data_5U07
# 
_entry.id   5U07 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5U07         
WWPDB D_1000225080 
EMDB  EMD-8477     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'CRISPR RNA-guided surveillance complex' EMD-8477 'associated EM volume' 
PDB  .                                        5U0A     unspecified            
EMDB .                                        EMD-8478 'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5U07 
_pdbx_database_status.recvd_initial_deposition_date   2016-11-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Xiao, Y.'    1 ? 
'Luo, M.'     2 ? 
'Hayes, R.P.' 3 ? 
'Kim, J.'     4 ? 
'Ng, S.'      5 ? 
'Ding, F.'    6 ? 
'Liao, M.'    7 ? 
'Ke, A.'      8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            170 
_citation.language                  ? 
_citation.page_first                48 
_citation.page_last                 60.e11 
_citation.title                     
'Structure Basis for Directional R-loop Formation and Substrate Handover Mechanisms in Type I CRISPR-Cas System.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2017.06.012 
_citation.pdbx_database_id_PubMed   28666122 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xiao, Y.'    1 
primary 'Luo, M.'     2 
primary 'Hayes, R.P.' 3 
primary 'Kim, J.'     4 
primary 'Ng, S.'      5 
primary 'Ding, F.'    6 
primary 'Liao, M.'    7 
primary 'Ke, A.'      8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5U07 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     316.928 
_cell.length_a_esd                 ? 
_cell.length_b                     316.928 
_cell.length_b_esd                 ? 
_cell.length_c                     316.928 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5U07 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CRISPR-associated protein, Cse3 family'  26327.938 1 ? ? ? ? 
2 polymer man Cse2                                      27446.613 2 ? ? ? ? 
3 polymer man 'CRISPR-associated protein, Cse1 family'  61433.297 1 ? ? ? ? 
4 polymer man 'CRISPR-associated protein, Cse4 family'  41043.043 6 ? ? ? ? 
5 polymer syn crRNA                                     19790.793 1 ? ? ? ? 
6 polymer syn 'Target Strand'                           6381.106  1 ? ? ? ? 
7 polymer man 'CRISPR-associated protein, Cas5e family' 28279.260 1 ? ? ? ? 
8 polymer syn 'Nontarget Strand'                        3986.600  1 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MTWLTKIVPDLRYRQTRADFRTAGNLHRKLIRLSSDLGEERIANPRQQSGLLFRIEETRNELYLLVQSHSPLRVDRLGPG
YHGVQMRNLDPFLARLDKGSRVRYRIVASPTKRLGRSENNTQRLGLKEPPKKPREYTWALRGAAAEEWWHSRAAANGLEL
LSTYAQTLDDVRDPGTADRSRKIRHPAVRFDGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLALIEEGEHG
;
;MTWLTKIVPDLRYRQTRADFRTAGNLHRKLIRLSSDLGEERIANPRQQSGLLFRIEETRNELYLLVQSHSPLRVDRLGPG
YHGVQMRNLDPFLARLDKGSRVRYRIVASPTKRLGRSENNTQRLGLKEPPKKPREYTWALRGAAAEEWWHSRAAANGLEL
LSTYAQTLDDVRDPGTADRSRKIRHPAVRFDGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLALIEEGEHG
;
A           ? 
2 'polypeptide(L)'        no no 
;MNSDYILQHADALVKRVSKLIVNEPAARAALRRGVGLAPEDPRMLAAHRVVAPYVPVPTDYDVDRRRAASLWDVHAVERA
FYAVAAIMAAQPRSARDQEAEATEEQTGEPQDSEALTEPTPAEESSATKDGKPDRRPNLGVSLAQAVFDKGLNADSTEQR
LHLIARQNLDGVHRHLPRLVLYLRSDQVHIDWGILIRDLARWGHTPRHVAREWVQDYHRTLETLTRQAEQKNKNNTTDEE
AEAA
;
;MNSDYILQHADALVKRVSKLIVNEPAARAALRRGVGLAPEDPRMLAAHRVVAPYVPVPTDYDVDRRRAASLWDVHAVERA
FYAVAAIMAAQPRSARDQEAEATEEQTGEPQDSEALTEPTPAEESSATKDGKPDRRPNLGVSLAQAVFDKGLNADSTEQR
LHLIARQNLDGVHRHLPRLVLYLRSDQVHIDWGILIRDLARWGHTPRHVAREWVQDYHRTLETLTRQAEQKNKNNTTDEE
AEAA
;
B,J         ? 
3 'polypeptide(L)'        no no 
;MLSVALCFLVGGAIPSPPSFDVTIAPWLIARSRDVLAAPEMLGLRDVLIRSHELSDVEIPLPPGAAVLWRILALITARIT
GLDQPPNKNPKRKWQARRSQILSKGRLDPEAVDAYFADYSERFDLFHPERPWLQDPRLREECPKTSGVNKLAWGRTAGEN
QVWLGGHHHDLDPHPLDSAEAVWHLLATLGYGPSGMCTARVVRGRSERNVTAGPLRGTVSYHPLGRTLFESLILNIPYPG
TGAADLAFWEQPELNDPLGLPEESAGLAGILRLDHFRHAVLLHPSPDGSHVVDAWVTWAWRERNISPELDPYLIYQTSKE
GRVYPRPAEAERAIWRDLDALLHYGEDGNYRPTILDNCTPLAQVPQEVLDSLRLRAFGFDQDGQARDKQWFTATTPAVLR
WLADRETDDNENARIVRRITLARKAAEALGRRLEKACKEAWKESNSPSSTSSGTNAKTETGVGPWVQHGMSRYWAKAEPV
FWNIVYDRPAQGYTPGMAGPGNAFNLVALAAYDEVTGPYCERPRVAKVVERHRSTLFSNWTPKQDKEAA
;
;MLSVALCFLVGGAIPSPPSFDVTIAPWLIARSRDVLAAPEMLGLRDVLIRSHELSDVEIPLPPGAAVLWRILALITARIT
GLDQPPNKNPKRKWQARRSQILSKGRLDPEAVDAYFADYSERFDLFHPERPWLQDPRLREECPKTSGVNKLAWGRTAGEN
QVWLGGHHHDLDPHPLDSAEAVWHLLATLGYGPSGMCTARVVRGRSERNVTAGPLRGTVSYHPLGRTLFESLILNIPYPG
TGAADLAFWEQPELNDPLGLPEESAGLAGILRLDHFRHAVLLHPSPDGSHVVDAWVTWAWRERNISPELDPYLIYQTSKE
GRVYPRPAEAERAIWRDLDALLHYGEDGNYRPTILDNCTPLAQVPQEVLDSLRLRAFGFDQDGQARDKQWFTATTPAVLR
WLADRETDDNENARIVRRITLARKAAEALGRRLEKACKEAWKESNSPSSTSSGTNAKTETGVGPWVQHGMSRYWAKAEPV
FWNIVYDRPAQGYTPGMAGPGNAFNLVALAAYDEVTGPYCERPRVAKVVERHRSTLFSNWTPKQDKEAA
;
C           ? 
4 'polypeptide(L)'        no no 
;MTFVDIHAIQTLPYSNINRDDLGSPKTVVYGGKERTRVSSQSWKRAVRHEVEARLGDKAVRTRRIISEIAKRLRERGWDA
DLADAGARQVVLSVGKKSGIKLEKEKDSEAPATSVLFYLPVPAIDELAAIADEHRDAVAKEAAKKTPKGILPADRITEVL
KSRNVSVNLFGRMLAELPSTEVDGAVQFAHAFTVHGTTVEVDFFTAVDDIPKENDHGSGHMNAGQFSAGTFYRYANVNLD
RLVENTGDAQTARTAVAEFLRAFLSTVPSGKQNATAAMTLPDLVHIAVRFDRPISFAPAFETALYGSDGYTLRACQELNN
YAERLREVWPDDAIRGYATVENKTDLAALGERYDSYPALIDAMVAAAFEGERE
;
;MTFVDIHAIQTLPYSNINRDDLGSPKTVVYGGKERTRVSSQSWKRAVRHEVEARLGDKAVRTRRIISEIAKRLRERGWDA
DLADAGARQVVLSVGKKSGIKLEKEKDSEAPATSVLFYLPVPAIDELAAIADEHRDAVAKEAAKKTPKGILPADRITEVL
KSRNVSVNLFGRMLAELPSTEVDGAVQFAHAFTVHGTTVEVDFFTAVDDIPKENDHGSGHMNAGQFSAGTFYRYANVNLD
RLVENTGDAQTARTAVAEFLRAFLSTVPSGKQNATAAMTLPDLVHIAVRFDRPISFAPAFETALYGSDGYTLRACQELNN
YAERLREVWPDDAIRGYATVENKTDLAALGERYDSYPALIDAMVAAAFEGERE
;
D,E,F,G,H,I ? 
5 polyribonucleotide      no no AUGGACCGCCAGUGAUAAGUGGAAUGCCAUGUGGGCUGUCGUGAGCCCCACGCACGUGGGG 
AUGGACCGCCAGUGAUAAGUGGAAUGCCAUGUGGGCUGUCGUGAGCCCCACGCACGUGGGG K           ? 
6 polydeoxyribonucleotide no no 
;(DT)(DT)(DA)(DT)(DC)(DA)(DC)(DT)(DG)(DG)(DC)(DT)(DT)(DC)(DG)(DT)(DC)(DC)(DG)(DC)
(DG)
;
TTATCACTGGCTTCGTCCGCG M           ? 
7 'polypeptide(L)'        no no 
;MSGFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPLDRYKELKFTVRVDRPGVRLVDFHTIGGGL
PKERTVPTAAGERRDPKKATIVTSRSYLADAVFTVAVTGPEADTIADALAAPYWQPYLGRRAFVPDPLLVLRRRVADPVR
ELVEAVPLPHRRVEEDAATVLVDLIYEEGEYPDTRTLTVLNDVPLSFDSKSRRYSTRQIRVVPTEVPATLVAGPGRDYQN
KLFTYVKQCAEEAA
;
;MSGFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPLDRYKELKFTVRVDRPGVRLVDFHTIGGGL
PKERTVPTAAGERRDPKKATIVTSRSYLADAVFTVAVTGPEADTIADALAAPYWQPYLGRRAFVPDPLLVLRRRVADPVR
ELVEAVPLPHRRVEEDAATVLVDLIYEEGEYPDTRTLTVLNDVPLSFDSKSRRYSTRQIRVVPTEVPATLVAGPGRDYQN
KLFTYVKQCAEEAA
;
N           ? 
8 polydeoxyribonucleotide no no '(DC)(DG)(DC)(DG)(DG)(DA)(DC)(DG)(DA)(DA)(DG)(DC)(DC)' CGCGGACGAAGCC O           ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   TRP n 
1 4   LEU n 
1 5   THR n 
1 6   LYS n 
1 7   ILE n 
1 8   VAL n 
1 9   PRO n 
1 10  ASP n 
1 11  LEU n 
1 12  ARG n 
1 13  TYR n 
1 14  ARG n 
1 15  GLN n 
1 16  THR n 
1 17  ARG n 
1 18  ALA n 
1 19  ASP n 
1 20  PHE n 
1 21  ARG n 
1 22  THR n 
1 23  ALA n 
1 24  GLY n 
1 25  ASN n 
1 26  LEU n 
1 27  HIS n 
1 28  ARG n 
1 29  LYS n 
1 30  LEU n 
1 31  ILE n 
1 32  ARG n 
1 33  LEU n 
1 34  SER n 
1 35  SER n 
1 36  ASP n 
1 37  LEU n 
1 38  GLY n 
1 39  GLU n 
1 40  GLU n 
1 41  ARG n 
1 42  ILE n 
1 43  ALA n 
1 44  ASN n 
1 45  PRO n 
1 46  ARG n 
1 47  GLN n 
1 48  GLN n 
1 49  SER n 
1 50  GLY n 
1 51  LEU n 
1 52  LEU n 
1 53  PHE n 
1 54  ARG n 
1 55  ILE n 
1 56  GLU n 
1 57  GLU n 
1 58  THR n 
1 59  ARG n 
1 60  ASN n 
1 61  GLU n 
1 62  LEU n 
1 63  TYR n 
1 64  LEU n 
1 65  LEU n 
1 66  VAL n 
1 67  GLN n 
1 68  SER n 
1 69  HIS n 
1 70  SER n 
1 71  PRO n 
1 72  LEU n 
1 73  ARG n 
1 74  VAL n 
1 75  ASP n 
1 76  ARG n 
1 77  LEU n 
1 78  GLY n 
1 79  PRO n 
1 80  GLY n 
1 81  TYR n 
1 82  HIS n 
1 83  GLY n 
1 84  VAL n 
1 85  GLN n 
1 86  MET n 
1 87  ARG n 
1 88  ASN n 
1 89  LEU n 
1 90  ASP n 
1 91  PRO n 
1 92  PHE n 
1 93  LEU n 
1 94  ALA n 
1 95  ARG n 
1 96  LEU n 
1 97  ASP n 
1 98  LYS n 
1 99  GLY n 
1 100 SER n 
1 101 ARG n 
1 102 VAL n 
1 103 ARG n 
1 104 TYR n 
1 105 ARG n 
1 106 ILE n 
1 107 VAL n 
1 108 ALA n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 LYS n 
1 113 ARG n 
1 114 LEU n 
1 115 GLY n 
1 116 ARG n 
1 117 SER n 
1 118 GLU n 
1 119 ASN n 
1 120 ASN n 
1 121 THR n 
1 122 GLN n 
1 123 ARG n 
1 124 LEU n 
1 125 GLY n 
1 126 LEU n 
1 127 LYS n 
1 128 GLU n 
1 129 PRO n 
1 130 PRO n 
1 131 LYS n 
1 132 LYS n 
1 133 PRO n 
1 134 ARG n 
1 135 GLU n 
1 136 TYR n 
1 137 THR n 
1 138 TRP n 
1 139 ALA n 
1 140 LEU n 
1 141 ARG n 
1 142 GLY n 
1 143 ALA n 
1 144 ALA n 
1 145 ALA n 
1 146 GLU n 
1 147 GLU n 
1 148 TRP n 
1 149 TRP n 
1 150 HIS n 
1 151 SER n 
1 152 ARG n 
1 153 ALA n 
1 154 ALA n 
1 155 ALA n 
1 156 ASN n 
1 157 GLY n 
1 158 LEU n 
1 159 GLU n 
1 160 LEU n 
1 161 LEU n 
1 162 SER n 
1 163 THR n 
1 164 TYR n 
1 165 ALA n 
1 166 GLN n 
1 167 THR n 
1 168 LEU n 
1 169 ASP n 
1 170 ASP n 
1 171 VAL n 
1 172 ARG n 
1 173 ASP n 
1 174 PRO n 
1 175 GLY n 
1 176 THR n 
1 177 ALA n 
1 178 ASP n 
1 179 ARG n 
1 180 SER n 
1 181 ARG n 
1 182 LYS n 
1 183 ILE n 
1 184 ARG n 
1 185 HIS n 
1 186 PRO n 
1 187 ALA n 
1 188 VAL n 
1 189 ARG n 
1 190 PHE n 
1 191 ASP n 
1 192 GLY n 
1 193 GLU n 
1 194 ALA n 
1 195 VAL n 
1 196 ILE n 
1 197 SER n 
1 198 ASP n 
1 199 VAL n 
1 200 ASP n 
1 201 ALA n 
1 202 VAL n 
1 203 ARG n 
1 204 HIS n 
1 205 ALA n 
1 206 VAL n 
1 207 LEU n 
1 208 ASN n 
1 209 GLY n 
1 210 ILE n 
1 211 GLY n 
1 212 ARG n 
1 213 GLY n 
1 214 LYS n 
1 215 SER n 
1 216 TYR n 
1 217 GLY n 
1 218 CYS n 
1 219 GLY n 
1 220 LEU n 
1 221 LEU n 
1 222 SER n 
1 223 LEU n 
1 224 ALA n 
1 225 LEU n 
1 226 ILE n 
1 227 GLU n 
1 228 GLU n 
1 229 GLY n 
1 230 GLU n 
1 231 HIS n 
1 232 GLY n 
2 1   MET n 
2 2   ASN n 
2 3   SER n 
2 4   ASP n 
2 5   TYR n 
2 6   ILE n 
2 7   LEU n 
2 8   GLN n 
2 9   HIS n 
2 10  ALA n 
2 11  ASP n 
2 12  ALA n 
2 13  LEU n 
2 14  VAL n 
2 15  LYS n 
2 16  ARG n 
2 17  VAL n 
2 18  SER n 
2 19  LYS n 
2 20  LEU n 
2 21  ILE n 
2 22  VAL n 
2 23  ASN n 
2 24  GLU n 
2 25  PRO n 
2 26  ALA n 
2 27  ALA n 
2 28  ARG n 
2 29  ALA n 
2 30  ALA n 
2 31  LEU n 
2 32  ARG n 
2 33  ARG n 
2 34  GLY n 
2 35  VAL n 
2 36  GLY n 
2 37  LEU n 
2 38  ALA n 
2 39  PRO n 
2 40  GLU n 
2 41  ASP n 
2 42  PRO n 
2 43  ARG n 
2 44  MET n 
2 45  LEU n 
2 46  ALA n 
2 47  ALA n 
2 48  HIS n 
2 49  ARG n 
2 50  VAL n 
2 51  VAL n 
2 52  ALA n 
2 53  PRO n 
2 54  TYR n 
2 55  VAL n 
2 56  PRO n 
2 57  VAL n 
2 58  PRO n 
2 59  THR n 
2 60  ASP n 
2 61  TYR n 
2 62  ASP n 
2 63  VAL n 
2 64  ASP n 
2 65  ARG n 
2 66  ARG n 
2 67  ARG n 
2 68  ALA n 
2 69  ALA n 
2 70  SER n 
2 71  LEU n 
2 72  TRP n 
2 73  ASP n 
2 74  VAL n 
2 75  HIS n 
2 76  ALA n 
2 77  VAL n 
2 78  GLU n 
2 79  ARG n 
2 80  ALA n 
2 81  PHE n 
2 82  TYR n 
2 83  ALA n 
2 84  VAL n 
2 85  ALA n 
2 86  ALA n 
2 87  ILE n 
2 88  MET n 
2 89  ALA n 
2 90  ALA n 
2 91  GLN n 
2 92  PRO n 
2 93  ARG n 
2 94  SER n 
2 95  ALA n 
2 96  ARG n 
2 97  ASP n 
2 98  GLN n 
2 99  GLU n 
2 100 ALA n 
2 101 GLU n 
2 102 ALA n 
2 103 THR n 
2 104 GLU n 
2 105 GLU n 
2 106 GLN n 
2 107 THR n 
2 108 GLY n 
2 109 GLU n 
2 110 PRO n 
2 111 GLN n 
2 112 ASP n 
2 113 SER n 
2 114 GLU n 
2 115 ALA n 
2 116 LEU n 
2 117 THR n 
2 118 GLU n 
2 119 PRO n 
2 120 THR n 
2 121 PRO n 
2 122 ALA n 
2 123 GLU n 
2 124 GLU n 
2 125 SER n 
2 126 SER n 
2 127 ALA n 
2 128 THR n 
2 129 LYS n 
2 130 ASP n 
2 131 GLY n 
2 132 LYS n 
2 133 PRO n 
2 134 ASP n 
2 135 ARG n 
2 136 ARG n 
2 137 PRO n 
2 138 ASN n 
2 139 LEU n 
2 140 GLY n 
2 141 VAL n 
2 142 SER n 
2 143 LEU n 
2 144 ALA n 
2 145 GLN n 
2 146 ALA n 
2 147 VAL n 
2 148 PHE n 
2 149 ASP n 
2 150 LYS n 
2 151 GLY n 
2 152 LEU n 
2 153 ASN n 
2 154 ALA n 
2 155 ASP n 
2 156 SER n 
2 157 THR n 
2 158 GLU n 
2 159 GLN n 
2 160 ARG n 
2 161 LEU n 
2 162 HIS n 
2 163 LEU n 
2 164 ILE n 
2 165 ALA n 
2 166 ARG n 
2 167 GLN n 
2 168 ASN n 
2 169 LEU n 
2 170 ASP n 
2 171 GLY n 
2 172 VAL n 
2 173 HIS n 
2 174 ARG n 
2 175 HIS n 
2 176 LEU n 
2 177 PRO n 
2 178 ARG n 
2 179 LEU n 
2 180 VAL n 
2 181 LEU n 
2 182 TYR n 
2 183 LEU n 
2 184 ARG n 
2 185 SER n 
2 186 ASP n 
2 187 GLN n 
2 188 VAL n 
2 189 HIS n 
2 190 ILE n 
2 191 ASP n 
2 192 TRP n 
2 193 GLY n 
2 194 ILE n 
2 195 LEU n 
2 196 ILE n 
2 197 ARG n 
2 198 ASP n 
2 199 LEU n 
2 200 ALA n 
2 201 ARG n 
2 202 TRP n 
2 203 GLY n 
2 204 HIS n 
2 205 THR n 
2 206 PRO n 
2 207 ARG n 
2 208 HIS n 
2 209 VAL n 
2 210 ALA n 
2 211 ARG n 
2 212 GLU n 
2 213 TRP n 
2 214 VAL n 
2 215 GLN n 
2 216 ASP n 
2 217 TYR n 
2 218 HIS n 
2 219 ARG n 
2 220 THR n 
2 221 LEU n 
2 222 GLU n 
2 223 THR n 
2 224 LEU n 
2 225 THR n 
2 226 ARG n 
2 227 GLN n 
2 228 ALA n 
2 229 GLU n 
2 230 GLN n 
2 231 LYS n 
2 232 ASN n 
2 233 LYS n 
2 234 ASN n 
2 235 ASN n 
2 236 THR n 
2 237 THR n 
2 238 ASP n 
2 239 GLU n 
2 240 GLU n 
2 241 ALA n 
2 242 GLU n 
2 243 ALA n 
2 244 ALA n 
3 1   MET n 
3 2   LEU n 
3 3   SER n 
3 4   VAL n 
3 5   ALA n 
3 6   LEU n 
3 7   CYS n 
3 8   PHE n 
3 9   LEU n 
3 10  VAL n 
3 11  GLY n 
3 12  GLY n 
3 13  ALA n 
3 14  ILE n 
3 15  PRO n 
3 16  SER n 
3 17  PRO n 
3 18  PRO n 
3 19  SER n 
3 20  PHE n 
3 21  ASP n 
3 22  VAL n 
3 23  THR n 
3 24  ILE n 
3 25  ALA n 
3 26  PRO n 
3 27  TRP n 
3 28  LEU n 
3 29  ILE n 
3 30  ALA n 
3 31  ARG n 
3 32  SER n 
3 33  ARG n 
3 34  ASP n 
3 35  VAL n 
3 36  LEU n 
3 37  ALA n 
3 38  ALA n 
3 39  PRO n 
3 40  GLU n 
3 41  MET n 
3 42  LEU n 
3 43  GLY n 
3 44  LEU n 
3 45  ARG n 
3 46  ASP n 
3 47  VAL n 
3 48  LEU n 
3 49  ILE n 
3 50  ARG n 
3 51  SER n 
3 52  HIS n 
3 53  GLU n 
3 54  LEU n 
3 55  SER n 
3 56  ASP n 
3 57  VAL n 
3 58  GLU n 
3 59  ILE n 
3 60  PRO n 
3 61  LEU n 
3 62  PRO n 
3 63  PRO n 
3 64  GLY n 
3 65  ALA n 
3 66  ALA n 
3 67  VAL n 
3 68  LEU n 
3 69  TRP n 
3 70  ARG n 
3 71  ILE n 
3 72  LEU n 
3 73  ALA n 
3 74  LEU n 
3 75  ILE n 
3 76  THR n 
3 77  ALA n 
3 78  ARG n 
3 79  ILE n 
3 80  THR n 
3 81  GLY n 
3 82  LEU n 
3 83  ASP n 
3 84  GLN n 
3 85  PRO n 
3 86  PRO n 
3 87  ASN n 
3 88  LYS n 
3 89  ASN n 
3 90  PRO n 
3 91  LYS n 
3 92  ARG n 
3 93  LYS n 
3 94  TRP n 
3 95  GLN n 
3 96  ALA n 
3 97  ARG n 
3 98  ARG n 
3 99  SER n 
3 100 GLN n 
3 101 ILE n 
3 102 LEU n 
3 103 SER n 
3 104 LYS n 
3 105 GLY n 
3 106 ARG n 
3 107 LEU n 
3 108 ASP n 
3 109 PRO n 
3 110 GLU n 
3 111 ALA n 
3 112 VAL n 
3 113 ASP n 
3 114 ALA n 
3 115 TYR n 
3 116 PHE n 
3 117 ALA n 
3 118 ASP n 
3 119 TYR n 
3 120 SER n 
3 121 GLU n 
3 122 ARG n 
3 123 PHE n 
3 124 ASP n 
3 125 LEU n 
3 126 PHE n 
3 127 HIS n 
3 128 PRO n 
3 129 GLU n 
3 130 ARG n 
3 131 PRO n 
3 132 TRP n 
3 133 LEU n 
3 134 GLN n 
3 135 ASP n 
3 136 PRO n 
3 137 ARG n 
3 138 LEU n 
3 139 ARG n 
3 140 GLU n 
3 141 GLU n 
3 142 CYS n 
3 143 PRO n 
3 144 LYS n 
3 145 THR n 
3 146 SER n 
3 147 GLY n 
3 148 VAL n 
3 149 ASN n 
3 150 LYS n 
3 151 LEU n 
3 152 ALA n 
3 153 TRP n 
3 154 GLY n 
3 155 ARG n 
3 156 THR n 
3 157 ALA n 
3 158 GLY n 
3 159 GLU n 
3 160 ASN n 
3 161 GLN n 
3 162 VAL n 
3 163 TRP n 
3 164 LEU n 
3 165 GLY n 
3 166 GLY n 
3 167 HIS n 
3 168 HIS n 
3 169 HIS n 
3 170 ASP n 
3 171 LEU n 
3 172 ASP n 
3 173 PRO n 
3 174 HIS n 
3 175 PRO n 
3 176 LEU n 
3 177 ASP n 
3 178 SER n 
3 179 ALA n 
3 180 GLU n 
3 181 ALA n 
3 182 VAL n 
3 183 TRP n 
3 184 HIS n 
3 185 LEU n 
3 186 LEU n 
3 187 ALA n 
3 188 THR n 
3 189 LEU n 
3 190 GLY n 
3 191 TYR n 
3 192 GLY n 
3 193 PRO n 
3 194 SER n 
3 195 GLY n 
3 196 MET n 
3 197 CYS n 
3 198 THR n 
3 199 ALA n 
3 200 ARG n 
3 201 VAL n 
3 202 VAL n 
3 203 ARG n 
3 204 GLY n 
3 205 ARG n 
3 206 SER n 
3 207 GLU n 
3 208 ARG n 
3 209 ASN n 
3 210 VAL n 
3 211 THR n 
3 212 ALA n 
3 213 GLY n 
3 214 PRO n 
3 215 LEU n 
3 216 ARG n 
3 217 GLY n 
3 218 THR n 
3 219 VAL n 
3 220 SER n 
3 221 TYR n 
3 222 HIS n 
3 223 PRO n 
3 224 LEU n 
3 225 GLY n 
3 226 ARG n 
3 227 THR n 
3 228 LEU n 
3 229 PHE n 
3 230 GLU n 
3 231 SER n 
3 232 LEU n 
3 233 ILE n 
3 234 LEU n 
3 235 ASN n 
3 236 ILE n 
3 237 PRO n 
3 238 TYR n 
3 239 PRO n 
3 240 GLY n 
3 241 THR n 
3 242 GLY n 
3 243 ALA n 
3 244 ALA n 
3 245 ASP n 
3 246 LEU n 
3 247 ALA n 
3 248 PHE n 
3 249 TRP n 
3 250 GLU n 
3 251 GLN n 
3 252 PRO n 
3 253 GLU n 
3 254 LEU n 
3 255 ASN n 
3 256 ASP n 
3 257 PRO n 
3 258 LEU n 
3 259 GLY n 
3 260 LEU n 
3 261 PRO n 
3 262 GLU n 
3 263 GLU n 
3 264 SER n 
3 265 ALA n 
3 266 GLY n 
3 267 LEU n 
3 268 ALA n 
3 269 GLY n 
3 270 ILE n 
3 271 LEU n 
3 272 ARG n 
3 273 LEU n 
3 274 ASP n 
3 275 HIS n 
3 276 PHE n 
3 277 ARG n 
3 278 HIS n 
3 279 ALA n 
3 280 VAL n 
3 281 LEU n 
3 282 LEU n 
3 283 HIS n 
3 284 PRO n 
3 285 SER n 
3 286 PRO n 
3 287 ASP n 
3 288 GLY n 
3 289 SER n 
3 290 HIS n 
3 291 VAL n 
3 292 VAL n 
3 293 ASP n 
3 294 ALA n 
3 295 TRP n 
3 296 VAL n 
3 297 THR n 
3 298 TRP n 
3 299 ALA n 
3 300 TRP n 
3 301 ARG n 
3 302 GLU n 
3 303 ARG n 
3 304 ASN n 
3 305 ILE n 
3 306 SER n 
3 307 PRO n 
3 308 GLU n 
3 309 LEU n 
3 310 ASP n 
3 311 PRO n 
3 312 TYR n 
3 313 LEU n 
3 314 ILE n 
3 315 TYR n 
3 316 GLN n 
3 317 THR n 
3 318 SER n 
3 319 LYS n 
3 320 GLU n 
3 321 GLY n 
3 322 ARG n 
3 323 VAL n 
3 324 TYR n 
3 325 PRO n 
3 326 ARG n 
3 327 PRO n 
3 328 ALA n 
3 329 GLU n 
3 330 ALA n 
3 331 GLU n 
3 332 ARG n 
3 333 ALA n 
3 334 ILE n 
3 335 TRP n 
3 336 ARG n 
3 337 ASP n 
3 338 LEU n 
3 339 ASP n 
3 340 ALA n 
3 341 LEU n 
3 342 LEU n 
3 343 HIS n 
3 344 TYR n 
3 345 GLY n 
3 346 GLU n 
3 347 ASP n 
3 348 GLY n 
3 349 ASN n 
3 350 TYR n 
3 351 ARG n 
3 352 PRO n 
3 353 THR n 
3 354 ILE n 
3 355 LEU n 
3 356 ASP n 
3 357 ASN n 
3 358 CYS n 
3 359 THR n 
3 360 PRO n 
3 361 LEU n 
3 362 ALA n 
3 363 GLN n 
3 364 VAL n 
3 365 PRO n 
3 366 GLN n 
3 367 GLU n 
3 368 VAL n 
3 369 LEU n 
3 370 ASP n 
3 371 SER n 
3 372 LEU n 
3 373 ARG n 
3 374 LEU n 
3 375 ARG n 
3 376 ALA n 
3 377 PHE n 
3 378 GLY n 
3 379 PHE n 
3 380 ASP n 
3 381 GLN n 
3 382 ASP n 
3 383 GLY n 
3 384 GLN n 
3 385 ALA n 
3 386 ARG n 
3 387 ASP n 
3 388 LYS n 
3 389 GLN n 
3 390 TRP n 
3 391 PHE n 
3 392 THR n 
3 393 ALA n 
3 394 THR n 
3 395 THR n 
3 396 PRO n 
3 397 ALA n 
3 398 VAL n 
3 399 LEU n 
3 400 ARG n 
3 401 TRP n 
3 402 LEU n 
3 403 ALA n 
3 404 ASP n 
3 405 ARG n 
3 406 GLU n 
3 407 THR n 
3 408 ASP n 
3 409 ASP n 
3 410 ASN n 
3 411 GLU n 
3 412 ASN n 
3 413 ALA n 
3 414 ARG n 
3 415 ILE n 
3 416 VAL n 
3 417 ARG n 
3 418 ARG n 
3 419 ILE n 
3 420 THR n 
3 421 LEU n 
3 422 ALA n 
3 423 ARG n 
3 424 LYS n 
3 425 ALA n 
3 426 ALA n 
3 427 GLU n 
3 428 ALA n 
3 429 LEU n 
3 430 GLY n 
3 431 ARG n 
3 432 ARG n 
3 433 LEU n 
3 434 GLU n 
3 435 LYS n 
3 436 ALA n 
3 437 CYS n 
3 438 LYS n 
3 439 GLU n 
3 440 ALA n 
3 441 TRP n 
3 442 LYS n 
3 443 GLU n 
3 444 SER n 
3 445 ASN n 
3 446 SER n 
3 447 PRO n 
3 448 SER n 
3 449 SER n 
3 450 THR n 
3 451 SER n 
3 452 SER n 
3 453 GLY n 
3 454 THR n 
3 455 ASN n 
3 456 ALA n 
3 457 LYS n 
3 458 THR n 
3 459 GLU n 
3 460 THR n 
3 461 GLY n 
3 462 VAL n 
3 463 GLY n 
3 464 PRO n 
3 465 TRP n 
3 466 VAL n 
3 467 GLN n 
3 468 HIS n 
3 469 GLY n 
3 470 MET n 
3 471 SER n 
3 472 ARG n 
3 473 TYR n 
3 474 TRP n 
3 475 ALA n 
3 476 LYS n 
3 477 ALA n 
3 478 GLU n 
3 479 PRO n 
3 480 VAL n 
3 481 PHE n 
3 482 TRP n 
3 483 ASN n 
3 484 ILE n 
3 485 VAL n 
3 486 TYR n 
3 487 ASP n 
3 488 ARG n 
3 489 PRO n 
3 490 ALA n 
3 491 GLN n 
3 492 GLY n 
3 493 TYR n 
3 494 THR n 
3 495 PRO n 
3 496 GLY n 
3 497 MET n 
3 498 ALA n 
3 499 GLY n 
3 500 PRO n 
3 501 GLY n 
3 502 ASN n 
3 503 ALA n 
3 504 PHE n 
3 505 ASN n 
3 506 LEU n 
3 507 VAL n 
3 508 ALA n 
3 509 LEU n 
3 510 ALA n 
3 511 ALA n 
3 512 TYR n 
3 513 ASP n 
3 514 GLU n 
3 515 VAL n 
3 516 THR n 
3 517 GLY n 
3 518 PRO n 
3 519 TYR n 
3 520 CYS n 
3 521 GLU n 
3 522 ARG n 
3 523 PRO n 
3 524 ARG n 
3 525 VAL n 
3 526 ALA n 
3 527 LYS n 
3 528 VAL n 
3 529 VAL n 
3 530 GLU n 
3 531 ARG n 
3 532 HIS n 
3 533 ARG n 
3 534 SER n 
3 535 THR n 
3 536 LEU n 
3 537 PHE n 
3 538 SER n 
3 539 ASN n 
3 540 TRP n 
3 541 THR n 
3 542 PRO n 
3 543 LYS n 
3 544 GLN n 
3 545 ASP n 
3 546 LYS n 
3 547 GLU n 
3 548 ALA n 
3 549 ALA n 
4 1   MET n 
4 2   THR n 
4 3   PHE n 
4 4   VAL n 
4 5   ASP n 
4 6   ILE n 
4 7   HIS n 
4 8   ALA n 
4 9   ILE n 
4 10  GLN n 
4 11  THR n 
4 12  LEU n 
4 13  PRO n 
4 14  TYR n 
4 15  SER n 
4 16  ASN n 
4 17  ILE n 
4 18  ASN n 
4 19  ARG n 
4 20  ASP n 
4 21  ASP n 
4 22  LEU n 
4 23  GLY n 
4 24  SER n 
4 25  PRO n 
4 26  LYS n 
4 27  THR n 
4 28  VAL n 
4 29  VAL n 
4 30  TYR n 
4 31  GLY n 
4 32  GLY n 
4 33  LYS n 
4 34  GLU n 
4 35  ARG n 
4 36  THR n 
4 37  ARG n 
4 38  VAL n 
4 39  SER n 
4 40  SER n 
4 41  GLN n 
4 42  SER n 
4 43  TRP n 
4 44  LYS n 
4 45  ARG n 
4 46  ALA n 
4 47  VAL n 
4 48  ARG n 
4 49  HIS n 
4 50  GLU n 
4 51  VAL n 
4 52  GLU n 
4 53  ALA n 
4 54  ARG n 
4 55  LEU n 
4 56  GLY n 
4 57  ASP n 
4 58  LYS n 
4 59  ALA n 
4 60  VAL n 
4 61  ARG n 
4 62  THR n 
4 63  ARG n 
4 64  ARG n 
4 65  ILE n 
4 66  ILE n 
4 67  SER n 
4 68  GLU n 
4 69  ILE n 
4 70  ALA n 
4 71  LYS n 
4 72  ARG n 
4 73  LEU n 
4 74  ARG n 
4 75  GLU n 
4 76  ARG n 
4 77  GLY n 
4 78  TRP n 
4 79  ASP n 
4 80  ALA n 
4 81  ASP n 
4 82  LEU n 
4 83  ALA n 
4 84  ASP n 
4 85  ALA n 
4 86  GLY n 
4 87  ALA n 
4 88  ARG n 
4 89  GLN n 
4 90  VAL n 
4 91  VAL n 
4 92  LEU n 
4 93  SER n 
4 94  VAL n 
4 95  GLY n 
4 96  LYS n 
4 97  LYS n 
4 98  SER n 
4 99  GLY n 
4 100 ILE n 
4 101 LYS n 
4 102 LEU n 
4 103 GLU n 
4 104 LYS n 
4 105 GLU n 
4 106 LYS n 
4 107 ASP n 
4 108 SER n 
4 109 GLU n 
4 110 ALA n 
4 111 PRO n 
4 112 ALA n 
4 113 THR n 
4 114 SER n 
4 115 VAL n 
4 116 LEU n 
4 117 PHE n 
4 118 TYR n 
4 119 LEU n 
4 120 PRO n 
4 121 VAL n 
4 122 PRO n 
4 123 ALA n 
4 124 ILE n 
4 125 ASP n 
4 126 GLU n 
4 127 LEU n 
4 128 ALA n 
4 129 ALA n 
4 130 ILE n 
4 131 ALA n 
4 132 ASP n 
4 133 GLU n 
4 134 HIS n 
4 135 ARG n 
4 136 ASP n 
4 137 ALA n 
4 138 VAL n 
4 139 ALA n 
4 140 LYS n 
4 141 GLU n 
4 142 ALA n 
4 143 ALA n 
4 144 LYS n 
4 145 LYS n 
4 146 THR n 
4 147 PRO n 
4 148 LYS n 
4 149 GLY n 
4 150 ILE n 
4 151 LEU n 
4 152 PRO n 
4 153 ALA n 
4 154 ASP n 
4 155 ARG n 
4 156 ILE n 
4 157 THR n 
4 158 GLU n 
4 159 VAL n 
4 160 LEU n 
4 161 LYS n 
4 162 SER n 
4 163 ARG n 
