587  C C   . THR A 1 78  ? 25.366  -14.355 39.267  1.00 59.75  ? 78  THR H C   1 
ATOM   588  O O   . THR A 1 78  ? 25.261  -15.419 39.876  1.00 64.54  ? 78  THR H O   1 
ATOM   589  C CB  . THR A 1 78  ? 27.344  -13.178 40.242  1.00 57.19  ? 78  THR H CB  1 
ATOM   590  O OG1 . THR A 1 78  ? 27.799  -11.963 40.849  1.00 64.03  ? 78  THR H OG1 1 
ATOM   591  C CG2 . THR A 1 78  ? 28.103  -13.404 38.945  1.00 57.05  ? 78  THR H CG2 1 
ATOM   592  N N   . ALA A 1 79  ? 25.085  -14.228 37.974  1.00 53.10  ? 79  ALA H N   1 
ATOM   593  C CA  . ALA A 1 79  ? 24.735  -15.374 37.143  1.00 51.33  ? 79  ALA H CA  1 
ATOM   594  C C   . ALA A 1 79  ? 25.952  -15.821 36.342  1.00 51.39  ? 79  ALA H C   1 
ATOM   595  O O   . ALA A 1 79  ? 26.803  -15.005 35.988  1.00 53.56  ? 79  ALA H O   1 
ATOM   596  C CB  . ALA A 1 79  ? 23.579  -15.032 36.216  1.00 44.78  ? 79  ALA H CB  1 
ATOM   597  N N   . TYR A 1 80  ? 26.035  -17.116 36.055  1.00 53.62  ? 80  TYR H N   1 
ATOM   598  C CA  . TYR A 1 80  ? 27.206  -17.664 35.381  1.00 52.27  ? 80  TYR H CA  1 
ATOM   599  C C   . TYR A 1 80  ? 26.862  -18.441 34.114  1.00 56.52  ? 80  TYR H C   1 
ATOM   600  O O   . TYR A 1 80  ? 25.800  -19.054 34.011  1.00 57.24  ? 80  TYR H O   1 
ATOM   601  C CB  . TYR A 1 80  ? 27.988  -18.571 36.335  1.00 54.11  ? 80  TYR H CB  1 
ATOM   602  C CG  . TYR A 1 80  ? 28.553  -17.861 37.545  1.00 63.42  ? 80  TYR H CG  1 
ATOM   603  C CD1 . TYR A 1 80  ? 29.718  -17.110 37.452  1.00 58.99  ? 80  TYR H CD1 1 
ATOM   604  C CD2 . TYR A 1 80  ? 27.926  -17.949 38.781  1.00 61.38  ? 80  TYR H CD2 1 
ATOM   605  C CE1 . TYR A 1 80  ? 30.241  -16.462 38.556  1.00 61.81  ? 80  TYR H CE1 1 
ATOM   606  C CE2 . TYR A 1 80  ? 28.442  -17.304 39.890  1.00 68.53  ? 80  TYR H CE2 1 
ATOM   607  C CZ  . TYR A 1 80  ? 29.599  -16.563 39.772  1.00 68.65  ? 80  TYR H CZ  1 
ATOM   608  O OH  . TYR A 1 80  ? 30.117  -15.919 40.872  1.00 78.57  ? 80  TYR H OH  1 
ATOM   609  N N   . LEU A 1 81  ? 27.780  -18.402 33.153  1.00 51.60  ? 81  LEU H N   1 
ATOM   610  C CA  . LEU A 1 81  ? 27.691  -19.211 31.944  1.00 45.32  ? 81  LEU H CA  1 
ATOM   611  C C   . LEU A 1 81  ? 28.996  -19.983 31.788  1.00 48.53  ? 81  LEU H C   1 
ATOM   612  O O   . LEU A 1 81  ? 30.061  -19.386 31.632  1.00 54.98  ? 81  LEU H O   1 
ATOM   613  C CB  . LEU A 1 81  ? 27.421  -18.335 30.720  1.00 47.90  ? 81  LEU H CB  1 
ATOM   614  C CG  . LEU A 1 81  ? 27.107  -19.054 29.408  1.00 42.79  ? 81  LEU H CG  1 
ATOM   615  C CD1 . LEU A 1 81  ? 25.843  -19.884 29.551  1.00 56.53  ? 81  LEU H CD1 1 
ATOM   616  C CD2 . LEU A 1 81  ? 26.968  -18.052 28.273  1.00 45.41  ? 81  LEU H CD2 1 
ATOM   617  N N   . GLN A 1 82  ? 28.917  -21.309 31.834  1.00 57.12  ? 82  GLN H N   1 
ATOM   618  C CA  . GLN A 1 82  ? 30.121  -22.127 31.940  1.00 57.90  ? 82  GLN H CA  1 
ATOM   619  C C   . GLN A 1 82  ? 30.219  -23.228 30.886  1.00 61.38  ? 82  GLN H C   1 
ATOM   620  O O   . GLN A 1 82  ? 29.252  -23.943 30.626  1.00 57.82  ? 82  GLN H O   1 
ATOM   621  C CB  . GLN A 1 82  ? 30.197  -22.750 33.337  1.00 59.34  ? 82  GLN H CB  1 
ATOM   622  C CG  . GLN A 1 82  ? 31.404  -23.643 33.566  1.00 77.90  ? 82  GLN H CG  1 
ATOM   623  C CD  . GLN A 1 82  ? 31.445  -24.207 34.972  1.00 87.79  ? 82  GLN H CD  1 
ATOM   624  O OE1 . GLN A 1 82  ? 30.606  -23.876 35.810  1.00 86.28  ? 82  GLN H OE1 1 
ATOM   625  N NE2 . GLN A 1 82  ? 32.425  -25.063 35.238  1.00 102.70 ? 82  GLN H NE2 1 
ATOM   626  N N   . TRP A 1 83  ? 31.401  -23.355 30.289  1.00 56.13  ? 83  TRP H N   1 
ATOM   627  C CA  . TRP A 1 83  ? 31.699  -24.448 29.370  1.00 52.09  ? 83  TRP H CA  1 
ATOM   628  C C   . TRP A 1 83  ? 32.709  -25.406 29.992  1.00 59.36  ? 83  TRP H C   1 
ATOM   629  O O   . TRP A 1 83  ? 33.525  -25.007 30.823  1.00 74.23  ? 83  TRP H O   1 
ATOM   630  C CB  . TRP A 1 83  ? 32.244  -23.917 28.043  1.00 56.08  ? 83  TRP H CB  1 
ATOM   631  C CG  . TRP A 1 83  ? 31.260  -23.128 27.240  1.00 53.77  ? 83  TRP H CG  1 
ATOM   632  C CD1 . TRP A 1 83  ? 30.404  -23.608 26.292  1.00 59.99  ? 83  TRP H CD1 1 
ATOM   633  C CD2 . TRP A 1 83  ? 31.040  -21.715 27.301  1.00 51.07  ? 83  TRP H CD2 1 
ATOM   634  N NE1 . TRP A 1 83  ? 29.659  -22.581 25.763  1.00 62.27  ? 83  TRP H NE1 1 
ATOM   635  C CE2 . TRP A 1 83  ? 30.031  -21.409 26.367  1.00 58.32  ? 83  TRP H CE2 1 
ATOM   636  C CE3 . TRP A 1 83  ? 31.595  -20.679 28.058  1.00 46.96  ? 83  TRP H CE3 1 
ATOM   637  C CZ2 . TRP A 1 83  ? 29.566  -20.111 26.170  1.00 58.09  ? 83  TRP H CZ2 1 
ATOM   638  C CZ3 . TRP A 1 83  ? 31.132  -19.391 27.861  1.00 50.63  ? 83  TRP H CZ3 1 
ATOM   639  C CH2 . TRP A 1 83  ? 30.128  -19.118 26.924  1.00 52.12  ? 83  TRP H CH2 1 
ATOM   640  N N   . SER A 1 84  ? 32.656  -26.669 29.583  1.00 57.62  ? 84  SER H N   1 
ATOM   641  C CA  . SER A 1 84  ? 33.613  -27.662 30.058  1.00 60.23  ? 84  SER H CA  1 
ATOM   642  C C   . SER A 1 84  ? 34.675  -27.931 28.997  1.00 73.56  ? 84  SER H C   1 
ATOM   643  O O   . SER A 1 84  ? 35.821  -28.249 29.316  1.00 71.72  ? 84  SER H O   1 
ATOM   644  C CB  . SER A 1 84  ? 32.900  -28.961 30.439  1.00 60.39  ? 84  SER H CB  1 
ATOM   645  O OG  . SER A 1 84  ? 32.219  -29.514 29.327  1.00 75.01  ? 84  SER H OG  1 
ATOM   646  N N   . SER A 1 85  ? 34.285  -27.798 27.733  1.00 72.18  ? 85  SER H N   1 
ATOM   647  C CA  . SER A 1 85  ? 35.200  -27.996 26.616  1.00 68.43  ? 85  SER H CA  1 
ATOM   648  C C   . SER A 1 85  ? 34.837  -27.075 25.456  1.00 66.74  ? 85  SER H C   1 
ATOM   649  O O   . SER A 1 85  ? 33.951  -27.384 24.659  1.00 69.15  ? 85  SER H O   1 
ATOM   650  C CB  . SER A 1 85  ? 35.186  -29.456 26.158  1.00 70.90  ? 85  SER H CB  1 
ATOM   651  O OG  . SER A 1 85  ? 36.123  -29.674 25.118  1.00 79.99  ? 85  SER H OG  1 
ATOM   652  N N   . LEU A 1 86  ? 35.528  -25.943 25.370  1.00 55.43  ? 86  LEU H N   1 
ATOM   653  C CA  . LEU A 1 86  ? 35.239  -24.936 24.355  1.00 45.75  ? 86  LEU H CA  1 
ATOM   654  C C   . LEU A 1 86  ? 35.552  -25.414 22.942  1.00 50.08  ? 86  LEU H C   1 
ATOM   655  O O   . LEU A 1 86  ? 36.504  -26.163 22.720  1.00 60.22  ? 86  LEU H O   1 
ATOM   656  C CB  . LEU A 1 86  ? 36.023  -23.654 24.642  1.00 49.85  ? 86  LEU H CB  1 
ATOM   657  C CG  . LEU A 1 86  ? 35.511  -22.757 25.768  1.00 52.57  ? 86  LEU H CG  1 
ATOM   658  C CD1 . LEU A 1 86  ? 36.513  -21.652 26.052  1.00 48.96  ? 86  LEU H CD1 1 
ATOM   659  C CD2 . LEU A 1 86  ? 34.155  -22.173 25.407  1.00 42.56  ? 86  LEU H CD2 1 
ATOM   660  N N   . LYS A 1 87  ? 34.737  -24.969 21.991  1.00 47.09  ? 87  LYS H N   1 
ATOM   661  C CA  . LYS A 1 87  ? 34.981  -25.223 20.579  1.00 58.82  ? 87  LYS H CA  1 
ATOM   662  C C   . LYS A 1 87  ? 35.206  -23.899 19.862  1.00 61.38  ? 87  LYS H C   1 
ATOM   663  O O   . LYS A 1 87  ? 34.875  -22.838 20.393  1.00 58.81  ? 87  LYS H O   1 
ATOM   664  C CB  . LYS A 1 87  ? 33.811  -25.981 19.948  1.00 60.30  ? 87  LYS H CB  1 
ATOM   665  C CG  . LYS A 1 87  ? 33.505  -27.317 20.606  1.00 63.66  ? 87  LYS H CG  1 
ATOM   666  C CD  . LYS A 1 87  ? 32.253  -27.950 20.019  1.00 61.99  ? 87  LYS H CD  1 
ATOM   667  N N   . ALA A 1 88  ? 35.766  -23.960 18.659  1.00 54.67  ? 88  ALA H N   1 
ATOM   668  C CA  . ALA A 1 88  ? 36.015  -22.756 17.875  1.00 47.77  ? 88  ALA H CA  1 
ATOM   669  C C   . ALA A 1 88  ? 34.705  -22.073 17.496  1.00 52.03  ? 88  ALA H C   1 
ATOM   670  O O   . ALA A 1 88  ? 34.657  -20.857 17.309  1.00 53.81  ? 88  ALA H O   1 
ATOM   671  C CB  . ALA A 1 88  ? 36.819  -23.091 16.630  1.00 49.61  ? 88  ALA H CB  1 
ATOM   672  N N   . SER A 1 89  ? 33.642  -22.864 17.393  1.00 56.40  ? 89  SER H N   1 
ATOM   673  C CA  . SER A 1 89  ? 32.328  -22.349 17.026  1.00 61.87  ? 89  SER H CA  1 
ATOM   674  C C   . SER A 1 89  ? 31.668  -21.595 18.179  1.00 67.07  ? 89  SER H C   1 
ATOM   675  O O   . SER A 1 89  ? 30.637  -20.948 17.996  1.00 69.12  ? 89  SER H O   1 
ATOM   676  C CB  . SER A 1 89  ? 31.422  -23.492 16.561  1.00 62.24  ? 89  SER H CB  1 
ATOM   677  O OG  . SER A 1 89  ? 31.357  -24.520 17.534  1.00 64.59  ? 89  SER H OG  1 
ATOM   678  N N   . ASP A 1 90  ? 32.266  -21.679 19.364  1.00 53.17  ? 90  ASP H N   1 
ATOM   679  C CA  . ASP A 1 90  ? 31.754  -20.967 20.531  1.00 53.74  ? 90  ASP H CA  1 
ATOM   680  C C   . ASP A 1 90  ? 32.160  -19.496 20.501  1.00 45.76  ? 90  ASP H C   1 
ATOM   681  O O   . ASP A 1 90  ? 31.749  -18.713 21.358  1.00 51.35  ? 90  ASP H O   1 
ATOM   682  C CB  . ASP A 1 90  ? 32.248  -21.620 21.824  1.00 57.60  ? 90  ASP H CB  1 
ATOM   683  C CG  . ASP A 1 90  ? 31.630  -22.984 22.062  1.00 68.02  ? 90  ASP H CG  1 
ATOM   684  O OD1 . ASP A 1 90  ? 30.448  -23.173 21.706  1.00 70.82  ? 90  ASP H OD1 1 
ATOM   685  O OD2 . ASP A 1 90  ? 32.326  -23.867 22.606  1.00 69.09  ? 90  ASP H OD2 1 
ATOM   686  N N   . THR A 1 91  ? 32.971  -19.129 19.514  1.00 45.71  ? 91  THR H N   1 
ATOM   687  C CA  . THR A 1 91  ? 33.399  -17.746 19.341  1.00 52.73  ? 91  THR H CA  1 
ATOM   688  C C   . THR A 1 91  ? 32.207  -16.847 19.040  1.00 44.44  ? 91  THR H C   1 
ATOM   689  O O   . THR A 1 91  ? 31.666  -16.866 17.934  1.00 60.36  ? 91  THR H O   1 
ATOM   690  C CB  . THR A 1 91  ? 34.434  -17.609 18.210  1.00 51.52  ? 91  THR H CB  1 
ATOM   691  O OG1 . THR A 1 91  ? 35.599  -18.381 18.529  1.00 55.04  ? 91  THR H OG1 1 
ATOM   692  C CG2 . THR A 1 91  ? 34.831  -16.151 18.023  1.00 48.65  ? 91  THR H CG2 1 
ATOM   693  N N   . ALA A 1 92  ? 31.801  -16.062 20.033  1.00 43.70  ? 92  ALA H N   1 
ATOM   694  C CA  . ALA A 1 92  ? 30.642  -15.189 19.895  1.00 54.42  ? 92  ALA H CA  1 
ATOM   695  C C   . ALA A 1 92  ? 30.611  -14.123 20.982  1.00 48.12  ? 92  ALA H C   1 
ATOM   696  O O   . ALA A 1 92  ? 31.459  -14.103 21.874  1.00 53.93  ? 92  ALA H O   1 
ATOM   697  C CB  . ALA A 1 92  ? 29.359  -16.006 19.930  1.00 41.52  ? 92  ALA H CB  1 
ATOM   698  N N   . VAL A 1 93  ? 29.627  -13.235 20.893  1.00 41.19  ? 93  VAL H N   1 
ATOM   699  C CA  . VAL A 1 93  ? 29.373  -12.261 21.944  1.00 41.47  ? 93  VAL H CA  1 
ATOM   700  C C   . VAL A 1 93  ? 28.218  -12.749 22.808  1.00 51.25  ? 93  VAL H C   1 
ATOM   701  O O   . VAL A 1 93  ? 27.126  -13.014 22.305  1.00 51.54  ? 93  VAL H O   1 
ATOM   702  C CB  . VAL A 1 93  ? 29.040  -10.870 21.375  1.00 44.03  ? 93  VAL H CB  1 
ATOM   703  C CG1 . VAL A 1 93  ? 28.688  -9.906  22.501  1.00 37.78  ? 93  VAL H CG1 1 
ATOM   704  C CG2 . VAL A 1 93  ? 30.204  -10.341 20.550  1.00 44.86  ? 93  VAL H CG2 1 
ATOM   705  N N   . TYR A 1 94  ? 28.462  -12.874 24.108  1.00 46.73  ? 94  TYR H N   1 
ATOM   706  C CA  . TYR A 1 94  ? 27.452  -13.395 25.019  1.00 36.01  ? 94  TYR H CA  1 
ATOM   707  C C   . TYR A 1 94  ? 26.859  -12.299 25.897  1.00 46.47  ? 94  TYR H C   1 
ATOM   708  O O   . TYR A 1 94  ? 27.577  -11.603 26.615  1.00 51.51  ? 94  TYR H O   1 
ATOM   709  C CB  . TYR A 1 94  ? 28.046  -14.508 25.884  1.00 30.82  ? 94  TYR H CB  1 
ATOM   710  C CG  . TYR A 1 94  ? 28.420  -15.739 25.094  1.00 38.64  ? 94  TYR H CG  1 
ATOM   711  C CD1 . TYR A 1 94  ? 27.508  -16.766 24.900  1.00 40.50  ? 94  TYR H CD1 1 
ATOM   712  C CD2 . TYR A 1 94  ? 29.683  -15.868 24.530  1.00 46.24  ? 94  TYR H CD2 1 
ATOM   713  C CE1 . TYR A 1 94  ? 27.844  -17.893 24.173  1.00 45.58  ? 94  TYR H CE1 1 
ATOM   714  C CE2 . TYR A 1 94  ? 30.028  -16.990 23.801  1.00 44.36  ? 94  TYR H CE2 1 
ATOM   715  C CZ  . TYR A 1 94  ? 29.105  -17.999 23.625  1.00 46.34  ? 94  TYR H CZ  1 
ATOM   716  O OH  . TYR A 1 94  ? 29.443  -19.120 22.900  1.00 55.84  ? 94  TYR H OH  1 
ATOM   717  N N   . TYR A 1 95  ? 25.541  -12.153 25.826  1.00 40.98  ? 95  TYR H N   1 
ATOM   718  C CA  . TYR A 1 95  ? 24.827  -11.161 26.618  1.00 37.78  ? 95  TYR H CA  1 
ATOM   719  C C   . TYR A 1 95  ? 24.044  -11.811 27.748  1.00 54.82  ? 95  TYR H C   1 
ATOM   720  O O   . TYR A 1 95  ? 23.398  -12.841 27.555  1.00 49.51  ? 95  TYR H O   1 
ATOM   721  C CB  . TYR A 1 95  ? 23.862  -10.354 25.744  1.00 43.54  ? 95  TYR H CB  1 
ATOM   722  C CG  . TYR A 1 95  ? 24.513  -9.506  24.677  1.00 51.53  ? 95  TYR H CG  1 
ATOM   723  C CD1 . TYR A 1 95  ? 25.079  -8.277  24.990  1.00 52.30  ? 95  TYR H CD1 1 
ATOM   724  C CD2 . TYR A 1 95  ? 24.539  -9.921  23.352  1.00 46.34  ? 95  TYR H CD2 1 
ATOM   725  C CE1 . TYR A 1 95  ? 25.668  -7.492  24.015  1.00 52.01  ? 95  TYR H CE1 1 
ATOM   726  C CE2 . TYR A 1 95  ? 25.124  -9.143  22.370  1.00 54.12  ? 95  TYR H CE2 1 
ATOM   727  C CZ  . TYR A 1 95  ? 25.687  -7.930  22.707  1.00 56.53  ? 95  TYR H CZ  1 
ATOM   728  O OH  . TYR A 1 95  ? 26.271  -7.153  21.734  1.00 57.85  ? 95  TYR H OH  1 
ATOM   729  N N   . CYS A 1 96  ? 24.106  -11.207 28.929  1.00 37.32  ? 96  CYS H N   1 
ATOM   730  C CA  . CYS A 1 96  ? 23.184  -11.554 29.996  1.00 49.79  ? 96  CYS H CA  1 
ATOM   731  C C   . CYS A 1 96  ? 22.114  -10.472 30.040  1.00 49.83  ? 96  CYS H C   1 
ATOM   732  O O   . CYS A 1 96  ? 22.394  -9.305  29.759  1.00 45.70  ? 96  CYS H O   1 
ATOM   733  C CB  . CYS A 1 96  ? 23.901  -11.678 31.342  1.00 47.52  ? 96  CYS H CB  1 
ATOM   734  S SG  . CYS A 1 96  ? 24.335  -10.105 32.110  1.00 80.92  ? 96  CYS H SG  1 
ATOM   735  N N   . ALA A 1 97  ? 20.887  -10.855 30.370  1.00 52.90  ? 97  ALA H N   1 
ATOM   736  C CA  . ALA A 1 97  ? 19.786  -9.903  30.376  1.00 46.90  ? 97  ALA H CA  1 
ATOM   737  C C   . ALA A 1 97  ? 18.716  -10.301 31.380  1.00 37.84  ? 97  ALA H C   1 
ATOM   738  O O   . ALA A 1 97  ? 18.519  -11.483 31.658  1.00 50.56  ? 97  ALA H O   1 
ATOM   739  C CB  . ALA A 1 97  ? 19.186  -9.780  28.981  1.00 49.59  ? 97  ALA H CB  1 
ATOM   740  N N   . ARG A 1 98  ? 18.025  -9.303  31.920  1.00 40.70  ? 98  ARG H N   1 
ATOM   741  C CA  . ARG A 1 98  ? 16.962  -9.548  32.882  1.00 49.79  ? 98  ARG H CA  1 
ATOM   742  C C   . ARG A 1 98  ? 15.622  -9.721  32.181  1.00 57.48  ? 98  ARG H C   1 
ATOM   743  O O   . ARG A 1 98  ? 15.217  -8.880  31.379  1.00 62.84  ? 98  ARG H O   1 
ATOM   744  C CB  . ARG A 1 98  ? 16.875  -8.407  33.895  1.00 53.48  ? 98  ARG H CB  1 
ATOM   745  C CG  . ARG A 1 98  ? 15.913  -8.683  35.036  1.00 65.14  ? 98  ARG H CG  1 
ATOM   746  C CD  . ARG A 1 98  ? 15.746  -7.477  35.944  1.00 61.72  ? 98  ARG H CD  1 
ATOM   747  N NE  . ARG A 1 98  ? 14.852  -6.476  35.373  1.00 55.30  ? 98  ARG H NE  1 
ATOM   748  C CZ  . ARG A 1 98  ? 14.345  -5.454  36.055  1.00 68.85  ? 98  ARG H CZ  1 
ATOM   749  N NH1 . ARG A 1 98  ? 14.644  -5.297  37.338  1.00 60.28  ? 98  ARG H NH1 1 
ATOM   750  N NH2 . ARG A 1 98  ? 13.538  -4.589  35.456  1.00 69.63  ? 98  ARG H NH2 1 
ATOM   751  N N   . VAL A 1 99  ? 14.938  -10.819 32.483  1.00 57.11  ? 99  VAL H N   1 
ATOM   752  C CA  . VAL A 1 99  ? 13.608  -11.056 31.941  1.00 50.97  ? 99  VAL H CA  1 
ATOM   753  C C   . VAL A 1 99  ? 12.574  -10.272 32.736  1.00 51.19  ? 99  VAL H C   1 
ATOM   754  O O   . VAL A 1 99  ? 12.428  -10.469 33.943  1.00 59.63  ? 99  VAL H O   1 
ATOM   755  C CB  . VAL A 1 99  ? 13.240  -12.550 31.961  1.00 45.83  ? 99  VAL H CB  1 
ATOM   756  C CG1 . VAL A 1 99  ? 11.867  -12.765 31.345  1.00 55.64  ? 99  VAL H CG1 1 
ATOM   757  C CG2 . VAL A 1 99  ? 14.294  -13.369 31.232  1.00 44.91  ? 99  VAL H CG2 1 
ATOM   758  N N   . GLY A 1 100 ? 11.864  -9.376  32.057  1.00 54.34  ? 100 GLY H N   1 
ATOM   759  C CA  . GLY A 1 100 ? 10.831  -8.583  32.696  1.00 48.20  ? 100 GLY H CA  1 
ATOM   760  C C   . GLY A 1 100 ? 9.710   -9.448  33.238  1.00 48.15  ? 100 GLY H C   1 
ATOM   761  O O   . GLY A 1 100 ? 9.440   -10.528 32.712  1.00 54.78  ? 100 GLY H O   1 
ATOM   762  N N   . ARG A 1 101 ? 9.059   -8.978  34.297  1.00 50.44  ? 101 ARG H N   1 
ATOM   763  C CA  . ARG A 1 101 ? 7.951   -9.714  34.891  1.00 57.78  ? 101 ARG H CA  1 
ATOM   764  C C   . ARG A 1 101 ? 6.666   -9.443  34.113  1.00 59.84  ? 101 ARG H C   1 
ATOM   765  O O   . ARG A 1 101 ? 5.731   -8.828  34.626  1.00 61.53  ? 101 ARG H O   1 
ATOM   766  C CB  . ARG A 1 101 ? 7.782   -9.339  36.367  1.00 63.09  ? 101 ARG H CB  1 
ATOM   767  C CG  . ARG A 1 101 ? 6.892   -10.294 37.152  1.00 69.19  ? 101 ARG H CG  1 
ATOM   768  C CD  . ARG A 1 101 ? 6.744   -9.871  38.606  1.00 77.12  ? 101 ARG H CD  1 
ATOM   769  N NE  . ARG A 1 101 ? 7.908   -10.232 39.410  1.00 79.82  ? 101 ARG H NE  1 
ATOM   770  C CZ  . ARG A 1 101 ? 8.806   -9.362  39.861  1.00 84.76  ? 101 ARG H CZ  1 
ATOM   771  N NH1 . ARG A 1 101 ? 8.673   -8.070  39.591  1.00 87.77  ? 101 ARG H NH1 1 
ATOM   772  N NH2 . ARG A 1 101 ? 9.834   -9.783  40.585  1.00 80.58  ? 101 ARG H NH2 1 
ATOM   773  N N   . PHE A 1 102 ? 6.633   -9.896  32.863  1.00 65.66  ? 102 PHE H N   1 
ATOM   774  C CA  . PHE A 1 102 ? 5.466   -9.719  32.004  1.00 68.38  ? 102 PHE H CA  1 
ATOM   775  C C   . PHE A 1 102 ? 5.189   -10.983 31.195  1.00 51.99  ? 102 PHE H C   1 
ATOM   776  O O   . PHE A 1 102 ? 6.017   -11.893 31.146  1.00 51.00  ? 102 PHE H O   1 
ATOM   777  C CB  . PHE A 1 102 ? 5.660   -8.525  31.067  1.00 58.37  ? 102 PHE H CB  1 
ATOM   778  C CG  . PHE A 1 102 ? 5.618   -7.194  31.764  1.00 53.49  ? 102 PHE H CG  1 
ATOM   779  C CD1 . PHE A 1 102 ? 6.775   -6.625  32.273  1.00 54.78  ? 102 PHE H CD1 1 
ATOM   780  C CD2 . PHE A 1 102 ? 4.421   -6.510  31.908  1.00 56.11  ? 102 PHE H CD2 1 
ATOM   781  C CE1 . PHE A 1 102 ? 6.739   -5.400  32.913  1.00 54.48  ? 102 PHE H CE1 1 
ATOM   782  C CE2 . PHE A 1 102 ? 4.378   -5.285  32.547  1.00 63.20  ? 102 PHE H CE2 1 
ATOM   783  C CZ  . PHE A 1 102 ? 5.538   -4.730  33.051  1.00 66.74  ? 102 PHE H CZ  1 
ATOM   784  N N   . ALA A 1 103 ? 4.025   -11.029 30.557  1.00 54.97  ? 103 ALA H N   1 
ATOM   785  C CA  . ALA A 1 103 ? 3.607   -12.207 29.803  1.00 62.58  ? 103 ALA H CA  1 
ATOM   786  C C   . ALA A 1 103 ? 4.476   -12.447 28.569  1.00 52.00  ? 103 ALA H C   1 
ATOM   787  O O   . ALA A 1 103 ? 4.565   -13.571 28.076  1.00 57.60  ? 103 ALA H O   1 
ATOM   788  C CB  . ALA A 1 103 ? 2.145   -12.079 29.398  1.00 62.58  ? 103 ALA H CB  1 
ATOM   789  N N   . SER A 1 104 ? 5.116   -11.391 28.076  1.00 53.63  ? 104 SER H N   1 
ATOM   790  C CA  . SER A 1 104 ? 5.938   -11.487 26.872  1.00 54.49  ? 104 SER H CA  1 
ATOM   791  C C   . SER A 1 104 ? 7.359   -11.956 27.173  1.00 61.01  ? 104 SER H C   1 
ATOM   792  O O   . SER A 1 104 ? 8.098   -12.331 26.262  1.00 55.22  ? 104 SER H O   1 
ATOM   793  C CB  . SER A 1 104 ? 5.983   -10.139 26.149  1.00 60.25  ? 104 SER H CB  1 
ATOM   794  O OG  . SER A 1 104 ? 4.706   -9.787  25.645  1.00 66.42  ? 104 SER H OG  1 
ATOM   795  N N   . HIS A 1 105 ? 7.730   -11.926 28.451  1.00 62.98  ? 105 HIS H N   1 
ATOM   796  C CA  . HIS A 1 105 ? 9.067   -12.320 28.896  1.00 47.09  ? 105 HIS H CA  1 
ATOM   797  C C   . HIS A 1 105 ? 10.167  -11.557 28.161  1.00 50.48  ? 105 HIS H C   1 
ATOM   798  O O   . HIS A 1 105 ? 11.213  -12.123 27.836  1.00 44.51  ? 105 HIS H O   1 
ATOM   799  C CB  . HIS A 1 105 ? 9.278   -13.825 28.713  1.00 53.59  ? 105 HIS H CB  1 
ATOM   800  C CG  . HIS A 1 105 ? 8.307   -14.670 29.475  1.00 55.10  ? 105 HIS H CG  1 
ATOM   801  N ND1 . HIS A 1 105 ? 7.048   -14.970 29.000  1.00 52.77  ? 105 HIS H ND1 1 
ATOM   802  C CD2 . HIS A 1 105 ? 8.412   -15.285 30.677  1.00 47.68  ? 105 HIS H CD2 1 
ATOM   803  C CE1 . HIS A 1 105 ? 6.418   -15.730 29.878  1.00 61.49  ? 105 HIS H CE1 1 
ATOM   804  N NE2 . HIS A 1 105 ? 7.224   -15.936 30.904  1.00 65.74  ? 105 HIS H NE2 1 
ATOM   805  N N   . GLN A 1 106 ? 9.929   -10.276 27.901  1.00 51.67  ? 106 GLN H N   1 
ATOM   806  C CA  . GLN A 1 106 ? 10.899  -9.454  27.188  1.00 54.39  ? 106 GLN H CA  1 
ATOM   807  C C   . GLN A 1 106 ? 12.125  -9.176  28.051  1.00 52.84  ? 106 GLN H C   1 
ATOM   808  O O   . GLN A 1 106 ? 12.096  -9.361  29.267  1.00 52.68  ? 106 GLN H O   1 
ATOM   809  C CB  . GLN A 1 106 ? 10.266  -8.136  26.738  1.00 44.17  ? 106 GLN H CB  1 
ATOM   810  C CG  . GLN A 1 106 ? 9.964   -7.164  27.868  1.00 53.40  ? 106 GLN H CG  1 
ATOM   811  C CD  . GLN A 1 106 ? 8.643   -7.448  28.556  1.00 55.28  ? 106 GLN H CD  1 
ATOM   812  O OE1 . GLN A 1 106 ? 8.017   -8.483  28.327  1.00 63.91  ? 106 GLN H OE1 1 
ATOM   813  N NE2 . GLN A 1 106 ? 8.210   -6.523  29.403  1.00 56.09  ? 106 GLN H NE2 1 
ATOM   814  N N   . LEU A 1 107 ? 13.201  -8.732  27.410  1.00 49.10  ? 107 LEU H N   1 
ATOM   815  C CA  . LEU A 1 107 ? 14.447  -8.433  28.107  1.00 49.44  ? 107 LEU H CA  1 
ATOM   816  C C   . LEU A 1 107 ? 14.651  -6.924  28.219  1.00 54.69  ? 107 LEU H C   1 
ATOM   817  O O   . LEU A 1 107 ? 15.168  -6.288  27.300  1.00 61.95  ? 107 LEU H O   1 
ATOM   818  C CB  . LEU A 1 107 ? 15.626  -9.087  27.384  1.00 49.52  ? 107 LEU H CB  1 
ATOM   819  C CG  . LEU A 1 107 ? 15.506  -10.604 27.208  1.00 51.42  ? 107 LEU H CG  1 
ATOM   820  C CD1 . LEU A 1 107 ? 16.515  -11.130 26.201  1.00 51.44  ? 107 LEU H CD1 1 
ATOM   821  C CD2 . LEU A 1 107 ? 15.671  -11.307 28.545  1.00 52.05  ? 107 LEU H CD2 1 
ATOM   822  N N   . ASP A 1 108 ? 14.244  -6.360  29.352  1.00 52.61  ? 108 ASP H N   1 
ATOM   823  C CA  . ASP A 1 108 ? 14.251  -4.911  29.539  1.00 57.80  ? 108 ASP H CA  1 
ATOM   824  C C   . ASP A 1 108 ? 15.653  -4.336  29.730  1.00 58.81  ? 108 ASP H C   1 
ATOM   825  O O   . ASP A 1 108 ? 15.949  -3.240  29.254  1.00 66.15  ? 108 ASP H O   1 
ATOM   826  C CB  . ASP A 1 108 ? 13.368  -4.529  30.731  1.00 63.58  ? 108 ASP H CB  1 
ATOM   827  C CG  . ASP A 1 108 ? 13.606  -5.411  31.944  1.00 70.39  ? 108 ASP H CG  1 
ATOM   828  O OD1 . ASP A 1 108 ? 14.696  -6.012  32.046  1.00 75.16  ? 108 ASP H OD1 1 
ATOM   829  O OD2 . ASP A 1 108 ? 12.701  -5.500  32.800  1.00 71.98  ? 108 ASP H OD2 1 
ATOM   830  N N   . TYR A 1 109 ? 16.510  -5.070  30.430  1.00 60.63  ? 109 TYR H N   1 
ATOM   831  C CA  . TYR A 1 109 ? 17.863  -4.597  30.700  1.00 51.48  ? 109 TYR H CA  1 
ATOM   832  C C   . TYR A 1 109 ? 18.910  -5.602  30.238  1.00 52.78  ? 109 TYR H C   1 
ATOM   833  O O   . TYR A 1 109 ? 18.759  -6.807  30.435  1.00 58.72  ? 109 TYR H O   1 
ATOM   834  C CB  . TYR A 1 109 ? 18.038  -4.300  32.191  1.00 44.94  ? 109 TYR H CB  1 
ATOM   835  C CG  . TYR A 1 109 ? 17.229  -3.117  32.670  1.00 56.09  ? 109 TYR H CG  1 
ATOM   836  C CD1 . TYR A 1 109 ? 17.735  -1.826  32.588  1.00 66.33  ? 109 TYR H CD1 1 
ATOM   837  C CD2 . TYR A 1 109 ? 15.957  -3.289  33.201  1.00 48.77  ? 109 TYR H CD2 1 
ATOM   838  C CE1 . TYR A 1 109 ? 16.998  -0.740  33.024  1.00 72.97  ? 109 TYR H CE1 1 
ATOM   839  C CE2 . TYR A 1 109 ? 15.213  -2.210  33.639  1.00 57.14  ? 109 TYR H CE2 1 
ATOM   840  C CZ  . TYR A 1 109 ? 15.738  -0.938  33.548  1.00 68.79  ? 109 TYR H CZ  1 
ATOM   841  O OH  . TYR A 1 109 ? 15.000  0.139   33.983  1.00 74.73  ? 109 TYR H OH  1 
ATOM   842  N N   . TRP A 1 110 ? 19.973  -5.092  29.624  1.00 52.30  ? 110 TRP H N   1 
ATOM   843  C CA  . TRP A 1 110 ? 21.020  -5.936  29.060  1.00 47.06  ? 110 TRP H CA  1 
ATOM   844  C C   . TRP A 1 110 ? 22.388  -5.623  29.655  1.00 41.45  ? 110 TRP H C   1 
ATOM   845  O O   . TRP A 1 110 ? 22.623  -4.524  30.156  1.00 51.73  ? 110 TRP H O   1 
ATOM   846  C CB  . TRP A 1 110 ? 21.080  -5.765  27.540  1.00 42.08  ? 110 TRP H CB  1 
ATOM   847  C CG  . TRP A 1 110 ? 19.866  -6.252  26.812  1.00 50.10  ? 110 TRP H CG  1 
ATOM   848  C CD1 . TRP A 1 110 ? 18.619  -5.699  26.834  1.00 46.15  ? 110 TRP H CD1 1 
ATOM   849  C CD2 . TRP A 1 110 ? 19.790  -7.381  25.934  1.00 45.72  ? 110 TRP H CD2 1 
ATOM   850  N NE1 . TRP A 1 110 ? 17.768  -6.421  26.031  1.00 51.69  ? 110 TRP H NE1 1 
ATOM   851  C CE2 . TRP A 1 110 ? 18.463  -7.458  25.467  1.00 49.45  ? 110 TRP H CE2 1 
ATOM   852  C CE3 . TRP A 1 110 ? 20.714  -8.337  25.502  1.00 46.74  ? 110 TRP H CE3 1 
ATOM   853  C CZ2 . TRP A 1 110 ? 18.039  -8.452  24.588  1.00 44.59  ? 110 TRP H CZ2 1 
ATOM   854  C CZ3 . TRP A 1 110 ? 20.290  -9.324  24.631  1.00 45.68  ? 110 TRP H CZ3 1 
ATOM   855  C CH2 . TRP A 1 110 ? 18.964  -9.374  24.184  1.00 51.01  ? 110 TRP H CH2 1 
ATOM   856  N N   . GLY A 1 111 ? 23.288  -6.598  29.592  1.00 48.86  ? 111 GLY H N   1 
ATOM   857  C CA  . GLY A 1 111 ? 24.672  -6.378  29.967  1.00 54.74  ? 111 GLY H CA  1 
ATOM   858  C C   . GLY A 1 111 ? 25.422  -5.775  28.797  1.00 63.36  ? 111 GLY H C   1 
ATOM   859  O O   . GLY A 1 111 ? 24.866  -5.638  27.707  1.00 67.26  ? 111 GLY H O   1 
ATOM   860  N N   . GLN A 1 112 ? 26.682  -5.413  29.012  1.00 52.58  ? 112 GLN H N   1 
ATOM   861  C CA  . GLN A 1 112 ? 27.484  -4.823  27.947  1.00 50.61  ? 112 GLN H CA  1 
ATOM   862  C C   . GLN A 1 112 ? 27.934  -5.890  26.954  1.00 51.21  ? 112 GLN H C   1 
ATOM   863  O O   . GLN A 1 112 ? 28.372  -5.577  25.847  1.00 57.57  ? 112 GLN H O   1 
ATOM   864  C CB  . GLN A 1 112 ? 28.698  -4.087  28.522  1.00 59.98  ? 112 GLN H CB  1 
ATOM   865  C CG  . GLN A 1 112 ? 29.812  -4.993  29.030  1.00 53.07  ? 112 GLN H CG  1 
ATOM   866  C CD  . GLN A 1 112 ? 29.570  -5.494  30.441  1.00 63.78  ? 112 GLN H CD  1 
ATOM   867  O OE1 . GLN A 1 112 ? 28.477  -5.347  30.989  1.00 66.34  ? 112 GLN H OE1 1 
ATOM   868  N NE2 . GLN A 1 112 ? 30.596  -6.087  31.039  1.00 63.03  ? 112 GLN H NE2 1 
ATOM   869  N N   . GLY A 1 113 ? 27.819  -7.152  27.356  1.00 50.21  ? 113 GLY H N   1 
ATOM   870  C CA  . GLY A 1 113 ? 28.216  -8.262  26.512  1.00 43.15  ? 113 GLY H CA  1 
ATOM   871  C C   . GLY A 1 113 ? 29.634  -8.723  26.785  1.00 50.22  ? 113 GLY H C   1 
ATOM   872  O O   . GLY A 1 113 ? 30.493  -7.927  27.163  1.00 46.83  ? 113 GLY H O   1 
ATOM   873  N N   . THR A 1 114 ? 29.878  -10.015 26.596  1.00 46.57  ? 114 THR H N   1 
ATOM   874  C CA  . THR A 1 114 ? 31.207  -10.579 26.798  1.00 51.00  ? 114 THR H CA  1 
ATOM   875  C C   . THR A 1 114 ? 31.724  -11.222 25.518  1.00 51.72  ? 114 THR H C   1 
ATOM   876  O O   . THR A 1 114 ? 31.171  -12.214 25.043  1.00 53.21  ? 114 THR H O   1 
ATOM   877  C CB  . THR A 1 114 ? 31.215  -11.628 27.926  1.00 55.31  ? 114 THR H CB  1 
ATOM   878  O OG1 . THR A 1 114 ? 30.825  -11.013 29.160  1.00 61.83  ? 114 THR H OG1 1 
ATOM   879  C CG2 . THR A 1 114 ? 32.604  -12.227 28.081  1.00 52.72  ? 114 THR H CG2 1 
ATOM   880  N N   . LEU A 1 115 ? 32.786  -10.649 24.961  1.00 51.81  ? 115 LEU H N   1 
ATOM   881  C CA  . LEU A 1 115 ? 33.391  -11.181 23.746  1.00 45.18  ? 115 LEU H CA  1 
ATOM   882  C C   . LEU A 1 115 ? 34.268  -12.389 24.053  1.00 46.32  ? 115 LEU H C   1 
ATOM   883  O O   . LEU A 1 115 ? 35.283  -12.274 24.739  1.00 54.90  ? 115 LEU H O   1 
ATOM   884  C CB  . LEU A 1 115 ? 34.214  -10.103 23.039  1.00 48.88  ? 115 LEU H CB  1 
ATOM   885  C CG  . LEU A 1 115 ? 35.013  -10.565 21.818  1.00 62.60  ? 115 LEU H CG  1 
ATOM   886  C CD1 . LEU A 1 115 ? 34.085  -11.101 20.738  1.00 60.23  ? 115 LEU H CD1 1 
ATOM   887  C CD2 . LEU A 1 115 ? 35.876  -9.434  21.278  1.00 64.42  ? 115 LEU H CD2 1 
ATOM   888  N N   . VAL A 1 116 ? 33.869  -13.549 23.541  1.00 47.27  ? 116 VAL H N   1 
ATOM   889  C CA  . VAL A 1 116 ? 34.642  -14.770 23.724  1.00 48.37  ? 116 VAL H CA  1 
ATOM   890  C C   . VAL A 1 116 ? 35.232  -15.238 22.400  1.00 55.47  ? 116 VAL H C   1 
ATOM   891  O O   . VAL A 1 116 ? 34.502  -15.501 21.444  1.00 57.97  ? 116 VAL H O   1 
ATOM   892  C CB  . VAL A 1 116 ? 33.786  -15.901 24.322  1.00 50.25  ? 116 VAL H CB  1 
ATOM   893  C CG1 . VAL A 1 116 ? 34.604  -17.180 24.430  1.00 42.38  ? 116 VAL H CG1 1 
ATOM   894  C CG2 . VAL A 1 116 ? 33.241  -15.493 25.681  1.00 35.62  ? 116 VAL H CG2 1 
ATOM   895  N N   . THR A 1 117 ? 36.556  -15.338 22.349  1.00 47.88  ? 117 THR H N   1 
ATOM   896  C CA  . THR A 1 117 ? 37.246  -15.785 21.145  1.00 48.41  ? 117 THR H CA  1 
ATOM   897  C C   . THR A 1 117 ? 37.941  -17.120 21.383  1.00 51.87  ? 117 THR H C   1 
ATOM   898  O O   . THR A 1 117 ? 38.744  -17.255 22.307  1.00 55.73  ? 117 THR H O   1 
ATOM   899  C CB  . THR A 1 117 ? 38.282  -14.750 20.671  1.00 55.13  ? 117 THR H CB  1 
ATOM   900  O OG1 . THR A 1 117 ? 37.632  -13.495 20.432  1.00 59.80  ? 117 THR H OG1 1 
ATOM   901  C CG2 . THR A 1 117 ? 38.960  -15.219 19.392  1.00 53.14  ? 117 THR H CG2 1 
ATOM   902  N N   . VAL A 1 118 ? 37.627  -18.106 20.549  1.00 52.88  ? 118 VAL H N   1 
ATOM   903  C CA  . VAL A 1 118 ? 38.217  -19.434 20.681  1.00 49.58  ? 118 VAL H CA  1 
ATOM   904  C C   . VAL A 1 118 ? 38.900  -19.883 19.394  1.00 56.10  ? 118 VAL H C   1 
ATOM   905  O O   . VAL A 1 118 ? 38.252  -20.045 18.360  1.00 51.71  ? 118 VAL H O   1 
ATOM   906  C CB  . VAL A 1 118 ? 37.163  -20.487 21.069  1.00 40.76  ? 118 VAL H CB  1 
ATOM   907  C CG1 . VAL A 1 118 ? 37.824  -21.844 21.261  1.00 43.30  ? 118 VAL H CG1 1 
ATOM   908  C CG2 . VAL A 1 118 ? 36.424  -20.067 22.330  1.00 52.62  ? 118 VAL H CG2 1 
ATOM   909  N N   . SER A 1 119 ? 40.212  -20.084 19.469  1.00 78.40  ? 119 SER H N   1 
ATOM   910  C CA  . SER A 1 119 ? 40.984  -20.594 18.342  1.00 68.86  ? 119 SER H CA  1 
ATOM   911  C C   . SER A 1 119 ? 42.322  -21.153 18.816  1.00 69.88  ? 119 SER H C   1 
ATOM   912  O O   . SER A 1 119 ? 42.751  -20.894 19.941  1.00 61.98  ? 119 SER H O   1 
ATOM   913  C CB  . SER A 1 119 ? 41.211  -19.500 17.297  1.00 78.62  ? 119 SER H CB  1 
ATOM   914  O OG  . SER A 1 119 ? 42.195  -18.578 17.728  1.00 91.58  ? 119 SER H OG  1 
ATOM   915  N N   . SER A 1 120 ? 42.977  -21.921 17.953  1.00 70.93  ? 120 SER H N   1 
ATOM   916  C CA  . SER A 1 120 ? 44.241  -22.559 18.300  1.00 63.09  ? 120 SER H CA  1 
ATOM   917  C C   . SER A 1 120 ? 45.417  -21.591 18.196  1.00 61.50  ? 120 SER H C   1 
ATOM   918  O O   . SER A 1 120 ? 46.543  -21.930 18.559  1.00 73.81  ? 120 SER H O   1 
ATOM   919  C CB  . SER A 1 120 ? 44.486  -23.774 17.402  1.00 64.61  ? 120 SER H CB  1 
ATOM   920  O OG  . SER A 1 120 ? 44.441  -23.410 16.033  1.00 89.42  ? 120 SER H OG  1 
ATOM   921  N N   . ALA A 1 121 ? 45.149  -20.387 17.701  1.00 59.92  ? 121 ALA H N   1 
ATOM   922  C CA  . ALA A 1 121 ? 46.193  -19.384 17.523  1.00 64.97  ? 121 ALA H CA  1 
ATOM   923  C C   . ALA A 1 121 ? 46.642  -18.798 18.858  1.00 76.06  ? 121 ALA H C   1 
ATOM   924  O O   . ALA A 1 121 ? 46.004  -19.010 19.889  1.00 59.77  ? 121 ALA H O   1 
ATOM   925  C CB  . ALA A 1 121 ? 45.709  -18.278 16.598  1.00 54.20  ? 121 ALA H CB  1 
ATOM   926  N N   . SER A 1 122 ? 47.748  -18.060 18.829  1.00 66.83  ? 122 SER H N   1 
ATOM   927  C CA  . SER A 1 122 ? 48.265  -17.400 20.022  1.00 70.63  ? 122 SER H CA  1 
ATOM   928  C C   . SER A 1 122 ? 48.490  -15.916 19.756  1.00 68.53  ? 122 SER H C   1 
ATOM   929  O O   . SER A 1 122 ? 48.432  -15.469 18.611  1.00 70.65  ? 122 SER H O   1 
ATOM   930  C CB  . SER A 1 122 ? 49.564  -18.060 20.483  1.00 80.92  ? 122 SER H CB  1 
ATOM   931  O OG  . SER A 1 122 ? 49.356  -19.424 20.806  1.00 81.81  ? 122 SER H OG  1 
ATOM   932  N N   . THR A 1 123 ? 48.746  -15.157 20.818  1.00 60.87  ? 123 THR H N   1 
ATOM   933  C CA  . THR A 1 123 ? 48.939  -13.715 20.704  1.00 68.92  ? 123 THR H CA  1 
ATOM   934  C C   . THR A 1 123 ? 50.160  -13.375 19.854  1.00 70.16  ? 123 THR H C   1 
ATOM   935  O O   . THR A 1 123 ? 51.279  -13.780 20.166  1.00 71.64  ? 123 THR H O   1 
ATOM   936  C CB  . THR A 1 123 ? 49.091  -13.057 22.088  1.00 59.39  ? 123 THR H CB  1 
ATOM   937  O OG1 . THR A 1 123 ? 47.893  -13.256 22.847  1.00 87.86  ? 123 THR H OG1 1 
ATOM   938  C CG2 . THR A 1 123 ? 49.354  -11.566 21.946  1.00 58.42  ? 123 THR H CG2 1 
ATOM   939  N N   . LYS A 1 124 ? 49.933  -12.628 18.778  1.00 62.81  ? 124 LYS H N   1 
ATOM   940  C CA  . LYS A 1 124 ? 51.005  -12.255 17.862  1.00 62.36  ? 124 LYS H CA  1 
ATOM   941  C C   . LYS A 1 124 ? 50.864  -10.811 17.392  1.00 60.77  ? 124 LYS H C   1 
ATOM   942  O O   . LYS A 1 124 ? 49.769  -10.361 17.057  1.00 50.20  ? 124 LYS H O   1 
ATOM   943  C CB  . LYS A 1 124 ? 51.025  -13.197 16.654  1.00 61.65  ? 124 LYS H CB  1 
ATOM   944  C CG  . LYS A 1 124 ? 52.114  -12.884 15.637  1.00 72.79  ? 124 LYS H CG  1 
ATOM   945  C CD  . LYS A 1 124 ? 52.028  -13.803 14.429  1.00 68.24  ? 124 LYS H CD  1 
ATOM   946  N N   . GLY A 1 125 ? 51.980  -10.089 17.375  1.00 62.60  ? 125 GLY H N   1 
ATOM   947  C CA  . GLY A 1 125 ? 51.997  -8.724  16.883  1.00 53.36  ? 125 GLY H CA  1 
ATOM   948  C C   . GLY A 1 125 ? 51.939  -8.683  15.369  1.00 61.64  ? 125 GLY H C   1 
ATOM   949  O O   . GLY A 1 125 ? 52.493  -9.556  14.701  1.00 67.16  ? 125 GLY H O   1 
ATOM   950  N N   . PRO A 1 126 ? 51.265  -7.664  14.816  1.00 56.41  ? 126 PRO H N   1 
ATOM   951  C CA  . PRO A 1 126 ? 51.063  -7.529  13.371  1.00 58.53  ? 126 PRO H CA  1 
ATOM   952  C C   . PRO A 1 126 ? 52.271  -6.972  12.623  1.00 65.32  ? 126 PRO H C   1 
ATOM   953  O O   . PRO A 1 126 ? 53.089  -6.255  13.199  1.00 49.38  ? 126 PRO H O   1 
ATOM   954  C CB  . PRO A 1 126 ? 49.894  -6.550  13.280  1.00 56.72  ? 126 PRO H CB  1 
ATOM   955  C CG  . PRO A 1 126 ? 50.050  -5.692  14.484  1.00 52.42  ? 126 PRO H CG  1 
ATOM   956  C CD  . PRO A 1 126 ? 50.595  -6.588  15.568  1.00 55.46  ? 126 PRO H CD  1 
ATOM   957  N N   . SER A 1 127 ? 52.370  -7.310  11.342  1.00 63.06  ? 127 SER H N   1 
ATOM   958  C CA  . SER A 1 127 ? 53.351  -6.699  10.456  1.00 70.83  ? 127 SER H CA  1 
ATOM   959  C C   . SER A 1 127 ? 52.652  -5.661  9.586   1.00 62.99  ? 127 SER H C   1 
ATOM   960  O O   . SER A 1 127 ? 51.638  -5.956  8.954   1.00 72.34  ? 127 SER H O   1 
ATOM   961  C CB  . SER A 1 127 ? 54.042  -7.754  9.591   1.00 67.56  ? 127 SER H CB  1 
ATOM   962  O OG  . SER A 1 127 ? 54.715  -8.712  10.390  1.00 65.42  ? 127 SER H OG  1 
ATOM   963  N N   . VAL A 1 128 ? 53.187  -4.446  9.562   1.00 53.16  ? 128 VAL H N   1 
ATOM   964  C CA  . VAL A 1 128 ? 52.547  -3.353  8.839   1.00 56.69  ? 128 VAL H CA  1 
ATOM   965  C C   . VAL A 1 128 ? 53.237  -3.061  7.510   1.00 58.98  ? 128 VAL H C   1 
ATOM   966  O O   . VAL A 1 128 ? 54.393  -2.640  7.476   1.00 58.34  ? 128 VAL H O   1 
ATOM   967  C CB  . VAL A 1 128 ? 52.519  -2.068  9.686   1.00 56.54  ? 128 VAL H CB  1 
ATOM   968  C CG1 . VAL A 1 128 ? 51.794  -0.958  8.941   1.00 56.47  ? 128 VAL H CG1 1 
ATOM   969  C CG2 . VAL A 1 128 ? 51.853  -2.337  11.025  1.00 52.16  ? 128 VAL H CG2 1 
ATOM   970  N N   . PHE A 1 129 ? 52.516  -3.287  6.417   1.00 59.95  ? 129 PHE H N   1 
ATOM   971  C CA  . PHE A 1 129 ? 53.048  -3.041  5.083   1.00 60.40  ? 129 PHE H CA  1 
ATOM   972  C C   . PHE A 1 129 ? 52.327  -1.872  4.421   1.00 58.93  ? 129 PHE H C   1 
ATOM   973  O O   . PHE A 1 129 ? 51.101  -1.780  4.483   1.00 62.42  ? 129 PHE H O   1 
ATOM   974  C CB  . PHE A 1 129 ? 52.931  -4.297  4.219   1.00 52.95  ? 129 PHE H CB  1 
ATOM   975  C CG  . PHE A 1 129 ? 53.508  -5.525  4.859   1.00 58.64  ? 129 PHE H CG  1 
ATOM   976  C CD1 . PHE A 1 129 ? 54.872  -5.633  5.075   1.00 49.01  ? 129 PHE H CD1 1 
ATOM   977  C CD2 . PHE A 1 129 ? 52.688  -6.573  5.244   1.00 64.96  ? 129 PHE H CD2 1 
ATOM   978  C CE1 . PHE A 1 129 ? 55.407  -6.761  5.667   1.00 52.28  ? 129 PHE H CE1 1 
ATOM   979  C CE2 . PHE A 1 129 ? 53.217  -7.705  5.835   1.00 66.62  ? 129 PHE H CE2 1 
ATOM   980  C CZ  . PHE A 1 129 ? 54.579  -7.799  6.045   1.00 67.98  ? 129 PHE H CZ  1 
ATOM   981  N N   . PRO A 1 130 ? 53.091  -0.973  3.784   1.00 57.38  ? 130 PRO H N   1 
ATOM   982  C CA  . PRO A 1 130 ? 52.539  0.240   3.174   1.00 60.31  ? 130 PRO H CA  1 
ATOM   983  C C   . PRO A 1 130 ? 51.787  -0.025  1.872   1.00 63.45  ? 130 PRO H C   1 
ATOM   984  O O   . PRO A 1 130 ? 52.171  -0.900  1.097   1.00 66.66  ? 130 PRO H O   1 
ATOM   985  C CB  . PRO A 1 130 ? 53.784  1.089   2.912   1.00 66.60  ? 130 PRO H CB  1 
ATOM   986  C CG  . PRO A 1 130 ? 54.866  0.090   2.697   1.00 64.55  ? 130 PRO H CG  1 
ATOM   987  C CD  . PRO A 1 130 ? 54.554  -1.056  3.622   1.00 65.87  ? 130 PRO H CD  1 
ATOM   988  N N   . LEU A 1 131 ? 50.719  0.733   1.648   1.00 57.63  ? 131 LEU H N   1 
ATOM   989  C CA  . LEU A 1 131 ? 49.985  0.681   0.391   1.00 59.06  ? 131 LEU H CA  1 
ATOM   990  C C   . LEU A 1 131 ? 50.238  1.962   -0.396  1.00 59.50  ? 131 LEU H C   1 
ATOM   991  O O   . LEU A 1 131 ? 49.438  2.897   -0.354  1.00 66.73  ? 131 LEU H O   1 
ATOM   992  C CB  . LEU A 1 131 ? 48.488  0.490   0.641   1.00 62.42  ? 131 LEU H CB  1 
ATOM   993  C CG  . LEU A 1 131 ? 48.081  -0.762  1.420   1.00 62.78  ? 131 LEU H CG  1 
ATOM   994  C CD1 . LEU A 1 131 ? 46.581  -0.777  1.667   1.00 58.05  ? 131 LEU H CD1 1 
ATOM   995  C CD2 . LEU A 1 131 ? 48.515  -2.018  0.682   1.00 59.62  ? 131 LEU H CD2 1 
ATOM   996  N N   . ALA A 1 132 ? 51.363  1.997   -1.104  1.00 58.98  ? 132 ALA H N   1 
ATOM   997  C CA  . ALA A 1 132 ? 51.779  3.185   -1.841  1.00 63.78  ? 132 ALA H CA  1 
ATOM   998  C C   . ALA A 1 132 ? 50.821  3.514   -2.981  1.00 64.24  ? 132 ALA H C   1 
ATOM   999  O O   . ALA A 1 132 ? 50.369  2.620   -3.696  1.00 63.15  ? 132 ALA H O   1 
ATOM   1000 C CB  . ALA A 1 132 ? 53.191  3.002   -2.377  1.00 67.10  ? 132 ALA H CB  1 
ATOM   1001 N N   . PRO A 1 133 ? 50.510  4.808   -3.151  1.00 69.24  ? 133 PRO H N   1 
ATOM   1002 C CA  . PRO A 1 133 ? 49.622  5.272   -4.222  1.00 72.32  ? 133 PRO H CA  1 
ATOM   1003 C C   . PRO A 1 133 ? 50.259  5.122   -5.600  1.00 66.42  ? 133 PRO H C   1 
ATOM   1004 O O   . PRO A 1 133 ? 51.487  5.118   -5.684  1.00 65.16  ? 133 PRO H O   1 
ATOM   1005 C CB  . PRO A 1 133 ? 49.402  6.747   -3.879  1.00 76.49  ? 133 PRO H CB  1 
ATOM   1006 C CG  . PRO A 1 133 ? 50.620  7.136   -3.118  1.00 78.39  ? 133 PRO H CG  1 
ATOM   1007 C CD  . PRO A 1 133 ? 50.999  5.922   -2.320  1.00 77.04  ? 133 PRO H CD  1 
ATOM   1008 N N   . GLY A 1 141 ? 43.211  13.360  -9.886  1.00 72.72  ? 141 GLY H N   1 
ATOM   1009 C CA  . GLY A 1 141 ? 42.730  14.323  -8.913  1.00 76.19  ? 141 GLY H CA  1 
ATOM   1010 C C   . GLY A 1 141 ? 42.777  13.787  -7.496  1.00 79.30  ? 141 GLY H C   1 
ATOM   1011 O O   . GLY A 1 141 ? 43.439  14.357  -6.629  1.00 80.39  ? 141 GLY H O   1 
ATOM   1012 N N   . THR A 1 142 ? 42.072  12.685  -7.261  1.00 83.06  ? 142 THR H N   1 
ATOM   1013 C CA  . THR A 1 142 ? 42.028  12.070  -5.939  1.00 84.42  ? 142 THR H CA  1 
ATOM   1014 C C   . THR A 1 142 ? 42.865  10.797  -5.890  1.00 79.71  ? 142 THR H C   1 
ATOM   1015 O O   . THR A 1 142 ? 42.587  9.832   -6.602  1.00 85.34  ? 142 THR H O   1 
ATOM   1016 C CB  . THR A 1 142 ? 40.583  11.737  -5.519  1.00 86.34  ? 142 THR H CB  1 
ATOM   1017 O OG1 . THR A 1 142 ? 39.805  12.940  -5.474  1.00 97.40  ? 142 THR H OG1 1 
ATOM   1018 C CG2 . THR A 1 142 ? 40.565  11.075  -4.148  1.00 78.94  ? 142 THR H CG2 1 
ATOM   1019 N N   . ALA A 1 143 ? 43.890  10.801  -5.045  1.00 72.66  ? 143 ALA H N   1 
ATOM   1020 C CA  . ALA A 1 143 ? 44.757  9.640   -4.888  1.00 67.03  ? 143 ALA H CA  1 
ATOM   1021 C C   . ALA A 1 143 ? 44.440  8.897   -3.595  1.00 70.80  ? 143 ALA H C   1 
ATOM   1022 O O   . ALA A 1 143 ? 43.915  9.479   -2.646  1.00 71.18  ? 143 ALA H O   1 
ATOM   1023 C CB  . ALA A 1 143 ? 46.217  10.059  -4.916  1.00 68.59  ? 143 ALA H CB  1 
ATOM   1024 N N   . ALA A 1 144 ? 44.761  7.608   -3.562  1.00 60.48  ? 144 ALA H N   1 
ATOM   1025 C CA  . ALA A 1 144 ? 44.491  6.790   -2.388  1.00 50.33  ? 144 ALA H CA  1 
ATOM   1026 C C   . ALA A 1 144 ? 45.746  6.070   -1.906  1.00 59.20  ? 144 ALA H C   1 
ATOM   1027 O O   . ALA A 1 144 ? 46.546  5.586   -2.707  1.00 51.47  ? 144 ALA H O   1 
ATOM   1028 C CB  . ALA A 1 144 ? 43.389  5.786   -2.687  1.00 50.94  ? 144 ALA H CB  1 
ATOM   1029 N N   . LEU A 1 145 ? 45.912  6.008   -0.589  1.00 52.45  ? 145 LEU H N   1 
ATOM   1030 C CA  . LEU A 1 145 ? 47.034  5.298   0.013   1.00 54.89  ? 145 LEU H CA  1 
ATOM   1031 C C   . LEU A 1 145 ? 46.602  4.663   1.328   1.00 60.90  ? 145 LEU H C   1 
ATOM   1032 O O   . LEU A 1 145 ? 45.542  4.989   1.862   1.00 68.25  ? 145 LEU H O   1 
ATOM   1033 C CB  . LEU A 1 145 ? 48.220  6.244   0.228   1.00 61.48  ? 145 LEU H CB  1 
ATOM   1034 C CG  . LEU A 1 145 ? 48.002  7.517   1.051   1.00 69.77  ? 145 LEU H CG  1 
ATOM   1035 C CD1 . LEU A 1 145 ? 48.302  7.290   2.528   1.00 66.28  ? 145 LEU H CD1 1 
ATOM   1036 C CD2 . LEU A 1 145 ? 48.844  8.658   0.501   1.00 80.05  ? 145 LEU H CD2 1 
ATOM   1037 N N   . GLY A 1 146 ? 47.420  3.757   1.850   1.00 58.89  ? 146 GLY H N   1 
ATOM   1038 C CA  . GLY A 1 146 ? 47.086  3.093   3.094   1.00 58.56  ? 146 GLY H CA  1 
ATOM   1039 C C   . GLY A 1 146 ? 48.166  2.186   3.648   1.00 53.17  ? 146 GLY H C   1 
ATOM   1040 O O   . GLY A 1 146 ? 49.344  2.325   3.322   1.00 44.56  ? 146 GLY H O   1 
ATOM   1041 N N   . CYS A 1 147 ? 47.753  1.252   4.499   1.00 42.36  ? 147 CYS H N   1 
ATOM   1042 C CA  . CYS A 1 147 ? 48.674  0.298   5.100   1.00 60.07  ? 147 CYS H CA  1 
ATOM   1043 C C   . CYS A 1 147 ? 47.980  -1.037  5.350   1.00 53.56  ? 147 CYS H C   1 
ATOM   1044 O O   . CYS A 1 147 ? 46.791  -1.080  5.667   1.00 44.28  ? 147 CYS H O   1 
ATOM   1045 C CB  . CYS A 1 147 ? 49.248  0.852   6.406   1.00 53.35  ? 147 CYS H CB  1 
ATOM   1046 S SG  . CYS A 1 147 ? 48.009  1.243   7.662   1.00 140.85 ? 147 CYS H SG  1 
ATOM   1047 N N   . LEU A 1 148 ? 48.729  -2.124  5.203   1.00 53.06  ? 148 LEU H N   1 
ATOM   1048 C CA  . LEU A 1 148 ? 48.184  -3.461  5.400   1.00 52.86  ? 148 LEU H CA  1 
ATOM   1049 C C   . LEU A 1 148 ? 48.628  -4.051  6.735   1.00 50.34  ? 148 LEU H C   1 
ATOM   1050 O O   . LEU A 1 148 ? 49.804  -4.365  6.926   1.00 48.54  ? 148 LEU H O   1 
ATOM   1051 C CB  . LEU A 1 148 ? 48.601  -4.382  4.252   1.00 39.33  ? 148 LEU H CB  1 
ATOM   1052 C CG  . LEU A 1 148 ? 48.054  -5.810  4.298   1.00 53.35  ? 148 LEU H CG  1 
ATOM   1053 C CD1 . LEU A 1 148 ? 46.542  -5.809  4.143   1.00 51.24  ? 148 LEU H CD1 1 
ATOM   1054 C CD2 . LEU A 1 148 ? 48.707  -6.670  3.229   1.00 62.29  ? 148 LEU H CD2 1 
ATOM   1055 N N   . VAL A 1 149 ? 47.679  -4.194  7.655   1.00 49.64  ? 149 VAL H N   1 
ATOM   1056 C CA  . VAL A 1 149 ? 47.946  -4.781  8.962   1.00 54.19  ? 149 VAL H CA  1 
ATOM   1057 C C   . VAL A 1 149 ? 47.668  -6.279  8.923   1.00 51.72  ? 149 VAL H C   1 
ATOM   1058 O O   . VAL A 1 149 ? 46.524  -6.709  9.073   1.00 48.95  ? 149 VAL H O   1 
ATOM   1059 C CB  . VAL A 1 149 ? 47.091  -4.121  10.060  1.00 53.57  ? 149 VAL H CB  1 
ATOM   1060 C CG1 . VAL A 1 149 ? 47.506  -4.624  11.432  1.00 55.86  ? 149 VAL H CG1 1 
ATOM   1061 C CG2 . VAL A 1 149 ? 47.206  -2.606  9.982   1.00 54.96  ? 149 VAL H CG2 1 
ATOM   1062 N N   . LYS A 1 150 ? 48.719  -7.071  8.724   1.00 58.56  ? 150 LYS H N   1 
ATOM   1063 C CA  . LYS A 1 150 ? 48.562  -8.494  8.431   1.00 63.47  ? 150 LYS H CA  1 
ATOM   1064 C C   . LYS A 1 150 ? 49.101  -9.405  9.533   1.00 61.95  ? 150 LYS H C   1 
ATOM   1065 O O   . LYS A 1 150 ? 50.078  -9.073  10.211  1.00 64.99  ? 150 LYS H O   1 
ATOM   1066 C CB  . LYS A 1 150 ? 49.254  -8.829  7.107   1.00 63.02  ? 150 LYS H CB  1 
ATOM   1067 C CG  . LYS A 1 150 ? 48.945  -10.215 6.562   1.00 68.85  ? 150 LYS H CG  1 
ATOM   1068 C CD  . LYS A 1 150 ? 49.584  -10.434 5.203   1.00 59.71  ? 150 LYS H CD  1 
ATOM   1069 C CE  . LYS A 1 150 ? 49.563  -11.901 4.819   1.00 64.95  ? 150 LYS H CE  1 
ATOM   1070 N NZ  . LYS A 1 150 ? 48.175  -12.397 4.623   1.00 73.44  ? 150 LYS H NZ  1 
ATOM   1071 N N   . ASP A 1 151 ? 48.437  -10.546 9.707   1.00 62.44  ? 151 ASP H N   1 
ATOM   1072 C CA  . ASP A 1 151 ? 48.900  -11.621 10.583  1.00 55.23  ? 151 ASP H CA  1 
ATOM   1073 C C   . ASP A 1 151 ? 49.027  -11.213 12.049  1.00 59.40  ? 151 ASP H C   1 
ATOM   1074 O O   . ASP A 1 151 ? 50.126  -11.195 12.606  1.00 59.66  ? 151 ASP H O   1 
ATOM   1075 C CB  . ASP A 1 151 ? 50.242  -12.162 10.081  1.00 54.73  ? 151 ASP H CB  1 
ATOM   1076 C CG  . ASP A 1 151 ? 50.130  -12.817 8.715   1.00 61.58  ? 151 ASP H CG  1 
ATOM   1077 O OD1 . ASP A 1 151 ? 48.991  -13.035 8.242   1.00 64.49  ? 151 ASP H OD1 1 
ATOM   1078 O OD2 . ASP A 1 151 ? 51.182  -13.109 8.113   1.00 65.10  ? 151 ASP H OD2 1 
ATOM   1079 N N   . TYR A 1 152 ? 47.899  -10.892 12.674  1.00 50.77  ? 152 TYR H N   1 
ATOM   1080 C CA  . TYR A 1 152 ? 47.895  -10.592 14.100  1.00 59.33  ? 152 TYR H CA  1 
ATOM   1081 C C   . TYR A 1 152 ? 46.808  -11.372 14.821  1.00 61.35  ? 152 TYR H C   1 
ATOM   1082 O O   . TYR A 1 152 ? 45.851  -11.847 14.207  1.00 56.09  ? 152 TYR H O   1 
ATOM   1083 C CB  . TYR A 1 152 ? 47.713  -9.093  14.341  1.00 52.59  ? 152 TYR H CB  1 
ATOM   1084 C CG  . TYR A 1 152 ? 46.358  -8.550  13.952  1.00 52.71  ? 152 TYR H CG  1 
ATOM   1085 C CD1 . TYR A 1 152 ? 45.346  -8.421  14.894  1.00 43.68  ? 152 TYR H CD1 1 
ATOM   1086 C CD2 . TYR A 1 152 ? 46.094  -8.152  12.649  1.00 55.49  ? 152 TYR H CD2 1 
ATOM   1087 C CE1 . TYR A 1 152 ? 44.108  -7.920  14.549  1.00 51.90  ? 152 TYR H CE1 1 
ATOM   1088 C CE2 . TYR A 1 152 ? 44.858  -7.648  12.293  1.00 57.10  ? 152 TYR H CE2 1 
ATOM   1089 C CZ  . TYR A 1 152 ? 43.869  -7.535  13.247  1.00 58.83  ? 152 TYR H CZ  1 
ATOM   1090 O OH  . TYR A 1 152 ? 42.638  -7.034  12.899  1.00 62.01  ? 152 TYR H OH  1 
ATOM   1091 N N   . PHE A 1 153 ? 46.969  -11.503 16.133  1.00 60.23  ? 153 PHE H N   1 
ATOM   1092 C CA  . PHE A 1 153 ? 45.995  -12.186 16.970  1.00 60.43  ? 153 PHE H CA  1 
ATOM   1093 C C   . PHE A 1 153 ? 46.162  -11.759 18.425  1.00 61.84  ? 153 PHE H C   1 
ATOM   1094 O O   . PHE A 1 153 ? 47.285  -11.627 18.909  1.00 65.74  ? 153 PHE H O   1 
ATOM   1095 C CB  . PHE A 1 153 ? 46.138  -13.706 16.839  1.00 58.61  ? 153 PHE H CB  1 
ATOM   1096 C CG  . PHE A 1 153 ? 45.073  -14.478 17.564  1.00 61.41  ? 153 PHE H CG  1 
ATOM   1097 C CD1 . PHE A 1 153 ? 43.858  -14.748 16.956  1.00 49.29  ? 153 PHE H CD1 1 
ATOM   1098 C CD2 . PHE A 1 153 ? 45.282  -14.923 18.859  1.00 64.35  ? 153 PHE H CD2 1 
ATOM   1099 C CE1 . PHE A 1 153 ? 42.874  -15.452 17.624  1.00 61.64  ? 153 PHE H CE1 1 
ATOM   1100 C CE2 . PHE A 1 153 ? 44.302  -15.627 19.532  1.00 60.90  ? 153 PHE H CE2 1 
ATOM   1101 C CZ  . PHE A 1 153 ? 43.097  -15.891 18.914  1.00 60.82  ? 153 PHE H CZ  1 
ATOM   1102 N N   . PRO A 1 154 ? 45.042  -11.527 19.124  1.00 62.28  ? 154 PRO H N   1 
ATOM   1103 C CA  . PRO A 1 154 ? 43.688  -11.566 18.568  1.00 55.19  ? 154 PRO H CA  1 
ATOM   1104 C C   . PRO A 1 154 ? 43.170  -10.181 18.197  1.00 59.76  ? 154 PRO H C   1 
ATOM   1105 O O   . PRO A 1 154 ? 43.957  -9.271  17.934  1.00 52.94  ? 154 PRO H O   1 
ATOM   1106 C CB  . PRO A 1 154 ? 42.873  -12.157 19.714  1.00 61.50  ? 154 PRO H CB  1 
ATOM   1107 C CG  . PRO A 1 154 ? 43.549  -11.609 20.939  1.00 58.54  ? 154 PRO H CG  1 
ATOM   1108 C CD  . PRO A 1 154 ? 45.019  -11.437 20.596  1.00 60.40  ? 154 PRO H CD  1 
ATOM   1109 N N   . GLU A 1 155 ? 41.850  -10.038 18.176  1.00 63.79  ? 155 GLU H N   1 
ATOM   1110 C CA  . GLU A 1 155 ? 41.211  -8.746  17.964  1.00 64.42  ? 155 GLU H CA  1 
ATOM   1111 C C   . GLU A 1 155 ? 41.243  -7.935  19.258  1.00 62.17  ? 155 GLU H C   1 
ATOM   1112 O O   . GLU A 1 155 ? 41.299  -8.509  20.345  1.00 69.83  ? 155 GLU H O   1 
ATOM   1113 C CB  . GLU A 1 155 ? 39.768  -8.938  17.482  1.00 59.55  ? 155 GLU H CB  1 
ATOM   1114 C CG  . GLU A 1 155 ? 39.635  -9.435  16.049  1.00 67.21  ? 155 GLU H CG  1 
ATOM   1115 C CD  . GLU A 1 155 ? 39.675  -8.311  15.028  1.00 71.90  ? 155 GLU H CD  1 
ATOM   1116 O OE1 . GLU A 1 155 ? 38.811  -8.299  14.125  1.00 67.38  ? 155 GLU H OE1 1 
ATOM   1117 O OE2 . GLU A 1 155 ? 40.569  -7.444  15.120  1.00 75.32  ? 155 GLU H OE2 1 
ATOM   1118 N N   . PRO A 1 156 ? 41.207  -6.596  19.151  1.00 61.21  ? 156 PRO H N   1 
ATOM   1119 C CA  . PRO A 1 156 ? 41.209  -5.816  17.914  1.00 55.16  ? 156 PRO H CA  1 
ATOM   1120 C C   . PRO A 1 156 ? 42.536  -5.112  17.658  1.00 69.41  ? 156 PRO H C   1 
ATOM   1121 O O   . PRO A 1 156 ? 43.517  -5.348  18.365  1.00 74.28  ? 156 PRO H O   1 
ATOM   1122 C CB  . PRO A 1 156 ? 40.107  -4.795  18.170  1.00 52.09  ? 156 PRO H CB  1 
ATOM   1123 C CG  . PRO A 1 156 ? 40.247  -4.506  19.649  1.00 59.68  ? 156 PRO H CG  1 
ATOM   1124 C CD  . PRO A 1 156 ? 40.836  -5.754  20.302  1.00 51.88  ? 156 PRO H CD  1 
ATOM   1125 N N   . VAL A 1 157 ? 42.553  -4.250  16.647  1.00 61.50  ? 157 VAL H N   1 
ATOM   1126 C CA  . VAL A 1 157 ? 43.701  -3.398  16.375  1.00 57.45  ? 157 VAL H CA  1 
ATOM   1127 C C   . VAL A 1 157 ? 43.202  -2.000  16.010  1.00 60.95  ? 157 VAL H C   1 
ATOM   1128 O O   . VAL A 1 157 ? 42.183  -1.852  15.333  1.00 66.53  ? 157 VAL H O   1 
ATOM   1129 C CB  . VAL A 1 157 ? 44.591  -3.975  15.245  1.00 64.46  ? 157 VAL H CB  1 
ATOM   1130 C CG1 . VAL A 1 157 ? 43.811  -4.095  13.941  1.00 63.28  ? 157 VAL H CG1 1 
ATOM   1131 C CG2 . VAL A 1 157 ? 45.842  -3.128  15.054  1.00 59.90  ? 157 VAL H CG2 1 
ATOM   1132 N N   . THR A 1 158 ? 43.902  -0.976  16.485  1.00 60.10  ? 158 THR H N   1 
ATOM   1133 C CA  . THR A 1 158 ? 43.510  0.400   16.208  1.00 59.06  ? 158 THR H CA  1 
ATOM   1134 C C   . THR A 1 158 ? 44.468  1.052   15.220  1.00 62.82  ? 158 THR H C   1 
ATOM   1135 O O   . THR A 1 158 ? 45.687  0.964   15.369  1.00 71.03  ? 158 THR H O   1 
ATOM   1136 C CB  . THR A 1 158 ? 43.462  1.247   17.491  1.00 63.31  ? 158 THR H CB  1 
ATOM   1137 O OG1 . THR A 1 158 ? 44.792  1.444   17.987  1.00 64.71  ? 158 THR H OG1 1 
ATOM   1138 C CG2 . THR A 1 158 ? 42.620  0.558   18.555  1.00 61.38  ? 158 THR H CG2 1 
ATOM   1139 N N   . VAL A 1 159 ? 43.908  1.702   14.205  1.00 54.36  ? 159 VAL H N   1 
ATOM   1140 C CA  . VAL A 1 159 ? 44.715  2.387   13.206  1.00 54.30  ? 159 VAL H CA  1 
ATOM   1141 C C   . VAL A 1 159 ? 44.282  3.839   13.048  1.00 60.62  ? 159 VAL H C   1 
ATOM   1142 O O   . VAL A 1 159 ? 43.126  4.122   12.732  1.00 78.23  ? 159 VAL H O   1 
ATOM   1143 C CB  . VAL A 1 159 ? 44.635  1.691   11.831  1.00 55.84  ? 159 VAL H CB  1 
ATOM   1144 C CG1 . VAL A 1 159 ? 45.469  2.447   10.807  1.00 46.03  ? 159 VAL H CG1 1 
ATOM   1145 C CG2 . VAL A 1 159 ? 45.097  0.244   11.934  1.00 61.68  ? 159 VAL H CG2 1 
ATOM   1146 N N   . SER A 1 160 ? 45.215  4.755   13.276  1.00 47.82  ? 160 SER H N   1 
ATOM   1147 C CA  . SER A 1 160 ? 44.974  6.169   13.025  1.00 52.60  ? 160 SER H CA  1 
ATOM   1148 C C   . SER A 1 160 ? 45.930  6.670   11.948  1.00 58.75  ? 160 SER H C   1 
ATOM   1149 O O   . SER A 1 160 ? 46.778  5.920   11.463  1.00 48.80  ? 160 SER H O   1 
ATOM   1150 C CB  . SER A 1 160 ? 45.135  6.986   14.307  1.00 51.86  ? 160 SER H CB  1 
ATOM   1151 O OG  . SER A 1 160 ? 46.486  7.007   14.730  1.00 58.42  ? 160 SER H OG  1 
ATOM   1152 N N   . TRP A 1 161 ? 45.790  7.936   11.572  1.00 55.13  ? 161 TRP H N   1 
ATOM   1153 C CA  . TRP A 1 161 ? 46.660  8.527   10.564  1.00 53.56  ? 161 TRP H CA  1 
ATOM   1154 C C   . TRP A 1 161 ? 47.162  9.893   11.011  1.00 58.06  ? 161 TRP H C   1 
ATOM   1155 O O   . TRP A 1 161 ? 46.372  10.757  11.395  1.00 68.13  ? 161 TRP H O   1 
ATOM   1156 C CB  . TRP A 1 161 ? 45.932  8.638   9.223   1.00 46.71  ? 161 TRP H CB  1 
ATOM   1157 C CG  . TRP A 1 161 ? 45.753  7.318   8.539   1.00 46.23  ? 161 TRP H CG  1 
ATOM   1158 C CD1 . TRP A 1 161 ? 44.683  6.478   8.642   1.00 47.15  ? 161 TRP H CD1 1 
ATOM   1159 C CD2 . TRP A 1 161 ? 46.678  6.681   7.649   1.00 54.74  ? 161 TRP H CD2 1 
ATOM   1160 N NE1 . TRP A 1 161 ? 44.882  5.359   7.869   1.00 47.53  ? 161 TRP H NE1 1 
ATOM   1161 C CE2 . TRP A 1 161 ? 46.100  5.460   7.249   1.00 55.50  ? 161 TRP H CE2 1 
ATOM   1162 C CE3 . TRP A 1 161 ? 47.938  7.026   7.151   1.00 50.63  ? 161 TRP H CE3 1 
ATOM   1163 C CZ2 . TRP A 1 161 ? 46.739  4.583   6.374   1.00 48.74  ? 161 TRP H CZ2 1 
ATOM   1164 C CZ3 . TRP A 1 161 ? 48.570  6.154   6.283   1.00 59.63  ? 161 TRP H CZ3 1 
ATOM   1165 C CH2 . TRP A 1 161 ? 47.971  4.947   5.905   1.00 58.17  ? 161 TRP H CH2 1 
ATOM   1166 N N   . ASN A 1 162 ? 48.480  10.073  10.956  1.00 53.08  ? 162 ASN H N   1 
ATOM   1167 C CA  . ASN A 1 162 ? 49.132  11.297  11.413  1.00 56.94  ? 162 ASN H CA  1 
ATOM   1168 C C   . ASN A 1 162 ? 48.757  11.636  12.852  1.00 62.08  ? 162 ASN H C   1 
ATOM   1169 O O   . ASN A 1 162 ? 48.486  12.792  13.176  1.00 65.15  ? 162 ASN H O   1 
ATOM   1170 C CB  . ASN A 1 162 ? 48.792  12.468  10.487  1.00 61.08  ? 162 ASN H CB  1 
ATOM   1171 C CG  . ASN A 1 162 ? 49.447  12.342  9.125   1.00 66.98  ? 162 ASN H CG  1 
ATOM   1172 O OD1 . ASN A 1 162 ? 50.071  11.327  8.814   1.00 68.57  ? 162 ASN H OD1 1 
ATOM   1173 N ND2 . ASN A 1 162 ? 49.308  13.376  8.303   1.00 63.00  ? 162 ASN H ND2 1 
ATOM   1174 N N   . SER A 1 163 ? 48.743  10.610  13.701  1.00 63.19  ? 163 SER H N   1 
ATOM   1175 C CA  . SER A 1 163 ? 48.419  10.748  15.120  1.00 66.85  ? 163 SER H CA  1 
ATOM   1176 C C   . SER A 1 163 ? 47.035  11.354  15.339  1.00 67.98  ? 163 SER H C   1 
ATOM   1177 O O   . SER A 1 163 ? 46.832  12.148  16.257  1.00 77.27  ? 163 SER H O   1 
ATOM   1178 C CB  . SER A 1 163 ? 49.481  11.590  15.834  1.00 74.13  ? 163 SER H CB  1 
ATOM   1179 O OG  . SER A 1 163 ? 50.770  11.019  15.686  1.00 71.28  ? 163 SER H OG  1 
ATOM   1180 N N   . GLY A 1 164 ? 46.085  10.975  14.489  1.00 64.49  ? 164 GLY H N   1 
ATOM   1181 C CA  . GLY A 1 164 ? 44.712  11.423  14.633  1.00 58.45  ? 164 GLY H CA  1 
ATOM   1182 C C   . GLY A 1 164 ? 44.439  12.780  14.015  1.00 60.46  ? 164 GLY H C   1 
ATOM   1183 O O   . GLY A 1 164 ? 43.323  13.292  14.098  1.00 74.64  ? 164 GLY H O   1 
ATOM   1184 N N   . ALA A 1 165 ? 45.457  13.367  13.392  1.00 58.94  ? 165 ALA H N   1 
ATOM   1185 C CA  . ALA A 1 165 ? 45.307  14.665  12.744  1.00 69.86  ? 165 ALA H CA  1 
ATOM   1186 C C   . ALA A 1 165 ? 44.658  14.520  11.370  1.00 58.23  ? 165 ALA H C   1 
ATOM   1187 O O   . ALA A 1 165 ? 44.355  15.512  10.707  1.00 59.47  ? 165 ALA H O   1 
ATOM   1188 C CB  . ALA A 1 165 ? 46.654  15.361  12.623  1.00 69.39  ? 165 ALA H CB  1 
ATOM   1189 N N   . LEU A 1 166 ? 44.449  13.276  10.952  1.00 55.07  ? 166 LEU H N   1 
ATOM   1190 C CA  . LEU A 1 166 ? 43.831  12.985  9.664   1.00 58.88  ? 166 LEU H CA  1 
ATOM   1191 C C   . LEU A 1 166 ? 42.700  11.973  9.825   1.00 60.47  ? 166 LEU H C   1 
ATOM   1192 O O   . LEU A 1 166 ? 42.938  10.812  10.161  1.00 50.37  ? 166 LEU H O   1 
ATOM   1193 C CB  . LEU A 1 166 ? 44.877  12.462  8.678   1.00 65.30  ? 166 LEU H CB  1 
ATOM   1194 C CG  . LEU A 1 166 ? 44.383  12.069  7.285   1.00 68.17  ? 166 LEU H CG  1 
ATOM   1195 C CD1 . LEU A 1 166 ? 43.898  13.292  6.522   1.00 65.71  ? 166 LEU H CD1 1 
ATOM   1196 C CD2 . LEU A 1 166 ? 45.479  11.351  6.513   1.00 72.32  ? 166 LEU H CD2 1 
ATOM   1197 N N   . THR A 1 167 ? 41.469  12.417  9.586   1.00 59.16  ? 167 THR H N   1 
ATOM   1198 C CA  . THR A 1 167 ? 40.301  11.559  9.760   1.00 60.91  ? 167 THR H CA  1 
ATOM   1199 C C   . THR A 1 167 ? 39.424  11.509  8.512   1.00 60.77  ? 167 THR H C   1 
ATOM   1200 O O   . THR A 1 167 ? 38.714  10.530  8.282   1.00 54.14  ? 167 THR H O   1 
ATOM   1201 C CB  . THR A 1 167 ? 39.435  12.021  10.950  1.00 65.71  ? 167 THR H CB  1 
ATOM   1202 O OG1 . THR A 1 167 ? 39.029  13.381  10.751  1.00 69.66  ? 167 THR H OG1 1 
ATOM   1203 C CG2 . THR A 1 167 ? 40.215  11.915  12.251  1.00 70.55  ? 167 THR H CG2 1 
ATOM   1204 N N   . SER A 1 168 ? 39.473  12.568  7.710   1.00 64.36  ? 168 SER H N   1 
ATOM   1205 C CA  . SER A 1 168 ? 38.645  12.660  6.512   1.00 61.55  ? 168 SER H CA  1 
ATOM   1206 C C   . SER A 1 168 ? 39.082  11.662  5.444   1.00 62.90  ? 168 SER H C   1 
ATOM   1207 O O   . SER A 1 168 ? 40.257  11.599  5.082   1.00 67.10  ? 168 SER H O   1 
ATOM   1208 C CB  . SER A 1 168 ? 38.681  14.080  5.944   1.00 62.01  ? 168 SER H CB  1 
ATOM   1209 O OG  . SER A 1 168 ? 38.162  15.016  6.873   1.00 66.22  ? 168 SER H OG  1 
ATOM   1210 N N   . GLY A 1 169 ? 38.127  10.882  4.948   1.00 64.87  ? 169 GLY H N   1 
ATOM   1211 C CA  . GLY A 1 169 ? 38.391  9.927   3.888   1.00 61.75  ? 169 GLY H CA  1 
ATOM   1212 C C   . GLY A 1 169 ? 39.086  8.667   4.366   1.00 56.54  ? 169 GLY H C   1 
ATOM   1213 O O   . GLY A 1 169 ? 39.478  7.823   3.562   1.00 62.86  ? 169 GLY H O   1 
ATOM   1214 N N   . VAL A 1 170 ? 39.236  8.536   5.680   1.00 57.43  ? 170 VAL H N   1 
ATOM   1215 C CA  . VAL A 1 170 ? 39.896  7.372   6.260   1.00 52.19  ? 170 VAL H CA  1 
ATOM   1216 C C   . VAL A 1 170 ? 38.937  6.191   6.378   1.00 50.21  ? 170 VAL H C   1 
ATOM   1217 O O   . VAL A 1 170 ? 37.862  6.306   6.967   1.00 52.41  ? 170 VAL H O   1 
ATOM   1218 C CB  . VAL A 1 170 ? 40.480  7.692   7.649   1.00 58.23  ? 170 VAL H CB  1 
ATOM   1219 C CG1 . VAL A 1 170 ? 41.063  6.439   8.283   1.00 56.82  ? 170 VAL H CG1 1 
ATOM   1220 C CG2 . VAL A 1 170 ? 41.536  8.781   7.540   1.00 58.80  ? 170 VAL H CG2 1 
ATOM   1221 N N   . HIS A 1 171 ? 39.332  5.056   5.811   1.00 50.64  ? 171 HIS H N   1 
ATOM   1222 C CA  . HIS A 1 171 ? 38.527  3.843   5.881   1.00 52.14  ? 171 HIS H CA  1 
ATOM   1223 C C   . HIS A 1 171 ? 39.328  2.680   6.455   1.00 52.62  ? 171 HIS H C   1 
ATOM   1224 O O   . HIS A 1 171 ? 40.232  2.155   5.804   1.00 43.82  ? 171 HIS H O   1 
ATOM   1225 C CB  . HIS A 1 171 ? 37.987  3.472   4.498   1.00 46.05  ? 171 HIS H CB  1 
ATOM   1226 C CG  . HIS A 1 171 ? 36.963  4.428   3.971   1.00 52.56  ? 171 HIS H CG  1 
ATOM   1227 N ND1 . HIS A 1 171 ? 35.706  4.552   4.524   1.00 51.95  ? 171 HIS H ND1 1 
ATOM   1228 C CD2 . HIS A 1 171 ? 37.007  5.302   2.938   1.00 48.92  ? 171 HIS H CD2 1 
ATOM   1229 C CE1 . HIS A 1 171 ? 35.022  5.463   3.857   1.00 56.56  ? 171 HIS H CE1 1 
ATOM   1230 N NE2 . HIS A 1 171 ? 35.788  5.934   2.889   1.00 57.89  ? 171 HIS H NE2 1 
ATOM   1231 N N   . THR A 1 172 ? 38.996  2.285   7.679   1.00 57.17  ? 172 THR H N   1 
ATOM   1232 C CA  . THR A 1 172 ? 39.609  1.116   8.298   1.00 56.36  ? 172 THR H CA  1 
ATOM   1233 C C   . THR A 1 172 ? 38.651  -0.066  8.218   1.00 57.69  ? 172 THR H C   1 
ATOM   1234 O O   . THR A 1 172 ? 37.669  -0.138  8.957   1.00 60.61  ? 172 THR H O   1 
ATOM   1235 C CB  . THR A 1 172 ? 39.995  1.381   9.762   1.00 55.71  ? 172 THR H CB  1 
ATOM   1236 O OG1 . THR A 1 172 ? 40.947  2.451   9.818   1.00 53.36  ? 172 THR H OG1 1 
ATOM   1237 C CG2 . THR A 1 172 ? 40.606  0.136   10.384  1.00 51.10  ? 172 THR H CG2 1 
ATOM   1238 N N   . PHE A 1 173 ? 38.945  -0.988  7.308   1.00 57.24  ? 173 PHE H N   1 
ATOM   1239 C CA  . PHE A 1 173 ? 38.053  -2.104  7.017   1.00 54.23  ? 173 PHE H CA  1 
ATOM   1240 C C   . PHE A 1 173 ? 38.034  -3.143  8.131   1.00 50.77  ? 173 PHE H C   1 
ATOM   1241 O O   . PHE A 1 173 ? 39.028  -3.320  8.837   1.00 51.35  ? 173 PHE H O   1 
ATOM   1242 C CB  . PHE A 1 173 ? 38.457  -2.763  5.696   1.00 49.46  ? 173 PHE H CB  1 
ATOM   1243 C CG  . PHE A 1 173 ? 38.292  -1.870  4.501   1.00 48.67  ? 173 PHE H CG  1 
ATOM   1244 C CD1 . PHE A 1 173 ? 39.308  -1.011  4.115   1.00 49.03  ? 173 PHE H CD1 1 
ATOM   1245 C CD2 . PHE A 1 173 ? 37.119  -1.887  3.767   1.00 48.67  ? 173 PHE H CD2 1 
ATOM   1246 C CE1 . PHE A 1 173 ? 39.156  -0.187  3.017   1.00 51.06  ? 173 PHE H CE1 1 
ATOM   1247 C CE2 . PHE A 1 173 ? 36.962  -1.063  2.669   1.00 44.97  ? 173 PHE H CE2 1 
ATOM   1248 C CZ  . PHE A 1 173 ? 37.981  -0.213  2.294   1.00 47.96  ? 173 PHE H CZ  1 
ATOM   1249 N N   . PRO A 1 174 ? 36.890  -3.826  8.300   1.00 48.25  ? 174 PRO H N   1 
ATOM   1250 C CA  . PRO A 1 174 ? 36.784  -4.946  9.239   1.00 43.54  ? 174 PRO H CA  1 
ATOM   1251 C C   . PRO A 1 174 ? 37.797  -6.037  8.917   1.00 51.83  ? 174 PRO H C   1 
ATOM   1252 O O   . PRO A 1 174 ? 38.010  -6.344  7.745   1.00 43.56  ? 174 PRO H O   1 
ATOM   1253 C CB  . PRO A 1 174 ? 35.353  -5.448  9.029   1.00 39.24  ? 174 PRO H CB  1 
ATOM   1254 C CG  . PRO A 1 174 ? 34.612  -4.260  8.521   1.00 45.69  ? 174 PRO H CG  1 
ATOM   1255 C CD  . PRO A 1 174 ? 35.595  -3.509  7.672   1.00 40.88  ? 174 PRO H CD  1 
ATOM   1256 N N   . ALA A 1 175 ? 38.415  -6.607  9.945   1.00 52.57  ? 175 ALA H N   1 
ATOM   1257 C CA  . ALA A 1 175 ? 39.433  -7.632  9.751   1.00 60.59  ? 175 ALA H CA  1 
ATOM   1258 C C   . ALA A 1 175 ? 38.834  -8.921  9.200   1.00 62.29  ? 175 ALA H C   1 
ATOM   1259 O O   . ALA A 1 175 ? 37.655  -9.209  9.408   1.00 54.96  ? 175 ALA H O   1 
ATOM   1260 C CB  . ALA A 1 175 ? 40.160  -7.906  11.057  1.00 60.40  ? 175 ALA H CB  1 
ATOM   1261 N N   . VAL A 1 176 ? 39.653  -9.692  8.492   1.00 53.41  ? 176 VAL H N   1 
ATOM   1262 C CA  . VAL A 1 176 ? 39.231  -10.991 7.988   1.00 51.91  ? 176 VAL H CA  1 
ATOM   1263 C C   . VAL A 1 176 ? 40.088  -12.102 8.588   1.00 54.60  ? 176 VAL H C   1 
ATOM   1264 O O   . VAL A 1 176 ? 41.300  -11.952 8.740   1.00 58.00  ? 176 VAL H O   1 
ATOM   1265 C CB  . VAL A 1 176 ? 39.302  -11.059 6.446   1.00 42.56  ? 176 VAL H CB  1 
ATOM   1266 C CG1 . VAL A 1 176 ? 38.197  -10.216 5.827   1.00 46.25  ? 176 VAL H CG1 1 
ATOM   1267 C CG2 . VAL A 1 176 ? 40.669  -10.610 5.948   1.00 53.98  ? 176 VAL H CG2 1 
ATOM   1268 N N   . LEU A 1 177 ? 39.448  -13.211 8.941   1.00 52.09  ? 177 LEU H N   1 
ATOM   1269 C CA  . LEU A 1 177 ? 40.160  -14.353 9.498   1.00 51.38  ? 177 LEU H CA  1 
ATOM   1270 C C   . LEU A 1 177 ? 40.745  -15.216 8.386   1.00 66.18  ? 177 LEU H C   1 
ATOM   1271 O O   . LEU A 1 177 ? 40.010  -15.822 7.606   1.00 73.40  ? 177 LEU H O   1 
ATOM   1272 C CB  . LEU A 1 177 ? 39.234  -15.186 10.385  1.00 46.67  ? 177 LEU H CB  1 
ATOM   1273 C CG  . LEU A 1 177 ? 39.908  -16.302 11.186  1.00 63.92  ? 177 LEU H CG  1 
ATOM   1274 C CD1 . LEU A 1 177 ? 40.974  -15.729 12.106  1.00 65.72  ? 177 LEU H CD1 1 
ATOM   1275 C CD2 . LEU A 1 177 ? 38.880  -17.094 11.979  1.00 62.10  ? 177 LEU H CD2 1 
ATOM   1276 N N   . GLN A 1 178 ? 42.071  -15.266 8.318   1.00 60.48  ? 178 GLN H N   1 
ATOM   1277 C CA  . GLN A 1 178 ? 42.754  -16.035 7.285   1.00 55.54  ? 178 GLN H CA  1 
ATOM   1278 C C   . GLN A 1 178 ? 42.793  -17.519 7.631   1.00 61.55  ? 178 GLN H C   1 
ATOM   1279 O O   . GLN A 1 178 ? 42.282  -17.938 8.670   1.00 55.11  ? 178 GLN H O   1 
ATOM   1280 C CB  . GLN A 1 178 ? 44.173  -15.502 7.076   1.00 63.48  ? 178 GLN H CB  1 
ATOM   1281 C CG  . GLN A 1 178 ? 44.224  -14.074 6.557   1.00 72.39  ? 178 GLN H CG  1 
ATOM   1282 C CD  . GLN A 1 178 ? 45.640  -13.548 6.437   1.00 92.85  ? 178 GLN H CD  1 
ATOM   1283 O OE1 . GLN A 1 178 ? 45.919  -12.661 5.630   1.00 98.31  ? 178 GLN H OE1 1 
ATOM   1284 N NE2 . GLN A 1 178 ? 46.545  -14.092 7.242   1.00 100.62 ? 178 GLN H NE2 1 
ATOM   1285 N N   . SER A 1 179 ? 43.403  -18.309 6.754   1.00 70.69  ? 179 SER H N   1 
ATOM   1286 C CA  . SER A 1 179 ? 43.474  -19.754 6.939   1.00 71.40  ? 179 SER H CA  1 
ATOM   1287 C C   . SER A 1 179 ? 44.444  -20.137 8.053   1.00 69.19  ? 179 SER H C   1 
ATOM   1288 O O   . SER A 1 179 ? 44.378  -21.242 8.591   1.00 78.71  ? 179 SER H O   1 
ATOM   1289 C CB  . SER A 1 179 ? 43.886  -20.437 5.633   1.00 76.12  ? 179 SER H CB  1 
ATOM   1290 O OG  . SER A 1 179 ? 45.112  -19.914 5.151   1.00 79.49  ? 179 SER H OG  1 
ATOM   1291 N N   . SER A 1 180 ? 45.342  -19.219 8.395   1.00 66.52  ? 180 SER H N   1 
ATOM   1292 C CA  . SER A 1 180 ? 46.339  -19.473 9.428   1.00 71.28  ? 180 SER H CA  1 
ATOM   1293 C C   . SER A 1 180 ? 45.774  -19.235 10.825  1.00 66.49  ? 180 SER H C   1 
ATOM   1294 O O   . SER A 1 180 ? 46.441  -19.497 11.826  1.00 70.79  ? 180 SER H O   1 
ATOM   1295 C CB  . SER A 1 180 ? 47.571  -18.593 9.209   1.00 74.09  ? 180 SER H CB  1 
ATOM   1296 O OG  . SER A 1 180 ? 47.238  -17.219 9.303   1.00 75.43  ? 180 SER H OG  1 
ATOM   1297 N N   . GLY A 1 181 ? 44.543  -18.740 10.885  1.00 57.15  ? 181 GLY H N   1 
ATOM   1298 C CA  . GLY A 1 181 ? 43.913  -18.420 12.152  1.00 56.98  ? 181 GLY H CA  1 
ATOM   1299 C C   . GLY A 1 181 ? 44.269  -17.015 12.597  1.00 67.15  ? 181 GLY H C   1 
ATOM   1300 O O   . GLY A 1 181 ? 43.873  -16.572 13.676  1.00 76.49  ? 181 GLY H O   1 
ATOM   1301 N N   . LEU A 1 182 ? 45.020  -16.314 11.755  1.00 68.78  ? 182 LEU H N   1 
ATOM   1302 C CA  . LEU A 1 182 ? 45.455  -14.954 12.051  1.00 64.21  ? 182 LEU H CA  1 
ATOM   1303 C C   . LEU A 1 182 ? 44.602  -13.940 11.297  1.00 62.12  ? 182 LEU H C   1 
ATOM   1304 O O   . LEU A 1 182 ? 44.093  -14.228 10.214  1.00 56.43  ? 182 LEU H O   1 
ATOM   1305 C CB  . LEU A 1 182 ? 46.934  -14.772 11.696  1.00 63.43  ? 182 LEU H CB  1 
ATOM   1306 C CG  . LEU A 1 182 ? 47.992  -15.107 12.755  1.00 69.34  ? 182 LEU H CG  1 
ATOM   1307 C CD1 . LEU A 1 182 ? 47.740  -16.455 13.415  1.00 65.55  ? 182 LEU H CD1 1 
ATOM   1308 C CD2 . LEU A 1 182 ? 49.381  -15.072 12.136  1.00 62.21  ? 182 LEU H CD2 1 
ATOM   1309 N N   . TYR A 1 183 ? 44.449  -12.753 11.874  1.00 63.81  ? 183 TYR H N   1 
ATOM   1310 C CA  . TYR A 1 183 ? 43.624  -11.714 11.271  1.00 50.57  ? 183 TYR H CA  1 
ATOM   1311 C C   . TYR A 1 183 ? 44.432  -10.805 10.353  1.00 58.53  ? 183 TYR H C   1 
ATOM   1312 O O   . TYR A 1 183 ? 45.637  -10.630 10.535  1.00 59.07  ? 183 TYR H O   1 
ATOM   1313 C CB  . TYR A 1 183 ? 42.939  -10.878 12.356  1.00 47.33  ? 183 TYR H CB  1 
ATOM   1314 C CG  . TYR A 1 183 ? 41.922  -11.645 13.170  1.00 53.25  ? 183 TYR H CG  1 
ATOM   1315 C CD1 . TYR A 1 183 ? 40.607  -11.763 12.739  1.00 50.89  ? 183 TYR H CD1 1 
ATOM   1316 C CD2 . TYR A 1 183 ? 42.276  -12.251 14.368  1.00 45.26  ? 183 TYR H CD2 1 
ATOM   1317 C CE1 . TYR A 1 183 ? 39.672  -12.462 13.480  1.00 57.67  ? 183 TYR H CE1 1 
ATOM   1318 C CE2 . TYR A 1 183 ? 41.348  -12.953 15.116  1.00 51.56  ? 183 TYR H CE2 1 
ATOM   1319 C CZ  . TYR A 1 183 ? 40.048  -13.055 14.666  1.00 52.82  ? 183 TYR H CZ  1 
ATOM   1320 O OH  . TYR A 1 183 ? 39.122  -13.753 15.406  1.00 63.60  ? 183 TYR H OH  1 
ATOM   1321 N N   . SER A 1 184 ? 43.755  -10.232 9.363   1.00 51.02  ? 184 SER H N   1 
ATOM   1322 C CA  . SER A 1 184 ? 44.373  -9.282  8.448   1.00 57.54  ? 184 SER H CA  1 
ATOM   1323 C C   . SER A 1 184 ? 43.453  -8.084  8.247   1.00 60.77  ? 184 SER H C   1 
ATOM   1324 O O   . SER A 1 184 ? 42.248  -8.244  8.052   1.00 54.48  ? 184 SER H O   1 
ATOM   1325 C CB  . SER A 1 184 ? 44.690  -9.945  7.107   1.00 63.64  ? 184 SER H CB  1 
ATOM   1326 O OG  . SER A 1 184 ? 45.306  -9.028  6.218   1.00 78.34  ? 184 SER H OG  1 
ATOM   1327 N N   . LEU A 1 185 ? 44.022  -6.885  8.297   1.00 64.99  ? 185 LEU H N   1 
ATOM   1328 C CA  . LEU A 1 185 ? 43.231  -5.666  8.205   1.00 53.84  ? 185 LEU H CA  1 
ATOM   1329 C C   . LEU A 1 185 ? 43.855  -4.660  7.242   1.00 55.98  ? 185 LEU H C   1 
ATOM   1330 O O   . LEU A 1 185 ? 45.077  -4.579  7.114   1.00 48.63  ? 185 LEU H O   1 
ATOM   1331 C CB  . LEU A 1 185 ? 43.063  -5.043  9.596   1.00 54.26  ? 185 LEU H CB  1 
ATOM   1332 C CG  . LEU A 1 185 ? 42.208  -3.783  9.758   1.00 66.85  ? 185 LEU H CG  1 
ATOM   1333 C CD1 . LEU A 1 185 ? 41.465  -3.822  11.083  1.00 68.40  ? 185 LEU H CD1 1 
ATOM   1334 C CD2 . LEU A 1 185 ? 43.064  -2.526  9.677   1.00 68.23  ? 185 LEU H CD2 1 
ATOM   1335 N N   . SER A 1 186 ? 43.003  -3.896  6.567   1.00 49.08  ? 186 SER H N   1 
ATOM   1336 C CA  . SER A 1 186 ? 43.459  -2.833  5.684   1.00 52.33  ? 186 SER H CA  1 
ATOM   1337 C C   . SER A 1 186 ? 42.892  -1.489  6.126   1.00 51.18  ? 186 SER H C   1 
ATOM   1338 O O   . SER A 1 186 ? 41.726  -1.391  6.509   1.00 43.69  ? 186 SER H O   1 
ATOM   1339 C CB  . SER A 1 186 ? 43.060  -3.123  4.236   1.00 56.34  ? 186 SER H CB  1 
ATOM   1340 O OG  . SER A 1 186 ? 43.548  -4.384  3.815   1.00 73.76  ? 186 SER H OG  1 
ATOM   1341 N N   . SER A 1 187 ? 43.727  -0.458  6.079   1.00 46.33  ? 187 SER H N   1 
ATOM   1342 C CA  . SER A 1 187 ? 43.292  0.897   6.390   1.00 44.70  ? 187 SER H CA  1 
ATOM   1343 C C   . SER A 1 187 ? 43.753  1.847   5.296   1.00 45.74  ? 187 SER H C   1 
ATOM   1344 O O   . SER A 1 187 ? 44.946  1.954   5.024   1.00 51.49  ? 187 SER H O   1 
ATOM   1345 C CB  . SER A 1 187 ? 43.832  1.345   7.748   1.00 47.35  ? 187 SER H CB  1 
ATOM   1346 O OG  . SER A 1 187 ? 43.468  2.688   8.021   1.00 45.63  ? 187 SER H OG  1 
ATOM   1347 N N   . VAL A 1 188 ? 42.805  2.529   4.664   1.00 44.22  ? 188 VAL H N   1 
ATOM   1348 C CA  . VAL A 1 188 ? 43.122  3.411   3.547   1.00 53.89  ? 188 VAL H CA  1 
ATOM   1349 C C   . VAL A 1 188 ? 42.604  4.827   3.772   1.00 52.09  ? 188 VAL H C   1 
ATOM   1350 O O   . VAL A 1 188 ? 41.769  5.064   4.645   1.00 49.45  ? 188 VAL H O   1 
ATOM   1351 C CB  . VAL A 1 188 ? 42.539  2.873   2.227   1.00 44.17  ? 188 VAL H CB  1 
ATOM   1352 C CG1 . VAL A 1 188 ? 43.106  1.496   1.918   1.00 49.27  ? 188 VAL H CG1 1 
ATOM   1353 C CG2 . VAL A 1 188 ? 41.022  2.829   2.298   1.00 44.79  ? 188 VAL H CG2 1 
ATOM   1354 N N   . VAL A 1 189 ? 43.106  5.763   2.973   1.00 51.35  ? 189 VAL H N   1 
ATOM   1355 C CA  . VAL A 1 189 ? 42.678  7.153   3.051   1.00 56.34  ? 189 VAL H CA  1 
ATOM   1356 C C   . VAL A 1 189 ? 42.875  7.851   1.706   1.00 59.53  ? 189 VAL H C   1 
ATOM   1357 O O   . VAL A 1 189 ? 43.929  7.731   1.080   1.00 56.49  ? 189 VAL H O   1 
ATOM   1358 C CB  . VAL A 1 189 ? 43.439  7.917   4.160   1.00 56.76  ? 189 VAL H CB  1 
ATOM   1359 C CG1 . VAL A 1 189 ? 44.937  7.661   4.062   1.00 61.23  ? 189 VAL H CG1 1 
ATOM   1360 C CG2 . VAL A 1 189 ? 43.132  9.408   4.103   1.00 54.62  ? 189 VAL H CG2 1 
ATOM   1361 N N   . THR A 1 190 ? 41.848  8.565   1.255   1.00 61.10  ? 190 THR H N   1 
ATOM   1362 C CA  . THR A 1 190 ? 41.928  9.300   -0.002  1.00 64.42  ? 190 THR H CA  1 
ATOM   1363 C C   . THR A 1 190 ? 42.403  10.729  0.229   1.00 69.48  ? 190 THR H C   1 
ATOM   1364 O O   . THR A 1 190 ? 41.800  11.480  0.996   1.00 67.28  ? 190 THR H O   1 
ATOM   1365 C CB  . THR A 1 190 ? 40.574  9.328   -0.732  1.00 62.29  ? 190 THR H CB  1 
ATOM   1366 O OG1 . THR A 1 190 ? 39.536  9.666   0.196   1.00 66.88  ? 190 THR H OG1 1 
ATOM   1367 C CG2 . THR A 1 190 ? 40.276  7.969   -1.346  1.00 52.03  ? 190 THR H CG2 1 
ATOM   1368 N N   . VAL A 1 191 ? 43.491  11.093  -0.440  1.00 69.43  ? 191 VAL H N   1 
ATOM   1369 C CA  . VAL A 1 191 ? 44.077  12.420  -0.307  1.00 78.48  ? 191 VAL H CA  1 
ATOM   1370 C C   . VAL A 1 191 ? 44.293  13.043  -1.683  1.00 76.53  ? 191 VAL H C   1 
ATOM   1371 O O   . VAL A 1 191 ? 44.414  12.324  -2.676  1.00 85.00  ? 191 VAL H O   1 
ATOM   1372 C CB  . VAL A 1 191 ? 45.420  12.367  0.454   1.00 83.21  ? 191 VAL H CB  1 
ATOM   1373 C CG1 . VAL A 1 191 ? 45.198  11.927  1.893   1.00 77.52  ? 191 VAL H CG1 1 
ATOM   1374 C CG2 . VAL A 1 191 ? 46.395  11.436  -0.252  1.00 81.14  ? 191 VAL H CG2 1 
ATOM   1375 N N   . PRO A 1 192 ? 44.321  14.385  -1.751  1.00 69.02  ? 192 PRO H N   1 
ATOM   1376 C CA  . PRO A 1 192 ? 44.617  15.070  -3.015  1.00 65.26  ? 192 PRO H CA  1 
ATOM   1377 C C   . PRO A 1 192 ? 45.950  14.621  -3.608  1.00 74.32  ? 192 PRO H C   1 
ATOM   1378 O O   . PRO A 1 192 ? 46.948  14.546  -2.891  1.00 78.84  ? 192 PRO H O   1 
ATOM   1379 C CB  . PRO A 1 192 ? 44.666  16.544  -2.610  1.00 60.32  ? 192 PRO H CB  1 
ATOM   1380 C CG  . PRO A 1 192 ? 43.769  16.629  -1.428  1.00 69.33  ? 192 PRO H CG  1 
ATOM   1381 C CD  . PRO A 1 192 ? 43.951  15.335  -0.686  1.00 64.80  ? 192 PRO H CD  1 
ATOM   1382 N N   . SER A 1 193 ? 45.954  14.324  -4.903  1.00 72.47  ? 193 SER H N   1 
ATOM   1383 C CA  . SER A 1 193 ? 47.142  13.816  -5.580  1.00 74.39  ? 193 SER H CA  1 
ATOM   1384 C C   . SER A 1 193 ? 48.293  14.819  -5.562  1.00 70.35  ? 193 SER H C   1 
ATOM   1385 O O   . SER A 1 193 ? 49.460  14.438  -5.651  1.00 76.44  ? 193 SER H O   1 
ATOM   1386 C CB  . SER A 1 193 ? 46.805  13.437  -7.024  1.00 74.01  ? 193 SER H CB  1 
ATOM   1387 O OG  . SER A 1 193 ? 46.360  14.566  -7.757  1.00 78.98  ? 193 SER H OG  1 
ATOM   1388 N N   . SER A 1 194 ? 47.958  16.099  -5.442  1.00 63.44  ? 194 SER H N   1 
ATOM   1389 C CA  . SER A 1 194 ? 48.961  17.157  -5.438  1.00 73.04  ? 194 SER H CA  1 
ATOM   1390 C C   . SER A 1 194 ? 49.666  17.274  -4.089  1.00 73.64  ? 194 SER H C   1 
ATOM   1391 O O   . SER A 1 194 ? 50.619  18.039  -3.943  1.00 82.83  ? 194 SER H O   1 
ATOM   1392 C CB  . SER A 1 194 ? 48.320  18.496  -5.810  1.00 76.41  ? 194 SER H CB  1 
ATOM   1393 O OG  . SER A 1 194 ? 47.241  18.803  -4.944  1.00 73.96  ? 194 SER H OG  1 
ATOM   1394 N N   . SER A 1 195 ? 49.197  16.511  -3.106  1.00 78.66  ? 195 SER H N   1 
ATOM   1395 C CA  . SER A 1 195 ? 49.773  16.555  -1.766  1.00 81.61  ? 195 SER H CA  1 
ATOM   1396 C C   . SER A 1 195 ? 50.716  15.382  -1.515  1.00 94.21  ? 195 SER H C   1 
ATOM   1397 O O   . SER A 1 195 ? 51.296  15.262  -0.437  1.00 104.39 ? 195 SER H O   1 
ATOM   1398 C CB  . SER A 1 195 ? 48.667  16.568  -0.708  1.00 70.98  ? 195 SER H CB  1 
ATOM   1399 O OG  . SER A 1 195 ? 47.953  15.344  -0.701  1.00 65.59  ? 195 SER H OG  1 
ATOM   1400 N N   . LEU A 1 196 ? 50.868  14.521  -2.517  1.00 95.53  ? 196 LEU H N   1 
ATOM   1401 C CA  . LEU A 1 196 ? 51.705  13.333  -2.386  1.00 94.05  ? 196 LEU H CA  1 
ATOM   1402 C C   . LEU A 1 196 ? 53.192  13.674  -2.384  1.00 93.34  ? 196 LEU H C   1 
ATOM   1403 O O   . LEU A 1 196 ? 54.024  12.850  -2.007  1.00 96.57  ? 196 LEU H O   1 
ATOM   1404 C CB  . LEU A 1 196 ? 51.405  12.342  -3.513  1.00 84.93  ? 196 LEU H CB  1 
ATOM   1405 C CG  . LEU A 1 196 ? 49.996  11.746  -3.550  1.00 77.28  ? 196 LEU H CG  1 
ATOM   1406 C CD1 . LEU A 1 196 ? 49.867  10.756  -4.697  1.00 73.33  ? 196 LEU H CD1 1 
ATOM   1407 C CD2 . LEU A 1 196 ? 49.657  11.081  -2.225  1.00 73.05  ? 196 LEU H CD2 1 
ATOM   1408 N N   . GLY A 1 197 ? 53.522  14.891  -2.803  1.00 89.78  ? 197 GLY H N   1 
ATOM   1409 C CA  . GLY A 1 197 ? 54.908  15.307  -2.904  1.00 95.88  ? 197 GLY H CA  1 
ATOM   1410 C C   . GLY A 1 197 ? 55.423  16.054  -1.689  1.00 100.35 ? 197 GLY H C   1 
ATOM   1411 O O   . GLY A 1 197 ? 56.631  16.123  -1.463  1.00 104.30 ? 197 GLY H O   1 
ATOM   1412 N N   . THR A 1 198 ? 54.510  16.614  -0.902  1.00 95.42  ? 198 THR H N   1 
ATOM   1413 C CA  . THR A 1 198 ? 54.895  17.419  0.253   1.00 95.41  ? 198 THR H CA  1 
ATOM   1414 C C   . THR A 1 198 ? 54.396  16.828  1.569   1.00 102.15 ? 198 THR H C   1 
ATOM   1415 O O   . THR A 1 198 ? 55.174  16.623  2.500   1.00 105.83 ? 198 THR H O   1 
ATOM   1416 C CB  . THR A 1 198 ? 54.371  18.862  0.128   1.00 89.37  ? 198 THR H CB  1 
ATOM   1417 N N   . GLN A 1 199 ? 53.096  16.560  1.640   1.00 99.56  ? 199 GLN H N   1 
ATOM   1418 C CA  . GLN A 1 199 ? 52.480  16.067  2.869   1.00 94.93  ? 199 GLN H CA  1 
ATOM   1419 C C   . GLN A 1 199 ? 52.954  14.660  3.223   1.00 86.75  ? 199 GLN H C   1 
ATOM   1420 O O   . GLN A 1 199 ? 53.021  13.781  2.364   1.00 79.37  ? 199 GLN H O   1 
ATOM   1421 C CB  . GLN A 1 199 ? 50.954  16.088  2.744   1.00 91.73  ? 199 GLN H CB  1 
ATOM   1422 C CG  . GLN A 1 199 ? 50.222  15.703  4.020   1.00 94.93  ? 199 GLN H CG  1 
ATOM   1423 C CD  . GLN A 1 199 ? 50.495  16.661  5.163   1.00 99.79  ? 199 GLN H CD  1 
ATOM   1424 O OE1 . GLN A 1 199 ? 50.632  17.867  4.958   1.00 105.68 ? 199 GLN H OE1 1 
ATOM   1425 N NE2 . GLN A 1 199 ? 50.577  16.127  6.376   1.00 97.13  ? 199 GLN H NE2 1 
ATOM   1426 N N   . THR A 1 200 ? 53.281  14.458  4.495   1.00 84.04  ? 200 THR H N   1 
ATOM   1427 C CA  . THR A 1 200 ? 53.729  13.158  4.981   1.00 80.42  ? 200 THR H CA  1 
ATOM   1428 C C   . THR A 1 200 ? 52.585  12.406  5.654   1.00 75.11  ? 200 THR H C   1 
ATOM   1429 O O   . THR A 1 200 ? 51.913  12.943  6.534   1.00 74.86  ? 200 THR H O   1 
ATOM   1430 C CB  . THR A 1 200 ? 54.898  13.297  5.976   1.00 81.19  ? 200 THR H CB  1 
ATOM   1431 O OG1 . THR A 1 200 ? 55.962  14.041  5.370   1.00 80.70  ? 200 THR H OG1 1 
ATOM   1432 C CG2 . THR A 1 200 ? 55.413  11.927  6.392   1.00 80.58  ? 200 THR H CG2 1 
ATOM   1433 N N   . TYR A 1 201 ? 52.369  11.164  5.235   1.00 63.67  ? 201 TYR H N   1 
ATOM   1434 C CA  . TYR A 1 201 ? 51.299  10.347  5.795   1.00 62.51  ? 201 TYR H CA  1 
ATOM   1435 C C   . TYR A 1 201 ? 51.855  9.159   6.572   1.00 69.38  ? 201 TYR H C   1 
ATOM   1436 O O   . TYR A 1 201 ? 52.563  8.318   6.017   1.00 60.86  ? 201 TYR H O   1 
ATOM   1437 C CB  . TYR A 1 201 ? 50.363  9.863   4.687   1.00 61.47  ? 201 TYR H CB  1 
ATOM   1438 C CG  . TYR A 1 201 ? 49.757  10.986  3.878   1.00 58.63  ? 201 TYR H CG  1 
ATOM   1439 C CD1 . TYR A 1 201 ? 48.712  11.747  4.384   1.00 52.34  ? 201 TYR H CD1 1 
ATOM   1440 C CD2 . TYR A 1 201 ? 50.233  11.288  2.608   1.00 57.89  ? 201 TYR H CD2 1 
ATOM   1441 C CE1 . TYR A 1 201 ? 48.156  12.776  3.649   1.00 67.83  ? 201 TYR H CE1 1 
ATOM   1442 C CE2 . TYR A 1 201 ? 49.683  12.315  1.865   1.00 61.86  ? 201 TYR H CE2 1 
ATOM   1443 C CZ  . TYR A 1 201 ? 48.645  13.055  2.389   1.00 67.14  ? 201 TYR H CZ  1 
ATOM   1444 O OH  . TYR A 1 201 ? 48.094  14.079  1.653   1.00 69.37  ? 201 TYR H OH  1 
ATOM   1445 N N   . ILE A 1 202 ? 51.528  9.098   7.860   1.00 66.47  ? 202 ILE H N   1 
ATOM   1446 C CA  . ILE A 1 202 ? 52.026  8.042   8.734   1.00 67.64  ? 202 ILE H CA  1 
ATOM   1447 C C   . ILE A 1 202 ? 50.895  7.143   9.225   1.00 64.38  ? 202 ILE H C   1 
ATOM   1448 O O   . ILE A 1 202 ? 49.853  7.625   9.671   1.00 63.94  ? 202 ILE H O   1 
ATOM   1449 C CB  . ILE A 1 202 ? 52.771  8.628   9.952   1.00 68.19  ? 202 ILE H CB  1 
ATOM   1450 C CG1 . ILE A 1 202 ? 53.864  9.596   9.494   1.00 76.45  ? 202 ILE H CG1 1 
ATOM   1451 C CG2 . ILE A 1 202 ? 53.362  7.517   10.808  1.00 64.54  ? 202 ILE H CG2 1 
ATOM   1452 N N   . CYS A 1 203 ? 51.107  5.834   9.139   1.00 57.03  ? 203 CYS H N   1 
ATOM   1453 C CA  . CYS A 1 203 ? 50.126  4.862   9.604   1.00 55.45  ? 203 CYS H CA  1 
ATOM   1454 C C   . CYS A 1 203 ? 50.434  4.421   11.033  1.00 61.61  ? 203 CYS H C   1 
ATOM   1455 O O   . CYS A 1 203 ? 51.399  3.695   11.273  1.00 66.01  ? 203 CYS H O   1 
ATOM   1456 C CB  . CYS A 1 203 ? 50.092  3.649   8.672   1.00 45.16  ? 203 CYS H CB  1 
ATOM   1457 S SG  . CYS A 1 203 ? 48.853  2.406   9.098   1.00 112.48 ? 203 CYS H SG  1 
ATOM   1458 N N   . ASN A 1 204 ? 49.612  4.865   11.978  1.00 61.00  ? 204 ASN H N   1 
ATOM   1459 C CA  . ASN A 1 204 ? 49.800  4.512   13.381  1.00 57.52  ? 204 ASN H CA  1 
ATOM   1460 C C   . ASN A 1 204 ? 49.014  3.262   13.761  1.00 52.92  ? 204 ASN H C   1 
ATOM   1461 O O   . ASN A 1 204 ? 47.796  3.312   13.934  1.00 54.41  ? 204 ASN H O   1 
ATOM   1462 C CB  . ASN A 1 204 ? 49.392  5.677   14.284  1.00 62.78  ? 204 ASN H CB  1 
ATOM   1463 C CG  . ASN A 1 204 ? 50.065  6.979   13.897  1.00 66.12  ? 204 ASN H CG  1 
ATOM   1464 O OD1 . ASN A 1 204 ? 49.398  7.960   13.564  1.00 65.71  ? 204 ASN H OD1 1 
ATOM   1465 N ND2 . ASN A 1 204 ? 51.392  6.997   13.939  1.00 65.65  ? 204 ASN H ND2 1 
ATOM   1466 N N   . VAL A 1 205 ? 49.717  2.141   13.888  1.00 51.49  ? 205 VAL H N   1 
ATOM   1467 C CA  . VAL A 1 205 ? 49.083  0.871   14.223  1.00 50.10  ? 205 VAL H CA  1 
ATOM   1468 C C   . VAL A 1 205 ? 49.372  0.471   15.665  1.00 62.58  ? 205 VAL H C   1 
ATOM   1469 O O   . VAL A 1 205 ? 50.529  0.383   16.075  1.00 70.37  ? 205 VAL H O   1 
ATOM   1470 C CB  . VAL A 1 205 ? 49.550  -0.255  13.283  1.00 54.54  ? 205 VAL H CB  1 
ATOM   1471 C CG1 . VAL A 1 205 ? 48.988  -1.595  13.732  1.00 51.12  ? 205 VAL H CG1 1 
ATOM   1472 C CG2 . VAL A 1 205 ? 49.136  0.049   11.853  1.00 58.60  ? 205 VAL H CG2 1 
ATOM   1473 N N   . ASN A 1 206 ? 48.313  0.232   16.432  1.00 55.51  ? 206 ASN H N   1 
ATOM   1474 C CA  . ASN A 1 206 ? 48.458  -0.157  17.828  1.00 63.10  ? 206 ASN H CA  1 
ATOM   1475 C C   . ASN A 1 206 ? 47.750  -1.474  18.129  1.00 60.70  ? 206 ASN H C   1 
ATOM   1476 O O   . ASN A 1 206 ? 46.545  -1.606  17.919  1.00 63.96  ? 206 ASN H O   1 
ATOM   1477 C CB  . ASN A 1 206 ? 47.926  0.946   18.745  1.00 62.80  ? 206 ASN H CB  1 
ATOM   1478 C CG  . ASN A 1 206 ? 48.273  0.711   20.202  1.00 84.82  ? 206 ASN H CG  1 
ATOM   1479 O OD1 . ASN A 1 206 ? 49.220  -0.008  20.518  1.00 96.64  ? 206 ASN H OD1 1 
ATOM   1480 N ND2 . ASN A 1 206 ? 47.505  1.320   21.098  1.00 95.55  ? 206 ASN H ND2 1 
ATOM   1481 N N   . HIS A 1 207 ? 48.511  -2.448  18.619  1.00 62.49  ? 207 HIS H N   1 
ATOM   1482 C CA  . HIS A 1 207 ? 47.958  -3.745  18.987  1.00 53.76  ? 207 HIS H CA  1 
ATOM   1483 C C   . HIS A 1 207 ? 48.164  -4.002  20.476  1.00 61.50  ? 207 HIS H C   1 
ATOM   1484 O O   . HIS A 1 207 ? 49.204  -4.514  20.892  1.00 62.30  ? 207 HIS H O   1 
ATOM   1485 C CB  . HIS A 1 207 ? 48.597  -4.859  18.155  1.00 54.32  ? 207 HIS H CB  1 
ATOM   1486 C CG  . HIS A 1 207 ? 47.900  -6.179  18.273  1.00 59.91  ? 207 HIS H CG  1 
ATOM   1487 N ND1 . HIS A 1 207 ? 48.521  -7.306  18.767  1.00 57.90  ? 207 HIS H ND1 1 
ATOM   1488 C CD2 . HIS A 1 207 ? 46.637  -6.553  17.958  1.00 59.92  ? 207 HIS H CD2 1 
ATOM   1489 C CE1 . HIS A 1 207 ? 47.670  -8.317  18.752  1.00 63.03  ? 207 HIS H CE1 1 
ATOM   1490 N NE2 . HIS A 1 207 ? 46.520  -7.886  18.266  1.00 63.34  ? 207 HIS H NE2 1 
ATOM   1491 N N   . LYS A 1 208 ? 47.163  -3.637  21.270  1.00 61.70  ? 208 LYS H N   1 
ATOM   1492 C CA  . LYS A 1 208 ? 47.230  -3.748  22.727  1.00 56.79  ? 208 LYS H CA  1 
ATOM   1493 C C   . LYS A 1 208 ? 47.471  -5.165  23.282  1.00 75.01  ? 208 LYS H C   1 
ATOM   1494 O O   . LYS A 1 208 ? 48.240  -5.315  24.232  1.00 71.41  ? 208 LYS H O   1 
ATOM   1495 C CB  . LYS A 1 208 ? 45.950  -3.175  23.347  1.00 69.43  ? 208 LYS H CB  1 
ATOM   1496 C CG  . LYS A 1 208 ? 45.755  -1.688  23.099  1.00 66.74  ? 208 LYS H CG  1 
ATOM   1497 N N   . PRO A 1 209 ? 46.815  -6.202  22.717  1.00 67.98  ? 209 PRO H N   1 
ATOM   1498 C CA  . PRO A 1 209 ? 47.055  -7.540  23.279  1.00 64.09  ? 209 PRO H CA  1 
ATOM   1499 C C   . PRO A 1 209 ? 48.513  -7.999  23.219  1.00 73.25  ? 209 PRO H C   1 
ATOM   1500 O O   . PRO A 1 209 ? 48.933  -8.787  24.067  1.00 83.22  ? 209 PRO H O   1 
ATOM   1501 C CB  . PRO A 1 209 ? 46.177  -8.444  22.408  1.00 62.62  ? 209 PRO H CB  1 
ATOM   1502 C CG  . PRO A 1 209 ? 45.085  -7.560  21.944  1.00 60.16  ? 209 PRO H CG  1 
ATOM   1503 C CD  . PRO A 1 209 ? 45.732  -6.229  21.715  1.00 55.13  ? 209 PRO H CD  1 
ATOM   1504 N N   . SER A 1 210 ? 49.270  -7.517  22.239  1.00 60.43  ? 210 SER H N   1 
ATOM   1505 C CA  . SER A 1 210 ? 50.678  -7.883  22.120  1.00 59.16  ? 210 SER H CA  1 
ATOM   1506 C C   . SER A 1 210 ? 51.587  -6.706  22.457  1.00 80.63  ? 210 SER H C   1 
ATOM   1507 O O   . SER A 1 210 ? 52.809  -6.800  22.324  1.00 79.25  ? 210 SER H O   1 
ATOM   1508 C CB  . SER A 1 210 ? 50.984  -8.395  20.710  1.00 56.93  ? 210 SER H CB  1 
ATOM   1509 O OG  . SER A 1 210 ? 50.787  -7.378  19.742  1.00 62.00  ? 210 SER H OG  1 
ATOM   1510 N N   . ASN A 1 211 ? 50.977  -5.606  22.896  1.00 64.46  ? 211 ASN H N   1 
ATOM   1511 C CA  . ASN A 1 211 ? 51.696  -4.382  23.243  1.00 67.47  ? 211 ASN H CA  1 
ATOM   1512 C C   . ASN A 1 211 ? 52.599  -3.907  22.105  1.00 68.61  ? 211 ASN H C   1 
ATOM   1513 O O   . ASN A 1 211 ? 53.776  -3.613  22.312  1.00 76.00  ? 211 ASN H O   1 
ATOM   1514 C CB  . ASN A 1 211 ? 52.518  -4.587  24.519  1.00 83.96  ? 211 ASN H CB  1 
ATOM   1515 C CG  . ASN A 1 211 ? 52.821  -3.284  25.236  1.00 93.65  ? 211 ASN H CG  1 
ATOM   1516 O OD1 . ASN A 1 211 ? 52.845  -2.215  24.626  1.00 100.01 ? 211 ASN H OD1 1 
ATOM   1517 N ND2 . ASN A 1 211 ? 53.054  -3.369  26.540  1.00 99.76  ? 211 ASN H ND2 1 
ATOM   1518 N N   . THR A 1 212 ? 52.037  -3.839  20.902  1.00 65.67  ? 212 THR H N   1 
ATOM   1519 C CA  . THR A 1 212 ? 52.798  -3.449  19.720  1.00 67.80  ? 212 THR H CA  1 
ATOM   1520 C C   . THR A 1 212 ? 52.343  -2.097  19.177  1.00 68.87  ? 212 THR H C   1 
ATOM   1521 O O   . THR A 1 212 ? 51.156  -1.880  18.937  1.00 64.09  ? 212 THR H O   1 
ATOM   1522 C CB  . THR A 1 212 ? 52.677  -4.504  18.604  1.00 67.07  ? 212 THR H CB  1 
ATOM   1523 O OG1 . THR A 1 212 ? 53.119  -5.776  19.094  1.00 64.56  ? 212 THR H OG1 1 
ATOM   1524 C CG2 . THR A 1 212 ? 53.520  -4.110  17.401  1.00 83.72  ? 212 THR H CG2 1 
ATOM   1525 N N   . LYS A 1 213 ? 53.297  -1.190  18.989  1.00 79.40  ? 213 LYS H N   1 
ATOM   1526 C CA  . LYS A 1 213 ? 53.012  0.126   18.428  1.00 77.86  ? 213 LYS H CA  1 
ATOM   1527 C C   . LYS A 1 213 ? 53.897  0.390   17.214  1.00 73.64  ? 213 LYS H C   1 
ATOM   1528 O O   . LYS A 1 213 ? 55.116  0.506   17.339  1.00 82.44  ? 213 LYS H O   1 
ATOM   1529 C CB  . LYS A 1 213 ? 53.215  1.218   19.480  1.00 79.53  ? 213 LYS H CB  1 
ATOM   1530 N N   . VAL A 1 214 ? 53.277  0.484   16.042  1.00 74.13  ? 214 VAL H N   1 
ATOM   1531 C CA  . VAL A 1 214 ? 54.019  0.659   14.797  1.00 66.60  ? 214 VAL H CA  1 
ATOM   1532 C C   . VAL A 1 214 ? 53.589  1.910   14.035  1.00 63.07  ? 214 VAL H C   1 
ATOM   1533 O O   . VAL A 1 214 ? 52.406  2.106   13.759  1.00 58.77  ? 214 VAL H O   1 
ATOM   1534 C CB  . VAL A 1 214 ? 53.853  -0.564  13.871  1.00 69.59  ? 214 VAL H CB  1 
ATOM   1535 C CG1 . VAL A 1 214 ? 54.589  -0.343  12.559  1.00 78.79  ? 214 VAL H CG1 1 
ATOM   1536 C CG2 . VAL A 1 214 ? 54.352  -1.825  14.559  1.00 65.65  ? 214 VAL H CG2 1 
ATOM   1537 N N   . ASP A 1 215 ? 54.562  2.753   13.701  1.00 66.93  ? 215 ASP H N   1 
ATOM   1538 C CA  . ASP A 1 215 ? 54.317  3.920   12.863  1.00 71.69  ? 215 ASP H CA  1 
ATOM   1539 C C   . ASP A 1 215 ? 54.976  3.729   11.501  1.00 73.38  ? 215 ASP H C   1 
ATOM   1540 O O   . ASP A 1 215 ? 56.202  3.691   11.397  1.00 80.03  ? 215 ASP H O   1 
ATOM   1541 C CB  . ASP A 1 215 ? 54.840  5.191   13.534  1.00 76.89  ? 215 ASP H CB  1 
ATOM   1542 C CG  . ASP A 1 215 ? 54.116  5.507   14.828  1.00 87.47  ? 215 ASP H CG  1 
ATOM   1543 O OD1 . ASP A 1 215 ? 52.923  5.157   14.944  1.00 87.49  ? 215 ASP H OD1 1 
ATOM   1544 O OD2 . ASP A 1 215 ? 54.741  6.105   15.729  1.00 96.07  ? 215 ASP H OD2 1 
ATOM   1545 N N   . LYS A 1 216 ? 54.160  3.607   10.459  1.00 65.93  ? 216 LYS H N   1 
ATOM   1546 C CA  . LYS A 1 216 ? 54.676  3.337   9.122   1.00 67.50  ? 216 LYS H CA  1 
ATOM   1547 C C   . LYS A 1 216 ? 54.439  4.509   8.175   1.00 68.88  ? 216 LYS H C   1 
ATOM   1548 O O   . LYS A 1 216 ? 53.309  4.965   8.005   1.00 72.56  ? 216 LYS H O   1 
ATOM   1549 C CB  . LYS A 1 216 ? 54.036  2.069   8.552   1.00 73.12  ? 216 LYS H CB  1 
ATOM   1550 C CG  . LYS A 1 216 ? 54.915  1.324   7.563   1.00 80.16  ? 216 LYS H CG  1 
ATOM   1551 C CD  . LYS A 1 216 ? 55.987  0.525   8.288   1.00 84.14  ? 216 LYS H CD  1 
ATOM   1552 C CE  . LYS A 1 216 ? 57.021  -0.027  7.321   1.00 91.91  ? 216 LYS H CE  1 
ATOM   1553 N NZ  . LYS A 1 216 ? 57.837  1.055   6.703   1.00 104.47 ? 216 LYS H NZ  1 
ATOM   1554 N N   . LYS A 1 217 ? 55.514  4.991   7.559   1.00 69.08  ? 217 LYS H N   1 
ATOM   1555 C CA  . LYS A 1 217 ? 55.423  6.090   6.605   1.00 67.43  ? 217 LYS H CA  1 
ATOM   1556 C C   . LYS A 1 217 ? 55.067  5.574   5.216   1.00 65.87  ? 217 LYS H C   1 
ATOM   1557 O O   . LYS A 1 217 ? 55.734  4.686   4.684   1.00 71.73  ? 217 LYS H O   1 
ATOM   1558 C CB  . LYS A 1 217 ? 56.738  6.872   6.557   1.00 75.86  ? 217 LYS H CB  1 
ATOM   1559 C CG  . LYS A 1 217 ? 56.759  7.989   5.525   1.00 72.80  ? 217 LYS H CG  1 
ATOM   1560 N N   . VAL A 1 218 ? 54.012  6.133   4.634   1.00 56.21  ? 218 VAL H N   1 
ATOM   1561 C CA  . VAL A 1 218 ? 53.570  5.726   3.307   1.00 62.44  ? 218 VAL H CA  1 
ATOM   1562 C C   . VAL A 1 218 ? 53.923  6.785   2.268   1.00 74.18  ? 218 VAL H C   1 
ATOM   1563 O O   . VAL A 1 218 ? 53.501  7.937   2.371   1.00 78.97  ? 218 VAL H O   1 
ATOM   1564 C CB  . VAL A 1 218 ? 52.054  5.463   3.274   1.00 68.74  ? 218 VAL H CB  1 
ATOM   1565 C CG1 . VAL A 1 218 ? 51.644  4.898   1.924   1.00 62.75  ? 218 VAL H CG1 1 
ATOM   1566 C CG2 . VAL A 1 218 ? 51.660  4.513   4.395   1.00 62.44  ? 218 VAL H CG2 1 
ATOM   1567 N N   . GLU A 1 219 ? 54.703  6.386   1.270   1.00 78.12  ? 219 GLU H N   1 
ATOM   1568 C CA  . GLU A 1 219 ? 55.147  7.300   0.225   1.00 81.67  ? 219 GLU H CA  1 
ATOM   1569 C C   . GLU A 1 219 ? 55.214  6.586   -1.122  1.00 81.99  ? 219 GLU H C   1 
ATOM   1570 O O   . GLU A 1 219 ? 55.430  5.375   -1.172  1.00 80.43  ? 219 GLU H O   1 
ATOM   1571 C CB  . GLU A 1 219 ? 56.512  7.895   0.581   1.00 78.01  ? 219 GLU H CB  1 
ATOM   1572 N N   . PRO A 1 220 ? 55.017  7.334   -2.221  1.00 81.90  ? 220 PRO H N   1 
ATOM   1573 C CA  . PRO A 1 220 ? 55.101  6.772   -3.574  1.00 80.38  ? 220 PRO H CA  1 
ATOM   1574 C C   . PRO A 1 220 ? 56.461  6.142   -3.866  1.00 78.88  ? 220 PRO H C   1 
ATOM   1575 O O   . PRO A 1 220 ? 57.447  6.532   -3.241  1.00 77.59  ? 220 PRO H O   1 
ATOM   1576 C CB  . PRO A 1 220 ? 54.865  7.989   -4.474  1.00 78.14  ? 220 PRO H CB  1 
ATOM   1577 C CG  . PRO A 1 220 ? 54.080  8.930   -3.634  1.00 82.10  ? 220 PRO H CG  1 
ATOM   1578 C CD  . PRO A 1 220 ? 54.598  8.747   -2.239  1.00 80.94  ? 220 PRO H CD  1 
ATOM   1579 N N   . GLU B 2 1   ? 9.395   -25.690 19.413  1.00 103.50 ? 1   GLU L N   1 
ATOM   1580 C CA  . GLU B 2 1   ? 9.924   -24.355 19.155  1.00 98.89  ? 1   GLU L CA  1 
ATOM   1581 C C   . GLU B 2 1   ? 9.017   -23.562 18.219  1.00 91.81  ? 1   GLU L C   1 
ATOM   1582 O O   . GLU B 2 1   ? 8.534   -24.085 17.215  1.00 89.07  ? 1   GLU L O   1 
ATOM   1583 C CB  . GLU B 2 1   ? 11.335  -24.441 18.564  1.00 108.59 ? 1   GLU L CB  1 
ATOM   1584 C CG  . GLU B 2 1   ? 11.768  -23.193 17.800  1.00 112.05 ? 1   GLU L CG  1 
ATOM   1585 C CD  . GLU B 2 1   ? 13.270  -22.984 17.815  1.00 112.94 ? 1   GLU L CD  1 
ATOM   1586 O OE1 . GLU B 2 1   ? 13.948  -23.581 18.680  1.00 121.97 ? 1   GLU L OE1 1 
ATOM   1587 O OE2 . GLU B 2 1   ? 13.774  -22.229 16.954  1.00 102.51 ? 1   GLU L OE2 1 
ATOM   1588 N N   . ILE B 2 2   ? 8.787   -22.298 18.559  1.00 88.53  ? 2   ILE L N   1 
ATOM   1589 C CA  . ILE B 2 2   ? 8.023   -21.400 17.702  1.00 77.70  ? 2   ILE L CA  1 
ATOM   1590 C C   . ILE B 2 2   ? 8.967   -20.555 16.855  1.00 68.85  ? 2   ILE L C   1 
ATOM   1591 O O   . ILE B 2 2   ? 9.637   -19.655 17.363  1.00 64.33  ? 2   ILE L O   1 
ATOM   1592 C CB  . ILE B 2 2   ? 7.105   -20.478 18.522  1.00 72.54  ? 2   ILE L CB  1 
ATOM   1593 C CG1 . ILE B 2 2   ? 6.145   -21.309 19.375  1.00 71.22  ? 2   ILE L CG1 1 
ATOM   1594 C CG2 . ILE B 2 2   ? 6.332   -19.543 17.605  1.00 65.26  ? 2   ILE L CG2 1 
ATOM   1595 C CD1 . ILE B 2 2   ? 5.156   -20.481 20.165  1.00 73.55  ? 2   ILE L CD1 1 
ATOM   1596 N N   . VAL B 2 3   ? 9.020   -20.853 15.561  1.00 72.78  ? 3   VAL L N   1 
ATOM   1597 C CA  . VAL B 2 3   ? 9.930   -20.165 14.654  1.00 65.30  ? 3   VAL L CA  1 
ATOM   1598 C C   . VAL B 2 3   ? 9.420   -18.772 14.296  1.00 68.41  ? 3   VAL L C   1 
ATOM   1599 O O   . VAL B 2 3   ? 8.260   -18.602 13.923  1.00 75.45  ? 3   VAL L O   1 
ATOM   1600 C CB  . VAL B 2 3   ? 10.144  -20.971 13.359  1.00 72.80  ? 3   VAL L CB  1 
ATOM   1601 C CG1 . VAL B 2 3   ? 11.186  -20.298 12.477  1.00 75.65  ? 3   VAL L CG1 1 
ATOM   1602 C CG2 . VAL B 2 3   ? 10.560  -22.396 13.690  1.00 76.23  ? 3   VAL L CG2 1 
ATOM   1603 N N   . LEU B 2 4   ? 10.295  -17.778 14.419  1.00 68.67  ? 4   LEU L N   1 
ATOM   1604 C CA  . LEU B 2 4   ? 9.960   -16.409 14.047  1.00 67.71  ? 4   LEU L CA  1 
ATOM   1605 C C   . LEU B 2 4   ? 10.699  -15.999 12.778  1.00 72.54  ? 4   LEU L C   1 
ATOM   1606 O O   . LEU B 2 4   ? 11.929  -15.970 12.749  1.00 85.09  ? 4   LEU L O   1 
ATOM   1607 C CB  . LEU B 2 4   ? 10.294  -15.442 15.184  1.00 53.82  ? 4   LEU L CB  1 
ATOM   1608 C CG  . LEU B 2 4   ? 9.597   -15.674 16.525  1.00 55.67  ? 4   LEU L CG  1 
ATOM   1609 C CD1 . LEU B 2 4   ? 9.945   -14.560 17.497  1.00 53.57  ? 4   LEU L CD1 1 
ATOM   1610 C CD2 . LEU B 2 4   ? 8.092   -15.780 16.345  1.00 54.81  ? 4   LEU L CD2 1 
ATOM   1611 N N   . THR B 2 5   ? 9.944   -15.683 11.732  1.00 74.45  ? 5   THR L N   1 
ATOM   1612 C CA  . THR B 2 5   ? 10.532  -15.259 10.468  1.00 74.70  ? 5   THR L CA  1 
ATOM   1613 C C   . THR B 2 5   ? 10.237  -13.789 10.192  1.00 60.75  ? 5   THR L C   1 
ATOM   1614 O O   . THR B 2 5   ? 9.077   -13.379 10.134  1.00 63.54  ? 5   THR L O   1 
ATOM   1615 C CB  . THR B 2 5   ? 10.015  -16.107 9.290   1.00 76.71  ? 5   THR L CB  1 
ATOM   1616 O OG1 . THR B 2 5   ? 8.637   -15.803 9.046   1.00 89.77  ? 5   THR L OG1 1 
ATOM   1617 C CG2 . THR B 2 5   ? 10.160  -17.590 9.595   1.00 73.72  ? 5   THR L CG2 1 
ATOM   1618 N N   . GLN B 2 6   ? 11.292  -12.998 10.026  1.00 63.31  ? 6   GLN L N   1 
ATOM   1619 C CA  . GLN B 2 6   ? 11.141  -11.577 9.737   1.00 65.26  ? 6   GLN L CA  1 
ATOM   1620 C C   . GLN B 2 6   ? 11.294  -11.307 8.244   1.00 71.63  ? 6   GLN L C   1 
ATOM   1621 O O   . GLN B 2 6   ? 11.963  -12.057 7.533   1.00 72.31  ? 6   GLN L O   1 
ATOM   1622 C CB  . GLN B 2 6   ? 12.159  -10.756 10.530  1.00 58.87  ? 6   GLN L CB  1 
ATOM   1623 C CG  . GLN B 2 6   ? 12.055  -10.936 12.034  1.00 51.84  ? 6   GLN L CG  1 
ATOM   1624 C CD  . GLN B 2 6   ? 12.986  -10.016 12.799  1.00 55.46  ? 6   GLN L CD  1 
ATOM   1625 O OE1 . GLN B 2 6   ? 13.679  -10.445 13.721  1.00 57.34  ? 6   GLN L OE1 1 
ATOM   1626 N NE2 . GLN B 2 6   ? 12.999  -8.741  12.426  1.00 48.88  ? 6   GLN L NE2 1 
ATOM   1627 N N   . SER B 2 7   ? 10.667  -10.233 7.775   1.00 72.20  ? 7   SER L N   1 
ATOM   1628 C CA  . SER B 2 7   ? 10.717  -9.872  6.364   1.00 82.12  ? 7   SER L CA  1 
ATOM   1629 C C   . SER B 2 7   ? 10.523  -8.371  6.174   1.00 81.80  ? 7   SER L C   1 
ATOM   1630 O O   . SER B 2 7   ? 9.696   -7.759  6.849   1.00 88.02  ? 7   SER L O   1 
ATOM   1631 C CB  . SER B 2 7   ? 9.656   -10.645 5.576   1.00 102.69 ? 7   SER L CB  1 
ATOM   1632 O OG  . SER B 2 7   ? 8.357   -10.382 6.077   1.00 111.12 ? 7   SER L OG  1 
ATOM   1633 N N   . PRO B 2 8   ? 11.291  -7.769  5.251   1.00 79.57  ? 8   PRO L N   1 
ATOM   1634 C CA  . PRO B 2 8   ? 12.315  -8.447  4.451   1.00 77.95  ? 8   PRO L CA  1 
ATOM   1635 C C   . PRO B 2 8   ? 13.650  -8.535  5.183   1.00 74.31  ? 8   PRO L C   1 
ATOM   1636 O O   . PRO B 2 8   ? 13.733  -8.171  6.355   1.00 77.73  ? 8   PRO L O   1 
ATOM   1637 C CB  . PRO B 2 8   ? 12.429  -7.556  3.217   1.00 78.81  ? 8   PRO L CB  1 
ATOM   1638 C CG  . PRO B 2 8   ? 12.142  -6.193  3.738   1.00 77.94  ? 8   PRO L CG  1 
ATOM   1639 C CD  . PRO B 2 8   ? 11.132  -6.359  4.852   1.00 80.12  ? 8   PRO L CD  1 
ATOM   1640 N N   . ALA B 2 9   ? 14.679  -9.015  4.494   1.00 79.00  ? 9   ALA L N   1 
ATOM   1641 C CA  . ALA B 2 9   ? 16.006  -9.126  5.085   1.00 84.52  ? 9   ALA L CA  1 
ATOM   1642 C C   . ALA B 2 9   ? 16.642  -7.750  5.249   1.00 79.67  ? 9   ALA L C   1 
ATOM   1643 O O   . ALA B 2 9   ? 17.337  -7.491  6.232   1.00 76.04  ? 9   ALA L O   1 
ATOM   1644 C CB  . ALA B 2 9   ? 16.892  -10.024 4.236   1.00 93.94  ? 9   ALA L CB  1 
ATOM   1645 N N   . THR B 2 10  ? 16.397  -6.870  4.283   1.00 74.51  ? 10  THR L N   1 
ATOM   1646 C CA  . THR B 2 10  ? 16.973  -5.530  4.302   1.00 78.08  ? 10  THR L CA  1 
ATOM   1647 C C   . THR B 2 10  ? 15.988  -4.491  3.773   1.00 81.23  ? 10  THR L C   1 
ATOM   1648 O O   . THR B 2 10  ? 15.375  -4.682  2.724   1.00 88.76  ? 10  THR L O   1 
ATOM   1649 C CB  . THR B 2 10  ? 18.267  -5.463  3.467   1.00 80.26  ? 10  THR L CB  1 
ATOM   1650 O OG1 . THR B 2 10  ? 19.150  -6.521  3.859   1.00 84.63  ? 10  THR L OG1 1 
ATOM   1651 C CG2 . THR B 2 10  ? 18.964  -4.124  3.664   1.00 73.61  ? 10  THR L CG2 1 
ATOM   1652 N N   . LEU B 2 11  ? 15.841  -3.392  4.507   1.00 78.34  ? 11  LEU L N   1 
ATOM   1653 C CA  . LEU B 2 11  ? 14.963  -2.303  4.094   1.00 75.56  ? 11  LEU L CA  1 
ATOM   1654 C C   . LEU B 2 11  ? 15.763  -1.045  3.770   1.00 80.19  ? 11  LEU L C   1 
ATOM   1655 O O   . LEU B 2 11  ? 16.306  -0.398  4.665   1.00 90.42  ? 11  LEU L O   1 
ATOM   1656 C CB  . LEU B 2 11  ? 13.931  -1.998  5.183   1.00 74.06  ? 11  LEU L CB  1 
ATOM   1657 C CG  . LEU B 2 11  ? 12.809  -3.019  5.379   1.00 80.05  ? 11  LEU L CG  1 
ATOM   1658 N N   . SER B 2 12  ? 15.833  -0.704  2.487   1.00 77.34  ? 12  SER L N   1 
ATOM   1659 C CA  . SER B 2 12  ? 16.532  0.501   2.054   1.00 76.32  ? 12  SER L CA  1 
ATOM   1660 C C   . SER B 2 12  ? 15.557  1.663   1.900   1.00 84.15  ? 12  SER L C   1 
ATOM   1661 O O   . SER B 2 12  ? 14.824  1.744   0.914   1.00 89.21  ? 12  SER L O   1 
ATOM   1662 C CB  . SER B 2 12  ? 17.272  0.253   0.738   1.00 75.24  ? 12  SER L CB  1 
ATOM   1663 O OG  . SER B 2 12  ? 18.294  -0.716  0.901   1.00 82.48  ? 12  SER L OG  1 
ATOM   1664 N N   . LEU B 2 13  ? 15.550  2.559   2.881   1.00 88.07  ? 13  LEU L N   1 
ATOM   1665 C CA  . LEU B 2 13  ? 14.636  3.695   2.873   1.00 77.93  ? 13  LEU L CA  1 
ATOM   1666 C C   . LEU B 2 13  ? 15.363  5.005   3.153   1.00 87.02  ? 13  LEU L C   1 
ATOM   1667 O O   . LEU B 2 13  ? 16.438  5.016   3.753   1.00 89.40  ? 13  LEU L O   1 
ATOM   1668 C CB  . LEU B 2 13  ? 13.520  3.489   3.899   1.00 77.48  ? 13  LEU L CB  1 
ATOM   1669 C CG  . LEU B 2 13  ? 12.563  2.325   3.636   1.00 80.76  ? 13  LEU L CG  1 
ATOM   1670 C CD1 . LEU B 2 13  ? 11.601  2.157   4.797   1.00 88.41  ? 13  LEU L CD1 1 
ATOM   1671 C CD2 . LEU B 2 13  ? 11.804  2.537   2.336   1.00 81.61  ? 13  LEU L CD2 1 
ATOM   1672 N N   . SER B 2 14  ? 14.766  6.108   2.713   1.00 89.37  ? 14  SER L N   1 
ATOM   1673 C CA  . SER B 2 14  ? 15.331  7.433   2.936   1.00 92.81  ? 14  SER L CA  1 
ATOM   1674 C C   . SER B 2 14  ? 14.878  7.995   4.281   1.00 93.77  ? 14  SER L C   1 
ATOM   1675 O O   . SER B 2 14  ? 13.776  7.694   4.740   1.00 96.50  ? 14  SER L O   1 
ATOM   1676 C CB  . SER B 2 14  ? 14.932  8.381   1.802   1.00 90.28  ? 14  SER L CB  1 
ATOM   1677 N N   . PRO B 2 15  ? 15.737  8.806   4.922   1.00 90.63  ? 15  PRO L N   1 
ATOM   1678 C CA  . PRO B 2 15  ? 15.399  9.454   6.196   1.00 86.14  ? 15  PRO L CA  1 
ATOM   1679 C C   . PRO B 2 15  ? 14.142  10.312  6.089   1.00 84.08  ? 15  PRO L C   1 
ATOM   1680 O O   . PRO B 2 15  ? 14.121  11.284  5.334   1.00 83.51  ? 15  PRO L O   1 
ATOM   1681 C CB  . PRO B 2 15  ? 16.628  10.319  6.486   1.00 88.13  ? 15  PRO L CB  1 
ATOM   1682 C CG  . PRO B 2 15  ? 17.740  9.646   5.761   1.00 85.76  ? 15  PRO L CG  1 
ATOM   1683 C CD  . PRO B 2 15  ? 17.122  9.091   4.512   1.00 88.78  ? 15  PRO L CD  1 
ATOM   1684 N N   . GLY B 2 16  ? 13.108  9.947   6.839   1.00 87.71  ? 16  GLY L N   1 
ATOM   1685 C CA  . GLY B 2 16  ? 11.843  10.657  6.793   1.00 93.99  ? 16  GLY L CA  1 
ATOM   1686 C C   . GLY B 2 16  ? 10.703  9.745   6.388   1.00 95.60  ? 16  GLY L C   1 
ATOM   1687 O O   . GLY B 2 16  ? 9.565   9.926   6.821   1.00 97.66  ? 16  GLY L O   1 
ATOM   1688 N N   . GLU B 2 17  ? 11.013  8.760   5.551   1.00 97.84  ? 17  GLU L N   1 
ATOM   1689 C CA  . GLU B 2 17  ? 10.020  7.790   5.103   1.00 94.96  ? 17  GLU L CA  1 
ATOM   1690 C C   . GLU B 2 17  ? 9.638   6.851   6.240   1.00 92.24  ? 17  GLU L C   1 
ATOM   1691 O O   . GLU B 2 17  ? 10.310  6.809   7.270   1.00 91.95  ? 17  GLU L O   1 
ATOM   1692 C CB  . GLU B 2 17  ? 10.548  6.990   3.911   1.00 86.60  ? 17  GLU L CB  1 
ATOM   1693 N N   . ARG B 2 18  ? 8.558   6.099   6.054   1.00 87.69  ? 18  ARG L N   1 
ATOM   1694 C CA  . ARG B 2 18  ? 8.112   5.167   7.083   1.00 71.51  ? 18  ARG L CA  1 
ATOM   1695 C C   . ARG B 2 18  ? 8.534   3.737   6.753   1.00 69.13  ? 18  ARG L C   1 
ATOM   1696 O O   . ARG B 2 18  ? 8.663   3.368   5.585   1.00 89.72  ? 18  ARG L O   1 
ATOM   1697 C CB  . ARG B 2 18  ? 6.593   5.249   7.270   1.00 88.32  ? 18  ARG L CB  1 
ATOM   1698 C CG  . ARG B 2 18  ? 5.784   4.293   6.412   1.00 85.53  ? 18  ARG L CG  1 
ATOM   1699 C CD  . ARG B 2 18  ? 4.342   4.224   6.887   1.00 84.59  ? 18  ARG L CD  1 
ATOM   1700 N NE  . ARG B 2 18  ? 3.593   3.167   6.213   1.00 96.27  ? 18  ARG L NE  1 
ATOM   1701 N N   . ALA B 2 19  ? 8.759   2.941   7.793   1.00 77.00  ? 19  ALA L N   1 
ATOM   1702 C CA  . ALA B 2 19  ? 9.212   1.566   7.623   1.00 69.53  ? 19  ALA L CA  1 
ATOM   1703 C C   . ALA B 2 19  ? 8.208   0.575   8.199   1.00 72.31  ? 19  ALA L C   1 
ATOM   1704 O O   . ALA B 2 19  ? 7.686   0.772   9.296   1.00 82.10  ? 19  ALA L O   1 
ATOM   1705 C CB  . ALA B 2 19  ? 10.577  1.375   8.270   1.00 60.78  ? 19  ALA L CB  1 
ATOM   1706 N N   . THR B 2 20  ? 7.945   -0.491  7.452   1.00 74.68  ? 20  THR L N   1 
ATOM   1707 C CA  . THR B 2 20  ? 7.020   -1.528  7.890   1.00 91.13  ? 20  THR L CA  1 
ATOM   1708 C C   . THR B 2 20  ? 7.725   -2.879  7.970   1.00 89.55  ? 20  THR L C   1 
ATOM   1709 O O   . THR B 2 20  ? 7.974   -3.523  6.951   1.00 91.95  ? 20  THR L O   1 
ATOM   1710 C CB  . THR B 2 20  ? 5.808   -1.637  6.946   1.00 98.49  ? 20  THR L CB  1 
ATOM   1711 O OG1 . THR B 2 20  ? 5.127   -0.377  6.894   1.00 109.07 ? 20  THR L OG1 1 
ATOM   1712 C CG2 . THR B 2 20  ? 4.845   -2.707  7.435   1.00 96.37  ? 20  THR L CG2 1 
ATOM   1713 N N   . LEU B 2 21  ? 8.045   -3.300  9.190   1.00 84.97  ? 21  LEU L N   1 
ATOM   1714 C CA  . LEU B 2 21  ? 8.760   -4.552  9.411   1.00 75.51  ? 21  LEU L CA  1 
ATOM   1715 C C   . LEU B 2 21  ? 7.804   -5.653  9.854   1.00 77.27  ? 21  LEU L C   1 
ATOM   1716 O O   . LEU B 2 21  ? 7.008   -5.461  10.772  1.00 71.04  ? 21  LEU L O   1 
ATOM   1717 C CB  . LEU B 2 21  ? 9.866   -4.367  10.454  1.00 69.55  ? 21  LEU L CB  1 
ATOM   1718 C CG  . LEU B 2 21  ? 11.085  -3.520  10.073  1.00 71.42  ? 21  LEU L CG  1 
ATOM   1719 C CD1 . LEU B 2 21  ? 10.799  -2.025  10.175  1.00 65.94  ? 21  LEU L CD1 1 
ATOM   1720 C CD2 . LEU B 2 21  ? 12.276  -3.895  10.937  1.00 71.64  ? 21  LEU L CD2 1 
ATOM   1721 N N   . SER B 2 22  ? 7.888   -6.808  9.201   1.00 74.80  ? 22  SER L N   1 
ATOM   1722 C CA  . SER B 2 22  ? 6.979   -7.913  9.485   1.00 77.13  ? 22  SER L CA  1 
ATOM   1723 C C   . SER B 2 22  ? 7.638   -8.995  10.334  1.00 70.03  ? 22  SER L C   1 
ATOM   1724 O O   . SER B 2 22  ? 8.863   -9.114  10.367  1.00 63.18  ? 22  SER L O   1 
ATOM   1725 C CB  . SER B 2 22  ? 6.459   -8.523  8.181   1.00 74.59  ? 22  SER L CB  1 
ATOM   1726 O OG  . SER B 2 22  ? 5.587   -7.628  7.512   1.00 90.78  ? 22  SER L OG  1 
ATOM   1727 N N   . CYS B 2 23  ? 6.812   -9.782  11.017  1.00 64.50  ? 23  CYS L N   1 
ATOM   1728 C CA  . CYS B 2 23  ? 7.293   -10.893 11.831  1.00 73.67  ? 23  CYS L CA  1 
ATOM   1729 C C   . CYS B 2 23  ? 6.234   -11.989 11.905  1.00 74.20  ? 23  CYS L C   1 
ATOM   1730 O O   . CYS B 2 23  ? 5.200   -11.822 12.551  1.00 72.64  ? 23  CYS L O   1 
ATOM   1731 C CB  . CYS B 2 23  ? 7.664   -10.415 13.238  1.00 70.67  ? 23  CYS L CB  1 
ATOM   1732 S SG  . CYS B 2 23  ? 8.478   -11.659 14.274  1.00 75.44  ? 23  CYS L SG  1 
ATOM   1733 N N   . ARG B 2 24  ? 6.494   -13.106 11.234  1.00 65.97  ? 24  ARG L N   1 
ATOM   1734 C CA  . ARG B 2 24  ? 5.552   -14.218 11.212  1.00 66.85  ? 24  ARG L CA  1 
ATOM   1735 C C   . ARG B 2 24  ? 5.997   -15.341 12.144  1.00 74.48  ? 24  ARG L C   1 
ATOM   1736 O O   . ARG B 2 24  ? 7.190   -15.610 12.282  1.00 83.51  ? 24  ARG L O   1 
ATOM   1737 C CB  . ARG B 2 24  ? 5.387   -14.752 9.788   1.00 69.22  ? 24  ARG L CB  1 
ATOM   1738 N N   . ALA B 2 25  ? 5.029   -15.991 12.782  1.00 65.51  ? 25  ALA L N   1 
ATOM   1739 C CA  . ALA B 2 25  ? 5.316   -17.091 13.694  1.00 73.10  ? 25  ALA L CA  1 
ATOM   1740 C C   . ALA B 2 25  ? 4.722   -18.397 13.178  1.00 70.26  ? 25  ALA L C   1 
ATOM   1741 O O   . ALA B 2 25  ? 3.727   -18.392 12.455  1.00 82.47  ? 25  ALA L O   1 
ATOM   1742 C CB  . ALA B 2 25  ? 4.783   -16.778 15.085  1.00 63.18  ? 25  ALA L CB  1 
ATOM   1743 N N   . SER B 2 26  ? 5.338   -19.514 13.556  1.00 78.75  ? 26  SER L N   1 
ATOM   1744 C CA  . SER B 2 26  ? 4.866   -20.829 13.136  1.00 76.32  ? 26  SER L CA  1 
ATOM   1745 C C   . SER B 2 26  ? 3.500   -21.140 13.741  1.00 78.21  ? 26  SER L C   1 
ATOM   1746 O O   . SER B 2 26  ? 2.724   -21.915 13.182  1.00 100.66 ? 26  SER L O   1 
ATOM   1747 C CB  . SER B 2 26  ? 5.875   -21.912 13.526  1.00 77.08  ? 26  SER L CB  1 
ATOM   1748 O OG  . SER B 2 26  ? 6.067   -21.948 14.929  1.00 86.17  ? 26  SER L OG  1 
ATOM   1749 N N   . GLN B 2 27  ? 3.217   -20.532 14.888  1.00 79.96  ? 27  GLN L N   1 
ATOM   1750 C CA  . GLN B 2 27  ? 1.925   -20.687 15.545  1.00 85.05  ? 27  GLN L CA  1 
ATOM   1751 C C   . GLN B 2 27  ? 1.594   -19.454 16.381  1.00 79.40  ? 27  GLN L C   1 
ATOM   1752 O O   . GLN B 2 27  ? 2.411   -18.542 16.504  1.00 68.80  ? 27  GLN L O   1 
ATOM   1753 C CB  . GLN B 2 27  ? 1.911   -21.944 16.418  1.00 87.74  ? 27  GLN L CB  1 
ATOM   1754 C CG  . GLN B 2 27  ? 3.100   -22.070 17.353  1.00 88.78  ? 27  GLN L CG  1 
ATOM   1755 C CD  . GLN B 2 27  ? 3.019   -23.301 18.234  1.00 101.44 ? 27  GLN L CD  1 
ATOM   1756 O OE1 . GLN B 2 27  ? 1.938   -23.691 18.677  1.00 112.76 ? 27  GLN L OE1 1 
ATOM   1757 N NE2 . GLN B 2 27  ? 4.164   -23.924 18.489  1.00 101.27 ? 27  GLN L NE2 1 
ATOM   1758 N N   . SER B 2 28  ? 0.393   -19.434 16.950  1.00 81.75  ? 28  SER L N   1 
ATOM   1759 C CA  . SER B 2 28  ? -0.074  -18.290 17.728  1.00 77.83  ? 28  SER L CA  1 
ATOM   1760 C C   . SER B 2 28  ? 0.784   -18.051 18.966  1.00 69.30  ? 28  SER L C   1 
ATOM   1761 O O   . SER B 2 28  ? 1.100   -18.984 19.704  1.00 68.49  ? 28  SER L O   1 
ATOM   1762 C CB  . SER B 2 28  ? -1.535  -18.487 18.138  1.00 78.79  ? 28  SER L CB  1 
ATOM   1763 N N   . VAL B 2 29  ? 1.161   -16.795 19.184  1.00 69.81  ? 29  VAL L N   1 
ATOM   1764 C CA  . VAL B 2 29  ? 1.934   -16.422 20.362  1.00 63.87  ? 29  VAL L CA  1 
ATOM   1765 C C   . VAL B 2 29  ? 1.113   -15.509 21.267  1.00 72.68  ? 29  VAL L C   1 
ATOM   1766 O O   . VAL B 2 29  ? 1.538   -15.168 22.371  1.00 68.48  ? 29  VAL L O   1 
ATOM   1767 C CB  . VAL B 2 29  ? 3.252   -15.723 19.984  1.00 64.78  ? 29  VAL L CB  1 
ATOM   1768 C CG1 . VAL B 2 29  ? 4.078   -16.612 19.066  1.00 60.05  ? 29  VAL L CG1 1 
ATOM   1769 C CG2 . VAL B 2 29  ? 2.971   -14.386 19.328  1.00 66.06  ? 29  VAL L CG2 1 
ATOM   1770 N N   . ASN B 2 30  ? -0.062  -15.114 20.779  1.00 76.65  ? 30  ASN L N   1 
ATOM   1771 C CA  . ASN B 2 30  ? -1.044  -14.374 21.570  1.00 78.12  ? 30  ASN L CA  1 
ATOM   1772 C C   . ASN B 2 30  ? -0.503  -13.080 22.171  1.00 75.58  ? 30  ASN L C   1 
ATOM   1773 O O   . ASN B 2 30  ? -0.422  -12.944 23.393  1.00 73.70  ? 30  ASN L O   1 
ATOM   1774 C CB  . ASN B 2 30  ? -1.588  -15.268 22.686  1.00 80.33  ? 30  ASN L CB  1 
ATOM   1775 C CG  . ASN B 2 30  ? -1.774  -16.704 22.239  1.00 95.14  ? 30  ASN L CG  1 
ATOM   1776 O OD1 . ASN B 2 30  ? -2.364  -16.969 21.192  1.00 111.85 ? 30  ASN L OD1 1 
ATOM   1777 N ND2 . ASN B 2 30  ? -1.267  -17.641 23.032  1.00 94.46  ? 30  ASN L ND2 1 
ATOM   1778 N N   . ASN B 2 31  ? -0.121  -12.147 21.300  1.00 74.47  ? 31  ASN L N   1 
ATOM   1779 C CA  . ASN B 2 31  ? 0.393   -10.830 21.689  1.00 58.41  ? 31  ASN L CA  1 
ATOM   1780 C C   . ASN B 2 31  ? 1.705   -10.862 22.477  1.00 68.74  ? 31  ASN L C   1 
ATOM   1781 O O   . ASN B 2 31  ? 2.336   -9.826  22.671  1.00 53.54  ? 31  ASN L O   1 
ATOM   1782 C CB  . ASN B 2 31  ? -0.658  -10.062 22.497  1.00 66.68  ? 31  ASN L CB  1 
ATOM   1783 C CG  . ASN B 2 31  ? -1.894  -9.735  21.684  1.00 80.99  ? 31  ASN L CG  1 
ATOM   1784 O OD1 . ASN B 2 31  ? -2.887  -10.461 21.721  1.00 91.64  ? 31  ASN L OD1 1 
ATOM   1785 N ND2 . ASN B 2 31  ? -1.840  -8.634  20.943  1.00 79.87  ? 31  ASN L ND2 1 
ATOM   1786 N N   . ARG B 2 32  ? 2.120   -12.044 22.920  1.00 54.79  ? 32  ARG L N   1 
ATOM   1787 C CA  . ARG B 2 32  ? 3.351   -12.176 23.692  1.00 52.28  ? 32  ARG L CA  1 
ATOM   1788 C C   . ARG B 2 32  ? 4.582   -12.082 22.794  1.00 52.94  ? 32  ARG L C   1 
ATOM   1789 O O   . ARG B 2 32  ? 5.388   -13.010 22.723  1.00 55.57  ? 32  ARG L O   1 
ATOM   1790 C CB  . ARG B 2 32  ? 3.353   -13.495 24.467  1.00 55.42  ? 32  ARG L CB  1 
ATOM   1791 C CG  . ARG B 2 32  ? 2.367   -13.522 25.626  1.00 56.86  ? 32  ARG L CG  1 
ATOM   1792 C CD  . ARG B 2 32  ? 2.195   -14.925 26.182  1.00 65.53  ? 32  ARG L CD  1 
ATOM   1793 N NE  . ARG B 2 32  ? 1.500   -14.924 27.466  1.00 67.79  ? 32  ARG L NE  1 
ATOM   1794 C CZ  . ARG B 2 32  ? 0.179   -14.875 27.602  1.00 73.86  ? 32  ARG L CZ  1 
ATOM   1795 N NH1 . ARG B 2 32  ? -0.599  -14.821 26.530  1.00 72.93  ? 32  ARG L NH1 1 
ATOM   1796 N NH2 . ARG B 2 32  ? -0.364  -14.880 28.812  1.00 66.86  ? 32  ARG L NH2 1 
ATOM   1797 N N   . LEU B 2 33  ? 4.717   -10.947 22.115  1.00 49.49  ? 33  LEU L N   1 
ATOM   1798 C CA  . LEU B 2 33  ? 5.837   -10.708 21.217  1.00 48.97  ? 33  LEU L CA  1 
ATOM   1799 C C   . LEU B 2 33  ? 6.540   -9.403  21.574  1.00 53.41  ? 33  LEU L C   1 
ATOM   1800 O O   . LEU B 2 33  ? 5.896   -8.432  21.968  1.00 47.06  ? 33  LEU L O   1 
ATOM   1801 C CB  . LEU B 2 33  ? 5.365   -10.666 19.763  1.00 56.95  ? 33  LEU L CB  1 
ATOM   1802 C CG  . LEU B 2 33  ? 6.472   -10.688 18.709  1.00 62.91  ? 33  LEU L CG  1 
ATOM   1803 C CD1 . LEU B 2 33  ? 6.862   -12.119 18.365  1.00 56.65  ? 33  LEU L CD1 1 
ATOM   1804 C CD2 . LEU B 2 33  ? 6.060   -9.921  17.466  1.00 49.77  ? 33  LEU L CD2 1 
ATOM   1805 N N   . ALA B 2 34  ? 7.862   -9.385  21.432  1.00 53.95  ? 34  ALA L N   1 
ATOM   1806 C CA  . ALA B 2 34  ? 8.644   -8.198  21.752  1.00 48.82  ? 34  ALA L CA  1 
ATOM   1807 C C   . ALA B 2 34  ? 9.529   -7.775  20.584  1.00 50.89  ? 34  ALA L C   1 
ATOM   1808 O O   . ALA B 2 34  ? 9.939   -8.603  19.772  1.00 54.96  ? 34  ALA L O   1 
ATOM   1809 C CB  . ALA B 2 34  ? 9.489   -8.440  22.994  1.00 54.42  ? 34  ALA L CB  1 
ATOM   1810 N N   . TRP B 2 35  ? 9.822   -6.480  20.510  1.00 51.62  ? 35  TRP L N   1 
ATOM   1811 C CA  . TRP B 2 35  ? 10.681  -5.943  19.460  1.00 52.96  ? 35  TRP L CA  1 
ATOM   1812 C C   . TRP B 2 35  ? 11.927  -5.282  20.040  1.00 61.34  ? 35  TRP L C   1 
ATOM   1813 O O   . TRP B 2 35  ? 11.872  -4.639  21.088  1.00 66.71  ? 35  TRP L O   1 
ATOM   1814 C CB  . TRP B 2 35  ? 9.914   -4.938  18.598  1.00 46.46  ? 35  TRP L CB  1 
ATOM   1815 C CG  . TRP B 2 35  ? 8.903   -5.564  17.690  1.00 52.15  ? 35  TRP L CG  1 
ATOM   1816 C CD1 . TRP B 2 35  ? 7.587   -5.798  17.964  1.00 56.45  ? 35  TRP L CD1 1 
ATOM   1817 C CD2 . TRP B 2 35  ? 9.123   -6.032  16.353  1.00 58.12  ? 35  TRP L CD2 1 
ATOM   1818 N NE1 . TRP B 2 35  ? 6.974   -6.384  16.882  1.00 61.35  ? 35  TRP L NE1 1 
ATOM   1819 C CE2 . TRP B 2 35  ? 7.896   -6.538  15.880  1.00 59.32  ? 35  TRP L CE2 1 
ATOM   1820 C CE3 . TRP B 2 35  ? 10.239  -6.073  15.511  1.00 56.67  ? 35  TRP L CE3 1 
ATOM   1821 C CZ2 . TRP B 2 35  ? 7.754   -7.079  14.604  1.00 58.35  ? 35  TRP L CZ2 1 
ATOM   1822 C CZ3 . TRP B 2 35  ? 10.096  -6.610  14.244  1.00 47.53  ? 35  TRP L CZ3 1 
ATOM   1823 C CH2 . TRP B 2 35  ? 8.863   -7.105  13.803  1.00 59.09  ? 35  TRP L CH2 1 
ATOM   1824 N N   . TYR B 2 36  ? 13.050  -5.443  19.346  1.00 58.53  ? 36  TYR L N   1 
ATOM   1825 C CA  . TYR B 2 36  ? 14.313  -4.856  19.775  1.00 59.50  ? 36  TYR L CA  1 
ATOM   1826 C C   . TYR B 2 36  ? 15.031  -4.181  18.612  1.00 57.53  ? 36  TYR L C   1 
ATOM   1827 O O   . TYR B 2 36  ? 14.805  -4.524  17.453  1.00 62.77  ? 36  TYR L O   1 
ATOM   1828 C CB  . TYR B 2 36  ? 15.229  -5.920  20.388  1.00 51.58  ? 36  TYR L CB  1 
ATOM   1829 C CG  . TYR B 2 36  ? 14.627  -6.692  21.540  1.00 51.21  ? 36  TYR L CG  1 
ATOM   1830 C CD1 . TYR B 2 36  ? 13.858  -7.827  21.316  1.00 55.12  ? 36  TYR L CD1 1 
ATOM   1831 C CD2 . TYR B 2 36  ? 14.842  -6.296  22.853  1.00 54.41  ? 36  TYR L CD2 1 
ATOM   1832 C CE1 . TYR B 2 36  ? 13.311  -8.537  22.366  1.00 61.34  ? 36  TYR L CE1 1 
ATOM   1833 C CE2 . TYR B 2 36  ? 14.299  -7.001  23.910  1.00 40.85  ? 36  TYR L CE2 1 
ATOM   1834 C CZ  . TYR B 2 36  ? 13.535  -8.120  23.659  1.00 48.35  ? 36  TYR L CZ  1 
ATOM   1835 O OH  . TYR B 2 36  ? 12.990  -8.828  24.705  1.00 50.13  ? 36  TYR L OH  1 
ATOM   1836 N N   . GLN B 2 37  ? 15.896  -3.222  18.926  1.00 48.13  ? 37  GLN L N   1 
ATOM   1837 C CA  . GLN B 2 37  ? 16.797  -2.662  17.926  1.00 59.71  ? 37  GLN L CA  1 
ATOM   1838 C C   . GLN B 2 37  ? 18.234  -2.853  18.391  1.00 58.70  ? 37  GLN L C   1 
ATOM   1839 O O   . GLN B 2 37  ? 18.506  -2.893  19.591  1.00 57.97  ? 37  GLN L O   1 
ATOM   1840 C CB  . GLN B 2 37  ? 16.505  -1.181  17.669  1.00 56.16  ? 37  GLN L CB  1 
ATOM   1841 C CG  . GLN B 2 37  ? 17.225  -0.217  18.596  1.00 58.37  ? 37  GLN L CG  1 
ATOM   1842 C CD  . GLN B 2 37  ? 17.224  1.204   18.065  1.00 57.57  ? 37  GLN L CD  1 
ATOM   1843 O OE1 . GLN B 2 37  ? 16.606  1.495   17.042  1.00 65.93  ? 37  GLN L OE1 1 
ATOM   1844 N NE2 . GLN B 2 37  ? 17.924  2.095   18.757  1.00 64.54  ? 37  GLN L NE2 1 
ATOM   1845 N N   . GLN B 2 38  ? 19.152  -2.989  17.441  1.00 57.46  ? 38  GLN L N   1 
ATOM   1846 C CA  . GLN B 2 38  ? 20.556  -3.181  17.778  1.00 50.73  ? 38  GLN L CA  1 
ATOM   1847 C C   . GLN B 2 38  ? 21.470  -2.422  16.830  1.00 61.57  ? 38  GLN L C   1 
ATOM   1848 O O   . GLN B 2 38  ? 21.459  -2.649  15.620  1.00 72.25  ? 38  GLN L O   1 
ATOM   1849 C CB  . GLN B 2 38  ? 20.919  -4.668  17.766  1.00 48.29  ? 38  GLN L CB  1 
ATOM   1850 C CG  . GLN B 2 38  ? 22.340  -4.953  18.234  1.00 46.53  ? 38  GLN L CG  1 
ATOM   1851 C CD  . GLN B 2 38  ? 22.653  -6.436  18.295  1.00 54.50  ? 38  GLN L CD  1 
ATOM   1852 O OE1 . GLN B 2 38  ? 22.158  -7.220  17.486  1.00 51.50  ? 38  GLN L OE1 1 
ATOM   1853 N NE2 . GLN B 2 38  ? 23.478  -6.828  19.261  1.00 56.81  ? 38  GLN L NE2 1 
ATOM   1854 N N   . LYS B 2 39  ? 22.260  -1.516  17.394  1.00 67.04  ? 39  LYS L N   1 
ATOM   1855 C CA  . LYS B 2 39  ? 23.266  -0.789  16.635  1.00 72.44  ? 39  LYS L CA  1 
ATOM   1856 C C   . LYS B 2 39  ? 24.616  -1.483  16.797  1.00 74.56  ? 39  LYS L C   1 
ATOM   1857 O O   . LYS B 2 39  ? 24.869  -2.106  17.829  1.00 65.33  ? 39  LYS L O   1 
ATOM   1858 C CB  . LYS B 2 39  ? 23.334  0.668   17.098  1.00 72.77  ? 39  LYS L CB  1 
ATOM   1859 C CG  . LYS B 2 39  ? 22.006  1.403   16.994  1.00 75.27  ? 39  LYS L CG  1 
ATOM   1860 C CD  . LYS B 2 39  ? 22.128  2.846   17.454  1.00 75.43  ? 39  LYS L CD  1 
ATOM   1861 C CE  . LYS B 2 39  ? 20.787  3.556   17.386  1.00 68.95  ? 39  LYS L CE  1 
ATOM   1862 N NZ  . LYS B 2 39  ? 20.887  4.971   17.833  1.00 73.12  ? 39  LYS L NZ  1 
ATOM   1863 N N   . PRO B 2 40  ? 25.479  -1.393  15.770  1.00 76.77  ? 40  PRO L N   1 
ATOM   1864 C CA  . PRO B 2 40  ? 26.798  -2.040  15.779  1.00 74.91  ? 40  PRO L CA  1 
ATOM   1865 C C   . PRO B 2 40  ? 27.618  -1.737  17.032  1.00 74.55  ? 40  PRO L C   1 
ATOM   1866 O O   . PRO B 2 40  ? 27.818  -0.572  17.378  1.00 76.49  ? 40  PRO L O   1 
ATOM   1867 C CB  . PRO B 2 40  ? 27.476  -1.458  14.536  1.00 75.30  ? 40  PRO L CB  1 
ATOM   1868 C CG  . PRO B 2 40  ? 26.350  -1.163  13.613  1.00 75.55  ? 40  PRO L CG  1 
ATOM   1869 C CD  . PRO B 2 40  ? 25.209  -0.718  14.487  1.00 70.72  ? 40  PRO L CD  1 
ATOM   1870 N N   . GLY B 2 41  ? 28.076  -2.787  17.706  1.00 76.86  ? 41  GLY L N   1 
ATOM   1871 C CA  . GLY B 2 41  ? 28.887  -2.639  18.900  1.00 76.91  ? 41  GLY L CA  1 
ATOM   1872 C C   . GLY B 2 41  ? 28.073  -2.310  20.136  1.00 71.34  ? 41  GLY L C   1 
ATOM   1873 O O   . GLY B 2 41  ? 28.619  -1.874  21.149  1.00 77.53  ? 41  GLY L O   1 
ATOM   1874 N N   . GLN B 2 42  ? 26.763  -2.518  20.055  1.00 64.08  ? 42  GLN L N   1 
ATOM   1875 C CA  . GLN B 2 42  ? 25.877  -2.227  21.176  1.00 67.71  ? 42  GLN L CA  1 
ATOM   1876 C C   . GLN B 2 42  ? 24.912  -3.376  21.453  1.00 66.13  ? 42  GLN L C   1 
ATOM   1877 O O   . GLN B 2 42  ? 24.581  -4.157  20.560  1.00 65.18  ? 42  GLN L O   1 
ATOM   1878 C CB  . GLN B 2 42  ? 25.091  -0.939  20.916  1.00 68.82  ? 42  GLN L CB  1 
ATOM   1879 C CG  . GLN B 2 42  ? 25.950  0.313   20.842  1.00 80.76  ? 42  GLN L CG  1 
ATOM   1880 C CD  . GLN B 2 42  ? 25.129  1.572   20.646  1.00 94.12  ? 42  GLN L CD  1 
ATOM   1881 O OE1 . GLN B 2 42  ? 23.978  1.516   20.213  1.00 100.51 ? 42  GLN L OE1 1 
ATOM   1882 N NE2 . GLN B 2 42  ? 25.719  2.719   20.965  1.00 100.28 ? 42  GLN L NE2 1 
ATOM   1883 N N   . ALA B 2 43  ? 24.467  -3.470  22.701  1.00 57.68  ? 43  ALA L N   1 
ATOM   1884 C CA  . ALA B 2 43  ? 23.506  -4.487  23.105  1.00 50.94  ? 43  ALA L CA  1 
ATOM   1885 C C   . ALA B 2 43  ? 22.117  -4.148  22.574  1.00 43.83  ? 43  ALA L C   1 
ATOM   1886 O O   . ALA B 2 43  ? 21.808  -2.978  22.351  1.00 55.16  ? 43  ALA L O   1 
ATOM   1887 C CB  . ALA B 2 43  ? 23.483  -4.619  24.625  1.00 47.26  ? 43  ALA L CB  1 
ATOM   1888 N N   . PRO B 2 44  ? 21.278  -5.176  22.357  1.00 41.70  ? 44  PRO L N   1 
ATOM   1889 C CA  . PRO B 2 44  ? 19.894  -4.966  21.918  1.00 51.35  ? 44  PRO L CA  1 
ATOM   1890 C C   . PRO B 2 44  ? 19.117  -4.039  22.849  1.00 57.62  ? 44  PRO L C   1 
ATOM   1891 O O   . PRO B 2 44  ? 19.402  -3.979  24.045  1.00 64.69  ? 44  PRO L O   1 
ATOM   1892 C CB  . PRO B 2 44  ? 19.305  -6.378  21.940  1.00 50.83  ? 44  PRO L CB  1 
ATOM   1893 C CG  . PRO B 2 44  ? 20.471  -7.263  21.699  1.00 45.89  ? 44  PRO L CG  1 
ATOM   1894 C CD  . PRO B 2 44  ? 21.627  -6.607  22.399  1.00 46.82  ? 44  PRO L CD  1 
ATOM   1895 N N   . ARG B 2 45  ? 18.143  -3.328  22.292  1.00 56.41  ? 45  ARG L N   1 
ATOM   1896 C CA  . ARG B 2 45  ? 17.380  -2.334  23.038  1.00 59.42  ? 45  ARG L CA  1 
ATOM   1897 C C   . ARG B 2 45  ? 15.881  -2.584  22.916  1.00 59.10  ? 45  ARG L C   1 
ATOM   1898 O O   . ARG B 2 45  ? 15.332  -2.569  21.815  1.00 64.54  ? 45  ARG L O   1 
ATOM   1899 C CB  . ARG B 2 45  ? 17.722  -0.930  22.540  1.00 69.65  ? 45  ARG L CB  1 
ATOM   1900 C CG  . ARG B 2 45  ? 17.043  0.199   23.294  1.00 73.46  ? 45  ARG L CG  1 
ATOM   1901 C CD  . ARG B 2 45  ? 17.237  1.514   22.554  1.00 80.31  ? 45  ARG L CD  1 
ATOM   1902 N NE  . ARG B 2 45  ? 16.535  2.623   23.192  1.00 93.67  ? 45  ARG L NE  1 
ATOM   1903 C CZ  . ARG B 2 45  ? 16.193  3.747   22.570  1.00 99.93  ? 45  ARG L CZ  1 
ATOM   1904 N NH1 . ARG B 2 45  ? 16.485  3.916   21.287  1.00 94.95  ? 45  ARG L NH1 1 
ATOM   1905 N NH2 . ARG B 2 45  ? 15.558  4.704   23.232  1.00 104.81 ? 45  ARG L NH2 1 
ATOM   1906 N N   . LEU B 2 46  ? 15.224  -2.806  24.050  1.00 48.31  ? 46  LEU L N   1 
ATOM   1907 C CA  . LEU B 2 46  ? 13.794  -3.105  24.063  1.00 51.43  ? 46  LEU L CA  1 
ATOM   1908 C C   . LEU B 2 46  ? 12.960  -1.935  23.548  1.00 54.68  ? 46  LEU L C   1 
ATOM   1909 O O   . LEU B 2 46  ? 13.094  -0.806  24.021  1.00 54.25  ? 46  LEU L O   1 
ATOM   1910 C CB  . LEU B 2 46  ? 13.340  -3.482  25.473  1.00 50.19  ? 46  LEU L CB  1 
ATOM   1911 C CG  . LEU B 2 46  ? 11.841  -3.744  25.640  1.00 50.69  ? 46  LEU L CG  1 
ATOM   1912 C CD1 . LEU B 2 46  ? 11.421  -4.971  24.843  1.00 43.78  ? 46  LEU L CD1 1 
ATOM   1913 C CD2 . LEU B 2 46  ? 11.475  -3.900  27.110  1.00 44.75  ? 46  LEU L CD2 1 
ATOM   1914 N N   . LEU B 2 47  ? 12.095  -2.217  22.579  1.00 52.04  ? 47  LEU L N   1 
ATOM   1915 C CA  . LEU B 2 47  ? 11.237  -1.196  21.989  1.00 52.95  ? 47  LEU L CA  1 
ATOM   1916 C C   . LEU B 2 47  ? 9.771   -1.447  22.325  1.00 50.29  ? 47  LEU L C   1 
ATOM   1917 O O   . LEU B 2 47  ? 9.109   -0.608  22.937  1.00 53.89  ? 47  LEU L O   1 
ATOM   1918 C CB  . LEU B 2 47  ? 11.422  -1.153  20.473  1.00 51.38  ? 47  LEU L CB  1 
ATOM   1919 C CG  . LEU B 2 47  ? 12.807  -0.757  19.964  1.00 49.30  ? 47  LEU L CG  1 
ATOM   1920 C CD1 . LEU B 2 47  ? 12.874  -0.902  18.452  1.00 55.02  ? 47  LEU L CD1 1 
ATOM   1921 C CD2 . LEU B 2 47  ? 13.156  0.661   20.388  1.00 62.05  ? 47  LEU L CD2 1 
ATOM   1922 N N   . ILE B 2 48  ? 9.272   -2.607  21.912  1.00 62.71  ? 48  ILE L N   1 
ATOM   1923 C CA  . ILE B 2 48  ? 7.881   -2.979  22.136  1.00 59.47  ? 48  ILE L CA  1 
ATOM   1924 C C   . ILE B 2 48  ? 7.781   -4.312  22.871  1.00 61.32  ? 48  ILE L C   1 
ATOM   1925 O O   . ILE B 2 48  ? 8.584   -5.214  22.643  1.00 62.86  ? 48  ILE L O   1 
ATOM   1926 C CB  . ILE B 2 48  ? 7.108   -3.090  20.803  1.00 54.75  ? 48  ILE L CB  1 
ATOM   1927 C CG1 . ILE B 2 48  ? 7.402   -1.887  19.903  1.00 56.66  ? 48  ILE L CG1 1 
ATOM   1928 C CG2 . ILE B 2 48  ? 5.610   -3.234  21.053  1.00 57.29  ? 48  ILE L CG2 1 
ATOM   1929 C CD1 . ILE B 2 48  ? 6.554   -0.677  20.197  1.00 67.27  ? 48  ILE L CD1 1 
ATOM   1930 N N   . HIS B 2 49  ? 6.805   -4.423  23.764  1.00 57.18  ? 49  HIS L N   1 
ATOM   1931 C CA  . HIS B 2 49  ? 6.431   -5.710  24.335  1.00 47.29  ? 49  HIS L CA  1 
ATOM   1932 C C   . HIS B 2 49  ? 4.912   -5.796  24.332  1.00 57.67  ? 49  HIS L C   1 
ATOM   1933 O O   . HIS B 2 49  ? 4.237   -4.782  24.148  1.00 57.02  ? 49  HIS L O   1 
ATOM   1934 C CB  . HIS B 2 49  ? 6.994   -5.887  25.748  1.00 56.12  ? 49  HIS L CB  1 
ATOM   1935 C CG  . HIS B 2 49  ? 6.260   -5.113  26.798  1.00 58.35  ? 49  HIS L CG  1 
ATOM   1936 N ND1 . HIS B 2 49  ? 5.214   -5.647  27.521  1.00 64.59  ? 49  HIS L ND1 1 
ATOM   1937 C CD2 . HIS B 2 49  ? 6.426   -3.850  27.257  1.00 57.37  ? 49  HIS L CD2 1 
ATOM   1938 C CE1 . HIS B 2 49  ? 4.763   -4.744  28.373  1.00 68.40  ? 49  HIS L CE1 1 
ATOM   1939 N NE2 . HIS B 2 49  ? 5.482   -3.645  28.233  1.00 63.05  ? 49  HIS L NE2 1 
ATOM   1940 N N   . TRP B 2 50  ? 4.383   -7.003  24.525  1.00 50.02  ? 50  TRP L N   1 
ATOM   1941 C CA  . TRP B 2 50  ? 2.946   -7.253  24.429  1.00 57.69  ? 50  TRP L CA  1 
ATOM   1942 C C   . TRP B 2 50  ? 2.432   -6.787  23.064  1.00 64.25  ? 50  TRP L C   1 
ATOM   1943 O O   . TRP B 2 50  ? 1.343   -6.227  22.950  1.00 56.33  ? 50  TRP L O   1 
ATOM   1944 C CB  . TRP B 2 50  ? 2.193   -6.563  25.574  1.00 54.95  ? 50  TRP L CB  1 
ATOM   1945 C CG  . TRP B 2 50  ? 0.737   -6.935  25.681  1.00 68.93  ? 50  TRP L CG  1 
ATOM   1946 C CD1 . TRP B 2 50  ? -0.332  -6.097  25.544  1.00 76.48  ? 50  TRP L CD1 1 
ATOM   1947 C CD2 . TRP B 2 50  ? 0.195   -8.237  25.935  1.00 65.28  ? 50  TRP L CD2 1 
ATOM   1948 N NE1 . TRP B 2 50  ? -1.505  -6.794  25.705  1.00 71.67  ? 50  TRP L NE1 1 
ATOM   1949 C CE2 . TRP B 2 50  ? -1.209  -8.111  25.945  1.00 68.63  ? 50  TRP L CE2 1 
ATOM   1950 C CE3 . TRP B 2 50  ? 0.759   -9.497  26.159  1.00 57.42  ? 50  TRP L CE3 1 
ATOM   1951 C CZ2 . TRP B 2 50  ? -2.056  -9.195  26.168  1.00 64.63  ? 50  TRP L CZ2 1 
ATOM   1952 C CZ3 . TRP B 2 50  ? -0.083  -10.573 26.380  1.00 59.54  ? 50  TRP L CZ3 1 
ATOM   1953 C CH2 . TRP B 2 50  ? -1.475  -10.414 26.383  1.00 65.20  ? 50  TRP L CH2 1 
ATOM   1954 N N   . ALA B 2 51  ? 3.255   -7.008  22.040  1.00 64.15  ? 51  ALA L N   1 
ATOM   1955 C CA  . ALA B 2 51  ? 2.928   -6.713  20.639  1.00 62.36  ? 51  ALA L CA  1 
ATOM   1956 C C   . ALA B 2 51  ? 2.752   -5.222  20.323  1.00 60.57  ? 51  ALA L C   1 
ATOM   1957 O O   . ALA B 2 51  ? 3.229   -4.750  19.293  1.00 56.55  ? 51  ALA L O   1 
ATOM   1958 C CB  . ALA B 2 51  ? 1.677   -7.477  20.219  1.00 62.61  ? 51  ALA L CB  1 
ATOM   1959 N N   . SER B 2 52  ? 2.071   -4.485  21.196  1.00 61.98  ? 52  SER L N   1 
ATOM   1960 C CA  . SER B 2 52  ? 1.741   -3.089  20.924  1.00 78.48  ? 52  SER L CA  1 
ATOM   1961 C C   . SER B 2 52  ? 2.230   -2.097  21.986  1.00 83.82  ? 52  SER L C   1 
ATOM   1962 O O   . SER B 2 52  ? 2.373   -0.906  21.713  1.00 88.65  ? 52  SER L O   1 
ATOM   1963 C CB  . SER B 2 52  ? 0.223   -2.941  20.769  1.00 84.04  ? 52  SER L CB  1 
ATOM   1964 O OG  . SER B 2 52  ? -0.350  -4.060  20.119  1.00 97.66  ? 52  SER L OG  1 
ATOM   1965 N N   . THR B 2 53  ? 2.468   -2.579  23.199  1.00 79.00  ? 53  THR L N   1 
ATOM   1966 C CA  . THR B 2 53  ? 2.849   -1.694  24.300  1.00 79.25  ? 53  THR L CA  1 
ATOM   1967 C C   . THR B 2 53  ? 4.284   -1.187  24.179  1.00 74.33  ? 53  THR L C   1 
ATOM   1968 O O   . THR B 2 53  ? 5.230   -1.973  24.181  1.00 69.01  ? 53  THR L O   1 
ATOM   1969 C CB  . THR B 2 53  ? 2.678   -2.394  25.669  1.00 78.12  ? 53  THR L CB  1 
ATOM   1970 O OG1 . THR B 2 53  ? 1.375   -2.983  25.737  1.00 86.34  ? 53  THR L OG1 1 
ATOM   1971 C CG2 . THR B 2 53  ? 2.837   -1.393  26.808  1.00 80.78  ? 53  THR L CG2 1 
ATOM   1972 N N   . ARG B 2 54  ? 4.435   0.132   24.074  1.00 73.45  ? 54  ARG L N   1 
ATOM   1973 C CA  . ARG B 2 54  ? 5.756   0.750   24.000  1.00 66.05  ? 54  ARG L CA  1 
ATOM   1974 C C   . ARG B 2 54  ? 6.451   0.739   25.356  1.00 69.73  ? 54  ARG L C   1 
ATOM   1975 O O   . ARG B 2 54  ? 5.798   0.809   26.396  1.00 68.51  ? 54  ARG L O   1 
ATOM   1976 C CB  . ARG B 2 54  ? 5.656   2.186   23.475  1.00 73.19  ? 54  ARG L CB  1 
ATOM   1977 C CG  . ARG B 2 54  ? 5.990   2.325   22.001  1.00 75.00  ? 54  ARG L CG  1 
ATOM   1978 C CD  . ARG B 2 54  ? 5.541   3.659   21.427  1.00 83.60  ? 54  ARG L CD  1 
ATOM   1979 N NE  . ARG B 2 54  ? 6.009   4.799   22.208  1.00 81.58  ? 54  ARG L NE  1 
ATOM   1980 C CZ  . ARG B 2 54  ? 5.206   5.718   22.737  1.00 85.09  ? 54  ARG L CZ  1 
ATOM   1981 N NH1 . ARG B 2 54  ? 3.894   5.633   22.563  1.00 85.31  ? 54  ARG L NH1 1 
ATOM   1982 N NH2 . ARG B 2 54  ? 5.715   6.725   23.434  1.00 89.33  ? 54  ARG L NH2 1 
ATOM   1983 N N   . ALA B 2 55  ? 7.777   0.646   25.337  1.00 68.04  ? 55  ALA L N   1 
ATOM   1984 C CA  . ALA B 2 55  ? 8.564   0.629   26.564  1.00 65.86  ? 55  ALA L CA  1 
ATOM   1985 C C   . ALA B 2 55  ? 8.846   2.047   27.054  1.00 76.04  ? 55  ALA L C   1 
ATOM   1986 O O   . ALA B 2 55  ? 8.599   3.021   26.342  1.00 80.94  ? 55  ALA L O   1 
ATOM   1987 C CB  . ALA B 2 55  ? 9.865   -0.127  26.347  1.00 56.03  ? 55  ALA L CB  1 
ATOM   1988 N N   . ILE B 2 56  ? 9.365   2.152   28.273  1.00 80.64  ? 56  ILE L N   1 
ATOM   1989 C CA  . ILE B 2 56  ? 9.666   3.446   28.877  1.00 84.61  ? 56  ILE L CA  1 
ATOM   1990 C C   . ILE B 2 56  ? 10.834  4.139   28.182  1.00 85.14  ? 56  ILE L C   1 
ATOM   1991 O O   . ILE B 2 56  ? 11.944  3.607   28.135  1.00 83.99  ? 56  ILE L O   1 
ATOM   1992 C CB  . ILE B 2 56  ? 9.992   3.304   30.377  1.00 87.36  ? 56  ILE L CB  1 
ATOM   1993 C CG1 . ILE B 2 56  ? 8.781   2.764   31.141  1.00 81.43  ? 56  ILE L CG1 1 
ATOM   1994 C CG2 . ILE B 2 56  ? 10.434  4.640   30.958  1.00 94.19  ? 56  ILE L CG2 1 
ATOM   1995 C CD1 . ILE B 2 56  ? 7.591   3.699   31.141  1.00 74.63  ? 56  ILE L CD1 1 
ATOM   1996 N N   . GLY B 2 57  ? 10.577  5.327   27.643  1.00 90.11  ? 57  GLY L N   1 
ATOM   1997 C CA  . GLY B 2 57  ? 11.612  6.114   26.999  1.00 93.68  ? 57  GLY L CA  1 
ATOM   1998 C C   . GLY B 2 57  ? 11.716  5.874   25.505  1.00 87.43  ? 57  GLY L C   1 
ATOM   1999 O O   . GLY B 2 57  ? 12.662  6.326   24.860  1.00 95.61  ? 57  GLY L O   1 
ATOM   2000 N N   . ILE B 2 58  ? 10.741  5.159   24.954  1.00 70.41  ? 58  ILE L N   1 
ATOM   2001 C CA  . ILE B 2 58  ? 10.725  4.863   23.526  1.00 74.58  ? 58  ILE L CA  1 
ATOM   2002 C C   . ILE B 2 58  ? 9.892   5.890   22.766  1.00 72.15  ? 58  ILE L C   1 
ATOM   2003 O O   . ILE B 2 58  ? 8.734   6.128   23.110  1.00 79.81  ? 58  ILE L O   1 
ATOM   2004 C CB  . ILE B 2 58  ? 10.173  3.450   23.251  1.00 69.54  ? 58  ILE L CB  1 
ATOM   2005 C CG1 . ILE B 2 58  ? 11.053  2.395   23.926  1.00 65.49  ? 58  ILE L CG1 1 
ATOM   2006 C CG2 . ILE B 2 58  ? 10.080  3.189   21.755  1.00 66.98  ? 58  ILE L CG2 1 
ATOM   2007 N N   . PRO B 2 59  ? 10.488  6.510   21.732  1.00 70.72  ? 59  PRO L N   1 
ATOM   2008 C CA  . PRO B 2 59  ? 9.830   7.516   20.889  1.00 74.33  ? 59  PRO L CA  1 
ATOM   2009 C C   . PRO B 2 59  ? 8.492   7.039   20.328  1.00 75.16  ? 59  PRO L C   1 
ATOM   2010 O O   . PRO B 2 59  ? 8.295   5.840   20.132  1.00 72.96  ? 59  PRO L O   1 
ATOM   2011 C CB  . PRO B 2 59  ? 10.841  7.739   19.763  1.00 70.28  ? 59  PRO L CB  1 
ATOM   2012 C CG  . PRO B 2 59  ? 12.154  7.437   20.386  1.00 63.53  ? 59  PRO L CG  1 
ATOM   2013 C CD  . PRO B 2 59  ? 11.896  6.310   21.347  1.00 67.49  ? 59  PRO L CD  1 
ATOM   2014 N N   . ALA B 2 60  ? 7.588   7.980   20.071  1.00 77.96  ? 60  ALA L N   1 
ATOM   2015 C CA  . ALA B 2 60  ? 6.237   7.652   19.628  1.00 79.77  ? 60  ALA L CA  1 
ATOM   2016 C C   . ALA B 2 60  ? 6.192   7.216   18.166  1.00 84.80  ? 60  ALA L C   1 
ATOM   2017 O O   . ALA B 2 60  ? 5.171   6.716   17.694  1.00 92.05  ? 60  ALA L O   1 
ATOM   2018 C CB  . ALA B 2 60  ? 5.312   8.840   19.848  1.00 81.13  ? 60  ALA L CB  1 
ATOM   2019 N N   . ARG B 2 61  ? 7.296   7.406   17.450  1.00 82.94  ? 61  ARG L N   1 
ATOM   2020 C CA  . ARG B 2 61  ? 7.357   7.027   16.042  1.00 73.95  ? 61  ARG L CA  1 
ATOM   2021 C C   . ARG B 2 61  ? 7.354   5.510   15.880  1.00 74.78  ? 61  ARG L C   1 
ATOM   2022 O O   . ARG B 2 61  ? 6.973   4.991   14.830  1.00 74.32  ? 61  ARG L O   1 
ATOM   2023 C CB  . ARG B 2 61  ? 8.593   7.632   15.371  1.00 73.42  ? 61  ARG L CB  1 
ATOM   2024 C CG  . ARG B 2 61  ? 9.911   7.302   16.049  1.00 74.02  ? 61  ARG L CG  1 
ATOM   2025 C CD  . ARG B 2 61  ? 11.080  7.873   15.260  1.00 83.25  ? 61  ARG L CD  1 
ATOM   2026 N NE  . ARG B 2 61  ? 12.353  7.707   15.955  1.00 87.46  ? 61  ARG L NE  1 
ATOM   2027 C CZ  . ARG B 2 61  ? 12.896  8.625   16.748  1.00 92.13  ? 61  ARG L CZ  1 
ATOM   2028 N NH1 . ARG B 2 61  ? 12.276  9.780   16.949  1.00 96.21  ? 61  ARG L NH1 1 
ATOM   2029 N NH2 . ARG B 2 61  ? 14.059  8.389   17.339  1.00 90.02  ? 61  ARG L NH2 1 
ATOM   2030 N N   . PHE B 2 62  ? 7.776   4.804   16.924  1.00 67.79  ? 62  PHE L N   1 
ATOM   2031 C CA  . PHE B 2 62  ? 7.744   3.346   16.925  1.00 62.74  ? 62  PHE L CA  1 
ATOM   2032 C C   . PHE B 2 62  ? 6.349   2.843   17.282  1.00 69.96  ? 62  PHE L C   1 
ATOM   2033 O O   . PHE B 2 62  ? 5.741   3.309   18.244  1.00 73.21  ? 62  PHE L O   1 
ATOM   2034 C CB  . PHE B 2 62  ? 8.775   2.783   17.905  1.00 54.89  ? 62  PHE L CB  1 
ATOM   2035 C CG  . PHE B 2 62  ? 10.198  3.081   17.529  1.00 60.67  ? 62  PHE L CG  1 
ATOM   2036 C CD1 . PHE B 2 62  ? 10.914  2.207   16.726  1.00 59.64  ? 62  PHE L CD1 1 
ATOM   2037 C CD2 . PHE B 2 62  ? 10.822  4.232   17.981  1.00 67.21  ? 62  PHE L CD2 1 
ATOM   2038 C CE1 . PHE B 2 62  ? 12.225  2.477   16.379  1.00 58.64  ? 62  PHE L CE1 1 
ATOM   2039 C CE2 . PHE B 2 62  ? 12.133  4.509   17.637  1.00 69.44  ? 62  PHE L CE2 1 
ATOM   2040 C CZ  . PHE B 2 62  ? 12.835  3.630   16.836  1.00 62.79  ? 62  PHE L CZ  1 
ATOM   2041 N N   . SER B 2 63  ? 5.846   1.892   16.502  1.00 69.59  ? 63  SER L N   1 
ATOM   2042 C CA  . SER B 2 63  ? 4.509   1.353   16.725  1.00 62.09  ? 63  SER L CA  1 
ATOM   2043 C C   . SER B 2 63  ? 4.473   -0.156  16.509  1.00 65.60  ? 63  SER L C   1 
ATOM   2044 O O   . SER B 2 63  ? 5.219   -0.695  15.692  1.00 70.28  ? 63  SER L O   1 
ATOM   2045 C CB  . SER B 2 63  ? 3.497   2.037   15.803  1.00 73.48  ? 63  SER L CB  1 
ATOM   2046 O OG  . SER B 2 63  ? 3.541   3.445   15.952  1.00 85.84  ? 63  SER L OG  1 
ATOM   2047 N N   . GLY B 2 64  ? 3.598   -0.832  17.246  1.00 58.52  ? 64  GLY L N   1 
ATOM   2048 C CA  . GLY B 2 64  ? 3.451   -2.270  17.127  1.00 57.71  ? 64  GLY L CA  1 
ATOM   2049 C C   . GLY B 2 64  ? 2.007   -2.681  16.918  1.00 63.64  ? 64  GLY L C   1 
ATOM   2050 O O   . GLY B 2 64  ? 1.092   -2.063  17.463  1.00 67.15  ? 64  GLY L O   1 
ATOM   2051 N N   . SER B 2 65  ? 1.801   -3.728  16.126  1.00 71.69  ? 65  SER L N   1 
ATOM   2052 C CA  . SER B 2 65  ? 0.459   -4.220  15.840  1.00 78.16  ? 65  SER L CA  1 
ATOM   2053 C C   . SER B 2 65  ? 0.481   -5.683  15.413  1.00 78.03  ? 65  SER L C   1 
ATOM   2054 O O   . SER B 2 65  ? 1.537   -6.233  15.094  1.00 60.13  ? 65  SER L O   1 
ATOM   2055 C CB  . SER B 2 65  ? -0.202  -3.367  14.755  1.00 81.87  ? 65  SER L CB  1 
ATOM   2056 O OG  . SER B 2 65  ? 0.571   -3.368  13.568  1.00 83.02  ? 65  SER L OG  1 
ATOM   2057 N N   . GLY B 2 66  ? -0.692  -6.308  15.406  1.00 65.15  ? 66  GLY L N   1 
ATOM   2058 C CA  . GLY B 2 66  ? -0.812  -7.705  15.031  1.00 65.87  ? 66  GLY L CA  1 
ATOM   2059 C C   . GLY B 2 66  ? -1.105  -8.600  16.219  1.00 98.95  ? 66  GLY L C   1 
ATOM   2060 O O   . GLY B 2 66  ? -0.819  -8.245  17.363  1.00 82.70  ? 66  GLY L O   1 
ATOM   2061 N N   . SER B 2 67  ? -1.678  -9.767  15.946  1.00 116.77 ? 67  SER L N   1 
ATOM   2062 C CA  . SER B 2 67  ? -2.010  -10.723 16.995  1.00 125.43 ? 67  SER L CA  1 
ATOM   2063 C C   . SER B 2 67  ? -2.096  -12.141 16.440  1.00 119.15 ? 67  SER L C   1 
ATOM   2064 O O   . SER B 2 67  ? -2.705  -12.373 15.396  1.00 127.17 ? 67  SER L O   1 
ATOM   2065 C CB  . SER B 2 67  ? -3.329  -10.343 17.671  1.00 136.50 ? 67  SER L CB  1 
ATOM   2066 N N   . GLY B 2 68  ? -1.480  -13.085 17.144  1.00 108.22 ? 68  GLY L N   1 
ATOM   2067 C CA  . GLY B 2 68  ? -1.503  -14.476 16.735  1.00 97.40  ? 68  GLY L CA  1 
ATOM   2068 C C   . GLY B 2 68  ? -0.290  -14.877 15.917  1.00 93.89  ? 68  GLY L C   1 
ATOM   2069 O O   . GLY B 2 68  ? 0.721   -15.317 16.465  1.00 90.93  ? 68  GLY L O   1 
ATOM   2070 N N   . THR B 2 69  ? -0.391  -14.721 14.601  1.00 90.30  ? 69  THR L N   1 
ATOM   2071 C CA  . THR B 2 69  ? 0.677   -15.132 13.697  1.00 70.76  ? 69  THR L CA  1 
ATOM   2072 C C   . THR B 2 69  ? 1.408   -13.939 13.087  1.00 72.36  ? 69  THR L C   1 
ATOM   2073 O O   . THR B 2 69  ? 2.630   -13.831 13.190  1.00 80.50  ? 69  THR L O   1 
ATOM   2074 C CB  . THR B 2 69  ? 0.133   -16.017 12.560  1.00 92.18  ? 69  THR L CB  1 
ATOM   2075 O OG1 . THR B 2 69  ? -0.372  -17.242 13.106  1.00 93.50  ? 69  THR L OG1 1 
ATOM   2076 C CG2 . THR B 2 69  ? 1.231   -16.332 11.555  1.00 96.92  ? 69  THR L CG2 1 
ATOM   2077 N N   . ASP B 2 70  ? 0.656   -13.046 12.453  1.00 84.96  ? 70  ASP L N   1 
ATOM   2078 C CA  . ASP B 2 70  ? 1.243   -11.896 11.774  1.00 78.16  ? 70  ASP L CA  1 
ATOM   2079 C C   . ASP B 2 70  ? 1.425   -10.709 12.716  1.00 71.74  ? 70  ASP L C   1 
ATOM   2080 O O   . ASP B 2 70  ? 0.495   -10.309 13.415  1.00 74.02  ? 70  ASP L O   1 
ATOM   2081 C CB  . ASP B 2 70  ? 0.380   -11.485 10.579  1.00 77.42  ? 70  ASP L CB  1 
ATOM   2082 N N   . PHE B 2 71  ? 2.632   -10.150 12.727  1.00 67.65  ? 71  PHE L N   1 
ATOM   2083 C CA  . PHE B 2 71  ? 2.938   -8.985  13.550  1.00 60.70  ? 71  PHE L CA  1 
ATOM   2084 C C   . PHE B 2 71  ? 3.706   -7.943  12.747  1.00 70.24  ? 71  PHE L C   1 
ATOM   2085 O O   . PHE B 2 71  ? 4.305   -8.259  11.719  1.00 61.42  ? 71  PHE L O   1 
ATOM   2086 C CB  . PHE B 2 71  ? 3.735   -9.395  14.787  1.00 66.02  ? 71  PHE L CB  1 
ATOM   2087 C CG  . PHE B 2 71  ? 2.950   -10.220 15.762  1.00 71.22  ? 71  PHE L CG  1 
ATOM   2088 C CD1 . PHE B 2 71  ? 2.904   -11.599 15.644  1.00 69.78  ? 71  PHE L CD1 1 
ATOM   2089 C CD2 . PHE B 2 71  ? 2.254   -9.616  16.796  1.00 66.76  ? 71  PHE L CD2 1 
ATOM   2090 C CE1 . PHE B 2 71  ? 2.178   -12.359 16.538  1.00 76.02  ? 71  PHE L CE1 1 
ATOM   2091 C CE2 . PHE B 2 71  ? 1.528   -10.372 17.694  1.00 71.16  ? 71  PHE L CE2 1 
ATOM   2092 C CZ  . PHE B 2 71  ? 1.490   -11.745 17.565  1.00 78.31  ? 71  PHE L CZ  1 
ATOM   2093 N N   . THR B 2 72  ? 3.693   -6.701  13.219  1.00 72.98  ? 72  THR L N   1 
ATOM   2094 C CA  . THR B 2 72  ? 4.293   -5.608  12.465  1.00 72.80  ? 72  THR L CA  1 
ATOM   2095 C C   . THR B 2 72  ? 4.855   -4.498  13.350  1.00 71.89  ? 72  THR L C   1 
ATOM   2096 O O   . THR B 2 72  ? 4.162   -3.967  14.217  1.00 69.01  ? 72  THR L O   1 
ATOM   2097 C CB  . THR B 2 72  ? 3.270   -4.987  11.490  1.00 74.90  ? 72  THR L CB  1 
ATOM   2098 O OG1 . THR B 2 72  ? 2.912   -5.950  10.491  1.00 86.65  ? 72  THR L OG1 1 
ATOM   2099 C CG2 . THR B 2 72  ? 3.852   -3.757  10.814  1.00 74.41  ? 72  THR L CG2 1 
ATOM   2100 N N   . LEU B 2 73  ? 6.120   -4.157  13.121  1.00 73.74  ? 73  LEU L N   1 
ATOM   2101 C CA  . LEU B 2 73  ? 6.733   -2.992  13.748  1.00 68.57  ? 73  LEU L CA  1 
ATOM   2102 C C   . LEU B 2 73  ? 6.738   -1.831  12.759  1.00 67.90  ? 73  LEU L C   1 
ATOM   2103 O O   . LEU B 2 73  ? 7.162   -1.986  11.614  1.00 70.18  ? 73  LEU L O   1 
ATOM   2104 C CB  . LEU B 2 73  ? 8.156   -3.305  14.213  1.00 66.26  ? 73  LEU L CB  1 
ATOM   2105 C CG  . LEU B 2 73  ? 8.934   -2.142  14.834  1.00 69.92  ? 73  LEU L CG  1 
ATOM   2106 C CD1 . LEU B 2 73  ? 8.297   -1.704  16.143  1.00 75.40  ? 73  LEU L CD1 1 
ATOM   2107 C CD2 . LEU B 2 73  ? 10.394  -2.514  15.044  1.00 62.50  ? 73  LEU L CD2 1 
ATOM   2108 N N   . THR B 2 74  ? 6.265   -0.670  13.201  1.00 67.70  ? 74  THR L N   1 
ATOM   2109 C CA  . THR B 2 74  ? 6.135   0.481   12.316  1.00 72.69  ? 74  THR L CA  1 
ATOM   2110 C C   . THR B 2 74  ? 6.905   1.695   12.829  1.00 76.75  ? 74  THR L C   1 
ATOM   2111 O O   . THR B 2 74  ? 6.809   2.055   14.002  1.00 78.34  ? 74  THR L O   1 
ATOM   2112 C CB  . THR B 2 74  ? 4.656   0.871   12.125  1.00 77.65  ? 74  THR L CB  1 
ATOM   2113 O OG1 . THR B 2 74  ? 3.895   -0.288  11.765  1.00 82.53  ? 74  THR L OG1 1 
ATOM   2114 C CG2 . THR B 2 74  ? 4.514   1.924   11.036  1.00 74.14  ? 74  THR L CG2 1 
ATOM   2115 N N   . ILE B 2 75  ? 7.670   2.319   11.940  1.00 77.34  ? 75  ILE L N   1 
ATOM   2116 C CA  . ILE B 2 75  ? 8.391   3.544   12.262  1.00 75.56  ? 75  ILE L CA  1 
ATOM   2117 C C   . ILE B 2 75  ? 7.899   4.679   11.372  1.00 77.10  ? 75  ILE L C   1 
ATOM   2118 O O   . ILE B 2 75  ? 8.201   4.711   10.182  1.00 71.51  ? 75  ILE L O   1 
ATOM   2119 C CB  . ILE B 2 75  ? 9.911   3.372   12.086  1.00 64.24  ? 75  ILE L CB  1 
ATOM   2120 C CG1 . ILE B 2 75  ? 10.419  2.210   12.942  1.00 56.39  ? 75  ILE L CG1 1 
ATOM   2121 C CG2 . ILE B 2 75  ? 10.638  4.661   12.441  1.00 65.73  ? 75  ILE L CG2 1 
ATOM   2122 C CD1 . ILE B 2 75  ? 11.902  1.942   12.793  1.00 60.45  ? 75  ILE L CD1 1 
ATOM   2123 N N   . SER B 2 76  ? 7.142   5.604   11.955  1.00 86.84  ? 76  SER L N   1 
ATOM   2124 C CA  . SER B 2 76  ? 6.491   6.671   11.194  1.00 99.47  ? 76  SER L CA  1 
ATOM   2125 C C   . SER B 2 76  ? 7.484   7.565   10.454  1.00 106.23 ? 76  SER L C   1 
ATOM   2126 O O   . SER B 2 76  ? 7.446   7.663   9.228   1.00 109.94 ? 76  SER L O   1 
ATOM   2127 C CB  . SER B 2 76  ? 5.619   7.525   12.117  1.00 99.16  ? 76  SER L CB  1 
ATOM   2128 O OG  . SER B 2 76  ? 6.408   8.241   13.049  1.00 103.70 ? 76  SER L OG  1 
ATOM   2129 N N   . SER B 2 77  ? 8.367   8.220   11.200  1.00 108.29 ? 77  SER L N   1 
ATOM   2130 C CA  . SER B 2 77  ? 9.363   9.099   10.598  1.00 103.31 ? 77  SER L CA  1 
ATOM   2131 C C   . SER B 2 77  ? 10.775  8.628   10.923  1.00 90.50  ? 77  SER L C   1 
ATOM   2132 O O   . SER B 2 77  ? 11.229  8.742   12.061  1.00 93.47  ? 77  SER L O   1 
ATOM   2133 C CB  . SER B 2 77  ? 9.165   10.540  11.071  1.00 108.32 ? 77  SER L CB  1 
ATOM   2134 O OG  . SER B 2 77  ? 10.084  11.414  10.439  1.00 109.32 ? 77  SER L OG  1 
ATOM   2135 N N   . LEU B 2 78  ? 11.464  8.101   9.916   1.00 84.12  ? 78  LEU L N   1 
ATOM   2136 C CA  . LEU B 2 78  ? 12.817  7.586   10.100  1.00 76.22  ? 78  LEU L CA  1 
ATOM   2137 C C   . LEU B 2 78  ? 13.812  8.692   10.425  1.00 79.69  ? 78  LEU L C   1 
ATOM   2138 O O   . LEU B 2 78  ? 13.983  9.638   9.658   1.00 76.89  ? 78  LEU L O   1 
ATOM   2139 C CB  . LEU B 2 78  ? 13.278  6.826   8.854   1.00 71.54  ? 78  LEU L CB  1 
ATOM   2140 C CG  . LEU B 2 78  ? 12.881  5.352   8.768   1.00 73.87  ? 78  LEU L CG  1 
ATOM   2141 C CD1 . LEU B 2 78  ? 13.317  4.754   7.440   1.00 83.95  ? 78  LEU L CD1 1 
ATOM   2142 C CD2 . LEU B 2 78  ? 13.478  4.573   9.929   1.00 55.81  ? 78  LEU L CD2 1 
ATOM   2143 N N   . GLU B 2 79  ? 14.463  8.561   11.576  1.00 84.40  ? 79  GLU L N   1 
ATOM   2144 C CA  . GLU B 2 79  ? 15.527  9.470   11.976  1.00 84.62  ? 79  GLU L CA  1 
ATOM   2145 C C   . GLU B 2 79  ? 16.873  8.782   11.768  1.00 73.39  ? 79  GLU L C   1 
ATOM   2146 O O   . GLU B 2 79  ? 16.935  7.553   11.727  1.00 66.13  ? 79  GLU L O   1 
ATOM   2147 C CB  . GLU B 2 79  ? 15.349  9.900   13.435  1.00 87.67  ? 79  GLU L CB  1 
ATOM   2148 C CG  . GLU B 2 79  ? 14.067  10.674  13.706  1.00 96.78  ? 79  GLU L CG  1 
ATOM   2149 C CD  . GLU B 2 79  ? 14.008  11.991  12.955  1.00 106.64 ? 79  GLU L CD  1 
ATOM   2150 O OE1 . GLU B 2 79  ? 15.073  12.614  12.759  1.00 112.39 ? 79  GLU L OE1 1 
ATOM   2151 O OE2 . GLU B 2 79  ? 12.897  12.403  12.560  1.00 108.71 ? 79  GLU L OE2 1 
ATOM   2152 N N   . PRO B 2 80  ? 17.953  9.568   11.621  1.00 80.06  ? 80  PRO L N   1 
ATOM   2153 C CA  . PRO B 2 80  ? 19.298  9.003   11.448  1.00 83.88  ? 80  PRO L CA  1 
ATOM   2154 C C   . PRO B 2 80  ? 19.694  8.016   12.547  1.00 86.43  ? 80  PRO L C   1 
ATOM   2155 O O   . PRO B 2 80  ? 20.530  7.144   12.312  1.00 86.09  ? 80  PRO L O   1 
ATOM   2156 C CB  . PRO B 2 80  ? 20.198  10.240  11.483  1.00 80.84  ? 80  PRO L CB  1 
ATOM   2157 C CG  . PRO B 2 80  ? 19.337  11.330  10.959  1.00 77.11  ? 80  PRO L CG  1 
ATOM   2158 C CD  . PRO B 2 80  ? 17.951  11.034  11.464  1.00 77.45  ? 80  PRO L CD  1 
ATOM   2159 N N   . GLU B 2 81  ? 19.096  8.153   13.727  1.00 91.64  ? 81  GLU L N   1 
ATOM   2160 C CA  . GLU B 2 81  ? 19.388  7.260   14.842  1.00 90.32  ? 81  GLU L CA  1 
ATOM   2161 C C   . GLU B 2 81  ? 18.397  6.100   14.914  1.00 92.45  ? 81  GLU L C   1 
ATOM   2162 O O   . GLU B 2 81  ? 18.191  5.516   15.978  1.00 100.26 ? 81  GLU L O   1 
ATOM   2163 C CB  . GLU B 2 81  ? 19.379  8.035   16.162  1.00 82.29  ? 81  GLU L CB  1 
ATOM   2164 N N   . ASP B 2 82  ? 17.788  5.769   13.779  1.00 81.74  ? 82  ASP L N   1 
ATOM   2165 C CA  . ASP B 2 82  ? 16.820  4.678   13.723  1.00 75.06  ? 82  ASP L CA  1 
ATOM   2166 C C   . ASP B 2 82  ? 17.245  3.597   12.735  1.00 63.11  ? 82  ASP L C   1 
ATOM   2167 O O   . ASP B 2 82  ? 16.661  2.514   12.697  1.00 63.44  ? 82  ASP L O   1 
ATOM   2168 C CB  . ASP B 2 82  ? 15.433  5.207   13.349  1.00 82.67  ? 82  ASP L CB  1 
ATOM   2169 C CG  . ASP B 2 82  ? 14.866  6.147   14.394  1.00 89.12  ? 82  ASP L CG  1 
ATOM   2170 O OD1 . ASP B 2 82  ? 15.268  6.043   15.572  1.00 88.91  ? 82  ASP L OD1 1 
ATOM   2171 O OD2 . ASP B 2 82  ? 14.014  6.988   14.038  1.00 95.07  ? 82  ASP L OD2 1 
ATOM   2172 N N   . PHE B 2 83  ? 18.264  3.894   11.936  1.00 60.63  ? 83  PHE L N   1 
ATOM   2173 C CA  . PHE B 2 83  ? 18.753  2.947   10.941  1.00 60.89  ? 83  PHE L CA  1 
ATOM   2174 C C   . PHE B 2 83  ? 19.668  1.903   11.573  1.00 63.17  ? 83  PHE L C   1 
ATOM   2175 O O   . PHE B 2 83  ? 20.851  2.155   11.799  1.00 73.30  ? 83  PHE L O   1 
ATOM   2176 C CB  . PHE B 2 83  ? 19.487  3.682   9.818   1.00 55.91  ? 83  PHE L CB  1 
ATOM   2177 C CG  . PHE B 2 83  ? 18.600  4.577   9.002   1.00 64.44  ? 83  PHE L CG  1 
ATOM   2178 C CD1 . PHE B 2 83  ? 17.896  4.075   7.920   1.00 63.89  ? 83  PHE L CD1 1 
ATOM   2179 C CD2 . PHE B 2 83  ? 18.468  5.919   9.318   1.00 69.89  ? 83  PHE L CD2 1 
ATOM   2180 C CE1 . PHE B 2 83  ? 17.077  4.896   7.167   1.00 65.82  ? 83  PHE L CE1 1 
ATOM   2181 C CE2 . PHE B 2 83  ? 17.651  6.744   8.569   1.00 75.78  ? 83  PHE L CE2 1 
ATOM   2182 C CZ  . PHE B 2 83  ? 16.955  6.232   7.492   1.00 70.61  ? 83  PHE L CZ  1 
ATOM   2183 N N   . ALA B 2 84  ? 19.109  0.729   11.852  1.00 59.41  ? 84  ALA L N   1 
ATOM   2184 C CA  . ALA B 2 84  ? 19.859  -0.355  12.475  1.00 61.37  ? 84  ALA L CA  1 
ATOM   2185 C C   . ALA B 2 84  ? 19.196  -1.703  12.211  1.00 59.03  ? 84  ALA L C   1 
ATOM   2186 O O   . ALA B 2 84  ? 18.383  -1.838  11.296  1.00 58.44  ? 84  ALA L O   1 
ATOM   2187 C CB  . ALA B 2 84  ? 19.994  -0.115  13.972  1.00 67.97  ? 84  ALA L CB  1 
ATOM   2188 N N   . VAL B 2 85  ? 19.548  -2.697  13.019  1.00 57.23  ? 85  VAL L N   1 
ATOM   2189 C CA  . VAL B 2 85  ? 18.962  -4.026  12.901  1.00 54.33  ? 85  VAL L CA  1 
ATOM   2190 C C   . VAL B 2 85  ? 17.849  -4.208  13.926  1.00 58.63  ? 85  VAL L C   1 
ATOM   2191 O O   . VAL B 2 85  ? 18.013  -3.867  15.097  1.00 63.53  ? 85  VAL L O   1 
ATOM   2192 C CB  . VAL B 2 85  ? 20.020  -5.129  13.091  1.00 48.03  ? 85  VAL L CB  1 
ATOM   2193 C CG1 . VAL B 2 85  ? 19.406  -6.503  12.865  1.00 55.78  ? 85  VAL L CG1 1 
ATOM   2194 C CG2 . VAL B 2 85  ? 21.192  -4.905  12.149  1.00 40.60  ? 85  VAL L CG2 1 
ATOM   2195 N N   . TYR B 2 86  ? 16.715  -4.742  13.482  1.00 53.59  ? 86  TYR L N   1 
ATOM   2196 C CA  . TYR B 2 86  ? 15.572  -4.942  14.365  1.00 42.16  ? 86  TYR L CA  1 
ATOM   2197 C C   . TYR B 2 86  ? 15.208  -6.418  14.492  1.00 51.20  ? 86  TYR L C   1 
ATOM   2198 O O   . TYR B 2 86  ? 15.145  -7.142  13.498  1.00 52.40  ? 86  TYR L O   1 
ATOM   2199 C CB  . TYR B 2 86  ? 14.368  -4.141  13.867  1.00 41.70  ? 86  TYR L CB  1 
ATOM   2200 C CG  . TYR B 2 86  ? 14.560  -2.642  13.944  1.00 52.93  ? 86  TYR L CG  1 
ATOM   2201 C CD1 . TYR B 2 86  ? 15.245  -1.957  12.948  1.00 53.25  ? 86  TYR L CD1 1 
ATOM   2202 C CD2 . TYR B 2 86  ? 14.058  -1.913  15.013  1.00 54.76  ? 86  TYR L CD2 1 
ATOM   2203 C CE1 . TYR B 2 86  ? 15.424  -0.588  13.015  1.00 56.80  ? 86  TYR L CE1 1 
ATOM   2204 C CE2 . TYR B 2 86  ? 14.231  -0.543  15.088  1.00 52.25  ? 86  TYR L CE2 1 
ATOM   2205 C CZ  . TYR B 2 86  ? 14.916  0.113   14.088  1.00 57.34  ? 86  TYR L CZ  1 
ATOM   2206 O OH  . TYR B 2 86  ? 15.091  1.476   14.161  1.00 64.03  ? 86  TYR L OH  1 
ATOM   2207 N N   . TYR B 2 87  ? 14.971  -6.856  15.725  1.00 47.93  ? 87  TYR L N   1 
ATOM   2208 C CA  . TYR B 2 87  ? 14.622  -8.245  16.000  1.00 52.59  ? 87  TYR L CA  1 
ATOM   2209 C C   . TYR B 2 87  ? 13.237  -8.360  16.627  1.00 54.04  ? 87  TYR L C   1 
ATOM   2210 O O   . TYR B 2 87  ? 12.781  -7.451  17.321  1.00 61.21  ? 87  TYR L O   1 
ATOM   2211 C CB  . TYR B 2 87  ? 15.654  -8.890  16.931  1.00 50.30  ? 87  TYR L CB  1 
ATOM   2212 C CG  . TYR B 2 87  ? 17.049  -8.996  16.357  1.00 45.03  ? 87  TYR L CG  1 
ATOM   2213 C CD1 . TYR B 2 87  ? 17.433  -10.105 15.614  1.00 45.36  ? 87  TYR L CD1 1 
ATOM   2214 C CD2 . TYR B 2 87  ? 17.987  -7.995  16.573  1.00 47.15  ? 87  TYR L CD2 1 
ATOM   2215 C CE1 . TYR B 2 87  ? 18.710  -10.208 15.092  1.00 50.65  ? 87  TYR L CE1 1 
ATOM   2216 C CE2 . TYR B 2 87  ? 19.266  -8.090  16.056  1.00 44.82  ? 87  TYR L CE2 1 
ATOM   2217 C CZ  . TYR B 2 87  ? 19.622  -9.198  15.316  1.00 54.23  ? 87  TYR L CZ  1 
ATOM   2218 O OH  . TYR B 2 87  ? 20.894  -9.296  14.800  1.00 53.57  ? 87  TYR L OH  1 
ATOM   2219 N N   . CYS B 2 88  ? 12.574  -9.484  16.380  1.00 54.34  ? 88  CYS L N   1 
ATOM   2220 C CA  . CYS B 2 88  ? 11.323  -9.794  17.060  1.00 59.39  ? 88  CYS L CA  1 
ATOM   2221 C C   . CYS B 2 88  ? 11.527  -11.010 17.959  1.00 55.88  ? 88  CYS L C   1 
ATOM   2222 O O   . CYS B 2 88  ? 12.301  -11.909 17.631  1.00 55.52  ? 88  CYS L O   1 
ATOM   2223 C CB  . CYS B 2 88  ? 10.195  -10.043 16.053  1.00 57.41  ? 88  CYS L CB  1 
ATOM   2224 S SG  . CYS B 2 88  ? 10.334  -11.576 15.102  1.00 66.00  ? 88  CYS L SG  1 
ATOM   2225 N N   . GLN B 2 89  ? 10.843  -11.029 19.098  1.00 56.83  ? 89  GLN L N   1 
ATOM   2226 C CA  . GLN B 2 89  ? 11.013  -12.106 20.066  1.00 54.00  ? 89  GLN L CA  1 
ATOM   2227 C C   . GLN B 2 89  ? 9.681   -12.517 20.683  1.00 54.44  ? 89  GLN L C   1 
ATOM   2228 O O   . GLN B 2 89  ? 8.894   -11.671 21.100  1.00 62.30  ? 89  GLN L O   1 
ATOM   2229 C CB  . GLN B 2 89  ? 12.001  -11.684 21.159  1.00 38.25  ? 89  GLN L CB  1 
ATOM   2230 C CG  . GLN B 2 89  ? 12.161  -12.682 22.299  1.00 40.59  ? 89  GLN L CG  1 
ATOM   2231 C CD  . GLN B 2 89  ? 11.329  -12.322 23.516  1.00 55.31  ? 89  GLN L CD  1 
ATOM   2232 O OE1 . GLN B 2 89  ? 11.132  -11.146 23.820  1.00 50.05  ? 89  GLN L OE1 1 
ATOM   2233 N NE2 . GLN B 2 89  ? 10.841  -13.336 24.221  1.00 59.77  ? 89  GLN L NE2 1 
ATOM   2234 N N   . GLN B 2 90  ? 9.434   -13.822 20.731  1.00 54.03  ? 90  GLN L N   1 
ATOM   2235 C CA  . GLN B 2 90  ? 8.210   -14.348 21.321  1.00 57.11  ? 90  GLN L CA  1 
ATOM   2236 C C   . GLN B 2 90  ? 8.482   -14.904 22.715  1.00 54.50  ? 90  GLN L C   1 
ATOM   2237 O O   . GLN B 2 90  ? 9.555   -15.446 22.977  1.00 55.17  ? 90  GLN L O   1 
ATOM   2238 C CB  . GLN B 2 90  ? 7.597   -15.426 20.420  1.00 50.44  ? 90  GLN L CB  1 
ATOM   2239 C CG  . GLN B 2 90  ? 8.480   -16.648 20.190  1.00 48.05  ? 90  GLN L CG  1 
ATOM   2240 C CD  . GLN B 2 90  ? 8.275   -17.728 21.237  1.00 48.15  ? 90  GLN L CD  1 
ATOM   2241 O OE1 . GLN B 2 90  ? 7.301   -17.702 21.990  1.00 48.91  ? 90  GLN L OE1 1 
ATOM   2242 N NE2 . GLN B 2 90  ? 9.195   -18.685 21.289  1.00 52.67  ? 90  GLN L NE2 1 
ATOM   2243 N N   . GLY B 2 91  ? 7.507   -14.763 23.606  1.00 48.80  ? 91  GLY L N   1 
ATOM   2244 C CA  . GLY B 2 91  ? 7.647   -15.245 24.967  1.00 54.30  ? 91  GLY L CA  1 
ATOM   2245 C C   . GLY B 2 91  ? 6.427   -16.012 25.438  1.00 59.71  ? 91  GLY L C   1 
ATOM   2246 O O   . GLY B 2 91  ? 6.133   -16.060 26.633  1.00 63.88  ? 91  GLY L O   1 
ATOM   2247 N N   . ALA B 2 92  ? 5.715   -16.614 24.492  1.00 58.86  ? 92  ALA L N   1 
ATOM   2248 C CA  . ALA B 2 92  ? 4.514   -17.377 24.805  1.00 61.14  ? 92  ALA L CA  1 
ATOM   2249 C C   . ALA B 2 92  ? 4.857   -18.807 25.191  1.00 64.52  ? 92  ALA L C   1 
ATOM   2250 O O   . ALA B 2 92  ? 4.244   -19.386 26.088  1.00 66.94  ? 92  ALA L O   1 
ATOM   2251 C CB  . ALA B 2 92  ? 3.559   -17.365 23.624  1.00 63.50  ? 92  ALA L CB  1 
ATOM   2252 N N   . SER B 2 93  ? 5.843   -19.373 24.505  1.00 60.98  ? 93  SER L N   1 
ATOM   2253 C CA  . SER B 2 93  ? 6.237   -20.754 24.741  1.00 63.99  ? 93  SER L CA  1 
ATOM   2254 C C   . SER B 2 93  ? 7.750   -20.894 24.852  1.00 71.55  ? 93  SER L C   1 
ATOM   2255 O O   . SER B 2 93  ? 8.499   -20.262 24.106  1.00 67.36  ? 93  SER L O   1 
ATOM   2256 C CB  . SER B 2 93  ? 5.705   -21.654 23.624  1.00 61.85  ? 93  SER L CB  1 
ATOM   2257 O OG  . SER B 2 93  ? 6.168   -22.985 23.773  1.00 69.60  ? 93  SER L OG  1 
ATOM   2258 N N   . TRP B 2 94  ? 8.192   -21.721 25.794  1.00 74.71  ? 94  TRP L N   1 
ATOM   2259 C CA  . TRP B 2 94  ? 9.607   -22.031 25.947  1.00 67.49  ? 94  TRP L CA  1 
ATOM   2260 C C   . TRP B 2 94  ? 9.967   -23.210 25.039  1.00 71.34  ? 94  TRP L C   1 
ATOM   2261 O O   . TRP B 2 94  ? 9.218   -24.185 24.964  1.00 82.41  ? 94  TRP L O   1 
ATOM   2262 C CB  . TRP B 2 94  ? 9.939   -22.338 27.413  1.00 56.01  ? 94  TRP L CB  1 
ATOM   2263 C CG  . TRP B 2 94  ? 11.391  -22.599 27.651  1.00 49.83  ? 94  TRP L CG  1 
ATOM   2264 C CD1 . TRP B 2 94  ? 11.984  -23.812 27.838  1.00 53.21  ? 94  TRP L CD1 1 
ATOM   2265 C CD2 . TRP B 2 94  ? 12.439  -21.625 27.710  1.00 54.59  ? 94  TRP L CD2 1 
ATOM   2266 N NE1 . TRP B 2 94  ? 13.338  -23.654 28.015  1.00 63.05  ? 94  TRP L NE1 1 
ATOM   2267 C CE2 . TRP B 2 94  ? 13.642  -22.320 27.938  1.00 55.21  ? 94  TRP L CE2 1 
ATOM   2268 C CE3 . TRP B 2 94  ? 12.477  -20.233 27.588  1.00 58.31  ? 94  TRP L CE3 1 
ATOM   2269 C CZ2 . TRP B 2 94  ? 14.869  -21.670 28.052  1.00 59.44  ? 94  TRP L CZ2 1 
ATOM   2270 C CZ3 . TRP B 2 94  ? 13.697  -19.589 27.701  1.00 50.55  ? 94  TRP L CZ3 1 
ATOM   2271 C CH2 . TRP B 2 94  ? 14.875  -20.308 27.931  1.00 57.26  ? 94  TRP L CH2 1 
ATOM   2272 N N   . PRO B 2 95  ? 11.114  -23.128 24.340  1.00 66.96  ? 95  PRO L N   1 
ATOM   2273 C CA  . PRO B 2 95  ? 12.131  -22.070 24.401  1.00 62.51  ? 95  PRO L CA  1 
ATOM   2274 C C   . PRO B 2 95  ? 11.737  -20.774 23.695  1.00 64.10  ? 95  PRO L C   1 
ATOM   2275 O O   . PRO B 2 95  ? 11.194  -20.803 22.590  1.00 72.63  ? 95  PRO L O   1 
ATOM   2276 C CB  . PRO B 2 95  ? 13.334  -22.710 23.703  1.00 63.12  ? 95  PRO L CB  1 
ATOM   2277 C CG  . PRO B 2 95  ? 12.724  -23.647 22.723  1.00 57.94  ? 95  PRO L CG  1 
ATOM   2278 C CD  . PRO B 2 95  ? 11.490  -24.192 23.391  1.00 63.11  ? 95  PRO L CD  1 
ATOM   2279 N N   . PHE B 2 96  ? 12.008  -19.648 24.346  1.00 52.66  ? 96  PHE L N   1 
ATOM   2280 C CA  . PHE B 2 96  ? 11.796  -18.342 23.739  1.00 54.33  ? 96  PHE L CA  1 
ATOM   2281 C C   . PHE B 2 96  ? 12.764  -18.173 22.575  1.00 58.31  ? 96  PHE L C   1 
ATOM   2282 O O   . PHE B 2 96  ? 13.928  -18.559 22.668  1.00 72.11  ? 96  PHE L O   1 
ATOM   2283 C CB  . PHE B 2 96  ? 11.987  -17.220 24.763  1.00 47.11  ? 96  PHE L CB  1 
ATOM   2284 C CG  . PHE B 2 96  ? 11.138  -17.366 25.996  1.00 51.90  ? 96  PHE L CG  1 
ATOM   2285 C CD1 . PHE B 2 96  ? 9.885   -17.953 25.929  1.00 55.98  ? 96  PHE L CD1 1 
ATOM   2286 C CD2 . PHE B 2 96  ? 11.595  -16.912 27.223  1.00 50.44  ? 96  PHE L CD2 1 
ATOM   2287 C CE1 . PHE B 2 96  ? 9.106   -18.089 27.064  1.00 46.08  ? 96  PHE L CE1 1 
ATOM   2288 C CE2 . PHE B 2 96  ? 10.820  -17.046 28.361  1.00 56.44  ? 96  PHE L CE2 1 
ATOM   2289 C CZ  . PHE B 2 96  ? 9.574   -17.635 28.280  1.00 52.90  ? 96  PHE L CZ  1 
ATOM   2290 N N   . THR B 2 97  ? 12.283  -17.601 21.477  1.00 54.48  ? 97  THR L N   1 
ATOM   2291 C CA  . THR B 2 97  ? 13.103  -17.475 20.278  1.00 52.32  ? 97  THR L CA  1 
ATOM   2292 C C   . THR B 2 97  ? 13.125  -16.053 19.730  1.00 52.10  ? 97  THR L C   1 
ATOM   2293 O O   . THR B 2 97  ? 12.236  -15.250 20.011  1.00 54.28  ? 97  THR L O   1 
ATOM   2294 C CB  . THR B 2 97  ? 12.613  -18.421 19.166  1.00 48.22  ? 97  THR L CB  1 
ATOM   2295 O OG1 . THR B 2 97  ? 11.209  -18.225 18.956  1.00 55.84  ? 97  THR L OG1 1 
ATOM   2296 C CG2 . THR B 2 97  ? 12.866  -19.873 19.545  1.00 46.17  ? 97  THR L CG2 1 
ATOM   2297 N N   . PHE B 2 98  ? 14.156  -15.755 18.945  1.00 59.06  ? 98  PHE L N   1 
ATOM   2298 C CA  . PHE B 2 98  ? 14.256  -14.480 18.247  1.00 49.30  ? 98  PHE L CA  1 
ATOM   2299 C C   . PHE B 2 98  ? 13.989  -14.671 16.760  1.00 60.09  ? 98  PHE L C   1 
ATOM   2300 O O   . PHE B 2 98  ? 13.948  -15.797 16.266  1.00 56.43  ? 98  PHE L O   1 
ATOM   2301 C CB  . PHE B 2 98  ? 15.637  -13.852 18.449  1.00 38.72  ? 98  PHE L CB  1 
ATOM   2302 C CG  . PHE B 2 98  ? 15.874  -13.329 19.836  1.00 48.17  ? 98  PHE L CG  1 
ATOM   2303 C CD1 . PHE B 2 98  ? 15.455  -12.058 20.191  1.00 48.65  ? 98  PHE L CD1 1 
ATOM   2304 C CD2 . PHE B 2 98  ? 16.528  -14.102 20.780  1.00 52.47  ? 98  PHE L CD2 1 
ATOM   2305 C CE1 . PHE B 2 98  ? 15.675  -11.570 21.466  1.00 62.81  ? 98  PHE L CE1 1 
ATOM   2306 C CE2 . PHE B 2 98  ? 16.753  -13.620 22.055  1.00 58.20  ? 98  PHE L CE2 1 
ATOM   2307 C CZ  . PHE B 2 98  ? 16.325  -12.353 22.399  1.00 60.79  ? 98  PHE L CZ  1 
ATOM   2308 N N   . GLY B 2 99  ? 13.808  -13.565 16.048  1.00 62.07  ? 99  GLY L N   1 
ATOM   2309 C CA  . GLY B 2 99  ? 13.682  -13.613 14.605  1.00 64.13  ? 99  GLY L CA  1 
ATOM   2310 C C   . GLY B 2 99  ? 15.059  -13.594 13.974  1.00 72.10  ? 99  GLY L C   1 
ATOM   2311 O O   . GLY B 2 99  ? 16.064  -13.460 14.672  1.00 74.93  ? 99  GLY L O   1 
ATOM   2312 N N   . GLN B 2 100 ? 15.109  -13.732 12.654  1.00 74.80  ? 100 GLN L N   1 
ATOM   2313 C CA  . GLN B 2 100 ? 16.376  -13.697 11.935  1.00 66.01  ? 100 GLN L CA  1 
ATOM   2314 C C   . GLN B 2 100 ? 16.982  -12.299 11.982  1.00 52.45  ? 100 GLN L C   1 
ATOM   2315 O O   . GLN B 2 100 ? 18.202  -12.138 11.959  1.00 54.94  ? 100 GLN L O   1 
ATOM   2316 C CB  . GLN B 2 100 ? 16.185  -14.144 10.484  1.00 65.45  ? 100 GLN L CB  1 
ATOM   2317 N N   . GLY B 2 101 ? 16.120  -11.290 12.051  1.00 50.66  ? 101 GLY L N   1 
ATOM   2318 C CA  . GLY B 2 101 ? 16.564  -9.910  12.099  1.00 52.53  ? 101 GLY L CA  1 
ATOM   2319 C C   . GLY B 2 101 ? 16.343  -9.177  10.791  1.00 61.14  ? 101 GLY L C   1 
ATOM   2320 O O   . GLY B 2 101 ? 16.412  -9.769  9.713   1.00 52.85  ? 101 GLY L O   1 
ATOM   2321 N N   . THR B 2 102 ? 16.072  -7.879  10.889  1.00 57.65  ? 102 THR L N   1 
ATOM   2322 C CA  . THR B 2 102 ? 15.876  -7.041  9.712   1.00 57.24  ? 102 THR L CA  1 
ATOM   2323 C C   . THR B 2 102 ? 16.716  -5.771  9.808   1.00 59.66  ? 102 THR L C   1 
ATOM   2324 O O   . THR B 2 102 ? 16.583  -4.997  10.756  1.00 53.87  ? 102 THR L O   1 
ATOM   2325 C CB  . THR B 2 102 ? 14.394  -6.658  9.526   1.00 64.43  ? 102 THR L CB  1 
ATOM   2326 O OG1 . THR B 2 102 ? 13.623  -7.834  9.253   1.00 70.50  ? 102 THR L OG1 1 
ATOM   2327 C CG2 . THR B 2 102 ? 14.237  -5.677  8.374   1.00 57.55  ? 102 THR L CG2 1 
ATOM   2328 N N   . LYS B 2 103 ? 17.583  -5.565  8.822   1.00 57.28  ? 103 LYS L N   1 
ATOM   2329 C CA  . LYS B 2 103 ? 18.445  -4.390  8.796   1.00 52.73  ? 103 LYS L CA  1 
ATOM   2330 C C   . LYS B 2 103 ? 17.808  -3.256  8.002   1.00 58.42  ? 103 LYS L C   1 
ATOM   2331 O O   . LYS B 2 103 ? 17.319  -3.460  6.891   1.00 59.69  ? 103 LYS L O   1 
ATOM   2332 C CB  . LYS B 2 103 ? 19.813  -4.742  8.207   1.00 50.90  ? 103 LYS L CB  1 
ATOM   2333 C CG  . LYS B 2 103 ? 20.785  -3.572  8.147   1.00 57.24  ? 103 LYS L CG  1 
ATOM   2334 C CD  . LYS B 2 103 ? 22.138  -4.002  7.601   1.00 52.83  ? 103 LYS L CD  1 
ATOM   2335 N N   . VAL B 2 104 ? 17.812  -2.061  8.582   1.00 55.26  ? 104 VAL L N   1 
ATOM   2336 C CA  . VAL B 2 104 ? 17.281  -0.882  7.910   1.00 60.82  ? 104 VAL L CA  1 
ATOM   2337 C C   . VAL B 2 104 ? 18.415  0.053   7.506   1.00 68.57  ? 104 VAL L C   1 
ATOM   2338 O O   . VAL B 2 104 ? 18.985  0.751   8.345   1.00 64.60  ? 104 VAL L O   1 
ATOM   2339 C CB  . VAL B 2 104 ? 16.281  -0.121  8.800   1.00 60.53  ? 104 VAL L CB  1 
ATOM   2340 C CG1 . VAL B 2 104 ? 15.715  1.078   8.055   1.00 57.10  ? 104 VAL L CG1 1 
ATOM   2341 C CG2 . VAL B 2 104 ? 15.163  -1.047  9.252   1.00 59.84  ? 104 VAL L CG2 1 
ATOM   2342 N N   . GLU B 2 105 ? 18.741  0.057   6.217   1.00 76.51  ? 105 GLU L N   1 
ATOM   2343 C CA  . GLU B 2 105 ? 19.830  0.881   5.705   1.00 67.98  ? 105 GLU L CA  1 
ATOM   2344 C C   . GLU B 2 105 ? 19.304  2.142   5.026   1.00 69.44  ? 105 GLU L C   1 
ATOM   2345 O O   . GLU B 2 105 ? 18.174  2.173   4.538   1.00 59.73  ? 105 GLU L O   1 
ATOM   2346 C CB  . GLU B 2 105 ? 20.691  0.078   4.727   1.00 61.24  ? 105 GLU L CB  1 
ATOM   2347 N N   . ILE B 2 106 ? 20.135  3.179   5.000   1.00 63.89  ? 106 ILE L N   1 
ATOM   2348 C CA  . ILE B 2 106 ? 19.764  4.449   4.386   1.00 66.61  ? 106 ILE L CA  1 
ATOM   2349 C C   . ILE B 2 106 ? 19.803  4.353   2.864   1.00 65.64  ? 106 ILE L C   1 
ATOM   2350 O O   . ILE B 2 106 ? 20.753  3.820   2.293   1.00 66.66  ? 106 ILE L O   1 
ATOM   2351 C CB  . ILE B 2 106 ? 20.695  5.589   4.846   1.00 67.56  ? 106 ILE L CB  1 
ATOM   2352 C CG1 . ILE B 2 106 ? 20.824  5.592   6.371   1.00 68.40  ? 106 ILE L CG1 1 
ATOM   2353 C CG2 . ILE B 2 106 ? 20.189  6.933   4.341   1.00 62.89  ? 106 ILE L CG2 1 
ATOM   2354 C CD1 . ILE B 2 106 ? 21.728  6.682   6.903   1.00 67.66  ? 106 ILE L CD1 1 
ATOM   2355 N N   . LYS B 2 107 ? 18.766  4.870   2.213   1.00 67.55  ? 107 LYS L N   1 
ATOM   2356 C CA  . LYS B 2 107 ? 18.695  4.858   0.756   1.00 71.08  ? 107 LYS L CA  1 
ATOM   2357 C C   . LYS B 2 107 ? 19.094  6.209   0.172   1.00 82.85  ? 107 LYS L C   1 
ATOM   2358 O O   . LYS B 2 107 ? 18.569  7.248   0.570   1.00 87.26  ? 107 LYS L O   1 
ATOM   2359 C CB  . LYS B 2 107 ? 17.288  4.481   0.289   1.00 71.72  ? 107 LYS L CB  1 
ATOM   2360 N N   . ARG B 2 108 ? 20.027  6.185   -0.775  1.00 73.80  ? 108 ARG L N   1 
ATOM   2361 C CA  . ARG B 2 108 ? 20.491  7.403   -1.428  1.00 67.39  ? 108 ARG L CA  1 
ATOM   2362 C C   . ARG B 2 108 ? 20.640  7.198   -2.931  1.00 70.42  ? 108 ARG L C   1 
ATOM   2363 O O   . ARG B 2 108 ? 20.337  6.126   -3.454  1.00 72.75  ? 108 ARG L O   1 
ATOM   2364 C CB  . ARG B 2 108 ? 21.823  7.861   -0.833  1.00 64.88  ? 108 ARG L CB  1 
ATOM   2365 C CG  . ARG B 2 108 ? 22.949  6.851   -0.987  1.00 64.51  ? 108 ARG L CG  1 
ATOM   2366 C CD  . ARG B 2 108 ? 24.305  7.528   -0.898  1.00 66.77  ? 108 ARG L CD  1 
ATOM   2367 N NE  . ARG B 2 108 ? 24.557  8.383   -2.054  1.00 74.95  ? 108 ARG L NE  1 
ATOM   2368 C CZ  . ARG B 2 108 ? 25.532  9.283   -2.121  1.00 73.31  ? 108 ARG L CZ  1 
ATOM   2369 N NH1 . ARG B 2 108 ? 26.350  9.457   -1.093  1.00 56.77  ? 108 ARG L NH1 1 
ATOM   2370 N NH2 . ARG B 2 108 ? 25.685  10.015  -3.216  1.00 80.13  ? 108 ARG L NH2 1 
ATOM   2371 N N   . THR B 2 109 ? 21.113  8.233   -3.619  1.00 72.95  ? 109 THR L N   1 
ATOM   2372 C CA  . THR B 2 109 ? 21.344  8.151   -5.056  1.00 72.13  ? 109 THR L CA  1 
ATOM   2373 C C   . THR B 2 109 ? 22.511  7.220   -5.361  1.00 65.71  ? 109 THR L C   1 
ATOM   2374 O O   . THR B 2 109 ? 23.422  7.063   -4.547  1.00 60.05  ? 109 THR L O   1 
ATOM   2375 C CB  . THR B 2 109 ? 21.627  9.537   -5.667  1.00 80.54  ? 109 THR L CB  1 
ATOM   2376 O OG1 . THR B 2 109 ? 22.829  10.077  -5.104  1.00 80.92  ? 109 THR L OG1 1 
ATOM   2377 C CG2 . THR B 2 109 ? 20.471  10.488  -5.394  1.00 86.66  ? 109 THR L CG2 1 
ATOM   2378 N N   . VAL B 2 110 ? 22.475  6.602   -6.537  1.00 61.96  ? 110 VAL L N   1 
ATOM   2379 C CA  . VAL B 2 110 ? 23.513  5.665   -6.951  1.00 59.56  ? 110 VAL L CA  1 
ATOM   2380 C C   . VAL B 2 110 ? 24.853  6.370   -7.140  1.00 58.67  ? 110 VAL L C   1 
ATOM   2381 O O   . VAL B 2 110 ? 24.937  7.395   -7.814  1.00 72.58  ? 110 VAL L O   1 
ATOM   2382 C CB  . VAL B 2 110 ? 23.126  4.944   -8.258  1.00 71.58  ? 110 VAL L CB  1 
ATOM   2383 C CG1 . VAL B 2 110 ? 24.216  3.970   -8.672  1.00 69.98  ? 110 VAL L CG1 1 
ATOM   2384 C CG2 . VAL B 2 110 ? 21.799  4.221   -8.090  1.00 68.17  ? 110 VAL L CG2 1 
ATOM   2385 N N   . ALA B 2 111 ? 25.897  5.816   -6.533  1.00 62.23  ? 111 ALA L N   1 
ATOM   2386 C CA  . ALA B 2 111 ? 27.235  6.382   -6.641  1.00 64.01  ? 111 ALA L CA  1 
ATOM   2387 C C   . ALA B 2 111 ? 28.241  5.321   -7.071  1.00 57.80  ? 111 ALA L C   1 
ATOM   2388 O O   . ALA B 2 111 ? 28.344  4.263   -6.450  1.00 60.00  ? 111 ALA L O   1 
ATOM   2389 C CB  . ALA B 2 111 ? 27.654  7.009   -5.321  1.00 65.39  ? 111 ALA L CB  1 
ATOM   2390 N N   . ALA B 2 112 ? 28.978  5.608   -8.138  1.00 66.85  ? 112 ALA L N   1 
ATOM   2391 C CA  . ALA B 2 112 ? 29.987  4.686   -8.646  1.00 63.74  ? 112 ALA L CA  1 
ATOM   2392 C C   . ALA B 2 112 ? 31.228  4.693   -7.760  1.00 61.19  ? 112 ALA L C   1 
ATOM   2393 O O   . ALA B 2 112 ? 31.648  5.746   -7.282  1.00 62.01  ? 112 ALA L O   1 
ATOM   2394 C CB  . ALA B 2 112 ? 30.355  5.041   -10.078 1.00 53.14  ? 112 ALA L CB  1 
ATOM   2395 N N   . PRO B 2 113 ? 31.817  3.509   -7.536  1.00 53.82  ? 113 PRO L N   1 
ATOM   2396 C CA  . PRO B 2 113 ? 33.019  3.384   -6.706  1.00 54.47  ? 113 PRO L CA  1 
ATOM   2397 C C   . PRO B 2 113 ? 34.286  3.847   -7.416  1.00 68.64  ? 113 PRO L C   1 
ATOM   2398 O O   . PRO B 2 113 ? 34.458  3.589   -8.608  1.00 73.86  ? 113 PRO L O   1 
ATOM   2399 C CB  . PRO B 2 113 ? 33.085  1.883   -6.418  1.00 52.18  ? 113 PRO L CB  1 
ATOM   2400 C CG  . PRO B 2 113 ? 32.426  1.255   -7.595  1.00 56.59  ? 113 PRO L CG  1 
ATOM   2401 C CD  . PRO B 2 113 ? 31.329  2.200   -8.004  1.00 61.33  ? 113 PRO L CD  1 
ATOM   2402 N N   . SER B 2 114 ? 35.159  4.531   -6.685  1.00 72.02  ? 114 SER L N   1 
ATOM   2403 C CA  . SER B 2 114 ? 36.484  4.860   -7.190  1.00 65.67  ? 114 SER L CA  1 
ATOM   2404 C C   . SER B 2 114 ? 37.411  3.679   -6.931  1.00 58.69  ? 114 SER L C   1 
ATOM   2405 O O   . SER B 2 114 ? 37.613  3.280   -5.785  1.00 57.86  ? 114 SER L O   1 
ATOM   2406 C CB  . SER B 2 114 ? 37.023  6.130   -6.531  1.00 72.63  ? 114 SER L CB  1 
ATOM   2407 O OG  . SER B 2 114 ? 36.169  7.233   -6.778  1.00 77.14  ? 114 SER L OG  1 
ATOM   2408 N N   . VAL B 2 115 ? 37.966  3.116   -7.998  1.00 55.03  ? 115 VAL L N   1 
ATOM   2409 C CA  . VAL B 2 115 ? 38.753  1.894   -7.883  1.00 51.64  ? 115 VAL L CA  1 
ATOM   2410 C C   . VAL B 2 115 ? 40.251  2.169   -7.831  1.00 53.79  ? 115 VAL L C   1 
ATOM   2411 O O   . VAL B 2 115 ? 40.793  2.892   -8.667  1.00 62.64  ? 115 VAL L O   1 
ATOM   2412 C CB  . VAL B 2 115 ? 38.465  0.935   -9.053  1.00 52.61  ? 115 VAL L CB  1 
ATOM   2413 C CG1 . VAL B 2 115 ? 39.106  -0.420  -8.796  1.00 42.17  ? 115 VAL L CG1 1 
ATOM   2414 C CG2 . VAL B 2 115 ? 36.967  0.786   -9.253  1.00 48.71  ? 115 VAL L CG2 1 
ATOM   2415 N N   . PHE B 2 116 ? 40.912  1.584   -6.837  1.00 51.31  ? 116 PHE L N   1 
ATOM   2416 C CA  . PHE B 2 116 ? 42.360  1.682   -6.702  1.00 48.20  ? 116 PHE L CA  1 
ATOM   2417 C C   . PHE B 2 116 ? 42.961  0.298   -6.482  1.00 57.15  ? 116 PHE L C   1 
ATOM   2418 O O   . PHE B 2 116 ? 42.399  -0.521  -5.755  1.00 67.78  ? 116 PHE L O   1 
ATOM   2419 C CB  . PHE B 2 116 ? 42.740  2.607   -5.543  1.00 44.04  ? 116 PHE L CB  1 
ATOM   2420 C CG  . PHE B 2 116 ? 42.131  3.977   -5.631  1.00 47.64  ? 116 PHE L CG  1 
ATOM   2421 C CD1 . PHE B 2 116 ? 40.960  4.274   -4.953  1.00 51.48  ? 116 PHE L CD1 1 
ATOM   2422 C CD2 . PHE B 2 116 ? 42.731  4.970   -6.388  1.00 52.01  ? 116 PHE L CD2 1 
ATOM   2423 C CE1 . PHE B 2 116 ? 40.397  5.534   -5.030  1.00 45.93  ? 116 PHE L CE1 1 
ATOM   2424 C CE2 . PHE B 2 116 ? 42.173  6.232   -6.469  1.00 57.60  ? 116 PHE L CE2 1 
ATOM   2425 C CZ  . PHE B 2 116 ? 41.005  6.515   -5.789  1.00 52.06  ? 116 PHE L CZ  1 
ATOM   2426 N N   . ILE B 2 117 ? 44.102  0.039   -7.111  1.00 52.42  ? 117 ILE L N   1 
ATOM   2427 C CA  . ILE B 2 117 ? 44.791  -1.233  -6.931  1.00 40.83  ? 117 ILE L CA  1 
ATOM   2428 C C   . ILE B 2 117 ? 46.169  -0.997  -6.312  1.00 57.21  ? 117 ILE L C   1 
ATOM   2429 O O   . ILE B 2 117 ? 46.849  -0.024  -6.638  1.00 63.05  ? 117 ILE L O   1 
ATOM   2430 C CB  . ILE B 2 117 ? 44.918  -2.003  -8.268  1.00 57.78  ? 117 ILE L CB  1 
ATOM   2431 C CG1 . ILE B 2 117 ? 45.514  -3.394  -8.040  1.00 52.70  ? 117 ILE L CG1 1 
ATOM   2432 C CG2 . ILE B 2 117 ? 45.729  -1.209  -9.286  1.00 53.59  ? 117 ILE L CG2 1 
ATOM   2433 C CD1 . ILE B 2 117 ? 45.501  -4.270  -9.273  1.00 43.43  ? 117 ILE L CD1 1 
ATOM   2434 N N   . PHE B 2 118 ? 46.565  -1.879  -5.399  1.00 57.68  ? 118 PHE L N   1 
ATOM   2435 C CA  . PHE B 2 118 ? 47.838  -1.734  -4.703  1.00 50.99  ? 118 PHE L CA  1 
ATOM   2436 C C   . PHE B 2 118 ? 48.717  -2.968  -4.861  1.00 59.88  ? 118 PHE L C   1 
ATOM   2437 O O   . PHE B 2 118 ? 48.316  -4.072  -4.495  1.00 55.90  ? 118 PHE L O   1 
ATOM   2438 C CB  . PHE B 2 118 ? 47.609  -1.455  -3.216  1.00 49.12  ? 118 PHE L CB  1 
ATOM   2439 C CG  . PHE B 2 118 ? 46.786  -0.230  -2.947  1.00 48.96  ? 118 PHE L CG  1 
ATOM   2440 C CD1 . PHE B 2 118 ? 47.364  1.028   -2.973  1.00 43.61  ? 118 PHE L CD1 1 
ATOM   2441 C CD2 . PHE B 2 118 ? 45.435  -0.337  -2.658  1.00 49.66  ? 118 PHE L CD2 1 
ATOM   2442 C CE1 . PHE B 2 118 ? 46.609  2.159   -2.723  1.00 57.07  ? 118 PHE L CE1 1 
ATOM   2443 C CE2 . PHE B 2 118 ? 44.674  0.789   -2.406  1.00 45.12  ? 118 PHE L CE2 1 
ATOM   2444 C CZ  . PHE B 2 118 ? 45.262  2.039   -2.439  1.00 49.34  ? 118 PHE L CZ  1 
ATOM   2445 N N   . PRO B 2 119 ? 49.926  -2.780  -5.411  1.00 64.15  ? 119 PRO L N   1 
ATOM   2446 C CA  . PRO B 2 119 ? 50.915  -3.858  -5.500  1.00 68.44  ? 119 PRO L CA  1 
ATOM   2447 C C   . PRO B 2 119 ? 51.523  -4.156  -4.134  1.00 64.85  ? 119 PRO L C   1 
ATOM   2448 O O   . PRO B 2 119 ? 51.605  -3.253  -3.301  1.00 70.56  ? 119 PRO L O   1 
ATOM   2449 C CB  . PRO B 2 119 ? 51.963  -3.292  -6.459  1.00 72.73  ? 119 PRO L CB  1 
ATOM   2450 C CG  . PRO B 2 119 ? 51.872  -1.818  -6.272  1.00 76.62  ? 119 PRO L CG  1 
ATOM   2451 C CD  . PRO B 2 119 ? 50.421  -1.525  -6.002  1.00 71.44  ? 119 PRO L CD  1 
ATOM   2452 N N   . PRO B 2 120 ? 51.938  -5.410  -3.900  1.00 63.40  ? 120 PRO L N   1 
ATOM   2453 C CA  . PRO B 2 120 ? 52.559  -5.771  -2.622  1.00 69.39  ? 120 PRO L CA  1 
ATOM   2454 C C   . PRO B 2 120 ? 53.888  -5.051  -2.420  1.00 68.43  ? 120 PRO L C   1 
ATOM   2455 O O   . PRO B 2 120 ? 54.685  -4.963  -3.353  1.00 60.01  ? 120 PRO L O   1 
ATOM   2456 C CB  . PRO B 2 120 ? 52.764  -7.285  -2.743  1.00 67.15  ? 120 PRO L CB  1 
ATOM   2457 C CG  . PRO B 2 120 ? 52.808  -7.544  -4.207  1.00 64.93  ? 120 PRO L CG  1 
ATOM   2458 C CD  . PRO B 2 120 ? 51.865  -6.555  -4.823  1.00 62.72  ? 120 PRO L CD  1 
ATOM   2459 N N   . SER B 2 121 ? 54.111  -4.537  -1.214  1.00 62.09  ? 121 SER L N   1 
ATOM   2460 C CA  . SER B 2 121 ? 55.327  -3.792  -0.909  1.00 63.95  ? 121 SER L CA  1 
ATOM   2461 C C   . SER B 2 121 ? 56.561  -4.687  -0.964  1.00 62.07  ? 121 SER L C   1 
ATOM   2462 O O   . SER B 2 121 ? 56.460  -5.909  -0.845  1.00 67.31  ? 121 SER L O   1 
ATOM   2463 C CB  . SER B 2 121 ? 55.220  -3.135  0.469   1.00 64.26  ? 121 SER L CB  1 
ATOM   2464 O OG  . SER B 2 121 ? 55.115  -4.110  1.492   1.00 66.93  ? 121 SER L OG  1 
ATOM   2465 N N   . ASP B 2 122 ? 57.724  -4.071  -1.143  1.00 56.92  ? 122 ASP L N   1 
ATOM   2466 C CA  . ASP B 2 122 ? 58.983  -4.805  -1.169  1.00 70.38  ? 122 ASP L CA  1 
ATOM   2467 C C   . ASP B 2 122 ? 59.311  -5.364  0.212   1.00 79.92  ? 122 ASP L C   1 
ATOM   2468 O O   . ASP B 2 122 ? 60.058  -6.334  0.339   1.00 91.77  ? 122 ASP L O   1 
ATOM   2469 C CB  . ASP B 2 122 ? 60.120  -3.906  -1.659  1.00 81.05  ? 122 ASP L CB  1 
ATOM   2470 N N   . GLU B 2 123 ? 58.743  -4.746  1.243   1.00 69.51  ? 123 GLU L N   1 
ATOM   2471 C CA  . GLU B 2 123 ? 58.948  -5.193  2.615   1.00 72.31  ? 123 GLU L CA  1 
ATOM   2472 C C   . GLU B 2 123 ? 58.272  -6.538  2.857   1.00 76.49  ? 123 GLU L C   1 
ATOM   2473 O O   . GLU B 2 123 ? 58.814  -7.402  3.546   1.00 85.10  ? 123 GLU L O   1 
ATOM   2474 C CB  . GLU B 2 123 ? 58.417  -4.151  3.603   1.00 68.79  ? 123 GLU L CB  1 
ATOM   2475 C CG  . GLU B 2 123 ? 59.057  -2.779  3.468   1.00 64.84  ? 123 GLU L CG  1 
ATOM   2476 N N   . GLN B 2 124 ? 57.085  -6.709  2.283   1.00 72.23  ? 124 GLN L N   1 
ATOM   2477 C CA  . GLN B 2 124 ? 56.323  -7.939  2.452   1.00 64.04  ? 124 GLN L CA  1 
ATOM   2478 C C   . GLN B 2 124 ? 56.882  -9.063  1.586   1.00 71.51  ? 124 GLN L C   1 
ATOM   2479 O O   . GLN B 2 124 ? 56.836  -10.233 1.967   1.00 69.23  ? 124 GLN L O   1 
ATOM   2480 C CB  . GLN B 2 124 ? 54.850  -7.706  2.118   1.00 53.75  ? 124 GLN L CB  1 
ATOM   2481 C CG  . GLN B 2 124 ? 53.940  -8.857  2.505   1.00 55.66  ? 124 GLN L CG  1 
ATOM   2482 C CD  . GLN B 2 124 ? 52.551  -8.721  1.919   1.00 61.22  ? 124 GLN L CD  1 
ATOM   2483 O OE1 . GLN B 2 124 ? 52.267  -7.780  1.178   1.00 54.68  ? 124 GLN L OE1 1 
ATOM   2484 N NE2 . GLN B 2 124 ? 51.674  -9.661  2.253   1.00 67.75  ? 124 GLN L NE2 1 
ATOM   2485 N N   . LEU B 2 125 ? 57.408  -8.700  0.420   1.00 63.13  ? 125 LEU L N   1 
ATOM   2486 C CA  . LEU B 2 125 ? 57.980  -9.674  -0.502  1.00 72.00  ? 125 LEU L CA  1 
ATOM   2487 C C   . LEU B 2 125 ? 59.225  -10.333 0.081   1.00 81.73  ? 125 LEU L C   1 
ATOM   2488 O O   . LEU B 2 125 ? 59.539  -11.479 -0.241  1.00 100.60 ? 125 LEU L O   1 
ATOM   2489 C CB  . LEU B 2 125 ? 58.320  -9.012  -1.839  1.00 65.01  ? 125 LEU L CB  1 
ATOM   2490 C CG  . LEU B 2 125 ? 57.135  -8.625  -2.725  1.00 59.75  ? 125 LEU L CG  1 
ATOM   2491 C CD1 . LEU B 2 125 ? 57.607  -7.876  -3.962  1.00 59.93  ? 125 LEU L CD1 1 
ATOM   2492 C CD2 . LEU B 2 125 ? 56.338  -9.860  -3.112  1.00 59.27  ? 125 LEU L CD2 1 
ATOM   2493 N N   . LYS B 2 126 ? 59.931  -9.604  0.939   1.00 77.67  ? 126 LYS L N   1 
ATOM   2494 C CA  . LYS B 2 126 ? 61.130  -10.127 1.582   1.00 87.61  ? 126 LYS L CA  1 
ATOM   2495 C C   . LYS B 2 126 ? 60.779  -11.229 2.576   1.00 93.08  ? 126 LYS L C   1 
ATOM   2496 O O   . LYS B 2 126 ? 61.595  -12.106 2.857   1.00 104.11 ? 126 LYS L O   1 
ATOM   2497 C CB  . LYS B 2 126 ? 61.896  -9.005  2.285   1.00 87.35  ? 126 LYS L CB  1 
ATOM   2498 N N   . SER B 2 127 ? 59.560  -11.178 3.104   1.00 84.24  ? 127 SER L N   1 
ATOM   2499 C CA  . SER B 2 127 ? 59.094  -12.185 4.052   1.00 87.83  ? 127 SER L CA  1 
ATOM   2500 C C   . SER B 2 127 ? 58.747  -13.489 3.341   1.00 100.46 ? 127 SER L C   1 
ATOM   2501 O O   . SER B 2 127 ? 58.958  -14.575 3.881   1.00 110.75 ? 127 SER L O   1 
ATOM   2502 C CB  . SER B 2 127 ? 57.882  -11.670 4.831   1.00 81.83  ? 127 SER L CB  1 
ATOM   2503 O OG  . SER B 2 127 ? 56.799  -11.385 3.963   1.00 86.92  ? 127 SER L OG  1 
ATOM   2504 N N   . GLY B 2 128 ? 58.212  -13.377 2.128   1.00 99.84  ? 128 GLY L N   1 
ATOM   2505 C CA  . GLY B 2 128 ? 57.876  -14.544 1.333   1.00 93.33  ? 128 GLY L CA  1 
ATOM   2506 C C   . GLY B 2 128 ? 56.398  -14.656 1.013   1.00 88.36  ? 128 GLY L C   1 
ATOM   2507 O O   . GLY B 2 128 ? 55.897  -15.743 0.725   1.00 80.80  ? 128 GLY L O   1 
ATOM   2508 N N   . THR B 2 129 ? 55.697  -13.528 1.063   1.00 85.39  ? 129 THR L N   1 
ATOM   2509 C CA  . THR B 2 129 ? 54.269  -13.499 0.766   1.00 77.40  ? 129 THR L CA  1 
ATOM   2510 C C   . THR B 2 129 ? 53.904  -12.216 0.025   1.00 67.90  ? 129 THR L C   1 
ATOM   2511 O O   . THR B 2 129 ? 54.436  -11.147 0.321   1.00 73.71  ? 129 THR L O   1 
ATOM   2512 C CB  . THR B 2 129 ? 53.421  -13.612 2.051   1.00 77.57  ? 129 THR L CB  1 
ATOM   2513 O OG1 . THR B 2 129 ? 53.875  -14.725 2.829   1.00 89.40  ? 129 THR L OG1 1 
ATOM   2514 C CG2 . THR B 2 129 ? 51.950  -13.806 1.712   1.00 76.10  ? 129 THR L CG2 1 
ATOM   2515 N N   . ALA B 2 130 ? 53.002  -12.327 -0.946  1.00 66.78  ? 130 ALA L N   1 
ATOM   2516 C CA  . ALA B 2 130 ? 52.557  -11.169 -1.711  1.00 60.83  ? 130 ALA L CA  1 
ATOM   2517 C C   . ALA B 2 130 ? 51.055  -10.958 -1.566  1.00 65.17  ? 130 ALA L C   1 
ATOM   2518 O O   . ALA B 2 130 ? 50.263  -11.862 -1.829  1.00 69.64  ? 130 ALA L O   1 
ATOM   2519 C CB  . ALA B 2 130 ? 52.930  -11.326 -3.175  1.00 61.32  ? 130 ALA L CB  1 
ATOM   2520 N N   . SER B 2 131 ? 50.670  -9.758  -1.145  1.00 56.73  ? 131 SER L N   1 
ATOM   2521 C CA  . SER B 2 131 ? 49.261  -9.413  -1.003  1.00 55.13  ? 131 SER L CA  1 
ATOM   2522 C C   . SER B 2 131 ? 48.889  -8.240  -1.904  1.00 54.08  ? 131 SER L C   1 
ATOM   2523 O O   . SER B 2 131 ? 49.371  -7.123  -1.716  1.00 58.95  ? 131 SER L O   1 
ATOM   2524 C CB  . SER B 2 131 ? 48.931  -9.081  0.454   1.00 56.86  ? 131 SER L CB  1 
ATOM   2525 O OG  . SER B 2 131 ? 49.112  -10.210 1.291   1.00 67.75  ? 131 SER L OG  1 
ATOM   2526 N N   . VAL B 2 132 ? 48.030  -8.503  -2.883  1.00 43.64  ? 132 VAL L N   1 
ATOM   2527 C CA  . VAL B 2 132 ? 47.546  -7.457  -3.775  1.00 48.95  ? 132 VAL L CA  1 
ATOM   2528 C C   . VAL B 2 132 ? 46.166  -6.982  -3.326  1.00 49.98  ? 132 VAL L C   1 
ATOM   2529 O O   . VAL B 2 132 ? 45.251  -7.785  -3.146  1.00 48.10  ? 132 VAL L O   1 
ATOM   2530 C CB  . VAL B 2 132 ? 47.476  -7.941  -5.235  1.00 46.03  ? 132 VAL L CB  1 
ATOM   2531 C CG1 . VAL B 2 132 ? 47.330  -6.758  -6.175  1.00 44.98  ? 132 VAL L CG1 1 
ATOM   2532 C CG2 . VAL B 2 132 ? 48.719  -8.742  -5.584  1.00 48.22  ? 132 VAL L CG2 1 
ATOM   2533 N N   . VAL B 2 133 ? 46.022  -5.673  -3.146  1.00 48.15  ? 133 VAL L N   1 
ATOM   2534 C CA  . VAL B 2 133 ? 44.783  -5.111  -2.623  1.00 47.35  ? 133 VAL L CA  1 
ATOM   2535 C C   . VAL B 2 133 ? 44.058  -4.246  -3.650  1.00 49.27  ? 133 VAL L C   1 
ATOM   2536 O O   . VAL B 2 133 ? 44.652  -3.353  -4.255  1.00 51.90  ? 133 VAL L O   1 
ATOM   2537 C CB  . VAL B 2 133 ? 45.048  -4.269  -1.360  1.00 48.58  ? 133 VAL L CB  1 
ATOM   2538 C CG1 . VAL B 2 133 ? 43.745  -3.723  -0.798  1.00 47.87  ? 133 VAL L CG1 1 
ATOM   2539 C CG2 . VAL B 2 133 ? 45.777  -5.099  -0.315  1.00 45.39  ? 133 VAL L CG2 1 
ATOM   2540 N N   . CYS B 2 134 ? 42.772  -4.522  -3.844  1.00 47.53  ? 134 CYS L N   1 
ATOM   2541 C CA  . CYS B 2 134 ? 41.926  -3.696  -4.697  1.00 47.72  ? 134 CYS L CA  1 
ATOM   2542 C C   . CYS B 2 134 ? 40.931  -2.923  -3.839  1.00 48.08  ? 134 CYS L C   1 
ATOM   2543 O O   . CYS B 2 134 ? 40.200  -3.510  -3.042  1.00 51.94  ? 134 CYS L O   1 
ATOM   2544 C CB  . CYS B 2 134 ? 41.190  -4.553  -5.730  1.00 56.91  ? 134 CYS L CB  1 
ATOM   2545 S SG  . CYS B 2 134 ? 40.419  -3.621  -7.075  1.00 79.62  ? 134 CYS L SG  1 
ATOM   2546 N N   . LEU B 2 135 ? 40.907  -1.605  -4.004  1.00 47.23  ? 135 LEU L N   1 
ATOM   2547 C CA  . LEU B 2 135 ? 40.075  -0.750  -3.164  1.00 51.84  ? 135 LEU L CA  1 
ATOM   2548 C C   . LEU B 2 135 ? 38.871  -0.174  -3.905  1.00 48.52  ? 135 LEU L C   1 
ATOM   2549 O O   . LEU B 2 135 ? 39.008  0.422   -4.973  1.00 49.42  ? 135 LEU L O   1 
ATOM   2550 C CB  . LEU B 2 135 ? 40.913  0.392   -2.584  1.00 40.21  ? 135 LEU L CB  1 
ATOM   2551 C CG  . LEU B 2 135 ? 40.138  1.533   -1.923  1.00 41.44  ? 135 LEU L CG  1 
ATOM   2552 C CD1 . LEU B 2 135 ? 39.399  1.040   -0.689  1.00 51.11  ? 135 LEU L CD1 1 
ATOM   2553 C CD2 . LEU B 2 135 ? 41.065  2.687   -1.576  1.00 45.71  ? 135 LEU L CD2 1 
ATOM   2554 N N   . LEU B 2 136 ? 37.690  -0.361  -3.323  1.00 52.29  ? 136 LEU L N   1 
ATOM   2555 C CA  . LEU B 2 136 ? 36.471  0.268   -3.817  1.00 46.74  ? 136 LEU L CA  1 
ATOM   2556 C C   . LEU B 2 136 ? 36.016  1.305   -2.799  1.00 44.36  ? 136 LEU L C   1 
ATOM   2557 O O   . LEU B 2 136 ? 35.701  0.964   -1.660  1.00 63.83  ? 136 LEU L O   1 
ATOM   2558 C CB  . LEU B 2 136 ? 35.371  -0.768  -4.060  1.00 51.24  ? 136 LEU L CB  1 
ATOM   2559 C CG  . LEU B 2 136 ? 35.416  -1.592  -5.351  1.00 52.73  ? 136 LEU L CG  1 
ATOM   2560 C CD1 . LEU B 2 136 ? 36.586  -2.566  -5.357  1.00 55.98  ? 136 LEU L CD1 1 
ATOM   2561 C CD2 . LEU B 2 136 ? 34.101  -2.331  -5.551  1.00 45.57  ? 136 LEU L CD2 1 
ATOM   2562 N N   . ASN B 2 137 ? 35.987  2.570   -3.205  1.00 42.93  ? 137 ASN L N   1 