4 164 ASN n 
4 165 VAL n 
4 166 SER n 
4 167 VAL n 
4 168 ASN n 
4 169 LEU n 
4 170 PHE n 
4 171 GLY n 
4 172 ARG n 
4 173 MET n 
4 174 LEU n 
4 175 ALA n 
4 176 GLU n 
4 177 LEU n 
4 178 PRO n 
4 179 SER n 
4 180 THR n 
4 181 GLU n 
4 182 VAL n 
4 183 ASP n 
4 184 GLY n 
4 185 ALA n 
4 186 VAL n 
4 187 GLN n 
4 188 PHE n 
4 189 ALA n 
4 190 HIS n 
4 191 ALA n 
4 192 PHE n 
4 193 THR n 
4 194 VAL n 
4 195 HIS n 
4 196 GLY n 
4 197 THR n 
4 198 THR n 
4 199 VAL n 
4 200 GLU n 
4 201 VAL n 
4 202 ASP n 
4 203 PHE n 
4 204 PHE n 
4 205 THR n 
4 206 ALA n 
4 207 VAL n 
4 208 ASP n 
4 209 ASP n 
4 210 ILE n 
4 211 PRO n 
4 212 LYS n 
4 213 GLU n 
4 214 ASN n 
4 215 ASP n 
4 216 HIS n 
4 217 GLY n 
4 218 SER n 
4 219 GLY n 
4 220 HIS n 
4 221 MET n 
4 222 ASN n 
4 223 ALA n 
4 224 GLY n 
4 225 GLN n 
4 226 PHE n 
4 227 SER n 
4 228 ALA n 
4 229 GLY n 
4 230 THR n 
4 231 PHE n 
4 232 TYR n 
4 233 ARG n 
4 234 TYR n 
4 235 ALA n 
4 236 ASN n 
4 237 VAL n 
4 238 ASN n 
4 239 LEU n 
4 240 ASP n 
4 241 ARG n 
4 242 LEU n 
4 243 VAL n 
4 244 GLU n 
4 245 ASN n 
4 246 THR n 
4 247 GLY n 
4 248 ASP n 
4 249 ALA n 
4 250 GLN n 
4 251 THR n 
4 252 ALA n 
4 253 ARG n 
4 254 THR n 
4 255 ALA n 
4 256 VAL n 
4 257 ALA n 
4 258 GLU n 
4 259 PHE n 
4 260 LEU n 
4 261 ARG n 
4 262 ALA n 
4 263 PHE n 
4 264 LEU n 
4 265 SER n 
4 266 THR n 
4 267 VAL n 
4 268 PRO n 
4 269 SER n 
4 270 GLY n 
4 271 LYS n 
4 272 GLN n 
4 273 ASN n 
4 274 ALA n 
4 275 THR n 
4 276 ALA n 
4 277 ALA n 
4 278 MET n 
4 279 THR n 
4 280 LEU n 
4 281 PRO n 
4 282 ASP n 
4 283 LEU n 
4 284 VAL n 
4 285 HIS n 
4 286 ILE n 
4 287 ALA n 
4 288 VAL n 
4 289 ARG n 
4 290 PHE n 
4 291 ASP n 
4 292 ARG n 
4 293 PRO n 
4 294 ILE n 
4 295 SER n 
4 296 PHE n 
4 297 ALA n 
4 298 PRO n 
4 299 ALA n 
4 300 PHE n 
4 301 GLU n 
4 302 THR n 
4 303 ALA n 
4 304 LEU n 
4 305 TYR n 
4 306 GLY n 
4 307 SER n 
4 308 ASP n 
4 309 GLY n 
4 310 TYR n 
4 311 THR n 
4 312 LEU n 
4 313 ARG n 
4 314 ALA n 
4 315 CYS n 
4 316 GLN n 
4 317 GLU n 
4 318 LEU n 
4 319 ASN n 
4 320 ASN n 
4 321 TYR n 
4 322 ALA n 
4 323 GLU n 
4 324 ARG n 
4 325 LEU n 
4 326 ARG n 
4 327 GLU n 
4 328 VAL n 
4 329 TRP n 
4 330 PRO n 
4 331 ASP n 
4 332 ASP n 
4 333 ALA n 
4 334 ILE n 
4 335 ARG n 
4 336 GLY n 
4 337 TYR n 
4 338 ALA n 
4 339 THR n 
4 340 VAL n 
4 341 GLU n 
4 342 ASN n 
4 343 LYS n 
4 344 THR n 
4 345 ASP n 
4 346 LEU n 
4 347 ALA n 
4 348 ALA n 
4 349 LEU n 
4 350 GLY n 
4 351 GLU n 
4 352 ARG n 
4 353 TYR n 
4 354 ASP n 
4 355 SER n 
4 356 TYR n 
4 357 PRO n 
4 358 ALA n 
4 359 LEU n 
4 360 ILE n 
4 361 ASP n 
4 362 ALA n 
4 363 MET n 
4 364 VAL n 
4 365 ALA n 
4 366 ALA n 
4 367 ALA n 
4 368 PHE n 
4 369 GLU n 
4 370 GLY n 
4 371 GLU n 
4 372 ARG n 
4 373 GLU n 
5 1   A   n 
5 2   U   n 
5 3   G   n 
5 4   G   n 
5 5   A   n 
5 6   C   n 
5 7   C   n 
5 8   G   n 
5 9   C   n 
5 10  C   n 
5 11  A   n 
5 12  G   n 
5 13  U   n 
5 14  G   n 
5 15  A   n 
5 16  U   n 
5 17  A   n 
5 18  A   n 
5 19  G   n 
5 20  U   n 
5 21  G   n 
5 22  G   n 
5 23  A   n 
5 24  A   n 
5 25  U   n 
5 26  G   n 
5 27  C   n 
5 28  C   n 
5 29  A   n 
5 30  U   n 
5 31  G   n 
5 32  U   n 
5 33  G   n 
5 34  G   n 
5 35  G   n 
5 36  C   n 
5 37  U   n 
5 38  G   n 
5 39  U   n 
5 40  C   n 
5 41  G   n 
5 42  U   n 
5 43  G   n 
5 44  A   n 
5 45  G   n 
5 46  C   n 
5 47  C   n 
5 48  C   n 
5 49  C   n 
5 50  A   n 
5 51  C   n 
5 52  G   n 
5 53  C   n 
5 54  A   n 
5 55  C   n 
5 56  G   n 
5 57  U   n 
5 58  G   n 
5 59  G   n 
5 60  G   n 
5 61  G   n 
6 1   DT  n 
6 2   DT  n 
6 3   DA  n 
6 4   DT  n 
6 5   DC  n 
6 6   DA  n 
6 7   DC  n 
6 8   DT  n 
6 9   DG  n 
6 10  DG  n 
6 11  DC  n 
6 12  DT  n 
6 13  DT  n 
6 14  DC  n 
6 15  DG  n 
6 16  DT  n 
6 17  DC  n 
6 18  DC  n 
6 19  DG  n 
6 20  DC  n 
6 21  DG  n 
7 1   MET n 
7 2   SER n 
7 3   GLY n 
7 4   PHE n 
7 5   LEU n 
7 6   LEU n 
7 7   ARG n 
7 8   LEU n 
7 9   ALA n 
7 10  GLY n 
7 11  PRO n 
7 12  MET n 
7 13  GLN n 
7 14  SER n 
7 15  TRP n 
7 16  GLY n 
7 17  GLU n 
7 18  HIS n 
7 19  SER n 
7 20  MET n 
7 21  PHE n 
7 22  GLY n 
7 23  GLU n 
7 24  ARG n 
7 25  ASP n 
7 26  THR n 
7 27  LEU n 
7 28  PRO n 
7 29  TYR n 
7 30  PRO n 
7 31  SER n 
7 32  ARG n 
7 33  SER n 
7 34  GLY n 
7 35  LEU n 
7 36  ILE n 
7 37  GLY n 
7 38  MET n 
7 39  PHE n 
7 40  ALA n 
7 41  ALA n 
7 42  ALA n 
7 43  GLN n 
7 44  GLY n 
7 45  VAL n 
7 46  ARG n 
7 47  ARG n 
7 48  GLY n 
7 49  ASP n 
7 50  PRO n 
7 51  LEU n 
7 52  ASP n 
7 53  ARG n 
7 54  TYR n 
7 55  LYS n 
7 56  GLU n 
7 57  LEU n 
7 58  LYS n 
7 59  PHE n 
7 60  THR n 
7 61  VAL n 
7 62  ARG n 
7 63  VAL n 
7 64  ASP n 
7 65  ARG n 
7 66  PRO n 
7 67  GLY n 
7 68  VAL n 
7 69  ARG n 
7 70  LEU n 
7 71  VAL n 
7 72  ASP n 
7 73  PHE n 
7 74  HIS n 
7 75  THR n 
7 76  ILE n 
7 77  GLY n 
7 78  GLY n 
7 79  GLY n 
7 80  LEU n 
7 81  PRO n 
7 82  LYS n 
7 83  GLU n 
7 84  ARG n 
7 85  THR n 
7 86  VAL n 
7 87  PRO n 
7 88  THR n 
7 89  ALA n 
7 90  ALA n 
7 91  GLY n 
7 92  GLU n 
7 93  ARG n 
7 94  ARG n 
7 95  ASP n 
7 96  PRO n 
7 97  LYS n 
7 98  LYS n 
7 99  ALA n 
7 100 THR n 
7 101 ILE n 
7 102 VAL n 
7 103 THR n 
7 104 SER n 
7 105 ARG n 
7 106 SER n 
7 107 TYR n 
7 108 LEU n 
7 109 ALA n 
7 110 ASP n 
7 111 ALA n 
7 112 VAL n 
7 113 PHE n 
7 114 THR n 
7 115 VAL n 
7 116 ALA n 
7 117 VAL n 
7 118 THR n 
7 119 GLY n 
7 120 PRO n 
7 121 GLU n 
7 122 ALA n 
7 123 ASP n 
7 124 THR n 
7 125 ILE n 
7 126 ALA n 
7 127 ASP n 
7 128 ALA n 
7 129 LEU n 
7 130 ALA n 
7 131 ALA n 
7 132 PRO n 
7 133 TYR n 
7 134 TRP n 
7 135 GLN n 
7 136 PRO n 
7 137 TYR n 
7 138 LEU n 
7 139 GLY n 
7 140 ARG n 
7 141 ARG n 
7 142 ALA n 
7 143 PHE n 
7 144 VAL n 
7 145 PRO n 
7 146 ASP n 
7 147 PRO n 
7 148 LEU n 
7 149 LEU n 
7 150 VAL n 
7 151 LEU n 
7 152 ARG n 
7 153 ARG n 
7 154 ARG n 
7 155 VAL n 
7 156 ALA n 
7 157 ASP n 
7 158 PRO n 
7 159 VAL n 
7 160 ARG n 
7 161 GLU n 
7 162 LEU n 
7 163 VAL n 
7 164 GLU n 
7 165 ALA n 
7 166 VAL n 
7 167 PRO n 
7 168 LEU n 
7 169 PRO n 
7 170 HIS n 
7 171 ARG n 
7 172 ARG n 
7 173 VAL n 
7 174 GLU n 
7 175 GLU n 
7 176 ASP n 
7 177 ALA n 
7 178 ALA n 
7 179 THR n 
7 180 VAL n 
7 181 LEU n 
7 182 VAL n 
7 183 ASP n 
7 184 LEU n 
7 185 ILE n 
7 186 TYR n 
7 187 GLU n 
7 188 GLU n 
7 189 GLY n 
7 190 GLU n 
7 191 TYR n 
7 192 PRO n 
7 193 ASP n 
7 194 THR n 
7 195 ARG n 
7 196 THR n 
7 197 LEU n 
7 198 THR n 
7 199 VAL n 
7 200 LEU n 
7 201 ASN n 
7 202 ASP n 
7 203 VAL n 
7 204 PRO n 
7 205 LEU n 
7 206 SER n 
7 207 PHE n 
7 208 ASP n 
7 209 SER n 
7 210 LYS n 
7 211 SER n 
7 212 ARG n 
7 213 ARG n 
7 214 TYR n 
7 215 SER n 
7 216 THR n 
7 217 ARG n 
7 218 GLN n 
7 219 ILE n 
7 220 ARG n 
7 221 VAL n 
7 222 VAL n 
7 223 PRO n 
7 224 THR n 
7 225 GLU n 
7 226 VAL n 
7 227 PRO n 
7 228 ALA n 
7 229 THR n 
7 230 LEU n 
7 231 VAL n 
7 232 ALA n 
7 233 GLY n 
7 234 PRO n 
7 235 GLY n 
7 236 ARG n 
7 237 ASP n 
7 238 TYR n 
7 239 GLN n 
7 240 ASN n 
7 241 LYS n 
7 242 LEU n 
7 243 PHE n 
7 244 THR n 
7 245 TYR n 
7 246 VAL n 
7 247 LYS n 
7 248 GLN n 
7 249 CYS n 
7 250 ALA n 
7 251 GLU n 
7 252 GLU n 
7 253 ALA n 
7 254 ALA n 
8 1   DC  n 
8 2   DG  n 
8 3   DC  n 
8 4   DG  n 
8 5   DG  n 
8 6   DA  n 
8 7   DC  n 
8 8   DG  n 
8 9   DA  n 
8 10  DA  n 
8 11  DG  n 
8 12  DC  n 
8 13  DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 232 ? ? Tfu_1588 ? YX ? ? ? ? 'Thermobifida fusca YX' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 244 ? ? Tfu_1591 ? YX ? ? ? ? 'Thermobifida fusca YX' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 549 ? ? Tfu_1592 ? YX ? ? ? ? 'Thermobifida fusca YX' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 373 ? ? Tfu_1590 ? YX ? ? ? ? 'Thermobifida fusca YX' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 254 ? ? Tfu_1589 ? YX ? ? ? ? 'Thermobifida fusca YX' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 61 'Thermobifida fusca YX' ? 269800 'RNA was prepared by in vitro transcription' 
6 1 sample 1 21 'Thermobifida fusca YX' ? 269800 ?                                            
8 1 sample 1 13 'Thermobifida fusca YX' ? 269800 ?                                            
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q47PJ5_THEFY Q47PJ5 ? 1 
;MTWLTKIVPDLRYRQTRADFRTAGNLHRKLIRLSSDLGEERIANPRQQSGLLFRIEETRNELYLLVQSHSPLRVDRLGPG
YHGVQMRNLDPFLARLDKGSRVRYRIVASPTKRLGRSENNTQRLGLKEPPKKPREYTWALRGAAAEEWWHSRAAANGLEL
LSTYAQTLDDVRDPGTADRSRKIRHPAVRFDGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLALIEEGEHG
;
1 
2 UNP Q47PJ2_THEFY Q47PJ2 ? 2 
;MNSDYILQHADALVKRVSKLIVNEPAARAALRRGVGLAPEDPRMLAAHRVVAPYVPVPTDYDVDRRRAASLWDVHAVERA
FYAVAAIMAAQPRSARDQEAEATEEQTGEPQDSEALTEPTPAEESSATKDGKPDRRPNLGVSLAQAVFDKGLNADSTEQR
LHLIARQNLDGVHRHLPRLVLYLRSDQVHIDWGILIRDLARWGHTPRHVAREWVQDYHRTLETLTRQAEQKNKNNTTDEE
AEAA
;
1 
3 UNP Q47PJ1_THEFY Q47PJ1 ? 3 
;MLSVALCFLVGGAIPSPPSFDVTIAPWLIARSRDVLAAPEMLGLRDVLIRSHELSDVEIPLPPGAAVLWRILALITARIT
GLDQPPNKNPKRKWQARRSQILSKGRLDPEAVDAYFADYSERFDLFHPERPWLQDPRLREECPKTSGVNKLAWGRTAGEN
QVWLGGHHHDLDPHPLDSAEAVWHLLATLGYGPSGMCTARVVRGRSERNVTAGPLRGTVSYHPLGRTLFESLILNIPYPG
TGAADLAFWEQPELNDPLGLPEESAGLAGILRLDHFRHAVLLHPSPDGSHVVDAWVTWAWRERNISPELDPYLIYQTSKE
GRVYPRPAEAERAIWRDLDALLHYGEDGNYRPTILDNCTPLAQVPQEVLDSLRLRAFGFDQDGQARDKQWFTATTPAVLR
WLADRETDDNENARIVRRITLARKAAEALGRRLEKACKEAWKESNSPSSTSSGTNAKTETGVGPWVQHGMSRYWAKAEPV
FWNIVYDRPAQGYTPGMAGPGNAFNLVALAAYDEVTGPYCERPRVAKVVERHRSTLFSNWTPKQDKEAA
;
1 
4 UNP Q47PJ3_THEFY Q47PJ3 ? 4 
;MTFVDIHAIQTLPYSNINRDDLGSPKTVVYGGKERTRVSSQSWKRAVRHEVEARLGDKAVRTRRIISEIAKRLRERGWDA
DLADAGARQVVLSVGKKSGIKLEKEKDSEAPATSVLFYLPVPAIDELAAIADEHRDAVAKEAAKKTPKGILPADRITEVL
KSRNVSVNLFGRMLAELPSTEVDGAVQFAHAFTVHGTTVEVDFFTAVDDIPKENDHGSGHMNAGQFSAGTFYRYANVNLD
RLVENTGDAQTARTAVAEFLRAFLSTVPSGKQNATAAMTLPDLVHIAVRFDRPISFAPAFETALYGSDGYTLRACQELNN
YAERLREVWPDDAIRGYATVENKTDLAALGERYDSYPALIDAMVAAAFEGERE
;
1 
5 PDB 5U07         5U07   ? 5 ? 1 
6 PDB 5U07         5U07   ? 6 ? 1 
7 UNP Q47PJ4_THEFY Q47PJ4 ? 7 
;MSGFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPLDRYKELKFTVRVDRPGVRLVDFHTIGGGL
PKERTVPTAAGERRDPKKATIVTSRSYLADAVFTVAVTGPEADTIADALAAPYWQPYLGRRAFVPDPLLVLRRRVADPVR
ELVEAVPLPHRRVEEDAATVLVDLIYEEGEYPDTRTLTVLNDVPLSFDSKSRRYSTRQIRVVPTEVPATLVAGPGRDYQN
KLFTYVKQCAEEAA
;
1 
8 PDB 5U07         5U07   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5U07 A 1 ? 232 ? Q47PJ5 1  ? 232 ? 1  232 
2  2 5U07 B 1 ? 244 ? Q47PJ2 1  ? 244 ? 1  244 
3  3 5U07 C 1 ? 549 ? Q47PJ1 1  ? 549 ? 1  549 
4  4 5U07 D 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
5  4 5U07 E 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
6  4 5U07 F 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
7  4 5U07 G 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
8  4 5U07 H 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
9  4 5U07 I 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
10 2 5U07 J 1 ? 244 ? Q47PJ2 1  ? 244 ? 1  244 
11 5 5U07 K 1 ? 61  ? 5U07   1  ? 61  ? 1  61  
12 6 5U07 M 1 ? 21  ? 5U07   34 ? 54  ? 34 54  
13 7 5U07 N 1 ? 254 ? Q47PJ4 1  ? 254 ? 1  254 
14 8 5U07 O 1 ? 13  ? 5U07   1  ? 13  ? 1  13  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5U07 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5U07 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.011  ? 28773 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.418  ? 39495 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 14.748 ? 17066 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.073  ? 4464  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.008  ? 4837  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     5U07 
_struct.title                        'CRISPR RNA-guided surveillance complex' 
_struct.pdbx_descriptor              'CRISPR RNA-guided surveillance complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5U07 
_struct_keywords.text            'CRISPR-Cas, Cascade, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 2 ? 
K N N 5 ? 
L N N 6 ? 
M N N 7 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A 22  ? ARG A 32  ? THR A 22  ARG A 32  1 ? 11 
HELX_P HELX_P2   AA2 TRP A 138 ? TRP A 138 ? TRP A 138 TRP A 138 1 ? 1  
HELX_P HELX_P3   AA3 GLY A 142 ? ALA A 154 ? GLY A 142 ALA A 154 1 ? 13 
HELX_P HELX_P4   AA4 ASP A 198 ? GLY A 209 ? ASP A 198 GLY A 209 1 ? 12 
HELX_P HELX_P5   AA5 GLY A 213 ? GLY A 217 ? GLY A 213 GLY A 217 5 ? 5  
HELX_P HELX_P6   AA6 ILE B 6   ? GLU B 24  ? ILE B 6   GLU B 24  1 ? 19 
HELX_P HELX_P7   AA7 GLU B 24  ? ARG B 33  ? GLU B 24  ARG B 33  1 ? 10 
HELX_P HELX_P8   AA8 GLY B 34  ? VAL B 35  ? GLY B 34  VAL B 35  5 ? 2  
HELX_P HELX_P9   AA9 ASP B 41  ? ARG B 43  ? ASP B 41  ARG B 43  5 ? 3  
HELX_P HELX_P10  AB1 MET B 44  ? ALA B 52  ? MET B 44  ALA B 52  1 ? 9  
HELX_P HELX_P11  AB2 PRO B 53  ? VAL B 55  ? PRO B 53  VAL B 55  5 ? 3  
HELX_P HELX_P12  AB3 VAL B 77  ? ALA B 90  ? VAL B 77  ALA B 90  1 ? 14 
HELX_P HELX_P13  AB4 ASN B 138 ? ASP B 149 ? ASN B 138 ASP B 149 1 ? 12 
HELX_P HELX_P14  AB5 ASN B 153 ? ALA B 165 ? ASN B 153 ALA B 165 1 ? 13 
HELX_P HELX_P15  AB6 ASN B 168 ? SER B 185 ? ASN B 168 SER B 185 1 ? 18 
HELX_P HELX_P16  AB7 ASP B 191 ? ARG B 201 ? ASP B 191 ARG B 201 1 ? 11 
HELX_P HELX_P17  AB8 THR B 205 ? GLN B 227 ? THR B 205 GLN B 227 1 ? 23 
HELX_P HELX_P18  AB9 GLY C 43  ? ARG C 50  ? GLY C 43  ARG C 50  1 ? 8  
HELX_P HELX_P19  AC1 LEU C 61  ? THR C 80  ? LEU C 61  THR C 80  1 ? 20 
HELX_P HELX_P20  AC2 PRO C 90  ? GLY C 105 ? PRO C 90  GLY C 105 1 ? 16 
HELX_P HELX_P21  AC3 ASP C 108 ? ALA C 117 ? ASP C 108 ALA C 117 1 ? 10 
HELX_P HELX_P22  AC4 ASP C 135 ? ARG C 139 ? ASP C 135 ARG C 139 5 ? 5  
HELX_P HELX_P23  AC5 GLY C 147 ? ALA C 152 ? GLY C 147 ALA C 152 1 ? 6  
HELX_P HELX_P24  AC6 SER C 178 ? TYR C 191 ? SER C 178 TYR C 191 1 ? 14 
HELX_P HELX_P25  AC7 THR C 227 ? ILE C 236 ? THR C 227 ILE C 236 1 ? 10 
HELX_P HELX_P26  AC8 ALA C 247 ? GLN C 251 ? ALA C 247 GLN C 251 5 ? 5  
HELX_P HELX_P27  AC9 GLY C 266 ? LEU C 271 ? GLY C 266 LEU C 271 1 ? 6  
HELX_P HELX_P28  AD1 ILE C 334 ? LEU C 341 ? ILE C 334 LEU C 341 1 ? 8  
HELX_P HELX_P29  AD2 PRO C 352 ? THR C 359 ? PRO C 352 THR C 359 1 ? 8  
HELX_P HELX_P30  AD3 GLU C 367 ? LEU C 372 ? GLU C 367 LEU C 372 1 ? 6  
HELX_P HELX_P31  AD4 ASN C 410 ? SER C 446 ? ASN C 410 SER C 446 1 ? 37 
HELX_P HELX_P32  AD5 PRO C 464 ? TYR C 486 ? PRO C 464 TYR C 486 1 ? 23 
HELX_P HELX_P33  AD6 ASN C 502 ? GLY C 517 ? ASN C 502 GLY C 517 1 ? 16 
HELX_P HELX_P34  AD7 PRO C 518 ? CYS C 520 ? PRO C 518 CYS C 520 5 ? 3  
HELX_P HELX_P35  AD8 ARG C 522 ? SER C 534 ? ARG C 522 SER C 534 1 ? 13 
HELX_P HELX_P36  AD9 THR C 535 ? SER C 538 ? THR C 535 SER C 538 5 ? 4  
HELX_P HELX_P37  AE1 SER D 39  ? LEU D 55  ? SER D 39  LEU D 55  1 ? 17 
HELX_P HELX_P38  AE2 VAL D 165 ? PHE D 170 ? VAL D 165 PHE D 170 1 ? 6  
HELX_P HELX_P39  AE3 LEU D 239 ? GLY D 247 ? LEU D 239 GLY D 247 1 ? 9  
HELX_P HELX_P40  AE4 ASP D 248 ? THR D 266 ? ASP D 248 THR D 266 1 ? 19 
HELX_P HELX_P41  AE5 PHE D 296 ? GLU D 301 ? PHE D 296 GLU D 301 5 ? 6  
HELX_P HELX_P42  AE6 TYR D 310 ? TRP D 329 ? TYR D 310 TRP D 329 1 ? 20 
HELX_P HELX_P43  AE7 LEU D 346 ? GLY D 350 ? LEU D 346 GLY D 350 5 ? 5  
HELX_P HELX_P44  AE8 SER D 355 ? PHE D 368 ? SER D 355 PHE D 368 1 ? 14 
HELX_P HELX_P45  AE9 SER E 39  ? GLY E 56  ? SER E 39  GLY E 56  1 ? 18 
HELX_P HELX_P46  AF1 ARG E 64  ? ARG E 76  ? ARG E 64  ARG E 76  1 ? 13 
HELX_P HELX_P47  AF2 ASP E 79  ? SER E 93  ? ASP E 79  SER E 93  1 ? 15 
HELX_P HELX_P48  AF3 VAL E 121 ? HIS E 134 ? VAL E 121 HIS E 134 1 ? 14 
HELX_P HELX_P49  AF4 HIS E 134 ? ALA E 142 ? HIS E 134 ALA E 142 1 ? 9  
HELX_P HELX_P50  AF5 PRO E 152 ? LYS E 161 ? PRO E 152 LYS E 161 1 ? 10 
HELX_P HELX_P51  AF6 ASN E 164 ? GLY E 171 ? ASN E 164 GLY E 171 1 ? 8  
HELX_P HELX_P52  AF7 LYS E 212 ? GLY E 219 ? LYS E 212 GLY E 219 1 ? 8  
HELX_P HELX_P53  AF8 LEU E 239 ? GLY E 247 ? LEU E 239 GLY E 247 1 ? 9  
HELX_P HELX_P54  AF9 ASP E 248 ? THR E 266 ? ASP E 248 THR E 266 1 ? 19 
HELX_P HELX_P55  AG1 PHE E 296 ? GLU E 301 ? PHE E 296 GLU E 301 5 ? 6  
HELX_P HELX_P56  AG2 GLY E 309 ? TRP E 329 ? GLY E 309 TRP E 329 1 ? 21 
HELX_P HELX_P57  AG3 LEU E 346 ? GLY E 350 ? LEU E 346 GLY E 350 5 ? 5  
HELX_P HELX_P58  AG4 SER E 355 ? PHE E 368 ? SER E 355 PHE E 368 1 ? 14 
HELX_P HELX_P59  AG5 SER F 39  ? GLY F 56  ? SER F 39  GLY F 56  1 ? 18 
HELX_P HELX_P60  AG6 ARG F 64  ? ARG F 76  ? ARG F 64  ARG F 76  1 ? 13 
HELX_P HELX_P61  AG7 ASP F 79  ? SER F 93  ? ASP F 79  SER F 93  1 ? 15 
HELX_P HELX_P62  AG8 VAL F 121 ? HIS F 134 ? VAL F 121 HIS F 134 1 ? 14 
HELX_P HELX_P63  AG9 HIS F 134 ? ALA F 142 ? HIS F 134 ALA F 142 1 ? 9  
HELX_P HELX_P64  AH1 PRO F 152 ? LYS F 161 ? PRO F 152 LYS F 161 1 ? 10 
HELX_P HELX_P65  AH2 ASN F 164 ? GLY F 171 ? ASN F 164 GLY F 171 1 ? 8  
HELX_P HELX_P66  AH3 LYS F 212 ? SER F 218 ? LYS F 212 SER F 218 1 ? 7  
HELX_P HELX_P67  AH4 LEU F 239 ? GLY F 247 ? LEU F 239 GLY F 247 1 ? 9  
HELX_P HELX_P68  AH5 ASP F 248 ? THR F 266 ? ASP F 248 THR F 266 1 ? 19 
HELX_P HELX_P69  AH6 PHE F 296 ? GLU F 301 ? PHE F 296 GLU F 301 5 ? 6  
HELX_P HELX_P70  AH7 GLY F 309 ? TRP F 329 ? GLY F 309 TRP F 329 1 ? 21 
HELX_P HELX_P71  AH8 LEU F 346 ? GLY F 350 ? LEU F 346 GLY F 350 5 ? 5  
HELX_P HELX_P72  AH9 SER F 355 ? PHE F 368 ? SER F 355 PHE F 368 1 ? 14 
HELX_P HELX_P73  AI1 SER G 39  ? GLY G 56  ? SER G 39  GLY G 56  1 ? 18 
HELX_P HELX_P74  AI2 ARG G 64  ? ARG G 76  ? ARG G 64  ARG G 76  1 ? 13 
HELX_P HELX_P75  AI3 ASP G 79  ? SER G 93  ? ASP G 79  SER G 93  1 ? 15 
HELX_P HELX_P76  AI4 VAL G 121 ? HIS G 134 ? VAL G 121 HIS G 134 1 ? 14 
HELX_P HELX_P77  AI5 HIS G 134 ? ALA G 142 ? HIS G 134 ALA G 142 1 ? 9  
HELX_P HELX_P78  AI6 PRO G 152 ? LYS G 161 ? PRO G 152 LYS G 161 1 ? 10 
HELX_P HELX_P79  AI7 ASN G 164 ? GLY G 171 ? ASN G 164 GLY G 171 1 ? 8  
HELX_P HELX_P80  AI8 LYS G 212 ? GLY G 219 ? LYS G 212 GLY G 219 1 ? 8  
HELX_P HELX_P81  AI9 LEU G 239 ? GLY G 247 ? LEU G 239 GLY G 247 1 ? 9  
HELX_P HELX_P82  AJ1 ASP G 248 ? THR G 266 ? ASP G 248 THR G 266 1 ? 19 
HELX_P HELX_P83  AJ2 PHE G 296 ? GLU G 301 ? PHE G 296 GLU G 301 5 ? 6  
HELX_P HELX_P84  AJ3 GLY G 309 ? TRP G 329 ? GLY G 309 TRP G 329 1 ? 21 
HELX_P HELX_P85  AJ4 LEU G 346 ? GLY G 350 ? LEU G 346 GLY G 350 5 ? 5  
HELX_P HELX_P86  AJ5 SER G 355 ? ALA G 367 ? SER G 355 ALA G 367 1 ? 13 
HELX_P HELX_P87  AJ6 SER H 39  ? GLY H 56  ? SER H 39  GLY H 56  1 ? 18 
HELX_P HELX_P88  AJ7 ARG H 64  ? ARG H 76  ? ARG H 64  ARG H 76  1 ? 13 
HELX_P HELX_P89  AJ8 ASP H 79  ? SER H 93  ? ASP H 79  SER H 93  1 ? 15 
HELX_P HELX_P90  AJ9 VAL H 121 ? HIS H 134 ? VAL H 121 HIS H 134 1 ? 14 
HELX_P HELX_P91  AK1 HIS H 134 ? ALA H 142 ? HIS H 134 ALA H 142 1 ? 9  
HELX_P HELX_P92  AK2 PRO H 152 ? LYS H 161 ? PRO H 152 LYS H 161 1 ? 10 
HELX_P HELX_P93  AK3 ASN H 164 ? GLY H 171 ? ASN H 164 GLY H 171 1 ? 8  
HELX_P HELX_P94  AK4 LEU H 239 ? GLY H 247 ? LEU H 239 GLY H 247 1 ? 9  
HELX_P HELX_P95  AK5 ASP H 248 ? THR H 266 ? ASP H 248 THR H 266 1 ? 19 
HELX_P HELX_P96  AK6 LYS H 271 ? ALA H 276 ? LYS H 271 ALA H 276 1 ? 6  
HELX_P HELX_P97  AK7 PHE H 296 ? GLU H 301 ? PHE H 296 GLU H 301 5 ? 6  
HELX_P HELX_P98  AK8 GLY H 309 ? TRP H 329 ? GLY H 309 TRP H 329 1 ? 21 
HELX_P HELX_P99  AK9 LEU H 346 ? GLY H 350 ? LEU H 346 GLY H 350 5 ? 5  
HELX_P HELX_P100 AL1 SER H 355 ? ALA H 367 ? SER H 355 ALA H 367 1 ? 13 
HELX_P HELX_P101 AL2 SER I 39  ? GLY I 56  ? SER I 39  GLY I 56  1 ? 18 
HELX_P HELX_P102 AL3 ARG I 64  ? ARG I 76  ? ARG I 64  ARG I 76  1 ? 13 
HELX_P HELX_P103 AL4 ASP I 79  ? SER I 93  ? ASP I 79  SER I 93  1 ? 15 
HELX_P HELX_P104 AL5 VAL I 121 ? HIS I 134 ? VAL I 121 HIS I 134 1 ? 14 
HELX_P HELX_P105 AL6 HIS I 134 ? ALA I 142 ? HIS I 134 ALA I 142 1 ? 9  
HELX_P HELX_P106 AL7 PRO I 152 ? LYS I 161 ? PRO I 152 LYS I 161 1 ? 10 
HELX_P HELX_P107 AL8 ASN I 164 ? GLY I 171 ? ASN I 164 GLY I 171 1 ? 8  
HELX_P HELX_P108 AL9 LEU I 239 ? GLY I 247 ? LEU I 239 GLY I 247 1 ? 9  
HELX_P HELX_P109 AM1 ASP I 248 ? THR I 266 ? ASP I 248 THR I 266 1 ? 19 
HELX_P HELX_P110 AM2 PHE I 296 ? GLU I 301 ? PHE I 296 GLU I 301 5 ? 6  
HELX_P HELX_P111 AM3 GLY I 309 ? TRP I 329 ? GLY I 309 TRP I 329 1 ? 21 
HELX_P HELX_P112 AM4 LEU I 346 ? GLY I 350 ? LEU I 346 GLY I 350 5 ? 5  
HELX_P HELX_P113 AM5 SER I 355 ? ALA I 367 ? SER I 355 ALA I 367 1 ? 13 
HELX_P HELX_P114 AM6 ILE J 6   ? VAL J 22  ? ILE J 6   VAL J 22  1 ? 17 
HELX_P HELX_P115 AM7 PRO J 25  ? ARG J 33  ? PRO J 25  ARG J 33  1 ? 9  
HELX_P HELX_P116 AM8 ASP J 41  ? ARG J 43  ? ASP J 41  ARG J 43  5 ? 3  
HELX_P HELX_P117 AM9 MET J 44  ? ALA J 52  ? MET J 44  ALA J 52  1 ? 9  
HELX_P HELX_P118 AN1 PRO J 53  ? VAL J 55  ? PRO J 53  VAL J 55  5 ? 3  
HELX_P HELX_P119 AN2 HIS J 75  ? ALA J 90  ? HIS J 75  ALA J 90  1 ? 16 
HELX_P HELX_P120 AN3 ASN J 138 ? GLY J 151 ? ASN J 138 GLY J 151 1 ? 14 
HELX_P HELX_P121 AN4 ASN J 153 ? ALA J 165 ? ASN J 153 ALA J 165 1 ? 13 
HELX_P HELX_P122 AN5 ASN J 168 ? SER J 185 ? ASN J 168 SER J 185 1 ? 18 
HELX_P HELX_P123 AN6 ASP J 191 ? ARG J 201 ? ASP J 191 ARG J 201 1 ? 11 
HELX_P HELX_P124 AN7 THR J 205 ? GLN J 227 ? THR J 205 GLN J 227 1 ? 23 
HELX_P HELX_P125 AN8 SER M 31  ? GLY M 44  ? SER N 31  GLY N 44  1 ? 14 
HELX_P HELX_P126 AN9 LEU M 51  ? LYS M 55  ? LEU N 51  LYS N 55  5 ? 5  
HELX_P HELX_P127 AO1 PRO M 81  ? THR M 85  ? PRO N 81  THR N 85  5 ? 5  
HELX_P HELX_P128 AO2 ASP M 95  ? ALA M 99  ? ASP N 95  ALA N 99  5 ? 5  
HELX_P HELX_P129 AO3 GLU M 121 ? ALA M 131 ? GLU N 121 ALA N 131 1 ? 11 
HELX_P HELX_P130 AO4 ASP M 157 ? GLU M 164 ? ASP N 157 GLU N 164 1 ? 8  
HELX_P HELX_P131 AO5 PRO M 227 ? VAL M 231 ? PRO N 227 VAL N 231 5 ? 5  
HELX_P HELX_P132 AO6 ARG M 236 ? GLN M 248 ? ARG N 236 GLN N 248 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? K C  9  N3 ? ? ? 1_555 L DG 10 N1 ? ? K C  9  M DG 43 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2  hydrog ? ? K C  9  N4 ? ? ? 1_555 L DG 10 O6 ? ? K C  9  M DG 43 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3  hydrog ? ? K C  9  O2 ? ? ? 1_555 L DG 10 N2 ? ? K C  9  M DG 43 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4  hydrog ? ? K C  10 N3 ? ? ? 1_555 L DG 9  N2 ? ? K C  10 M DG 42 1_555 ? ? ? ? ? ? 'C-DG PAIR'             ? ? 