ATOM   2563 C CA  . ASN B 2 137 ? 35.745  3.657   -2.263  1.00 52.67  ? 137 ASN L CA  1 
ATOM   2564 C C   . ASN B 2 137 ? 34.452  4.428   -2.514  1.00 55.80  ? 137 ASN L C   1 
ATOM   2565 O O   . ASN B 2 137 ? 34.203  4.898   -3.625  1.00 49.39  ? 137 ASN L O   1 
ATOM   2566 C CB  . ASN B 2 137 ? 36.924  4.632   -2.285  1.00 52.39  ? 137 ASN L CB  1 
ATOM   2567 C CG  . ASN B 2 137 ? 36.736  5.792   -1.330  1.00 70.94  ? 137 ASN L CG  1 
ATOM   2568 O OD1 . ASN B 2 137 ? 36.233  5.624   -0.220  1.00 88.30  ? 137 ASN L OD1 1 
ATOM   2569 N ND2 . ASN B 2 137 ? 37.135  6.983   -1.762  1.00 71.88  ? 137 ASN L ND2 1 
ATOM   2570 N N   . ASN B 2 138 ? 33.642  4.549   -1.463  1.00 57.49  ? 138 ASN L N   1 
ATOM   2571 C CA  . ASN B 2 138 ? 32.430  5.368   -1.470  1.00 53.45  ? 138 ASN L CA  1 
ATOM   2572 C C   . ASN B 2 138 ? 31.479  5.067   -2.624  1.00 49.39  ? 138 ASN L C   1 
ATOM   2573 O O   . ASN B 2 138 ? 31.477  5.769   -3.635  1.00 58.22  ? 138 ASN L O   1 
ATOM   2574 C CB  . ASN B 2 138 ? 32.802  6.853   -1.492  1.00 53.06  ? 138 ASN L CB  1 
ATOM   2575 C CG  . ASN B 2 138 ? 33.504  7.295   -0.222  1.00 61.22  ? 138 ASN L CG  1 
ATOM   2576 O OD1 . ASN B 2 138 ? 33.369  6.664   0.826   1.00 59.37  ? 138 ASN L OD1 1 
ATOM   2577 N ND2 . ASN B 2 138 ? 34.257  8.385   -0.310  1.00 70.90  ? 138 ASN L ND2 1 
ATOM   2578 N N   . PHE B 2 139 ? 30.666  4.027   -2.468  1.00 50.85  ? 139 PHE L N   1 
ATOM   2579 C CA  . PHE B 2 139 ? 29.699  3.668   -3.497  1.00 57.59  ? 139 PHE L CA  1 
ATOM   2580 C C   . PHE B 2 139 ? 28.348  3.266   -2.914  1.00 54.27  ? 139 PHE L C   1 
ATOM   2581 O O   . PHE B 2 139 ? 28.226  2.982   -1.722  1.00 66.06  ? 139 PHE L O   1 
ATOM   2582 C CB  . PHE B 2 139 ? 30.244  2.537   -4.375  1.00 55.19  ? 139 PHE L CB  1 
ATOM   2583 C CG  . PHE B 2 139 ? 30.523  1.261   -3.629  1.00 53.34  ? 139 PHE L CG  1 
ATOM   2584 C CD1 . PHE B 2 139 ? 29.546  0.286   -3.505  1.00 52.62  ? 139 PHE L CD1 1 
ATOM   2585 C CD2 . PHE B 2 139 ? 31.766  1.030   -3.064  1.00 50.32  ? 139 PHE L CD2 1 
ATOM   2586 C CE1 . PHE B 2 139 ? 29.800  -0.889  -2.823  1.00 44.52  ? 139 PHE L CE1 1 
ATOM   2587 C CE2 . PHE B 2 139 ? 32.026  -0.144  -2.382  1.00 44.67  ? 139 PHE L CE2 1 
ATOM   2588 C CZ  . PHE B 2 139 ? 31.042  -1.104  -2.262  1.00 45.68  ? 139 PHE L CZ  1 
ATOM   2589 N N   . TYR B 2 140 ? 27.338  3.249   -3.776  1.00 54.69  ? 140 TYR L N   1 
ATOM   2590 C CA  . TYR B 2 140 ? 25.995  2.825   -3.407  1.00 48.06  ? 140 TYR L CA  1 
ATOM   2591 C C   . TYR B 2 140 ? 25.261  2.373   -4.666  1.00 47.77  ? 140 TYR L C   1 
ATOM   2592 O O   . TYR B 2 140 ? 25.349  3.033   -5.701  1.00 56.22  ? 140 TYR L O   1 
ATOM   2593 C CB  . TYR B 2 140 ? 25.237  3.957   -2.707  1.00 49.33  ? 140 TYR L CB  1 
ATOM   2594 C CG  . TYR B 2 140 ? 23.931  3.520   -2.083  1.00 52.71  ? 140 TYR L CG  1 
ATOM   2595 C CD1 . TYR B 2 140 ? 23.897  2.981   -0.804  1.00 49.62  ? 140 TYR L CD1 1 
ATOM   2596 C CD2 . TYR B 2 140 ? 22.733  3.638   -2.776  1.00 50.45  ? 140 TYR L CD2 1 
ATOM   2597 C CE1 . TYR B 2 140 ? 22.706  2.575   -0.230  1.00 55.54  ? 140 TYR L CE1 1 
ATOM   2598 C CE2 . TYR B 2 140 ? 21.537  3.235   -2.212  1.00 55.92  ? 140 TYR L CE2 1 
ATOM   2599 C CZ  . TYR B 2 140 ? 21.530  2.705   -0.939  1.00 62.57  ? 140 TYR L CZ  1 
ATOM   2600 O OH  . TYR B 2 140 ? 20.342  2.302   -0.374  1.00 75.52  ? 140 TYR L OH  1 
ATOM   2601 N N   . PRO B 2 141 ? 24.527  1.249   -4.589  1.00 50.33  ? 141 PRO L N   1 
ATOM   2602 C CA  . PRO B 2 141 ? 24.269  0.422   -3.403  1.00 52.11  ? 141 PRO L CA  1 
ATOM   2603 C C   . PRO B 2 141 ? 25.441  -0.472  -2.998  1.00 53.45  ? 141 PRO L C   1 
ATOM   2604 O O   . PRO B 2 141 ? 26.507  -0.420  -3.610  1.00 54.23  ? 141 PRO L O   1 
ATOM   2605 C CB  . PRO B 2 141 ? 23.073  -0.426  -3.833  1.00 48.91  ? 141 PRO L CB  1 
ATOM   2606 C CG  . PRO B 2 141 ? 23.254  -0.582  -5.299  1.00 61.37  ? 141 PRO L CG  1 
ATOM   2607 C CD  . PRO B 2 141 ? 23.845  0.717   -5.783  1.00 52.87  ? 141 PRO L CD  1 
ATOM   2608 N N   . ARG B 2 142 ? 25.223  -1.287  -1.971  1.00 54.27  ? 142 ARG L N   1 
ATOM   2609 C CA  . ARG B 2 142 ? 26.275  -2.111  -1.383  1.00 59.73  ? 142 ARG L CA  1 
ATOM   2610 C C   . ARG B 2 142 ? 26.767  -3.204  -2.330  1.00 61.64  ? 142 ARG L C   1 
ATOM   2611 O O   . ARG B 2 142 ? 27.931  -3.603  -2.276  1.00 63.82  ? 142 ARG L O   1 
ATOM   2612 C CB  . ARG B 2 142 ? 25.777  -2.737  -0.078  1.00 59.87  ? 142 ARG L CB  1 
ATOM   2613 C CG  . ARG B 2 142 ? 26.845  -3.465  0.722   1.00 69.94  ? 142 ARG L CG  1 
ATOM   2614 C CD  . ARG B 2 142 ? 26.278  -4.005  2.026   1.00 81.28  ? 142 ARG L CD  1 
ATOM   2615 N NE  . ARG B 2 142 ? 27.281  -4.728  2.803   1.00 86.03  ? 142 ARG L NE  1 
ATOM   2616 C CZ  . ARG B 2 142 ? 27.504  -6.034  2.703   1.00 89.01  ? 142 ARG L CZ  1 
ATOM   2617 N NH1 . ARG B 2 142 ? 26.793  -6.768  1.857   1.00 89.14  ? 142 ARG L NH1 1 
ATOM   2618 N NH2 . ARG B 2 142 ? 28.437  -6.609  3.450   1.00 91.60  ? 142 ARG L NH2 1 
ATOM   2619 N N   . GLU B 2 143 ? 25.877  -3.683  -3.193  1.00 62.65  ? 143 GLU L N   1 
ATOM   2620 C CA  . GLU B 2 143 ? 26.208  -4.758  -4.122  1.00 58.11  ? 143 GLU L CA  1 
ATOM   2621 C C   . GLU B 2 143 ? 27.330  -4.355  -5.074  1.00 56.25  ? 143 GLU L C   1 
ATOM   2622 O O   . GLU B 2 143 ? 27.205  -3.387  -5.824  1.00 59.31  ? 143 GLU L O   1 
ATOM   2623 C CB  . GLU B 2 143 ? 24.971  -5.179  -4.920  1.00 65.94  ? 143 GLU L CB  1 
ATOM   2624 C CG  . GLU B 2 143 ? 23.885  -5.855  -4.090  1.00 80.81  ? 143 GLU L CG  1 
ATOM   2625 C CD  . GLU B 2 143 ? 23.022  -4.868  -3.325  1.00 89.44  ? 143 GLU L CD  1 
ATOM   2626 O OE1 . GLU B 2 143 ? 23.196  -3.646  -3.517  1.00 90.02  ? 143 GLU L OE1 1 
ATOM   2627 O OE2 . GLU B 2 143 ? 22.167  -5.316  -2.533  1.00 94.91  ? 143 GLU L OE2 1 
ATOM   2628 N N   . ALA B 2 144 ? 28.427  -5.104  -5.033  1.00 51.64  ? 144 ALA L N   1 
ATOM   2629 C CA  . ALA B 2 144 ? 29.581  -4.830  -5.881  1.00 54.89  ? 144 ALA L CA  1 
ATOM   2630 C C   . ALA B 2 144 ? 30.373  -6.105  -6.155  1.00 64.03  ? 144 ALA L C   1 
ATOM   2631 O O   . ALA B 2 144 ? 30.733  -6.835  -5.232  1.00 68.30  ? 144 ALA L O   1 
ATOM   2632 C CB  . ALA B 2 144 ? 30.473  -3.778  -5.238  1.00 43.63  ? 144 ALA L CB  1 
ATOM   2633 N N   . LYS B 2 145 ? 30.641  -6.367  -7.430  1.00 68.23  ? 145 LYS L N   1 
ATOM   2634 C CA  . LYS B 2 145 ? 31.371  -7.565  -7.828  1.00 69.01  ? 145 LYS L CA  1 
ATOM   2635 C C   . LYS B 2 145 ? 32.814  -7.241  -8.200  1.00 66.73  ? 145 LYS L C   1 
ATOM   2636 O O   . LYS B 2 145 ? 33.068  -6.461  -9.118  1.00 69.81  ? 145 LYS L O   1 
ATOM   2637 C CB  . LYS B 2 145 ? 30.669  -8.255  -9.000  1.00 66.56  ? 145 LYS L CB  1 
ATOM   2638 N N   . VAL B 2 146 ? 33.754  -7.843  -7.481  1.00 61.31  ? 146 VAL L N   1 
ATOM   2639 C CA  . VAL B 2 146 ? 35.173  -7.645  -7.751  1.00 51.18  ? 146 VAL L CA  1 
ATOM   2640 C C   . VAL B 2 146 ? 35.816  -8.945  -8.218  1.00 55.30  ? 146 VAL L C   1 
ATOM   2641 O O   . VAL B 2 146 ? 35.737  -9.965  -7.534  1.00 57.52  ? 146 VAL L O   1 
ATOM   2642 C CB  . VAL B 2 146 ? 35.920  -7.128  -6.510  1.00 57.67  ? 146 VAL L CB  1 
ATOM   2643 C CG1 . VAL B 2 146 ? 37.354  -6.768  -6.866  1.00 63.34  ? 146 VAL L CG1 1 
ATOM   2644 C CG2 . VAL B 2 146 ? 35.198  -5.929  -5.920  1.00 59.87  ? 146 VAL L CG2 1 
ATOM   2645 N N   . GLN B 2 147 ? 36.451  -8.904  -9.384  1.00 56.06  ? 147 GLN L N   1 
ATOM   2646 C CA  . GLN B 2 147 ? 37.094  -10.089 -9.941  1.00 58.72  ? 147 GLN L CA  1 
ATOM   2647 C C   . GLN B 2 147 ? 38.581  -9.856  -10.186 1.00 60.05  ? 147 GLN L C   1 
ATOM   2648 O O   . GLN B 2 147 ? 38.975  -8.843  -10.763 1.00 60.66  ? 147 GLN L O   1 
ATOM   2649 C CB  . GLN B 2 147 ? 36.406  -10.507 -11.241 1.00 58.05  ? 147 GLN L CB  1 
ATOM   2650 C CG  . GLN B 2 147 ? 34.971  -10.971 -11.056 1.00 65.30  ? 147 GLN L CG  1 
ATOM   2651 C CD  . GLN B 2 147 ? 34.303  -11.338 -12.366 1.00 75.09  ? 147 GLN L CD  1 
ATOM   2652 O OE1 . GLN B 2 147 ? 34.758  -10.943 -13.439 1.00 72.34  ? 147 GLN L OE1 1 
ATOM   2653 N NE2 . GLN B 2 147 ? 33.216  -12.097 -12.284 1.00 81.20  ? 147 GLN L NE2 1 
ATOM   2654 N N   . TRP B 2 148 ? 39.401  -10.803 -9.741  1.00 53.18  ? 148 TRP L N   1 
ATOM   2655 C CA  . TRP B 2 148 ? 40.846  -10.709 -9.907  1.00 53.76  ? 148 TRP L CA  1 
ATOM   2656 C C   . TRP B 2 148 ? 41.313  -11.416 -11.174 1.00 65.65  ? 148 TRP L C   1 
ATOM   2657 O O   . TRP B 2 148 ? 40.973  -12.574 -11.412 1.00 73.59  ? 148 TRP L O   1 
ATOM   2658 C CB  . TRP B 2 148 ? 41.565  -11.297 -8.692  1.00 58.47  ? 148 TRP L CB  1 
ATOM   2659 C CG  . TRP B 2 148 ? 41.500  -10.431 -7.475  1.00 52.41  ? 148 TRP L CG  1 
ATOM   2660 C CD1 . TRP B 2 148 ? 40.609  -10.526 -6.446  1.00 40.88  ? 148 TRP L CD1 1 
ATOM   2661 C CD2 . TRP B 2 148 ? 42.367  -9.336  -7.156  1.00 59.52  ? 148 TRP L CD2 1 
ATOM   2662 N NE1 . TRP B 2 148 ? 40.867  -9.557  -5.506  1.00 52.12  ? 148 TRP L NE1 1 
ATOM   2663 C CE2 . TRP B 2 148 ? 41.941  -8.814  -5.918  1.00 51.75  ? 148 TRP L CE2 1 
ATOM   2664 C CE3 . TRP B 2 148 ? 43.460  -8.748  -7.797  1.00 53.22  ? 148 TRP L CE3 1 
ATOM   2665 C CZ2 . TRP B 2 148 ? 42.572  -7.732  -5.309  1.00 45.56  ? 148 TRP L CZ2 1 
ATOM   2666 C CZ3 . TRP B 2 148 ? 44.084  -7.673  -7.192  1.00 57.46  ? 148 TRP L CZ3 1 
ATOM   2667 C CH2 . TRP B 2 148 ? 43.638  -7.176  -5.961  1.00 59.30  ? 148 TRP L CH2 1 
ATOM   2668 N N   . LYS B 2 149 ? 42.097  -10.710 -11.981 1.00 59.64  ? 149 LYS L N   1 
ATOM   2669 C CA  . LYS B 2 149 ? 42.654  -11.285 -13.198 1.00 58.92  ? 149 LYS L CA  1 
ATOM   2670 C C   . LYS B 2 149 ? 44.175  -11.206 -13.187 1.00 61.76  ? 149 LYS L C   1 
ATOM   2671 O O   . LYS B 2 149 ? 44.752  -10.118 -13.163 1.00 57.71  ? 149 LYS L O   1 
ATOM   2672 C CB  . LYS B 2 149 ? 42.095  -10.577 -14.434 1.00 68.07  ? 149 LYS L CB  1 
ATOM   2673 C CG  . LYS B 2 149 ? 40.601  -10.767 -14.632 1.00 68.98  ? 149 LYS L CG  1 
ATOM   2674 C CD  . LYS B 2 149 ? 40.123  -10.099 -15.911 1.00 65.23  ? 149 LYS L CD  1 
ATOM   2675 N N   . VAL B 2 150 ? 44.819  -12.368 -13.197 1.00 60.28  ? 150 VAL L N   1 
ATOM   2676 C CA  . VAL B 2 150 ? 46.273  -12.445 -13.227 1.00 53.99  ? 150 VAL L CA  1 
ATOM   2677 C C   . VAL B 2 150 ? 46.739  -12.994 -14.570 1.00 61.82  ? 150 VAL L C   1 
ATOM   2678 O O   . VAL B 2 150 ? 46.503  -14.162 -14.882 1.00 67.02  ? 150 VAL L O   1 
ATOM   2679 C CB  . VAL B 2 150 ? 46.815  -13.328 -12.090 1.00 50.92  ? 150 VAL L CB  1 
ATOM   2680 C CG1 . VAL B 2 150 ? 48.324  -13.432 -12.175 1.00 56.18  ? 150 VAL L CG1 1 
ATOM   2681 C CG2 . VAL B 2 150 ? 46.393  -12.770 -10.741 1.00 51.28  ? 150 VAL L CG2 1 
ATOM   2682 N N   . ASP B 2 151 ? 47.402  -12.144 -15.352 1.00 67.91  ? 151 ASP L N   1 
ATOM   2683 C CA  . ASP B 2 151 ? 47.760  -12.458 -16.735 1.00 65.78  ? 151 ASP L CA  1 
ATOM   2684 C C   . ASP B 2 151 ? 46.523  -12.878 -17.523 1.00 56.74  ? 151 ASP L C   1 
ATOM   2685 O O   . ASP B 2 151 ? 46.523  -13.909 -18.197 1.00 67.16  ? 151 ASP L O   1 
ATOM   2686 C CB  . ASP B 2 151 ? 48.829  -13.553 -16.798 1.00 64.68  ? 151 ASP L CB  1 
ATOM   2687 C CG  . ASP B 2 151 ? 50.222  -13.027 -16.511 1.00 70.18  ? 151 ASP L CG  1 
ATOM   2688 O OD1 . ASP B 2 151 ? 50.435  -11.802 -16.634 1.00 66.83  ? 151 ASP L OD1 1 
ATOM   2689 O OD2 . ASP B 2 151 ? 51.107  -13.839 -16.170 1.00 68.36  ? 151 ASP L OD2 1 
ATOM   2690 N N   . ASN B 2 152 ? 45.472  -12.068 -17.417 1.00 59.22  ? 152 ASN L N   1 
ATOM   2691 C CA  . ASN B 2 152 ? 44.197  -12.315 -18.089 1.00 66.45  ? 152 ASN L CA  1 
ATOM   2692 C C   . ASN B 2 152 ? 43.584  -13.668 -17.736 1.00 70.59  ? 152 ASN L C   1 
ATOM   2693 O O   . ASN B 2 152 ? 42.915  -14.290 -18.560 1.00 88.06  ? 152 ASN L O   1 
ATOM   2694 C CB  . ASN B 2 152 ? 44.365  -12.199 -19.606 1.00 64.73  ? 152 ASN L CB  1 
ATOM   2695 C CG  . ASN B 2 152 ? 44.911  -10.850 -20.028 1.00 72.47  ? 152 ASN L CG  1 
ATOM   2696 O OD1 . ASN B 2 152 ? 44.200  -9.846  -20.007 1.00 80.29  ? 152 ASN L OD1 1 
ATOM   2697 N ND2 . ASN B 2 152 ? 46.181  -10.821 -20.415 1.00 73.49  ? 152 ASN L ND2 1 
ATOM   2698 N N   . ALA B 2 153 ? 43.815  -14.115 -16.506 1.00 68.00  ? 153 ALA L N   1 
ATOM   2699 C CA  . ALA B 2 153 ? 43.235  -15.362 -16.020 1.00 66.70  ? 153 ALA L CA  1 
ATOM   2700 C C   . ALA B 2 153 ? 42.432  -15.118 -14.747 1.00 59.28  ? 153 ALA L C   1 
ATOM   2701 O O   . ALA B 2 153 ? 42.955  -14.591 -13.765 1.00 58.96  ? 153 ALA L O   1 
ATOM   2702 C CB  . ALA B 2 153 ? 44.321  -16.397 -15.776 1.00 60.35  ? 153 ALA L CB  1 
ATOM   2703 N N   . LEU B 2 154 ? 41.159  -15.501 -14.773 1.00 57.51  ? 154 LEU L N   1 
ATOM   2704 C CA  . LEU B 2 154 ? 40.266  -15.289 -13.639 1.00 59.93  ? 154 LEU L CA  1 
ATOM   2705 C C   . LEU B 2 154 ? 40.659  -16.150 -12.444 1.00 65.38  ? 154 LEU L C   1 
ATOM   2706 O O   . LEU B 2 154 ? 40.732  -17.375 -12.545 1.00 73.16  ? 154 LEU L O   1 
ATOM   2707 C CB  . LEU B 2 154 ? 38.818  -15.579 -14.038 1.00 64.63  ? 154 LEU L CB  1 
ATOM   2708 N N   . GLN B 2 155 ? 40.909  -15.501 -11.312 1.00 66.36  ? 155 GLN L N   1 
ATOM   2709 C CA  . GLN B 2 155 ? 41.298  -16.202 -10.094 1.00 70.61  ? 155 GLN L CA  1 
ATOM   2710 C C   . GLN B 2 155 ? 40.073  -16.638 -9.299  1.00 66.34  ? 155 GLN L C   1 
ATOM   2711 O O   . GLN B 2 155 ? 38.971  -16.136 -9.519  1.00 68.37  ? 155 GLN L O   1 
ATOM   2712 C CB  . GLN B 2 155 ? 42.199  -15.315 -9.233  1.00 69.81  ? 155 GLN L CB  1 
ATOM   2713 C CG  . GLN B 2 155 ? 43.427  -14.803 -9.963  1.00 75.03  ? 155 GLN L CG  1 
ATOM   2714 C CD  . GLN B 2 155 ? 44.270  -15.924 -10.538 1.00 79.08  ? 155 GLN L CD  1 
ATOM   2715 O OE1 . GLN B 2 155 ? 44.613  -16.878 -9.841  1.00 77.82  ? 155 GLN L OE1 1 
ATOM   2716 N NE2 . GLN B 2 155 ? 44.600  -15.818 -11.820 1.00 82.87  ? 155 GLN L NE2 1 
ATOM   2717 N N   . SER B 2 156 ? 40.272  -17.574 -8.375  1.00 69.02  ? 156 SER L N   1 
ATOM   2718 C CA  . SER B 2 156 ? 39.176  -18.087 -7.560  1.00 72.47  ? 156 SER L CA  1 
ATOM   2719 C C   . SER B 2 156 ? 39.674  -18.770 -6.289  1.00 77.35  ? 156 SER L C   1 
ATOM   2720 O O   . SER B 2 156 ? 40.570  -19.613 -6.335  1.00 81.35  ? 156 SER L O   1 
ATOM   2721 C CB  . SER B 2 156 ? 38.324  -19.065 -8.373  1.00 69.75  ? 156 SER L CB  1 
ATOM   2722 N N   . GLY B 2 157 ? 39.086  -18.398 -5.156  1.00 78.60  ? 157 GLY L N   1 
ATOM   2723 C CA  . GLY B 2 157 ? 39.378  -19.046 -3.891  1.00 81.49  ? 157 GLY L CA  1 
ATOM   2724 C C   . GLY B 2 157 ? 40.665  -18.598 -3.224  1.00 83.04  ? 157 GLY L C   1 
ATOM   2725 O O   . GLY B 2 157 ? 41.082  -19.175 -2.220  1.00 90.98  ? 157 GLY L O   1 
ATOM   2726 N N   . ASN B 2 158 ? 41.297  -17.568 -3.776  1.00 72.40  ? 158 ASN L N   1 
ATOM   2727 C CA  . ASN B 2 158 ? 42.545  -17.060 -3.218  1.00 71.34  ? 158 ASN L CA  1 
ATOM   2728 C C   . ASN B 2 158 ? 42.453  -15.585 -2.842  1.00 64.46  ? 158 ASN L C   1 
ATOM   2729 O O   . ASN B 2 158 ? 43.461  -14.880 -2.808  1.00 51.10  ? 158 ASN L O   1 
ATOM   2730 C CB  . ASN B 2 158 ? 43.695  -17.276 -4.203  1.00 73.68  ? 158 ASN L CB  1 
ATOM   2731 C CG  . ASN B 2 158 ? 43.462  -16.588 -5.534  1.00 81.57  ? 158 ASN L CG  1 
ATOM   2732 O OD1 . ASN B 2 158 ? 42.327  -16.271 -5.892  1.00 72.90  ? 158 ASN L OD1 1 
ATOM   2733 N ND2 . ASN B 2 158 ? 44.538  -16.357 -6.276  1.00 91.73  ? 158 ASN L ND2 1 
ATOM   2734 N N   . SER B 2 159 ? 41.239  -15.126 -2.556  1.00 64.52  ? 159 SER L N   1 
ATOM   2735 C CA  . SER B 2 159 ? 41.018  -13.730 -2.197  1.00 55.99  ? 159 SER L CA  1 
ATOM   2736 C C   . SER B 2 159 ? 39.982  -13.586 -1.087  1.00 54.75  ? 159 SER L C   1 
ATOM   2737 O O   . SER B 2 159 ? 39.030  -14.363 -1.005  1.00 53.85  ? 159 SER L O   1 
ATOM   2738 C CB  . SER B 2 159 ? 40.579  -12.927 -3.422  1.00 56.97  ? 159 SER L CB  1 
ATOM   2739 O OG  . SER B 2 159 ? 39.310  -13.356 -3.883  1.00 60.28  ? 159 SER L OG  1 
ATOM   2740 N N   . GLN B 2 160 ? 40.180  -12.588 -0.233  1.00 55.23  ? 160 GLN L N   1 
ATOM   2741 C CA  . GLN B 2 160 ? 39.224  -12.270 0.819   1.00 55.10  ? 160 GLN L CA  1 
ATOM   2742 C C   . GLN B 2 160 ? 38.840  -10.798 0.744   1.00 55.45  ? 160 GLN L C   1 
ATOM   2743 O O   . GLN B 2 160 ? 39.632  -9.964  0.306   1.00 50.81  ? 160 GLN L O   1 
ATOM   2744 C CB  . GLN B 2 160 ? 39.800  -12.599 2.198   1.00 47.95  ? 160 GLN L CB  1 
ATOM   2745 C CG  . GLN B 2 160 ? 39.957  -14.086 2.471   1.00 57.80  ? 160 GLN L CG  1 
ATOM   2746 C CD  . GLN B 2 160 ? 40.429  -14.372 3.884   1.00 74.34  ? 160 GLN L CD  1 
ATOM   2747 O OE1 . GLN B 2 160 ? 41.172  -13.587 4.473   1.00 79.15  ? 160 GLN L OE1 1 
ATOM   2748 N NE2 . GLN B 2 160 ? 39.997  -15.500 4.436   1.00 78.28  ? 160 GLN L NE2 1 
ATOM   2749 N N   . GLU B 2 161 ? 37.621  -10.481 1.167   1.00 53.79  ? 161 GLU L N   1 
ATOM   2750 C CA  . GLU B 2 161 ? 37.145  -9.105  1.129   1.00 54.48  ? 161 GLU L CA  1 
ATOM   2751 C C   . GLU B 2 161 ? 36.367  -8.741  2.387   1.00 54.63  ? 161 GLU L C   1 
ATOM   2752 O O   . GLU B 2 161 ? 35.884  -9.614  3.109   1.00 48.06  ? 161 GLU L O   1 
ATOM   2753 C CB  . GLU B 2 161 ? 36.270  -8.877  -0.105  1.00 57.20  ? 161 GLU L CB  1 
ATOM   2754 C CG  . GLU B 2 161 ? 34.926  -9.583  -0.050  1.00 65.15  ? 161 GLU L CG  1 
ATOM   2755 C CD  . GLU B 2 161 ? 34.043  -9.250  -1.236  1.00 79.20  ? 161 GLU L CD  1 
ATOM   2756 O OE1 . GLU B 2 161 ? 34.585  -8.850  -2.288  1.00 73.25  ? 161 GLU L OE1 1 
ATOM   2757 O OE2 . GLU B 2 161 ? 32.807  -9.387  -1.116  1.00 86.48  ? 161 GLU L OE2 1 
ATOM   2758 N N   . SER B 2 162 ? 36.256  -7.442  2.643   1.00 49.11  ? 162 SER L N   1 
ATOM   2759 C CA  . SER B 2 162 ? 35.456  -6.941  3.752   1.00 53.76  ? 162 SER L CA  1 
ATOM   2760 C C   . SER B 2 162 ? 34.878  -5.579  3.393   1.00 46.26  ? 162 SER L C   1 
ATOM   2761 O O   . SER B 2 162 ? 35.529  -4.774  2.728   1.00 46.81  ? 162 SER L O   1 
ATOM   2762 C CB  . SER B 2 162 ? 36.287  -6.850  5.033   1.00 50.31  ? 162 SER L CB  1 
ATOM   2763 O OG  . SER B 2 162 ? 37.184  -5.755  4.986   1.00 55.34  ? 162 SER L OG  1 
ATOM   2764 N N   . VAL B 2 163 ? 33.650  -5.328  3.833   1.00 48.28  ? 163 VAL L N   1 
ATOM   2765 C CA  . VAL B 2 163 ? 32.963  -4.085  3.513   1.00 48.81  ? 163 VAL L CA  1 
ATOM   2766 C C   . VAL B 2 163 ? 32.700  -3.269  4.772   1.00 49.08  ? 163 VAL L C   1 
ATOM   2767 O O   . VAL B 2 163 ? 32.274  -3.808  5.793   1.00 51.67  ? 163 VAL L O   1 
ATOM   2768 C CB  . VAL B 2 163 ? 31.626  -4.355  2.790   1.00 59.60  ? 163 VAL L CB  1 
ATOM   2769 C CG1 . VAL B 2 163 ? 31.012  -3.055  2.295   1.00 59.39  ? 163 VAL L CG1 1 
ATOM   2770 C CG2 . VAL B 2 163 ? 31.836  -5.317  1.633   1.00 48.24  ? 163 VAL L CG2 1 
ATOM   2771 N N   . THR B 2 164 ? 32.965  -1.969  4.698   1.00 38.14  ? 164 THR L N   1 
ATOM   2772 C CA  . THR B 2 164 ? 32.685  -1.070  5.809   1.00 46.01  ? 164 THR L CA  1 
ATOM   2773 C C   . THR B 2 164 ? 31.183  -0.903  6.003   1.00 57.67  ? 164 THR L C   1 
ATOM   2774 O O   . THR B 2 164 ? 30.395  -1.201  5.105   1.00 55.09  ? 164 THR L O   1 
ATOM   2775 C CB  . THR B 2 164 ? 33.313  0.320   5.593   1.00 41.26  ? 164 THR L CB  1 
ATOM   2776 O OG1 . THR B 2 164 ? 32.701  0.954   4.463   1.00 49.14  ? 164 THR L OG1 1 
ATOM   2777 C CG2 . THR B 2 164 ? 34.807  0.201   5.357   1.00 45.83  ? 164 THR L CG2 1 
ATOM   2778 N N   . GLU B 2 165 ? 30.792  -0.427  7.180   1.00 57.49  ? 165 GLU L N   1 
ATOM   2779 C CA  . GLU B 2 165 ? 29.396  -0.098  7.435   1.00 53.79  ? 165 GLU L CA  1 
ATOM   2780 C C   . GLU B 2 165 ? 29.012  1.139   6.631   1.00 59.38  ? 165 GLU L C   1 
ATOM   2781 O O   . GLU B 2 165 ? 29.878  1.820   6.079   1.00 64.17  ? 165 GLU L O   1 
ATOM   2782 C CB  . GLU B 2 165 ? 29.155  0.135   8.927   1.00 45.22  ? 165 GLU L CB  1 
ATOM   2783 C CG  . GLU B 2 165 ? 29.424  -1.082  9.797   1.00 56.07  ? 165 GLU L CG  1 
ATOM   2784 N N   . GLN B 2 166 ? 27.716  1.424   6.560   1.00 59.53  ? 166 GLN L N   1 
ATOM   2785 C CA  . GLN B 2 166 ? 27.241  2.591   5.829   1.00 63.09  ? 166 GLN L CA  1 
ATOM   2786 C C   . GLN B 2 166 ? 27.779  3.865   6.473   1.00 60.37  ? 166 GLN L C   1 
ATOM   2787 O O   . GLN B 2 166 ? 27.632  4.070   7.678   1.00 61.17  ? 166 GLN L O   1 
ATOM   2788 C CB  . GLN B 2 166 ? 25.712  2.614   5.778   1.00 65.12  ? 166 GLN L CB  1 
ATOM   2789 C CG  . GLN B 2 166 ? 25.143  3.529   4.706   1.00 63.61  ? 166 GLN L CG  1 
ATOM   2790 C CD  . GLN B 2 166 ? 23.673  3.275   4.438   1.00 61.68  ? 166 GLN L CD  1 
ATOM   2791 O OE1 . GLN B 2 166 ? 22.961  2.728   5.280   1.00 53.56  ? 166 GLN L OE1 1 
ATOM   2792 N NE2 . GLN B 2 166 ? 23.210  3.669   3.256   1.00 60.43  ? 166 GLN L NE2 1 
ATOM   2793 N N   . ASP B 2 167 ? 28.413  4.706   5.662   1.00 60.86  ? 167 ASP L N   1 
ATOM   2794 C CA  . ASP B 2 167 ? 29.059  5.921   6.148   1.00 68.42  ? 167 ASP L CA  1 
ATOM   2795 C C   . ASP B 2 167 ? 28.070  6.843   6.853   1.00 86.23  ? 167 ASP L C   1 
ATOM   2796 O O   . ASP B 2 167 ? 26.901  6.920   6.478   1.00 89.12  ? 167 ASP L O   1 
ATOM   2797 C CB  . ASP B 2 167 ? 29.737  6.657   4.990   1.00 66.60  ? 167 ASP L CB  1 
ATOM   2798 C CG  . ASP B 2 167 ? 30.548  7.850   5.452   1.00 79.11  ? 167 ASP L CG  1 
ATOM   2799 O OD1 . ASP B 2 167 ? 30.021  8.981   5.405   1.00 82.61  ? 167 ASP L OD1 1 
ATOM   2800 O OD2 . ASP B 2 167 ? 31.712  7.658   5.862   1.00 86.21  ? 167 ASP L OD2 1 
ATOM   2801 N N   . SER B 2 168 ? 28.546  7.537   7.882   1.00 92.46  ? 168 SER L N   1 
ATOM   2802 C CA  . SER B 2 168 ? 27.689  8.400   8.686   1.00 92.83  ? 168 SER L CA  1 
ATOM   2803 C C   . SER B 2 168 ? 27.304  9.678   7.947   1.00 94.29  ? 168 SER L C   1 
ATOM   2804 O O   . SER B 2 168 ? 26.260  10.270  8.219   1.00 105.11 ? 168 SER L O   1 
ATOM   2805 C CB  . SER B 2 168 ? 28.379  8.750   10.006  1.00 92.26  ? 168 SER L CB  1 
ATOM   2806 O OG  . SER B 2 168 ? 29.610  9.414   9.778   1.00 92.27  ? 168 SER L OG  1 
ATOM   2807 N N   . LYS B 2 169 ? 28.146  10.098  7.009   1.00 88.38  ? 169 LYS L N   1 
ATOM   2808 C CA  . LYS B 2 169 ? 27.929  11.356  6.304   1.00 83.66  ? 169 LYS L CA  1 
ATOM   2809 C C   . LYS B 2 169 ? 27.290  11.157  4.931   1.00 83.14  ? 169 LYS L C   1 
ATOM   2810 O O   . LYS B 2 169 ? 26.150  11.563  4.706   1.00 96.78  ? 169 LYS L O   1 
ATOM   2811 C CB  . LYS B 2 169 ? 29.251  12.114  6.158   1.00 80.04  ? 169 LYS L CB  1 
ATOM   2812 C CG  . LYS B 2 169 ? 29.883  12.511  7.484   1.00 80.30  ? 169 LYS L CG  1 
ATOM   2813 C CD  . LYS B 2 169 ? 31.176  13.283  7.274   1.00 80.41  ? 169 LYS L CD  1 
ATOM   2814 N N   . ASP B 2 170 ? 28.025  10.532  4.015   1.00 75.99  ? 170 ASP L N   1 
ATOM   2815 C CA  . ASP B 2 170 ? 27.557  10.376  2.640   1.00 64.17  ? 170 ASP L CA  1 
ATOM   2816 C C   . ASP B 2 170 ? 26.748  9.097   2.437   1.00 56.65  ? 170 ASP L C   1 
ATOM   2817 O O   . ASP B 2 170 ? 26.213  8.862   1.353   1.00 67.16  ? 170 ASP L O   1 
ATOM   2818 C CB  . ASP B 2 170 ? 28.743  10.407  1.670   1.00 65.90  ? 170 ASP L CB  1 
ATOM   2819 C CG  . ASP B 2 170 ? 29.849  9.444   2.063   1.00 84.39  ? 170 ASP L CG  1 
ATOM   2820 O OD1 . ASP B 2 170 ? 29.569  8.238   2.222   1.00 77.56  ? 170 ASP L OD1 1 
ATOM   2821 O OD2 . ASP B 2 170 ? 31.003  9.896   2.213   1.00 101.67 ? 170 ASP L OD2 1 
ATOM   2822 N N   . SER B 2 171 ? 26.670  8.279   3.484   1.00 48.19  ? 171 SER L N   1 
ATOM   2823 C CA  . SER B 2 171 ? 25.888  7.042   3.475   1.00 53.81  ? 171 SER L CA  1 
ATOM   2824 C C   . SER B 2 171 ? 26.293  6.092   2.350   1.00 56.43  ? 171 SER L C   1 
ATOM   2825 O O   . SER B 2 171 ? 25.440  5.503   1.686   1.00 72.72  ? 171 SER L O   1 
ATOM   2826 C CB  . SER B 2 171 ? 24.392  7.359   3.374   1.00 56.61  ? 171 SER L CB  1 
ATOM   2827 N N   . THR B 2 172 ? 27.598  5.941   2.144   1.00 56.31  ? 172 THR L N   1 
ATOM   2828 C CA  . THR B 2 172 ? 28.110  5.029   1.128   1.00 55.63  ? 172 THR L CA  1 
ATOM   2829 C C   . THR B 2 172 ? 28.878  3.872   1.756   1.00 55.08  ? 172 THR L C   1 
ATOM   2830 O O   . THR B 2 172 ? 29.120  3.855   2.963   1.00 56.29  ? 172 THR L O   1 
ATOM   2831 C CB  . THR B 2 172 ? 29.031  5.751   0.127   1.00 58.38  ? 172 THR L CB  1 
ATOM   2832 O OG1 . THR B 2 172 ? 30.088  6.410   0.836   1.00 50.17  ? 172 THR L OG1 1 
ATOM   2833 C CG2 . THR B 2 172 ? 28.248  6.775   -0.676  1.00 41.97  ? 172 THR L CG2 1 
ATOM   2834 N N   . TYR B 2 173 ? 29.257  2.906   0.925   1.00 53.72  ? 173 TYR L N   1 
ATOM   2835 C CA  . TYR B 2 173 ? 30.026  1.758   1.385   1.00 44.57  ? 173 TYR L CA  1 
ATOM   2836 C C   . TYR B 2 173 ? 31.420  1.762   0.772   1.00 55.67  ? 173 TYR L C   1 
ATOM   2837 O O   . TYR B 2 173 ? 31.674  2.451   -0.215  1.00 55.00  ? 173 TYR L O   1 
ATOM   2838 C CB  . TYR B 2 173 ? 29.309  0.451   1.037   1.00 36.33  ? 173 TYR L CB  1 
ATOM   2839 C CG  . TYR B 2 173 ? 27.944  0.304   1.668   1.00 55.80  ? 173 TYR L CG  1 
ATOM   2840 C CD1 . TYR B 2 173 ? 26.798  0.692   0.986   1.00 51.01  ? 173 TYR L CD1 1 
ATOM   2841 C CD2 . TYR B 2 173 ? 27.799  -0.226  2.944   1.00 58.65  ? 173 TYR L CD2 1 
ATOM   2842 C CE1 . TYR B 2 173 ? 25.546  0.559   1.558   1.00 50.47  ? 173 TYR L CE1 1 
ATOM   2843 C CE2 . TYR B 2 173 ? 26.552  -0.363  3.524   1.00 67.90  ? 173 TYR L CE2 1 
ATOM   2844 C CZ  . TYR B 2 173 ? 25.429  0.031   2.826   1.00 66.49  ? 173 TYR L CZ  1 
ATOM   2845 O OH  . TYR B 2 173 ? 24.184  -0.104  3.399   1.00 66.39  ? 173 TYR L OH  1 
ATOM   2846 N N   . SER B 2 174 ? 32.322  0.990   1.367   1.00 42.17  ? 174 SER L N   1 
ATOM   2847 C CA  . SER B 2 174 ? 33.660  0.814   0.820   1.00 34.65  ? 174 SER L CA  1 
ATOM   2848 C C   . SER B 2 174 ? 34.086  -0.642  0.948   1.00 43.61  ? 174 SER L C   1 
ATOM   2849 O O   . SER B 2 174 ? 33.802  -1.294  1.953   1.00 50.43  ? 174 SER L O   1 
ATOM   2850 C CB  . SER B 2 174 ? 34.662  1.731   1.521   1.00 43.49  ? 174 SER L CB  1 
ATOM   2851 O OG  . SER B 2 174 ? 34.404  3.091   1.217   1.00 40.79  ? 174 SER L OG  1 
ATOM   2852 N N   . LEU B 2 175 ? 34.766  -1.150  -0.074  1.00 41.58  ? 175 LEU L N   1 
ATOM   2853 C CA  . LEU B 2 175 ? 35.169  -2.550  -0.099  1.00 46.84  ? 175 LEU L CA  1 
ATOM   2854 C C   . LEU B 2 175 ? 36.676  -2.681  -0.291  1.00 57.64  ? 175 LEU L C   1 
ATOM   2855 O O   . LEU B 2 175 ? 37.286  -1.918  -1.042  1.00 54.42  ? 175 LEU L O   1 
ATOM   2856 C CB  . LEU B 2 175 ? 34.418  -3.299  -1.205  1.00 34.98  ? 175 LEU L CB  1 
ATOM   2857 C CG  . LEU B 2 175 ? 34.429  -4.832  -1.206  1.00 48.74  ? 175 LEU L CG  1 
ATOM   2858 C CD1 . LEU B 2 175 ? 33.147  -5.358  -1.826  1.00 51.46  ? 175 LEU L CD1 1 
ATOM   2859 C CD2 . LEU B 2 175 ? 35.634  -5.383  -1.956  1.00 58.96  ? 175 LEU L CD2 1 
ATOM   2860 N N   . SER B 2 176 ? 37.268  -3.653  0.394   1.00 52.16  ? 176 SER L N   1 
ATOM   2861 C CA  . SER B 2 176 ? 38.695  -3.920  0.276   1.00 47.42  ? 176 SER L CA  1 
ATOM   2862 C C   . SER B 2 176 ? 38.947  -5.397  -0.002  1.00 56.42  ? 176 SER L C   1 
ATOM   2863 O O   . SER B 2 176 ? 38.788  -6.239  0.881   1.00 70.80  ? 176 SER L O   1 
ATOM   2864 C CB  . SER B 2 176 ? 39.430  -3.488  1.546   1.00 55.04  ? 176 SER L CB  1 
ATOM   2865 O OG  . SER B 2 176 ? 40.794  -3.868  1.504   1.00 44.23  ? 176 SER L OG  1 
ATOM   2866 N N   . SER B 2 177 ? 39.337  -5.703  -1.235  1.00 52.77  ? 177 SER L N   1 
ATOM   2867 C CA  . SER B 2 177 ? 39.620  -7.078  -1.629  1.00 55.11  ? 177 SER L CA  1 
ATOM   2868 C C   . SER B 2 177 ? 41.122  -7.332  -1.684  1.00 56.55  ? 177 SER L C   1 
ATOM   2869 O O   . SER B 2 177 ? 41.855  -6.623  -2.373  1.00 56.27  ? 177 SER L O   1 
ATOM   2870 C CB  . SER B 2 177 ? 38.984  -7.389  -2.985  1.00 53.15  ? 177 SER L CB  1 
ATOM   2871 O OG  . SER B 2 177 ? 39.219  -8.735  -3.360  1.00 53.64  ? 177 SER L OG  1 
ATOM   2872 N N   . THR B 2 178 ? 41.573  -8.348  -0.955  1.00 56.84  ? 178 THR L N   1 
ATOM   2873 C CA  . THR B 2 178 ? 42.992  -8.677  -0.896  1.00 56.74  ? 178 THR L CA  1 
ATOM   2874 C C   . THR B 2 178 ? 43.299  -9.991  -1.606  1.00 55.58  ? 178 THR L C   1 
ATOM   2875 O O   . THR B 2 178 ? 42.732  -11.034 -1.278  1.00 49.22  ? 178 THR L O   1 
ATOM   2876 C CB  . THR B 2 178 ? 43.490  -8.767  0.561   1.00 48.69  ? 178 THR L CB  1 
ATOM   2877 O OG1 . THR B 2 178 ? 43.388  -7.481  1.184   1.00 53.83  ? 178 THR L OG1 1 
ATOM   2878 C CG2 . THR B 2 178 ? 44.940  -9.229  0.606   1.00 44.24  ? 178 THR L CG2 1 
ATOM   2879 N N   . LEU B 2 179 ? 44.196  -9.930  -2.585  1.00 60.56  ? 179 LEU L N   1 
ATOM   2880 C CA  . LEU B 2 179 ? 44.650  -11.121 -3.290  1.00 57.52  ? 179 LEU L CA  1 
ATOM   2881 C C   . LEU B 2 179 ? 45.940  -11.637 -2.663  1.00 52.77  ? 179 LEU L C   1 
ATOM   2882 O O   . LEU B 2 179 ? 46.985  -10.996 -2.760  1.00 52.73  ? 179 LEU L O   1 
ATOM   2883 C CB  . LEU B 2 179 ? 44.864  -10.823 -4.776  1.00 62.45  ? 179 LEU L CB  1 
ATOM   2884 C CG  . LEU B 2 179 ? 45.335  -11.990 -5.646  1.00 57.85  ? 179 LEU L CG  1 
ATOM   2885 C CD1 . LEU B 2 179 ? 44.233  -13.026 -5.801  1.00 61.72  ? 179 LEU L CD1 1 
ATOM   2886 C CD2 . LEU B 2 179 ? 45.806  -11.495 -7.004  1.00 60.35  ? 179 LEU L CD2 1 
ATOM   2887 N N   . THR B 2 180 ? 45.862  -12.795 -2.017  1.00 51.33  ? 180 THR L N   1 
ATOM   2888 C CA  . THR B 2 180 ? 47.017  -13.352 -1.322  1.00 63.37  ? 180 THR L CA  1 
ATOM   2889 C C   . THR B 2 180 ? 47.702  -14.444 -2.136  1.00 65.50  ? 180 THR L C   1 
ATOM   2890 O O   . THR B 2 180 ? 47.092  -15.458 -2.474  1.00 71.43  ? 180 THR L O   1 
ATOM   2891 C CB  . THR B 2 180 ? 46.622  -13.926 0.050   1.00 61.74  ? 180 THR L CB  1 
ATOM   2892 O OG1 . THR B 2 180 ? 45.991  -12.905 0.834   1.00 67.64  ? 180 THR L OG1 1 
ATOM   2893 C CG2 . THR B 2 180 ? 47.851  -14.437 0.786   1.00 59.67  ? 180 THR L CG2 1 
ATOM   2894 N N   . LEU B 2 181 ? 48.976  -14.225 -2.445  1.00 55.96  ? 181 LEU L N   1 
ATOM   2895 C CA  . LEU B 2 181 ? 49.772  -15.200 -3.181  1.00 59.96  ? 181 LEU L CA  1 
ATOM   2896 C C   . LEU B 2 181 ? 51.156  -15.341 -2.560  1.00 63.86  ? 181 LEU L C   1 
ATOM   2897 O O   . LEU B 2 181 ? 51.650  -14.419 -1.911  1.00 67.18  ? 181 LEU L O   1 
ATOM   2898 C CB  . LEU B 2 181 ? 49.898  -14.796 -4.652  1.00 54.46  ? 181 LEU L CB  1 
ATOM   2899 C CG  . LEU B 2 181 ? 48.618  -14.781 -5.490  1.00 65.02  ? 181 LEU L CG  1 
ATOM   2900 C CD1 . LEU B 2 181 ? 48.898  -14.227 -6.878  1.00 69.58  ? 181 LEU L CD1 1 
ATOM   2901 C CD2 . LEU B 2 181 ? 48.017  -16.175 -5.576  1.00 72.68  ? 181 LEU L CD2 1 
ATOM   2902 N N   . SER B 2 182 ? 51.777  -16.499 -2.757  1.00 61.95  ? 182 SER L N   1 
ATOM   2903 C CA  . SER B 2 182 ? 53.138  -16.717 -2.286  1.00 67.88  ? 182 SER L CA  1 
ATOM   2904 C C   . SER B 2 182 ? 54.109  -15.898 -3.127  1.00 74.31  ? 182 SER L C   1 
ATOM   2905 O O   . SER B 2 182 ? 53.766  -15.457 -4.224  1.00 68.39  ? 182 SER L O   1 
ATOM   2906 C CB  . SER B 2 182 ? 53.503  -18.201 -2.340  1.00 81.04  ? 182 SER L CB  1 
ATOM   2907 O OG  . SER B 2 182 ? 53.409  -18.700 -3.663  1.00 90.36  ? 182 SER L OG  1 
ATOM   2908 N N   . LYS B 2 183 ? 55.316  -15.694 -2.611  1.00 78.46  ? 183 LYS L N   1 
ATOM   2909 C CA  . LYS B 2 183 ? 56.330  -14.923 -3.323  1.00 82.66  ? 183 LYS L CA  1 
ATOM   2910 C C   . LYS B 2 183 ? 56.707  -15.594 -4.639  1.00 73.20  ? 183 LYS L C   1 
ATOM   2911 O O   . LYS B 2 183 ? 56.923  -14.925 -5.650  1.00 75.75  ? 183 LYS L O   1 
ATOM   2912 C CB  . LYS B 2 183 ? 57.574  -14.738 -2.452  1.00 87.72  ? 183 LYS L CB  1 
ATOM   2913 C CG  . LYS B 2 183 ? 58.669  -13.908 -3.103  1.00 87.69  ? 183 LYS L CG  1 
ATOM   2914 C CD  . LYS B 2 183 ? 59.967  -13.980 -2.315  1.00 100.15 ? 183 LYS L CD  1 
ATOM   2915 C CE  . LYS B 2 183 ? 61.059  -13.149 -2.972  1.00 102.08 ? 183 LYS L CE  1 
ATOM   2916 N NZ  . LYS B 2 183 ? 60.710  -11.701 -3.008  1.00 103.19 ? 183 LYS L NZ  1 
ATOM   2917 N N   . ALA B 2 184 ? 56.775  -16.922 -4.619  1.00 71.58  ? 184 ALA L N   1 
ATOM   2918 C CA  . ALA B 2 184 ? 57.145  -17.693 -5.800  1.00 85.08  ? 184 ALA L CA  1 
ATOM   2919 C C   . ALA B 2 184 ? 56.086  -17.591 -6.894  1.00 95.11  ? 184 ALA L C   1 
ATOM   2920 O O   . ALA B 2 184 ? 56.408  -17.389 -8.065  1.00 96.34  ? 184 ALA L O   1 
ATOM   2921 C CB  . ALA B 2 184 ? 57.380  -19.148 -5.425  1.00 81.29  ? 184 ALA L CB  1 
ATOM   2922 N N   . ASP B 2 185 ? 54.822  -17.733 -6.506  1.00 93.54  ? 185 ASP L N   1 
ATOM   2923 C CA  . ASP B 2 185 ? 53.718  -17.672 -7.458  1.00 89.25  ? 185 ASP L CA  1 
ATOM   2924 C C   . ASP B 2 185 ? 53.522  -16.257 -7.995  1.00 84.76  ? 185 ASP L C   1 
ATOM   2925 O O   . ASP B 2 185 ? 53.093  -16.069 -9.134  1.00 87.60  ? 185 ASP L O   1 
ATOM   2926 C CB  . ASP B 2 185 ? 52.424  -18.172 -6.811  1.00 84.47  ? 185 ASP L CB  1 
ATOM   2927 C CG  . ASP B 2 185 ? 52.473  -19.650 -6.477  1.00 87.13  ? 185 ASP L CG  1 
ATOM   2928 N N   . TYR B 2 186 ? 53.841  -15.266 -7.169  1.00 75.32  ? 186 TYR L N   1 
ATOM   2929 C CA  . TYR B 2 186 ? 53.707  -13.869 -7.560  1.00 60.58  ? 186 TYR L CA  1 
ATOM   2930 C C   . TYR B 2 186 ? 54.741  -13.491 -8.617  1.00 66.84  ? 186 TYR L C   1 
ATOM   2931 O O   . TYR B 2 186 ? 54.493  -12.633 -9.464  1.00 61.51  ? 186 TYR L O   1 
ATOM   2932 C CB  . TYR B 2 186 ? 53.843  -12.956 -6.339  1.00 56.11  ? 186 TYR L CB  1 
ATOM   2933 C CG  . TYR B 2 186 ? 53.793  -11.481 -6.665  1.00 52.69  ? 186 TYR L CG  1 
ATOM   2934 C CD1 . TYR B 2 186 ? 52.601  -10.870 -7.029  1.00 50.75  ? 186 TYR L CD1 1 
ATOM   2935 C CD2 . TYR B 2 186 ? 54.938  -10.697 -6.604  1.00 54.35  ? 186 TYR L CD2 1 
ATOM   2936 C CE1 . TYR B 2 186 ? 52.550  -9.521  -7.327  1.00 55.20  ? 186 TYR L CE1 1 
ATOM   2937 C CE2 . TYR B 2 186 ? 54.898  -9.347  -6.899  1.00 53.44  ? 186 TYR L CE2 1 
ATOM   2938 C CZ  . TYR B 2 186 ? 53.701  -8.765  -7.262  1.00 63.53  ? 186 TYR L CZ  1 
ATOM   2939 O OH  . TYR B 2 186 ? 53.654  -7.422  -7.557  1.00 65.07  ? 186 TYR L OH  1 
ATOM   2940 N N   . GLU B 2 187 ? 55.897  -14.144 -8.564  1.00 72.07  ? 187 GLU L N   1 
ATOM   2941 C CA  . GLU B 2 187 ? 56.981  -13.860 -9.497  1.00 73.31  ? 187 GLU L CA  1 
ATOM   2942 C C   . GLU B 2 187 ? 56.823  -14.640 -10.799 1.00 75.26  ? 187 GLU L C   1 
ATOM   2943 O O   . GLU B 2 187 ? 57.637  -14.509 -11.712 1.00 71.82  ? 187 GLU L O   1 
ATOM   2944 C CB  . GLU B 2 187 ? 58.333  -14.179 -8.854  1.00 67.78  ? 187 GLU L CB  1 
ATOM   2945 N N   . LYS B 2 188 ? 55.772  -15.450 -10.880 1.00 80.24  ? 188 LYS L N   1 
ATOM   2946 C CA  . LYS B 2 188 ? 55.511  -16.252 -12.071 1.00 81.69  ? 188 LYS L CA  1 
ATOM   2947 C C   . LYS B 2 188 ? 54.680  -15.489 -13.097 1.00 79.54  ? 188 LYS L C   1 
ATOM   2948 O O   . LYS B 2 188 ? 54.564  -15.910 -14.248 1.00 88.98  ? 188 LYS L O   1 
ATOM   2949 C CB  . LYS B 2 188 ? 54.799  -17.554 -11.698 1.00 83.63  ? 188 LYS L CB  1 
ATOM   2950 C CG  . LYS B 2 188 ? 55.704  -18.623 -11.108 1.00 91.41  ? 188 LYS L CG  1 
ATOM   2951 C CD  . LYS B 2 188 ? 54.953  -19.933 -10.926 1.00 93.35  ? 188 LYS L CD  1 
ATOM   2952 C CE  . LYS B 2 188 ? 55.875  -21.039 -10.438 1.00 96.15  ? 188 LYS L CE  1 
ATOM   2953 N N   . HIS B 2 189 ? 54.103  -14.368 -12.678 1.00 73.39  ? 189 HIS L N   1 
ATOM   2954 C CA  . HIS B 2 189 ? 53.213  -13.608 -13.547 1.00 66.14  ? 189 HIS L CA  1 
ATOM   2955 C C   . HIS B 2 189 ? 53.636  -12.149 -13.673 1.00 69.87  ? 189 HIS L C   1 
ATOM   2956 O O   . HIS B 2 189 ? 54.560  -11.699 -12.994 1.00 78.47  ? 189 HIS L O   1 
ATOM   2957 C CB  . HIS B 2 189 ? 51.778  -13.693 -13.030 1.00 60.80  ? 189 HIS L CB  1 
ATOM   2958 C CG  . HIS B 2 189 ? 51.316  -15.092 -12.764 1.00 75.71  ? 189 HIS L CG  1 
ATOM   2959 N ND1 . HIS B 2 189 ? 51.256  -15.627 -11.495 1.00 72.02  ? 189 HIS L ND1 1 
ATOM   2960 C CD2 . HIS B 2 189 ? 50.896  -16.067 -13.604 1.00 81.83  ? 189 HIS L CD2 1 
ATOM   2961 C CE1 . HIS B 2 189 ? 50.817  -16.871 -11.565 1.00 79.62  ? 189 HIS L CE1 1 
ATOM   2962 N NE2 . HIS B 2 189 ? 50.591  -17.163 -12.834 1.00 86.81  ? 189 HIS L NE2 1 
ATOM   2963 N N   . LYS B 2 190 ? 52.951  -11.413 -14.543 1.00 69.14  ? 190 LYS L N   1 
ATOM   2964 C CA  . LYS B 2 190 ? 53.298  -10.023 -14.815 1.00 66.23  ? 190 LYS L CA  1 
ATOM   2965 C C   . LYS B 2 190 ? 52.121  -9.074  -14.600 1.00 67.33  ? 190 LYS L C   1 
ATOM   2966 O O   . LYS B 2 190 ? 52.247  -8.063  -13.908 1.00 74.28  ? 190 LYS L O   1 
ATOM   2967 C CB  . LYS B 2 190 ? 53.820  -9.879  -16.246 1.00 57.80  ? 190 LYS L CB  1 
ATOM   2968 C CG  . LYS B 2 190 ? 54.108  -8.445  -16.661 1.00 63.85  ? 190 LYS L CG  1 
ATOM   2969 N N   . VAL B 2 191 ? 50.979  -9.402  -15.196 1.00 63.69  ? 191 VAL L N   1 
ATOM   2970 C CA  . VAL B 2 191 ? 49.811  -8.530  -15.140 1.00 63.09  ? 191 VAL L CA  1 
ATOM   2971 C C   . VAL B 2 191 ? 48.864  -8.897  -14.001 1.00 63.86  ? 191 VAL L C   1 
ATOM   2972 O O   . VAL B 2 191 ? 48.362  -10.019 -13.932 1.00 61.68  ? 191 VAL L O   1 
ATOM   2973 C CB  . VAL B 2 191 ? 49.027  -8.563  -16.464 1.00 66.66  ? 191 VAL L CB  1 
ATOM   2974 C CG1 . VAL B 2 191 ? 47.815  -7.646  -16.385 1.00 63.99  ? 191 VAL L CG1 1 
ATOM   2975 C CG2 . VAL B 2 191 ? 49.929  -8.168  -17.624 1.00 59.46  ? 191 VAL L CG2 1 
ATOM   2976 N N   . TYR B 2 192 ? 48.625  -7.939  -13.111 1.00 61.37  ? 192 TYR L N   1 
ATOM   2977 C CA  . TYR B 2 192 ? 47.682  -8.116  -12.012 1.00 57.45  ? 192 TYR L CA  1 
ATOM   2978 C C   . TYR B 2 192 ? 46.600  -7.046  -12.074 1.00 57.86  ? 192 TYR L C   1 
ATOM   2979 O O   . TYR B 2 192 ? 46.898  -5.852  -12.066 1.00 61.46  ? 192 TYR L O   1 
ATOM   2980 C CB  . TYR B 2 192 ? 48.403  -8.068  -10.663 1.00 45.25  ? 192 TYR L CB  1 
ATOM   2981 C CG  . TYR B 2 192 ? 49.357  -9.219  -10.443 1.00 53.47  ? 192 TYR L CG  1 
ATOM   2982 C CD1 . TYR B 2 192 ? 50.666  -9.160  -10.904 1.00 61.10  ? 192 TYR L CD1 1 
ATOM   2983 C CD2 . TYR B 2 192 ? 48.947  -10.366 -9.777  1.00 62.44  ? 192 TYR L CD2 1 
ATOM   2984 C CE1 . TYR B 2 192 ? 51.540  -10.211 -10.707 1.00 59.17  ? 192 TYR L CE1 1 
ATOM   2985 C CE2 . TYR B 2 192 ? 49.815  -11.422 -9.574  1.00 67.45  ? 192 TYR L CE2 1 
ATOM   2986 C CZ  . TYR B 2 192 ? 51.110  -11.339 -10.042 1.00 65.41  ? 192 TYR L CZ  1 
ATOM   2987 O OH  . TYR B 2 192 ? 51.976  -12.388 -9.843  1.00 76.26  ? 192 TYR L OH  1 
ATOM   2988 N N   . ALA B 2 193 ? 45.345  -7.476  -12.137 1.00 54.49  ? 193 ALA L N   1 
ATOM   2989 C CA  . ALA B 2 193 ? 44.237  -6.545  -12.306 1.00 49.52  ? 193 ALA L CA  1 
ATOM   2990 C C   . ALA B 2 193 ? 43.016  -6.936  -11.484 1.00 50.60  ? 193 ALA L C   1 
ATOM   2991 O O   . ALA B 2 193 ? 42.801  -8.112  -11.187 1.00 47.86  ? 193 ALA L O   1 
ATOM   2992 C CB  . ALA B 2 193 ? 43.860  -6.443  -13.778 1.00 51.01  ? 193 ALA L CB  1 
ATOM   2993 N N   . CYS B 2 194 ? 42.218  -5.938  -11.120 1.00 53.28  ? 194 CYS L N   1 
ATOM   2994 C CA  . CYS B 2 194 ? 40.935  -6.178  -10.473 1.00 64.41  ? 194 CYS L CA  1 
ATOM   2995 C C   . CYS B 2 194 ? 39.818  -5.533  -11.289 1.00 56.10  ? 194 CYS L C   1 
ATOM   2996 O O   . CYS B 2 194 ? 39.845  -4.333  -11.561 1.00 53.17  ? 194 CYS L O   1 
ATOM   2997 C CB  . CYS B 2 194 ? 40.935  -5.647  -9.036  1.00 66.02  ? 194 CYS L CB  1 
ATOM   2998 S SG  . CYS B 2 194 ? 41.373  -3.901  -8.848  1.00 73.21  ? 194 CYS L SG  1 
ATOM   2999 N N   . GLU B 2 195 ? 38.844  -6.342  -11.691 1.00 54.75  ? 195 GLU L N   1 
ATOM   3000 C CA  . GLU B 2 195 ? 37.735  -5.856  -12.502 1.00 59.02  ? 195 GLU L CA  1 
ATOM   3001 C C   . GLU B 2 195 ? 36.501  -5.618  -11.639 1.00 62.55  ? 195 GLU L C   1 
ATOM   3002 O O   . GLU B 2 195 ? 35.953  -6.549  -11.049 1.00 54.21  ? 195 GLU L O   1 
ATOM   3003 C CB  . GLU B 2 195 ? 37.424  -6.845  -13.626 1.00 44.20  ? 195 GLU L CB  1 
ATOM   3004 C CG  . GLU B 2 195 ? 36.338  -6.385  -14.583 1.00 71.75  ? 195 GLU L CG  1 
ATOM   3005 C CD  . GLU B 2 195 ? 36.287  -7.225  -15.845 1.00 88.87  ? 195 GLU L CD  1 
ATOM   3006 O OE1 . GLU B 2 195 ? 37.234  -8.005  -16.076 1.00 95.46  ? 195 GLU L OE1 1 
ATOM   3007 O OE2 . GLU B 2 195 ? 35.301  -7.107  -16.602 1.00 94.98  ? 195 GLU L OE2 1 
ATOM   3008 N N   . VAL B 2 196 ? 36.070  -4.363  -11.572 1.00 65.53  ? 196 VAL L N   1 
ATOM   3009 C CA  . VAL B 2 196 ? 34.968  -3.975  -10.700 1.00 53.57  ? 196 VAL L CA  1 
ATOM   3010 C C   . VAL B 2 196 ? 33.659  -3.800  -11.461 1.00 60.12  ? 196 VAL L C   1 
ATOM   3011 O O   . VAL B 2 196 ? 33.595  -3.076  -12.455 1.00 64.63  ? 196 VAL L O   1 
ATOM   3012 C CB  . VAL B 2 196 ? 35.290  -2.669  -9.950  1.00 53.62  ? 196 VAL L CB  1 
ATOM   3013 C CG1 . VAL B 2 196 ? 34.064  -2.160  -9.208  1.00 48.63  ? 196 VAL L CG1 1 
ATOM   3014 C CG2 . VAL B 2 196 ? 36.447  -2.886  -8.992  1.00 40.93  ? 196 VAL L CG2 1 
ATOM   3015 N N   . THR B 2 197 ? 32.617  -4.474  -10.984 1.00 61.43  ? 197 THR L N   1 
ATOM   3016 C CA  . THR B 2 197 ? 31.285  -4.345  -11.558 1.00 69.46  ? 197 THR L CA  1 
ATOM   3017 C C   . THR B 2 197 ? 30.329  -3.724  -10.545 1.00 61.19  ? 197 THR L C   1 
ATOM   3018 O O   . THR B 2 197 ? 30.160  -4.242  -9.441  1.00 66.87  ? 197 THR L O   1 
ATOM   3019 C CB  . THR B 2 197 ? 30.732  -5.707  -12.014 1.00 84.72  ? 197 THR L CB  1 
ATOM   3020 O OG1 . THR B 2 197 ? 31.550  -6.229  -13.069 1.00 95.57  ? 197 THR L OG1 1 
ATOM   3021 C CG2 . THR B 2 197 ? 29.305  -5.561  -12.513 1.00 92.21  ? 197 THR L CG2 1 
ATOM   3022 N N   . HIS B 2 198 ? 29.708  -2.610  -10.922 1.00 61.78  ? 198 HIS L N   1 
ATOM   3023 C CA  . HIS B 2 198 ? 28.775  -1.921  -10.038 1.00 60.12  ? 198 HIS L CA  1 
ATOM   3024 C C   . HIS B 2 198 ? 27.618  -1.308  -10.822 1.00 65.21  ? 198 HIS L C   1 
ATOM   3025 O O   . HIS B 2 198 ? 27.728  -1.072  -12.026 1.00 52.32  ? 198 HIS L O   1 
ATOM   3026 C CB  . HIS B 2 198 ? 29.502  -0.840  -9.233  1.00 53.26  ? 198 HIS L CB  1 
ATOM   3027 C CG  . HIS B 2 198 ? 28.672  -0.237  -8.143  1.00 52.56  ? 198 HIS L CG  1 
ATOM   3028 N ND1 . HIS B 2 198 ? 28.120  1.022   -8.238  1.00 53.33  ? 198 HIS L ND1 1 
ATOM   3029 C CD2 . HIS B 2 198 ? 28.295  -0.723  -6.937  1.00 57.41  ? 198 HIS L CD2 1 
ATOM   3030 C CE1 . HIS B 2 198 ? 27.442  1.288   -7.136  1.00 58.32  ? 198 HIS L CE1 1 
ATOM   3031 N NE2 . HIS B 2 198 ? 27.532  0.245   -6.330  1.00 63.02  ? 198 HIS L NE2 1 
ATOM   3032 N N   . GLN B 2 199 ? 26.511  -1.056  -10.129 1.00 69.79  ? 199 GLN L N   1 
ATOM   3033 C CA  . GLN B 2 199 ? 25.317  -0.486  -10.745 1.00 65.30  ? 199 GLN L CA  1 
ATOM   3034 C C   . GLN B 2 199 ? 25.579  0.912   -11.302 1.00 57.93  ? 199 GLN L C   1 
ATOM   3035 O O   . GLN B 2 199 ? 25.005  1.303   -12.318 1.00 57.26  ? 199 GLN L O   1 
ATOM   3036 C CB  . GLN B 2 199 ? 24.171  -0.441  -9.730  1.00 61.64  ? 199 GLN L CB  1 
ATOM   3037 C CG  . GLN B 2 199 ? 22.850  0.059   -10.294 1.00 66.82  ? 199 GLN L CG  1 
ATOM   3038 C CD  . GLN B 2 199 ? 21.756  0.117   -9.246  1.00 77.33  ? 199 GLN L CD  1 
ATOM   3039 N N   . GLY B 2 200 ? 26.455  1.658   -10.637 1.00 57.26  ? 200 GLY L N   1 
ATOM   3040 C CA  . GLY B 2 200 ? 26.785  3.007   -11.060 1.00 58.06  ? 200 GLY L CA  1 
ATOM   3041 C C   . GLY B 2 200 ? 27.806  3.044   -12.180 1.00 61.40  ? 200 GLY L C   1 
ATOM   3042 O O   . GLY B 2 200 ? 28.255  4.115   -12.586 1.00 68.02  ? 200 GLY L O   1 
ATOM   3043 N N   . LEU B 2 201 ? 28.173  1.868   -12.680 1.00 54.59  ? 201 LEU L N   1 
ATOM   3044 C CA  . LEU B 2 201 ? 29.134  1.763   -13.771 1.00 56.07  ? 201 LEU L CA  1 
ATOM   3045 C C   . LEU B 2 201 ? 28.489  1.191   -15.028 1.00 69.63  ? 201 LEU L C   1 
ATOM   3046 O O   . LEU B 2 201 ? 27.915  0.102   -15.002 1.00 77.03  ? 201 LEU L O   1 
ATOM   3047 C CB  . LEU B 2 201 ? 30.324  0.896   -13.355 1.00 47.33  ? 201 LEU L CB  1 
ATOM   3048 C CG  . LEU B 2 201 ? 31.185  1.423   -12.207 1.00 55.38  ? 201 LEU L CG  1 
ATOM   3049 C CD1 . LEU B 2 201 ? 32.233  0.397   -11.804 1.00 51.71  ? 201 LEU L CD1 1 
ATOM   3050 C CD2 . LEU B 2 201 ? 31.841  2.737   -12.597 1.00 59.53  ? 201 LEU L CD2 1 
ATOM   3051 N N   . SER B 2 202 ? 28.586  1.931   -16.127 1.00 65.98  ? 202 SER L N   1 
ATOM   3052 C CA  . SER B 2 202 ? 28.069  1.466   -17.407 1.00 78.72  ? 202 SER L CA  1 
ATOM   3053 C C   . SER B 2 202 ? 28.986  0.395   -17.990 1.00 79.25  ? 202 SER L C   1 
ATOM   3054 O O   . SER B 2 202 ? 28.562  -0.432  -18.797 1.00 90.90  ? 202 SER L O   1 
ATOM   3055 C CB  . SER B 2 202 ? 27.924  2.632   -18.385 1.00 79.86  ? 202 SER L CB  1 
ATOM   3056 O OG  . SER B 2 202 ? 29.185  3.205   -18.684 1.00 89.33  ? 202 SER L OG  1 
ATOM   3057 N N   . SER B 2 203 ? 30.245  0.420   -17.569 1.00 72.86  ? 203 SER L N   1 
ATOM   3058 C CA  . SER B 2 203 ? 31.234  -0.550  -18.021 1.00 73.78  ? 203 SER L CA  1 
ATOM   3059 C C   . SER B 2 203 ? 32.130  -0.976  -16.864 1.00 72.23  ? 203 SER L C   1 
ATOM   3060 O O   . SER B 2 203 ? 32.465  -0.161  -16.005 1.00 65.99  ? 203 SER L O   1 
ATOM   3061 C CB  . SER B 2 203 ? 32.075  0.033   -19.159 1.00 80.94  ? 203 SER L CB  1 
ATOM   3062 O OG  . SER B 2 203 ? 33.150  -0.828  -19.494 1.00 85.30  ? 203 SER L OG  1 
ATOM   3063 N N   . PRO B 2 204 ? 32.511  -2.263  -16.832 1.00 73.87  ? 204 PRO L N   1 
ATOM   3064 C CA  . PRO B 2 204 ? 33.408  -2.793  -15.799 1.00 68.02  ? 204 PRO L CA  1 
ATOM   3065 C C   . PRO B 2 204 ? 34.748  -2.062  -15.761 1.00 64.04  ? 204 PRO L C   1 
ATOM   3066 O O   . PRO B 2 204 ? 35.472  -2.051  -16.757 1.00 67.23  ? 204 PRO L O   1 
ATOM   3067 C CB  . PRO B 2 204 ? 33.597  -4.255  -16.216 1.00 73.96  ? 204 PRO L CB  1 
ATOM   3068 C CG  . PRO B 2 204 ? 32.377  -4.580  -17.005 1.00 80.89  ? 204 PRO L CG  1 
ATOM   3069 C CD  . PRO B 2 204 ? 32.034  -3.320  -17.742 1.00 79.58  ? 204 PRO L CD  1 
ATOM   3070 N N   . VAL B 2 205 ? 35.064  -1.457  -14.621 1.00 62.53  ? 205 VAL L N   1 
ATOM   3071 C CA  . VAL B 2 205 ? 36.311  -0.717  -14.462 1.00 60.39  ? 205 VAL L CA  1 
ATOM   3072 C C   . VAL B 2 205 ? 37.457  -1.640  -14.060 1.00 63.57  ? 205 VAL L C   1 
ATOM   3073 O O   . VAL B 2 205 ? 37.374  -2.349  -13.056 1.00 68.30  ? 205 VAL L O   1 
ATOM   3074 C CB  . VAL B 2 205 ? 36.170  0.402   -13.412 1.00 61.30  ? 205 VAL L CB  1 
ATOM   3075 C CG1 . VAL B 2 205 ? 37.520  1.046   -13.133 1.00 57.95  ? 205 VAL L CG1 1 
ATOM   3076 C CG2 . VAL B 2 205 ? 35.164  1.441   -13.879 1.00 54.44  ? 205 VAL L CG2 1 
ATOM   3077 N N   . THR B 2 206 ? 38.525  -1.625  -14.850 1.00 56.40  ? 206 THR L N   1 
ATOM   3078 C CA  . THR B 2 206 ? 39.681  -2.473  -14.588 1.00 57.07  ? 206 THR L CA  1 
ATOM   3079 C C   . THR B 2 206 ? 40.924  -1.655  -14.254 1.00 64.52  ? 206 THR L C   1 
ATOM   3080 O O   . THR B 2 206 ? 41.433  -0.909  -15.090 1.00 82.75  ? 206 THR L O   1 
ATOM   3081 C CB  . THR B 2 206 ? 39.995  -3.383  -15.791 1.00 47.43  ? 206 THR L CB  1 
ATOM   3082 O OG1 . THR B 2 206 ? 38.881  -4.246  -16.046 1.00 61.95  ? 206 THR L OG1 1 
ATOM   3083 C CG2 . THR B 2 206 ? 41.229  -4.227  -15.511 1.00 54.67  ? 206 THR L CG2 1 
ATOM   3084 N N   . LYS B 2 207 ? 41.404  -1.796  -13.024 1.00 63.63  ? 207 LYS L N   1 
ATOM   3085 C CA  . LYS B 2 207 ? 42.656  -1.175  -12.613 1.00 60.36  ? 207 LYS L CA  1 
ATOM   3086 C C   . LYS B 2 207 ? 43.743  -2.238  -12.537 1.00 60.73  ? 207 LYS L C   1 
ATOM   3087 O O   . LYS B 2 207 ? 43.524  -3.318  -11.990 1.00 63.91  ? 207 LYS L O   1 
ATOM   3088 C CB  . LYS B 2 207 ? 42.500  -0.467  -11.267 1.00 54.97  ? 207 LYS L CB  1 
ATOM   3089 C CG  . LYS B 2 207 ? 41.482  0.662   -11.275 1.00 58.53  ? 207 LYS L CG  1 
ATOM   3090 C CD  . LYS B 2 207 ? 41.911  1.798   -12.188 1.00 50.82  ? 207 LYS L CD  1 
ATOM   3091 C CE  . LYS B 2 207 ? 40.921  2.951   -12.130 1.00 61.39  ? 207 LYS L CE  1 
ATOM   3092 N NZ  . LYS B 2 207 ? 41.330  4.086   -13.001 1.00 76.81  ? 207 LYS L NZ  1 
ATOM   3093 N N   . SER B 2 208 ? 44.914  -1.933  -13.085 1.00 59.60  ? 208 SER L N   1 
ATOM   3094 C CA  . SER B 2 208 ? 45.975  -2.927  -13.181 1.00 55.42  ? 208 SER L CA  1 
ATOM   3095 C C   . SER B 2 208 ? 47.366  -2.343  -12.972 1.00 56.76  ? 208 SER L C   1 
ATOM   3096 O O   . SER B 2 208 ? 47.541  -1.129  -12.870 1.00 53.81  ? 208 SER L O   1 
ATOM   3097 C CB  . SER B 2 208 ? 45.919  -3.622  -14.543 1.00 57.22  ? 208 SER L CB  1 
ATOM   3098 O OG  . SER B 2 208 ? 46.172  -2.704  -15.592 1.00 63.20  ? 208 SER L OG  1 
ATOM   3099 N N   . PHE B 2 209 ? 48.350  -3.234  -12.908 1.00 62.73  ? 209 PHE L N   1 
ATOM   3100 C CA  . PHE B 2 209 ? 49.752  -2.852  -12.829 1.00 59.38  ? 209 PHE L CA  1 
ATOM   3101 C C   . PHE B 2 209 ? 50.617  -4.012  -13.303 1.00 66.45  ? 209 PHE L C   1 
ATOM   3102 O O   . PHE B 2 209 ? 50.246  -5.175  -13.148 1.00 62.36  ? 209 PHE L O   1 
ATOM   3103 C CB  . PHE B 2 209 ? 50.135  -2.445  -11.402 1.00 55.54  ? 209 PHE L CB  1 
ATOM   3104 C CG  . PHE B 2 209 ? 50.186  -3.594  -10.431 1.00 64.35  ? 209 PHE L CG  1 
ATOM   3105 C CD1 . PHE B 2 209 ? 51.378  -4.257  -10.178 1.00 62.06  ? 209 PHE L CD1 1 
ATOM   3106 C CD2 . PHE B 2 209 ? 49.044  -4.005  -9.764  1.00 65.52  ? 209 PHE L CD2 1 
ATOM   3107 C CE1 . PHE B 2 209 ? 51.427  -5.312  -9.287  1.00 59.52  ? 209 PHE L CE1 1 
ATOM   3108 C CE2 . PHE B 2 209 ? 49.088  -5.059  -8.869  1.00 60.87  ? 209 PHE L CE2 1 
ATOM   3109 C CZ  . PHE B 2 209 ? 50.280  -5.713  -8.631  1.00 55.12  ? 209 PHE L CZ  1 
ATOM   3110 N N   . ASN B 2 210 ? 51.768  -3.694  -13.884 1.00 74.70  ? 210 ASN L N   1 
ATOM   3111 C CA  . ASN B 2 210 ? 52.718  -4.720  -14.289 1.00 76.19  ? 210 ASN L CA  1 
ATOM   3112 C C   . ASN B 2 210 ? 53.823  -4.874  -13.251 1.00 71.48  ? 210 ASN L C   1 
ATOM   3113 O O   . ASN B 2 210 ? 54.405  -3.885  -12.804 1.00 73.82  ? 210 ASN L O   1 
ATOM   3114 C CB  . ASN B 2 210 ? 53.312  -4.394  -15.659 1.00 87.04  ? 210 ASN L CB  1 
ATOM   3115 C CG  . ASN B 2 210 ? 52.286  -4.481  -16.773 1.00 90.16  ? 210 ASN L CG  1 
ATOM   3116 O OD1 . ASN B 2 210 ? 52.079  -5.542  -17.360 1.00 84.55  ? 210 ASN L OD1 1 
ATOM   3117 N ND2 . ASN B 2 210 ? 51.635  -3.361  -17.066 1.00 95.28  ? 210 ASN L ND2 1 
ATOM   3118 N N   . ARG B 2 211 ? 54.096  -6.116  -12.865 1.00 64.59  ? 211 ARG L N   1 
ATOM   3119 C CA  . ARG B 2 211 ? 55.112  -6.406  -11.860 1.00 73.58  ? 211 ARG L CA  1 
ATOM   3120 C C   . ARG B 2 211 ? 56.491  -5.939  -12.314 1.00 87.68  ? 211 ARG L C   1 
ATOM   3121 O O   . ARG B 2 211 ? 57.115  -6.558  -13.176 1.00 87.67  ? 211 ARG L O   1 
ATOM   3122 C CB  . ARG B 2 211 ? 55.139  -7.902  -11.546 1.00 65.12  ? 211 ARG L CB  1 
ATOM   3123 C CG  . ARG B 2 211 ? 56.095  -8.286  -10.431 1.00 66.99  ? 211 ARG L CG  1 
ATOM   3124 C CD  . ARG B 2 211 ? 56.070  -9.784  -10.179 1.00 64.76  ? 211 ARG L CD  1 
ATOM   3125 N NE  . ARG B 2 211 ? 56.443  -10.544 -11.368 1.00 69.84  ? 211 ARG L NE  1 
ATOM   3126 C CZ  . ARG B 2 211 ? 57.691  -10.869 -11.684 1.00 71.00  ? 211 ARG L CZ  1 
ATOM   3127 N NH1 . ARG B 2 211 ? 58.693  -10.500 -10.898 1.00 72.51  ? 211 ARG L NH1 1 
ATOM   3128 N NH2 . ARG B 2 211 ? 57.939  -11.562 -12.787 1.00 76.48  ? 211 ARG L NH2 1 
ATOM   3129 N N   . GLY B 2 212 ? 56.958  -4.841  -11.729 1.00 98.11  ? 212 GLY L N   1 
ATOM   3130 C CA  . GLY B 2 212 ? 58.246  -4.275  -12.083 1.00 97.75  ? 212 GLY L CA  1 
ATOM   3131 C C   . GLY B 2 212 ? 58.111  -2.972  -12.846 1.00 91.55  ? 212 GLY L C   1 
ATOM   3132 O O   . GLY B 2 212 ? 58.898  -2.045  -12.656 1.00 95.21  ? 212 GLY L O   1 
ATOM   3133 N N   . GLN C 3 1   ? -13.839 -6.587  27.678  1.00 73.44  ? 1   GLN C N   1 
ATOM   3134 C CA  . GLN C 3 1   ? -12.683 -7.445  27.902  1.00 72.28  ? 1   GLN C CA  1 
ATOM   3135 C C   . GLN C 3 1   ? -12.965 -8.434  29.032  1.00 67.87  ? 1   GLN C C   1 
ATOM   3136 O O   . GLN C 3 1   ? -14.005 -9.092  29.042  1.00 70.46  ? 1   GLN C O   1 
ATOM   3137 C CB  . GLN C 3 1   ? -11.444 -6.602  28.218  1.00 71.00  ? 1   GLN C CB  1 
ATOM   3138 C CG  . GLN C 3 1   ? -10.130 -7.223  27.765  1.00 70.89  ? 1   GLN C CG  1 
ATOM   3139 N N   . LEU C 3 2   ? -12.041 -8.535  29.984  1.00 64.49  ? 2   LEU C N   1 
ATOM   3140 C CA  . LEU C 3 2   ? -12.205 -9.448  31.111  1.00 59.55  ? 2   LEU C CA  1 
ATOM   3141 C C   . LEU C 3 2   ? -13.159 -8.874  32.152  1.00 52.66  ? 2   LEU C C   1 
ATOM   3142 O O   . LEU C 3 2   ? -13.076 -7.697  32.504  1.00 50.22  ? 2   LEU C O   1 
ATOM   3143 C CB  . LEU C 3 2   ? -10.854 -9.759  31.757  1.00 58.55  ? 2   LEU C CB  1 
ATOM   3144 C CG  . LEU C 3 2   ? -9.911  -10.672 30.972  1.00 51.54  ? 2   LEU C CG  1 
ATOM   3145 C CD1 . LEU C 3 2   ? -8.698  -11.033 31.814  1.00 44.35  ? 2   LEU C CD1 1 
ATOM   3146 C CD2 . LEU C 3 2   ? -10.636 -11.925 30.507  1.00 49.42  ? 2   LEU C CD2 1 
ATOM   3147 N N   . LEU C 3 3   ? -14.062 -9.716  32.643  1.00 48.65  ? 3   LEU C N   1 
ATOM   3148 C CA  . LEU C 3 3   ? -15.042 -9.291  33.634  1.00 62.37  ? 3   LEU C CA  1 
ATOM   3149 C C   . LEU C 3 3   ? -14.861 -10.040 34.951  1.00 57.51  ? 3   LEU C C   1 
ATOM   3150 O O   . LEU C 3 3   ? -14.415 -11.187 34.970  1.00 57.27  ? 3   LEU C O   1 
ATOM   3151 C CB  . LEU C 3 3   ? -16.461 -9.498  33.102  1.00 65.46  ? 3   LEU C CB  1 
ATOM   3152 C CG  . LEU C 3 3   ? -16.758 -8.906  31.723  1.00 68.31  ? 3   LEU C CG  1 
ATOM   3153 C CD1 . LEU C 3 3   ? -18.199 -9.181  31.317  1.00 61.53  ? 3   LEU C CD1 1 
ATOM   3154 C CD2 . LEU C 3 3   ? -16.465 -7.414  31.702  1.00 74.11  ? 3   LEU C CD2 1 
ATOM   3155 N N   . PHE C 3 4   ? -15.212 -9.380  36.050  1.00 68.55  ? 4   PHE C N   1 
ATOM   3156 C CA  . PHE C 3 4   ? -15.088 -9.967  37.379  1.00 70.17  ? 4   PHE C CA  1 
ATOM   3157 C C   . PHE C 3 4   ? -16.397 -9.826  38.147  1.00 75.91  ? 4   PHE C C   1 
ATOM   3158 O O   . PHE C 3 4   ? -17.126 -8.853  37.956  1.00 83.86  ? 4   PHE C O   1 
ATOM   3159 C CB  . PHE C 3 4   ? -13.958 -9.299  38.171  1.00 66.29  ? 4   PHE C CB  1 
ATOM   3160 C CG  . PHE C 3 4   ? -12.642 -9.245  37.444  1.00 60.28  ? 4   PHE C CG  1 
ATOM   3161 C CD1 . PHE C 3 4   ? -12.380 -8.241  36.524  1.00 67.01  ? 4   PHE C CD1 1 
ATOM   3162 C CD2 . PHE C 3 4   ? -11.657 -10.184 37.701  1.00 66.29  ? 4   PHE C CD2 1 
ATOM   3163 C CE1 . PHE C 3 4   ? -11.168 -8.187  35.861  1.00 58.37  ? 4   PHE C CE1 1 
ATOM   3164 C CE2 . PHE C 3 4   ? -10.442 -10.133 37.043  1.00 60.39  ? 4   PHE C CE2 1 
ATOM   3165 C CZ  . PHE C 3 4   ? -10.198 -9.134  36.122  1.00 59.96  ? 4   PHE C CZ  1 
ATOM   3166 N N   . ASN C 3 5   ? -16.698 -10.788 39.015  1.00 85.41  ? 5   ASN C N   1 
ATOM   3167 C CA  . ASN C 3 5   ? -17.813 -10.622 39.943  1.00 101.85 ? 5   ASN C CA  1 
ATOM   3168 C C   . ASN C 3 5   ? -17.299 -9.944  41.214  1.00 95.32  ? 5   ASN C C   1 
ATOM   3169 O O   . ASN C 3 5   ? -17.454 -10.452 42.325  1.00 112.90 ? 5   ASN C O   1 
ATOM   3170 C CB  . ASN C 3 5   ? -18.504 -11.964 40.240  1.00 112.41 ? 5   ASN C CB  1 
ATOM   3171 C CG  . ASN C 3 5   ? -17.554 -13.037 40.770  1.00 124.14 ? 5   ASN C CG  1 
ATOM   3172 O OD1 . ASN C 3 5   ? -16.497 -12.732 41.320  1.00 125.32 ? 5   ASN C OD1 1 
ATOM   3173 N ND2 . ASN C 3 5   ? -17.938 -14.308 40.614  1.00 138.52 ? 5   ASN C ND2 1 
ATOM   3174 N N   . LYS C 3 6   ? -16.707 -8.768  41.010  1.00 69.13  ? 6   LYS C N   1 
ATOM   3175 C CA  . LYS C 3 6   ? -15.893 -8.062  41.999  1.00 70.60  ? 6   LYS C CA  1 
ATOM   3176 C C   . LYS C 3 6   ? -16.469 -7.968  43.411  1.00 78.34  ? 6   LYS C C   1 
ATOM   3177 O O   . LYS C 3 6   ? -17.683 -7.973  43.612  1.00 87.00  ? 6   LYS C O   1 
ATOM   3178 C CB  . LYS C 3 6   ? -15.604 -6.646  41.493  1.00 66.14  ? 6   LYS C CB  1 
ATOM   3179 N N   . THR C 3 7   ? -15.564 -7.875  44.381  1.00 78.37  ? 7   THR C N   1 
ATOM   3180 C CA  . THR C 3 7   ? -15.920 -7.698  45.782  1.00 78.10  ? 7   THR C CA  1 
ATOM   3181 C C   . THR C 3 7   ? -15.260 -6.431  46.320  1.00 70.91  ? 7   THR C C   1 
ATOM   3182 O O   . THR C 3 7   ? -14.077 -6.190  46.075  1.00 68.82  ? 7   THR C O   1 
ATOM   3183 C CB  . THR C 3 7   ? -15.493 -8.909  46.634  1.00 78.69  ? 7   THR C CB  1 
ATOM   3184 O OG1 . THR C 3 7   ? -16.083 -10.102 46.103  1.00 83.27  ? 7   THR C OG1 1 
ATOM   3185 C CG2 . THR C 3 7   ? -15.931 -8.733  48.080  1.00 84.82  ? 7   THR C CG2 1 
ATOM   3186 N N   . LYS C 3 8   ? -16.028 -5.624  47.045  1.00 70.11  ? 8   LYS C N   1 
ATOM   3187 C CA  . LYS C 3 8   ? -15.534 -4.356  47.571  1.00 63.72  ? 8   LYS C CA  1 
ATOM   3188 C C   . LYS C 3 8   ? -14.374 -4.549  48.545  1.00 74.27  ? 8   LYS C C   1 
ATOM   3189 O O   . LYS C 3 8   ? -13.295 -3.989  48.354  1.00 65.33  ? 8   LYS C O   1 
ATOM   3190 C CB  . LYS C 3 8   ? -16.667 -3.588  48.257  1.00 68.74  ? 8   LYS C CB  1 
ATOM   3191 N N   . SER C 3 9   ? -14.600 -5.344  49.586  1.00 74.38  ? 9   SER C N   1 
ATOM   3192 C CA  . SER C 3 9   ? -13.577 -5.570  50.600  1.00 68.01  ? 9   SER C CA  1 
ATOM   3193 C C   . SER C 3 9   ? -13.823 -6.853  51.383  1.00 62.88  ? 9   SER C C   1 
ATOM   3194 O O   . SER C 3 9   ? -14.956 -7.323  51.489  1.00 78.20  ? 9   SER C O   1 
ATOM   3195 C CB  . SER C 3 9   ? -13.511 -4.382  51.562  1.00 77.80  ? 9   SER C CB  1 
ATOM   3196 O OG  . SER C 3 9   ? -14.731 -4.228  52.266  1.00 88.91  ? 9   SER C OG  1 
ATOM   3197 N N   . VAL C 3 10  ? -12.750 -7.415  51.930  1.00 67.37  ? 10  VAL C N   1 
ATOM   3198 C CA  . VAL C 3 10  ? -12.846 -8.590  52.786  1.00 74.37  ? 10  VAL C CA  1 
ATOM   3199 C C   . VAL C 3 10  ? -12.199 -8.303  54.138  1.00 71.48  ? 10  VAL C C   1 
ATOM   3200 O O   . VAL C 3 10  ? -11.205 -7.581  54.221  1.00 61.88  ? 10  VAL C O   1 
ATOM   3201 C CB  . VAL C 3 10  ? -12.184 -9.821  52.143  1.00 78.39  ? 10  VAL C CB  1 
ATOM   3202 C CG1 . VAL C 3 10  ? -13.045 -10.354 51.008  1.00 82.49  ? 10  VAL C CG1 1 
ATOM   3203 C CG2 . VAL C 3 10  ? -10.786 -9.479  51.647  1.00 63.62  ? 10  VAL C CG2 1 
ATOM   3204 N N   . GLU C 3 11  ? -12.770 -8.867  55.197  1.00 67.95  ? 11  GLU C N   1 
ATOM   3205 C CA  . GLU C 3 11  ? -12.285 -8.610  56.547  1.00 73.94  ? 11  GLU C CA  1 
ATOM   3206 C C   . GLU C 3 11  ? -11.821 -9.884  57.240  1.00 71.17  ? 11  GLU C C   1 
ATOM   3207 O O   . GLU C 3 11  ? -12.414 -10.948 57.067  1.00 89.16  ? 11  GLU C O   1 
ATOM   3208 C CB  . GLU C 3 11  ? -13.373 -7.929  57.382  1.00 85.90  ? 11  GLU C CB  1 
ATOM   3209 N N   . PHE C 3 12  ? -10.756 -9.766  58.025  1.00 70.86  ? 12  PHE C N   1 
ATOM   3210 C CA  . PHE C 3 12  ? -10.259 -10.887 58.811  1.00 81.28  ? 12  PHE C CA  1 
ATOM   3211 C C   . PHE C 3 12  ? -9.964  -10.429 60.233  1.00 84.49  ? 12  PHE C C   1 
ATOM   3212 O O   . PHE C 3 12  ? -9.760  -9.240  60.482  1.00 77.72  ? 12  PHE C O   1 
ATOM   3213 C CB  . PHE C 3 12  ? -9.011  -11.500 58.164  1.00 74.61  ? 12  PHE C CB  1 
ATOM   3214 C CG  . PHE C 3 12  ? -7.777  -10.646 58.279  1.00 76.66  ? 12  PHE C CG  1 
ATOM   3215 C CD1 . PHE C 3 12  ? -6.790  -10.951 59.204  1.00 81.38  ? 12  PHE C CD1 1 
ATOM   3216 C CD2 . PHE C 3 12  ? -7.601  -9.541  57.462  1.00 72.83  ? 12  PHE C CD2 1 
ATOM   3217 C CE1 . PHE C 3 12  ? -5.650  -10.173 59.308  1.00 74.75  ? 12  PHE C CE1 1 
ATOM   3218 C CE2 . PHE C 3 12  ? -6.465  -8.758  57.564  1.00 75.45  ? 12  PHE C CE2 1 
ATOM   3219 C CZ  . PHE C 3 12  ? -5.490  -9.074  58.488  1.00 71.66  ? 12  PHE C CZ  1 
ATOM   3220 N N   . THR C 3 13  ? -9.954  -11.375 61.166  1.00 91.08  ? 13  THR C N   1 
ATOM   3221 C CA  . THR C 3 13  ? -9.723  -11.062 62.570  1.00 92.44  ? 13  THR C CA  1 
ATOM   3222 C C   . THR C 3 13  ? -8.602  -11.918 63.152  1.00 95.10  ? 13  THR C C   1 
ATOM   3223 O O   . THR C 3 13  ? -7.815  -12.514 62.415  1.00 81.20  ? 13  THR C O   1 
ATOM   3224 C CB  . THR C 3 13  ? -11.002 -11.261 63.409  1.00 98.47  ? 13  THR C CB  1 
ATOM   3225 O OG1 . THR C 3 13  ? -11.528 -12.574 63.183  1.00 103.61 ? 13  THR C OG1 1 
ATOM   3226 C CG2 . THR C 3 13  ? -12.055 -10.229 63.031  1.00 89.88  ? 13  THR C CG2 1 
ATOM   3227 N N   . PHE C 3 14  ? -8.532  -11.968 64.479  1.00 89.42  ? 14  PHE C N   1 
ATOM   3228 C CA  . PHE C 3 14  ? -7.519  -12.761 65.163  1.00 91.24  ? 14  PHE C CA  1 
ATOM   3229 C C   . PHE C 3 14  ? -7.774  -14.251 64.962  1.00 106.09 ? 14  PHE C C   1 
ATOM   3230 O O   . PHE C 3 14  ? -6.842  -15.054 64.937  1.00 103.61 ? 14  PHE C O   1 
ATOM   3231 C CB  . PHE C 3 14  ? -7.489  -12.423 66.655  1.00 108.26 ? 14  PHE C CB  1 
ATOM   3232 N N   . GLY C 3 15  ? -9.045  -14.611 64.809  1.00 108.20 ? 15  GLY C N   1 
ATOM   3233 C CA  . GLY C 3 15  ? -9.427  -15.996 64.609  1.00 111.72 ? 15  GLY C CA  1 
ATOM   3234 C C   . GLY C 3 15  ? -9.035  -16.519 63.240  1.00 104.06 ? 15  GLY C C   1 
ATOM   3235 O O   . GLY C 3 15  ? -8.873  -17.724 63.050  1.00 108.28 ? 15  GLY C O   1 
ATOM   3236 N N   . ASN C 3 16  ? -8.884  -15.608 62.284  1.00 99.33  ? 16  ASN C N   1 
ATOM   3237 C CA  . ASN C 3 16  ? -8.489  -15.982 60.931  1.00 87.70  ? 16  ASN C CA  1 
ATOM   3238 C C   . ASN C 3 16  ? -7.042  -16.456 60.870  1.00 88.99  ? 16  ASN C C   1 
ATOM   3239 O O   . ASN C 3 16  ? -6.113  -15.649 60.901  1.00 90.77  ? 16  ASN C O   1 
ATOM   3240 C CB  . ASN C 3 16  ? -8.696  -14.809 59.969  1.00 94.12  ? 16  ASN C CB  1 
ATOM   3241 C CG  . ASN C 3 16  ? -10.158 -14.567 59.652  1.00 98.83  ? 16  ASN C CG  1 
ATOM   3242 O OD1 . ASN C 3 16  ? -10.836 -13.803 60.336  1.00 108.96 ? 16  ASN C OD1 1 
ATOM   3243 N ND2 . ASN C 3 16  ? -10.652 -15.222 58.607  1.00 112.38 ? 16  ASN C ND2 1 
ATOM   3244 N N   . ASP C 3 17  ? -6.859  -17.770 60.786  1.00 94.01  ? 17  ASP C N   1 
ATOM   3245 C CA  . ASP C 3 17  ? -5.528  -18.356 60.680  1.00 93.03  ? 17  ASP C CA  1 
ATOM   3246 C C   . ASP C 3 17  ? -4.881  -17.965 59.356  1.00 83.73  ? 17  ASP C C   1 
ATOM   3247 O O   . ASP C 3 17  ? -3.702  -17.615 59.306  1.00 83.39  ? 17  ASP C O   1 
ATOM   3248 C CB  . ASP C 3 17  ? -5.599  -19.878 60.811  1.00 100.76 ? 17  ASP C CB  1 
ATOM   3249 C CG  . ASP C 3 17  ? -4.229  -20.527 60.821  1.00 102.00 ? 17  ASP C CG  1 
ATOM   3250 O OD1 . ASP C 3 17  ? -3.269  -19.884 61.293  1.00 104.49 ? 17  ASP C OD1 1 
ATOM   3251 O OD2 . ASP C 3 17  ? -4.114  -21.682 60.359  1.00 102.21 ? 17  ASP C OD2 1 
ATOM   3252 N N   . THR C 3 18  ? -5.663  -18.035 58.284  1.00 85.92  ? 18  THR C N   1 
ATOM   3253 C CA  . THR C 3 18  ? -5.213  -17.593 56.969  1.00 85.46  ? 18  THR C CA  1 
ATOM   3254 C C   . THR C 3 18  ? -6.269  -16.691 56.340  1.00 90.62  ? 18  THR C C   1 
ATOM   3255 O O   . THR C 3 18  ? -7.456  -16.811 56.646  1.00 100.71 ? 18  THR C O   1 
ATOM   3256 C CB  . THR C 3 18  ? -4.933  -18.778 56.022  1.00 78.17  ? 18  THR C CB  1 
ATOM   3257 O OG1 . THR C 3 18  ? -6.153  -19.480 55.756  1.00 77.08  ? 18  THR C OG1 1 
ATOM   3258 C CG2 . THR C 3 18  ? -3.919  -19.736 56.634  1.00 79.44  ? 18  THR C CG2 1 
ATOM   3259 N N   . VAL C 3 19  ? -5.839  -15.788 55.466  1.00 83.32  ? 19  VAL C N   1 
ATOM   3260 C CA  . VAL C 3 19  ? -6.775  -14.911 54.774  1.00 83.67  ? 19  VAL C CA  1 
ATOM   3261 C C   . VAL C 3 19  ? -6.826  -15.249 53.286  1.00 77.76  ? 19  VAL C C   1 
ATOM   3262 O O   . VAL C 3 19  ? -5.869  -15.785 52.724  1.00 73.78  ? 19  VAL C O   1 
ATOM   3263 C CB  . VAL C 3 19  ? -6.409  -13.421 54.962  1.00 77.46  ? 19  VAL C CB  1 
ATOM   3264 C CG1 . VAL C 3 19  ? -6.069  -13.141 56.417  1.00 74.00  ? 19  VAL C CG1 1 
ATOM   3265 C CG2 . VAL C 3 19  ? -5.253  -13.026 54.062  1.00 72.43  ? 19  VAL C CG2 1 
ATOM   3266 N N   . VAL C 3 20  ? -7.960  -14.954 52.657  1.00 73.34  ? 20  VAL C N   1 
ATOM   3267 C CA  . VAL C 3 20  ? -8.143  -15.224 51.236  1.00 62.84  ? 20  VAL C CA  1 
ATOM   3268 C C   . VAL C 3 20  ? -8.724  -14.011 50.522  1.00 56.96  ? 20  VAL C C   1 
ATOM   3269 O O   . VAL C 3 20  ? -9.839  -13.581 50.817  1.00 67.71  ? 20  VAL C O   1 
ATOM   3270 C CB  . VAL C 3 20  ? -9.068  -16.436 50.998  1.00 67.96  ? 20  VAL C CB  1 
ATOM   3271 C CG1 . VAL C 3 20  ? -9.350  -16.603 49.513  1.00 66.79  ? 20  VAL C CG1 1 
ATOM   3272 C CG2 . VAL C 3 20  ? -8.450  -17.701 51.569  1.00 66.50  ? 20  VAL C CG2 1 
ATOM   3273 N N   . ILE C 3 21  ? -7.961  -13.461 49.585  1.00 52.99  ? 21  ILE C N   1 
ATOM   3274 C CA  . ILE C 3 21  ? -8.422  -12.324 48.799  1.00 59.38  ? 21  ILE C CA  1 
ATOM   3275 C C   . ILE C 3 21  ? -9.000  -12.810 47.473  1.00 56.92  ? 21  ILE C C   1 
ATOM   3276 O O   . ILE C 3 21  ? -8.271  -13.327 46.626  1.00 60.50  ? 21  ILE C O   1 
ATOM   3277 C CB  . ILE C 3 21  ? -7.288  -11.321 48.539  1.00 51.32  ? 21  ILE C CB  1 
ATOM   3278 C CG1 . ILE C 3 21  ? -6.476  -11.100 49.816  1.00 59.00  ? 21  ILE C CG1 1 
ATOM   3279 C CG2 . ILE C 3 21  ? -7.851  -10.005 48.027  1.00 46.97  ? 21  ILE C CG2 1 
ATOM   3280 C CD1 . ILE C 3 21  ? -5.285  -10.192 49.631  1.00 70.49  ? 21  ILE C CD1 1 
ATOM   3281 N N   . PRO C 3 22  ? -10.319 -12.643 47.293  1.00 53.34  ? 22  PRO C N   1 
ATOM   3282 C CA  . PRO C 3 22  ? -11.050 -13.180 46.140  1.00 58.36  ? 22  PRO C CA  1 
ATOM   3283 C C   . PRO C 3 22  ? -10.712 -12.495 44.817  1.00 63.53  ? 22  PRO C C   1 
ATOM   3284 O O   . PRO C 3 22  ? -10.460 -11.291 44.781  1.00 70.22  ? 22  PRO C O   1 
ATOM   3285 C CB  . PRO C 3 22  ? -12.514 -12.929 46.512  1.00 51.80  ? 22  PRO C CB  1 
ATOM   3286 C CG  . PRO C 3 22  ? -12.467 -11.745 47.410  1.00 61.85  ? 22  PRO C CG  1 
ATOM   3287 C CD  . PRO C 3 22  ? -11.200 -11.891 48.203  1.00 52.97  ? 22  PRO C CD  1 
ATOM   3288 N N   . CYS C 3 23  ? -10.714 -13.277 43.742  1.00 61.35  ? 23  CYS C N   1 
ATOM   3289 C CA  . CYS C 3 23  ? -10.497 -12.764 42.395  1.00 61.68  ? 23  CYS C CA  1 
ATOM   3290 C C   . CYS C 3 23  ? -11.027 -13.766 41.377  1.00 56.38  ? 23  CYS C C   1 
ATOM   3291 O O   . CYS C 3 23  ? -10.388 -14.783 41.104  1.00 59.45  ? 23  CYS C O   1 
ATOM   3292 C CB  . CYS C 3 23  ? -9.015  -12.485 42.146  1.00 57.79  ? 23  CYS C CB  1 
ATOM   3293 S SG  . CYS C 3 23  ? -8.652  -11.710 40.552  1.00 61.72  ? 23  CYS C SG  1 
ATOM   3294 N N   . PHE C 3 24  ? -12.200 -13.480 40.823  1.00 54.14  ? 24  PHE C N   1 
ATOM   3295 C CA  . PHE C 3 24  ? -12.852 -14.402 39.902  1.00 45.04  ? 24  PHE C CA  1 
ATOM   3296 C C   . PHE C 3 24  ? -13.159 -13.755 38.555  1.00 57.81  ? 24  PHE C C   1 
ATOM   3297 O O   . PHE C 3 24  ? -13.922 -12.792 38.481  1.00 45.44  ? 24  PHE C O   1 
ATOM   3298 C CB  . PHE C 3 24  ? -14.145 -14.942 40.518  1.00 46.74  ? 24  PHE C CB  1 
ATOM   3299 C CG  . PHE C 3 24  ? -13.937 -15.718 41.788  1.00 65.04  ? 24  PHE C CG  1 
ATOM   3300 C CD1 . PHE C 3 24  ? -13.728 -17.086 41.753  1.00 58.25  ? 24  PHE C CD1 1 
ATOM   3301 C CD2 . PHE C 3 24  ? -13.960 -15.080 43.018  1.00 62.65  ? 24  PHE C CD2 1 
ATOM   3302 C CE1 . PHE C 3 24  ? -13.541 -17.804 42.920  1.00 60.63  ? 24  PHE C CE1 1 
ATOM   3303 C CE2 . PHE C 3 24  ? -13.773 -15.793 44.188  1.00 64.66  ? 24  PHE C CE2 1 
ATOM   3304 C CZ  . PHE C 3 24  ? -13.563 -17.157 44.138  1.00 64.29  ? 24  PHE C CZ  1 
ATOM   3305 N N   . VAL C 3 25  ? -12.563 -14.288 37.493  1.00 56.42  ? 25  VAL C N   1 
ATOM   3306 C CA  . VAL C 3 25  ? -12.877 -13.843 36.141  1.00 51.12  ? 25  VAL C CA  1 
ATOM   3307 C C   . VAL C 3 25  ? -14.066 -14.635 35.611  1.00 46.13  ? 25  VAL C C   1 
ATOM   3308 O O   . VAL C 3 25  ? -14.078 -15.864 35.672  1.00 49.99  ? 25  VAL C O   1 
ATOM   3309 C CB  . VAL C 3 25  ? -11.684 -14.010 35.185  1.00 52.57  ? 25  VAL C CB  1 
ATOM   3310 C CG1 . VAL C 3 25  ? -11.986 -13.351 33.846  1.00 52.24  ? 25  VAL C CG1 1 
ATOM   3311 C CG2 . VAL C 3 25  ? -10.424 -13.424 35.799  1.00 50.13  ? 25  VAL C CG2 1 
ATOM   3312 N N   . THR C 3 26  ? -15.065 -13.930 35.091  1.00 47.40  ? 26  THR C N   1 
ATOM   3313 C CA  . THR C 3 26  ? -16.298 -14.572 34.649  1.00 57.02  ? 26  THR C CA  1 
ATOM   3314 C C   . THR C 3 26  ? -16.254 -14.993 33.183  1.00 59.57  ? 26  THR C C   1 
ATOM   3315 O O   . THR C 3 26  ? -16.946 -15.929 32.782  1.00 70.78  ? 26  THR C O   1 
ATOM   3316 C CB  . THR C 3 26  ? -17.514 -13.650 34.860  1.00 58.01  ? 26  THR C CB  1 
ATOM   3317 O OG1 . THR C 3 26  ? -17.324 -12.430 34.135  1.00 51.16  ? 26  THR C OG1 1 
ATOM   3318 C CG2 . THR C 3 26  ? -17.691 -13.335 36.337  1.00 51.76  ? 26  THR C CG2 1 
ATOM   3319 N N   . ASN C 3 27  ? -15.443 -14.308 32.384  1.00 57.68  ? 27  ASN C N   1 
ATOM   3320 C CA  . ASN C 3 27  ? -15.390 -14.585 30.951  1.00 64.07  ? 27  ASN C CA  1 
ATOM   3321 C C   . ASN C 3 27  ? -14.015 -15.034 30.462  1.00 74.07  ? 27  ASN C C   1 
ATOM   3322 O O   . ASN C 3 27  ? -13.465 -14.463 29.521  1.00 73.86  ? 27  ASN C O   1 
ATOM   3323 C CB  . ASN C 3 27  ? -15.842 -13.354 30.161  1.00 53.46  ? 27  ASN C CB  1 
ATOM   3324 C CG  . ASN C 3 27  ? -15.033 -12.114 30.493  1.00 63.57  ? 27  ASN C CG  1 
ATOM   3325 O OD1 . ASN C 3 27  ? -14.350 -12.058 31.516  1.00 59.48  ? 27  ASN C OD1 1 
ATOM   3326 N ND2 . ASN C 3 27  ? -15.105 -11.113 29.625  1.00 62.73  ? 27  ASN C ND2 1 
ATOM   3327 N N   . MET C 3 28  ? -13.467 -16.066 31.097  1.00 74.91  ? 28  MET C N   1 
ATOM   3328 C CA  . MET C 3 28  ? -12.205 -16.645 30.652  1.00 70.51  ? 28  MET C CA  1 
ATOM   3329 C C   . MET C 3 28  ? -12.439 -17.678 29.558  1.00 69.09  ? 28  MET C C   1 
ATOM   3330 O O   . MET C 3 28  ? -13.414 -18.430 29.600  1.00 68.95  ? 28  MET C O   1 
ATOM   3331 C CB  . MET C 3 28  ? -11.454 -17.284 31.822  1.00 66.25  ? 28  MET C CB  1 
ATOM   3332 C CG  . MET C 3 28  ? -10.475 -16.353 32.513  1.00 59.43  ? 28  MET C CG  1 
ATOM   3333 S SD  . MET C 3 28  ? -9.378  -17.221 33.649  1.00 90.94  ? 28  MET C SD  1 
ATOM   3334 C CE  . MET C 3 28  ? -8.865  -18.605 32.635  1.00 83.42  ? 28  MET C CE  1 
ATOM   3335 N N   . GLU C 3 29  ? -11.539 -17.713 28.582  1.00 66.82  ? 29  GLU C N   1 
ATOM   3336 C CA  . GLU C 3 29  ? -11.660 -18.638 27.463  1.00 65.68  ? 29  GLU C CA  1 
ATOM   3337 C C   . GLU C 3 29  ? -10.397 -19.478 27.299  1.00 66.27  ? 29  GLU C C   1 
ATOM   3338 O O   . GLU C 3 29  ? -10.274 -20.251 26.350  1.00 65.60  ? 29  GLU C O   1 
ATOM   3339 C CB  . GLU C 3 29  ? -11.956 -17.874 26.171  1.00 67.34  ? 29  GLU C CB  1 
ATOM   3340 C CG  . GLU C 3 29  ? -10.814 -16.989 25.705  1.00 70.85  ? 29  GLU C CG  1 
ATOM   3341 C CD  . GLU C 3 29  ? -11.220 -16.041 24.596  1.00 83.69  ? 29  GLU C CD  1 
ATOM   3342 O OE1 . GLU C 3 29  ? -12.383 -16.111 24.145  1.00 84.08  ? 29  GLU C OE1 1 
ATOM   3343 O OE2 . GLU C 3 29  ? -10.373 -15.227 24.173  1.00 85.79  ? 29  GLU C OE2 1 
ATOM   3344 N N   . ALA C 3 30  ? -9.460  -19.320 28.228  1.00 65.19  ? 30  ALA C N   1 
ATOM   3345 C CA  . ALA C 3 30  ? -8.211  -20.073 28.187  1.00 62.11  ? 30  ALA C CA  1 
ATOM   3346 C C   . ALA C 3 30  ? -8.450  -21.545 28.503  1.00 58.78  ? 30  ALA C C   1 
ATOM   3347 O O   . ALA C 3 30  ? -9.186  -21.878 29.431  1.00 56.97  ? 30  ALA C O   1 
ATOM   3348 C CB  . ALA C 3 30  ? -7.201  -19.482 29.157  1.00 63.07  ? 30  ALA C CB  1 
ATOM   3349 N N   . GLN C 3 31  ? -7.825  -22.421 27.724  1.00 68.66  ? 31  GLN C N   1 
ATOM   3350 C CA  . GLN C 3 31  ? -7.972  -23.859 27.920  1.00 66.01  ? 31  GLN C CA  1 
ATOM   3351 C C   . GLN C 3 31  ? -6.716  -24.465 28.540  1.00 63.16  ? 31  GLN C C   1 
ATOM   3352 O O   . GLN C 3 31  ? -6.657  -25.668 28.794  1.00 65.07  ? 31  GLN C O   1 
ATOM   3353 C CB  . GLN C 3 31  ? -8.289  -24.550 26.592  1.00 66.61  ? 31  GLN C CB  1 
ATOM   3354 N N   . ASN C 3 32  ? -5.714  -23.625 28.780  1.00 66.50  ? 32  ASN C N   1 
ATOM   3355 C CA  . ASN C 3 32  ? -4.464  -24.080 29.376  1.00 63.29  ? 32  ASN C CA  1 
ATOM   3356 C C   . ASN C 3 32  ? -3.865  -23.019 30.293  1.00 71.23  ? 32  ASN C C   1 
ATOM   3357 O O   . ASN C 3 32  ? -3.958  -21.824 30.015  1.00 78.23  ? 32  ASN C O   1 
ATOM   3358 C CB  . ASN C 3 32  ? -3.461  -24.460 28.285  1.00 69.56  ? 32  ASN C CB  1 
ATOM   3359 C CG  . ASN C 3 32  ? -2.426  -25.456 28.766  1.00 82.71  ? 32  ASN C CG  1 
ATOM   3360 O OD1 . ASN C 3 32  ? -1.911  -25.349 29.879  1.00 86.50  ? 32  ASN C OD1 1 
ATOM   3361 N ND2 . ASN C 3 32  ? -2.116  -26.437 27.926  1.00 96.42  ? 32  ASN C ND2 1 
ATOM   3362 N N   . THR C 3 33  ? -3.247  -23.463 31.383  1.00 62.46  ? 33  THR C N   1 
ATOM   3363 C CA  . THR C 3 33  ? -2.660  -22.548 32.358  1.00 63.14  ? 33  THR C CA  1 
ATOM   3364 C C   . THR C 3 33  ? -1.431  -21.836 31.801  1.00 60.23  ? 33  THR C C   1 
ATOM   3365 O O   . THR C 3 33  ? -0.981  -20.836 32.358  1.00 65.15  ? 33  THR C O   1 
ATOM   3366 C CB  . THR C 3 33  ? -2.268  -23.280 33.656  1.00 52.25  ? 33  THR C CB  1 
ATOM   3367 O OG1 . THR C 3 33  ? -1.391  -24.370 33.349  1.00 64.67  ? 33  THR C OG1 1 
ATOM   3368 C CG2 . THR C 3 33  ? -3.505  -23.816 34.360  1.00 58.22  ? 33  THR C CG2 1 
ATOM   3369 N N   . THR C 3 34  ? -0.895  -22.352 30.700  1.00 65.91  ? 34  THR C N   1 
ATOM   3370 C CA  . THR C 3 34  ? 0.264   -21.746 30.053  1.00 58.90  ? 34  THR C CA  1 
ATOM   3371 C C   . THR C 3 34  ? -0.108  -20.446 29.345  1.00 64.63  ? 34  THR C C   1 
ATOM   3372 O O   . THR C 3 34  ? 0.764   -19.666 28.963  1.00 73.66  ? 34  THR C O   1 
ATOM   3373 C CB  . THR C 3 34  ? 0.907   -22.705 29.034  1.00 73.78  ? 34  THR C CB  1 
ATOM   3374 O OG1 . THR C 3 34  ? -0.030  -22.998 27.990  1.00 78.81  ? 34  THR C OG1 1 
ATOM   3375 C CG2 . THR C 3 34  ? 1.330   -23.999 29.714  1.00 67.74  ? 34  THR C CG2 1 
ATOM   3376 N N   . GLU C 3 35  ? -1.407  -20.221 29.176  1.00 61.69  ? 35  GLU C N   1 
ATOM   3377 C CA  . GLU C 3 35  ? -1.899  -19.022 28.507  1.00 64.74  ? 35  GLU C CA  1 
ATOM   3378 C C   . GLU C 3 35  ? -2.333  -17.960 29.512  1.00 61.28  ? 35  GLU C C   1 
ATOM   3379 O O   . GLU C 3 35  ? -2.875  -16.922 29.132  1.00 57.42  ? 35  GLU C O   1 
ATOM   3380 C CB  . GLU C 3 35  ? -3.067  -19.369 27.580  1.00 67.54  ? 35  GLU C CB  1 
ATOM   3381 C CG  . GLU C 3 35  ? -2.715  -20.353 26.476  1.00 63.98  ? 35  GLU C CG  1 
ATOM   3382 N N   . VAL C 3 36  ? -2.090  -18.224 30.792  1.00 45.43  ? 36  VAL C N   1 
ATOM   3383 C CA  . VAL C 3 36  ? -2.524  -17.322 31.854  1.00 46.12  ? 36  VAL C CA  1 
ATOM   3384 C C   . VAL C 3 36  ? -1.344  -16.737 32.628  1.00 62.56  ? 36  VAL C C   1 
ATOM   3385 O O   . VAL C 3 36  ? -0.423  -17.457 33.013  1.00 62.24  ? 36  VAL C O   1 
ATOM   3386 C CB  . VAL C 3 36  ? -3.466  -18.040 32.842  1.00 45.52  ? 36  VAL C CB  1 
ATOM   3387 C CG1 . VAL C 3 36  ? -4.002  -17.062 33.877  1.00 51.06  ? 36  VAL C CG1 1 
ATOM   3388 C CG2 . VAL C 3 36  ? -4.610  -18.702 32.094  1.00 51.17  ? 36  VAL C CG2 1 
ATOM   3389 N N   . TYR C 3 37  ? -1.382  -15.427 32.850  1.00 66.04  ? 37  TYR C N   1 
ATOM   3390 C CA  . TYR C 3 37  ? -0.354  -14.744 33.626  1.00 56.54  ? 37  TYR C CA  1 
ATOM   3391 C C   . TYR C 3 37  ? -0.997  -13.898 34.723  1.00 53.60  ? 37  TYR C C   1 
ATOM   3392 O O   . TYR C 3 37  ? -1.632  -12.882 34.442  1.00 62.30  ? 37  TYR C O   1 
ATOM   3393 C CB  . TYR C 3 37  ? 0.515   -13.872 32.716  1.00 47.05  ? 37  TYR C CB  1 
ATOM   3394 C CG  . TYR C 3 37  ? 1.857   -13.504 33.309  1.00 60.92  ? 37  TYR C CG  1 
ATOM   3395 C CD1 . TYR C 3 37  ? 2.979   -14.290 33.076  1.00 62.71  ? 37  TYR C CD1 1 
ATOM   3396 C CD2 . TYR C 3 37  ? 2.005   -12.370 34.098  1.00 63.48  ? 37  TYR C CD2 1 
ATOM   3397 C CE1 . TYR C 3 37  ? 4.209   -13.959 33.613  1.00 61.57  ? 37  TYR C CE1 1 
ATOM   3398 C CE2 . TYR C 3 37  ? 3.232   -12.030 34.640  1.00 66.09  ? 37  TYR C CE2 1 
ATOM   3399 C CZ  . TYR C 3 37  ? 4.330   -12.829 34.394  1.00 70.60  ? 37  TYR C CZ  1 
ATOM   3400 O OH  . TYR C 3 37  ? 5.554   -12.497 34.930  1.00 76.65  ? 37  TYR C OH  1 
ATOM   3401 N N   . VAL C 3 38  ? -0.832  -14.321 35.972  1.00 57.10  ? 38  VAL C N   1 
ATOM   3402 C CA  . VAL C 3 38  ? -1.461  -13.643 37.101  1.00 45.80  ? 38  VAL C CA  1 
ATOM   3403 C C   . VAL C 3 38  ? -0.448  -12.897 37.963  1.00 46.32  ? 38  VAL C C   1 
ATOM   3404 O O   . VAL C 3 38  ? 0.574   -13.456 38.358  1.00 57.55  ? 38  VAL C O   1 
ATOM   3405 C CB  . VAL C 3 38  ? -2.231  -14.639 37.991  1.00 41.66  ? 38  VAL C CB  1 
ATOM   3406 C CG1 . VAL C 3 38  ? -2.890  -13.917 39.156  1.00 43.91  ? 38  VAL C CG1 1 
ATOM   3407 C CG2 . VAL C 3 38  ? -3.271  -15.382 37.173  1.00 45.95  ? 38  VAL C CG2 1 
ATOM   3408 N N   . LYS C 3 39  ? -0.738  -11.630 38.248  1.00 43.00  ? 39  LYS C N   1 
ATOM   3409 C CA  . LYS C 3 39  ? 0.090   -10.834 39.145  1.00 45.91  ? 39  LYS C CA  1 
ATOM   3410 C C   . LYS C 3 39  ? -0.759  -10.134 40.199  1.00 57.61  ? 39  LYS C C   1 
ATOM   3411 O O   . LYS C 3 39  ? -1.699  -9.410  39.872  1.00 57.93  ? 39  LYS C O   1 
ATOM   3412 C CB  . LYS C 3 39  ? 0.903   -9.797  38.367  1.00 52.01  ? 39  LYS C CB  1 
ATOM   3413 C CG  . LYS C 3 39  ? 2.122   -10.356 37.654  1.00 68.77  ? 39  LYS C CG  1 
ATOM   3414 C CD  . LYS C 3 39  ? 3.060   -9.239  37.218  1.00 72.32  ? 39  LYS C CD  1 
ATOM   3415 C CE  . LYS C 3 39  ? 2.361   -8.249  36.302  1.00 68.50  ? 39  LYS C CE  1 
ATOM   3416 N NZ  . LYS C 3 39  ? 3.295   -7.204  35.801  1.00 64.38  ? 39  LYS C NZ  1 
ATOM   3417 N N   . TRP C 3 40  ? -0.422  -10.357 41.465  1.00 55.58  ? 40  TRP C N   1 
ATOM   3418 C CA  . TRP C 3 40  ? -1.073  -9.659  42.565  1.00 48.29  ? 40  TRP C CA  1 
ATOM   3419 C C   . TRP C 3 40  ? -0.218  -8.484  43.025  1.00 50.33  ? 40  TRP C C   1 
ATOM   3420 O O   . TRP C 3 40  ? 0.972   -8.642  43.301  1.00 52.07  ? 40  TRP C O   1 
ATOM   3421 C CB  . TRP C 3 40  ? -1.339  -10.610 43.732  1.00 42.52  ? 40  TRP C CB  1 
ATOM   3422 C CG  . TRP C 3 40  ? -2.606  -11.392 43.590  1.00 43.19  ? 40  TRP C CG  1 
ATOM   3423 C CD1 . TRP C 3 40  ? -2.764  -12.594 42.962  1.00 48.54  ? 40  TRP C CD1 1 
ATOM   3424 C CD2 . TRP C 3 40  ? -3.898  -11.024 44.084  1.00 46.13  ? 40  TRP C CD2 1 
ATOM   3425 N NE1 . TRP C 3 40  ? -4.075  -12.998 43.039  1.00 45.27  ? 40  TRP C NE1 1 
ATOM   3426 C CE2 . TRP C 3 40  ? -4.792  -12.051 43.722  1.00 44.40  ? 40  TRP C CE2 1 
ATOM   3427 C CE3 . TRP C 3 40  ? -4.386  -9.925  44.799  1.00 52.54  ? 40  TRP C CE3 1 
ATOM   3428 C CZ2 . TRP C 3 40  ? -6.144  -12.012 44.052  1.00 43.70  ? 40  TRP C CZ2 1 
ATOM   3429 C CZ3 . TRP C 3 40  ? -5.730  -9.888  45.124  1.00 53.90  ? 40  TRP C CZ3 1 
ATOM   3430 C CH2 . TRP C 3 40  ? -6.593  -10.925 44.750  1.00 44.96  ? 40  TRP C CH2 1 
ATOM   3431 N N   . LYS C 3 41  ? -0.828  -7.306  43.105  1.00 50.52  ? 41  LYS C N   1 
ATOM   3432 C CA  . LYS C 3 41  ? -0.106  -6.104  43.501  1.00 52.33  ? 41  LYS C CA  1 
ATOM   3433 C C   . LYS C 3 41  ? -0.601  -5.544  44.830  1.00 57.98  ? 41  LYS C C   1 
ATOM   3434 O O   . LYS C 3 41  ? -1.785  -5.632  45.155  1.00 54.76  ? 41  LYS C O   1 
ATOM   3435 C CB  . LYS C 3 41  ? -0.216  -5.034  42.412  1.00 52.38  ? 41  LYS C CB  1 
ATOM   3436 C CG  . LYS C 3 41  ? 0.336   -5.460  41.060  1.00 63.94  ? 41  LYS C CG  1 
ATOM   3437 C CD  . LYS C 3 41  ? 0.051   -4.414  39.994  1.00 75.11  ? 41  LYS C CD  1 
ATOM   3438 C CE  . LYS C 3 41  ? 0.678   -4.795  38.663  1.00 88.38  ? 41  LYS C CE  1 
ATOM   3439 N NZ  . LYS C 3 41  ? 2.164   -4.846  38.739  1.00 89.76  ? 41  LYS C NZ  1 
ATOM   3440 N N   . PHE C 3 42  ? 0.322   -4.972  45.594  1.00 61.38  ? 42  PHE C N   1 
ATOM   3441 C CA  . PHE C 3 42  ? -0.008  -4.314  46.851  1.00 50.04  ? 42  PHE C CA  1 
ATOM   3442 C C   . PHE C 3 42  ? 0.880   -3.089  47.037  1.00 51.78  ? 42  PHE C C   1 
ATOM   3443 O O   . PHE C 3 42  ? 2.096   -3.215  47.188  1.00 49.92  ? 42  PHE C O   1 
ATOM   3444 C CB  . PHE C 3 42  ? 0.149   -5.276  48.030  1.00 48.05  ? 42  PHE C CB  1 
ATOM   3445 C CG  . PHE C 3 42  ? -0.133  -4.649  49.366  1.00 62.39  ? 42  PHE C CG  1 
ATOM   3446 C CD1 . PHE C 3 42  ? -1.432  -4.361  49.751  1.00 62.88  ? 42  PHE C CD1 1 
ATOM   3447 C CD2 . PHE C 3 42  ? 0.901   -4.352  50.239  1.00 55.93  ? 42  PHE C CD2 1 
ATOM   3448 C CE1 . PHE C 3 42  ? -1.694  -3.784  50.979  1.00 56.55  ? 42  PHE C CE1 1 
ATOM   3449 C CE2 . PHE C 3 42  ? 0.645   -3.776  51.468  1.00 54.67  ? 42  PHE C CE2 1 
ATOM   3450 C CZ  . PHE C 3 42  ? -0.654  -3.491  51.839  1.00 59.22  ? 42  PHE C CZ  1 
ATOM   3451 N N   . LYS C 3 43  ? 0.259   -1.912  47.013  1.00 49.55  ? 43  LYS C N   1 
ATOM   3452 C CA  . LYS C 3 43  ? 0.964   -0.638  47.125  1.00 62.37  ? 43  LYS C CA  1 
ATOM   3453 C C   . LYS C 3 43  ? 2.037   -0.490  46.048  1.00 83.08  ? 43  LYS C C   1 
ATOM   3454 O O   . LYS C 3 43  ? 3.139   -0.012  46.315  1.00 93.94  ? 43  LYS C O   1 
ATOM   3455 C CB  . LYS C 3 43  ? 1.584   -0.484  48.518  1.00 64.16  ? 43  LYS C CB  1 
ATOM   3456 C CG  . LYS C 3 43  ? 0.567   -0.492  49.649  1.00 69.59  ? 43  LYS C CG  1 
ATOM   3457 C CD  . LYS C 3 43  ? 1.233   -0.278  50.999  1.00 66.34  ? 43  LYS C CD  1 
ATOM   3458 N N   . GLY C 3 44  ? 1.704   -0.909  44.830  1.00 85.70  ? 44  GLY C N   1 
ATOM   3459 C CA  . GLY C 3 44  ? 2.595   -0.756  43.694  1.00 84.12  ? 44  GLY C CA  1 
ATOM   3460 C C   . GLY C 3 44  ? 3.749   -1.741  43.662  1.00 79.71  ? 44  GLY C C   1 
ATOM   3461 O O   . GLY C 3 44  ? 4.811   -1.442  43.116  1.00 89.30  ? 44  GLY C O   1 
ATOM   3462 N N   . ARG C 3 45  ? 3.543   -2.918  44.244  1.00 67.25  ? 45  ARG C N   1 
ATOM   3463 C CA  . ARG C 3 45  ? 4.577   -3.948  44.267  1.00 62.17  ? 45  ARG C CA  1 
ATOM   3464 C C   . ARG C 3 45  ? 4.010   -5.322  43.927  1.00 62.16  ? 45  ARG C C   1 
ATOM   3465 O O   . ARG C 3 45  ? 2.964   -5.715  44.441  1.00 64.12  ? 45  ARG C O   1 
ATOM   3466 C CB  . ARG C 3 45  ? 5.258   -3.995  45.637  1.00 58.93  ? 45  ARG C CB  1 
ATOM   3467 C CG  . ARG C 3 45  ? 6.194   -2.829  45.913  1.00 74.29  ? 45  ARG C CG  1 
ATOM   3468 C CD  . ARG C 3 45  ? 6.849   -2.950  47.283  1.00 74.72  ? 45  ARG C CD  1 
ATOM   3469 N NE  . ARG C 3 45  ? 7.676   -4.149  47.399  1.00 70.92  ? 45  ARG C NE  1 
ATOM   3470 C CZ  . ARG C 3 45  ? 7.324   -5.240  48.073  1.00 75.88  ? 45  ARG C CZ  1 
ATOM   3471 N NH1 . ARG C 3 45  ? 6.155   -5.288  48.697  1.00 69.02  ? 45  ARG C NH1 1 
ATOM   3472 N NH2 . ARG C 3 45  ? 8.141   -6.283  48.124  1.00 74.96  ? 45  ARG C NH2 1 
ATOM   3473 N N   . ASP C 3 46  ? 4.708   -6.047  43.059  1.00 62.01  ? 46  ASP C N   1 
ATOM   3474 C CA  . ASP C 3 46  ? 4.315   -7.406  42.704  1.00 60.42  ? 46  ASP C CA  1 
ATOM   3475 C C   . ASP C 3 46  ? 4.571   -8.352  43.872  1.00 66.49  ? 46  ASP C C   1 
ATOM   3476 O O   . ASP C 3 46  ? 5.689   -8.833  44.058  1.00 84.79  ? 46  ASP C O   1 
ATOM   3477 C CB  . ASP C 3 46  ? 5.072   -7.882  41.462  1.00 67.74  ? 46  ASP C CB  1 
ATOM   3478 C CG  . ASP C 3 46  ? 4.823   -7.001  40.255  1.00 66.19  ? 46  ASP C CG  1 
ATOM   3479 O OD1 . ASP C 3 46  ? 3.668   -6.567  40.062  1.00 58.63  ? 46  ASP C OD1 1 
ATOM   3480 O OD2 . ASP C 3 46  ? 5.784   -6.740  39.500  1.00 72.17  ? 46  ASP C OD2 1 
ATOM   3481 N N   . ILE C 3 47  ? 3.532   -8.614  44.657  1.00 62.53  ? 47  ILE C N   1 
ATOM   3482 C CA  . ILE C 3 47  ? 3.670   -9.447  45.846  1.00 58.48  ? 47  ILE C CA  1 
ATOM   3483 C C   . ILE C 3 47  ? 3.385   -10.913 45.530  1.00 55.57  ? 47  ILE C C   1 
ATOM   3484 O O   . ILE C 3 47  ? 3.716   -11.805 46.312  1.00 55.85  ? 47  ILE C O   1 
ATOM   3485 C CB  . ILE C 3 47  ? 2.748   -8.951  46.979  1.00 55.46  ? 47  ILE C CB  1 
ATOM   3486 C CG1 . ILE C 3 47  ? 1.285   -8.941  46.533  1.00 50.99  ? 47  ILE C CG1 1 
ATOM   3487 C CG2 . ILE C 3 47  ? 3.162   -7.556  47.417  1.00 51.51  ? 47  ILE C CG2 1 
ATOM   3488 C CD1 . ILE C 3 47  ? 0.494   -10.142 46.989  1.00 44.83  ? 47  ILE C CD1 1 
ATOM   3489 N N   . TYR C 3 48  ? 2.761   -11.156 44.383  1.00 56.71  ? 48  TYR C N   1 
ATOM   3490 C CA  . TYR C 3 48  ? 2.619   -12.511 43.862  1.00 52.48  ? 48  TYR C CA  1 
ATOM   3491 C C   . TYR C 3 48  ? 2.612   -12.493 42.340  1.00 59.47  ? 48  TYR C C   1 
ATOM   3492 O O   . TYR C 3 48  ? 2.128   -11.544 41.725  1.00 61.10  ? 48  TYR C O   1 
ATOM   3493 C CB  . TYR C 3 48  ? 1.346   -13.185 44.379  1.00 50.46  ? 48  TYR C CB  1 
ATOM   3494 C CG  . TYR C 3 48  ? 1.184   -14.604 43.871  1.00 45.94  ? 48  TYR C CG  1 
ATOM   3495 C CD1 . TYR C 3 48  ? 1.833   -15.661 44.493  1.00 51.49  ? 48  TYR C CD1 1 
ATOM   3496 C CD2 . TYR C 3 48  ? 0.396   -14.883 42.760  1.00 51.03  ? 48  TYR C CD2 1 
ATOM   3497 C CE1 . TYR C 3 48  ? 1.701   -16.956 44.030  1.00 45.60  ? 48  TYR C CE1 1 
ATOM   3498 C CE2 . TYR C 3 48  ? 0.258   -16.177 42.290  1.00 58.71  ? 48  TYR C CE2 1 
ATOM   3499 C CZ  . TYR C 3 48  ? 0.913   -17.209 42.931  1.00 64.23  ? 48  TYR C CZ  1 
ATOM   3500 O OH  . TYR C 3 48  ? 0.782   -18.500 42.473  1.00 76.59  ? 48  TYR C OH  1 
ATOM   3501 N N   . THR C 3 49  ? 3.150   -13.549 41.741  1.00 56.86  ? 49  THR C N   1 
ATOM   3502 C CA  . THR C 3 49  ? 3.189   -13.672 40.292  1.00 51.50  ? 49  THR C CA  1 
ATOM   3503 C C   . THR C 3 49  ? 3.131   -15.136 39.865  1.00 54.01  ? 49  THR C C   1 
ATOM   3504 O O   . THR C 3 49  ? 3.853   -15.974 40.402  1.00 54.31  ? 49  THR C O   1 
ATOM   3505 C CB  . THR C 3 49  ? 4.460   -13.021 39.707  1.00 57.47  ? 49  THR C CB  1 
ATOM   3506 O OG1 . THR C 3 49  ? 4.508   -11.638 40.078  1.00 51.83  ? 49  THR C OG1 1 
ATOM   3507 C CG2 . THR C 3 49  ? 4.472   -13.136 38.190  1.00 64.19  ? 49  THR C CG2 1 
ATOM   3508 N N   . PHE C 3 50  ? 2.260   -15.442 38.910  1.00 63.93  ? 50  PHE C N   1 
ATOM   3509 C CA  . PHE C 3 50  ? 2.207   -16.780 38.337  1.00 61.56  ? 50  PHE C CA  1 
ATOM   3510 C C   . PHE C 3 50  ? 2.554   -16.739 36.854  1.00 60.13  ? 50  PHE C C   1 
ATOM   3511 O O   . PHE C 3 50  ? 1.792   -16.212 36.044  1.00 63.12  ? 50  PHE C O   1 
ATOM   3512 C CB  . PHE C 3 50  ? 0.829   -17.412 38.536  1.00 50.75  ? 50  PHE C CB  1 
ATOM   3513 C CG  . PHE C 3 50  ? 0.693   -18.764 37.897  1.00 60.09  ? 50  PHE C CG  1 
ATOM   3514 C CD1 . PHE C 3 50  ? 1.217   -19.888 38.511  1.00 62.24  ? 50  PHE C CD1 1 
ATOM   3515 C CD2 . PHE C 3 50  ? 0.048   -18.909 36.680  1.00 53.32  ? 50  PHE C CD2 1 
ATOM   3516 C CE1 . PHE C 3 50  ? 1.099   -21.132 37.925  1.00 65.40  ? 50  PHE C CE1 1 
ATOM   3517 C CE2 . PHE C 3 50  ? -0.073  -20.150 36.089  1.00 59.64  ? 50  PHE C CE2 1 
ATOM   3518 C CZ  . PHE C 3 50  ? 0.452   -21.263 36.713  1.00 62.47  ? 50  PHE C CZ  1 
ATOM   3519 N N   . ASP C 3 51  ? 3.710   -17.295 36.509  1.00 60.66  ? 51  ASP C N   1 
ATOM   3520 C CA  . ASP C 3 51  ? 4.141   -17.374 35.120  1.00 68.60  ? 51  ASP C CA  1 
ATOM   3521 C C   . ASP C 3 51  ? 3.650   -18.676 34.499  1.00 68.57  ? 51  ASP C C   1 
ATOM   3522 O O   . ASP C 3 51  ? 4.255   -19.728 34.691  1.00 70.82  ? 51  ASP C O   1 
ATOM   3523 C CB  . ASP C 3 51  ? 5.664   -17.278 35.024  1.00 72.96  ? 51  ASP C CB  1 
ATOM   3524 C CG  . ASP C 3 51  ? 6.138   -16.880 33.641  1.00 74.14  ? 51  ASP C CG  1 
ATOM   3525 O OD1 . ASP C 3 51  ? 5.462   -17.230 32.651  1.00 74.70  ? 51  ASP C OD1 1 
ATOM   3526 O OD2 . ASP C 3 51  ? 7.188   -16.210 33.544  1.00 79.78  ? 51  ASP C OD2 1 
ATOM   3527 N N   . GLY C 3 52  ? 2.551   -18.596 33.756  1.00 62.33  ? 52  GLY C N   1 
ATOM   3528 C CA  . GLY C 3 52  ? 1.944   -19.770 33.156  1.00 58.43  ? 52  GLY C CA  1 
ATOM   3529 C C   . GLY C 3 52  ? 2.830   -20.482 32.153  1.00 64.24  ? 52  GLY C C   1 
ATOM   3530 O O   . GLY C 3 52  ? 2.860   -21.712 32.104  1.00 60.47  ? 52  GLY C O   1 
ATOM   3531 N N   . ALA C 3 53  ? 3.556   -19.709 31.352  1.00 66.18  ? 53  ALA C N   1 
ATOM   3532 C CA  . ALA C 3 53  ? 4.419   -20.271 30.320  1.00 57.91  ? 53  ALA C CA  1 
ATOM   3533 C C   . ALA C 3 53  ? 5.594   -21.042 30.920  1.00 64.11  ? 53  ALA C C   1 
ATOM   3534 O O   . ALA C 3 53  ? 6.063   -22.021 30.340  1.00 68.84  ? 53  ALA C O   1 
ATOM   3535 C CB  . ALA C 3 53  ? 4.923   -19.170 29.398  1.00 66.91  ? 53  ALA C CB  1 
ATOM   3536 N N   . LEU C 3 54  ? 6.062   -20.598 32.083  1.00 57.49  ? 54  LEU C N   1 
ATOM   3537 C CA  . LEU C 3 54  ? 7.198   -21.232 32.747  1.00 62.77  ? 54  LEU C CA  1 
ATOM   3538 C C   . LEU C 3 54  ? 6.748   -22.095 33.923  1.00 61.81  ? 54  LEU C C   1 
ATOM   3539 O O   . LEU C 3 54  ? 7.555   -22.806 34.527  1.00 63.29  ? 54  LEU C O   1 
ATOM   3540 C CB  . LEU C 3 54  ? 8.193   -20.173 33.224  1.00 59.23  ? 54  LEU C CB  1 
ATOM   3541 C CG  . LEU C 3 54  ? 8.933   -19.401 32.128  1.00 59.28  ? 54  LEU C CG  1 
ATOM   3542 C CD1 . LEU C 3 54  ? 9.795   -18.302 32.730  1.00 60.52  ? 54  LEU C CD1 1 
ATOM   3543 C CD2 . LEU C 3 54  ? 9.778   -20.350 31.294  1.00 52.99  ? 54  LEU C CD2 1 
ATOM   3544 N N   . ASN C 3 55  ? 5.456   -22.022 34.232  1.00 64.24  ? 55  ASN C N   1 
ATOM   3545 C CA  . ASN C 3 55  ? 4.847   -22.783 35.321  1.00 59.87  ? 55  ASN C CA  1 
ATOM   3546 C C   . ASN C 3 55  ? 5.546   -22.574 36.655  1.00 57.78  ? 55  ASN C C   1 
ATOM   3547 O O   . ASN C 3 55  ? 5.942   -23.538 37.310  1.00 60.73  ? 55  ASN C O   1 
ATOM   3548 C CB  . ASN C 3 55  ? 4.830   -24.275 34.995  1.00 68.87  ? 55  ASN C CB  1 
ATOM   3549 C CG  . ASN C 3 55  ? 3.622   -24.973 35.570  1.00 88.16  ? 55  ASN C CG  1 
ATOM   3550 O OD1 . ASN C 3 55  ? 2.493   -24.524 35.382  1.00 85.51  ? 55  ASN C OD1 1 