hydrog5  hydrog ? ? K G  12 N1 ? ? ? 1_555 L DC 7  N3 ? ? K G  12 M DC 40 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6  hydrog ? ? K G  12 N2 ? ? ? 1_555 L DC 7  O2 ? ? K G  12 M DC 40 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7  hydrog ? ? K G  12 O6 ? ? ? 1_555 L DC 7  N4 ? ? K G  12 M DC 40 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8  hydrog ? ? K U  13 O4 ? ? ? 1_555 L DA 6  N6 ? ? K U  13 M DA 39 1_555 ? ? ? ? ? ? 'U-DA PAIR'             ? ? 
hydrog9  hydrog ? ? K A  15 N1 ? ? ? 1_555 L DT 4  N3 ? ? K A  15 M DT 37 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10 hydrog ? ? K A  15 N6 ? ? ? 1_555 L DT 4  O4 ? ? K A  15 M DT 37 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11 hydrog ? ? K U  16 N3 ? ? ? 1_555 L DA 3  N1 ? ? K U  16 M DA 36 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12 hydrog ? ? K U  16 O4 ? ? ? 1_555 L DA 3  N6 ? ? K U  16 M DA 36 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13 hydrog ? ? K A  17 N1 ? ? ? 1_555 L DT 2  N3 ? ? K A  17 M DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14 hydrog ? ? K A  17 N6 ? ? ? 1_555 L DT 2  O4 ? ? K A  17 M DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15 hydrog ? ? K A  18 N1 ? ? ? 1_555 L DT 1  N3 ? ? K A  18 M DT 34 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16 hydrog ? ? K A  18 N6 ? ? ? 1_555 L DT 1  O4 ? ? K A  18 M DT 34 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17 hydrog ? ? K C  46 N3 ? ? ? 1_555 K G  61 N1 ? ? K C  46 K G  61 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18 hydrog ? ? K C  46 N4 ? ? ? 1_555 K G  61 O6 ? ? K C  46 K G  61 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19 hydrog ? ? K C  46 O2 ? ? ? 1_555 K G  61 N2 ? ? K C  46 K G  61 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20 hydrog ? ? K C  47 N3 ? ? ? 1_555 K G  60 N1 ? ? K C  47 K G  60 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog21 hydrog ? ? K C  47 N4 ? ? ? 1_555 K G  60 O6 ? ? K C  47 K G  60 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog22 hydrog ? ? K C  47 O2 ? ? ? 1_555 K G  60 N2 ? ? K C  47 K G  60 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog23 hydrog ? ? K C  48 N3 ? ? ? 1_555 K G  59 N1 ? ? K C  48 K G  59 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24 hydrog ? ? K C  48 N4 ? ? ? 1_555 K G  59 O6 ? ? K C  48 K G  59 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25 hydrog ? ? K C  48 O2 ? ? ? 1_555 K G  59 N2 ? ? K C  48 K G  59 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26 hydrog ? ? K C  49 N3 ? ? ? 1_555 K G  58 N1 ? ? K C  49 K G  58 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27 hydrog ? ? K C  49 N4 ? ? ? 1_555 K G  58 O6 ? ? K C  49 K G  58 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog28 hydrog ? ? K C  49 O2 ? ? ? 1_555 K G  58 N2 ? ? K C  49 K G  58 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29 hydrog ? ? K A  50 N1 ? ? ? 1_555 K U  57 N3 ? ? K A  50 K U  57 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30 hydrog ? ? K A  50 N6 ? ? ? 1_555 K U  57 O4 ? ? K A  50 K U  57 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31 hydrog ? ? K C  51 N3 ? ? ? 1_555 K G  56 N1 ? ? K C  51 K G  56 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog32 hydrog ? ? K C  51 N4 ? ? ? 1_555 K G  56 O6 ? ? K C  51 K G  56 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog33 hydrog ? ? K C  51 O2 ? ? ? 1_555 K G  56 N2 ? ? K C  51 K G  56 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog34 hydrog ? ? K G  52 N3 ? ? ? 1_555 K C  55 N4 ? ? K G  52 K C  55 1_555 ? ? ? ? ? ? 'G-C PAIR'              ? ? 
hydrog35 hydrog ? ? L DC 11 N3 ? ? ? 1_555 N DG 11 N2 ? ? M DC 44 O DG 11 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog36 hydrog ? ? L DT 12 N3 ? ? ? 1_555 N DA 10 N1 ? ? M DT 45 O DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog37 hydrog ? ? L DT 12 O4 ? ? ? 1_555 N DA 10 N6 ? ? M DT 45 O DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog38 hydrog ? ? L DT 13 N3 ? ? ? 1_555 N DA 9  N1 ? ? M DT 46 O DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog39 hydrog ? ? L DT 13 O4 ? ? ? 1_555 N DA 9  N6 ? ? M DT 46 O DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog40 hydrog ? ? L DC 14 N3 ? ? ? 1_555 N DG 8  N1 ? ? M DC 47 O DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog41 hydrog ? ? L DC 14 N4 ? ? ? 1_555 N DG 8  O6 ? ? M DC 47 O DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog42 hydrog ? ? L DC 14 O2 ? ? ? 1_555 N DG 8  N2 ? ? M DC 47 O DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog43 hydrog ? ? L DG 15 N1 ? ? ? 1_555 N DC 7  N3 ? ? M DG 48 O DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog44 hydrog ? ? L DG 15 N2 ? ? ? 1_555 N DC 7  O2 ? ? M DG 48 O DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog45 hydrog ? ? L DG 15 O6 ? ? ? 1_555 N DC 7  N4 ? ? M DG 48 O DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog46 hydrog ? ? L DT 16 N3 ? ? ? 1_555 N DA 6  N1 ? ? M DT 49 O DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog47 hydrog ? ? L DT 16 O4 ? ? ? 1_555 N DA 6  N6 ? ? M DT 49 O DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog48 hydrog ? ? L DC 17 N3 ? ? ? 1_555 N DG 5  N1 ? ? M DC 50 O DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog49 hydrog ? ? L DC 17 N4 ? ? ? 1_555 N DG 5  O6 ? ? M DC 50 O DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog50 hydrog ? ? L DC 17 O2 ? ? ? 1_555 N DG 5  N2 ? ? M DC 50 O DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog51 hydrog ? ? L DC 18 N3 ? ? ? 1_555 N DG 4  N1 ? ? M DC 51 O DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog52 hydrog ? ? L DC 18 N4 ? ? ? 1_555 N DG 4  O6 ? ? M DC 51 O DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog53 hydrog ? ? L DC 18 O2 ? ? ? 1_555 N DG 4  N2 ? ? M DC 51 O DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog54 hydrog ? ? L DG 19 N1 ? ? ? 1_555 N DC 3  N3 ? ? M DG 52 O DC 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog55 hydrog ? ? L DG 19 N2 ? ? ? 1_555 N DC 3  O2 ? ? M DG 52 O DC 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog56 hydrog ? ? L DG 19 O6 ? ? ? 1_555 N DC 3  N4 ? ? M DG 52 O DC 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog57 hydrog ? ? L DC 20 N3 ? ? ? 1_555 N DG 2  N1 ? ? M DC 53 O DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog58 hydrog ? ? L DC 20 N4 ? ? ? 1_555 N DG 2  O6 ? ? M DC 53 O DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog59 hydrog ? ? L DC 20 O2 ? ? ? 1_555 N DG 2  N2 ? ? M DC 53 O DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog60 hydrog ? ? L DG 21 N1 ? ? ? 1_555 N DC 1  O2 ? ? M DG 54 O DC 1  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog61 hydrog ? ? L DG 21 N2 ? ? ? 1_555 N DC 1  N3 ? ? M DG 54 O DC 1  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 3 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 5 ? 
AB2 ? 8 ? 
AB3 ? 5 ? 
AB4 ? 7 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 5 ? 
AB8 ? 8 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 5 ? 
AC3 ? 8 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 5 ? 
AC7 ? 8 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 5 ? 
AD2 ? 7 ? 
AD3 ? 2 ? 
AD4 ? 7 ? 
AD5 ? 3 ? 
AD6 ? 3 ? 
AD7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB2 7 8 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB4 5 6 ? anti-parallel 
AB4 6 7 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB8 5 6 ? anti-parallel 
AB8 6 7 ? anti-parallel 
AB8 7 8 ? parallel      
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC3 4 5 ? anti-parallel 
AC3 5 6 ? anti-parallel 
AC3 6 7 ? anti-parallel 
AC3 7 8 ? parallel      
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC7 5 6 ? anti-parallel 
AC7 6 7 ? anti-parallel 
AC7 7 8 ? parallel      
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD2 5 6 ? anti-parallel 
AD2 6 7 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD4 4 5 ? anti-parallel 
AD4 5 6 ? anti-parallel 
AD4 6 7 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? parallel      
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TRP A 3   ? LEU A 4   ? TRP A 3   LEU A 4   
AA1 2 GLN A 67  ? SER A 68  ? GLN A 67  SER A 68  
AA2 1 GLU A 40  ? ARG A 41  ? GLU A 40  ARG A 41  
AA2 2 GLN A 47  ? GLN A 48  ? GLN A 47  GLN A 48  
AA3 1 GLY A 157 ? GLU A 159 ? GLY A 157 GLU A 159 
AA3 2 VAL A 188 ? ILE A 196 ? VAL A 188 ILE A 196 
AA3 3 ARG A 101 ? ALA A 108 ? ARG A 101 ALA A 108 
AA3 4 LEU A 221 ? LEU A 225 ? LEU A 221 LEU A 225 
AA4 1 LYS A 112 ? LEU A 114 ? LYS A 112 LEU A 114 
AA4 2 GLN A 122 ? LEU A 124 ? GLN A 122 LEU A 124 
AA5 1 ASP A 170 ? ARG A 172 ? ASP A 170 ARG A 172 
AA5 2 LYS A 182 ? ARG A 184 ? LYS A 182 ARG A 184 
AA6 1 GLU C 40  ? LEU C 42  ? GLU C 40  LEU C 42  
AA6 2 LEU C 28  ? SER C 32  ? LEU C 28  SER C 32  
AA6 3 LEU C 54  ? GLU C 58  ? LEU C 54  GLU C 58  
AA7 1 LEU C 176 ? ASP C 177 ? LEU C 176 ASP C 177 
AA7 2 HIS C 290 ? VAL C 296 ? HIS C 290 VAL C 296 
AA7 3 VAL C 280 ? PRO C 284 ? VAL C 280 PRO C 284 
AA8 1 VAL C 219 ? LEU C 224 ? VAL C 219 LEU C 224 
AA8 2 ARG C 373 ? GLN C 381 ? ARG C 373 GLN C 381 
AA8 3 ASP C 387 ? ALA C 393 ? ASP C 387 ALA C 393 
AA9 1 TYR C 315 ? SER C 318 ? TYR C 315 SER C 318 
AA9 2 ARG C 322 ? PRO C 325 ? ARG C 322 PRO C 325 
AB1 1 THR D 27  ? TYR D 30  ? THR D 27  TYR D 30  
AB1 2 LYS D 33  ? VAL D 38  ? LYS D 33  VAL D 38  
AB1 3 VAL D 186 ? THR D 193 ? VAL D 186 THR D 193 
AB1 4 HIS D 220 ? ASN D 238 ? HIS D 220 ASN D 238 
AB1 5 GLU D 200 ? ALA D 206 ? GLU D 200 ALA D 206 
AB2 1 THR D 27  ? TYR D 30  ? THR D 27  TYR D 30  
AB2 2 LYS D 33  ? VAL D 38  ? LYS D 33  VAL D 38  
AB2 3 VAL D 186 ? THR D 193 ? VAL D 186 THR D 193 
AB2 4 HIS D 220 ? ASN D 238 ? HIS D 220 ASN D 238 
AB2 5 PHE D 3   ? SER D 15  ? PHE D 3   SER D 15  
AB2 6 LEU D 283 ? ARG D 289 ? LEU D 283 ARG D 289 
AB2 7 GLY D 336 ? THR D 339 ? GLY D 336 THR D 339 
AB2 8 GLU D 351 ? ARG D 352 ? GLU D 351 ARG D 352 
AB3 1 THR E 27  ? TYR E 30  ? THR E 27  TYR E 30  
AB3 2 LYS E 33  ? VAL E 38  ? LYS E 33  VAL E 38  
AB3 3 ALA E 191 ? THR E 193 ? ALA E 191 THR E 193 
AB3 4 GLY E 229 ? ASN E 238 ? GLY E 229 ASN E 238 
AB3 5 VAL E 186 ? PHE E 188 ? VAL E 186 PHE E 188 
AB4 1 THR E 27  ? TYR E 30  ? THR E 27  TYR E 30  
AB4 2 LYS E 33  ? VAL E 38  ? LYS E 33  VAL E 38  
AB4 3 ALA E 191 ? THR E 193 ? ALA E 191 THR E 193 
AB4 4 GLY E 229 ? ASN E 238 ? GLY E 229 ASN E 238 
AB4 5 PHE E 3   ? LEU E 12  ? PHE E 3   LEU E 12  
AB4 6 LEU E 283 ? ARG E 289 ? LEU E 283 ARG E 289 
AB4 7 ILE E 334 ? THR E 339 ? ILE E 334 THR E 339 
AB5 1 ALA E 59  ? THR E 62  ? ALA E 59  THR E 62  
AB5 2 PHE E 117 ? PRO E 120 ? PHE E 117 PRO E 120 
AB6 1 GLU E 200 ? PHE E 203 ? GLU E 200 PHE E 203 
AB6 2 ALA E 223 ? PHE E 226 ? ALA E 223 PHE E 226 
AB7 1 THR F 27  ? TYR F 30  ? THR F 27  TYR F 30  
AB7 2 LYS F 33  ? VAL F 38  ? LYS F 33  VAL F 38  
AB7 3 ALA F 191 ? THR F 193 ? ALA F 191 THR F 193 
AB7 4 GLY F 229 ? ASN F 238 ? GLY F 229 ASN F 238 
AB7 5 VAL F 186 ? PHE F 188 ? VAL F 186 PHE F 188 
AB8 1 THR F 27  ? TYR F 30  ? THR F 27  TYR F 30  
AB8 2 LYS F 33  ? VAL F 38  ? LYS F 33  VAL F 38  
AB8 3 ALA F 191 ? THR F 193 ? ALA F 191 THR F 193 
AB8 4 GLY F 229 ? ASN F 238 ? GLY F 229 ASN F 238 
AB8 5 PHE F 3   ? LEU F 12  ? PHE F 3   LEU F 12  
AB8 6 LEU F 283 ? ARG F 289 ? LEU F 283 ARG F 289 
AB8 7 ILE F 334 ? THR F 339 ? ILE F 334 THR F 339 
AB8 8 GLU F 351 ? ARG F 352 ? GLU F 351 ARG F 352 
AB9 1 ALA F 59  ? THR F 62  ? ALA F 59  THR F 62  
AB9 2 PHE F 117 ? PRO F 120 ? PHE F 117 PRO F 120 
AC1 1 GLU F 200 ? PHE F 203 ? GLU F 200 PHE F 203 
AC1 2 ALA F 223 ? PHE F 226 ? ALA F 223 PHE F 226 
AC2 1 THR G 27  ? TYR G 30  ? THR G 27  TYR G 30  
AC2 2 LYS G 33  ? VAL G 38  ? LYS G 33  VAL G 38  
AC2 3 ALA G 191 ? THR G 193 ? ALA G 191 THR G 193 
AC2 4 GLY G 229 ? ASN G 238 ? GLY G 229 ASN G 238 
AC2 5 VAL G 186 ? PHE G 188 ? VAL G 186 PHE G 188 
AC3 1 THR G 27  ? TYR G 30  ? THR G 27  TYR G 30  
AC3 2 LYS G 33  ? VAL G 38  ? LYS G 33  VAL G 38  
AC3 3 ALA G 191 ? THR G 193 ? ALA G 191 THR G 193 
AC3 4 GLY G 229 ? ASN G 238 ? GLY G 229 ASN G 238 
AC3 5 PHE G 3   ? LEU G 12  ? PHE G 3   LEU G 12  
AC3 6 LEU G 283 ? ARG G 289 ? LEU G 283 ARG G 289 
AC3 7 ILE G 334 ? THR G 339 ? ILE G 334 THR G 339 
AC3 8 GLU G 351 ? ARG G 352 ? GLU G 351 ARG G 352 
AC4 1 ALA G 59  ? THR G 62  ? ALA G 59  THR G 62  
AC4 2 PHE G 117 ? PRO G 120 ? PHE G 117 PRO G 120 
AC5 1 GLU G 200 ? PHE G 203 ? GLU G 200 PHE G 203 
AC5 2 ALA G 223 ? PHE G 226 ? ALA G 223 PHE G 226 
AC6 1 THR H 27  ? TYR H 30  ? THR H 27  TYR H 30  
AC6 2 LYS H 33  ? VAL H 38  ? LYS H 33  VAL H 38  
AC6 3 ALA H 191 ? THR H 193 ? ALA H 191 THR H 193 
AC6 4 GLY H 229 ? ASN H 238 ? GLY H 229 ASN H 238 
AC6 5 VAL H 186 ? PHE H 188 ? VAL H 186 PHE H 188 
AC7 1 THR H 27  ? TYR H 30  ? THR H 27  TYR H 30  
AC7 2 LYS H 33  ? VAL H 38  ? LYS H 33  VAL H 38  
AC7 3 ALA H 191 ? THR H 193 ? ALA H 191 THR H 193 
AC7 4 GLY H 229 ? ASN H 238 ? GLY H 229 ASN H 238 
AC7 5 PHE H 3   ? LEU H 12  ? PHE H 3   LEU H 12  
AC7 6 LEU H 283 ? ARG H 289 ? LEU H 283 ARG H 289 
AC7 7 ILE H 334 ? THR H 339 ? ILE H 334 THR H 339 
AC7 8 GLU H 351 ? ARG H 352 ? GLU H 351 ARG H 352 
AC8 1 ALA H 59  ? THR H 62  ? ALA H 59  THR H 62  
AC8 2 PHE H 117 ? PRO H 120 ? PHE H 117 PRO H 120 
AC9 1 GLU H 200 ? PHE H 203 ? GLU H 200 PHE H 203 
AC9 2 ALA H 223 ? PHE H 226 ? ALA H 223 PHE H 226 
AD1 1 THR I 27  ? TYR I 30  ? THR I 27  TYR I 30  
AD1 2 LYS I 33  ? VAL I 38  ? LYS I 33  VAL I 38  
AD1 3 ALA I 191 ? THR I 193 ? ALA I 191 THR I 193 
AD1 4 GLY I 229 ? ASN I 238 ? GLY I 229 ASN I 238 
AD1 5 VAL I 186 ? PHE I 188 ? VAL I 186 PHE I 188 
AD2 1 THR I 27  ? TYR I 30  ? THR I 27  TYR I 30  
AD2 2 LYS I 33  ? VAL I 38  ? LYS I 33  VAL I 38  
AD2 3 ALA I 191 ? THR I 193 ? ALA I 191 THR I 193 
AD2 4 GLY I 229 ? ASN I 238 ? GLY I 229 ASN I 238 
AD2 5 PHE I 3   ? LEU I 12  ? PHE I 3   LEU I 12  
AD2 6 LEU I 283 ? ARG I 289 ? LEU I 283 ARG I 289 
AD2 7 ILE I 334 ? THR I 339 ? ILE I 334 THR I 339 
AD3 1 ALA I 59  ? THR I 62  ? ALA I 59  THR I 62  
AD3 2 PHE I 117 ? PRO I 120 ? PHE I 117 PRO I 120 
AD4 1 VAL M 150 ? ARG M 152 ? VAL N 150 ARG N 152 
AD4 2 PHE M 4   ? LEU M 6   ? PHE N 4   LEU N 6   
AD4 3 VAL M 112 ? THR M 118 ? VAL N 112 THR N 118 
AD4 4 LYS M 58  ? ARG M 65  ? LYS N 58  ARG N 65  
AD4 5 VAL M 180 ? TYR M 186 ? VAL N 180 TYR N 186 
AD4 6 ARG M 213 ? VAL M 226 ? ARG N 213 VAL N 226 
AD4 7 LEU M 197 ? SER M 206 ? LEU N 197 SER N 206 
AD5 1 MET M 12  ? GLN M 13  ? MET N 12  GLN N 13  
AD5 2 ILE M 101 ? ALA M 109 ? ILE N 101 ALA N 109 
AD5 3 GLU M 23  ? ARG M 24  ? GLU N 23  ARG N 24  
AD6 1 MET M 12  ? GLN M 13  ? MET N 12  GLN N 13  
AD6 2 ILE M 101 ? ALA M 109 ? ILE N 101 ALA N 109 
AD6 3 VAL M 68  ? ILE M 76  ? VAL N 68  ILE N 76  
AD7 1 TRP M 15  ? GLY M 16  ? TRP N 15  GLY N 16  
AD7 2 THR M 26  ? LEU M 27  ? THR N 26  LEU N 27  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TRP A 3   ? N TRP A 3   O SER A 68  ? O SER A 68  
AA2 1 2 N GLU A 40  ? N GLU A 40  O GLN A 48  ? O GLN A 48  
AA3 1 2 N LEU A 158 ? N LEU A 158 O VAL A 195 ? O VAL A 195 
AA3 2 3 O PHE A 190 ? O PHE A 190 N ILE A 106 ? N ILE A 106 
AA3 3 4 N ARG A 105 ? N ARG A 105 O SER A 222 ? O SER A 222 
AA4 1 2 N LYS A 112 ? N LYS A 112 O LEU A 124 ? O LEU A 124 
AA5 1 2 N VAL A 171 ? N VAL A 171 O ILE A 183 ? O ILE A 183 
AA6 1 2 O LEU C 42  ? O LEU C 42  N LEU C 28  ? N LEU C 28  
AA6 2 3 N ARG C 31  ? N ARG C 31  O ASP C 56  ? O ASP C 56  
AA7 1 2 N LEU C 176 ? N LEU C 176 O VAL C 291 ? O VAL C 291 
AA7 2 3 O ASP C 293 ? O ASP C 293 N HIS C 283 ? N HIS C 283 
AA8 1 2 N SER C 220 ? N SER C 220 O PHE C 377 ? O PHE C 377 
AA8 2 3 N GLY C 378 ? N GLY C 378 O PHE C 391 ? O PHE C 391 
AA9 1 2 N GLN C 316 ? N GLN C 316 O TYR C 324 ? O TYR C 324 
AB1 1 2 N VAL D 28  ? N VAL D 28  O ARG D 35  ? O ARG D 35  
AB1 2 3 N THR D 36  ? N THR D 36  O THR D 193 ? O THR D 193 
AB1 3 4 N GLN D 187 ? N GLN D 187 O ASN D 236 ? O ASN D 236 
AB1 4 5 O GLY D 224 ? O GLY D 224 N ASP D 202 ? N ASP D 202 
AB2 1 2 N VAL D 28  ? N VAL D 28  O ARG D 35  ? O ARG D 35  
AB2 2 3 N THR D 36  ? N THR D 36  O THR D 193 ? O THR D 193 
AB2 3 4 N GLN D 187 ? N GLN D 187 O ASN D 236 ? O ASN D 236 
AB2 4 5 O GLY D 229 ? O GLY D 229 N LEU D 12  ? N LEU D 12  
AB2 5 6 N PHE D 3   ? N PHE D 3   O ARG D 289 ? O ARG D 289 
AB2 6 7 N VAL D 284 ? N VAL D 284 O ALA D 338 ? O ALA D 338 
AB2 7 8 N TYR D 337 ? N TYR D 337 O GLU D 351 ? O GLU D 351 
AB3 1 2 N VAL E 28  ? N VAL E 28  O ARG E 35  ? O ARG E 35  
AB3 2 3 N VAL E 38  ? N VAL E 38  O ALA E 191 ? O ALA E 191 
AB3 3 4 N PHE E 192 ? N PHE E 192 O TYR E 232 ? O TYR E 232 
AB3 4 5 O ASN E 236 ? O ASN E 236 N GLN E 187 ? N GLN E 187 
AB4 1 2 N VAL E 28  ? N VAL E 28  O ARG E 35  ? O ARG E 35  
AB4 2 3 N VAL E 38  ? N VAL E 38  O ALA E 191 ? O ALA E 191 
AB4 3 4 N PHE E 192 ? N PHE E 192 O TYR E 232 ? O TYR E 232 
AB4 4 5 O ARG E 233 ? O ARG E 233 N ALA E 8   ? N ALA E 8   
AB4 5 6 N ASP E 5   ? N ASP E 5   O ALA E 287 ? O ALA E 287 
AB4 6 7 N VAL E 288 ? N VAL E 288 O ILE E 334 ? O ILE E 334 
AB5 1 2 N THR E 62  ? N THR E 62  O PHE E 117 ? O PHE E 117 
AB6 1 2 N ASP E 202 ? N ASP E 202 O GLY E 224 ? O GLY E 224 
AB7 1 2 N VAL F 28  ? N VAL F 28  O ARG F 35  ? O ARG F 35  
AB7 2 3 N VAL F 38  ? N VAL F 38  O ALA F 191 ? O ALA F 191 
AB7 3 4 N PHE F 192 ? N PHE F 192 O TYR F 232 ? O TYR F 232 
AB7 4 5 O ASN F 236 ? O ASN F 236 N GLN F 187 ? N GLN F 187 
AB8 1 2 N VAL F 28  ? N VAL F 28  O ARG F 35  ? O ARG F 35  
AB8 2 3 N VAL F 38  ? N VAL F 38  O ALA F 191 ? O ALA F 191 
AB8 3 4 N PHE F 192 ? N PHE F 192 O TYR F 232 ? O TYR F 232 
AB8 4 5 O ARG F 233 ? O ARG F 233 N ALA F 8   ? N ALA F 8   
AB8 5 6 N ASP F 5   ? N ASP F 5   O ALA F 287 ? O ALA F 287 
AB8 6 7 N VAL F 284 ? N VAL F 284 O ALA F 338 ? O ALA F 338 
AB8 7 8 N TYR F 337 ? N TYR F 337 O GLU F 351 ? O GLU F 351 
AB9 1 2 N THR F 62  ? N THR F 62  O PHE F 117 ? O PHE F 117 
AC1 1 2 N ASP F 202 ? N ASP F 202 O GLY F 224 ? O GLY F 224 
AC2 1 2 N VAL G 28  ? N VAL G 28  O ARG G 35  ? O ARG G 35  
AC2 2 3 N VAL G 38  ? N VAL G 38  O ALA G 191 ? O ALA G 191 
AC2 3 4 N PHE G 192 ? N PHE G 192 O TYR G 232 ? O TYR G 232 
AC2 4 5 O ASN G 236 ? O ASN G 236 N GLN G 187 ? N GLN G 187 
AC3 1 2 N VAL G 28  ? N VAL G 28  O ARG G 35  ? O ARG G 35  
AC3 2 3 N VAL G 38  ? N VAL G 38  O ALA G 191 ? O ALA G 191 
AC3 3 4 N PHE G 192 ? N PHE G 192 O TYR G 232 ? O TYR G 232 
AC3 4 5 O ARG G 233 ? O ARG G 233 N ALA G 8   ? N ALA G 8   
AC3 5 6 N ASP G 5   ? N ASP G 5   O ALA G 287 ? O ALA G 287 
AC3 6 7 N VAL G 284 ? N VAL G 284 O ALA G 338 ? O ALA G 338 
AC3 7 8 N TYR G 337 ? N TYR G 337 O GLU G 351 ? O GLU G 351 
AC4 1 2 N THR G 62  ? N THR G 62  O PHE G 117 ? O PHE G 117 
AC5 1 2 N GLU G 200 ? N GLU G 200 O PHE G 226 ? O PHE G 226 
AC6 1 2 N VAL H 28  ? N VAL H 28  O ARG H 35  ? O ARG H 35  
AC6 2 3 N VAL H 38  ? N VAL H 38  O ALA H 191 ? O ALA H 191 
AC6 3 4 N PHE H 192 ? N PHE H 192 O TYR H 232 ? O TYR H 232 
AC6 4 5 O ASN H 236 ? O ASN H 236 N GLN H 187 ? N GLN H 187 
AC7 1 2 N VAL H 28  ? N VAL H 28  O ARG H 35  ? O ARG H 35  
AC7 2 3 N VAL H 38  ? N VAL H 38  O ALA H 191 ? O ALA H 191 
AC7 3 4 N PHE H 192 ? N PHE H 192 O TYR H 232 ? O TYR H 232 
AC7 4 5 O ARG H 233 ? O ARG H 233 N ALA H 8   ? N ALA H 8   
AC7 5 6 N PHE H 3   ? N PHE H 3   O ARG H 289 ? O ARG H 289 
AC7 6 7 N VAL H 284 ? N VAL H 284 O ALA H 338 ? O ALA H 338 
AC7 7 8 N TYR H 337 ? N TYR H 337 O GLU H 351 ? O GLU H 351 
AC8 1 2 N THR H 62  ? N THR H 62  O PHE H 117 ? O PHE H 117 
AC9 1 2 N ASP H 202 ? N ASP H 202 O GLY H 224 ? O GLY H 224 
AD1 1 2 N VAL I 28  ? N VAL I 28  O ARG I 35  ? O ARG I 35  
AD1 2 3 N VAL I 38  ? N VAL I 38  O ALA I 191 ? O ALA I 191 
AD1 3 4 N PHE I 192 ? N PHE I 192 O TYR I 232 ? O TYR I 232 
AD1 4 5 O ASN I 236 ? O ASN I 236 N GLN I 187 ? N GLN I 187 
AD2 1 2 N VAL I 28  ? N VAL I 28  O ARG I 35  ? O ARG I 35  
AD2 2 3 N VAL I 38  ? N VAL I 38  O ALA I 191 ? O ALA I 191 
AD2 3 4 N PHE I 192 ? N PHE I 192 O TYR I 232 ? O TYR I 232 
AD2 4 5 O ARG I 233 ? O ARG I 233 N ALA I 8   ? N ALA I 8   
AD2 5 6 N ASP I 5   ? N ASP I 5   O ALA I 287 ? O ALA I 287 
AD2 6 7 N VAL I 284 ? N VAL I 284 O ALA I 338 ? O ALA I 338 
AD3 1 2 N THR I 62  ? N THR I 62  O PHE I 117 ? O PHE I 117 
AD4 1 2 O LEU M 151 ? O LEU N 151 N LEU M 5   ? N LEU N 5   
AD4 2 3 N LEU M 6   ? N LEU N 6   O VAL M 115 ? O VAL N 115 
AD4 3 4 O ALA M 116 ? O ALA N 116 N THR M 60  ? N THR N 60  
AD4 4 5 N VAL M 61  ? N VAL N 61  O ILE M 185 ? O ILE N 185 
AD4 5 6 N LEU M 184 ? N LEU N 184 O VAL M 222 ? O VAL N 222 
AD4 6 7 O ILE M 219 ? O ILE N 219 N THR M 198 ? N THR N 198 
AD5 1 2 N GLN M 13  ? N GLN N 13  O LEU M 108 ? O LEU N 108 
AD5 2 3 O SER M 106 ? O SER N 106 N ARG M 24  ? N ARG N 24  
AD6 1 2 N GLN M 13  ? N GLN N 13  O LEU M 108 ? O LEU N 108 
AD6 2 3 O TYR M 107 ? O TYR N 107 N LEU M 70  ? N LEU N 70  
AD7 1 2 N TRP M 15  ? N TRP N 15  O LEU M 27  ? O LEU N 27  
# 
_atom_sites.entry_id                    5U07 
_atom_sites.fract_transf_matrix[1][1]   0.003155 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003155 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003155 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . THR A 1 2   ? 83.600  150.485 158.169 1.00 31.72  ? 2   THR A N     1 
ATOM 2     C CA    . THR A 1 2   ? 84.919  150.242 157.603 1.00 31.72  ? 2   THR A CA    1 
ATOM 3     C C     . THR A 1 2   ? 85.898  150.592 158.737 1.00 31.72  ? 2   THR A C     1 
ATOM 4     O O     . THR A 1 2   ? 85.455  150.993 159.812 1.00 31.72  ? 2   THR A O     1 
ATOM 5     C CB    . THR A 1 2   ? 85.132  151.075 156.323 1.00 31.72  ? 2   THR A CB    1 
ATOM 6     O OG1   . THR A 1 2   ? 84.120  150.726 155.372 1.00 31.72  ? 2   THR A OG1   1 
ATOM 7     C CG2   . THR A 1 2   ? 86.445  150.743 155.672 1.00 31.72  ? 2   THR A CG2   1 
ATOM 8     N N     . TRP A 1 3   ? 87.207  150.431 158.540 1.00 35.31  ? 3   TRP A N     1 
ATOM 9     C CA    . TRP A 1 3   ? 88.190  150.967 159.473 1.00 35.31  ? 3   TRP A CA    1 
ATOM 10    C C     . TRP A 1 3   ? 89.478  151.344 158.742 1.00 35.31  ? 3   TRP A C     1 
ATOM 11    O O     . TRP A 1 3   ? 89.833  150.728 157.724 1.00 35.31  ? 3   TRP A O     1 
ATOM 12    C CB    . TRP A 1 3   ? 88.391  149.976 160.627 1.00 35.31  ? 3   TRP A CB    1 
ATOM 13    C CG    . TRP A 1 3   ? 88.959  148.660 160.273 1.00 35.31  ? 3   TRP A CG    1 
ATOM 14    C CD1   . TRP A 1 3   ? 88.268  147.521 160.006 1.00 35.31  ? 3   TRP A CD1   1 
ATOM 15    C CD2   . TRP A 1 3   ? 90.338  148.292 160.311 1.00 35.31  ? 3   TRP A CD2   1 
ATOM 16    N NE1   . TRP A 1 3   ? 89.134  146.483 159.783 1.00 35.31  ? 3   TRP A NE1   1 
ATOM 17    C CE2   . TRP A 1 3   ? 90.414  146.930 159.978 1.00 35.31  ? 3   TRP A CE2   1 
ATOM 18    C CE3   . TRP A 1 3   ? 91.518  148.991 160.560 1.00 35.31  ? 3   TRP A CE3   1 
ATOM 19    C CZ2   . TRP A 1 3   ? 91.623  146.255 159.884 1.00 35.31  ? 3   TRP A CZ2   1 
ATOM 20    C CZ3   . TRP A 1 3   ? 92.709  148.316 160.476 1.00 35.31  ? 3   TRP A CZ3   1 
ATOM 21    C CH2   . TRP A 1 3   ? 92.758  146.966 160.135 1.00 35.31  ? 3   TRP A CH2   1 
ATOM 22    N N     . LEU A 1 4   ? 90.142  152.395 159.254 1.00 35.35  ? 4   LEU A N     1 
ATOM 23    C CA    . LEU A 1 4   ? 91.307  153.031 158.642 1.00 35.35  ? 4   LEU A CA    1 
ATOM 24    C C     . LEU A 1 4   ? 92.609  152.697 159.351 1.00 35.35  ? 4   LEU A C     1 
ATOM 25    O O     . LEU A 1 4   ? 92.697  152.786 160.576 1.00 35.35  ? 4   LEU A O     1 
ATOM 26    C CB    . LEU A 1 4   ? 91.163  154.557 158.681 1.00 35.35  ? 4   LEU A CB    1 
ATOM 27    C CG    . LEU A 1 4   ? 92.162  155.481 157.967 1.00 35.35  ? 4   LEU A CG    1 
ATOM 28    C CD1   . LEU A 1 4   ? 92.154  155.445 156.440 1.00 35.35  ? 4   LEU A CD1   1 
ATOM 29    C CD2   . LEU A 1 4   ? 91.963  156.906 158.479 1.00 35.35  ? 4   LEU A CD2   1 
ATOM 30    N N     . THR A 1 5   ? 93.632  152.359 158.563 1.00 40.50  ? 5   THR A N     1 
ATOM 31    C CA    . THR A 1 5   ? 94.934  152.007 159.114 1.00 40.50  ? 5   THR A CA    1 
ATOM 32    C C     . THR A 1 5   ? 96.052  152.329 158.131 1.00 40.50  ? 5   THR A C     1 
ATOM 33    O O     . THR A 1 5   ? 95.861  152.278 156.913 1.00 40.50  ? 5   THR A O     1 
ATOM 34    C CB    . THR A 1 5   ? 94.975  150.515 159.492 1.00 20.00  ? 5   THR A CB    1 
ATOM 35    N N     . LYS A 1 6   ? 97.198  152.754 158.677 1.00 48.80  ? 6   LYS A N     1 
ATOM 36    C CA    . LYS A 1 6   ? 98.409  153.019 157.898 1.00 48.80  ? 6   LYS A CA    1 
ATOM 37    C C     . LYS A 1 6   ? 99.416  151.903 158.156 1.00 48.80  ? 6   LYS A C     1 
ATOM 38    O O     . LYS A 1 6   ? 99.899  151.740 159.284 1.00 48.80  ? 6   LYS A O     1 
ATOM 39    C CB    . LYS A 1 6   ? 99.018  154.405 158.142 1.00 48.80  ? 6   LYS A CB    1 
ATOM 40    C CG    . LYS A 1 6   ? 98.204  155.579 157.579 1.00 48.80  ? 6   LYS A CG    1 
ATOM 41    C CD    . LYS A 1 6   ? 98.274  156.833 158.422 1.00 48.80  ? 6   LYS A CD    1 
ATOM 42    C CE    . LYS A 1 6   ? 99.531  157.648 158.081 1.00 48.80  ? 6   LYS A CE    1 
ATOM 43    N NZ    . LYS A 1 6   ? 99.594  158.002 156.665 1.00 48.80  ? 6   LYS A NZ    1 
ATOM 44    N N     . ILE A 1 7   ? 99.663  151.104 157.115 1.00 55.97  ? 7   ILE A N     1 
ATOM 45    C CA    . ILE A 1 7   ? 100.524 149.929 157.129 1.00 55.97  ? 7   ILE A CA    1 
ATOM 46    C C     . ILE A 1 7   ? 101.667 150.213 156.162 1.00 55.97  ? 7   ILE A C     1 
ATOM 47    O O     . ILE A 1 7   ? 101.567 151.104 155.315 1.00 55.97  ? 7   ILE A O     1 
ATOM 48    C CB    . ILE A 1 7   ? 99.770  148.661 156.693 1.00 55.97  ? 7   ILE A CB    1 
ATOM 49    C CG1   . ILE A 1 7   ? 99.366  148.794 155.226 1.00 55.97  ? 7   ILE A CG1   1 
ATOM 50    C CG2   . ILE A 1 7   ? 98.502  148.456 157.532 1.00 55.97  ? 7   ILE A CG2   1 
ATOM 51    C CD1   . ILE A 1 7   ? 98.726  147.563 154.656 1.00 55.97  ? 7   ILE A CD1   1 
ATOM 52    N N     . VAL A 1 8   ? 102.762 149.461 156.278 1.00 65.08  ? 8   VAL A N     1 
ATOM 53    C CA    . VAL A 1 8   ? 103.812 149.703 155.290 1.00 65.08  ? 8   VAL A CA    1 
ATOM 54    C C     . VAL A 1 8   ? 104.280 148.376 154.697 1.00 65.08  ? 8   VAL A C     1 
ATOM 55    O O     . VAL A 1 8   ? 104.491 147.392 155.421 1.00 65.08  ? 8   VAL A O     1 
ATOM 56    C CB    . VAL A 1 8   ? 104.980 150.500 155.904 1.00 65.08  ? 8   VAL A CB    1 
ATOM 57    C CG1   . VAL A 1 8   ? 105.626 149.748 157.076 1.00 65.08  ? 8   VAL A CG1   1 
ATOM 58    C CG2   . VAL A 1 8   ? 106.004 150.873 154.840 1.00 65.08  ? 8   VAL A CG2   1 
ATOM 59    N N     . PRO A 1 9   ? 104.434 148.313 153.364 1.00 74.83  ? 9   PRO A N     1 
ATOM 60    C CA    . PRO A 1 9   ? 105.040 147.149 152.701 1.00 74.83  ? 9   PRO A CA    1 
ATOM 61    C C     . PRO A 1 9   ? 106.478 147.333 152.228 1.00 74.83  ? 9   PRO A C     1 
ATOM 62    O O     . PRO A 1 9   ? 106.792 148.342 151.589 1.00 74.83  ? 9   PRO A O     1 
ATOM 63    C CB    . PRO A 1 9   ? 104.120 146.933 151.492 1.00 74.83  ? 9   PRO A CB    1 
ATOM 64    C CG    . PRO A 1 9   ? 103.673 148.318 151.177 1.00 74.83  ? 9   PRO A CG    1 
ATOM 65    C CD    . PRO A 1 9   ? 103.379 148.900 152.523 1.00 74.83  ? 9   PRO A CD    1 
ATOM 66    N N     . ASP A 1 10  ? 107.365 146.396 152.542 1.00 82.16  ? 10  ASP A N     1 
ATOM 67    C CA    . ASP A 1 10  ? 108.748 146.456 152.089 1.00 82.16  ? 10  ASP A CA    1 
ATOM 68    C C     . ASP A 1 10  ? 109.000 145.283 151.137 1.00 82.16  ? 10  ASP A C     1 
ATOM 69    O O     . ASP A 1 10  ? 108.152 144.404 150.967 1.00 82.16  ? 10  ASP A O     1 
ATOM 70    C CB    . ASP A 1 10  ? 109.722 146.485 153.273 1.00 82.16  ? 10  ASP A CB    1 
ATOM 71    C CG    . ASP A 1 10  ? 109.370 147.561 154.290 1.00 82.16  ? 10  ASP A CG    1 
ATOM 72    O OD1   . ASP A 1 10  ? 109.003 148.676 153.866 1.00 82.16  ? 10  ASP A OD1   1 
ATOM 73    O OD2   . ASP A 1 10  ? 109.465 147.302 155.507 1.00 82.16  ? 10  ASP A OD2   1 
ATOM 74    N N     . LEU A 1 11  ? 110.179 145.262 150.514 1.00 93.44  ? 11  LEU A N     1 
ATOM 75    C CA    . LEU A 1 11  ? 110.632 144.134 149.696 1.00 93.44  ? 11  LEU A CA    1 
ATOM 76    C C     . LEU A 1 11  ? 111.504 143.199 150.523 1.00 93.44  ? 11  LEU A C     1 
ATOM 77    O O     . LEU A 1 11  ? 112.472 143.632 151.159 1.00 93.44  ? 11  LEU A O     1 
ATOM 78    C CB    . LEU A 1 11  ? 111.436 144.616 148.493 1.00 93.44  ? 11  LEU A CB    1 
ATOM 79    N N     . ARG A 1 12  ? 111.161 141.914 150.486 1.00 91.04  ? 12  ARG A N     1 
ATOM 80    C CA    . ARG A 1 12  ? 111.615 140.925 151.458 1.00 91.04  ? 12  ARG A CA    1 
ATOM 81    C C     . ARG A 1 12  ? 113.124 140.672 151.436 1.00 91.04  ? 12  ARG A C     1 
ATOM 82    O O     . ARG A 1 12  ? 113.667 140.233 152.456 1.00 91.04  ? 12  ARG A O     1 
ATOM 83    C CB    . ARG A 1 12  ? 110.752 139.671 151.296 1.00 91.04  ? 12  ARG A CB    1 
ATOM 84    C CG    . ARG A 1 12  ? 109.333 139.959 151.840 1.00 91.04  ? 12  ARG A CG    1 
ATOM 85    C CD    . ARG A 1 12  ? 108.378 140.615 150.842 1.00 91.04  ? 12  ARG A CD    1 
ATOM 86    N NE    . ARG A 1 12  ? 107.915 139.759 149.762 1.00 91.04  ? 12  ARG A NE    1 
ATOM 87    C CZ    . ARG A 1 12  ? 106.936 138.871 149.903 1.00 91.04  ? 12  ARG A CZ    1 
ATOM 88    N NH1   . ARG A 1 12  ? 106.348 138.724 151.082 1.00 91.04  ? 12  ARG A NH1   1 
ATOM 89    N NH2   . ARG A 1 12  ? 106.552 138.129 148.878 1.00 91.04  ? 12  ARG A NH2   1 
ATOM 90    N N     . TYR A 1 13  ? 113.823 140.931 150.329 1.00 101.70 ? 13  TYR A N     1 
ATOM 91    C CA    . TYR A 1 13  ? 115.258 140.667 150.287 1.00 101.70 ? 13  TYR A CA    1 
ATOM 92    C C     . TYR A 1 13  ? 115.941 141.776 149.485 1.00 101.70 ? 13  TYR A C     1 
ATOM 93    O O     . TYR A 1 13  ? 115.296 142.724 149.029 1.00 101.70 ? 13  TYR A O     1 
ATOM 94    C CB    . TYR A 1 13  ? 115.507 139.258 149.713 1.00 101.70 ? 13  TYR A CB    1 
ATOM 95    C CG    . TYR A 1 13  ? 116.956 138.818 149.581 1.00 101.70 ? 13  TYR A CG    1 
ATOM 96    C CD1   . TYR A 1 13  ? 117.675 138.392 150.691 1.00 101.70 ? 13  TYR A CD1   1 
ATOM 97    C CD2   . TYR A 1 13  ? 117.582 138.771 148.341 1.00 101.70 ? 13  TYR A CD2   1 
ATOM 98    C CE1   . TYR A 1 13  ? 118.988 137.970 150.577 1.00 101.70 ? 13  TYR A CE1   1 
ATOM 99    C CE2   . TYR A 1 13  ? 118.896 138.354 148.219 1.00 101.70 ? 13  TYR A CE2   1 
ATOM 100   C CZ    . TYR A 1 13  ? 119.594 137.952 149.340 1.00 101.70 ? 13  TYR A CZ    1 
ATOM 101   O OH    . TYR A 1 13  ? 120.905 137.541 149.228 1.00 101.70 ? 13  TYR A OH    1 
ATOM 102   N N     . ARG A 1 14  ? 117.264 141.663 149.327 1.00 107.06 ? 14  ARG A N     1 
ATOM 103   C CA    . ARG A 1 14  ? 118.098 142.693 148.712 1.00 107.06 ? 14  ARG A CA    1 
ATOM 104   C C     . ARG A 1 14  ? 118.159 142.608 147.186 1.00 107.06 ? 14  ARG A C     1 
ATOM 105   O O     . ARG A 1 14  ? 118.876 143.402 146.569 1.00 107.06 ? 14  ARG A O     1 
ATOM 106   C CB    . ARG A 1 14  ? 119.517 142.595 149.292 1.00 107.06 ? 14  ARG A CB    1 
ATOM 107   C CG    . ARG A 1 14  ? 119.614 142.867 150.799 1.00 107.06 ? 14  ARG A CG    1 
ATOM 108   C CD    . ARG A 1 14  ? 121.056 142.823 151.313 1.00 107.06 ? 14  ARG A CD    1 
ATOM 109   N NE    . ARG A 1 14  ? 121.135 143.077 152.753 1.00 107.06 ? 14  ARG A NE    1 
ATOM 110   C CZ    . ARG A 1 14  ? 122.265 143.107 153.452 1.00 107.06 ? 14  ARG A CZ    1 
ATOM 111   N NH1   . ARG A 1 14  ? 123.429 142.910 152.851 1.00 107.06 ? 14  ARG A NH1   1 
ATOM 112   N NH2   . ARG A 1 14  ? 122.233 143.335 154.758 1.00 107.06 ? 14  ARG A NH2   1 
ATOM 113   N N     . GLN A 1 15  ? 117.421 141.685 146.566 1.00 99.61  ? 15  GLN A N     1 
ATOM 114   C CA    . GLN A 1 15  ? 117.388 141.499 145.116 1.00 99.61  ? 15  GLN A CA    1 
ATOM 115   C C     . GLN A 1 15  ? 116.056 141.858 144.479 1.00 99.61  ? 15  GLN A C     1 
ATOM 116   O O     . GLN A 1 15  ? 115.896 141.626 143.278 1.00 99.61  ? 15  GLN A O     1 
ATOM 117   C CB    . GLN A 1 15  ? 117.790 140.076 144.716 1.00 99.61  ? 15  GLN A CB    1 
ATOM 118   C CG    . GLN A 1 15  ? 119.229 139.768 145.032 1.00 99.61  ? 15  GLN A CG    1 
ATOM 119   C CD    . GLN A 1 15  ? 119.637 138.395 144.565 1.00 99.61  ? 15  GLN A CD    1 
ATOM 120   O OE1   . GLN A 1 15  ? 118.808 137.494 144.439 1.00 99.61  ? 15  GLN A OE1   1 
ATOM 121   N NE2   . GLN A 1 15  ? 120.924 138.228 144.290 1.00 99.61  ? 15  GLN A NE2   1 
ATOM 122   N N     . THR A 1 16  ? 115.067 142.252 145.298 1.00 102.96 ? 16  THR A N     1 
ATOM 123   C CA    . THR A 1 16  ? 113.662 142.573 144.959 1.00 102.96 ? 16  THR A CA    1 
ATOM 124   C C     . THR A 1 16  ? 112.897 141.376 144.394 1.00 102.96 ? 16  THR A C     1 
ATOM 125   O O     . THR A 1 16  ? 112.091 141.509 143.476 1.00 102.96 ? 16  THR A O     1 
ATOM 126   C CB    . THR A 1 16  ? 113.507 143.791 144.022 1.00 102.96 ? 16  THR A CB    1 
ATOM 127   O OG1   . THR A 1 16  ? 112.111 144.049 143.838 1.00 102.96 ? 16  THR A OG1   1 
ATOM 128   C CG2   . THR A 1 16  ? 114.109 143.649 142.635 1.00 102.96 ? 16  THR A CG2   1 
ATOM 129   N N     . ARG A 1 17  ? 113.196 140.183 144.899 1.00 99.33  ? 17  ARG A N     1 
ATOM 130   C CA    . ARG A 1 17  ? 112.463 139.001 144.469 1.00 99.33  ? 17  ARG A CA    1 
ATOM 131   C C     . ARG A 1 17  ? 110.974 139.209 144.692 1.00 99.33  ? 17  ARG A C     1 
ATOM 132   O O     . ARG A 1 17  ? 110.137 138.680 143.947 1.00 99.33  ? 17  ARG A O     1 
ATOM 133   C CB    . ARG A 1 17  ? 112.984 137.777 145.199 1.00 99.33  ? 17  ARG A CB    1 
ATOM 134   C CG    . ARG A 1 17  ? 112.312 136.459 144.805 1.00 99.33  ? 17  ARG A CG    1 
ATOM 135   C CD    . ARG A 1 17  ? 112.691 136.102 143.366 1.00 99.33  ? 17  ARG A CD    1 
ATOM 136   N NE    . ARG A 1 17  ? 114.137 135.980 143.184 1.00 99.33  ? 17  ARG A NE    1 
ATOM 137   C CZ    . ARG A 1 17  ? 114.719 135.681 142.027 1.00 99.33  ? 17  ARG A CZ    1 
ATOM 138   N NH1   . ARG A 1 17  ? 113.975 135.502 140.945 1.00 99.33  ? 17  ARG A NH1   1 
ATOM 139   N NH2   . ARG A 1 17  ? 116.040 135.586 141.942 1.00 99.33  ? 17  ARG A NH2   1 
ATOM 140   N N     . PHE A 1 20  ? 107.151 144.826 146.327 1.00 91.92  ? 20  PHE A N     1 
ATOM 141   C CA    . PHE A 1 20  ? 106.487 146.065 145.951 1.00 91.92  ? 20  PHE A CA    1 
ATOM 142   C C     . PHE A 1 20  ? 106.934 146.601 144.595 1.00 91.92  ? 20  PHE A C     1 
ATOM 143   O O     . PHE A 1 20  ? 106.746 147.786 144.323 1.00 91.92  ? 20  PHE A O     1 
ATOM 144   C CB    . PHE A 1 20  ? 106.714 147.084 147.071 1.00 91.92  ? 20  PHE A CB    1 
ATOM 145   C CG    . PHE A 1 20  ? 105.932 148.345 146.931 1.00 91.92  ? 20  PHE A CG    1 
ATOM 146   C CD1   . PHE A 1 20  ? 104.575 148.327 147.201 1.00 91.92  ? 20  PHE A CD1   1 
ATOM 147   C CD2   . PHE A 1 20  ? 106.525 149.536 146.577 1.00 91.92  ? 20  PHE A CD2   1 
ATOM 148   C CE1   . PHE A 1 20  ? 103.823 149.466 147.090 1.00 91.92  ? 20  PHE A CE1   1 
ATOM 149   C CE2   . PHE A 1 20  ? 105.774 150.685 146.466 1.00 91.92  ? 20  PHE A CE2   1 
ATOM 150   C CZ    . PHE A 1 20  ? 104.422 150.644 146.725 1.00 91.92  ? 20  PHE A CZ    1 
ATOM 151   N N     . ARG A 1 21  ? 107.506 145.758 143.730 1.00 98.23  ? 21  ARG A N     1 
ATOM 152   C CA    . ARG A 1 21  ? 107.999 146.268 142.453 1.00 98.23  ? 21  ARG A CA    1 
ATOM 153   C C     . ARG A 1 21  ? 106.866 146.651 141.492 1.00 98.23  ? 21  ARG A C     1 
ATOM 154   O O     . ARG A 1 21  ? 106.998 147.618 140.733 1.00 98.23  ? 21  ARG A O     1 
ATOM 155   C CB    . ARG A 1 21  ? 108.974 145.261 141.844 1.00 98.23  ? 21  ARG A CB    1 
ATOM 156   C CG    . ARG A 1 21  ? 108.420 143.894 141.545 1.00 98.23  ? 21  ARG A CG    1 
ATOM 157   C CD    . ARG A 1 21  ? 109.497 143.045 140.890 1.00 98.23  ? 21  ARG A CD    1 
ATOM 158   N NE    . ARG A 1 21  ? 109.030 141.701 140.568 1.00 98.23  ? 21  ARG A NE    1 
ATOM 159   C CZ    . ARG A 1 21  ? 108.962 140.715 141.459 1.00 98.23  ? 21  ARG A CZ    1 
ATOM 160   N NH1   . ARG A 1 21  ? 109.164 140.969 142.748 1.00 98.23  ? 21  ARG A NH1   1 
ATOM 161   N NH2   . ARG A 1 21  ? 108.538 139.516 141.091 1.00 98.23  ? 21  ARG A NH2   1 
ATOM 162   N N     . THR A 1 22  ? 105.754 145.909 141.486 1.00 102.94 ? 22  THR A N     1 
ATOM 163   C CA    . THR A 1 22  ? 104.679 146.166 140.529 1.00 102.94 ? 22  THR A CA    1 
ATOM 164   C C     . THR A 1 22  ? 103.327 146.322 141.224 1.00 102.94 ? 22  THR A C     1 
ATOM 165   O O     . THR A 1 22  ? 103.166 146.011 142.407 1.00 102.94 ? 22  THR A O     1 
ATOM 166   C CB    . THR A 1 22  ? 104.596 145.042 139.484 1.00 102.94 ? 22  THR A CB    1 
ATOM 167   O OG1   . THR A 1 22  ? 103.614 145.379 138.495 1.00 102.94 ? 22  THR A OG1   1 
ATOM 168   C CG2   . THR A 1 22  ? 104.239 143.724 140.148 1.00 102.94 ? 22  THR A CG2   1 
ATOM 169   N N     . ALA A 1 23  ? 102.349 146.833 140.459 1.00 99.33  ? 23  ALA A N     1 
ATOM 170   C CA    . ALA A 1 23  ? 100.992 147.034 140.971 1.00 99.33  ? 23  ALA A CA    1 
ATOM 171   C C     . ALA A 1 23  ? 100.292 145.715 141.267 1.00 99.33  ? 23  ALA A C     1 
ATOM 172   O O     . ALA A 1 23  ? 99.620  145.574 142.294 1.00 99.33  ? 23  ALA A O     1 
ATOM 173   C CB    . ALA A 1 23  ? 100.147 147.863 140.013 1.00 99.33  ? 23  ALA A CB    1 
ATOM 174   N N     . GLY A 1 24  ? 100.386 144.744 140.360 1.00 103.87 ? 24  GLY A N     1 
ATOM 175   C CA    . GLY A 1 24  ? 99.684  143.502 140.612 1.00 103.87 ? 24  GLY A CA    1 
ATOM 176   C C     . GLY A 1 24  ? 100.170 142.873 141.899 1.00 103.87 ? 24  GLY A C     1 
ATOM 177   O O     . GLY A 1 24  ? 99.372  142.393 142.714 1.00 103.87 ? 24  GLY A O     1 
ATOM 178   N N     . ASN A 1 25  ? 101.486 142.911 142.124 1.00 98.40  ? 25  ASN A N     1 
ATOM 179   C CA    . ASN A 1 25  ? 102.010 142.361 143.360 1.00 98.40  ? 25  ASN A CA    1 
ATOM 180   C C     . ASN A 1 25  ? 101.526 143.193 144.544 1.00 98.40  ? 25  ASN A C     1 
ATOM 181   O O     . ASN A 1 25  ? 101.395 142.664 145.648 1.00 98.40  ? 25  ASN A O     1 
ATOM 182   C CB    . ASN A 1 25  ? 103.537 142.295 143.284 1.00 98.40  ? 25  ASN A CB    1 
ATOM 183   C CG    . ASN A 1 25  ? 104.164 141.483 144.398 1.00 98.40  ? 25  ASN A CG    1 
ATOM 184   O OD1   . ASN A 1 25  ? 103.628 141.355 145.494 1.00 98.40  ? 25  ASN A OD1   1 
ATOM 185   N ND2   . ASN A 1 25  ? 105.352 140.956 144.121 1.00 98.40  ? 25  ASN A ND2   1 
ATOM 186   N N     . LEU A 1 26  ? 101.220 144.486 144.337 1.00 95.85  ? 26  LEU A N     1 
ATOM 187   C CA    . LEU A 1 26  ? 100.676 145.266 145.450 1.00 95.85  ? 26  LEU A CA    1 
ATOM 188   C C     . LEU A 1 26  ? 99.278  144.784 145.789 1.00 95.85  ? 26  LEU A C     1 
ATOM 189   O O     . LEU A 1 26  ? 98.948  144.623 146.965 1.00 95.85  ? 26  LEU A O     1 
ATOM 190   C CB    . LEU A 1 26  ? 100.685 146.778 145.182 1.00 95.85  ? 26  LEU A CB    1 
ATOM 191   C CG    . LEU A 1 26  ? 99.731  147.602 144.310 1.00 95.85  ? 26  LEU A CG    1 
ATOM 192   C CD1   . LEU A 1 26  ? 98.396  147.974 144.964 1.00 95.85  ? 26  LEU A CD1   1 
ATOM 193   C CD2   . LEU A 1 26  ? 100.482 148.868 143.913 1.00 95.85  ? 26  LEU A CD2   1 
ATOM 194   N N     . HIS A 1 27  ? 98.447  144.549 144.769 1.00 98.24  ? 27  HIS A N     1 
ATOM 195   C CA    . HIS A 1 27  ? 97.141  143.940 145.004 1.00 98.24  ? 27  HIS A CA    1 
ATOM 196   C C     . HIS A 1 27  ? 97.278  142.658 145.806 1.00 98.24  ? 27  HIS A C     1 
ATOM 197   O O     . HIS A 1 27  ? 96.641  142.489 146.853 1.00 98.24  ? 27  HIS A O     1 
ATOM 198   C CB    . HIS A 1 27  ? 96.434  143.668 143.678 1.00 98.24  ? 27  HIS A CB    1 
ATOM 199   C CG    . HIS A 1 27  ? 95.056  143.110 143.839 1.00 98.24  ? 27  HIS A CG    1 
ATOM 200   N ND1   . HIS A 1 27  ? 94.830  141.821 144.271 1.00 98.24  ? 27  HIS A ND1   1 
ATOM 201   C CD2   . HIS A 1 27  ? 93.836  143.666 143.658 1.00 98.24  ? 27  HIS A CD2   1 
ATOM 202   C CE1   . HIS A 1 27  ? 93.529  141.598 144.327 1.00 98.24  ? 27  HIS A CE1   1 
ATOM 203   N NE2   . HIS A 1 27  ? 92.903  142.704 143.963 1.00 98.24  ? 27  HIS A NE2   1 
ATOM 204   N N     . ARG A 1 28  ? 98.109  141.734 145.322 1.00 97.01  ? 28  ARG A N     1 
ATOM 205   C CA    . ARG A 1 28  ? 98.257  140.451 146.000 1.00 97.01  ? 28  ARG A CA    1 
ATOM 206   C C     . ARG A 1 28  ? 98.721  140.646 147.444 1.00 97.01  ? 28  ARG A C     1 
ATOM 207   O O     . ARG A 1 28  ? 98.180  140.031 148.370 1.00 97.01  ? 28  ARG A O     1 
ATOM 208   C CB    . ARG A 1 28  ? 99.226  139.586 145.198 1.00 97.01  ? 28  ARG A CB    1 
ATOM 209   C CG    . ARG A 1 28  ? 99.486  138.197 145.729 1.00 97.01  ? 28  ARG A CG    1 
ATOM 210   C CD    . ARG A 1 28  ? 100.431 137.472 144.773 1.00 97.01  ? 28  ARG A CD    1 
ATOM 211   N NE    . ARG A 1 28  ? 101.753 138.095 144.705 1.00 97.01  ? 28  ARG A NE    1 
ATOM 212   C CZ    . ARG A 1 28  ? 102.760 137.827 145.531 1.00 97.01  ? 28  ARG A CZ    1 
ATOM 213   N NH1   . ARG A 1 28  ? 102.611 136.931 146.496 1.00 97.01  ? 28  ARG A NH1   1 
ATOM 214   N NH2   . ARG A 1 28  ? 103.921 138.451 145.386 1.00 97.01  ? 28  ARG A NH2   1 
ATOM 215   N N     . LYS A 1 29  ? 99.769  141.456 147.645 1.00 90.64  ? 29  LYS A N     1 
ATOM 216   C CA    . LYS A 1 29  ? 100.278 141.711 148.989 1.00 90.64  ? 29  LYS A CA    1 
ATOM 217   C C     . LYS A 1 29  ? 99.204  142.288 149.896 1.00 90.64  ? 29  LYS A C     1 
ATOM 218   O O     . LYS A 1 29  ? 99.194  142.027 151.102 1.00 90.64  ? 29  LYS A O     1 
ATOM 219   C CB    . LYS A 1 29  ? 101.445 142.694 148.923 1.00 90.64  ? 29  LYS A CB    1 
ATOM 220   C CG    . LYS A 1 29  ? 102.728 142.158 148.326 1.00 90.64  ? 29  LYS A CG    1 
ATOM 221   C CD    . LYS A 1 29  ? 103.284 140.963 149.052 1.00 90.64  ? 29  LYS A CD    1 
ATOM 222   C CE    . LYS A 1 29  ? 102.963 139.665 148.336 1.00 90.64  ? 29  LYS A CE    1 
ATOM 223   N NZ    . LYS A 1 29  ? 103.594 138.510 149.026 1.00 90.64  ? 29  LYS A NZ    1 
ATOM 224   N N     . LEU A 1 30  ? 98.329  143.125 149.339 1.00 82.95  ? 30  LEU A N     1 
ATOM 225   C CA    . LEU A 1 30  ? 97.250  143.717 150.120 1.00 82.95  ? 30  LEU A CA    1 
ATOM 226   C C     . LEU A 1 30  ? 96.214  142.668 150.504 1.00 82.95  ? 30  LEU A C     1 
ATOM 227   O O     . LEU A 1 30  ? 95.740  142.645 151.643 1.00 82.95  ? 30  LEU A O     1 
ATOM 228   C CB    . LEU A 1 30  ? 96.657  144.910 149.371 1.00 82.95  ? 30  LEU A CB    1 
ATOM 229   C CG    . LEU A 1 30  ? 97.713  146.033 149.391 1.00 82.95  ? 30  LEU A CG    1 
ATOM 230   C CD1   . LEU A 1 30  ? 97.288  147.304 148.678 1.00 82.95  ? 30  LEU A CD1   1 
ATOM 231   C CD2   . LEU A 1 30  ? 98.117  146.354 150.834 1.00 82.95  ? 30  LEU A CD2   1 
ATOM 232   N N     . ILE A 1 31  ? 95.835  141.797 149.565 1.00 90.67  ? 31  ILE A N     1 
ATOM 233   C CA    . ILE A 1 31  ? 94.802  140.817 149.890 1.00 90.67  ? 31  ILE A CA    1 
ATOM 234   C C     . ILE A 1 31  ? 95.345  139.735 150.821 1.00 90.67  ? 31  ILE A C     1 
ATOM 235   O O     . ILE A 1 31  ? 94.581  139.140 151.592 1.00 90.67  ? 31  ILE A O     1 
ATOM 236   C CB    . ILE A 1 31  ? 94.186  140.214 148.609 1.00 90.67  ? 31  ILE A CB    1 
ATOM 237   C CG1   . ILE A 1 31  ? 95.227  139.444 147.803 1.00 90.67  ? 31  ILE A CG1   1 
ATOM 238   C CG2   . ILE A 1 31  ? 93.535  141.295 147.767 1.00 90.67  ? 31  ILE A CG2   1 
ATOM 239   C CD1   . ILE A 1 31  ? 94.653  138.724 146.612 1.00 90.67  ? 31  ILE A CD1   1 
ATOM 240   N N     . ARG A 1 32  ? 96.649  139.435 150.755 1.00 84.00  ? 32  ARG A N     1 
ATOM 241   C CA    . ARG A 1 32  ? 97.197  138.349 151.563 1.00 84.00  ? 32  ARG A CA    1 
ATOM 242   C C     . ARG A 1 32  ? 97.207  138.684 153.051 1.00 84.00  ? 32  ARG A C     1 
ATOM 243   O O     . ARG A 1 32  ? 97.435  137.783 153.867 1.00 84.00  ? 32  ARG A O     1 
ATOM 244   C CB    . ARG A 1 32  ? 98.634  137.996 151.185 1.00 84.00  ? 32  ARG A CB    1 
ATOM 245   C CG    . ARG A 1 32  ? 99.593  139.100 151.494 1.00 84.00  ? 32  ARG A CG    1 
ATOM 246   C CD    . ARG A 1 32  ? 100.999 138.746 151.113 1.00 84.00  ? 32  ARG A CD    1 
ATOM 247   N NE    . ARG A 1 32  ? 101.903 139.843 151.427 1.00 84.00  ? 32  ARG A NE    1 
ATOM 248   C CZ    . ARG A 1 32  ? 102.425 140.065 152.627 1.00 84.00  ? 32  ARG A CZ    1 
ATOM 249   N NH1   . ARG A 1 32  ? 102.148 139.246 153.628 1.00 84.00  ? 32  ARG A NH1   1 
ATOM 250   N NH2   . ARG A 1 32  ? 103.244 141.090 152.823 1.00 84.00  ? 32  ARG A NH2   1 
ATOM 251   N N     . LEU A 1 33  ? 96.974  139.945 153.424 1.00 76.39  ? 33  LEU A N     1 
ATOM 252   C CA    . LEU A 1 33  ? 96.967  140.360 154.820 1.00 76.39  ? 33  LEU A CA    1 
ATOM 253   C C     . LEU A 1 33  ? 95.563  140.438 155.394 1.00 76.39  ? 33  LEU A C     1 
ATOM 254   O O     . LEU A 1 33  ? 95.336  141.127 156.394 1.00 76.39  ? 33  LEU A O     1 
ATOM 255   C CB    . LEU A 1 33  ? 97.718  141.684 154.992 1.00 76.39  ? 33  LEU A CB    1 
ATOM 256   C CG    . LEU A 1 33  ? 97.375  142.983 154.256 1.00 76.39  ? 33  LEU A CG    1 
ATOM 257   C CD1   . LEU A 1 33  ? 96.029  143.592 154.607 1.00 76.39  ? 33  LEU A CD1   1 
ATOM 258   C CD2   . LEU A 1 33  ? 98.480  143.980 154.543 1.00 76.39  ? 33  LEU A CD2   1 
ATOM 259   N N     . SER A 1 34  ? 94.631  139.709 154.795 1.00 62.72  ? 34  SER A N     1 
ATOM 260   C CA    . SER A 1 34  ? 93.250  139.633 155.252 1.00 62.72  ? 34  SER A CA    1 
ATOM 261   C C     . SER A 1 34  ? 92.821  138.201 154.980 1.00 62.72  ? 34  SER A C     1 
ATOM 262   O O     . SER A 1 34  ? 92.732  137.785 153.820 1.00 62.72  ? 34  SER A O     1 
ATOM 263   C CB    . SER A 1 34  ? 92.368  140.641 154.522 1.00 62.72  ? 34  SER A CB    1 
ATOM 264   O OG    . SER A 1 34  ? 92.379  140.393 153.129 1.00 62.72  ? 34  SER A OG    1 
ATOM 265   N N     . SER A 1 35  ? 92.562  137.449 156.049 1.00 56.49  ? 35  SER A N     1 
ATOM 266   C CA    . SER A 1 35  ? 92.206  136.041 155.921 1.00 56.49  ? 35  SER A CA    1 
ATOM 267   C C     . SER A 1 35  ? 90.784  135.858 155.418 1.00 56.49  ? 35  SER A C     1 
ATOM 268   O O     . SER A 1 35  ? 90.577  135.537 154.243 1.00 56.49  ? 35  SER A O     1 
ATOM 269   C CB    . SER A 1 35  ? 92.379  135.320 157.260 1.00 56.49  ? 35  SER A CB    1 
ATOM 270   O OG    . SER A 1 35  ? 91.534  135.873 158.253 1.00 56.49  ? 35  SER A OG    1 
ATOM 271   N N     . ASP A 1 36  ? 89.800  136.044 156.290 1.00 55.87  ? 36  ASP A N     1 
ATOM 272   C CA    . ASP A 1 36  ? 88.414  135.855 155.885 1.00 55.87  ? 36  ASP A CA    1 
ATOM 273   C C     . ASP A 1 36  ? 88.007  136.956 154.913 1.00 55.87  ? 36  ASP A C     1 
ATOM 274   O O     . ASP A 1 36  ? 87.833  138.114 155.309 1.00 55.87  ? 36  ASP A O     1 
ATOM 275   C CB    . ASP A 1 36  ? 87.512  135.847 157.115 1.00 55.87  ? 36  ASP A CB    1 
ATOM 276   C CG    . ASP A 1 36  ? 87.790  134.669 158.031 1.00 55.87  ? 36  ASP A CG    1 
ATOM 277   O OD1   . ASP A 1 36  ? 88.292  133.638 157.536 1.00 55.87  ? 36  ASP A OD1   1 
ATOM 278   O OD2   . ASP A 1 36  ? 87.513  134.777 159.244 1.00 55.87  ? 36  ASP A OD2   1 
ATOM 279   N N     . LEU A 1 37  ? 87.871  136.601 153.638 1.00 51.03  ? 37  LEU A N     1 
ATOM 280   C CA    . LEU A 1 37  ? 87.455  137.531 152.600 1.00 51.03  ? 37  LEU A CA    1 
ATOM 281   C C     . LEU A 1 37  ? 86.154  137.069 151.961 1.00 51.03  ? 37  LEU A C     1 