ATOM   3551 N ND2 . ASN C 3 55  ? 3.843   -26.066 36.285  1.00 107.42 ? 55  ASN C ND2 1 
ATOM   3552 N N   . LYS C 3 56  ? 5.693   -21.316 37.057  1.00 44.88  ? 56  LYS C N   1 
ATOM   3553 C CA  . LYS C 3 56  ? 6.381   -20.993 38.301  1.00 52.35  ? 56  LYS C CA  1 
ATOM   3554 C C   . LYS C 3 56  ? 5.735   -19.822 39.037  1.00 53.54  ? 56  LYS C C   1 
ATOM   3555 O O   . LYS C 3 56  ? 5.290   -18.854 38.419  1.00 55.68  ? 56  LYS C O   1 
ATOM   3556 C CB  . LYS C 3 56  ? 7.854   -20.683 38.026  1.00 53.66  ? 56  LYS C CB  1 
ATOM   3557 C CG  . LYS C 3 56  ? 8.718   -20.630 39.275  1.00 68.05  ? 56  LYS C CG  1 
ATOM   3558 C CD  . LYS C 3 56  ? 10.125  -20.156 38.958  1.00 70.66  ? 56  LYS C CD  1 
ATOM   3559 C CE  . LYS C 3 56  ? 11.031  -20.270 40.171  1.00 76.79  ? 56  LYS C CE  1 
ATOM   3560 N NZ  . LYS C 3 56  ? 11.141  -21.681 40.632  1.00 79.54  ? 56  LYS C NZ  1 
ATOM   3561 N N   . SER C 3 57  ? 5.689   -19.919 40.362  1.00 54.44  ? 57  SER C N   1 
ATOM   3562 C CA  . SER C 3 57  ? 5.171   -18.839 41.191  1.00 59.08  ? 57  SER C CA  1 
ATOM   3563 C C   . SER C 3 57  ? 6.318   -18.006 41.753  1.00 59.71  ? 57  SER C C   1 
ATOM   3564 O O   . SER C 3 57  ? 7.361   -18.542 42.127  1.00 67.78  ? 57  SER C O   1 
ATOM   3565 C CB  . SER C 3 57  ? 4.309   -19.393 42.327  1.00 65.46  ? 57  SER C CB  1 
ATOM   3566 O OG  . SER C 3 57  ? 3.176   -20.079 41.822  1.00 68.86  ? 57  SER C OG  1 
ATOM   3567 N N   . THR C 3 58  ? 6.121   -16.693 41.808  1.00 63.51  ? 58  THR C N   1 
ATOM   3568 C CA  . THR C 3 58  ? 7.154   -15.785 42.290  1.00 68.86  ? 58  THR C CA  1 
ATOM   3569 C C   . THR C 3 58  ? 6.631   -14.880 43.401  1.00 61.38  ? 58  THR C C   1 
ATOM   3570 O O   . THR C 3 58  ? 5.646   -14.162 43.220  1.00 53.11  ? 58  THR C O   1 
ATOM   3571 C CB  . THR C 3 58  ? 7.713   -14.915 41.146  1.00 70.27  ? 58  THR C CB  1 
ATOM   3572 O OG1 . THR C 3 58  ? 8.588   -15.703 40.330  1.00 60.23  ? 58  THR C OG1 1 
ATOM   3573 C CG2 . THR C 3 58  ? 8.486   -13.726 41.699  1.00 81.62  ? 58  THR C CG2 1 
ATOM   3574 N N   . VAL C 3 59  ? 7.294   -14.925 44.552  1.00 60.79  ? 59  VAL C N   1 
ATOM   3575 C CA  . VAL C 3 59  ? 6.919   -14.088 45.686  1.00 67.41  ? 59  VAL C CA  1 
ATOM   3576 C C   . VAL C 3 59  ? 8.136   -13.432 46.329  1.00 59.28  ? 59  VAL C C   1 
ATOM   3577 O O   . VAL C 3 59  ? 9.206   -14.037 46.410  1.00 65.17  ? 59  VAL C O   1 
ATOM   3578 C CB  . VAL C 3 59  ? 6.165   -14.895 46.768  1.00 74.56  ? 59  VAL C CB  1 
ATOM   3579 C CG1 . VAL C 3 59  ? 4.782   -15.280 46.279  1.00 73.88  ? 59  VAL C CG1 1 
ATOM   3580 C CG2 . VAL C 3 59  ? 6.957   -16.132 47.168  1.00 79.86  ? 59  VAL C CG2 1 
ATOM   3581 N N   . PRO C 3 60  ? 7.979   -12.179 46.779  1.00 62.91  ? 60  PRO C N   1 
ATOM   3582 C CA  . PRO C 3 60  ? 9.010   -11.518 47.585  1.00 62.13  ? 60  PRO C CA  1 
ATOM   3583 C C   . PRO C 3 60  ? 9.088   -12.133 48.981  1.00 65.08  ? 60  PRO C C   1 
ATOM   3584 O O   . PRO C 3 60  ? 8.229   -12.938 49.341  1.00 74.44  ? 60  PRO C O   1 
ATOM   3585 C CB  . PRO C 3 60  ? 8.539   -10.063 47.638  1.00 65.56  ? 60  PRO C CB  1 
ATOM   3586 C CG  . PRO C 3 60  ? 7.065   -10.134 47.412  1.00 55.92  ? 60  PRO C CG  1 
ATOM   3587 C CD  . PRO C 3 60  ? 6.856   -11.279 46.468  1.00 61.84  ? 60  PRO C CD  1 
ATOM   3588 N N   . THR C 3 61  ? 10.099  -11.758 49.757  1.00 75.41  ? 61  THR C N   1 
ATOM   3589 C CA  . THR C 3 61  ? 10.338  -12.396 51.047  1.00 78.99  ? 61  THR C CA  1 
ATOM   3590 C C   . THR C 3 61  ? 9.326   -11.986 52.119  1.00 76.57  ? 61  THR C C   1 
ATOM   3591 O O   . THR C 3 61  ? 9.147   -12.695 53.110  1.00 82.14  ? 61  THR C O   1 
ATOM   3592 C CB  . THR C 3 61  ? 11.757  -12.092 51.562  1.00 86.70  ? 61  THR C CB  1 
ATOM   3593 O OG1 . THR C 3 61  ? 11.982  -12.794 52.791  1.00 95.95  ? 61  THR C OG1 1 
ATOM   3594 C CG2 . THR C 3 61  ? 11.938  -10.601 51.787  1.00 90.08  ? 61  THR C CG2 1 
ATOM   3595 N N   . ASP C 3 62  ? 8.663   -10.850 51.923  1.00 79.69  ? 62  ASP C N   1 
ATOM   3596 C CA  . ASP C 3 62  ? 7.675   -10.380 52.889  1.00 80.54  ? 62  ASP C CA  1 
ATOM   3597 C C   . ASP C 3 62  ? 6.323   -11.053 52.661  1.00 78.25  ? 62  ASP C C   1 
ATOM   3598 O O   . ASP C 3 62  ? 5.430   -10.976 53.504  1.00 78.70  ? 62  ASP C O   1 
ATOM   3599 C CB  . ASP C 3 62  ? 7.531   -8.857  52.821  1.00 89.40  ? 62  ASP C CB  1 
ATOM   3600 C CG  . ASP C 3 62  ? 7.139   -8.369  51.442  1.00 98.22  ? 62  ASP C CG  1 
ATOM   3601 O OD1 . ASP C 3 62  ? 7.416   -9.084  50.458  1.00 107.26 ? 62  ASP C OD1 1 
ATOM   3602 O OD2 . ASP C 3 62  ? 6.553   -7.270  51.342  1.00 94.19  ? 62  ASP C OD2 1 
ATOM   3603 N N   . PHE C 3 63  ? 6.184   -11.711 51.514  1.00 69.12  ? 63  PHE C N   1 
ATOM   3604 C CA  . PHE C 3 63  ? 4.985   -12.482 51.198  1.00 62.02  ? 63  PHE C CA  1 
ATOM   3605 C C   . PHE C 3 63  ? 5.356   -13.929 50.896  1.00 71.37  ? 63  PHE C C   1 
ATOM   3606 O O   . PHE C 3 63  ? 4.987   -14.472 49.856  1.00 68.30  ? 63  PHE C O   1 
ATOM   3607 C CB  . PHE C 3 63  ? 4.240   -11.874 50.009  1.00 62.55  ? 63  PHE C CB  1 
ATOM   3608 C CG  . PHE C 3 63  ? 3.376   -10.701 50.368  1.00 59.36  ? 63  PHE C CG  1 
ATOM   3609 C CD1 . PHE C 3 63  ? 3.919   -9.432  50.479  1.00 64.55  ? 63  PHE C CD1 1 
ATOM   3610 C CD2 . PHE C 3 63  ? 2.018   -10.865 50.582  1.00 55.36  ? 63  PHE C CD2 1 
ATOM   3611 C CE1 . PHE C 3 63  ? 3.124   -8.350  50.805  1.00 63.43  ? 63  PHE C CE1 1 
ATOM   3612 C CE2 . PHE C 3 63  ? 1.218   -9.786  50.907  1.00 54.08  ? 63  PHE C CE2 1 
ATOM   3613 C CZ  . PHE C 3 63  ? 1.771   -8.527  51.017  1.00 55.35  ? 63  PHE C CZ  1 
ATOM   3614 N N   . SER C 3 64  ? 6.084   -14.548 51.818  1.00 65.24  ? 64  SER C N   1 
ATOM   3615 C CA  . SER C 3 64  ? 6.606   -15.895 51.613  1.00 72.72  ? 64  SER C CA  1 
ATOM   3616 C C   . SER C 3 64  ? 5.521   -16.969 51.551  1.00 66.63  ? 64  SER C C   1 
ATOM   3617 O O   . SER C 3 64  ? 5.735   -18.043 50.985  1.00 72.40  ? 64  SER C O   1 
ATOM   3618 C CB  . SER C 3 64  ? 7.598   -16.244 52.723  1.00 74.52  ? 64  SER C CB  1 
ATOM   3619 O OG  . SER C 3 64  ? 6.982   -16.178 53.998  1.00 81.32  ? 64  SER C OG  1 
ATOM   3620 N N   . SER C 3 65  ? 4.361   -16.675 52.130  1.00 66.47  ? 65  SER C N   1 
ATOM   3621 C CA  . SER C 3 65  ? 3.278   -17.651 52.219  1.00 73.20  ? 65  SER C CA  1 
ATOM   3622 C C   . SER C 3 65  ? 2.187   -17.410 51.174  1.00 63.87  ? 65  SER C C   1 
ATOM   3623 O O   . SER C 3 65  ? 1.221   -18.169 51.084  1.00 71.47  ? 65  SER C O   1 
ATOM   3624 C CB  . SER C 3 65  ? 2.661   -17.632 53.621  1.00 64.60  ? 65  SER C CB  1 
ATOM   3625 O OG  . SER C 3 65  ? 2.047   -16.384 53.891  1.00 63.39  ? 65  SER C OG  1 
ATOM   3626 N N   . ALA C 3 66  ? 2.337   -16.346 50.392  1.00 63.87  ? 66  ALA C N   1 
ATOM   3627 C CA  . ALA C 3 66  ? 1.344   -15.997 49.380  1.00 54.42  ? 66  ALA C CA  1 
ATOM   3628 C C   . ALA C 3 66  ? 1.344   -17.007 48.234  1.00 64.58  ? 66  ALA C C   1 
ATOM   3629 O O   . ALA C 3 66  ? 2.393   -17.327 47.673  1.00 67.10  ? 66  ALA C O   1 
ATOM   3630 C CB  . ALA C 3 66  ? 1.597   -14.593 48.849  1.00 52.03  ? 66  ALA C CB  1 
ATOM   3631 N N   . LYS C 3 67  ? 0.159   -17.498 47.888  1.00 64.35  ? 67  LYS C N   1 
ATOM   3632 C CA  . LYS C 3 67  ? 0.013   -18.461 46.802  1.00 69.23  ? 67  LYS C CA  1 
ATOM   3633 C C   . LYS C 3 67  ? -1.429  -18.531 46.309  1.00 74.68  ? 67  LYS C C   1 
ATOM   3634 O O   . LYS C 3 67  ? -2.358  -18.149 47.022  1.00 77.77  ? 67  LYS C O   1 
ATOM   3635 C CB  . LYS C 3 67  ? 0.478   -19.849 47.250  1.00 67.03  ? 67  LYS C CB  1 
ATOM   3636 C CG  . LYS C 3 67  ? -0.327  -20.436 48.397  1.00 70.27  ? 67  LYS C CG  1 
ATOM   3637 N N   . ILE C 3 68  ? -1.608  -19.014 45.084  1.00 62.51  ? 68  ILE C N   1 
ATOM   3638 C CA  . ILE C 3 68  ? -2.940  -19.230 44.530  1.00 59.44  ? 68  ILE C CA  1 
ATOM   3639 C C   . ILE C 3 68  ? -3.107  -20.687 44.116  1.00 63.04  ? 68  ILE C C   1 
ATOM   3640 O O   . ILE C 3 68  ? -2.123  -21.400 43.913  1.00 65.07  ? 68  ILE C O   1 
ATOM   3641 C CB  . ILE C 3 68  ? -3.217  -18.322 43.312  1.00 50.08  ? 68  ILE C CB  1 
ATOM   3642 C CG1 . ILE C 3 68  ? -2.390  -18.773 42.105  1.00 51.39  ? 68  ILE C CG1 1 
ATOM   3643 C CG2 . ILE C 3 68  ? -2.940  -16.866 43.652  1.00 49.11  ? 68  ILE C CG2 1 
ATOM   3644 C CD1 . ILE C 3 68  ? -2.660  -17.975 40.846  1.00 48.94  ? 68  ILE C CD1 1 
ATOM   3645 N N   . GLU C 3 69  ? -4.354  -21.129 43.995  1.00 63.18  ? 69  GLU C N   1 
ATOM   3646 C CA  . GLU C 3 69  ? -4.634  -22.490 43.558  1.00 62.68  ? 69  GLU C CA  1 
ATOM   3647 C C   . GLU C 3 69  ? -4.641  -22.558 42.035  1.00 61.68  ? 69  GLU C C   1 
ATOM   3648 O O   . GLU C 3 69  ? -5.587  -22.110 41.387  1.00 47.33  ? 69  GLU C O   1 
ATOM   3649 C CB  . GLU C 3 69  ? -5.969  -22.977 44.124  1.00 68.99  ? 69  GLU C CB  1 
ATOM   3650 C CG  . GLU C 3 69  ? -6.172  -24.480 44.023  1.00 72.84  ? 69  GLU C CG  1 
ATOM   3651 N N   . VAL C 3 70  ? -3.573  -23.118 41.474  1.00 58.48  ? 70  VAL C N   1 
ATOM   3652 C CA  . VAL C 3 70  ? -3.390  -23.184 40.027  1.00 60.43  ? 70  VAL C CA  1 
ATOM   3653 C C   . VAL C 3 70  ? -4.477  -24.019 39.349  1.00 63.80  ? 70  VAL C C   1 
ATOM   3654 O O   . VAL C 3 70  ? -4.875  -23.739 38.218  1.00 70.24  ? 70  VAL C O   1 
ATOM   3655 C CB  . VAL C 3 70  ? -2.006  -23.768 39.673  1.00 60.22  ? 70  VAL C CB  1 
ATOM   3656 C CG1 . VAL C 3 70  ? -1.745  -23.669 38.178  1.00 53.49  ? 70  VAL C CG1 1 
ATOM   3657 C CG2 . VAL C 3 70  ? -0.914  -23.052 40.455  1.00 63.12  ? 70  VAL C CG2 1 
ATOM   3658 N N   . SER C 3 71  ? -4.965  -25.034 40.055  1.00 68.99  ? 71  SER C N   1 
ATOM   3659 C CA  . SER C 3 71  ? -5.980  -25.929 39.510  1.00 68.62  ? 71  SER C CA  1 
ATOM   3660 C C   . SER C 3 71  ? -7.339  -25.245 39.357  1.00 69.25  ? 71  SER C C   1 
ATOM   3661 O O   . SER C 3 71  ? -8.256  -25.802 38.754  1.00 76.25  ? 71  SER C O   1 
ATOM   3662 C CB  . SER C 3 71  ? -6.120  -27.170 40.397  1.00 68.98  ? 71  SER C CB  1 
ATOM   3663 O OG  . SER C 3 71  ? -6.551  -26.819 41.700  1.00 79.82  ? 71  SER C OG  1 
ATOM   3664 N N   . GLN C 3 72  ? -7.463  -24.037 39.900  1.00 68.69  ? 72  GLN C N   1 
ATOM   3665 C CA  . GLN C 3 72  ? -8.718  -23.294 39.840  1.00 59.47  ? 72  GLN C CA  1 
ATOM   3666 C C   . GLN C 3 72  ? -8.633  -22.103 38.886  1.00 53.36  ? 72  GLN C C   1 
ATOM   3667 O O   . GLN C 3 72  ? -9.595  -21.350 38.738  1.00 61.35  ? 72  GLN C O   1 
ATOM   3668 C CB  . GLN C 3 72  ? -9.117  -22.812 41.237  1.00 51.35  ? 72  GLN C CB  1 
ATOM   3669 C CG  . GLN C 3 72  ? -9.296  -23.927 42.256  1.00 61.03  ? 72  GLN C CG  1 
ATOM   3670 C CD  . GLN C 3 72  ? -10.550 -24.746 42.019  1.00 74.51  ? 72  GLN C CD  1 
ATOM   3671 O OE1 . GLN C 3 72  ? -11.555 -24.236 41.522  1.00 85.18  ? 72  GLN C OE1 1 
ATOM   3672 N NE2 . GLN C 3 72  ? -10.498 -26.025 42.375  1.00 81.57  ? 72  GLN C NE2 1 
ATOM   3673 N N   . LEU C 3 73  ? -7.481  -21.941 38.241  1.00 52.42  ? 73  LEU C N   1 
ATOM   3674 C CA  . LEU C 3 73  ? -7.252  -20.811 37.344  1.00 57.80  ? 73  LEU C CA  1 
ATOM   3675 C C   . LEU C 3 73  ? -8.180  -20.818 36.135  1.00 59.38  ? 73  LEU C C   1 
ATOM   3676 O O   . LEU C 3 73  ? -8.809  -19.807 35.823  1.00 66.93  ? 73  LEU C O   1 
ATOM   3677 C CB  . LEU C 3 73  ? -5.798  -20.793 36.868  1.00 54.11  ? 73  LEU C CB  1 
ATOM   3678 C CG  . LEU C 3 73  ? -4.826  -19.954 37.695  1.00 59.62  ? 73  LEU C CG  1 
ATOM   3679 C CD1 . LEU C 3 73  ? -3.454  -19.951 37.049  1.00 54.70  ? 73  LEU C CD1 1 
ATOM   3680 C CD2 . LEU C 3 73  ? -5.348  -18.535 37.854  1.00 51.71  ? 73  LEU C CD2 1 
ATOM   3681 N N   . LEU C 3 74  ? -8.266  -21.960 35.460  1.00 59.34  ? 74  LEU C N   1 
ATOM   3682 C CA  . LEU C 3 74  ? -9.067  -22.074 34.246  1.00 60.89  ? 74  LEU C CA  1 
ATOM   3683 C C   . LEU C 3 74  ? -10.562 -21.937 34.527  1.00 68.38  ? 74  LEU C C   1 
ATOM   3684 O O   . LEU C 3 74  ? -11.364 -21.800 33.604  1.00 72.49  ? 74  LEU C O   1 
ATOM   3685 C CB  . LEU C 3 74  ? -8.785  -23.405 33.547  1.00 58.32  ? 74  LEU C CB  1 
ATOM   3686 C CG  . LEU C 3 74  ? -7.357  -23.585 33.028  1.00 63.24  ? 74  LEU C CG  1 
ATOM   3687 C CD1 . LEU C 3 74  ? -7.191  -24.935 32.346  1.00 68.78  ? 74  LEU C CD1 1 
ATOM   3688 C CD2 . LEU C 3 74  ? -6.988  -22.453 32.082  1.00 59.66  ? 74  LEU C CD2 1 
ATOM   3689 N N   . LYS C 3 75  ? -10.929 -21.976 35.804  1.00 60.13  ? 75  LYS C N   1 
ATOM   3690 C CA  . LYS C 3 75  ? -12.312 -21.762 36.210  1.00 58.55  ? 75  LYS C CA  1 
ATOM   3691 C C   . LYS C 3 75  ? -12.557 -20.286 36.509  1.00 47.18  ? 75  LYS C C   1 
ATOM   3692 O O   . LYS C 3 75  ? -13.663 -19.890 36.875  1.00 57.03  ? 75  LYS C O   1 
ATOM   3693 C CB  . LYS C 3 75  ? -12.653 -22.617 37.431  1.00 47.89  ? 75  LYS C CB  1 
ATOM   3694 C CG  . LYS C 3 75  ? -12.399 -24.103 37.231  1.00 61.97  ? 75  LYS C CG  1 
ATOM   3695 C CD  . LYS C 3 75  ? -12.589 -24.879 38.523  1.00 74.74  ? 75  LYS C CD  1 
ATOM   3696 C CE  . LYS C 3 75  ? -12.190 -26.336 38.355  1.00 83.75  ? 75  LYS C CE  1 
ATOM   3697 N NZ  . LYS C 3 75  ? -12.288 -27.090 39.635  1.00 87.90  ? 75  LYS C NZ  1 
ATOM   3698 N N   . GLY C 3 76  ? -11.514 -19.477 36.348  1.00 53.45  ? 76  GLY C N   1 
ATOM   3699 C CA  . GLY C 3 76  ? -11.612 -18.047 36.574  1.00 55.79  ? 76  GLY C CA  1 
ATOM   3700 C C   . GLY C 3 76  ? -11.139 -17.638 37.955  1.00 51.19  ? 76  GLY C C   1 
ATOM   3701 O O   . GLY C 3 76  ? -10.931 -16.456 38.225  1.00 55.69  ? 76  GLY C O   1 
ATOM   3702 N N   . ASP C 3 77  ? -10.965 -18.623 38.830  1.00 49.64  ? 77  ASP C N   1 
ATOM   3703 C CA  . ASP C 3 77  ? -10.557 -18.364 40.207  1.00 47.62  ? 77  ASP C CA  1 
ATOM   3704 C C   . ASP C 3 77  ? -9.062  -18.078 40.311  1.00 56.91  ? 77  ASP C C   1 
ATOM   3705 O O   . ASP C 3 77  ? -8.232  -18.958 40.083  1.00 59.31  ? 77  ASP C O   1 
ATOM   3706 C CB  . ASP C 3 77  ? -10.929 -19.551 41.100  1.00 62.94  ? 77  ASP C CB  1 
ATOM   3707 C CG  . ASP C 3 77  ? -10.503 -19.352 42.542  1.00 70.99  ? 77  ASP C CG  1 
ATOM   3708 O OD1 . ASP C 3 77  ? -10.435 -18.189 42.992  1.00 68.48  ? 77  ASP C OD1 1 
ATOM   3709 O OD2 . ASP C 3 77  ? -10.239 -20.362 43.228  1.00 82.03  ? 77  ASP C OD2 1 
ATOM   3710 N N   . ALA C 3 78  ? -8.727  -16.840 40.661  1.00 45.94  ? 78  ALA C N   1 
ATOM   3711 C CA  . ALA C 3 78  ? -7.338  -16.444 40.857  1.00 43.97  ? 78  ALA C CA  1 
ATOM   3712 C C   . ALA C 3 78  ? -7.139  -15.881 42.261  1.00 50.34  ? 78  ALA C C   1 
ATOM   3713 O O   . ALA C 3 78  ? -6.305  -15.001 42.476  1.00 48.15  ? 78  ALA C O   1 
ATOM   3714 C CB  . ALA C 3 78  ? -6.921  -15.424 39.809  1.00 48.07  ? 78  ALA C CB  1 
ATOM   3715 N N   . SER C 3 79  ? -7.913  -16.399 43.210  1.00 39.03  ? 79  SER C N   1 
ATOM   3716 C CA  . SER C 3 79  ? -7.882  -15.918 44.587  1.00 52.95  ? 79  SER C CA  1 
ATOM   3717 C C   . SER C 3 79  ? -6.523  -16.137 45.238  1.00 59.56  ? 79  SER C C   1 
ATOM   3718 O O   . SER C 3 79  ? -5.896  -17.182 45.063  1.00 57.59  ? 79  SER C O   1 
ATOM   3719 C CB  . SER C 3 79  ? -8.969  -16.604 45.416  1.00 45.95  ? 79  SER C CB  1 
ATOM   3720 O OG  . SER C 3 79  ? -10.259 -16.284 44.927  1.00 56.62  ? 79  SER C OG  1 
ATOM   3721 N N   . LEU C 3 80  ? -6.077  -15.140 45.994  1.00 50.62  ? 80  LEU C N   1 
ATOM   3722 C CA  . LEU C 3 80  ? -4.787  -15.200 46.662  1.00 49.40  ? 80  LEU C CA  1 
ATOM   3723 C C   . LEU C 3 80  ? -4.929  -15.705 48.093  1.00 59.04  ? 80  LEU C C   1 
ATOM   3724 O O   . LEU C 3 80  ? -5.784  -15.237 48.846  1.00 54.87  ? 80  LEU C O   1 
ATOM   3725 C CB  . LEU C 3 80  ? -4.121  -13.825 46.655  1.00 46.18  ? 80  LEU C CB  1 
ATOM   3726 C CG  . LEU C 3 80  ? -2.724  -13.741 47.267  1.00 50.03  ? 80  LEU C CG  1 
ATOM   3727 C CD1 . LEU C 3 80  ? -1.721  -14.506 46.420  1.00 47.05  ? 80  LEU C CD1 1 
ATOM   3728 C CD2 . LEU C 3 80  ? -2.312  -12.292 47.416  1.00 49.69  ? 80  LEU C CD2 1 
ATOM   3729 N N   . LYS C 3 81  ? -4.086  -16.663 48.460  1.00 61.36  ? 81  LYS C N   1 
ATOM   3730 C CA  . LYS C 3 81  ? -4.106  -17.218 49.807  1.00 56.00  ? 81  LYS C CA  1 
ATOM   3731 C C   . LYS C 3 81  ? -2.776  -16.988 50.516  1.00 59.03  ? 81  LYS C C   1 
ATOM   3732 O O   . LYS C 3 81  ? -1.707  -17.233 49.953  1.00 61.19  ? 81  LYS C O   1 
ATOM   3733 C CB  . LYS C 3 81  ? -4.430  -18.712 49.767  1.00 65.64  ? 81  LYS C CB  1 
ATOM   3734 C CG  . LYS C 3 81  ? -5.790  -19.032 49.169  1.00 71.84  ? 81  LYS C CG  1 
ATOM   3735 N N   . MET C 3 82  ? -2.853  -16.512 51.755  1.00 61.28  ? 82  MET C N   1 
ATOM   3736 C CA  . MET C 3 82  ? -1.666  -16.296 52.576  1.00 63.91  ? 82  MET C CA  1 
ATOM   3737 C C   . MET C 3 82  ? -1.978  -16.515 54.054  1.00 70.77  ? 82  MET C C   1 
ATOM   3738 O O   . MET C 3 82  ? -3.148  -16.558 54.442  1.00 74.40  ? 82  MET C O   1 
ATOM   3739 C CB  . MET C 3 82  ? -1.117  -14.886 52.360  1.00 64.39  ? 82  MET C CB  1 
ATOM   3740 C CG  . MET C 3 82  ? -1.920  -13.797 53.059  1.00 48.90  ? 82  MET C CG  1 
ATOM   3741 S SD  . MET C 3 82  ? -1.320  -12.126 52.738  1.00 76.35  ? 82  MET C SD  1 
ATOM   3742 C CE  . MET C 3 82  ? -1.580  -12.006 50.971  1.00 52.53  ? 82  MET C CE  1 
ATOM   3743 N N   . ASP C 3 83  ? -0.942  -16.647 54.880  1.00 73.14  ? 83  ASP C N   1 
ATOM   3744 C CA  . ASP C 3 83  ? -1.158  -16.784 56.316  1.00 70.82  ? 83  ASP C CA  1 
ATOM   3745 C C   . ASP C 3 83  ? -1.317  -15.420 56.980  1.00 60.64  ? 83  ASP C C   1 
ATOM   3746 O O   . ASP C 3 83  ? -0.933  -14.396 56.415  1.00 63.57  ? 83  ASP C O   1 
ATOM   3747 C CB  . ASP C 3 83  ? -0.022  -17.569 56.969  1.00 80.40  ? 83  ASP C CB  1 
ATOM   3748 C CG  . ASP C 3 83  ? 0.299   -18.855 56.226  1.00 98.94  ? 83  ASP C CG  1 
ATOM   3749 O OD1 . ASP C 3 83  ? -0.648  -19.554 55.793  1.00 100.91 ? 83  ASP C OD1 1 
ATOM   3750 O OD2 . ASP C 3 83  ? 1.500   -19.179 56.098  1.00 105.86 ? 83  ASP C OD2 1 
ATOM   3751 N N   . LYS C 3 84  ? -1.886  -15.419 58.183  1.00 65.41  ? 84  LYS C N   1 
ATOM   3752 C CA  . LYS C 3 84  ? -2.206  -14.185 58.895  1.00 70.65  ? 84  LYS C CA  1 
ATOM   3753 C C   . LYS C 3 84  ? -0.974  -13.330 59.189  1.00 76.37  ? 84  LYS C C   1 
ATOM   3754 O O   . LYS C 3 84  ? -1.065  -12.106 59.244  1.00 76.53  ? 84  LYS C O   1 
ATOM   3755 C CB  . LYS C 3 84  ? -2.941  -14.504 60.203  1.00 77.13  ? 84  LYS C CB  1 
ATOM   3756 C CG  . LYS C 3 84  ? -2.172  -15.417 61.149  1.00 82.03  ? 84  LYS C CG  1 
ATOM   3757 C CD  . LYS C 3 84  ? -2.946  -15.659 62.440  1.00 87.04  ? 84  LYS C CD  1 
ATOM   3758 N N   . SER C 3 85  ? 0.173   -13.977 59.379  1.00 82.23  ? 85  SER C N   1 
ATOM   3759 C CA  . SER C 3 85  ? 1.408   -13.268 59.700  1.00 83.59  ? 85  SER C CA  1 
ATOM   3760 C C   . SER C 3 85  ? 1.837   -12.336 58.568  1.00 79.89  ? 85  SER C C   1 
ATOM   3761 O O   . SER C 3 85  ? 2.468   -11.306 58.806  1.00 81.43  ? 85  SER C O   1 
ATOM   3762 C CB  . SER C 3 85  ? 2.527   -14.264 60.014  1.00 86.70  ? 85  SER C CB  1 
ATOM   3763 O OG  . SER C 3 85  ? 2.928   -14.967 58.851  1.00 93.50  ? 85  SER C OG  1 
ATOM   3764 N N   . ASP C 3 86  ? 1.486   -12.699 57.339  1.00 62.05  ? 86  ASP C N   1 
ATOM   3765 C CA  . ASP C 3 86  ? 1.818   -11.882 56.176  1.00 76.39  ? 86  ASP C CA  1 
ATOM   3766 C C   . ASP C 3 86  ? 0.739   -10.841 55.894  1.00 63.27  ? 86  ASP C C   1 
ATOM   3767 O O   . ASP C 3 86  ? 0.989   -9.845  55.216  1.00 74.27  ? 86  ASP C O   1 
ATOM   3768 C CB  . ASP C 3 86  ? 2.027   -12.764 54.943  1.00 69.40  ? 86  ASP C CB  1 
ATOM   3769 C CG  . ASP C 3 86  ? 3.359   -13.488 54.963  1.00 85.07  ? 86  ASP C CG  1 
ATOM   3770 O OD1 . ASP C 3 86  ? 4.319   -12.955 55.558  1.00 94.59  ? 86  ASP C OD1 1 
ATOM   3771 O OD2 . ASP C 3 86  ? 3.447   -14.588 54.381  1.00 87.87  ? 86  ASP C OD2 1 
ATOM   3772 N N   . ALA C 3 87  ? -0.458  -11.077 56.418  1.00 54.16  ? 87  ALA C N   1 
ATOM   3773 C CA  . ALA C 3 87  ? -1.583  -10.180 56.181  1.00 51.85  ? 87  ALA C CA  1 
ATOM   3774 C C   . ALA C 3 87  ? -1.682  -9.098  57.252  1.00 59.63  ? 87  ALA C C   1 
ATOM   3775 O O   . ALA C 3 87  ? -2.225  -8.021  57.004  1.00 57.89  ? 87  ALA C O   1 
ATOM   3776 C CB  . ALA C 3 87  ? -2.881  -10.971 56.110  1.00 52.64  ? 87  ALA C CB  1 
ATOM   3777 N N   . VAL C 3 88  ? -1.153  -9.392  58.437  1.00 58.16  ? 88  VAL C N   1 
ATOM   3778 C CA  . VAL C 3 88  ? -1.222  -8.477  59.576  1.00 56.80  ? 88  VAL C CA  1 
ATOM   3779 C C   . VAL C 3 88  ? -0.607  -7.113  59.262  1.00 69.26  ? 88  VAL C C   1 
ATOM   3780 O O   . VAL C 3 88  ? -1.201  -6.074  59.557  1.00 78.04  ? 88  VAL C O   1 
ATOM   3781 C CB  . VAL C 3 88  ? -0.524  -9.083  60.820  1.00 63.73  ? 88  VAL C CB  1 
ATOM   3782 C CG1 . VAL C 3 88  ? -0.011  -7.992  61.751  1.00 63.50  ? 88  VAL C CG1 1 
ATOM   3783 C CG2 . VAL C 3 88  ? -1.471  -10.016 61.559  1.00 65.62  ? 88  VAL C CG2 1 
ATOM   3784 N N   . SER C 3 89  ? 0.572   -7.120  58.650  1.00 66.79  ? 89  SER C N   1 
ATOM   3785 C CA  . SER C 3 89  ? 1.274   -5.878  58.347  1.00 76.77  ? 89  SER C CA  1 
ATOM   3786 C C   . SER C 3 89  ? 1.038   -5.431  56.908  1.00 69.25  ? 89  SER C C   1 
ATOM   3787 O O   . SER C 3 89  ? 1.740   -4.558  56.399  1.00 67.54  ? 89  SER C O   1 
ATOM   3788 C CB  . SER C 3 89  ? 2.774   -6.038  58.603  1.00 92.10  ? 89  SER C CB  1 
ATOM   3789 O OG  . SER C 3 89  ? 3.437   -4.789  58.514  1.00 99.41  ? 89  SER C OG  1 
ATOM   3790 N N   . HIS C 3 90  ? 0.044   -6.028  56.259  1.00 67.96  ? 90  HIS C N   1 
ATOM   3791 C CA  . HIS C 3 90  ? -0.242  -5.720  54.863  1.00 69.20  ? 90  HIS C CA  1 
ATOM   3792 C C   . HIS C 3 90  ? -1.730  -5.506  54.607  1.00 69.08  ? 90  HIS C C   1 
ATOM   3793 O O   . HIS C 3 90  ? -2.315  -6.140  53.729  1.00 57.91  ? 90  HIS C O   1 
ATOM   3794 C CB  . HIS C 3 90  ? 0.285   -6.835  53.959  1.00 59.01  ? 90  HIS C CB  1 
ATOM   3795 C CG  . HIS C 3 90  ? 1.778   -6.897  53.887  1.00 62.36  ? 90  HIS C CG  1 
ATOM   3796 N ND1 . HIS C 3 90  ? 2.492   -8.038  54.186  1.00 66.14  ? 90  HIS C ND1 1 
ATOM   3797 C CD2 . HIS C 3 90  ? 2.693   -5.961  53.539  1.00 59.00  ? 90  HIS C CD2 1 
ATOM   3798 C CE1 . HIS C 3 90  ? 3.782   -7.800  54.032  1.00 74.10  ? 90  HIS C CE1 1 
ATOM   3799 N NE2 . HIS C 3 90  ? 3.931   -6.548  53.638  1.00 69.73  ? 90  HIS C NE2 1 
ATOM   3800 N N   . THR C 3 91  ? -2.339  -4.610  55.377  1.00 73.20  ? 91  THR C N   1 
ATOM   3801 C CA  . THR C 3 91  ? -3.735  -4.252  55.165  1.00 63.53  ? 91  THR C CA  1 
ATOM   3802 C C   . THR C 3 91  ? -3.835  -3.108  54.165  1.00 57.21  ? 91  THR C C   1 
ATOM   3803 O O   . THR C 3 91  ? -3.022  -2.185  54.183  1.00 60.42  ? 91  THR C O   1 
ATOM   3804 C CB  . THR C 3 91  ? -4.430  -3.844  56.479  1.00 52.29  ? 91  THR C CB  1 
ATOM   3805 O OG1 . THR C 3 91  ? -3.666  -2.821  57.128  1.00 61.73  ? 91  THR C OG1 1 
ATOM   3806 C CG2 . THR C 3 91  ? -4.557  -5.041  57.406  1.00 46.51  ? 91  THR C CG2 1 
ATOM   3807 N N   . GLY C 3 92  ? -4.830  -3.176  53.288  1.00 68.06  ? 92  GLY C N   1 
ATOM   3808 C CA  . GLY C 3 92  ? -5.020  -2.152  52.279  1.00 70.77  ? 92  GLY C CA  1 
ATOM   3809 C C   . GLY C 3 92  ? -5.625  -2.694  51.000  1.00 62.38  ? 92  GLY C C   1 
ATOM   3810 O O   . GLY C 3 92  ? -6.302  -3.722  51.010  1.00 57.06  ? 92  GLY C O   1 
ATOM   3811 N N   . ASN C 3 93  ? -5.376  -2.001  49.894  1.00 64.88  ? 93  ASN C N   1 
ATOM   3812 C CA  . ASN C 3 93  ? -5.944  -2.382  48.607  1.00 61.37  ? 93  ASN C CA  1 
ATOM   3813 C C   . ASN C 3 93  ? -5.033  -3.292  47.794  1.00 53.94  ? 93  ASN C C   1 
ATOM   3814 O O   . ASN C 3 93  ? -3.898  -2.935  47.479  1.00 57.14  ? 93  ASN C O   1 
ATOM   3815 C CB  . ASN C 3 93  ? -6.284  -1.134  47.791  1.00 67.62  ? 93  ASN C CB  1 
ATOM   3816 C CG  . ASN C 3 93  ? -7.601  -0.513  48.206  1.00 73.19  ? 93  ASN C CG  1 
ATOM   3817 O OD1 . ASN C 3 93  ? -8.596  -1.213  48.387  1.00 67.33  ? 93  ASN C OD1 1 
ATOM   3818 N ND2 . ASN C 3 93  ? -7.615  0.803   48.364  1.00 93.66  ? 93  ASN C ND2 1 
ATOM   3819 N N   . TYR C 3 94  ? -5.543  -4.473  47.460  1.00 50.33  ? 94  TYR C N   1 
ATOM   3820 C CA  . TYR C 3 94  ? -4.822  -5.414  46.615  1.00 43.06  ? 94  TYR C CA  1 
ATOM   3821 C C   . TYR C 3 94  ? -5.346  -5.352  45.188  1.00 47.36  ? 94  TYR C C   1 
ATOM   3822 O O   . TYR C 3 94  ? -6.551  -5.239  44.967  1.00 52.61  ? 94  TYR C O   1 
ATOM   3823 C CB  . TYR C 3 94  ? -4.949  -6.839  47.154  1.00 47.85  ? 94  TYR C CB  1 
ATOM   3824 C CG  . TYR C 3 94  ? -4.121  -7.110  48.388  1.00 52.70  ? 94  TYR C CG  1 
ATOM   3825 C CD1 . TYR C 3 94  ? -4.551  -6.693  49.640  1.00 51.02  ? 94  TYR C CD1 1 
ATOM   3826 C CD2 . TYR C 3 94  ? -2.913  -7.789  48.300  1.00 53.75  ? 94  TYR C CD2 1 
ATOM   3827 C CE1 . TYR C 3 94  ? -3.798  -6.942  50.771  1.00 53.49  ? 94  TYR C CE1 1 
ATOM   3828 C CE2 . TYR C 3 94  ? -2.154  -8.042  49.425  1.00 58.61  ? 94  TYR C CE2 1 
ATOM   3829 C CZ  . TYR C 3 94  ? -2.601  -7.617  50.658  1.00 52.90  ? 94  TYR C CZ  1 
ATOM   3830 O OH  . TYR C 3 94  ? -1.849  -7.867  51.780  1.00 61.47  ? 94  TYR C OH  1 
ATOM   3831 N N   . THR C 3 95  ? -4.436  -5.427  44.224  1.00 54.67  ? 95  THR C N   1 
ATOM   3832 C CA  . THR C 3 95  ? -4.816  -5.423  42.818  1.00 50.28  ? 95  THR C CA  1 
ATOM   3833 C C   . THR C 3 95  ? -4.572  -6.788  42.187  1.00 40.51  ? 95  THR C C   1 
ATOM   3834 O O   . THR C 3 95  ? -3.448  -7.291  42.184  1.00 44.00  ? 95  THR C O   1 
ATOM   3835 C CB  . THR C 3 95  ? -4.047  -4.351  42.027  1.00 49.99  ? 95  THR C CB  1 
ATOM   3836 O OG1 . THR C 3 95  ? -4.356  -3.054  42.552  1.00 56.17  ? 95  THR C OG1 1 
ATOM   3837 C CG2 . THR C 3 95  ? -4.428  -4.399  40.555  1.00 64.02  ? 95  THR C CG2 1 
ATOM   3838 N N   . CYS C 3 96  ? -5.634  -7.387  41.660  1.00 44.18  ? 96  CYS C N   1 
ATOM   3839 C CA  . CYS C 3 96  ? -5.531  -8.678  40.992  1.00 46.63  ? 96  CYS C CA  1 
ATOM   3840 C C   . CYS C 3 96  ? -5.518  -8.509  39.477  1.00 45.34  ? 96  CYS C C   1 
ATOM   3841 O O   . CYS C 3 96  ? -6.572  -8.413  38.847  1.00 48.12  ? 96  CYS C O   1 
ATOM   3842 C CB  . CYS C 3 96  ? -6.684  -9.592  41.411  1.00 40.58  ? 96  CYS C CB  1 
ATOM   3843 S SG  . CYS C 3 96  ? -6.683  -11.212 40.609  1.00 59.67  ? 96  CYS C SG  1 
ATOM   3844 N N   . GLU C 3 97  ? -4.323  -8.469  38.897  1.00 48.38  ? 97  GLU C N   1 
ATOM   3845 C CA  . GLU C 3 97  ? -4.174  -8.328  37.452  1.00 48.23  ? 97  GLU C CA  1 
ATOM   3846 C C   . GLU C 3 97  ? -4.070  -9.689  36.770  1.00 54.85  ? 97  GLU C C   1 
ATOM   3847 O O   . GLU C 3 97  ? -3.167  -10.472 37.063  1.00 58.62  ? 97  GLU C O   1 
ATOM   3848 C CB  . GLU C 3 97  ? -2.945  -7.482  37.118  1.00 42.96  ? 97  GLU C CB  1 
ATOM   3849 C CG  . GLU C 3 97  ? -2.568  -7.499  35.645  1.00 69.16  ? 97  GLU C CG  1 
ATOM   3850 C CD  . GLU C 3 97  ? -1.293  -6.731  35.361  1.00 82.82  ? 97  GLU C CD  1 
ATOM   3851 O OE1 . GLU C 3 97  ? -0.554  -7.125  34.434  1.00 88.91  ? 97  GLU C OE1 1 
ATOM   3852 O OE2 . GLU C 3 97  ? -1.030  -5.733  36.064  1.00 93.94  ? 97  GLU C OE2 1 
ATOM   3853 N N   . VAL C 3 98  ? -4.994  -9.962  35.856  1.00 56.35  ? 98  VAL C N   1 
ATOM   3854 C CA  . VAL C 3 98  ? -5.032  -11.249 35.172  1.00 51.52  ? 98  VAL C CA  1 
ATOM   3855 C C   . VAL C 3 98  ? -4.828  -11.104 33.667  1.00 61.64  ? 98  VAL C C   1 
ATOM   3856 O O   . VAL C 3 98  ? -5.610  -10.444 32.984  1.00 58.99  ? 98  VAL C O   1 
ATOM   3857 C CB  . VAL C 3 98  ? -6.367  -11.977 35.424  1.00 45.77  ? 98  VAL C CB  1 
ATOM   3858 C CG1 . VAL C 3 98  ? -6.391  -13.311 34.693  1.00 41.37  ? 98  VAL C CG1 1 
ATOM   3859 C CG2 . VAL C 3 98  ? -6.589  -12.174 36.915  1.00 48.07  ? 98  VAL C CG2 1 
ATOM   3860 N N   . THR C 3 99  ? -3.768  -11.724 33.158  1.00 65.42  ? 99  THR C N   1 
ATOM   3861 C CA  . THR C 3 99  ? -3.511  -11.753 31.723  1.00 65.53  ? 99  THR C CA  1 
ATOM   3862 C C   . THR C 3 99  ? -3.907  -13.110 31.154  1.00 59.58  ? 99  THR C C   1 
ATOM   3863 O O   . THR C 3 99  ? -3.307  -14.133 31.485  1.00 66.29  ? 99  THR C O   1 
ATOM   3864 C CB  . THR C 3 99  ? -2.033  -11.470 31.400  1.00 72.19  ? 99  THR C CB  1 
ATOM   3865 O OG1 . THR C 3 99  ? -1.687  -10.154 31.851  1.00 78.72  ? 99  THR C OG1 1 
ATOM   3866 C CG2 . THR C 3 99  ? -1.787  -11.568 29.902  1.00 75.08  ? 99  THR C CG2 1 
ATOM   3867 N N   . GLU C 3 100 ? -4.922  -13.111 30.297  1.00 51.36  ? 100 GLU C N   1 
ATOM   3868 C CA  . GLU C 3 100 ? -5.470  -14.350 29.760  1.00 65.28  ? 100 GLU C CA  1 
ATOM   3869 C C   . GLU C 3 100 ? -5.483  -14.331 28.235  1.00 74.74  ? 100 GLU C C   1 
ATOM   3870 O O   . GLU C 3 100 ? -6.277  -13.616 27.622  1.00 79.07  ? 100 GLU C O   1 
ATOM   3871 C CB  . GLU C 3 100 ? -6.881  -14.582 30.310  1.00 82.11  ? 100 GLU C CB  1 
ATOM   3872 C CG  . GLU C 3 100 ? -7.516  -15.897 29.895  1.00 90.04  ? 100 GLU C CG  1 
ATOM   3873 C CD  . GLU C 3 100 ? -8.397  -15.760 28.671  1.00 97.41  ? 100 GLU C CD  1 
ATOM   3874 O OE1 . GLU C 3 100 ? -8.821  -14.626 28.363  1.00 102.51 ? 100 GLU C OE1 1 
ATOM   3875 O OE2 . GLU C 3 100 ? -8.664  -16.788 28.016  1.00 98.61  ? 100 GLU C OE2 1 
ATOM   3876 N N   . LEU C 3 101 ? -4.594  -15.124 27.639  1.00 84.10  ? 101 LEU C N   1 
ATOM   3877 C CA  . LEU C 3 101 ? -4.453  -15.210 26.187  1.00 82.54  ? 101 LEU C CA  1 
ATOM   3878 C C   . LEU C 3 101 ? -4.230  -13.841 25.553  1.00 85.84  ? 101 LEU C C   1 
ATOM   3879 O O   . LEU C 3 101 ? -3.157  -13.254 25.688  1.00 101.84 ? 101 LEU C O   1 
ATOM   3880 C CB  . LEU C 3 101 ? -5.680  -15.886 25.567  1.00 83.95  ? 101 LEU C CB  1 
ATOM   3881 C CG  . LEU C 3 101 ? -5.516  -17.356 25.172  1.00 88.04  ? 101 LEU C CG  1 
ATOM   3882 C CD1 . LEU C 3 101 ? -6.867  -17.982 24.868  1.00 84.72  ? 101 LEU C CD1 1 
ATOM   3883 C CD2 . LEU C 3 101 ? -4.587  -17.491 23.979  1.00 97.33  ? 101 LEU C CD2 1 
ATOM   3884 N N   . THR C 3 102 ? -5.250  -13.338 24.866  1.00 75.60  ? 102 THR C N   1 
ATOM   3885 C CA  . THR C 3 102 ? -5.154  -12.057 24.177  1.00 76.75  ? 102 THR C CA  1 
ATOM   3886 C C   . THR C 3 102 ? -5.642  -10.895 25.040  1.00 71.09  ? 102 THR C C   1 
ATOM   3887 O O   . THR C 3 102 ? -5.272  -9.741  24.812  1.00 70.90  ? 102 THR C O   1 
ATOM   3888 C CB  . THR C 3 102 ? -5.957  -12.076 22.861  1.00 85.52  ? 102 THR C CB  1 
ATOM   3889 O OG1 . THR C 3 102 ? -5.885  -10.789 22.234  1.00 84.90  ? 102 THR C OG1 1 
ATOM   3890 C CG2 . THR C 3 102 ? -7.416  -12.441 23.120  1.00 89.05  ? 102 THR C CG2 1 
ATOM   3891 N N   . ARG C 3 103 ? -6.465  -11.203 26.036  1.00 60.81  ? 103 ARG C N   1 
ATOM   3892 C CA  . ARG C 3 103 ? -7.092  -10.168 26.847  1.00 56.90  ? 103 ARG C CA  1 
ATOM   3893 C C   . ARG C 3 103 ? -6.397  -9.973  28.189  1.00 71.53  ? 103 ARG C C   1 
ATOM   3894 O O   . ARG C 3 103 ? -5.643  -10.832 28.648  1.00 58.87  ? 103 ARG C O   1 
ATOM   3895 C CB  . ARG C 3 103 ? -8.568  -10.497 27.070  1.00 55.65  ? 103 ARG C CB  1 
ATOM   3896 C CG  . ARG C 3 103 ? -9.359  -10.682 25.784  1.00 58.22  ? 103 ARG C CG  1 
ATOM   3897 C CD  . ARG C 3 103 ? -10.751 -11.211 26.069  1.00 57.07  ? 103 ARG C CD  1 
ATOM   3898 N NE  . ARG C 3 103 ? -10.716 -12.505 26.743  1.00 54.01  ? 103 ARG C NE  1 
ATOM   3899 C CZ  . ARG C 3 103 ? -11.793 -13.144 27.187  1.00 70.24  ? 103 ARG C CZ  1 
ATOM   3900 N NH1 . ARG C 3 103 ? -12.996 -12.607 27.030  1.00 65.37  ? 103 ARG C NH1 1 
ATOM   3901 N NH2 . ARG C 3 103 ? -11.668 -14.319 27.789  1.00 69.04  ? 103 ARG C NH2 1 
ATOM   3902 N N   . GLU C 3 104 ? -6.661  -8.831  28.814  1.00 65.73  ? 104 GLU C N   1 
ATOM   3903 C CA  . GLU C 3 104 ? -6.045  -8.492  30.087  1.00 66.16  ? 104 GLU C CA  1 
ATOM   3904 C C   . GLU C 3 104 ? -6.909  -7.499  30.857  1.00 70.72  ? 104 GLU C C   1 
ATOM   3905 O O   . GLU C 3 104 ? -7.400  -6.521  30.293  1.00 73.66  ? 104 GLU C O   1 
ATOM   3906 C CB  . GLU C 3 104 ? -4.641  -7.926  29.864  1.00 77.80  ? 104 GLU C CB  1 
ATOM   3907 C CG  . GLU C 3 104 ? -3.849  -7.679  31.138  1.00 92.64  ? 104 GLU C CG  1 
ATOM   3908 C CD  . GLU C 3 104 ? -4.002  -6.263  31.657  1.00 105.03 ? 104 GLU C CD  1 
ATOM   3909 O OE1 . GLU C 3 104 ? -4.641  -5.441  30.966  1.00 112.77 ? 104 GLU C OE1 1 
ATOM   3910 O OE2 . GLU C 3 104 ? -3.484  -5.972  32.756  1.00 102.00 ? 104 GLU C OE2 1 
ATOM   3911 N N   . GLY C 3 105 ? -7.093  -7.763  32.146  1.00 61.33  ? 105 GLY C N   1 
ATOM   3912 C CA  . GLY C 3 105 ? -7.881  -6.898  33.005  1.00 57.98  ? 105 GLY C CA  1 
ATOM   3913 C C   . GLY C 3 105 ? -7.451  -7.013  34.454  1.00 58.26  ? 105 GLY C C   1 
ATOM   3914 O O   . GLY C 3 105 ? -6.577  -7.814  34.785  1.00 54.24  ? 105 GLY C O   1 
ATOM   3915 N N   . GLU C 3 106 ? -8.063  -6.214  35.322  1.00 60.59  ? 106 GLU C N   1 
ATOM   3916 C CA  . GLU C 3 106 ? -7.716  -6.236  36.739  1.00 54.15  ? 106 GLU C CA  1 
ATOM   3917 C C   . GLU C 3 106 ? -8.857  -5.742  37.623  1.00 57.08  ? 106 GLU C C   1 
ATOM   3918 O O   . GLU C 3 106 ? -9.733  -5.003  37.173  1.00 48.41  ? 106 GLU C O   1 
ATOM   3919 C CB  . GLU C 3 106 ? -6.464  -5.393  36.993  1.00 52.41  ? 106 GLU C CB  1 
ATOM   3920 C CG  . GLU C 3 106 ? -6.680  -3.898  36.835  1.00 63.22  ? 106 GLU C CG  1 
ATOM   3921 C CD  . GLU C 3 106 ? -5.430  -3.095  37.134  1.00 80.78  ? 106 GLU C CD  1 
ATOM   3922 O OE1 . GLU C 3 106 ? -4.319  -3.619  36.912  1.00 88.08  ? 106 GLU C OE1 1 
ATOM   3923 O OE2 . GLU C 3 106 ? -5.560  -1.940  37.594  1.00 87.49  ? 106 GLU C OE2 1 
ATOM   3924 N N   . THR C 3 107 ? -8.836  -6.159  38.885  1.00 59.54  ? 107 THR C N   1 
ATOM   3925 C CA  . THR C 3 107 ? -9.823  -5.720  39.864  1.00 61.04  ? 107 THR C CA  1 
ATOM   3926 C C   . THR C 3 107 ? -9.146  -5.411  41.197  1.00 65.02  ? 107 THR C C   1 
ATOM   3927 O O   . THR C 3 107 ? -8.084  -5.954  41.506  1.00 56.99  ? 107 THR C O   1 
ATOM   3928 C CB  . THR C 3 107 ? -10.926 -6.777  40.076  1.00 59.12  ? 107 THR C CB  1 
ATOM   3929 O OG1 . THR C 3 107 ? -11.859 -6.310  41.058  1.00 74.74  ? 107 THR C OG1 1 
ATOM   3930 C CG2 . THR C 3 107 ? -10.325 -8.096  40.538  1.00 53.83  ? 107 THR C CG2 1 
ATOM   3931 N N   . ILE C 3 108 ? -9.763  -4.534  41.984  1.00 60.07  ? 108 ILE C N   1 
ATOM   3932 C CA  . ILE C 3 108 ? -9.181  -4.104  43.250  1.00 54.70  ? 108 ILE C CA  1 
ATOM   3933 C C   . ILE C 3 108 ? -10.002 -4.580  44.445  1.00 59.33  ? 108 ILE C C   1 
ATOM   3934 O O   . ILE C 3 108 ? -11.203 -4.323  44.529  1.00 63.82  ? 108 ILE C O   1 
ATOM   3935 C CB  . ILE C 3 108 ? -9.046  -2.570  43.310  1.00 55.29  ? 108 ILE C CB  1 
ATOM   3936 C CG1 . ILE C 3 108 ? -8.160  -2.070  42.167  1.00 64.75  ? 108 ILE C CG1 1 
ATOM   3937 C CG2 . ILE C 3 108 ? -8.482  -2.135  44.653  1.00 50.08  ? 108 ILE C CG2 1 
ATOM   3938 C CD1 . ILE C 3 108 ? -7.942  -0.573  42.171  1.00 70.87  ? 108 ILE C CD1 1 
ATOM   3939 N N   . ILE C 3 109 ? -9.343  -5.276  45.367  1.00 63.54  ? 109 ILE C N   1 
ATOM   3940 C CA  . ILE C 3 109 ? -9.992  -5.768  46.577  1.00 58.54  ? 109 ILE C CA  1 
ATOM   3941 C C   . ILE C 3 109 ? -9.281  -5.219  47.810  1.00 51.66  ? 109 ILE C C   1 
ATOM   3942 O O   . ILE C 3 109 ? -8.052  -5.182  47.858  1.00 64.20  ? 109 ILE C O   1 
ATOM   3943 C CB  . ILE C 3 109 ? -10.006 -7.315  46.645  1.00 51.32  ? 109 ILE C CB  1 
ATOM   3944 C CG1 . ILE C 3 109 ? -10.346 -7.927  45.282  1.00 64.69  ? 109 ILE C CG1 1 
ATOM   3945 C CG2 . ILE C 3 109 ? -10.977 -7.797  47.714  1.00 58.95  ? 109 ILE C CG2 1 
ATOM   3946 C CD1 . ILE C 3 109 ? -9.133  -8.304  44.446  1.00 56.40  ? 109 ILE C CD1 1 
ATOM   3947 N N   . GLU C 3 110 ? -10.053 -4.790  48.803  1.00 55.30  ? 110 GLU C N   1 
ATOM   3948 C CA  . GLU C 3 110 ? -9.478  -4.225  50.018  1.00 55.49  ? 110 GLU C CA  1 
ATOM   3949 C C   . GLU C 3 110 ? -9.431  -5.243  51.153  1.00 55.58  ? 110 GLU C C   1 
ATOM   3950 O O   . GLU C 3 110 ? -10.415 -5.931  51.427  1.00 57.19  ? 110 GLU C O   1 
ATOM   3951 C CB  . GLU C 3 110 ? -10.264 -2.991  50.462  1.00 56.61  ? 110 GLU C CB  1 
ATOM   3952 C CG  . GLU C 3 110 ? -9.662  -2.279  51.664  1.00 71.43  ? 110 GLU C CG  1 
ATOM   3953 C CD  . GLU C 3 110 ? -10.360 -0.971  51.982  1.00 80.90  ? 110 GLU C CD  1 
ATOM   3954 O OE1 . GLU C 3 110 ? -11.426 -0.704  51.387  1.00 94.56  ? 110 GLU C OE1 1 
ATOM   3955 O OE2 . GLU C 3 110 ? -9.842  -0.210  52.825  1.00 68.52  ? 110 GLU C OE2 1 
ATOM   3956 N N   . LEU C 3 111 ? -8.279  -5.333  51.809  1.00 58.63  ? 111 LEU C N   1 
ATOM   3957 C CA  . LEU C 3 111 ? -8.115  -6.213  52.960  1.00 60.95  ? 111 LEU C CA  1 
ATOM   3958 C C   . LEU C 3 111 ? -8.033  -5.390  54.241  1.00 59.10  ? 111 LEU C C   1 
ATOM   3959 O O   . LEU C 3 111 ? -7.081  -4.637  54.446  1.00 73.15  ? 111 LEU C O   1 
ATOM   3960 C CB  . LEU C 3 111 ? -6.867  -7.082  52.801  1.00 65.34  ? 111 LEU C CB  1 
ATOM   3961 C CG  . LEU C 3 111 ? -6.627  -8.136  53.884  1.00 63.55  ? 111 LEU C CG  1 
ATOM   3962 C CD1 . LEU C 3 111 ? -7.757  -9.153  53.902  1.00 58.17  ? 111 LEU C CD1 1 
ATOM   3963 C CD2 . LEU C 3 111 ? -5.286  -8.823  53.676  1.00 57.12  ? 111 LEU C CD2 1 
ATOM   3964 N N   . LYS C 3 112 ? -9.038  -5.534  55.099  1.00 61.67  ? 112 LYS C N   1 
ATOM   3965 C CA  . LYS C 3 112 ? -9.120  -4.738  56.319  1.00 68.68  ? 112 LYS C CA  1 
ATOM   3966 C C   . LYS C 3 112 ? -9.235  -5.612  57.565  1.00 74.29  ? 112 LYS C C   1 
ATOM   3967 O O   . LYS C 3 112 ? -9.687  -6.754  57.494  1.00 55.29  ? 112 LYS C O   1 
ATOM   3968 C CB  . LYS C 3 112 ? -10.306 -3.773  56.238  1.00 72.20  ? 112 LYS C CB  1 
ATOM   3969 C CG  . LYS C 3 112 ? -11.483 -4.304  55.439  1.00 78.84  ? 112 LYS C CG  1 
ATOM   3970 C CD  . LYS C 3 112 ? -12.445 -3.186  55.068  1.00 76.06  ? 112 LYS C CD  1 
ATOM   3971 C CE  . LYS C 3 112 ? -13.292 -2.767  56.258  1.00 83.48  ? 112 LYS C CE  1 
ATOM   3972 N N   . TYR C 3 113 ? -8.817  -5.063  58.702  1.00 83.75  ? 113 TYR C N   1 
ATOM   3973 C CA  . TYR C 3 113 ? -8.856  -5.779  59.975  1.00 101.38 ? 113 TYR C CA  1 
ATOM   3974 C C   . TYR C 3 113 ? -10.034 -5.315  60.826  1.00 108.30 ? 113 TYR C C   1 
ATOM   3975 O O   . TYR C 3 113 ? -10.443 -4.157  60.754  1.00 119.54 ? 113 TYR C O   1 
ATOM   3976 C CB  . TYR C 3 113 ? -7.543  -5.580  60.739  1.00 107.46 ? 113 TYR C CB  1 
ATOM   3977 C CG  . TYR C 3 113 ? -7.262  -6.640  61.782  1.00 115.65 ? 113 TYR C CG  1 
ATOM   3978 C CD1 . TYR C 3 113 ? -7.089  -7.968  61.419  1.00 116.99 ? 113 TYR C CD1 1 
ATOM   3979 C CD2 . TYR C 3 113 ? -7.164  -6.312  63.129  1.00 125.02 ? 113 TYR C CD2 1 
ATOM   3980 C CE1 . TYR C 3 113 ? -6.829  -8.941  62.366  1.00 122.09 ? 113 TYR C CE1 1 
ATOM   3981 C CE2 . TYR C 3 113 ? -6.905  -7.279  64.084  1.00 127.20 ? 113 TYR C CE2 1 
ATOM   3982 C CZ  . TYR C 3 113 ? -6.739  -8.591  63.697  1.00 126.94 ? 113 TYR C CZ  1 
ATOM   3983 O OH  . TYR C 3 113 ? -6.480  -9.551  64.649  1.00 128.50 ? 113 TYR C OH  1 
ATOM   3984 N N   . ARG C 3 114 ? -10.576 -6.222  61.633  1.00 100.74 ? 114 ARG C N   1 
ATOM   3985 C CA  . ARG C 3 114 ? -11.707 -5.896  62.495  1.00 94.32  ? 114 ARG C CA  1 
ATOM   3986 C C   . ARG C 3 114 ? -11.495 -6.422  63.911  1.00 87.69  ? 114 ARG C C   1 
ATOM   3987 O O   . ARG C 3 114 ? -10.989 -5.710  64.779  1.00 84.79  ? 114 ARG C O   1 
ATOM   3988 C CB  . ARG C 3 114 ? -13.005 -6.460  61.914  1.00 88.37  ? 114 ARG C CB  1 
HETATM 3989 C C1  . NAG D 4 .   ? 2.830   -26.879 36.912  1.00 79.88  ? 1   NAG A C1  1 
HETATM 3990 C C2  . NAG D 4 .   ? 2.359   -28.075 36.117  1.00 87.72  ? 1   NAG A C2  1 
HETATM 3991 C C3  . NAG D 4 .   ? 1.496   -28.941 37.010  1.00 94.50  ? 1   NAG A C3  1 
HETATM 3992 C C4  . NAG D 4 .   ? 2.207   -29.324 38.301  1.00 100.65 ? 1   NAG A C4  1 
HETATM 3993 C C5  . NAG D 4 .   ? 3.055   -28.196 38.878  1.00 94.41  ? 1   NAG A C5  1 
HETATM 3994 C C6  . NAG D 4 .   ? 4.115   -28.777 39.802  1.00 96.85  ? 1   NAG A C6  1 
HETATM 3995 C C7  . NAG D 4 .   ? 2.152   -27.590 33.730  1.00 86.35  ? 1   NAG A C7  1 
HETATM 3996 C C8  . NAG D 4 .   ? 3.487   -28.236 33.509  1.00 82.49  ? 1   NAG A C8  1 
HETATM 3997 N N2  . NAG D 4 .   ? 1.622   -27.661 34.947  1.00 86.14  ? 1   NAG A N2  1 
HETATM 3998 O O3  . NAG D 4 .   ? 1.137   -30.125 36.299  1.00 93.58  ? 1   NAG A O3  1 
HETATM 3999 O O4  . NAG D 4 .   ? 1.196   -29.599 39.272  1.00 116.79 ? 1   NAG A O4  1 
HETATM 4000 O O5  . NAG D 4 .   ? 3.708   -27.412 37.886  1.00 89.64  ? 1   NAG A O5  1 
HETATM 4001 O O6  . NAG D 4 .   ? 5.096   -27.778 40.098  1.00 99.65  ? 1   NAG A O6  1 
HETATM 4002 O O7  . NAG D 4 .   ? 1.571   -27.026 32.827  1.00 88.00  ? 1   NAG A O7  1 
HETATM 4003 C C1  . NAG D 4 .   ? 1.114   -30.984 39.656  1.00 131.59 ? 2   NAG A C1  1 
HETATM 4004 C C2  . NAG D 4 .   ? 0.242   -31.755 38.672  1.00 133.69 ? 2   NAG A C2  1 
HETATM 4005 C C3  . NAG D 4 .   ? -0.001  -33.171 39.178  1.00 135.62 ? 2   NAG A C3  1 
HETATM 4006 C C4  . NAG D 4 .   ? 1.330   -33.854 39.470  1.00 143.38 ? 2   NAG A C4  1 
HETATM 4007 C C5  . NAG D 4 .   ? 2.183   -32.989 40.400  1.00 144.32 ? 2   NAG A C5  1 
HETATM 4008 C C6  . NAG D 4 .   ? 3.569   -33.547 40.632  1.00 143.28 ? 2   NAG A C6  1 
HETATM 4009 C C7  . NAG D 4 .   ? -1.874  -30.650 39.339  1.00 132.09 ? 2   NAG A C7  1 
HETATM 4010 C C8  . NAG D 4 .   ? -3.098  -29.946 38.830  1.00 127.76 ? 2   NAG A C8  1 
HETATM 4011 N N2  . NAG D 4 .   ? -1.015  -31.067 38.402  1.00 133.20 ? 2   NAG A N2  1 
HETATM 4012 O O3  . NAG D 4 .   ? -0.719  -33.910 38.197  1.00 128.13 ? 2   NAG A O3  1 
HETATM 4013 O O4  . NAG D 4 .   ? 1.097   -35.119 40.078  1.00 146.20 ? 2   NAG A O4  1 
HETATM 4014 O O5  . NAG D 4 .   ? 2.352   -31.675 39.842  1.00 142.23 ? 2   NAG A O5  1 
HETATM 4015 O O6  . NAG D 4 .   ? 4.045   -34.269 39.504  1.00 144.11 ? 2   NAG A O6  1 
HETATM 4016 O O7  . NAG D 4 .   ? -1.684  -30.836 40.541  1.00 133.72 ? 2   NAG A O7  1 
HETATM 4017 C C1  . NAG E 4 .   ? -8.828  1.464   48.760  1.00 76.06  ? 1   NAG B C1  1 
HETATM 4018 C C2  . NAG E 4 .   ? -8.592  2.468   49.881  1.00 85.49  ? 1   NAG B C2  1 
HETATM 4019 C C3  . NAG E 4 .   ? -9.910  3.100   50.318  1.00 94.20  ? 1   NAG B C3  1 
HETATM 4020 C C4  . NAG E 4 .   ? -10.658 3.674   49.116  1.00 94.61  ? 1   NAG B C4  1 
HETATM 4021 C C5  . NAG E 4 .   ? -10.779 2.613   48.024  1.00 87.00  ? 1   NAG B C5  1 
HETATM 4022 C C6  . NAG E 4 .   ? -11.404 3.136   46.751  1.00 82.36  ? 1   NAG B C6  1 
HETATM 4023 C C7  . NAG E 4 .   ? -6.917  2.395   51.673  1.00 81.32  ? 1   NAG B C7  1 
HETATM 4024 C C8  . NAG E 4 .   ? -6.359  1.605   52.820  1.00 65.81  ? 1   NAG B C8  1 
HETATM 4025 N N2  . NAG E 4 .   ? -7.934  1.833   51.017  1.00 86.65  ? 1   NAG B N2  1 
HETATM 4026 O O3  . NAG E 4 .   ? -9.629  4.113   51.276  1.00 97.97  ? 1   NAG B O3  1 
HETATM 4027 O O4  . NAG E 4 .   ? -11.982 4.060   49.475  1.00 108.15 ? 1   NAG B O4  1 
HETATM 4028 O O5  . NAG E 4 .   ? -9.481  2.113   47.677  1.00 88.43  ? 1   NAG B O5  1 
HETATM 4029 O O6  . NAG E 4 .   ? -10.419 3.433   45.771  1.00 77.52  ? 1   NAG B O6  1 
HETATM 4030 O O7  . NAG E 4 .   ? -6.462  3.489   51.357  1.00 87.86  ? 1   NAG B O7  1 
HETATM 4031 C C1  . NAG E 4 .   ? -12.068 5.351   50.114  1.00 119.03 ? 2   NAG B C1  1 
HETATM 4032 C C2  . NAG E 4 .   ? -13.489 5.914   49.950  1.00 119.55 ? 2   NAG B C2  1 
HETATM 4033 C C3  . NAG E 4 .   ? -13.680 7.175   50.798  1.00 126.92 ? 2   NAG B C3  1 
HETATM 4034 C C4  . NAG E 4 .   ? -13.241 6.937   52.237  1.00 128.28 ? 2   NAG B C4  1 
HETATM 4035 C C5  . NAG E 4 .   ? -11.814 6.413   52.254  1.00 127.97 ? 2   NAG B C5  1 
HETATM 4036 C C6  . NAG E 4 .   ? -11.312 6.092   53.643  1.00 126.59 ? 2   NAG B C6  1 
HETATM 4037 C C7  . NAG E 4 .   ? -14.488 5.387   47.766  1.00 104.81 ? 2   NAG B C7  1 
HETATM 4038 C C8  . NAG E 4 .   ? -14.682 5.845   46.351  1.00 100.16 ? 2   NAG B C8  1 
HETATM 4039 N N2  . NAG E 4 .   ? -13.774 6.200   48.551  1.00 109.81 ? 2   NAG B N2  1 
HETATM 4040 O O3  . NAG E 4 .   ? -15.051 7.552   50.776  1.00 129.38 ? 2   NAG B O3  1 
HETATM 4041 O O4  . NAG E 4 .   ? -13.305 8.151   52.977  1.00 129.40 ? 2   NAG B O4  1 
HETATM 4042 O O5  . NAG E 4 .   ? -11.767 5.194   51.504  1.00 125.40 ? 2   NAG B O5  1 
HETATM 4043 O O6  . NAG E 4 .   ? -11.566 7.157   54.550  1.00 123.80 ? 2   NAG B O6  1 
HETATM 4044 O O7  . NAG E 4 .   ? -14.955 4.331   48.177  1.00 102.57 ? 2   NAG B O7  1 
HETATM 4045 C C1  . GOL F 5 .   ? 40.452  -6.909  5.756   1.00 87.67  ? 301 GOL L C1  1 
HETATM 4046 O O1  . GOL F 5 .   ? 40.418  -5.696  6.474   1.00 88.82  ? 301 GOL L O1  1 
HETATM 4047 C C2  . GOL F 5 .   ? 40.271  -6.623  4.272   1.00 91.71  ? 301 GOL L C2  1 
HETATM 4048 O O2  . GOL F 5 .   ? 40.671  -5.299  4.000   1.00 93.27  ? 301 GOL L O2  1 
HETATM 4049 C C3  . GOL F 5 .   ? 41.127  -7.589  3.464   1.00 88.44  ? 301 GOL L C3  1 
HETATM 4050 O O3  . GOL F 5 .   ? 41.018  -7.268  2.095   1.00 81.94  ? 301 GOL L O3  1 
HETATM 4051 C C1  . NAG G 6 .   ? -19.029 -15.033 40.181  1.00 96.57  ? 201 NAG C C1  1 
HETATM 4052 C C2  . NAG G 6 .   ? -19.162 -16.515 39.852  1.00 104.33 ? 201 NAG C C2  1 
HETATM 4053 C C3  . NAG G 6 .   ? -20.616 -16.964 39.933  1.00 107.68 ? 201 NAG C C3  1 
HETATM 4054 C C4  . NAG G 6 .   ? -21.257 -16.508 41.238  1.00 110.33 ? 201 NAG C C4  1 
HETATM 4055 C C5  . NAG G 6 .   ? -20.999 -15.026 41.484  1.00 112.16 ? 201 NAG C C5  1 
HETATM 4056 C C6  . NAG G 6 .   ? -21.574 -14.587 42.825  1.00 117.32 ? 201 NAG C C6  1 
HETATM 4057 C C7  . NAG G 6 .   ? -17.658 -17.659 38.329  1.00 111.90 ? 201 NAG C C7  1 
HETATM 4058 C C8  . NAG G 6 .   ? -16.491 -17.555 39.266  1.00 116.23 ? 201 NAG C C8  1 
HETATM 4059 N N2  . NAG G 6 .   ? -18.635 -16.778 38.527  1.00 108.99 ? 201 NAG C N2  1 
HETATM 4060 O O3  . NAG G 6 .   ? -20.680 -18.392 39.844  1.00 109.39 ? 201 NAG C O3  1 
HETATM 4061 O O4  . NAG G 6 .   ? -22.668 -16.744 41.185  1.00 107.42 ? 201 NAG C O4  1 
HETATM 4062 O O5  . NAG G 6 .   ? -19.594 -14.779 41.465  1.00 107.73 ? 201 NAG C O5  1 
HETATM 4063 O O6  . NAG G 6 .   ? -23.004 -14.583 42.753  1.00 120.30 ? 201 NAG C O6  1 
HETATM 4064 O O7  . NAG G 6 .   ? -17.708 -18.497 37.445  1.00 106.21 ? 201 NAG C O7  1 
HETATM 4065 C C1  . NAG H 6 .   ? -12.029 -15.076 58.218  1.00 71.17  ? 202 NAG C C1  1 
HETATM 4066 C C2  . NAG H 6 .   ? -12.203 -14.918 56.707  1.00 82.22  ? 202 NAG C C2  1 
HETATM 4067 C C3  . NAG H 6 .   ? -13.683 -14.780 56.355  1.00 85.45  ? 202 NAG C C3  1 
HETATM 4068 C C4  . NAG H 6 .   ? -14.483 -15.930 56.951  1.00 92.72  ? 202 NAG C C4  1 
HETATM 4069 C C5  . NAG H 6 .   ? -14.217 -16.029 58.450  1.00 91.99  ? 202 NAG C C5  1 
HETATM 4070 C C6  . NAG H 6 .   ? -14.894 -17.216 59.094  1.00 102.26 ? 202 NAG C C6  1 
HETATM 4071 C C7  . NAG H 6 .   ? -10.638 -13.838 55.153  1.00 69.69  ? 202 NAG C C7  1 
HETATM 4072 C C8  . NAG H 6 .   ? -9.951  -12.560 54.776  1.00 60.34  ? 202 NAG C C8  1 
HETATM 4073 N N2  . NAG H 6 .   ? -11.454 -13.774 56.211  1.00 78.60  ? 202 NAG C N2  1 
HETATM 4074 O O3  . NAG H 6 .   ? -13.834 -14.763 54.941  1.00 87.00  ? 202 NAG C O3  1 
HETATM 4075 O O4  . NAG H 6 .   ? -15.873 -15.721 56.732  1.00 99.87  ? 202 NAG C O4  1 
HETATM 4076 O O5  . NAG H 6 .   ? -12.809 -16.181 58.680  1.00 84.08  ? 202 NAG C O5  1 
HETATM 4077 O O6  . NAG H 6 .   ? -16.060 -17.602 58.379  1.00 108.31 ? 202 NAG C O6  1 
HETATM 4078 O O7  . NAG H 6 .   ? -10.461 -14.879 54.529  1.00 59.95  ? 202 NAG C O7  1 
HETATM 4079 C C1  . NAG I 6 .   ? -1.149  -27.440 28.285  1.00 63.50  ? 203 NAG C C1  1 
HETATM 4080 C C2  . NAG I 6 .   ? -1.775  -28.826 28.399  1.00 74.51  ? 203 NAG C C2  1 
HETATM 4081 C C3  . NAG I 6 .   ? -0.726  -29.840 28.849  1.00 79.50  ? 203 NAG C C3  1 
HETATM 4082 C C4  . NAG I 6 .   ? 0.490   -29.788 27.934  1.00 82.26  ? 203 NAG C C4  1 
HETATM 4083 C C5  . NAG I 6 .   ? 1.012   -28.357 27.828  1.00 79.08  ? 203 NAG C C5  1 
HETATM 4084 C C6  . NAG I 6 .   ? 2.141   -28.212 26.834  1.00 79.69  ? 203 NAG C C6  1 
HETATM 4085 C C7  . NAG I 6 .   ? -4.122  -29.251 28.977  1.00 86.16  ? 203 NAG C C7  1 
HETATM 4086 C C8  . NAG I 6 .   ? -5.169  -29.168 30.045  1.00 84.52  ? 203 NAG C C8  1 
HETATM 4087 N N2  . NAG I 6 .   ? -2.903  -28.817 29.315  1.00 78.18  ? 203 NAG C N2  1 
HETATM 4088 O O3  . NAG I 6 .   ? -1.291  -31.146 28.831  1.00 83.62  ? 203 NAG C O3  1 
HETATM 4089 O O4  . NAG I 6 .   ? 1.519   -30.626 28.448  1.00 90.72  ? 203 NAG C O4  1 
HETATM 4090 O O5  . NAG I 6 .   ? -0.041  -27.486 27.387  1.00 73.59  ? 203 NAG C O5  1 
HETATM 4091 O O6  . NAG I 6 .   ? 2.413   -26.846 26.551  1.00 79.95  ? 203 NAG C O6  1 
HETATM 4092 O O7  . NAG I 6 .   ? -4.367  -29.692 27.858  1.00 96.47  ? 203 NAG C O7  1 
HETATM 4093 O O   . HOH J 7 .   ? 54.318  -2.783  28.642  1.00 30.00  ? 301 HOH H O   1 
HETATM 4094 O O   . HOH J 7 .   ? 24.152  -15.933 17.089  1.00 55.47  ? 302 HOH H O   1 
HETATM 4095 O O   . HOH J 7 .   ? 16.402  -1.978  27.014  1.00 51.98  ? 303 HOH H O   1 
HETATM 4096 O O   . HOH J 7 .   ? 20.151  -7.190  44.600  1.00 71.24  ? 304 HOH H O   1 
HETATM 4097 O O   . HOH J 7 .   ? 38.808  -11.691 31.647  1.00 64.35  ? 305 HOH H O   1 
HETATM 4098 O O   . HOH J 7 .   ? 41.681  -17.814 14.551  1.00 72.44  ? 306 HOH H O   1 
HETATM 4099 O O   . HOH J 7 .   ? 43.348  9.165   12.251  1.00 59.60  ? 307 HOH H O   1 
HETATM 4100 O O   . HOH J 7 .   ? 37.635  -12.372 22.896  1.00 60.54  ? 308 HOH H O   1 
HETATM 4101 O O   . HOH J 7 .   ? 43.318  -22.484 13.725  1.00 76.34  ? 309 HOH H O   1 
HETATM 4102 O O   . HOH J 7 .   ? 46.367  -10.819 3.209   1.00 73.14  ? 310 HOH H O   1 
HETATM 4103 O O   . HOH J 7 .   ? 44.621  -3.070  20.233  1.00 50.79  ? 311 HOH H O   1 
HETATM 4104 O O   . HOH J 7 .   ? 37.610  7.916   1.252   1.00 63.77  ? 312 HOH H O   1 
HETATM 4105 O O   . HOH J 7 .   ? 33.825  -6.030  33.499  1.00 74.65  ? 313 HOH H O   1 
HETATM 4106 O O   . HOH J 7 .   ? 32.482  -24.844 38.072  1.00 74.30  ? 314 HOH H O   1 
HETATM 4107 O O   . HOH J 7 .   ? 40.042  -16.449 15.886  1.00 48.10  ? 315 HOH H O   1 
HETATM 4108 O O   . HOH J 7 .   ? 56.138  -4.221  9.625   1.00 70.81  ? 316 HOH H O   1 
HETATM 4109 O O   . HOH J 7 .   ? 40.828  -25.245 31.069  1.00 59.16  ? 317 HOH H O   1 
HETATM 4110 O O   . HOH J 7 .   ? 8.246   -16.015 36.575  1.00 71.16  ? 318 HOH H O   1 
HETATM 4111 O O   . HOH J 7 .   ? 38.104  -18.444 15.812  1.00 64.76  ? 319 HOH H O   1 
HETATM 4112 O O   . HOH J 7 .   ? 37.426  -26.367 17.710  1.00 57.24  ? 320 HOH H O   1 
HETATM 4113 O O   . HOH J 7 .   ? 13.283  -5.270  42.830  1.00 61.97  ? 321 HOH H O   1 
HETATM 4114 O O   . HOH J 7 .   ? 39.802  -17.702 32.414  1.00 80.82  ? 322 HOH H O   1 
HETATM 4115 O O   . HOH J 7 .   ? 51.140  5.429   -8.753  1.00 64.62  ? 323 HOH H O   1 
HETATM 4116 O O   . HOH J 7 .   ? 28.032  -31.831 20.744  1.00 76.99  ? 324 HOH H O   1 
HETATM 4117 O O   . HOH J 7 .   ? 39.913  9.352   -8.192  1.00 79.22  ? 325 HOH H O   1 
HETATM 4118 O O   . HOH J 7 .   ? 1.607   -9.413  31.817  1.00 58.19  ? 326 HOH H O   1 
HETATM 4119 O O   . HOH J 7 .   ? 40.862  0.727   14.025  1.00 56.56  ? 327 HOH H O   1 
HETATM 4120 O O   . HOH J 7 .   ? 15.268  -27.149 30.624  1.00 64.79  ? 328 HOH H O   1 
HETATM 4121 O O   . HOH J 7 .   ? 43.487  -18.436 28.677  1.00 63.55  ? 329 HOH H O   1 
HETATM 4122 O O   . HOH J 7 .   ? 36.794  -10.200 34.262  1.00 69.38  ? 330 HOH H O   1 
HETATM 4123 O O   . HOH J 7 .   ? 36.928  3.825   9.621   1.00 77.45  ? 331 HOH H O   1 
HETATM 4124 O O   . HOH J 7 .   ? 16.624  -18.068 19.594  1.00 52.74  ? 332 HOH H O   1 
HETATM 4125 O O   . HOH J 7 .   ? 38.238  -2.598  11.933  1.00 66.23  ? 333 HOH H O   1 
HETATM 4126 O O   . HOH J 7 .   ? 33.901  4.496   7.258   1.00 68.50  ? 334 HOH H O   1 
HETATM 4127 O O   . HOH J 7 .   ? 25.778  -25.480 20.987  1.00 78.18  ? 335 HOH H O   1 
HETATM 4128 O O   . HOH J 7 .   ? 58.486  4.156   8.782   1.00 63.75  ? 336 HOH H O   1 
HETATM 4129 O O   . HOH J 7 .   ? 56.677  3.445   17.651  1.00 70.68  ? 337 HOH H O   1 
HETATM 4130 O O   . HOH J 7 .   ? 22.757  -1.855  44.418  1.00 78.34  ? 338 HOH H O   1 
HETATM 4131 O O   . HOH J 7 .   ? 22.781  -28.921 30.718  1.00 73.75  ? 339 HOH H O   1 
HETATM 4132 O O   . HOH J 7 .   ? 46.948  15.832  8.394   1.00 64.35  ? 340 HOH H O   1 
HETATM 4133 O O   . HOH J 7 .   ? 9.429   -12.983 37.888  1.00 68.34  ? 341 HOH H O   1 
HETATM 4134 O O   . HOH J 7 .   ? 42.307  -18.901 3.228   1.00 67.99  ? 342 HOH H O   1 
HETATM 4135 O O   . HOH J 7 .   ? 44.432  -16.296 3.761   1.00 73.78  ? 343 HOH H O   1 
HETATM 4136 O O   . HOH J 7 .   ? 33.913  -7.193  36.101  1.00 77.42  ? 344 HOH H O   1 
HETATM 4137 O O   . HOH J 7 .   ? 1.430   -7.617  29.477  1.00 50.07  ? 345 HOH H O   1 
HETATM 4138 O O   . HOH J 7 .   ? 48.654  4.433   -9.550  1.00 58.21  ? 346 HOH H O   1 
HETATM 4139 O O   . HOH K 7 .   ? 31.809  3.302   4.457   1.00 52.83  ? 401 HOH L O   1 
HETATM 4140 O O   . HOH K 7 .   ? 22.771  6.532   17.092  1.00 83.33  ? 402 HOH L O   1 
HETATM 4141 O O   . HOH K 7 .   ? 41.789  -9.362  -19.269 1.00 74.38  ? 403 HOH L O   1 
HETATM 4142 O O   . HOH K 7 .   ? 30.269  -8.411  3.533   1.00 81.19  ? 404 HOH L O   1 
HETATM 4143 O O   . HOH K 7 .   ? 35.047  4.856   -10.792 1.00 72.01  ? 405 HOH L O   1 
HETATM 4144 O O   . HOH K 7 .   ? 5.637   0.249   29.106  1.00 70.30  ? 406 HOH L O   1 
HETATM 4145 O O   . HOH K 7 .   ? 51.878  -5.028  1.128   1.00 72.12  ? 407 HOH L O   1 
HETATM 4146 O O   . HOH K 7 .   ? 32.147  4.671   2.390   1.00 47.90  ? 408 HOH L O   1 
HETATM 4147 O O   . HOH K 7 .   ? 32.913  10.733  4.104   1.00 75.14  ? 409 HOH L O   1 
HETATM 4148 O O   . HOH K 7 .   ? 26.345  10.746  -5.927  1.00 81.53  ? 410 HOH L O   1 
HETATM 4149 O O   . HOH K 7 .   ? 23.431  10.650  7.723   1.00 92.42  ? 411 HOH L O   1 
HETATM 4150 O O   . HOH K 7 .   ? 43.196  4.184   -9.726  1.00 43.45  ? 412 HOH L O   1 
HETATM 4151 O O   . HOH K 7 .   ? 32.903  -0.135  9.208   1.00 59.01  ? 413 HOH L O   1 
HETATM 4152 O O   . HOH K 7 .   ? 8.661   -25.730 14.762  1.00 72.53  ? 414 HOH L O   1 
HETATM 4153 O O   . HOH K 7 .   ? 21.634  -0.739  20.184  1.00 52.59  ? 415 HOH L O   1 
HETATM 4154 O O   . HOH K 7 .   ? 33.435  -9.772  -4.870  1.00 56.13  ? 416 HOH L O   1 
HETATM 4155 O O   . HOH K 7 .   ? 37.870  -17.542 4.861   1.00 82.09  ? 417 HOH L O   1 
HETATM 4156 O O   . HOH K 7 .   ? 32.678  -7.585  5.565   1.00 63.26  ? 418 HOH L O   1 
HETATM 4157 O O   . HOH K 7 .   ? 14.343  -17.916 12.494  1.00 44.34  ? 419 HOH L O   1 
HETATM 4158 O O   . HOH K 7 .   ? 25.361  -0.458  7.445   1.00 75.42  ? 420 HOH L O   1 
HETATM 4159 O O   . HOH K 7 .   ? 38.460  0.738   -16.967 1.00 69.23  ? 421 HOH L O   1 
HETATM 4160 O O   . HOH K 7 .   ? 28.251  8.482   -9.303  1.00 59.25  ? 422 HOH L O   1 
HETATM 4161 O O   . HOH K 7 .   ? 9.063   10.023  17.899  1.00 73.95  ? 423 HOH L O   1 
HETATM 4162 O O   . HOH K 7 .   ? 45.113  2.421   -9.003  1.00 51.92  ? 424 HOH L O   1 
HETATM 4163 O O   . HOH K 7 .   ? 1.727   1.841   24.346  1.00 54.72  ? 425 HOH L O   1 
HETATM 4164 O O   . HOH K 7 .   ? 45.656  1.078   -14.272 1.00 64.92  ? 426 HOH L O   1 
HETATM 4165 O O   . HOH K 7 .   ? -4.661  -9.324  14.787  1.00 63.72  ? 427 HOH L O   1 
HETATM 4166 O O   . HOH K 7 .   ? 52.649  -17.296 1.291   1.00 62.83  ? 428 HOH L O   1 
HETATM 4167 O O   . HOH K 7 .   ? 22.238  -6.760  2.884   1.00 78.95  ? 429 HOH L O   1 
HETATM 4168 O O   . HOH K 7 .   ? 31.085  -4.825  8.641   1.00 64.59  ? 430 HOH L O   1 
HETATM 4169 O O   . HOH K 7 .   ? 23.151  13.187  -4.195  1.00 91.03  ? 431 HOH L O   1 
HETATM 4170 O O   . HOH K 7 .   ? 47.965  1.646   -11.142 1.00 66.26  ? 432 HOH L O   1 
HETATM 4171 O O   . HOH K 7 .   ? 37.905  4.535   -11.026 1.00 65.39  ? 433 HOH L O   1 
HETATM 4172 O O   . HOH K 7 .   ? 34.891  7.463   -9.873  1.00 73.76  ? 434 HOH L O   1 
HETATM 4173 O O   . HOH K 7 .   ? 13.204  0.468   27.980  1.00 73.17  ? 435 HOH L O   1 
HETATM 4174 O O   . HOH K 7 .   ? 17.095  -22.610 17.508  1.00 77.11  ? 436 HOH L O   1 
HETATM 4175 O O   . HOH K 7 .   ? 46.418  -18.618 -12.408 1.00 65.95  ? 437 HOH L O   1 
HETATM 4176 O O   . HOH K 7 .   ? 39.984  -17.619 -17.145 1.00 68.45  ? 438 HOH L O   1 
HETATM 4177 O O   . HOH K 7 .   ? 44.005  -7.571  -17.500 1.00 60.70  ? 439 HOH L O   1 
HETATM 4178 O O   . HOH L 7 .   ? -2.351  -0.985  47.649  1.00 57.04  ? 301 HOH C O   1 
HETATM 4179 O O   . HOH L 7 .   ? -3.628  -2.032  44.807  1.00 56.96  ? 302 HOH C O   1 
HETATM 4180 O O   . HOH L 7 .   ? -6.458  -19.588 44.250  1.00 56.12  ? 303 HOH C O   1 
HETATM 4181 O O   . HOH L 7 .   ? -2.174  -2.281  37.799  1.00 76.53  ? 304 HOH C O   1 
HETATM 4182 O O   . HOH L 7 .   ? 2.998   -22.821 41.504  1.00 71.14  ? 305 HOH C O   1 
HETATM 4183 O O   . HOH L 7 .   ? -13.845 -10.507 25.396  1.00 69.60  ? 306 HOH C O   1 
HETATM 4184 O O   . HOH L 7 .   ? -14.455 -17.692 33.534  1.00 62.88  ? 307 HOH C O   1 
HETATM 4185 O O   . HOH L 7 .   ? -1.010  -1.550  44.161  1.00 70.10  ? 308 HOH C O   1 
HETATM 4186 O O   . HOH L 7 .   ? -12.563 -9.732  43.540  1.00 55.14  ? 309 HOH C O   1 
HETATM 4187 O O   . HOH L 7 .   ? -13.913 -5.930  34.685  1.00 75.64  ? 310 HOH C O   1 
HETATM 4188 O O   . HOH L 7 .   ? -13.886 -21.329 29.431  1.00 63.92  ? 311 HOH C O   1 
HETATM 4189 O O   . HOH L 7 .   ? 7.411   -5.192  42.243  1.00 68.73  ? 312 HOH C O   1 
HETATM 4190 O O   . HOH L 7 .   ? -3.478  -5.368  28.144  1.00 62.96  ? 313 HOH C O   1 
HETATM 4191 O O   . HOH L 7 .   ? -10.195 -4.055  34.236  1.00 60.11  ? 314 HOH C O   1 
HETATM 4192 O O   . HOH L 7 .   ? -12.417 -2.763  41.207  1.00 51.77  ? 315 HOH C O   1 
HETATM 4193 O O   . HOH L 7 .   ? -15.648 -14.479 26.517  1.00 62.46  ? 316 HOH C O   1 
HETATM 4194 O O   . HOH L 7 .   ? -3.694  -5.402  61.624  1.00 62.92  ? 317 HOH C O   1 
HETATM 4195 O O   . HOH L 7 .   ? -14.977 -11.330 54.625  1.00 55.23  ? 318 HOH C O   1 
HETATM 4196 O O   . HOH L 7 .   ? -3.657  -2.695  60.685  1.00 73.39  ? 319 HOH C O   1 
HETATM 4197 O O   . HOH L 7 .   ? -0.843  -2.191  34.874  1.00 86.82  ? 320 HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.0550 1.4344 1.3516 0.2274  -0.0548 -0.5563 1   GLU H N   
2    C CA  . GLU A 1   ? 1.0765 1.4093 1.3700 0.2258  -0.0442 -0.5129 1   GLU H CA  
3    C C   . GLU A 1   ? 1.0701 1.4136 1.3152 0.2190  -0.0454 -0.4799 1   GLU H C   
4    O O   . GLU A 1   ? 1.1550 1.5211 1.3834 0.2121  -0.0549 -0.4881 1   GLU H O   
5    C CB  . GLU A 1   ? 1.0882 1.3541 1.4415 0.2196  -0.0424 -0.5091 1   GLU H CB  
6    N N   . VAL A 2   ? 0.9683 1.2981 1.1944 0.2220  -0.0359 -0.4432 2   VAL H N   
7    C CA  . VAL A 2   ? 0.7894 1.1279 0.9733 0.2165  -0.0357 -0.4118 2   VAL H CA  
8    C C   . VAL A 2   ? 0.8064 1.0995 1.0052 0.2060  -0.0404 -0.4012 2   VAL H C   
9    O O   . VAL A 2   ? 0.8584 1.1023 1.0943 0.2056  -0.0368 -0.3907 2   VAL H O   
10   C CB  . VAL A 2   ? 0.7278 1.0674 0.8959 0.2227  -0.0254 -0.3787 2   VAL H CB  
11   C CG1 . VAL A 2   ? 0.6911 1.0407 0.8205 0.2167  -0.0253 -0.3495 2   VAL H CG1 
12   C CG2 . VAL A 2   ? 0.7509 1.1379 0.9079 0.2334  -0.0192 -0.3865 2   VAL H CG2 
13   N N   . GLN A 3   ? 0.7947 1.1079 0.9659 0.1989  -0.0473 -0.4008 3   GLN H N   
14   C CA  . GLN A 3   ? 0.8015 1.0777 0.9841 0.1897  -0.0515 -0.3914 3   GLN H CA  
15   C C   . GLN A 3   ? 0.7229 1.0180 0.8578 0.1865  -0.0519 -0.3678 3   GLN H C   
16   O O   . GLN A 3   ? 0.7372 1.0834 0.8369 0.1880  -0.0540 -0.3698 3   GLN H O   
17   C CB  . GLN A 3   ? 0.9429 1.2188 1.1607 0.1831  -0.0620 -0.4252 3   GLN H CB  
18   C CG  . GLN A 3   ? 1.1140 1.3477 1.3956 0.1823  -0.0603 -0.4405 3   GLN H CG  
19   C CD  . GLN A 3   ? 1.1662 1.3414 1.4767 0.1790  -0.0536 -0.4096 3   GLN H CD  
20   O OE1 . GLN A 3   ? 1.2087 1.3565 1.5365 0.1858  -0.0441 -0.3891 3   GLN H OE1 
21   N NE2 . GLN A 3   ? 1.0928 1.2535 1.4099 0.1703  -0.0582 -0.4037 3   GLN H NE2 
22   N N   . LEU A 4   ? 0.7023 0.9568 0.8377 0.1811  -0.0495 -0.3389 4   LEU H N   
23   C CA  . LEU A 4   ? 0.6372 0.8969 0.7333 0.1710  -0.0510 -0.3057 4   LEU H CA  
24   C C   . LEU A 4   ? 0.6790 0.9055 0.7916 0.1617  -0.0558 -0.2990 4   LEU H C   
25   O O   . LEU A 4   ? 0.7320 0.9144 0.8645 0.1586  -0.0522 -0.2789 4   LEU H O   
26   C CB  . LEU A 4   ? 0.6594 0.9045 0.7346 0.1681  -0.0444 -0.2663 4   LEU H CB  
27   C CG  . LEU A 4   ? 0.6891 0.9769 0.7375 0.1720  -0.0397 -0.2580 4   LEU H CG  
28   C CD1 . LEU A 4   ? 0.7924 1.1005 0.8598 0.1851  -0.0355 -0.2838 4   LEU H CD1 
29   C CD2 . LEU A 4   ? 0.6681 0.9386 0.7009 0.1640  -0.0365 -0.2197 4   LEU H CD2 
30   N N   . VAL A 5   ? 0.6578 0.9120 0.7627 0.1585  -0.0637 -0.3143 5   VAL H N   
31   C CA  . VAL A 5   ? 0.5331 0.7637 0.6577 0.1498  -0.0687 -0.3098 5   VAL H CA  
32   C C   . VAL A 5   ? 0.4996 0.7332 0.5878 0.1436  -0.0680 -0.2735 5   VAL H C   
33   O O   . VAL A 5   ? 0.6276 0.9035 0.6835 0.1454  -0.0704 -0.2694 5   VAL H O   
34   C CB  . VAL A 5   ? 0.6087 0.8689 0.7586 0.1498  -0.0802 -0.3544 5   VAL H CB  
35   C CG1 . VAL A 5   ? 0.5987 0.8366 0.7760 0.1396  -0.0852 -0.3475 5   VAL H CG1 
36   C CG2 . VAL A 5   ? 0.6017 0.8558 0.7955 0.1566  -0.0807 -0.3962 5   VAL H CG2 
37   N N   . GLN A 6   ? 0.5479 0.7386 0.6439 0.1381  -0.0635 -0.2458 6   GLN H N   
38   C CA  . GLN A 6   ? 0.5136 0.7004 0.5816 0.1336  -0.0616 -0.2138 6   GLN H CA  
39   C C   . GLN A 6   ? 0.4640 0.6517 0.5493 0.1290  -0.0670 -0.2158 6   GLN H C   
40   O O   . GLN A 6   ? 0.5492 0.7310 0.6740 0.1269  -0.0714 -0.2382 6   GLN H O   
41   C CB  . GLN A 6   ? 0.4529 0.5994 0.5132 0.1326  -0.0532 -0.1841 6   GLN H CB  
42   C CG  . GLN A 6   ? 0.4737 0.6193 0.5247 0.1365  -0.0492 -0.1822 6   GLN H CG  
43   C CD  . GLN A 6   ? 0.5225 0.6389 0.5614 0.1357  -0.0439 -0.1556 6   GLN H CD  
44   O OE1 . GLN A 6   ? 0.5709 0.6768 0.6172 0.1399  -0.0412 -0.1532 6   GLN H OE1 
45   N NE2 . GLN A 6   ? 0.4551 0.5619 0.4764 0.1317  -0.0427 -0.1371 6   GLN H NE2 
46   N N   . SER A 7   ? 0.5259 0.7211 0.5877 0.1272  -0.0663 -0.1918 7   SER H N   
47   C CA  . SER A 7   ? 0.5143 0.7143 0.5916 0.1240  -0.0708 -0.1888 7   SER H CA  
48   C C   . SER A 7   ? 0.7002 0.8558 0.8053 0.1209  -0.0642 -0.1756 7   SER H C   
49   O O   . SER A 7   ? 0.7722 0.8955 0.8748 0.1227  -0.0557 -0.1626 7   SER H O   
50   C CB  . SER A 7   ? 0.5471 0.7660 0.5947 0.1256  -0.0697 -0.1623 7   SER H CB  
51   O OG  . SER A 7   ? 0.7157 0.9045 0.7420 0.1260  -0.0598 -0.1353 7   SER H OG  
52   N N   . GLY A 8   ? 0.6027 0.7630 0.7350 0.1172  -0.0679 -0.1773 8   GLY H N   
53   C CA  . GLY A 8   ? 0.6459 0.7725 0.8107 0.1151  -0.0601 -0.1623 8   GLY H CA  
54   C C   . GLY A 8   ? 0.6466 0.7489 0.7846 0.1194  -0.0484 -0.1275 8   GLY H C   
55   O O   . GLY A 8   ? 0.6655 0.7727 0.7648 0.1224  -0.0472 -0.1161 8   GLY H O   
56   N N   . ALA A 9   ? 0.5833 0.6616 0.7460 0.1204  -0.0391 -0.1108 9   ALA H N   
57   C CA  . ALA A 9   ? 0.5571 0.6164 0.6956 0.1269  -0.0273 -0.0823 9   ALA H CA  
58   C C   . ALA A 9   ? 0.5767 0.6490 0.6997 0.1283  -0.0278 -0.0721 9   ALA H C   
59   O O   . ALA A 9   ? 0.6113 0.7062 0.7568 0.1243  -0.0348 -0.0787 9   ALA H O   
60   C CB  . ALA A 9   ? 0.4545 0.4965 0.6258 0.1299  -0.0161 -0.0647 9   ALA H CB  
61   N N   . GLU A 10  ? 0.5283 0.5875 0.6166 0.1345  -0.0210 -0.0571 10  GLU H N   
62   C CA  . GLU A 10  ? 0.3962 0.4627 0.4730 0.1380  -0.0195 -0.0454 10  GLU H CA  
63   C C   . GLU A 10  ? 0.5662 0.6136 0.6378 0.1471  -0.0061 -0.0275 10  GLU H C   
64   O O   . GLU A 10  ? 0.5276 0.5565 0.5803 0.1521  0.0007  -0.0248 10  GLU H O   
65   C CB  . GLU A 10  ? 0.4969 0.5679 0.5438 0.1378  -0.0234 -0.0462 10  GLU H CB  
66   C CG  . GLU A 10  ? 0.6878 0.7891 0.7350 0.1322  -0.0350 -0.0613 10  GLU H CG  
67   C CD  . GLU A 10  ? 0.8641 1.0017 0.9271 0.1319  -0.0429 -0.0621 10  GLU H CD  
68   O OE1 . GLU A 10  ? 0.9729 1.1106 1.0434 0.1362  -0.0388 -0.0456 10  GLU H OE1 
69   O OE2 . GLU A 10  ? 0.9513 1.1215 1.0197 0.1286  -0.0537 -0.0808 10  GLU H OE2 
70   N N   . VAL A 11  ? 0.4637 0.5214 0.5522 0.1506  -0.0026 -0.0166 11  VAL H N   
71   C CA  . VAL A 11  ? 0.5765 0.6219 0.6599 0.1618  0.0114  -0.0010 11  VAL H CA  
72   C C   . VAL A 11  ? 0.7202 0.7681 0.7952 0.1677  0.0125  0.0061  11  VAL H C   
73   O O   . VAL A 11  ? 0.7955 0.8654 0.8924 0.1672  0.0088  0.0127  11  VAL H O   
74   C CB  . VAL A 11  ? 0.5877 0.6432 0.7076 0.1636  0.0191  0.0111  11  VAL H CB  
75   C CG1 . VAL A 11  ? 0.5168 0.5663 0.6280 0.1784  0.0354  0.0272  11  VAL H CG1 
76   C CG2 . VAL A 11  ? 0.5217 0.5723 0.6600 0.1588  0.0200  0.0092  11  VAL H CG2 
77   N N   . LYS A 12  ? 0.6285 0.6554 0.6768 0.1733  0.0170  0.0044  12  LYS H N   
78   C CA  . LYS A 12  ? 0.5438 0.5672 0.5910 0.1789  0.0189  0.0120  12  LYS H CA  
79   C C   . LYS A 12  ? 0.6415 0.6435 0.6810 0.1927  0.0325  0.0133  12  LYS H C   
80   O O   . LYS A 12  ? 0.6499 0.6439 0.6765 0.1983  0.0397  0.0073  12  LYS H O   
81   C CB  . LYS A 12  ? 0.6426 0.6611 0.6761 0.1718  0.0111  0.0072  12  LYS H CB  
82   C CG  . LYS A 12  ? 0.6358 0.6763 0.6685 0.1604  -0.0011 -0.0005 12  LYS H CG  
83   C CD  . LYS A 12  ? 0.5968 0.6741 0.6490 0.1587  -0.0089 0.0059  12  LYS H CD  
84   C CE  . LYS A 12  ? 0.7422 0.8337 0.7960 0.1631  -0.0096 0.0233  12  LYS H CE  
85   N NZ  . LYS A 12  ? 0.8047 0.9437 0.8733 0.1631  -0.0196 0.0291  12  LYS H NZ  
86   N N   . LYS A 13  ? 0.5798 0.5759 0.6286 0.1999  0.0365  0.0214  13  LYS H N   
87   C CA  . LYS A 13  ? 0.6380 0.6122 0.6835 0.2143  0.0493  0.0171  13  LYS H CA  
88   C C   . LYS A 13  ? 0.7752 0.7220 0.8148 0.2121  0.0473  0.0063  13  LYS H C   
89   O O   . LYS A 13  ? 0.7633 0.7132 0.8099 0.2021  0.0389  0.0138  13  LYS H O   
90   C CB  . LYS A 13  ? 0.6477 0.6332 0.7193 0.2266  0.0578  0.0345  13  LYS H CB  
91   C CG  . LYS A 13  ? 0.7341 0.7429 0.8166 0.2317  0.0644  0.0430  13  LYS H CG  
92   C CD  . LYS A 13  ? 0.7938 0.8160 0.9043 0.2453  0.0736  0.0601  13  LYS H CD  
93   C CE  . LYS A 13  ? 0.7954 0.8427 0.9222 0.2502  0.0821  0.0703  13  LYS H CE  
94   N NZ  . LYS A 13  ? 0.7903 0.8623 0.9333 0.2331  0.0695  0.0744  13  LYS H NZ  
95   N N   . PRO A 14  ? 0.8124 0.7358 0.8416 0.2217  0.0550  -0.0122 14  PRO H N   
96   C CA  . PRO A 14  ? 0.7208 0.6156 0.7541 0.2184  0.0528  -0.0274 14  PRO H CA  
97   C C   . PRO A 14  ? 0.6616 0.5465 0.7297 0.2190  0.0548  -0.0081 14  PRO H C   
98   O O   . PRO A 14  ? 0.7212 0.6084 0.8093 0.2321  0.0639  0.0055  14  PRO H O   
99   C CB  . PRO A 14  ? 0.7972 0.6768 0.8187 0.2334  0.0621  -0.0533 14  PRO H CB  
100  C CG  . PRO A 14  ? 0.7905 0.6959 0.7875 0.2404  0.0664  -0.0514 14  PRO H CG  
101  C CD  . PRO A 14  ? 0.7708 0.6986 0.7852 0.2363  0.0660  -0.0220 14  PRO H CD  
102  N N   . GLY A 15  ? 0.7156 0.5931 0.7941 0.2061  0.0475  -0.0034 15  GLY H N   
103  C CA  . GLY A 15  ? 0.6783 0.5501 0.7935 0.2070  0.0506  0.0217  15  GLY H CA  
104  C C   . GLY A 15  ? 0.7986 0.7091 0.9156 0.2005  0.0436  0.0522  15  GLY H C   
105  O O   . GLY A 15  ? 0.9255 0.8423 1.0697 0.2009  0.0453  0.0794  15  GLY H O   
106  N N   . GLU A 16  ? 0.7188 0.6581 0.8095 0.1955  0.0361  0.0475  16  GLU H N   
107  C CA  . GLU A 16  ? 0.7984 0.7803 0.8881 0.1901  0.0274  0.0671  16  GLU H CA  
108  C C   . GLU A 16  ? 0.7518 0.7431 0.8293 0.1763  0.0191  0.0641  16  GLU H C   
109  O O   . GLU A 16  ? 0.7073 0.6755 0.7723 0.1690  0.0179  0.0435  16  GLU H O   
110  C CB  . GLU A 16  ? 0.6747 0.6826 0.7522 0.1905  0.0228  0.0599  16  GLU H CB  
111  C CG  . GLU A 16  ? 0.6814 0.6938 0.7763 0.2040  0.0307  0.0696  16  GLU H CG  
112  C CD  . GLU A 16  ? 0.7904 0.8312 0.8840 0.2016  0.0259  0.0650  16  GLU H CD  
113  O OE1 . GLU A 16  ? 0.7512 0.8036 0.8314 0.1900  0.0166  0.0521  16  GLU H OE1 
114  O OE2 . GLU A 16  ? 0.9352 0.9865 1.0467 0.2114  0.0320  0.0745  16  GLU H OE2 
115  N N   . SER A 17  ? 0.6044 0.6359 0.6856 0.1744  0.0135  0.0849  17  SER H N   
116  C CA  . SER A 17  ? 0.5124 0.5632 0.5814 0.1638  0.0069  0.0839  17  SER H CA  
117  C C   . SER A 17  ? 0.5346 0.6103 0.5793 0.1580  -0.0032 0.0620  17  SER H C   
118  O O   . SER A 17  ? 0.6077 0.6974 0.6522 0.1618  -0.0064 0.0562  17  SER H O   
119  C CB  . SER A 17  ? 0.6629 0.7522 0.7471 0.1673  0.0076  0.1188  17  SER H CB  
120  O OG  . SER A 17  ? 0.6851 0.8209 0.7675 0.1753  0.0019  0.1300  17  SER H OG  
121  N N   . LEU A 18  ? 0.4943 0.5753 0.5250 0.1490  -0.0078 0.0501  18  LEU H N   
122  C CA  . LEU A 18  ? 0.5129 0.6124 0.5269 0.1442  -0.0164 0.0273  18  LEU H CA  
123  C C   . LEU A 18  ? 0.5601 0.6858 0.5640 0.1382  -0.0209 0.0244  18  LEU H C   
124  O O   . LEU A 18  ? 0.6591 0.7712 0.6652 0.1337  -0.0168 0.0311  18  LEU H O   
125  C CB  . LEU A 18  ? 0.5811 0.6441 0.5873 0.1422  -0.0147 0.0056  18  LEU H CB  
126  C CG  . LEU A 18  ? 0.4740 0.5480 0.4720 0.1378  -0.0214 -0.0153 18  LEU H CG  
127  C CD1 . LEU A 18  ? 0.4510 0.5546 0.4605 0.1395  -0.0272 -0.0186 18  LEU H CD1 
128  C CD2 . LEU A 18  ? 0.4737 0.5155 0.4654 0.1384  -0.0175 -0.0275 18  LEU H CD2 
129  N N   . LYS A 19  ? 0.5911 0.7565 0.5873 0.1384  -0.0292 0.0123  19  LYS H N   
130  C CA  . LYS A 19  ? 0.5743 0.7711 0.5593 0.1355  -0.0327 0.0056  19  LYS H CA  
131  C C   . LYS A 19  ? 0.6186 0.8244 0.5984 0.1332  -0.0407 -0.0272 19  LYS H C   
132  O O   . LYS A 19  ? 0.7300 0.9662 0.7140 0.1359  -0.0485 -0.0395 19  LYS H O   
133  C CB  . LYS A 19  ? 0.7072 0.9608 0.6908 0.1419  -0.0337 0.0277  19  LYS H CB  
134  C CG  . LYS A 19  ? 0.6862 0.9769 0.6585 0.1414  -0.0331 0.0288  19  LYS H CG  
135  C CD  . LYS A 19  ? 0.7247 1.0787 0.6946 0.1509  -0.0319 0.0582  19  LYS H CD  
136  C CE  . LYS A 19  ? 0.8424 1.2377 0.8023 0.1521  -0.0277 0.0655  19  LYS H CE  
137  N NZ  . LYS A 19  ? 0.7751 1.2419 0.7310 0.1642  -0.0249 0.0995  19  LYS H NZ  
138  N N   . ILE A 20  ? 0.5888 0.7687 0.5646 0.1285  -0.0394 -0.0417 20  ILE H N   
139  C CA  . ILE A 20  ? 0.6106 0.7944 0.5892 0.1275  -0.0450 -0.0702 20  ILE H CA  
140  C C   . ILE A 20  ? 0.6191 0.8385 0.5886 0.1284  -0.0472 -0.0807 20  ILE H C   
141  O O   . ILE A 20  ? 0.6596 0.8868 0.6212 0.1273  -0.0423 -0.0646 20  ILE H O   
142  C CB  . ILE A 20  ? 0.5393 0.6774 0.5219 0.1251  -0.0415 -0.0772 20  ILE H CB  
143  C CG1 . ILE A 20  ? 0.6056 0.7263 0.5779 0.1222  -0.0371 -0.0686 20  ILE H CG1 
144  C CG2 . ILE A 20  ? 0.5527 0.6640 0.5437 0.1269  -0.0380 -0.0688 20  ILE H CG2 
145  C CD1 . ILE A 20  ? 0.6837 0.7701 0.6557 0.1221  -0.0350 -0.0745 20  ILE H CD1 
146  N N   . SER A 21  ? 0.6440 0.8861 0.6194 0.1305  -0.0541 -0.1088 21  SER H N   
147  C CA  . SER A 21  ? 0.6722 0.9580 0.6385 0.1346  -0.0560 -0.1232 21  SER H CA  
148  C C   . SER A 21  ? 0.6413 0.9116 0.6186 0.1348  -0.0567 -0.1506 21  SER H C   
149  O O   . SER A 21  ? 0.4940 0.7232 0.4888 0.1319  -0.0566 -0.1577 21  SER H O   
150  C CB  . SER A 21  ? 0.5248 0.8679 0.4879 0.1407  -0.0646 -0.1375 21  SER H CB  
151  O OG  . SER A 21  ? 0.5347 0.8696 0.5200 0.1389  -0.0734 -0.1682 21  SER H OG  
152  N N   . CYS A 22  ? 0.7057 1.0128 0.6747 0.1400  -0.0560 -0.1630 22  CYS H N   
153  C CA  . CYS A 22  ? 0.6853 0.9843 0.6676 0.1429  -0.0558 -0.1894 22  CYS H CA  
154  C C   . CYS A 22  ? 0.5929 0.9510 0.5660 0.1523  -0.0571 -0.2122 22  CYS H C   
155  O O   . CYS A 22  ? 0.6464 1.0365 0.6016 0.1556  -0.0507 -0.1951 22  CYS H O   
156  C CB  . CYS A 22  ? 0.6098 0.8750 0.5916 0.1396  -0.0487 -0.1713 22  CYS H CB  
157  S SG  . CYS A 22  ? 0.8638 1.1319 0.8609 0.1466  -0.0466 -0.1958 22  CYS H SG  
158  N N   . LYS A 23  ? 0.6276 1.0030 0.6164 0.1571  -0.0650 -0.2519 23  LYS H N   
159  C CA  . LYS A 23  ? 0.6203 1.0585 0.5992 0.1686  -0.0674 -0.2820 23  LYS H CA  
160  C C   . LYS A 23  ? 0.6648 1.0923 0.6628 0.1750  -0.0634 -0.3099 23  LYS H C   
161  O O   . LYS A 23  ? 0.7493 1.1335 0.7825 0.1726  -0.0660 -0.3309 23  LYS H O   
162  C CB  . LYS A 23  ? 0.5263 1.0000 0.5125 0.1714  -0.0805 -0.3166 23  LYS H CB  
163  C CG  . LYS A 23  ? 0.4931 1.0382 0.4717 0.1825  -0.0831 -0.3398 23  LYS H CG  
164  C CD  . LYS A 23  ? 0.5785 1.1563 0.5748 0.1823  -0.0963 -0.3669 23  LYS H CD  
165  C CE  . LYS A 23  ? 0.6438 1.2942 0.6372 0.1943  -0.0975 -0.3856 23  LYS H CE  
166  N N   . GLY A 24  ? 0.6960 1.1651 0.6753 0.1840  -0.0559 -0.3067 24  GLY H N   
167  C CA  . GLY A 24  ? 0.5822 1.0465 0.5815 0.1909  -0.0514 -0.3280 24  GLY H CA  
168  C C   . GLY A 24  ? 0.6584 1.1659 0.6716 0.1971  -0.0584 -0.3613 24  GLY H C   
169  O O   . GLY A 24  ? 0.7712 1.3363 0.7652 0.2013  -0.0621 -0.3613 24  GLY H O   
170  N N   . SER A 25  ? 0.7337 1.2158 0.7827 0.1989  -0.0596 -0.3889 25  SER H N   
171  C CA  . SER A 25  ? 0.7536 1.2730 0.8211 0.2054  -0.0664 -0.4265 25  SER H CA  
172  C C   . SER A 25  ? 0.6974 1.1947 0.7932 0.2109  -0.0611 -0.4430 25  SER H C   
173  O O   . SER A 25  ? 0.6381 1.0816 0.7511 0.2082  -0.0546 -0.4293 25  SER H O   
174  C CB  . SER A 25  ? 0.7221 1.2321 0.8206 0.1989  -0.0796 -0.4568 25  SER H CB  
175  O OG  . SER A 25  ? 0.8278 1.2672 0.9663 0.1902  -0.0798 -0.4607 25  SER H OG  
176  N N   . GLY A 26  ? 0.7703 1.3128 0.8715 0.2205  -0.0635 -0.4715 26  GLY H N   
177  C CA  . GLY A 26  ? 0.7796 1.3062 0.9082 0.2276  -0.0581 -0.4899 26  GLY H CA  
178  C C   . GLY A 26  ? 0.7793 1.3312 0.8806 0.2368  -0.0453 -0.4649 26  GLY H C   
179  O O   . GLY A 26  ? 0.8181 1.3585 0.9394 0.2442  -0.0387 -0.4745 26  GLY H O   
180  N N   . TYR A 27  ? 0.7592 1.3466 0.8191 0.2365  -0.0408 -0.4313 27  TYR H N   
181  C CA  . TYR A 27  ? 0.7442 1.3630 0.7820 0.2439  -0.0279 -0.4038 27  TYR H CA  
182  C C   . TYR A 27  ? 0.7265 1.4053 0.7240 0.2451  -0.0247 -0.3734 27  TYR H C   
183  O O   . TYR A 27  ? 0.6816 1.3684 0.6668 0.2397  -0.0319 -0.3686 27  TYR H O   
184  C CB  . TYR A 27  ? 0.5506 1.1170 0.5994 0.2390  -0.0193 -0.3775 27  TYR H CB  
185  C CG  . TYR A 27  ? 0.5172 1.0669 0.5460 0.2288  -0.0181 -0.3437 27  TYR H CG  
186  C CD1 . TYR A 27  ? 0.5724 1.0761 0.6096 0.2193  -0.0265 -0.3479 27  TYR H CD1 
187  C CD2 . TYR A 27  ? 0.6531 1.2341 0.6590 0.2289  -0.0074 -0.3073 27  TYR H CD2 
188  C CE1 . TYR A 27  ? 0.5668 1.0550 0.5852 0.2115  -0.0248 -0.3192 27  TYR H CE1 
189  C CE2 . TYR A 27  ? 0.5655 1.1312 0.5569 0.2201  -0.0053 -0.2788 27  TYR H CE2 
190  C CZ  . TYR A 27  ? 0.5346 1.0518 0.5300 0.2114  -0.0148 -0.2851 27  TYR H CZ  
191  O OH  . TYR A 27  ? 0.5086 0.9958 0.4935 0.1954  -0.0173 -0.2469 27  TYR H OH  
192  N N   . SER A 28  ? 0.6167 1.3394 0.5980 0.2527  -0.0127 -0.3497 28  SER H N   
193  C CA  . SER A 28  ? 0.6429 1.4233 0.5928 0.2542  -0.0062 -0.3116 28  SER H CA  
194  C C   . SER A 28  ? 0.6151 1.3612 0.5573 0.2414  -0.0011 -0.2743 28  SER H C   
195  O O   . SER A 28  ? 0.5475 1.2789 0.4960 0.2379  0.0100  -0.2495 28  SER H O   
196  C CB  . SER A 28  ? 0.7510 1.5863 0.6933 0.2649  0.0071  -0.2929 28  SER H CB  
197  O OG  . SER A 28  ? 0.8575 1.7513 0.7760 0.2667  0.0148  -0.2507 28  SER H OG  
198  N N   . PHE A 29  ? 0.6447 1.3819 0.5766 0.2351  -0.0094 -0.2716 29  PHE H N   
199  C CA  . PHE A 29  ? 0.6875 1.3865 0.6120 0.2235  -0.0062 -0.2424 29  PHE H CA  
200  C C   . PHE A 29  ? 0.7343 1.4694 0.6448 0.2221  0.0099  -0.1918 29  PHE H C   
201  O O   . PHE A 29  ? 0.8674 1.5515 0.7906 0.2060  0.0105  -0.1607 29  PHE H O   
202  C CB  . PHE A 29  ? 0.7281 1.4208 0.6437 0.2190  -0.0182 -0.2489 29  PHE H CB  
203  C CG  . PHE A 29  ? 0.7081 1.3557 0.6166 0.2069  -0.0172 -0.2211 29  PHE H CG  
204  C CD1 . PHE A 29  ? 0.6308 1.1999 0.5623 0.1954  -0.0240 -0.2299 29  PHE H CD1 
205  C CD2 . PHE A 29  ? 0.6835 1.3551 0.5773 0.2023  -0.0126 -0.1750 29  PHE H CD2 
206  C CE1 . PHE A 29  ? 0.6733 1.1916 0.6079 0.1803  -0.0265 -0.1982 29  PHE H CE1 
207  C CE2 . PHE A 29  ? 0.7376 1.3522 0.6401 0.1865  -0.0152 -0.1441 29  PHE H CE2 
208  C CZ  . PHE A 29  ? 0.6618 1.2010 0.5823 0.1758  -0.0224 -0.1582 29  PHE H CZ  
209  N N   . THR A 30  ? 0.6742 1.4789 0.5744 0.2313  0.0162  -0.1740 30  THR H N   
210  C CA  . THR A 30  ? 0.7457 1.5915 0.6411 0.2293  0.0328  -0.1185 30  THR H CA  
211  C C   . THR A 30  ? 0.7616 1.6143 0.6789 0.2280  0.0476  -0.1017 30  THR H C   
212  O O   . THR A 30  ? 0.7859 1.6686 0.7141 0.2227  0.0602  -0.0527 30  THR H O   
213  C CB  . THR A 30  ? 0.7782 1.7018 0.6579 0.2412  0.0335  -0.0987 30  THR H CB  
214  O OG1 . THR A 30  ? 0.8734 1.8302 0.7567 0.2374  0.0503  -0.0363 30  THR H OG1 
215  C CG2 . THR A 30  ? 0.6211 1.5888 0.5020 0.2556  0.0321  -0.1253 30  THR H CG2 
216  N N   . ASP A 31  ? 0.5380 1.3558 0.4708 0.2300  0.0430  -0.1377 31  ASP H N   
217  C CA  . ASP A 31  ? 0.6571 1.4849 0.6149 0.2299  0.0539  -0.1248 31  ASP H CA  
218  C C   . ASP A 31  ? 0.6362 1.3826 0.6219 0.2134  0.0445  -0.1260 31  ASP H C   
219  O O   . ASP A 31  ? 0.6095 1.3584 0.6191 0.2128  0.0495  -0.1200 31  ASP H O   
220  C CB  . ASP A 31  ? 0.7145 1.5697 0.6698 0.2449  0.0517  -0.1562 31  ASP H CB  
221  C CG  . ASP A 31  ? 0.8819 1.8111 0.8155 0.2560  0.0553  -0.1417 31  ASP H CG  
222  O OD1 . ASP A 31  ? 0.9128 1.8818 0.8448 0.2524  0.0673  -0.0922 31  ASP H OD1 
223  O OD2 . ASP A 31  ? 0.8663 1.8162 0.7899 0.2688  0.0463  -0.1784 31  ASP H OD2 
224  N N   . TYR A 32  ? 0.5777 1.2586 0.5603 0.2014  0.0310  -0.1325 32  TYR H N   
225  C CA  . TYR A 32  ? 0.6325 1.2428 0.6363 0.1879  0.0219  -0.1321 32  TYR H CA  
226  C C   . TYR A 32  ? 0.5542 1.1178 0.5571 0.1684  0.0151  -0.1048 32  TYR H C   
227  O O   . TYR A 32  ? 0.5093 1.0714 0.4944 0.1673  0.0125  -0.1014 32  TYR H O   
228  C CB  . TYR A 32  ? 0.6678 1.2389 0.6755 0.1967  0.0130  -0.1744 32  TYR H CB  
229  C CG  . TYR A 32  ? 0.5865 1.1863 0.6083 0.2152  0.0191  -0.2034 32  TYR H CG  
230  C CD1 . TYR A 32  ? 0.4703 1.1235 0.4795 0.2338  0.0246  -0.2340 32  TYR H CD1 
231  C CD2 . TYR A 32  ? 0.4845 1.0615 0.5334 0.2158  0.0189  -0.2018 32  TYR H CD2 
232  C CE1 . TYR A 32  ? 0.6238 1.2848 0.6480 0.2443  0.0255  -0.2561 32  TYR H CE1 
233  C CE2 . TYR A 32  ? 0.4527 1.0549 0.5195 0.2346  0.0255  -0.2270 32  TYR H CE2 
234  C CZ  . TYR A 32  ? 0.4805 1.1187 0.5344 0.2471  0.0286  -0.2538 32  TYR H CZ  
235  O OH  . TYR A 32  ? 0.7599 1.4048 0.8305 0.2587  0.0312  -0.2740 32  TYR H OH  
236  N N   . TRP A 33  ? 0.4103 0.9389 0.4341 0.1542  0.0116  -0.0878 33  TRP H N   
237  C CA  . TRP A 33  ? 0.4918 0.9713 0.5178 0.1370  0.0044  -0.0697 33  TRP H CA  
238  C C   . TRP A 33  ? 0.5451 0.9729 0.5575 0.1385  -0.0062 -0.0927 33  TRP H C   
239  O O   . TRP A 33  ? 0.6535 1.0654 0.6688 0.1470  -0.0102 -0.1177 33  TRP H O   
240  C CB  . TRP A 33  ? 0.5112 0.9710 0.5641 0.1227  0.0009  -0.0551 33  TRP H CB  
241  C CG  . TRP A 33  ? 0.5638 1.0649 0.6412 0.1144  0.0108  -0.0241 33  TRP H CG  
242  C CD1 . TRP A 33  ? 0.4834 1.0348 0.5779 0.1203  0.0195  -0.0186 33  TRP H CD1 
243  C CD2 . TRP A 33  ? 0.5355 1.0312 0.6310 0.0989  0.0142  0.0081  33  TRP H CD2 
244  N NE1 . TRP A 33  ? 0.4567 1.0365 0.5795 0.1082  0.0285  0.0172  33  TRP H NE1 
245  C CE2 . TRP A 33  ? 0.4913 1.0356 0.6177 0.0946  0.0254  0.0343  33  TRP H CE2 
246  C CE3 . TRP A 33  ? 0.5803 1.0349 0.6740 0.0889  0.0101  0.0183  33  TRP H CE3 
247  C CZ2 . TRP A 33  ? 0.5747 1.1251 0.7348 0.0795  0.0326  0.0718  33  TRP H CZ2 
248  C CZ3 . TRP A 33  ? 0.5355 0.9943 0.6609 0.0753  0.0169  0.0529  33  TRP H CZ3 
249  C CH2 . TRP A 33  ? 0.5718 1.0770 0.7323 0.0700  0.0281  0.0801  33  TRP H CH2 
250  N N   . ILE A 34  ? 0.4788 0.8818 0.4814 0.1308  -0.0093 -0.0814 34  ILE H N   
251  C CA  . ILE A 34  ? 0.5693 0.9246 0.5629 0.1307  -0.0179 -0.0976 34  ILE H CA  
252  C C   . ILE A 34  ? 0.6174 0.9258 0.6173 0.1174  -0.0231 -0.0837 34  ILE H C   
253  O O   . ILE A 34  ? 0.7540 1.0596 0.7584 0.1079  -0.0207 -0.0615 34  ILE H O   
254  C CB  . ILE A 34  ? 0.5098 0.8774 0.4865 0.1355  -0.0183 -0.1015 34  ILE H CB  
255  C CG1 . ILE A 34  ? 0.5867 0.9977 0.5563 0.1506  -0.0168 -0.1291 34  ILE H CG1 
256  C CG2 . ILE A 34  ? 0.5973 0.9143 0.5712 0.1320  -0.0259 -0.1095 34  ILE H CG2 
257  C CD1 . ILE A 34  ? 0.5151 0.8994 0.4969 0.1573  -0.0217 -0.1618 34  ILE H CD1 
258  N N   . GLY A 35  ? 0.4746 0.7488 0.4770 0.1183  -0.0296 -0.0966 35  GLY H N   
259  C CA  . GLY A 35  ? 0.6666 0.9033 0.6710 0.1088  -0.0353 -0.0895 35  GLY H CA  
260  C C   . GLY A 35  ? 0.6504 0.8506 0.6424 0.1110  -0.0384 -0.0950 35  GLY H C   
261  O O   . GLY A 35  ? 0.5133 0.7096 0.5021 0.1198  -0.0384 -0.1078 35  GLY H O   
262  N N   . TRP A 36  ? 0.7252 0.8994 0.7152 0.1029  -0.0406 -0.0862 36  TRP H N   
263  C CA  . TRP A 36  ? 0.6715 0.8132 0.6508 0.1058  -0.0421 -0.0893 36  TRP H CA  
264  C C   . TRP A 36  ? 0.6856 0.8051 0.6618 0.1058  -0.0474 -0.0938 36  TRP H C   
265  O O   . TRP A 36  ? 0.6501 0.7681 0.6322 0.0979  -0.0512 -0.0929 36  TRP H O   
266  C CB  . TRP A 36  ? 0.6629 0.7959 0.6411 0.1007  -0.0389 -0.0766 36  TRP H CB  
267  C CG  . TRP A 36  ? 0.6389 0.7977 0.6139 0.1049  -0.0351 -0.0723 36  TRP H CG  
268  C CD1 . TRP A 36  ? 0.6636 0.8581 0.6430 0.1036  -0.0305 -0.0591 36  TRP H CD1 
269  C CD2 . TRP A 36  ? 0.6279 0.7857 0.5962 0.1119  -0.0361 -0.0813 36  TRP H CD2 
270  N NE1 . TRP A 36  ? 0.6524 0.8722 0.6226 0.1109  -0.0296 -0.0613 36  TRP H NE1 
271  C CE2 . TRP A 36  ? 0.7353 0.9316 0.7008 0.1149  -0.0341 -0.0772 36  TRP H CE2 
272  C CE3 . TRP A 36  ? 0.5845 0.7166 0.5519 0.1161  -0.0383 -0.0912 36  TRP H CE3 
273  C CZ2 . TRP A 36  ? 0.7388 0.9489 0.7006 0.1209  -0.0369 -0.0882 36  TRP H CZ2 
274  C CZ3 . TRP A 36  ? 0.5337 0.6751 0.5036 0.1203  -0.0395 -0.0992 36  TRP H CZ3 
275  C CH2 . TRP A 36  ? 0.7038 0.8839 0.6708 0.1222  -0.0402 -0.1004 36  TRP H CH2 
276  N N   . VAL A 37  ? 0.6665 0.7727 0.6363 0.1151  -0.0478 -0.0987 37  VAL H N   
277  C CA  . VAL A 37  ? 0.5490 0.6450 0.5119 0.1195  -0.0520 -0.1002 37  VAL H CA  
278  C C   . VAL A 37  ? 0.6690 0.7418 0.6204 0.1247  -0.0490 -0.0974 37  VAL H C   
279  O O   . VAL A 37  ? 0.6487 0.7143 0.6041 0.1295  -0.0440 -0.0944 37  VAL H O   
280  C CB  . VAL A 37  ? 0.5067 0.6159 0.4770 0.1296  -0.0530 -0.1007 37  VAL H CB  
281  C CG1 . VAL A 37  ? 0.6362 0.7445 0.5966 0.1371  -0.0571 -0.0974 37  VAL H CG1 
282  C CG2 . VAL A 37  ? 0.4558 0.5915 0.4388 0.1262  -0.0551 -0.1037 37  VAL H CG2 
283  N N   . ARG A 38  ? 0.5937 0.6578 0.5338 0.1239  -0.0521 -0.1006 38  ARG H N   
284  C CA  . ARG A 38  ? 0.6559 0.7035 0.5835 0.1314  -0.0478 -0.0983 38  ARG H CA  
285  C C   . ARG A 38  ? 0.6822 0.7401 0.5981 0.1442  -0.0489 -0.0956 38  ARG H C   
286  O O   . ARG A 38  ? 0.6710 0.7460 0.5810 0.1449  -0.0568 -0.1023 38  ARG H O   
287  C CB  . ARG A 38  ? 0.5928 0.6254 0.5162 0.1254  -0.0487 -0.1059 38  ARG H CB  
288  C CG  . ARG A 38  ? 0.5816 0.5999 0.4921 0.1351  -0.0426 -0.1050 38  ARG H CG  
289  C CD  . ARG A 38  ? 0.5968 0.5982 0.5085 0.1309  -0.0430 -0.1164 38  ARG H CD  
290  N NE  . ARG A 38  ? 0.8231 0.8318 0.7271 0.1309  -0.0516 -0.1363 38  ARG H NE  
291  C CZ  . ARG A 38  ? 0.8965 0.8911 0.8037 0.1292  -0.0534 -0.1547 38  ARG H CZ  
292  N NH1 . ARG A 38  ? 0.9704 0.9406 0.8894 0.1284  -0.0455 -0.1508 38  ARG H NH1 
293  N NH2 . ARG A 38  ? 0.8398 0.8467 0.7415 0.1289  -0.0638 -0.1786 38  ARG H NH2 
294  N N   . GLN A 39  ? 0.6605 0.7129 0.5759 0.1546  -0.0409 -0.0835 39  GLN H N   
295  C CA  . GLN A 39  ? 0.6486 0.7157 0.5539 0.1696  -0.0388 -0.0729 39  GLN H CA  
296  C C   . GLN A 39  ? 0.7599 0.8198 0.6536 0.1786  -0.0299 -0.0655 39  GLN H C   
297  O O   . GLN A 39  ? 0.7468 0.7979 0.6565 0.1821  -0.0205 -0.0505 39  GLN H O   
298  C CB  . GLN A 39  ? 0.5655 0.6399 0.4932 0.1767  -0.0349 -0.0569 39  GLN H CB  
299  C CG  . GLN A 39  ? 0.5860 0.6817 0.5079 0.1943  -0.0315 -0.0377 39  GLN H CG  
300  C CD  . GLN A 39  ? 0.6948 0.7951 0.6486 0.2018  -0.0272 -0.0198 39  GLN H CD  
301  O OE1 . GLN A 39  ? 0.7992 0.8827 0.7811 0.1945  -0.0251 -0.0249 39  GLN H OE1 
302  N NE2 . GLN A 39  ? 0.7056 0.8317 0.6573 0.2179  -0.0257 0.0007  39  GLN H NE2 
303  N N   . MET A 40  ? 0.8373 0.9031 0.7069 0.1823  -0.0329 -0.0782 40  MET H N   
304  C CA  . MET A 40  ? 0.8220 0.8874 0.6773 0.1940  -0.0234 -0.0735 40  MET H CA  
305  C C   . MET A 40  ? 0.7565 0.8465 0.6082 0.2121  -0.0149 -0.0479 40  MET H C   
306  O O   . MET A 40  ? 0.8808 0.9938 0.7309 0.2182  -0.0197 -0.0403 40  MET H O   
307  C CB  . MET A 40  ? 0.8759 0.9451 0.7077 0.1956  -0.0296 -0.0997 40  MET H CB  
308  C CG  . MET A 40  ? 0.8445 0.8855 0.6899 0.1787  -0.0344 -0.1187 40  MET H CG  
309  S SD  . MET A 40  ? 1.1789 1.2183 1.0111 0.1794  -0.0419 -0.1546 40  MET H SD  
310  C CE  . MET A 40  ? 0.8954 0.9710 0.7161 0.1791  -0.0583 -0.1696 40  MET H CE  
311  N N   . PRO A 41  ? 0.7520 0.8400 0.6071 0.2215  -0.0011 -0.0308 41  PRO H N   
312  C CA  . PRO A 41  ? 0.7988 0.9106 0.6598 0.2389  0.0110  0.0019  41  PRO H CA  
313  C C   . PRO A 41  ? 0.8418 0.9961 0.6729 0.2564  0.0076  0.0065  41  PRO H C   
314  O O   . PRO A 41  ? 0.7827 0.9567 0.5787 0.2655  0.0052  -0.0113 41  PRO H O   
315  C CB  . PRO A 41  ? 0.8802 0.9883 0.7403 0.2460  0.0250  0.0106  41  PRO H CB  
316  C CG  . PRO A 41  ? 0.8417 0.9150 0.7153 0.2283  0.0208  -0.0086 41  PRO H CG  
317  C CD  . PRO A 41  ? 0.7735 0.8382 0.6335 0.2162  0.0049  -0.0376 41  PRO H CD  
318  N N   . GLY A 42  ? 0.8931 1.0641 0.7401 0.2621  0.0070  0.0288  42  GLY H N   
319  C CA  . GLY A 42  ? 0.8160 1.0357 0.6378 0.2808  0.0033  0.0395  42  GLY H CA  
320  C C   . GLY A 42  ? 0.9301 1.1631 0.7274 0.2737  -0.0171 0.0046  42  GLY H C   
321  O O   . GLY A 42  ? 0.9052 1.1848 0.6729 0.2886  -0.0241 0.0018  42  GLY H O   
322  N N   . LYS A 43  ? 0.8391 1.0364 0.6511 0.2513  -0.0266 -0.0213 43  LYS H N   
323  C CA  . LYS A 43  ? 0.8075 1.0144 0.6073 0.2410  -0.0451 -0.0534 43  LYS H CA  
324  C C   . LYS A 43  ? 0.8175 1.0158 0.6462 0.2292  -0.0518 -0.0499 43  LYS H C   
325  O O   . LYS A 43  ? 0.7887 0.9712 0.6459 0.2294  -0.0426 -0.0271 43  LYS H O   
326  C CB  . LYS A 43  ? 0.7872 0.9648 0.5803 0.2258  -0.0499 -0.0882 43  LYS H CB  
327  C CG  . LYS A 43  ? 0.8497 1.0339 0.6165 0.2385  -0.0426 -0.0971 43  LYS H CG  
328  C CD  . LYS A 43  ? 0.8627 1.1013 0.5945 0.2578  -0.0496 -0.1059 43  LYS H CD  
329  N N   . GLY A 44  ? 0.6839 0.8943 0.5090 0.2189  -0.0677 -0.0747 44  GLY H N   
330  C CA  . GLY A 44  ? 0.6316 0.8421 0.4825 0.2096  -0.0738 -0.0725 44  GLY H CA  
331  C C   . GLY A 44  ? 0.6302 0.8020 0.5031 0.1891  -0.0720 -0.0841 44  GLY H C   
332  O O   . GLY A 44  ? 0.6616 0.8047 0.5317 0.1819  -0.0662 -0.0914 44  GLY H O   
333  N N   . LEU A 45  ? 0.6106 0.7871 0.5055 0.1816  -0.0763 -0.0841 45  LEU H N   
334  C CA  . LEU A 45  ? 0.6387 0.7902 0.5528 0.1651  -0.0737 -0.0920 45  LEU H CA  
335  C C   . LEU A 45  ? 0.6726 0.8220 0.5865 0.1481  -0.0830 -0.1140 45  LEU H C   
336  O O   . LEU A 45  ? 0.7902 0.9645 0.7026 0.1456  -0.0951 -0.1261 45  LEU H O   
337  C CB  . LEU A 45  ? 0.6672 0.8292 0.6063 0.1667  -0.0724 -0.0834 45  LEU H CB  
338  C CG  . LEU A 45  ? 0.6253 0.7848 0.5794 0.1825  -0.0626 -0.0623 45  LEU H CG  
339  C CD1 . LEU A 45  ? 0.5462 0.7190 0.5279 0.1859  -0.0626 -0.0590 45  LEU H CD1 
340  C CD2 . LEU A 45  ? 0.6140 0.7415 0.5752 0.1802  -0.0518 -0.0595 45  LEU H CD2 
341  N N   . GLU A 46  ? 0.6962 0.8182 0.6166 0.1366  -0.0775 -0.1180 46  GLU H N   
342  C CA  . GLU A 46  ? 0.7133 0.8283 0.6442 0.1201  -0.0831 -0.1330 46  GLU H CA  
343  C C   . GLU A 46  ? 0.6531 0.7629 0.6058 0.1086  -0.0777 -0.1251 46  GLU H C   
344  O O   . GLU A 46  ? 0.6819 0.7760 0.6340 0.1099  -0.0684 -0.1159 46  GLU H O   
345  C CB  . GLU A 46  ? 0.6372 0.7275 0.5571 0.1195  -0.0806 -0.1429 46  GLU H CB  
346  C CG  . GLU A 46  ? 0.7568 0.8601 0.6526 0.1316  -0.0863 -0.1560 46  GLU H CG  
347  C CD  . GLU A 46  ? 0.7984 0.8780 0.6820 0.1362  -0.0796 -0.1635 46  GLU H CD  
348  O OE1 . GLU A 46  ? 0.7509 0.8133 0.6314 0.1417  -0.0676 -0.1466 46  GLU H OE1 
349  O OE2 . GLU A 46  ? 1.0489 1.1282 0.9291 0.1344  -0.0868 -0.1887 46  GLU H OE2 
350  N N   . TRP A 47  ? 0.6347 0.7637 0.6074 0.0982  -0.0835 -0.1282 47  TRP H N   
351  C CA  . TRP A 47  ? 0.6188 0.7532 0.6118 0.0890  -0.0770 -0.1179 47  TRP H CA  
352  C C   . TRP A 47  ? 0.6810 0.7948 0.6867 0.0769  -0.0732 -0.1156 47  TRP H C   
353  O O   . TRP A 47  ? 0.6568 0.7679 0.6826 0.0649  -0.0792 -0.1239 47  TRP H O   
354  C CB  . TRP A 47  ? 0.5372 0.7041 0.5519 0.0829  -0.0825 -0.1181 47  TRP H CB  
355  C CG  . TRP A 47  ? 0.7204 0.9056 0.7476 0.0827  -0.0733 -0.1055 47  TRP H CG  
356  C CD1 . TRP A 47  ? 0.7282 0.9113 0.7629 0.0767  -0.0640 -0.0942 47  TRP H CD1 
357  C CD2 . TRP A 47  ? 0.7439 0.9581 0.7775 0.0912  -0.0719 -0.1031 47  TRP H CD2 