ATOM 282   O O     . LEU A 1 37  ? 85.878  135.870 151.863 1.00 51.03  ? 37  LEU A O     1 
ATOM 283   C CB    . LEU A 1 37  ? 88.534  137.708 151.524 1.00 51.03  ? 37  LEU A CB    1 
ATOM 284   C CG    . LEU A 1 37  ? 89.807  138.389 152.024 1.00 51.03  ? 37  LEU A CG    1 
ATOM 285   C CD1   . LEU A 1 37  ? 90.855  138.484 150.926 1.00 51.03  ? 37  LEU A CD1   1 
ATOM 286   C CD2   . LEU A 1 37  ? 89.441  139.769 152.541 1.00 51.03  ? 37  LEU A CD2   1 
ATOM 287   N N     . GLY A 1 38  ? 85.363  138.038 151.532 1.00 46.35  ? 38  GLY A N     1 
ATOM 288   C CA    . GLY A 1 38  ? 84.085  137.761 150.906 1.00 46.35  ? 38  GLY A CA    1 
ATOM 289   C C     . GLY A 1 38  ? 83.893  138.697 149.735 1.00 46.35  ? 38  GLY A C     1 
ATOM 290   O O     . GLY A 1 38  ? 84.463  139.789 149.693 1.00 46.35  ? 38  GLY A O     1 
ATOM 291   N N     . GLU A 1 39  ? 83.094  138.261 148.767 1.00 46.96  ? 39  GLU A N     1 
ATOM 292   C CA    . GLU A 1 39  ? 82.809  139.133 147.635 1.00 46.96  ? 39  GLU A CA    1 
ATOM 293   C C     . GLU A 1 39  ? 81.381  138.900 147.171 1.00 46.96  ? 39  GLU A C     1 
ATOM 294   O O     . GLU A 1 39  ? 81.047  137.819 146.676 1.00 46.96  ? 39  GLU A O     1 
ATOM 295   C CB    . GLU A 1 39  ? 83.806  138.893 146.498 1.00 46.96  ? 39  GLU A CB    1 
ATOM 296   C CG    . GLU A 1 39  ? 83.557  139.734 145.254 1.00 46.96  ? 39  GLU A CG    1 
ATOM 297   C CD    . GLU A 1 39  ? 84.597  139.495 144.174 1.00 46.96  ? 39  GLU A CD    1 
ATOM 298   O OE1   . GLU A 1 39  ? 85.493  138.648 144.381 1.00 46.96  ? 39  GLU A OE1   1 
ATOM 299   O OE2   . GLU A 1 39  ? 84.533  140.171 143.128 1.00 46.96  ? 39  GLU A OE2   1 
ATOM 300   N N     . GLU A 1 40  ? 80.555  139.930 147.327 1.00 57.42  ? 40  GLU A N     1 
ATOM 301   C CA    . GLU A 1 40  ? 79.151  139.941 146.935 1.00 57.42  ? 40  GLU A CA    1 
ATOM 302   C C     . GLU A 1 40  ? 79.036  140.924 145.778 1.00 57.42  ? 40  GLU A C     1 
ATOM 303   O O     . GLU A 1 40  ? 79.213  142.132 145.966 1.00 57.42  ? 40  GLU A O     1 
ATOM 304   C CB    . GLU A 1 40  ? 78.250  140.324 148.107 1.00 57.42  ? 40  GLU A CB    1 
ATOM 305   C CG    . GLU A 1 40  ? 76.765  140.252 147.795 1.00 57.42  ? 40  GLU A CG    1 
ATOM 306   C CD    . GLU A 1 40  ? 75.908  140.607 148.991 1.00 57.42  ? 40  GLU A CD    1 
ATOM 307   O OE1   . GLU A 1 40  ? 76.476  140.850 150.077 1.00 57.42  ? 40  GLU A OE1   1 
ATOM 308   O OE2   . GLU A 1 40  ? 74.669  140.638 148.848 1.00 57.42  ? 40  GLU A OE2   1 
ATOM 309   N N     . ARG A 1 41  ? 78.779  140.409 144.582 1.00 59.45  ? 41  ARG A N     1 
ATOM 310   C CA    . ARG A 1 41  ? 78.774  141.210 143.370 1.00 59.45  ? 41  ARG A CA    1 
ATOM 311   C C     . ARG A 1 41  ? 77.360  141.348 142.820 1.00 59.45  ? 41  ARG A C     1 
ATOM 312   O O     . ARG A 1 41  ? 76.505  140.483 143.035 1.00 59.45  ? 41  ARG A O     1 
ATOM 313   C CB    . ARG A 1 41  ? 79.638  140.526 142.308 1.00 59.45  ? 41  ARG A CB    1 
ATOM 314   C CG    . ARG A 1 41  ? 81.114  140.433 142.624 1.00 59.45  ? 41  ARG A CG    1 
ATOM 315   C CD    . ARG A 1 41  ? 81.828  139.753 141.466 1.00 59.45  ? 41  ARG A CD    1 
ATOM 316   N NE    . ARG A 1 41  ? 81.431  138.346 141.395 1.00 59.45  ? 41  ARG A NE    1 
ATOM 317   C CZ    . ARG A 1 41  ? 81.807  137.500 140.443 1.00 59.45  ? 41  ARG A CZ    1 
ATOM 318   N NH1   . ARG A 1 41  ? 82.612  137.901 139.470 1.00 59.45  ? 41  ARG A NH1   1 
ATOM 319   N NH2   . ARG A 1 41  ? 81.387  136.245 140.478 1.00 59.45  ? 41  ARG A NH2   1 
ATOM 320   N N     . ILE A 1 42  ? 77.118  142.449 142.110 1.00 59.27  ? 42  ILE A N     1 
ATOM 321   C CA    . ILE A 1 42  ? 75.872  142.653 141.384 1.00 59.27  ? 42  ILE A CA    1 
ATOM 322   C C     . ILE A 1 42  ? 76.224  143.139 139.987 1.00 59.27  ? 42  ILE A C     1 
ATOM 323   O O     . ILE A 1 42  ? 77.168  143.918 139.817 1.00 59.27  ? 42  ILE A O     1 
ATOM 324   C CB    . ILE A 1 42  ? 74.968  143.684 142.096 1.00 59.27  ? 42  ILE A CB    1 
ATOM 325   C CG1   . ILE A 1 42  ? 74.655  143.241 143.524 1.00 59.27  ? 42  ILE A CG1   1 
ATOM 326   C CG2   . ILE A 1 42  ? 73.670  143.885 141.330 1.00 59.27  ? 42  ILE A CG2   1 
ATOM 327   C CD1   . ILE A 1 42  ? 73.827  144.243 144.310 1.00 59.27  ? 42  ILE A CD1   1 
ATOM 328   N N     . ALA A 1 43  ? 75.470  142.682 138.993 1.00 59.10  ? 43  ALA A N     1 
ATOM 329   C CA    . ALA A 1 43  ? 75.706  143.077 137.610 1.00 59.10  ? 43  ALA A CA    1 
ATOM 330   C C     . ALA A 1 43  ? 75.215  144.500 137.362 1.00 59.10  ? 43  ALA A C     1 
ATOM 331   O O     . ALA A 1 43  ? 74.135  144.875 137.818 1.00 59.10  ? 43  ALA A O     1 
ATOM 332   C CB    . ALA A 1 43  ? 75.027  142.106 136.657 1.00 59.10  ? 43  ALA A CB    1 
ATOM 333   N N     . ASN A 1 44  ? 76.027  145.276 136.645 1.00 57.18  ? 44  ASN A N     1 
ATOM 334   C CA    . ASN A 1 44  ? 75.733  146.672 136.298 1.00 57.18  ? 44  ASN A CA    1 
ATOM 335   C C     . ASN A 1 44  ? 76.274  147.716 137.282 1.00 57.18  ? 44  ASN A C     1 
ATOM 336   O O     . ASN A 1 44  ? 76.765  148.766 136.853 1.00 57.18  ? 44  ASN A O     1 
ATOM 337   C CB    . ASN A 1 44  ? 74.238  146.897 136.037 1.00 57.18  ? 44  ASN A CB    1 
ATOM 338   C CG    . ASN A 1 44  ? 73.961  147.403 134.635 1.00 57.18  ? 44  ASN A CG    1 
ATOM 339   O OD1   . ASN A 1 44  ? 73.989  148.607 134.381 1.00 57.18  ? 44  ASN A OD1   1 
ATOM 340   N ND2   . ASN A 1 44  ? 73.690  146.483 133.717 1.00 57.18  ? 44  ASN A ND2   1 
ATOM 341   N N     . PRO A 1 45  ? 76.176  147.412 138.635 1.00 52.87  ? 45  PRO A N     1 
ATOM 342   C CA    . PRO A 1 45  ? 76.710  148.449 139.527 1.00 52.87  ? 45  PRO A CA    1 
ATOM 343   C C     . PRO A 1 45  ? 78.124  148.124 139.998 1.00 52.87  ? 45  PRO A C     1 
ATOM 344   O O     . PRO A 1 45  ? 78.938  147.641 139.210 1.00 52.87  ? 45  PRO A O     1 
ATOM 345   C CB    . PRO A 1 45  ? 75.738  148.420 140.706 1.00 52.87  ? 45  PRO A CB    1 
ATOM 346   C CG    . PRO A 1 45  ? 75.327  146.989 140.824 1.00 52.87  ? 45  PRO A CG    1 
ATOM 347   C CD    . PRO A 1 45  ? 75.673  146.287 139.537 1.00 52.87  ? 45  PRO A CD    1 
ATOM 348   N N     . ARG A 1 46  ? 78.408  148.388 141.269 1.00 45.25  ? 46  ARG A N     1 
ATOM 349   C CA    . ARG A 1 46  ? 79.728  148.122 141.830 1.00 45.25  ? 46  ARG A CA    1 
ATOM 350   C C     . ARG A 1 46  ? 79.726  146.876 142.710 1.00 45.25  ? 46  ARG A C     1 
ATOM 351   O O     . ARG A 1 46  ? 78.752  146.124 142.739 1.00 45.25  ? 46  ARG A O     1 
ATOM 352   C CB    . ARG A 1 46  ? 80.222  149.329 142.630 1.00 45.25  ? 46  ARG A CB    1 
ATOM 353   C CG    . ARG A 1 46  ? 79.681  150.662 142.140 1.00 45.25  ? 46  ARG A CG    1 
ATOM 354   C CD    . ARG A 1 46  ? 80.594  151.809 142.541 1.00 45.25  ? 46  ARG A CD    1 
ATOM 355   N NE    . ARG A 1 46  ? 80.755  152.783 141.465 1.00 45.25  ? 46  ARG A NE    1 
ATOM 356   C CZ    . ARG A 1 46  ? 80.610  154.095 141.616 1.00 45.25  ? 46  ARG A CZ    1 
ATOM 357   N NH1   . ARG A 1 46  ? 80.299  154.597 142.803 1.00 45.25  ? 46  ARG A NH1   1 
ATOM 358   N NH2   . ARG A 1 46  ? 80.775  154.906 140.580 1.00 45.25  ? 46  ARG A NH2   1 
ATOM 359   N N     . GLN A 1 47  ? 80.826  146.666 143.426 1.00 47.49  ? 47  GLN A N     1 
ATOM 360   C CA    . GLN A 1 47  ? 80.964  145.514 144.311 1.00 47.49  ? 47  GLN A CA    1 
ATOM 361   C C     . GLN A 1 47  ? 80.956  145.864 145.788 1.00 47.49  ? 47  GLN A C     1 
ATOM 362   O O     . GLN A 1 47  ? 81.233  146.994 146.199 1.00 47.49  ? 47  GLN A O     1 
ATOM 363   C CB    . GLN A 1 47  ? 82.251  144.721 144.086 1.00 47.49  ? 47  GLN A CB    1 
ATOM 364   C CG    . GLN A 1 47  ? 82.462  144.017 142.793 1.00 47.49  ? 47  GLN A CG    1 
ATOM 365   C CD    . GLN A 1 47  ? 83.745  143.224 142.877 1.00 47.49  ? 47  GLN A CD    1 
ATOM 366   O OE1   . GLN A 1 47  ? 84.677  143.624 143.572 1.00 47.49  ? 47  GLN A OE1   1 
ATOM 367   N NE2   . GLN A 1 47  ? 83.813  142.116 142.155 1.00 47.49  ? 47  GLN A NE2   1 
ATOM 368   N N     . GLN A 1 48  ? 80.591  144.862 146.581 1.00 49.97  ? 48  GLN A N     1 
ATOM 369   C CA    . GLN A 1 48  ? 80.724  144.920 148.023 1.00 49.97  ? 48  GLN A CA    1 
ATOM 370   C C     . GLN A 1 48  ? 81.652  143.744 148.275 1.00 49.97  ? 48  GLN A C     1 
ATOM 371   O O     . GLN A 1 48  ? 81.290  142.596 147.997 1.00 49.97  ? 48  GLN A O     1 
ATOM 372   C CB    . GLN A 1 48  ? 79.392  144.731 148.753 1.00 49.97  ? 48  GLN A CB    1 
ATOM 373   C CG    . GLN A 1 48  ? 78.297  145.710 148.394 1.00 49.97  ? 48  GLN A CG    1 
ATOM 374   C CD    . GLN A 1 48  ? 77.584  145.348 147.101 1.00 49.97  ? 48  GLN A CD    1 
ATOM 375   O OE1   . GLN A 1 48  ? 77.861  144.319 146.491 1.00 49.97  ? 48  GLN A OE1   1 
ATOM 376   N NE2   . GLN A 1 48  ? 76.651  146.194 146.687 1.00 49.97  ? 48  GLN A NE2   1 
ATOM 377   N N     . LEU A 1 51  ? 87.959  145.699 149.779 1.00 35.64  ? 51  LEU A N     1 
ATOM 378   C CA    . LEU A 1 51  ? 88.581  146.847 150.432 1.00 35.64  ? 51  LEU A CA    1 
ATOM 379   C C     . LEU A 1 51  ? 88.852  147.951 149.412 1.00 35.64  ? 51  LEU A C     1 
ATOM 380   O O     . LEU A 1 51  ? 88.585  147.809 148.216 1.00 35.64  ? 51  LEU A O     1 
ATOM 381   C CB    . LEU A 1 51  ? 89.905  146.445 151.105 1.00 35.64  ? 51  LEU A CB    1 
ATOM 382   C CG    . LEU A 1 51  ? 90.091  145.708 152.443 1.00 35.64  ? 51  LEU A CG    1 
ATOM 383   C CD1   . LEU A 1 51  ? 89.653  144.250 152.443 1.00 35.64  ? 51  LEU A CD1   1 
ATOM 384   C CD2   . LEU A 1 51  ? 91.548  145.782 152.876 1.00 35.64  ? 51  LEU A CD2   1 
ATOM 385   N N     . LEU A 1 52  ? 89.419  149.055 149.908 1.00 40.52  ? 52  LEU A N     1 
ATOM 386   C CA    . LEU A 1 52  ? 89.827  150.205 149.111 1.00 40.52  ? 52  LEU A CA    1 
ATOM 387   C C     . LEU A 1 52  ? 91.157  150.706 149.652 1.00 40.52  ? 52  LEU A C     1 
ATOM 388   O O     . LEU A 1 52  ? 91.413  150.635 150.856 1.00 40.52  ? 52  LEU A O     1 
ATOM 389   C CB    . LEU A 1 52  ? 88.798  151.339 149.137 1.00 40.52  ? 52  LEU A CB    1 
ATOM 390   C CG    . LEU A 1 52  ? 87.642  151.298 148.133 1.00 40.52  ? 52  LEU A CG    1 
ATOM 391   C CD1   . LEU A 1 52  ? 88.186  151.199 146.709 1.00 40.52  ? 52  LEU A CD1   1 
ATOM 392   C CD2   . LEU A 1 52  ? 86.617  150.212 148.434 1.00 40.52  ? 52  LEU A CD2   1 
ATOM 393   N N     . PHE A 1 53  ? 91.960  151.303 148.765 1.00 44.01  ? 53  PHE A N     1 
ATOM 394   C CA    . PHE A 1 53  ? 93.319  151.732 149.089 1.00 44.01  ? 53  PHE A CA    1 
ATOM 395   C C     . PHE A 1 53  ? 93.729  152.974 148.310 1.00 44.01  ? 53  PHE A C     1 
ATOM 396   O O     . PHE A 1 53  ? 93.170  153.279 147.254 1.00 44.01  ? 53  PHE A O     1 
ATOM 397   C CB    . PHE A 1 53  ? 94.330  150.652 148.673 1.00 44.01  ? 53  PHE A CB    1 
ATOM 398   C CG    . PHE A 1 53  ? 94.086  149.298 149.261 1.00 44.01  ? 53  PHE A CG    1 
ATOM 399   C CD1   . PHE A 1 53  ? 93.779  149.129 150.590 1.00 44.01  ? 53  PHE A CD1   1 
ATOM 400   C CD2   . PHE A 1 53  ? 94.077  148.188 148.431 1.00 44.01  ? 53  PHE A CD2   1 
ATOM 401   C CE1   . PHE A 1 53  ? 93.539  147.876 151.101 1.00 44.01  ? 53  PHE A CE1   1 
ATOM 402   C CE2   . PHE A 1 53  ? 93.830  146.935 148.932 1.00 44.01  ? 53  PHE A CE2   1 
ATOM 403   C CZ    . PHE A 1 53  ? 93.561  146.779 150.269 1.00 44.01  ? 53  PHE A CZ    1 
ATOM 404   N N     . ARG A 1 54  ? 94.679  153.714 148.890 1.00 39.65  ? 54  ARG A N     1 
ATOM 405   C CA    . ARG A 1 54  ? 95.285  154.921 148.326 1.00 39.65  ? 54  ARG A CA    1 
ATOM 406   C C     . ARG A 1 54  ? 96.798  154.792 148.436 1.00 39.65  ? 54  ARG A C     1 
ATOM 407   O O     . ARG A 1 54  ? 97.309  154.405 149.494 1.00 39.65  ? 54  ARG A O     1 
ATOM 408   C CB    . ARG A 1 54  ? 94.827  156.209 149.008 1.00 39.65  ? 54  ARG A CB    1 
ATOM 409   C CG    . ARG A 1 54  ? 93.465  156.692 148.594 1.00 39.65  ? 54  ARG A CG    1 
ATOM 410   C CD    . ARG A 1 54  ? 93.167  157.956 149.332 1.00 39.65  ? 54  ARG A CD    1 
ATOM 411   N NE    . ARG A 1 54  ? 93.246  157.730 150.767 1.00 39.65  ? 54  ARG A NE    1 
ATOM 412   C CZ    . ARG A 1 54  ? 93.128  158.691 151.670 1.00 39.65  ? 54  ARG A CZ    1 
ATOM 413   N NH1   . ARG A 1 54  ? 92.874  159.926 151.270 1.00 39.65  ? 54  ARG A NH1   1 
ATOM 414   N NH2   . ARG A 1 54  ? 93.217  158.412 152.962 1.00 39.65  ? 54  ARG A NH2   1 
ATOM 415   N N     . ILE A 1 55  ? 97.513  155.105 147.360 1.00 39.38  ? 55  ILE A N     1 
ATOM 416   C CA    . ILE A 1 55  ? 98.975  155.050 147.398 1.00 39.38  ? 55  ILE A CA    1 
ATOM 417   C C     . ILE A 1 55  ? 99.562  156.322 148.009 1.00 39.38  ? 55  ILE A C     1 
ATOM 418   O O     . ILE A 1 55  ? 98.967  157.397 147.934 1.00 39.38  ? 55  ILE A O     1 
ATOM 419   C CB    . ILE A 1 55  ? 99.579  154.825 145.995 1.00 39.38  ? 55  ILE A CB    1 
ATOM 420   C CG1   . ILE A 1 55  ? 99.232  155.996 145.072 1.00 39.38  ? 55  ILE A CG1   1 
ATOM 421   C CG2   . ILE A 1 55  ? 99.081  153.507 145.408 1.00 39.38  ? 55  ILE A CG2   1 
ATOM 422   C CD1   . ILE A 1 55  ? 99.876  155.912 143.703 1.00 39.38  ? 55  ILE A CD1   1 
ATOM 423   N N     . VAL A 1 66  ? 94.553  152.735 154.344 1.00 39.57  ? 66  VAL A N     1 
ATOM 424   C CA    . VAL A 1 66  ? 93.837  151.551 153.878 1.00 39.57  ? 66  VAL A CA    1 
ATOM 425   C C     . VAL A 1 66  ? 92.569  151.378 154.743 1.00 39.57  ? 66  VAL A C     1 
ATOM 426   O O     . VAL A 1 66  ? 92.611  151.385 155.978 1.00 39.57  ? 66  VAL A O     1 
ATOM 427   C CB    . VAL A 1 66  ? 94.741  150.297 153.814 1.00 39.57  ? 66  VAL A CB    1 
ATOM 428   C CG1   . VAL A 1 66  ? 95.859  150.522 152.805 1.00 39.57  ? 66  VAL A CG1   1 
ATOM 429   C CG2   . VAL A 1 66  ? 95.331  149.974 155.112 1.00 39.57  ? 66  VAL A CG2   1 
ATOM 430   N N     . GLN A 1 67  ? 91.452  151.242 154.035 1.00 35.91  ? 67  GLN A N     1 
ATOM 431   C CA    . GLN A 1 67  ? 90.109  151.005 154.558 1.00 35.91  ? 67  GLN A CA    1 
ATOM 432   C C     . GLN A 1 67  ? 89.666  149.563 154.363 1.00 35.91  ? 67  GLN A C     1 
ATOM 433   O O     . GLN A 1 67  ? 89.884  148.982 153.295 1.00 35.91  ? 67  GLN A O     1 
ATOM 434   C CB    . GLN A 1 67  ? 89.096  151.886 153.813 1.00 35.91  ? 67  GLN A CB    1 
ATOM 435   C CG    . GLN A 1 67  ? 89.149  153.378 153.994 1.00 35.91  ? 67  GLN A CG    1 
ATOM 436   C CD    . GLN A 1 67  ? 88.730  153.782 155.385 1.00 35.91  ? 67  GLN A CD    1 
ATOM 437   O OE1   . GLN A 1 67  ? 89.553  154.043 156.240 1.00 35.91  ? 67  GLN A OE1   1 
ATOM 438   N NE2   . GLN A 1 67  ? 87.421  153.844 155.609 1.00 35.91  ? 67  GLN A NE2   1 
ATOM 439   N N     . SER A 1 68  ? 89.061  148.977 155.400 1.00 33.39  ? 68  SER A N     1 
ATOM 440   C CA    . SER A 1 68  ? 88.775  147.549 155.324 1.00 33.39  ? 68  SER A CA    1 
ATOM 441   C C     . SER A 1 68  ? 87.595  147.192 156.218 1.00 33.39  ? 68  SER A C     1 
ATOM 442   O O     . SER A 1 68  ? 87.232  147.937 157.129 1.00 33.39  ? 68  SER A O     1 
ATOM 443   C CB    . SER A 1 68  ? 89.994  146.729 155.757 1.00 33.39  ? 68  SER A CB    1 
ATOM 444   O OG    . SER A 1 68  ? 90.460  147.145 157.029 1.00 33.39  ? 68  SER A OG    1 
ATOM 445   N N     . HIS A 1 69  ? 87.001  146.025 155.934 1.00 32.46  ? 69  HIS A N     1 
ATOM 446   C CA    . HIS A 1 69  ? 85.884  145.485 156.709 1.00 32.46  ? 69  HIS A CA    1 
ATOM 447   C C     . HIS A 1 69  ? 86.313  144.515 157.800 1.00 32.46  ? 69  HIS A C     1 
ATOM 448   O O     . HIS A 1 69  ? 85.671  144.456 158.856 1.00 32.46  ? 69  HIS A O     1 
ATOM 449   C CB    . HIS A 1 69  ? 84.843  144.831 155.787 1.00 32.46  ? 69  HIS A CB    1 
ATOM 450   C CG    . HIS A 1 69  ? 85.331  143.635 155.030 1.00 32.46  ? 69  HIS A CG    1 
ATOM 451   N ND1   . HIS A 1 69  ? 85.358  142.367 155.574 1.00 32.46  ? 69  HIS A ND1   1 
ATOM 452   C CD2   . HIS A 1 69  ? 85.768  143.504 153.755 1.00 32.46  ? 69  HIS A CD2   1 
ATOM 453   C CE1   . HIS A 1 69  ? 85.810  141.513 154.673 1.00 32.46  ? 69  HIS A CE1   1 
ATOM 454   N NE2   . HIS A 1 69  ? 86.069  142.178 153.562 1.00 32.46  ? 69  HIS A NE2   1 
ATOM 455   N N     . SER A 1 70  ? 87.382  143.759 157.576 1.00 34.74  ? 70  SER A N     1 
ATOM 456   C CA    . SER A 1 70  ? 87.875  142.718 158.468 1.00 34.74  ? 70  SER A CA    1 
ATOM 457   C C     . SER A 1 70  ? 89.139  143.171 159.184 1.00 34.74  ? 70  SER A C     1 
ATOM 458   O O     . SER A 1 70  ? 89.864  144.045 158.698 1.00 34.74  ? 70  SER A O     1 
ATOM 459   C CB    . SER A 1 70  ? 88.161  141.424 157.686 1.00 34.74  ? 70  SER A CB    1 
ATOM 460   O OG    . SER A 1 70  ? 86.964  140.837 157.216 1.00 34.74  ? 70  SER A OG    1 
ATOM 461   N N     . PRO A 1 71  ? 89.445  142.580 160.340 1.00 40.63  ? 71  PRO A N     1 
ATOM 462   C CA    . PRO A 1 71  ? 90.641  142.988 161.093 1.00 40.63  ? 71  PRO A CA    1 
ATOM 463   C C     . PRO A 1 71  ? 91.927  142.489 160.451 1.00 40.63  ? 71  PRO A C     1 
ATOM 464   O O     . PRO A 1 71  ? 92.150  141.287 160.298 1.00 40.63  ? 71  PRO A O     1 
ATOM 465   C CB    . PRO A 1 71  ? 90.408  142.363 162.473 1.00 40.63  ? 71  PRO A CB    1 
ATOM 466   C CG    . PRO A 1 71  ? 89.683  141.095 162.150 1.00 40.63  ? 71  PRO A CG    1 
ATOM 467   C CD    . PRO A 1 71  ? 88.735  141.478 161.023 1.00 40.63  ? 71  PRO A CD    1 
ATOM 468   N N     . LEU A 1 72  ? 92.770  143.444 160.077 1.00 47.20  ? 72  LEU A N     1 
ATOM 469   C CA    . LEU A 1 72  ? 94.085  143.165 159.530 1.00 47.20  ? 72  LEU A CA    1 
ATOM 470   C C     . LEU A 1 72  ? 95.020  142.778 160.665 1.00 47.20  ? 72  LEU A C     1 
ATOM 471   O O     . LEU A 1 72  ? 94.933  143.318 161.772 1.00 47.20  ? 72  LEU A O     1 
ATOM 472   C CB    . LEU A 1 72  ? 94.609  144.402 158.789 1.00 47.20  ? 72  LEU A CB    1 
ATOM 473   C CG    . LEU A 1 72  ? 95.981  144.560 158.116 1.00 47.20  ? 72  LEU A CG    1 
ATOM 474   C CD1   . LEU A 1 72  ? 95.939  145.811 157.241 1.00 47.20  ? 72  LEU A CD1   1 
ATOM 475   C CD2   . LEU A 1 72  ? 97.191  144.596 159.053 1.00 47.20  ? 72  LEU A CD2   1 
ATOM 476   N N     . ARG A 1 73  ? 95.903  141.825 160.393 1.00 53.56  ? 73  ARG A N     1 
ATOM 477   C CA    . ARG A 1 73  ? 96.965  141.453 161.314 1.00 53.56  ? 73  ARG A CA    1 
ATOM 478   C C     . ARG A 1 73  ? 98.272  141.416 160.544 1.00 53.56  ? 73  ARG A C     1 
ATOM 479   O O     . ARG A 1 73  ? 98.325  140.885 159.429 1.00 53.56  ? 73  ARG A O     1 
ATOM 480   C CB    . ARG A 1 73  ? 96.673  140.116 161.993 1.00 53.56  ? 73  ARG A CB    1 
ATOM 481   C CG    . ARG A 1 73  ? 95.455  140.173 162.910 1.00 53.56  ? 73  ARG A CG    1 
ATOM 482   C CD    . ARG A 1 73  ? 95.701  141.115 164.090 1.00 53.56  ? 73  ARG A CD    1 
ATOM 483   N NE    . ARG A 1 73  ? 94.565  141.176 165.008 1.00 53.56  ? 73  ARG A NE    1 
ATOM 484   C CZ    . ARG A 1 73  ? 93.516  141.977 164.847 1.00 53.56  ? 73  ARG A CZ    1 
ATOM 485   N NH1   . ARG A 1 73  ? 93.462  142.791 163.805 1.00 53.56  ? 73  ARG A NH1   1 
ATOM 486   N NH2   . ARG A 1 73  ? 92.525  141.967 165.725 1.00 53.56  ? 73  ARG A NH2   1 
ATOM 487   N N     . VAL A 1 74  ? 99.315  142.003 161.139 1.00 68.06  ? 74  VAL A N     1 
ATOM 488   C CA    . VAL A 1 74  ? 100.574 142.225 160.438 1.00 68.06  ? 74  VAL A CA    1 
ATOM 489   C C     . VAL A 1 74  ? 101.115 140.922 159.863 1.00 68.06  ? 74  VAL A C     1 
ATOM 490   O O     . VAL A 1 74  ? 100.958 139.838 160.442 1.00 68.06  ? 74  VAL A O     1 
ATOM 491   C CB    . VAL A 1 74  ? 101.590 142.886 161.389 1.00 68.06  ? 74  VAL A CB    1 
ATOM 492   C CG1   . VAL A 1 74  ? 101.899 141.972 162.571 1.00 68.06  ? 74  VAL A CG1   1 
ATOM 493   C CG2   . VAL A 1 74  ? 102.860 143.273 160.645 1.00 68.06  ? 74  VAL A CG2   1 
ATOM 494   N N     . ASP A 1 75  ? 101.744 141.035 158.693 1.00 79.39  ? 75  ASP A N     1 
ATOM 495   C CA    . ASP A 1 75  ? 102.387 139.925 158.002 1.00 79.39  ? 75  ASP A CA    1 
ATOM 496   C C     . ASP A 1 75  ? 103.877 140.156 157.801 1.00 79.39  ? 75  ASP A C     1 
ATOM 497   O O     . ASP A 1 75  ? 104.487 140.986 158.480 1.00 79.39  ? 75  ASP A O     1 
ATOM 498   C CB    . ASP A 1 75  ? 101.707 139.636 156.664 1.00 79.39  ? 75  ASP A CB    1 
ATOM 499   C CG    . ASP A 1 75  ? 100.298 139.115 156.831 1.00 79.39  ? 75  ASP A CG    1 
ATOM 500   O OD1   . ASP A 1 75  ? 99.979  138.577 157.912 1.00 79.39  ? 75  ASP A OD1   1 
ATOM 501   O OD2   . ASP A 1 75  ? 99.530  139.186 155.860 1.00 79.39  ? 75  ASP A OD2   1 
ATOM 502   N N     . ARG A 1 76  ? 104.463 139.400 156.876 1.00 77.41  ? 76  ARG A N     1 
ATOM 503   C CA    . ARG A 1 76  ? 105.904 139.405 156.689 1.00 77.41  ? 76  ARG A CA    1 
ATOM 504   C C     . ARG A 1 76  ? 106.430 140.770 156.262 1.00 77.41  ? 76  ARG A C     1 
ATOM 505   O O     . ARG A 1 76  ? 105.819 141.482 155.459 1.00 77.41  ? 76  ARG A O     1 
ATOM 506   C CB    . ARG A 1 76  ? 106.225 138.379 155.594 1.00 77.41  ? 76  ARG A CB    1 
ATOM 507   C CG    . ARG A 1 76  ? 107.674 138.168 155.169 1.00 77.41  ? 76  ARG A CG    1 
ATOM 508   C CD    . ARG A 1 76  ? 108.394 137.124 156.013 1.00 77.41  ? 76  ARG A CD    1 
ATOM 509   N NE    . ARG A 1 76  ? 109.105 137.681 157.155 1.00 77.41  ? 76  ARG A NE    1 
ATOM 510   C CZ    . ARG A 1 76  ? 110.301 138.254 157.066 1.00 77.41  ? 76  ARG A CZ    1 
ATOM 511   N NH1   . ARG A 1 76  ? 110.909 138.340 155.892 1.00 77.41  ? 76  ARG A NH1   1 
ATOM 512   N NH2   . ARG A 1 76  ? 110.891 138.734 158.149 1.00 77.41  ? 76  ARG A NH2   1 
ATOM 513   N N     . LEU A 1 77  ? 107.602 141.109 156.807 1.00 77.47  ? 77  LEU A N     1 
ATOM 514   C CA    . LEU A 1 77  ? 108.351 142.329 156.497 1.00 77.47  ? 77  LEU A CA    1 
ATOM 515   C C     . LEU A 1 77  ? 107.488 143.586 156.649 1.00 77.47  ? 77  LEU A C     1 
ATOM 516   O O     . LEU A 1 77  ? 107.485 144.479 155.796 1.00 77.47  ? 77  LEU A O     1 
ATOM 517   C CB    . LEU A 1 77  ? 109.034 142.244 155.131 1.00 77.47  ? 77  LEU A CB    1 
ATOM 518   C CG    . LEU A 1 77  ? 110.005 143.416 154.950 1.00 77.47  ? 77  LEU A CG    1 
ATOM 519   C CD1   . LEU A 1 77  ? 110.993 143.421 156.102 1.00 77.47  ? 77  LEU A CD1   1 
ATOM 520   C CD2   . LEU A 1 77  ? 110.754 143.278 153.695 1.00 77.47  ? 77  LEU A CD2   1 
ATOM 521   N N     . GLY A 1 78  ? 106.681 143.641 157.699 1.00 70.16  ? 78  GLY A N     1 
ATOM 522   C CA    . GLY A 1 78  ? 105.875 144.823 157.899 1.00 70.16  ? 78  GLY A CA    1 
ATOM 523   C C     . GLY A 1 78  ? 106.271 145.639 159.114 1.00 70.16  ? 78  GLY A C     1 
ATOM 524   O O     . GLY A 1 78  ? 107.438 145.676 159.519 1.00 70.16  ? 78  GLY A O     1 
ATOM 525   N N     . PRO A 1 79  ? 105.301 146.321 159.707 1.00 63.01  ? 79  PRO A N     1 
ATOM 526   C CA    . PRO A 1 79  ? 105.568 147.130 160.899 1.00 63.01  ? 79  PRO A CA    1 
ATOM 527   C C     . PRO A 1 79  ? 105.749 146.300 162.161 1.00 63.01  ? 79  PRO A C     1 
ATOM 528   O O     . PRO A 1 79  ? 105.350 145.139 162.247 1.00 63.01  ? 79  PRO A O     1 
ATOM 529   C CB    . PRO A 1 79  ? 104.318 148.008 160.997 1.00 63.01  ? 79  PRO A CB    1 
ATOM 530   C CG    . PRO A 1 79  ? 103.243 147.139 160.429 1.00 63.01  ? 79  PRO A CG    1 
ATOM 531   C CD    . PRO A 1 79  ? 103.894 146.414 159.284 1.00 63.01  ? 79  PRO A CD    1 
ATOM 532   N N     . GLY A 1 80  ? 106.370 146.935 163.156 1.00 59.10  ? 80  GLY A N     1 
ATOM 533   C CA    . GLY A 1 80  ? 106.632 146.274 164.419 1.00 59.10  ? 80  GLY A CA    1 
ATOM 534   C C     . GLY A 1 80  ? 105.485 146.495 165.382 1.00 59.10  ? 80  GLY A C     1 
ATOM 535   O O     . GLY A 1 80  ? 105.647 146.445 166.604 1.00 59.10  ? 80  GLY A O     1 
ATOM 536   N N     . TYR A 1 81  ? 104.308 146.722 164.805 1.00 59.57  ? 81  TYR A N     1 