358  N NE1 . TRP A 47  ? 0.7487 0.9616 0.7897 0.0815  -0.0572 -0.0872 47  TRP H NE1 
359  C CE2 . TRP A 47  ? 0.7170 0.9467 0.7590 0.0902  -0.0616 -0.0943 47  TRP H CE2 
360  C CE3 . TRP A 47  ? 0.7222 0.9541 0.7565 0.1016  -0.0779 -0.1065 47  TRP H CE3 
361  C CZ2 . TRP A 47  ? 0.5804 0.8406 0.6309 0.0992  -0.0567 -0.0938 47  TRP H CZ2 
362  C CZ3 . TRP A 47  ? 0.6648 0.9228 0.7121 0.1101  -0.0728 -0.1028 47  TRP H CZ3 
363  C CH2 . TRP A 47  ? 0.6995 0.9704 0.7545 0.1088  -0.0622 -0.0989 47  TRP H CH2 
364  N N   . MET A 48  ? 0.5319 0.6325 0.5311 0.0802  -0.0636 -0.1043 48  MET H N   
365  C CA  . MET A 48  ? 0.6415 0.7235 0.6543 0.0722  -0.0584 -0.0963 48  MET H CA  
366  C C   . MET A 48  ? 0.6657 0.7673 0.7077 0.0610  -0.0538 -0.0800 48  MET H C   
367  O O   . MET A 48  ? 0.8505 0.9414 0.9215 0.0493  -0.0534 -0.0756 48  MET H O   
368  C CB  . MET A 48  ? 0.7085 0.7774 0.7049 0.0812  -0.0506 -0.0877 48  MET H CB  
369  C CG  . MET A 48  ? 0.8404 0.8937 0.8129 0.0928  -0.0520 -0.0978 48  MET H CG  
370  S SD  . MET A 48  ? 0.7784 0.8197 0.7417 0.1007  -0.0437 -0.0874 48  MET H SD  
371  C CE  . MET A 48  ? 0.5608 0.5826 0.5410 0.0937  -0.0395 -0.0788 48  MET H CE  
372  N N   . GLY A 49  ? 0.6545 0.7865 0.6928 0.0655  -0.0493 -0.0707 49  GLY H N   
373  C CA  . GLY A 49  ? 0.5977 0.7589 0.6608 0.0581  -0.0426 -0.0515 49  GLY H CA  
374  C C   . GLY A 49  ? 0.6251 0.8228 0.6749 0.0684  -0.0363 -0.0461 49  GLY H C   
375  O O   . GLY A 49  ? 0.5638 0.7584 0.5894 0.0801  -0.0373 -0.0580 49  GLY H O   
376  N N   . ILE A 50  ? 0.5491 0.7836 0.6187 0.0644  -0.0293 -0.0289 50  ILE H N   
377  C CA  . ILE A 50  ? 0.5251 0.8026 0.5826 0.0760  -0.0224 -0.0266 50  ILE H CA  
378  C C   . ILE A 50  ? 0.6124 0.9235 0.6768 0.0766  -0.0107 0.0014  50  ILE H C   
379  O O   . ILE A 50  ? 0.5630 0.8677 0.6541 0.0658  -0.0063 0.0254  50  ILE H O   
380  C CB  . ILE A 50  ? 0.4878 0.7956 0.5591 0.0764  -0.0230 -0.0320 50  ILE H CB  
381  C CG1 . ILE A 50  ? 0.5979 0.9162 0.7085 0.0601  -0.0216 -0.0137 50  ILE H CG1 
382  C CG2 . ILE A 50  ? 0.4660 0.7520 0.5266 0.0818  -0.0334 -0.0564 50  ILE H CG2 
383  C CD1 . ILE A 50  ? 0.5678 0.9215 0.6975 0.0598  -0.0221 -0.0162 50  ILE H CD1 
384  N N   . ILE A 51  ? 0.5944 0.9442 0.6375 0.0905  -0.0056 -0.0017 51  ILE H N   
385  C CA  . ILE A 51  ? 0.5713 0.9686 0.6150 0.0955  0.0058  0.0259  51  ILE H CA  
386  C C   . ILE A 51  ? 0.6248 1.0826 0.6544 0.1100  0.0120  0.0172  51  ILE H C   
387  O O   . ILE A 51  ? 0.6211 1.0775 0.6315 0.1202  0.0063  -0.0160 51  ILE H O   
388  C CB  . ILE A 51  ? 0.4978 0.8855 0.5228 0.1011  0.0047  0.0310  51  ILE H CB  
389  C CG1 . ILE A 51  ? 0.4773 0.9253 0.5010 0.1093  0.0162  0.0636  51  ILE H CG1 
390  C CG2 . ILE A 51  ? 0.4897 0.8658 0.4856 0.1115  -0.0043 -0.0053 51  ILE H CG2 
391  C CD1 . ILE A 51  ? 0.5515 0.9968 0.5624 0.1149  0.0149  0.0750  51  ILE H CD1 
392  N N   . TYR A 52  ? 0.5168 1.0287 0.5607 0.1114  0.0248  0.0477  52  TYR H N   
393  C CA  . TYR A 52  ? 0.6281 1.2080 0.6566 0.1280  0.0331  0.0412  52  TYR H CA  
394  C C   . TYR A 52  ? 0.5893 1.2196 0.5926 0.1419  0.0389  0.0542  52  TYR H C   
395  O O   . TYR A 52  ? 0.5916 1.2555 0.6082 0.1407  0.0501  0.0981  52  TYR H O   
396  C CB  . TYR A 52  ? 0.6126 1.2330 0.6725 0.1236  0.0452  0.0676  52  TYR H CB  
397  C CG  . TYR A 52  ? 0.6299 1.3170 0.6755 0.1423  0.0538  0.0533  52  TYR H CG  
398  C CD1 . TYR A 52  ? 0.6756 1.3517 0.7212 0.1474  0.0483  0.0177  52  TYR H CD1 
399  C CD2 . TYR A 52  ? 0.7717 1.5368 0.8045 0.1571  0.0683  0.0761  52  TYR H CD2 
400  C CE1 . TYR A 52  ? 0.8016 1.5374 0.8378 0.1663  0.0571  0.0015  52  TYR H CE1 
401  C CE2 . TYR A 52  ? 0.7775 1.6081 0.7954 0.1766  0.0769  0.0588  52  TYR H CE2 
402  C CZ  . TYR A 52  ? 0.7361 1.5492 0.7571 0.1809  0.0714  0.0196  52  TYR H CZ  
403  O OH  . TYR A 52  ? 0.9249 1.8020 0.9348 0.2021  0.0809  -0.0006 52  TYR H OH  
404  N N   . PRO A 53  ? 0.6220 1.2606 0.5931 0.1554  0.0309  0.0167  53  PRO H N   
405  C CA  . PRO A 53  ? 0.6692 1.3568 0.6127 0.1693  0.0312  0.0190  53  PRO H CA  
406  C C   . PRO A 53  ? 0.7057 1.4866 0.6413 0.1839  0.0466  0.0477  53  PRO H C   
407  O O   . PRO A 53  ? 0.7908 1.6214 0.7067 0.1951  0.0486  0.0641  53  PRO H O   
408  C CB  . PRO A 53  ? 0.5982 1.2789 0.5199 0.1797  0.0191  -0.0381 53  PRO H CB  
409  C CG  . PRO A 53  ? 0.6184 1.2225 0.5583 0.1674  0.0112  -0.0588 53  PRO H CG  
410  C CD  . PRO A 53  ? 0.4985 1.0996 0.4634 0.1580  0.0201  -0.0313 53  PRO H CD  
411  N N   . GLY A 54  ? 0.7601 1.5699 0.7111 0.1853  0.0576  0.0555  54  GLY H N   
412  C CA  . GLY A 54  ? 0.6917 1.5954 0.6377 0.2003  0.0751  0.0864  54  GLY H CA  
413  C C   . GLY A 54  ? 0.6409 1.5677 0.6063 0.1951  0.0872  0.1526  54  GLY H C   
414  O O   . GLY A 54  ? 0.7221 1.7269 0.6671 0.2122  0.0962  0.1779  54  GLY H O   
415  N N   . ASP A 55  ? 0.6057 1.4671 0.6136 0.1724  0.0874  0.1803  55  ASP H N   
416  C CA  . ASP A 55  ? 0.7519 1.6230 0.7935 0.1652  0.0998  0.2444  55  ASP H CA  
417  C C   . ASP A 55  ? 0.6987 1.4800 0.7616 0.1469  0.0887  0.2467  55  ASP H C   
418  O O   . ASP A 55  ? 0.7006 1.4662 0.8062 0.1361  0.0976  0.2946  55  ASP H O   
419  C CB  . ASP A 55  ? 0.9307 1.8260 1.0217 0.1555  0.1169  0.2852  55  ASP H CB  
420  C CG  . ASP A 55  ? 0.9577 1.7851 1.0789 0.1349  0.1074  0.2566  55  ASP H CG  
421  O OD1 . ASP A 55  ? 0.8657 1.6456 0.9599 0.1345  0.0905  0.2026  55  ASP H OD1 
422  O OD2 . ASP A 55  ? 1.0022 1.8271 1.1774 0.1193  0.1168  0.2896  55  ASP H OD2 
423  N N   . SER A 56  ? 0.7704 1.4946 0.8075 0.1445  0.0705  0.1951  56  SER H N   
424  C CA  . SER A 56  ? 0.7631 1.4044 0.8137 0.1301  0.0595  0.1890  56  SER H CA  
425  C C   . SER A 56  ? 0.6972 1.2835 0.7994 0.1079  0.0613  0.2042  56  SER H C   
426  O O   . SER A 56  ? 0.6930 1.2316 0.8234 0.0970  0.0606  0.2227  56  SER H O   
427  C CB  . SER A 56  ? 0.7419 1.3968 0.7892 0.1373  0.0625  0.2223  56  SER H CB  
428  O OG  . SER A 56  ? 0.7205 1.4228 0.7204 0.1561  0.0559  0.1994  56  SER H OG  
429  N N   . ASP A 57  ? 0.6401 1.2358 0.7573 0.1019  0.0631  0.1937  57  ASP H N   
430  C CA  . ASP A 57  ? 0.6095 1.1586 0.7761 0.0801  0.0611  0.1985  57  ASP H CA  
431  C C   . ASP A 57  ? 0.6215 1.0946 0.7762 0.0715  0.0426  0.1544  57  ASP H C   
432  O O   . ASP A 57  ? 0.6191 1.0852 0.7436 0.0776  0.0329  0.1152  57  ASP H O   
433  C CB  . ASP A 57  ? 0.6675 1.2575 0.8532 0.0779  0.0673  0.1994  57  ASP H CB  
434  C CG  . ASP A 57  ? 0.7060 1.2672 0.9557 0.0543  0.0678  0.2159  57  ASP H CG  
435  O OD1 . ASP A 57  ? 0.6955 1.1945 0.9694 0.0396  0.0595  0.2122  57  ASP H OD1 
436  O OD2 . ASP A 57  ? 0.6772 1.2807 0.9561 0.0507  0.0762  0.2303  57  ASP H OD2 
437  N N   . THR A 58  ? 0.6939 1.1126 0.8750 0.0590  0.0390  0.1624  58  THR H N   
438  C CA  . THR A 58  ? 0.6870 1.0401 0.8535 0.0538  0.0233  0.1239  58  THR H CA  
439  C C   . THR A 58  ? 0.6854 0.9983 0.8933 0.0344  0.0160  0.1127  58  THR H C   
440  O O   . THR A 58  ? 0.6746 0.9809 0.9353 0.0210  0.0225  0.1392  58  THR H O   
441  C CB  . THR A 58  ? 0.7873 1.1079 0.9444 0.0580  0.0226  0.1308  58  THR H CB  
442  O OG1 . THR A 58  ? 0.9434 1.2454 1.1526 0.0469  0.0307  0.1647  58  THR H OG1 
443  C CG2 . THR A 58  ? 0.7526 1.1209 0.8735 0.0764  0.0280  0.1428  58  THR H CG2 
444  N N   . ARG A 59  ? 0.7004 0.9894 0.8878 0.0336  0.0022  0.0733  59  ARG H N   
445  C CA  . ARG A 59  ? 0.7189 0.9743 0.9370 0.0176  -0.0089 0.0542  59  ARG H CA  
446  C C   . ARG A 59  ? 0.7639 0.9687 0.9536 0.0207  -0.0212 0.0219  59  ARG H C   
447  O O   . ARG A 59  ? 0.7189 0.9224 0.8642 0.0340  -0.0258 0.0029  59  ARG H O   
448  C CB  . ARG A 59  ? 0.6837 0.9694 0.9068 0.0152  -0.0143 0.0404  59  ARG H CB  
449  C CG  . ARG A 59  ? 0.6240 0.9701 0.8618 0.0187  -0.0003 0.0691  59  ARG H CG  
450  C CD  . ARG A 59  ? 0.6046 0.9628 0.9056 0.0023  0.0100  0.1056  59  ARG H CD  
451  N NE  . ARG A 59  ? 0.6464 1.0691 0.9564 0.0096  0.0277  0.1416  59  ARG H NE  
452  C CZ  . ARG A 59  ? 0.6808 1.1493 1.0076 0.0088  0.0314  0.1451  59  ARG H CZ  
453  N NH1 . ARG A 59  ? 0.6436 1.0999 0.9816 0.0003  0.0171  0.1157  59  ARG H NH1 
454  N NH2 . ARG A 59  ? 0.7531 1.2852 1.0852 0.0183  0.0496  0.1791  59  ARG H NH2 
455  N N   . TYR A 60  ? 0.7081 0.8727 0.9275 0.0093  -0.0254 0.0159  60  TYR H N   
456  C CA  . TYR A 60  ? 0.7964 0.9180 0.9899 0.0141  -0.0351 -0.0137 60  TYR H CA  
457  C C   . TYR A 60  ? 0.7883 0.8962 0.9921 0.0051  -0.0505 -0.0475 60  TYR H C   
458  O O   . TYR A 60  ? 0.7535 0.8705 1.0031 -0.0105 -0.0542 -0.0479 60  TYR H O   
459  C CB  . TYR A 60  ? 0.8306 0.9171 1.0442 0.0128  -0.0284 -0.0010 60  TYR H CB  
460  C CG  . TYR A 60  ? 0.7372 0.8400 0.9353 0.0246  -0.0156 0.0310  60  TYR H CG  
461  C CD1 . TYR A 60  ? 0.7008 0.7979 0.8521 0.0396  -0.0168 0.0217  60  TYR H CD1 
462  C CD2 . TYR A 60  ? 0.7097 0.8389 0.9431 0.0211  -0.0025 0.0721  60  TYR H CD2 
463  C CE1 . TYR A 60  ? 0.8112 0.9296 0.9496 0.0502  -0.0079 0.0474  60  TYR H CE1 
464  C CE2 . TYR A 60  ? 0.7647 0.9188 0.9811 0.0340  0.0078  0.1016  60  TYR H CE2 
465  C CZ  . TYR A 60  ? 0.8232 0.9722 0.9912 0.0482  0.0038  0.0866  60  TYR H CZ  
466  O OH  . TYR A 60  ? 0.8770 1.0569 1.0292 0.0609  0.0114  0.1124  60  TYR H OH  
467  N N   . SER A 61  ? 0.7619 0.8531 0.9253 0.0155  -0.0595 -0.0749 61  SER H N   
468  C CA  . SER A 61  ? 0.8702 0.9520 1.0368 0.0106  -0.0748 -0.1087 61  SER H CA  
469  C C   . SER A 61  ? 0.9588 1.0023 1.1567 0.0019  -0.0763 -0.1220 61  SER H C   
470  O O   . SER A 61  ? 1.0749 1.0921 1.2687 0.0080  -0.0665 -0.1104 61  SER H O   
471  C CB  . SER A 61  ? 0.8531 0.9363 0.9663 0.0276  -0.0814 -0.1274 61  SER H CB  
472  O OG  . SER A 61  ? 0.9106 1.0249 1.0038 0.0361  -0.0796 -0.1169 61  SER H OG  
473  N N   . PRO A 62  ? 0.8834 0.9251 1.1166 -0.0119 -0.0891 -0.1485 62  PRO H N   
474  C CA  . PRO A 62  ? 0.8583 0.8627 1.1320 -0.0214 -0.0919 -0.1690 62  PRO H CA  
475  C C   . PRO A 62  ? 0.7920 0.7663 1.0264 -0.0051 -0.0910 -0.1887 62  PRO H C   
476  O O   . PRO A 62  ? 0.9558 0.8939 1.2203 -0.0074 -0.0857 -0.1936 62  PRO H O   
477  C CB  . PRO A 62  ? 0.9156 0.9362 1.2180 -0.0352 -0.1113 -0.2058 62  PRO H CB  
478  C CG  . PRO A 62  ? 0.8749 0.9404 1.1791 -0.0397 -0.1127 -0.1861 62  PRO H CG  
479  C CD  . PRO A 62  ? 0.7887 0.8670 1.0319 -0.0196 -0.1023 -0.1620 62  PRO H CD  
480  N N   . SER A 63  ? 0.7507 0.7411 0.9236 0.0121  -0.0947 -0.1973 63  SER H N   
481  C CA  . SER A 63  ? 0.8797 0.8497 1.0139 0.0291  -0.0924 -0.2129 63  SER H CA  
482  C C   . SER A 63  ? 0.8430 0.7960 0.9628 0.0390  -0.0756 -0.1802 63  SER H C   
483  O O   . SER A 63  ? 0.8892 0.8222 0.9882 0.0518  -0.0705 -0.1873 63  SER H O   
484  C CB  . SER A 63  ? 0.9489 0.9476 1.0293 0.0440  -0.1016 -0.2293 63  SER H CB  
485  O OG  . SER A 63  ? 1.0595 1.0844 1.1508 0.0363  -0.1189 -0.2575 63  SER H OG  
486  N N   . PHE A 64  ? 0.8679 0.8346 0.9993 0.0342  -0.0671 -0.1454 64  PHE H N   
487  C CA  . PHE A 64  ? 0.8227 0.7847 0.9389 0.0440  -0.0537 -0.1156 64  PHE H CA  
488  C C   . PHE A 64  ? 0.8475 0.8051 1.0086 0.0350  -0.0429 -0.0832 64  PHE H C   
489  O O   . PHE A 64  ? 0.9063 0.8662 1.0593 0.0431  -0.0326 -0.0566 64  PHE H O   
490  C CB  . PHE A 64  ? 0.7262 0.7188 0.8038 0.0528  -0.0529 -0.1036 64  PHE H CB  
491  C CG  . PHE A 64  ? 0.7535 0.7495 0.7897 0.0655  -0.0591 -0.1237 64  PHE H CG  
492  C CD1 . PHE A 64  ? 0.7626 0.7447 0.7731 0.0790  -0.0533 -0.1226 64  PHE H CD1 
493  C CD2 . PHE A 64  ? 0.8350 0.8524 0.8615 0.0649  -0.0697 -0.1398 64  PHE H CD2 
494  C CE1 . PHE A 64  ? 0.8438 0.8325 0.8212 0.0915  -0.0565 -0.1345 64  PHE H CE1 
495  C CE2 . PHE A 64  ? 0.7422 0.7675 0.7334 0.0788  -0.0737 -0.1512 64  PHE H CE2 
496  C CZ  . PHE A 64  ? 0.8305 0.8412 0.7979 0.0920  -0.0662 -0.1472 64  PHE H CZ  
497  N N   . GLN A 65  ? 0.7858 0.7414 0.9978 0.0185  -0.0452 -0.0833 65  GLN H N   
498  C CA  . GLN A 65  ? 0.8892 0.8439 1.1526 0.0100  -0.0330 -0.0459 65  GLN H CA  
499  C C   . GLN A 65  ? 0.8961 0.8104 1.1869 0.0142  -0.0249 -0.0403 65  GLN H C   
500  O O   . GLN A 65  ? 0.9538 0.8338 1.2696 0.0100  -0.0305 -0.0716 65  GLN H O   
501  C CB  . GLN A 65  ? 0.9354 0.8984 1.2563 -0.0103 -0.0369 -0.0462 65  GLN H CB  
502  C CG  . GLN A 65  ? 0.9239 0.8974 1.3008 -0.0186 -0.0216 0.0023  65  GLN H CG  
503  C CD  . GLN A 65  ? 0.8922 0.8813 1.3290 -0.0394 -0.0244 0.0061  65  GLN H CD  
504  N N   . GLY A 66  ? 0.8793 0.8016 1.1664 0.0240  -0.0120 -0.0018 66  GLY H N   
505  C CA  . GLY A 66  ? 0.8942 0.7831 1.2077 0.0312  -0.0027 0.0103  66  GLY H CA  
506  C C   . GLY A 66  ? 0.8368 0.7140 1.0988 0.0487  -0.0043 -0.0085 66  GLY H C   
507  O O   . GLY A 66  ? 0.9526 0.8100 1.2270 0.0589  0.0042  0.0049  66  GLY H O   
508  N N   . GLN A 67  ? 0.8230 0.7147 1.0317 0.0529  -0.0143 -0.0362 67  GLN H N   
509  C CA  . GLN A 67  ? 0.9085 0.7936 1.0711 0.0688  -0.0151 -0.0520 67  GLN H CA  
510  C C   . GLN A 67  ? 0.8954 0.8133 1.0219 0.0779  -0.0118 -0.0280 67  GLN H C   
511  O O   . GLN A 67  ? 0.8568 0.7723 0.9580 0.0904  -0.0094 -0.0291 67  GLN H O   
512  C CB  . GLN A 67  ? 0.8525 0.7361 0.9830 0.0701  -0.0268 -0.0935 67  GLN H CB  
513  C CG  . GLN A 67  ? 0.9709 0.8284 1.1326 0.0625  -0.0334 -0.1276 67  GLN H CG  
514  C CD  . GLN A 67  ? 1.1035 0.9232 1.2937 0.0695  -0.0253 -0.1335 67  GLN H CD  
515  O OE1 . GLN A 67  ? 1.1517 0.9658 1.3157 0.0854  -0.0186 -0.1303 67  GLN H OE1 
516  N NE2 . GLN A 67  ? 1.1577 0.9512 1.4079 0.0576  -0.0254 -0.1421 67  GLN H NE2 
517  N N   . VAL A 68  ? 0.9364 0.8880 1.0640 0.0716  -0.0118 -0.0085 68  VAL H N   
518  C CA  . VAL A 68  ? 0.8593 0.8470 0.9548 0.0797  -0.0107 0.0062  68  VAL H CA  
519  C C   . VAL A 68  ? 0.8735 0.8995 0.9857 0.0750  -0.0055 0.0372  68  VAL H C   
520  O O   . VAL A 68  ? 0.9093 0.9359 1.0551 0.0637  -0.0037 0.0457  68  VAL H O   
521  C CB  . VAL A 68  ? 0.7722 0.7703 0.8288 0.0825  -0.0193 -0.0201 68  VAL H CB  
522  C CG1 . VAL A 68  ? 0.5322 0.5543 0.5926 0.0734  -0.0237 -0.0231 68  VAL H CG1 
523  C CG2 . VAL A 68  ? 0.8151 0.8336 0.8439 0.0932  -0.0187 -0.0155 68  VAL H CG2 
524  N N   . THR A 69  ? 0.7409 0.8034 0.8320 0.0843  -0.0032 0.0537  69  THR H N   
525  C CA  . THR A 69  ? 0.7036 0.8147 0.8027 0.0843  0.0026  0.0831  69  THR H CA  
526  C C   . THR A 69  ? 0.6867 0.8382 0.7487 0.0898  -0.0028 0.0679  69  THR H C   
527  O O   . THR A 69  ? 0.6545 0.8098 0.6893 0.0982  -0.0078 0.0522  69  THR H O   
528  C CB  . THR A 69  ? 0.7939 0.9252 0.9074 0.0933  0.0113  0.1215  69  THR H CB  
529  O OG1 . THR A 69  ? 0.8488 0.9380 1.0050 0.0894  0.0177  0.1358  69  THR H OG1 
530  C CG2 . THR A 69  ? 0.7876 0.9787 0.9075 0.0957  0.0187  0.1555  69  THR H CG2 
531  N N   . ILE A 70  ? 0.6918 0.8735 0.7584 0.0851  -0.0012 0.0716  70  ILE H N   
532  C CA  . ILE A 70  ? 0.5589 0.7805 0.5963 0.0916  -0.0048 0.0554  70  ILE H CA  
533  C C   . ILE A 70  ? 0.6667 0.9520 0.7035 0.0988  0.0033  0.0832  70  ILE H C   
534  O O   . ILE A 70  ? 0.7954 1.0993 0.8597 0.0937  0.0125  0.1132  70  ILE H O   
535  C CB  . ILE A 70  ? 0.5681 0.7827 0.6069 0.0845  -0.0092 0.0334  70  ILE H CB  
536  C CG1 . ILE A 70  ? 0.6783 0.8403 0.7141 0.0800  -0.0174 0.0078  70  ILE H CG1 
537  C CG2 . ILE A 70  ? 0.5167 0.7694 0.5308 0.0935  -0.0117 0.0152  70  ILE H CG2 
538  C CD1 . ILE A 70  ? 0.6882 0.8479 0.7263 0.0745  -0.0233 -0.0114 70  ILE H CD1 
539  N N   . SER A 71  ? 0.6050 0.9277 0.6129 0.1111  -0.0001 0.0731  71  SER H N   
540  C CA  . SER A 71  ? 0.5788 0.9737 0.5778 0.1218  0.0062  0.0945  71  SER H CA  
541  C C   . SER A 71  ? 0.6991 1.1330 0.6673 0.1317  -0.0005 0.0587  71  SER H C   
542  O O   . SER A 71  ? 0.6677 1.0677 0.6273 0.1296  -0.0093 0.0217  71  SER H O   
543  C CB  . SER A 71  ? 0.4567 0.8726 0.4572 0.1302  0.0090  0.1248  71  SER H CB  
544  O OG  . SER A 71  ? 0.5088 0.9112 0.4897 0.1353  -0.0018 0.0985  71  SER H OG  
545  N N   . ALA A 72  ? 0.5967 1.1042 0.5514 0.1437  0.0045  0.0703  72  ALA H N   
546  C CA  . ALA A 72  ? 0.5973 1.1486 0.5257 0.1551  -0.0016 0.0319  72  ALA H CA  
547  C C   . ALA A 72  ? 0.6522 1.2894 0.5598 0.1718  0.0005  0.0452  72  ALA H C   
548  O O   . ALA A 72  ? 0.6301 1.3045 0.5453 0.1756  0.0114  0.0932  72  ALA H O   
549  C CB  . ALA A 72  ? 0.5263 1.0846 0.4591 0.1537  0.0031  0.0175  72  ALA H CB  
550  N N   . ASP A 73  ? 0.7402 1.4115 0.6248 0.1823  -0.0100 0.0027  73  ASP H N   
551  C CA  . ASP A 73  ? 0.6858 1.4490 0.5455 0.2003  -0.0112 0.0051  73  ASP H CA  
552  C C   . ASP A 73  ? 0.7157 1.5320 0.5565 0.2127  -0.0129 -0.0390 73  ASP H C   
553  O O   . ASP A 73  ? 0.6935 1.4865 0.5350 0.2120  -0.0248 -0.0928 73  ASP H O   
554  C CB  . ASP A 73  ? 0.7748 1.5403 0.6274 0.2030  -0.0255 -0.0087 73  ASP H CB  
555  C CG  . ASP A 73  ? 0.9744 1.8321 0.8119 0.2196  -0.0255 0.0035  73  ASP H CG  
556  O OD1 . ASP A 73  ? 1.1185 2.0130 0.9555 0.2266  -0.0317 -0.0410 73  ASP H OD1 
557  O OD2 . ASP A 73  ? 0.9501 1.8329 0.7926 0.2237  -0.0167 0.0580  73  ASP H OD2 
558  N N   . LYS A 74  ? 0.6793 1.5601 0.5169 0.2229  0.0004  -0.0144 74  LYS H N   
559  C CA  . LYS A 74  ? 0.7831 1.7025 0.6237 0.2328  0.0001  -0.0508 74  LYS H CA  
560  C C   . LYS A 74  ? 0.7796 1.7364 0.6213 0.2427  -0.0142 -0.0949 74  LYS H C   
561  O O   . LYS A 74  ? 0.9334 1.8920 0.7824 0.2468  -0.0214 -0.1434 74  LYS H O   
562  C CB  . LYS A 74  ? 0.8430 1.8276 0.6865 0.2420  0.0165  -0.0072 74  LYS H CB  
563  C CG  . LYS A 74  ? 0.8377 1.7956 0.6903 0.2309  0.0340  0.0447  74  LYS H CG  
564  C CD  . LYS A 74  ? 0.8695 1.8960 0.7349 0.2394  0.0504  0.0962  74  LYS H CD  
565  C CE  . LYS A 74  ? 0.8405 1.9167 0.7021 0.2529  0.0486  0.0646  74  LYS H CE  
566  N N   . SER A 75  ? 0.7072 1.6948 0.5452 0.2466  -0.0176 -0.0772 75  SER H N   
567  C CA  . SER A 75  ? 0.8221 1.8598 0.6620 0.2571  -0.0292 -0.1144 75  SER H CA  
568  C C   . SER A 75  ? 0.8072 1.7921 0.6595 0.2487  -0.0454 -0.1760 75  SER H C   
569  O O   . SER A 75  ? 0.8134 1.8336 0.6748 0.2565  -0.0550 -0.2208 75  SER H O   
570  C CB  . SER A 75  ? 0.8488 1.9255 0.6841 0.2618  -0.0282 -0.0786 75  SER H CB  
571  N N   . ILE A 76  ? 0.6253 1.5282 0.4817 0.2334  -0.0485 -0.1773 76  ILE H N   
572  C CA  . ILE A 76  ? 0.6761 1.5255 0.5518 0.2246  -0.0625 -0.2282 76  ILE H CA  
573  C C   . ILE A 76  ? 0.6993 1.4754 0.5850 0.2148  -0.0604 -0.2414 76  ILE H C   
574  O O   . ILE A 76  ? 0.6634 1.3845 0.5695 0.2061  -0.0696 -0.2730 76  ILE H O   
575  C CB  . ILE A 76  ? 0.7125 1.5359 0.5898 0.2164  -0.0717 -0.2215 76  ILE H CB  
576  C CG1 . ILE A 76  ? 0.6577 1.4446 0.5203 0.2093  -0.0646 -0.1686 76  ILE H CG1 
577  C CG2 . ILE A 76  ? 0.5707 1.4668 0.4445 0.2266  -0.0761 -0.2213 76  ILE H CG2 
578  C CD1 . ILE A 76  ? 0.5114 1.2734 0.3776 0.2028  -0.0745 -0.1575 76  ILE H CD1 
579  N N   . SER A 77  ? 0.5872 1.3664 0.4622 0.2168  -0.0473 -0.2150 77  SER H N   
580  C CA  . SER A 77  ? 0.6019 1.3218 0.4860 0.2100  -0.0428 -0.2249 77  SER H CA  
581  C C   . SER A 77  ? 0.6579 1.3017 0.5471 0.1970  -0.0471 -0.2224 77  SER H C   
582  O O   . SER A 77  ? 0.5655 1.1571 0.4782 0.1919  -0.0523 -0.2535 77  SER H O   
583  C CB  . SER A 77  ? 0.5224 1.2383 0.4310 0.2144  -0.0485 -0.2739 77  SER H CB  
584  O OG  . SER A 77  ? 0.7222 1.5089 0.6252 0.2278  -0.0451 -0.2775 77  SER H OG  
585  N N   . THR A 78  ? 0.5334 1.1605 0.4189 0.1888  -0.0439 -0.1760 78  THR H N   
586  C CA  . THR A 78  ? 0.5239 1.0740 0.4275 0.1744  -0.0476 -0.1646 78  THR H CA  
587  C C   . THR A 78  ? 0.6157 1.1309 0.5235 0.1648  -0.0372 -0.1161 78  THR H C   
588  O O   . THR A 78  ? 0.6670 1.2182 0.5668 0.1674  -0.0299 -0.0788 78  THR H O   
589  C CB  . THR A 78  ? 0.5703 1.1296 0.4729 0.1743  -0.0583 -0.1681 78  THR H CB  
590  O OG1 . THR A 78  ? 0.6455 1.2350 0.5523 0.1808  -0.0704 -0.2195 78  THR H OG1 
591  C CG2 . THR A 78  ? 0.5873 1.0713 0.5089 0.1614  -0.0599 -0.1556 78  THR H CG2 
592  N N   . ALA A 79  ? 0.5487 0.9965 0.4725 0.1544  -0.0365 -0.1171 79  ALA H N   
593  C CA  . ALA A 79  ? 0.5364 0.9453 0.4687 0.1440  -0.0297 -0.0811 79  ALA H CA  
594  C C   . ALA A 79  ? 0.5508 0.9128 0.4890 0.1376  -0.0338 -0.0720 79  ALA H C   
595  O O   . ALA A 79  ? 0.5838 0.9257 0.5254 0.1381  -0.0412 -0.0957 79  ALA H O   
596  C CB  . ALA A 79  ? 0.4608 0.8361 0.4045 0.1385  -0.0272 -0.0885 79  ALA H CB  
597  N N   . TYR A 80  ? 0.5825 0.9275 0.5273 0.1319  -0.0279 -0.0377 80  TYR H N   
598  C CA  . TYR A 80  ? 0.5763 0.8824 0.5273 0.1286  -0.0298 -0.0277 80  TYR H CA  
599  C C   . TYR A 80  ? 0.6443 0.8944 0.6086 0.1191  -0.0260 -0.0167 80  TYR H C   
600  O O   . TYR A 80  ? 0.6507 0.8995 0.6248 0.1134  -0.0209 -0.0036 80  TYR H O   
601  C CB  . TYR A 80  ? 0.5877 0.9304 0.5379 0.1345  -0.0271 0.0018  80  TYR H CB  
602  C CG  . TYR A 80  ? 0.6901 1.0950 0.6247 0.1453  -0.0339 -0.0123 80  TYR H CG  
603  C CD1 . TYR A 80  ? 0.6354 1.0362 0.5698 0.1471  -0.0441 -0.0368 80  TYR H CD1 
604  C CD2 . TYR A 80  ? 0.6455 1.1185 0.5680 0.1540  -0.0302 -0.0021 80  TYR H CD2 
605  C CE1 . TYR A 80  ? 0.6545 1.1158 0.5782 0.1561  -0.0530 -0.0560 80  TYR H CE1 
606  C CE2 . TYR A 80  ? 0.7202 1.2580 0.6256 0.1656  -0.0381 -0.0205 80  TYR H CE2 
607  C CZ  . TYR A 80  ? 0.7235 1.2544 0.6303 0.1659  -0.0507 -0.0500 80  TYR H CZ  
608  O OH  . TYR A 80  ? 0.8311 1.4296 0.7244 0.1766  -0.0611 -0.0744 80  TYR H OH  
609  N N   . LEU A 81  ? 0.5953 0.8035 0.5617 0.1178  -0.0287 -0.0238 81  LEU H N   
610  C CA  . LEU A 81  ? 0.5286 0.6886 0.5048 0.1116  -0.0259 -0.0175 81  LEU H CA  
611  C C   . LEU A 81  ? 0.5728 0.7156 0.5555 0.1148  -0.0235 -0.0032 81  LEU H C   
612  O O   . LEU A 81  ? 0.6572 0.7968 0.6349 0.1196  -0.0267 -0.0127 81  LEU H O   
613  C CB  . LEU A 81  ? 0.5735 0.7025 0.5442 0.1103  -0.0300 -0.0414 81  LEU H CB  
614  C CG  . LEU A 81  ? 0.5202 0.6098 0.4957 0.1055  -0.0291 -0.0423 81  LEU H CG  
615  C CD1 . LEU A 81  ? 0.6878 0.7832 0.6769 0.0970  -0.0277 -0.0338 81  LEU H CD1 
616  C CD2 . LEU A 81  ? 0.5624 0.6343 0.5286 0.1084  -0.0328 -0.0613 81  LEU H CD2 
617  N N   . GLN A 82  ? 0.6794 0.8116 0.6794 0.1122  -0.0172 0.0204  82  GLN H N   
618  C CA  . GLN A 82  ? 0.6882 0.8120 0.6996 0.1179  -0.0133 0.0392  82  GLN H CA  
619  C C   . GLN A 82  ? 0.7423 0.8166 0.7735 0.1149  -0.0082 0.0418  82  GLN H C   
620  O O   . GLN A 82  ? 0.6963 0.7552 0.7455 0.1068  -0.0056 0.0450  82  GLN H O   
621  C CB  . GLN A 82  ? 0.6880 0.8576 0.7088 0.1226  -0.0088 0.0724  82  GLN H CB  
622  C CG  . GLN A 82  ? 0.9184 1.0858 0.9556 0.1307  -0.0041 0.0982  82  GLN H CG  
623  C CD  . GLN A 82  ? 1.0225 1.2448 1.0682 0.1380  0.0006  0.1365  82  GLN H CD  
624  O OE1 . GLN A 82  ? 0.9921 1.2584 1.0276 0.1377  0.0006  0.1417  82  GLN H OE1 
625  N NE2 . GLN A 82  ? 1.2042 1.4289 1.2692 0.1467  0.0056  0.1657  82  GLN H NE2 
626  N N   . TRP A 83  ? 0.6832 0.7352 0.7144 0.1217  -0.0068 0.0381  83  TRP H N   
627  C CA  . TRP A 83  ? 0.6397 0.6485 0.6908 0.1226  -0.0011 0.0378  83  TRP H CA  
628  C C   . TRP A 83  ? 0.7227 0.7349 0.7977 0.1311  0.0063  0.0674  83  TRP H C   
629  O O   . TRP A 83  ? 0.9019 0.9487 0.9696 0.1384  0.0049  0.0819  83  TRP H O   
630  C CB  . TRP A 83  ? 0.7051 0.6869 0.7387 0.1270  -0.0027 0.0108  83  TRP H CB  
631  C CG  . TRP A 83  ? 0.6840 0.6604 0.6985 0.1212  -0.0089 -0.0143 83  TRP H CG  
632  C CD1 . TRP A 83  ? 0.7693 0.7226 0.7873 0.1160  -0.0107 -0.0318 83  TRP H CD1 
633  C CD2 . TRP A 83  ? 0.6501 0.6470 0.6431 0.1210  -0.0146 -0.0250 83  TRP H CD2 
634  N NE1 . TRP A 83  ? 0.8023 0.7648 0.7991 0.1138  -0.0172 -0.0489 83  TRP H NE1 
635  C CE2 . TRP A 83  ? 0.7487 0.7349 0.7321 0.1171  -0.0186 -0.0437 83  TRP H CE2 
636  C CE3 . TRP A 83  ? 0.5913 0.6157 0.5771 0.1240  -0.0173 -0.0223 83  TRP H CE3 
637  C CZ2 . TRP A 83  ? 0.7463 0.7461 0.7146 0.1175  -0.0233 -0.0545 83  TRP H CZ2 
638  C CZ3 . TRP A 83  ? 0.6387 0.6723 0.6128 0.1229  -0.0221 -0.0377 83  TRP H CZ3 
639  C CH2 . TRP A 83  ? 0.6646 0.6848 0.6308 0.1204  -0.0241 -0.0510 83  TRP H CH2 
640  N N   . SER A 84  ? 0.7012 0.6793 0.8087 0.1308  0.0136  0.0751  84  SER H N   
641  C CA  . SER A 84  ? 0.7249 0.7007 0.8628 0.1409  0.0223  0.1053  84  SER H CA  
642  C C   . SER A 84  ? 0.9046 0.8452 1.0451 0.1508  0.0261  0.0881  84  SER H C   
643  O O   . SER A 84  ? 0.8747 0.8230 1.0272 0.1630  0.0313  0.1076  84  SER H O   
644  C CB  . SER A 84  ? 0.7159 0.6771 0.9014 0.1355  0.0304  0.1307  84  SER H CB  
645  O OG  . SER A 84  ? 0.9110 0.8244 1.1149 0.1266  0.0303  0.1017  84  SER H OG  
646  N N   . SER A 85  ? 0.9020 0.8100 1.0306 0.1471  0.0238  0.0520  85  SER H N   
647  C CA  . SER A 85  ? 0.8646 0.7451 0.9903 0.1584  0.0285  0.0317  85  SER H CA  
648  C C   . SER A 85  ? 0.8572 0.7329 0.9457 0.1565  0.0224  -0.0041 85  SER H C   
649  O O   . SER A 85  ? 0.8945 0.7497 0.9832 0.1504  0.0191  -0.0294 85  SER H O   
650  C CB  . SER A 85  ? 0.8954 0.7343 1.0641 0.1615  0.0367  0.0279  85  SER H CB  
651  O OG  . SER A 85  ? 1.0191 0.8362 1.1840 0.1756  0.0426  0.0067  85  SER H OG  
652  N N   . LEU A 86  ? 0.7157 0.6136 0.7766 0.1618  0.0206  -0.0047 86  LEU H N   
653  C CA  . LEU A 86  ? 0.6031 0.5032 0.6320 0.1619  0.0165  -0.0292 86  LEU H CA  
654  C C   . LEU A 86  ? 0.6677 0.5445 0.6904 0.1726  0.0222  -0.0533 86  LEU H C   
655  O O   . LEU A 86  ? 0.7954 0.6588 0.8340 0.1842  0.0313  -0.0505 86  LEU H O   
656  C CB  . LEU A 86  ? 0.6508 0.5786 0.6646 0.1652  0.0152  -0.0201 86  LEU H CB  
657  C CG  . LEU A 86  ? 0.6770 0.6340 0.6863 0.1551  0.0066  -0.0111 86  LEU H CG  
658  C CD1 . LEU A 86  ? 0.6240 0.6048 0.6313 0.1587  0.0053  -0.0059 86  LEU H CD1 
659  C CD2 . LEU A 86  ? 0.5560 0.5121 0.5489 0.1463  -0.0001 -0.0278 86  LEU H CD2 
660  N N   . LYS A 87  ? 0.6377 0.5147 0.6369 0.1705  0.0169  -0.0773 87  LYS H N   
661  C CA  . LYS A 87  ? 0.7943 0.6626 0.7781 0.1831  0.0211  -0.1031 87  LYS H CA  
662  C C   . LYS A 87  ? 0.8291 0.7228 0.7804 0.1903  0.0218  -0.1024 87  LYS H C   
663  O O   . LYS A 87  ? 0.7930 0.7036 0.7378 0.1824  0.0167  -0.0887 87  LYS H O   
664  C CB  . LYS A 87  ? 0.8168 0.6700 0.8042 0.1765  0.0134  -0.1338 87  LYS H CB  
665  C CG  . LYS A 87  ? 0.8541 0.6790 0.8856 0.1677  0.0138  -0.1328 87  LYS H CG  
666  C CD  . LYS A 87  ? 0.8332 0.6460 0.8760 0.1574  0.0039  -0.1653 87  LYS H CD  
667  N N   . ALA A 88  ? 0.7484 0.6464 0.6824 0.2066  0.0293  -0.1163 88  ALA H N   
668  C CA  . ALA A 88  ? 0.6607 0.5861 0.5684 0.2160  0.0330  -0.1096 88  ALA H CA  
669  C C   . ALA A 88  ? 0.7166 0.6561 0.6042 0.2090  0.0219  -0.1189 88  ALA H C   
670  O O   . ALA A 88  ? 0.7357 0.6961 0.6128 0.2108  0.0227  -0.1032 88  ALA H O   
671  C CB  . ALA A 88  ? 0.6863 0.6206 0.5781 0.2375  0.0449  -0.1217 88  ALA H CB  
672  N N   . SER A 89  ? 0.7752 0.7035 0.6641 0.2008  0.0118  -0.1433 89  SER H N   
673  C CA  . SER A 89  ? 0.8442 0.7889 0.7174 0.1942  -0.0002 -0.1539 89  SER H CA  
674  C C   . SER A 89  ? 0.9052 0.8517 0.7914 0.1783  -0.0066 -0.1342 89  SER H C   
675  O O   . SER A 89  ? 0.9290 0.8918 0.8055 0.1739  -0.0151 -0.1367 89  SER H O   
676  C CB  . SER A 89  ? 0.8508 0.7853 0.7288 0.1891  -0.0102 -0.1893 89  SER H CB  
677  O OG  . SER A 89  ? 0.8786 0.7820 0.7936 0.1758  -0.0108 -0.1891 89  SER H OG  
678  N N   . ASP A 90  ? 0.7259 0.6604 0.6341 0.1715  -0.0027 -0.1153 90  ASP H N   
679  C CA  . ASP A 90  ? 0.7270 0.6691 0.6458 0.1590  -0.0079 -0.0996 90  ASP H CA  
680  C C   . ASP A 90  ? 0.6223 0.5820 0.5344 0.1639  -0.0050 -0.0847 90  ASP H C   
681  O O   . ASP A 90  ? 0.6873 0.6560 0.6079 0.1560  -0.0094 -0.0768 90  ASP H O   
682  C CB  . ASP A 90  ? 0.7711 0.7033 0.7143 0.1521  -0.0055 -0.0853 90  ASP H CB  
683  C CG  . ASP A 90  ? 0.9026 0.8167 0.8651 0.1442  -0.0079 -0.0934 90  ASP H CG  
684  O OD1 . ASP A 90  ? 0.9383 0.8526 0.9000 0.1366  -0.0157 -0.1090 90  ASP H OD1 
685  O OD2 . ASP A 90  ? 0.9135 0.8141 0.8974 0.1456  -0.0020 -0.0825 90  ASP H OD2 
686  N N   . THR A 91  ? 0.6231 0.5893 0.5243 0.1778  0.0033  -0.0809 91  THR H N   
687  C CA  . THR A 91  ? 0.7058 0.6873 0.6104 0.1829  0.0081  -0.0635 91  THR H CA  
688  C C   . THR A 91  ? 0.5989 0.5936 0.4962 0.1812  0.0015  -0.0643 91  THR H C   
689  O O   . THR A 91  ? 0.8030 0.8106 0.6796 0.1902  0.0006  -0.0704 91  THR H O   
690  C CB  . THR A 91  ? 0.6901 0.6813 0.5862 0.1999  0.0209  -0.0548 91  THR H CB  
691  O OG1 . THR A 91  ? 0.7344 0.7151 0.6418 0.2028  0.0280  -0.0523 91  THR H OG1 
692  C CG2 . THR A 91  ? 0.6438 0.6504 0.5542 0.2039  0.0273  -0.0316 91  THR H CG2 
693  N N   . ALA A 92  ? 0.5833 0.5792 0.4981 0.1713  -0.0034 -0.0592 92  ALA H N   
694  C CA  . ALA A 92  ? 0.7153 0.7228 0.6296 0.1703  -0.0092 -0.0593 92  ALA H CA  
695  C C   . ALA A 92  ? 0.6265 0.6349 0.5669 0.1631  -0.0108 -0.0541 92  ALA H C   
696  O O   . ALA A 92  ? 0.6962 0.7002 0.6528 0.1579  -0.0094 -0.0528 92  ALA H O   
697  C CB  . ALA A 92  ? 0.5558 0.5645 0.4574 0.1632  -0.0194 -0.0764 92  ALA H CB  
698  N N   . VAL A 93  ? 0.5338 0.5512 0.4801 0.1641  -0.0142 -0.0533 93  VAL H N   
699  C CA  . VAL A 93  ? 0.5281 0.5471 0.5004 0.1583  -0.0168 -0.0561 93  VAL H CA  
700  C C   . VAL A 93  ? 0.6521 0.6779 0.6171 0.1494  -0.0254 -0.0705 93  VAL H C   
701  O O   . VAL A 93  ? 0.6576 0.6909 0.6099 0.1503  -0.0298 -0.0736 93  VAL H O   
702  C CB  . VAL A 93  ? 0.5520 0.5758 0.5453 0.1668  -0.0129 -0.0441 93  VAL H CB  
703  C CG1 . VAL A 93  ? 0.4626 0.4863 0.4866 0.1614  -0.0162 -0.0548 93  VAL H CG1 
704  C CG2 . VAL A 93  ? 0.5584 0.5794 0.5664 0.1756  -0.0018 -0.0235 93  VAL H CG2 
705  N N   . TYR A 94  ? 0.5907 0.6197 0.5649 0.1416  -0.0279 -0.0782 94  TYR H N   
706  C CA  . TYR A 94  ? 0.4526 0.4943 0.4212 0.1343  -0.0334 -0.0869 94  TYR H CA  
707  C C   . TYR A 94  ? 0.5743 0.6311 0.5601 0.1347  -0.0355 -0.0969 94  TYR H C   
708  O O   . TYR A 94  ? 0.6314 0.6919 0.6340 0.1349  -0.0353 -0.1039 94  TYR H O   
709  C CB  . TYR A 94  ? 0.3879 0.4315 0.3516 0.1280  -0.0335 -0.0851 94  TYR H CB  
710  C CG  . TYR A 94  ? 0.4965 0.5234 0.4483 0.1279  -0.0313 -0.0792 94  TYR H CG  
711  C CD1 . TYR A 94  ? 0.5226 0.5474 0.4688 0.1224  -0.0340 -0.0816 94  TYR H CD1 
712  C CD2 . TYR A 94  ? 0.5972 0.6111 0.5485 0.1335  -0.0260 -0.0733 94  TYR H CD2 
713  C CE1 . TYR A 94  ? 0.5944 0.6018 0.5357 0.1226  -0.0325 -0.0825 94  TYR H CE1 
714  C CE2 . TYR A 94  ? 0.5815 0.5807 0.5234 0.1358  -0.0231 -0.0723 94  TYR H CE2 
715  C CZ  . TYR A 94  ? 0.6097 0.6041 0.5470 0.1304  -0.0268 -0.0791 94  TYR H CZ  
716  O OH  . TYR A 94  ? 0.7368 0.7144 0.6705 0.1328  -0.0244 -0.0841 94  TYR H OH  
717  N N   . TYR A 95  ? 0.5017 0.5694 0.4858 0.1352  -0.0380 -0.1002 95  TYR H N   
718  C CA  . TYR A 95  ? 0.4502 0.5341 0.4511 0.1379  -0.0389 -0.1119 95  TYR H CA  
719  C C   . TYR A 95  ? 0.6602 0.7695 0.6531 0.1325  -0.0408 -0.1177 95  TYR H C   
720  O O   . TYR A 95  ? 0.5953 0.7089 0.5768 0.1268  -0.0420 -0.1098 95  TYR H O   
721  C CB  . TYR A 95  ? 0.5199 0.6037 0.5307 0.1458  -0.0386 -0.1081 95  TYR H CB  
722  C CG  . TYR A 95  ? 0.6222 0.6886 0.6471 0.1544  -0.0343 -0.0962 95  TYR H CG  
723  C CD1 . TYR A 95  ? 0.6236 0.6814 0.6822 0.1587  -0.0304 -0.1004 95  TYR H CD1 
724  C CD2 . TYR A 95  ? 0.5635 0.6257 0.5717 0.1588  -0.0336 -0.0806 95  TYR H CD2 
725  C CE1 . TYR A 95  ? 0.6177 0.6610 0.6975 0.1664  -0.0241 -0.0830 95  TYR H CE1 
726  C CE2 . TYR A 95  ? 0.6604 0.7145 0.6813 0.1689  -0.0273 -0.0636 95  TYR H CE2 
727  C CZ  . TYR A 95  ? 0.6817 0.7255 0.7408 0.1723  -0.0217 -0.0616 95  TYR H CZ  
728  O OH  . TYR A 95  ? 0.6937 0.7307 0.7735 0.1822  -0.0132 -0.0384 95  TYR H OH  
729  N N   . CYS A 96  ? 0.4287 0.5581 0.4310 0.1346  -0.0408 -0.1320 96  CYS H N   
730  C CA  . CYS A 96  ? 0.5772 0.7407 0.5738 0.1336  -0.0404 -0.1363 96  CYS H CA  
731  C C   . CYS A 96  ? 0.5686 0.7436 0.5813 0.1416  -0.0394 -0.1494 96  CYS H C   
732  O O   . CYS A 96  ? 0.5142 0.6748 0.5474 0.1483  -0.0392 -0.1608 96  CYS H O   
733  C CB  . CYS A 96  ? 0.5411 0.7318 0.5326 0.1339  -0.0409 -0.1447 96  CYS H CB  
734  S SG  . CYS A 96  ? 0.9528 1.1566 0.9652 0.1424  -0.0437 -0.1783 96  CYS H SG  
735  N N   . ALA A 97  ? 0.6000 0.8005 0.6094 0.1411  -0.0378 -0.1457 97  ALA H N   
736  C CA  . ALA A 97  ? 0.5138 0.7279 0.5402 0.1503  -0.0360 -0.1561 97  ALA H CA  
737  C C   . ALA A 97  ? 0.3856 0.6436 0.4085 0.1511  -0.0321 -0.1567 97  ALA H C   
738  O O   . ALA A 97  ? 0.5458 0.8184 0.5569 0.1421  -0.0309 -0.1399 97  ALA H O   
739  C CB  . ALA A 97  ? 0.5521 0.7467 0.5853 0.1513  -0.0383 -0.1432 97  ALA H CB  
740  N N   . ARG A 98  ? 0.4095 0.6895 0.4474 0.1628  -0.0287 -0.1750 98  ARG H N   
741  C CA  . ARG A 98  ? 0.5091 0.8376 0.5452 0.1668  -0.0227 -0.1759 98  ARG H CA  
742  C C   . ARG A 98  ? 0.5997 0.9352 0.6489 0.1659  -0.0219 -0.1612 98  ARG H C   
743  O O   . ARG A 98  ? 0.6674 0.9859 0.7344 0.1732  -0.0238 -0.1654 98  ARG H O   
744  C CB  . ARG A 98  ? 0.5435 0.8988 0.5895 0.1823  -0.0188 -0.2081 98  ARG H CB  
745  C CG  . ARG A 98  ? 0.6734 1.0891 0.7124 0.1894  -0.0106 -0.2096 98  ARG H CG  
746  C CD  . ARG A 98  ? 0.6171 1.0608 0.6670 0.2076  -0.0068 -0.2485 98  ARG H CD  
747  N NE  . ARG A 98  ? 0.5299 0.9601 0.6111 0.2184  -0.0041 -0.2591 98  ARG H NE  
748  C CZ  . ARG A 98  ? 0.6875 1.1419 0.7863 0.2356  0.0012  -0.2909 98  ARG H CZ  
749  N NH1 . ARG A 98  ? 0.5739 1.0607 0.6558 0.2368  0.0001  -0.3105 98  ARG H NH1 
750  N NH2 . ARG A 98  ? 0.6932 1.1287 0.8238 0.2437  0.0035  -0.2929 98  ARG H NH2 
751  N N   . VAL A 99  ? 0.5872 0.9505 0.6321 0.1569  -0.0192 -0.1418 99  VAL H N   
752  C CA  . VAL A 99  ? 0.4985 0.8773 0.5606 0.1542  -0.0195 -0.1292 99  VAL H CA  
753  C C   . VAL A 99  ? 0.4818 0.9048 0.5584 0.1691  -0.0109 -0.1405 99  VAL H C   
754  O O   . VAL A 99  ? 0.5770 1.0417 0.6468 0.1735  -0.0021 -0.1421 99  VAL H O   
755  C CB  . VAL A 99  ? 0.4287 0.8201 0.4926 0.1370  -0.0193 -0.1043 99  VAL H CB  
756  C CG1 . VAL A 99  ? 0.5388 0.9484 0.6270 0.1324  -0.0221 -0.0947 99  VAL H CG1 
757  C CG2 . VAL A 99  ? 0.4356 0.7835 0.4873 0.1243  -0.0266 -0.0968 99  VAL H CG2 
758  N N   . GLY A 100 ? 0.5168 0.9344 0.6136 0.1790  -0.0128 -0.1470 100 GLY H N   
759  C CA  . GLY A 100 ? 0.4195 0.8768 0.5351 0.1954  -0.0041 -0.1587 100 GLY H CA  
760  C C   . GLY A 100 ? 0.3993 0.9082 0.5219 0.1898  0.0025  -0.1400 100 GLY H C   
761  O O   . GLY A 100 ? 0.4829 0.9897 0.6087 0.1722  -0.0027 -0.1170 100 GLY H O   
762  N N   . ARG A 101 ? 0.4100 0.9674 0.5391 0.2049  0.0145  -0.1510 101 ARG H N   
763  C CA  . ARG A 101 ? 0.4801 1.0945 0.6208 0.2018  0.0240  -0.1302 101 ARG H CA  
764  C C   . ARG A 101 ? 0.4910 1.1179 0.6650 0.2042  0.0217  -0.1215 101 ARG H C   
765  O O   . ARG A 101 ? 0.4921 1.1617 0.6840 0.2209  0.0319  -0.1284 101 ARG H O   
766  C CB  . ARG A 101 ? 0.5316 1.2029 0.6625 0.2199  0.0393  -0.1447 101 ARG H CB  
767  C CG  . ARG A 101 ? 0.5847 1.3208 0.7234 0.2156  0.0523  -0.1150 101 ARG H CG  
768  C CD  . ARG A 101 ? 0.6683 1.4702 0.7918 0.2377  0.0685  -0.1302 101 ARG H CD  
769  N NE  . ARG A 101 ? 0.7120 1.5206 0.8002 0.2374  0.0690  -0.1338 101 ARG H NE  
770  C CZ  . ARG A 101 ? 0.7894 1.5785 0.8527 0.2479  0.0625  -0.1708 101 ARG H CZ  
771  N NH1 . ARG A 101 ? 0.8355 1.5903 0.9091 0.2577  0.0561  -0.2056 101 ARG H NH1 
772  N NH2 . ARG A 101 ? 0.7431 1.5430 0.7757 0.2459  0.0603  -0.1701 101 ARG H NH2 
773  N N   . PHE A 102 ? 0.5731 1.1666 0.7550 0.1890  0.0079  -0.1079 102 PHE H N   
774  C CA  . PHE A 102 ? 0.5921 1.2013 0.8049 0.1900  0.0019  -0.0987 102 PHE H CA  
775  C C   . PHE A 102 ? 0.3826 0.9875 0.6053 0.1648  -0.0102 -0.0779 102 PHE H C   
776  O O   . PHE A 102 ? 0.3847 0.9625 0.5906 0.1480  -0.0142 -0.0723 102 PHE H O   
777  C CB  . PHE A 102 ? 0.4750 1.0500 0.6927 0.2053  -0.0055 -0.1117 102 PHE H CB  
778  C CG  . PHE A 102 ? 0.4079 0.9899 0.6345 0.2312  0.0062  -0.1344 102 PHE H CG  
779  C CD1 . PHE A 102 ? 0.4408 0.9917 0.6489 0.2381  0.0096  -0.1571 102 PHE H CD1 
780  C CD2 . PHE A 102 ? 0.4175 1.0385 0.6758 0.2489  0.0135  -0.1355 102 PHE H CD2 
781  C CE1 . PHE A 102 ? 0.4304 0.9864 0.6533 0.2612  0.0192  -0.1846 102 PHE H CE1 
782  C CE2 . PHE A 102 ? 0.5015 1.1267 0.7733 0.2740  0.0248  -0.1609 102 PHE H CE2 
783  C CZ  . PHE A 102 ? 0.5630 1.1546 0.8181 0.2798  0.0272  -0.1875 102 PHE H CZ  
784  N N   . ALA A 103 ? 0.4006 1.0338 0.6545 0.1626  -0.0167 -0.0687 103 ALA H N   
785  C CA  . ALA A 103 ? 0.4895 1.1263 0.7620 0.1382  -0.0300 -0.0550 103 ALA H CA  
786  C C   . ALA A 103 ? 0.3797 0.9655 0.6306 0.1294  -0.0475 -0.0629 103 ALA H C   
787  O O   . ALA A 103 ? 0.4519 1.0273 0.7093 0.1077  -0.0579 -0.0591 103 ALA H O   
788  C CB  . ALA A 103 ? 0.4595 1.1452 0.7729 0.1397  -0.0347 -0.0469 103 ALA H CB  
789  N N   . SER A 104 ? 0.4176 0.9734 0.6468 0.1470  -0.0497 -0.0740 104 SER H N   
790  C CA  . SER A 104 ? 0.4494 0.9644 0.6567 0.1431  -0.0640 -0.0787 104 SER H CA  
791  C C   . SER A 104 ? 0.5575 1.0270 0.7337 0.1350  -0.0606 -0.0839 104 SER H C   
792  O O   . SER A 104 ? 0.5007 0.9385 0.6588 0.1285  -0.0709 -0.0871 104 SER H O   
793  C CB  . SER A 104 ? 0.5259 1.0323 0.7310 0.1663  -0.0662 -0.0807 104 SER H CB  
794  O OG  . SER A 104 ? 0.5801 1.1294 0.8142 0.1743  -0.0723 -0.0730 104 SER H OG  
795  N N   . HIS A 105 ? 0.5835 1.0561 0.7533 0.1373  -0.0462 -0.0849 105 HIS H N   
796  C CA  . HIS A 105 ? 0.4029 0.8406 0.5456 0.1317  -0.0423 -0.0882 105 HIS H CA  
797  C C   . HIS A 105 ? 0.4678 0.8615 0.5887 0.1413  -0.0470 -0.0984 105 HIS H C   
798  O O   . HIS A 105 ? 0.4099 0.7700 0.5113 0.1325  -0.0508 -0.0987 105 HIS H O   
799  C CB  . HIS A 105 ? 0.4878 0.9153 0.6331 0.1087  -0.0476 -0.0781 105 HIS H CB  
800  C CG  . HIS A 105 ? 0.4833 0.9519 0.6585 0.0969  -0.0410 -0.0623 105 HIS H CG  
801  N ND1 . HIS A 105 ? 0.4320 0.9318 0.6413 0.0888  -0.0477 -0.0569 105 HIS H ND1 
802  C CD2 . HIS A 105 ? 0.3812 0.8697 0.5609 0.0921  -0.0276 -0.0475 105 HIS H CD2 
803  C CE1 . HIS A 105 ? 0.5216 1.0556 0.7590 0.0783  -0.0377 -0.0390 105 HIS H CE1 
804  N NE2 . HIS A 105 ? 0.5834 1.1123 0.8023 0.0811  -0.0246 -0.0309 105 HIS H NE2 
805  N N   . GLN A 106 ? 0.4796 0.8744 0.6090 0.1600  -0.0454 -0.1044 106 GLN H N   
806  C CA  . GLN A 106 ? 0.5305 0.8868 0.6494 0.1700  -0.0477 -0.1086 106 GLN H CA  
807  C C   . GLN A 106 ? 0.5238 0.8552 0.6286 0.1716  -0.0400 -0.1208 106 GLN H C   
808  O O   . GLN A 106 ? 0.5158 0.8671 0.6185 0.1706  -0.0323 -0.1284 106 GLN H O   
809  C CB  . GLN A 106 ? 0.3902 0.7551 0.5330 0.1905  -0.0462 -0.1074 106 GLN H CB  
810  C CG  . GLN A 106 ? 0.4961 0.8747 0.6584 0.2056  -0.0337 -0.1220 106 GLN H CG  
811  C CD  . GLN A 106 ? 0.4979 0.9265 0.6760 0.2064  -0.0291 -0.1209 106 GLN H CD  
812  O OE1 . GLN A 106 ? 0.5999 1.0514 0.7771 0.1917  -0.0351 -0.1085 106 GLN H OE1 
813  N NE2 . GLN A 106 ? 0.4955 0.9428 0.6929 0.2237  -0.0180 -0.1351 106 GLN H NE2 
814  N N   . LEU A 107 ? 0.4917 0.7856 0.5883 0.1750  -0.0422 -0.1217 107 LEU H N   
815  C CA  . LEU A 107 ? 0.5066 0.7773 0.5947 0.1755  -0.0373 -0.1343 107 LEU H CA  
816  C C   . LEU A 107 ? 0.5687 0.8268 0.6825 0.1925  -0.0319 -0.1469 107 LEU H C   
817  O O   . LEU A 107 ? 0.6663 0.8967 0.7907 0.1984  -0.0331 -0.1387 107 LEU H O   
818  C CB  . LEU A 107 ? 0.5257 0.7633 0.5926 0.1655  -0.0423 -0.1262 107 LEU H CB  
819  C CG  . LEU A 107 ? 0.5540 0.7968 0.6031 0.1489  -0.0475 -0.1168 107 LEU H CG  
820  C CD1 . LEU A 107 ? 0.5706 0.7818 0.6022 0.1436  -0.0525 -0.1108 107 LEU H CD1 
821  C CD2 . LEU A 107 ? 0.5585 0.8177 0.6014 0.1410  -0.0420 -0.1195 107 LEU H CD2 
822  N N   . ASP A 108 ? 0.5305 0.8108 0.6577 0.2010  -0.0252 -0.1666 108 ASP H N   
823  C CA  . ASP A 108 ? 0.5882 0.8581 0.7501 0.2181  -0.0197 -0.1842 108 ASP H CA  
824  C C   . ASP A 108 ? 0.6097 0.8454 0.7794 0.2172  -0.0196 -0.1998 108 ASP H C   
825  O O   . ASP A 108 ? 0.6999 0.9084 0.9051 0.2269  -0.0171 -0.2018 108 ASP H O   
826  C CB  . ASP A 108 ? 0.6444 0.9536 0.8180 0.2291  -0.0123 -0.2067 108 ASP H CB  
827  C CG  . ASP A 108 ? 0.7304 1.0710 0.8731 0.2205  -0.0107 -0.2173 108 ASP H CG  
828  O OD1 . ASP A 108 ? 0.8038 1.1283 0.9236 0.2084  -0.0150 -0.2153 108 ASP H OD1 
829  O OD2 . ASP A 108 ? 0.7355 1.1212 0.8782 0.2273  -0.0041 -0.2248 108 ASP H OD2 
830  N N   . TYR A 109 ? 0.6408 0.8801 0.7830 0.2056  -0.0221 -0.2085 109 TYR H N   
831  C CA  . TYR A 109 ? 0.5303 0.7443 0.6813 0.2032  -0.0237 -0.2251 109 TYR H CA  
832  C C   . TYR A 109 ? 0.5625 0.7585 0.6844 0.1885  -0.0286 -0.2064 109 TYR H C   
833  O O   . TYR A 109 ? 0.6425 0.8561 0.7323 0.1790  -0.0305 -0.1942 109 TYR H O   
834  C CB  . TYR A 109 ? 0.4377 0.6812 0.5888 0.2077  -0.0225 -0.2620 109 TYR H CB  
835  C CG  . TYR A 109 ? 0.5627 0.8186 0.7499 0.2248  -0.0169 -0.2896 109 TYR H CG  
836  C CD1 . TYR A 109 ? 0.6894 0.9113 0.9196 0.2273  -0.0168 -0.3068 109 TYR H CD1 
837  C CD2 . TYR A 109 ? 0.4585 0.7564 0.6382 0.2336  -0.0114 -0.2922 109 TYR H CD2 
838  C CE1 . TYR A 109 ? 0.7629 0.9864 1.0233 0.2352  -0.0122 -0.3240 109 TYR H CE1 
839  C CE2 . TYR A 109 ? 0.5540 0.8559 0.7613 0.2429  -0.0067 -0.3096 109 TYR H CE2 
840  C CZ  . TYR A 109 ? 0.7013 0.9643 0.9481 0.2438  -0.0072 -0.3262 109 TYR H CZ  
841  O OH  . TYR A 109 ? 0.7659 1.0304 1.0429 0.2534  -0.0018 -0.3442 109 TYR H OH  
842  N N   . TRP A 110 ? 0.5623 0.7235 0.7014 0.1872  -0.0294 -0.2031 110 TRP H N   
843  C CA  . TRP A 110 ? 0.5097 0.6525 0.6258 0.1760  -0.0325 -0.1850 110 TRP H CA  
844  C C   . TRP A 110 ? 0.4383 0.5709 0.5656 0.1717  -0.0345 -0.2023 110 TRP H C   
845  O O   . TRP A 110 ? 0.5578 0.6866 0.7210 0.1772  -0.0339 -0.2270 110 TRP H O   
846  C CB  . TRP A 110 ? 0.4528 0.5701 0.5761 0.1790  -0.0310 -0.1570 110 TRP H CB  
847  C CG  . TRP A 110 ? 0.5545 0.6866 0.6625 0.1816  -0.0325 -0.1395 110 TRP H CG  
848  C CD1 . TRP A 110 ? 0.4928 0.6427 0.6179 0.1914  -0.0310 -0.1409 110 TRP H CD1 
849  C CD2 . TRP A 110 ? 0.5091 0.6422 0.5858 0.1747  -0.0369 -0.1208 110 TRP H CD2 
850  N NE1 . TRP A 110 ? 0.5643 0.7292 0.6707 0.1898  -0.0354 -0.1230 110 TRP H NE1 
851  C CE2 . TRP A 110 ? 0.5492 0.7036 0.6261 0.1792  -0.0396 -0.1129 110 TRP H CE2 
852  C CE3 . TRP A 110 ? 0.5350 0.6545 0.5866 0.1657  -0.0390 -0.1125 110 TRP H CE3 
853  C CZ2 . TRP A 110 ? 0.4924 0.6559 0.5460 0.1736  -0.0461 -0.1008 110 TRP H CZ2 
854  C CZ3 . TRP A 110 ? 0.5273 0.6526 0.5555 0.1616  -0.0439 -0.1013 110 TRP H CZ3 
855  C CH2 . TRP A 110 ? 0.5869 0.7345 0.6167 0.1648  -0.0483 -0.0973 110 TRP H CH2 
856  N N   . GLY A 111 ? 0.5421 0.6711 0.6433 0.1619  -0.0372 -0.1909 111 GLY H N   
857  C CA  . GLY A 111 ? 0.6153 0.7358 0.7286 0.1571  -0.0399 -0.2019 111 GLY H CA  
858  C C   . GLY A 111 ? 0.7272 0.8119 0.8681 0.1578  -0.0362 -0.1849 111 GLY H C   
859  O O   . GLY A 111 ? 0.7805 0.8515 0.9236 0.1632  -0.0318 -0.1626 111 GLY H O   
860  N N   . GLN A 112 ? 0.5863 0.6615 0.7501 0.1531  -0.0379 -0.1932 112 GLN H N   
861  C CA  . GLN A 112 ? 0.5605 0.6059 0.7567 0.1538  -0.0322 -0.1730 112 GLN H CA  
862  C C   . GLN A 112 ? 0.5823 0.6202 0.7430 0.1516  -0.0290 -0.1413 112 GLN H C   
863  O O   . GLN A 112 ? 0.6636 0.6841 0.8396 0.1555  -0.0220 -0.1167 112 GLN H O   
864  C CB  . GLN A 112 ? 0.6661 0.7065 0.9063 0.1479  -0.0354 -0.1934 112 GLN H CB  
865  C CG  . GLN A 112 ? 0.5816 0.6367 0.7980 0.1390  -0.0414 -0.1958 112 GLN H CG  
866  C CD  . GLN A 112 ? 0.7141 0.8065 0.9027 0.1371  -0.0508 -0.2244 112 GLN H CD  
867  O OE1 . GLN A 112 ? 0.7446 0.8535 0.9226 0.1426  -0.0517 -0.2401 112 GLN H OE1 
868  N NE2 . GLN A 112 ? 0.7021 0.8132 0.8795 0.1311  -0.0572 -0.2287 112 GLN H NE2 
869  N N   . GLY A 113 ? 0.5793 0.6328 0.6956 0.1467  -0.0333 -0.1415 113 GLY H N   
870  C CA  . GLY A 113 ? 0.5029 0.5490 0.5877 0.1451  -0.0308 -0.1185 113 GLY H CA  
871  C C   . GLY A 113 ? 0.5927 0.6373 0.6782 0.1396  -0.0313 -0.1169 113 GLY H C   
872  O O   . GLY A 113 ? 0.5388 0.5819 0.6587 0.1375  -0.0322 -0.1264 113 GLY H O   
873  N N   . THR A 114 ? 0.5570 0.6026 0.6098 0.1374  -0.0312 -0.1058 114 THR H N   
874  C CA  . THR A 114 ? 0.6129 0.6588 0.6659 0.1343  -0.0308 -0.1006 114 THR H CA  
875  C C   . THR A 114 ? 0.6323 0.6613 0.6714 0.1388  -0.0232 -0.0795 114 THR H C   
876  O O   . THR A 114 ? 0.6620 0.6872 0.6724 0.1401  -0.0225 -0.0743 114 THR H O   
877  C CB  . THR A 114 ? 0.6677 0.7343 0.6995 0.1297  -0.0363 -0.1060 114 THR H CB  
878  O OG1 . THR A 114 ? 0.7387 0.8307 0.7799 0.1281  -0.0429 -0.1273 114 THR H OG1 
879  C CG2 . THR A 114 ? 0.6332 0.7021 0.6679 0.1287  -0.0356 -0.0972 114 THR H CG2 
880  N N   . LEU A 115 ? 0.6280 0.6495 0.6911 0.1416  -0.0171 -0.0691 115 LEU H N   
881  C CA  . LEU A 115 ? 0.5512 0.5637 0.6016 0.1488  -0.0079 -0.0494 115 LEU H CA  
882  C C   . LEU A 115 ? 0.5701 0.5843 0.6057 0.1474  -0.0078 -0.0477 115 LEU H C   
883  O O   . LEU A 115 ? 0.6691 0.6914 0.7256 0.1436  -0.0094 -0.0488 115 LEU H O   
884  C CB  . LEU A 115 ? 0.5872 0.5961 0.6739 0.1535  0.0012  -0.0332 115 LEU H CB  
885  C CG  . LEU A 115 ? 0.7649 0.7731 0.8404 0.1635  0.0132  -0.0109 115 LEU H CG  
886  C CD1 . LEU A 115 ? 0.7477 0.7574 0.7836 0.1736  0.0157  -0.0058 115 LEU H CD1 
887  C CD2 . LEU A 115 ? 0.7723 0.7819 0.8933 0.1670  0.0239  0.0101  115 LEU H CD2 
888  N N   . VAL A 116 ? 0.5947 0.6026 0.5987 0.1508  -0.0064 -0.0460 116 VAL H N   
889  C CA  . VAL A 116 ? 0.6126 0.6178 0.6073 0.1517  -0.0044 -0.0427 116 VAL H CA  
890  C C   . VAL A 116 ? 0.7092 0.7060 0.6925 0.1630  0.0061  -0.0333 116 VAL H C   
891  O O   . VAL A 116 ? 0.7495 0.7422 0.7110 0.1687  0.0076  -0.0367 116 VAL H O   
892  C CB  . VAL A 116 ? 0.6430 0.6465 0.6199 0.1465  -0.0102 -0.0500 116 VAL H CB  
893  C CG1 . VAL A 116 ? 0.5461 0.5430 0.5213 0.1493  -0.0062 -0.0432 116 VAL H CG1 
894  C CG2 . VAL A 116 ? 0.4492 0.4702 0.4339 0.1381  -0.0186 -0.0573 116 VAL H CG2 
895  N N   . THR A 117 ? 0.6071 0.6069 0.6054 0.1673  0.0130  -0.0229 117 THR H N   
896  C CA  . THR A 117 ? 0.6178 0.6154 0.6061 0.1806  0.0251  -0.0142 117 THR H CA  
897  C C   . THR A 117 ? 0.6652 0.6560 0.6496 0.1843  0.0278  -0.0157 117 THR H C   
898  O O   . THR A 117 ? 0.7051 0.7023 0.7101 0.1802  0.0259  -0.0098 117 THR H O   
899  C CB  . THR A 117 ? 0.6899 0.6992 0.7054 0.1858  0.0351  0.0044  117 THR H CB  
900  O OG1 . THR A 117 ? 0.7438 0.7566 0.7716 0.1836  0.0341  0.0092  117 THR H OG1 
901  C CG2 . THR A 117 ? 0.6676 0.6825 0.6692 0.2026  0.0499  0.0151  117 THR H CG2 
902  N N   . VAL A 118 ? 0.6893 0.6693 0.6505 0.1928  0.0318  -0.0251 118 VAL H N   
903  C CA  . VAL A 118 ? 0.6506 0.6191 0.6141 0.1980  0.0358  -0.0282 118 VAL H CA  
904  C C   . VAL A 118 ? 0.7368 0.7060 0.6886 0.2160  0.0491  -0.0307 118 VAL H C   
905  O O   . VAL A 118 ? 0.6894 0.6590 0.6163 0.2233  0.0502  -0.0451 118 VAL H O   
906  C CB  . VAL A 118 ? 0.5472 0.4979 0.5034 0.1906  0.0277  -0.0432 118 VAL H CB  
907  C CG1 . VAL A 118 ? 0.5800 0.5154 0.5498 0.1966  0.0334  -0.0429 118 VAL H CG1 
908  C CG2 . VAL A 118 ? 0.6925 0.6497 0.6570 0.1753  0.0165  -0.0394 118 VAL H CG2 
909  N N   . SER A 119 ? 1.0838 0.9926 0.9022 0.3193  0.2342  0.2931  119 SER H N   
910  C CA  . SER A 119 ? 0.9667 0.8561 0.7938 0.3133  0.2196  0.2747  119 SER H CA  
911  C C   . SER A 119 ? 0.9909 0.8794 0.7850 0.3490  0.2154  0.2787  119 SER H C   
912  O O   . SER A 119 ? 0.8930 0.8054 0.6567 0.3756  0.2156  0.2897  119 SER H O   
913  C CB  . SER A 119 ? 1.0743 0.9937 0.9191 0.2929  0.1985  0.2410  119 SER H CB  
914  O OG  . SER A 119 ? 1.2307 1.1942 1.0545 0.3110  0.1845  0.2264  119 SER H OG  
915  N N   . SER A 120 ? 1.0120 0.8723 0.8107 0.3512  0.2110  0.2700  120 SER H N   
916  C CA  . SER A 120 ? 0.9208 0.7801 0.6963 0.3875  0.2083  0.2761  120 SER H CA  
917  C C   . SER A 120 ? 0.8810 0.8001 0.6557 0.3993  0.1868  0.2531  120 SER H C   
918  O O   . SER A 120 ? 1.0356 0.9709 0.7979 0.4307  0.1806  0.2580  120 SER H O   
919  C CB  . SER A 120 ? 0.9578 0.7594 0.7375 0.3884  0.2155  0.2755  120 SER H CB  
920  O OG  . SER A 120 ? 1.2666 1.0646 1.0664 0.3613  0.2059  0.2461  120 SER H OG  
921  N N   . ALA A 121 ? 0.8444 0.7969 0.6354 0.3737  0.1749  0.2299  121 ALA H N   
922  C CA  . ALA A 121 ? 0.8886 0.8959 0.6839 0.3776  0.1545  0.2075  121 ALA H CA  
923  C C   . ALA A 121 ? 1.0241 1.0719 0.7941 0.3993  0.1438  0.2152  121 ALA H C   
924  O O   . ALA A 121 ? 0.8309 0.8642 0.5760 0.4095  0.1544  0.2362  121 ALA H O   
925  C CB  . ALA A 121 ? 0.7402 0.7625 0.5567 0.3430  0.1460  0.1825  121 ALA H CB  
926  N N   . SER A 122 ? 0.8888 0.9864 0.6639 0.4054  0.1228  0.1985  122 SER H N   
927  C CA  . SER A 122 ? 0.9325 1.0695 0.6815 0.4221  0.1055  0.2007  122 SER H CA  
928  C C   . SER A 122 ? 0.8890 1.0664 0.6483 0.3989  0.0857  0.1729  122 SER H C   
929  O O   . SER A 122 ? 0.9052 1.0850 0.6943 0.3739  0.0855  0.1542  122 SER H O   
930  C CB  . SER A 122 ? 1.0559 1.2178 0.8009 0.4566  0.0937  0.2123  122 SER H CB  
931  O OG  . SER A 122 ? 1.0867 1.2048 0.8169 0.4807  0.1126  0.2400  122 SER H OG  
932  N N   . THR A 123 ? 0.7932 0.9969 0.5227 0.4071  0.0688  0.1703  123 THR H N   
933  C CA  . THR A 123 ? 0.8839 1.1179 0.6167 0.3849  0.0491  0.1441  123 THR H CA  
934  C C   . THR A 123 ? 0.8719 1.1490 0.6450 0.3755  0.0309  0.1270  123 THR H C   
935  O O   . THR A 123 ? 0.8765 1.1877 0.6577 0.3959  0.0165  0.1333  123 THR H O   
936  C CB  . THR A 123 ? 0.7748 1.0226 0.4590 0.3981  0.0316  0.1435  123 THR H CB  
937  O OG1 . THR A 123 ? 1.1615 1.3697 0.8071 0.4065  0.0537  0.1593  123 THR H OG1 
938  C CG2 . THR A 123 ? 0.7539 1.0258 0.4400 0.3736  0.0096  0.1145  123 THR H CG2 
939  N N   . LYS A 124 ? 0.7698 1.0471 0.5698 0.3455  0.0326  0.1076  124 LYS H N   
940  C CA  . LYS A 124 ? 0.7380 1.0538 0.5778 0.3335  0.0213  0.0929  124 LYS H CA  
941  C C   . LYS A 124 ? 0.7117 1.0378 0.5596 0.3006  0.0103  0.0695  124 LYS H C   
942  O O   . LYS A 124 ? 0.5923 0.8844 0.4307 0.2832  0.0212  0.0641  124 LYS H O   
943  C CB  . LYS A 124 ? 0.7267 1.0223 0.5934 0.3342  0.0421  0.0972  124 LYS H CB  
944  C CG  . LYS A 124 ? 0.8420 1.1755 0.7483 0.3248  0.0375  0.0844  124 LYS H CG  
945  C CD  . LYS A 124 ? 0.7904 1.0923 0.7099 0.3270  0.0608  0.0865  124 LYS H CD  
946  N N   . GLY A 125 ? 0.7121 1.0858 0.5807 0.2923  -0.0116 0.0574  125 GLY H N   
947  C CA  . GLY A 125 ? 0.5890 0.9708 0.4678 0.2600  -0.0223 0.0362  125 GLY H CA  
948  C C   . GLY A 125 ? 0.6858 1.0595 0.5968 0.2405  -0.0058 0.0303  125 GLY H C   
949  O O   . GLY A 125 ? 0.7438 1.1283 0.6796 0.2517  0.0061  0.0380  125 GLY H O   
950  N N   . PRO A 126 ? 0.6285 0.9797 0.5349 0.2135  -0.0045 0.0169  126 PRO H N   
951  C CA  . PRO A 126 ? 0.6538 0.9899 0.5801 0.1940  0.0099  0.0115  126 PRO H CA  
952  C C   . PRO A 126 ? 0.7142 1.0916 0.6759 0.1783  0.0040  0.0031  126 PRO H C   
953  O O   . PRO A 126 ? 0.4957 0.9113 0.4693 0.1712  -0.0161 -0.0033 126 PRO H O   
954  C CB  . PRO A 126 ? 0.6500 0.9495 0.5556 0.1745  0.0099  0.0030  126 PRO H CB  
955  C CG  . PRO A 126 ? 0.5987 0.9095 0.4834 0.1748  -0.0095 -0.0046 126 PRO H CG  
956  C CD  . PRO A 126 ? 0.6330 0.9659 0.5082 0.2029  -0.0158 0.0068  126 PRO H CD  
957  N N   . SER A 127 ? 0.6833 1.0519 0.6607 0.1721  0.0219  0.0036  127 SER H N   
958  C CA  . SER A 127 ? 0.7602 1.1618 0.7693 0.1544  0.0233  -0.0027 127 SER H CA  
959  C C   . SER A 127 ? 0.6761 1.0444 0.6730 0.1247  0.0262  -0.0126 127 SER H C   
960  O O   . SER A 127 ? 0.8172 1.1394 0.7920 0.1230  0.0379  -0.0116 127 SER H O   
961  C CB  . SER A 127 ? 0.7082 1.1215 0.7372 0.1711  0.0445  0.0051  127 SER H CB  
962  O OG  . SER A 127 ? 0.6665 1.1104 0.7088 0.2018  0.0419  0.0164  127 SER H OG  
963  N N   . VAL A 128 ? 0.5391 0.9298 0.5510 0.1008  0.0138  -0.0213 128 VAL H N   
964  C CA  . VAL A 128 ? 0.5998 0.9564 0.5978 0.0738  0.0147  -0.0292 128 VAL H CA  
965  C C   . VAL A 128 ? 0.6180 0.9863 0.6368 0.0569  0.0295  -0.0285 128 VAL H C   
966  O O   . VAL A 128 ? 0.5828 0.9975 0.6365 0.0462  0.0263  -0.0286 128 VAL H O   
967  C CB  . VAL A 128 ? 0.6001 0.9570 0.5910 0.0563  -0.0076 -0.0399 128 VAL H CB  
968  C CG1 . VAL A 128 ? 0.6187 0.9338 0.5932 0.0321  -0.0052 -0.0460 128 VAL H CG1 
969  C CG2 . VAL A 128 ? 0.5588 0.9018 0.5213 0.0757  -0.0189 -0.0404 128 VAL H CG2 
970  N N   . PHE A 129 ? 0.6513 0.9782 0.6483 0.0540  0.0453  -0.0267 129 PHE H N   
971  C CA  . PHE A 129 ? 0.6544 0.9825 0.6582 0.0402  0.0626  -0.0251 129 PHE H CA  
972  C C   . PHE A 129 ? 0.6563 0.9448 0.6378 0.0144  0.0592  -0.0289 129 PHE H C   
973  O O   . PHE A 129 ? 0.7244 0.9700 0.6773 0.0152  0.0524  -0.0304 129 PHE H O   
974  C CB  . PHE A 129 ? 0.5720 0.8798 0.5600 0.0592  0.0839  -0.0204 129 PHE H CB  
975  C CG  . PHE A 129 ? 0.6290 0.9649 0.6340 0.0888  0.0887  -0.0151 129 PHE H CG  
976  C CD1 . PHE A 129 ? 0.4728 0.8692 0.5201 0.0966  0.0934  -0.0105 129 PHE H CD1 
977  C CD2 . PHE A 129 ? 0.7279 1.0305 0.7097 0.1088  0.0885  -0.0127 129 PHE H CD2 
978  C CE1 . PHE A 129 ? 0.5002 0.9225 0.5636 0.1272  0.0971  -0.0035 129 PHE H CE1 
979  C CE2 . PHE A 129 ? 0.7381 1.0607 0.7324 0.1375  0.0936  -0.0059 129 PHE H CE2 
980  C CZ  . PHE A 129 ? 0.7225 1.1043 0.7562 0.1485  0.0976  -0.0012 129 PHE H CZ  
981  N N   . PRO A 130 ? 0.6261 0.9305 0.6237 -0.0080 0.0647  -0.0282 130 PRO H N   
982  C CA  . PRO A 130 ? 0.6827 0.9489 0.6598 -0.0328 0.0614  -0.0297 130 PRO H CA  
983  C C   . PRO A 130 ? 0.7504 0.9702 0.6902 -0.0321 0.0752  -0.0252 130 PRO H C   
984  O O   . PRO A 130 ? 0.7917 1.0153 0.7259 -0.0211 0.0940  -0.0214 130 PRO H O   
985  C CB  . PRO A 130 ? 0.7384 1.0420 0.7500 -0.0561 0.0662  -0.0273 130 PRO H CB  
986  C CG  . PRO A 130 ? 0.6850 1.0393 0.7283 -0.0405 0.0839  -0.0211 130 PRO H CG  
987  C CD  . PRO A 130 ? 0.6999 1.0621 0.7407 -0.0106 0.0755  -0.0236 130 PRO H CD  
988  N N   . LEU A 131 ? 0.7009 0.8755 0.6132 -0.0425 0.0649  -0.0258 131 LEU H N   
989  C CA  . LEU A 131 ? 0.7464 0.8764 0.6213 -0.0455 0.0718  -0.0208 131 LEU H CA  
990  C C   . LEU A 131 ? 0.7606 0.8738 0.6264 -0.0699 0.0758  -0.0159 131 LEU H C   
991  O O   . LEU A 131 ? 0.8681 0.9481 0.7191 -0.0794 0.0627  -0.0150 131 LEU H O   
992  C CB  . LEU A 131 ? 0.8082 0.9015 0.6620 -0.0366 0.0562  -0.0214 131 LEU H CB  
993  C CG  . LEU A 131 ? 0.8072 0.9100 0.6683 -0.0146 0.0532  -0.0235 131 LEU H CG  
994  C CD1 . LEU A 131 ? 0.7615 0.8333 0.6108 -0.0099 0.0392  -0.0210 131 LEU H CD1 
995  C CD2 . LEU A 131 ? 0.7709 0.8734 0.6212 -0.0032 0.0687  -0.0228 131 LEU H CD2 
996  N N   . ALA A 132 ? 0.7431 0.8789 0.6189 -0.0785 0.0960  -0.0108 132 ALA H N   
997  C CA  . ALA A 132 ? 0.8096 0.9330 0.6806 -0.1035 0.1042  -0.0031 132 ALA H CA  
998  C C   . ALA A 132 ? 0.8527 0.9174 0.6707 -0.1070 0.1043  0.0038  132 ALA H C   
999  O O   . ALA A 132 ? 0.8570 0.9009 0.6415 -0.0928 0.1096  0.0043  132 ALA H O   
1000 C CB  . ALA A 132 ? 0.8286 0.9949 0.7259 -0.1094 0.1307  0.0037  132 ALA H CB  
1001 N N   . PRO A 133 ? 0.9295 0.9639 0.7372 -0.1259 0.0965  0.0093  133 PRO H N   
1002 C CA  . PRO A 133 ? 1.0036 0.9826 0.7615 -0.1292 0.0937  0.0188  133 PRO H CA  
1003 C C   . PRO A 133 ? 0.9426 0.9121 0.6692 -0.1347 0.1194  0.0296  133 PRO H C   
1004 O O   . PRO A 133 ? 0.9052 0.9118 0.6588 -0.1431 0.1418  0.0327  133 PRO H O   
1005 C CB  . PRO A 133 ? 1.0630 1.0173 0.8262 -0.1473 0.0822  0.0224  133 PRO H CB  
1006 C CG  . PRO A 133 ? 1.0569 1.0540 0.8675 -0.1632 0.0885  0.0176  133 PRO H CG  
1007 C CD  . PRO A 133 ? 1.0129 1.0603 0.8538 -0.1452 0.0881  0.0067  133 PRO H CD  
1008 N N   . GLY A 141 ? 1.2545 0.7965 0.7121 -0.1473 0.0072  0.1487  141 GLY H N   
1009 C CA  . GLY A 141 ? 1.2940 0.8184 0.7825 -0.1420 -0.0025 0.1466  141 GLY H CA  
1010 C C   . GLY A 141 ? 1.2999 0.8698 0.8432 -0.1360 -0.0047 0.1219  141 GLY H C   
1011 O O   . GLY A 141 ? 1.3046 0.8759 0.8740 -0.1482 0.0047  0.1111  141 GLY H O   
1012 N N   . THR A 142 ? 1.3312 0.9358 0.8891 -0.1182 -0.0185 0.1136  142 THR H N   
1013 C CA  . THR A 142 ? 1.3186 0.9655 0.9234 -0.1096 -0.0201 0.0930  142 THR H CA  
1014 C C   . THR A 142 ? 1.2397 0.9336 0.8554 -0.1159 -0.0083 0.0797  142 THR H C   
1015 O O   . THR A 142 ? 1.3139 1.0175 0.9113 -0.1102 -0.0129 0.0819  142 THR H O   
1016 C CB  . THR A 142 ? 1.3342 0.9891 0.9574 -0.0838 -0.0415 0.0947  142 THR H CB  
1017 O OG1 . THR A 142 ? 1.4898 1.1032 1.1079 -0.0730 -0.0504 0.1075  142 THR H OG1 
1018 C CG2 . THR A 142 ? 1.2122 0.9087 0.8786 -0.0744 -0.0393 0.0756  142 THR H CG2 
1019 N N   . ALA A 143 ? 1.1317 0.8525 0.7764 -0.1270 0.0054  0.0656  143 ALA H N   
1020 C CA  . ALA A 143 ? 1.0393 0.8074 0.7003 -0.1299 0.0177  0.0540  143 ALA H CA  
1021 C C   . ALA A 143 ? 1.0627 0.8670 0.7605 -0.1144 0.0096  0.0382  143 ALA H C   
1022 O O   . ALA A 143 ? 1.0648 0.8608 0.7787 -0.1069 0.0003  0.0332  143 ALA H O   
1023 C CB  . ALA A 143 ? 1.0504 0.8327 0.7230 -0.1531 0.0385  0.0525  143 ALA H CB  
1024 N N   . ALA A 144 ? 0.9170 0.7570 0.6238 -0.1080 0.0151  0.0309  144 ALA H N   
1025 C CA  . ALA A 144 ? 0.7671 0.6401 0.5050 -0.0927 0.0094  0.0187  144 ALA H CA  
1026 C C   . ALA A 144 ? 0.8574 0.7741 0.6181 -0.0964 0.0234  0.0082  144 ALA H C   
1027 O O   . ALA A 144 ? 0.7591 0.6865 0.5101 -0.1028 0.0381  0.0107  144 ALA H O   
1028 C CB  . ALA A 144 ? 0.7775 0.6492 0.5086 -0.0769 -0.0021 0.0220  144 ALA H CB  
1029 N N   . LEU A 145 ? 0.7539 0.6956 0.5432 -0.0901 0.0192  -0.0026 145 LEU H N   
1030 C CA  . LEU A 145 ? 0.7609 0.7485 0.5760 -0.0900 0.0280  -0.0113 145 LEU H CA  
1031 C C   . LEU A 145 ? 0.8244 0.8325 0.6572 -0.0711 0.0192  -0.0198 145 LEU H C   
1032 O O   . LEU A 145 ? 0.9260 0.9133 0.7539 -0.0609 0.0090  -0.0198 145 LEU H O   
1033 C CB  . LEU A 145 ? 0.8344 0.8349 0.6665 -0.1120 0.0328  -0.0143 145 LEU H CB  
1034 C CG  . LEU A 145 ? 0.9473 0.9231 0.7805 -0.1212 0.0198  -0.0206 145 LEU H CG  
1035 C CD1 . LEU A 145 ? 0.8862 0.8914 0.7406 -0.1134 0.0096  -0.0350 145 LEU H CD1 
1036 C CD2 . LEU A 145 ? 1.0819 1.0433 0.9164 -0.1503 0.0259  -0.0159 145 LEU H CD2 
1037 N N   . GLY A 146 ? 0.7785 0.8274 0.6315 -0.0643 0.0249  -0.0252 146 GLY H N   
1038 C CA  . GLY A 146 ? 0.7643 0.8315 0.6293 -0.0454 0.0182  -0.0309 146 GLY H CA  
1039 C C   . GLY A 146 ? 0.6732 0.7865 0.5606 -0.0379 0.0235  -0.0349 146 GLY H C   
1040 O O   . GLY A 146 ? 0.5498 0.6898 0.4535 -0.0498 0.0306  -0.0353 146 GLY H O   
1041 N N   . CYS A 147 ? 0.5314 0.6558 0.4224 -0.0170 0.0210  -0.0355 147 CYS H N   
1042 C CA  . CYS A 147 ? 0.7355 0.9012 0.6457 -0.0046 0.0247  -0.0369 147 CYS H CA  
1043 C C   . CYS A 147 ? 0.6566 0.8171 0.5614 0.0179  0.0290  -0.0316 147 CYS H C   
1044 O O   . CYS A 147 ? 0.5509 0.6866 0.4447 0.0248  0.0247  -0.0287 147 CYS H O   
1045 C CB  . CYS A 147 ? 0.6384 0.8286 0.5601 -0.0052 0.0115  -0.0449 147 CYS H CB  
1046 S SG  . CYS A 147 ? 1.7640 1.9253 1.6626 0.0082  0.0002  -0.0490 147 CYS H SG  
1047 N N   . LEU A 148 ? 0.6390 0.8227 0.5543 0.0296  0.0390  -0.0291 148 LEU H N   
1048 C CA  . LEU A 148 ? 0.6418 0.8153 0.5512 0.0497  0.0443  -0.0236 148 LEU H CA  
1049 C C   . LEU A 148 ? 0.5957 0.7991 0.5177 0.0693  0.0409  -0.0218 148 LEU H C   
1050 O O   . LEU A 148 ? 0.5548 0.7948 0.4948 0.0762  0.0437  -0.0219 148 LEU H O   
1051 C CB  . LEU A 148 ? 0.4755 0.6406 0.3781 0.0532  0.0593  -0.0218 148 LEU H CB  
1052 C CG  . LEU A 148 ? 0.6636 0.8071 0.5562 0.0711  0.0649  -0.0172 148 LEU H CG  
1053 C CD1 . LEU A 148 ? 0.6547 0.7594 0.5329 0.0642  0.0559  -0.0141 148 LEU H CD1 
1054 C CD2 . LEU A 148 ? 0.7842 0.9175 0.6652 0.0771  0.0814  -0.0186 148 LEU H CD2 
1055 N N   . VAL A 149 ? 0.5947 0.7840 0.5075 0.0795  0.0355  -0.0183 149 VAL H N   
1056 C CA  . VAL A 149 ? 0.6446 0.8547 0.5595 0.1001  0.0327  -0.0144 149 VAL H CA  
1057 C C   . VAL A 149 ? 0.6179 0.8160 0.5312 0.1188  0.0442  -0.0038 149 VAL H C   
1058 O O   . VAL A 149 ? 0.5950 0.7650 0.4998 0.1224  0.0477  0.0034  149 VAL H O   
1059 C CB  . VAL A 149 ? 0.6457 0.8441 0.5456 0.1036  0.0248  -0.0151 149 VAL H CB  
1060 C CG1 . VAL A 149 ? 0.6698 0.8895 0.5631 0.1250  0.0206  -0.0113 149 VAL H CG1 
1061 C CG2 . VAL A 149 ? 0.6658 0.8610 0.5615 0.0841  0.0141  -0.0268 149 VAL H CG2 
1062 N N   . LYS A 150 ? 0.6939 0.9132 0.6181 0.1306  0.0509  -0.0018 150 LYS H N   
1063 C CA  . LYS A 150 ? 0.7648 0.9627 0.6840 0.1469  0.0638  0.0064  150 LYS H CA  
1064 C C   . LYS A 150 ? 0.7376 0.9553 0.6609 0.1744  0.0651  0.0165  150 LYS H C   
1065 O O   . LYS A 150 ? 0.7576 1.0180 0.6939 0.1821  0.0564  0.0157  150 LYS H O   
1066 C CB  . LYS A 150 ? 0.7599 0.9535 0.6811 0.1432  0.0758  0.0016  150 LYS H CB  
1067 C CG  . LYS A 150 ? 0.8519 1.0062 0.7581 0.1560  0.0890  0.0060  150 LYS H CG  
1068 C CD  . LYS A 150 ? 0.7427 0.8857 0.6402 0.1531  0.1027  -0.0012 150 LYS H CD  
1069 C CE  . LYS A 150 ? 0.8283 0.9319 0.7077 0.1717  0.1168  0.0012  150 LYS H CE  
1070 N NZ  . LYS A 150 ? 0.9615 1.0100 0.8190 0.1606  0.1105  0.0021  150 LYS H NZ  
1071 N N   . ASP A 151 ? 0.7584 0.9433 0.6706 0.1879  0.0742  0.0270  151 ASP H N   
1072 C CA  . ASP A 151 ? 0.6649 0.8572 0.5764 0.2166  0.0789  0.0399  151 ASP H CA  
1073 C C   . ASP A 151 ? 0.7097 0.9307 0.6166 0.2284  0.0669  0.0459  151 ASP H C   
1074 O O   . ASP A 151 ? 0.6962 0.9578 0.6127 0.2429  0.0585  0.0471  151 ASP H O   
1075 C CB  . ASP A 151 ? 0.6455 0.8619 0.5720 0.2320  0.0861  0.0389  151 ASP H CB  
1076 C CG  . ASP A 151 ? 0.7482 0.9252 0.6664 0.2276  0.1019  0.0337  151 ASP H CG  
1077 O OD1 . ASP A 151 ? 0.8069 0.9358 0.7074 0.2132  0.1039  0.0324  151 ASP H OD1 
1078 O OD2 . ASP A 151 ? 0.7833 0.9779 0.7123 0.2388  0.1121  0.0310  151 ASP H OD2 
1079 N N   . TYR A 152 ? 0.6123 0.8129 0.5037 0.2231  0.0657  0.0499  152 TYR H N   
1080 C CA  . TYR A 152 ? 0.7209 0.9379 0.5954 0.2371  0.0574  0.0558  152 TYR H CA  
1081 C C   . TYR A 152 ? 0.7631 0.9476 0.6203 0.2498  0.0707  0.0739  152 TYR H C   
1082 O O   . TYR A 152 ? 0.7054 0.8564 0.5695 0.2397  0.0828  0.0795  152 TYR H O   
1083 C CB  . TYR A 152 ? 0.6338 0.8628 0.5017 0.2193  0.0440  0.0412  152 TYR H CB  
1084 C CG  . TYR A 152 ? 0.6470 0.8442 0.5117 0.2024  0.0511  0.0394  152 TYR H CG  
1085 C CD1 . TYR A 152 ? 0.5442 0.7253 0.3899 0.2108  0.0575  0.0481  152 TYR H CD1 
1086 C CD2 . TYR A 152 ? 0.6809 0.8660 0.5614 0.1798  0.0521  0.0306  152 TYR H CD2 
1087 C CE1 . TYR A 152 ? 0.6540 0.8130 0.5049 0.1978  0.0647  0.0488  152 TYR H CE1 
1088 C CE2 . TYR A 152 ? 0.7093 0.8698 0.5906 0.1661  0.0556  0.0310  152 TYR H CE2 
1089 C CZ  . TYR A 152 ? 0.7382 0.8884 0.6089 0.1755  0.0618  0.0405  152 TYR H CZ  
1090 O OH  . TYR A 152 ? 0.7814 0.9138 0.6609 0.1643  0.0660  0.0431  152 TYR H OH  
1091 N N   . PHE A 153 ? 0.7529 0.9480 0.5875 0.2710  0.0676  0.0841  153 PHE H N   
1092 C CA  . PHE A 153 ? 0.7713 0.9383 0.5865 0.2849  0.0831  0.1045  153 PHE H CA  
1093 C C   . PHE A 153 ? 0.7964 0.9780 0.5753 0.3037  0.0758  0.1088  153 PHE H C   
1094 O O   . PHE A 153 ? 0.8390 1.0507 0.6082 0.3161  0.0580  0.1042  153 PHE H O   
1095 C CB  . PHE A 153 ? 0.7541 0.8991 0.5739 0.3012  0.0964  0.1228  153 PHE H CB  
1096 C CG  . PHE A 153 ? 0.8052 0.9171 0.6110 0.3108  0.1155  0.1466  153 PHE H CG  
1097 C CD1 . PHE A 153 ? 0.6561 0.7364 0.4803 0.2911  0.1293  0.1522  153 PHE H CD1 
1098 C CD2 . PHE A 153 ? 0.8522 0.9659 0.6269 0.3385  0.1190  0.1651  153 PHE H CD2 
1099 C CE1 . PHE A 153 ? 0.8230 0.8770 0.6421 0.2971  0.1486  0.1766  153 PHE H CE1 
1100 C CE2 . PHE A 153 ? 0.8232 0.9058 0.5848 0.3468  0.1403  0.1899  153 PHE H CE2 
1101 C CZ  . PHE A 153 ? 0.8231 0.8773 0.6104 0.3251  0.1563  0.1961  153 PHE H CZ  
1102 N N   . PRO A 154 ? 0.8157 0.9768 0.5737 0.3062  0.0892  0.1180  154 PRO H N   
1103 C CA  . PRO A 154 ? 0.7277 0.8627 0.5064 0.2899  0.1077  0.1244  154 PRO H CA  
1104 C C   . PRO A 154 ? 0.7821 0.9216 0.5668 0.2702  0.1018  0.1059  154 PRO H C   
1105 O O   . PRO A 154 ? 0.6903 0.8485 0.4726 0.2612  0.0827  0.0850  154 PRO H O   
1106 C CB  . PRO A 154 ? 0.8219 0.9386 0.5762 0.3096  0.1289  0.1496  154 PRO H CB  
1107 C CG  . PRO A 154 ? 0.7954 0.9277 0.5013 0.3308  0.1173  0.1452  154 PRO H CG  
1108 C CD  . PRO A 154 ? 0.8074 0.9689 0.5185 0.3301  0.0897  0.1279  154 PRO H CD  
1109 N N   . GLU A 155 ? 0.8351 0.9579 0.6309 0.2638  0.1186  0.1155  155 GLU H N   
1110 C CA  . GLU A 155 ? 0.8415 0.9650 0.6410 0.2513  0.1165  0.1023  155 GLU H CA  
1111 C C   . GLU A 155 ? 0.8283 0.9525 0.5812 0.2700  0.1177  0.0977  155 GLU H C   
1112 O O   . GLU A 155 ? 0.9372 1.0579 0.6582 0.2927  0.1275  0.1121  155 GLU H O   
1113 C CB  . GLU A 155 ? 0.7723 0.8832 0.6071 0.2402  0.1339  0.1170  155 GLU H CB  
1114 C CG  . GLU A 155 ? 0.8581 0.9628 0.7329 0.2163  0.1265  0.1150  155 GLU H CG  
1115 C CD  . GLU A 155 ? 0.9119 1.0208 0.7991 0.1962  0.1105  0.0947  155 GLU H CD  
1116 O OE1 . GLU A 155 ? 0.8465 0.9484 0.7652 0.1787  0.1099  0.0984  155 GLU H OE1 
1117 O OE2 . GLU A 155 ? 0.9590 1.0779 0.8249 0.1967  0.0972  0.0763  155 GLU H OE2 
1118 N N   . PRO A 156 ? 0.8198 0.9431 0.5628 0.2613  0.1078  0.0776  156 PRO H N   
1119 C CA  . PRO A 156 ? 0.7324 0.8572 0.5063 0.2359  0.0955  0.0615  156 PRO H CA  
1120 C C   . PRO A 156 ? 0.9122 1.0500 0.6749 0.2246  0.0696  0.0382  156 PRO H C   
1121 O O   . PRO A 156 ? 0.9773 1.1289 0.7160 0.2354  0.0580  0.0347  156 PRO H O   
1122 C CB  . PRO A 156 ? 0.7007 0.8102 0.4685 0.2386  0.1073  0.0600  156 PRO H CB  
1123 C CG  . PRO A 156 ? 0.8181 0.9194 0.5300 0.2634  0.1130  0.0584  156 PRO H CG  
1124 C CD  . PRO A 156 ? 0.7211 0.8321 0.4178 0.2786  0.1149  0.0732  156 PRO H CD  
1125 N N   . VAL A 157 ? 0.8063 0.9414 0.5889 0.2025  0.0602  0.0243  157 VAL H N   
1126 C CA  . VAL A 157 ? 0.7533 0.8994 0.5300 0.1877  0.0382  0.0032  157 VAL H CA  
1127 C C   . VAL A 157 ? 0.8063 0.9310 0.5786 0.1738  0.0349  -0.0102 157 VAL H C   
1128 O O   . VAL A 157 ? 0.8748 0.9854 0.6675 0.1686  0.0458  -0.0029 157 VAL H O   
1129 C CB  . VAL A 157 ? 0.8242 0.9908 0.6342 0.1727  0.0308  0.0023  157 VAL H CB  
1130 C CG1 . VAL A 157 ? 0.8044 0.9565 0.6433 0.1574  0.0394  0.0076  157 VAL H CG1 
1131 C CG2 . VAL A 157 ? 0.7599 0.9454 0.5705 0.1570  0.0102  -0.0160 157 VAL H CG2 
1132 N N   . THR A 158 ? 0.8059 0.9264 0.5514 0.1681  0.0185  -0.0292 158 THR H N   
1133 C CA  . THR A 158 ? 0.8053 0.8976 0.5410 0.1560  0.0151  -0.0429 158 THR H CA  
1134 C C   . THR A 158 ? 0.8436 0.9438 0.5994 0.1272  -0.0022 -0.0558 158 THR H C   
1135 O O   . THR A 158 ? 0.9384 1.0638 0.6966 0.1183  -0.0185 -0.0639 158 THR H O   
1136 C CB  . THR A 158 ? 0.8854 0.9524 0.5676 0.1693  0.0108  -0.0570 158 THR H CB  
1137 O OG1 . THR A 158 ? 0.9041 0.9865 0.5680 0.1604  -0.0144 -0.0726 158 THR H OG1 
1138 C CG2 . THR A 158 ? 0.8714 0.9325 0.5283 0.2002  0.0313  -0.0423 158 THR H CG2 
1139 N N   . VAL A 159 ? 0.7375 0.8183 0.5097 0.1130  0.0019  -0.0555 159 VAL H N   
1140 C CA  . VAL A 159 ? 0.7306 0.8135 0.5191 0.0854  -0.0102 -0.0647 159 VAL H CA  
1141 C C   . VAL A 159 ? 0.8301 0.8720 0.6011 0.0754  -0.0133 -0.0752 159 VAL H C   
1142 O O   . VAL A 159 ? 1.0609 1.0783 0.8331 0.0836  -0.0018 -0.0671 159 VAL H O   
1143 C CB  . VAL A 159 ? 0.7341 0.8302 0.5572 0.0752  -0.0029 -0.0520 159 VAL H CB  
1144 C CG1 . VAL A 159 ? 0.6059 0.7022 0.4409 0.0479  -0.0112 -0.0594 159 VAL H CG1 
1145 C CG2 . VAL A 159 ? 0.7924 0.9210 0.6304 0.0861  0.0016  -0.0425 159 VAL H CG2 
1146 N N   . SER A 160 ? 0.6751 0.7094 0.4323 0.0575  -0.0298 -0.0923 160 SER H N   
1147 C CA  . SER A 160 ? 0.7564 0.7455 0.4965 0.0442  -0.0339 -0.1030 160 SER H CA  
1148 C C   . SER A 160 ? 0.8236 0.8206 0.5882 0.0112  -0.0432 -0.1054 160 SER H C   
1149 O O   . SER A 160 ? 0.6733 0.7134 0.4676 0.0013  -0.0449 -0.0997 160 SER H O   
1150 C CB  . SER A 160 ? 0.7729 0.7312 0.4664 0.0498  -0.0450 -0.1230 160 SER H CB  
1151 O OG  . SER A 160 ? 0.8475 0.8312 0.5409 0.0316  -0.0671 -0.1360 160 SER H OG  
1152 N N   . TRP A 161 ? 0.7965 0.7499 0.5481 -0.0042 -0.0465 -0.1125 161 TRP H N   
1153 C CA  . TRP A 161 ? 0.7692 0.7244 0.5415 -0.0369 -0.0524 -0.1126 161 TRP H CA  
1154 C C   . TRP A 161 ? 0.8476 0.7621 0.5962 -0.0579 -0.0674 -0.1311 161 TRP H C   
1155 O O   . TRP A 161 ? 1.0051 0.8641 0.7193 -0.0480 -0.0658 -0.1385 161 TRP H O   
1156 C CB  . TRP A 161 ? 0.6844 0.6221 0.4684 -0.0391 -0.0391 -0.0960 161 TRP H CB  
1157 C CG  . TRP A 161 ? 0.6568 0.6338 0.4659 -0.0294 -0.0286 -0.0801 161 TRP H CG  
1158 C CD1 . TRP A 161 ? 0.6664 0.6480 0.4772 -0.0045 -0.0195 -0.0696 161 TRP H CD1 
1159 C CD2 . TRP A 161 ? 0.7435 0.7575 0.5788 -0.0446 -0.0253 -0.0734 161 TRP H CD2 
1160 N NE1 . TRP A 161 ? 0.6535 0.6666 0.4858 -0.0051 -0.0134 -0.0587 161 TRP H NE1 
1161 C CE2 . TRP A 161 ? 0.7440 0.7762 0.5888 -0.0273 -0.0155 -0.0613 161 TRP H CE2 
1162 C CE3 . TRP A 161 ? 0.6791 0.7125 0.5320 -0.0712 -0.0280 -0.0759 161 TRP H CE3 
1163 C CZ2 . TRP A 161 ? 0.6424 0.7043 0.5054 -0.0330 -0.0081 -0.0539 161 TRP H CZ2 
1164 C CZ3 . TRP A 161 ? 0.7731 0.8433 0.6494 -0.0752 -0.0178 -0.0661 161 TRP H CZ3 
1165 C CH2 . TRP A 161 ? 0.7507 0.8315 0.6279 -0.0549 -0.0078 -0.0564 161 TRP H CH2 
1166 N N   . ASN A 162 ? 0.7683 0.7106 0.5377 -0.0869 -0.0817 -0.1380 162 ASN H N   
1167 C CA  . ASN A 162 ? 0.8344 0.7425 0.5866 -0.1138 -0.1006 -0.1568 162 ASN H CA  
1168 C C   . ASN A 162 ? 0.9285 0.8007 0.6297 -0.0960 -0.1132 -0.1773 162 ASN H C   
1169 O O   . ASN A 162 ? 1.0016 0.8087 0.6650 -0.1029 -0.1194 -0.1923 162 ASN H O   
1170 C CB  . ASN A 162 ? 0.9082 0.7592 0.6532 -0.1321 -0.0934 -0.1528 162 ASN H CB  
1171 C CG  . ASN A 162 ? 0.9585 0.8404 0.7463 -0.1569 -0.0838 -0.1351 162 ASN H CG  
1172 O OD1 . ASN A 162 ? 0.9454 0.8909 0.7690 -0.1571 -0.0796 -0.1258 162 ASN H OD1 
1173 N ND2 . ASN A 162 ? 0.9265 0.7599 0.7073 -0.1760 -0.0783 -0.1296 162 ASN H ND2 
1174 N N   . SER A 163 ? 0.9317 0.8421 0.6273 -0.0718 -0.1154 -0.1775 163 SER H N   
1175 C CA  . SER A 163 ? 1.0058 0.8873 0.6467 -0.0506 -0.1251 -0.1950 163 SER H CA  
1176 C C   . SER A 163 ? 1.0574 0.8717 0.6540 -0.0244 -0.1065 -0.1971 163 SER H C   
1177 O O   . SER A 163 ? 1.2115 0.9713 0.7531 -0.0179 -0.1144 -0.2175 163 SER H O   
1178 C CB  . SER A 163 ? 1.1099 0.9763 0.7304 -0.0795 -0.1574 -0.2197 163 SER H CB  
1179 O OG  . SER A 163 ? 1.0337 0.9711 0.7033 -0.1019 -0.1752 -0.2157 163 SER H OG  
1180 N N   . GLY A 164 ? 1.0037 0.8223 0.6243 -0.0086 -0.0824 -0.1759 164 GLY H N   
1181 C CA  . GLY A 164 ? 0.9534 0.7219 0.5457 0.0199  -0.0627 -0.1724 164 GLY H CA  
1182 C C   . GLY A 164 ? 1.0039 0.7094 0.5840 0.0062  -0.0619 -0.1773 164 GLY H C   
1183 O O   . GLY A 164 ? 1.2057 0.8663 0.7640 0.0310  -0.0459 -0.1742 164 GLY H O   
1184 N N   . ALA A 165 ? 0.9801 0.6827 0.5765 -0.0324 -0.0778 -0.1828 165 ALA H N   
1185 C CA  . ALA A 165 ? 1.1434 0.7825 0.7283 -0.0492 -0.0774 -0.1852 165 ALA H CA  
1186 C C   . ALA A 165 ? 0.9816 0.6296 0.6014 -0.0463 -0.0606 -0.1586 165 ALA H C   
1187 O O   . ALA A 165 ? 1.0175 0.6135 0.6288 -0.0543 -0.0571 -0.1543 165 ALA H O   
1188 C CB  . ALA A 165 ? 1.1379 0.7699 0.7287 -0.0945 -0.0999 -0.1993 165 ALA H CB  
1189 N N   . LEU A 166 ? 0.9091 0.6190 0.5642 -0.0347 -0.0518 -0.1408 166 LEU H N   
1190 C CA  . LEU A 166 ? 0.9439 0.6655 0.6279 -0.0318 -0.0397 -0.1166 166 LEU H CA  
1191 C C   . LEU A 166 ? 0.9502 0.7007 0.6466 0.0027  -0.0263 -0.1024 166 LEU H C   
1192 O O   . LEU A 166 ? 0.7999 0.6012 0.5126 0.0090  -0.0254 -0.1001 166 LEU H O   
1193 C CB  . LEU A 166 ? 0.9982 0.7655 0.7173 -0.0613 -0.0434 -0.1077 166 LEU H CB  
1194 C CG  . LEU A 166 ? 1.0235 0.8025 0.7641 -0.0608 -0.0332 -0.0844 166 LEU H CG  
1195 C CD1 . LEU A 166 ? 1.0178 0.7369 0.7418 -0.0672 -0.0312 -0.0766 166 LEU H CD1 
1196 C CD2 . LEU A 166 ? 1.0501 0.8785 0.8192 -0.0838 -0.0327 -0.0782 166 LEU H CD2 
1197 N N   . THR A 167 ? 0.9459 0.6644 0.6376 0.0248  -0.0159 -0.0914 167 THR H N   
1198 C CA  . THR A 167 ? 0.9527 0.6988 0.6628 0.0559  -0.0030 -0.0761 167 THR H CA  
1199 C C   . THR A 167 ? 0.9408 0.6897 0.6784 0.0592  -0.0002 -0.0526 167 THR H C   
1200 O O   . THR A 167 ? 0.8345 0.6215 0.6011 0.0721  0.0048  -0.0370 167 THR H O   
1201 C CB  . THR A 167 ? 1.0335 0.7476 0.7155 0.0888  0.0090  -0.0834 167 THR H CB  
1202 O OG1 . THR A 167 ? 1.1124 0.7631 0.7714 0.0932  0.0106  -0.0866 167 THR H OG1 
1203 C CG2 . THR A 167 ? 1.1068 0.8196 0.7540 0.0888  0.0042  -0.1062 167 THR H CG2 
1204 N N   . SER A 168 ? 1.0039 0.7103 0.7311 0.0466  -0.0049 -0.0494 168 SER H N   
1205 C CA  . SER A 168 ? 0.9632 0.6662 0.7091 0.0507  -0.0058 -0.0266 168 SER H CA  
1206 C C   . SER A 168 ? 0.9589 0.7045 0.7265 0.0307  -0.0122 -0.0158 168 SER H C   
1207 O O   . SER A 168 ? 1.0120 0.7642 0.7733 0.0039  -0.0161 -0.0232 168 SER H O   
1208 C CB  . SER A 168 ? 0.9978 0.6383 0.7200 0.0425  -0.0091 -0.0250 168 SER H CB  
1209 O OG  . SER A 168 ? 1.0751 0.6676 0.7732 0.0651  -0.0016 -0.0349 168 SER H OG  
1210 N N   . GLY A 169 ? 0.9659 0.7396 0.7593 0.0441  -0.0129 0.0017  169 GLY H N   
1211 C CA  . GLY A 169 ? 0.9119 0.7162 0.7180 0.0280  -0.0196 0.0110  169 GLY H CA  
1212 C C   . GLY A 169 ? 0.8277 0.6758 0.6446 0.0226  -0.0160 0.0018  169 GLY H C   
1213 O O   . GLY A 169 ? 0.8990 0.7684 0.7210 0.0097  -0.0191 0.0060  169 GLY H O   
1214 N N   . VAL A 170 ? 0.8363 0.6939 0.6519 0.0347  -0.0091 -0.0104 170 VAL H N   
1215 C CA  . VAL A 170 ? 0.7540 0.6510 0.5779 0.0334  -0.0060 -0.0176 170 VAL H CA  
1216 C C   . VAL A 170 ? 0.7105 0.6371 0.5602 0.0499  -0.0018 -0.0045 170 VAL H C   
1217 O O   . VAL A 170 ? 0.7355 0.6600 0.5959 0.0711  0.0046  0.0030  170 VAL H O   
1218 C CB  . VAL A 170 ? 0.8376 0.7313 0.6434 0.0396  -0.0031 -0.0352 170 VAL H CB  
1219 C CG1 . VAL A 170 ? 0.8029 0.7385 0.6175 0.0430  -0.0008 -0.0389 170 VAL H CG1 
1220 C CG2 . VAL A 170 ? 0.8608 0.7275 0.6458 0.0171  -0.0105 -0.0492 170 VAL H CG2 
1221 N N   . HIS A 171 ? 0.7038 0.6562 0.5642 0.0401  -0.0039 -0.0013 171 HIS H N   
1222 C CA  . HIS A 171 ? 0.7066 0.6832 0.5914 0.0506  -0.0013 0.0104  171 HIS H CA  
1223 C C   . HIS A 171 ? 0.7035 0.7065 0.5893 0.0514  0.0046  0.0042  171 HIS H C   
1224 O O   . HIS A 171 ? 0.5915 0.6019 0.4717 0.0378  0.0022  -0.0002 171 HIS H O   
1225 C CB  . HIS A 171 ? 0.6276 0.6006 0.5216 0.0394  -0.0122 0.0224  171 HIS H CB  
1226 C CG  . HIS A 171 ? 0.7146 0.6678 0.6146 0.0437  -0.0201 0.0339  171 HIS H CG  
1227 N ND1 . HIS A 171 ? 0.6950 0.6563 0.6227 0.0630  -0.0171 0.0462  171 HIS H ND1 
1228 C CD2 . HIS A 171 ? 0.6831 0.6097 0.5660 0.0331  -0.0300 0.0374  171 HIS H CD2 
1229 C CE1 . HIS A 171 ? 0.7588 0.7013 0.6890 0.0655  -0.0263 0.0563  171 HIS H CE1 
1230 N NE2 . HIS A 171 ? 0.7935 0.7121 0.6939 0.0473  -0.0350 0.0514  171 HIS H NE2 
1231 N N   . THR A 172 ? 0.7552 0.7708 0.6462 0.0697  0.0141  0.0054  172 THR H N   
1232 C CA  . THR A 172 ? 0.7369 0.7758 0.6288 0.0748  0.0197  0.0037  172 THR H CA  
1233 C C   . THR A 172 ? 0.7414 0.7918 0.6589 0.0815  0.0248  0.0198  172 THR H C   
1234 O O   . THR A 172 ? 0.7722 0.8270 0.7036 0.0970  0.0342  0.0305  172 THR H O   
1235 C CB  . THR A 172 ? 0.7337 0.7766 0.6066 0.0903  0.0261  -0.0049 172 THR H CB  
1236 O OG1 . THR A 172 ? 0.7152 0.7461 0.5663 0.0792  0.0175  -0.0214 172 THR H OG1 
1237 C CG2 . THR A 172 ? 0.6672 0.7341 0.5404 0.0981  0.0307  -0.0033 172 THR H CG2 
1238 N N   . PHE A 173 ? 0.7330 0.7861 0.6559 0.0693  0.0198  0.0217  173 PHE H N   
1239 C CA  . PHE A 173 ? 0.6860 0.7423 0.6322 0.0689  0.0202  0.0355  173 PHE H CA  
1240 C C   . PHE A 173 ? 0.6352 0.7053 0.5885 0.0838  0.0337  0.0422  173 PHE H C   
1241 O O   . PHE A 173 ? 0.6461 0.7239 0.5809 0.0922  0.0393  0.0342  173 PHE H O   
1242 C CB  . PHE A 173 ? 0.6322 0.6768 0.5704 0.0517  0.0103  0.0320  173 PHE H CB  
1243 C CG  . PHE A 173 ? 0.6312 0.6588 0.5593 0.0373  -0.0030 0.0299  173 PHE H CG  
1244 C CD1 . PHE A 173 ? 0.6461 0.6668 0.5501 0.0301  -0.0034 0.0187  173 PHE H CD1 
1245 C CD2 . PHE A 173 ? 0.6284 0.6481 0.5727 0.0303  -0.0161 0.0411  173 PHE H CD2 
1246 C CE1 . PHE A 173 ? 0.6828 0.6839 0.5734 0.0176  -0.0138 0.0195  173 PHE H CE1 
1247 C CE2 . PHE A 173 ? 0.5921 0.5943 0.5222 0.0191  -0.0299 0.0412  173 PHE H CE2 
1248 C CZ  . PHE A 173 ? 0.6439 0.6343 0.5443 0.0135  -0.0274 0.0308  173 PHE H CZ  
1249 N N   . PRO A 174 ? 0.5923 0.6668 0.5743 0.0868  0.0383  0.0589  174 PRO H N   
1250 C CA  . PRO A 174 ? 0.5274 0.6102 0.5169 0.0987  0.0527  0.0695  174 PRO H CA  
1251 C C   . PRO A 174 ? 0.6403 0.7154 0.6137 0.0945  0.0512  0.0631  174 PRO H C   
1252 O O   . PRO A 174 ? 0.5414 0.6023 0.5114 0.0785  0.0398  0.0570  174 PRO H O   
1253 C CB  . PRO A 174 ? 0.4575 0.5446 0.4889 0.0930  0.0535  0.0892  174 PRO H CB  
1254 C CG  . PRO A 174 ? 0.5332 0.6233 0.5794 0.0894  0.0442  0.0903  174 PRO H CG  
1255 C CD  . PRO A 174 ? 0.4886 0.5632 0.5016 0.0793  0.0301  0.0711  174 PRO H CD  
1256 N N   . ALA A 175 ? 0.6517 0.7340 0.6119 0.1109  0.0630  0.0649  175 ALA H N   
1257 C CA  . ALA A 175 ? 0.7597 0.8364 0.7060 0.1127  0.0636  0.0604  175 ALA H CA  
1258 C C   . ALA A 175 ? 0.7829 0.8391 0.7445 0.1040  0.0649  0.0711  175 ALA H C   
1259 O O   . ALA A 175 ? 0.6822 0.7364 0.6697 0.1001  0.0686  0.0865  175 ALA H O   
1260 C CB  . ALA A 175 ? 0.7585 0.8491 0.6875 0.1349  0.0736  0.0628  175 ALA H CB  
1261 N N   . VAL A 176 ? 0.6809 0.7208 0.6275 0.1007  0.0622  0.0628  176 VAL H N   
1262 C CA  . VAL A 176 ? 0.6701 0.6802 0.6220 0.0929  0.0628  0.0696  176 VAL H CA  
1263 C C   . VAL A 176 ? 0.7119 0.7135 0.6493 0.1118  0.0757  0.0734  176 VAL H C   
1264 O O   . VAL A 176 ? 0.7561 0.7718 0.6759 0.1256  0.0783  0.0641  176 VAL H O   
1265 C CB  . VAL A 176 ? 0.5647 0.5486 0.5036 0.0731  0.0486  0.0561  176 VAL H CB  
1266 C CG1 . VAL A 176 ? 0.6045 0.5914 0.5613 0.0541  0.0331  0.0581  176 VAL H CG1 
1267 C CG2 . VAL A 176 ? 0.7163 0.7066 0.6281 0.0788  0.0496  0.0393  176 VAL H CG2 
1268 N N   . LEU A 177 ? 0.6838 0.6636 0.6319 0.1124  0.0835  0.0888  177 LEU H N   
1269 C CA  . LEU A 177 ? 0.6849 0.6491 0.6182 0.1318  0.0963  0.0957  177 LEU H CA  
1270 C C   . LEU A 177 ? 0.8918 0.8172 0.8056 0.1271  0.0933  0.0834  177 LEU H C   
1271 O O   . LEU A 177 ? 0.9948 0.8827 0.9115 0.1074  0.0867  0.0828  177 LEU H O   
1272 C CB  . LEU A 177 ? 0.6238 0.5753 0.5743 0.1346  0.1089  0.1199  177 LEU H CB  
1273 C CG  . LEU A 177 ? 0.8535 0.7885 0.7866 0.1588  0.1239  0.1322  177 LEU H CG  
1274 C CD1 . LEU A 177 ? 0.8705 0.8424 0.7843 0.1861  0.1271  0.1299  177 LEU H CD1 
1275 C CD2 . LEU A 177 ? 0.8300 0.7484 0.7811 0.1574  0.1383  0.1590  177 LEU H CD2 
1276 N N   . GLN A 178 ? 0.8232 0.7578 0.7170 0.1457  0.0979  0.0734  178 GLN H N   
1277 C CA  . GLN A 178 ? 0.7802 0.6789 0.6512 0.1474  0.1002  0.0609  178 GLN H CA  
1278 C C   . GLN A 178 ? 0.8733 0.7298 0.7354 0.1616  0.1124  0.0724  178 GLN H C   
1279 O O   . GLN A 178 ? 0.7873 0.6444 0.6623 0.1685  0.1190  0.0918  178 GLN H O   
1280 C CB  . GLN A 178 ? 0.8732 0.8044 0.7343 0.1633  0.1038  0.0486  178 GLN H CB  
1281 C CG  . GLN A 178 ? 0.9739 0.9367 0.8397 0.1466  0.0928  0.0365  178 GLN H CG  
1282 C CD  . GLN A 178 ? 1.2213 1.2211 1.0856 0.1594  0.0974  0.0274  178 GLN H CD  
1283 O OE1 . GLN A 178 ? 1.2878 1.2990 1.1485 0.1456  0.0930  0.0159  178 GLN H OE1 
1284 N NE2 . GLN A 178 ? 1.3109 1.3317 1.1806 0.1857  0.1061  0.0346  178 GLN H NE2 
1285 N N   . SER A 179 ? 1.0112 0.8269 0.8478 0.1673  0.1173  0.0609  179 SER H N   
1286 C CA  . SER A 179 ? 1.0424 0.8055 0.8649 0.1812  0.1292  0.0696  179 SER H CA  
1287 C C   . SER A 179 ? 1.0052 0.7937 0.8301 0.2182  0.1437  0.0840  179 SER H C   
1288 O O   . SER A 179 ? 1.1400 0.8920 0.9584 0.2329  0.1544  0.0991  179 SER H O   
1289 C CB  . SER A 179 ? 1.1331 0.8392 0.9200 0.1796  0.1316  0.0505  179 SER H CB  
1290 O OG  . SER A 179 ? 1.1692 0.9060 0.9449 0.1970  0.1385  0.0370  179 SER H OG  
1291 N N   . SER A 180 ? 0.9478 0.7978 0.7819 0.2324  0.1421  0.0802  180 SER H N   
1292 C CA  . SER A 180 ? 0.9958 0.8788 0.8337 0.2672  0.1500  0.0931  180 SER H CA  
1293 C C   . SER A 180 ? 0.9234 0.8312 0.7717 0.2714  0.1477  0.1131  180 SER H C   
1294 O O   . SER A 180 ? 0.9709 0.9018 0.8170 0.3000  0.1515  0.1270  180 SER H O   
1295 C CB  . SER A 180 ? 1.0088 0.9501 0.8560 0.2777  0.1465  0.0808  180 SER H CB  
1296 O OG  . SER A 180 ? 1.0073 0.9907 0.8680 0.2558  0.1326  0.0734  180 SER H OG  
1297 N N   . GLY A 181 ? 0.8033 0.7068 0.6616 0.2448  0.1420  0.1155  181 GLY H N   
1298 C CA  . GLY A 181 ? 0.7913 0.7171 0.6567 0.2486  0.1438  0.1337  181 GLY H CA  
1299 C C   . GLY A 181 ? 0.8993 0.8832 0.7689 0.2490  0.1327  0.1246  181 GLY H C   
1300 O O   . GLY A 181 ? 1.0113 1.0161 0.8788 0.2553  0.1339  0.1359  181 GLY H O   
1301 N N   . LEU A 182 ? 0.9116 0.9176 0.7842 0.2421  0.1233  0.1039  182 LEU H N   
1302 C CA  . LEU A 182 ? 0.8356 0.8914 0.7127 0.2387  0.1113  0.0929  182 LEU H CA  
1303 C C   . LEU A 182 ? 0.8067 0.8604 0.6930 0.2086  0.1034  0.0808  182 LEU H C   
1304 O O   . LEU A 182 ? 0.7443 0.7666 0.6331 0.1906  0.1033  0.0750  182 LEU H O   
1305 C CB  . LEU A 182 ? 0.8138 0.9019 0.6942 0.2507  0.1068  0.0815  182 LEU H CB  
1306 C CG  . LEU A 182 ? 0.8783 0.9996 0.7565 0.2816  0.1049  0.0918  182 LEU H CG  
1307 C CD1 . LEU A 182 ? 0.8460 0.9334 0.7110 0.3049  0.1174  0.1133  182 LEU H CD1 
1308 C CD2 . LEU A 182 ? 0.7722 0.9259 0.6656 0.2911  0.1032  0.0821  182 LEU H CD2 
1309 N N   . TYR A 183 ? 0.8176 0.9016 0.7054 0.2042  0.0955  0.0768  183 TYR H N   
1310 C CA  . TYR A 183 ? 0.6475 0.7299 0.5440 0.1798  0.0883  0.0678  183 TYR H CA  
1311 C C   . TYR A 183 ? 0.7425 0.8418 0.6397 0.1671  0.0783  0.0488  183 TYR H C   
1312 O O   . TYR A 183 ? 0.7405 0.8676 0.6362 0.1770  0.0754  0.0426  183 TYR H O   
1313 C CB  . TYR A 183 ? 0.6022 0.6996 0.4963 0.1834  0.0883  0.0736  183 TYR H CB  
1314 C CG  . TYR A 183 ? 0.6819 0.7628 0.5786 0.1925  0.1024  0.0952  183 TYR H CG  
1315 C CD1 . TYR A 183 ? 0.6508 0.7136 0.5693 0.1759  0.1068  0.1039  183 TYR H CD1 
1316 C CD2 . TYR A 183 ? 0.5852 0.6705 0.4641 0.2172  0.1111  0.1090  183 TYR H CD2 
1317 C CE1 . TYR A 183 ? 0.7372 0.7889 0.6652 0.1819  0.1222  0.1263  183 TYR H CE1 
1318 C CE2 . TYR A 183 ? 0.6700 0.7388 0.5502 0.2251  0.1276  0.1316  183 TYR H CE2 
1319 C CZ  . TYR A 183 ? 0.6821 0.7351 0.5895 0.2064  0.1345  0.1405  183 TYR H CZ  
1320 O OH  . TYR A 183 ? 0.8201 0.8606 0.7358 0.2121  0.1533  0.1655  183 TYR H OH  
1321 N N   . SER A 184 ? 0.6508 0.7351 0.5527 0.1448  0.0728  0.0417  184 SER H N   
1322 C CA  . SER A 184 ? 0.7304 0.8254 0.6303 0.1304  0.0653  0.0265  184 SER H CA  
1323 C C   . SER A 184 ? 0.7711 0.8630 0.6748 0.1133  0.0566  0.0238  184 SER H C   
1324 O O   . SER A 184 ? 0.6954 0.7677 0.6068 0.1056  0.0554  0.0315  184 SER H O   
1325 C CB  . SER A 184 ? 0.8187 0.8890 0.7101 0.1231  0.0689  0.0203  184 SER H CB  
1326 O OG  . SER A 184 ? 1.0031 1.0835 0.8901 0.1099  0.0653  0.0084  184 SER H OG  
1327 N N   . LEU A 185 ? 0.8188 0.9303 0.7203 0.1073  0.0500  0.0138  185 LEU H N   
1328 C CA  . LEU A 185 ? 0.6793 0.7846 0.5818 0.0950  0.0427  0.0114  185 LEU H CA  
1329 C C   . LEU A 185 ? 0.7079 0.8141 0.6051 0.0776  0.0363  0.0000  185 LEU H C   
1330 O O   . LEU A 185 ? 0.6085 0.7338 0.5052 0.0767  0.0374  -0.0070 185 LEU H O   
1331 C CB  . LEU A 185 ? 0.6816 0.8002 0.5798 0.1074  0.0427  0.0125  185 LEU H CB  
1332 C CG  . LEU A 185 ? 0.8450 0.9536 0.7413 0.1019  0.0387  0.0105  185 LEU H CG  
1333 C CD1 . LEU A 185 ? 0.8659 0.9755 0.7574 0.1207  0.0472  0.0191  185 LEU H CD1 
1334 C CD2 . LEU A 185 ? 0.8645 0.9782 0.7496 0.0914  0.0293  -0.0045 185 LEU H CD2 
1335 N N   . SER A 186 ? 0.6273 0.7143 0.5234 0.0643  0.0301  0.0006  186 SER H N   
1336 C CA  . SER A 186 ? 0.6731 0.7546 0.5606 0.0476  0.0249  -0.0071 186 SER H CA  
1337 C C   . SER A 186 ? 0.6612 0.7356 0.5477 0.0443  0.0184  -0.0084 186 SER H C   
1338 O O   . SER A 186 ? 0.5672 0.6322 0.4605 0.0513  0.0175  -0.0008 186 SER H O   
1339 C CB  . SER A 186 ? 0.7355 0.7920 0.6131 0.0350  0.0223  -0.0049 186 SER H CB  
1340 O OG  . SER A 186 ? 0.9590 1.0127 0.8306 0.0399  0.0297  -0.0057 186 SER H OG  
1341 N N   . SER A 187 ? 0.6007 0.6790 0.4807 0.0339  0.0153  -0.0175 187 SER H N   
1342 C CA  . SER A 187 ? 0.5880 0.6494 0.4611 0.0297  0.0094  -0.0207 187 SER H CA  
1343 C C   . SER A 187 ? 0.6092 0.6550 0.4739 0.0090  0.0061  -0.0235 187 SER H C   
1344 O O   . SER A 187 ? 0.6764 0.7375 0.5425 -0.0025 0.0082  -0.0292 187 SER H O   
1345 C CB  . SER A 187 ? 0.6193 0.6929 0.4867 0.0374  0.0073  -0.0303 187 SER H CB  
1346 O OG  . SER A 187 ? 0.6104 0.6586 0.4648 0.0333  0.0023  -0.0361 187 SER H OG  
1347 N N   . VAL A 188 ? 0.6015 0.6189 0.4597 0.0051  0.0016  -0.0171 188 VAL H N   
1348 C CA  . VAL A 188 ? 0.7355 0.7317 0.5805 -0.0133 -0.0007 -0.0159 188 VAL H CA  
1349 C C   . VAL A 188 ? 0.7255 0.6917 0.5619 -0.0151 -0.0061 -0.0161 188 VAL H C   
1350 O O   . VAL A 188 ? 0.6930 0.6528 0.5332 0.0008  -0.0073 -0.0158 188 VAL H O   
1351 C CB  . VAL A 188 ? 0.6200 0.6020 0.4563 -0.0174 -0.0032 -0.0058 188 VAL H CB  
1352 C CG1 . VAL A 188 ? 0.6780 0.6789 0.5153 -0.0153 0.0038  -0.0077 188 VAL H CG1 
1353 C CG2 . VAL A 188 ? 0.6291 0.5988 0.4740 -0.0060 -0.0120 0.0043  188 VAL H CG2 
1354 N N   . VAL A 189 ? 0.7276 0.6726 0.5507 -0.0331 -0.0070 -0.0155 189 VAL H N   
1355 C CA  . VAL A 189 ? 0.8076 0.7148 0.6184 -0.0357 -0.0115 -0.0148 189 VAL H CA  
1356 C C   . VAL A 189 ? 0.8631 0.7423 0.6566 -0.0535 -0.0118 -0.0053 189 VAL H C   
1357 O O   . VAL A 189 ? 0.8221 0.7120 0.6124 -0.0712 -0.0052 -0.0060 189 VAL H O   
1358 C CB  . VAL A 189 ? 0.8148 0.7188 0.6229 -0.0412 -0.0123 -0.0303 189 VAL H CB  
1359 C CG1 . VAL A 189 ? 0.8582 0.7922 0.6760 -0.0613 -0.0096 -0.0375 189 VAL H CG1 
1360 C CG2 . VAL A 189 ? 0.8105 0.6644 0.6002 -0.0469 -0.0158 -0.0308 189 VAL H CG2 
1361 N N   . THR A 190 ? 0.8981 0.7428 0.6808 -0.0468 -0.0181 0.0057  190 THR H N   
1362 C CA  . THR A 190 ? 0.9587 0.7704 0.7186 -0.0610 -0.0195 0.0176  190 THR H CA  
1363 C C   . THR A 190 ? 1.0393 0.8135 0.7870 -0.0736 -0.0173 0.0142  190 THR H C   
1364 O O   . THR A 190 ? 1.0200 0.7692 0.7671 -0.0611 -0.0208 0.0105  190 THR H O   
1365 C CB  . THR A 190 ? 0.9400 0.7330 0.6936 -0.0470 -0.0310 0.0343  190 THR H CB  
1366 O OG1 . THR A 190 ? 0.9938 0.7824 0.7649 -0.0251 -0.0351 0.0348  190 THR H OG1 
1367 C CG2 . THR A 190 ? 0.7999 0.6199 0.5569 -0.0444 -0.0357 0.0384  190 THR H CG2 
1368 N N   . VAL A 191 ? 1.0439 0.8123 0.7816 -0.0983 -0.0097 0.0158  191 VAL H N   
1369 C CA  . VAL A 191 ? 1.1741 0.9052 0.9024 -0.1170 -0.0075 0.0134  191 VAL H CA  
1370 C C   . VAL A 191 ? 1.1690 0.8666 0.8722 -0.1336 -0.0016 0.0319  191 VAL H C   
1371 O O   . VAL A 191 ? 1.2740 0.9882 0.9674 -0.1355 0.0037  0.0420  191 VAL H O   
1372 C CB  . VAL A 191 ? 1.2170 0.9787 0.9660 -0.1370 -0.0032 -0.0029 191 VAL H CB  
1373 C CG1 . VAL A 191 ? 1.1324 0.9172 0.8958 -0.1197 -0.0107 -0.0205 191 VAL H CG1 
1374 C CG2 . VAL A 191 ? 1.1709 0.9788 0.9332 -0.1495 0.0084  0.0013  191 VAL H CG2 
1375 N N   . PRO A 192 ? 1.0969 0.7415 0.7840 -0.1447 -0.0018 0.0366  192 PRO H N   
1376 C CA  . PRO A 192 ? 1.0704 0.6784 0.7307 -0.1622 0.0061  0.0565  192 PRO H CA  
1377 C C   . PRO A 192 ? 1.1708 0.8137 0.8394 -0.1881 0.0229  0.0586  192 PRO H C   
1378 O O   . PRO A 192 ? 1.2074 0.8822 0.9059 -0.2048 0.0275  0.0446  192 PRO H O   
1379 C CB  . PRO A 192 ? 1.0313 0.5792 0.6812 -0.1731 0.0044  0.0555  192 PRO H CB  
1380 C CG  . PRO A 192 ? 1.1453 0.6856 0.8031 -0.1469 -0.0074 0.0407  192 PRO H CG  
1381 C CD  . PRO A 192 ? 1.0562 0.6637 0.7424 -0.1378 -0.0089 0.0249  192 PRO H CD  
1382 N N   . SER A 193 ? 1.1582 0.7958 0.7996 -0.1898 0.0317  0.0766  193 SER H N   
1383 C CA  . SER A 193 ? 1.1701 0.8409 0.8154 -0.2088 0.0528  0.0811  193 SER H CA  
1384 C C   . SER A 193 ? 1.1176 0.7777 0.7778 -0.2423 0.0674  0.0854  193 SER H C   
1385 O O   . SER A 193 ? 1.1711 0.8755 0.8579 -0.2599 0.0848  0.0841  193 SER H O   
1386 C CB  . SER A 193 ? 1.1869 0.8396 0.7857 -0.2019 0.0596  0.1001  193 SER H CB  
1387 O OG  . SER A 193 ? 1.2832 0.8737 0.8441 -0.2066 0.0576  0.1203  193 SER H OG  
1388 N N   . SER A 194 ? 1.0544 0.6556 0.7005 -0.2509 0.0607  0.0913  194 SER H N   
1389 C CA  . SER A 194 ? 1.1788 0.7589 0.8375 -0.2864 0.0723  0.0965  194 SER H CA  
1390 C C   . SER A 194 ? 1.1605 0.7713 0.8661 -0.3021 0.0631  0.0723  194 SER H C   
1391 O O   . SER A 194 ? 1.2719 0.8763 0.9991 -0.3362 0.0692  0.0730  194 SER H O   