ATOM 537   C CA    . TYR A 1 81  ? 103.041 146.918 165.498 1.00 59.57  ? 81  TYR A CA    1 
ATOM 538   C C     . TYR A 1 81  ? 101.954 146.559 164.501 1.00 59.57  ? 81  TYR A C     1 
ATOM 539   O O     . TYR A 1 81  ? 102.183 146.567 163.290 1.00 59.57  ? 81  TYR A O     1 
ATOM 540   C CB    . TYR A 1 81  ? 102.862 148.348 166.032 1.00 59.57  ? 81  TYR A CB    1 
ATOM 541   C CG    . TYR A 1 81  ? 103.840 148.727 167.123 1.00 59.57  ? 81  TYR A CG    1 
ATOM 542   C CD1   . TYR A 1 81  ? 103.591 148.386 168.447 1.00 59.57  ? 81  TYR A CD1   1 
ATOM 543   C CD2   . TYR A 1 81  ? 105.002 149.432 166.835 1.00 59.57  ? 81  TYR A CD2   1 
ATOM 544   C CE1   . TYR A 1 81  ? 104.472 148.724 169.451 1.00 59.57  ? 81  TYR A CE1   1 
ATOM 545   C CE2   . TYR A 1 81  ? 105.894 149.772 167.834 1.00 59.57  ? 81  TYR A CE2   1 
ATOM 546   C CZ    . TYR A 1 81  ? 105.621 149.418 169.140 1.00 59.57  ? 81  TYR A CZ    1 
ATOM 547   O OH    . TYR A 1 81  ? 106.503 149.753 170.139 1.00 59.57  ? 81  TYR A OH    1 
ATOM 548   N N     . HIS A 1 82  ? 100.771 146.228 165.023 1.00 50.75  ? 82  HIS A N     1 
ATOM 549   C CA    . HIS A 1 82  ? 99.695  145.773 164.146 1.00 50.75  ? 82  HIS A CA    1 
ATOM 550   C C     . HIS A 1 82  ? 99.391  146.772 163.036 1.00 50.75  ? 82  HIS A C     1 
ATOM 551   O O     . HIS A 1 82  ? 98.933  146.374 161.959 1.00 50.75  ? 82  HIS A O     1 
ATOM 552   C CB    . HIS A 1 82  ? 98.431  145.505 164.963 1.00 50.75  ? 82  HIS A CB    1 
ATOM 553   C CG    . HIS A 1 82  ? 97.941  146.698 165.722 1.00 50.75  ? 82  HIS A CG    1 
ATOM 554   N ND1   . HIS A 1 82  ? 97.066  147.615 165.183 1.00 50.75  ? 82  HIS A ND1   1 
ATOM 555   C CD2   . HIS A 1 82  ? 98.217  147.134 166.974 1.00 50.75  ? 82  HIS A CD2   1 
ATOM 556   C CE1   . HIS A 1 82  ? 96.813  148.557 166.074 1.00 50.75  ? 82  HIS A CE1   1 
ATOM 557   N NE2   . HIS A 1 82  ? 97.500  148.289 167.169 1.00 50.75  ? 82  HIS A NE2   1 
ATOM 558   N N     . ARG A 1 87  ? 92.738  152.544 163.411 1.00 34.36  ? 87  ARG A N     1 
ATOM 559   C CA    . ARG A 1 87  ? 91.549  153.073 164.056 1.00 34.36  ? 87  ARG A CA    1 
ATOM 560   C C     . ARG A 1 87  ? 90.334  152.504 163.337 1.00 34.36  ? 87  ARG A C     1 
ATOM 561   O O     . ARG A 1 87  ? 90.415  152.084 162.178 1.00 34.36  ? 87  ARG A O     1 
ATOM 562   C CB    . ARG A 1 87  ? 91.556  154.612 164.000 1.00 34.36  ? 87  ARG A CB    1 
ATOM 563   C CG    . ARG A 1 87  ? 90.460  155.358 164.749 1.00 34.36  ? 87  ARG A CG    1 
ATOM 564   C CD    . ARG A 1 87  ? 90.479  155.194 166.250 1.00 34.36  ? 87  ARG A CD    1 
ATOM 565   N NE    . ARG A 1 87  ? 89.398  155.976 166.848 1.00 34.36  ? 87  ARG A NE    1 
ATOM 566   C CZ    . ARG A 1 87  ? 88.126  155.598 166.871 1.00 34.36  ? 87  ARG A CZ    1 
ATOM 567   N NH1   . ARG A 1 87  ? 87.763  154.441 166.340 1.00 34.36  ? 87  ARG A NH1   1 
ATOM 568   N NH2   . ARG A 1 87  ? 87.216  156.376 167.438 1.00 34.36  ? 87  ARG A NH2   1 
ATOM 569   N N     . ASN A 1 88  ? 89.195  152.510 164.025 1.00 30.61  ? 88  ASN A N     1 
ATOM 570   C CA    . ASN A 1 88  ? 87.961  151.979 163.458 1.00 30.61  ? 88  ASN A CA    1 
ATOM 571   C C     . ASN A 1 88  ? 86.858  153.020 163.535 1.00 30.61  ? 88  ASN A C     1 
ATOM 572   O O     . ASN A 1 88  ? 86.589  153.578 164.601 1.00 30.61  ? 88  ASN A O     1 
ATOM 573   C CB    . ASN A 1 88  ? 87.583  150.634 164.110 1.00 30.61  ? 88  ASN A CB    1 
ATOM 574   C CG    . ASN A 1 88  ? 87.322  150.716 165.619 1.00 30.61  ? 88  ASN A CG    1 
ATOM 575   O OD1   . ASN A 1 88  ? 86.843  151.709 166.157 1.00 30.61  ? 88  ASN A OD1   1 
ATOM 576   N ND2   . ASN A 1 88  ? 87.668  149.637 166.309 1.00 30.61  ? 88  ASN A ND2   1 
ATOM 577   N N     . LEU A 1 89  ? 86.277  153.341 162.389 1.00 26.16  ? 89  LEU A N     1 
ATOM 578   C CA    . LEU A 1 89  ? 85.339  154.445 162.311 1.00 26.16  ? 89  LEU A CA    1 
ATOM 579   C C     . LEU A 1 89  ? 84.023  153.986 161.700 1.00 26.16  ? 89  LEU A C     1 
ATOM 580   O O     . LEU A 1 89  ? 83.987  153.082 160.862 1.00 26.16  ? 89  LEU A O     1 
ATOM 581   C CB    . LEU A 1 89  ? 85.920  155.599 161.485 1.00 26.16  ? 89  LEU A CB    1 
ATOM 582   C CG    . LEU A 1 89  ? 87.131  156.330 162.077 1.00 26.16  ? 89  LEU A CG    1 
ATOM 583   C CD1   . LEU A 1 89  ? 87.807  157.187 161.020 1.00 26.16  ? 89  LEU A CD1   1 
ATOM 584   C CD2   . LEU A 1 89  ? 86.746  157.167 163.289 1.00 26.16  ? 89  LEU A CD2   1 
ATOM 585   N N     . ASP A 1 90  ? 82.942  154.615 162.140 1.00 28.32  ? 90  ASP A N     1 
ATOM 586   C CA    . ASP A 1 90  ? 81.656  154.541 161.480 1.00 28.32  ? 90  ASP A CA    1 
ATOM 587   C C     . ASP A 1 90  ? 81.148  155.969 161.332 1.00 28.32  ? 90  ASP A C     1 
ATOM 588   O O     . ASP A 1 90  ? 81.256  156.756 162.280 1.00 28.32  ? 90  ASP A O     1 
ATOM 589   C CB    . ASP A 1 90  ? 80.672  153.676 162.265 1.00 28.32  ? 90  ASP A CB    1 
ATOM 590   C CG    . ASP A 1 90  ? 81.007  152.206 162.175 1.00 28.32  ? 90  ASP A CG    1 
ATOM 591   O OD1   . ASP A 1 90  ? 81.432  151.764 161.086 1.00 28.32  ? 90  ASP A OD1   1 
ATOM 592   O OD2   . ASP A 1 90  ? 80.858  151.499 163.194 1.00 28.32  ? 90  ASP A OD2   1 
ATOM 593   N N     . PRO A 1 91  ? 80.601  156.346 160.178 1.00 27.18  ? 91  PRO A N     1 
ATOM 594   C CA    . PRO A 1 91  ? 80.092  157.712 160.008 1.00 27.18  ? 91  PRO A CA    1 
ATOM 595   C C     . PRO A 1 91  ? 78.760  158.001 160.683 1.00 27.18  ? 91  PRO A C     1 
ATOM 596   O O     . PRO A 1 91  ? 78.158  159.035 160.378 1.00 27.18  ? 91  PRO A O     1 
ATOM 597   C CB    . PRO A 1 91  ? 79.948  157.824 158.485 1.00 27.18  ? 91  PRO A CB    1 
ATOM 598   C CG    . PRO A 1 91  ? 79.683  156.447 158.052 1.00 27.18  ? 91  PRO A CG    1 
ATOM 599   C CD    . PRO A 1 91  ? 80.454  155.542 158.954 1.00 27.18  ? 91  PRO A CD    1 
ATOM 600   N N     . PHE A 1 92  ? 78.268  157.146 161.581 1.00 29.66  ? 92  PHE A N     1 
ATOM 601   C CA    . PHE A 1 92  ? 77.001  157.456 162.236 1.00 29.66  ? 92  PHE A CA    1 
ATOM 602   C C     . PHE A 1 92  ? 77.138  158.662 163.154 1.00 29.66  ? 92  PHE A C     1 
ATOM 603   O O     . PHE A 1 92  ? 76.216  159.477 163.268 1.00 29.66  ? 92  PHE A O     1 
ATOM 604   C CB    . PHE A 1 92  ? 76.506  156.248 163.037 1.00 29.66  ? 92  PHE A CB    1 
ATOM 605   C CG    . PHE A 1 92  ? 77.349  155.930 164.248 1.00 29.66  ? 92  PHE A CG    1 
ATOM 606   C CD1   . PHE A 1 92  ? 78.442  155.097 164.161 1.00 29.66  ? 92  PHE A CD1   1 
ATOM 607   C CD2   . PHE A 1 92  ? 77.025  156.461 165.486 1.00 29.66  ? 92  PHE A CD2   1 
ATOM 608   C CE1   . PHE A 1 92  ? 79.212  154.811 165.276 1.00 29.66  ? 92  PHE A CE1   1 
ATOM 609   C CE2   . PHE A 1 92  ? 77.789  156.180 166.603 1.00 29.66  ? 92  PHE A CE2   1 
ATOM 610   C CZ    . PHE A 1 92  ? 78.883  155.354 166.497 1.00 29.66  ? 92  PHE A CZ    1 
ATOM 611   N N     . LEU A 1 93  ? 78.292  158.790 163.803 1.00 26.91  ? 93  LEU A N     1 
ATOM 612   C CA    . LEU A 1 93  ? 78.543  159.878 164.741 1.00 26.91  ? 93  LEU A CA    1 
ATOM 613   C C     . LEU A 1 93  ? 78.505  161.253 164.079 1.00 26.91  ? 93  LEU A C     1 
ATOM 614   O O     . LEU A 1 93  ? 79.147  161.489 163.051 1.00 26.91  ? 93  LEU A O     1 
ATOM 615   C CB    . LEU A 1 93  ? 79.892  159.636 165.435 1.00 26.91  ? 93  LEU A CB    1 
ATOM 616   C CG    . LEU A 1 93  ? 80.488  160.529 166.534 1.00 26.91  ? 93  LEU A CG    1 
ATOM 617   C CD1   . LEU A 1 93  ? 81.635  159.804 167.215 1.00 26.91  ? 93  LEU A CD1   1 
ATOM 618   C CD2   . LEU A 1 93  ? 81.000  161.863 166.001 1.00 26.91  ? 93  LEU A CD2   1 
ATOM 619   N N     . ALA A 1 94  ? 77.734  162.155 164.692 1.00 22.85  ? 94  ALA A N     1 
ATOM 620   C CA    . ALA A 1 94  ? 77.572  163.549 164.268 1.00 22.85  ? 94  ALA A CA    1 
ATOM 621   C C     . ALA A 1 94  ? 77.193  163.716 162.797 1.00 22.85  ? 94  ALA A C     1 
ATOM 622   O O     . ALA A 1 94  ? 77.644  164.665 162.146 1.00 22.85  ? 94  ALA A O     1 
ATOM 623   C CB    . ALA A 1 94  ? 78.835  164.359 164.580 1.00 22.85  ? 94  ALA A CB    1 
ATOM 624   N N     . ASP A 1 97  ? 76.872  166.443 158.552 1.00 17.97  ? 97  ASP A N     1 
ATOM 625   C CA    . ASP A 1 97  ? 75.688  167.203 158.162 1.00 17.97  ? 97  ASP A CA    1 
ATOM 626   C C     . ASP A 1 97  ? 75.880  167.891 156.820 1.00 17.97  ? 97  ASP A C     1 
ATOM 627   O O     . ASP A 1 97  ? 76.896  168.556 156.591 1.00 17.97  ? 97  ASP A O     1 
ATOM 628   C CB    . ASP A 1 97  ? 75.334  168.246 159.226 1.00 17.97  ? 97  ASP A CB    1 
ATOM 629   C CG    . ASP A 1 97  ? 74.042  169.005 158.913 1.00 17.97  ? 97  ASP A CG    1 
ATOM 630   O OD1   . ASP A 1 97  ? 73.420  168.769 157.854 1.00 17.97  ? 97  ASP A OD1   1 
ATOM 631   O OD2   . ASP A 1 97  ? 73.643  169.850 159.740 1.00 17.97  ? 97  ASP A OD2   1 
ATOM 632   N N     . LYS A 1 98  ? 74.900  167.705 155.936 1.00 19.43  ? 98  LYS A N     1 
ATOM 633   C CA    . LYS A 1 98  ? 74.951  168.299 154.612 1.00 19.43  ? 98  LYS A CA    1 
ATOM 634   C C     . LYS A 1 98  ? 75.045  169.812 154.748 1.00 19.43  ? 98  LYS A C     1 
ATOM 635   O O     . LYS A 1 98  ? 74.438  170.415 155.637 1.00 19.43  ? 98  LYS A O     1 
ATOM 636   C CB    . LYS A 1 98  ? 73.717  167.887 153.801 1.00 19.43  ? 98  LYS A CB    1 
ATOM 637   C CG    . LYS A 1 98  ? 72.375  168.342 154.361 1.00 19.43  ? 98  LYS A CG    1 
ATOM 638   C CD    . LYS A 1 98  ? 71.229  167.861 153.478 1.00 19.43  ? 98  LYS A CD    1 
ATOM 639   C CE    . LYS A 1 98  ? 70.992  166.361 153.608 1.00 19.43  ? 98  LYS A CE    1 
ATOM 640   N NZ    . LYS A 1 98  ? 70.554  165.965 154.978 1.00 19.43  ? 98  LYS A NZ    1 
ATOM 641   N N     . GLY A 1 99  ? 75.824  170.428 153.851 1.00 20.19  ? 99  GLY A N     1 
ATOM 642   C CA    . GLY A 1 99  ? 76.067  171.854 153.851 1.00 20.19  ? 99  GLY A CA    1 
ATOM 643   C C     . GLY A 1 99  ? 77.490  172.184 154.268 1.00 20.19  ? 99  GLY A C     1 
ATOM 644   O O     . GLY A 1 99  ? 78.052  173.185 153.810 1.00 20.19  ? 99  GLY A O     1 
ATOM 645   N N     . SER A 1 100 ? 78.079  171.339 155.112 1.00 20.03  ? 100 SER A N     1 
ATOM 646   C CA    . SER A 1 100 ? 79.432  171.512 155.630 1.00 20.03  ? 100 SER A CA    1 
ATOM 647   C C     . SER A 1 100 ? 80.511  171.201 154.592 1.00 20.03  ? 100 SER A C     1 
ATOM 648   O O     . SER A 1 100 ? 80.402  170.250 153.814 1.00 20.03  ? 100 SER A O     1 
ATOM 649   C CB    . SER A 1 100 ? 79.634  170.630 156.859 1.00 20.03  ? 100 SER A CB    1 
ATOM 650   O OG    . SER A 1 100 ? 79.492  169.258 156.535 1.00 20.03  ? 100 SER A OG    1 
ATOM 651   N N     . ARG A 1 101 ? 81.569  172.016 154.608 1.00 20.72  ? 101 ARG A N     1 
ATOM 652   C CA    . ARG A 1 101 ? 82.759  171.847 153.782 1.00 20.72  ? 101 ARG A CA    1 
ATOM 653   C C     . ARG A 1 101 ? 83.723  170.879 154.453 1.00 20.72  ? 101 ARG A C     1 
ATOM 654   O O     . ARG A 1 101 ? 83.801  170.795 155.681 1.00 20.72  ? 101 ARG A O     1 
ATOM 655   C CB    . ARG A 1 101 ? 83.467  173.179 153.528 1.00 20.72  ? 101 ARG A CB    1 
ATOM 656   C CG    . ARG A 1 101 ? 82.673  174.180 152.729 1.00 20.72  ? 101 ARG A CG    1 
ATOM 657   C CD    . ARG A 1 101 ? 82.484  173.657 151.309 1.00 20.72  ? 101 ARG A CD    1 
ATOM 658   N NE    . ARG A 1 101 ? 81.760  174.592 150.458 1.00 20.72  ? 101 ARG A NE    1 
ATOM 659   C CZ    . ARG A 1 101 ? 80.455  174.812 150.529 1.00 20.72  ? 101 ARG A CZ    1 
ATOM 660   N NH1   . ARG A 1 101 ? 79.736  174.253 151.489 1.00 20.72  ? 101 ARG A NH1   1 
ATOM 661   N NH2   . ARG A 1 101 ? 79.887  175.670 149.697 1.00 20.72  ? 101 ARG A NH2   1 
ATOM 662   N N     . VAL A 1 102 ? 84.452  170.133 153.626 1.00 24.82  ? 102 VAL A N     1 
ATOM 663   C CA    . VAL A 1 102 ? 85.351  169.083 154.089 1.00 24.82  ? 102 VAL A CA    1 
ATOM 664   C C     . VAL A 1 102 ? 86.643  169.058 153.281 1.00 24.82  ? 102 VAL A C     1 
ATOM 665   O O     . VAL A 1 102 ? 86.701  169.511 152.133 1.00 24.82  ? 102 VAL A O     1 
ATOM 666   C CB    . VAL A 1 102 ? 84.670  167.690 154.045 1.00 24.82  ? 102 VAL A CB    1 
ATOM 667   C CG1   . VAL A 1 102 ? 83.451  167.642 154.969 1.00 24.82  ? 102 VAL A CG1   1 
ATOM 668   C CG2   . VAL A 1 102 ? 84.258  167.377 152.648 1.00 24.82  ? 102 VAL A CG2   1 
ATOM 669   N N     . ARG A 1 103 ? 87.683  168.520 153.924 1.00 27.91  ? 103 ARG A N     1 
ATOM 670   C CA    . ARG A 1 103 ? 88.966  168.238 153.304 1.00 27.91  ? 103 ARG A CA    1 
ATOM 671   C C     . ARG A 1 103 ? 88.835  167.005 152.427 1.00 27.91  ? 103 ARG A C     1 
ATOM 672   O O     . ARG A 1 103 ? 88.092  166.064 152.730 1.00 27.91  ? 103 ARG A O     1 
ATOM 673   C CB    . ARG A 1 103 ? 89.999  167.965 154.405 1.00 27.91  ? 103 ARG A CB    1 
ATOM 674   C CG    . ARG A 1 103 ? 91.351  167.428 153.990 1.00 27.91  ? 103 ARG A CG    1 
ATOM 675   C CD    . ARG A 1 103 ? 92.112  166.996 155.246 1.00 27.91  ? 103 ARG A CD    1 
ATOM 676   N NE    . ARG A 1 103 ? 93.424  166.402 154.995 1.00 27.91  ? 103 ARG A NE    1 
ATOM 677   C CZ    . ARG A 1 103 ? 94.178  165.857 155.948 1.00 27.91  ? 103 ARG A CZ    1 
ATOM 678   N NH1   . ARG A 1 103 ? 93.740  165.814 157.204 1.00 27.91  ? 103 ARG A NH1   1 
ATOM 679   N NH2   . ARG A 1 103 ? 95.356  165.327 155.649 1.00 27.91  ? 103 ARG A NH2   1 
ATOM 680   N N     . TYR A 1 104 ? 89.549  167.036 151.313 1.00 34.00  ? 104 TYR A N     1 
ATOM 681   C CA    . TYR A 1 104 ? 89.485  165.955 150.357 1.00 34.00  ? 104 TYR A CA    1 
ATOM 682   C C     . TYR A 1 104 ? 90.722  165.593 149.562 1.00 34.00  ? 104 TYR A C     1 
ATOM 683   O O     . TYR A 1 104 ? 91.546  166.448 149.233 1.00 34.00  ? 104 TYR A O     1 
ATOM 684   C CB    . TYR A 1 104 ? 88.447  166.494 149.402 1.00 34.00  ? 104 TYR A CB    1 
ATOM 685   N N     . ARG A 1 105 ? 90.853  164.283 149.292 1.00 37.19  ? 105 ARG A N     1 
ATOM 686   C CA    . ARG A 1 105 ? 91.839  163.738 148.359 1.00 37.19  ? 105 ARG A CA    1 
ATOM 687   C C     . ARG A 1 105 ? 91.312  162.425 147.741 1.00 37.19  ? 105 ARG A C     1 
ATOM 688   O O     . ARG A 1 105 ? 90.758  161.615 148.501 1.00 37.19  ? 105 ARG A O     1 
ATOM 689   C CB    . ARG A 1 105 ? 93.216  163.583 149.001 1.00 37.19  ? 105 ARG A CB    1 
ATOM 690   C CG    . ARG A 1 105 ? 94.250  163.069 148.031 1.00 37.19  ? 105 ARG A CG    1 
ATOM 691   C CD    . ARG A 1 105 ? 94.509  161.604 147.976 1.00 37.19  ? 105 ARG A CD    1 
ATOM 692   N NE    . ARG A 1 105 ? 95.643  161.387 147.087 1.00 37.19  ? 105 ARG A NE    1 
ATOM 693   C CZ    . ARG A 1 105 ? 96.017  160.202 146.632 1.00 37.19  ? 105 ARG A CZ    1 
ATOM 694   N NH1   . ARG A 1 105 ? 95.327  159.121 146.964 1.00 37.19  ? 105 ARG A NH1   1 
ATOM 695   N NH2   . ARG A 1 105 ? 97.065  160.104 145.827 1.00 37.19  ? 105 ARG A NH2   1 
ATOM 696   N N     . ILE A 1 106 ? 91.381  162.213 146.416 1.00 40.93  ? 106 ILE A N     1 
ATOM 697   C CA    . ILE A 1 106 ? 91.007  160.901 145.845 1.00 40.93  ? 106 ILE A CA    1 
ATOM 698   C C     . ILE A 1 106 ? 91.929  160.642 144.665 1.00 40.93  ? 106 ILE A C     1 
ATOM 699   O O     . ILE A 1 106 ? 92.203  161.546 143.875 1.00 40.93  ? 106 ILE A O     1 
ATOM 700   C CB    . ILE A 1 106 ? 89.602  160.621 145.267 1.00 40.93  ? 106 ILE A CB    1 
ATOM 701   N N     . VAL A 1 107 ? 92.428  159.423 144.546 1.00 44.26  ? 107 VAL A N     1 
ATOM 702   C CA    . VAL A 1 107 ? 93.190  159.023 143.370 1.00 44.26  ? 107 VAL A CA    1 
ATOM 703   C C     . VAL A 1 107 ? 92.264  158.109 142.567 1.00 44.26  ? 107 VAL A C     1 
ATOM 704   O O     . VAL A 1 107 ? 91.724  157.137 143.102 1.00 44.26  ? 107 VAL A O     1 
ATOM 705   C CB    . VAL A 1 107 ? 94.526  158.366 143.763 1.00 44.26  ? 107 VAL A CB    1 
ATOM 706   C CG1   . VAL A 1 107 ? 94.326  157.081 144.530 1.00 44.26  ? 107 VAL A CG1   1 
ATOM 707   C CG2   . VAL A 1 107 ? 95.393  158.143 142.560 1.00 44.26  ? 107 VAL A CG2   1 
ATOM 708   N N     . ALA A 1 108 ? 91.947  158.528 141.333 1.00 40.69  ? 108 ALA A N     1 
ATOM 709   C CA    . ALA A 1 108 ? 91.007  157.825 140.455 1.00 40.69  ? 108 ALA A CA    1 
ATOM 710   C C     . ALA A 1 108 ? 91.512  157.816 139.012 1.00 40.69  ? 108 ALA A C     1 
ATOM 711   O O     . ALA A 1 108 ? 92.639  158.220 138.726 1.00 40.69  ? 108 ALA A O     1 
ATOM 712   C CB    . ALA A 1 108 ? 89.612  158.449 140.542 1.00 40.69  ? 108 ALA A CB    1 
ATOM 713   N N     . SER A 1 109 ? 90.711  157.248 138.104 1.00 36.63  ? 109 SER A N     1 
ATOM 714   C CA    . SER A 1 109 ? 91.043  157.204 136.677 1.00 36.63  ? 109 SER A CA    1 
ATOM 715   C C     . SER A 1 109 ? 89.884  157.675 135.802 1.00 36.63  ? 109 SER A C     1 
ATOM 716   O O     . SER A 1 109 ? 89.053  156.865 135.370 1.00 36.63  ? 109 SER A O     1 
ATOM 717   C CB    . SER A 1 109 ? 91.468  155.801 136.260 1.00 36.63  ? 109 SER A CB    1 
ATOM 718   O OG    . SER A 1 109 ? 91.831  155.765 134.890 1.00 36.63  ? 109 SER A OG    1 
ATOM 719   N N     . PRO A 1 110 ? 89.793  158.980 135.521 1.00 34.32  ? 110 PRO A N     1 
ATOM 720   C CA    . PRO A 1 110 ? 88.757  159.469 134.597 1.00 34.32  ? 110 PRO A CA    1 
ATOM 721   C C     . PRO A 1 110 ? 88.928  158.856 133.214 1.00 34.32  ? 110 PRO A C     1 
ATOM 722   O O     . PRO A 1 110 ? 89.997  158.952 132.607 1.00 34.32  ? 110 PRO A O     1 
ATOM 723   C CB    . PRO A 1 110 ? 88.989  160.984 134.581 1.00 34.32  ? 110 PRO A CB    1 
ATOM 724   C CG    . PRO A 1 110 ? 90.422  161.145 134.960 1.00 34.32  ? 110 PRO A CG    1 
ATOM 725   C CD    . PRO A 1 110 ? 90.688  160.061 135.964 1.00 34.32  ? 110 PRO A CD    1 
ATOM 726   N N     . THR A 1 111 ? 87.862  158.235 132.704 1.00 30.57  ? 111 THR A N     1 
ATOM 727   C CA    . THR A 1 111 ? 87.964  157.559 131.420 1.00 30.57  ? 111 THR A CA    1 
ATOM 728   C C     . THR A 1 111 ? 86.762  157.835 130.523 1.00 30.57  ? 111 THR A C     1 
ATOM 729   O O     . THR A 1 111 ? 85.735  158.372 130.942 1.00 30.57  ? 111 THR A O     1 
ATOM 730   C CB    . THR A 1 111 ? 88.113  156.048 131.612 1.00 30.57  ? 111 THR A CB    1 
ATOM 731   O OG1   . THR A 1 111 ? 88.317  155.417 130.342 1.00 30.57  ? 111 THR A OG1   1 
ATOM 732   C CG2   . THR A 1 111 ? 86.861  155.495 132.241 1.00 30.57  ? 111 THR A CG2   1 
ATOM 733   N N     . LYS A 1 112 ? 86.927  157.407 129.270 1.00 29.01  ? 112 LYS A N     1 
ATOM 734   C CA    . LYS A 1 112 ? 85.922  157.291 128.226 1.00 29.01  ? 112 LYS A CA    1 
ATOM 735   C C     . LYS A 1 112 ? 86.076  155.920 127.577 1.00 29.01  ? 112 LYS A C     1 
ATOM 736   O O     . LYS A 1 112 ? 87.186  155.398 127.476 1.00 29.01  ? 112 LYS A O     1 
ATOM 737   C CB    . LYS A 1 112 ? 86.078  158.380 127.139 1.00 29.01  ? 112 LYS A CB    1 
ATOM 738   C CG    . LYS A 1 112 ? 85.006  158.326 126.052 1.00 29.01  ? 112 LYS A CG    1 
ATOM 739   C CD    . LYS A 1 112 ? 85.185  159.393 124.980 1.00 29.01  ? 112 LYS A CD    1 
ATOM 740   C CE    . LYS A 1 112 ? 85.047  160.801 125.506 1.00 29.01  ? 112 LYS A CE    1 
ATOM 741   N NZ    . LYS A 1 112 ? 85.195  161.800 124.405 1.00 29.01  ? 112 LYS A NZ    1 
ATOM 742   N N     . ARG A 1 113 ? 84.963  155.328 127.151 1.00 27.46  ? 113 ARG A N     1 
ATOM 743   C CA    . ARG A 1 113 ? 84.964  154.019 126.505 1.00 27.46  ? 113 ARG A CA    1 
ATOM 744   C C     . ARG A 1 113 ? 84.632  154.218 125.034 1.00 27.46  ? 113 ARG A C     1 
ATOM 745   O O     . ARG A 1 113 ? 83.554  154.717 124.706 1.00 27.46  ? 113 ARG A O     1 
ATOM 746   C CB    . ARG A 1 113 ? 83.962  153.046 127.120 1.00 27.46  ? 113 ARG A CB    1 
ATOM 747   C CG    . ARG A 1 113 ? 84.118  151.660 126.504 1.00 27.46  ? 113 ARG A CG    1 
ATOM 748   C CD    . ARG A 1 113 ? 83.201  150.625 127.097 1.00 27.46  ? 113 ARG A CD    1 
ATOM 749   N NE    . ARG A 1 113 ? 83.448  150.350 128.505 1.00 27.46  ? 113 ARG A NE    1 
ATOM 750   C CZ    . ARG A 1 113 ? 84.379  149.515 128.949 1.00 27.46  ? 113 ARG A CZ    1 
ATOM 751   N NH1   . ARG A 1 113 ? 85.161  148.869 128.096 1.00 27.46  ? 113 ARG A NH1   1 
ATOM 752   N NH2   . ARG A 1 113 ? 84.520  149.322 130.251 1.00 27.46  ? 113 ARG A NH2   1 
ATOM 753   N N     . LEU A 1 114 ? 85.544  153.806 124.154 1.00 25.02  ? 114 LEU A N     1 
ATOM 754   C CA    . LEU A 1 114 ? 85.418  154.058 122.728 1.00 25.02  ? 114 LEU A CA    1 
ATOM 755   C C     . LEU A 1 114 ? 85.603  152.767 121.935 1.00 25.02  ? 114 LEU A C     1 
ATOM 756   O O     . LEU A 1 114 ? 86.054  151.741 122.454 1.00 25.02  ? 114 LEU A O     1 
ATOM 757   C CB    . LEU A 1 114 ? 86.469  155.098 122.300 1.00 25.02  ? 114 LEU A CB    1 
ATOM 758   C CG    . LEU A 1 114 ? 86.602  155.659 120.884 1.00 25.02  ? 114 LEU A CG    1 
ATOM 759   C CD1   . LEU A 1 114 ? 85.370  156.407 120.482 1.00 25.02  ? 114 LEU A CD1   1 
ATOM 760   C CD2   . LEU A 1 114 ? 87.810  156.561 120.798 1.00 25.02  ? 114 LEU A CD2   1 
ATOM 761   N N     . GLY A 1 115 ? 85.195  152.825 120.667 1.00 21.47  ? 115 GLY A N     1 
ATOM 762   C CA    . GLY A 1 115 ? 85.487  151.768 119.709 1.00 21.47  ? 115 GLY A CA    1 
ATOM 763   C C     . GLY A 1 115 ? 86.898  151.871 119.165 1.00 21.47  ? 115 GLY A C     1 
ATOM 764   O O     . GLY A 1 115 ? 87.352  152.957 118.789 1.00 21.47  ? 115 GLY A O     1 
ATOM 765   N N     . ARG A 1 116 ? 87.599  150.744 119.125 1.00 21.62  ? 116 ARG A N     1 
ATOM 766   C CA    . ARG A 1 116 ? 88.963  150.700 118.618 1.00 21.62  ? 116 ARG A CA    1 
ATOM 767   C C     . ARG A 1 116 ? 89.012  149.886 117.331 1.00 21.62  ? 116 ARG A C     1 
ATOM 768   O O     . ARG A 1 116 ? 88.248  148.931 117.156 1.00 21.62  ? 116 ARG A O     1 
ATOM 769   C CB    . ARG A 1 116 ? 89.930  150.115 119.647 1.00 21.62  ? 116 ARG A CB    1 
ATOM 770   C CG    . ARG A 1 116 ? 91.395  150.104 119.211 1.00 21.62  ? 116 ARG A CG    1 
ATOM 771   C CD    . ARG A 1 116 ? 92.232  149.550 120.332 1.00 21.62  ? 116 ARG A CD    1 
ATOM 772   N NE    . ARG A 1 116 ? 92.271  150.441 121.481 1.00 21.62  ? 116 ARG A NE    1 
ATOM 773   C CZ    . ARG A 1 116 ? 92.841  150.121 122.635 1.00 21.62  ? 116 ARG A CZ    1 
ATOM 774   N NH1   . ARG A 1 116 ? 93.378  148.921 122.787 1.00 21.62  ? 116 ARG A NH1   1 
ATOM 775   N NH2   . ARG A 1 116 ? 92.858  150.983 123.644 1.00 21.62  ? 116 ARG A NH2   1 
ATOM 776   N N     . SER A 1 117 ? 89.813  150.356 116.384 1.00 20.57  ? 117 SER A N     1 
ATOM 777   C CA    . SER A 1 117 ? 90.004  149.643 115.130 1.00 20.57  ? 117 SER A CA    1 
ATOM 778   C C     . SER A 1 117 ? 90.677  148.289 115.360 1.00 20.57  ? 117 SER A C     1 
ATOM 779   O O     . SER A 1 117 ? 91.558  148.150 116.212 1.00 20.57  ? 117 SER A O     1 
ATOM 780   C CB    . SER A 1 117 ? 90.832  150.492 114.168 1.00 20.57  ? 117 SER A CB    1 
ATOM 781   O OG    . SER A 1 117 ? 90.140  151.673 113.805 1.00 20.57  ? 117 SER A OG    1 
ATOM 782   N N     . GLU A 1 118 ? 90.219  147.281 114.628 1.00 22.80  ? 118 GLU A N     1 
ATOM 783   C CA    . GLU A 1 118 ? 90.729  145.931 114.812 1.00 22.80  ? 118 GLU A CA    1 
ATOM 784   C C     . GLU A 1 118 ? 90.168  145.449 116.151 1.00 22.80  ? 118 GLU A C     1 
ATOM 785   O O     . GLU A 1 118 ? 90.793  144.657 116.858 1.00 22.80  ? 118 GLU A O     1 
ATOM 786   C CB    . GLU A 1 118 ? 92.256  145.924 114.835 1.00 22.80  ? 118 GLU A CB    1 
ATOM 787   N N     . THR A 1 121 ? 86.199  146.852 121.756 1.00 20.70  ? 121 THR A N     1 
ATOM 788   C CA    . THR A 1 121 ? 86.114  148.164 122.394 1.00 20.70  ? 121 THR A CA    1 
ATOM 789   C C     . THR A 1 121 ? 87.437  148.541 123.055 1.00 20.70  ? 121 THR A C     1 
ATOM 790   O O     . THR A 1 121 ? 88.456  147.889 122.827 1.00 20.70  ? 121 THR A O     1 
ATOM 791   C CB    . THR A 1 121 ? 84.993  148.207 123.448 1.00 20.70  ? 121 THR A CB    1 