1392 C CB  . SER A 194 ? 1.2621 0.7579 0.8834 -0.2892 0.0677  0.1118  194 SER H CB  
1393 O OG  . SER A 194 ? 1.2432 0.7085 0.8586 -0.2646 0.0460  0.0988  194 SER H OG  
1394 N N   . SER A 195 ? 1.2083 0.8517 0.9287 -0.2783 0.0474  0.0517  195 SER H N   
1395 C CA  . SER A 195 ? 1.2249 0.8955 0.9806 -0.2886 0.0349  0.0278  195 SER H CA  
1396 C C   . SER A 195 ? 1.3423 1.0973 1.1398 -0.2913 0.0409  0.0204  195 SER H C   
1397 O O   . SER A 195 ? 1.4495 1.2383 1.2786 -0.2990 0.0289  0.0021  195 SER H O   
1398 C CB  . SER A 195 ? 1.1029 0.7501 0.8440 -0.2591 0.0153  0.0106  195 SER H CB  
1399 O OG  . SER A 195 ? 1.0220 0.7072 0.7630 -0.2269 0.0138  0.0098  195 SER H OG  
1400 N N   . LEU A 196 ? 1.3499 1.1358 1.1440 -0.2832 0.0589  0.0348  196 LEU H N   
1401 C CA  . LEU A 196 ? 1.2936 1.1557 1.1241 -0.2795 0.0682  0.0299  196 LEU H CA  
1402 C C   . LEU A 196 ? 1.2553 1.1585 1.1329 -0.3142 0.0803  0.0336  196 LEU H C   
1403 O O   . LEU A 196 ? 1.2591 1.2310 1.1790 -0.3131 0.0842  0.0278  196 LEU H O   
1404 C CB  . LEU A 196 ? 1.1832 1.0557 0.9880 -0.2595 0.0853  0.0429  196 LEU H CB  
1405 C CG  . LEU A 196 ? 1.1066 0.9539 0.8757 -0.2266 0.0715  0.0399  196 LEU H CG  
1406 C CD1 . LEU A 196 ? 1.0630 0.9186 0.8045 -0.2125 0.0864  0.0505  196 LEU H CD1 
1407 C CD2 . LEU A 196 ? 1.0350 0.9127 0.8279 -0.2076 0.0539  0.0200  196 LEU H CD2 
1408 N N   . GLY A 197 ? 1.2253 1.0874 1.0987 -0.3449 0.0862  0.0450  197 GLY H N   
1409 C CA  . GLY A 197 ? 1.2731 1.1733 1.1965 -0.3827 0.0992  0.0525  197 GLY H CA  
1410 C C   . GLY A 197 ? 1.3169 1.2199 1.2760 -0.4096 0.0741  0.0343  197 GLY H C   
1411 O O   . GLY A 197 ? 1.3296 1.2871 1.3461 -0.4387 0.0767  0.0354  197 GLY H O   
1412 N N   . THR A 198 ? 1.2854 1.1298 1.2104 -0.3996 0.0493  0.0175  198 THR H N   
1413 C CA  . THR A 198 ? 1.2843 1.1138 1.2270 -0.4244 0.0233  -0.0029 198 THR H CA  
1414 C C   . THR A 198 ? 1.3671 1.2118 1.3023 -0.3964 -0.0026 -0.0296 198 THR H C   
1415 O O   . THR A 198 ? 1.3855 1.2780 1.3575 -0.4090 -0.0204 -0.0451 198 THR H O   
1416 C CB  . THR A 198 ? 1.2541 0.9849 1.1565 -0.4416 0.0179  -0.0012 198 THR H CB  
1417 N N   . GLN A 199 ? 1.3629 1.1687 1.2513 -0.3584 -0.0047 -0.0329 199 GLN H N   
1418 C CA  . GLN A 199 ? 1.3070 1.1183 1.1816 -0.3294 -0.0248 -0.0552 199 GLN H CA  
1419 C C   . GLN A 199 ? 1.1634 1.0606 1.0723 -0.3125 -0.0245 -0.0584 199 GLN H C   
1420 O O   . GLN A 199 ? 1.0536 0.9883 0.9737 -0.3004 -0.0050 -0.0428 199 GLN H O   
1421 C CB  . GLN A 199 ? 1.3013 1.0573 1.1267 -0.2928 -0.0227 -0.0528 199 GLN H CB  
1422 C CG  . GLN A 199 ? 1.3485 1.1023 1.1561 -0.2622 -0.0387 -0.0734 199 GLN H CG  
1423 C CD  . GLN A 199 ? 1.4281 1.1421 1.2215 -0.2781 -0.0593 -0.0967 199 GLN H CD  
1424 O OE1 . GLN A 199 ? 1.5278 1.1814 1.3064 -0.3026 -0.0617 -0.0973 199 GLN H OE1 
1425 N NE2 . GLN A 199 ? 1.3849 1.1276 1.1779 -0.2641 -0.0747 -0.1162 199 GLN H NE2 
1426 N N   . THR A 200 ? 1.1166 1.0396 1.0368 -0.3106 -0.0465 -0.0789 200 THR H N   
1427 C CA  . THR A 200 ? 1.0349 1.0352 0.9853 -0.2922 -0.0491 -0.0820 200 THR H CA  
1428 C C   . THR A 200 ? 0.9833 0.9718 0.8989 -0.2496 -0.0534 -0.0901 200 THR H C   
1429 O O   . THR A 200 ? 1.0075 0.9490 0.8877 -0.2401 -0.0680 -0.1055 200 THR H O   
1430 C CB  . THR A 200 ? 1.0171 1.0628 1.0049 -0.3160 -0.0730 -0.0965 200 THR H CB  
1431 O OG1 . THR A 200 ? 0.9927 1.0525 1.0213 -0.3596 -0.0689 -0.0872 200 THR H OG1 
1432 C CG2 . THR A 200 ? 0.9707 1.0986 0.9923 -0.2943 -0.0743 -0.0954 200 THR H CG2 
1433 N N   . TYR A 201 ? 0.8219 0.8507 0.7468 -0.2242 -0.0390 -0.0793 201 TYR H N   
1434 C CA  . TYR A 201 ? 0.8178 0.8404 0.7170 -0.1862 -0.0404 -0.0832 201 TYR H CA  
1435 C C   . TYR A 201 ? 0.8754 0.9620 0.7988 -0.1700 -0.0462 -0.0877 201 TYR H C   
1436 O O   . TYR A 201 ? 0.7395 0.8775 0.6953 -0.1694 -0.0344 -0.0774 201 TYR H O   
1437 C CB  . TYR A 201 ? 0.8162 0.8201 0.6991 -0.1685 -0.0217 -0.0669 201 TYR H CB  
1438 C CG  . TYR A 201 ? 0.8099 0.7511 0.6667 -0.1802 -0.0170 -0.0590 201 TYR H CG  
1439 C CD1 . TYR A 201 ? 0.7599 0.6443 0.5844 -0.1683 -0.0255 -0.0655 201 TYR H CD1 
1440 C CD2 . TYR A 201 ? 0.8000 0.7372 0.6623 -0.2005 -0.0022 -0.0436 201 TYR H CD2 
1441 C CE1 . TYR A 201 ? 0.9836 0.8091 0.7846 -0.1757 -0.0216 -0.0563 201 TYR H CE1 
1442 C CE2 . TYR A 201 ? 0.8796 0.7565 0.7143 -0.2097 0.0015  -0.0338 201 TYR H CE2 
1443 C CZ  . TYR A 201 ? 0.9748 0.7961 0.7802 -0.1969 -0.0094 -0.0400 201 TYR H CZ  
1444 O OH  . TYR A 201 ? 1.0326 0.7923 0.8110 -0.2028 -0.0061 -0.0285 201 TYR H OH  
1445 N N   . ILE A 202 ? 0.8473 0.9272 0.7511 -0.1545 -0.0630 -0.1023 202 ILE H N   
1446 C CA  . ILE A 202 ? 0.8385 0.9731 0.7584 -0.1373 -0.0715 -0.1059 202 ILE H CA  
1447 C C   . ILE A 202 ? 0.8101 0.9335 0.7027 -0.0995 -0.0649 -0.1035 202 ILE H C   
1448 O O   . ILE A 202 ? 0.8331 0.9073 0.6889 -0.0872 -0.0660 -0.1093 202 ILE H O   
1449 C CB  . ILE A 202 ? 0.8431 0.9863 0.7615 -0.1518 -0.0997 -0.1242 202 ILE H CB  
1450 C CG1 . ILE A 202 ? 0.9335 1.0864 0.8847 -0.1946 -0.1080 -0.1259 202 ILE H CG1 
1451 C CG2 . ILE A 202 ? 0.7708 0.9747 0.7066 -0.1330 -0.1103 -0.1247 202 ILE H CG2 
1452 N N   . CYS A 203 ? 0.6952 0.8637 0.6078 -0.0808 -0.0562 -0.0938 203 CYS H N   
1453 C CA  . CYS A 203 ? 0.6840 0.8459 0.5769 -0.0478 -0.0490 -0.0891 203 CYS H CA  
1454 C C   . CYS A 203 ? 0.7575 0.9424 0.6408 -0.0313 -0.0641 -0.0970 203 CYS H C   
1455 O O   . CYS A 203 ? 0.7875 1.0234 0.6971 -0.0282 -0.0696 -0.0940 203 CYS H O   
1456 C CB  . CYS A 203 ? 0.5392 0.7250 0.4518 -0.0361 -0.0305 -0.0739 203 CYS H CB  
1457 S SG  . CYS A 203 ? 1.4015 1.5760 1.2963 -0.0013 -0.0208 -0.0653 203 CYS H SG  
1458 N N   . ASN A 204 ? 0.7759 0.9225 0.6194 -0.0185 -0.0700 -0.1059 204 ASN H N   
1459 C CA  . ASN A 204 ? 0.7352 0.8943 0.5559 -0.0008 -0.0839 -0.1134 204 ASN H CA  
1460 C C   . ASN A 204 ? 0.6778 0.8435 0.4895 0.0328  -0.0686 -0.0998 204 ASN H C   
1461 O O   . ASN A 204 ? 0.7168 0.8464 0.5042 0.0488  -0.0554 -0.0962 204 ASN H O   
1462 C CB  . ASN A 204 ? 0.8343 0.9432 0.6077 -0.0032 -0.0966 -0.1318 204 ASN H CB  
1463 C CG  . ASN A 204 ? 0.8808 0.9710 0.6602 -0.0391 -0.1115 -0.1452 204 ASN H CG  
1464 O OD1 . ASN A 204 ? 0.9004 0.9369 0.6593 -0.0465 -0.1058 -0.1503 204 ASN H OD1 
1465 N ND2 . ASN A 204 ? 0.8495 0.9845 0.6604 -0.0615 -0.1306 -0.1495 204 ASN H ND2 
1466 N N   . VAL A 205 ? 0.6366 0.8490 0.4709 0.0435  -0.0694 -0.0908 205 VAL H N   
1467 C CA  . VAL A 205 ? 0.6194 0.8367 0.4474 0.0733  -0.0547 -0.0761 205 VAL H CA  
1468 C C   . VAL A 205 ? 0.7825 1.0128 0.5824 0.0941  -0.0675 -0.0780 205 VAL H C   
1469 O O   . VAL A 205 ? 0.8646 1.1330 0.6761 0.0900  -0.0873 -0.0822 205 VAL H O   
1470 C CB  . VAL A 205 ? 0.6517 0.9019 0.5187 0.0759  -0.0425 -0.0620 205 VAL H CB  
1471 C CG1 . VAL A 205 ? 0.6108 0.8615 0.4699 0.1051  -0.0295 -0.0471 205 VAL H CG1 
1472 C CG2 . VAL A 205 ? 0.7043 0.9349 0.5873 0.0586  -0.0289 -0.0592 205 VAL H CG2 
1473 N N   . ASN A 206 ? 0.7151 0.9155 0.4785 0.1170  -0.0562 -0.0731 206 ASN H N   
1474 C CA  . ASN A 206 ? 0.8224 1.0274 0.5476 0.1400  -0.0652 -0.0728 206 ASN H CA  
1475 C C   . ASN A 206 ? 0.7932 0.9986 0.5147 0.1687  -0.0435 -0.0509 206 ASN H C   
1476 O O   . ASN A 206 ? 0.8448 1.0223 0.5632 0.1762  -0.0210 -0.0416 206 ASN H O   
1477 C CB  . ASN A 206 ? 0.8515 1.0130 0.5215 0.1425  -0.0716 -0.0893 206 ASN H CB  
1478 C CG  . ASN A 206 ? 1.1464 1.3102 0.7662 0.1632  -0.0865 -0.0931 206 ASN H CG  
1479 O OD1 . ASN A 206 ? 1.2784 1.4834 0.9101 0.1685  -0.1023 -0.0873 206 ASN H OD1 
1480 N ND2 . ASN A 206 ? 1.3172 1.4357 0.8777 0.1773  -0.0811 -0.1020 206 ASN H ND2 
1481 N N   . HIS A 207 ? 0.8037 1.0417 0.5288 0.1841  -0.0508 -0.0411 207 HIS H N   
1482 C CA  . HIS A 207 ? 0.6962 0.9313 0.4153 0.2111  -0.0312 -0.0188 207 HIS H CA  
1483 C C   . HIS A 207 ? 0.8108 1.0463 0.4796 0.2361  -0.0411 -0.0154 207 HIS H C   
1484 O O   . HIS A 207 ? 0.8088 1.0780 0.4803 0.2451  -0.0594 -0.0118 207 HIS H O   
1485 C CB  . HIS A 207 ? 0.6780 0.9432 0.4427 0.2125  -0.0262 -0.0059 207 HIS H CB  
1486 C CG  . HIS A 207 ? 0.7539 1.0048 0.5174 0.2346  -0.0032 0.0169  207 HIS H CG  
1487 N ND1 . HIS A 207 ? 0.7226 0.9921 0.4852 0.2574  -0.0044 0.0321  207 HIS H ND1 
1488 C CD2 . HIS A 207 ? 0.7638 0.9831 0.5296 0.2361  0.0206  0.0283  207 HIS H CD2 
1489 C CE1 . HIS A 207 ? 0.7965 1.0409 0.5576 0.2710  0.0191  0.0514  207 HIS H CE1 
1490 N NE2 . HIS A 207 ? 0.8083 1.0244 0.5738 0.2569  0.0338  0.0493  207 HIS H NE2 
1491 N N   . LYS A 208 ? 0.8413 1.0398 0.4631 0.2491  -0.0284 -0.0153 208 LYS H N   
1492 C CA  . LYS A 208 ? 0.8033 0.9920 0.3624 0.2741  -0.0352 -0.0132 208 LYS H CA  
1493 C C   . LYS A 208 ? 1.0303 1.2358 0.5840 0.3012  -0.0289 0.0122  208 LYS H C   
1494 O O   . LYS A 208 ? 0.9922 1.2115 0.5094 0.3158  -0.0509 0.0117  208 LYS H O   
1495 C CB  . LYS A 208 ? 0.9945 1.1369 0.5066 0.2863  -0.0124 -0.0144 208 LYS H CB  
1496 C CG  . LYS A 208 ? 0.9732 1.0894 0.4731 0.2665  -0.0209 -0.0406 208 LYS H CG  
1497 N N   . PRO A 209 ? 0.9316 1.1328 0.5185 0.3078  -0.0009 0.0348  209 PRO H N   
1498 C CA  . PRO A 209 ? 0.8826 1.0919 0.4606 0.3342  0.0059  0.0599  209 PRO H CA  
1499 C C   . PRO A 209 ? 0.9777 1.2296 0.5759 0.3378  -0.0217 0.0595  209 PRO H C   
1500 O O   . PRO A 209 ? 1.1103 1.3699 0.6818 0.3640  -0.0271 0.0759  209 PRO H O   
1501 C CB  . PRO A 209 ? 0.8547 1.0494 0.4753 0.3310  0.0367  0.0790  209 PRO H CB  
1502 C CG  . PRO A 209 ? 0.8283 1.0005 0.4572 0.3137  0.0511  0.0694  209 PRO H CG  
1503 C CD  . PRO A 209 ? 0.7622 0.9449 0.3874 0.2941  0.0252  0.0402  209 PRO H CD  
1504 N N   . SER A 210 ? 0.7900 1.0705 0.4358 0.3134  -0.0376 0.0433  210 SER H N   
1505 C CA  . SER A 210 ? 0.7476 1.0768 0.4235 0.3164  -0.0619 0.0437  210 SER H CA  
1506 C C   . SER A 210 ? 1.0122 1.3694 0.6819 0.2986  -0.0986 0.0200  210 SER H C   
1507 O O   . SER A 210 ? 0.9666 1.3734 0.6710 0.2957  -0.1223 0.0185  210 SER H O   
1508 C CB  . SER A 210 ? 0.6924 1.0383 0.4325 0.3044  -0.0490 0.0470  210 SER H CB  
1509 O OG  . SER A 210 ? 0.7499 1.0913 0.5146 0.2722  -0.0482 0.0277  210 SER H OG  
1510 N N   . ASN A 211 ? 0.8325 1.1569 0.4597 0.2868  -0.1027 0.0022  211 ASN H N   
1511 C CA  . ASN A 211 ? 0.8713 1.2078 0.4844 0.2657  -0.1378 -0.0234 211 ASN H CA  
1512 C C   . ASN A 211 ? 0.8493 1.2258 0.5316 0.2342  -0.1506 -0.0344 211 ASN H C   
1513 O O   . ASN A 211 ? 0.9215 1.3423 0.6238 0.2237  -0.1836 -0.0423 211 ASN H O   
1514 C CB  . ASN A 211 ? 1.0866 1.4452 0.6583 0.2846  -0.1709 -0.0220 211 ASN H CB  
1515 C CG  . ASN A 211 ? 1.2295 1.5741 0.7546 0.2668  -0.2048 -0.0503 211 ASN H CG  
1516 O OD1 . ASN A 211 ? 1.3069 1.6420 0.8512 0.2349  -0.2107 -0.0716 211 ASN H OD1 
1517 N ND2 . ASN A 211 ? 1.3312 1.6683 0.7910 0.2867  -0.2272 -0.0507 211 ASN H ND2 
1518 N N   . THR A 212 ? 0.8047 1.1667 0.5238 0.2190  -0.1245 -0.0335 212 THR H N   
1519 C CA  . THR A 212 ? 0.8001 1.1949 0.5812 0.1910  -0.1290 -0.0406 212 THR H CA  
1520 C C   . THR A 212 ? 0.8259 1.1881 0.6026 0.1597  -0.1286 -0.0605 212 THR H C   
1521 O O   . THR A 212 ? 0.7883 1.1037 0.5432 0.1610  -0.1063 -0.0605 212 THR H O   
1522 C CB  . THR A 212 ? 0.7730 1.1769 0.5987 0.1985  -0.1002 -0.0230 212 THR H CB  
1523 O OG1 . THR A 212 ? 0.7318 1.1601 0.5610 0.2295  -0.0993 -0.0036 212 THR H OG1 
1524 C CG2 . THR A 212 ? 0.9531 1.3911 0.8369 0.1725  -0.1017 -0.0291 212 THR H CG2 
1525 N N   . LYS A 213 ? 0.9427 1.3309 0.7435 0.1315  -0.1537 -0.0758 213 LYS H N   
1526 C CA  . LYS A 213 ? 0.9343 1.2903 0.7336 0.0998  -0.1548 -0.0936 213 LYS H CA  
1527 C C   . LYS A 213 ? 0.8461 1.2405 0.7113 0.0715  -0.1545 -0.0929 213 LYS H C   
1528 O O   . LYS A 213 ? 0.9283 1.3747 0.8293 0.0584  -0.1780 -0.0952 213 LYS H O   
1529 C CB  . LYS A 213 ? 0.9788 1.3124 0.7307 0.0880  -0.1859 -0.1160 213 LYS H CB  
1530 N N   . VAL A 214 ? 0.8548 1.2255 0.7363 0.0623  -0.1279 -0.0884 214 VAL H N   
1531 C CA  . VAL A 214 ? 0.7307 1.1321 0.6677 0.0388  -0.1205 -0.0848 214 VAL H CA  
1532 C C   . VAL A 214 ? 0.7017 1.0615 0.6333 0.0088  -0.1155 -0.0954 214 VAL H C   
1533 O O   . VAL A 214 ? 0.6746 0.9828 0.5758 0.0144  -0.0993 -0.0953 214 VAL H O   
1534 C CB  . VAL A 214 ? 0.7560 1.1700 0.7183 0.0572  -0.0915 -0.0665 214 VAL H CB  
1535 C CG1 . VAL A 214 ? 0.8476 1.2880 0.8581 0.0350  -0.0797 -0.0630 214 VAL H CG1 
1536 C CG2 . VAL A 214 ? 0.6906 1.1430 0.6609 0.0882  -0.0948 -0.0539 214 VAL H CG2 
1537 N N   . ASP A 215 ? 0.7316 1.1155 0.6958 -0.0232 -0.1298 -0.1025 215 ASP H N   
1538 C CA  . ASP A 215 ? 0.8044 1.1507 0.7687 -0.0535 -0.1237 -0.1092 215 ASP H CA  
1539 C C   . ASP A 215 ? 0.7972 1.1774 0.8135 -0.0687 -0.1042 -0.0959 215 ASP H C   
1540 O O   . ASP A 215 ? 0.8457 1.2840 0.9112 -0.0829 -0.1124 -0.0924 215 ASP H O   
1541 C CB  . ASP A 215 ? 0.8778 1.2116 0.8320 -0.0829 -0.1538 -0.1282 215 ASP H CB  
1542 C CG  . ASP A 215 ? 1.0489 1.3361 0.9384 -0.0672 -0.1701 -0.1439 215 ASP H CG  
1543 O OD1 . ASP A 215 ? 1.0752 1.3224 0.9266 -0.0405 -0.1512 -0.1399 215 ASP H OD1 
1544 O OD2 . ASP A 215 ? 1.1611 1.4516 1.0373 -0.0817 -0.2017 -0.1599 215 ASP H OD2 
1545 N N   . LYS A 216 ? 0.7183 1.0634 0.7232 -0.0648 -0.0782 -0.0878 216 LYS H N   
1546 C CA  . LYS A 216 ? 0.7185 1.0870 0.7592 -0.0743 -0.0557 -0.0750 216 LYS H CA  
1547 C C   . LYS A 216 ? 0.7517 1.0798 0.7854 -0.1038 -0.0479 -0.0760 216 LYS H C   
1548 O O   . LYS A 216 ? 0.8312 1.1004 0.8252 -0.1012 -0.0443 -0.0788 216 LYS H O   
1549 C CB  . LYS A 216 ? 0.7956 1.1569 0.8256 -0.0450 -0.0323 -0.0633 216 LYS H CB  
1550 C CG  . LYS A 216 ? 0.8581 1.2617 0.9259 -0.0423 -0.0113 -0.0510 216 LYS H CG  
1551 C CD  . LYS A 216 ? 0.8738 1.3434 0.9798 -0.0264 -0.0195 -0.0469 216 LYS H CD  
1552 C CE  . LYS A 216 ? 0.9414 1.4586 1.0922 -0.0246 0.0033  -0.0346 216 LYS H CE  
1553 N NZ  . LYS A 216 ? 1.0811 1.6212 1.2672 -0.0601 0.0055  -0.0334 216 LYS H NZ  
1554 N N   . LYS A 217 ? 0.7294 1.0909 0.8045 -0.1309 -0.0443 -0.0713 217 LYS H N   
1555 C CA  . LYS A 217 ? 0.7225 1.0469 0.7926 -0.1603 -0.0345 -0.0685 217 LYS H CA  
1556 C C   . LYS A 217 ? 0.7100 1.0211 0.7717 -0.1513 -0.0035 -0.0537 217 LYS H C   
1557 O O   . LYS A 217 ? 0.7599 1.1158 0.8496 -0.1410 0.0143  -0.0434 217 LYS H O   
1558 C CB  . LYS A 217 ? 0.7989 1.1644 0.9189 -0.1967 -0.0428 -0.0679 217 LYS H CB  
1559 C CG  . LYS A 217 ? 0.7734 1.1014 0.8912 -0.2290 -0.0295 -0.0613 217 LYS H CG  
1560 N N   . VAL A 218 ? 0.6228 0.8701 0.6428 -0.1536 0.0023  -0.0527 218 VAL H N   
1561 C CA  . VAL A 218 ? 0.7151 0.9410 0.7164 -0.1465 0.0266  -0.0399 218 VAL H CA  
1562 C C   . VAL A 218 ? 0.8711 1.0752 0.8724 -0.1765 0.0387  -0.0308 218 VAL H C   
1563 O O   . VAL A 218 ? 0.9532 1.1116 0.9358 -0.1939 0.0281  -0.0344 218 VAL H O   
1564 C CB  . VAL A 218 ? 0.8277 1.0010 0.7833 -0.1250 0.0238  -0.0413 218 VAL H CB  
1565 C CG1 . VAL A 218 ? 0.7654 0.9195 0.6995 -0.1175 0.0438  -0.0295 218 VAL H CG1 
1566 C CG2 . VAL A 218 ? 0.7423 0.9328 0.6973 -0.0977 0.0132  -0.0484 218 VAL H CG2 
1567 N N   . GLU A 219 ? 0.9048 1.1386 0.9248 -0.1807 0.0633  -0.0181 219 GLU H N   
1568 C CA  . GLU A 219 ? 0.9550 1.1727 0.9756 -0.2086 0.0802  -0.0056 219 GLU H CA  
1569 C C   . GLU A 219 ? 0.9660 1.1822 0.9670 -0.1965 0.1113  0.0084  219 GLU H C   
1570 O O   . GLU A 219 ? 0.9333 1.1817 0.9412 -0.1720 0.1220  0.0079  219 GLU H O   
1571 C CB  . GLU A 219 ? 0.8711 1.1413 0.9515 -0.2384 0.0786  -0.0036 219 GLU H CB  
1572 N N   . PRO A 220 ? 0.9896 1.1624 0.9597 -0.2124 0.1260  0.0207  220 PRO H N   
1573 C CA  . PRO A 220 ? 0.9838 1.1470 0.9234 -0.2025 0.1561  0.0339  220 PRO H CA  
1574 C C   . PRO A 220 ? 0.9273 1.1575 0.9124 -0.2012 0.1845  0.0418  220 PRO H C   
1575 O O   . PRO A 220 ? 0.8728 1.1559 0.9193 -0.2196 0.1818  0.0428  220 PRO H O   
1576 C CB  . PRO A 220 ? 0.9841 1.0939 0.8908 -0.2266 0.1637  0.0476  220 PRO H CB  
1577 C CG  . PRO A 220 ? 1.0493 1.1203 0.9497 -0.2363 0.1328  0.0383  220 PRO H CG  
1578 C CD  . PRO A 220 ? 1.0006 1.1215 0.9531 -0.2375 0.1140  0.0228  220 PRO H CD  
1579 N N   . GLU B 1   ? 1.5338 1.1426 1.2562 -0.1982 -0.1211 -0.2619 1   GLU L N   
1580 C CA  . GLU B 1   ? 1.4492 1.1276 1.1807 -0.1565 -0.1074 -0.2584 1   GLU L CA  
1581 C C   . GLU B 1   ? 1.3430 1.0958 1.0495 -0.1738 -0.1186 -0.2704 1   GLU L C   
1582 O O   . GLU B 1   ? 1.3324 1.0581 0.9938 -0.2031 -0.1279 -0.3005 1   GLU L O   
1583 C CB  . GLU B 1   ? 1.5957 1.2150 1.3151 -0.1104 -0.0813 -0.2794 1   GLU L CB  
1584 C CG  . GLU B 1   ? 1.6209 1.3027 1.3337 -0.0779 -0.0693 -0.2855 1   GLU L CG  
1585 C CD  . GLU B 1   ? 1.6341 1.2914 1.3656 -0.0264 -0.0436 -0.2813 1   GLU L CD  
1586 O OE1 . GLU B 1   ? 1.7531 1.3660 1.5151 -0.0126 -0.0371 -0.2636 1   GLU L OE1 
1587 O OE2 . GLU B 1   ? 1.4961 1.1842 1.2148 -0.0006 -0.0305 -0.2914 1   GLU L OE2 
1588 N N   . ILE B 2   ? 1.2615 1.1064 0.9960 -0.1560 -0.1182 -0.2461 2   ILE L N   
1589 C CA  . ILE B 2   ? 1.1029 1.0262 0.8233 -0.1633 -0.1263 -0.2494 2   ILE L CA  
1590 C C   . ILE B 2   ? 0.9923 0.9236 0.7003 -0.1216 -0.1080 -0.2623 2   ILE L C   
1591 O O   . ILE B 2   ? 0.9157 0.8734 0.6552 -0.0851 -0.0958 -0.2435 2   ILE L O   
1592 C CB  . ILE B 2   ? 0.9921 1.0119 0.7520 -0.1663 -0.1348 -0.2134 2   ILE L CB  
1593 C CG1 . ILE B 2   ? 0.9687 0.9933 0.7441 -0.2084 -0.1514 -0.1948 2   ILE L CG1 
1594 C CG2 . ILE B 2   ? 0.8752 0.9774 0.6269 -0.1695 -0.1421 -0.2115 2   ILE L CG2 
1595 C CD1 . ILE B 2   ? 0.9528 1.0772 0.7646 -0.2102 -0.1562 -0.1596 2   ILE L CD1 
1596 N N   . VAL B 3   ? 1.0657 0.9744 0.7254 -0.1298 -0.1070 -0.2940 3   VAL L N   
1597 C CA  . VAL B 3   ? 0.9734 0.8906 0.6171 -0.0924 -0.0881 -0.3054 3   VAL L CA  
1598 C C   . VAL B 3   ? 0.9741 0.9916 0.6337 -0.0835 -0.0936 -0.2833 3   VAL L C   
1599 O O   . VAL B 3   ? 1.0476 1.1213 0.6977 -0.1143 -0.1128 -0.2783 3   VAL L O   
1600 C CB  . VAL B 3   ? 1.1092 0.9698 0.6870 -0.1034 -0.0830 -0.3489 3   VAL L CB  
1601 C CG1 . VAL B 3   ? 1.1457 1.0192 0.7093 -0.0609 -0.0590 -0.3566 3   VAL L CG1 
1602 C CG2 . VAL B 3   ? 1.1951 0.9449 0.7563 -0.1120 -0.0770 -0.3722 3   VAL L CG2 
1603 N N   . LEU B 4   ? 0.9606 1.0007 0.6478 -0.0420 -0.0775 -0.2668 4   LEU L N   
1604 C CA  . LEU B 4   ? 0.9150 1.0380 0.6195 -0.0281 -0.0799 -0.2444 4   LEU L CA  
1605 C C   . LEU B 4   ? 0.9826 1.1142 0.6596 -0.0070 -0.0662 -0.2550 4   LEU L C   
1606 O O   . LEU B 4   ? 1.1513 1.2479 0.8339 0.0235  -0.0465 -0.2579 4   LEU L O   
1607 C CB  . LEU B 4   ? 0.7142 0.8592 0.4714 -0.0011 -0.0749 -0.2142 4   LEU L CB  
1608 C CG  . LEU B 4   ? 0.7273 0.8761 0.5117 -0.0164 -0.0850 -0.1996 4   LEU L CG  
1609 C CD1 . LEU B 4   ? 0.6800 0.8517 0.5038 0.0118  -0.0790 -0.1753 4   LEU L CD1 
1610 C CD2 . LEU B 4   ? 0.6998 0.9037 0.4790 -0.0500 -0.1030 -0.1935 4   LEU L CD2 
1611 N N   . THR B 5   ? 0.9981 1.1839 0.6469 -0.0240 -0.0769 -0.2570 5   THR L N   
1612 C CA  . THR B 5   ? 1.0045 1.2111 0.6226 -0.0069 -0.0648 -0.2635 5   THR L CA  
1613 C C   . THR B 5   ? 0.7883 1.0808 0.4392 0.0092  -0.0686 -0.2260 5   THR L C   
1614 O O   . THR B 5   ? 0.7999 1.1536 0.4608 -0.0100 -0.0872 -0.2084 5   THR L O   
1615 C CB  . THR B 5   ? 1.0564 1.2547 0.6034 -0.0401 -0.0737 -0.2977 5   THR L CB  
1616 O OG1 . THR B 5   ? 1.1981 1.4685 0.7444 -0.0742 -0.1006 -0.2824 5   THR L OG1 
1617 C CG2 . THR B 5   ? 1.0616 1.1637 0.5758 -0.0599 -0.0723 -0.3358 5   THR L CG2 
1618 N N   . GLN B 6   ? 0.8121 1.1097 0.4837 0.0448  -0.0508 -0.2105 6   GLN L N   
1619 C CA  . GLN B 6   ? 0.8026 1.1698 0.5072 0.0621  -0.0529 -0.1730 6   GLN L CA  
1620 C C   . GLN B 6   ? 0.8810 1.2932 0.5474 0.0636  -0.0484 -0.1718 6   GLN L C   
1621 O O   . GLN B 6   ? 0.9160 1.2962 0.5353 0.0645  -0.0348 -0.2001 6   GLN L O   
1622 C CB  . GLN B 6   ? 0.7110 1.0595 0.4662 0.0949  -0.0403 -0.1507 6   GLN L CB  
1623 C CG  . GLN B 6   ? 0.6240 0.9337 0.4121 0.0938  -0.0449 -0.1502 6   GLN L CG  
1624 C CD  . GLN B 6   ? 0.6595 0.9555 0.4923 0.1203  -0.0374 -0.1279 6   GLN L CD  
1625 O OE1 . GLN B 6   ? 0.6946 0.9430 0.5409 0.1250  -0.0331 -0.1339 6   GLN L OE1 
1626 N NE2 . GLN B 6   ? 0.5544 0.8918 0.4110 0.1354  -0.0378 -0.0999 6   GLN L NE2 
1627 N N   . SER B 7   ? 0.8566 1.3439 0.5427 0.0660  -0.0584 -0.1377 7   SER L N   
1628 C CA  . SER B 7   ? 0.9748 1.5187 0.6269 0.0657  -0.0568 -0.1283 7   SER L CA  
1629 C C   . SER B 7   ? 0.9316 1.5433 0.6332 0.0855  -0.0604 -0.0764 7   SER L C   
1630 O O   . SER B 7   ? 0.9877 1.6231 0.7334 0.0865  -0.0726 -0.0527 7   SER L O   
1631 C CB  . SER B 7   ? 1.2445 1.8183 0.8388 0.0261  -0.0759 -0.1498 7   SER L CB  
1632 O OG  . SER B 7   ? 1.3260 1.9443 0.9519 0.0071  -0.0989 -0.1290 7   SER L OG  
1633 N N   . PRO B 8   ? 0.8952 1.5375 0.5906 0.1030  -0.0479 -0.0571 8   PRO L N   
1634 C CA  . PRO B 8   ? 0.8993 1.5192 0.5433 0.1079  -0.0280 -0.0834 8   PRO L CA  
1635 C C   . PRO B 8   ? 0.8642 1.4214 0.5380 0.1343  -0.0063 -0.0886 8   PRO L C   
1636 O O   . PRO B 8   ? 0.9006 1.4259 0.6270 0.1427  -0.0103 -0.0773 8   PRO L O   
1637 C CB  . PRO B 8   ? 0.8861 1.5858 0.5224 0.1159  -0.0255 -0.0471 8   PRO L CB  
1638 C CG  . PRO B 8   ? 0.8398 1.5708 0.5508 0.1316  -0.0346 0.0046  8   PRO L CG  
1639 C CD  . PRO B 8   ? 0.8662 1.5737 0.6042 0.1198  -0.0516 -0.0040 8   PRO L CD  
1640 N N   . ALA B 9   ? 0.9394 1.4837 0.5787 0.1474  0.0167  -0.1045 9   ALA L N   
1641 C CA  . ALA B 9   ? 1.0142 1.5120 0.6853 0.1734  0.0381  -0.1036 9   ALA L CA  
1642 C C   . ALA B 9   ? 0.9190 1.4529 0.6551 0.1932  0.0399  -0.0509 9   ALA L C   
1643 O O   . ALA B 9   ? 0.8682 1.3666 0.6544 0.2051  0.0423  -0.0390 9   ALA L O   
1644 C CB  . ALA B 9   ? 1.1570 1.6380 0.7741 0.1861  0.0660  -0.1330 9   ALA L CB  
1645 N N   . THR B 10  ? 0.8308 1.4351 0.5652 0.1937  0.0368  -0.0178 10  THR L N   
1646 C CA  . THR B 10  ? 0.8449 1.4822 0.6394 0.2094  0.0374  0.0357  10  THR L CA  
1647 C C   . THR B 10  ? 0.8597 1.5593 0.6675 0.2022  0.0192  0.0732  10  THR L C   
1648 O O   . THR B 10  ? 0.9528 1.7059 0.7137 0.1910  0.0159  0.0714  10  THR L O   
1649 C CB  . THR B 10  ? 0.8643 1.5314 0.6540 0.2281  0.0634  0.0529  10  THR L CB  
1650 O OG1 . THR B 10  ? 0.9415 1.5563 0.7177 0.2392  0.0834  0.0189  10  THR L OG1 
1651 C CG2 . THR B 10  ? 0.7487 1.4391 0.6091 0.2395  0.0615  0.1100  10  THR L CG2 
1652 N N   . LEU B 11  ? 0.8051 1.4961 0.6755 0.2087  0.0072  0.1075  11  LEU L N   
1653 C CA  . LEU B 11  ? 0.7439 1.4878 0.6392 0.2086  -0.0078 0.1496  11  LEU L CA  
1654 C C   . LEU B 11  ? 0.7786 1.5449 0.7234 0.2234  -0.0032 0.2044  11  LEU L C   
1655 O O   . LEU B 11  ? 0.9074 1.6257 0.9025 0.2312  -0.0051 0.2181  11  LEU L O   
1656 C CB  . LEU B 11  ? 0.7248 1.4380 0.6512 0.2064  -0.0247 0.1455  11  LEU L CB  
1657 C CG  . LEU B 11  ? 0.8135 1.5276 0.7004 0.1873  -0.0349 0.1069  11  LEU L CG  
1658 N N   . SER B 12  ? 0.7234 1.5633 0.6518 0.2241  0.0014  0.2368  12  SER L N   
1659 C CA  . SER B 12  ? 0.6844 1.5545 0.6608 0.2350  0.0047  0.2964  12  SER L CA  
1660 C C   . SER B 12  ? 0.7602 1.6614 0.7758 0.2384  -0.0131 0.3434  12  SER L C   
1661 O O   . SER B 12  ? 0.8078 1.7825 0.7993 0.2337  -0.0188 0.3641  12  SER L O   
1662 C CB  . SER B 12  ? 0.6605 1.5987 0.5996 0.2365  0.0231  0.3119  12  SER L CB  
1663 O OG  . SER B 12  ? 0.7711 1.6784 0.6842 0.2409  0.0443  0.2745  12  SER L OG  
1664 N N   . LEU B 13  ? 0.8091 1.6533 0.8838 0.2470  -0.0216 0.3604  13  LEU L N   
1665 C CA  . LEU B 13  ? 0.6645 1.5152 0.7812 0.2534  -0.0327 0.3993  13  LEU L CA  
1666 C C   . LEU B 13  ? 0.7766 1.5769 0.9530 0.2567  -0.0306 0.4380  13  LEU L C   
1667 O O   . LEU B 13  ? 0.8155 1.5719 1.0093 0.2572  -0.0290 0.4337  13  LEU L O   
1668 C CB  . LEU B 13  ? 0.6710 1.4819 0.7910 0.2573  -0.0428 0.3678  13  LEU L CB  
1669 C CG  . LEU B 13  ? 0.7145 1.5727 0.7815 0.2461  -0.0488 0.3332  13  LEU L CG  
1670 C CD1 . LEU B 13  ? 0.8213 1.6373 0.9006 0.2494  -0.0560 0.3053  13  LEU L CD1 
1671 C CD2 . LEU B 13  ? 0.7035 1.6416 0.7558 0.2346  -0.0497 0.3618  13  LEU L CD2 
1672 N N   . SER B 14  ? 0.7933 1.6006 1.0017 0.2572  -0.0319 0.4768  14  SER L N   
1673 C CA  . SER B 14  ? 0.8358 1.5913 1.0993 0.2584  -0.0330 0.5143  14  SER L CA  
1674 C C   . SER B 14  ? 0.8695 1.5322 1.1611 0.2700  -0.0423 0.4954  14  SER L C   
1675 O O   . SER B 14  ? 0.9100 1.5677 1.1890 0.2797  -0.0450 0.4704  14  SER L O   
1676 C CB  . SER B 14  ? 0.7789 1.5858 1.0655 0.2559  -0.0294 0.5670  14  SER L CB  
1677 N N   . PRO B 15  ? 0.8411 1.4328 1.1698 0.2683  -0.0474 0.5078  15  PRO L N   
1678 C CA  . PRO B 15  ? 0.8078 1.3053 1.1598 0.2807  -0.0561 0.4908  15  PRO L CA  
1679 C C   . PRO B 15  ? 0.7779 1.2678 1.1491 0.2983  -0.0548 0.5072  15  PRO L C   
1680 O O   . PRO B 15  ? 0.7564 1.2592 1.1575 0.2976  -0.0535 0.5521  15  PRO L O   
1681 C CB  . PRO B 15  ? 0.8402 1.2794 1.2291 0.2686  -0.0635 0.5159  15  PRO L CB  
1682 C CG  . PRO B 15  ? 0.7930 1.2944 1.1709 0.2505  -0.0576 0.5279  15  PRO L CG  
1683 C CD  . PRO B 15  ? 0.8087 1.4077 1.1569 0.2529  -0.0454 0.5375  15  PRO L CD  
1684 N N   . GLY B 16  ? 0.8339 1.3076 1.1910 0.3145  -0.0540 0.4736  16  GLY L N   
1685 C CA  . GLY B 16  ? 0.9068 1.3813 1.2830 0.3346  -0.0500 0.4880  16  GLY L CA  
1686 C C   . GLY B 16  ? 0.9095 1.4650 1.2579 0.3348  -0.0459 0.4753  16  GLY L C   
1687 O O   . GLY B 16  ? 0.9337 1.4862 1.2907 0.3528  -0.0422 0.4689  16  GLY L O   
1688 N N   . GLU B 17  ? 0.9247 1.5536 1.2390 0.3145  -0.0464 0.4723  17  GLU L N   
1689 C CA  . GLU B 17  ? 0.8734 1.5796 1.1550 0.3077  -0.0463 0.4588  17  GLU L CA  
1690 C C   . GLU B 17  ? 0.8553 1.5352 1.1143 0.3112  -0.0486 0.4080  17  GLU L C   
1691 O O   . GLU B 17  ? 0.8741 1.4838 1.1358 0.3170  -0.0494 0.3817  17  GLU L O   
1692 C CB  . GLU B 17  ? 0.7541 1.5379 0.9985 0.2857  -0.0463 0.4648  17  GLU L CB  
1693 N N   . ARG B 18  ? 0.7849 1.5244 1.0225 0.3053  -0.0504 0.3964  18  ARG L N   
1694 C CA  . ARG B 18  ? 0.5915 1.3162 0.8093 0.3056  -0.0526 0.3520  18  ARG L CA  
1695 C C   . ARG B 18  ? 0.5649 1.3290 0.7327 0.2821  -0.0593 0.3205  18  ARG L C   
1696 O O   . ARG B 18  ? 0.8137 1.6393 0.9558 0.2652  -0.0622 0.3329  18  ARG L O   
1697 C CB  . ARG B 18  ? 0.7878 1.5488 1.0192 0.3135  -0.0507 0.3591  18  ARG L CB  
1698 C CG  . ARG B 18  ? 0.7316 1.5853 0.9331 0.2886  -0.0586 0.3600  18  ARG L CG  
1699 C CD  . ARG B 18  ? 0.7038 1.5888 0.9215 0.2945  -0.0571 0.3627  18  ARG L CD  
1700 N NE  . ARG B 18  ? 0.8344 1.8021 1.0214 0.2636  -0.0683 0.3576  18  ARG L NE  
1701 N N   . ALA B 19  ? 0.6822 1.4093 0.8341 0.2822  -0.0614 0.2786  19  ALA L N   
1702 C CA  . ALA B 19  ? 0.5998 1.3405 0.7015 0.2586  -0.0653 0.2405  19  ALA L CA  
1703 C C   . ALA B 19  ? 0.6380 1.3917 0.7178 0.2445  -0.0703 0.2073  19  ALA L C   
1704 O O   . ALA B 19  ? 0.7658 1.4866 0.8671 0.2570  -0.0672 0.1974  19  ALA L O   
1705 C CB  . ALA B 19  ? 0.5183 1.1785 0.6126 0.2555  -0.0574 0.2132  19  ALA L CB  
1706 N N   . THR B 20  ? 0.6674 1.4683 0.7018 0.2169  -0.0778 0.1900  20  THR L N   
1707 C CA  . THR B 20  ? 0.8785 1.6940 0.8901 0.1955  -0.0858 0.1607  20  THR L CA  
1708 C C   . THR B 20  ? 0.8918 1.6610 0.8498 0.1693  -0.0840 0.1103  20  THR L C   
1709 O O   . THR B 20  ? 0.9285 1.7236 0.8414 0.1497  -0.0872 0.0994  20  THR L O   
1710 C CB  . THR B 20  ? 0.9399 1.8563 0.9459 0.1801  -0.1015 0.1870  20  THR L CB  
1711 O OG1 . THR B 20  ? 1.0497 1.9849 1.1095 0.2026  -0.0933 0.2318  20  THR L OG1 
1712 C CG2 . THR B 20  ? 0.9141 1.8461 0.9013 0.1525  -0.1119 0.1599  20  THR L CG2 
1713 N N   . LEU B 21  ? 0.8558 1.5553 0.8173 0.1707  -0.0779 0.0801  21  LEU L N   
1714 C CA  . LEU B 21  ? 0.7675 1.4142 0.6873 0.1512  -0.0743 0.0362  21  LEU L CA  
1715 C C   . LEU B 21  ? 0.7953 1.4472 0.6935 0.1239  -0.0846 0.0107  21  LEU L C   
1716 O O   . LEU B 21  ? 0.7050 1.3626 0.6315 0.1280  -0.0874 0.0172  21  LEU L O   
1717 C CB  . LEU B 21  ? 0.7120 1.2806 0.6501 0.1671  -0.0629 0.0241  21  LEU L CB  
1718 C CG  . LEU B 21  ? 0.7352 1.2872 0.6913 0.1859  -0.0537 0.0446  21  LEU L CG  
1719 C CD1 . LEU B 21  ? 0.6453 1.2117 0.6483 0.2086  -0.0551 0.0843  21  LEU L CD1 
1720 C CD2 . LEU B 21  ? 0.7609 1.2423 0.7189 0.1883  -0.0458 0.0233  21  LEU L CD2 
1721 N N   . SER B 22  ? 0.7824 1.4305 0.6292 0.0960  -0.0894 -0.0182 22  SER L N   
1722 C CA  . SER B 22  ? 0.8185 1.4701 0.6421 0.0627  -0.1027 -0.0409 22  SER L CA  
1723 C C   . SER B 22  ? 0.7629 1.3300 0.5679 0.0537  -0.0958 -0.0792 22  SER L C   
1724 O O   . SER B 22  ? 0.6971 1.2098 0.4937 0.0690  -0.0813 -0.0931 22  SER L O   
1725 C CB  . SER B 22  ? 0.7868 1.4873 0.5602 0.0306  -0.1172 -0.0489 22  SER L CB  
1726 O OG  . SER B 22  ? 0.9536 1.7463 0.7493 0.0334  -0.1286 -0.0073 22  SER L OG  
1727 N N   . CYS B 23  ? 0.6950 1.2572 0.4982 0.0288  -0.1064 -0.0909 23  CYS L N   
1728 C CA  . CYS B 23  ? 0.8419 1.3278 0.6296 0.0167  -0.1024 -0.1222 23  CYS L CA  
1729 C C   . CYS B 23  ? 0.8525 1.3480 0.6187 -0.0263 -0.1204 -0.1358 23  CYS L C   
1730 O O   . CYS B 23  ? 0.8078 1.3478 0.6044 -0.0354 -0.1297 -0.1158 23  CYS L O   
1731 C CB  . CYS B 23  ? 0.8008 1.2536 0.6305 0.0411  -0.0924 -0.1125 23  CYS L CB  
1732 S SG  . CYS B 23  ? 0.8956 1.2577 0.7132 0.0323  -0.0864 -0.1416 23  CYS L SG  
1733 N N   . ARG B 24  ? 0.7798 1.2331 0.4935 -0.0528 -0.1246 -0.1693 24  ARG L N   
1734 C CA  . ARG B 24  ? 0.8003 1.2516 0.4879 -0.1006 -0.1448 -0.1848 24  ARG L CA  
1735 C C   . ARG B 24  ? 0.9286 1.2906 0.6107 -0.1108 -0.1400 -0.2090 24  ARG L C   
1736 O O   . ARG B 24  ? 1.0698 1.3611 0.7422 -0.0874 -0.1217 -0.2275 24  ARG L O   
1737 C CB  . ARG B 24  ? 0.8487 1.3085 0.4728 -0.1305 -0.1565 -0.2086 24  ARG L CB  
1738 N N   . ALA B 25  ? 0.8083 1.1797 0.5010 -0.1457 -0.1566 -0.2036 25  ALA L N   
1739 C CA  . ALA B 25  ? 0.9313 1.2235 0.6226 -0.1599 -0.1550 -0.2196 25  ALA L CA  
1740 C C   . ALA B 25  ? 0.9223 1.1789 0.5682 -0.2143 -0.1754 -0.2456 25  ALA L C   
1741 O O   . ALA B 25  ? 1.0623 1.3795 0.6918 -0.2493 -0.1970 -0.2408 25  ALA L O   
1742 C CB  . ALA B 25  ? 0.7769 1.1018 0.5220 -0.1544 -0.1550 -0.1882 25  ALA L CB  
1743 N N   . SER B 26  ? 1.0695 1.2265 0.6962 -0.2226 -0.1698 -0.2712 26  SER L N   
1744 C CA  . SER B 26  ? 1.0730 1.1730 0.6538 -0.2751 -0.1886 -0.2999 26  SER L CA  
1745 C C   . SER B 26  ? 1.0693 1.2238 0.6786 -0.3233 -0.2153 -0.2725 26  SER L C   
1746 O O   . SER B 26  ? 1.3670 1.5154 0.9423 -0.3778 -0.2405 -0.2862 26  SER L O   
1747 C CB  . SER B 26  ? 1.1299 1.1051 0.6935 -0.2659 -0.1732 -0.3279 26  SER L CB  
1748 O OG  . SER B 26  ? 1.2302 1.1957 0.8482 -0.2508 -0.1663 -0.2997 26  SER L OG  
1749 N N   . GLN B 27  ? 1.0529 1.2622 0.7230 -0.3039 -0.2096 -0.2333 27  GLN L N   
1750 C CA  . GLN B 27  ? 1.0821 1.3613 0.7881 -0.3418 -0.2297 -0.1994 27  GLN L CA  
1751 C C   . GLN B 27  ? 0.9601 1.3321 0.7246 -0.3033 -0.2168 -0.1579 27  GLN L C   
1752 O O   . GLN B 27  ? 0.8235 1.1920 0.5986 -0.2517 -0.1950 -0.1579 27  GLN L O   
1753 C CB  . GLN B 27  ? 1.1397 1.3444 0.8497 -0.3735 -0.2361 -0.2014 27  GLN L CB  
1754 C CG  . GLN B 27  ? 1.1731 1.3021 0.8983 -0.3316 -0.2113 -0.2046 27  GLN L CG  
1755 C CD  . GLN B 27  ? 1.3523 1.4151 1.0866 -0.3636 -0.2190 -0.1984 27  GLN L CD  
1756 O OE1 . GLN B 27  ? 1.4734 1.5821 1.2289 -0.4071 -0.2383 -0.1724 27  GLN L OE1 
1757 N NE2 . GLN B 27  ? 1.3888 1.3476 1.1115 -0.3419 -0.2036 -0.2176 27  GLN L NE2 
1758 N N   . SER B 28  ? 0.9503 1.4040 0.7520 -0.3291 -0.2299 -0.1225 28  SER L N   
1759 C CA  . SER B 28  ? 0.8528 1.3974 0.7068 -0.2924 -0.2157 -0.0843 28  SER L CA  
1760 C C   . SER B 28  ? 0.7547 1.2516 0.6266 -0.2513 -0.1913 -0.0828 28  SER L C   
1761 O O   . SER B 28  ? 0.7662 1.2013 0.6348 -0.2683 -0.1921 -0.0874 28  SER L O   
1762 C CB  . SER B 28  ? 0.8200 1.4625 0.7110 -0.3298 -0.2323 -0.0451 28  SER L CB  
1763 N N   . VAL B 29  ? 0.7459 1.2707 0.6361 -0.1992 -0.1714 -0.0749 29  VAL L N   
1764 C CA  . VAL B 29  ? 0.6782 1.1665 0.5820 -0.1621 -0.1509 -0.0729 29  VAL L CA  
1765 C C   . VAL B 29  ? 0.7490 1.3215 0.6910 -0.1387 -0.1391 -0.0409 29  VAL L C   
1766 O O   . VAL B 29  ? 0.6989 1.2538 0.6491 -0.1122 -0.1233 -0.0372 29  VAL L O   
1767 C CB  . VAL B 29  ? 0.7134 1.1461 0.6018 -0.1204 -0.1362 -0.0944 29  VAL L CB  
1768 C CG1 . VAL B 29  ? 0.6925 1.0466 0.5425 -0.1369 -0.1423 -0.1261 29  VAL L CG1 
1769 C CG2 . VAL B 29  ? 0.7044 1.1996 0.6060 -0.0902 -0.1302 -0.0834 29  VAL L CG2 
1770 N N   . ASN B 30  ? 0.7611 1.4268 0.7244 -0.1478 -0.1463 -0.0176 30  ASN L N   
1771 C CA  . ASN B 30  ? 0.7363 1.4928 0.7391 -0.1270 -0.1335 0.0163  30  ASN L CA  
1772 C C   . ASN B 30  ? 0.7052 1.4510 0.7157 -0.0671 -0.1072 0.0138  30  ASN L C   
1773 O O   . ASN B 30  ? 0.6818 1.4212 0.6971 -0.0499 -0.0917 0.0181  30  ASN L O   
1774 C CB  . ASN B 30  ? 0.7545 1.5274 0.7701 -0.1562 -0.1355 0.0342  30  ASN L CB  
1775 C CG  . ASN B 30  ? 0.9577 1.6998 0.9575 -0.2187 -0.1625 0.0286  30  ASN L CG  
1776 O OD1 . ASN B 30  ? 1.1593 1.9349 1.1555 -0.2514 -0.1832 0.0306  30  ASN L OD1 
1777 N ND2 . ASN B 30  ? 0.9752 1.6503 0.9636 -0.2371 -0.1637 0.0221  30  ASN L ND2 
1778 N N   . ASN B 31  ? 0.6933 1.4347 0.7014 -0.0385 -0.1035 0.0067  31  ASN L N   
1779 C CA  . ASN B 31  ? 0.4935 1.2175 0.5084 0.0154  -0.0816 0.0038  31  ASN L CA  
1780 C C   . ASN B 31  ? 0.6639 1.2939 0.6540 0.0294  -0.0731 -0.0220 31  ASN L C   
1781 O O   . ASN B 31  ? 0.4821 1.0811 0.4709 0.0667  -0.0601 -0.0294 31  ASN L O   
1782 C CB  . ASN B 31  ? 0.5617 1.3621 0.6097 0.0443  -0.0631 0.0311  31  ASN L CB  
1783 C CG  . ASN B 31  ? 0.6968 1.6008 0.7797 0.0422  -0.0687 0.0640  31  ASN L CG  
1784 O OD1 . ASN B 31  ? 0.8023 1.7764 0.9031 0.0085  -0.0797 0.0865  31  ASN L OD1 
1785 N ND2 . ASN B 31  ? 0.6735 1.5915 0.7698 0.0765  -0.0627 0.0714  31  ASN L ND2 
1786 N N   . ARG B 32  ? 0.5082 1.0929 0.4808 -0.0021 -0.0821 -0.0329 32  ARG L N   
1787 C CA  . ARG B 32  ? 0.5091 1.0145 0.4627 0.0080  -0.0766 -0.0510 32  ARG L CA  
1788 C C   . ARG B 32  ? 0.5445 0.9854 0.4816 0.0155  -0.0805 -0.0720 32  ARG L C   
1789 O O   . ARG B 32  ? 0.6026 0.9851 0.5238 -0.0020 -0.0871 -0.0858 32  ARG L O   
1790 C CB  . ARG B 32  ? 0.5587 1.0417 0.5052 -0.0262 -0.0844 -0.0485 32  ARG L CB  
1791 C CG  . ARG B 32  ? 0.5519 1.0956 0.5130 -0.0290 -0.0764 -0.0254 32  ARG L CG  
1792 C CD  . ARG B 32  ? 0.6662 1.1980 0.6258 -0.0710 -0.0880 -0.0151 32  ARG L CD  
1793 N NE  . ARG B 32  ? 0.6737 1.2587 0.6434 -0.0700 -0.0771 0.0083  32  ARG L NE  
1794 C CZ  . ARG B 32  ? 0.7121 1.3880 0.7061 -0.0788 -0.0735 0.0349  32  ARG L CZ  
1795 N NH1 . ARG B 32  ? 0.6782 1.4028 0.6902 -0.0919 -0.0833 0.0428  32  ARG L NH1 
1796 N NH2 . ARG B 32  ? 0.6050 1.3300 0.6052 -0.0747 -0.0600 0.0563  32  ARG L NH2 
1797 N N   . LEU B 33  ? 0.4941 0.9484 0.4381 0.0437  -0.0746 -0.0712 33  LEU L N   
1798 C CA  . LEU B 33  ? 0.5069 0.9144 0.4393 0.0534  -0.0759 -0.0851 33  LEU L CA  
1799 C C   . LEU B 33  ? 0.5681 0.9528 0.5084 0.0902  -0.0648 -0.0845 33  LEU L C   
1800 O O   . LEU B 33  ? 0.4720 0.8893 0.4269 0.1128  -0.0559 -0.0732 33  LEU L O   
1801 C CB  . LEU B 33  ? 0.5956 1.0426 0.5259 0.0442  -0.0839 -0.0815 33  LEU L CB  
1802 C CG  . LEU B 33  ? 0.6911 1.0962 0.6029 0.0483  -0.0845 -0.0962 33  LEU L CG  
1803 C CD1 . LEU B 33  ? 0.6363 0.9966 0.5198 0.0177  -0.0920 -0.1174 33  LEU L CD1 
1804 C CD2 . LEU B 33  ? 0.5058 0.9632 0.4220 0.0567  -0.0870 -0.0836 33  LEU L CD2 
1805 N N   . ALA B 34  ? 0.5969 0.9246 0.5284 0.0960  -0.0650 -0.0958 34  ALA L N   
1806 C CA  . ALA B 34  ? 0.5390 0.8384 0.4774 0.1232  -0.0588 -0.0947 34  ALA L CA  
1807 C C   . ALA B 34  ? 0.5690 0.8537 0.5107 0.1318  -0.0596 -0.0934 34  ALA L C   
1808 O O   . ALA B 34  ? 0.6268 0.9039 0.5577 0.1179  -0.0628 -0.1001 34  ALA L O   
1809 C CB  . ALA B 34  ? 0.6289 0.8805 0.5583 0.1207  -0.0595 -0.1025 34  ALA L CB  
1810 N N   . TRP B 35  ? 0.5759 0.8545 0.5310 0.1552  -0.0556 -0.0845 35  TRP L N   
1811 C CA  . TRP B 35  ? 0.5930 0.8634 0.5558 0.1639  -0.0558 -0.0766 35  TRP L CA  
1812 C C   . TRP B 35  ? 0.7136 0.9337 0.6834 0.1724  -0.0567 -0.0761 35  TRP L C   
1813 O O   . TRP B 35  ? 0.7896 0.9857 0.7595 0.1800  -0.0567 -0.0793 35  TRP L O   
1814 C CB  . TRP B 35  ? 0.4905 0.8052 0.4696 0.1803  -0.0531 -0.0575 35  TRP L CB  
1815 C CG  . TRP B 35  ? 0.5449 0.9184 0.5180 0.1671  -0.0566 -0.0529 35  TRP L CG  
1816 C CD1 . TRP B 35  ? 0.5824 1.0026 0.5597 0.1616  -0.0577 -0.0480 35  TRP L CD1 
1817 C CD2 . TRP B 35  ? 0.6175 1.0137 0.5769 0.1550  -0.0606 -0.0518 35  TRP L CD2 
1818 N NE1 . TRP B 35  ? 0.6308 1.1010 0.5993 0.1427  -0.0658 -0.0431 35  TRP L NE1 
1819 C CE2 . TRP B 35  ? 0.6160 1.0691 0.5687 0.1385  -0.0675 -0.0480 35  TRP L CE2 
1820 C CE3 . TRP B 35  ? 0.6082 0.9861 0.5587 0.1562  -0.0584 -0.0529 35  TRP L CE3 
1821 C CZ2 . TRP B 35  ? 0.6003 1.0860 0.5307 0.1205  -0.0744 -0.0496 35  TRP L CZ2 
1822 C CZ3 . TRP B 35  ? 0.4889 0.9003 0.4167 0.1433  -0.0609 -0.0549 35  TRP L CZ3 
1823 C CH2 . TRP B 35  ? 0.6231 1.0846 0.5375 0.1243  -0.0700 -0.0554 35  TRP L CH2 
1824 N N   . TYR B 36  ? 0.6810 0.8878 0.6551 0.1702  -0.0576 -0.0716 36  TYR L N   
1825 C CA  . TYR B 36  ? 0.7017 0.8705 0.6883 0.1735  -0.0614 -0.0651 36  TYR L CA  
1826 C C   . TYR B 36  ? 0.6668 0.8478 0.6713 0.1819  -0.0593 -0.0454 36  TYR L C   
1827 O O   . TYR B 36  ? 0.7231 0.9389 0.7229 0.1831  -0.0536 -0.0412 36  TYR L O   
1828 C CB  . TYR B 36  ? 0.6118 0.7551 0.5930 0.1605  -0.0643 -0.0730 36  TYR L CB  
1829 C CG  . TYR B 36  ? 0.6158 0.7496 0.5803 0.1494  -0.0671 -0.0871 36  TYR L CG  
1830 C CD1 . TYR B 36  ? 0.6642 0.8149 0.6152 0.1389  -0.0640 -0.0967 36  TYR L CD1 
1831 C CD2 . TYR B 36  ? 0.6664 0.7746 0.6263 0.1463  -0.0739 -0.0898 36  TYR L CD2 
1832 C CE1 . TYR B 36  ? 0.7483 0.8944 0.6879 0.1266  -0.0667 -0.1038 36  TYR L CE1 
1833 C CE2 . TYR B 36  ? 0.5006 0.6075 0.4439 0.1360  -0.0754 -0.0989 36  TYR L CE2 
1834 C CZ  . TYR B 36  ? 0.5910 0.7187 0.5274 0.1266  -0.0714 -0.1034 36  TYR L CZ  
1835 O OH  . TYR B 36  ? 0.6169 0.7472 0.5405 0.1142  -0.0731 -0.1069 36  TYR L OH  
1836 N N   . GLN B 37  ? 0.5509 0.7045 0.5736 0.1849  -0.0649 -0.0324 37  GLN L N   
1837 C CA  . GLN B 37  ? 0.6859 0.8522 0.7306 0.1890  -0.0637 -0.0082 37  GLN L CA  
1838 C C   . GLN B 37  ? 0.6758 0.8197 0.7349 0.1793  -0.0695 -0.0008 37  GLN L C   
1839 O O   . GLN B 37  ? 0.6790 0.7894 0.7340 0.1696  -0.0793 -0.0104 37  GLN L O   
1840 C CB  . GLN B 37  ? 0.6366 0.7975 0.6998 0.1997  -0.0668 0.0111  37  GLN L CB  
1841 C CG  . GLN B 37  ? 0.6781 0.7860 0.7537 0.1938  -0.0787 0.0155  37  GLN L CG  
1842 C CD  . GLN B 37  ? 0.6637 0.7604 0.7633 0.2029  -0.0815 0.0408  37  GLN L CD  
1843 O OE1 . GLN B 37  ? 0.7538 0.8882 0.8628 0.2163  -0.0737 0.0579  37  GLN L OE1 
1844 N NE2 . GLN B 37  ? 0.7663 0.8101 0.8757 0.1932  -0.0943 0.0453  37  GLN L NE2 
1845 N N   . GLN B 38  ? 0.6460 0.8153 0.7220 0.1820  -0.0630 0.0185  38  GLN L N   
1846 C CA  . GLN B 38  ? 0.5555 0.7177 0.6542 0.1748  -0.0671 0.0332  38  GLN L CA  
1847 C C   . GLN B 38  ? 0.6730 0.8629 0.8035 0.1780  -0.0644 0.0680  38  GLN L C   
1848 O O   . GLN B 38  ? 0.7957 1.0256 0.9240 0.1894  -0.0492 0.0768  38  GLN L O   
1849 C CB  . GLN B 38  ? 0.5256 0.6954 0.6140 0.1773  -0.0561 0.0204  38  GLN L CB  
1850 C CG  . GLN B 38  ? 0.4938 0.6626 0.6117 0.1731  -0.0596 0.0396  38  GLN L CG  
1851 C CD  . GLN B 38  ? 0.5973 0.7657 0.7080 0.1804  -0.0468 0.0282  38  GLN L CD  
1852 O OE1 . GLN B 38  ? 0.5648 0.7405 0.6515 0.1911  -0.0301 0.0107  38  GLN L OE1 
1853 N NE2 . GLN B 38  ? 0.6236 0.7810 0.7540 0.1736  -0.0557 0.0388  38  GLN L NE2 
1854 N N   . LYS B 39  ? 0.7399 0.9096 0.8976 0.1651  -0.0803 0.0885  39  LYS L N   
1855 C CA  . LYS B 39  ? 0.7864 0.9839 0.9820 0.1626  -0.0808 0.1283  39  LYS L CA  
1856 C C   . LYS B 39  ? 0.7965 1.0178 1.0185 0.1581  -0.0788 0.1460  39  LYS L C   
1857 O O   . LYS B 39  ? 0.6884 0.8884 0.9055 0.1498  -0.0872 0.1322  39  LYS L O   
1858 C CB  . LYS B 39  ? 0.7978 0.9563 1.0107 0.1473  -0.1016 0.1437  39  LYS L CB  
1859 C CG  . LYS B 39  ? 0.8448 0.9775 1.0375 0.1578  -0.1009 0.1295  39  LYS L CG  
1860 C CD  . LYS B 39  ? 0.8591 0.9393 1.0675 0.1454  -0.1193 0.1427  39  LYS L CD  
1861 C CE  . LYS B 39  ? 0.7914 0.8449 0.9836 0.1630  -0.1147 0.1301  39  LYS L CE  
1862 N NZ  . LYS B 39  ? 0.8618 0.8499 1.0664 0.1542  -0.1302 0.1397  39  LYS L NZ  
1863 N N   . PRO B 40  ? 0.7975 1.0698 1.0495 0.1654  -0.0663 0.1802  40  PRO L N   
1864 C CA  . PRO B 40  ? 0.7510 1.0593 1.0361 0.1676  -0.0591 0.2039  40  PRO L CA  
1865 C C   . PRO B 40  ? 0.7442 1.0310 1.0576 0.1420  -0.0859 0.2185  40  PRO L C   
1866 O O   . PRO B 40  ? 0.7698 1.0362 1.1005 0.1185  -0.1092 0.2362  40  PRO L O   
1867 C CB  . PRO B 40  ? 0.7260 1.0922 1.0430 0.1745  -0.0462 0.2461  40  PRO L CB  
1868 C CG  . PRO B 40  ? 0.7394 1.1086 1.0225 0.1863  -0.0357 0.2319  40  PRO L CG  
1869 C CD  . PRO B 40  ? 0.7078 1.0149 0.9642 0.1751  -0.0553 0.2011  40  PRO L CD  
1870 N N   . GLY B 41  ? 0.7715 1.0608 1.0879 0.1453  -0.0839 0.2116  41  GLY L N   
1871 C CA  . GLY B 41  ? 0.7669 1.0468 1.1085 0.1198  -0.1106 0.2282  41  GLY L CA  
1872 C C   . GLY B 41  ? 0.7306 0.9469 1.0333 0.0989  -0.1350 0.1946  41  GLY L C   
1873 O O   . GLY B 41  ? 0.8111 1.0111 1.1237 0.0705  -0.1630 0.2048  41  GLY L O   
1874 N N   . GLN B 42  ? 0.6646 0.8489 0.9212 0.1121  -0.1243 0.1552  42  GLN L N   
1875 C CA  . GLN B 42  ? 0.7422 0.8718 0.9589 0.0983  -0.1412 0.1223  42  GLN L CA  
1876 C C   . GLN B 42  ? 0.7378 0.8574 0.9175 0.1133  -0.1268 0.0880  42  GLN L C   
1877 O O   . GLN B 42  ? 0.7200 0.8618 0.8948 0.1346  -0.1037 0.0814  42  GLN L O   
1878 C CB  . GLN B 42  ? 0.7724 0.8684 0.9740 0.0956  -0.1466 0.1133  42  GLN L CB  
1879 C CG  . GLN B 42  ? 0.9154 1.0035 1.1496 0.0735  -0.1665 0.1451  42  GLN L CG  
1880 C CD  . GLN B 42  ? 1.1047 1.1473 1.3242 0.0739  -0.1708 0.1359  42  GLN L CD  
1881 O OE1 . GLN B 42  ? 1.1950 1.2331 1.3908 0.0967  -0.1539 0.1154  42  GLN L OE1 
1882 N NE2 . GLN B 42  ? 1.1888 1.1969 1.4246 0.0480  -0.1942 0.1533  42  GLN L NE2 
1883 N N   . ALA B 43  ? 0.6516 0.7374 0.8027 0.0997  -0.1414 0.0665  43  ALA L N   
1884 C CA  . ALA B 43  ? 0.5804 0.6567 0.6983 0.1087  -0.1310 0.0380  43  ALA L CA  
1885 C C   . ALA B 43  ? 0.5033 0.5693 0.5926 0.1218  -0.1186 0.0133  43  ALA L C   
1886 O O   . ALA B 43  ? 0.6520 0.7036 0.7402 0.1215  -0.1231 0.0138  43  ALA L O   
1887 C CB  . ALA B 43  ? 0.5491 0.6013 0.6451 0.0890  -0.1503 0.0278  43  ALA L CB  
1888 N N   . PRO B 44  ? 0.4803 0.5544 0.5498 0.1324  -0.1038 -0.0052 44  PRO L N   
1889 C CA  . PRO B 44  ? 0.6101 0.6856 0.6554 0.1420  -0.0941 -0.0250 44  PRO L CA  
1890 C C   . PRO B 44  ? 0.7057 0.7538 0.7300 0.1376  -0.1035 -0.0392 44  PRO L C   
1891 O O   . PRO B 44  ? 0.8070 0.8317 0.8194 0.1243  -0.1164 -0.0446 44  PRO L O   
1892 C CB  . PRO B 44  ? 0.6069 0.6897 0.6346 0.1435  -0.0840 -0.0408 44  PRO L CB  
1893 C CG  . PRO B 44  ? 0.5354 0.6242 0.5840 0.1456  -0.0794 -0.0267 44  PRO L CG  
1894 C CD  . PRO B 44  ? 0.5407 0.6243 0.6139 0.1358  -0.0952 -0.0049 44  PRO L CD  
1895 N N   . ARG B 45  ? 0.6907 0.7436 0.7090 0.1503  -0.0960 -0.0445 45  ARG L N   
1896 C CA  . ARG B 45  ? 0.7442 0.7687 0.7449 0.1543  -0.0994 -0.0575 45  ARG L CA  
1897 C C   . ARG B 45  ? 0.7376 0.7855 0.7224 0.1680  -0.0860 -0.0711 45  ARG L C   
1898 O O   . ARG B 45  ? 0.7919 0.8725 0.7878 0.1791  -0.0770 -0.0625 45  ARG L O   
1899 C CB  . ARG B 45  ? 0.8746 0.8782 0.8938 0.1595  -0.1040 -0.0426 45  ARG L CB  
1900 C CG  . ARG B 45  ? 0.9438 0.9032 0.9441 0.1672  -0.1056 -0.0578 45  ARG L CG  
1901 C CD  . ARG B 45  ? 1.0297 0.9680 1.0538 0.1754  -0.1077 -0.0388 45  ARG L CD  
1902 N NE  . ARG B 45  ? 1.2221 1.1086 1.2283 0.1885  -0.1055 -0.0547 45  ARG L NE  
1903 C CZ  . ARG B 45  ? 1.3016 1.1686 1.3266 0.2058  -0.1009 -0.0406 45  ARG L CZ  
1904 N NH1 . ARG B 45  ? 1.2146 1.1172 1.2760 0.2089  -0.0998 -0.0076 45  ARG L NH1 
1905 N NH2 . ARG B 45  ? 1.3883 1.1995 1.3945 0.2218  -0.0960 -0.0584 45  ARG L NH2 
1906 N N   . LEU B 46  ? 0.6128 0.6507 0.5720 0.1659  -0.0852 -0.0892 46  LEU L N   
1907 C CA  . LEU B 46  ? 0.6455 0.7148 0.5939 0.1769  -0.0726 -0.0977 46  LEU L CA  
1908 C C   . LEU B 46  ? 0.6815 0.7564 0.6397 0.2005  -0.0634 -0.0926 46  LEU L C   
1909 O O   . LEU B 46  ? 0.6916 0.7248 0.6450 0.2104  -0.0644 -0.0972 46  LEU L O   
1910 C CB  . LEU B 46  ? 0.6422 0.7033 0.5617 0.1707  -0.0721 -0.1142 46  LEU L CB  
1911 C CG  . LEU B 46  ? 0.6376 0.7388 0.5495 0.1815  -0.0581 -0.1189 46  LEU L CG  
1912 C CD1 . LEU B 46  ? 0.5313 0.6768 0.4551 0.1699  -0.0571 -0.1107 46  LEU L CD1 
1913 C CD2 . LEU B 46  ? 0.5753 0.6686 0.4562 0.1781  -0.0554 -0.1332 46  LEU L CD2 
1914 N N   . LEU B 47  ? 0.6271 0.7518 0.5984 0.2087  -0.0554 -0.0824 47  LEU L N   
1915 C CA  . LEU B 47  ? 0.6270 0.7698 0.6149 0.2330  -0.0465 -0.0698 47  LEU L CA  
1916 C C   . LEU B 47  ? 0.5798 0.7672 0.5640 0.2445  -0.0348 -0.0725 47  LEU L C   
1917 O O   . LEU B 47  ? 0.6295 0.8058 0.6123 0.2676  -0.0238 -0.0760 47  LEU L O   
1918 C CB  . LEU B 47  ? 0.5879 0.7658 0.5984 0.2335  -0.0484 -0.0472 47  LEU L CB  
1919 C CG  . LEU B 47  ? 0.5677 0.7155 0.5901 0.2263  -0.0567 -0.0358 47  LEU L CG  
1920 C CD1 . LEU B 47  ? 0.6192 0.8147 0.6565 0.2266  -0.0553 -0.0143 47  LEU L CD1 
1921 C CD2 . LEU B 47  ? 0.7436 0.8383 0.7759 0.2383  -0.0593 -0.0305 47  LEU L CD2 
1922 N N   . ILE B 48  ? 0.7206 0.9582 0.7037 0.2281  -0.0365 -0.0702 48  ILE L N   
1923 C CA  . ILE B 48  ? 0.6602 0.9535 0.6458 0.2322  -0.0283 -0.0664 48  ILE L CA  
1924 C C   . ILE B 48  ? 0.6876 0.9884 0.6539 0.2060  -0.0323 -0.0790 48  ILE L C   
1925 O O   . ILE B 48  ? 0.7166 0.9979 0.6737 0.1831  -0.0424 -0.0855 48  ILE L O   
1926 C CB  . ILE B 48  ? 0.5712 0.9310 0.5779 0.2320  -0.0301 -0.0447 48  ILE L CB  
1927 C CG1 . ILE B 48  ? 0.5904 0.9438 0.6185 0.2539  -0.0289 -0.0259 48  ILE L CG1 
1928 C CG2 . ILE B 48  ? 0.5770 1.0038 0.5959 0.2389  -0.0220 -0.0331 48  ILE L CG2 
1929 C CD1 . ILE B 48  ? 0.7148 1.0769 0.7641 0.2898  -0.0151 -0.0122 48  ILE L CD1 
1930 N N   . HIS B 49  ? 0.6272 0.9563 0.5892 0.2114  -0.0228 -0.0800 49  HIS L N   
1931 C CA  . HIS B 49  ? 0.4978 0.8503 0.4486 0.1849  -0.0265 -0.0829 49  HIS L CA  
1932 C C   . HIS B 49  ? 0.5980 1.0273 0.5659 0.1901  -0.0175 -0.0662 49  HIS L C   
1933 O O   . HIS B 49  ? 0.5745 1.0317 0.5603 0.2205  -0.0051 -0.0550 49  HIS L O   
1934 C CB  . HIS B 49  ? 0.6324 0.9425 0.5572 0.1803  -0.0253 -0.0980 49  HIS L CB  
1935 C CG  . HIS B 49  ? 0.6605 0.9816 0.5748 0.2050  -0.0082 -0.1019 49  HIS L CG  
1936 N ND1 . HIS B 49  ? 0.7226 1.0968 0.6347 0.2017  0.0018  -0.0945 49  HIS L ND1 
1937 C CD2 . HIS B 49  ? 0.6648 0.9476 0.5676 0.2341  0.0024  -0.1134 49  HIS L CD2 
1938 C CE1 . HIS B 49  ? 0.7760 1.1487 0.6743 0.2315  0.0208  -0.1021 49  HIS L CE1 
1939 N NE2 . HIS B 49  ? 0.7313 1.0431 0.6213 0.2515  0.0212  -0.1161 49  HIS L NE2 
1940 N N   . TRP B 50  ? 0.4900 0.9544 0.4562 0.1605  -0.0239 -0.0612 50  TRP L N   
1941 C CA  . TRP B 50  ? 0.5517 1.1007 0.5396 0.1565  -0.0195 -0.0395 50  TRP L CA  
1942 C C   . TRP B 50  ? 0.6110 1.2064 0.6238 0.1634  -0.0241 -0.0223 50  TRP L C   
1943 O O   . TRP B 50  ? 0.4787 1.1426 0.5189 0.1828  -0.0143 0.0003  50  TRP L O   
1944 C CB  . TRP B 50  ? 0.5063 1.0841 0.4973 0.1868  0.0029  -0.0341 50  TRP L CB  
1945 C CG  . TRP B 50  ? 0.6423 1.3170 0.6598 0.1816  0.0095  -0.0069 50  TRP L CG  
1946 C CD1 . TRP B 50  ? 0.7050 1.4477 0.7533 0.2148  0.0267  0.0152  50  TRP L CD1 
1947 C CD2 . TRP B 50  ? 0.5807 1.2982 0.6014 0.1404  -0.0014 0.0056  50  TRP L CD2 
1948 N NE1 . TRP B 50  ? 0.6055 1.4396 0.6779 0.1962  0.0271  0.0424  50  TRP L NE1 
1949 C CE2 . TRP B 50  ? 0.5782 1.3964 0.6332 0.1479  0.0088  0.0367  50  TRP L CE2 
1950 C CE3 . TRP B 50  ? 0.5003 1.1799 0.5016 0.0982  -0.0186 -0.0034 50  TRP L CE3 
1951 C CZ2 . TRP B 50  ? 0.5005 1.3847 0.5704 0.1097  0.0000  0.0593  50  TRP L CZ2 
1952 C CZ3 . TRP B 50  ? 0.5044 1.2395 0.5184 0.0619  -0.0267 0.0170  50  TRP L CZ3 
1953 C CH2 . TRP B 50  ? 0.5307 1.3681 0.5783 0.0653  -0.0186 0.0482  50  TRP L CH2 
1954 N N   . ALA B 51  ? 0.6243 1.1856 0.6277 0.1493  -0.0380 -0.0309 51  ALA L N   
1955 C CA  . ALA B 51  ? 0.5825 1.1863 0.6008 0.1487  -0.0462 -0.0153 51  ALA L CA  
1956 C C   . ALA B 51  ? 0.5468 1.1648 0.5897 0.1915  -0.0339 0.0016  51  ALA L C   
1957 O O   . ALA B 51  ? 0.4974 1.1080 0.5433 0.1971  -0.0394 0.0074  51  ALA L O   
1958 C CB  . ALA B 51  ? 0.5536 1.2405 0.5849 0.1201  -0.0569 0.0038  51  ALA L CB  
1959 N N   . SER B 52  ? 0.5528 1.1898 0.6125 0.2229  -0.0156 0.0105  52  SER L N   
1960 C CA  . SER B 52  ? 0.7484 1.3978 0.8357 0.2669  -0.0016 0.0293  52  SER L CA  
1961 C C   . SER B 52  ? 0.8438 1.4209 0.9199 0.3025  0.0172  0.0112  52  SER L C   
1962 O O   . SER B 52  ? 0.9087 1.4597 0.9998 0.3361  0.0260  0.0192  52  SER L O   
1963 C CB  . SER B 52  ? 0.7716 1.5245 0.8972 0.2803  0.0062  0.0636  52  SER L CB  
1964 O OG  . SER B 52  ? 0.9204 1.7411 1.0490 0.2373  -0.0136 0.0761  52  SER L OG  
1965 N N   . THR B 53  ? 0.8036 1.3469 0.8513 0.2937  0.0223  -0.0123 53  THR L N   
1966 C CA  . THR B 53  ? 0.8358 1.3128 0.8627 0.3232  0.0390  -0.0334 53  THR L CA  
1967 C C   . THR B 53  ? 0.8108 1.1952 0.8180 0.3192  0.0281  -0.0527 53  THR L C   
1968 O O   . THR B 53  ? 0.7604 1.1135 0.7484 0.2867  0.0115  -0.0655 53  THR L O   
1969 C CB  . THR B 53  ? 0.8315 1.3082 0.8287 0.3117  0.0465  -0.0506 53  THR L CB  
1970 O OG1 . THR B 53  ? 0.8963 1.4677 0.9165 0.3087  0.0544  -0.0274 53  THR L OG1 
1971 C CG2 . THR B 53  ? 0.8936 1.3124 0.8632 0.3455  0.0667  -0.0732 53  THR L CG2 
1972 N N   . ARG B 54  ? 0.8111 1.1527 0.8268 0.3527  0.0378  -0.0516 54  ARG L N   
1973 C CA  . ARG B 54  ? 0.7509 1.0061 0.7524 0.3478  0.0267  -0.0656 54  ARG L CA  
1974 C C   . ARG B 54  ? 0.8350 1.0220 0.7923 0.3391  0.0264  -0.0989 54  ARG L C   
1975 O O   . ARG B 54  ? 0.8254 1.0162 0.7616 0.3547  0.0431  -0.1127 54  ARG L O   
1976 C CB  . ARG B 54  ? 0.8430 1.0687 0.8691 0.3836  0.0355  -0.0511 54  ARG L CB  
1977 C CG  . ARG B 54  ? 0.8468 1.0975 0.9054 0.3760  0.0220  -0.0216 54  ARG L CG  
1978 C CD  . ARG B 54  ? 0.9462 1.1907 1.0394 0.4150  0.0331  0.0042  54  ARG L CD  
1979 N NE  . ARG B 54  ? 0.9586 1.1046 1.0366 0.4368  0.0414  -0.0153 54  ARG L NE  
1980 C CZ  . ARG B 54  ? 1.0082 1.1326 1.0921 0.4802  0.0646  -0.0170 54  ARG L CZ  
1981 N NH1 . ARG B 54  ? 0.9743 1.1802 1.0868 0.5084  0.0825  0.0055  54  ARG L NH1 
1982 N NH2 . ARG B 54  ? 1.1040 1.1248 1.1653 0.4955  0.0702  -0.0406 54  ARG L NH2 
1983 N N   . ALA B 55  ? 0.8370 0.9683 0.7801 0.3139  0.0076  -0.1091 55  ALA L N   
1984 C CA  . ALA B 55  ? 0.8434 0.9139 0.7450 0.2995  0.0015  -0.1368 55  ALA L CA  
1985 C C   . ALA B 55  ? 1.0048 0.9960 0.8885 0.3212  0.0069  -0.1536 55  ALA L C   
1986 O O   . ALA B 55  ? 1.0630 1.0396 0.9729 0.3462  0.0137  -0.1403 55  ALA L O   
1987 C CB  . ALA B 55  ? 0.7252 0.7788 0.6249 0.2627  -0.0218 -0.1356 55  ALA L CB  
1988 N N   . ILE B 56  ? 1.0963 1.0342 0.9336 0.3098  0.0027  -0.1821 56  ILE L N   
1989 C CA  . ILE B 56  ? 1.1858 1.0355 0.9933 0.3245  0.0056  -0.2059 56  ILE L CA  
1990 C C   . ILE B 56  ? 1.2051 0.9978 1.0320 0.3077  -0.0165 -0.1959 56  ILE L C   
1991 O O   . ILE B 56  ? 1.1916 0.9803 1.0192 0.2715  -0.0402 -0.1908 56  ILE L O   
1992 C CB  . ILE B 56  ? 1.2550 1.0656 0.9988 0.3089  0.0025  -0.2405 56  ILE L CB  
1993 C CG1 . ILE B 56  ? 1.1678 1.0355 0.8907 0.3292  0.0283  -0.2485 56  ILE L CG1 
1994 C CG2 . ILE B 56  ? 1.3890 1.0958 1.0940 0.3167  0.0007  -0.2700 56  ILE L CG2 
1995 C CD1 . ILE B 56  ? 1.0813 0.9463 0.8080 0.3809  0.0615  -0.2537 56  ILE L CD1 
1996 N N   . GLY B 57  ? 1.2751 1.0269 1.1218 0.3353  -0.0077 -0.1889 57  GLY L N   
1997 C CA  . GLY B 57  ? 1.3320 1.0278 1.1998 0.3201  -0.0275 -0.1753 57  GLY L CA  
1998 C C   . GLY B 57  ? 1.2132 0.9693 1.1393 0.3190  -0.0323 -0.1328 57  GLY L C   
1999 O O   . GLY B 57  ? 1.3180 1.0473 1.2673 0.3017  -0.0495 -0.1138 57  GLY L O   
2000 N N   . ILE B 58  ? 0.9621 0.8033 0.9100 0.3350  -0.0179 -0.1167 58  ILE L N   
2001 C CA  . ILE B 58  ? 0.9782 0.8835 0.9721 0.3332  -0.0218 -0.0794 58  ILE L CA  
2002 C C   . ILE B 58  ? 0.9333 0.8456 0.9624 0.3709  -0.0073 -0.0539 58  ILE L C   
2003 O O   . ILE B 58  ? 1.0245 0.9545 1.0536 0.4039  0.0136  -0.0577 58  ILE L O   
2004 C CB  . ILE B 58  ? 0.8838 0.8782 0.8800 0.3224  -0.0191 -0.0746 58  ILE L CB  
2005 C CG1 . ILE B 58  ? 0.8446 0.8310 0.8129 0.2871  -0.0333 -0.0935 58  ILE L CG1 
2006 C CG2 . ILE B 58  ? 0.8176 0.8760 0.8512 0.3205  -0.0227 -0.0405 58  ILE L CG2 
2007 N N   . PRO B 59  ? 0.9072 0.8102 0.9697 0.3673  -0.0176 -0.0233 59  PRO L N   
2008 C CA  . PRO B 59  ? 0.9368 0.8478 1.0395 0.4008  -0.0071 0.0103  59  PRO L CA  
2009 C C   . PRO B 59  ? 0.9069 0.9165 1.0322 0.4245  0.0081  0.0310  59  PRO L C   
2010 O O   . PRO B 59  ? 0.8581 0.9390 0.9752 0.4044  0.0040  0.0283  59  PRO L O   
2011 C CB  . PRO B 59  ? 0.8737 0.7908 1.0057 0.3790  -0.0249 0.0441  59  PRO L CB  
2012 C CG  . PRO B 59  ? 0.8143 0.6799 0.9197 0.3415  -0.0431 0.0212  59  PRO L CG  
2013 C CD  . PRO B 59  ? 0.8706 0.7566 0.9370 0.3308  -0.0398 -0.0150 59  PRO L CD  
2014 N N   . ALA B 60  ? 0.9315 0.9436 1.0870 0.4658  0.0244  0.0535  60  ALA L N   
2015 C CA  . ALA B 60  ? 0.9126 1.0232 1.0950 0.4906  0.0387  0.0778  60  ALA L CA  
2016 C C   . ALA B 60  ? 0.9354 1.1374 1.1491 0.4745  0.0252  0.1199  60  ALA L C   
2017 O O   . ALA B 60  ? 0.9908 1.2856 1.2212 0.4775  0.0292  0.1396  60  ALA L O   
2018 C CB  . ALA B 60  ? 0.9305 1.0141 1.1380 0.5357  0.0611  0.0902  60  ALA L CB  
2019 N N   . ARG B 61  ? 0.9187 1.0959 1.1368 0.4512  0.0084  0.1333  61  ARG L N   
2020 C CA  . ARG B 61  ? 0.7701 1.0307 1.0091 0.4354  -0.0032 0.1708  61  ARG L CA  
2021 C C   . ARG B 61  ? 0.7690 1.0941 0.9784 0.4013  -0.0116 0.1514  61  ARG L C   
2022 O O   . ARG B 61  ? 0.7324 1.1419 0.9495 0.3906  -0.0181 0.1751  61  ARG L O   
2023 C CB  . ARG B 61  ? 0.7734 0.9925 1.0239 0.4203  -0.0160 0.1913  61  ARG L CB  
2024 C CG  . ARG B 61  ? 0.8149 0.9634 1.0341 0.3891  -0.0265 0.1569  61  ARG L CG  
2025 C CD  . ARG B 61  ? 0.9321 1.0599 1.1711 0.3730  -0.0390 0.1866  61  ARG L CD  
2026 N NE  . ARG B 61  ? 1.0144 1.0765 1.2322 0.3444  -0.0502 0.1605  61  ARG L NE  
2027 C CZ  . ARG B 61  ? 1.1058 1.0719 1.3227 0.3433  -0.0554 0.1496  61  ARG L CZ  
2028 N NH1 . ARG B 61  ? 1.1693 1.0832 1.4032 0.3730  -0.0474 0.1591  61  ARG L NH1 
2029 N NH2 . ARG B 61  ? 1.1001 1.0211 1.2991 0.3123  -0.0692 0.1299  61  ARG L NH2 
2030 N N   . PHE B 62  ? 0.7067 0.9890 0.8800 0.3833  -0.0124 0.1085  62  PHE L N   
2031 C CA  . PHE B 62  ? 0.6364 0.9653 0.7821 0.3528  -0.0189 0.0880  62  PHE L CA  
2032 C C   . PHE B 62  ? 0.7065 1.0976 0.8542 0.3625  -0.0099 0.0863  62  PHE L C   
2033 O O   . PHE B 62  ? 0.7544 1.1226 0.9046 0.3876  0.0044  0.0766  62  PHE L O   
2034 C CB  . PHE B 62  ? 0.5704 0.8330 0.6823 0.3299  -0.0242 0.0500  62  PHE L CB  
2035 C CG  . PHE B 62  ? 0.6581 0.8757 0.7714 0.3143  -0.0350 0.0551  62  PHE L CG  
2036 C CD1 . PHE B 62  ? 0.6369 0.8868 0.7424 0.2898  -0.0430 0.0583  62  PHE L CD1 
2037 C CD2 . PHE B 62  ? 0.7629 0.9055 0.8852 0.3238  -0.0365 0.0569  62  PHE L CD2 
2038 C CE1 . PHE B 62  ? 0.6321 0.8518 0.7441 0.2777  -0.0503 0.0679  62  PHE L CE1 
2039 C CE2 . PHE B 62  ? 0.7998 0.9096 0.9292 0.3057  -0.0481 0.0672  62  PHE L CE2 
2040 C CZ  . PHE B 62  ? 0.7015 0.8556 0.8285 0.2839  -0.0541 0.0750  62  PHE L CZ  
2041 N N   . SER B 63  ? 0.6761 1.1468 0.8212 0.3414  -0.0182 0.0960  63  SER L N   
2042 C CA  . SER B 63  ? 0.5546 1.0975 0.7069 0.3433  -0.0137 0.1014  63  SER L CA  
2043 C C   . SER B 63  ? 0.5964 1.1765 0.7197 0.3011  -0.0269 0.0837  63  SER L C   
2044 O O   . SER B 63  ? 0.6630 1.2403 0.7672 0.2761  -0.0389 0.0789  63  SER L O   
2045 C CB  . SER B 63  ? 0.6586 1.2808 0.8526 0.3662  -0.0118 0.1477  63  SER L CB  
2046 O OG  . SER B 63  ? 0.8234 1.3952 1.0431 0.4023  0.0016  0.1643  63  SER L OG  
2047 N N   . GLY B 64  ? 0.4969 1.1098 0.6166 0.2940  -0.0233 0.0748  64  GLY L N   
2048 C CA  . GLY B 64  ? 0.4856 1.1273 0.5800 0.2524  -0.0364 0.0593  64  GLY L CA  
2049 C C   . GLY B 64  ? 0.5217 1.2606 0.6360 0.2437  -0.0401 0.0825  64  GLY L C   
2050 O O   . GLY B 64  ? 0.5434 1.3195 0.6885 0.2728  -0.0260 0.1016  64  GLY L O   
2051 N N   . SER B 65  ? 0.6158 1.3962 0.7120 0.2031  -0.0588 0.0810  65  SER L N   
2052 C CA  . SER B 65  ? 0.6591 1.5375 0.7733 0.1840  -0.0686 0.1050  65  SER L CA  
2053 C C   . SER B 65  ? 0.6682 1.5515 0.7450 0.1288  -0.0899 0.0843  65  SER L C   
2054 O O   . SER B 65  ? 0.4765 1.2934 0.5148 0.1113  -0.0953 0.0546  65  SER L O   
2055 C CB  . SER B 65  ? 0.6681 1.6269 0.8158 0.2010  -0.0732 0.1482  65  SER L CB  
2056 O OG  . SER B 65  ? 0.6955 1.6403 0.8184 0.1869  -0.0858 0.1455  65  SER L OG  
2057 N N   . GLY B 66  ? 0.4747 1.4364 0.5645 0.1019  -0.1016 0.1015  66  GLY L N   
2058 C CA  . GLY B 66  ? 0.4951 1.4582 0.5496 0.0453  -0.1240 0.0826  66  GLY L CA  
2059 C C   . GLY B 66  ? 0.9208 1.8650 0.9739 0.0250  -0.1218 0.0699  66  GLY L C   
2060 O O   . GLY B 66  ? 0.7245 1.6294 0.7882 0.0542  -0.1018 0.0635  66  GLY L O   
2061 N N   . SER B 67  ? 1.1426 2.1142 1.1800 -0.0278 -0.1439 0.0670  67  SER L N   
2062 C CA  . SER B 67  ? 1.2564 2.2150 1.2944 -0.0543 -0.1452 0.0607  67  SER L CA  
2063 C C   . SER B 67  ? 1.1961 2.1340 1.1969 -0.1180 -0.1726 0.0414  67  SER L C   
2064 O O   . SER B 67  ? 1.2860 2.2672 1.2787 -0.1490 -0.1906 0.0512  67  SER L O   
2065 C CB  . SER B 67  ? 1.3447 2.4064 1.4355 -0.0435 -0.1379 0.1027  67  SER L CB  
2066 N N   . GLY B 68  ? 1.0938 1.9480 1.0701 -0.1361 -0.1713 0.0139  68  GLY L N   
2067 C CA  . GLY B 68  ? 0.9824 1.7964 0.9220 -0.1944 -0.1948 -0.0077 68  GLY L CA  
2068 C C   . GLY B 68  ? 0.9882 1.7052 0.8740 -0.1966 -0.1959 -0.0504 68  GLY L C   
2069 O O   . GLY B 68  ? 0.9874 1.6119 0.8558 -0.1858 -0.1840 -0.0756 68  GLY L O   
2070 N N   . THR B 69  ? 0.9423 1.6865 0.8021 -0.2092 -0.2092 -0.0558 69  THR L N   
2071 C CA  . THR B 69  ? 0.7408 1.4035 0.5442 -0.2120 -0.2085 -0.0962 69  THR L CA  
2072 C C   . THR B 69  ? 0.7570 1.4301 0.5624 -0.1637 -0.1918 -0.0922 69  THR L C   
2073 O O   . THR B 69  ? 0.8896 1.4881 0.6807 -0.1343 -0.1734 -0.1137 69  THR L O   
2074 C CB  . THR B 69  ? 1.0286 1.6828 0.7908 -0.2620 -0.2295 -0.1099 69  THR L CB  
2075 O OG1 . THR B 69  ? 1.0587 1.6783 0.8155 -0.3084 -0.2444 -0.1173 69  THR L OG1 
2076 C CG2 . THR B 69  ? 1.1350 1.7118 0.8359 -0.2568 -0.2238 -0.1516 69  THR L CG2 
2077 N N   . ASP B 70  ? 0.8781 1.6434 0.7068 -0.1556 -0.1975 -0.0594 70  ASP L N   
2078 C CA  . ASP B 70  ? 0.7840 1.5690 0.6166 -0.1149 -0.1856 -0.0488 70  ASP L CA  
2079 C C   . ASP B 70  ? 0.6820 1.4756 0.5683 -0.0620 -0.1637 -0.0240 70  ASP L C   
2080 O O   . ASP B 70  ? 0.6764 1.5287 0.6071 -0.0536 -0.1624 0.0054  70  ASP L O   
2081 C CB  . ASP B 70  ? 0.7492 1.6045 0.5880 -0.1277 -0.1943 -0.0208 70  ASP L CB  
2082 N N   . PHE B 71  ? 0.6520 1.3854 0.5330 -0.0267 -0.1455 -0.0360 71  PHE L N   
2083 C CA  . PHE B 71  ? 0.5528 1.2777 0.4761 0.0208  -0.1260 -0.0178 71  PHE L CA  
2084 C C   . PHE B 71  ? 0.6734 1.3959 0.5994 0.0517  -0.1175 -0.0068 71  PHE L C   
2085 O O   . PHE B 71  ? 0.5778 1.2882 0.4676 0.0398  -0.1216 -0.0204 71  PHE L O   
2086 C CB  . PHE B 71  ? 0.6489 1.2901 0.5694 0.0289  -0.1135 -0.0415 71  PHE L CB  
2087 C CG  . PHE B 71  ? 0.7096 1.3592 0.6374 0.0047  -0.1189 -0.0428 71  PHE L CG  
2088 C CD1 . PHE B 71  ? 0.7118 1.3316 0.6079 -0.0383 -0.1324 -0.0649 71  PHE L CD1 
2089 C CD2 . PHE B 71  ? 0.6285 1.3143 0.5939 0.0254  -0.1091 -0.0211 71  PHE L CD2 
2090 C CE1 . PHE B 71  ? 0.7841 1.4139 0.6906 -0.0636 -0.1384 -0.0605 71  PHE L CE1 
2091 C CE2 . PHE B 71  ? 0.6759 1.3787 0.6492 0.0029  -0.1125 -0.0177 71  PHE L CE2 
2092 C CZ  . PHE B 71  ? 0.7841 1.4609 0.7303 -0.0434 -0.1284 -0.0349 71  PHE L CZ  
2093 N N   . THR B 72  ? 0.6914 1.4230 0.6587 0.0916  -0.1045 0.0177  72  THR L N   
2094 C CA  . THR B 72  ? 0.6840 1.4196 0.6625 0.1194  -0.0982 0.0370  72  THR L CA  
2095 C C   . THR B 72  ? 0.6780 1.3649 0.6885 0.1596  -0.0814 0.0445  72  THR L C   
2096 O O   . THR B 72  ? 0.6275 1.3264 0.6683 0.1795  -0.0739 0.0566  72  THR L O   
2097 C CB  . THR B 72  ? 0.6707 1.5044 0.6706 0.1216  -0.1082 0.0773  72  THR L CB  
2098 O OG1 . THR B 72  ? 0.8190 1.6944 0.7788 0.0798  -0.1272 0.0682  72  THR L OG1 
2099 C CG2 . THR B 72  ? 0.6569 1.4941 0.6762 0.1532  -0.1008 0.1047  72  THR L CG2 
2100 N N   . LEU B 73  ? 0.7225 1.3549 0.7243 0.1704  -0.0752 0.0369  73  LEU L N   
2101 C CA  . LEU B 73  ? 0.6635 1.2489 0.6931 0.2031  -0.0637 0.0466  73  LEU L CA  
2102 C C   . LEU B 73  ? 0.6348 1.2555 0.6895 0.2237  -0.0632 0.0842  73  LEU L C   
2103 O O   . LEU B 73  ? 0.6605 1.3070 0.6990 0.2126  -0.0683 0.0924  73  LEU L O   
2104 C CB  . LEU B 73  ? 0.6661 1.1732 0.6782 0.1991  -0.0595 0.0212  73  LEU L CB  
2105 C CG  . LEU B 73  ? 0.7228 1.1752 0.7584 0.2240  -0.0524 0.0293  73  LEU L CG  
2106 C CD1 . LEU B 73  ? 0.7957 1.2253 0.8438 0.2396  -0.0464 0.0230  73  LEU L CD1 
2107 C CD2 . LEU B 73  ? 0.6528 1.0474 0.6746 0.2148  -0.0519 0.0122  73  LEU L CD2 
2108 N N   . THR B 74  ? 0.6197 1.2401 0.7125 0.2551  -0.0556 0.1078  74  THR L N   
2109 C CA  . THR B 74  ? 0.6611 1.3155 0.7854 0.2772  -0.0552 0.1503  74  THR L CA  
2110 C C   . THR B 74  ? 0.7290 1.3096 0.8774 0.3046  -0.0460 0.1581  74  THR L C   
2111 O O   . THR B 74  ? 0.7649 1.2916 0.9199 0.3208  -0.0372 0.1416  74  THR L O   
2112 C CB  . THR B 74  ? 0.6864 1.4210 0.8431 0.2930  -0.0554 0.1835  74  THR L CB  
2113 O OG1 . THR B 74  ? 0.7333 1.5350 0.8674 0.2608  -0.0677 0.1754  74  THR L OG1 
2114 C CG2 . THR B 74  ? 0.6256 1.3852 0.8060 0.3032  -0.0537 0.2276  74  THR L CG2 
2115 N N   . ILE B 75  ? 0.7338 1.3125 0.8924 0.3072  -0.0487 0.1833  75  ILE L N   
2116 C CA  . ILE B 75  ? 0.7249 1.2361 0.9102 0.3281  -0.0438 0.1977  75  ILE L CA  
2117 C C   . ILE B 75  ? 0.7204 1.2659 0.9432 0.3472  -0.0424 0.2481  75  ILE L C   
2118 O O   . ILE B 75  ? 0.6362 1.2244 0.8564 0.3328  -0.0473 0.2735  75  ILE L O   
2119 C CB  . ILE B 75  ? 0.6016 1.0677 0.7715 0.3090  -0.0476 0.1876  75  ILE L CB  
2120 C CG1 . ILE B 75  ? 0.5265 0.9556 0.6605 0.2875  -0.0481 0.1401  75  ILE L CG1 
2121 C CG2 . ILE B 75  ? 0.6342 1.0297 0.8336 0.3238  -0.0467 0.2048  75  ILE L CG2 
2122 C CD1 . ILE B 75  ? 0.5926 0.9878 0.7165 0.2711  -0.0503 0.1331  75  ILE L CD1 
2123 N N   . SER B 76  ? 0.9808 1.3072 1.0116 0.4778  0.1003  0.2366  76  SER L N   
2124 C CA  . SER B 76  ? 1.1353 1.4783 1.1656 0.5038  0.1220  0.2747  76  SER L CA  
2125 C C   . SER B 76  ? 1.2450 1.5332 1.2582 0.5121  0.1377  0.2865  76  SER L C   
2126 O O   . SER B 76  ? 1.2750 1.6129 1.2894 0.5168  0.1313  0.3071  76  SER L O   
2127 C CB  . SER B 76  ? 1.1417 1.4517 1.1741 0.5251  0.1525  0.2880  76  SER L CB  
2128 O OG  . SER B 76  ? 1.2405 1.4430 1.2564 0.5249  0.1783  0.2728  76  SER L OG  
2129 N N   . SER B 77  ? 1.3105 1.4977 1.3061 0.5114  0.1598  0.2726  77  SER L N   
2130 C CA  . SER B 77  ? 1.2745 1.4011 1.2499 0.5161  0.1776  0.2806  77  SER L CA  
2131 C C   . SER B 77  ? 1.1362 1.2062 1.0961 0.4918  0.1661  0.2476  77  SER L C   
2132 O O   . SER B 77  ? 1.2009 1.2015 1.1491 0.4809  0.1796  0.2241  77  SER L O   
2133 C CB  . SER B 77  ? 1.3679 1.4190 1.3288 0.5358  0.2234  0.2971  77  SER L CB  
2134 O OG  . SER B 77  ? 1.4066 1.4012 1.3460 0.5391  0.2427  0.3054  77  SER L OG  
2135 N N   . LEU B 78  ? 1.0450 1.1474 1.0038 0.4822  0.1423  0.2461  78  LEU L N   
2136 C CA  . LEU B 78  ? 0.9656 1.0226 0.9077 0.4496  0.1282  0.2133  78  LEU L CA  
2137 C C   . LEU B 78  ? 1.0535 1.0079 0.9665 0.4478  0.1596  0.2083  78  LEU L C   
2138 O O   . LEU B 78  ? 1.0288 0.9608 0.9318 0.4716  0.1803  0.2340  78  LEU L O   
2139 C CB  . LEU B 78  ? 0.8858 1.0014 0.8312 0.4338  0.0978  0.2122  78  LEU L CB  
2140 C CG  . LEU B 78  ? 0.8840 1.0766 0.8464 0.4084  0.0631  0.1935  78  LEU L CG  
2141 C CD1 . LEU B 78  ? 0.9940 1.2392 0.9564 0.3938  0.0406  0.1943  78  LEU L CD1 
2142 C CD2 . LEU B 78  ? 0.6711 0.8216 0.6279 0.3735  0.0538  0.1542  78  LEU L CD2 
2143 N N   . GLU B 79  ? 1.1377 1.0330 1.0360 0.4174  0.1642  0.1754  79  GLU L N   
2144 C CA  . GLU B 79  ? 1.1821 0.9846 1.0483 0.4033  0.1919  0.1629  79  GLU L CA  
2145 C C   . GLU B 79  ? 1.0452 0.8439 0.8994 0.3633  0.1664  0.1356  79  GLU L C   
2146 O O   . GLU B 79  ? 0.9297 0.7826 0.8002 0.3440  0.1321  0.1206  79  GLU L O   
2147 C CB  . GLU B 79  ? 1.2444 0.9872 1.0995 0.3939  0.2187  0.1458  79  GLU L CB  
2148 C CG  . GLU B 79  ? 1.3584 1.0948 1.2241 0.4351  0.2505  0.1729  79  GLU L CG  
2149 C CD  . GLU B 79  ? 1.4997 1.2006 1.3513 0.4580  0.2839  0.2022  79  GLU L CD  
2150 O OE1 . GLU B 79  ? 1.6039 1.2401 1.4263 0.4447  0.3014  0.1941  79  GLU L OE1 
2151 O OE2 . GLU B 79  ? 1.5069 1.2485 1.3752 0.4849  0.2924  0.2327  79  GLU L OE2 
2152 N N   . PRO B 80  ? 1.1608 0.8953 0.9858 0.3511  0.1854  0.1298  80  PRO L N   
2153 C CA  . PRO B 80  ? 1.2144 0.9453 1.0273 0.3141  0.1642  0.1058  80  PRO L CA  
2154 C C   . PRO B 80  ? 1.2415 0.9828 1.0596 0.2789  0.1446  0.0750  80  PRO L C   
2155 O O   . PRO B 80  ? 1.2274 0.9946 1.0489 0.2549  0.1184  0.0603  80  PRO L O   
2156 C CB  . PRO B 80  ? 1.2153 0.8647 0.9917 0.3062  0.1984  0.1034  80  PRO L CB  
2157 C CG  . PRO B 80  ? 1.1761 0.8032 0.9506 0.3490  0.2305  0.1368  80  PRO L CG  
2158 C CD  . PRO B 80  ? 1.1584 0.8239 0.9603 0.3737  0.2296  0.1488  80  PRO L CD  
2159 N N   . GLU B 81  ? 1.3135 1.0357 1.1326 0.2772  0.1587  0.0673  81  GLU L N   
2160 C CA  . GLU B 81  ? 1.2909 1.0253 1.1154 0.2455  0.1420  0.0415  81  GLU L CA  
2161 C C   . GLU B 81  ? 1.2849 1.0862 1.1417 0.2545  0.1149  0.0434  81  GLU L C   
2162 O O   . GLU B 81  ? 1.3787 1.1878 1.2428 0.2382  0.1082  0.0279  81  GLU L O   
2163 C CB  . GLU B 81  ? 1.2156 0.8916 1.0196 0.2313  0.1731  0.0282  81  GLU L CB  
2164 N N   . ASP B 82  ? 1.1264 0.9785 1.0009 0.2777  0.1004  0.0621  82  ASP L N   
2165 C CA  . ASP B 82  ? 1.0103 0.9298 0.9120 0.2830  0.0767  0.0632  82  ASP L CA  
2166 C C   . ASP B 82  ? 0.8390 0.8083 0.7508 0.2708  0.0475  0.0589  82  ASP L C   
2167 O O   . ASP B 82  ? 0.8197 0.8411 0.7496 0.2653  0.0278  0.0533  82  ASP L O   
2168 C CB  . ASP B 82  ? 1.0922 1.0414 1.0073 0.3205  0.0884  0.0904  82  ASP L CB  
2169 C CG  . ASP B 82  ? 1.1922 1.0935 1.1006 0.3342  0.1198  0.0941  82  ASP L CG  
2170 O OD1 . ASP B 82  ? 1.2052 1.0690 1.1040 0.3093  0.1249  0.0709  82  ASP L OD1 
2171 O OD2 . ASP B 82  ? 1.2653 1.1687 1.1782 0.3698  0.1411  0.1214  82  ASP L OD2 
2172 N N   . PHE B 83  ? 0.8181 0.7690 0.7164 0.2649  0.0475  0.0602  83  PHE L N   
2173 C CA  . PHE B 83  ? 0.8055 0.7972 0.7110 0.2525  0.0241  0.0554  83  PHE L CA  
2174 C C   . PHE B 83  ? 0.8357 0.8217 0.7428 0.2214  0.0098  0.0307  83  PHE L C   
2175 O O   . PHE B 83  ? 0.9812 0.9302 0.8737 0.2054  0.0141  0.0217  83  PHE L O   
2176 C CB  . PHE B 83  ? 0.7526 0.7283 0.6435 0.2590  0.0302  0.0673  83  PHE L CB  
2177 C CG  . PHE B 83  ? 0.8544 0.8472 0.7469 0.2923  0.0428  0.0971  83  PHE L CG  
2178 C CD1 . PHE B 83  ? 0.8187 0.8823 0.7266 0.3025  0.0274  0.1113  83  PHE L CD1 
2179 C CD2 . PHE B 83  ? 0.9459 0.8860 0.8237 0.3127  0.0726  0.1121  83  PHE L CD2 
2180 C CE1 . PHE B 83  ? 0.8331 0.9233 0.7447 0.3348  0.0387  0.1436  83  PHE L CE1 
2181 C CE2 . PHE B 83  ? 1.0138 0.9705 0.8951 0.3480  0.0872  0.1446  83  PHE L CE2 
2182 C CZ  . PHE B 83  ? 0.9156 0.9519 0.8153 0.3603  0.0688  0.1623  83  PHE L CZ  
2183 N N   . ALA B 84  ? 0.7691 0.7944 0.6937 0.2132  -0.0055 0.0213  84  ALA L N   
2184 C CA  . ALA B 84  ? 0.7932 0.8161 0.7226 0.1881  -0.0165 0.0022  84  ALA L CA  
2185 C C   . ALA B 84  ? 0.7418 0.8127 0.6884 0.1815  -0.0314 -0.0049 84  ALA L C   
2186 O O   . ALA B 84  ? 0.7188 0.8306 0.6709 0.1909  -0.0359 0.0030  84  ALA L O   
2187 C CB  . ALA B 84  ? 0.8889 0.8795 0.8140 0.1787  -0.0080 -0.0063 84  ALA L CB  
2188 N N   . VAL B 85  ? 0.7178 0.7855 0.6713 0.1639  -0.0370 -0.0192 85  VAL L N   
2189 C CA  . VAL B 85  ? 0.6650 0.7679 0.6314 0.1544  -0.0462 -0.0286 85  VAL L CA  
2190 C C   . VAL B 85  ? 0.7131 0.8274 0.6873 0.1570  -0.0457 -0.0312 85  VAL L C   
2191 O O   . VAL B 85  ? 0.7847 0.8719 0.7573 0.1551  -0.0408 -0.0333 85  VAL L O   
2192 C CB  . VAL B 85  ? 0.5877 0.6791 0.5579 0.1358  -0.0492 -0.0401 85  VAL L CB  
2193 C CG1 . VAL B 85  ? 0.6734 0.7931 0.6530 0.1248  -0.0527 -0.0508 85  VAL L CG1 
2194 C CG2 . VAL B 85  ? 0.5002 0.5795 0.4629 0.1333  -0.0487 -0.0375 85  VAL L CG2 
2195 N N   . TYR B 86  ? 0.6323 0.7903 0.6137 0.1587  -0.0505 -0.0318 86  TYR L N   
2196 C CA  . TYR B 86  ? 0.4792 0.6545 0.4682 0.1610  -0.0505 -0.0343 86  TYR L CA  
2197 C C   . TYR B 86  ? 0.5839 0.7825 0.5791 0.1412  -0.0563 -0.0501 86  TYR L C   
2198 O O   . TYR B 86  ? 0.5904 0.8161 0.5843 0.1306  -0.0590 -0.0556 86  TYR L O   
2199 C CB  . TYR B 86  ? 0.4602 0.6727 0.4516 0.1823  -0.0481 -0.0184 86  TYR L CB  
2200 C CG  . TYR B 86  ? 0.6153 0.7960 0.6000 0.2048  -0.0358 -0.0015 86  TYR L CG  
2201 C CD1 . TYR B 86  ? 0.6259 0.7955 0.6017 0.2131  -0.0325 0.0096  86  TYR L CD1 
2202 C CD2 . TYR B 86  ? 0.6459 0.8036 0.6311 0.2164  -0.0245 0.0024  86  TYR L CD2 
2203 C CE1 . TYR B 86  ? 0.6860 0.8197 0.6526 0.2328  -0.0168 0.0246  86  TYR L CE1 
2204 C CE2 . TYR B 86  ? 0.6298 0.7500 0.6055 0.2353  -0.0070 0.0164  86  TYR L CE2 
2205 C CZ  . TYR B 86  ? 0.7020 0.8087 0.6678 0.2436  -0.0026 0.0276  86  TYR L CZ  
2206 O OH  . TYR B 86  ? 0.8055 0.8684 0.7590 0.2616  0.0190  0.0412  86  TYR L OH  
2207 N N   . TYR B 87  ? 0.5450 0.7310 0.5451 0.1344  -0.0557 -0.0580 87  TYR L N   
2208 C CA  . TYR B 87  ? 0.5981 0.7977 0.6025 0.1157  -0.0575 -0.0726 87  TYR L CA  
2209 C C   . TYR B 87  ? 0.6049 0.8345 0.6140 0.1169  -0.0590 -0.0754 87  TYR L C   
2210 O O   . TYR B 87  ? 0.6963 0.9213 0.7079 0.1312  -0.0574 -0.0673 87  TYR L O   
2211 C CB  . TYR B 87  ? 0.5810 0.7420 0.5880 0.1047  -0.0548 -0.0783 87  TYR L CB  
2212 C CG  . TYR B 87  ? 0.5232 0.6604 0.5275 0.1019  -0.0525 -0.0758 87  TYR L CG  
2213 C CD1 . TYR B 87  ? 0.5268 0.6657 0.5311 0.0898  -0.0483 -0.0838 87  TYR L CD1 
2214 C CD2 . TYR B 87  ? 0.5597 0.6718 0.5600 0.1096  -0.0520 -0.0664 87  TYR L CD2 
2215 C CE1 . TYR B 87  ? 0.6009 0.7194 0.6042 0.0887  -0.0448 -0.0806 87  TYR L CE1 
2216 C CE2 . TYR B 87  ? 0.5365 0.6320 0.5345 0.1065  -0.0503 -0.0637 87  TYR L CE2 
2217 C CZ  . TYR B 87  ? 0.6532 0.7529 0.6542 0.0977  -0.0473 -0.0699 87  TYR L CZ  
2218 O OH  . TYR B 87  ? 0.6502 0.7347 0.6504 0.0962  -0.0443 -0.0663 87  TYR L OH  
2219 N N   . CYS B 88  ? 0.5991 0.8578 0.6079 0.1000  -0.0597 -0.0879 88  CYS L N   
2220 C CA  . CYS B 88  ? 0.6522 0.9398 0.6645 0.0961  -0.0611 -0.0935 88  CYS L CA  
2221 C C   . CYS B 88  ? 0.6160 0.8787 0.6286 0.0766  -0.0574 -0.1085 88  CYS L C   
2222 O O   . CYS B 88  ? 0.6197 0.8610 0.6287 0.0629  -0.0517 -0.1163 88  CYS L O   
2223 C CB  . CYS B 88  ? 0.6066 0.9589 0.6157 0.0902  -0.0636 -0.0951 88  CYS L CB  
2224 S SG  . CYS B 88  ? 0.7148 1.0810 0.7118 0.0562  -0.0578 -0.1162 88  CYS L SG  
2225 N N   . GLN B 89  ? 0.6259 0.8901 0.6432 0.0767  -0.0586 -0.1110 89  GLN L N   
2226 C CA  . GLN B 89  ? 0.5978 0.8382 0.6159 0.0605  -0.0546 -0.1219 89  GLN L CA  
2227 C C   . GLN B 89  ? 0.5932 0.8637 0.6116 0.0519  -0.0558 -0.1312 89  GLN L C   
2228 O O   . GLN B 89  ? 0.6841 0.9758 0.7074 0.0648  -0.0603 -0.1250 89  GLN L O   
2229 C CB  . GLN B 89  ? 0.4102 0.6090 0.4341 0.0671  -0.0546 -0.1137 89  GLN L CB  
2230 C CG  . GLN B 89  ? 0.4451 0.6249 0.4723 0.0538  -0.0509 -0.1193 89  GLN L CG  
2231 C CD  . GLN B 89  ? 0.6274 0.8158 0.6584 0.0543  -0.0546 -0.1207 89  GLN L CD  
2232 O OE1 . GLN B 89  ? 0.5596 0.7501 0.5920 0.0668  -0.0573 -0.1143 89  GLN L OE1 
2233 N NE2 . GLN B 89  ? 0.6832 0.8730 0.7147 0.0403  -0.0519 -0.1296 89  GLN L NE2 
2234 N N   . GLN B 90  ? 0.5901 0.8604 0.6024 0.0299  -0.0491 -0.1460 90  GLN L N   
2235 C CA  . GLN B 90  ? 0.6208 0.9185 0.6306 0.0173  -0.0490 -0.1572 90  GLN L CA  
2236 C C   . GLN B 90  ? 0.5984 0.8598 0.6124 0.0115  -0.0458 -0.1597 90  GLN L C   
2237 O O   . GLN B 90  ? 0.6202 0.8404 0.6356 0.0090  -0.0391 -0.1567 90  GLN L O   
2238 C CB  . GLN B 90  ? 0.5317 0.8576 0.5272 -0.0084 -0.0408 -0.1745 90  GLN L CB  
2239 C CG  . GLN B 90  ? 0.5195 0.8002 0.5062 -0.0263 -0.0247 -0.1848 90  GLN L CG  
2240 C CD  . GLN B 90  ? 0.5310 0.7843 0.5143 -0.0418 -0.0141 -0.1951 90  GLN L CD  
2241 O OE1 . GLN B 90  ? 0.5328 0.8090 0.5166 -0.0459 -0.0196 -0.1997 90  GLN L OE1 
2242 N NE2 . GLN B 90  ? 0.6059 0.8096 0.5859 -0.0492 0.0027  -0.1972 90  GLN L NE2 
2243 N N   . GLY B 91  ? 0.5189 0.7997 0.5357 0.0104  -0.0502 -0.1631 91  GLY L N   
2244 C CA  . GLY B 91  ? 0.5963 0.8499 0.6169 0.0037  -0.0482 -0.1648 91  GLY L CA  
2245 C C   . GLY B 91  ? 0.6588 0.9366 0.6732 -0.0140 -0.0461 -0.1797 91  GLY L C   
2246 O O   . GLY B 91  ? 0.7125 0.9836 0.7313 -0.0163 -0.0481 -0.1804 91  GLY L O   
2247 N N   . ALA B 92  ? 0.6417 0.9506 0.6442 -0.0295 -0.0413 -0.1926 92  ALA L N   
2248 C CA  . ALA B 92  ? 0.6641 1.0018 0.6569 -0.0510 -0.0378 -0.2092 92  ALA L CA  
2249 C C   . ALA B 92  ? 0.7249 1.0203 0.7064 -0.0737 -0.0214 -0.2213 92  ALA L C   
2250 O O   . ALA B 92  ? 0.7575 1.0511 0.7350 -0.0868 -0.0182 -0.2299 92  ALA L O   
2251 C CB  . ALA B 92  ? 0.6770 1.0761 0.6595 -0.0618 -0.0387 -0.2178 92  ALA L CB  
2252 N N   . SER B 93  ? 0.6939 0.9532 0.6700 -0.0774 -0.0086 -0.2208 93  SER L N   
2253 C CA  . SER B 93  ? 0.7512 0.9641 0.7162 -0.0959 0.0135  -0.2296 93  SER L CA  
2254 C C   . SER B 93  ? 0.8610 1.0212 0.8365 -0.0798 0.0212  -0.2123 93  SER L C   
2255 O O   . SER B 93  ? 0.8060 0.9657 0.7877 -0.0656 0.0160  -0.2028 93  SER L O   
2256 C CB  . SER B 93  ? 0.7281 0.9527 0.6691 -0.1256 0.0315  -0.2522 93  SER L CB  
2257 O OG  . SER B 93  ? 0.8492 1.0178 0.7775 -0.1423 0.0596  -0.2604 93  SER L OG  
2258 N N   . TRP B 94  ? 0.9136 1.0336 0.8917 -0.0815 0.0339  -0.2063 94  TRP L N   
2259 C CA  . TRP B 94  ? 0.8331 0.9091 0.8220 -0.0665 0.0447  -0.1868 94  TRP L CA  
2260 C C   . TRP B 94  ? 0.8994 0.9379 0.8733 -0.0803 0.0752  -0.1968 94  TRP L C   
2261 O O   . TRP B 94  ? 1.0497 1.0770 1.0045 -0.1044 0.0946  -0.2160 94  TRP L O   
2262 C CB  . TRP B 94  ? 0.6898 0.7477 0.6908 -0.0595 0.0451  -0.1704 94  TRP L CB  
2263 C CG  . TRP B 94  ? 0.6174 0.6435 0.6325 -0.0420 0.0548  -0.1450 94  TRP L CG  
2264 C CD1 . TRP B 94  ? 0.6742 0.6586 0.6889 -0.0416 0.0821  -0.1352 94  TRP L CD1 
2265 C CD2 . TRP B 94  ? 0.6687 0.7051 0.7003 -0.0219 0.0394  -0.1246 94  TRP L CD2 
2266 N NE1 . TRP B 94  ? 0.7960 0.7707 0.8288 -0.0203 0.0831  -0.1074 94  TRP L NE1 
2267 C CE2 . TRP B 94  ? 0.6827 0.6904 0.7248 -0.0103 0.0563  -0.1020 94  TRP L CE2 
2268 C CE3 . TRP B 94  ? 0.7039 0.7702 0.7412 -0.0130 0.0158  -0.1228 94  TRP L CE3 
2269 C CZ2 . TRP B 94  ? 0.7282 0.7441 0.7862 0.0074  0.0474  -0.0786 94  TRP L CZ2 
2270 C CZ3 . TRP B 94  ? 0.6015 0.6677 0.6516 0.0024  0.0091  -0.1022 94  TRP L CZ3 
2271 C CH2 . TRP B 94  ? 0.6901 0.7351 0.7503 0.0112  0.0234  -0.0808 94  TRP L CH2 
2272 N N   . PRO B 95  ? 0.8490 0.8660 0.8294 -0.0670 0.0821  -0.1851 95  PRO L N   
2273 C CA  . PRO B 95  ? 0.7831 0.8089 0.7832 -0.0414 0.0631  -0.1628 95  PRO L CA  
2274 C C   . PRO B 95  ? 0.7890 0.8575 0.7891 -0.0368 0.0391  -0.1680 95  PRO L C   
2275 O O   . PRO B 95  ? 0.8956 0.9820 0.8821 -0.0498 0.0422  -0.1846 95  PRO L O   
2276 C CB  . PRO B 95  ? 0.8033 0.7897 0.8051 -0.0345 0.0859  -0.1537 95  PRO L CB  
2277 C CG  . PRO B 95  ? 0.7508 0.7215 0.7292 -0.0598 0.1108  -0.1795 95  PRO L CG  
2278 C CD  . PRO B 95  ? 0.8181 0.7963 0.7836 -0.0801 0.1145  -0.1957 95  PRO L CD  
2279 N N   . PHE B 96  ? 0.6336 0.7193 0.6479 -0.0195 0.0176  -0.1530 96  PHE L N   
2280 C CA  . PHE B 96  ? 0.6438 0.7612 0.6595 -0.0100 -0.0010 -0.1527 96  PHE L CA  
2281 C C   . PHE B 96  ? 0.6981 0.8041 0.7133 -0.0031 0.0035  -0.1479 96  PHE L C   
2282 O O   . PHE B 96  ? 0.8806 0.9566 0.9027 0.0041  0.0131  -0.1353 96  PHE L O   
2283 C CB  . PHE B 96  ? 0.5450 0.6718 0.5730 0.0045  -0.0182 -0.1387 96  PHE L CB  
2284 C CG  . PHE B 96  ? 0.6020 0.7385 0.6316 -0.0025 -0.0222 -0.1426 96  PHE L CG  
2285 C CD1 . PHE B 96  ? 0.6511 0.8051 0.6708 -0.0176 -0.0186 -0.1601 96  PHE L CD1 
2286 C CD2 . PHE B 96  ? 0.5816 0.7135 0.6213 0.0032  -0.0291 -0.1296 96  PHE L CD2 
2287 C CE1 . PHE B 96  ? 0.5221 0.6854 0.5431 -0.0245 -0.0224 -0.1641 96  PHE L CE1 
2288 C CE2 . PHE B 96  ? 0.6540 0.7956 0.6949 -0.0047 -0.0325 -0.1338 96  PHE L CE2 
2289 C CZ  . PHE B 96  ? 0.6074 0.7630 0.6395 -0.0174 -0.0294 -0.1509 96  PHE L CZ  
2290 N N   . THR B 97  ? 0.6429 0.7768 0.6505 -0.0047 -0.0029 -0.1560 97  THR L N   
2291 C CA  . THR B 97  ? 0.6190 0.7451 0.6240 -0.0012 0.0017  -0.1538 97  THR L CA  
2292 C C   . THR B 97  ? 0.6063 0.7588 0.6144 0.0142  -0.0159 -0.1452 97  THR L C   
2293 O O   . THR B 97  ? 0.6233 0.8062 0.6327 0.0201  -0.0283 -0.1443 97  THR L O   
2294 C CB  . THR B 97  ? 0.5708 0.7025 0.5587 -0.0243 0.0182  -0.1738 97  THR L CB  
2295 O OG1 . THR B 97  ? 0.6544 0.8342 0.6332 -0.0368 0.0102  -0.1866 97  THR L OG1 
2296 C CG2 . THR B 97  ? 0.5608 0.6502 0.5432 -0.0383 0.0439  -0.1811 97  THR L CG2 
2297 N N   . PHE B 98  ? 0.6987 0.8376 0.7078 0.0219  -0.0144 -0.1379 98  PHE L N   
2298 C CA  . PHE B 98  ? 0.5684 0.7273 0.5777 0.0356  -0.0271 -0.1297 98  PHE L CA  
2299 C C   . PHE B 98  ? 0.7007 0.8831 0.6993 0.0254  -0.0231 -0.1390 98  PHE L C   
2300 O O   . PHE B 98  ? 0.6596 0.8350 0.6495 0.0060  -0.0082 -0.1531 98  PHE L O   
2301 C CB  . PHE B 98  ? 0.4412 0.5723 0.4577 0.0500  -0.0297 -0.1142 98  PHE L CB  
2302 C CG  . PHE B 98  ? 0.5618 0.6821 0.5865 0.0578  -0.0359 -0.1040 98  PHE L CG  
2303 C CD1 . PHE B 98  ? 0.5641 0.6958 0.5884 0.0682  -0.0457 -0.0988 98  PHE L CD1 
2304 C CD2 . PHE B 98  ? 0.6207 0.7202 0.6528 0.0543  -0.0293 -0.0986 98  PHE L CD2 
2305 C CE1 . PHE B 98  ? 0.7456 0.8668 0.7742 0.0703  -0.0486 -0.0924 98  PHE L CE1 
2306 C CE2 . PHE B 98  ? 0.6920 0.7892 0.7303 0.0573  -0.0352 -0.0894 98  PHE L CE2 
2307 C CZ  . PHE B 98  ? 0.7224 0.8298 0.7576 0.0631  -0.0447 -0.0883 98  PHE L CZ  
2308 N N   . GLY B 99  ? 0.7169 0.9268 0.7147 0.0373  -0.0340 -0.1308 99  GLY L N   
2309 C CA  . GLY B 99  ? 0.7369 0.9747 0.7252 0.0283  -0.0319 -0.1360 99  GLY L CA  
2310 C C   . GLY B 99  ? 0.8487 1.0538 0.8370 0.0318  -0.0267 -0.1316 99  GLY L C   
2311 O O   . GLY B 99  ? 0.8947 1.0615 0.8910 0.0428  -0.0260 -0.1225 99  GLY L O   
2312 N N   . GLN B 100 ? 0.8794 1.1045 0.8583 0.0210  -0.0229 -0.1376 100 GLN L N   
2313 C CA  . GLN B 100 ? 0.7773 0.9751 0.7555 0.0235  -0.0177 -0.1343 100 GLN L CA  
2314 C C   . GLN B 100 ? 0.6052 0.7979 0.5896 0.0480  -0.0312 -0.1149 100 GLN L C   
2315 O O   . GLN B 100 ? 0.6465 0.8068 0.6340 0.0550  -0.0289 -0.1085 100 GLN L O   
2316 C CB  . GLN B 100 ? 0.7656 0.9908 0.7304 0.0025  -0.0099 -0.1471 100 GLN L CB  
2317 N N   . GLY B 101 ? 0.5716 0.7962 0.5568 0.0608  -0.0428 -0.1052 101 GLY L N   
2318 C CA  . GLY B 101 ? 0.5978 0.8129 0.5852 0.0832  -0.0506 -0.0876 101 GLY L CA  
2319 C C   . GLY B 101 ? 0.6974 0.9469 0.6786 0.0890  -0.0549 -0.0790 101 GLY L C   
2320 O O   . GLY B 101 ? 0.5878 0.8578 0.5626 0.0732  -0.0517 -0.0874 101 GLY L O   
2321 N N   . THR B 102 ? 0.6510 0.9061 0.6334 0.1113  -0.0597 -0.0615 102 THR L N   
2322 C CA  . THR B 102 ? 0.6365 0.9238 0.6144 0.1222  -0.0626 -0.0472 102 THR L CA  
2323 C C   . THR B 102 ? 0.6814 0.9292 0.6561 0.1424  -0.0607 -0.0320 102 THR L C   
2324 O O   . THR B 102 ? 0.6158 0.8387 0.5923 0.1573  -0.0575 -0.0242 102 THR L O   
2325 C CB  . THR B 102 ? 0.7063 1.0538 0.6880 0.1323  -0.0661 -0.0358 102 THR L CB  
2326 O OG1 . THR B 102 ? 0.7688 1.1607 0.7491 0.1078  -0.0670 -0.0518 102 THR L OG1 
2327 C CG2 . THR B 102 ? 0.6085 0.9909 0.5874 0.1487  -0.0679 -0.0144 102 THR L CG2 
2328 N N   . LYS B 103 ? 0.6560 0.8968 0.6238 0.1401  -0.0607 -0.0294 103 LYS L N   
2329 C CA  . LYS B 103 ? 0.6134 0.8160 0.5742 0.1553  -0.0572 -0.0168 103 LYS L CA  
2330 C C   . LYS B 103 ? 0.6775 0.9074 0.6349 0.1767  -0.0557 0.0054  103 LYS L C   
2331 O O   . LYS B 103 ? 0.6765 0.9574 0.6341 0.1739  -0.0603 0.0106  103 LYS L O   
2332 C CB  . LYS B 103 ? 0.6003 0.7783 0.5554 0.1421  -0.0569 -0.0248 103 LYS L CB  
2333 C CG  . LYS B 103 ? 0.6969 0.8365 0.6417 0.1530  -0.0527 -0.0142 103 LYS L CG  
2334 C CD  . LYS B 103 ? 0.6486 0.7696 0.5891 0.1392  -0.0530 -0.0224 103 LYS L CD  
2335 N N   . VAL B 104 ? 0.6498 0.8467 0.6032 0.1973  -0.0469 0.0193  104 VAL L N   
2336 C CA  . VAL B 104 ? 0.7160 0.9287 0.6662 0.2229  -0.0401 0.0447  104 VAL L CA  
2337 C C   . VAL B 104 ? 0.8349 1.0004 0.7702 0.2282  -0.0319 0.0516  104 VAL L C   
2338 O O   . VAL B 104 ? 0.8067 0.9154 0.7325 0.2311  -0.0204 0.0497  104 VAL L O   
2339 C CB  . VAL B 104 ? 0.7122 0.9200 0.6676 0.2459  -0.0292 0.0583  104 VAL L CB  
2340 C CG1 . VAL B 104 ? 0.6636 0.8886 0.6175 0.2770  -0.0182 0.0896  104 VAL L CG1 
2341 C CG2 . VAL B 104 ? 0.6828 0.9387 0.6522 0.2390  -0.0377 0.0505  104 VAL L CG2 
2342 N N   . GLU B 105 ? 0.9284 1.1191 0.8595 0.2260  -0.0370 0.0581  105 GLU L N   
2343 C CA  . GLU B 105 ? 0.8391 0.9892 0.7548 0.2288  -0.0301 0.0639  105 GLU L CA  
2344 C C   . GLU B 105 ? 0.8566 1.0148 0.7671 0.2579  -0.0186 0.0942  105 GLU L C   
2345 O O   . GLU B 105 ? 0.7106 0.9269 0.6319 0.2734  -0.0209 0.1126  105 GLU L O   
2346 C CB  . GLU B 105 ? 0.7492 0.9152 0.6626 0.2065  -0.0413 0.0508  105 GLU L CB  
2347 N N   . ILE B 106 ? 0.8108 0.9128 0.7039 0.2650  -0.0044 0.1007  106 ILE L N   
2348 C CA  . ILE B 106 ? 0.8496 0.9462 0.7351 0.2945  0.0120  0.1313  106 ILE L CA  
2349 C C   . ILE B 106 ? 0.8195 0.9687 0.7060 0.2957  0.0015  0.1455  106 ILE L C   
2350 O O   . ILE B 106 ? 0.8348 0.9829 0.7151 0.2724  -0.0098 0.1291  106 ILE L O   
2351 C CB  . ILE B 106 ? 0.8975 0.9102 0.7591 0.2971  0.0345  0.1308  106 ILE L CB  
2352 C CG1 . ILE B 106 ? 0.9258 0.8895 0.7834 0.2866  0.0441  0.1118  106 ILE L CG1 
2353 C CG2 . ILE B 106 ? 0.8462 0.8438 0.6995 0.3316  0.0584  0.1648  106 ILE L CG2 
2354 C CD1 . ILE B 106 ? 0.9523 0.8361 0.7823 0.2815  0.0688  0.1073  106 ILE L CD1 
2355 N N   . LYS B 107 ? 0.8242 1.0234 0.7190 0.3230  0.0061  0.1774  107 LYS L N   
2356 C CA  . LYS B 107 ? 0.8485 1.1081 0.7443 0.3247  -0.0032 0.1952  107 LYS L CA  
2357 C C   . LYS B 107 ? 1.0151 1.2372 0.8955 0.3493  0.0161  0.2230  107 LYS L C   
2358 O O   . LYS B 107 ? 1.0811 1.2745 0.9599 0.3818  0.0392  0.2483  107 LYS L O   
2359 C CB  . LYS B 107 ? 0.8173 1.1748 0.7329 0.3363  -0.0123 0.2160  107 LYS L CB  
2360 N N   . ARG B 108 ? 0.9054 1.1250 0.7738 0.3337  0.0092  0.2180  108 ARG L N   
2361 C CA  . ARG B 108 ? 0.8418 1.0257 0.6931 0.3534  0.0270  0.2428  108 ARG L CA  
2362 C C   . ARG B 108 ? 0.8586 1.1068 0.7102 0.3461  0.0125  0.2552  108 ARG L C   
2363 O O   . ARG B 108 ? 0.8597 1.1807 0.7239 0.3245  -0.0095 0.2437  108 ARG L O   
2364 C CB  . ARG B 108 ? 0.8505 0.9371 0.6775 0.3380  0.0397  0.2198  108 ARG L CB  
2365 C CG  . ARG B 108 ? 0.8478 0.9323 0.6710 0.2984  0.0191  0.1838  108 ARG L CG  
2366 C CD  . ARG B 108 ? 0.9104 0.9193 0.7072 0.2864  0.0316  0.1721  108 ARG L CD  
2367 N NE  . ARG B 108 ? 1.0188 1.0274 0.8017 0.2992  0.0400  0.1960  108 ARG L NE  
2368 C CZ  . ARG B 108 ? 1.0290 0.9713 0.7850 0.2959  0.0573  0.1949  108 ARG L CZ  
2369 N NH1 . ARG B 108 ? 0.8472 0.7231 0.5869 0.2779  0.0678  0.1705  108 ARG L NH1 
2370 N NH2 . ARG B 108 ? 1.1181 1.0641 0.8624 0.3085  0.0647  0.2185  108 ARG L NH2 
2371 N N   . THR B 109 ? 0.9055 1.1250 0.7412 0.3619  0.0270  0.2777  109 THR L N   
2372 C CA  . THR B 109 ? 0.8770 1.1531 0.7104 0.3544  0.0148  0.2906  109 THR L CA  
2373 C C   . THR B 109 ? 0.8020 1.0677 0.6271 0.3113  -0.0038 0.2504  109 THR L C   
2374 O O   . THR B 109 ? 0.7571 0.9526 0.5720 0.2943  -0.0007 0.2206  109 THR L O   
2375 C CB  . THR B 109 ? 1.0016 1.2405 0.8179 0.3828  0.0377  0.3252  109 THR L CB  
2376 O OG1 . THR B 109 ? 1.0498 1.1842 0.8406 0.3717  0.0532  0.3033  109 THR L OG1 
2377 C CG2 . THR B 109 ? 1.0735 1.3198 0.8992 0.4301  0.0615  0.3693  109 THR L CG2 
2378 N N   . VAL B 110 ? 0.7281 1.0679 0.5581 0.2934  -0.0214 0.2509  110 VAL L N   
2379 C CA  . VAL B 110 ? 0.7011 1.0370 0.5248 0.2536  -0.0363 0.2147  110 VAL L CA  
2380 C C   . VAL B 110 ? 0.7218 0.9842 0.5230 0.2494  -0.0270 0.2085  110 VAL L C   
2381 O O   . VAL B 110 ? 0.9043 1.1598 0.6935 0.2683  -0.0164 0.2366  110 VAL L O   
2382 C CB  . VAL B 110 ? 0.8187 1.2516 0.6493 0.2335  -0.0529 0.2177  110 VAL L CB  
2383 C CG1 . VAL B 110 ? 0.8046 1.2258 0.6284 0.1931  -0.0632 0.1793  110 VAL L CG1 
2384 C CG2 . VAL B 110 ? 0.7428 1.2549 0.5926 0.2323  -0.0613 0.2219  110 VAL L CG2 
2385 N N   . ALA B 111 ? 0.7864 0.9966 0.5816 0.2247  -0.0299 0.1731  111 ALA L N   
2386 C CA  . ALA B 111 ? 0.8376 0.9835 0.6110 0.2155  -0.0223 0.1633  111 ALA L CA  
2387 C C   . ALA B 111 ? 0.7555 0.9110 0.5297 0.1804  -0.0366 0.1313  111 ALA L C   
2388 O O   . ALA B 111 ? 0.7782 0.9366 0.5650 0.1635  -0.0441 0.1061  111 ALA L O   
2389 C CB  . ALA B 111 ? 0.8861 0.9506 0.6478 0.2227  -0.0054 0.1556  111 ALA L CB  
2390 N N   . ALA B 112 ? 0.8732 1.0326 0.6341 0.1708  -0.0383 0.1337  112 ALA L N   
2391 C CA  . ALA B 112 ? 0.8316 0.9980 0.5924 0.1392  -0.0485 0.1053  112 ALA L CA  
2392 C C   . ALA B 112 ? 0.8247 0.9240 0.5764 0.1282  -0.0428 0.0831  112 ALA L C   
2393 O O   . ALA B 112 ? 0.8591 0.9043 0.5928 0.1389  -0.0299 0.0913  112 ALA L O   
2394 C CB  . ALA B 112 ? 0.6917 0.8865 0.4408 0.1320  -0.0518 0.1159  112 ALA L CB  
2395 N N   . PRO B 113 ? 0.7258 0.8303 0.4890 0.1059  -0.0499 0.0557  113 PRO L N   
2396 C CA  . PRO B 113 ? 0.7518 0.8078 0.5101 0.0948  -0.0458 0.0371  113 PRO L CA  
2397 C C   . PRO B 113 ? 0.9441 0.9799 0.6839 0.0822  -0.0437 0.0327  113 PRO L C   
2398 O O   . PRO B 113 ? 1.0001 1.0672 0.7390 0.0719  -0.0493 0.0316  113 PRO L O   
2399 C CB  . PRO B 113 ? 0.7079 0.7865 0.4881 0.0792  -0.0520 0.0151  113 PRO L CB  
2400 C CG  . PRO B 113 ? 0.7429 0.8769 0.5303 0.0703  -0.0585 0.0148  113 PRO L CG  
2401 C CD  . PRO B 113 ? 0.7968 0.9551 0.5782 0.0898  -0.0592 0.0420  113 PRO L CD  
2402 N N   . SER B 114 ? 1.0087 0.9954 0.7322 0.0804  -0.0349 0.0293  114 SER L N   
2403 C CA  . SER B 114 ? 0.9402 0.9087 0.6464 0.0646  -0.0328 0.0214  114 SER L CA  
2404 C C   . SER B 114 ? 0.8422 0.8232 0.5645 0.0465  -0.0385 -0.0004 114 SER L C   
2405 O O   . SER B 114 ? 0.8323 0.8021 0.5641 0.0452  -0.0368 -0.0080 114 SER L O   
2406 C CB  . SER B 114 ? 1.0560 0.9696 0.7339 0.0661  -0.0181 0.0264  114 SER L CB  
2407 O OG  . SER B 114 ? 1.1243 1.0194 0.7873 0.0863  -0.0073 0.0491  114 SER L OG  
2408 N N   . VAL B 115 ? 0.7865 0.7920 0.5124 0.0332  -0.0436 -0.0089 115 VAL L N   
2409 C CA  . VAL B 115 ? 0.7328 0.7520 0.4772 0.0196  -0.0451 -0.0270 115 VAL L CA  
2410 C C   . VAL B 115 ? 0.7695 0.7718 0.5023 0.0072  -0.0416 -0.0339 115 VAL L C   
2411 O O   . VAL B 115 ? 0.8904 0.8865 0.6031 0.0002  -0.0411 -0.0316 115 VAL L O   
2412 C CB  . VAL B 115 ? 0.7283 0.7852 0.4853 0.0096  -0.0484 -0.0354 115 VAL L CB  
2413 C CG1 . VAL B 115 ? 0.5869 0.6503 0.3652 -0.0003 -0.0436 -0.0528 115 VAL L CG1 
2414 C CG2 . VAL B 115 ? 0.6675 0.7518 0.4316 0.0180  -0.0524 -0.0271 115 VAL L CG2 
2415 N N   . PHE B 116 ? 0.7347 0.7343 0.4803 0.0042  -0.0390 -0.0410 116 PHE L N   
2416 C CA  . PHE B 116 ? 0.6985 0.6954 0.4374 -0.0082 -0.0359 -0.0464 116 PHE L CA  
2417 C C   . PHE B 116 ? 0.7945 0.8146 0.5624 -0.0102 -0.0334 -0.0544 116 PHE L C   
2418 O O   . PHE B 116 ? 0.9199 0.9460 0.7093 -0.0015 -0.0320 -0.0543 116 PHE L O   
2419 C CB  . PHE B 116 ? 0.6597 0.6333 0.3802 -0.0109 -0.0315 -0.0420 116 PHE L CB  
2420 C CG  . PHE B 116 ? 0.7263 0.6665 0.4172 -0.0070 -0.0270 -0.0334 116 PHE L CG  
2421 C CD1 . PHE B 116 ? 0.7797 0.7046 0.4718 0.0073  -0.0245 -0.0255 116 PHE L CD1 
2422 C CD2 . PHE B 116 ? 0.7975 0.7197 0.4590 -0.0166 -0.0226 -0.0320 116 PHE L CD2 
2423 C CE1 . PHE B 116 ? 0.7295 0.6201 0.3954 0.0145  -0.0155 -0.0148 116 PHE L CE1 
2424 C CE2 . PHE B 116 ? 0.8897 0.7752 0.5234 -0.0104 -0.0134 -0.0216 116 PHE L CE2 
2425 C CZ  . PHE B 116 ? 0.8241 0.6931 0.4607 0.0064  -0.0087 -0.0122 116 PHE L CZ  
2426 N N   . ILE B 117 ? 0.7304 0.7622 0.4990 -0.0204 -0.0306 -0.0600 117 ILE L N   