ATOM 792   N N     . GLN A 1 122 ? 87.419  149.591 123.872 1.00 22.48  ? 122 GLN A N     1 
ATOM 793   C CA    . GLN A 1 122 ? 88.631  150.037 124.557 1.00 22.48  ? 122 GLN A CA    1 
ATOM 794   C C     . GLN A 1 122 ? 88.370  151.107 125.616 1.00 22.48  ? 122 GLN A C     1 
ATOM 795   O O     . GLN A 1 122 ? 87.260  151.625 125.733 1.00 22.48  ? 122 GLN A O     1 
ATOM 796   C CB    . GLN A 1 122 ? 89.657  150.552 123.544 1.00 22.48  ? 122 GLN A CB    1 
ATOM 797   N N     . ARG A 1 123 ? 89.410  151.426 126.383 1.00 29.35  ? 123 ARG A N     1 
ATOM 798   C CA    . ARG A 1 123 ? 89.340  152.429 127.434 1.00 29.35  ? 123 ARG A CA    1 
ATOM 799   C C     . ARG A 1 123 ? 90.381  153.510 127.147 1.00 29.35  ? 123 ARG A C     1 
ATOM 800   O O     . ARG A 1 123 ? 91.585  153.227 127.117 1.00 29.35  ? 123 ARG A O     1 
ATOM 801   C CB    . ARG A 1 123 ? 89.554  151.780 128.797 1.00 29.35  ? 123 ARG A CB    1 
ATOM 802   C CG    . ARG A 1 123 ? 88.384  150.894 129.199 1.00 29.35  ? 123 ARG A CG    1 
ATOM 803   C CD    . ARG A 1 123 ? 88.444  150.474 130.652 1.00 29.35  ? 123 ARG A CD    1 
ATOM 804   N NE    . ARG A 1 123 ? 87.287  149.671 131.028 1.00 29.35  ? 123 ARG A NE    1 
ATOM 805   C CZ    . ARG A 1 123 ? 87.246  148.883 132.095 1.00 29.35  ? 123 ARG A CZ    1 
ATOM 806   N NH1   . ARG A 1 123 ? 88.295  148.801 132.897 1.00 29.35  ? 123 ARG A NH1   1 
ATOM 807   N NH2   . ARG A 1 123 ? 86.151  148.187 132.366 1.00 29.35  ? 123 ARG A NH2   1 
ATOM 808   N N     . LEU A 1 124 ? 89.911  154.739 126.937 1.00 31.01  ? 124 LEU A N     1 
ATOM 809   C CA    . LEU A 1 124 ? 90.734  155.893 126.600 1.00 31.01  ? 124 LEU A CA    1 
ATOM 810   C C     . LEU A 1 124 ? 90.588  156.961 127.679 1.00 31.01  ? 124 LEU A C     1 
ATOM 811   O O     . LEU A 1 124 ? 89.488  157.206 128.167 1.00 31.01  ? 124 LEU A O     1 
ATOM 812   C CB    . LEU A 1 124 ? 90.288  156.407 125.221 1.00 31.01  ? 124 LEU A CB    1 
ATOM 813   C CG    . LEU A 1 124 ? 90.989  157.480 124.412 1.00 31.01  ? 124 LEU A CG    1 
ATOM 814   C CD1   . LEU A 1 124 ? 90.597  157.348 122.963 1.00 31.01  ? 124 LEU A CD1   1 
ATOM 815   C CD2   . LEU A 1 124 ? 90.467  158.788 124.936 1.00 31.01  ? 124 LEU A CD2   1 
ATOM 816   N N     . GLY A 1 125 ? 91.702  157.603 128.049 1.00 31.52  ? 125 GLY A N     1 
ATOM 817   C CA    . GLY A 1 125 ? 91.661  158.579 129.132 1.00 31.52  ? 125 GLY A CA    1 
ATOM 818   C C     . GLY A 1 125 ? 90.946  159.892 128.863 1.00 31.52  ? 125 GLY A C     1 
ATOM 819   O O     . GLY A 1 125 ? 90.351  160.469 129.779 1.00 31.52  ? 125 GLY A O     1 
ATOM 820   N N     . LEU A 1 126 ? 90.977  160.382 127.625 1.00 34.15  ? 126 LEU A N     1 
ATOM 821   C CA    . LEU A 1 126 ? 90.282  161.626 127.282 1.00 34.15  ? 126 LEU A CA    1 
ATOM 822   C C     . LEU A 1 126 ? 88.769  161.456 127.227 1.00 34.15  ? 126 LEU A C     1 
ATOM 823   O O     . LEU A 1 126 ? 88.230  160.786 126.341 1.00 34.15  ? 126 LEU A O     1 
ATOM 824   C CB    . LEU A 1 126 ? 90.849  162.283 126.021 1.00 34.15  ? 126 LEU A CB    1 
ATOM 825   C CG    . LEU A 1 126 ? 92.352  162.512 126.257 1.00 34.15  ? 126 LEU A CG    1 
ATOM 826   C CD1   . LEU A 1 126 ? 93.241  162.990 125.127 1.00 34.15  ? 126 LEU A CD1   1 
ATOM 827   C CD2   . LEU A 1 126 ? 92.414  163.504 127.276 1.00 34.15  ? 126 LEU A CD2   1 
ATOM 828   N N     . LYS A 1 127 ? 88.097  162.082 128.191 1.00 36.51  ? 127 LYS A N     1 
ATOM 829   C CA    . LYS A 1 127 ? 86.644  162.128 128.296 1.00 36.51  ? 127 LYS A CA    1 
ATOM 830   C C     . LYS A 1 127 ? 86.139  163.555 128.110 1.00 36.51  ? 127 LYS A C     1 
ATOM 831   O O     . LYS A 1 127 ? 86.808  164.388 127.500 1.00 36.51  ? 127 LYS A O     1 
ATOM 832   C CB    . LYS A 1 127 ? 86.188  161.622 129.666 1.00 36.51  ? 127 LYS A CB    1 
ATOM 833   C CG    . LYS A 1 127 ? 84.680  161.600 129.858 1.00 36.51  ? 127 LYS A CG    1 
ATOM 834   C CD    . LYS A 1 127 ? 84.329  161.074 131.236 1.00 36.51  ? 127 LYS A CD    1 
ATOM 835   C CE    . LYS A 1 127 ? 82.834  161.018 131.435 1.00 36.51  ? 127 LYS A CE    1 
ATOM 836   N NZ    . LYS A 1 127 ? 82.493  160.482 132.775 1.00 36.51  ? 127 LYS A NZ    1 
ATOM 837   N N     . THR A 1 137 ? 86.736  169.350 124.264 1.00 53.69  ? 137 THR A N     1 
ATOM 838   C CA    . THR A 1 137 ? 87.589  169.551 125.430 1.00 53.69  ? 137 THR A CA    1 
ATOM 839   C C     . THR A 1 137 ? 88.057  168.223 126.036 1.00 53.69  ? 137 THR A C     1 
ATOM 840   O O     . THR A 1 137 ? 87.256  167.347 126.372 1.00 53.69  ? 137 THR A O     1 
ATOM 841   C CB    . THR A 1 137 ? 86.901  170.404 126.528 1.00 53.69  ? 137 THR A CB    1 
ATOM 842   O OG1   . THR A 1 137 ? 85.726  169.741 127.011 1.00 53.69  ? 137 THR A OG1   1 
ATOM 843   C CG2   . THR A 1 137 ? 86.524  171.780 125.991 1.00 53.69  ? 137 THR A CG2   1 
ATOM 844   N N     . TRP A 1 138 ? 89.373  168.102 126.175 1.00 45.53  ? 138 TRP A N     1 
ATOM 845   C CA    . TRP A 1 138 ? 90.056  166.936 126.715 1.00 45.53  ? 138 TRP A CA    1 
ATOM 846   C C     . TRP A 1 138 ? 90.469  167.157 128.170 1.00 45.53  ? 138 TRP A C     1 
ATOM 847   O O     . TRP A 1 138 ? 90.180  168.178 128.791 1.00 45.53  ? 138 TRP A O     1 
ATOM 848   C CB    . TRP A 1 138 ? 91.224  166.422 125.859 1.00 45.53  ? 138 TRP A CB    1 
ATOM 849   C CG    . TRP A 1 138 ? 90.990  166.293 124.381 1.00 45.53  ? 138 TRP A CG    1 
ATOM 850   C CD1   . TRP A 1 138 ? 90.862  165.115 123.701 1.00 45.53  ? 138 TRP A CD1   1 
ATOM 851   C CD2   . TRP A 1 138 ? 90.996  167.323 123.385 1.00 45.53  ? 138 TRP A CD2   1 
ATOM 852   N NE1   . TRP A 1 138 ? 90.706  165.346 122.364 1.00 45.53  ? 138 TRP A NE1   1 
ATOM 853   C CE2   . TRP A 1 138 ? 90.795  166.693 122.137 1.00 45.53  ? 138 TRP A CE2   1 
ATOM 854   C CE3   . TRP A 1 138 ? 91.117  168.713 123.425 1.00 45.53  ? 138 TRP A CE3   1 
ATOM 855   C CZ2   . TRP A 1 138 ? 90.716  167.403 120.946 1.00 45.53  ? 138 TRP A CZ2   1 
ATOM 856   C CZ3   . TRP A 1 138 ? 91.038  169.417 122.237 1.00 45.53  ? 138 TRP A CZ3   1 
ATOM 857   C CH2   . TRP A 1 138 ? 90.839  168.760 121.014 1.00 45.53  ? 138 TRP A CH2   1 
ATOM 858   N N     . ARG A 1 141 ? 93.065  168.221 129.649 1.00 38.49  ? 141 ARG A N     1 
ATOM 859   C CA    . ARG A 1 141 ? 92.734  169.549 130.161 1.00 38.49  ? 141 ARG A CA    1 
ATOM 860   C C     . ARG A 1 141 ? 91.957  169.409 131.479 1.00 38.49  ? 141 ARG A C     1 
ATOM 861   O O     . ARG A 1 141 ? 91.402  168.355 131.790 1.00 38.49  ? 141 ARG A O     1 
ATOM 862   C CB    . ARG A 1 141 ? 91.962  170.398 129.142 1.00 38.49  ? 141 ARG A CB    1 
ATOM 863   C CG    . ARG A 1 141 ? 92.841  171.110 128.120 1.00 38.49  ? 141 ARG A CG    1 
ATOM 864   C CD    . ARG A 1 141 ? 93.425  170.111 127.132 1.00 38.49  ? 141 ARG A CD    1 
ATOM 865   N NE    . ARG A 1 141 ? 94.469  170.685 126.295 1.00 38.49  ? 141 ARG A NE    1 
ATOM 866   C CZ    . ARG A 1 141 ? 95.120  170.017 125.349 1.00 38.49  ? 141 ARG A CZ    1 
ATOM 867   N NH1   . ARG A 1 141 ? 94.740  168.793 125.012 1.00 38.49  ? 141 ARG A NH1   1 
ATOM 868   N NH2   . ARG A 1 141 ? 96.068  170.622 124.648 1.00 38.49  ? 141 ARG A NH2   1 
ATOM 869   N N     . GLY A 1 142 ? 91.943  170.480 132.274 1.00 39.69  ? 142 GLY A N     1 
ATOM 870   C CA    . GLY A 1 142 ? 91.247  170.455 133.562 1.00 39.69  ? 142 GLY A CA    1 
ATOM 871   C C     . GLY A 1 142 ? 89.725  170.380 133.482 1.00 39.69  ? 142 GLY A C     1 
ATOM 872   O O     . GLY A 1 142 ? 89.081  169.598 134.203 1.00 39.69  ? 142 GLY A O     1 
ATOM 873   N N     . ALA A 1 143 ? 89.121  171.211 132.624 1.00 39.93  ? 143 ALA A N     1 
ATOM 874   C CA    . ALA A 1 143 ? 87.663  171.348 132.604 1.00 39.93  ? 143 ALA A CA    1 
ATOM 875   C C     . ALA A 1 143 ? 86.944  170.045 132.255 1.00 39.93  ? 143 ALA A C     1 
ATOM 876   O O     . ALA A 1 143 ? 85.879  169.754 132.819 1.00 39.93  ? 143 ALA A O     1 
ATOM 877   C CB    . ALA A 1 143 ? 87.268  172.455 131.626 1.00 39.93  ? 143 ALA A CB    1 
ATOM 878   N N     . ALA A 1 144 ? 87.488  169.250 131.331 1.00 39.32  ? 144 ALA A N     1 
ATOM 879   C CA    . ALA A 1 144 ? 86.892  167.937 131.090 1.00 39.32  ? 144 ALA A CA    1 
ATOM 880   C C     . ALA A 1 144 ? 86.895  167.122 132.372 1.00 39.32  ? 144 ALA A C     1 
ATOM 881   O O     . ALA A 1 144 ? 85.976  166.334 132.621 1.00 39.32  ? 144 ALA A O     1 
ATOM 882   C CB    . ALA A 1 144 ? 87.597  167.196 129.961 1.00 39.32  ? 144 ALA A CB    1 
ATOM 883   N N     . ALA A 1 145 ? 87.935  167.286 133.194 1.00 37.06  ? 145 ALA A N     1 
ATOM 884   C CA    . ALA A 1 145 ? 88.031  166.502 134.417 1.00 37.06  ? 145 ALA A CA    1 
ATOM 885   C C     . ALA A 1 145 ? 86.937  166.935 135.375 1.00 37.06  ? 145 ALA A C     1 
ATOM 886   O O     . ALA A 1 145 ? 86.383  166.108 136.109 1.00 37.06  ? 145 ALA A O     1 
ATOM 887   C CB    . ALA A 1 145 ? 89.410  166.649 135.055 1.00 37.06  ? 145 ALA A CB    1 
ATOM 888   N N     . GLU A 1 146 ? 86.629  168.234 135.410 1.00 36.92  ? 146 GLU A N     1 
ATOM 889   C CA    . GLU A 1 146 ? 85.549  168.654 136.299 1.00 36.92  ? 146 GLU A CA    1 
ATOM 890   C C     . GLU A 1 146 ? 84.206  168.144 135.779 1.00 36.92  ? 146 GLU A C     1 
ATOM 891   O O     . GLU A 1 146 ? 83.326  167.780 136.569 1.00 36.92  ? 146 GLU A O     1 
ATOM 892   C CB    . GLU A 1 146 ? 85.527  170.175 136.442 1.00 36.92  ? 146 GLU A CB    1 
ATOM 893   C CG    . GLU A 1 146 ? 84.469  170.722 137.413 1.00 36.92  ? 146 GLU A CG    1 
ATOM 894   C CD    . GLU A 1 146 ? 83.054  170.682 136.894 1.00 36.92  ? 146 GLU A CD    1 
ATOM 895   O OE1   . GLU A 1 146 ? 82.865  170.806 135.669 1.00 36.92  ? 146 GLU A OE1   1 
ATOM 896   O OE2   . GLU A 1 146 ? 82.130  170.530 137.718 1.00 36.92  ? 146 GLU A OE2   1 
ATOM 897   N N     . GLU A 1 147 ? 84.008  168.164 134.454 1.00 35.00  ? 147 GLU A N     1 
ATOM 898   C CA    . GLU A 1 147 ? 82.870  167.462 133.857 1.00 35.00  ? 147 GLU A CA    1 
ATOM 899   C C     . GLU A 1 147 ? 82.790  166.038 134.405 1.00 35.00  ? 147 GLU A C     1 
ATOM 900   O O     . GLU A 1 147 ? 81.725  165.565 134.845 1.00 35.00  ? 147 GLU A O     1 
ATOM 901   C CB    . GLU A 1 147 ? 82.998  167.491 132.329 1.00 35.00  ? 147 GLU A CB    1 
ATOM 902   C CG    . GLU A 1 147 ? 81.842  166.895 131.518 1.00 35.00  ? 147 GLU A CG    1 
ATOM 903   C CD    . GLU A 1 147 ? 81.717  165.390 131.646 1.00 35.00  ? 147 GLU A CD    1 
ATOM 904   O OE1   . GLU A 1 147 ? 82.751  164.719 131.838 1.00 35.00  ? 147 GLU A OE1   1 
ATOM 905   O OE2   . GLU A 1 147 ? 80.579  164.878 131.562 1.00 35.00  ? 147 GLU A OE2   1 
ATOM 906   N N     . TRP A 1 148 ? 83.946  165.361 134.428 1.00 33.46  ? 148 TRP A N     1 
ATOM 907   C CA    . TRP A 1 148 ? 84.035  164.007 134.953 1.00 33.46  ? 148 TRP A CA    1 
ATOM 908   C C     . TRP A 1 148 ? 83.557  164.005 136.386 1.00 33.46  ? 148 TRP A C     1 
ATOM 909   O O     . TRP A 1 148 ? 82.951  163.035 136.850 1.00 33.46  ? 148 TRP A O     1 
ATOM 910   C CB    . TRP A 1 148 ? 85.469  163.487 134.873 1.00 33.46  ? 148 TRP A CB    1 
ATOM 911   C CG    . TRP A 1 148 ? 85.610  162.068 135.318 1.00 33.46  ? 148 TRP A CG    1 
ATOM 912   C CD1   . TRP A 1 148 ? 85.070  160.969 134.720 1.00 33.46  ? 148 TRP A CD1   1 
ATOM 913   C CD2   . TRP A 1 148 ? 86.289  161.594 136.489 1.00 33.46  ? 148 TRP A CD2   1 
ATOM 914   N NE1   . TRP A 1 148 ? 85.401  159.838 135.423 1.00 33.46  ? 148 TRP A NE1   1 
ATOM 915   C CE2   . TRP A 1 148 ? 86.144  160.196 136.516 1.00 33.46  ? 148 TRP A CE2   1 
ATOM 916   C CE3   . TRP A 1 148 ? 87.017  162.215 137.507 1.00 33.46  ? 148 TRP A CE3   1 
ATOM 917   C CZ2   . TRP A 1 148 ? 86.700  159.409 137.518 1.00 33.46  ? 148 TRP A CZ2   1 
ATOM 918   C CZ3   . TRP A 1 148 ? 87.566  161.430 138.501 1.00 33.46  ? 148 TRP A CZ3   1 
ATOM 919   C CH2   . TRP A 1 148 ? 87.405  160.044 138.499 1.00 33.46  ? 148 TRP A CH2   1 
ATOM 920   N N     . TRP A 1 149 ? 83.813  165.104 137.092 1.00 30.62  ? 149 TRP A N     1 
ATOM 921   C CA    . TRP A 1 149 ? 83.363  165.210 138.465 1.00 30.62  ? 149 TRP A CA    1 
ATOM 922   C C     . TRP A 1 149 ? 81.853  165.306 138.582 1.00 30.62  ? 149 TRP A C     1 
ATOM 923   O O     . TRP A 1 149 ? 81.262  164.632 139.430 1.00 30.62  ? 149 TRP A O     1 
ATOM 924   C CB    . TRP A 1 149 ? 83.921  166.448 139.121 1.00 30.62  ? 149 TRP A CB    1 
ATOM 925   N N     . HIS A 1 150 ? 81.201  166.186 137.815 1.00 33.36  ? 150 HIS A N     1 
ATOM 926   C CA    . HIS A 1 150 ? 79.759  166.271 138.022 1.00 33.36  ? 150 HIS A CA    1 
ATOM 927   C C     . HIS A 1 150 ? 79.110  164.940 137.676 1.00 33.36  ? 150 HIS A C     1 
ATOM 928   O O     . HIS A 1 150 ? 78.126  164.539 138.310 1.00 33.36  ? 150 HIS A O     1 
ATOM 929   C CB    . HIS A 1 150 ? 79.093  167.416 137.251 1.00 33.36  ? 150 HIS A CB    1 
ATOM 930   C CG    . HIS A 1 150 ? 79.169  167.302 135.764 1.00 33.36  ? 150 HIS A CG    1 
ATOM 931   N ND1   . HIS A 1 150 ? 78.310  166.501 135.041 1.00 33.36  ? 150 HIS A ND1   1 
ATOM 932   C CD2   . HIS A 1 150 ? 79.903  167.980 134.855 1.00 33.36  ? 150 HIS A CD2   1 
ATOM 933   C CE1   . HIS A 1 150 ? 78.570  166.633 133.753 1.00 33.36  ? 150 HIS A CE1   1 
ATOM 934   N NE2   . HIS A 1 150 ? 79.532  167.527 133.613 1.00 33.36  ? 150 HIS A NE2   1 
ATOM 935   N N     . SER A 1 151 ? 79.632  164.244 136.658 1.00 32.36  ? 151 SER A N     1 
ATOM 936   C CA    . SER A 1 151 ? 79.070  162.931 136.353 1.00 32.36  ? 151 SER A CA    1 
ATOM 937   C C     . SER A 1 151 ? 79.309  161.929 137.486 1.00 32.36  ? 151 SER A C     1 
ATOM 938   O O     . SER A 1 151 ? 78.373  161.271 137.954 1.00 32.36  ? 151 SER A O     1 
ATOM 939   C CB    . SER A 1 151 ? 79.665  162.403 135.044 1.00 32.36  ? 151 SER A CB    1 
ATOM 940   O OG    . SER A 1 151 ? 79.313  163.221 133.940 1.00 32.36  ? 151 SER A OG    1 
ATOM 941   N N     . ARG A 1 152 ? 80.563  161.796 137.937 1.00 30.15  ? 152 ARG A N     1 
ATOM 942   C CA    . ARG A 1 152 ? 80.896  160.813 138.972 1.00 30.15  ? 152 ARG A CA    1 
ATOM 943   C C     . ARG A 1 152 ? 80.257  161.096 140.331 1.00 30.15  ? 152 ARG A C     1 
ATOM 944   O O     . ARG A 1 152 ? 79.834  160.165 141.025 1.00 30.15  ? 152 ARG A O     1 
ATOM 945   C CB    . ARG A 1 152 ? 82.413  160.696 139.115 1.00 30.15  ? 152 ARG A CB    1 
ATOM 946   C CG    . ARG A 1 152 ? 83.100  160.089 137.906 1.00 30.15  ? 152 ARG A CG    1 
ATOM 947   C CD    . ARG A 1 152 ? 82.656  158.640 137.729 1.00 30.15  ? 152 ARG A CD    1 
ATOM 948   N NE    . ARG A 1 152 ? 83.288  157.973 136.591 1.00 30.15  ? 152 ARG A NE    1 
ATOM 949   C CZ    . ARG A 1 152 ? 82.845  158.049 135.341 1.00 30.15  ? 152 ARG A CZ    1 
ATOM 950   N NH1   . ARG A 1 152 ? 81.761  158.758 135.063 1.00 30.15  ? 152 ARG A NH1   1 
ATOM 951   N NH2   . ARG A 1 152 ? 83.476  157.405 134.368 1.00 30.15  ? 152 ARG A NH2   1 
ATOM 952   N N     . ALA A 1 153 ? 80.186  162.365 140.741 1.00 28.69  ? 153 ALA A N     1 
ATOM 953   C CA    . ALA A 1 153 ? 79.591  162.681 142.038 1.00 28.69  ? 153 ALA A CA    1 
ATOM 954   C C     . ALA A 1 153 ? 78.069  162.649 142.016 1.00 28.69  ? 153 ALA A C     1 
ATOM 955   O O     . ALA A 1 153 ? 77.449  162.150 142.963 1.00 28.69  ? 153 ALA A O     1 
ATOM 956   C CB    . ALA A 1 153 ? 80.078  164.047 142.516 1.00 28.69  ? 153 ALA A CB    1 
ATOM 957   N N     . ALA A 1 154 ? 77.456  163.175 140.958 1.00 25.50  ? 154 ALA A N     1 
ATOM 958   C CA    . ALA A 1 154 ? 75.997  163.150 140.773 1.00 25.50  ? 154 ALA A CA    1 
ATOM 959   C C     . ALA A 1 154 ? 75.339  163.830 141.973 1.00 25.50  ? 154 ALA A C     1 
ATOM 960   O O     . ALA A 1 154 ? 75.798  164.907 142.390 1.00 25.50  ? 154 ALA A O     1 
ATOM 961   C CB    . ALA A 1 154 ? 75.553  161.717 140.506 1.00 25.50  ? 154 ALA A CB    1 
ATOM 962   N N     . ALA A 1 155 ? 74.292  163.244 142.557 1.00 24.10  ? 155 ALA A N     1 
ATOM 963   C CA    . ALA A 1 155 ? 73.524  163.836 143.649 1.00 24.10  ? 155 ALA A CA    1 
ATOM 964   C C     . ALA A 1 155 ? 74.302  163.972 144.954 1.00 24.10  ? 155 ALA A C     1 
ATOM 965   O O     . ALA A 1 155 ? 73.862  164.722 145.831 1.00 24.10  ? 155 ALA A O     1 
ATOM 966   C CB    . ALA A 1 155 ? 72.259  163.017 143.897 1.00 24.10  ? 155 ALA A CB    1 
ATOM 967   N N     . ASN A 1 156 ? 75.419  163.258 145.113 1.00 22.44  ? 156 ASN A N     1 
ATOM 968   C CA    . ASN A 1 156 ? 76.137  163.195 146.385 1.00 22.44  ? 156 ASN A CA    1 
ATOM 969   C C     . ASN A 1 156 ? 76.549  164.555 146.945 1.00 22.44  ? 156 ASN A C     1 
ATOM 970   O O     . ASN A 1 156 ? 75.743  165.233 147.580 1.00 22.44  ? 156 ASN A O     1 
ATOM 971   C CB    . ASN A 1 156 ? 77.385  162.316 146.241 1.00 22.44  ? 156 ASN A CB    1 
ATOM 972   C CG    . ASN A 1 156 ? 77.052  160.858 145.971 1.00 22.44  ? 156 ASN A CG    1 
ATOM 973   O OD1   . ASN A 1 156 ? 76.120  160.305 146.550 1.00 22.44  ? 156 ASN A OD1   1 
ATOM 974   N ND2   . ASN A 1 156 ? 77.828  160.223 145.098 1.00 22.44  ? 156 ASN A ND2   1 
ATOM 975   N N     . GLY A 1 157 ? 77.813  164.927 146.788 1.00 22.38  ? 157 GLY A N     1 
ATOM 976   C CA    . GLY A 1 157 ? 78.333  166.155 147.359 1.00 22.38  ? 157 GLY A CA    1 
ATOM 977   C C     . GLY A 1 157 ? 78.979  167.072 146.345 1.00 22.38  ? 157 GLY A C     1 
ATOM 978   O O     . GLY A 1 157 ? 79.791  166.595 145.548 1.00 22.38  ? 157 GLY A O     1 
ATOM 979   N N     . LEU A 1 158 ? 78.602  168.344 146.303 1.00 23.67  ? 158 LEU A N     1 
ATOM 980   C CA    . LEU A 1 158 ? 79.184  169.254 145.319 1.00 23.67  ? 158 LEU A CA    1 
ATOM 981   C C     . LEU A 1 158 ? 80.480  169.799 145.883 1.00 23.67  ? 158 LEU A C     1 
ATOM 982   O O     . LEU A 1 158 ? 80.453  170.626 146.798 1.00 23.67  ? 158 LEU A O     1 
ATOM 983   C CB    . LEU A 1 158 ? 78.219  170.397 145.000 1.00 23.67  ? 158 LEU A CB    1 
ATOM 984   C CG    . LEU A 1 158 ? 76.746  170.020 144.824 1.00 23.67  ? 158 LEU A CG    1 
ATOM 985   C CD1   . LEU A 1 158 ? 75.886  171.262 144.644 1.00 23.67  ? 158 LEU A CD1   1 
ATOM 986   C CD2   . LEU A 1 158 ? 76.570  169.064 143.654 1.00 23.67  ? 158 LEU A CD2   1 
ATOM 987   N N     . GLU A 1 159 ? 81.618  169.344 145.358 1.00 26.01  ? 159 GLU A N     1 
ATOM 988   C CA    . GLU A 1 159 ? 82.876  169.824 145.916 1.00 26.01  ? 159 GLU A CA    1 
ATOM 989   C C     . GLU A 1 159 ? 84.193  169.828 145.134 1.00 26.01  ? 159 GLU A C     1 
ATOM 990   O O     . GLU A 1 159 ? 84.433  169.078 144.187 1.00 26.01  ? 159 GLU A O     1 
ATOM 991   C CB    . GLU A 1 159 ? 83.121  169.133 147.266 1.00 26.01  ? 159 GLU A CB    1 
ATOM 992   N N     . LEU A 1 160 ? 85.016  170.741 145.630 1.00 29.44  ? 160 LEU A N     1 
ATOM 993   C CA    . LEU A 1 160 ? 86.399  171.073 145.296 1.00 29.44  ? 160 LEU A CA    1 
ATOM 994   C C     . LEU A 1 160 ? 87.338  169.886 145.092 1.00 29.44  ? 160 LEU A C     1 
ATOM 995   O O     . LEU A 1 160 ? 87.957  169.384 146.036 1.00 29.44  ? 160 LEU A O     1 
ATOM 996   C CB    . LEU A 1 160 ? 86.972  172.016 146.350 1.00 29.44  ? 160 LEU A CB    1 
ATOM 997   C CG    . LEU A 1 160 ? 88.375  172.481 146.024 1.00 29.44  ? 160 LEU A CG    1 
ATOM 998   C CD1   . LEU A 1 160 ? 88.237  173.361 144.838 1.00 29.44  ? 160 LEU A CD1   1 
ATOM 999   C CD2   . LEU A 1 160 ? 88.891  173.263 147.194 1.00 29.44  ? 160 LEU A CD2   1 
ATOM 1000  N N     . LEU A 1 161 ? 87.421  169.433 143.844 1.00 34.96  ? 161 LEU A N     1 
ATOM 1001  C CA    . LEU A 1 161 ? 88.242  168.311 143.406 1.00 34.96  ? 161 LEU A CA    1 
ATOM 1002  C C     . LEU A 1 161 ? 89.512  168.901 142.773 1.00 34.96  ? 161 LEU A C     1 
ATOM 1003  O O     . LEU A 1 161 ? 89.427  169.529 141.713 1.00 34.96  ? 161 LEU A O     1 
ATOM 1004  C CB    . LEU A 1 161 ? 87.434  167.603 142.314 1.00 34.96  ? 161 LEU A CB    1 
ATOM 1005  N N     . SER A 1 162 ? 90.690  168.750 143.399 1.00 41.37  ? 162 SER A N     1 
ATOM 1006  C CA    . SER A 1 162 ? 91.862  169.291 142.711 1.00 41.37  ? 162 SER A CA    1 
ATOM 1007  C C     . SER A 1 162 ? 92.106  168.439 141.477 1.00 41.37  ? 162 SER A C     1 
ATOM 1008  O O     . SER A 1 162 ? 92.217  167.223 141.577 1.00 41.37  ? 162 SER A O     1 
ATOM 1009  C CB    . SER A 1 162 ? 93.094  169.296 143.610 1.00 41.37  ? 162 SER A CB    1 
ATOM 1010  O OG    . SER A 1 162 ? 94.203  169.826 142.914 1.00 41.37  ? 162 SER A OG    1 
ATOM 1011  N N     . THR A 1 163 ? 92.403  169.064 140.354 1.00 42.63  ? 163 THR A N     1 
ATOM 1012  C CA    . THR A 1 163 ? 92.432  168.305 139.114 1.00 42.63  ? 163 THR A CA    1 
ATOM 1013  C C     . THR A 1 163 ? 93.720  168.383 138.320 1.00 42.63  ? 163 THR A C     1 
ATOM 1014  O O     . THR A 1 163 ? 94.385  169.423 138.279 1.00 42.63  ? 163 THR A O     1 
ATOM 1015  C CB    . THR A 1 163 ? 91.285  168.728 138.185 1.00 42.63  ? 163 THR A CB    1 
ATOM 1016  O OG1   . THR A 1 163 ? 91.411  170.119 137.870 1.00 42.63  ? 163 THR A OG1   1 
ATOM 1017  C CG2   . THR A 1 163 ? 89.927  168.440 138.802 1.00 42.63  ? 163 THR A CG2   1 
ATOM 1018  N N     . TYR A 1 164 ? 94.043  167.258 137.690 1.00 46.26  ? 164 TYR A N     1 
ATOM 1019  C CA    . TYR A 1 164 ? 95.105  167.194 136.707 1.00 46.26  ? 164 TYR A CA    1 
ATOM 1020  C C     . TYR A 1 164 ? 94.782  165.992 135.847 1.00 46.26  ? 164 TYR A C     1 
ATOM 1021  O O     . TYR A 1 164 ? 94.316  164.963 136.339 1.00 46.26  ? 164 TYR A O     1 
ATOM 1022  C CB    . TYR A 1 164 ? 96.494  167.078 137.336 1.00 46.26  ? 164 TYR A CB    1 
ATOM 1023  C CG    . TYR A 1 164 ? 96.810  165.775 138.020 1.00 46.26  ? 164 TYR A CG    1 
ATOM 1024  C CD1   . TYR A 1 164 ? 96.431  165.558 139.333 1.00 46.26  ? 164 TYR A CD1   1 
ATOM 1025  C CD2   . TYR A 1 164 ? 97.515  164.772 137.367 1.00 46.26  ? 164 TYR A CD2   1 
ATOM 1026  C CE1   . TYR A 1 164 ? 96.722  164.379 139.966 1.00 46.26  ? 164 TYR A CE1   1 
ATOM 1027  C CE2   . TYR A 1 164 ? 97.815  163.580 138.002 1.00 46.26  ? 164 TYR A CE2   1 
ATOM 1028  C CZ    . TYR A 1 164 ? 97.415  163.389 139.305 1.00 46.26  ? 164 TYR A CZ    1 
ATOM 1029  O OH    . TYR A 1 164 ? 97.717  162.212 139.952 1.00 46.26  ? 164 TYR A OH    1 
ATOM 1030  N N     . ALA A 1 165 ? 95.025  166.151 134.563 1.00 45.90  ? 165 ALA A N     1 
ATOM 1031  C CA    . ALA A 1 165 ? 94.872  165.124 133.548 1.00 45.90  ? 165 ALA A CA    1 
ATOM 1032  C C     . ALA A 1 165 ? 96.185  164.931 132.800 1.00 45.90  ? 165 ALA A C     1 
ATOM 1033  O O     . ALA A 1 165 ? 96.545  165.777 131.976 1.00 45.90  ? 165 ALA A O     1 
ATOM 1034  C CB    . ALA A 1 165 ? 93.714  165.498 132.661 1.00 45.90  ? 165 ALA A CB    1 
ATOM 1035  N N     . GLN A 1 166 ? 96.858  163.805 133.010 1.00 46.94  ? 166 GLN A N     1 
ATOM 1036  C CA    . GLN A 1 166 ? 98.212  163.615 132.495 1.00 46.94  ? 166 GLN A CA    1 
ATOM 1037  C C     . GLN A 1 166 ? 98.624  162.158 132.570 1.00 46.94  ? 166 GLN A C     1 
ATOM 1038  O O     . GLN A 1 166 ? 97.780  161.257 132.602 1.00 46.94  ? 166 GLN A O     1 
ATOM 1039  C CB    . GLN A 1 166 ? 99.276  164.440 133.247 1.00 46.94  ? 166 GLN A CB    1 
ATOM 1040  C CG    . GLN A 1 166 ? 99.178  165.955 133.171 1.00 46.94  ? 166 GLN A CG    1 
ATOM 1041  C CD    . GLN A 1 166 ? 99.514  166.492 131.792 1.00 46.94  ? 166 GLN A CD    1 
ATOM 1042  O OE1   . GLN A 1 166 ? 100.269 165.881 131.035 1.00 46.94  ? 166 GLN A OE1   1 
ATOM 1043  N NE2   . GLN A 1 166 ? 98.924  167.632 131.447 1.00 46.94  ? 166 GLN A NE2   1 
ATOM 1044  N N     . ASP A 1 169 ? 100.640 155.516 134.586 1.00 77.66  ? 169 ASP A N     1 
ATOM 1045  C CA    . ASP A 1 169 ? 101.271 154.454 135.348 1.00 77.66  ? 169 ASP A CA    1 
ATOM 1046  C C     . ASP A 1 169 ? 101.382 153.218 134.476 1.00 77.66  ? 169 ASP A C     1 