2427 C CA  . ILE B 117 ? 0.5679 0.6193 0.3643 -0.0192 -0.0233 -0.0643 117 ILE L CA  
2428 C C   . ILE B 117 ? 0.7720 0.8355 0.5663 -0.0248 -0.0209 -0.0598 117 ILE L C   
2429 O O   . ILE B 117 ? 0.8556 0.9152 0.6249 -0.0368 -0.0236 -0.0601 117 ILE L O   
2430 C CB  . ILE B 117 ? 0.7764 0.8379 0.5812 -0.0257 -0.0178 -0.0751 117 ILE L CB  
2431 C CG1 . ILE B 117 ? 0.6981 0.7716 0.5329 -0.0210 -0.0037 -0.0784 117 ILE L CG1 
2432 C CG2 . ILE B 117 ? 0.7305 0.7928 0.5128 -0.0390 -0.0208 -0.0781 117 ILE L CG2 
2433 C CD1 . ILE B 117 ? 0.5769 0.6538 0.4195 -0.0295 0.0075  -0.0921 117 ILE L CD1 
2434 N N   . PHE B 118 ? 0.7634 0.8450 0.5832 -0.0167 -0.0149 -0.0540 118 PHE L N   
2435 C CA  . PHE B 118 ? 0.6696 0.7769 0.4909 -0.0216 -0.0129 -0.0458 118 PHE L CA  
2436 C C   . PHE B 118 ? 0.7625 0.8974 0.6151 -0.0131 -0.0010 -0.0414 118 PHE L C   
2437 O O   . PHE B 118 ? 0.7025 0.8387 0.5828 0.0017  0.0079  -0.0375 118 PHE L O   
2438 C CB  . PHE B 118 ? 0.6441 0.7571 0.4652 -0.0197 -0.0157 -0.0365 118 PHE L CB  
2439 C CG  . PHE B 118 ? 0.6627 0.7443 0.4531 -0.0269 -0.0220 -0.0399 118 PHE L CG  
2440 C CD1 . PHE B 118 ? 0.6095 0.6820 0.3653 -0.0450 -0.0226 -0.0423 118 PHE L CD1 
2441 C CD2 . PHE B 118 ? 0.6774 0.7370 0.4725 -0.0155 -0.0242 -0.0404 118 PHE L CD2 
2442 C CE1 . PHE B 118 ? 0.8019 0.8379 0.5286 -0.0498 -0.0224 -0.0444 118 PHE L CE1 
2443 C CE2 . PHE B 118 ? 0.6386 0.6683 0.4073 -0.0186 -0.0264 -0.0410 118 PHE L CE2 
2444 C CZ  . PHE B 118 ? 0.7085 0.7233 0.4429 -0.0348 -0.0240 -0.0426 118 PHE L CZ  
2445 N N   . PRO B 119 ? 0.8115 0.9668 0.6592 -0.0219 0.0015  -0.0412 119 PRO L N   
2446 C CA  . PRO B 119 ? 0.8457 1.0310 0.7236 -0.0115 0.0156  -0.0330 119 PRO L CA  
2447 C C   . PRO B 119 ? 0.7806 1.0058 0.6775 -0.0024 0.0182  -0.0126 119 PRO L C   
2448 O O   . PRO B 119 ? 0.8554 1.0928 0.7328 -0.0143 0.0075  -0.0083 119 PRO L O   
2449 C CB  . PRO B 119 ? 0.9017 1.0992 0.7625 -0.0265 0.0145  -0.0390 119 PRO L CB  
2450 C CG  . PRO B 119 ? 0.9675 1.1544 0.7892 -0.0456 -0.0002 -0.0433 119 PRO L CG  
2451 C CD  . PRO B 119 ? 0.9174 1.0671 0.7299 -0.0414 -0.0066 -0.0478 119 PRO L CD  
2452 N N   . PRO B 120 ? 0.7432 0.9890 0.6767 0.0176  0.0348  0.0008  120 PRO L N   
2453 C CA  . PRO B 120 ? 0.7958 1.0896 0.7512 0.0289  0.0382  0.0257  120 PRO L CA  
2454 C C   . PRO B 120 ? 0.7694 1.1169 0.7136 0.0146  0.0323  0.0358  120 PRO L C   
2455 O O   . PRO B 120 ? 0.6612 1.0173 0.6014 0.0091  0.0363  0.0309  120 PRO L O   
2456 C CB  . PRO B 120 ? 0.7529 1.0496 0.7490 0.0558  0.0627  0.0381  120 PRO L CB  
2457 C CG  . PRO B 120 ? 0.7369 1.0016 0.7285 0.0517  0.0728  0.0190  120 PRO L CG  
2458 C CD  . PRO B 120 ? 0.7340 0.9598 0.6894 0.0301  0.0544  -0.0054 120 PRO L CD  
2459 N N   . SER B 121 ? 0.6788 1.0644 0.6161 0.0057  0.0234  0.0486  121 SER L N   
2460 C CA  . SER B 121 ? 0.6880 1.1318 0.6100 -0.0143 0.0178  0.0570  121 SER L CA  
2461 C C   . SER B 121 ? 0.6315 1.1379 0.5889 0.0035  0.0315  0.0814  121 SER L C   
2462 O O   . SER B 121 ? 0.6841 1.1930 0.6805 0.0339  0.0471  0.0977  121 SER L O   
2463 C CB  . SER B 121 ? 0.6868 1.1611 0.5936 -0.0311 0.0082  0.0646  121 SER L CB  
2464 O OG  . SER B 121 ? 0.6967 1.2062 0.6399 -0.0088 0.0145  0.0891  121 SER L OG  
2465 N N   . ASP B 122 ? 0.5545 1.1108 0.4973 -0.0152 0.0279  0.0847  122 ASP L N   
2466 C CA  . ASP B 122 ? 0.6906 1.3174 0.6662 0.0012  0.0406  0.1109  122 ASP L CA  
2467 C C   . ASP B 122 ? 0.7774 1.4765 0.7827 0.0158  0.0443  0.1457  122 ASP L C   
2468 O O   . ASP B 122 ? 0.8967 1.6477 0.9426 0.0438  0.0603  0.1757  122 ASP L O   
2469 C CB  . ASP B 122 ? 0.8208 1.4891 0.7694 -0.0268 0.0340  0.1048  122 ASP L CB  
2470 N N   . GLU B 123 ? 0.6509 1.3539 0.6361 -0.0028 0.0311  0.1429  123 GLU L N   
2471 C CA  . GLU B 123 ? 0.6549 1.4281 0.6644 0.0065  0.0324  0.1747  123 GLU L CA  
2472 C C   . GLU B 123 ? 0.7022 1.4487 0.7555 0.0484  0.0476  0.1922  123 GLU L C   
2473 O O   . GLU B 123 ? 0.7769 1.5875 0.8688 0.0737  0.0593  0.2291  123 GLU L O   
2474 C CB  . GLU B 123 ? 0.6223 1.3966 0.5949 -0.0281 0.0164  0.1621  123 GLU L CB  
2475 C CG  . GLU B 123 ? 0.5816 1.3768 0.5054 -0.0741 0.0062  0.1432  123 GLU L CG  
2476 N N   . GLN B 124 ? 0.6814 1.3355 0.7276 0.0552  0.0489  0.1668  124 GLN L N   
2477 C CA  . GLN B 124 ? 0.5784 1.1958 0.6589 0.0893  0.0651  0.1772  124 GLN L CA  
2478 C C   . GLN B 124 ? 0.6639 1.2747 0.7785 0.1203  0.0914  0.1892  124 GLN L C   
2479 O O   . GLN B 124 ? 0.6209 1.2362 0.7734 0.1533  0.1129  0.2138  124 GLN L O   
2480 C CB  . GLN B 124 ? 0.4853 1.0131 0.5438 0.0817  0.0579  0.1448  124 GLN L CB  
2481 C CG  . GLN B 124 ? 0.5117 1.0043 0.5988 0.1095  0.0726  0.1528  124 GLN L CG  
2482 C CD  . GLN B 124 ? 0.6167 1.0259 0.6836 0.1021  0.0679  0.1201  124 GLN L CD  
2483 O OE1 . GLN B 124 ? 0.5553 0.9333 0.5891 0.0795  0.0543  0.0940  124 GLN L OE1 
2484 N NE2 . GLN B 124 ? 0.7038 1.0801 0.7904 0.1211  0.0801  0.1231  124 GLN L NE2 
2485 N N   . LEU B 125 ? 0.5671 1.1642 0.6672 0.1093  0.0921  0.1717  125 LEU L N   
2486 C CA  . LEU B 125 ? 0.6735 1.2605 0.8018 0.1345  0.1191  0.1790  125 LEU L CA  
2487 C C   . LEU B 125 ? 0.7547 1.4287 0.9221 0.1607  0.1356  0.2235  125 LEU L C   
2488 O O   . LEU B 125 ? 0.9842 1.6505 1.1876 0.1944  0.1666  0.2417  125 LEU L O   
2489 C CB  . LEU B 125 ? 0.6026 1.1636 0.7036 0.1125  0.1134  0.1502  125 LEU L CB  
2490 C CG  . LEU B 125 ? 0.5752 1.0495 0.6456 0.0945  0.1049  0.1103  125 LEU L CG  
2491 C CD1 . LEU B 125 ? 0.5907 1.0529 0.6335 0.0716  0.0976  0.0869  125 LEU L CD1 
2492 C CD2 . LEU B 125 ? 0.5811 0.9963 0.6746 0.1174  0.1301  0.1050  125 LEU L CD2 
2493 N N   . LYS B 126 ? 0.6777 1.4362 0.8370 0.1443  0.1174  0.2418  126 LYS L N   
2494 C CA  . LYS B 126 ? 0.7576 1.6177 0.9534 0.1667  0.1298  0.2885  126 LYS L CA  
2495 C C   . LYS B 126 ? 0.8088 1.6827 1.0450 0.2035  0.1476  0.3240  126 LYS L C   
2496 O O   . LYS B 126 ? 0.9146 1.8478 1.1932 0.2386  0.1709  0.3667  126 LYS L O   
2497 C CB  . LYS B 126 ? 0.7317 1.6843 0.9029 0.1319  0.1047  0.2961  126 LYS L CB  
2498 N N   . SER B 127 ? 0.7194 1.5388 0.9426 0.1965  0.1381  0.3078  127 SER L N   
2499 C CA  . SER B 127 ? 0.7524 1.5753 1.0094 0.2283  0.1540  0.3376  127 SER L CA  
2500 C C   . SER B 127 ? 0.9275 1.6761 1.2134 0.2656  0.1910  0.3390  127 SER L C   
2501 O O   . SER B 127 ? 1.0396 1.8050 1.3633 0.3030  0.2172  0.3766  127 SER L O   
2502 C CB  . SER B 127 ? 0.6966 1.4843 0.9282 0.2062  0.1318  0.3173  127 SER L CB  
2503 O OG  . SER B 127 ? 0.8049 1.4902 1.0074 0.1906  0.1263  0.2713  127 SER L OG  
2504 N N   . GLY B 128 ? 0.9557 1.6183 1.2192 0.2526  0.1941  0.2973  128 GLY L N   
2505 C CA  . GLY B 128 ? 0.8918 1.4793 1.1750 0.2788  0.2316  0.2911  128 GLY L CA  
2506 C C   . GLY B 128 ? 0.8685 1.3596 1.1291 0.2648  0.2296  0.2522  128 GLY L C   
2507 O O   . GLY B 128 ? 0.7876 1.2180 1.0643 0.2851  0.2623  0.2498  128 GLY L O   
2508 N N   . THR B 129 ? 1.0404 1.3223 0.8818 0.3633  -0.1146 -0.0996 129 THR L N   
2509 C CA  . THR B 129 ? 0.9735 1.1744 0.7930 0.3283  -0.0944 -0.0750 129 THR L CA  
2510 C C   . THR B 129 ? 0.8237 1.0477 0.7083 0.2708  -0.0914 -0.0833 129 THR L C   
2511 O O   . THR B 129 ? 0.8589 1.1473 0.7947 0.2572  -0.1058 -0.1076 129 THR L O   
2512 C CB  . THR B 129 ? 1.0089 1.1634 0.7749 0.3465  -0.0948 -0.0639 129 THR L CB  
2513 O OG1 . THR B 129 ? 1.1870 1.3219 0.8878 0.4068  -0.0966 -0.0566 129 THR L OG1 
2514 C CG2 . THR B 129 ? 1.0259 1.0968 0.7689 0.3142  -0.0707 -0.0382 129 THR L CG2 
2515 N N   . ALA B 130 ? 0.8286 0.9990 0.7100 0.2388  -0.0720 -0.0647 130 ALA L N   
2516 C CA  . ALA B 130 ? 0.7329 0.9144 0.6640 0.1902  -0.0661 -0.0683 130 ALA L CA  
2517 C C   . ALA B 130 ? 0.8155 0.9363 0.7243 0.1663  -0.0560 -0.0515 130 ALA L C   
2518 O O   . ALA B 130 ? 0.9053 0.9657 0.7749 0.1691  -0.0430 -0.0331 130 ALA L O   
2519 C CB  . ALA B 130 ? 0.7296 0.9164 0.6839 0.1753  -0.0536 -0.0652 130 ALA L CB  
2520 N N   . SER B 131 ? 0.6936 0.8318 0.6299 0.1426  -0.0613 -0.0599 131 SER L N   
2521 C CA  . SER B 131 ? 0.6943 0.7847 0.6158 0.1202  -0.0525 -0.0461 131 SER L CA  
2522 C C   . SER B 131 ? 0.6636 0.7641 0.6272 0.0806  -0.0459 -0.0487 131 SER L C   
2523 O O   . SER B 131 ? 0.6991 0.8399 0.7010 0.0669  -0.0521 -0.0648 131 SER L O   
2524 C CB  . SER B 131 ? 0.7234 0.8122 0.6247 0.1342  -0.0623 -0.0498 131 SER L CB  
2525 O OG  . SER B 131 ? 0.8860 0.9522 0.7359 0.1752  -0.0637 -0.0423 131 SER L OG  
2526 N N   . VAL B 132 ? 0.5470 0.6093 0.5019 0.0640  -0.0326 -0.0341 132 VAL L N   
2527 C CA  . VAL B 132 ? 0.6045 0.6683 0.5872 0.0334  -0.0248 -0.0331 132 VAL L CA  
2528 C C   . VAL B 132 ? 0.6320 0.6646 0.6024 0.0194  -0.0223 -0.0249 132 VAL L C   
2529 O O   . VAL B 132 ? 0.6304 0.6254 0.5719 0.0238  -0.0180 -0.0139 132 VAL L O   
2530 C CB  . VAL B 132 ? 0.5733 0.6222 0.5535 0.0279  -0.0140 -0.0253 132 VAL L CB  
2531 C CG1 . VAL B 132 ? 0.5477 0.6063 0.5551 0.0045  -0.0050 -0.0255 132 VAL L CG1 
2532 C CG2 . VAL B 132 ? 0.5931 0.6644 0.5744 0.0484  -0.0151 -0.0304 132 VAL L CG2 
2533 N N   . VAL B 133 ? 0.5959 0.6436 0.5902 0.0021  -0.0229 -0.0312 133 VAL L N   
2534 C CA  . VAL B 133 ? 0.5972 0.6208 0.5811 -0.0081 -0.0212 -0.0248 133 VAL L CA  
2535 C C   . VAL B 133 ? 0.6209 0.6343 0.6171 -0.0291 -0.0112 -0.0190 133 VAL L C   
2536 O O   . VAL B 133 ? 0.6403 0.6707 0.6610 -0.0401 -0.0058 -0.0246 133 VAL L O   
2537 C CB  . VAL B 133 ? 0.6041 0.6464 0.5955 -0.0055 -0.0309 -0.0372 133 VAL L CB  
2538 C CG1 . VAL B 133 ? 0.6087 0.6245 0.5858 -0.0131 -0.0278 -0.0293 133 VAL L CG1 
2539 C CG2 . VAL B 133 ? 0.5655 0.6208 0.5382 0.0227  -0.0428 -0.0440 133 VAL L CG2 
2540 N N   . CYS B 134 ? 0.6137 0.5995 0.5927 -0.0329 -0.0071 -0.0084 134 CYS L N   
2541 C CA  . CYS B 134 ? 0.6171 0.5948 0.6013 -0.0460 -0.0002 -0.0034 134 CYS L CA  
2542 C C   . CYS B 134 ? 0.6259 0.5944 0.6064 -0.0509 -0.0007 -0.0013 134 CYS L C   
2543 O O   . CYS B 134 ? 0.6837 0.6395 0.6502 -0.0461 -0.0023 0.0024  134 CYS L O   
2544 C CB  . CYS B 134 ? 0.7423 0.7054 0.7147 -0.0452 0.0026  0.0022  134 CYS L CB  
2545 S SG  . CYS B 134 ? 1.0301 0.9914 1.0036 -0.0512 0.0087  0.0062  134 CYS L SG  
2546 N N   . LEU B 135 ? 0.6106 0.5819 0.6019 -0.0596 0.0039  -0.0030 135 LEU L N   
2547 C CA  . LEU B 135 ? 0.6737 0.6359 0.6602 -0.0622 0.0038  -0.0021 135 LEU L CA  
2548 C C   . LEU B 135 ? 0.6379 0.5879 0.6177 -0.0648 0.0106  0.0065  135 LEU L C   
2549 O O   . LEU B 135 ? 0.6496 0.5970 0.6312 -0.0668 0.0183  0.0094  135 LEU L O   
2550 C CB  . LEU B 135 ? 0.5183 0.4893 0.5201 -0.0684 0.0039  -0.0137 135 LEU L CB  
2551 C CG  . LEU B 135 ? 0.5405 0.4975 0.5364 -0.0717 0.0065  -0.0140 135 LEU L CG  
2552 C CD1 . LEU B 135 ? 0.6707 0.6230 0.6483 -0.0612 -0.0014 -0.0120 135 LEU L CD1 
2553 C CD2 . LEU B 135 ? 0.5861 0.5488 0.6018 -0.0819 0.0091  -0.0294 135 LEU L CD2 
2554 N N   . LEU B 136 ? 0.6909 0.6345 0.6615 -0.0621 0.0090  0.0107  136 LEU L N   
2555 C CA  . LEU B 136 ? 0.6234 0.5630 0.5894 -0.0610 0.0130  0.0161  136 LEU L CA  
2556 C C   . LEU B 136 ? 0.5977 0.5294 0.5585 -0.0600 0.0151  0.0164  136 LEU L C   
2557 O O   . LEU B 136 ? 0.8462 0.7764 0.8027 -0.0576 0.0125  0.0159  136 LEU L O   
2558 C CB  . LEU B 136 ? 0.6784 0.6235 0.6450 -0.0598 0.0108  0.0173  136 LEU L CB  
2559 C CG  . LEU B 136 ? 0.6942 0.6461 0.6632 -0.0593 0.0084  0.0145  136 LEU L CG  
2560 C CD1 . LEU B 136 ? 0.7365 0.6847 0.7056 -0.0603 0.0068  0.0121  136 LEU L CD1 
2561 C CD2 . LEU B 136 ? 0.5979 0.5590 0.5746 -0.0611 0.0064  0.0101  136 LEU L CD2 
2562 N N   . ASN B 137 ? 0.5840 0.5059 0.5412 -0.0598 0.0220  0.0180  137 ASN L N   
2563 C CA  . ASN B 137 ? 0.7138 0.6230 0.6646 -0.0590 0.0250  0.0161  137 ASN L CA  
2564 C C   . ASN B 137 ? 0.7604 0.6617 0.6979 -0.0494 0.0306  0.0239  137 ASN L C   
2565 O O   . ASN B 137 ? 0.6835 0.5796 0.6135 -0.0432 0.0371  0.0296  137 ASN L O   
2566 C CB  . ASN B 137 ? 0.7114 0.6095 0.6699 -0.0678 0.0314  0.0080  137 ASN L CB  
2567 C CG  . ASN B 137 ? 0.9543 0.8351 0.9060 -0.0683 0.0345  0.0021  137 ASN L CG  
2568 O OD1 . ASN B 137 ? 1.1759 1.0597 1.1196 -0.0624 0.0268  -0.0003 137 ASN L OD1 
2569 N ND2 . ASN B 137 ? 0.9733 0.8318 0.9258 -0.0746 0.0485  -0.0002 137 ASN L ND2 
2570 N N   . ASN B 138 ? 0.7838 0.6850 0.7155 -0.0446 0.0288  0.0243  138 ASN L N   
2571 C CA  . ASN B 138 ? 0.7383 0.6349 0.6578 -0.0329 0.0341  0.0302  138 ASN L CA  
2572 C C   . ASN B 138 ? 0.6803 0.5952 0.6013 -0.0236 0.0334  0.0352  138 ASN L C   
2573 O O   . ASN B 138 ? 0.7992 0.7050 0.7077 -0.0144 0.0386  0.0394  138 ASN L O   
2574 C CB  . ASN B 138 ? 0.7481 0.6150 0.6530 -0.0307 0.0439  0.0299  138 ASN L CB  
2575 C CG  . ASN B 138 ? 0.8560 0.7094 0.7608 -0.0380 0.0422  0.0192  138 ASN L CG  
2576 O OD1 . ASN B 138 ? 0.8283 0.6932 0.7342 -0.0368 0.0341  0.0157  138 ASN L OD1 
2577 N ND2 . ASN B 138 ? 0.9879 0.8156 0.8906 -0.0448 0.0511  0.0128  138 ASN L ND2 
2578 N N   . PHE B 139 ? 0.6854 0.6256 0.6211 -0.0249 0.0281  0.0334  139 PHE L N   
2579 C CA  . PHE B 139 ? 0.7590 0.7260 0.7030 -0.0169 0.0241  0.0314  139 PHE L CA  
2580 C C   . PHE B 139 ? 0.7025 0.6959 0.6635 -0.0152 0.0242  0.0283  139 PHE L C   
2581 O O   . PHE B 139 ? 0.8524 0.8399 0.8177 -0.0216 0.0295  0.0301  139 PHE L O   
2582 C CB  . PHE B 139 ? 0.7213 0.6988 0.6769 -0.0254 0.0177  0.0258  139 PHE L CB  
2583 C CG  . PHE B 139 ? 0.6922 0.6708 0.6636 -0.0407 0.0171  0.0222  139 PHE L CG  
2584 C CD1 . PHE B 139 ? 0.6690 0.6685 0.6618 -0.0467 0.0172  0.0159  139 PHE L CD1 
2585 C CD2 . PHE B 139 ? 0.6626 0.6213 0.6278 -0.0478 0.0180  0.0240  139 PHE L CD2 
2586 C CE1 . PHE B 139 ? 0.5666 0.5568 0.5681 -0.0588 0.0221  0.0150  139 PHE L CE1 
2587 C CE2 . PHE B 139 ? 0.5903 0.5453 0.5615 -0.0554 0.0189  0.0227  139 PHE L CE2 
2588 C CZ  . PHE B 139 ? 0.5946 0.5603 0.5809 -0.0606 0.0228  0.0200  139 PHE L CZ  
2589 N N   . TYR B 140 ? 0.6942 0.7190 0.6649 -0.0044 0.0191  0.0226  140 TYR L N   
2590 C CA  . TYR B 140 ? 0.5892 0.6502 0.5868 -0.0044 0.0198  0.0154  140 TYR L CA  
2591 C C   . TYR B 140 ? 0.5649 0.6683 0.5816 0.0022  0.0083  0.0009  140 TYR L C   
2592 O O   . TYR B 140 ? 0.6786 0.7839 0.6736 0.0220  0.0012  0.0015  140 TYR L O   
2593 C CB  . TYR B 140 ? 0.6097 0.6699 0.5947 0.0120  0.0263  0.0223  140 TYR L CB  
2594 C CG  . TYR B 140 ? 0.6297 0.7270 0.6462 0.0098  0.0315  0.0160  140 TYR L CG  
2595 C CD1 . TYR B 140 ? 0.5917 0.6766 0.6171 -0.0039 0.0442  0.0206  140 TYR L CD1 
2596 C CD2 . TYR B 140 ? 0.5775 0.7244 0.6149 0.0236  0.0250  0.0048  140 TYR L CD2 
2597 C CE1 . TYR B 140 ? 0.6457 0.7625 0.7021 -0.0072 0.0545  0.0161  140 TYR L CE1 
2598 C CE2 . TYR B 140 ? 0.6210 0.8081 0.6958 0.0191  0.0320  -0.0034 140 TYR L CE2 
2599 C CZ  . TYR B 140 ? 0.7074 0.8772 0.7926 0.0021  0.0488  0.0033  140 TYR L CZ  
2600 O OH  . TYR B 140 ? 0.8459 1.0535 0.9701 -0.0034 0.0612  -0.0036 140 TYR L OH  
2601 N N   . PRO B 141 ? 0.5730 0.7097 0.6296 -0.0131 0.0075  -0.0135 141 PRO L N   
2602 C CA  . PRO B 141 ? 0.5891 0.7207 0.6699 -0.0341 0.0216  -0.0128 141 PRO L CA  
2603 C C   . PRO B 141 ? 0.6226 0.7143 0.6940 -0.0516 0.0273  -0.0066 141 PRO L C   
2604 O O   . PRO B 141 ? 0.6463 0.7176 0.6965 -0.0493 0.0195  -0.0037 141 PRO L O   
2605 C CB  . PRO B 141 ? 0.5151 0.6984 0.6449 -0.0440 0.0197  -0.0346 141 PRO L CB  
2606 C CG  . PRO B 141 ? 0.6665 0.8703 0.7948 -0.0360 0.0006  -0.0491 141 PRO L CG  
2607 C CD  . PRO B 141 ? 0.5817 0.7646 0.6624 -0.0090 -0.0065 -0.0344 141 PRO L CD  
2608 N N   . ARG B 142 ? 0.6318 0.7125 0.7176 -0.0662 0.0428  -0.0041 142 ARG L N   
2609 C CA  . ARG B 142 ? 0.7198 0.7599 0.7898 -0.0761 0.0504  0.0040  142 ARG L CA  
2610 C C   . ARG B 142 ? 0.7410 0.7795 0.8217 -0.0879 0.0444  -0.0069 142 ARG L C   
2611 O O   . ARG B 142 ? 0.7860 0.7941 0.8448 -0.0884 0.0432  -0.0007 142 ARG L O   
2612 C CB  . ARG B 142 ? 0.7242 0.7493 0.8012 -0.0838 0.0728  0.0111  142 ARG L CB  
2613 C CG  . ARG B 142 ? 0.8763 0.8558 0.9254 -0.0846 0.0818  0.0225  142 ARG L CG  
2614 C CD  . ARG B 142 ? 1.0271 0.9867 1.0744 -0.0861 0.1078  0.0325  142 ARG L CD  
2615 N NE  . ARG B 142 ? 1.1138 1.0285 1.1266 -0.0797 0.1166  0.0441  142 ARG L NE  
2616 C CZ  . ARG B 142 ? 1.1587 1.0490 1.1743 -0.0897 0.1297  0.0436  142 ARG L CZ  
2617 N NH1 . ARG B 142 ? 1.1412 1.0483 1.1974 -0.1109 0.1352  0.0294  142 ARG L NH1 
2618 N NH2 . ARG B 142 ? 1.2181 1.0673 1.1949 -0.0766 0.1370  0.0556  142 ARG L NH2 
2619 N N   . GLU B 143 ? 0.7305 0.8046 0.8454 -0.0960 0.0398  -0.0256 143 GLU L N   
2620 C CA  . GLU B 143 ? 0.6693 0.7428 0.7958 -0.1073 0.0339  -0.0401 143 GLU L CA  
2621 C C   . GLU B 143 ? 0.6594 0.7227 0.7551 -0.0939 0.0173  -0.0368 143 GLU L C   
2622 O O   . GLU B 143 ? 0.6947 0.7788 0.7802 -0.0774 0.0044  -0.0381 143 GLU L O   
2623 C CB  . GLU B 143 ? 0.7370 0.8597 0.9089 -0.1163 0.0280  -0.0667 143 GLU L CB  
2624 C CG  . GLU B 143 ? 0.9075 1.0414 1.1217 -0.1368 0.0495  -0.0744 143 GLU L CG  
2625 C CD  . GLU B 143 ? 1.0064 1.1641 1.2278 -0.1267 0.0561  -0.0661 143 GLU L CD  
2626 O OE1 . GLU B 143 ? 1.0203 1.1863 1.2139 -0.1035 0.0422  -0.0566 143 GLU L OE1 
2627 O OE2 . GLU B 143 ? 1.0624 1.2275 1.3163 -0.1417 0.0780  -0.0687 143 GLU L OE2 
2628 N N   . ALA B 144 ? 0.6178 0.6474 0.6969 -0.0988 0.0202  -0.0316 144 ALA L N   
2629 C CA  . ALA B 144 ? 0.6709 0.6904 0.7243 -0.0878 0.0087  -0.0281 144 ALA L CA  
2630 C C   . ALA B 144 ? 0.7959 0.7918 0.8453 -0.0959 0.0110  -0.0324 144 ALA L C   
2631 O O   . ALA B 144 ? 0.8613 0.8281 0.9057 -0.1025 0.0239  -0.0250 144 ALA L O   
2632 C CB  . ALA B 144 ? 0.5436 0.5440 0.5701 -0.0772 0.0103  -0.0101 144 ALA L CB  
2633 N N   . LYS B 145 ? 0.8465 0.8527 0.8932 -0.0913 -0.0007 -0.0438 145 LYS L N   
2634 C CA  . LYS B 145 ? 0.8659 0.8498 0.9066 -0.0964 0.0007  -0.0496 145 LYS L CA  
2635 C C   . LYS B 145 ? 0.8516 0.8206 0.8632 -0.0828 -0.0033 -0.0377 145 LYS L C   
2636 O O   . LYS B 145 ? 0.8894 0.8732 0.8899 -0.0701 -0.0120 -0.0372 145 LYS L O   
2637 C CB  . LYS B 145 ? 0.8213 0.8271 0.8806 -0.1011 -0.0093 -0.0750 145 LYS L CB  
2638 N N   . VAL B 146 ? 0.7967 0.7370 0.7956 -0.0835 0.0051  -0.0281 146 VAL L N   
2639 C CA  . VAL B 146 ? 0.6778 0.6102 0.6566 -0.0718 0.0025  -0.0197 146 VAL L CA  
2640 C C   . VAL B 146 ? 0.7396 0.6525 0.7092 -0.0703 0.0040  -0.0257 146 VAL L C   
2641 O O   . VAL B 146 ? 0.7769 0.6642 0.7444 -0.0755 0.0137  -0.0258 146 VAL L O   
2642 C CB  . VAL B 146 ? 0.7660 0.6891 0.7361 -0.0677 0.0075  -0.0059 146 VAL L CB  
2643 C CG1 . VAL B 146 ? 0.8399 0.7667 0.8000 -0.0579 0.0042  -0.0018 146 VAL L CG1 
2644 C CG2 . VAL B 146 ? 0.7874 0.7230 0.7643 -0.0696 0.0076  -0.0012 146 VAL L CG2 
2645 N N   . GLN B 147 ? 0.7496 0.6704 0.7099 -0.0610 -0.0028 -0.0296 147 GLN L N   
2646 C CA  . GLN B 147 ? 0.7934 0.6958 0.7418 -0.0566 -0.0019 -0.0361 147 GLN L CA  
2647 C C   . GLN B 147 ? 0.8149 0.7186 0.7481 -0.0421 -0.0014 -0.0264 147 GLN L C   
2648 O O   . GLN B 147 ? 0.8166 0.7393 0.7491 -0.0357 -0.0036 -0.0217 147 GLN L O   
2649 C CB  . GLN B 147 ? 0.7808 0.6928 0.7322 -0.0573 -0.0106 -0.0550 147 GLN L CB  
2650 C CG  . GLN B 147 ? 0.8632 0.7792 0.8386 -0.0743 -0.0108 -0.0715 147 GLN L CG  
2651 C CD  . GLN B 147 ? 0.9791 0.9136 0.9606 -0.0731 -0.0238 -0.0964 147 GLN L CD  
2652 O OE1 . GLN B 147 ? 0.9461 0.8937 0.9087 -0.0555 -0.0336 -0.0978 147 GLN L OE1 
2653 N NE2 . GLN B 147 ? 1.0468 0.9833 1.0552 -0.0913 -0.0229 -0.1177 147 GLN L NE2 
2654 N N   . TRP B 148 ? 0.7388 0.6217 0.6602 -0.0358 0.0039  -0.0237 148 TRP L N   
2655 C CA  . TRP B 148 ? 0.7464 0.6372 0.6588 -0.0211 0.0045  -0.0173 148 TRP L CA  
2656 C C   . TRP B 148 ? 0.9032 0.7888 0.8022 -0.0111 0.0034  -0.0245 148 TRP L C   
2657 O O   . TRP B 148 ? 1.0160 0.8759 0.9043 -0.0115 0.0046  -0.0335 148 TRP L O   
2658 C CB  . TRP B 148 ? 0.8140 0.6906 0.7170 -0.0123 0.0091  -0.0106 148 TRP L CB  
2659 C CG  . TRP B 148 ? 0.7304 0.6187 0.6424 -0.0154 0.0084  -0.0037 148 TRP L CG  
2660 C CD1 . TRP B 148 ? 0.5904 0.4622 0.5006 -0.0219 0.0128  -0.0004 148 TRP L CD1 
2661 C CD2 . TRP B 148 ? 0.8060 0.7246 0.7308 -0.0121 0.0044  -0.0014 148 TRP L CD2 
2662 N NE1 . TRP B 148 ? 0.7249 0.6142 0.6411 -0.0199 0.0095  0.0042  148 TRP L NE1 
2663 C CE2 . TRP B 148 ? 0.7068 0.6252 0.6340 -0.0154 0.0036  0.0019  148 TRP L CE2 
2664 C CE3 . TRP B 148 ? 0.7133 0.6588 0.6500 -0.0078 0.0036  -0.0032 148 TRP L CE3 
2665 C CZ2 . TRP B 148 ? 0.6153 0.5595 0.5562 -0.0150 -0.0009 0.0004  148 TRP L CZ2 
2666 C CZ3 . TRP B 148 ? 0.7521 0.7236 0.7076 -0.0105 0.0019  -0.0045 148 TRP L CZ3 
2667 C CH2 . TRP B 148 ? 0.7750 0.7457 0.7324 -0.0143 -0.0018 -0.0041 148 TRP L CH2 
2668 N N   . LYS B 149 ? 0.8201 0.7270 0.7190 -0.0022 0.0035  -0.0210 149 LYS L N   
2669 C CA  . LYS B 149 ? 0.8175 0.7212 0.7000 0.0114  0.0041  -0.0260 149 LYS L CA  
2670 C C   . LYS B 149 ? 0.8484 0.7664 0.7316 0.0248  0.0109  -0.0184 149 LYS L C   
2671 O O   . LYS B 149 ? 0.7838 0.7263 0.6828 0.0232  0.0161  -0.0114 149 LYS L O   
2672 C CB  . LYS B 149 ? 0.9311 0.8470 0.8081 0.0144  0.0011  -0.0296 149 LYS L CB  
2673 C CG  . LYS B 149 ? 0.9434 0.8551 0.8224 0.0050  -0.0088 -0.0431 149 LYS L CG  
2674 C CD  . LYS B 149 ? 0.8950 0.8221 0.7612 0.0168  -0.0141 -0.0479 149 LYS L CD  
2675 N N   . VAL B 150 ? 0.8399 0.7425 0.7078 0.0378  0.0122  -0.0213 150 VAL L N   
2676 C CA  . VAL B 150 ? 0.7532 0.6749 0.6233 0.0540  0.0178  -0.0168 150 VAL L CA  
2677 C C   . VAL B 150 ? 0.8606 0.7771 0.7111 0.0697  0.0218  -0.0205 150 VAL L C   
2678 O O   . VAL B 150 ? 0.9447 0.8306 0.7711 0.0778  0.0195  -0.0280 150 VAL L O   
2679 C CB  . VAL B 150 ? 0.7205 0.6313 0.5830 0.0651  0.0169  -0.0157 150 VAL L CB  
2680 C CG1 . VAL B 150 ? 0.7756 0.7156 0.6436 0.0851  0.0205  -0.0145 150 VAL L CG1 
2681 C CG2 . VAL B 150 ? 0.7186 0.6346 0.5951 0.0539  0.0132  -0.0121 150 VAL L CG2 
2682 N N   . ASP B 151 ? 0.9258 0.8688 0.7857 0.0744  0.0302  -0.0153 151 ASP L N   
2683 C CA  . ASP B 151 ? 0.9075 0.8465 0.7454 0.0913  0.0363  -0.0169 151 ASP L CA  
2684 C C   . ASP B 151 ? 0.8107 0.7225 0.6227 0.0907  0.0266  -0.0274 151 ASP L C   
2685 O O   . ASP B 151 ? 0.9584 0.8490 0.7444 0.1040  0.0235  -0.0371 151 ASP L O   
2686 C CB  . ASP B 151 ? 0.8985 0.8347 0.7241 0.1120  0.0396  -0.0189 151 ASP L CB  
2687 C CG  . ASP B 151 ? 0.9450 0.9227 0.7988 0.1184  0.0506  -0.0123 151 ASP L CG  
2688 O OD1 . ASP B 151 ? 0.8850 0.8892 0.7652 0.1069  0.0603  -0.0065 151 ASP L OD1 
2689 O OD2 . ASP B 151 ? 0.9208 0.9051 0.7716 0.1356  0.0507  -0.0143 151 ASP L OD2 
2690 N N   . ASN B 152 ? 0.8381 0.7531 0.6587 0.0761  0.0212  -0.0277 152 ASN L N   
2691 C CA  . ASN B 152 ? 0.9396 0.8412 0.7440 0.0747  0.0092  -0.0416 152 ASN L CA  
2692 C C   . ASN B 152 ? 1.0031 0.8767 0.8022 0.0676  -0.0002 -0.0582 152 ASN L C   
2693 O O   . ASN B 152 ? 1.2338 1.0952 1.0167 0.0717  -0.0093 -0.0763 152 ASN L O   
2694 C CB  . ASN B 152 ? 0.9270 0.8306 0.7018 0.0974  0.0115  -0.0442 152 ASN L CB  
2695 C CG  . ASN B 152 ? 1.0184 0.9405 0.7947 0.1048  0.0276  -0.0260 152 ASN L CG  
2696 O OD1 . ASN B 152 ? 1.1139 1.0427 0.8941 0.0994  0.0273  -0.0213 152 ASN L OD1 
2697 N ND2 . ASN B 152 ? 1.0300 0.9587 0.8035 0.1177  0.0443  -0.0157 152 ASN L ND2 
2698 N N   . ALA B 153 ? 0.9701 0.8319 0.7817 0.0579  0.0032  -0.0532 153 ALA L N   
2699 C CA  . ALA B 153 ? 0.9674 0.7935 0.7733 0.0497  0.0014  -0.0654 153 ALA L CA  
2700 C C   . ALA B 153 ? 0.8675 0.6897 0.6952 0.0288  0.0022  -0.0616 153 ALA L C   
2701 O O   . ALA B 153 ? 0.8563 0.6899 0.6941 0.0287  0.0067  -0.0466 153 ALA L O   
2702 C CB  . ALA B 153 ? 0.9013 0.7038 0.6878 0.0664  0.0097  -0.0613 153 ALA L CB  
2703 N N   . LEU B 154 ? 0.8465 0.6555 0.6831 0.0117  -0.0021 -0.0773 154 LEU L N   
2704 C CA  . LEU B 154 ? 0.8712 0.6766 0.7293 -0.0083 0.0013  -0.0745 154 LEU L CA  
2705 C C   . LEU B 154 ? 0.9561 0.7240 0.8043 -0.0074 0.0152  -0.0647 154 LEU L C   
2706 O O   . LEU B 154 ? 1.0736 0.8011 0.9049 -0.0048 0.0232  -0.0727 154 LEU L O   
2707 C CB  . LEU B 154 ? 0.9248 0.7300 0.8007 -0.0272 -0.0049 -0.0974 154 LEU L CB  
2708 N N   . GLN B 155 ? 0.9627 0.7411 0.8175 -0.0070 0.0189  -0.0480 155 GLN L N   
2709 C CA  . GLN B 155 ? 1.0331 0.7782 0.8716 0.0009  0.0316  -0.0366 155 GLN L CA  
2710 C C   . GLN B 155 ? 0.9864 0.7009 0.8332 -0.0186 0.0437  -0.0392 155 GLN L C   
2711 O O   . GLN B 155 ? 0.9972 0.7300 0.8707 -0.0392 0.0393  -0.0487 155 GLN L O   
2712 C CB  . GLN B 155 ? 1.0128 0.7871 0.8527 0.0141  0.0281  -0.0210 155 GLN L CB  
2713 C CG  . GLN B 155 ? 1.0666 0.8763 0.9079 0.0295  0.0203  -0.0195 155 GLN L CG  
2714 C CD  . GLN B 155 ? 1.1335 0.9217 0.9495 0.0496  0.0244  -0.0224 155 GLN L CD  
2715 O OE1 . GLN B 155 ? 1.1366 0.8917 0.9286 0.0644  0.0326  -0.0179 155 GLN L OE1 
2716 N NE2 . GLN B 155 ? 1.1763 0.9799 0.9926 0.0535  0.0202  -0.0291 155 GLN L NE2 
2717 N N   . SER B 156 ? 1.0438 0.7117 0.8668 -0.0097 0.0609  -0.0302 156 SER L N   
2718 C CA  . SER B 156 ? 1.0984 0.7286 0.9266 -0.0273 0.0800  -0.0300 156 SER L CA  
2719 C C   . SER B 156 ? 1.1884 0.7713 0.9792 -0.0062 0.1000  -0.0109 156 SER L C   
2720 O O   . SER B 156 ? 1.2611 0.8122 1.0174 0.0173  0.1062  -0.0062 156 SER L O   
2721 C CB  . SER B 156 ? 1.0702 0.6698 0.9102 -0.0486 0.0885  -0.0522 156 SER L CB  
2722 N N   . GLY B 157 ? 1.2050 0.7828 0.9987 -0.0108 0.1105  0.0006  157 GLY L N   
2723 C CA  . GLY B 157 ? 1.2718 0.7998 1.0245 0.0119  0.1324  0.0196  157 GLY L CA  
2724 C C   . GLY B 157 ? 1.2932 0.8451 1.0169 0.0490  0.1189  0.0333  157 GLY L C   
2725 O O   . GLY B 157 ? 1.4210 0.9344 1.1016 0.0778  0.1337  0.0485  157 GLY L O   
2726 N N   . ASN B 158 ? 1.1292 0.7451 0.8765 0.0498  0.0919  0.0266  158 ASN L N   
2727 C CA  . ASN B 158 ? 1.1093 0.7598 0.8417 0.0805  0.0769  0.0330  158 ASN L CA  
2728 C C   . ASN B 158 ? 0.9934 0.6996 0.7560 0.0704  0.0599  0.0311  158 ASN L C   
2729 O O   . ASN B 158 ? 0.8058 0.5586 0.5771 0.0837  0.0425  0.0275  158 ASN L O   
2730 C CB  . ASN B 158 ? 1.1312 0.8049 0.8633 0.0946  0.0645  0.0255  158 ASN L CB  
2731 C CG  . ASN B 158 ? 1.2056 0.9169 0.9767 0.0685  0.0518  0.0125  158 ASN L CG  
2732 O OD1 . ASN B 158 ? 1.0887 0.7984 0.8827 0.0403  0.0535  0.0068  158 ASN L OD1 
2733 N ND2 . ASN B 158 ? 1.3203 1.0672 1.0979 0.0806  0.0400  0.0078  158 ASN L ND2 
2734 N N   . SER B 159 ? 0.9899 0.6911 0.7704 0.0465  0.0664  0.0321  159 SER L N   
2735 C CA  . SER B 159 ? 0.8587 0.6045 0.6644 0.0366  0.0528  0.0305  159 SER L CA  
2736 C C   . SER B 159 ? 0.8527 0.5762 0.6513 0.0316  0.0666  0.0394  159 SER L C   
2737 O O   . SER B 159 ? 0.8563 0.5386 0.6510 0.0197  0.0876  0.0429  159 SER L O   
2738 C CB  . SER B 159 ? 0.8467 0.6267 0.6912 0.0102  0.0417  0.0194  159 SER L CB  
2739 O OG  . SER B 159 ? 0.8914 0.6498 0.7490 -0.0125 0.0525  0.0148  159 SER L OG  
2740 N N   . GLN B 160 ? 0.8495 0.6007 0.6483 0.0403  0.0562  0.0416  160 GLN L N   
2741 C CA  . GLN B 160 ? 0.8553 0.5913 0.6472 0.0377  0.0679  0.0499  160 GLN L CA  
2742 C C   . GLN B 160 ? 0.8345 0.6141 0.6584 0.0210  0.0530  0.0431  160 GLN L C   
2743 O O   . GLN B 160 ? 0.7570 0.5757 0.5977 0.0209  0.0340  0.0341  160 GLN L O   
2744 C CB  . GLN B 160 ? 0.7871 0.5023 0.5324 0.0740  0.0729  0.0606  160 GLN L CB  
2745 C CG  . GLN B 160 ? 0.9456 0.6022 0.6483 0.0948  0.0957  0.0724  160 GLN L CG  
2746 C CD  . GLN B 160 ? 1.1811 0.8143 0.8290 0.1374  0.1022  0.0850  160 GLN L CD  
2747 O OE1 . GLN B 160 ? 1.2304 0.9046 0.8724 0.1582  0.0797  0.0785  160 GLN L OE1 
2748 N NE2 . GLN B 160 ? 1.2677 0.8332 0.8736 0.1518  0.1342  0.1018  160 GLN L NE2 
2749 N N   . GLU B 161 ? 0.8134 0.5842 0.6460 0.0072  0.0645  0.0475  161 GLU L N   
2750 C CA  . GLU B 161 ? 0.8022 0.6078 0.6601 -0.0059 0.0531  0.0424  161 GLU L CA  
2751 C C   . GLU B 161 ? 0.8129 0.6060 0.6567 0.0004  0.0642  0.0513  161 GLU L C   
2752 O O   . GLU B 161 ? 0.7498 0.5052 0.5711 0.0081  0.0859  0.0623  161 GLU L O   
2753 C CB  . GLU B 161 ? 0.8195 0.6407 0.7132 -0.0326 0.0521  0.0346  161 GLU L CB  
2754 C CG  . GLU B 161 ? 0.9237 0.7233 0.8286 -0.0481 0.0723  0.0363  161 GLU L CG  
2755 C CD  . GLU B 161 ? 1.0800 0.9070 1.0220 -0.0701 0.0661  0.0237  161 GLU L CD  
2756 O OE1 . GLU B 161 ? 0.9944 0.8441 0.9445 -0.0709 0.0496  0.0159  161 GLU L OE1 
2757 O OE2 . GLU B 161 ? 1.1650 0.9929 1.1278 -0.0845 0.0784  0.0208  161 GLU L OE2 
2758 N N   . SER B 162 ? 0.7301 0.5510 0.5848 -0.0019 0.0519  0.0469  162 SER L N   
2759 C CA  . SER B 162 ? 0.7957 0.6085 0.6383 0.0041  0.0611  0.0539  162 SER L CA  
2760 C C   . SER B 162 ? 0.6821 0.5243 0.5515 -0.0109 0.0514  0.0472  162 SER L C   
2761 O O   . SER B 162 ? 0.6758 0.5425 0.5603 -0.0162 0.0346  0.0375  162 SER L O   
2762 C CB  . SER B 162 ? 0.7677 0.5730 0.5708 0.0349  0.0556  0.0562  162 SER L CB  
2763 O OG  . SER B 162 ? 0.8164 0.6566 0.6295 0.0378  0.0314  0.0418  162 SER L OG  
2764 N N   . VAL B 163 ? 0.7075 0.5450 0.5820 -0.0163 0.0649  0.0531  163 VAL L N   
2765 C CA  . VAL B 163 ? 0.6991 0.5609 0.5946 -0.0264 0.0582  0.0484  163 VAL L CA  
2766 C C   . VAL B 163 ? 0.7113 0.5681 0.5853 -0.0115 0.0603  0.0523  163 VAL L C   
2767 O O   . VAL B 163 ? 0.7588 0.5936 0.6107 0.0005  0.0768  0.0624  163 VAL L O   
2768 C CB  . VAL B 163 ? 0.8219 0.6939 0.7487 -0.0450 0.0696  0.0478  163 VAL L CB  
2769 C CG1 . VAL B 163 ? 0.8043 0.7036 0.7485 -0.0495 0.0603  0.0426  163 VAL L CG1 
2770 C CG2 . VAL B 163 ? 0.6719 0.5450 0.6160 -0.0578 0.0681  0.0413  163 VAL L CG2 
2771 N N   . THR B 164 ? 0.5463 0.4065 0.4965 0.0295  -0.0185 0.0721  164 THR L N   
2772 C CA  . THR B 164 ? 0.6537 0.5136 0.5810 0.0509  -0.0161 0.0772  164 THR L CA  
2773 C C   . THR B 164 ? 0.7911 0.6558 0.7442 0.0526  -0.0023 0.0895  164 THR L C   
2774 O O   . THR B 164 ? 0.7417 0.6176 0.7339 0.0328  -0.0025 0.0885  164 THR L O   
2775 C CB  . THR B 164 ? 0.6002 0.4626 0.5049 0.0473  -0.0391 0.0612  164 THR L CB  
2776 O OG1 . THR B 164 ? 0.6926 0.5582 0.6162 0.0283  -0.0488 0.0566  164 THR L OG1 
2777 C CG2 . THR B 164 ? 0.6611 0.5287 0.5515 0.0423  -0.0521 0.0476  164 THR L CG2 
2778 N N   . GLU B 165 ? 0.7977 0.6577 0.7291 0.0781  0.0091  0.0995  165 GLU L N   
2779 C CA  . GLU B 165 ? 0.7399 0.6094 0.6945 0.0840  0.0233  0.1120  165 GLU L CA  
2780 C C   . GLU B 165 ? 0.8062 0.6856 0.7643 0.0745  0.0023  0.1008  165 GLU L C   
2781 O O   . GLU B 165 ? 0.8773 0.7483 0.8126 0.0658  -0.0192 0.0853  165 GLU L O   
2782 C CB  . GLU B 165 ? 0.6465 0.5046 0.5673 0.1196  0.0425  0.1264  165 GLU L CB  
2783 C CG  . GLU B 165 ? 0.7922 0.6359 0.7022 0.1372  0.0691  0.1427  165 GLU L CG  
2784 N N   . GLN B 166 ? 0.7923 0.6900 0.7798 0.0777  0.0110  0.1098  166 GLN L N   
2785 C CA  . GLN B 166 ? 0.8350 0.7410 0.8211 0.0763  -0.0061 0.1026  166 GLN L CA  
2786 C C   . GLN B 166 ? 0.8291 0.7063 0.7586 0.0960  -0.0135 0.0971  166 GLN L C   
2787 O O   . GLN B 166 ? 0.8516 0.7172 0.7552 0.1211  0.0002  0.1052  166 GLN L O   
2788 C CB  . GLN B 166 ? 0.8348 0.7741 0.8653 0.0821  0.0060  0.1143  166 GLN L CB  
2789 C CG  . GLN B 166 ? 0.8074 0.7642 0.8454 0.0801  -0.0135 0.1067  166 GLN L CG  
2790 C CD  . GLN B 166 ? 0.7463 0.7530 0.8442 0.0810  -0.0061 0.1140  166 GLN L CD  
2791 O OE1 . GLN B 166 ? 0.6272 0.6513 0.7567 0.0878  0.0188  0.1282  166 GLN L OE1 
2792 N NE2 . GLN B 166 ? 0.7161 0.7490 0.8308 0.0758  -0.0269 0.1043  166 GLN L NE2 
2793 N N   . ASP B 167 ? 0.8472 0.7094 0.7559 0.0847  -0.0335 0.0827  167 ASP L N   
2794 C CA  . ASP B 167 ? 0.9709 0.7994 0.8295 0.0954  -0.0412 0.0723  167 ASP L CA  
2795 C C   . ASP B 167 ? 1.2066 1.0248 1.0449 0.1236  -0.0312 0.0810  167 ASP L C   
2796 O O   . ASP B 167 ? 1.2273 1.0671 1.0916 0.1311  -0.0246 0.0929  167 ASP L O   
2797 C CB  . ASP B 167 ? 0.9568 0.7689 0.8048 0.0757  -0.0577 0.0590  167 ASP L CB  
2798 C CG  . ASP B 167 ? 1.1431 0.9163 0.9463 0.0785  -0.0639 0.0445  167 ASP L CG  
2799 O OD1 . ASP B 167 ? 1.2042 0.9514 0.9834 0.0905  -0.0619 0.0454  167 ASP L OD1 
2800 O OD2 . ASP B 167 ? 1.2378 1.0068 1.0309 0.0690  -0.0707 0.0309  167 ASP L OD2 
2801 N N   . SER B 168 ? 1.3112 1.0990 1.1028 0.1408  -0.0312 0.0731  168 SER L N   
2802 C CA  . SER B 168 ? 1.3313 1.1022 1.0937 0.1724  -0.0200 0.0802  168 SER L CA  
2803 C C   . SER B 168 ? 1.3637 1.1101 1.1087 0.1744  -0.0259 0.0767  168 SER L C   
2804 O O   . SER B 168 ? 1.5049 1.2488 1.2402 0.2009  -0.0147 0.0884  168 SER L O   
2805 C CB  . SER B 168 ? 1.3510 1.0928 1.0615 0.1919  -0.0210 0.0682  168 SER L CB  
2806 O OG  . SER B 168 ? 1.3688 1.0829 1.0541 0.1726  -0.0412 0.0423  168 SER L OG  
2807 N N   . LYS B 169 ? 1.2973 1.0243 1.0365 0.1493  -0.0406 0.0627  169 LYS L N   
2808 C CA  . LYS B 169 ? 1.2581 0.9494 0.9712 0.1528  -0.0425 0.0604  169 LYS L CA  
2809 C C   . LYS B 169 ? 1.2316 0.9506 0.9767 0.1465  -0.0454 0.0718  169 LYS L C   
2810 O O   . LYS B 169 ? 1.3998 1.1301 1.1471 0.1700  -0.0394 0.0851  169 LYS L O   
2811 C CB  . LYS B 169 ? 1.2382 0.8826 0.9202 0.1310  -0.0520 0.0383  169 LYS L CB  
2812 C CG  . LYS B 169 ? 1.2629 0.8792 0.9089 0.1387  -0.0544 0.0200  169 LYS L CG  
2813 C CD  . LYS B 169 ? 1.2837 0.8602 0.9113 0.1112  -0.0643 -0.0058 169 LYS L CD  
2814 N N   . ASP B 170 ? 1.1289 0.8617 0.8968 0.1182  -0.0555 0.0657  170 ASP L N   
2815 C CA  . ASP B 170 ? 0.9646 0.7199 0.7538 0.1135  -0.0617 0.0722  170 ASP L CA  
2816 C C   . ASP B 170 ? 0.8300 0.6473 0.6751 0.1106  -0.0636 0.0796  170 ASP L C   
2817 O O   . ASP B 170 ? 0.9462 0.7920 0.8135 0.1090  -0.0722 0.0817  170 ASP L O   
2818 C CB  . ASP B 170 ? 0.9961 0.7309 0.7767 0.0870  -0.0695 0.0619  170 ASP L CB  
2819 C CG  . ASP B 170 ? 1.2200 0.9674 1.0191 0.0626  -0.0736 0.0511  170 ASP L CG  
2820 O OD1 . ASP B 170 ? 1.1082 0.8955 0.9431 0.0589  -0.0745 0.0547  170 ASP L OD1 
2821 O OD2 . ASP B 170 ? 1.4554 1.1729 1.2346 0.0476  -0.0747 0.0385  170 ASP L OD2 
2822 N N   . SER B 171 ? 0.7099 0.5454 0.5756 0.1107  -0.0548 0.0826  171 SER L N   
2823 C CA  . SER B 171 ? 0.7452 0.6322 0.6673 0.1053  -0.0499 0.0900  171 SER L CA  
2824 C C   . SER B 171 ? 0.7613 0.6686 0.7140 0.0778  -0.0625 0.0812  171 SER L C   
2825 O O   . SER B 171 ? 0.9393 0.8880 0.9358 0.0728  -0.0670 0.0818  171 SER L O   
2826 C CB  . SER B 171 ? 0.7598 0.6829 0.7080 0.1270  -0.0447 0.1015  171 SER L CB  
2827 N N   . THR B 172 ? 0.7761 0.6567 0.7067 0.0607  -0.0687 0.0712  172 THR L N   
2828 C CA  . THR B 172 ? 0.7562 0.6497 0.7076 0.0377  -0.0787 0.0628  172 THR L CA  
2829 C C   . THR B 172 ? 0.7457 0.6386 0.7086 0.0253  -0.0713 0.0609  172 THR L C   
2830 O O   . THR B 172 ? 0.7692 0.6511 0.7186 0.0361  -0.0601 0.0657  172 THR L O   
2831 C CB  . THR B 172 ? 0.8116 0.6775 0.7290 0.0299  -0.0895 0.0546  172 THR L CB  
2832 O OG1 . THR B 172 ? 0.7307 0.5611 0.6143 0.0284  -0.0852 0.0503  172 THR L OG1 
2833 C CG2 . THR B 172 ? 0.6101 0.4733 0.5114 0.0462  -0.0951 0.0588  172 THR L CG2 
2834 N N   . TYR B 173 ? 0.7187 0.6215 0.7010 0.0068  -0.0773 0.0539  173 TYR L N   
2835 C CA  . TYR B 173 ? 0.6021 0.5003 0.5911 -0.0019 -0.0692 0.0531  173 TYR L CA  
2836 C C   . TYR B 173 ? 0.7558 0.6383 0.7210 -0.0128 -0.0785 0.0429  173 TYR L C   
2837 O O   . TYR B 173 ? 0.7541 0.6305 0.7051 -0.0180 -0.0895 0.0370  173 TYR L O   
2838 C CB  . TYR B 173 ? 0.4760 0.3944 0.5101 -0.0142 -0.0635 0.0532  173 TYR L CB  
2839 C CG  . TYR B 173 ? 0.7029 0.6439 0.7735 -0.0072 -0.0498 0.0638  173 TYR L CG  
2840 C CD1 . TYR B 173 ? 0.6217 0.5945 0.7218 -0.0079 -0.0594 0.0607  173 TYR L CD1 
2841 C CD2 . TYR B 173 ? 0.7396 0.6735 0.8153 0.0030  -0.0256 0.0778  173 TYR L CD2 
2842 C CE1 . TYR B 173 ? 0.5911 0.5935 0.7330 -0.0019 -0.0454 0.0702  173 TYR L CE1 
2843 C CE2 . TYR B 173 ? 0.8372 0.7931 0.9496 0.0095  -0.0079 0.0899  173 TYR L CE2 
2844 C CZ  . TYR B 173 ? 0.7946 0.7875 0.9443 0.0052  -0.0179 0.0856  173 TYR L CZ  
2845 O OH  . TYR B 173 ? 0.7683 0.7916 0.9627 0.0113  0.0011  0.0975  173 TYR L OH  
2846 N N   . SER B 174 ? 0.5884 0.4654 0.5484 -0.0131 -0.0718 0.0426  174 SER L N   
2847 C CA  . SER B 174 ? 0.4998 0.3712 0.4454 -0.0223 -0.0783 0.0336  174 SER L CA  
2848 C C   . SER B 174 ? 0.6093 0.4820 0.5657 -0.0234 -0.0695 0.0351  174 SER L C   
2849 O O   . SER B 174 ? 0.6949 0.5655 0.6557 -0.0119 -0.0556 0.0443  174 SER L O   
2850 C CB  . SER B 174 ? 0.6229 0.4873 0.5424 -0.0169 -0.0817 0.0282  174 SER L CB  
2851 O OG  . SER B 174 ? 0.5975 0.4492 0.5030 -0.0187 -0.0874 0.0254  174 SER L OG  
2852 N N   . LEU B 175 ? 0.5842 0.4557 0.5401 -0.0342 -0.0747 0.0277  175 LEU L N   
2853 C CA  . LEU B 175 ? 0.6509 0.5163 0.6124 -0.0339 -0.0653 0.0285  175 LEU L CA  
2854 C C   . LEU B 175 ? 0.7930 0.6613 0.7357 -0.0307 -0.0678 0.0235  175 LEU L C   
2855 O O   . LEU B 175 ? 0.7530 0.6270 0.6876 -0.0385 -0.0774 0.0166  175 LEU L O   
2856 C CB  . LEU B 175 ? 0.4954 0.3566 0.4772 -0.0482 -0.0680 0.0221  175 LEU L CB  
2857 C CG  . LEU B 175 ? 0.6717 0.5159 0.6642 -0.0508 -0.0544 0.0221  175 LEU L CG  
2858 C CD1 . LEU B 175 ? 0.6944 0.5398 0.7210 -0.0673 -0.0563 0.0142  175 LEU L CD1 
2859 C CD2 . LEU B 175 ? 0.8116 0.6458 0.7826 -0.0497 -0.0567 0.0150  175 LEU L CD2 
2860 N N   . SER B 176 ? 0.7270 0.5918 0.6631 -0.0172 -0.0566 0.0284  176 SER L N   
2861 C CA  . SER B 176 ? 0.6678 0.5437 0.5902 -0.0097 -0.0581 0.0241  176 SER L CA  
2862 C C   . SER B 176 ? 0.7891 0.6472 0.7076 -0.0024 -0.0451 0.0277  176 SER L C   
2863 O O   . SER B 176 ? 0.9779 0.8219 0.8904 0.0141  -0.0298 0.0379  176 SER L O   
2864 C CB  . SER B 176 ? 0.7619 0.6574 0.6719 0.0086  -0.0601 0.0247  176 SER L CB  
2865 O OG  . SER B 176 ? 0.6204 0.5366 0.5235 0.0188  -0.0617 0.0200  176 SER L OG  
2866 N N   . SER B 177 ? 0.7448 0.5983 0.6618 -0.0122 -0.0488 0.0200  177 SER L N   
2867 C CA  . SER B 177 ? 0.7853 0.6151 0.6936 -0.0051 -0.0367 0.0206  177 SER L CA  
2868 C C   . SER B 177 ? 0.8033 0.6507 0.6949 0.0122  -0.0346 0.0205  177 SER L C   
2869 O O   . SER B 177 ? 0.7915 0.6625 0.6839 0.0056  -0.0440 0.0139  177 SER L O   
2870 C CB  . SER B 177 ? 0.7651 0.5756 0.6786 -0.0237 -0.0424 0.0095  177 SER L CB  
2871 O OG  . SER B 177 ? 0.7855 0.5650 0.6876 -0.0178 -0.0301 0.0071  177 SER L OG  
2872 N N   . THR B 178 ? 0.8154 0.6518 0.6923 0.0362  -0.0197 0.0293  178 THR L N   
2873 C CA  . THR B 178 ? 0.8109 0.6714 0.6734 0.0590  -0.0174 0.0301  178 THR L CA  
2874 C C   . THR B 178 ? 0.8143 0.6399 0.6577 0.0701  -0.0025 0.0314  178 THR L C   
2875 O O   . THR B 178 ? 0.7525 0.5331 0.5845 0.0783  0.0149  0.0387  178 THR L O   
2876 C CB  . THR B 178 ? 0.7056 0.5874 0.5569 0.0893  -0.0137 0.0389  178 THR L CB  
2877 O OG1 . THR B 178 ? 0.7548 0.6704 0.6200 0.0803  -0.0301 0.0331  178 THR L OG1 
2878 C CG2 . THR B 178 ? 0.6428 0.5565 0.4817 0.1173  -0.0121 0.0390  178 THR L CG2 
2879 N N   . LEU B 179 ? 0.8730 0.7158 0.7123 0.0704  -0.0064 0.0246  179 LEU L N   
2880 C CA  . LEU B 179 ? 0.8531 0.6641 0.6683 0.0857  0.0076  0.0247  179 LEU L CA  
2881 C C   . LEU B 179 ? 0.7889 0.6272 0.5891 0.1233  0.0171  0.0336  179 LEU L C   
2882 O O   . LEU B 179 ? 0.7653 0.6603 0.5779 0.1290  0.0086  0.0308  179 LEU L O   
2883 C CB  . LEU B 179 ? 0.9159 0.7279 0.7289 0.0704  0.0005  0.0134  179 LEU L CB  
2884 C CG  . LEU B 179 ? 0.8800 0.6559 0.6623 0.0871  0.0139  0.0105  179 LEU L CG  
2885 C CD1 . LEU B 179 ? 0.9558 0.6637 0.7258 0.0784  0.0218  0.0045  179 LEU L CD1 
2886 C CD2 . LEU B 179 ? 0.9089 0.6991 0.6850 0.0798  0.0077  0.0022  179 LEU L CD2 
2887 N N   . THR B 180 ? 0.7922 0.5911 0.5670 0.1498  0.0362  0.0446  180 THR L N   
2888 C CA  . THR B 180 ? 0.9432 0.7673 0.6975 0.1939  0.0457  0.0551  180 THR L CA  
2889 C C   . THR B 180 ? 0.9898 0.7842 0.7147 0.2164  0.0624  0.0566  180 THR L C   
2890 O O   . THR B 180 ? 1.0976 0.8182 0.7983 0.2161  0.0803  0.0582  180 THR L O   
2891 C CB  . THR B 180 ? 0.9379 0.7362 0.6718 0.2209  0.0604  0.0710  180 THR L CB  
2892 O OG1 . THR B 180 ? 0.9963 0.8211 0.7526 0.2039  0.0457  0.0694  180 THR L OG1 
2893 C CG2 . THR B 180 ? 0.9090 0.7411 0.6172 0.2736  0.0670  0.0815  180 THR L CG2 
2894 N N   . LEU B 181 ? 0.8482 0.7007 0.5774 0.2354  0.0575  0.0549  181 LEU L N   
2895 C CA  . LEU B 181 ? 0.9152 0.7483 0.6147 0.2637  0.0742  0.0577  181 LEU L CA  
2896 C C   . LEU B 181 ? 0.9428 0.8435 0.6403 0.3093  0.0760  0.0660  181 LEU L C   
2897 O O   . LEU B 181 ? 0.9477 0.9261 0.6788 0.3080  0.0577  0.0623  181 LEU L O   
2898 C CB  . LEU B 181 ? 0.8415 0.6778 0.5498 0.2383  0.0684  0.0451  181 LEU L CB  
2899 C CG  . LEU B 181 ? 0.9978 0.7707 0.7019 0.2000  0.0643  0.0333  181 LEU L CG  
2900 C CD1 . LEU B 181 ? 1.0495 0.8376 0.7567 0.1836  0.0571  0.0227  181 LEU L CD1 
2901 C CD2 . LEU B 181 ? 1.1373 0.8212 0.8031 0.2109  0.0840  0.0337  181 LEU L CD2 
2902 N N   . SER B 182 ? 0.9412 0.8131 0.5995 0.3509  0.0972  0.0752  182 SER L N   
2903 C CA  . SER B 182 ? 0.9938 0.9357 0.6497 0.4000  0.0992  0.0828  182 SER L CA  
2904 C C   . SER B 182 ? 1.0337 1.0582 0.7314 0.3869  0.0873  0.0722  182 SER L C   
2905 O O   . SER B 182 ? 0.9610 0.9667 0.6706 0.3497  0.0854  0.0632  182 SER L O   
2906 C CB  . SER B 182 ? 1.2004 1.0811 0.7976 0.4515  0.1286  0.0972  182 SER L CB  
2907 O OG  . SER B 182 ? 1.3440 1.1683 0.9209 0.4398  0.1417  0.0910  182 SER L OG  
2908 N N   . LYS B 183 ? 1.0474 1.1656 0.7683 0.4187  0.0804  0.0734  183 LYS L N   
2909 C CA  . LYS B 183 ? 1.0550 1.2605 0.8252 0.4063  0.0735  0.0644  183 LYS L CA  
2910 C C   . LYS B 183 ? 0.9557 1.1260 0.6996 0.4182  0.0962  0.0692  183 LYS L C   
2911 O O   . LYS B 183 ? 0.9715 1.1640 0.7429 0.3889  0.0967  0.0628  183 LYS L O   
2912 C CB  . LYS B 183 ? 1.0705 1.3888 0.8738 0.4426  0.0619  0.0626  183 LYS L CB  
2913 C CG  . LYS B 183 ? 1.0150 1.4340 0.8829 0.4261  0.0570  0.0523  183 LYS L CG  
2914 C CD  . LYS B 183 ? 1.1234 1.6581 1.0237 0.4697  0.0471  0.0490  183 LYS L CD  
2915 C CE  . LYS B 183 ? 1.0875 1.7273 1.0638 0.4482  0.0457  0.0380  183 LYS L CE  
2916 N NZ  . LYS B 183 ? 1.0734 1.7387 1.1085 0.3823  0.0281  0.0203  183 LYS L NZ  
2917 N N   . ALA B 184 ? 0.9752 1.0841 0.6604 0.4639  0.1175  0.0812  184 ALA L N   
2918 C CA  . ALA B 184 ? 1.1726 1.2387 0.8214 0.4832  0.1404  0.0849  184 ALA L CA  
2919 C C   . ALA B 184 ? 1.3347 1.3149 0.9643 0.4389  0.1420  0.0749  184 ALA L C   
2920 O O   . ALA B 184 ? 1.3487 1.3332 0.9784 0.4304  0.1486  0.0707  184 ALA L O   
2921 C CB  . ALA B 184 ? 1.1656 1.1731 0.7501 0.5432  0.1639  0.0993  184 ALA L CB  
2922 N N   . ASP B 185 ? 1.3450 1.2509 0.9583 0.4132  0.1364  0.0711  185 ASP L N   
2923 C CA  . ASP B 185 ? 1.3212 1.1509 0.9191 0.3723  0.1336  0.0583  185 ASP L CA  
2924 C C   . ASP B 185 ? 1.2312 1.1127 0.8766 0.3261  0.1138  0.0486  185 ASP L C   
2925 O O   . ASP B 185 ? 1.2831 1.1297 0.9155 0.3041  0.1128  0.0390  185 ASP L O   
2926 C CB  . ASP B 185 ? 1.2938 1.0423 0.8733 0.3559  0.1337  0.0567  185 ASP L CB  
2927 C CG  . ASP B 185 ? 1.3719 1.0429 0.8959 0.3975  0.1603  0.0663  185 ASP L CG  
2928 N N   . TYR B 186 ? 1.0680 1.0295 0.7642 0.3141  0.0986  0.0503  186 TYR L N   
2929 C CA  . TYR B 186 ? 0.8509 0.8582 0.5926 0.2713  0.0833  0.0426  186 TYR L CA  
2930 C C   . TYR B 186 ? 0.9095 0.9647 0.6654 0.2760  0.0945  0.0441  186 TYR L C   
2931 O O   . TYR B 186 ? 0.8377 0.8932 0.6064 0.2451  0.0921  0.0397  186 TYR L O   
2932 C CB  . TYR B 186 ? 0.7552 0.8312 0.5454 0.2588  0.0652  0.0412  186 TYR L CB  
2933 C CG  . TYR B 186 ? 0.6816 0.8014 0.5190 0.2156  0.0526  0.0332  186 TYR L CG  
2934 C CD1 . TYR B 186 ? 0.6749 0.7455 0.5080 0.1781  0.0433  0.0276  186 TYR L CD1 
2935 C CD2 . TYR B 186 ? 0.6556 0.8658 0.5436 0.2127  0.0516  0.0311  186 TYR L CD2 
2936 C CE1 . TYR B 186 ? 0.7089 0.8102 0.5781 0.1427  0.0354  0.0226  186 TYR L CE1 
2937 C CE2 . TYR B 186 ? 0.6202 0.8602 0.5503 0.1716  0.0450  0.0244  186 TYR L CE2 
2938 C CZ  . TYR B 186 ? 0.7723 0.9531 0.6884 0.1386  0.0379  0.0215  186 TYR L CZ  
2939 O OH  . TYR B 186 ? 0.7733 0.9749 0.7242 0.1017  0.0347  0.0171  186 TYR L OH  
2940 N N   . GLU B 187 ? 0.9638 1.0591 0.7155 0.3182  0.1094  0.0521  187 GLU L N   
2941 C CA  . GLU B 187 ? 0.9556 1.1047 0.7252 0.3278  0.1250  0.0562  187 GLU L CA  
2942 C C   . GLU B 187 ? 1.0254 1.0998 0.7341 0.3443  0.1439  0.0575  187 GLU L C   
2943 O O   . GLU B 187 ? 0.9709 1.0758 0.6820 0.3567  0.1615  0.0629  187 GLU L O   
2944 C CB  . GLU B 187 ? 0.8462 1.0846 0.6443 0.3686  0.1319  0.0634  187 GLU L CB  
2945 N N   . LYS B 188 ? 1.1390 1.1158 0.7941 0.3443  0.1409  0.0512  188 LYS L N   
2946 C CA  . LYS B 188 ? 1.2049 1.1020 0.7971 0.3588  0.1544  0.0461  188 LYS L CA  
2947 C C   . LYS B 188 ? 1.1906 1.0559 0.7757 0.3212  0.1440  0.0351  188 LYS L C   
2948 O O   . LYS B 188 ? 1.3440 1.1575 0.8794 0.3324  0.1526  0.0286  188 LYS L O   
2949 C CB  . LYS B 188 ? 1.2779 1.0817 0.8178 0.3755  0.1576  0.0409  188 LYS L CB  
2950 C CG  . LYS B 188 ? 1.3830 1.1909 0.8992 0.4296  0.1775  0.0538  188 LYS L CG  
2951 C CD  . LYS B 188 ? 1.4647 1.1606 0.9217 0.4439  0.1875  0.0488  188 LYS L CD  
2952 C CE  . LYS B 188 ? 1.5145 1.2029 0.9358 0.5049  0.2120  0.0641  188 LYS L CE  
2953 N N   . HIS B 189 ? 1.0878 0.9829 0.7177 0.2806  0.1254  0.0325  189 HIS L N   
2954 C CA  . HIS B 189 ? 1.0092 0.8736 0.6301 0.2484  0.1140  0.0234  189 HIS L CA  
2955 C C   . HIS B 189 ? 1.0171 0.9499 0.6878 0.2240  0.1143  0.0314  189 HIS L C   
2956 O O   . HIS B 189 ? 1.0844 1.0918 0.8055 0.2253  0.1199  0.0402  189 HIS L O   
2957 C CB  . HIS B 189 ? 0.9601 0.7723 0.5779 0.2204  0.0919  0.0106  189 HIS L CB  
2958 C CG  . HIS B 189 ? 1.1854 0.9273 0.7639 0.2376  0.0950  0.0027  189 HIS L CG  
2959 N ND1 . HIS B 189 ? 1.1347 0.8749 0.7267 0.2454  0.0966  0.0089  189 HIS L ND1 
2960 C CD2 . HIS B 189 ? 1.3064 0.9724 0.8303 0.2490  0.0989  -0.0114 189 HIS L CD2 
2961 C CE1 . HIS B 189 ? 1.2712 0.9337 0.8204 0.2593  0.1050  0.0014  189 HIS L CE1 
2962 N NE2 . HIS B 189 ? 1.3908 1.0073 0.9003 0.2596  0.1053  -0.0131 189 HIS L NE2 
2963 N N   . LYS B 190 ? 1.0216 0.9276 0.6776 0.2025  0.1086  0.0271  190 LYS L N   
2964 C CA  . LYS B 190 ? 0.9562 0.9099 0.6501 0.1801  0.1149  0.0364  190 LYS L CA  
2965 C C   . LYS B 190 ? 0.9730 0.9069 0.6784 0.1443  0.0936  0.0300  190 LYS L C   
2966 O O   . LYS B 190 ? 1.0299 1.0068 0.7856 0.1195  0.0899  0.0341  190 LYS L O   
2967 C CB  . LYS B 190 ? 0.8647 0.8086 0.5230 0.1980  0.1383  0.0444  190 LYS L CB  
2968 C CG  . LYS B 190 ? 0.9192 0.8973 0.6094 0.1754  0.1516  0.0567  190 LYS L CG  
2969 N N   . VAL B 191 ? 0.9634 0.8338 0.6226 0.1426  0.0790  0.0182  191 VAL L N   
2970 C CA  . VAL B 191 ? 0.9598 0.8125 0.6249 0.1145  0.0593  0.0125  191 VAL L CA  
2971 C C   . VAL B 191 ? 0.9674 0.8067 0.6522 0.0987  0.0373  0.0022  191 VAL L C   
2972 O O   . VAL B 191 ? 0.9615 0.7602 0.6220 0.1079  0.0306  -0.0091 191 VAL L O   
2973 C CB  . VAL B 191 ? 1.0413 0.8428 0.6489 0.1226  0.0526  0.0035  191 VAL L CB  
2974 C CG1 . VAL B 191 ? 1.0086 0.7991 0.6236 0.0984  0.0316  -0.0016 191 VAL L CG1 
2975 C CG2 . VAL B 191 ? 0.9566 0.7660 0.5368 0.1427  0.0785  0.0169  191 VAL L CG2 
2976 N N   . TYR B 192 ? 0.9113 0.7811 0.6393 0.0749  0.0290  0.0064  192 TYR L N   
2977 C CA  . TYR B 192 ? 0.8589 0.7182 0.6056 0.0606  0.0111  -0.0003 192 TYR L CA  
2978 C C   . TYR B 192 ? 0.8645 0.7152 0.6189 0.0368  -0.0041 -0.0030 192 TYR L C   
2979 O O   . TYR B 192 ? 0.8950 0.7714 0.6690 0.0244  0.0001  0.0049  192 TYR L O   
2980 C CB  . TYR B 192 ? 0.6756 0.5810 0.4625 0.0615  0.0140  0.0062  192 TYR L CB  
2981 C CG  . TYR B 192 ? 0.7798 0.6945 0.5571 0.0910  0.0273  0.0095  192 TYR L CG  
2982 C CD1 . TYR B 192 ? 0.8608 0.8162 0.6446 0.1072  0.0445  0.0169  192 TYR L CD1 
2983 C CD2 . TYR B 192 ? 0.9098 0.7912 0.6715 0.1047  0.0259  0.0068  192 TYR L CD2 
2984 C CE1 . TYR B 192 ? 0.8360 0.8029 0.6092 0.1394  0.0571  0.0209  192 TYR L CE1 
2985 C CE2 . TYR B 192 ? 0.9778 0.8615 0.7237 0.1370  0.0405  0.0118  192 TYR L CE2 
2986 C CZ  . TYR B 192 ? 0.9353 0.8638 0.6861 0.1560  0.0546  0.0185  192 TYR L CZ  
2987 O OH  . TYR B 192 ? 1.0767 1.0107 0.8103 0.1931  0.0694  0.0244  192 TYR L OH  
2988 N N   . ALA B 193 ? 0.8383 0.6527 0.5793 0.0307  -0.0205 -0.0148 193 ALA L N   
2989 C CA  . ALA B 193 ? 0.7764 0.5844 0.5209 0.0140  -0.0360 -0.0180 193 ALA L CA  
2990 C C   . ALA B 193 ? 0.7881 0.5829 0.5516 0.0012  -0.0516 -0.0268 193 ALA L C   
2991 O O   . ALA B 193 ? 0.7612 0.5345 0.5229 0.0050  -0.0510 -0.0344 193 ALA L O   
2992 C CB  . ALA B 193 ? 0.8179 0.6008 0.5194 0.0237  -0.0408 -0.0249 193 ALA L CB  
2993 N N   . CYS B 194 ? 0.8125 0.6177 0.5941 -0.0131 -0.0622 -0.0245 194 CYS L N   
2994 C CA  . CYS B 194 ? 0.9494 0.7465 0.7513 -0.0250 -0.0757 -0.0319 194 CYS L CA  
2995 C C   . CYS B 194 ? 0.8489 0.6416 0.6410 -0.0293 -0.0930 -0.0399 194 CYS L C   
2996 O O   . CYS B 194 ? 0.8107 0.6136 0.5959 -0.0286 -0.0933 -0.0313 194 CYS L O   
2997 C CB  . CYS B 194 ? 0.9519 0.7704 0.7862 -0.0328 -0.0724 -0.0212 194 CYS L CB  
2998 S SG  . CYS B 194 ? 1.0320 0.8756 0.8741 -0.0395 -0.0706 -0.0102 194 CYS L SG  
2999 N N   . GLU B 195 ? 0.8371 0.6144 0.6288 -0.0327 -0.1068 -0.0576 195 GLU L N   
3000 C CA  . GLU B 195 ? 0.8924 0.6740 0.6762 -0.0329 -0.1277 -0.0694 195 GLU L CA  
3001 C C   . GLU B 195 ? 0.9173 0.7161 0.7433 -0.0477 -0.1378 -0.0712 195 GLU L C   
3002 O O   . GLU B 195 ? 0.8035 0.5968 0.6594 -0.0603 -0.1376 -0.0800 195 GLU L O   
3003 C CB  . GLU B 195 ? 0.7200 0.4813 0.4782 -0.0270 -0.1410 -0.0938 195 GLU L CB  
3004 C CG  . GLU B 195 ? 1.0694 0.8424 0.8143 -0.0214 -0.1670 -0.1099 195 GLU L CG  
3005 C CD  . GLU B 195 ? 1.3060 1.0587 1.0121 -0.0096 -0.1813 -0.1359 195 GLU L CD  
3006 O OE1 . GLU B 195 ? 1.4067 1.1319 1.0882 -0.0026 -0.1668 -0.1368 195 GLU L OE1 
3007 O OE2 . GLU B 195 ? 1.3815 1.1474 1.0799 -0.0047 -0.2081 -0.1568 195 GLU L OE2 
3008 N N   . VAL B 196 ? 0.9487 0.7653 0.7758 -0.0448 -0.1432 -0.0613 196 VAL L N   
3009 C CA  . VAL B 196 ? 0.7781 0.6142 0.6431 -0.0544 -0.1496 -0.0591 196 VAL L CA  
3010 C C   . VAL B 196 ? 0.8533 0.7079 0.7232 -0.0513 -0.1737 -0.0750 196 VAL L C   
3011 O O   . VAL B 196 ? 0.9215 0.7783 0.7559 -0.0343 -0.1839 -0.0756 196 VAL L O   
3012 C CB  . VAL B 196 ? 0.7767 0.6195 0.6413 -0.0515 -0.1391 -0.0384 196 VAL L CB  
3013 C CG1 . VAL B 196 ? 0.6969 0.5588 0.5920 -0.0551 -0.1462 -0.0359 196 VAL L CG1 
3014 C CG2 . VAL B 196 ? 0.6158 0.4527 0.4867 -0.0558 -0.1202 -0.0274 196 VAL L CG2 
3015 N N   . THR B 197 ? 0.8497 0.7197 0.7648 -0.0661 -0.1813 -0.0874 197 THR L N   
3016 C CA  . THR B 197 ? 0.9343 0.8359 0.8689 -0.0654 -0.2062 -0.1053 197 THR L CA  
3017 C C   . THR B 197 ? 0.8055 0.7365 0.7831 -0.0700 -0.2037 -0.0939 197 THR L C   
3018 O O   . THR B 197 ? 0.8649 0.7943 0.8816 -0.0857 -0.1878 -0.0875 197 THR L O   
3019 C CB  . THR B 197 ? 1.1187 1.0207 1.0795 -0.0821 -0.2193 -0.1359 197 THR L CB  
3020 O OG1 . THR B 197 ? 1.2820 1.1551 1.1943 -0.0725 -0.2238 -0.1486 197 THR L OG1 
3021 C CG2 . THR B 197 ? 1.1873 1.1355 1.1807 -0.0837 -0.2479 -0.1580 197 THR L CG2 
3022 N N   . HIS B 198 ? 0.8089 0.7639 0.7745 -0.0521 -0.2170 -0.0895 198 HIS L N   
3023 C CA  . HIS B 198 ? 0.7667 0.7502 0.7673 -0.0506 -0.2144 -0.0780 198 HIS L CA  
3024 C C   . HIS B 198 ? 0.8161 0.8419 0.8198 -0.0325 -0.2402 -0.0888 198 HIS L C   
3025 O O   . HIS B 198 ? 0.6670 0.6923 0.6285 -0.0139 -0.2577 -0.0987 198 HIS L O   
3026 C CB  . HIS B 198 ? 0.6971 0.6561 0.6704 -0.0410 -0.1936 -0.0505 198 HIS L CB  
3027 C CG  . HIS B 198 ? 0.6713 0.6501 0.6755 -0.0385 -0.1863 -0.0377 198 HIS L CG  
3028 N ND1 . HIS B 198 ? 0.6837 0.6727 0.6699 -0.0167 -0.1909 -0.0274 198 HIS L ND1 
3029 C CD2 . HIS B 198 ? 0.7157 0.7027 0.7631 -0.0515 -0.1719 -0.0320 198 HIS L CD2 
3030 C CE1 . HIS B 198 ? 0.7311 0.7358 0.7490 -0.0166 -0.1811 -0.0173 198 HIS L CE1 
3031 N NE2 . HIS B 198 ? 0.7781 0.7828 0.8335 -0.0375 -0.1691 -0.0194 198 HIS L NE2 
3032 N N   . GLN B 199 ? 0.8450 0.9097 0.8968 -0.0339 -0.2416 -0.0860 199 GLN L N   
3033 C CA  . GLN B 199 ? 0.7670 0.8835 0.8305 -0.0139 -0.2665 -0.0960 199 GLN L CA  
3034 C C   . GLN B 199 ? 0.7019 0.8013 0.6977 0.0230  -0.2683 -0.0783 199 GLN L C   
3035 O O   . GLN B 199 ? 0.6916 0.8186 0.6653 0.0490  -0.2922 -0.0887 199 GLN L O   
3036 C CB  . GLN B 199 ? 0.6830 0.8446 0.8143 -0.0215 -0.2605 -0.0913 199 GLN L CB  
3037 C CG  . GLN B 199 ? 0.7179 0.9469 0.8739 -0.0003 -0.2870 -0.1033 199 GLN L CG  
3038 C CD  . GLN B 199 ? 0.8116 1.0882 1.0383 -0.0067 -0.2764 -0.0959 199 GLN L CD  
3039 N N   . GLY B 200 ? 0.7205 0.7728 0.6824 0.0260  -0.2423 -0.0524 200 GLY L N   
3040 C CA  . GLY B 200 ? 0.7614 0.7844 0.6603 0.0564  -0.2362 -0.0335 200 GLY L CA  
3041 C C   . GLY B 200 ? 0.8362 0.8216 0.6751 0.0655  -0.2356 -0.0342 200 GLY L C   
3042 O O   . GLY B 200 ? 0.9503 0.9005 0.7336 0.0881  -0.2238 -0.0163 200 GLY L O   
3043 N N   . LEU B 201 ? 0.7455 0.7342 0.5943 0.0488  -0.2452 -0.0540 201 LEU L N   
3044 C CA  . LEU B 201 ? 0.7941 0.7498 0.5864 0.0593  -0.2436 -0.0557 201 LEU L CA  
3045 C C   . LEU B 201 ? 0.9603 0.9462 0.7394 0.0757  -0.2755 -0.0825 201 LEU L C   
3046 O O   . LEU B 201 ? 1.0273 1.0456 0.8538 0.0562  -0.2944 -0.1093 201 LEU L O   
3047 C CB  . LEU B 201 ? 0.6902 0.6163 0.4917 0.0317  -0.2256 -0.0559 201 LEU L CB  
3048 C CG  . LEU B 201 ? 0.7994 0.6974 0.6074 0.0176  -0.1968 -0.0334 201 LEU L CG  
3049 C CD1 . LEU B 201 ? 0.7535 0.6356 0.5758 -0.0050 -0.1841 -0.0371 201 LEU L CD1 
3050 C CD2 . LEU B 201 ? 0.8810 0.7444 0.6365 0.0362  -0.1798 -0.0122 201 LEU L CD2 
3051 N N   . SER B 202 ? 0.9405 0.9132 0.6533 0.1124  -0.2804 -0.0762 202 SER L N   
3052 C CA  . SER B 202 ? 1.1020 1.1011 0.7878 0.1357  -0.3127 -0.1027 202 SER L CA  
3053 C C   . SER B 202 ? 1.1244 1.0962 0.7907 0.1226  -0.3116 -0.1187 202 SER L C   
3054 O O   . SER B 202 ? 1.2651 1.2600 0.9287 0.1272  -0.3409 -0.1511 202 SER L O   
3055 C CB  . SER B 202 ? 1.1457 1.1334 0.7552 0.1869  -0.3145 -0.0868 202 SER L CB  
3056 O OG  . SER B 202 ? 1.3073 1.2307 0.8562 0.1960  -0.2803 -0.0594 202 SER L OG  
3057 N N   . SER B 203 ? 1.0634 0.9879 0.7169 0.1073  -0.2782 -0.0976 203 SER L N   
3058 C CA  . SER B 203 ? 1.0910 0.9871 0.7250 0.0975  -0.2712 -0.1078 203 SER L CA  
3059 C C   . SER B 203 ? 1.0651 0.9403 0.7389 0.0629  -0.2435 -0.0951 203 SER L C   
3060 O O   . SER B 203 ? 0.9853 0.8505 0.6714 0.0557  -0.2215 -0.0702 203 SER L O   
3061 C CB  . SER B 203 ? 1.2215 1.0810 0.7730 0.1320  -0.2571 -0.0923 203 SER L CB  
3062 O OG  . SER B 203 ? 1.2922 1.1234 0.8256 0.1240  -0.2440 -0.0972 203 SER L OG  
3063 N N   . PRO B 204 ? 1.0828 0.9501 0.7740 0.0437  -0.2452 -0.1137 204 PRO L N   
3064 C CA  . PRO B 204 ? 1.0047 0.8531 0.7266 0.0177  -0.2200 -0.1025 204 PRO L CA  
3065 C C   . PRO B 204 ? 0.9745 0.7953 0.6633 0.0254  -0.1896 -0.0744 204 PRO L C   
3066 O O   . PRO B 204 ? 1.0384 0.8390 0.6772 0.0441  -0.1825 -0.0720 204 PRO L O   
3067 C CB  . PRO B 204 ? 1.0840 0.9196 0.8066 0.0085  -0.2280 -0.1287 204 PRO L CB  
3068 C CG  . PRO B 204 ? 1.1621 1.0237 0.8878 0.0145  -0.2633 -0.1602 204 PRO L CG  
3069 C CD  . PRO B 204 ? 1.1550 1.0308 0.8378 0.0469  -0.2730 -0.1493 204 PRO L CD  
3070 N N   . VAL B 205 ? 0.9452 0.7671 0.6634 0.0111  -0.1716 -0.0549 205 VAL L N   
3071 C CA  . VAL B 205 ? 0.9304 0.7330 0.6310 0.0120  -0.1437 -0.0320 205 VAL L CA  
3072 C C   . VAL B 205 ? 0.9681 0.7648 0.6824 -0.0005 -0.1284 -0.0324 205 VAL L C   
3073 O O   . VAL B 205 ? 1.0120 0.8177 0.7652 -0.0169 -0.1292 -0.0375 205 VAL L O   
3074 C CB  . VAL B 205 ? 0.9331 0.7391 0.6569 0.0028  -0.1336 -0.0152 205 VAL L CB  
3075 C CG1 . VAL B 205 ? 0.8976 0.6879 0.6162 -0.0041 -0.1059 0.0022  205 VAL L CG1 
3076 C CG2 . VAL B 205 ? 0.8537 0.6602 0.5547 0.0219  -0.1438 -0.0103 205 VAL L CG2 
3077 N N   . THR B 206 ? 0.8937 0.6754 0.5737 0.0110  -0.1121 -0.0252 206 THR L N   
3078 C CA  . THR B 206 ? 0.8996 0.6800 0.5888 0.0055  -0.0965 -0.0245 206 THR L CA  
3079 C C   . THR B 206 ? 0.9896 0.7751 0.6869 0.0004  -0.0696 -0.0044 206 THR L C   
3080 O O   . THR B 206 ? 1.2343 1.0084 0.9016 0.0115  -0.0537 0.0079  206 THR L O   
3081 C CB  . THR B 206 ? 0.7972 0.5605 0.4443 0.0240  -0.0983 -0.0363 206 THR L CB  
3082 O OG1 . THR B 206 ? 0.9822 0.7423 0.6293 0.0235  -0.1251 -0.0613 206 THR L OG1 
3083 C CG2 . THR B 206 ? 0.8867 0.6493 0.5411 0.0231  -0.0795 -0.0332 206 THR L CG2 
3084 N N   . LYS B 207 ? 0.9585 0.7620 0.6972 -0.0158 -0.0639 -0.0018 207 LYS L N   
3085 C CA  . LYS B 207 ? 0.9058 0.7245 0.6631 -0.0239 -0.0421 0.0107  207 LYS L CA  
3086 C C   . LYS B 207 ? 0.9029 0.7365 0.6679 -0.0184 -0.0319 0.0086  207 LYS L C   
3087 O O   . LYS B 207 ? 0.9396 0.7747 0.7140 -0.0165 -0.0413 -0.0006 207 LYS L O   
3088 C CB  . LYS B 207 ? 0.8200 0.6537 0.6150 -0.0417 -0.0451 0.0127  207 LYS L CB  
3089 C CG  . LYS B 207 ? 0.8737 0.6906 0.6595 -0.0442 -0.0519 0.0166  207 LYS L CG  
3090 C CD  . LYS B 207 ? 0.7914 0.5884 0.5512 -0.0406 -0.0328 0.0297  207 LYS L CD  
3091 C CE  . LYS B 207 ? 0.9371 0.7124 0.6830 -0.0386 -0.0371 0.0355  207 LYS L CE  
3092 N NZ  . LYS B 207 ? 1.1527 0.8980 0.8679 -0.0328 -0.0130 0.0514  207 LYS L NZ  
3093 N N   . SER B 208 ? 0.8867 0.7302 0.6478 -0.0143 -0.0098 0.0184  208 SER L N   
3094 C CA  . SER B 208 ? 0.8272 0.6874 0.5910 -0.0028 0.0018  0.0179  208 SER L CA  
3095 C C   . SER B 208 ? 0.8208 0.7185 0.6174 -0.0101 0.0249  0.0282  208 SER L C   
3096 O O   . SER B 208 ? 0.7751 0.6789 0.5904 -0.0269 0.0346  0.0352  208 SER L O   
3097 C CB  . SER B 208 ? 0.8766 0.7083 0.5891 0.0204  0.0052  0.0153  208 SER L CB  
3098 O OG  . SER B 208 ? 0.9652 0.7854 0.6506 0.0271  0.0222  0.0277  208 SER L OG  
3099 N N   . PHE B 209 ? 0.8850 0.8081 0.6904 0.0028  0.0346  0.0280  209 PHE L N   
3100 C CA  . PHE B 209 ? 0.8148 0.7846 0.6567 -0.0012 0.0570  0.0358  209 PHE L CA  
3101 C C   . PHE B 209 ? 0.9047 0.8880 0.7323 0.0258  0.0697  0.0378  209 PHE L C   
3102 O O   . PHE B 209 ? 0.8676 0.8310 0.6706 0.0432  0.0576  0.0302  209 PHE L O   
3103 C CB  . PHE B 209 ? 0.7322 0.7479 0.6301 -0.0200 0.0478  0.0292  209 PHE L CB  
3104 C CG  . PHE B 209 ? 0.8358 0.8692 0.7398 -0.0046 0.0328  0.0212  209 PHE L CG  
3105 C CD1 . PHE B 209 ? 0.7839 0.8652 0.7088 0.0120  0.0423  0.0219  209 PHE L CD1 
3106 C CD2 . PHE B 209 ? 0.8661 0.8687 0.7547 -0.0042 0.0122  0.0147  209 PHE L CD2 
3107 C CE1 . PHE B 209 ? 0.7492 0.8407 0.6716 0.0322  0.0315  0.0174  209 PHE L CE1 
3108 C CE2 . PHE B 209 ? 0.8042 0.8150 0.6937 0.0123  0.0044  0.0109  209 PHE L CE2 
3109 C CZ  . PHE B 209 ? 0.7132 0.7653 0.6158 0.0322  0.0141  0.0128  209 PHE L CZ  
3110 N N   . ASN B 210 ? 0.9935 1.0081 0.8368 0.0295  0.0969  0.0486  210 ASN L N   
3111 C CA  . ASN B 210 ? 1.0086 1.0439 0.8424 0.0580  0.1123  0.0522  210 ASN L CA  
3112 C C   . ASN B 210 ? 0.9041 1.0132 0.7988 0.0564  0.1146  0.0499  210 ASN L C   
3113 O O   . ASN B 210 ? 0.8989 1.0557 0.8501 0.0315  0.1210  0.0503  210 ASN L O   
3114 C CB  . ASN B 210 ? 1.1569 1.1840 0.9663 0.0703  0.1440  0.0671  210 ASN L CB  
3115 C CG  . ASN B 210 ? 1.2444 1.2009 0.9805 0.0844  0.1390  0.0671  210 ASN L CG  
3116 O OD1 . ASN B 210 ? 1.2011 1.1253 0.8861 0.1122  0.1345  0.0609  210 ASN L OD1 
3117 N ND2 . ASN B 210 ? 1.3201 1.2516 1.0486 0.0672  0.1391  0.0723  210 ASN L ND2 
3118 N N   . ARG B 211 ? 0.8183 0.9355 0.7004 0.0841  0.1088  0.0460  211 ARG L N   
3119 C CA  . ARG B 211 ? 0.8913 1.0813 0.8230 0.0926  0.1077  0.0433  211 ARG L CA  
3120 C C   . ARG B 211 ? 1.0314 1.2904 1.0098 0.0924  0.1348  0.0516  211 ARG L C   
3121 O O   . ARG B 211 ? 1.0383 1.2988 0.9939 0.1201  0.1572  0.0614  211 ARG L O   
3122 C CB  . ARG B 211 ? 0.8019 0.9749 0.6974 0.1306  0.1028  0.0417  211 ARG L CB  
3123 C CG  . ARG B 211 ? 0.7873 1.0338 0.7242 0.1484  0.0986  0.0394  211 ARG L CG  
3124 C CD  . ARG B 211 ? 0.7851 1.0002 0.6752 0.1907  0.0989  0.0414  211 ARG L CD  
3125 N NE  . ARG B 211 ? 0.8743 1.0585 0.7206 0.2186  0.1216  0.0491  211 ARG L NE  
3126 C CZ  . ARG B 211 ? 0.8656 1.1053 0.7267 0.2471  0.1421  0.0572  211 ARG L CZ  
3127 N NH1 . ARG B 211 ? 0.8315 1.1673 0.7564 0.2494  0.1406  0.0569  211 ARG L NH1 
3128 N NH2 . ARG B 211 ? 0.9637 1.1660 0.7762 0.2749  0.1634  0.0640  211 ARG L NH2 
3129 N N   . GLY B 212 ? 1.1222 1.4378 1.1676 0.0604  0.1339  0.0464  212 GLY L N   
3130 C CA  . GLY B 212 ? 1.0736 1.4614 1.1791 0.0513  0.1608  0.0520  212 GLY L CA  
3131 C C   . GLY B 212 ? 0.9988 1.3622 1.1175 0.0164  0.1829  0.0602  212 GLY L C   
3132 O O   . GLY B 212 ? 1.0025 1.4231 1.1920 -0.0132 0.1971  0.0574  212 GLY L O   
3133 N N   . GLN C 1   ? 1.3594 0.6621 0.7687 0.1926  -0.2478 0.0470  1   GLN C N   
3134 C CA  . GLN C 1   ? 1.3263 0.6191 0.8009 0.1129  -0.2304 0.0458  1   GLN C CA  
3135 C C   . GLN C 1   ? 1.1865 0.6005 0.7918 0.0909  -0.2450 0.0692  1   GLN C C   
3136 O O   . GLN C 1   ? 1.1448 0.6957 0.8368 0.1044  -0.2711 0.0782  1   GLN C O   
3137 C CB  . GLN C 1   ? 1.3422 0.5843 0.7710 0.0822  -0.1774 0.0249  1   GLN C CB  
3138 C CG  . GLN C 1   ? 1.3066 0.5875 0.7996 0.0143  -0.1482 0.0127  1   GLN C CG  
3139 N N   . LEU C 2   ? 1.1399 0.5359 0.7745 0.0494  -0.2184 0.0702  2   LEU C N   
3140 C CA  . LEU C 2   ? 0.9915 0.5183 0.7528 0.0191  -0.2208 0.0882  2   LEU C CA  
3141 C C   . LEU C 2   ? 0.8767 0.4860 0.6383 0.0734  -0.2201 0.1022  2   LEU C C   
3142 O O   . LEU C 2   ? 0.9021 0.4376 0.5684 0.1168  -0.2040 0.0959  2   LEU C O   
3143 C CB  . LEU C 2   ? 0.9773 0.4759 0.7714 -0.0388 -0.1913 0.0782  2   LEU C CB  
3144 C CG  . LEU C 2   ? 0.8474 0.4036 0.7075 -0.0840 -0.1673 0.0535  2   LEU C CG  
3145 C CD1 . LEU C 2   ? 0.7161 0.3368 0.6323 -0.1005 -0.1220 0.0395  2   LEU C CD1 
3146 C CD2 . LEU C 2   ? 0.7694 0.3917 0.7167 -0.1081 -0.2059 0.0693  2   LEU C CD2 
3147 N N   . LEU C 3   ? 0.7386 0.5011 0.6089 0.0682  -0.2353 0.1186  3   LEU C N   
3148 C CA  . LEU C 3   ? 0.8747 0.7357 0.7594 0.1142  -0.2333 0.1284  3   LEU C CA  
3149 C C   . LEU C 3   ? 0.7542 0.7030 0.7280 0.0702  -0.2196 0.1488  3   LEU C C   
3150 O O   . LEU C 3   ? 0.7140 0.6923 0.7697 0.0088  -0.2233 0.1596  3   LEU C O   
3151 C CB  . LEU C 3   ? 0.8613 0.8375 0.7884 0.1545  -0.2610 0.1253  3   LEU C CB  
3152 C CG  . LEU C 3   ? 0.9505 0.8517 0.7934 0.2008  -0.2829 0.1068  3   LEU C CG  
3153 C CD1 . LEU C 3   ? 0.8000 0.8373 0.7004 0.2422  -0.3138 0.0992  3   LEU C CD1 
3154 C CD2 . LEU C 3   ? 1.1177 0.8821 0.8160 0.2581  -0.2706 0.0972  3   LEU C CD2 
3155 N N   . PHE C 4   ? 0.8884 0.8750 0.8413 0.1033  -0.2046 0.1538  4   PHE C N   
3156 C CA  . PHE C 4   ? 0.8609 0.9259 0.8794 0.0678  -0.1902 0.1745  4   PHE C CA  
3157 C C   . PHE C 4   ? 0.8752 1.0786 0.9304 0.1041  -0.1884 0.1809  4   PHE C C   
3158 O O   . PHE C 4   ? 0.9918 1.2005 0.9941 0.1691  -0.1920 0.1642  4   PHE C O   
3159 C CB  . PHE C 4   ? 0.8659 0.8336 0.8191 0.0617  -0.1668 0.1702  4   PHE C CB  
3160 C CG  . PHE C 4   ? 0.8509 0.6791 0.7603 0.0300  -0.1635 0.1541  4   PHE C CG  
3161 C CD1 . PHE C 4   ? 1.0098 0.7177 0.8186 0.0633  -0.1596 0.1305  4   PHE C CD1 
3162 C CD2 . PHE C 4   ? 0.9129 0.7272 0.8786 -0.0330 -0.1634 0.1605  4   PHE C CD2 
3163 C CE1 . PHE C 4   ? 0.9560 0.5380 0.7240 0.0285  -0.1511 0.1117  4   PHE C CE1 
3164 C CE2 . PHE C 4   ? 0.8887 0.5841 0.8217 -0.0633 -0.1589 0.1384  4   PHE C CE2 
3165 C CZ  . PHE C 4   ? 0.9538 0.5354 0.7890 -0.0354 -0.1502 0.1130  4   PHE C CZ  
3166 N N   . ASN C 5   ? 0.9297 1.2426 1.0729 0.0623  -0.1822 0.2035  5   ASN C N   
3167 C CA  . ASN C 5   ? 1.0842 1.5271 1.2584 0.0884  -0.1717 0.2074  5   ASN C CA  
3168 C C   . ASN C 5   ? 1.0289 1.4432 1.1497 0.0975  -0.1470 0.2126  5   ASN C C   
3169 O O   . ASN C 5   ? 1.2113 1.7044 1.3738 0.0682  -0.1319 0.2329  5   ASN C O   
3170 C CB  . ASN C 5   ? 1.1350 1.7119 1.4241 0.0374  -0.1727 0.2277  5   ASN C CB  
3171 C CG  . ASN C 5   ? 1.2806 1.8273 1.6088 -0.0359 -0.1665 0.2575  5   ASN C CG  
3172 O OD1 . ASN C 5   ? 1.3426 1.8003 1.6188 -0.0453 -0.1574 0.2636  5   ASN C OD1 
3173 N ND2 . ASN C 5   ? 1.4065 2.0281 1.8285 -0.0870 -0.1727 0.2739  5   ASN C ND2 
3174 N N   . LYS C 6   ? 0.7686 1.0663 0.7917 0.1386  -0.1423 0.1927  6   LYS C N   
3175 C CA  . LYS C 6   ? 0.8289 1.0634 0.7903 0.1431  -0.1202 0.1904  6   LYS C CA  
3176 C C   . LYS C 6   ? 0.8840 1.2269 0.8656 0.1506  -0.1013 0.2001  6   LYS C C   
3177 O O   . LYS C 6   ? 0.9410 1.4028 0.9616 0.1759  -0.1012 0.1980  6   LYS C O   
3178 C CB  . LYS C 6   ? 0.8484 0.9625 0.7021 0.2005  -0.1162 0.1615  6   LYS C CB  
3179 N N   . THR C 7   ? 0.9069 1.2094 0.8613 0.1280  -0.0852 0.2070  7   THR C N   
3180 C CA  . THR C 7   ? 0.8748 1.2619 0.8306 0.1335  -0.0649 0.2149  7   THR C CA  
3181 C C   . THR C 7   ? 0.8416 1.1443 0.7085 0.1705  -0.0483 0.1905  7   THR C C   
3182 O O   . THR C 7   ? 0.8697 1.0526 0.6928 0.1564  -0.0480 0.1802  7   THR C O   
3183 C CB  . THR C 7   ? 0.8501 1.2814 0.8584 0.0678  -0.0619 0.2496  7   THR C CB  
3184 O OG1 . THR C 7   ? 0.8572 1.3579 0.9486 0.0298  -0.0752 0.2710  7   THR C OG1 
3185 C CG2 . THR C 7   ? 0.8999 1.4215 0.9012 0.0726  -0.0394 0.2590  7   THR C CG2 
3186 N N   . LYS C 8   ? 0.8170 1.1855 0.6615 0.2165  -0.0331 0.1769  8   LYS C N   
3187 C CA  . LYS C 8   ? 0.7876 1.0836 0.5500 0.2562  -0.0159 0.1497  8   LYS C CA  
3188 C C   . LYS C 8   ? 0.9398 1.1975 0.6846 0.2165  -0.0037 0.1566  8   LYS C C   
3189 O O   . LYS C 8   ? 0.8851 1.0222 0.5751 0.2162  0.0005  0.1365  8   LYS C O   
3190 C CB  . LYS C 8   ? 0.8203 1.2152 0.5763 0.3103  -0.0027 0.1332  8   LYS C CB  
3191 N N   . SER C 9   ? 0.8925 1.2521 0.6815 0.1825  0.0023  0.1832  9   SER C N   
3192 C CA  . SER C 9   ? 0.8265 1.1609 0.5967 0.1495  0.0093  0.1910  9   SER C CA  
3193 C C   . SER C 9   ? 0.7110 1.1413 0.5369 0.0989  0.0068  0.2331  9   SER C C   
3194 O O   . SER C 9   ? 0.8530 1.3930 0.7254 0.0950  0.0113  0.2506  9   SER C O   
3195 C CB  . SER C 9   ? 0.9713 1.3058 0.6790 0.1905  0.0319  0.1627  9   SER C CB  
3196 O OG  . SER C 9   ? 1.0637 1.5261 0.7886 0.2142  0.0462  0.1664  9   SER C OG  
3197 N N   . VAL C 10  ? 0.7848 1.1708 0.6042 0.0601  -0.0002 0.2470  10  VAL C N   
3198 C CA  . VAL C 10  ? 0.8389 1.2944 0.6925 0.0133  -0.0032 0.2895  10  VAL C CA  
3199 C C   . VAL C 10  ? 0.8197 1.2749 0.6213 0.0133  0.0062  0.2883  10  VAL C C   
3200 O O   . VAL C 10  ? 0.7405 1.1135 0.4971 0.0301  0.0048  0.2568  10  VAL C O   
3201 C CB  . VAL C 10  ? 0.8907 1.2951 0.7927 -0.0373 -0.0296 0.3144  10  VAL C CB  
3202 C CG1 . VAL C 10  ? 0.9107 1.3489 0.8744 -0.0458 -0.0375 0.3234  10  VAL C CG1 
3203 C CG2 . VAL C 10  ? 0.7547 1.0330 0.6297 -0.0373 -0.0439 0.2853  10  VAL C CG2 
3204 N N   . GLU C 11  ? 0.7426 1.2906 0.5484 -0.0071 0.0172  0.3204  11  GLU C N   
3205 C CA  . GLU C 11  ? 0.8329 1.3931 0.5834 -0.0052 0.0264  0.3210  11  GLU C CA  
3206 C C   . GLU C 11  ? 0.7955 1.3574 0.5512 -0.0558 0.0106  0.3678  11  GLU C C   
3207 O O   . GLU C 11  ? 0.9944 1.5980 0.7952 -0.0932 0.0075  0.4075  11  GLU C O   
3208 C CB  . GLU C 11  ? 0.9560 1.6236 0.6843 0.0230  0.0583  0.3124  11  GLU C CB  
3209 N N   . PHE C 12  ? 0.8236 1.3372 0.5314 -0.0556 -0.0002 0.3610  12  PHE C N   
3210 C CA  . PHE C 12  ? 0.9614 1.4668 0.6603 -0.0947 -0.0191 0.4023  12  PHE C CA  
3211 C C   . PHE C 12  ? 1.0169 1.5417 0.6516 -0.0788 -0.0095 0.3906  12  PHE C C   
3212 O O   . PHE C 12  ? 0.9440 1.4738 0.5351 -0.0409 0.0047  0.3520  12  PHE C O   
3213 C CB  . PHE C 12  ? 0.9030 1.3067 0.6251 -0.1141 -0.0571 0.4008  12  PHE C CB  
3214 C CG  . PHE C 12  ? 0.9649 1.2965 0.6514 -0.0870 -0.0676 0.3501  12  PHE C CG  
3215 C CD1 . PHE C 12  ? 1.0460 1.3499 0.6960 -0.0927 -0.0899 0.3526  12  PHE C CD1 
3216 C CD2 . PHE C 12  ? 0.9303 1.2195 0.6174 -0.0560 -0.0552 0.2982  12  PHE C CD2 
3217 C CE1 . PHE C 12  ? 0.9898 1.2356 0.6148 -0.0698 -0.0987 0.2989  12  PHE C CE1 
3218 C CE2 . PHE C 12  ? 0.9963 1.2181 0.6524 -0.0368 -0.0598 0.2479  12  PHE C CE2 
3219 C CZ  . PHE C 12  ? 0.9623 1.1679 0.5924 -0.0445 -0.0810 0.2456  12  PHE C CZ  
3220 N N   . THR C 13  ? 1.1009 1.6326 0.7272 -0.1067 -0.0166 0.4218  13  THR C N   
3221 C CA  . THR C 13  ? 1.1333 1.6834 0.6956 -0.0947 -0.0092 0.4154  13  THR C CA  
3222 C C   . THR C 13  ? 1.1985 1.6794 0.7354 -0.1112 -0.0445 0.4328  13  THR C C   
3223 O O   . THR C 13  ? 1.0344 1.4476 0.6032 -0.1244 -0.0761 0.4376  13  THR C O   
3224 C CB  . THR C 13  ? 1.1818 1.8213 0.7384 -0.1070 0.0229  0.4358  13  THR C CB  
3225 O OG1 . THR C 13  ? 1.2318 1.8748 0.8303 -0.1500 0.0180  0.4792  13  THR C OG1 
3226 C CG2 . THR C 13  ? 1.0406 1.7592 0.6150 -0.0795 0.0563  0.4084  13  THR C CG2 
3227 N N   . PHE C 14  ? 1.1402 1.6382 0.6191 -0.1084 -0.0404 0.4400  14  PHE C N   
3228 C CA  . PHE C 14  ? 1.1959 1.6318 0.6390 -0.1169 -0.0753 0.4568  14  PHE C CA  
3229 C C   . PHE C 14  ? 1.3824 1.7888 0.8598 -0.1559 -0.0889 0.5041  14  PHE C C   
3230 O O   . PHE C 14  ? 1.3740 1.7106 0.8521 -0.1632 -0.1260 0.5153  14  PHE C O   
3231 C CB  . PHE C 14  ? 1.4284 1.8917 0.7932 -0.1026 -0.0656 0.4538  14  PHE C CB  
3232 N N   . GLY C 15  ? 1.3800 1.8428 0.8884 -0.1798 -0.0590 0.5277  15  GLY C N   
3233 C CA  . GLY C 15  ? 1.4202 1.8620 0.9625 -0.2193 -0.0661 0.5687  15  GLY C CA  
3234 C C   . GLY C 15  ? 1.3134 1.7077 0.9326 -0.2317 -0.0909 0.5654  15  GLY C C   
3235 O O   . GLY C 15  ? 1.3729 1.7224 1.0187 -0.2586 -0.1105 0.5910  15  GLY C O   
3236 N N   . ASN C 16  ? 1.2405 1.6412 0.8925 -0.2114 -0.0895 0.5320  16  ASN C N   
3237 C CA  . ASN C 16  ? 1.0852 1.4395 0.8075 -0.2219 -0.1116 0.5234  16  ASN C CA  
3238 C C   . ASN C 16  ? 1.1316 1.3972 0.8523 -0.2203 -0.1547 0.5146  16  ASN C C   
3239 O O   . ASN C 16  ? 1.1734 1.4096 0.8658 -0.1945 -0.1688 0.4833  16  ASN C O   
3240 C CB  . ASN C 16  ? 1.1524 1.5286 0.8949 -0.1982 -0.0972 0.4903  16  ASN C CB  
3241 C CG  . ASN C 16  ? 1.1739 1.6373 0.9439 -0.2019 -0.0623 0.4985  16  ASN C CG  
3242 O OD1 . ASN C 16  ? 1.2921 1.8234 1.0245 -0.1834 -0.0329 0.4917  16  ASN C OD1 
3243 N ND2 . ASN C 16  ? 1.3213 1.7884 1.1603 -0.2246 -0.0666 0.5091  16  ASN C ND2 
3244 N N   . ASP C 17  ? 1.1979 1.4243 0.9499 -0.2476 -0.1763 0.5389  17  ASP C N   
3245 C CA  . ASP C 17  ? 1.2088 1.3560 0.9699 -0.2467 -0.2199 0.5293  17  ASP C CA  
3246 C C   . ASP C 17  ? 1.0830 1.1951 0.9034 -0.2435 -0.2362 0.4922  17  ASP C C   
3247 O O   . ASP C 17  ? 1.0982 1.1616 0.9085 -0.2280 -0.2644 0.4638  17  ASP C O   
3248 C CB  . ASP C 17  ? 1.3094 1.4254 1.0935 -0.2757 -0.2367 0.5621  17  ASP C CB  
3249 C CG  . ASP C 17  ? 1.3488 1.3873 1.1395 -0.2714 -0.2838 0.5519  17  ASP C CG  
3250 O OD1 . ASP C 17  ? 1.4021 1.4170 1.1511 -0.2438 -0.3032 0.5295  17  ASP C OD1 
3251 O OD2 . ASP C 17  ? 1.3465 1.3517 1.1853 -0.2937 -0.3032 0.5625  17  ASP C OD2 
3252 N N   . THR C 18  ? 1.0822 1.2195 0.9629 -0.2584 -0.2198 0.4903  18  THR C N   
3253 C CA  . THR C 18  ? 1.0704 1.1757 1.0009 -0.2556 -0.2289 0.4551  18  THR C CA  
3254 C C   . THR C 18  ? 1.1162 1.2742 1.0527 -0.2459 -0.1941 0.4494  18  THR C C   
3255 O O   . THR C 18  ? 1.2223 1.4471 1.1570 -0.2518 -0.1681 0.4741  18  THR C O   
3256 C CB  . THR C 18  ? 0.9633 1.0351 0.9716 -0.2802 -0.2542 0.4494  18  THR C CB  
3257 O OG1 . THR C 18  ? 0.9214 1.0440 0.9631 -0.2974 -0.2369 0.4732  18  THR C OG1 
3258 C CG2 . THR C 18  ? 0.9979 1.0190 1.0016 -0.2878 -0.2911 0.4558  18  THR C CG2 
3259 N N   . VAL C 19  ? 1.0333 1.1586 0.9741 -0.2310 -0.1945 0.4163  19  VAL C N   
3260 C CA  . VAL C 19  ? 1.0245 1.1887 0.9659 -0.2169 -0.1653 0.4100  19  VAL C CA  
3261 C C   . VAL C 19  ? 0.9371 1.0705 0.9468 -0.2302 -0.1732 0.3927  19  VAL C C   
3262 O O   . VAL C 19  ? 0.8948 0.9676 0.9407 -0.2419 -0.1993 0.3690  19  VAL C O   
3263 C CB  . VAL C 19  ? 0.9711 1.1217 0.8504 -0.1790 -0.1505 0.3736  19  VAL C CB  
3264 C CG1 . VAL C 19  ? 0.9417 1.1145 0.7556 -0.1644 -0.1497 0.3779  19  VAL C CG1 
3265 C CG2 . VAL C 19  ? 0.9316 0.9923 0.8281 -0.1738 -0.1648 0.3205  19  VAL C CG2 
3266 N N   . VAL C 20  ? 0.8585 1.0422 0.8857 -0.2252 -0.1517 0.4002  20  VAL C N   
3267 C CA  . VAL C 20  ? 0.7133 0.8764 0.7981 -0.2325 -0.1583 0.3816  20  VAL C CA  
3268 C C   . VAL C 20  ? 0.6453 0.8147 0.7044 -0.2053 -0.1371 0.3693  20  VAL C C   
3269 O O   . VAL C 20  ? 0.7599 1.0069 0.8060 -0.1854 -0.1142 0.3787  20  VAL C O   
3270 C CB  . VAL C 20  ? 0.7402 0.9594 0.8827 -0.2529 -0.1625 0.4021  20  VAL C CB  
3271 C CG1 . VAL C 20  ? 0.7160 0.9201 0.9016 -0.2483 -0.1684 0.3782  20  VAL C CG1 
3272 C CG2 . VAL C 20  ? 0.7247 0.9209 0.8812 -0.2697 -0.1866 0.4086  20  VAL C CG2 
3273 N N   . ILE C 21  ? 0.6237 0.7119 0.6777 -0.1945 -0.1426 0.3268  21  ILE C N   
3274 C CA  . ILE C 21  ? 0.7190 0.7937 0.7434 -0.1572 -0.1234 0.2942  21  ILE C CA  
3275 C C   . ILE C 21  ? 0.6691 0.7480 0.7457 -0.1699 -0.1317 0.2978  21  ILE C C   
3276 O O   . ILE C 21  ? 0.7243 0.7410 0.8335 -0.1951 -0.1491 0.2845  21  ILE C O   
3277 C CB  . ILE C 21  ? 0.6669 0.6421 0.6408 -0.1385 -0.1183 0.2436  21  ILE C CB  
3278 C CG1 . ILE C 21  ? 0.7787 0.7466 0.7163 -0.1353 -0.1183 0.2362  21  ILE C CG1 
3279 C CG2 . ILE C 21  ? 0.6352 0.5932 0.5563 -0.0930 -0.0945 0.2154  21  ILE C CG2 
3280 C CD1 . ILE C 21  ? 0.9687 0.8440 0.8655 -0.1237 -0.1119 0.1811  21  ILE C CD1 
3281 N N   . PRO C 22  ? 0.5487 0.8654 0.6127 -0.0440 0.1126  -0.0223 22  PRO C N   
3282 C CA  . PRO C 22  ? 0.6212 0.9045 0.6919 -0.0565 0.1089  0.0059  22  PRO C CA  
3283 C C   . PRO C 22  ? 0.6800 0.9411 0.7928 -0.0463 0.1095  -0.0026 22  PRO C C   
3284 O O   . PRO C 22  ? 0.7421 1.0260 0.9001 -0.0369 0.1230  -0.0284 22  PRO C O   
3285 C CB  . PRO C 22  ? 0.5185 0.8385 0.6112 -0.0751 0.1277  0.0123  22  PRO C CB  
3286 C CG  . PRO C 22  ? 0.6179 0.9916 0.7405 -0.0670 0.1468  -0.0216 22  PRO C CG  
3287 C CD  . PRO C 22  ? 0.5203 0.8903 0.6019 -0.0516 0.1355  -0.0367 22  PRO C CD  
3288 N N   . CYS C 23  ? 0.6754 0.8873 0.7684 -0.0488 0.0953  0.0194  23  CYS C N   
3289 C CA  . CYS C 23  ? 0.6842 0.8626 0.7969 -0.0410 0.0969  0.0173  23  CYS C CA  
3290 C C   . CYS C 23  ? 0.6435 0.7735 0.7254 -0.0482 0.0786  0.0448  23  CYS C C   
3291 O O   . CYS C 23  ? 0.7065 0.8009 0.7514 -0.0456 0.0644  0.0538  23  CYS C O   
3292 C CB  . CYS C 23  ? 0.6383 0.8017 0.7556 -0.0254 0.1019  -0.0035 23  CYS C CB  
3293 S SG  . CYS C 23  ? 0.6986 0.8161 0.8306 -0.0184 0.1159  -0.0060 23  CYS C SG  
3294 N N   . PHE C 24  ? 0.6087 0.7377 0.7106 -0.0555 0.0755  0.0544  24  PHE C N   
3295 C CA  . PHE C 24  ? 0.5153 0.6021 0.5940 -0.0623 0.0533  0.0766  24  PHE C CA  
3296 C C   . PHE C 24  ? 0.6883 0.7376 0.7708 -0.0526 0.0462  0.0769  24  PHE C C   
3297 O O   . PHE C 24  ? 0.5118 0.5812 0.6335 -0.0510 0.0495  0.0702  24  PHE C O   
3298 C CB  . PHE C 24  ? 0.5206 0.6372 0.6181 -0.0824 0.0481  0.0893  24  PHE C CB  
3299 C CG  . PHE C 24  ? 0.7530 0.8912 0.8272 -0.0945 0.0549  0.0964  24  PHE C CG  
3300 C CD1 . PHE C 24  ? 0.6943 0.7937 0.7252 -0.1022 0.0371  0.1171  24  PHE C CD1 
3301 C CD2 . PHE C 24  ? 0.6999 0.8912 0.7893 -0.0970 0.0773  0.0824  24  PHE C CD2 
3302 C CE1 . PHE C 24  ? 0.7327 0.8401 0.7310 -0.1124 0.0409  0.1278  24  PHE C CE1 
3303 C CE2 . PHE C 24  ? 0.7346 0.9363 0.7857 -0.1067 0.0822  0.0913  24  PHE C CE2 
3304 C CZ  . PHE C 24  ? 0.7610 0.9177 0.7640 -0.1146 0.0636  0.1162  24  PHE C CZ  
3305 N N   . VAL C 25  ? 0.7051 0.6961 0.7426 -0.0446 0.0355  0.0840  25  VAL C N   
3306 C CA  . VAL C 25  ? 0.6612 0.6021 0.6792 -0.0349 0.0253  0.0885  25  VAL C CA  
3307 C C   . VAL C 25  ? 0.6062 0.5283 0.6184 -0.0418 -0.0084 0.1029  25  VAL C C   
3308 O O   . VAL C 25  ? 0.6660 0.5757 0.6578 -0.0502 -0.0237 0.1122  25  VAL C O   
3309 C CB  . VAL C 25  ? 0.7158 0.6001 0.6816 -0.0232 0.0343  0.0864  25  VAL C CB  
3310 C CG1 . VAL C 25  ? 0.7420 0.5688 0.6739 -0.0125 0.0290  0.0924  25  VAL C CG1 
3311 C CG2 . VAL C 25  ? 0.6699 0.5792 0.6556 -0.0189 0.0665  0.0678  25  VAL C CG2 
3312 N N   . THR C 26  ? 0.6160 0.5340 0.6510 -0.0374 -0.0231 0.1028  26  THR C N   
3313 C CA  . THR C 26  ? 0.7363 0.6457 0.7847 -0.0434 -0.0589 0.1102  26  THR C CA  
3314 C C   . THR C 26  ? 0.8159 0.6474 0.8001 -0.0300 -0.0886 0.1172  26  THR C C   
3315 O O   . THR C 26  ? 0.9644 0.7789 0.9461 -0.0354 -0.1211 0.1219  26  THR C O   
3316 C CB  . THR C 26  ? 0.7125 0.6617 0.8300 -0.0430 -0.0672 0.1012  26  THR C CB  
3317 O OG1 . THR C 26  ? 0.6422 0.5573 0.7445 -0.0229 -0.0671 0.0970  26  THR C OG1 
3318 C CG2 . THR C 26  ? 0.5864 0.6151 0.7651 -0.0577 -0.0369 0.0912  26  THR C CG2 
3319 N N   . ASN C 27  ? 0.8261 0.6083 0.7571 -0.0134 -0.0760 0.1168  27  ASN C N   
3320 C CA  . ASN C 27  ? 0.9593 0.6610 0.8140 0.0012  -0.1002 0.1229  27  ASN C CA  
3321 C C   . ASN C 27  ? 1.1237 0.7812 0.9094 0.0062  -0.0758 0.1224  27  ASN C C   
3322 O O   . ASN C 27  ? 1.1608 0.7607 0.8849 0.0192  -0.0628 0.1241  27  ASN C O   
3323 C CB  . ASN C 27  ? 0.8438 0.5066 0.6806 0.0182  -0.1108 0.1251  27  ASN C CB  
3324 C CG  . ASN C 27  ? 0.9664 0.6375 0.8115 0.0214  -0.0675 0.1222  27  ASN C CG  
3325 O OD1 . ASN C 27  ? 0.8830 0.6076 0.7692 0.0105  -0.0337 0.1140  27  ASN C OD1 
3326 N ND2 . ASN C 27  ? 0.9889 0.6018 0.7929 0.0369  -0.0707 0.1287  27  ASN C ND2 
3327 N N   . MET C 28  ? 1.1226 0.8047 0.9188 -0.0042 -0.0689 0.1195  28  MET C N   
3328 C CA  . MET C 28  ? 1.0965 0.7421 0.8404 0.0019  -0.0504 0.1136  28  MET C CA  
3329 C C   . MET C 28  ? 1.1196 0.7035 0.8021 0.0088  -0.0832 0.1154  28  MET C C   
3330 O O   . MET C 28  ? 1.1105 0.6984 0.8110 0.0022  -0.1214 0.1201  28  MET C O   
3331 C CB  . MET C 28  ? 1.0137 0.7076 0.7959 -0.0078 -0.0346 0.1074  28  MET C CB  
3332 C CG  . MET C 28  ? 0.9049 0.6353 0.7180 -0.0064 0.0063  0.0955  28  MET C CG  
3333 S SD  . MET C 28  ? 1.2826 1.0509 1.1217 -0.0096 0.0153  0.0839  28  MET C SD  
3334 C CE  . MET C 28  ? 1.2271 0.9333 1.0092 -0.0014 -0.0029 0.0815  28  MET C CE  
3335 N N   . GLU C 29  ? 1.1329 0.6604 0.7455 0.0212  -0.0659 0.1089  29  GLU C N   
3336 C CA  . GLU C 29  ? 1.1631 0.6264 0.7060 0.0309  -0.0943 0.1059  29  GLU C CA  
3337 C C   . GLU C 29  ? 1.1848 0.6319 0.7013 0.0347  -0.0720 0.0908  29  GLU C C   
3338 O O   . GLU C 29  ? 1.2151 0.6076 0.6698 0.0446  -0.0880 0.0827  29  GLU C O   
3339 C CB  . GLU C 29  ? 1.2343 0.6278 0.6964 0.0464  -0.1000 0.1110  29  GLU C CB  
3340 C CG  . GLU C 29  ? 1.3051 0.6677 0.7193 0.0524  -0.0454 0.1084  29  GLU C CG  
3341 C CD  . GLU C 29  ? 1.5191 0.8095 0.8514 0.0656  -0.0497 0.1208  29  GLU C CD  
3342 O OE1 . GLU C 29  ? 1.5395 0.8037 0.8513 0.0742  -0.1020 0.1281  29  GLU C OE1 
3343 O OE2 . GLU C 29  ? 1.5713 0.8282 0.8603 0.0676  -0.0016 0.1227  29  GLU C OE2 
3344 N N   . ALA C 30  ? 1.1383 0.6336 0.7050 0.0290  -0.0376 0.0831  30  ALA C N   
3345 C CA  . ALA C 30  ? 1.1037 0.5925 0.6636 0.0345  -0.0178 0.0638  30  ALA C CA  
3346 C C   . ALA C 30  ? 1.0574 0.5457 0.6302 0.0322  -0.0574 0.0625  30  ALA C C   
3347 O O   . ALA C 30  ? 1.0065 0.5313 0.6266 0.0195  -0.0823 0.0762  30  ALA C O   
3348 C CB  . ALA C 30  ? 1.0777 0.6209 0.6978 0.0310  0.0212  0.0528  30  ALA C CB  
3349 N N   . GLN C 31  ? 1.2114 0.6557 0.7416 0.0435  -0.0605 0.0455  31  GLN C N   
3350 C CA  . GLN C 31  ? 1.1783 0.6113 0.7185 0.0430  -0.0992 0.0422  31  GLN C CA  
3351 C C   . GLN C 31  ? 1.1235 0.5769 0.6994 0.0491  -0.0845 0.0235  31  GLN C C   
3352 O O   . GLN C 31  ? 1.1479 0.5890 0.7355 0.0506  -0.1153 0.0200  31  GLN C O   
3353 C CB  . GLN C 31  ? 1.2321 0.5969 0.7017 0.0543  -0.1247 0.0323  31  GLN C CB  
3354 N N   . ASN C 32  ? 1.1487 0.6313 0.7467 0.0533  -0.0401 0.0100  32  ASN C N   
3355 C CA  . ASN C 32  ? 1.0849 0.5922 0.7278 0.0621  -0.0279 -0.0135 32  ASN C CA  
3356 C C   . ASN C 32  ? 1.1474 0.7127 0.8463 0.0584  0.0048  -0.0178 32  ASN C C   
3357 O O   . ASN C 32  ? 1.2356 0.8088 0.9282 0.0532  0.0377  -0.0139 32  ASN C O   
3358 C CB  . ASN C 32  ? 1.1873 0.6569 0.7988 0.0783  -0.0042 -0.0461 32  ASN C CB  
3359 C CG  . ASN C 32  ? 1.3343 0.8158 0.9925 0.0914  -0.0151 -0.0728 32  ASN C CG  
3360 O OD1 . ASN C 32  ? 1.3462 0.8740 1.0662 0.0918  -0.0169 -0.0763 32  ASN C OD1 
3361 N ND2 . ASN C 32  ? 1.5329 0.9701 1.1603 0.1046  -0.0262 -0.0943 32  ASN C ND2 
3362 N N   . THR C 33  ? 0.5154 0.8300 1.0280 0.0607  -0.1050 -0.3011 33  THR C N   
3363 C CA  . THR C 33  ? 0.5305 0.8403 1.0284 0.0422  -0.0990 -0.2728 33  THR C CA  
3364 C C   . THR C 33  ? 0.4802 0.8555 0.9526 -0.0008 -0.0697 -0.3158 33  THR C C   
3365 O O   . THR C 33  ? 0.5820 0.9164 0.9769 -0.0259 -0.0521 -0.2826 33  THR C O   
3366 C CB  . THR C 33  ? 0.4027 0.6551 0.9273 0.0498  -0.1100 -0.2384 33  THR C CB  
3367 O OG1 . THR C 33  ? 0.5414 0.8056 1.1103 0.0519  -0.1109 -0.2794 33  THR C OG1 
3368 C CG2 . THR C 33  ? 0.5047 0.6913 1.0160 0.0650  -0.1272 -0.1885 33  THR C CG2 
3369 N N   . THR C 34  ? 0.5237 0.9644 1.0160 -0.0091 -0.0534 -0.3759 34  THR C N   
3370 C CA  . THR C 34  ? 0.4246 0.9343 0.8791 -0.0597 -0.0164 -0.4209 34  THR C CA  
3371 C C   . THR C 34  ? 0.5719 1.0318 0.8518 -0.0979 0.0100  -0.3861 34  THR C C   
3372 O O   . THR C 34  ? 0.7047 1.1854 0.9088 -0.1495 0.0447  -0.3964 34  THR C O   
3373 C CB  . THR C 34  ? 0.5746 1.1529 1.0756 -0.0497 0.0008  -0.4894 34  THR C CB  
3374 O OG1 . THR C 34  ? 0.6343 1.2385 1.1218 -0.0390 -0.0058 -0.5093 34  THR C OG1 
3375 C CG2 . THR C 34  ? 0.4881 1.0161 1.0698 -0.0054 -0.0246 -0.4957 34  THR C CG2 
3376 N N   . GLU C 35  ? 0.5809 0.9676 0.7953 -0.0727 -0.0093 -0.3425 35  GLU C N   
3377 C CA  . GLU C 35  ? 0.6991 1.0157 0.7451 -0.1006 0.0018  -0.3029 35  GLU C CA  
3378 C C   . GLU C 35  ? 0.7170 0.9241 0.6871 -0.0966 -0.0092 -0.2309 35  GLU C C   
3379 O O   . GLU C 35  ? 0.7383 0.8665 0.5770 -0.1114 -0.0137 -0.1915 35  GLU C O   
3380 C CB  . GLU C 35  ? 0.7474 1.0521 0.7667 -0.0737 -0.0186 -0.3087 35  GLU C CB  
3381 C CG  . GLU C 35  ? 0.6437 1.0593 0.7280 -0.0772 -0.0091 -0.3853 35  GLU C CG  
3382 N N   . VAL C 36  ? 0.4900 0.6923 0.5437 -0.0765 -0.0182 -0.2163 36  VAL C N   
3383 C CA  . VAL C 36  ? 0.5469 0.6601 0.5454 -0.0677 -0.0296 -0.1570 36  VAL C CA  
3384 C C   . VAL C 36  ? 0.7560 0.8711 0.7498 -0.0992 -0.0114 -0.1504 36  VAL C C   
3385 O O   . VAL C 36  ? 0.6957 0.8785 0.7905 -0.1020 -0.0052 -0.1844 36  VAL C O   
3386 C CB  . VAL C 36  ? 0.5154 0.6133 0.6009 -0.0172 -0.0586 -0.1364 36  VAL C CB  
3387 C CG1 . VAL C 36  ? 0.6326 0.6510 0.6564 -0.0086 -0.0681 -0.0841 36  VAL C CG1 
3388 C CG2 . VAL C 36  ? 0.5778 0.6812 0.6854 0.0144  -0.0773 -0.1485 36  VAL C CG2 
3389 N N   . TYR C 37  ? 0.8632 0.9011 0.7447 -0.1211 -0.0082 -0.1095 37  TYR C N   
3390 C CA  . TYR C 37  ? 0.7495 0.7788 0.6200 -0.1498 0.0060  -0.0998 37  TYR C CA  
3391 C C   . TYR C 37  ? 0.7551 0.6987 0.5827 -0.1281 -0.0151 -0.0500 37  TYR C C   
3392 O O   . TYR C 37  ? 0.9260 0.7908 0.6502 -0.1331 -0.0268 -0.0194 37  TYR C O   
3393 C CB  . TYR C 37  ? 0.6608 0.6914 0.4353 -0.2127 0.0349  -0.1080 37  TYR C CB  
3394 C CG  . TYR C 37  ? 0.8183 0.8788 0.6175 -0.2483 0.0571  -0.1209 37  TYR C CG  
3395 C CD1 . TYR C 37  ? 0.7741 0.9420 0.6667 -0.2678 0.0810  -0.1802 37  TYR C CD1 
3396 C CD2 . TYR C 37  ? 0.8963 0.8814 0.6343 -0.2604 0.0509  -0.0805 37  TYR C CD2 
3397 C CE1 . TYR C 37  ? 0.7388 0.9381 0.6624 -0.2991 0.0992  -0.1980 37  TYR C CE1 
3398 C CE2 . TYR C 37  ? 0.9111 0.9242 0.6760 -0.2922 0.0695  -0.0947 37  TYR C CE2 
3399 C CZ  . TYR C 37  ? 0.9017 1.0219 0.7589 -0.3119 0.0943  -0.1530 37  TYR C CZ  
3400 O OH  . TYR C 37  ? 0.9560 1.1081 0.8481 -0.3423 0.1109  -0.1729 37  TYR C OH  
3401 N N   . VAL C 38  ? 0.7672 0.7273 0.6751 -0.1044 -0.0239 -0.0448 38  VAL C N   
3402 C CA  . VAL C 38  ? 0.6542 0.5528 0.5334 -0.0819 -0.0421 -0.0065 38  VAL C CA  
3403 C C   . VAL C 38  ? 0.6693 0.5556 0.5351 -0.1051 -0.0340 0.0008  38  VAL C C   
3404 O O   . VAL C 38  ? 0.7691 0.7107 0.7071 -0.1158 -0.0248 -0.0213 38  VAL C O   
3405 C CB  . VAL C 38  ? 0.5645 0.4874 0.5309 -0.0393 -0.0608 0.0011  38  VAL C CB  
3406 C CG1 . VAL C 38  ? 0.6196 0.4955 0.5534 -0.0204 -0.0745 0.0331  38  VAL C CG1 
3407 C CG2 . VAL C 38  ? 0.6074 0.5425 0.5959 -0.0153 -0.0706 -0.0079 38  VAL C CG2 
3408 N N   . LYS C 39  ? 0.6806 0.4932 0.4602 -0.1107 -0.0427 0.0278  39  LYS C N   
3409 C CA  . LYS C 39  ? 0.7280 0.5219 0.4943 -0.1281 -0.0400 0.0353  39  LYS C CA  
3410 C C   . LYS C 39  ? 0.9025 0.6439 0.6425 -0.0967 -0.0639 0.0599  39  LYS C C   
3411 O O   . LYS C 39  ? 0.9482 0.6284 0.6243 -0.0844 -0.0821 0.0739  39  LYS C O   
3412 C CB  . LYS C 39  ? 0.8438 0.6030 0.5292 -0.1804 -0.0253 0.0357  39  LYS C CB  
3413 C CG  . LYS C 39  ? 1.0185 0.8525 0.7419 -0.2217 0.0066  0.0004  39  LYS C CG  
3414 C CD  . LYS C 39  ? 1.0980 0.9034 0.7463 -0.2817 0.0243  0.0038  39  LYS C CD  
3415 C CE  . LYS C 39  ? 1.1211 0.8381 0.6433 -0.3037 0.0115  0.0370  39  LYS C CE  
3416 N NZ  . LYS C 39  ? 1.1055 0.7918 0.5489 -0.3729 0.0277  0.0460  39  LYS C NZ  
3417 N N   . TRP C 40  ? 0.8505 0.6195 0.6418 -0.0836 -0.0670 0.0609  40  TRP C N   
3418 C CA  . TRP C 40  ? 0.7765 0.5129 0.5455 -0.0586 -0.0854 0.0755  40  TRP C CA  
3419 C C   . TRP C 40  ? 0.8287 0.5272 0.5566 -0.0813 -0.0871 0.0762  40  TRP C C   
3420 O O   . TRP C 40  ? 0.8298 0.5591 0.5897 -0.1047 -0.0742 0.0658  40  TRP C O   
3421 C CB  . TRP C 40  ? 0.6619 0.4527 0.5008 -0.0334 -0.0900 0.0795  40  TRP C CB  
3422 C CG  . TRP C 40  ? 0.6554 0.4652 0.5204 -0.0053 -0.0965 0.0851  40  TRP C CG  
3423 C CD1 . TRP C 40  ? 0.6920 0.5398 0.6126 -0.0018 -0.0929 0.0803  40  TRP C CD1 
3424 C CD2 . TRP C 40  ? 0.7035 0.5009 0.5485 0.0229  -0.1088 0.0906  40  TRP C CD2 
3425 N NE1 . TRP C 40  ? 0.6437 0.4989 0.5776 0.0247  -0.1015 0.0873  40  TRP C NE1 
3426 C CE2 . TRP C 40  ? 0.6565 0.4853 0.5452 0.0394  -0.1095 0.0919  40  TRP C CE2 
3427 C CE3 . TRP C 40  ? 0.8085 0.5771 0.6108 0.0364  -0.1207 0.0879  40  TRP C CE3 
3428 C CZ2 . TRP C 40  ? 0.6447 0.4808 0.5350 0.0658  -0.1178 0.0911  40  TRP C CZ2 
3429 C CZ3 . TRP C 40  ? 0.8203 0.6005 0.6271 0.0653  -0.1302 0.0819  40  TRP C CZ3 
3430 C CH2 . TRP C 40  ? 0.6810 0.4964 0.5309 0.0781  -0.1268 0.0839  40  TRP C CH2 
3431 N N   . LYS C 41  ? 0.8744 0.5058 0.5391 -0.0730 -0.1073 0.0843  41  LYS C N   
3432 C CA  . LYS C 41  ? 0.9257 0.5108 0.5518 -0.0938 -0.1154 0.0848  41  LYS C CA  
3433 C C   . LYS C 41  ? 0.9966 0.5766 0.6299 -0.0608 -0.1363 0.0798  41  LYS C C   
3434 O O   . LYS C 41  ? 0.9525 0.5376 0.5906 -0.0246 -0.1504 0.0768  41  LYS C O   
3435 C CB  . LYS C 41  ? 0.9830 0.4817 0.5252 -0.1201 -0.1298 0.0967  41  LYS C CB  
3436 C CG  . LYS C 41  ? 1.1338 0.6427 0.6531 -0.1623 -0.1061 0.0997  41  LYS C CG  
3437 C CD  . LYS C 41  ? 1.3285 0.7611 0.7644 -0.1861 -0.1250 0.1128  41  LYS C CD  
3438 C CE  . LYS C 41  ? 1.5027 0.9524 0.9028 -0.2370 -0.0979 0.1152  41  LYS C CE  
3439 N NZ  . LYS C 41  ? 1.5040 0.9908 0.9157 -0.2913 -0.0634 0.1072  41  LYS C NZ  
3440 N N   . PHE C 42  ? 1.0387 0.6169 0.6764 -0.0748 -0.1372 0.0734  42  PHE C N   
3441 C CA  . PHE C 42  ? 0.8948 0.4716 0.5349 -0.0475 -0.1573 0.0623  42  PHE C CA  
3442 C C   . PHE C 42  ? 0.9439 0.4678 0.5558 -0.0711 -0.1701 0.0565  42  PHE C C   
3443 O O   . PHE C 42  ? 0.9061 0.4514 0.5393 -0.1001 -0.1541 0.0538  42  PHE C O   
3444 C CB  . PHE C 42  ? 0.8239 0.4824 0.5194 -0.0318 -0.1462 0.0587  42  PHE C CB  
3445 C CG  . PHE C 42  ? 1.0018 0.6740 0.6949 -0.0082 -0.1629 0.0436  42  PHE C CG  
3446 C CD1 . PHE C 42  ? 1.0089 0.6882 0.6922 0.0251  -0.1768 0.0313  42  PHE C CD1 
3447 C CD2 . PHE C 42  ? 0.9113 0.5975 0.6164 -0.0190 -0.1651 0.0350  42  PHE C CD2 
3448 C CE1 . PHE C 42  ? 0.9195 0.6260 0.6030 0.0456  -0.1899 0.0084  42  PHE C CE1 
3449 C CE2 . PHE C 42  ? 0.8902 0.5961 0.5908 0.0026  -0.1806 0.0166  42  PHE C CE2 
3450 C CZ  . PHE C 42  ? 0.9473 0.6667 0.6361 0.0342  -0.1917 0.0020  42  PHE C CZ  
3451 N N   . LYS C 43  ? 0.9524 0.4066 0.5238 -0.0581 -0.2032 0.0511  43  LYS C N   
3452 C CA  . LYS C 43  ? 1.1460 0.5341 0.6896 -0.0803 -0.2247 0.0472  43  LYS C CA  
3453 C C   . LYS C 43  ? 1.4305 0.7826 0.9436 -0.1397 -0.2071 0.0670  43  LYS C C   
3454 O O   . LYS C 43  ? 1.5679 0.9137 1.0877 -0.1710 -0.2019 0.0625  43  LYS C O   
3455 C CB  . LYS C 43  ? 1.1399 0.5748 0.7232 -0.0685 -0.2248 0.0253  43  LYS C CB  
3456 C CG  . LYS C 43  ? 1.1868 0.6657 0.7915 -0.0176 -0.2405 0.0012  43  LYS C CG  
3457 C CD  . LYS C 43  ? 1.1215 0.6454 0.7538 -0.0102 -0.2427 -0.0205 43  LYS C CD  
3458 N N   . GLY C 44  ? 1.4801 0.8156 0.9603 -0.1571 -0.1967 0.0857  44  GLY C N   
3459 C CA  . GLY C 44  ? 1.4718 0.8022 0.9224 -0.2131 -0.1747 0.0980  44  GLY C CA  
3460 C C   . GLY C 44  ? 1.3785 0.7783 0.8718 -0.2477 -0.1309 0.0897  44  GLY C C   
3461 O O   . GLY C 44  ? 1.5003 0.9086 0.9841 -0.2980 -0.1103 0.0883  44  GLY C O   
3462 N N   . ARG C 45  ? 1.1712 0.6530 0.7310 -0.2116 -0.1161 0.0756  45  ARG C N   
3463 C CA  . ARG C 45  ? 1.0562 0.6239 0.6820 -0.2299 -0.0830 0.0573  45  ARG C CA  
3464 C C   . ARG C 45  ? 1.0223 0.6499 0.6896 -0.2055 -0.0703 0.0545  45  ARG C C   
3465 O O   . ARG C 45  ? 1.0417 0.6746 0.7201 -0.1612 -0.0856 0.0618  45  ARG C O   
3466 C CB  . ARG C 45  ? 0.9833 0.5895 0.6665 -0.2138 -0.0884 0.0400  45  ARG C CB  
3467 C CG  . ARG C 45  ? 1.1967 0.7637 0.8622 -0.2465 -0.0943 0.0333  45  ARG C CG  
3468 C CD  . ARG C 45  ? 1.1684 0.7783 0.8924 -0.2264 -0.1026 0.0129  45  ARG C CD  
3469 N NE  . ARG C 45  ? 1.0674 0.7600 0.8673 -0.2308 -0.0834 -0.0068 45  ARG C NE  
3470 C CZ  . ARG C 45  ? 1.0980 0.8410 0.9443 -0.1937 -0.0910 -0.0070 45  ARG C CZ  
3471 N NH1 . ARG C 45  ? 1.0238 0.7537 0.8451 -0.1539 -0.1088 0.0110  45  ARG C NH1 
3472 N NH2 . ARG C 45  ? 1.0400 0.8475 0.9608 -0.1988 -0.0834 -0.0270 45  ARG C NH2 
3473 N N   . ASP C 46  ? 0.9943 0.6724 0.6893 -0.2365 -0.0426 0.0395  46  ASP C N   
3474 C CA  . ASP C 46  ? 0.9359 0.6749 0.6848 -0.2151 -0.0337 0.0303  46  ASP C CA  
3475 C C   . ASP C 46  ? 0.9641 0.7614 0.8009 -0.1835 -0.0424 0.0190  46  ASP C C   
3476 O O   . ASP C 46  ? 1.1569 1.0069 1.0581 -0.1992 -0.0335 -0.0071 46  ASP C O   
3477 C CB  . ASP C 46  ? 1.0086 0.7949 0.7702 -0.2577 -0.0033 0.0067  46  ASP C CB  
3478 C CG  . ASP C 46  ? 1.0423 0.7700 0.7025 -0.2975 0.0039  0.0242  46  ASP C CG  
3479 O OD1 . ASP C 46  ? 0.9898 0.6501 0.5878 -0.2750 -0.0192 0.0523  46  ASP C OD1 
3480 O OD2 . ASP C 46  ? 1.1166 0.8667 0.7588 -0.3537 0.0308  0.0089  46  ASP C OD2 
3481 N N   . ILE C 47  ? 0.9161 0.7048 0.7551 -0.1415 -0.0625 0.0375  47  ILE C N   
3482 C CA  . ILE C 47  ? 0.8283 0.6617 0.7322 -0.1169 -0.0762 0.0372  47  ILE C CA  
3483 C C   . ILE C 47  ? 0.7526 0.6355 0.7233 -0.1029 -0.0776 0.0345  47  ILE C C   
3484 O O   . ILE C 47  ? 0.7224 0.6424 0.7572 -0.0913 -0.0932 0.0337  47  ILE C O   
3485 C CB  . ILE C 47  ? 0.8093 0.6189 0.6788 -0.0867 -0.0951 0.0568  47  ILE C CB  
3486 C CG1 . ILE C 47  ? 0.7718 0.5594 0.6062 -0.0641 -0.0983 0.0709  47  ILE C CG1 
3487 C CG2 . ILE C 47  ? 0.7903 0.5554 0.6115 -0.0972 -0.1009 0.0519  47  ILE C CG2 
3488 C CD1 . ILE C 47  ? 0.6638 0.4963 0.5433 -0.0400 -0.1039 0.0829  47  ILE C CD1 
3489 N N   . TYR C 48  ? 0.7738 0.6521 0.7289 -0.1042 -0.0668 0.0336  48  TYR C N   
3490 C CA  . TYR C 48  ? 0.6806 0.6072 0.7063 -0.0947 -0.0680 0.0222  48  TYR C CA  
3491 C C   . TYR C 48  ? 0.7748 0.7059 0.7788 -0.1148 -0.0474 0.0035  48  TYR C C   
3492 O O   . TYR C 48  ? 0.8404 0.7213 0.7597 -0.1256 -0.0400 0.0159  48  TYR C O   
3493 C CB  . TYR C 48  ? 0.6507 0.5772 0.6896 -0.0610 -0.0853 0.0480  48  TYR C CB  
3494 C CG  . TYR C 48  ? 0.5520 0.5222 0.6712 -0.0511 -0.0927 0.0374  48  TYR C CG  
3495 C CD1 . TYR C 48  ? 0.5806 0.5884 0.7875 -0.0474 -0.1138 0.0312  48  TYR C CD1 
3496 C CD2 . TYR C 48  ? 0.6195 0.5893 0.7301 -0.0445 -0.0850 0.0316  48  TYR C CD2 
3497 C CE1 . TYR C 48  ? 0.4668 0.5091 0.7566 -0.0371 -0.1285 0.0186  48  TYR C CE1 
3498 C CE2 . TYR C 48  ? 0.6760 0.6869 0.8677 -0.0339 -0.0949 0.0171  48  TYR C CE2 
3499 C CZ  . TYR C 48  ? 0.7033 0.7496 0.9875 -0.0301 -0.1174 0.0101  48  TYR C CZ  
3500 O OH  . TYR C 48  ? 0.8181 0.8999 1.1922 -0.0181 -0.1352 -0.0069 48  TYR C OH  
3501 N N   . THR C 49  ? 0.6960 0.6873 0.7772 -0.1201 -0.0426 -0.0284 49  THR C N   
3502 C CA  . THR C 49  ? 0.6258 0.6392 0.6920 -0.1409 -0.0214 -0.0534 49  THR C CA  
3503 C C   . THR C 49  ? 0.6025 0.6800 0.7696 -0.1224 -0.0305 -0.0833 49  THR C C   
3504 O O   . THR C 49  ? 0.5584 0.6816 0.8235 -0.1146 -0.0458 -0.1066 49  THR C O   
3505 C CB  . THR C 49  ? 0.7003 0.7370 0.7464 -0.1902 0.0068  -0.0838 49  THR C CB  
3506 O OG1 . THR C 49  ? 0.6818 0.6506 0.6369 -0.2092 0.0098  -0.0544 49  THR C OG1 
3507 C CG2 . THR C 49  ? 0.7848 0.8522 0.8017 -0.2188 0.0316  -0.1094 49  THR C CG2 
3508 N N   . PHE C 50  ? 0.7353 0.8119 0.8820 -0.1135 -0.0273 -0.0842 50  PHE C N   
3509 C CA  . PHE C 50  ? 0.6523 0.7910 0.8957 -0.0974 -0.0364 -0.1194 50  PHE C CA  
3510 C C   . PHE C 50  ? 0.6271 0.8096 0.8478 -0.1263 -0.0087 -0.1617 50  PHE C C   
3511 O O   . PHE C 50  ? 0.7067 0.8536 0.8378 -0.1327 0.0009  -0.1452 50  PHE C O   
3512 C CB  . PHE C 50  ? 0.5186 0.6325 0.7772 -0.0589 -0.0602 -0.0901 50  PHE C CB  
3513 C CG  . PHE C 50  ? 0.5844 0.7548 0.9438 -0.0414 -0.0743 -0.1258 50  PHE C CG  
3514 C CD1 . PHE C 50  ? 0.5583 0.7673 1.0394 -0.0272 -0.1031 -0.1436 50  PHE C CD1 
3515 C CD2 . PHE C 50  ? 0.5034 0.6848 0.8378 -0.0386 -0.0650 -0.1432 50  PHE C CD2 
3516 C CE1 . PHE C 50  ? 0.5839 0.8004 1.1004 -0.0047 -0.1079 -0.1642 50  PHE C CE1 
3517 C CE2 . PHE C 50  ? 0.5318 0.7685 0.9658 -0.0205 -0.0804 -0.1818 50  PHE C CE2 
3518 C CZ  . PHE C 50  ? 0.5403 0.7815 1.0519 -0.0019 -0.0990 -0.1879 50  PHE C CZ  
3519 N N   . ASP C 51  ? 0.5797 0.8430 0.8822 -0.1447 0.0018  -0.2195 51  ASP C N   
3520 C CA  . ASP C 51  ? 0.6619 0.9908 0.9537 -0.1768 0.0318  -0.2709 51  ASP C CA  
3521 C C   . ASP C 51  ? 0.6130 0.9964 0.9961 -0.1452 0.0140  -0.3085 51  ASP C C   
3522 O O   . ASP C 51  ? 0.6033 1.0133 1.0744 -0.1125 0.0010  -0.3353 51  ASP C O   
3523 C CB  . ASP C 51  ? 0.6776 1.0792 1.0155 -0.2133 0.0563  -0.3246 51  ASP C CB  
3524 C CG  . ASP C 51  ? 0.6935 1.1530 0.9705 -0.2656 0.1005  -0.3646 51  ASP C CG  
3525 O OD1 . ASP C 51  ? 0.7009 1.1822 0.9552 -0.2655 0.1045  -0.3784 51  ASP C OD1 
3526 O OD2 . ASP C 51  ? 0.7690 1.2494 1.0128 -0.3057 0.1313  -0.3795 51  ASP C OD2 
3527 N N   . GLY C 52  ? 0.7134 0.8489 0.8059 0.0969  -0.0102 0.0202  52  GLY C N   
3528 C CA  . GLY C 52  ? 0.6839 0.8088 0.7275 0.1041  -0.0615 0.0233  52  GLY C CA  
3529 C C   . GLY C 52  ? 0.7655 0.9056 0.7697 0.1315  -0.0888 -0.0005 52  GLY C C   
3530 O O   . GLY C 52  ? 0.7373 0.8572 0.7030 0.1343  -0.1379 -0.0233 52  GLY C O   
3531 N N   . ALA C 53  ? 0.7748 0.9466 0.7933 0.1533  -0.0502 0.0060  53  ALA C N   
3532 C CA  . ALA C 53  ? 0.6781 0.8647 0.6577 0.1847  -0.0660 -0.0121 53  ALA C CA  
3533 C C   . ALA C 53  ? 0.7668 0.9336 0.7354 0.1794  -0.0920 -0.0618 53  ALA C C   
3534 O O   . ALA C 53  ? 0.8423 1.0075 0.7658 0.1970  -0.1306 -0.0844 53  ALA C O   
3535 C CB  . ALA C 53  ? 0.7748 0.9900 0.7775 0.2136  -0.0006 0.0144  53  ALA C CB  
3536 N N   . LEU C 54  ? 0.6732 0.8286 0.6827 0.1601  -0.0740 -0.0830 54  LEU C N   
3537 C CA  . LEU C 54  ? 0.7473 0.8902 0.7476 0.1639  -0.1007 -0.1357 54  LEU C CA  
3538 C C   . LEU C 54  ? 0.7642 0.8637 0.7207 0.1539  -0.1435 -0.1465 54  LEU C C   
3539 O O   . LEU C 54  ? 0.7983 0.8805 0.7259 0.1663  -0.1739 -0.1863 54  LEU C O   
3540 C CB  . LEU C 54  ? 0.6668 0.8347 0.7487 0.1623  -0.0547 -0.1673 54  LEU C CB  
3541 C CG  . LEU C 54  ? 0.6379 0.8378 0.7765 0.1770  0.0020  -0.1620 54  LEU C CG  
3542 C CD1 . LEU C 54  ? 0.6072 0.8311 0.8611 0.1689  0.0541  -0.2006 54  LEU C CD1 
3543 C CD2 . LEU C 54  ? 0.5731 0.7741 0.6661 0.2009  -0.0263 -0.1836 54  LEU C CD2 
3544 N N   . ASN C 55  ? 0.8029 0.8828 0.7551 0.1367  -0.1406 -0.1088 55  ASN C N   
3545 C CA  . ASN C 55  ? 0.7772 0.8055 0.6920 0.1298  -0.1639 -0.1056 55  ASN C CA  
3546 C C   . ASN C 55  ? 0.7590 0.7724 0.6640 0.1410  -0.1608 -0.1373 55  ASN C C   
3547 O O   . ASN C 55  ? 0.8281 0.8037 0.6757 0.1607  -0.1915 -0.1582 55  ASN C O   
3548 C CB  . ASN C 55  ? 0.9191 0.9145 0.7830 0.1392  -0.2098 -0.1153 55  ASN C CB  
3549 C CG  . ASN C 55  ? 1.1842 1.1274 1.0382 0.1258  -0.2155 -0.0889 55  ASN C CG  
3550 O OD1 . ASN C 55  ? 1.1352 1.0858 1.0281 0.1064  -0.1982 -0.0578 55  ASN C OD1 
3551 N ND2 . ASN C 55  ? 1.4622 1.3494 1.2698 0.1389  -0.2343 -0.1001 55  ASN C ND2 
3552 N N   . LYS C 56  ? 0.5662 0.6107 0.5282 0.1343  -0.1238 -0.1438 56  LYS C N   
3553 C CA  . LYS C 56  ? 0.6600 0.7056 0.6234 0.1520  -0.1257 -0.1879 56  LYS C CA  
3554 C C   . LYS C 56  ? 0.6556 0.7113 0.6672 0.1376  -0.0868 -0.1748 56  LYS C C   
3555 O O   . LYS C 56  ? 0.6507 0.7349 0.7302 0.1140  -0.0462 -0.1475 56  LYS C O   
3556 C CB  . LYS C 56  ? 0.6446 0.7372 0.6571 0.1679  -0.1285 -0.2488 56  LYS C CB  
3557 C CG  . LYS C 56  ? 0.8253 0.9271 0.8333 0.1992  -0.1510 -0.3146 56  LYS C CG  
3558 C CD  . LYS C 56  ? 0.8102 0.9694 0.9052 0.2095  -0.1473 -0.3837 56  LYS C CD  
3559 C CE  . LYS C 56  ? 0.8772 1.0622 0.9783 0.2316  -0.1778 -0.4143 56  LYS C CE  
3560 N NZ  . LYS C 56  ? 0.9615 1.1027 0.9582 0.2622  -0.2184 -0.3893 56  LYS C NZ  
3561 N N   . SER C 57  ? 0.6895 0.7199 0.6592 0.1585  -0.0976 -0.1935 57  SER C N   
3562 C CA  . SER C 57  ? 0.7311 0.7722 0.7415 0.1511  -0.0647 -0.1913 57  SER C CA  
3563 C C   . SER C 57  ? 0.6988 0.7946 0.7752 0.1712  -0.0644 -0.2690 57  SER C C   
3564 O O   . SER C 57  ? 0.8076 0.9133 0.8546 0.2072  -0.1033 -0.3274 57  SER C O   
3565 C CB  . SER C 57  ? 0.8621 0.8405 0.7848 0.1686  -0.0701 -0.1624 57  SER C CB  
3566 O OG  . SER C 57  ? 0.9295 0.8612 0.8256 0.1447  -0.0630 -0.0978 57  SER C OG  
3567 N N   . THR C 58  ? 0.7008 0.8347 0.8774 0.1494  -0.0204 -0.2747 58  THR C N   
3568 C CA  . THR C 58  ? 0.7154 0.9089 0.9922 0.1630  -0.0133 -0.3579 58  THR C CA  
3569 C C   . THR C 58  ? 0.6077 0.8110 0.9136 0.1669  0.0054  -0.3742 58  THR C C   
3570 O O   . THR C 58  ? 0.4933 0.6882 0.8364 0.1339  0.0504  -0.3204 58  THR C O   
3571 C CB  . THR C 58  ? 0.6722 0.9123 1.0854 0.1343  0.0359  -0.3653 58  THR C CB  
3572 O OG1 . THR C 58  ? 0.5498 0.7935 0.9450 0.1447  0.0127  -0.3803 58  THR C OG1 
3573 C CG2 . THR C 58  ? 0.7695 1.0479 1.2837 0.1158  0.0498  -0.4098 58  THR C CG2 
3574 N N   . VAL C 59  ? 0.4881 0.8860 0.9358 0.0882  -0.1788 -0.2531 59  VAL C N   
3575 C CA  . VAL C 59  ? 0.6033 0.9652 0.9926 0.0697  -0.1883 -0.2291 59  VAL C CA  
3576 C C   . VAL C 59  ? 0.4589 0.8777 0.9157 0.0764  -0.2171 -0.2652 59  VAL C C   
3577 O O   . VAL C 59  ? 0.5013 0.9553 1.0194 0.1089  -0.2563 -0.2979 59  VAL C O   
3578 C CB  . VAL C 59  ? 0.7608 1.0220 1.0503 0.0861  -0.2282 -0.1920 59  VAL C CB  
3579 C CG1 . VAL C 59  ? 0.7947 0.9978 1.0145 0.0677  -0.1940 -0.1540 59  VAL C CG1 
3580 C CG2 . VAL C 59  ? 0.8247 1.0698 1.1398 0.1342  -0.2828 -0.2078 59  VAL C CG2 
3581 N N   . PRO C 60  ? 0.5027 0.9342 0.9536 0.0453  -0.1960 -0.2624 60  PRO C N   
3582 C CA  . PRO C 60  ? 0.4568 0.9378 0.9659 0.0472  -0.2276 -0.3021 60  PRO C CA  
3583 C C   . PRO C 60  ? 0.5313 0.9684 0.9732 0.0797  -0.2980 -0.2975 60  PRO C C   
3584 O O   . PRO C 60  ? 0.7077 1.0654 1.0553 0.0957  -0.3126 -0.2551 60  PRO C O   
3585 C CB  . PRO C 60  ? 0.4976 0.9863 1.0072 0.0019  -0.1761 -0.2951 60  PRO C CB  
3586 C CG  . PRO C 60  ? 0.4350 0.8506 0.8393 -0.0143 -0.1398 -0.2378 60  PRO C CG  
3587 C CD  . PRO C 60  ? 0.5135 0.9221 0.9139 0.0061  -0.1361 -0.2263 60  PRO C CD  
3588 N N   . THR C 61  ? 0.6264 1.1200 1.1190 0.0913  -0.3387 -0.3400 61  THR C N   
3589 C CA  . THR C 61  ? 0.7034 1.1672 1.1305 0.1318  -0.3989 -0.3321 61  THR C CA  
3590 C C   . THR C 61  ? 0.7264 1.1359 1.0470 0.1248  -0.4137 -0.3026 61  THR C C   
3591 O O   . THR C 61  ? 0.8382 1.2039 1.0787 0.1627  -0.4534 -0.2742 61  THR C O   
3592 C CB  . THR C 61  ? 0.7589 1.2866 1.2486 0.1444  -0.4179 -0.3766 61  THR C CB  
3593 O OG1 . THR C 61  ? 0.9032 1.4135 1.3287 0.1888  -0.4713 -0.3648 61  THR C OG1 
3594 C CG2 . THR C 61  ? 0.7755 1.3415 1.3054 0.1017  -0.3896 -0.4085 61  THR C CG2 
3595 N N   . ASP C 62  ? 0.7726 1.1724 1.0828 0.0767  -0.3655 -0.2981 62  ASP C N   
3596 C CA  . ASP C 62  ? 0.8395 1.1791 1.0414 0.0666  -0.3667 -0.2658 62  ASP C CA  
3597 C C   . ASP C 62  ? 0.8781 1.1197 0.9753 0.0670  -0.3428 -0.1950 62  ASP C C   
3598 O O   . ASP C 62  ? 0.9386 1.1190 0.9326 0.0697  -0.3497 -0.1560 62  ASP C O   
3599 C CB  . ASP C 62  ? 0.9319 1.2963 1.1687 0.0155  -0.3195 -0.2894 62  ASP C CB  
3600 C CG  . ASP C 62  ? 1.0269 1.3928 1.3122 -0.0236 -0.2414 -0.2731 62  ASP C CG  
3601 O OD1 . ASP C 62  ? 1.1204 1.5043 1.4505 -0.0118 -0.2311 -0.2698 62  ASP C OD1 
3602 O OD2 . ASP C 62  ? 0.9824 1.3354 1.2608 -0.0625 -0.1886 -0.2630 62  ASP C OD2 
3603 N N   . PHE C 63  ? 0.7552 0.9879 0.8833 0.0647  -0.3144 -0.1819 63  PHE C N   
3604 C CA  . PHE C 63  ? 0.7195 0.8699 0.7670 0.0651  -0.2940 -0.1250 63  PHE C CA  
3605 C C   . PHE C 63  ? 0.8359 0.9706 0.9052 0.1050  -0.3236 -0.1238 63  PHE C C   
3606 O O   . PHE C 63  ? 0.7950 0.9172 0.8828 0.0964  -0.2928 -0.1163 63  PHE C O   
3607 C CB  . PHE C 63  ? 0.7209 0.8761 0.7796 0.0211  -0.2224 -0.1105 63  PHE C CB  
3608 C CG  . PHE C 63  ? 0.7076 0.8395 0.7084 -0.0145 -0.1847 -0.0849 63  PHE C CG  
3609 C CD1 . PHE C 63  ? 0.7367 0.9218 0.7940 -0.0390 -0.1645 -0.1188 63  PHE C CD1 
3610 C CD2 . PHE C 63  ? 0.7170 0.7729 0.6135 -0.0241 -0.1661 -0.0277 63  PHE C CD2 
3611 C CE1 . PHE C 63  ? 0.7478 0.9065 0.7558 -0.0706 -0.1253 -0.0959 63  PHE C CE1 
3612 C CE2 . PHE C 63  ? 0.7262 0.7603 0.5681 -0.0544 -0.1293 -0.0020 63  PHE C CE2 
3613 C CZ  . PHE C 63  ? 0.7077 0.7911 0.6042 -0.0769 -0.1081 -0.0360 63  PHE C CZ  
3614 N N   . SER C 64  ? 0.7715 0.8247 0.8825 0.1504  -0.3664 -0.1168 64  SER C N   
3615 C CA  . SER C 64  ? 0.8659 0.9065 0.9907 0.1962  -0.4160 -0.1325 64  SER C CA  
3616 C C   . SER C 64  ? 0.8542 0.7902 0.8873 0.2017  -0.4124 -0.0785 64  SER C C   
3617 O O   . SER C 64  ? 0.9254 0.8502 0.9751 0.2277  -0.4319 -0.0857 64  SER C O   
3618 C CB  . SER C 64  ? 0.8952 0.9292 1.0071 0.2462  -0.4940 -0.1674 64  SER C CB  
3619 O OG  . SER C 64  ? 1.0564 0.9898 1.0437 0.2499  -0.5137 -0.1281 64  SER C OG  
3620 N N   . SER C 65  ? 0.9085 0.7699 0.8472 0.1748  -0.3844 -0.0293 65  SER C N   
3621 C CA  . SER C 65  ? 1.0589 0.8182 0.9040 0.1718  -0.3758 0.0168  65  SER C CA  
3622 C C   . SER C 65  ? 0.9254 0.7083 0.7929 0.1302  -0.3096 0.0416  65  SER C C   
3623 O O   . SER C 65  ? 1.0638 0.7807 0.8710 0.1195  -0.2931 0.0728  65  SER C O   
3624 C CB  . SER C 65  ? 1.0278 0.6818 0.7450 0.1686  -0.3884 0.0497  65  SER C CB  
3625 O OG  . SER C 65  ? 1.0048 0.6849 0.7189 0.1296  -0.3442 0.0630  65  SER C OG  
3626 N N   . ALA C 66  ? 0.8685 0.7413 0.8168 0.1067  -0.2716 0.0250  66  ALA C N   
3627 C CA  . ALA C 66  ? 0.7356 0.6316 0.7005 0.0745  -0.2147 0.0453  66  ALA C CA  
3628 C C   . ALA C 66  ? 0.8469 0.7566 0.8503 0.0825  -0.2118 0.0394  66  ALA C C   
3629 O O   . ALA C 66  ? 0.8399 0.7975 0.9121 0.1018  -0.2317 0.0041  66  ALA C O   
3630 C CB  . ALA C 66  ? 0.6622 0.6302 0.6843 0.0517  -0.1776 0.0286  66  ALA C CB  
3631 N N   . LYS C 67  ? 0.8696 0.7428 0.8328 0.0658  -0.1853 0.0692  67  LYS C N   
3632 C CA  . LYS C 67  ? 0.9188 0.8005 0.9110 0.0689  -0.1789 0.0651  67  LYS C CA  
3633 C C   . LYS C 67  ? 1.0008 0.8719 0.9649 0.0404  -0.1373 0.0916  67  LYS C C   
3634 O O   . LYS C 67  ? 1.0688 0.9079 0.9783 0.0224  -0.1204 0.1141  67  LYS C O   
3635 C CB  . LYS C 67  ? 0.9253 0.7399 0.8815 0.0992  -0.2242 0.0612  67  LYS C CB  
3636 C CG  . LYS C 67  ? 1.0407 0.7458 0.8833 0.0943  -0.2327 0.0932  67  LYS C CG  
3637 N N   . ILE C 68  ? 0.8221 0.7259 0.8271 0.0367  -0.1213 0.0838  68  ILE C N   
3638 C CA  . ILE C 68  ? 0.7893 0.6929 0.7764 0.0136  -0.0882 0.1002  68  ILE C CA  
3639 C C   . ILE C 68  ? 0.8508 0.7175 0.8269 0.0158  -0.0966 0.0975  68  ILE C C   
3640 O O   . ILE C 68  ? 0.8726 0.7292 0.8707 0.0390  -0.1245 0.0807  68  ILE C O   
3641 C CB  . ILE C 68  ? 0.6300 0.6065 0.6663 0.0044  -0.0560 0.0933  68  ILE C CB  
3642 C CG1 . ILE C 68  ? 0.6149 0.6288 0.7089 0.0146  -0.0593 0.0692  68  ILE C CG1 
3643 C CG2 . ILE C 68  ? 0.6082 0.6089 0.6489 0.0025  -0.0452 0.0937  68  ILE C CG2 
3644 C CD1 . ILE C 68  ? 0.5571 0.6234 0.6789 0.0057  -0.0274 0.0635  68  ILE C CD1 
3645 N N   . GLU C 69  ? 0.8693 0.7177 0.8135 -0.0085 -0.0716 0.1097  69  GLU C N   
3646 C CA  . GLU C 69  ? 0.8807 0.6908 0.8100 -0.0141 -0.0719 0.1054  69  GLU C CA  
3647 C C   . GLU C 69  ? 0.8218 0.7035 0.8183 -0.0145 -0.0575 0.0879  69  GLU C C   
3648 O O   . GLU C 69  ? 0.6174 0.5497 0.6311 -0.0322 -0.0297 0.0877  69  GLU C O   
3649 C CB  . GLU C 69  ? 0.9984 0.7585 0.8645 -0.0476 -0.0464 0.1183  69  GLU C CB  
3650 C CG  . GLU C 69  ? 1.0858 0.7720 0.9098 -0.0576 -0.0468 0.1151  69  GLU C CG  
3651 N N   . VAL C 70  ? 0.7679 0.6536 0.8004 0.0078  -0.0784 0.0702  70  VAL C N   
3652 C CA  . VAL C 70  ? 0.7521 0.6998 0.8443 0.0082  -0.0651 0.0509  70  VAL C CA  
3653 C C   . VAL C 70  ? 0.8004 0.7437 0.8801 -0.0141 -0.0443 0.0504  70  VAL C C   
3654 O O   . VAL C 70  ? 0.8508 0.8534 0.9645 -0.0222 -0.0249 0.0407  70  VAL C O   
3655 C CB  . VAL C 70  ? 0.7351 0.6840 0.8690 0.0359  -0.0912 0.0262  70  VAL C CB  
3656 C CG1 . VAL C 70  ? 0.6081 0.6229 0.8015 0.0324  -0.0717 0.0040  70  VAL C CG1 
3657 C CG2 . VAL C 70  ? 0.7629 0.7214 0.9141 0.0575  -0.1156 0.0180  70  VAL C CG2 
3658 N N   . SER C 71  ? 0.9100 0.7776 0.9338 -0.0256 -0.0474 0.0588  71  SER C N   
3659 C CA  . SER C 71  ? 0.9129 0.7711 0.9232 -0.0532 -0.0249 0.0523  71  SER C CA  
3660 C C   . SER C 71  ? 0.9000 0.8153 0.9158 -0.0812 0.0056  0.0538  71  SER C C   
3661 O O   . SER C 71  ? 0.9797 0.9158 1.0016 -0.1053 0.0258  0.0400  71  SER C O   
3662 C CB  . SER C 71  ? 0.9810 0.7250 0.9147 -0.0630 -0.0308 0.0597  71  SER C CB  
3663 O OG  . SER C 71  ? 1.1568 0.8483 1.0277 -0.0752 -0.0274 0.0793  71  SER C OG  
3664 N N   . GLN C 72  ? 0.8832 0.8272 0.8996 -0.0763 0.0074  0.0660  72  GLN C N   
3665 C CA  . GLN C 72  ? 0.7453 0.7455 0.7689 -0.0942 0.0317  0.0642  72  GLN C CA  
3666 C C   . GLN C 72  ? 0.6267 0.7060 0.6945 -0.0741 0.0329  0.0601  72  GLN C C   
3667 O O   . GLN C 72  ? 0.7090 0.8382 0.7840 -0.0773 0.0464  0.0568  72  GLN C O   
3668 C CB  . GLN C 72  ? 0.6704 0.6324 0.6480 -0.1056 0.0377  0.0801  72  GLN C CB  
3669 C CG  . GLN C 72  ? 0.8488 0.7121 0.7578 -0.1291 0.0414  0.0862  72  GLN C CG  
3670 C CD  . GLN C 72  ? 1.0209 0.8884 0.9218 -0.1695 0.0734  0.0676  72  GLN C CD  
3671 O OE1 . GLN C 72  ? 1.1134 1.0661 1.0569 -0.1821 0.0935  0.0504  72  GLN C OE1 
3672 N NE2 . GLN C 72  ? 1.1608 0.9340 1.0045 -0.1892 0.0777  0.0672  72  GLN C NE2 
3673 N N   . LEU C 73  ? 0.6044 0.6902 0.6972 -0.0529 0.0197  0.0572  73  LEU C N   
3674 C CA  . LEU C 73  ? 0.6477 0.7850 0.7634 -0.0371 0.0253  0.0542  73  LEU C CA  
3675 C C   . LEU C 73  ? 0.6463 0.8355 0.7743 -0.0390 0.0367  0.0404  73  LEU C C   
3676 O O   . LEU C 73  ? 0.7328 0.9566 0.8537 -0.0291 0.0434  0.0422  73  LEU C O   
3677 C CB  . LEU C 73  ? 0.5944 0.7263 0.7353 -0.0225 0.0158  0.0458  73  LEU C CB  
3678 C CG  . LEU C 73  ? 0.6696 0.7858 0.8098 -0.0124 0.0075  0.0523  73  LEU C CG  
3679 C CD1 . LEU C 73  ? 0.5897 0.7196 0.7689 -0.0026 0.0039  0.0317  73  LEU C CD1 
3680 C CD2 . LEU C 73  ? 0.5704 0.7040 0.6901 -0.0117 0.0225  0.0647  73  LEU C CD2 
3681 N N   . LEU C 74  ? 0.6405 0.8315 0.7827 -0.0488 0.0364  0.0249  74  LEU C N   
3682 C CA  . LEU C 74  ? 0.6389 0.8813 0.7935 -0.0497 0.0430  0.0069  74  LEU C CA  
3683 C C   . LEU C 74  ? 0.7209 1.0035 0.8736 -0.0608 0.0506  -0.0014 74  LEU C C   
3684 O O   . LEU C 74  ? 0.7508 1.0886 0.9147 -0.0549 0.0508  -0.0197 74  LEU C O   
3685 C CB  . LEU C 74  ? 0.6047 0.8362 0.7751 -0.0610 0.0422  -0.0106 74  LEU C CB  
3686 C CG  . LEU C 74  ? 0.6696 0.8787 0.8546 -0.0478 0.0362  -0.0136 74  LEU C CG  
3687 C CD1 . LEU C 74  ? 0.7388 0.9361 0.9384 -0.0577 0.0361  -0.0332 74  LEU C CD1 
3688 C CD2 . LEU C 74  ? 0.6146 0.8539 0.7981 -0.0314 0.0426  -0.0148 74  LEU C CD2 
3689 N N   . LYS C 75  ? 0.6298 0.8867 0.7680 -0.0764 0.0562  0.0079  75  LYS C N   
3690 C CA  . LYS C 75  ? 0.5937 0.8942 0.7366 -0.0901 0.0682  -0.0055 75  LYS C CA  
3691 C C   . LYS C 75  ? 0.4438 0.7696 0.5794 -0.0651 0.0657  0.0057  75  LYS C C   
3692 O O   . LYS C 75  ? 0.5510 0.9204 0.6955 -0.0687 0.0737  -0.0077 75  LYS C O   
3693 C CB  . LYS C 75  ? 0.4829 0.7331 0.6037 -0.1265 0.0833  -0.0048 75  LYS C CB  
3694 C CG  . LYS C 75  ? 0.6801 0.8826 0.7920 -0.1510 0.0875  -0.0142 75  LYS C CG  
3695 C CD  . LYS C 75  ? 0.8854 1.0061 0.9481 -0.1850 0.1033  -0.0076 75  LYS C CD  
3696 C CE  . LYS C 75  ? 1.0324 1.0806 1.0690 -0.2033 0.1053  -0.0128 75  LYS C CE  
3697 N NZ  . LYS C 75  ? 1.1453 1.0857 1.1088 -0.2336 0.1200  -0.0024 75  LYS C NZ  
3698 N N   . GLY C 76  ? 0.5375 0.8355 0.6578 -0.0412 0.0567  0.0261  76  GLY C N   
3699 C CA  . GLY C 76  ? 0.5707 0.8760 0.6732 -0.0174 0.0564  0.0382  76  GLY C CA  
3700 C C   . GLY C 76  ? 0.5346 0.7932 0.6170 -0.0253 0.0598  0.0586  76  GLY C C   
3701 O O   . GLY C 76  ? 0.6010 0.8504 0.6645 -0.0081 0.0608  0.0711  76  GLY C O   
3702 N N   . ASP C 77  ? 0.5297 0.7496 0.6069 -0.0509 0.0613  0.0617  77  ASP C N   
3703 C CA  . ASP C 77  ? 0.5312 0.6993 0.5790 -0.0586 0.0611  0.0797  77  ASP C CA  
3704 C C   . ASP C 77  ? 0.6633 0.7930 0.7061 -0.0440 0.0459  0.0929  77  ASP C C   
3705 O O   . ASP C 77  ? 0.6993 0.8037 0.7505 -0.0445 0.0337  0.0897  77  ASP C O   
3706 C CB  . ASP C 77  ? 0.7480 0.8711 0.7725 -0.0901 0.0679  0.0777  77  ASP C CB  
3707 C CG  . ASP C 77  ? 0.8872 0.9444 0.8657 -0.0967 0.0648  0.0968  77  ASP C CG  
3708 O OD1 . ASP C 77  ? 0.8538 0.9214 0.8267 -0.0843 0.0656  0.1062  77  ASP C OD1 
3709 O OD2 . ASP C 77  ? 1.0634 1.0504 1.0029 -0.1131 0.0610  0.1021  77  ASP C OD2 
3710 N N   . ALA C 78  ? 0.5286 0.6567 0.5603 -0.0310 0.0473  0.1030  78  ALA C N   
3711 C CA  . ALA C 78  ? 0.5117 0.6138 0.5450 -0.0220 0.0365  0.1078  78  ALA C CA  
3712 C C   . ALA C 78  ? 0.6137 0.6811 0.6178 -0.0257 0.0328  0.1203  78  ALA C C   
3713 O O   . ALA C 78  ? 0.5881 0.6493 0.5920 -0.0184 0.0310  0.1215  78  ALA C O   
3714 C CB  . ALA C 78  ? 0.5530 0.6785 0.5950 -0.0076 0.0464  0.1031  78  ALA C CB  
3715 N N   . SER C 79  ? 0.4884 0.5304 0.4642 -0.0411 0.0350  0.1266  79  SER C N   
3716 C CA  . SER C 79  ? 0.6907 0.6938 0.6275 -0.0474 0.0337  0.1384  79  SER C CA  
3717 C C   . SER C 79  ? 0.7922 0.7523 0.7183 -0.0389 0.0068  0.1408  79  SER C C   
3718 O O   . SER C 79  ? 0.7728 0.7106 0.7049 -0.0337 -0.0129 0.1353  79  SER C O   
3719 C CB  . SER C 79  ? 0.6237 0.5985 0.5239 -0.0717 0.0466  0.1409  79  SER C CB  
3720 O OG  . SER C 79  ? 0.7333 0.7636 0.6543 -0.0782 0.0703  0.1299  79  SER C OG  
3721 N N   . LEU C 80  ? 0.6870 0.6377 0.5984 -0.0350 0.0042  0.1453  80  LEU C N   
3722 C CA  . LEU C 80  ? 0.6823 0.6053 0.5896 -0.0243 -0.0248 0.1404  80  LEU C CA  
3723 C C   . LEU C 80  ? 0.8498 0.7028 0.6907 -0.0299 -0.0410 0.1527  80  LEU C C   
3724 O O   . LEU C 80  ? 0.8170 0.6509 0.6168 -0.0453 -0.0223 0.1643  80  LEU C O   
3725 C CB  . LEU C 80  ? 0.6253 0.5765 0.5527 -0.0201 -0.0178 0.1327  80  LEU C CB  
3726 C CG  . LEU C 80  ? 0.6722 0.6165 0.6121 -0.0099 -0.0474 0.1166  80  LEU C CG  
3727 C CD1 . LEU C 80  ? 0.6070 0.5789 0.6016 0.0036  -0.0660 0.0935  80  LEU C CD1 
3728 C CD2 . LEU C 80  ? 0.6581 0.6233 0.6066 -0.0162 -0.0306 0.1083  80  LEU C CD2 
3729 N N   . LYS C 81  ? 0.8991 0.7086 0.7238 -0.0154 -0.0761 0.1482  81  LYS C N   
3730 C CA  . LYS C 81  ? 0.8880 0.6102 0.6294 -0.0159 -0.0968 0.1606  81  LYS C CA  
3731 C C   . LYS C 81  ? 0.9319 0.6408 0.6702 0.0106  -0.1402 0.1486  81  LYS C C   
3732 O O   . LYS C 81  ? 0.9284 0.6730 0.7234 0.0344  -0.1667 0.1266  81  LYS C O   
3733 C CB  . LYS C 81  ? 1.0476 0.7027 0.7439 -0.0185 -0.1041 0.1667  81  LYS C CB  
3734 C CG  . LYS C 81  ? 1.1198 0.7907 0.8191 -0.0496 -0.0611 0.1714  81  LYS C CG  
3735 N N   . MET C 82  ? 0.9970 0.6595 0.6718 0.0061  -0.1471 0.1584  82  MET C N   
3736 C CA  . MET C 82  ? 1.0390 0.6870 0.7022 0.0320  -0.1928 0.1439  82  MET C CA  
3737 C C   . MET C 82  ? 1.1989 0.7445 0.7455 0.0291  -0.2082 0.1627  82  MET C C   
3738 O O   . MET C 82  ? 1.2808 0.7800 0.7661 -0.0011 -0.1722 0.1847  82  MET C O   
3739 C CB  . MET C 82  ? 0.9945 0.7255 0.7267 0.0279  -0.1810 0.1248  82  MET C CB  
3740 C CG  . MET C 82  ? 0.8155 0.5356 0.5070 0.0025  -0.1483 0.1406  82  MET C CG  
3741 S SD  . MET C 82  ? 1.1138 0.9136 0.8734 -0.0058 -0.1274 0.1185  82  MET C SD  
3742 C CE  . MET C 82  ? 0.7639 0.6307 0.6015 -0.0117 -0.0911 0.1134  82  MET C CE  
3743 N N   . ASP C 83  ? 1.2510 0.7624 0.7654 0.0602  -0.2613 0.1501  83  ASP C N   
3744 C CA  . ASP C 83  ? 1.2986 0.7036 0.6885 0.0598  -0.2792 0.1674  83  ASP C CA  
3745 C C   . ASP C 83  ? 1.1593 0.5959 0.5487 0.0394  -0.2592 0.1663  83  ASP C C   
3746 O O   . ASP C 83  ? 1.1319 0.6675 0.6161 0.0352  -0.2451 0.1469  83  ASP C O   
3747 C CB  . ASP C 83  ? 1.4532 0.8021 0.7995 0.1077  -0.3486 0.1514  83  ASP C CB  
3748 C CG  . ASP C 83  ? 1.6871 1.0190 1.0531 0.1329  -0.3678 0.1439  83  ASP C CG  
3749 O OD1 . ASP C 83  ? 1.7336 1.0271 1.0732 0.1070  -0.3285 0.1632  83  ASP C OD1 
3750 O OD2 . ASP C 83  ? 1.7500 1.1113 1.1611 0.1780  -0.4209 0.1135  83  ASP C OD2 
3751 N N   . LYS C 84  ? 1.2833 0.6347 0.5674 0.0239  -0.2510 0.1829  84  LYS C N   
3752 C CA  . LYS C 84  ? 1.3506 0.7159 0.6177 0.0013  -0.2274 0.1850  84  LYS C CA  
3753 C C   . LYS C 84  ? 1.3920 0.8094 0.7004 0.0246  -0.2687 0.1581  84  LYS C C   
3754 O O   . LYS C 84  ? 1.3622 0.8354 0.7102 0.0052  -0.2406 0.1500  84  LYS C O   
3755 C CB  . LYS C 84  ? 1.4875 0.7752 0.6679 -0.0181 -0.2050 0.1901  84  LYS C CB  
3756 C CG  . LYS C 84  ? 1.6034 0.8059 0.7074 0.0121  -0.2558 0.1819  84  LYS C CG  
3757 C CD  . LYS C 84  ? 1.7281 0.8439 0.7353 -0.0121 -0.2303 0.1872  84  LYS C CD  
3758 N N   . SER C 85  ? 1.4709 0.8760 0.7775 0.0667  -0.3331 0.1380  85  SER C N   
3759 C CA  . SER C 85  ? 1.4490 0.9182 0.8087 0.0895  -0.3749 0.0996  85  SER C CA  
3760 C C   . SER C 85  ? 1.3098 0.9120 0.8137 0.0753  -0.3440 0.0708  85  SER C C   
3761 O O   . SER C 85  ? 1.2943 0.9560 0.8435 0.0688  -0.3457 0.0420  85  SER C O   
3762 C CB  . SER C 85  ? 1.5051 0.9442 0.8448 0.1448  -0.4544 0.0768  85  SER C CB  
3763 O OG  . SER C 85  ? 1.5441 1.0367 0.9717 0.1638  -0.4615 0.0620  85  SER C OG  
3764 N N   . ASP C 86  ? 1.0499 0.6907 0.6168 0.0677  -0.3132 0.0773  86  ASP C N   
3765 C CA  . ASP C 86  ? 1.1570 0.9044 0.8412 0.0521  -0.2785 0.0536  86  ASP C CA  
3766 C C   . ASP C 86  ? 0.9890 0.7455 0.6695 0.0134  -0.2127 0.0764  86  ASP C C   
3767 O O   . ASP C 86  ? 1.0844 0.9060 0.8316 -0.0028 -0.1809 0.0588  86  ASP C O   
3768 C CB  . ASP C 86  ? 1.0347 0.8177 0.7847 0.0658  -0.2801 0.0462  86  ASP C CB  
3769 C CG  . ASP C 86  ? 1.2093 1.0199 1.0032 0.1072  -0.3419 0.0067  86  ASP C CG  
3770 O OD1 . ASP C 86  ? 1.3083 1.1573 1.1283 0.1193  -0.3740 -0.0297 86  ASP C OD1 
3771 O OD2 . ASP C 86  ? 1.2452 1.0429 1.0507 0.1289  -0.3594 0.0077  86  ASP C OD2 
3772 N N   . ALA C 87  ? 0.9244 0.6110 0.5223 -0.0008 -0.1912 0.1125  87  ALA C N   
3773 C CA  . ALA C 87  ? 0.8930 0.5896 0.4876 -0.0303 -0.1332 0.1308  87  ALA C CA  
3774 C C   . ALA C 87  ? 1.0139 0.6893 0.5625 -0.0450 -0.1229 0.1300  87  ALA C C   
3775 O O   . ALA C 87  ? 0.9779 0.6782 0.5433 -0.0632 -0.0798 0.1327  87  ALA C O   
3776 C CB  . ALA C 87  ? 0.9349 0.5844 0.4808 -0.0420 -0.1090 0.1601  87  ALA C CB  
3777 N N   . VAL C 88  ? 1.0340 0.6576 0.5184 -0.0341 -0.1647 0.1255  88  VAL C N   
3778 C CA  . VAL C 88  ? 1.0451 0.6395 0.4737 -0.0480 -0.1595 0.1239  88  VAL C CA  
3779 C C   . VAL C 88  ? 1.1562 0.8211 0.6544 -0.0589 -0.1409 0.0963  88  VAL C C   
3780 O O   . VAL C 88  ? 1.2762 0.9344 0.7545 -0.0806 -0.1016 0.1026  88  VAL C O   
3781 C CB  . VAL C 88  ? 1.1820 0.7103 0.5292 -0.0268 -0.2194 0.1176  88  VAL C CB  
3782 C CG1 . VAL C 88  ? 1.1828 0.7182 0.5118 -0.0345 -0.2279 0.0971  88  VAL C CG1 
3783 C CG2 . VAL C 88  ? 1.2823 0.7008 0.5103 -0.0328 -0.2166 0.1517  88  VAL C CG2 
3784 N N   . SER C 89  ? 1.0767 0.8062 0.6550 -0.0456 -0.1655 0.0625  89  SER C N   
3785 C CA  . SER C 89  ? 1.1618 0.9524 0.8026 -0.0624 -0.1444 0.0294  89  SER C CA  
3786 C C   . SER C 89  ? 1.0295 0.8652 0.7367 -0.0756 -0.0957 0.0299  89  SER C C   
3787 O O   . SER C 89  ? 0.9742 0.8562 0.7357 -0.0912 -0.0745 -0.0007 89  SER C O   
3788 C CB  . SER C 89  ? 1.3220 1.1635 1.0140 -0.0459 -0.1960 -0.0196 89  SER C CB  
3789 O OG  . SER C 89  ? 1.3809 1.2740 1.1223 -0.0711 -0.1711 -0.0568 89  SER C OG  
3790 N N   . HIS C 90  ? 1.0230 0.8403 0.7190 -0.0711 -0.0767 0.0624  90  HIS C N   
3791 C CA  . HIS C 90  ? 1.0104 0.8622 0.7567 -0.0774 -0.0369 0.0650  90  HIS C CA  
3792 C C   . HIS C 90  ? 1.0318 0.8537 0.7391 -0.0819 0.0016  0.1000  90  HIS C C   
3793 O O   . HIS C 90  ? 0.8811 0.7134 0.6059 -0.0741 0.0100  0.1140  90  HIS C O   
3794 C CB  . HIS C 90  ? 0.8512 0.7379 0.6529 -0.0606 -0.0606 0.0550  90  HIS C CB  
3795 C CG  . HIS C 90  ? 0.8549 0.7939 0.7205 -0.0552 -0.0904 0.0092  90  HIS C CG  
3796 N ND1 . HIS C 90  ? 0.8942 0.8423 0.7765 -0.0281 -0.1455 -0.0064 90  HIS C ND1 
3797 C CD2 . HIS C 90  ? 0.7788 0.7656 0.6972 -0.0738 -0.0714 -0.0297 90  HIS C CD2 
3798 C CE1 . HIS C 90  ? 0.9498 0.9620 0.9035 -0.0269 -0.1627 -0.0566 90  HIS C CE1 
3799 N NE2 . HIS C 90  ? 0.8776 0.9160 0.8560 -0.0588 -0.1151 -0.0728 90  HIS C NE2 
3800 N N   . THR C 91  ? 1.1111 0.9010 0.7694 -0.0934 0.0241  0.1092  91  THR C N   
3801 C CA  . THR C 91  ? 1.0034 0.7763 0.6341 -0.0945 0.0609  0.1329  91  THR C CA  
3802 C C   . THR C 91  ? 0.9119 0.6985 0.5633 -0.0950 0.0990  0.1279  91  THR C C   
3803 O O   . THR C 91  ? 0.9513 0.7362 0.6080 -0.1065 0.1097  0.1088  91  THR C O   
3804 C CB  . THR C 91  ? 0.8975 0.6265 0.4626 -0.1048 0.0698  0.1427  91  THR C CB  
3805 O OG1 . THR C 91  ? 1.0249 0.7438 0.5768 -0.1160 0.0709  0.1249  91  THR C OG1 
3806 C CG2 . THR C 91  ? 0.8514 0.5444 0.3714 -0.1056 0.0389  0.1529  91  THR C CG2 
3807 N N   . GLY C 92  ? 0.8265 1.0662 0.6932 -0.0446 0.1005  0.0330  92  GLY C N   
3808 C CA  . GLY C 92  ? 0.8997 1.0594 0.7298 -0.0178 0.1271  0.0133  92  GLY C CA  
3809 C C   . GLY C 92  ? 0.8068 0.9288 0.6346 -0.0041 0.1122  0.0362  92  GLY C C   
3810 O O   . GLY C 92  ? 0.7146 0.8839 0.5694 -0.0070 0.0831  0.0675  92  GLY C O   
3811 N N   . ASN C 93  ? 0.8771 0.9155 0.6725 0.0087  0.1310  0.0217  93  ASN C N   
3812 C CA  . ASN C 93  ? 0.8483 0.8494 0.6342 0.0220  0.1195  0.0402  93  ASN C CA  
3813 C C   . ASN C 93  ? 0.7561 0.7335 0.5600 0.0027  0.1070  0.0388  93  ASN C C   
3814 O O   . ASN C 93  ? 0.8152 0.7485 0.6072 -0.0116 0.1249  0.0130  93  ASN C O   
3815 C CB  . ASN C 93  ? 0.9678 0.8951 0.7064 0.0446  0.1425  0.0297  93  ASN C CB  
3816 C CG  . ASN C 93  ? 1.0317 0.9845 0.7649 0.0727  0.1423  0.0358  93  ASN C CG  
3817 O OD1 . ASN C 93  ? 0.9315 0.9408 0.6860 0.0813  0.1215  0.0586  93  ASN C OD1 
3818 N ND2 . ASN C 93  ? 1.3119 1.2250 1.0218 0.0869  0.1640  0.0130  93  ASN C ND2 
3819 N N   . TYR C 94  ? 0.6878 0.6990 0.5253 0.0021  0.0754  0.0634  94  TYR C N   
3820 C CA  . TYR C 94  ? 0.5914 0.5880 0.4568 -0.0124 0.0587  0.0576  94  TYR C CA  
3821 C C   . TYR C 94  ? 0.6693 0.6229 0.5073 0.0036  0.0607  0.0620  94  TYR C C   
3822 O O   . TYR C 94  ? 0.7383 0.6984 0.5621 0.0256  0.0543  0.0848  94  TYR C O   
3823 C CB  . TYR C 94  ? 0.6086 0.6698 0.5397 -0.0257 0.0163  0.0795  94  TYR C CB  
3824 C CG  . TYR C 94  ? 0.6463 0.7459 0.6100 -0.0498 0.0074  0.0743  94  TYR C CG  
3825 C CD1 . TYR C 94  ? 0.6127 0.7591 0.5669 -0.0516 0.0126  0.0867  94  TYR C CD1 
3826 C CD2 . TYR C 94  ? 0.6474 0.7414 0.6537 -0.0712 -0.0078 0.0544  94  TYR C CD2 
3827 C CE1 . TYR C 94  ? 0.6222 0.8075 0.6026 -0.0758 0.0029  0.0839  94  TYR C CE1 
3828 C CE2 . TYR C 94  ? 0.6875 0.8147 0.7246 -0.0933 -0.0198 0.0512  94  TYR C CE2 
3829 C CZ  . TYR C 94  ? 0.6056 0.7777 0.6266 -0.0963 -0.0146 0.0683  94  TYR C CZ  
3830 O OH  . TYR C 94  ? 0.6930 0.9018 0.7409 -0.1204 -0.0280 0.0670  94  TYR C OH  
3831 N N   . THR C 95  ? 0.7771 0.6921 0.6080 -0.0090 0.0694  0.0385  95  THR C N   
3832 C CA  . THR C 95  ? 0.7421 0.6233 0.5450 0.0004  0.0709  0.0409  95  THR C CA  
3833 C C   . THR C 95  ? 0.5897 0.5024 0.4471 -0.0091 0.0408  0.0347  95  THR C C   
3834 O O   . THR C 95  ? 0.6189 0.5407 0.5123 -0.0304 0.0372  0.0064  95  THR C O   
3835 C CB  . THR C 95  ? 0.7797 0.5955 0.5243 -0.0094 0.1062  0.0180  95  THR C CB  
3836 O OG1 . THR C 95  ? 0.8843 0.6653 0.5849 0.0023  0.1292  0.0236  95  THR C OG1 
3837 C CG2 . THR C 95  ? 0.9773 0.7660 0.6893 -0.0046 0.1053  0.0231  95  THR C CG2 
3838 N N   . CYS C 96  ? 0.6261 0.5573 0.4953 0.0080  0.0175  0.0579  96  CYS C N   
3839 C CA  . CYS C 96  ? 0.6278 0.5898 0.5543 0.0026  -0.0141 0.0503  96  CYS C CA  
3840 C C   . CYS C 96  ? 0.6337 0.5660 0.5230 0.0049  -0.0023 0.0346  96  CYS C C   
3841 O O   . CYS C 96  ? 0.6802 0.6054 0.5427 0.0246  -0.0075 0.0565  96  CYS C O   
3842 C CB  . CYS C 96  ? 0.5196 0.5294 0.4930 0.0166  -0.0520 0.0855  96  CYS C CB  
3843 S SG  . CYS C 96  ? 0.7214 0.7688 0.7771 0.0131  -0.0977 0.0767  96  CYS C SG  
3844 N N   . GLU C 97  ? 0.6770 0.5968 0.5643 -0.0169 0.0135  -0.0043 97  GLU C N   
3845 C CA  . GLU C 97  ? 0.6932 0.5959 0.5432 -0.0224 0.0266  -0.0230 97  GLU C CA  
3846 C C   . GLU C 97  ? 0.7372 0.6891 0.6579 -0.0255 -0.0058 -0.0463 97  GLU C C   
3847 O O   . GLU C 97  ? 0.7513 0.7345 0.7416 -0.0407 -0.0215 -0.0783 97  GLU C O   
3848 C CB  . GLU C 97  ? 0.6525 0.5220 0.4579 -0.0485 0.0645  -0.0555 97  GLU C CB  
3849 C CG  . GLU C 97  ? 0.9945 0.8639 0.7693 -0.0644 0.0771  -0.0816 97  GLU C CG  
3850 C CD  . GLU C 97  ? 1.1884 1.0340 0.9241 -0.0960 0.1143  -0.1145 97  GLU C CD  
3851 O OE1 . GLU C 97  ? 1.2531 1.1268 0.9981 -0.1185 0.1207  -0.1544 97  GLU C OE1 
3852 O OE2 . GLU C 97  ? 1.3560 1.1592 1.0542 -0.0994 0.1374  -0.1032 97  GLU C OE2 
3853 N N   . VAL C 98  ? 0.7583 0.7172 0.6657 -0.0100 -0.0182 -0.0326 98  VAL C N   
3854 C CA  . VAL C 98  ? 0.6570 0.6651 0.6355 -0.0093 -0.0515 -0.0558 98  VAL C CA  
3855 C C   . VAL C 98  ? 0.7983 0.8083 0.7353 -0.0188 -0.0352 -0.0843 98  VAL C C   
3856 O O   . VAL C 98  ? 0.7981 0.7809 0.6626 -0.0084 -0.0223 -0.0587 98  VAL C O   
3857 C CB  . VAL C 98  ? 0.5631 0.5950 0.5808 0.0166  -0.0889 -0.0176 98  VAL C CB  
3858 C CG1 . VAL C 98  ? 0.4641 0.5453 0.5625 0.0178  -0.1261 -0.0445 98  VAL C CG1 
3859 C CG2 . VAL C 98  ? 0.5756 0.6177 0.6331 0.0202  -0.1062 0.0123  98  VAL C CG2 
3860 N N   . THR C 99  ? 0.8182 0.8645 0.8031 -0.0399 -0.0374 -0.1389 99  THR C N   
3861 C CA  . THR C 99  ? 0.8219 0.8899 0.7779 -0.0536 -0.0242 -0.1739 99  THR C CA  
3862 C C   . THR C 99  ? 0.6980 0.8257 0.7401 -0.0416 -0.0657 -0.1978 99  THR C C   
3863 O O   . THR C 99  ? 0.7353 0.9041 0.8795 -0.0456 -0.0946 -0.2348 99  THR C O   
3864 C CB  . THR C 99  ? 0.9045 0.9841 0.8542 -0.0884 0.0058  -0.2286 99  THR C CB  
3865 O OG1 . THR C 99  ? 1.0342 1.0551 0.9016 -0.1004 0.0445  -0.2056 99  THR C OG1 
3866 C CG2 . THR C 99  ? 0.9379 1.0556 0.8594 -0.1067 0.0190  -0.2677 99  THR C CG2 
3867 N N   . GLU C 100 ? 0.6052 0.7363 0.6100 -0.0264 -0.0716 -0.1774 100 GLU C N   
3868 C CA  . GLU C 100 ? 0.7370 0.9220 0.8213 -0.0113 -0.1126 -0.1954 100 GLU C CA  
3869 C C   . GLU C 100 ? 0.8597 1.0772 0.9031 -0.0213 -0.1000 -0.2276 100 GLU C C   
3870 O O   . GLU C 100 ? 0.9533 1.1433 0.9077 -0.0145 -0.0850 -0.1922 100 GLU C O   
3871 C CB  . GLU C 100 ? 0.9517 1.1210 1.0471 0.0206  -0.1411 -0.1369 100 GLU C CB  
3872 C CG  . GLU C 100 ? 1.0044 1.2257 1.1909 0.0374  -0.1879 -0.1499 100 GLU C CG  
3873 C CD  . GLU C 100 ? 1.1125 1.3429 1.2457 0.0494  -0.1850 -0.1438 100 GLU C CD  
3874 O OE1 . GLU C 100 ? 1.2281 1.4140 1.2528 0.0508  -0.1537 -0.1105 100 GLU C OE1 
3875 O OE2 . GLU C 100 ? 1.0874 1.3691 1.2904 0.0575  -0.2167 -0.1729 100 GLU C OE2 
3876 N N   . LEU C 101 ? 0.9345 1.2144 1.0464 -0.0384 -0.1081 -0.2969 101 LEU C N   
3877 C CA  . LEU C 101 ? 0.9077 1.2378 0.9904 -0.0535 -0.0959 -0.3400 101 LEU C CA  
3878 C C   . LEU C 101 ? 1.0074 1.3018 0.9523 -0.0789 -0.0455 -0.3212 101 LEU C C   
3879 O O   . LEU C 101 ? 1.2227 1.5084 1.1383 -0.1081 -0.0132 -0.3437 101 LEU C O   
3880 C CB  . LEU C 101 ? 0.9093 1.2654 1.0148 -0.0265 -0.1290 -0.3252 101 LEU C CB  
3881 C CG  . LEU C 101 ? 0.8910 1.3261 1.1281 -0.0193 -0.1714 -0.3878 101 LEU C CG  
3882 C CD1 . LEU C 101 ? 0.8361 1.2823 1.1007 0.0123  -0.2079 -0.3589 101 LEU C CD1 
3883 C CD2 . LEU C 101 ? 0.9893 1.4864 1.2224 -0.0459 -0.1459 -0.4560 101 LEU C CD2 
3884 N N   . THR C 102 ? 0.9123 1.1849 0.7753 -0.0687 -0.0417 -0.2783 102 THR C N   
3885 C CA  . THR C 102 ? 0.9829 1.2184 0.7149 -0.0938 -0.0020 -0.2527 102 THR C CA  
3886 C C   . THR C 102 ? 0.9665 1.1076 0.6269 -0.0815 0.0118  -0.1824 102 THR C C   
3887 O O   . THR C 102 ? 1.0104 1.1068 0.5766 -0.1059 0.0450  -0.1623 102 THR C O   
3888 C CB  . THR C 102 ? 1.1030 1.3664 0.7799 -0.0929 -0.0078 -0.2447 102 THR C CB  
3889 O OG1 . THR C 102 ? 1.1528 1.3732 0.7000 -0.1202 0.0259  -0.2107 102 THR C OG1 
3890 C CG2 . THR C 102 ? 1.1477 1.3887 0.8470 -0.0483 -0.0438 -0.1974 102 THR C CG2 
3891 N N   . ARG C 103 ? 1.0283 0.8188 0.4633 -0.2061 -0.0951 -0.0198 103 ARG C N   
3892 C CA  . ARG C 103 ? 1.0170 0.7292 0.4158 -0.1826 -0.1231 0.0065  103 ARG C CA  
3893 C C   . ARG C 103 ? 1.1828 0.9165 0.6187 -0.1806 -0.1022 0.0152  103 ARG C C   
3894 O O   . ARG C 103 ? 0.9710 0.7847 0.4809 -0.1807 -0.0703 0.0007  103 ARG C O   
3895 C CB  . ARG C 103 ? 0.9851 0.6869 0.4425 -0.1260 -0.1489 0.0009  103 ARG C CB  
3896 C CG  . ARG C 103 ? 1.0327 0.7201 0.4592 -0.1203 -0.1753 -0.0129 103 ARG C CG  
3897 C CD  . ARG C 103 ? 0.9840 0.6894 0.4951 -0.0656 -0.1924 -0.0322 103 ARG C CD  
3898 N NE  . ARG C 103 ? 0.8759 0.6646 0.5116 -0.0496 -0.1522 -0.0515 103 ARG C NE  
3899 C CZ  . ARG C 103 ? 1.0434 0.8585 0.7668 -0.0108 -0.1511 -0.0724 103 ARG C CZ  
3900 N NH1 . ARG C 103 ? 0.9972 0.7771 0.7094 0.0193  -0.1901 -0.0831 103 ARG C NH1 
3901 N NH2 . ARG C 103 ? 0.9762 0.8504 0.7966 -0.0023 -0.1112 -0.0856 103 ARG C NH2 
3902 N N   . GLU C 104 ? 1.1513 0.8120 0.5341 -0.1759 -0.1234 0.0369  104 GLU C N   
3903 C CA  . GLU C 104 ? 1.1431 0.8200 0.5506 -0.1756 -0.1072 0.0443  104 GLU C CA  
3904 C C   . GLU C 104 ? 1.2336 0.8359 0.6176 -0.1479 -0.1370 0.0618  104 GLU C C   
3905 O O   . GLU C 104 ? 1.3301 0.8416 0.6272 -0.1541 -0.1698 0.0740  104 GLU C O   
3906 C CB  . GLU C 104 ? 1.3097 0.9934 0.6528 -0.2352 -0.0852 0.0418  104 GLU C CB  
3907 C CG  . GLU C 104 ? 1.4739 1.1954 0.8504 -0.2366 -0.0661 0.0410  104 GLU C CG  
3908 C CD  . GLU C 104 ? 1.6845 1.3190 0.9873 -0.2479 -0.0841 0.0603  104 GLU C CD  
3909 O OE1 . GLU C 104 ? 1.8441 1.3799 1.0607 -0.2563 -0.1126 0.0760  104 GLU C OE1 
3910 O OE2 . GLU C 104 ? 1.6279 1.2906 0.9572 -0.2463 -0.0718 0.0586  104 GLU C OE2 
3911 N N   . GLY C 105 ? 1.0779 0.7159 0.5365 -0.1162 -0.1269 0.0615  105 GLY C N   
3912 C CA  . GLY C 105 ? 1.0557 0.6396 0.5077 -0.0899 -0.1504 0.0707  105 GLY C CA  
3913 C C   . GLY C 105 ? 1.0251 0.6565 0.5318 -0.0792 -0.1277 0.0719  105 GLY C C   
3914 O O   . GLY C 105 ? 0.9360 0.6393 0.4856 -0.0863 -0.0977 0.0668  105 GLY C O   
3915 N N   . GLU C 106 ? 1.0686 0.6606 0.5730 -0.0598 -0.1444 0.0762  106 GLU C N   
3916 C CA  . GLU C 106 ? 0.9585 0.5928 0.5062 -0.0502 -0.1251 0.0771  106 GLU C CA  
3917 C C   . GLU C 106 ? 0.9963 0.6022 0.5703 -0.0169 -0.1429 0.0726  106 GLU C C   
3918 O O   . GLU C 106 ? 0.9185 0.4591 0.4620 -0.0053 -0.1762 0.0685  106 GLU C O   
3919 C CB  . GLU C 106 ? 0.9560 0.5865 0.4488 -0.0903 -0.1149 0.0821  106 GLU C CB  
3920 C CG  . GLU C 106 ? 1.1514 0.6871 0.5634 -0.1081 -0.1411 0.0888  106 GLU C CG  
3921 C CD  . GLU C 106 ? 1.3906 0.9260 0.7526 -0.1538 -0.1241 0.0883  106 GLU C CD  
3922 O OE1 . GLU C 106 ? 1.4594 1.0593 0.8281 -0.1823 -0.0968 0.0800  106 GLU C OE1 
3923 O OE2 . GLU C 106 ? 1.5098 0.9839 0.8303 -0.1615 -0.1376 0.0908  106 GLU C OE2 
3924 N N   . THR C 107 ? 0.9924 0.6485 0.6212 -0.0006 -0.1219 0.0707  107 THR C N   
3925 C CA  . THR C 107 ? 1.0059 0.6492 0.6642 0.0250  -0.1314 0.0609  107 THR C CA  
3926 C C   . THR C 107 ? 1.0439 0.7198 0.7066 0.0188  -0.1134 0.0655  107 THR C C   
3927 O O   . THR C 107 ? 0.9245 0.6501 0.5907 0.0072  -0.0902 0.0742  107 THR C O   
3928 C CB  . THR C 107 ? 0.9467 0.6220 0.6778 0.0552  -0.1209 0.0462  107 THR C CB  
3929 O OG1 . THR C 107 ? 1.1360 0.8070 0.8969 0.0744  -0.1265 0.0296  107 THR C OG1 
3930 C CG2 . THR C 107 ? 0.8465 0.5822 0.6168 0.0560  -0.0834 0.0554  107 THR C CG2 
3931 N N   . ILE C 108 ? 0.9886 0.6406 0.6533 0.0288  -0.1264 0.0553  108 ILE C N   
3932 C CA  . ILE C 108 ? 0.9104 0.5926 0.5752 0.0218  -0.1121 0.0560  108 ILE C CA  
3933 C C   . ILE C 108 ? 0.9382 0.6577 0.6584 0.0463  -0.0972 0.0451  108 ILE C C   
3934 O O   . ILE C 108 ? 0.9928 0.6914 0.7405 0.0641  -0.1106 0.0250  108 ILE C O   
3935 C CB  . ILE C 108 ? 0.9539 0.5784 0.5685 0.0051  -0.1347 0.0502  108 ILE C CB  
3936 C CG1 . ILE C 108 ? 1.1122 0.6910 0.6568 -0.0293 -0.1430 0.0619  108 ILE C CG1 
3937 C CG2 . ILE C 108 ? 0.8720 0.5373 0.4934 -0.0024 -0.1188 0.0451  108 ILE C CG2 
3938 C CD1 . ILE C 108 ? 1.2350 0.7405 0.7172 -0.0522 -0.1613 0.0587  108 ILE C CD1 
3939 N N   . ILE C 109 ? 0.9686 0.7438 0.7020 0.0467  -0.0699 0.0555  109 ILE C N   
3940 C CA  . ILE C 109 ? 0.8833 0.6891 0.6521 0.0628  -0.0503 0.0493  109 ILE C CA  
3941 C C   . ILE C 109 ? 0.7915 0.6297 0.5416 0.0554  -0.0425 0.0509  109 ILE C C   
3942 O O   . ILE C 109 ? 0.9504 0.8147 0.6742 0.0443  -0.0397 0.0625  109 ILE C O   
3943 C CB  . ILE C 109 ? 0.7747 0.6070 0.5682 0.0749  -0.0235 0.0630  109 ILE C CB  
3944 C CG1 . ILE C 109 ? 0.9458 0.7573 0.7549 0.0775  -0.0295 0.0617  109 ILE C CG1 
3945 C CG2 . ILE C 109 ? 0.8580 0.7018 0.6799 0.0849  -0.0011 0.0534  109 ILE C CG2 
3946 C CD1 . ILE C 109 ? 0.8443 0.6676 0.6310 0.0673  -0.0305 0.0778  109 ILE C CD1 
3947 N N   . GLU C 110 ? 0.8298 0.6742 0.5972 0.0608  -0.0387 0.0335  110 GLU C N   
3948 C CA  . GLU C 110 ? 0.8262 0.7053 0.5770 0.0536  -0.0317 0.0305  110 GLU C CA  
3949 C C   . GLU C 110 ? 0.8123 0.7340 0.5655 0.0638  -0.0035 0.0428  110 GLU C C   
3950 O O   . GLU C 110 ? 0.8267 0.7429 0.6032 0.0715  0.0134  0.0381  110 GLU C O   
3951 C CB  . GLU C 110 ? 0.8426 0.7028 0.6054 0.0506  -0.0462 -0.0001 110 GLU C CB  
3952 C CG  . GLU C 110 ? 1.0228 0.9209 0.7701 0.0398  -0.0399 -0.0087 110 GLU C CG  
3953 C CD  . GLU C 110 ? 1.1461 1.0202 0.9074 0.0364  -0.0569 -0.0428 110 GLU C CD  
3954 O OE1 . GLU C 110 ? 1.3247 1.1563 1.1117 0.0481  -0.0747 -0.0615 110 GLU C OE1 
3955 O OE2 . GLU C 110 ? 0.9848 0.8847 0.7340 0.0242  -0.0546 -0.0547 110 GLU C OE2 
3956 N N   . LEU C 111 ? 0.8471 0.8092 0.5715 0.0627  0.0014  0.0564  111 LEU C N   
3957 C CA  . LEU C 111 ? 0.8713 0.8648 0.5798 0.0753  0.0223  0.0719  111 LEU C CA  
3958 C C   . LEU C 111 ? 0.8410 0.8699 0.5348 0.0680  0.0246  0.0564  111 LEU C C   
3959 O O   . LEU C 111 ? 1.0133 1.0741 0.6920 0.0603  0.0125  0.0490  111 LEU C O   
3960 C CB  . LEU C 111 ? 0.9261 0.9443 0.6124 0.0890  0.0212  0.0965  111 LEU C CB  
3961 C CG  . LEU C 111 ? 0.9083 0.9418 0.5644 0.1099  0.0365  0.1194  111 LEU C CG  
3962 C CD1 . LEU C 111 ? 0.8537 0.8402 0.5164 0.1145  0.0602  0.1310  111 LEU C CD1 
3963 C CD2 . LEU C 111 ? 0.8225 0.8854 0.4623 0.1301  0.0254  0.1353  111 LEU C CD2 
3964 N N   . LYS C 112 ? 0.8719 0.8994 0.5720 0.0669  0.0429  0.0465  112 LYS C N   
3965 C CA  . LYS C 112 ? 0.9518 1.0155 0.6422 0.0572  0.0475  0.0258  112 LYS C CA  
3966 C C   . LYS C 112 ? 1.0291 1.1117 0.6820 0.0621  0.0734  0.0419  112 LYS C C   
3967 O O   . LYS C 112 ? 0.8021 0.8541 0.4446 0.0684  0.0926  0.0624  112 LYS C O   
3968 C CB  . LYS C 112 ? 0.9874 1.0349 0.7211 0.0456  0.0432  -0.0143 112 LYS C CB  
3969 C CG  . LYS C 112 ? 1.0720 1.0800 0.8436 0.0500  0.0484  -0.0227 112 LYS C CG  
3970 C CD  . LYS C 112 ? 1.0273 1.0178 0.8449 0.0476  0.0288  -0.0663 112 LYS C CD  
3971 C CE  . LYS C 112 ? 1.1023 1.1280 0.9418 0.0382  0.0457  -0.1047 112 LYS C CE  
3972 N N   . TYR C 113 ? 1.1424 1.2707 0.7690 0.0571  0.0745  0.0323  113 TYR C N   
3973 C CA  . TYR C 113 ? 1.3781 1.5217 0.9520 0.0600  0.0964  0.0487  113 TYR C CA  
3974 C C   . TYR C 113 ? 1.4577 1.6122 1.0449 0.0369  0.1197  0.0152  113 TYR C C   
3975 O O   . TYR C 113 ? 1.5784 1.7517 1.2120 0.0240  0.1103  -0.0253 113 TYR C O   
3976 C CB  . TYR C 113 ? 1.4522 1.6494 0.9814 0.0724  0.0810  0.0584  113 TYR C CB  
3977 C CG  . TYR C 113 ? 1.5814 1.7770 1.0357 0.0886  0.0932  0.0919  113 TYR C CG  
3978 C CD1 . TYR C 113 ? 1.6258 1.7712 1.0480 0.1106  0.0967  0.1323  113 TYR C CD1 
3979 C CD2 . TYR C 113 ? 1.7009 1.9391 1.1103 0.0827  0.0998  0.0833  113 TYR C CD2 
3980 C CE1 . TYR C 113 ? 1.7242 1.8497 1.0648 0.1284  0.1044  0.1668  113 TYR C CE1 
3981 C CE2 . TYR C 113 ? 1.7612 1.9860 1.0859 0.0989  0.1078  0.1179  113 TYR C CE2 
3982 C CZ  . TYR C 113 ? 1.7913 1.9537 1.0783 0.1228  0.1090  0.1614  113 TYR C CZ  
3983 O OH  . TYR C 113 ? 1.8498 1.9759 1.0567 0.1356  0.1108  0.1943  113 TYR C OH  
3984 N N   . ARG C 114 ? 1.3815 1.5206 0.9255 0.0302  0.1509  0.0298  114 ARG C N   
3985 C CA  . ARG C 114 ? 1.2911 1.4474 0.8450 0.0023  0.1798  -0.0067 114 ARG C CA  
3986 C C   . ARG C 114 ? 1.2314 1.4011 0.6993 -0.0057 0.2033  0.0132  114 ARG C C   
3987 O O   . ARG C 114 ? 1.1843 1.4073 0.6302 -0.0082 0.1947  0.0002  114 ARG C O   
3988 C CB  . ARG C 114 ? 1.2151 1.3317 0.8108 -0.0116 0.2050  -0.0231 114 ARG C CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU H . n 
A 1 2   VAL 2   2   2   VAL VAL H . n 
A 1 3   GLN 3   3   3   GLN GLN H . n 
A 1 4   LEU 4   4   4   LEU LEU H . n 
A 1 5   VAL 5   5   5   VAL VAL H . n 
A 1 6   GLN 6   6   6   GLN GLN H . n 
A 1 7   SER 7   7   7   SER SER H . n 
A 1 8   GLY 8   8   8   GLY GLY H . n 
A 1 9   ALA 9   9   9   ALA ALA H . n 
A 1 10  GLU 10  10  10  GLU GLU H . n 
A 1 11  VAL 11  11  11  VAL VAL H . n 
A 1 12  LYS 12  12  12  LYS LYS H . n 
A 1 13  LYS 13  13  13  LYS LYS H . n 
A 1 14  PRO 14  14  14  PRO PRO H . n 
A 1 15  GLY 15  15  15  GLY GLY H . n 
A 1 16  GLU 16  16  16  GLU GLU H . n 
A 1 17  SER 17  17  17  SER SER H . n 
A 1 18  LEU 18  18  18  LEU LEU H . n 
A 1 19  LYS 19  19  19  LYS LYS H . n 
A 1 20  ILE 20  20  20  ILE ILE H . n 
A 1 21  SER 21  21  21  SER SER H . n 
A 1 22  CYS 22  22  22  CYS CYS H . n 
A 1 23  LYS 23  23  23  LYS LYS H . n 
A 1 24  GLY 24  24  24  GLY GLY H . n 
A 1 25  SER 25  25  25  SER SER H . n 
A 1 26  GLY 26  26  26  GLY GLY H . n 
A 1 27  TYR 27  27  27  TYR TYR H . n 
A 1 28  SER 28  28  28  SER SER H . n 
A 1 29  PHE 29  29  29  PHE PHE H . n 
A 1 30  THR 30  30  30  THR THR H . n 
A 1 31  ASP 31  31  31  ASP ASP H . n 
A 1 32  TYR 32  32  32  TYR TYR H . n 
A 1 33  TRP 33  33  33  TRP TRP H . n 
A 1 34  ILE 34  34  34  ILE ILE H . n 
A 1 35  GLY 35  35  35  GLY GLY H . n 
A 1 36  TRP 36  36  36  TRP TRP H . n 
A 1 37  VAL 37  37  37  VAL VAL H . n 
A 1 38  ARG 38  38  38  ARG ARG H . n 
A 1 39  GLN 39  39  39  GLN GLN H . n 
A 1 40  MET 40  40  40  MET MET H . n 
A 1 41  PRO 41  41  41  PRO PRO H . n 
A 1 42  GLY 42  42  42  GLY GLY H . n 
A 1 43  LYS 43  43  43  LYS LYS H . n 
A 1 44  GLY 44  44  44  GLY GLY H . n 
A 1 45  LEU 45  45  45  LEU LEU H . n 
A 1 46  GLU 46  46  46  GLU GLU H . n 
A 1 47  TRP 47  47  47  TRP TRP H . n 
A 1 48  MET 48  48  48  MET MET H . n 
A 1 49  GLY 49  49  49  GLY GLY H . n 
A 1 50  ILE 50  50  50  ILE ILE H . n 
A 1 51  ILE 51  51  51  ILE ILE H . n 
A 1 52  TYR 52  52  52  TYR TYR H . n 
A 1 53  PRO 53  53  53  PRO PRO H . n 
A 1 54  GLY 54  54  54  GLY GLY H . n 
A 1 55  ASP 55  55  55  ASP ASP H . n 
A 1 56  SER 56  56  56  SER SER H . n 
A 1 57  ASP 57  57  57  ASP ASP H . n 
A 1 58  THR 58  58  58  THR THR H . n 
A 1 59  ARG 59  59  59  ARG ARG H . n 
A 1 60  TYR 60  60  60  TYR TYR H . n 
A 1 61  SER 61  61  61  SER SER H . n 
A 1 62  PRO 62  62  62  PRO PRO H . n 
A 1 63  SER 63  63  63  SER SER H . n 
A 1 64  PHE 64  64  64  PHE PHE H . n 
A 1 65  GLN 65  65  65  GLN GLN H . n 
A 1 66  GLY 66  66  66  GLY GLY H . n 
A 1 67  GLN 67  67  67  GLN GLN H . n 
A 1 68  VAL 68  68  68  VAL VAL H . n 
A 1 69  THR 69  69  69  THR THR H . n 
A 1 70  ILE 70  70  70  ILE ILE H . n 
A 1 71  SER 71  71  71  SER SER H . n 
A 1 72  ALA 72  72  72  ALA ALA H . n 
A 1 73  ASP 73  73  73  ASP ASP H . n 
A 1 74  LYS 74  74  74  LYS LYS H . n 
A 1 75  SER 75  75  75  SER SER H . n 
A 1 76  ILE 76  76  76  ILE ILE H . n 
A 1 77  SER 77  77  77  SER SER H . n 
A 1 78  THR 78  78  78  THR THR H . n 
A 1 79  ALA 79  79  79  ALA ALA H . n 
A 1 80  TYR 80  80  80  TYR TYR H . n 
A 1 81  LEU 81  81  81  LEU LEU H . n 
A 1 82  GLN 82  82  82  GLN GLN H . n 
A 1 83  TRP 83  83  83  TRP TRP H . n 
A 1 84  SER 84  84  84  SER SER H . n 
A 1 85  SER 85  85  85  SER SER H . n 
A 1 86  LEU 86  86  86  LEU LEU H . n 
A 1 87  LYS 87  87  87  LYS LYS H . n 
A 1 88  ALA 88  88  88  ALA ALA H . n 
A 1 89  SER 89  89  89  SER SER H . n 
A 1 90  ASP 90  90  90  ASP ASP H . n 
A 1 91  THR 91  91  91  THR THR H . n 
A 1 92  ALA 92  92  92  ALA ALA H . n 
A 1 93  VAL 93  93  93  VAL VAL H . n 
A 1 94  TYR 94  94  94  TYR TYR H . n 
A 1 95  TYR 95  95  95  TYR TYR H . n 
A 1 96  CYS 96  96  96  CYS CYS H . n 
A 1 97  ALA 97  97  97  ALA ALA H . n 
A 1 98  ARG 98  98  98  ARG ARG H . n 
A 1 99  VAL 99  99  99  VAL VAL H . n 
A 1 100 GLY 100 100 100 GLY GLY H . n 
A 1 101 ARG 101 101 101 ARG ARG H . n 
A 1 102 PHE 102 102 102 PHE PHE H . n 
A 1 103 ALA 103 103 103 ALA ALA H . n 
A 1 104 SER 104 104 104 SER SER H . n 
A 1 105 HIS 105 105 105 HIS HIS H . n 
A 1 106 GLN 106 106 106 GLN GLN H . n 
A 1 107 LEU 107 107 107 LEU LEU H . n 
A 1 108 ASP 108 108 108 ASP ASP H . n 
A 1 109 TYR 109 109 109 TYR TYR H . n 
A 1 110 TRP 110 110 110 TRP TRP H . n 
A 1 111 GLY 111 111 111 GLY GLY H . n 
A 1 112 GLN 112 112 112 GLN GLN H . n 
A 1 113 GLY 113 113 113 GLY GLY H . n 
A 1 114 THR 114 114 114 THR THR H . n 
A 1 115 LEU 115 115 115 LEU LEU H . n 
A 1 116 VAL 116 116 116 VAL VAL H . n 
A 1 117 THR 117 117 117 THR THR H . n 
A 1 118 VAL 118 118 118 VAL VAL H . n 
A 1 119 SER 119 119 119 SER SER H . n 
A 1 120 SER 120 120 120 SER SER H . n 
A 1 121 ALA 121 121 121 ALA ALA H . n 
A 1 122 SER 122 122 122 SER SER H . n 
A 1 123 THR 123 123 123 THR THR H . n 
A 1 124 LYS 124 124 124 LYS LYS H . n 
A 1 125 GLY 125 125 125 GLY GLY H . n 
A 1 126 PRO 126 126 126 PRO PRO H . n 
A 1 127 SER 127 127 127 SER SER H . n 
A 1 128 VAL 128 128 128 VAL VAL H . n 
A 1 129 PHE 129 129 129 PHE PHE H . n 
A 1 130 PRO 130 130 130 PRO PRO H . n 
A 1 131 LEU 131 131 131 LEU LEU H . n 
A 1 132 ALA 132 132 132 ALA ALA H . n 
A 1 133 PRO 133 133 133 PRO PRO H . n 
A 1 134 SER 134 134 ?   ?   ?   H . n 
A 1 135 SER 135 135 ?   ?   ?   H . n 
A 1 136 LYS 136 136 ?   ?   ?   H . n 
A 1 137 SER 137 137 ?   ?   ?   H . n 
A 1 138 THR 138 138 ?   ?   ?   H . n 
A 1 139 SER 139 139 ?   ?   ?   H . n 
A 1 140 GLY 140 140 ?   ?   ?   H . n 
A 1 141 GLY 141 141 141 GLY GLY H . n 
A 1 142 THR 142 142 142 THR THR H . n 
A 1 143 ALA 143 143 143 ALA ALA H . n 
A 1 144 ALA 144 144 144 ALA ALA H . n 
A 1 145 LEU 145 145 145 LEU LEU H . n 
A 1 146 GLY 146 146 146 GLY GLY H . n 
A 1 147 CYS 147 147 147 CYS CYS H . n 
A 1 148 LEU 148 148 148 LEU LEU H . n 
A 1 149 VAL 149 149 149 VAL VAL H . n 
A 1 150 LYS 150 150 150 LYS LYS H . n 
A 1 151 ASP 151 151 151 ASP ASP H . n 
A 1 152 TYR 152 152 152 TYR TYR H . n 
A 1 153 PHE 153 153 153 PHE PHE H . n 
A 1 154 PRO 154 154 154 PRO PRO H . n 
A 1 155 GLU 155 155 155 GLU GLU H . n 
A 1 156 PRO 156 156 156 PRO PRO H . n 
A 1 157 VAL 157 157 157 VAL VAL H . n 
A 1 158 THR 158 158 158 THR THR H . n 
A 1 159 VAL 159 159 159 VAL VAL H . n 
A 1 160 SER 160 160 160 SER SER H . n 
A 1 161 TRP 161 161 161 TRP TRP H . n 
A 1 162 ASN 162 162 162 ASN ASN H . n 
A 1 163 SER 163 163 163 SER SER H . n 
A 1 164 GLY 164 164 164 GLY GLY H . n 
A 1 165 ALA 165 165 165 ALA ALA H . n 
A 1 166 LEU 166 166 166 LEU LEU H . n 
A 1 167 THR 167 167 167 THR THR H . n 
A 1 168 SER 168 168 168 SER SER H . n 
A 1 169 GLY 169 169 169 GLY GLY H . n 
A 1 170 VAL 170 170 170 VAL VAL H . n 
A 1 171 HIS 171 171 171 HIS HIS H . n 
A 1 172 THR 172 172 172 THR THR H . n 
A 1 173 PHE 173 173 173 PHE PHE H . n 
A 1 174 PRO 174 174 174 PRO PRO H . n 
A 1 175 ALA 175 175 175 ALA ALA H . n 
A 1 176 VAL 176 176 176 VAL VAL H . n 
A 1 177 LEU 177 177 177 LEU LEU H . n 
A 1 178 GLN 178 178 178 GLN GLN H . n 
A 1 179 SER 179 179 179 SER SER H . n 
A 1 180 SER 180 180 180 SER SER H . n 
A 1 181 GLY 181 181 181 GLY GLY H . n 
A 1 182 LEU 182 182 182 LEU LEU H . n 
A 1 183 TYR 183 183 183 TYR TYR H . n 
A 1 184 SER 184 184 184 SER SER H . n 
A 1 185 LEU 185 185 185 LEU LEU H . n 
A 1 186 SER 186 186 186 SER SER H . n 
A 1 187 SER 187 187 187 SER SER H . n 
A 1 188 VAL 188 188 188 VAL VAL H . n 
A 1 189 VAL 189 189 189 VAL VAL H . n 
A 1 190 THR 190 190 190 THR THR H . n 
A 1 191 VAL 191 191 191 VAL VAL H . n 
A 1 192 PRO 192 192 192 PRO PRO H . n 
A 1 193 SER 193 193 193 SER SER H . n 
A 1 194 SER 194 194 194 SER SER H . n 
A 1 195 SER 195 195 195 SER SER H . n 
A 1 196 LEU 196 196 196 LEU LEU H . n 
A 1 197 GLY 197 197 197 GLY GLY H . n 
A 1 198 THR 198 198 198 THR THR H . n 
A 1 199 GLN 199 199 199 GLN GLN H . n 
A 1 200 THR 200 200 200 THR THR H . n 
A 1 201 TYR 201 201 201 TYR TYR H . n 
A 1 202 ILE 202 202 202 ILE ILE H . n 
A 1 203 CYS 203 203 203 CYS CYS H . n 
A 1 204 ASN 204 204 204 ASN ASN H . n 
A 1 205 VAL 205 205 205 VAL VAL H . n 
A 1 206 ASN 206 206 206 ASN ASN H . n 
A 1 207 HIS 207 207 207 HIS HIS H . n 
A 1 208 LYS 208 208 208 LYS LYS H . n 
A 1 209 PRO 209 209 209 PRO PRO H . n 
A 1 210 SER 210 210 210 SER SER H . n 
A 1 211 ASN 211 211 211 ASN ASN H . n 
A 1 212 THR 212 212 212 THR THR H . n 
A 1 213 LYS 213 213 213 LYS LYS H . n 
A 1 214 VAL 214 214 214 VAL VAL H . n 
A 1 215 ASP 215 215 215 ASP ASP H . n 
A 1 216 LYS 216 216 216 LYS LYS H . n 
A 1 217 LYS 217 217 217 LYS LYS H . n 
A 1 218 VAL 218 218 218 VAL VAL H . n 
A 1 219 GLU 219 219 219 GLU GLU H . n 
A 1 220 PRO 220 220 220 PRO PRO H . n 
A 1 221 LYS 221 221 ?   ?   ?   H . n 
A 1 222 SER 222 222 ?   ?   ?   H . n 
A 1 223 CYS 223 223 ?   ?   ?   H . n 
A 1 224 HIS 224 224 ?   ?   ?   H . n 
A 1 225 HIS 225 225 ?   ?   ?   H . n 
A 1 226 HIS 226 226 ?   ?   ?   H . n 
A 1 227 HIS 227 227 ?   ?   ?   H . n 
A 1 228 HIS 228 228 ?   ?   ?   H . n 
A 1 229 HIS 229 229 ?   ?   ?   H . n 
B 2 1   GLU 1   1   1   GLU GLU L . n 
B 2 2   ILE 2   2   2   ILE ILE L . n 
B 2 3   VAL 3   3   3   VAL VAL L . n 
B 2 4   LEU 4   4   4   LEU LEU L . n 
B 2 5   THR 5   5   5   THR THR L . n 
B 2 6   GLN 6   6   6   GLN GLN L . n 
B 2 7   SER 7   7   7   SER SER L . n 
B 2 8   PRO 8   8   8   PRO PRO L . n 
B 2 9   ALA 9   9   9   ALA ALA L . n 
B 2 10  THR 10  10  10  THR THR L . n 
B 2 11  LEU 11  11  11  LEU LEU L . n 
B 2 12  SER 12  12  12  SER SER L . n 
B 2 13  LEU 13  13  13  LEU LEU L . n 
B 2 14  SER 14  14  14  SER SER L . n 
B 2 15  PRO 15  15  15  PRO PRO L . n 
B 2 16  GLY 16  16  16  GLY GLY L . n 
B 2 17  GLU 17  17  17  GLU GLU L . n 
B 2 18  ARG 18  18  18  ARG ARG L . n 
B 2 19  ALA 19  19  19  ALA ALA L . n 
B 2 20  THR 20  20  20  THR THR L . n 
B 2 21  LEU 21  21  21  LEU LEU L . n 
B 2 22  SER 22  22  22  SER SER L . n 
B 2 23  CYS 23  23  23  CYS CYS L . n 
B 2 24  ARG 24  24  24  ARG ARG L . n 
B 2 25  ALA 25  25  25  ALA ALA L . n 
B 2 26  SER 26  26  26  SER SER L . n 
B 2 27  GLN 27  27  27  GLN GLN L . n 
B 2 28  SER 28  28  28  SER SER L . n 
B 2 29  VAL 29  29  29  VAL VAL L . n 
B 2 30  ASN 30  30  30  ASN ASN L . n 
B 2 31  ASN 31  31  31  ASN ASN L . n 
B 2 32  ARG 32  32  32  ARG ARG L . n 
B 2 33  LEU 33  33  33  LEU LEU L . n 
B 2 34  ALA 34  34  34  ALA ALA L . n 
B 2 35  TRP 35  35  35  TRP TRP L . n 
B 2 36  TYR 36  36  36  TYR TYR L . n 
B 2 37  GLN 37  37  37  GLN GLN L . n 
B 2 38  GLN 38  38  38  GLN GLN L . n 
B 2 39  LYS 39  39  39  LYS LYS L . n 
B 2 40  PRO 40  40  40  PRO PRO L . n 
B 2 41  GLY 41  41  41  GLY GLY L . n 
B 2 42  GLN 42  42  42  GLN GLN L . n 
B 2 43  ALA 43  43  43  ALA ALA L . n 
B 2 44  PRO 44  44  44  PRO PRO L . n 
B 2 45  ARG 45  45  45  ARG ARG L . n 
B 2 46  LEU 46  46  46  LEU LEU L . n 
B 2 47  LEU 47  47  47  LEU LEU L . n 
B 2 48  ILE 48  48  48  ILE ILE L . n 
B 2 49  HIS 49  49  49  HIS HIS L . n 
B 2 50  TRP 50  50  50  TRP TRP L . n 
B 2 51  ALA 51  51  51  ALA ALA L . n 
B 2 52  SER 52  52  52  SER SER L . n 
B 2 53  THR 53  53  53  THR THR L . n 
B 2 54  ARG 54  54  54  ARG ARG L . n 
B 2 55  ALA 55  55  55  ALA ALA L . n 
B 2 56  ILE 56  56  56  ILE ILE L . n 
B 2 57  GLY 57  57  57  GLY GLY L . n 
B 2 58  ILE 58  58  58  ILE ILE L . n 
B 2 59  PRO 59  59  59  PRO PRO L . n 
B 2 60  ALA 60  60  60  ALA ALA L . n 
B 2 61  ARG 61  61  61  ARG ARG L . n 
B 2 62  PHE 62  62  62  PHE PHE L . n 
B 2 63  SER 63  63  63  SER SER L . n 
B 2 64  GLY 64  64  64  GLY GLY L . n 
B 2 65  SER 65  65  65  SER SER L . n 
B 2 66  GLY 66  66  66  GLY GLY L . n 
B 2 67  SER 67  67  67  SER SER L . n 
B 2 68  GLY 68  68  68  GLY GLY L . n 
B 2 69  THR 69  69  69  THR THR L . n 
B 2 70  ASP 70  70  70  ASP ASP L . n 
B 2 71  PHE 71  71  71  PHE PHE L . n 
B 2 72  THR 72  72  72  THR THR L . n 
B 2 73  LEU 73  73  73  LEU LEU L . n 
B 2 74  THR 74  74  74  THR THR L . n 
B 2 75  ILE 75  75  75  ILE ILE L . n 
B 2 76  SER 76  76  76  SER SER L . n 
B 2 77  SER 77  77  77  SER SER L . n 
B 2 78  LEU 78  78  78  LEU LEU L . n 
B 2 79  GLU 79  79  79  GLU GLU L . n 
B 2 80  PRO 80  80  80  PRO PRO L . n 
B 2 81  GLU 81  81  81  GLU GLU L . n 
B 2 82  ASP 82  82  82  ASP ASP L . n 
B 2 83  PHE 83  83  83  PHE PHE L . n 
B 2 84  ALA 84  84  84  ALA ALA L . n 
B 2 85  VAL 85  85  85  VAL VAL L . n 
B 2 86  TYR 86  86  86  TYR TYR L . n 
B 2 87  TYR 87  87  87  TYR TYR L . n 
B 2 88  CYS 88  88  88  CYS CYS L . n 
B 2 89  GLN 89  89  89  GLN GLN L . n 
B 2 90  GLN 90  90  90  GLN GLN L . n 
B 2 91  GLY 91  91  91  GLY GLY L . n 
B 2 92  ALA 92  92  92  ALA ALA L . n 
B 2 93  SER 93  93  93  SER SER L . n 
B 2 94  TRP 94  94  94  TRP TRP L . n 
B 2 95  PRO 95  95  95  PRO PRO L . n 
B 2 96  PHE 96  96  96  PHE PHE L . n 
B 2 97  THR 97  97  97  THR THR L . n 
B 2 98  PHE 98  98  98  PHE PHE L . n 
B 2 99  GLY 99  99  99  GLY GLY L . n 
B 2 100 GLN 100 100 100 GLN GLN L . n 
B 2 101 GLY 101 101 101 GLY GLY L . n 
B 2 102 THR 102 102 102 THR THR L . n 
B 2 103 LYS 103 103 103 LYS LYS L . n 
B 2 104 VAL 104 104 104 VAL VAL L . n 
B 2 105 GLU 105 105 105 GLU GLU L . n 
B 2 106 ILE 106 106 106 ILE ILE L . n 
B 2 107 LYS 107 107 107 LYS LYS L . n 
B 2 108 ARG 108 108 108 ARG ARG L . n 
B 2 109 THR 109 109 109 THR THR L . n 
B 2 110 VAL 110 110 110 VAL VAL L . n 
B 2 111 ALA 111 111 111 ALA ALA L . n 
B 2 112 ALA 112 112 112 ALA ALA L . n 
B 2 113 PRO 113 113 113 PRO PRO L . n 
B 2 114 SER 114 114 114 SER SER L . n 
B 2 115 VAL 115 115 115 VAL VAL L . n 
B 2 116 PHE 116 116 116 PHE PHE L . n 
B 2 117 ILE 117 117 117 ILE ILE L . n 
B 2 118 PHE 118 118 118 PHE PHE L . n 
B 2 119 PRO 119 119 119 PRO PRO L . n 
B 2 120 PRO 120 120 120 PRO PRO L . n 
B 2 121 SER 121 121 121 SER SER L . n 
B 2 122 ASP 122 122 122 ASP ASP L . n 
B 2 123 GLU 123 123 123 GLU GLU L . n 
B 2 124 GLN 124 124 124 GLN GLN L . n 
B 2 125 LEU 125 125 125 LEU LEU L . n 
B 2 126 LYS 126 126 126 LYS LYS L . n 
B 2 127 SER 127 127 127 SER SER L . n 
B 2 128 GLY 128 128 128 GLY GLY L . n 
B 2 129 THR 129 129 129 THR THR L . n 
B 2 130 ALA 130 130 130 ALA ALA L . n 
B 2 131 SER 131 131 131 SER SER L . n 
B 2 132 VAL 132 132 132 VAL VAL L . n 
B 2 133 VAL 133 133 133 VAL VAL L . n 
B 2 134 CYS 134 134 134 CYS CYS L . n 
B 2 135 LEU 135 135 135 LEU LEU L . n 
B 2 136 LEU 136 136 136 LEU LEU L . n 
B 2 137 ASN 137 137 137 ASN ASN L . n 
B 2 138 ASN 138 138 138 ASN ASN L . n 
B 2 139 PHE 139 139 139 PHE PHE L . n 
B 2 140 TYR 140 140 140 TYR TYR L . n 
B 2 141 PRO 141 141 141 PRO PRO L . n 
B 2 142 ARG 142 142 142 ARG ARG L . n 
B 2 143 GLU 143 143 143 GLU GLU L . n 
B 2 144 ALA 144 144 144 ALA ALA L . n 
B 2 145 LYS 145 145 145 LYS LYS L . n 
B 2 146 VAL 146 146 146 VAL VAL L . n 
B 2 147 GLN 147 147 147 GLN GLN L . n 
B 2 148 TRP 148 148 148 TRP TRP L . n 
B 2 149 LYS 149 149 149 LYS LYS L . n 
B 2 150 VAL 150 150 150 VAL VAL L . n 
B 2 151 ASP 151 151 151 ASP ASP L . n 
B 2 152 ASN 152 152 152 ASN ASN L . n 
B 2 153 ALA 153 153 153 ALA ALA L . n 
B 2 154 LEU 154 154 154 LEU LEU L . n 
B 2 155 GLN 155 155 155 GLN GLN L . n 
B 2 156 SER 156 156 156 SER SER L . n 
B 2 157 GLY 157 157 157 GLY GLY L . n 
B 2 158 ASN 158 158 158 ASN ASN L . n 
B 2 159 SER 159 159 159 SER SER L . n 
B 2 160 GLN 160 160 160 GLN GLN L . n 
B 2 161 GLU 161 161 161 GLU GLU L . n 
B 2 162 SER 162 162 162 SER SER L . n 
B 2 163 VAL 163 163 163 VAL VAL L . n 
B 2 164 THR 164 164 164 THR THR L . n 
B 2 165 GLU 165 165 165 GLU GLU L . n 
B 2 166 GLN 166 166 166 GLN GLN L . n 
B 2 167 ASP 167 167 167 ASP ASP L . n 
B 2 168 SER 168 168 168 SER SER L . n 
B 2 169 LYS 169 169 169 LYS LYS L . n 
B 2 170 ASP 170 170 170 ASP ASP L . n 
B 2 171 SER 171 171 171 SER SER L . n 
B 2 172 THR 172 172 172 THR THR L . n 
B 2 173 TYR 173 173 173 TYR TYR L . n 
B 2 174 SER 174 174 174 SER SER L . n 
B 2 175 LEU 175 175 175 LEU LEU L . n 
B 2 176 SER 176 176 176 SER SER L . n 
B 2 177 SER 177 177 177 SER SER L . n 
B 2 178 THR 178 178 178 THR THR L . n 
B 2 179 LEU 179 179 179 LEU LEU L . n 
B 2 180 THR 180 180 180 THR THR L . n 
B 2 181 LEU 181 181 181 LEU LEU L . n 
B 2 182 SER 182 182 182 SER SER L . n 
B 2 183 LYS 183 183 183 LYS LYS L . n 
B 2 184 ALA 184 184 184 ALA ALA L . n 
B 2 185 ASP 185 185 185 ASP ASP L . n 
B 2 186 TYR 186 186 186 TYR TYR L . n 
B 2 187 GLU 187 187 187 GLU GLU L . n 
B 2 188 LYS 188 188 188 LYS LYS L . n 
B 2 189 HIS 189 189 189 HIS HIS L . n 
B 2 190 LYS 190 190 190 LYS LYS L . n 
B 2 191 VAL 191 191 191 VAL VAL L . n 
B 2 192 TYR 192 192 192 TYR TYR L . n 
B 2 193 ALA 193 193 193 ALA ALA L . n 
B 2 194 CYS 194 194 194 CYS CYS L . n 
B 2 195 GLU 195 195 195 GLU GLU L . n 
B 2 196 VAL 196 196 196 VAL VAL L . n 
B 2 197 THR 197 197 197 THR THR L . n 
B 2 198 HIS 198 198 198 HIS HIS L . n 
B 2 199 GLN 199 199 199 GLN GLN L . n 
B 2 200 GLY 200 200 200 GLY GLY L . n 
B 2 201 LEU 201 201 201 LEU LEU L . n 
B 2 202 SER 202 202 202 SER SER L . n 
B 2 203 SER 203 203 203 SER SER L . n 
B 2 204 PRO 204 204 204 PRO PRO L . n 
B 2 205 VAL 205 205 205 VAL VAL L . n 
B 2 206 THR 206 206 206 THR THR L . n 
B 2 207 LYS 207 207 207 LYS LYS L . n 
B 2 208 SER 208 208 208 SER SER L . n 
B 2 209 PHE 209 209 209 PHE PHE L . n 
B 2 210 ASN 210 210 210 ASN ASN L . n 
B 2 211 ARG 211 211 211 ARG ARG L . n 
B 2 212 GLY 212 212 212 GLY GLY L . n 
B 2 213 GLU 213 213 ?   ?   ?   L . n 
B 2 214 CYS 214 214 ?   ?   ?   L . n 
C 3 1   GLN 1   1   1   GLN GLN C . n 
C 3 2   LEU 2   2   2   LEU LEU C . n 
C 3 3   LEU 3   3   3   LEU LEU C . n 
C 3 4   PHE 4   4   4   PHE PHE C . n 
C 3 5   ASN 5   5   5   ASN ASN C . n 
C 3 6   LYS 6   6   6   LYS LYS C . n 
C 3 7   THR 7   7   7   THR THR C . n 
C 3 8   LYS 8   8   8   LYS LYS C . n 
C 3 9   SER 9   9   9   SER SER C . n 
C 3 10  VAL 10  10  10  VAL VAL C . n 
C 3 11  GLU 11  11  11  GLU GLU C . n 
C 3 12  PHE 12  12  12  PHE PHE C . n 
C 3 13  THR 13  13  13  THR THR C . n 
C 3 14  PHE 14  14  14  PHE PHE C . n 
C 3 15  GLY 15  15  15  GLY GLY C . n 
C 3 16  ASN 16  16  16  ASN ASN C . n 
C 3 17  ASP 17  17  17  ASP ASP C . n 
C 3 18  THR 18  18  18  THR THR C . n 
C 3 19  VAL 19  19  19  VAL VAL C . n 
C 3 20  VAL 20  20  20  VAL VAL C . n 
C 3 21  ILE 21  21  21  ILE ILE C . n 
C 3 22  PRO 22  22  22  PRO PRO C . n 
C 3 23  CYS 23  23  23  CYS CYS C . n 
C 3 24  PHE 24  24  24  PHE PHE C . n 
C 3 25  VAL 25  25  25  VAL VAL C . n 
C 3 26  THR 26  26  26  THR THR C . n 
C 3 27  ASN 27  27  27  ASN ASN C . n 
C 3 28  MET 28  28  28  MET MET C . n 
C 3 29  GLU 29  29  29  GLU GLU C . n 
C 3 30  ALA 30  30  30  ALA ALA C . n 
C 3 31  GLN 31  31  31  GLN GLN C . n 
C 3 32  ASN 32  32  32  ASN ASN C . n 
C 3 33  THR 33  33  33  THR THR C . n 
C 3 34  THR 34  34  34  THR THR C . n 
C 3 35  GLU 35  35  35  GLU GLU C . n 
C 3 36  VAL 36  36  36  VAL VAL C . n 
C 3 37  TYR 37  37  37  TYR TYR C . n 
C 3 38  VAL 38  38  38  VAL VAL C . n 
C 3 39  LYS 39  39  39  LYS LYS C . n 
C 3 40  TRP 40  40  40  TRP TRP C . n 
C 3 41  LYS 41  41  41  LYS LYS C . n 
C 3 42  PHE 42  42  42  PHE PHE C . n 
C 3 43  LYS 43  43  43  LYS LYS C . n 
C 3 44  GLY 44  44  44  GLY GLY C . n 
C 3 45  ARG 45  45  45  ARG ARG C . n 
C 3 46  ASP 46  46  46  ASP ASP C . n 
C 3 47  ILE 47  47  47  ILE ILE C . n 
C 3 48  TYR 48  48  48  TYR TYR C . n 
C 3 49  THR 49  49  49  THR THR C . n 
C 3 50  PHE 50  50  50  PHE PHE C . n 
C 3 51  ASP 51  51  51  ASP ASP C . n 
C 3 52  GLY 52  52  52  GLY GLY C . n 
C 3 53  ALA 53  53  53  ALA ALA C . n 
C 3 54  LEU 54  54  54  LEU LEU C . n 
C 3 55  ASN 55  55  55  ASN ASN C . n 
C 3 56  LYS 56  56  56  LYS LYS C . n 
C 3 57  SER 57  57  57  SER SER C . n 
C 3 58  THR 58  58  58  THR THR C . n 
C 3 59  VAL 59  59  59  VAL VAL C . n 
C 3 60  PRO 60  60  60  PRO PRO C . n 
C 3 61  THR 61  61  61  THR THR C . n 
C 3 62  ASP 62  62  62  ASP ASP C . n 
C 3 63  PHE 63  63  63  PHE PHE C . n 
C 3 64  SER 64  64  64  SER SER C . n 
C 3 65  SER 65  65  65  SER SER C . n 
C 3 66  ALA 66  66  66  ALA ALA C . n 
C 3 67  LYS 67  67  67  LYS LYS C . n 
C 3 68  ILE 68  68  68  ILE ILE C . n 
C 3 69  GLU 69  69  69  GLU GLU C . n 
C 3 70  VAL 70  70  70  VAL VAL C . n 
C 3 71  SER 71  71  71  SER SER C . n 
C 3 72  GLN 72  72  72  GLN GLN C . n 
C 3 73  LEU 73  73  73  LEU LEU C . n 
C 3 74  LEU 74  74  74  LEU LEU C . n 
C 3 75  LYS 75  75  75  LYS LYS C . n 
C 3 76  GLY 76  76  76  GLY GLY C . n 
C 3 77  ASP 77  77  77  ASP ASP C . n 
C 3 78  ALA 78  78  78  ALA ALA C . n 
C 3 79  SER 79  79  79  SER SER C . n 
C 3 80  LEU 80  80  80  LEU LEU C . n 
C 3 81  LYS 81  81  81  LYS LYS C . n 
C 3 82  MET 82  82  82  MET MET C . n 
C 3 83  ASP 83  83  83  ASP ASP C . n 
C 3 84  LYS 84  84  84  LYS LYS C . n 
C 3 85  SER 85  85  85  SER SER C . n 
C 3 86  ASP 86  86  86  ASP ASP C . n 
C 3 87  ALA 87  87  87  ALA ALA C . n 
C 3 88  VAL 88  88  88  VAL VAL C . n 
C 3 89  SER 89  89  89  SER SER C . n 
C 3 90  HIS 90  90  90  HIS HIS C . n 
C 3 91  THR 91  91  91  THR THR C . n 
C 3 92  GLY 92  92  92  GLY GLY C . n 
C 3 93  ASN 93  93  93  ASN ASN C . n 
C 3 94  TYR 94  94  94  TYR TYR C . n 
C 3 95  THR 95  95  95  THR THR C . n 
C 3 96  CYS 96  96  96  CYS CYS C . n 
C 3 97  GLU 97  97  97  GLU GLU C . n 
C 3 98  VAL 98  98  98  VAL VAL C . n 
C 3 99  THR 99  99  99  THR THR C . n 
C 3 100 GLU 100 100 100 GLU GLU C . n 
C 3 101 LEU 101 101 101 LEU LEU C . n 
C 3 102 THR 102 102 102 THR THR C . n 
C 3 103 ARG 103 103 103 ARG ARG C . n 
C 3 104 GLU 104 104 104 GLU GLU C . n 
C 3 105 GLY 105 105 105 GLY GLY C . n 
C 3 106 GLU 106 106 106 GLU GLU C . n 
C 3 107 THR 107 107 107 THR THR C . n 
C 3 108 ILE 108 108 108 ILE ILE C . n 
C 3 109 ILE 109 109 109 ILE ILE C . n 
C 3 110 GLU 110 110 110 GLU GLU C . n 
C 3 111 LEU 111 111 111 LEU LEU C . n 
C 3 112 LYS 112 112 112 LYS LYS C . n 
C 3 113 TYR 113 113 113 TYR TYR C . n 
C 3 114 ARG 114 114 114 ARG ARG C . n 
C 3 115 VAL 115 115 ?   ?   ?   C . n 
C 3 116 VAL 116 116 ?   ?   ?   C . n 
C 3 117 SER 117 117 ?   ?   ?   C . n 
C 3 118 TRP 118 118 ?   ?   ?   C . n 
C 3 119 PHE 119 119 ?   ?   ?   C . n 
C 3 120 SER 120 120 ?   ?   ?   C . n 
C 3 121 PRO 121 121 ?   ?   ?   C . n 
C 3 122 ASN 122 122 ?   ?   ?   C . n 
C 3 123 GLU 123 123 ?   ?   ?   C . n 
C 3 124 HIS 124 124 ?   ?   ?   C . n 
C 3 125 HIS 125 125 ?   ?   ?   C . n 
C 3 126 HIS 126 126 ?   ?   ?   C . n 
C 3 127 HIS 127 127 ?   ?   ?   C . n 
C 3 128 HIS 128 128 ?   ?   ?   C . n 
C 3 129 HIS 129 129 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 5 GOL 1  301 1   GOL GOL L . 
G 6 NAG 1  201 205 NAG NAG C . 
H 6 NAG 1  202 216 NAG NAG C . 
I 6 NAG 1  203 232 NAG NAG C . 
J 7 HOH 1  301 105 HOH HOH H . 
J 7 HOH 2  302 97  HOH HOH H . 
J 7 HOH 3  303 71  HOH HOH H . 
J 7 HOH 4  304 65  HOH HOH H . 
J 7 HOH 5  305 22  HOH HOH H . 
J 7 HOH 6  306 98  HOH HOH H . 
J 7 HOH 7  307 8   HOH HOH H . 
J 7 HOH 8  308 58  HOH HOH H . 
J 7 HOH 9  309 36  HOH HOH H . 
J 7 HOH 10 310 48  HOH HOH H . 
J 7 HOH 11 311 6   HOH HOH H . 
J 7 HOH 12 312 11  HOH HOH H . 
J 7 HOH 13 313 80  HOH HOH H . 
J 7 HOH 14 314 12  HOH HOH H . 
J 7 HOH 15 315 3   HOH HOH H . 
J 7 HOH 16 316 85  HOH HOH H . 
J 7 HOH 17 317 2   HOH HOH H . 
J 7 HOH 18 318 66  HOH HOH H . 
J 7 HOH 19 319 4   HOH HOH H . 
J 7 HOH 20 320 40  HOH HOH H . 
J 7 HOH 21 321 56  HOH HOH H . 
J 7 HOH 22 322 37  HOH HOH H . 
J 7 HOH 23 323 42  HOH HOH H . 
J 7 HOH 24 324 83  HOH HOH H . 
J 7 HOH 25 325 81  HOH HOH H . 
J 7 HOH 26 326 46  HOH HOH H . 
J 7 HOH 27 327 39  HOH HOH H . 
J 7 HOH 28 328 34  HOH HOH H . 
J 7 HOH 29 329 68  HOH HOH H . 
J 7 HOH 30 330 28  HOH HOH H . 
J 7 HOH 31 331 82  HOH HOH H . 
J 7 HOH 32 332 41  HOH HOH H . 
J 7 HOH 33 333 70  HOH HOH H . 
J 7 HOH 34 334 99  HOH HOH H . 
J 7 HOH 35 335 102 HOH HOH H . 
J 7 HOH 36 336 33  HOH HOH H . 
J 7 HOH 37 337 47  HOH HOH H . 
J 7 HOH 38 338 103 HOH HOH H . 
J 7 HOH 39 339 35  HOH HOH H . 
J 7 HOH 40 340 21  HOH HOH H . 
J 7 HOH 41 341 30  HOH HOH H . 
J 7 HOH 42 342 79  HOH HOH H . 
J 7 HOH 43 343 100 HOH HOH H . 
J 7 HOH 44 344 88  HOH HOH H . 
J 7 HOH 45 345 59  HOH HOH H . 
J 7 HOH 46 346 51  HOH HOH H . 
K 7 HOH 1  401 104 HOH HOH L . 
K 7 HOH 2  402 77  HOH HOH L . 
K 7 HOH 3  403 73  HOH HOH L . 
K 7 HOH 4  404 69  HOH HOH L . 
K 7 HOH 5  405 84  HOH HOH L . 
K 7 HOH 6  406 15  HOH HOH L . 
K 7 HOH 7  407 7   HOH HOH L . 
K 7 HOH 8  408 1   HOH HOH L . 
K 7 HOH 9  409 60  HOH HOH L . 
K 7 HOH 10 410 57  HOH HOH L . 
K 7 HOH 11 411 95  HOH HOH L . 
K 7 HOH 12 412 16  HOH HOH L . 
K 7 HOH 13 413 49  HOH HOH L . 
K 7 HOH 14 414 64  HOH HOH L . 
K 7 HOH 15 415 20  HOH HOH L . 
K 7 HOH 16 416 50  HOH HOH L . 
K 7 HOH 17 417 75  HOH HOH L . 
K 7 HOH 18 418 23  HOH HOH L . 
K 7 HOH 19 419 14  HOH HOH L . 
K 7 HOH 20 420 53  HOH HOH L . 
K 7 HOH 21 421 26  HOH HOH L . 
K 7 HOH 22 422 19  HOH HOH L . 
K 7 HOH 23 423 62  HOH HOH L . 
K 7 HOH 24 424 54  HOH HOH L . 
K 7 HOH 25 425 31  HOH HOH L . 
K 7 HOH 26 426 96  HOH HOH L . 
K 7 HOH 27 427 24  HOH HOH L . 
K 7 HOH 28 428 52  HOH HOH L . 
K 7 HOH 29 429 63  HOH HOH L . 
K 7 HOH 30 430 27  HOH HOH L . 
K 7 HOH 31 431 91  HOH HOH L . 
K 7 HOH 32 432 13  HOH HOH L . 
K 7 HOH 33 433 86  HOH HOH L . 
K 7 HOH 34 434 89  HOH HOH L . 
K 7 HOH 35 435 92  HOH HOH L . 
K 7 HOH 36 436 25  HOH HOH L . 
K 7 HOH 37 437 93  HOH HOH L . 
K 7 HOH 38 438 45  HOH HOH L . 
K 7 HOH 39 439 72  HOH HOH L . 
L 7 HOH 1  301 10  HOH HOH C . 
L 7 HOH 2  302 29  HOH HOH C . 
L 7 HOH 3  303 74  HOH HOH C . 
L 7 HOH 4  304 76  HOH HOH C . 
L 7 HOH 5  305 55  HOH HOH C . 
L 7 HOH 6  306 32  HOH HOH C . 
L 7 HOH 7  307 9   HOH HOH C . 
L 7 HOH 8  308 94  HOH HOH C . 
L 7 HOH 9  309 18  HOH HOH C . 
L 7 HOH 10 310 78  HOH HOH C . 
L 7 HOH 11 311 17  HOH HOH C . 
L 7 HOH 12 312 67  HOH HOH C . 
L 7 HOH 13 313 38  HOH HOH C . 
L 7 HOH 14 314 5   HOH HOH C . 
L 7 HOH 15 315 44  HOH HOH C . 
L 7 HOH 16 316 61  HOH HOH C . 
L 7 HOH 17 317 90  HOH HOH C . 
L 7 HOH 18 318 43  HOH HOH C . 
L 7 HOH 19 319 101 HOH HOH C . 
L 7 HOH 20 320 87  HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-03-15 
2 'Structure model' 1 1 2017-11-22 
3 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Refinement description' 
2 3 'Structure model' Advisory                 
3 3 'Structure model' 'Atomic model'           
4 3 'Structure model' 'Data collection'        
5 3 'Structure model' 'Derived calculations'   
6 3 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' software                      
2  3 'Structure model' atom_site                     
3  3 'Structure model' chem_comp                     
4  3 'Structure model' entity                        
5  3 'Structure model' pdbx_branch_scheme            
6  3 'Structure model' pdbx_chem_comp_identifier     
7  3 'Structure model' pdbx_entity_branch            
8  3 'Structure model' pdbx_entity_branch_descriptor 
9  3 'Structure model' pdbx_entity_branch_link       
10 3 'Structure model' pdbx_entity_branch_list       
11 3 'Structure model' pdbx_entity_nonpoly           
12 3 'Structure model' pdbx_nonpoly_scheme           
13 3 'Structure model' pdbx_struct_assembly_gen      
14 3 'Structure model' pdbx_validate_close_contact   
15 3 'Structure model' struct_asym                   
16 3 'Structure model' struct_conn                   
17 3 'Structure model' struct_site                   
18 3 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_software.name'                              
2  3 'Structure model' '_atom_site.B_iso_or_equiv'                   
3  3 'Structure model' '_atom_site.Cartn_x'                          
4  3 'Structure model' '_atom_site.Cartn_y'                          
5  3 'Structure model' '_atom_site.Cartn_z'                          
6  3 'Structure model' '_atom_site.auth_asym_id'                     
7  3 'Structure model' '_atom_site.auth_atom_id'                     
8  3 'Structure model' '_atom_site.auth_comp_id'                     
9  3 'Structure model' '_atom_site.auth_seq_id'                      
10 3 'Structure model' '_atom_site.label_asym_id'                    
11 3 'Structure model' '_atom_site.label_atom_id'                    
12 3 'Structure model' '_atom_site.label_comp_id'                    
13 3 'Structure model' '_atom_site.label_entity_id'                  
14 3 'Structure model' '_atom_site.type_symbol'                      
15 3 'Structure model' '_chem_comp.name'                             
16 3 'Structure model' '_chem_comp.type'                             
17 3 'Structure model' '_pdbx_entity_nonpoly.entity_id'              
18 3 'Structure model' '_pdbx_entity_nonpoly.name'                   
19 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
20 3 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 
21 3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'  
22 3 'Structure model' '_struct_conn.pdbx_role'                      
23 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
24 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
25 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
26 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
27 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
28 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 23.8982  -15.4933 30.4121 0.3816 0.5448 0.3515 0.1126  -0.0366 -0.0862 7.5857 2.1880 2.1393 
-1.4776 -0.4818 -0.5684 -0.0611 0.0258  0.0429  -0.7776 -0.0926 0.0980  0.0209  0.0918  -0.3005 
'X-RAY DIFFRACTION' 2  ? refined 46.9462  -0.1628  8.9600  0.4799 0.6413 0.3677 0.0450  0.0039  -0.0412 2.8361 5.1213 4.3251 
-0.7535 -0.2554 -1.3010 -0.3139 0.2733  0.0942  -0.3737 0.1504  -0.2791 0.1877  -0.3216 0.6783  
'X-RAY DIFFRACTION' 3  ? refined 9.2190   -5.2500  16.3938 0.4624 0.8578 0.4364 0.1700  -0.0579 -0.0407 6.0357 3.6020 5.9051 
0.6337  -0.0198 -3.1063 0.0061  0.1640  -0.1144 0.8704  0.4420  0.1116  -0.1042 0.1001  -1.0693 
'X-RAY DIFFRACTION' 4  ? refined 25.5614  -4.1592  8.2431  0.4727 0.5205 0.4058 0.1193  -0.0470 -0.0316 2.9577 0.4317 4.2520 
1.4676  -3.0074 -0.8789 0.0243  0.0132  -0.1091 0.4096  0.0237  0.0745  -0.0862 -0.3126 -0.4022 
'X-RAY DIFFRACTION' 5  ? refined 38.0332  -7.3334  -5.1594 0.5054 0.4133 0.4537 -0.0517 0.0096  0.0055  2.9890 3.5831 4.4928 
-2.7042 -1.9081 1.5702  -0.1126 0.0291  0.1623  0.0628  -0.2397 0.1580  0.1439  0.4330  0.0878  
'X-RAY DIFFRACTION' 6  ? refined 40.6877  -4.4681  -6.6826 0.5268 0.3782 0.4048 -0.0425 -0.0721 -0.0074 3.6259 4.3218 5.3783 
-2.9657 -1.8703 0.5419  -0.0785 -0.0356 0.0370  0.1440  -0.2229 0.1197  -0.3868 0.3039  0.3094  
'X-RAY DIFFRACTION' 7  ? refined -11.0017 -11.4276 49.5232 0.5718 0.8274 0.5735 -0.1019 -0.0824 0.3172  3.5564 4.1265 4.9411 
0.1306  -0.2623 4.0371  0.2519  0.1946  -0.1272 -1.5116 -0.7126 0.4417  0.5360  -0.5599 -2.0400 
'X-RAY DIFFRACTION' 8  ? refined -11.1585 -16.6437 34.1690 0.6765 0.4827 0.5553 -0.0228 -0.0037 0.1000  4.5231 7.9230 3.0633 
-0.6694 0.8753  2.8642  0.4532  0.0392  -0.4007 -0.2769 0.0912  0.3260  -0.9742 0.3555  -0.1840 
'X-RAY DIFFRACTION' 9  ? refined 1.1230   -11.8452 39.8280 0.5264 0.3991 0.3994 -0.1288 -0.0304 0.0109  7.7813 5.2888 4.4065 
2.1496  4.5481  4.1332  -0.3040 0.6404  -0.4280 0.8089  -0.5688 -0.6110 -0.7317 -1.3841 0.7923  
'X-RAY DIFFRACTION' 10 ? refined 6.1081   -20.1017 36.7532 0.5285 0.6194 0.5669 0.1276  -0.0838 -0.1531 8.7338 8.6658 2.2388 
-7.0848 -3.8486 3.6538  0.6215  0.8174  -1.2678 0.1206  0.9325  -0.4011 0.3244  0.7592  0.5161  
'X-RAY DIFFRACTION' 11 ? refined 7.0435   -11.6778 49.8986 0.5591 0.8720 0.8220 0.0511  -0.2753 -0.2220 8.5566 2.1832 3.3293 
-3.4322 -3.3788 0.0943  0.2437  0.9960  -1.3164 -0.6587 -0.1672 -2.0624 1.2594  0.7439  1.6108  
'X-RAY DIFFRACTION' 12 ? refined -3.3791  -16.3235 48.0279 0.6378 0.4834 0.5048 -0.0046 -0.0836 0.1355  1.8358 6.5481 7.7179 
0.1266  -1.1482 5.2361  0.2757  0.2524  -0.4648 -0.0828 -0.4575 -0.6871 1.3254  0.9077  0.2625  
'X-RAY DIFFRACTION' 13 ? refined -4.9516  -9.1554  37.4278 0.5603 0.4944 0.4515 -0.0076 -0.0040 -0.0070 6.5370 2.0283 2.0309 
1.8823  2.7905  1.9050  0.4924  0.5897  -0.7959 0.4266  -0.6724 -0.3044 -0.6083 -1.0785 -0.0134 
'X-RAY DIFFRACTION' 14 ? refined -8.6193  -6.2528  45.1383 0.6849 0.4919 0.4215 0.0462  -0.0537 0.0700  4.4989 4.5943 6.7318 
1.0298  -0.0696 5.4327  -0.4024 -0.0516 0.6159  -0.4020 0.0193  0.5842  -0.2462 -0.6420 0.5959  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  H 1   H 117 
;chain 'H' and (resid 1 through 117 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  H 118 H 219 
;chain 'H' and (resid 118 through 219 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  L 1   L 75  
;chain 'L' and (resid 1 through 75 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  L 76  L 128 
;chain 'L' and (resid 76 through 128 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  L 129 L 163 
;chain 'L' and (resid 129 through 163 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  L 164 L 212 
;chain 'L' and (resid 164 through 212 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  C 1   C 21  
;chain 'C' and (resid 1 through 21 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  C 22  C 32  
;chain 'C' and (resid 22 through 32 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  C 33  C 51  
;chain 'C' and (resid 33 through 51 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 C 52  C 58  
;chain 'C' and (resid 52 through 58 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 C 59  C 63  
;chain 'C' and (resid 59 through 63 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 C 64  C 91  
;chain 'C' and (resid 64 through 91 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 C 92  C 102 
;chain 'C' and (resid 92 through 102 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 C 103 C 114 
;chain 'C' and (resid 103 through 114 )
;
? ? ? ? ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    5 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? DENZO       ? ? ? .    6 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .    7 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND2 C ASN 5  ? ? O5 C NAG 201 ? ? 1.92 
2 1 ND2 C ASN 55 ? ? O5 A NAG 1   ? ? 2.10 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP H 151 ? ? 61.18   65.06   
2  1 PRO H 154 ? ? -97.28  -155.34 
3  1 ASN L 31  ? ? 63.40   -11.04  
4  1 ALA L 51  ? ? 65.77   -42.56  
5  1 ASN L 138 ? ? 52.71   81.90   
6  1 LYS L 169 ? ? -99.38  -66.63  
7  1 LYS L 190 ? ? -124.72 -50.46  
8  1 LYS C 6   ? ? -46.33  152.16  
9  1 THR C 13  ? ? -127.43 -163.48 
10 1 CYS C 23  ? ? -160.39 102.39  
11 1 ASN C 27  ? ? -119.25 53.60   
12 1 LEU C 101 ? ? 54.26   -107.62 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 H GLU 1   ? CG  ? A GLU 1   CG  
2   1 Y 1 H GLU 1   ? CD  ? A GLU 1   CD  
3   1 Y 1 H GLU 1   ? OE1 ? A GLU 1   OE1 
4   1 Y 1 H GLU 1   ? OE2 ? A GLU 1   OE2 
5   1 Y 1 H LYS 23  ? NZ  ? A LYS 23  NZ  
6   1 Y 1 H LYS 43  ? CE  ? A LYS 43  CE  
7   1 Y 1 H LYS 43  ? NZ  ? A LYS 43  NZ  
8   1 Y 1 H GLN 65  ? OE1 ? A GLN 65  OE1 
9   1 Y 1 H GLN 65  ? NE2 ? A GLN 65  NE2 
10  1 Y 1 H LYS 74  ? NZ  ? A LYS 74  NZ  
11  1 Y 1 H SER 75  ? OG  ? A SER 75  OG  
12  1 Y 1 H LYS 87  ? CE  ? A LYS 87  CE  
13  1 Y 1 H LYS 87  ? NZ  ? A LYS 87  NZ  
14  1 Y 1 H LYS 124 ? CE  ? A LYS 124 CE  
15  1 Y 1 H LYS 124 ? NZ  ? A LYS 124 NZ  
16  1 Y 1 H THR 198 ? OG1 ? A THR 198 OG1 
17  1 Y 1 H THR 198 ? CG2 ? A THR 198 CG2 
18  1 Y 1 H ILE 202 ? CD1 ? A ILE 202 CD1 
19  1 Y 1 H LYS 208 ? CD  ? A LYS 208 CD  
20  1 Y 1 H LYS 208 ? CE  ? A LYS 208 CE  
21  1 Y 1 H LYS 208 ? NZ  ? A LYS 208 NZ  
22  1 Y 1 H LYS 213 ? CG  ? A LYS 213 CG  
23  1 Y 1 H LYS 213 ? CD  ? A LYS 213 CD  
24  1 Y 1 H LYS 213 ? CE  ? A LYS 213 CE  
25  1 Y 1 H LYS 213 ? NZ  ? A LYS 213 NZ  
26  1 Y 1 H LYS 217 ? CD  ? A LYS 217 CD  
27  1 Y 1 H LYS 217 ? CE  ? A LYS 217 CE  
28  1 Y 1 H LYS 217 ? NZ  ? A LYS 217 NZ  
29  1 Y 1 H GLU 219 ? CG  ? A GLU 219 CG  
30  1 Y 1 H GLU 219 ? CD  ? A GLU 219 CD  
31  1 Y 1 H GLU 219 ? OE1 ? A GLU 219 OE1 
32  1 Y 1 H GLU 219 ? OE2 ? A GLU 219 OE2 
33  1 Y 1 L LEU 11  ? CD1 ? B LEU 11  CD1 
34  1 Y 1 L LEU 11  ? CD2 ? B LEU 11  CD2 
35  1 Y 1 L SER 14  ? OG  ? B SER 14  OG  
36  1 Y 1 L GLU 17  ? CG  ? B GLU 17  CG  
37  1 Y 1 L GLU 17  ? CD  ? B GLU 17  CD  
38  1 Y 1 L GLU 17  ? OE1 ? B GLU 17  OE1 
39  1 Y 1 L GLU 17  ? OE2 ? B GLU 17  OE2 
40  1 Y 1 L ARG 18  ? CZ  ? B ARG 18  CZ  
41  1 Y 1 L ARG 18  ? NH1 ? B ARG 18  NH1 
42  1 Y 1 L ARG 18  ? NH2 ? B ARG 18  NH2 
43  1 Y 1 L ARG 24  ? CG  ? B ARG 24  CG  
44  1 Y 1 L ARG 24  ? CD  ? B ARG 24  CD  
45  1 Y 1 L ARG 24  ? NE  ? B ARG 24  NE  
46  1 Y 1 L ARG 24  ? CZ  ? B ARG 24  CZ  
47  1 Y 1 L ARG 24  ? NH1 ? B ARG 24  NH1 
48  1 Y 1 L ARG 24  ? NH2 ? B ARG 24  NH2 
49  1 Y 1 L SER 28  ? OG  ? B SER 28  OG  
50  1 Y 1 L ILE 58  ? CD1 ? B ILE 58  CD1 
51  1 Y 1 L SER 67  ? OG  ? B SER 67  OG  
52  1 Y 1 L ASP 70  ? CG  ? B ASP 70  CG  
53  1 Y 1 L ASP 70  ? OD1 ? B ASP 70  OD1 
54  1 Y 1 L ASP 70  ? OD2 ? B ASP 70  OD2 
55  1 Y 1 L GLU 81  ? CG  ? B GLU 81  CG  
56  1 Y 1 L GLU 81  ? CD  ? B GLU 81  CD  
57  1 Y 1 L GLU 81  ? OE1 ? B GLU 81  OE1 
58  1 Y 1 L GLU 81  ? OE2 ? B GLU 81  OE2 
59  1 Y 1 L GLN 100 ? CG  ? B GLN 100 CG  
60  1 Y 1 L GLN 100 ? CD  ? B GLN 100 CD  
61  1 Y 1 L GLN 100 ? OE1 ? B GLN 100 OE1 
62  1 Y 1 L GLN 100 ? NE2 ? B GLN 100 NE2 
63  1 Y 1 L LYS 103 ? CE  ? B LYS 103 CE  
64  1 Y 1 L LYS 103 ? NZ  ? B LYS 103 NZ  
65  1 Y 1 L GLU 105 ? CG  ? B GLU 105 CG  
66  1 Y 1 L GLU 105 ? CD  ? B GLU 105 CD  
67  1 Y 1 L GLU 105 ? OE1 ? B GLU 105 OE1 
68  1 Y 1 L GLU 105 ? OE2 ? B GLU 105 OE2 
69  1 Y 1 L LYS 107 ? CG  ? B LYS 107 CG  
70  1 Y 1 L LYS 107 ? CD  ? B LYS 107 CD  
71  1 Y 1 L LYS 107 ? CE  ? B LYS 107 CE  
72  1 Y 1 L LYS 107 ? NZ  ? B LYS 107 NZ  
73  1 Y 1 L ASP 122 ? CG  ? B ASP 122 CG  
74  1 Y 1 L ASP 122 ? OD1 ? B ASP 122 OD1 
75  1 Y 1 L ASP 122 ? OD2 ? B ASP 122 OD2 
76  1 Y 1 L GLU 123 ? CD  ? B GLU 123 CD  
77  1 Y 1 L GLU 123 ? OE1 ? B GLU 123 OE1 
78  1 Y 1 L GLU 123 ? OE2 ? B GLU 123 OE2 
79  1 Y 1 L LYS 126 ? CG  ? B LYS 126 CG  
80  1 Y 1 L LYS 126 ? CD  ? B LYS 126 CD  
81  1 Y 1 L LYS 126 ? CE  ? B LYS 126 CE  
82  1 Y 1 L LYS 126 ? NZ  ? B LYS 126 NZ  
83  1 Y 1 L LYS 145 ? CG  ? B LYS 145 CG  
84  1 Y 1 L LYS 145 ? CD  ? B LYS 145 CD  
85  1 Y 1 L LYS 145 ? CE  ? B LYS 145 CE  
86  1 Y 1 L LYS 145 ? NZ  ? B LYS 145 NZ  
87  1 Y 1 L LYS 149 ? CE  ? B LYS 149 CE  
88  1 Y 1 L LYS 149 ? NZ  ? B LYS 149 NZ  
89  1 Y 1 L LEU 154 ? CG  ? B LEU 154 CG  
90  1 Y 1 L LEU 154 ? CD1 ? B LEU 154 CD1 
91  1 Y 1 L LEU 154 ? CD2 ? B LEU 154 CD2 
92  1 Y 1 L SER 156 ? OG  ? B SER 156 OG  
93  1 Y 1 L GLU 165 ? CD  ? B GLU 165 CD  
94  1 Y 1 L GLU 165 ? OE1 ? B GLU 165 OE1 
95  1 Y 1 L GLU 165 ? OE2 ? B GLU 165 OE2 
96  1 Y 1 L LYS 169 ? CE  ? B LYS 169 CE  
97  1 Y 1 L LYS 169 ? NZ  ? B LYS 169 NZ  
98  1 Y 1 L SER 171 ? OG  ? B SER 171 OG  
99  1 Y 1 L ASP 185 ? OD1 ? B ASP 185 OD1 
100 1 Y 1 L ASP 185 ? OD2 ? B ASP 185 OD2 
101 1 Y 1 L GLU 187 ? CG  ? B GLU 187 CG  
102 1 Y 1 L GLU 187 ? CD  ? B GLU 187 CD  
103 1 Y 1 L GLU 187 ? OE1 ? B GLU 187 OE1 
104 1 Y 1 L GLU 187 ? OE2 ? B GLU 187 OE2 
105 1 Y 1 L LYS 188 ? NZ  ? B LYS 188 NZ  
106 1 Y 1 L LYS 190 ? CD  ? B LYS 190 CD  
107 1 Y 1 L LYS 190 ? CE  ? B LYS 190 CE  
108 1 Y 1 L LYS 190 ? NZ  ? B LYS 190 NZ  
109 1 Y 1 L GLN 199 ? OE1 ? B GLN 199 OE1 
110 1 Y 1 L GLN 199 ? NE2 ? B GLN 199 NE2 
111 1 Y 1 C GLN 1   ? CD  ? C GLN 1   CD  
112 1 Y 1 C GLN 1   ? OE1 ? C GLN 1   OE1 
113 1 Y 1 C GLN 1   ? NE2 ? C GLN 1   NE2 
114 1 Y 1 C LYS 6   ? CG  ? C LYS 6   CG  
115 1 Y 1 C LYS 6   ? CD  ? C LYS 6   CD  
116 1 Y 1 C LYS 6   ? CE  ? C LYS 6   CE  
117 1 Y 1 C LYS 6   ? NZ  ? C LYS 6   NZ  
118 1 Y 1 C LYS 8   ? CG  ? C LYS 8   CG  
119 1 Y 1 C LYS 8   ? CD  ? C LYS 8   CD  
120 1 Y 1 C LYS 8   ? CE  ? C LYS 8   CE  
121 1 Y 1 C LYS 8   ? NZ  ? C LYS 8   NZ  
122 1 Y 1 C GLU 11  ? CG  ? C GLU 11  CG  
123 1 Y 1 C GLU 11  ? CD  ? C GLU 11  CD  
124 1 Y 1 C GLU 11  ? OE1 ? C GLU 11  OE1 
125 1 Y 1 C GLU 11  ? OE2 ? C GLU 11  OE2 
126 1 Y 1 C PHE 14  ? CG  ? C PHE 14  CG  
127 1 Y 1 C PHE 14  ? CD1 ? C PHE 14  CD1 
128 1 Y 1 C PHE 14  ? CD2 ? C PHE 14  CD2 
129 1 Y 1 C PHE 14  ? CE1 ? C PHE 14  CE1 
130 1 Y 1 C PHE 14  ? CE2 ? C PHE 14  CE2 
131 1 Y 1 C PHE 14  ? CZ  ? C PHE 14  CZ  
132 1 Y 1 C GLN 31  ? CG  ? C GLN 31  CG  
133 1 Y 1 C GLN 31  ? CD  ? C GLN 31  CD  
134 1 Y 1 C GLN 31  ? OE1 ? C GLN 31  OE1 
135 1 Y 1 C GLN 31  ? NE2 ? C GLN 31  NE2 
136 1 Y 1 C GLU 35  ? CD  ? C GLU 35  CD  
137 1 Y 1 C GLU 35  ? OE1 ? C GLU 35  OE1 
138 1 Y 1 C GLU 35  ? OE2 ? C GLU 35  OE2 
139 1 Y 1 C LYS 43  ? CE  ? C LYS 43  CE  
140 1 Y 1 C LYS 43  ? NZ  ? C LYS 43  NZ  
141 1 Y 1 C LYS 67  ? CD  ? C LYS 67  CD  
142 1 Y 1 C LYS 67  ? CE  ? C LYS 67  CE  
143 1 Y 1 C LYS 67  ? NZ  ? C LYS 67  NZ  
144 1 Y 1 C GLU 69  ? CD  ? C GLU 69  CD  
145 1 Y 1 C GLU 69  ? OE1 ? C GLU 69  OE1 
146 1 Y 1 C GLU 69  ? OE2 ? C GLU 69  OE2 
147 1 Y 1 C LYS 81  ? CD  ? C LYS 81  CD  
148 1 Y 1 C LYS 81  ? CE  ? C LYS 81  CE  
149 1 Y 1 C LYS 81  ? NZ  ? C LYS 81  NZ  
150 1 Y 1 C LYS 84  ? CE  ? C LYS 84  CE  
151 1 Y 1 C LYS 84  ? NZ  ? C LYS 84  NZ  
152 1 Y 1 C LYS 112 ? NZ  ? C LYS 112 NZ  
153 1 Y 1 C ARG 114 ? CG  ? C ARG 114 CG  
154 1 Y 1 C ARG 114 ? CD  ? C ARG 114 CD  
155 1 Y 1 C ARG 114 ? NE  ? C ARG 114 NE  
156 1 Y 1 C ARG 114 ? CZ  ? C ARG 114 CZ  
157 1 Y 1 C ARG 114 ? NH1 ? C ARG 114 NH1 
158 1 Y 1 C ARG 114 ? NH2 ? C ARG 114 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 H SER 134 ? A SER 134 
2  1 Y 1 H SER 135 ? A SER 135 
3  1 Y 1 H LYS 136 ? A LYS 136 
4  1 Y 1 H SER 137 ? A SER 137 
5  1 Y 1 H THR 138 ? A THR 138 
6  1 Y 1 H SER 139 ? A SER 139 
7  1 Y 1 H GLY 140 ? A GLY 140 
8  1 Y 1 H LYS 221 ? A LYS 221 
9  1 Y 1 H SER 222 ? A SER 222 
10 1 Y 1 H CYS 223 ? A CYS 223 
11 1 Y 1 H HIS 224 ? A HIS 224 
12 1 Y 1 H HIS 225 ? A HIS 225 
13 1 Y 1 H HIS 226 ? A HIS 226 
14 1 Y 1 H HIS 227 ? A HIS 227 
15 1 Y 1 H HIS 228 ? A HIS 228 
16 1 Y 1 H HIS 229 ? A HIS 229 
17 1 Y 1 L GLU 213 ? B GLU 213 
18 1 Y 1 L CYS 214 ? B CYS 214 
19 1 Y 1 C VAL 115 ? C VAL 115 
20 1 Y 1 C VAL 116 ? C VAL 116 
21 1 Y 1 C SER 117 ? C SER 117 
22 1 Y 1 C TRP 118 ? C TRP 118 
23 1 Y 1 C PHE 119 ? C PHE 119 
24 1 Y 1 C SER 120 ? C SER 120 
25 1 Y 1 C PRO 121 ? C PRO 121 
26 1 Y 1 C ASN 122 ? C ASN 122 
27 1 Y 1 C GLU 123 ? C GLU 123 
28 1 Y 1 C HIS 124 ? C HIS 124 
29 1 Y 1 C HIS 125 ? C HIS 125 
30 1 Y 1 C HIS 126 ? C HIS 126 
31 1 Y 1 C HIS 127 ? C HIS 127 
32 1 Y 1 C HIS 128 ? C HIS 128 
33 1 Y 1 C HIS 129 ? C HIS 129 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
D 4 NAG 1 A NAG 1 C NAG 255 n 
D 4 NAG 2 A NAG 2 C NAG 256 n 
E 4 NAG 1 B NAG 1 C NAG 293 n 
E 4 NAG 2 B NAG 2 C NAG 294 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   4 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 4 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 4 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 4 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  4 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
4 NAG 1 n 
4 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 GLYCEROL                                 GOL 
6 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
7 water                                    HOH 
#