ATOM 1047  O O     . ASP A 1 169 ? 100.414 152.829 133.824 1.00 77.66  ? 169 ASP A O     1 
ATOM 1048  C CB    . ASP A 1 169 ? 100.477 154.135 136.634 1.00 77.66  ? 169 ASP A CB    1 
ATOM 1049  C CG    . ASP A 1 169 ? 101.129 153.045 137.480 1.00 77.66  ? 169 ASP A CG    1 
ATOM 1050  O OD1   . ASP A 1 169 ? 102.231 152.579 137.128 1.00 77.66  ? 169 ASP A OD1   1 
ATOM 1051  O OD2   . ASP A 1 169 ? 100.533 152.649 138.505 1.00 77.66  ? 169 ASP A OD2   1 
ATOM 1052  N N     . ASP A 1 170 ? 102.530 152.557 134.511 1.00 88.99  ? 170 ASP A N     1 
ATOM 1053  C CA    . ASP A 1 170 ? 102.663 151.337 133.741 1.00 88.99  ? 170 ASP A CA    1 
ATOM 1054  C C     . ASP A 1 170 ? 102.918 150.257 134.773 1.00 88.99  ? 170 ASP A C     1 
ATOM 1055  O O     . ASP A 1 170 ? 103.530 150.509 135.814 1.00 88.99  ? 170 ASP A O     1 
ATOM 1056  C CB    . ASP A 1 170 ? 103.798 151.440 132.709 1.00 88.99  ? 170 ASP A CB    1 
ATOM 1057  C CG    . ASP A 1 170 ? 103.879 150.234 131.789 1.00 88.99  ? 170 ASP A CG    1 
ATOM 1058  O OD1   . ASP A 1 170 ? 103.088 149.287 131.962 1.00 88.99  ? 170 ASP A OD1   1 
ATOM 1059  O OD2   . ASP A 1 170 ? 104.731 150.238 130.876 1.00 88.99  ? 170 ASP A OD2   1 
ATOM 1060  N N     . VAL A 1 171 ? 102.541 149.028 134.431 1.00 102.60 ? 171 VAL A N     1 
ATOM 1061  C CA    . VAL A 1 171 ? 102.760 147.878 135.295 1.00 102.60 ? 171 VAL A CA    1 
ATOM 1062  C C     . VAL A 1 171 ? 102.791 146.584 134.503 1.00 102.60 ? 171 VAL A C     1 
ATOM 1063  O O     . VAL A 1 171 ? 102.230 146.478 133.407 1.00 102.60 ? 171 VAL A O     1 
ATOM 1064  C CB    . VAL A 1 171 ? 101.707 147.797 136.425 1.00 102.60 ? 171 VAL A CB    1 
ATOM 1065  C CG1   . VAL A 1 171 ? 102.077 148.754 137.534 1.00 102.60 ? 171 VAL A CG1   1 
ATOM 1066  C CG2   . VAL A 1 171 ? 100.320 148.145 135.883 1.00 102.60 ? 171 VAL A CG2   1 
ATOM 1067  N N     . ARG A 1 172 ? 103.433 145.582 135.095 1.00 114.00 ? 172 ARG A N     1 
ATOM 1068  C CA    . ARG A 1 172 ? 103.357 144.240 134.554 1.00 114.00 ? 172 ARG A CA    1 
ATOM 1069  C C     . ARG A 1 172 ? 103.510 143.263 135.705 1.00 114.00 ? 172 ARG A C     1 
ATOM 1070  O O     . ARG A 1 172 ? 104.222 143.511 136.682 1.00 114.00 ? 172 ARG A O     1 
ATOM 1071  C CB    . ARG A 1 172 ? 104.428 143.944 133.495 1.00 114.00 ? 172 ARG A CB    1 
ATOM 1072  C CG    . ARG A 1 172 ? 105.876 144.011 133.937 1.00 114.00 ? 172 ARG A CG    1 
ATOM 1073  C CD    . ARG A 1 172 ? 106.742 143.594 132.753 1.00 114.00 ? 172 ARG A CD    1 
ATOM 1074  N NE    . ARG A 1 172 ? 108.174 143.597 133.032 1.00 114.00 ? 172 ARG A NE    1 
ATOM 1075  C CZ    . ARG A 1 172 ? 109.106 143.333 132.122 1.00 114.00 ? 172 ARG A CZ    1 
ATOM 1076  N NH1   . ARG A 1 172 ? 108.754 143.056 130.873 1.00 114.00 ? 172 ARG A NH1   1 
ATOM 1077  N NH2   . ARG A 1 172 ? 110.389 143.358 132.453 1.00 114.00 ? 172 ARG A NH2   1 
ATOM 1078  N N     . ASP A 1 173 ? 102.837 142.138 135.537 1.00 121.56 ? 173 ASP A N     1 
ATOM 1079  C CA    . ASP A 1 173 ? 102.813 141.047 136.489 1.00 121.56 ? 173 ASP A CA    1 
ATOM 1080  C C     . ASP A 1 173 ? 104.163 140.355 136.642 1.00 121.56 ? 173 ASP A C     1 
ATOM 1081  O O     . ASP A 1 173 ? 104.940 140.257 135.689 1.00 121.56 ? 173 ASP A O     1 
ATOM 1082  C CB    . ASP A 1 173 ? 101.746 140.058 136.078 1.00 121.56 ? 173 ASP A CB    1 
ATOM 1083  C CG    . ASP A 1 173 ? 100.377 140.573 136.384 1.00 121.56 ? 173 ASP A CG    1 
ATOM 1084  O OD1   . ASP A 1 173 ? 100.189 141.205 137.445 1.00 121.56 ? 173 ASP A OD1   1 
ATOM 1085  O OD2   . ASP A 1 173 ? 99.514  140.424 135.519 1.00 121.56 ? 173 ASP A OD2   1 
ATOM 1086  N N     . PRO A 1 174 ? 104.448 139.848 137.841 1.00 121.73 ? 174 PRO A N     1 
ATOM 1087  C CA    . PRO A 1 174 ? 105.701 139.131 138.097 1.00 121.73 ? 174 PRO A CA    1 
ATOM 1088  C C     . PRO A 1 174 ? 105.777 137.726 137.515 1.00 121.73 ? 174 PRO A C     1 
ATOM 1089  O O     . PRO A 1 174 ? 106.737 137.013 137.823 1.00 121.73 ? 174 PRO A O     1 
ATOM 1090  C CB    . PRO A 1 174 ? 105.739 139.085 139.632 1.00 121.73 ? 174 PRO A CB    1 
ATOM 1091  C CG    . PRO A 1 174 ? 104.302 139.022 140.022 1.00 121.73 ? 174 PRO A CG    1 
ATOM 1092  C CD    . PRO A 1 174 ? 103.601 139.929 139.046 1.00 121.73 ? 174 PRO A CD    1 
ATOM 1093  N N     . GLY A 1 175 ? 104.815 137.281 136.699 1.00 129.53 ? 175 GLY A N     1 
ATOM 1094  C CA    . GLY A 1 175 ? 104.860 135.953 136.120 1.00 129.53 ? 175 GLY A CA    1 
ATOM 1095  C C     . GLY A 1 175 ? 103.834 134.948 136.610 1.00 129.53 ? 175 GLY A C     1 
ATOM 1096  O O     . GLY A 1 175 ? 103.603 133.954 135.908 1.00 129.53 ? 175 GLY A O     1 
ATOM 1097  N N     . THR A 1 176 ? 103.232 135.141 137.786 1.00 134.26 ? 176 THR A N     1 
ATOM 1098  C CA    . THR A 1 176 ? 102.286 134.149 138.291 1.00 134.26 ? 176 THR A CA    1 
ATOM 1099  C C     . THR A 1 176 ? 101.181 133.874 137.269 1.00 134.26 ? 176 THR A C     1 
ATOM 1100  O O     . THR A 1 176 ? 100.625 134.791 136.658 1.00 134.26 ? 176 THR A O     1 
ATOM 1101  C CB    . THR A 1 176 ? 101.689 134.621 139.615 1.00 134.26 ? 176 THR A CB    1 
ATOM 1102  O OG1   . THR A 1 176 ? 102.744 134.808 140.567 1.00 134.26 ? 176 THR A OG1   1 
ATOM 1103  C CG2   . THR A 1 176 ? 100.711 133.594 140.159 1.00 134.26 ? 176 THR A CG2   1 
ATOM 1104  N N     . ALA A 1 177 ? 100.878 132.585 137.095 1.00 136.16 ? 177 ALA A N     1 
ATOM 1105  C CA    . ALA A 1 177 ? 99.885  132.125 136.131 1.00 136.16 ? 177 ALA A CA    1 
ATOM 1106  C C     . ALA A 1 177 ? 98.456  132.563 136.439 1.00 136.16 ? 177 ALA A C     1 
ATOM 1107  O O     . ALA A 1 177 ? 98.039  132.643 137.598 1.00 136.16 ? 177 ALA A O     1 
ATOM 1108  C CB    . ALA A 1 177 ? 99.940  130.600 136.041 1.00 136.16 ? 177 ALA A CB    1 
ATOM 1109  N N     . ASP A 1 178 ? 97.713  132.845 135.363 1.00 132.78 ? 178 ASP A N     1 
ATOM 1110  C CA    . ASP A 1 178 ? 96.308  133.267 135.384 1.00 132.78 ? 178 ASP A CA    1 
ATOM 1111  C C     . ASP A 1 178 ? 96.096  134.496 136.267 1.00 132.78 ? 178 ASP A C     1 
ATOM 1112  O O     . ASP A 1 178 ? 94.997  134.750 136.763 1.00 132.78 ? 178 ASP A O     1 
ATOM 1113  C CB    . ASP A 1 178 ? 95.415  132.087 135.814 1.00 132.78 ? 178 ASP A CB    1 
ATOM 1114  C CG    . ASP A 1 178 ? 93.930  132.433 135.871 1.00 132.78 ? 178 ASP A CG    1 
ATOM 1115  O OD1   . ASP A 1 178 ? 93.293  132.522 134.800 1.00 132.78 ? 178 ASP A OD1   1 
ATOM 1116  O OD2   . ASP A 1 178 ? 93.397  132.589 136.992 1.00 132.78 ? 178 ASP A OD2   1 
ATOM 1117  N N     . ARG A 1 179 ? 97.165  135.264 136.458 1.00 128.63 ? 179 ARG A N     1 
ATOM 1118  C CA    . ARG A 1 179 ? 97.108  136.465 137.285 1.00 128.63 ? 179 ARG A CA    1 
ATOM 1119  C C     . ARG A 1 179 ? 97.390  137.740 136.491 1.00 128.63 ? 179 ARG A C     1 
ATOM 1120  O O     . ARG A 1 179 ? 98.486  138.297 136.566 1.00 128.63 ? 179 ARG A O     1 
ATOM 1121  C CB    . ARG A 1 179 ? 98.089  136.352 138.456 1.00 128.63 ? 179 ARG A CB    1 
ATOM 1122  C CG    . ARG A 1 179 ? 97.584  136.963 139.752 1.00 128.63 ? 179 ARG A CG    1 
ATOM 1123  C CD    . ARG A 1 179 ? 97.559  135.943 140.879 1.00 128.63 ? 179 ARG A CD    1 
ATOM 1124  N NE    . ARG A 1 179 ? 96.356  136.061 141.698 1.00 128.63 ? 179 ARG A NE    1 
ATOM 1125  C CZ    . ARG A 1 179 ? 96.355  136.427 142.976 1.00 128.63 ? 179 ARG A CZ    1 
ATOM 1126  N NH1   . ARG A 1 179 ? 97.496  136.711 143.587 1.00 128.63 ? 179 ARG A NH1   1 
ATOM 1127  N NH2   . ARG A 1 179 ? 95.213  136.508 143.644 1.00 128.63 ? 179 ARG A NH2   1 
ATOM 1128  N N     . SER A 1 180 ? 96.395  138.196 135.736 1.00 121.95 ? 180 SER A N     1 
ATOM 1129  C CA    . SER A 1 180 ? 96.520  139.411 134.933 1.00 121.95 ? 180 SER A CA    1 
ATOM 1130  C C     . SER A 1 180 ? 97.764  139.415 134.046 1.00 121.95 ? 180 SER A C     1 
ATOM 1131  O O     . SER A 1 180 ? 98.525  138.448 134.021 1.00 121.95 ? 180 SER A O     1 
ATOM 1132  C CB    . SER A 1 180 ? 96.516  140.649 135.833 1.00 20.00  ? 180 SER A CB    1 
ATOM 1133  O OG    . SER A 1 180 ? 96.896  140.317 137.158 1.00 20.00  ? 180 SER A OG    1 
ATOM 1134  N N     . ARG A 1 181 ? 97.961  140.514 133.322 1.00 118.37 ? 181 ARG A N     1 
ATOM 1135  C CA    . ARG A 1 181 ? 99.108  140.656 132.430 1.00 118.37 ? 181 ARG A CA    1 
ATOM 1136  C C     . ARG A 1 181 ? 99.841  141.974 132.672 1.00 118.37 ? 181 ARG A C     1 
ATOM 1137  O O     . ARG A 1 181 ? 100.209 142.289 133.804 1.00 118.37 ? 181 ARG A O     1 
ATOM 1138  C CB    . ARG A 1 181 ? 98.665  140.562 130.969 1.00 118.37 ? 181 ARG A CB    1 
ATOM 1139  C CG    . ARG A 1 181 ? 97.567  141.542 130.588 1.00 118.37 ? 181 ARG A CG    1 
ATOM 1140  C CD    . ARG A 1 181 ? 96.716  141.003 129.451 1.00 118.37 ? 181 ARG A CD    1 
ATOM 1141  N NE    . ARG A 1 181 ? 95.904  139.863 129.867 1.00 118.37 ? 181 ARG A NE    1 
ATOM 1142  C CZ    . ARG A 1 181 ? 94.801  139.961 130.602 1.00 118.37 ? 181 ARG A CZ    1 
ATOM 1143  N NH1   . ARG A 1 181 ? 94.373  141.150 131.006 1.00 118.37 ? 181 ARG A NH1   1 
ATOM 1144  N NH2   . ARG A 1 181 ? 94.124  138.870 130.935 1.00 118.37 ? 181 ARG A NH2   1 
ATOM 1145  N N     . LYS A 1 182 ? 100.051 142.740 131.605 1.00 106.31 ? 182 LYS A N     1 
ATOM 1146  C CA    . LYS A 1 182 ? 100.739 144.016 131.710 1.00 106.31 ? 182 LYS A CA    1 
ATOM 1147  C C     . LYS A 1 182 ? 99.887  145.057 131.011 1.00 106.31 ? 182 LYS A C     1 
ATOM 1148  O O     . LYS A 1 182 ? 99.154  144.733 130.071 1.00 106.31 ? 182 LYS A O     1 
ATOM 1149  C CB    . LYS A 1 182 ? 102.126 143.977 131.060 1.00 106.31 ? 182 LYS A CB    1 
ATOM 1150  C CG    . LYS A 1 182 ? 102.107 143.715 129.560 1.00 106.31 ? 182 LYS A CG    1 
ATOM 1151  C CD    . LYS A 1 182 ? 103.511 143.662 128.977 1.00 106.31 ? 182 LYS A CD    1 
ATOM 1152  C CE    . LYS A 1 182 ? 103.473 143.424 127.483 1.00 106.31 ? 182 LYS A CE    1 
ATOM 1153  N NZ    . LYS A 1 182 ? 102.820 144.552 126.782 1.00 106.31 ? 182 LYS A NZ    1 
ATOM 1154  N N     . ILE A 1 183 ? 100.025 146.317 131.443 1.00 86.58  ? 183 ILE A N     1 
ATOM 1155  C CA    . ILE A 1 183 ? 99.234  147.403 130.866 1.00 86.58  ? 183 ILE A CA    1 
ATOM 1156  C C     . ILE A 1 183 ? 99.570  148.693 131.620 1.00 86.58  ? 183 ILE A C     1 
ATOM 1157  O O     . ILE A 1 183 ? 100.564 148.753 132.347 1.00 86.58  ? 183 ILE A O     1 
ATOM 1158  C CB    . ILE A 1 183 ? 97.726  147.070 130.871 1.00 86.58  ? 183 ILE A CB    1 
ATOM 1159  N N     . ARG A 1 184 ? 98.718  149.707 131.491 1.00 65.93  ? 184 ARG A N     1 
ATOM 1160  C CA    . ARG A 1 184 ? 98.912  151.055 131.989 1.00 65.93  ? 184 ARG A CA    1 
ATOM 1161  C C     . ARG A 1 184 ? 97.576  151.596 132.478 1.00 65.93  ? 184 ARG A C     1 
ATOM 1162  O O     . ARG A 1 184 ? 96.543  151.432 131.824 1.00 65.93  ? 184 ARG A O     1 
ATOM 1163  C CB    . ARG A 1 184 ? 99.491  151.909 130.849 1.00 65.93  ? 184 ARG A CB    1 
ATOM 1164  C CG    . ARG A 1 184 ? 99.663  153.388 131.087 1.00 65.93  ? 184 ARG A CG    1 
ATOM 1165  C CD    . ARG A 1 184 ? 98.452  154.166 130.585 1.00 65.93  ? 184 ARG A CD    1 
ATOM 1166  N NE    . ARG A 1 184 ? 98.630  155.599 130.776 1.00 65.93  ? 184 ARG A NE    1 
ATOM 1167  C CZ    . ARG A 1 184 ? 97.669  156.509 130.716 1.00 65.93  ? 184 ARG A CZ    1 
ATOM 1168  N NH1   . ARG A 1 184 ? 96.421  156.149 130.482 1.00 65.93  ? 184 ARG A NH1   1 
ATOM 1169  N NH2   . ARG A 1 184 ? 97.965  157.786 130.905 1.00 65.93  ? 184 ARG A NH2   1 
ATOM 1170  N N     . HIS A 1 185 ? 97.631  152.255 133.637 1.00 54.33  ? 185 HIS A N     1 
ATOM 1171  C CA    . HIS A 1 185 ? 96.516  152.909 134.295 1.00 54.33  ? 185 HIS A CA    1 
ATOM 1172  C C     . HIS A 1 185 ? 96.903  154.333 134.677 1.00 54.33  ? 185 HIS A C     1 
ATOM 1173  O O     . HIS A 1 185 ? 97.988  154.547 135.244 1.00 54.33  ? 185 HIS A O     1 
ATOM 1174  C CB    . HIS A 1 185 ? 96.169  152.086 135.546 1.00 54.33  ? 185 HIS A CB    1 
ATOM 1175  C CG    . HIS A 1 185 ? 95.049  152.638 136.363 1.00 54.33  ? 185 HIS A CG    1 
ATOM 1176  N ND1   . HIS A 1 185 ? 93.722  152.441 136.044 1.00 54.33  ? 185 HIS A ND1   1 
ATOM 1177  C CD2   . HIS A 1 185 ? 95.058  153.366 137.505 1.00 54.33  ? 185 HIS A CD2   1 
ATOM 1178  C CE1   . HIS A 1 185 ? 92.965  153.024 136.955 1.00 54.33  ? 185 HIS A CE1   1 
ATOM 1179  N NE2   . HIS A 1 185 ? 93.750  153.599 137.847 1.00 54.33  ? 185 HIS A NE2   1 
ATOM 1180  N N     . PRO A 1 186 ? 96.054  155.325 134.408 1.00 51.48  ? 186 PRO A N     1 
ATOM 1181  C CA    . PRO A 1 186 ? 96.394  156.704 134.785 1.00 51.48  ? 186 PRO A CA    1 
ATOM 1182  C C     . PRO A 1 186 ? 95.665  157.193 136.027 1.00 51.48  ? 186 PRO A C     1 
ATOM 1183  O O     . PRO A 1 186 ? 94.439  157.341 136.011 1.00 51.48  ? 186 PRO A O     1 
ATOM 1184  C CB    . PRO A 1 186 ? 95.967  157.494 133.545 1.00 51.48  ? 186 PRO A CB    1 
ATOM 1185  C CG    . PRO A 1 186 ? 94.732  156.756 133.103 1.00 51.48  ? 186 PRO A CG    1 
ATOM 1186  C CD    . PRO A 1 186 ? 95.023  155.286 133.358 1.00 51.48  ? 186 PRO A CD    1 
ATOM 1187  N N     . ALA A 1 187 ? 96.385  157.440 137.115 1.00 45.28  ? 187 ALA A N     1 
ATOM 1188  C CA    . ALA A 1 187 ? 95.714  157.839 138.340 1.00 45.28  ? 187 ALA A CA    1 
ATOM 1189  C C     . ALA A 1 187 ? 95.740  159.359 138.506 1.00 45.28  ? 187 ALA A C     1 
ATOM 1190  O O     . ALA A 1 187 ? 96.521  160.068 137.866 1.00 45.28  ? 187 ALA A O     1 
ATOM 1191  C CB    . ALA A 1 187 ? 96.373  157.147 139.530 1.00 45.28  ? 187 ALA A CB    1 
ATOM 1192  N N     . VAL A 1 188 ? 94.873  159.855 139.393 1.00 43.16  ? 188 VAL A N     1 
ATOM 1193  C CA    . VAL A 1 188 ? 94.751  161.278 139.689 1.00 43.16  ? 188 VAL A CA    1 
ATOM 1194  C C     . VAL A 1 188 ? 94.519  161.501 141.181 1.00 43.16  ? 188 VAL A C     1 
ATOM 1195  O O     . VAL A 1 188 ? 93.838  160.715 141.843 1.00 43.16  ? 188 VAL A O     1 
ATOM 1196  C CB    . VAL A 1 188 ? 93.643  161.941 138.843 1.00 43.16  ? 188 VAL A CB    1 
ATOM 1197  C CG1   . VAL A 1 188 ? 94.067  162.021 137.385 1.00 43.16  ? 188 VAL A CG1   1 
ATOM 1198  C CG2   . VAL A 1 188 ? 92.395  161.139 138.935 1.00 43.16  ? 188 VAL A CG2   1 
ATOM 1199  N N     . ARG A 1 189 ? 95.020  162.628 141.687 1.00 43.71  ? 189 ARG A N     1 
ATOM 1200  C CA    . ARG A 1 189 ? 94.938  163.021 143.099 1.00 43.71  ? 189 ARG A CA    1 
ATOM 1201  C C     . ARG A 1 189 ? 94.164  164.342 143.191 1.00 43.71  ? 189 ARG A C     1 
ATOM 1202  O O     . ARG A 1 189 ? 94.687  165.420 142.895 1.00 43.71  ? 189 ARG A O     1 
ATOM 1203  C CB    . ARG A 1 189 ? 96.318  163.075 143.774 1.00 43.71  ? 189 ARG A CB    1 
ATOM 1204  C CG    . ARG A 1 189 ? 97.438  163.869 143.102 1.00 43.71  ? 189 ARG A CG    1 
ATOM 1205  C CD    . ARG A 1 189 ? 97.508  165.300 143.588 1.00 43.71  ? 189 ARG A CD    1 
ATOM 1206  N NE    . ARG A 1 189 ? 97.774  165.404 145.015 1.00 43.71  ? 189 ARG A NE    1 
ATOM 1207  C CZ    . ARG A 1 189 ? 97.164  166.280 145.803 1.00 43.71  ? 189 ARG A CZ    1 
ATOM 1208  N NH1   . ARG A 1 189 ? 96.255  167.098 145.291 1.00 43.71  ? 189 ARG A NH1   1 
ATOM 1209  N NH2   . ARG A 1 189 ? 97.447  166.328 147.097 1.00 43.71  ? 189 ARG A NH2   1 
ATOM 1210  N N     . PHE A 1 190 ? 92.881  164.224 143.531 1.00 41.78  ? 190 PHE A N     1 
ATOM 1211  C CA    . PHE A 1 190 ? 91.988  165.346 143.783 1.00 41.78  ? 190 PHE A CA    1 
ATOM 1212  C C     . PHE A 1 190 ? 92.060  165.765 145.254 1.00 41.78  ? 190 PHE A C     1 
ATOM 1213  O O     . PHE A 1 190 ? 92.023  164.918 146.147 1.00 41.78  ? 190 PHE A O     1 
ATOM 1214  C CB    . PHE A 1 190 ? 90.565  164.960 143.385 1.00 41.78  ? 190 PHE A CB    1 
ATOM 1215  C CG    . PHE A 1 190 ? 90.433  164.514 141.937 1.00 41.78  ? 190 PHE A CG    1 
ATOM 1216  C CD1   . PHE A 1 190 ? 90.361  165.415 140.896 1.00 41.78  ? 190 PHE A CD1   1 
ATOM 1217  C CD2   . PHE A 1 190 ? 90.253  163.181 141.640 1.00 41.78  ? 190 PHE A CD2   1 
ATOM 1218  C CE1   . PHE A 1 190 ? 90.209  164.996 139.591 1.00 41.78  ? 190 PHE A CE1   1 
ATOM 1219  C CE2   . PHE A 1 190 ? 90.069  162.761 140.352 1.00 41.78  ? 190 PHE A CE2   1 
ATOM 1220  C CZ    . PHE A 1 190 ? 90.061  163.667 139.321 1.00 41.78  ? 190 PHE A CZ    1 
ATOM 1221  N N     . ASP A 1 191 ? 92.172  167.071 145.502 1.00 36.48  ? 191 ASP A N     1 
ATOM 1222  C CA    . ASP A 1 191 ? 92.224  167.637 146.851 1.00 36.48  ? 191 ASP A CA    1 
ATOM 1223  C C     . ASP A 1 191 ? 91.342  168.871 146.989 1.00 36.48  ? 191 ASP A C     1 
ATOM 1224  O O     . ASP A 1 191 ? 91.360  169.741 146.114 1.00 36.48  ? 191 ASP A O     1 
ATOM 1225  C CB    . ASP A 1 191 ? 93.686  167.994 147.171 1.00 36.48  ? 191 ASP A CB    1 
ATOM 1226  C CG    . ASP A 1 191 ? 93.898  168.500 148.586 1.00 36.48  ? 191 ASP A CG    1 
ATOM 1227  O OD1   . ASP A 1 191 ? 92.938  168.593 149.373 1.00 36.48  ? 191 ASP A OD1   1 
ATOM 1228  O OD2   . ASP A 1 191 ? 95.064  168.794 148.916 1.00 36.48  ? 191 ASP A OD2   1 
ATOM 1229  N N     . GLY A 1 192 ? 90.563  168.953 148.074 1.00 31.68  ? 192 GLY A N     1 
ATOM 1230  C CA    . GLY A 1 192 ? 89.804  170.183 148.272 1.00 31.68  ? 192 GLY A CA    1 
ATOM 1231  C C     . GLY A 1 192 ? 88.804  170.191 149.420 1.00 31.68  ? 192 GLY A C     1 
ATOM 1232  O O     . GLY A 1 192 ? 89.054  169.634 150.488 1.00 31.68  ? 192 GLY A O     1 
ATOM 1233  N N     . GLU A 1 193 ? 87.695  170.900 149.193 1.00 26.63  ? 193 GLU A N     1 
ATOM 1234  C CA    . GLU A 1 193 ? 86.609  171.107 150.149 1.00 26.63  ? 193 GLU A CA    1 
ATOM 1235  C C     . GLU A 1 193 ? 85.291  170.677 149.519 1.00 26.63  ? 193 GLU A C     1 
ATOM 1236  O O     . GLU A 1 193 ? 84.993  171.066 148.387 1.00 26.63  ? 193 GLU A O     1 
ATOM 1237  C CB    . GLU A 1 193 ? 86.499  172.566 150.615 1.00 26.63  ? 193 GLU A CB    1 
ATOM 1238  C CG    . GLU A 1 193 ? 86.181  173.578 149.529 1.00 26.63  ? 193 GLU A CG    1 
ATOM 1239  C CD    . GLU A 1 193 ? 86.054  174.990 150.067 1.00 26.63  ? 193 GLU A CD    1 
ATOM 1240  O OE1   . GLU A 1 193 ? 86.273  175.197 151.279 1.00 26.63  ? 193 GLU A OE1   1 
ATOM 1241  O OE2   . GLU A 1 193 ? 85.708  175.893 149.277 1.00 26.63  ? 193 GLU A OE2   1 
ATOM 1242  N N     . ALA A 1 194 ? 84.505  169.869 150.223 1.00 23.47  ? 194 ALA A N     1 
ATOM 1243  C CA    . ALA A 1 194 ? 83.198  169.525 149.681 1.00 23.47  ? 194 ALA A CA    1 
ATOM 1244  C C     . ALA A 1 194 ? 82.062  169.977 150.580 1.00 23.47  ? 194 ALA A C     1 
ATOM 1245  O O     . ALA A 1 194 ? 82.229  170.208 151.780 1.00 23.47  ? 194 ALA A O     1 
ATOM 1246  C CB    . ALA A 1 194 ? 83.052  168.016 149.485 1.00 23.47  ? 194 ALA A CB    1 
ATOM 1247  N N     . VAL A 1 195 ? 80.898  170.122 149.947 1.00 22.95  ? 195 VAL A N     1 
ATOM 1248  C CA    . VAL A 1 195 ? 79.610  170.232 150.615 1.00 22.95  ? 195 VAL A CA    1 
ATOM 1249  C C     . VAL A 1 195 ? 78.817  168.947 150.402 1.00 22.95  ? 195 VAL A C     1 
ATOM 1250  O O     . VAL A 1 195 ? 78.807  168.372 149.303 1.00 22.95  ? 195 VAL A O     1 
ATOM 1251  C CB    . VAL A 1 195 ? 78.839  171.464 150.091 1.00 22.95  ? 195 VAL A CB    1 
ATOM 1252  C CG1   . VAL A 1 195 ? 78.522  171.330 148.614 1.00 22.95  ? 195 VAL A CG1   1 
ATOM 1253  C CG2   . VAL A 1 195 ? 77.564  171.660 150.852 1.00 22.95  ? 195 VAL A CG2   1 
ATOM 1254  N N     . ILE A 1 196 ? 78.169  168.499 151.471 1.00 20.03  ? 196 ILE A N     1 
ATOM 1255  C CA    . ILE A 1 196 ? 77.348  167.295 151.525 1.00 20.03  ? 196 ILE A CA    1 
ATOM 1256  C C     . ILE A 1 196 ? 75.906  167.625 151.154 1.00 20.03  ? 196 ILE A C     1 
ATOM 1257  O O     . ILE A 1 196 ? 75.405  168.705 151.483 1.00 20.03  ? 196 ILE A O     1 
ATOM 1258  C CB    . ILE A 1 196 ? 77.442  166.650 152.919 1.00 20.03  ? 196 ILE A CB    1 
ATOM 1259  C CG1   . ILE A 1 196 ? 78.906  166.451 153.305 1.00 20.03  ? 196 ILE A CG1   1 
ATOM 1260  C CG2   . ILE A 1 196 ? 76.705  165.325 152.944 1.00 20.03  ? 196 ILE A CG2   1 
ATOM 1261  C CD1   . ILE A 1 196 ? 79.101  165.819 154.661 1.00 20.03  ? 196 ILE A CD1   1 
ATOM 1262  N N     . SER A 1 197 ? 75.264  166.745 150.382 1.00 21.11  ? 197 SER A N     1 
ATOM 1263  C CA    . SER A 1 197 ? 73.873  166.927 149.982 1.00 21.11  ? 197 SER A CA    1 
ATOM 1264  C C     . SER A 1 197 ? 72.945  165.776 150.370 1.00 21.11  ? 197 SER A C     1 
ATOM 1265  O O     . SER A 1 197 ? 71.725  165.973 150.373 1.00 21.11  ? 197 SER A O     1 
ATOM 1266  C CB    . SER A 1 197 ? 73.760  167.171 148.467 1.00 21.11  ? 197 SER A CB    1 
ATOM 1267  O OG    . SER A 1 197 ? 72.412  167.385 148.090 1.00 21.11  ? 197 SER A OG    1 
ATOM 1268  N N     . ASP A 1 198 ? 73.476  164.597 150.705 1.00 20.28  ? 198 ASP A N     1 
ATOM 1269  C CA    . ASP A 1 198 ? 72.635  163.438 151.043 1.00 20.28  ? 198 ASP A CA    1 
ATOM 1270  C C     . ASP A 1 198 ? 73.512  162.426 151.791 1.00 20.28  ? 198 ASP A C     1 
ATOM 1271  O O     . ASP A 1 198 ? 74.234  161.646 151.169 1.00 20.28  ? 198 ASP A O     1 
ATOM 1272  C CB    . ASP A 1 198 ? 71.991  162.811 149.823 1.00 20.28  ? 198 ASP A CB    1 
ATOM 1273  C CG    . ASP A 1 198 ? 71.066  161.659 150.182 1.00 20.28  ? 198 ASP A CG    1 
ATOM 1274  O OD1   . ASP A 1 198 ? 70.667  161.564 151.361 1.00 20.28  ? 198 ASP A OD1   1 
ATOM 1275  O OD2   . ASP A 1 198 ? 70.739  160.852 149.290 1.00 20.28  ? 198 ASP A OD2   1 
ATOM 1276  N N     . VAL A 1 199 ? 73.448  162.473 153.129 1.00 19.68  ? 199 VAL A N     1 
ATOM 1277  C CA    . VAL A 1 199 ? 74.373  161.724 153.984 1.00 19.68  ? 199 VAL A CA    1 
ATOM 1278  C C     . VAL A 1 199 ? 74.478  160.258 153.557 1.00 19.68  ? 199 VAL A C     1 
ATOM 1279  O O     . VAL A 1 199 ? 75.586  159.730 153.387 1.00 19.68  ? 199 VAL A O     1 
ATOM 1280  C CB    . VAL A 1 199 ? 73.966  161.876 155.465 1.00 19.68  ? 199 VAL A CB    1 
ATOM 1281  C CG1   . VAL A 1 199 ? 73.857  163.349 155.827 1.00 19.68  ? 199 VAL A CG1   1 
ATOM 1282  C CG2   . VAL A 1 199 ? 72.629  161.190 155.767 1.00 19.68  ? 199 VAL A CG2   1 
ATOM 1283  N N     . ASP A 1 200 ? 73.348  159.566 153.384 1.00 22.92  ? 200 ASP A N     1 
ATOM 1284  C CA    . ASP A 1 200 ? 73.455  158.137 153.094 1.00 22.92  ? 200 ASP A CA    1 
ATOM 1285  C C     . ASP A 1 200 ? 74.068  157.915 151.718 1.00 22.92  ? 200 ASP A C     1 
ATOM 1286  O O     . ASP A 1 200 ? 74.750  156.907 151.489 1.00 22.92  ? 200 ASP A O     1 
ATOM 1287  C CB    . ASP A 1 200 ? 72.093  157.459 153.194 1.00 22.92  ? 200 ASP A CB    1 
ATOM 1288  C CG    . ASP A 1 200 ? 71.597  157.367 154.620 1.00 22.92  ? 200 ASP A CG    1 
ATOM 1289  O OD1   . ASP A 1 200 ? 72.444  157.310 155.533 1.00 22.92  ? 200 ASP A OD1   1 
ATOM 1290  O OD2   . ASP A 1 200 ? 70.364  157.355 154.828 1.00 22.92  ? 200 ASP A OD2   1 
ATOM 1291  N N     . ALA A 1 201 ? 73.879  158.873 150.806 1.00 22.63  ? 201 ALA A N     1 
ATOM 1292  C CA    . ALA A 1 201 ? 74.421  158.720 149.463 1.00 22.63  ? 201 ALA A CA    1 
ATOM 1293  C C     . ALA A 1 201 ? 75.928  158.893 149.512 1.00 22.63  ? 201 ALA A C     1 
ATOM 1294  O O     . ALA A 1 201 ? 76.677  158.163 148.850 1.00 22.63  ? 201 ALA A O     1 
ATOM 1295  C CB    . ALA A 1 201 ? 73.781  159.731 148.514 1.00 22.63  ? 201 ALA A CB    1 
ATOM 1296  N N     . VAL A 1 202 ? 76.381  159.867 150.300 1.00 26.39  ? 202 VAL A N     1 
ATOM 1297  C CA    . VAL A 1 202 ? 77.806  160.058 150.523 1.00 26.39  ? 202 VAL A CA    1 
ATOM 1298  C C     . VAL A 1 202 ? 78.396  158.795 151.134 1.00 26.39  ? 202 VAL A C     1 
ATOM 1299  O O     . VAL A 1 202 ? 79.533  158.418 150.836 1.00 26.39  ? 202 VAL A O     1 
ATOM 1300  C CB    . VAL A 1 202 ? 78.053  161.289 151.413 1.00 26.39  ? 202 VAL A CB    1 
ATOM 1301  C CG1   . VAL A 1 202 ? 79.533  161.402 151.771 1.00 26.39  ? 202 VAL A CG1   1 
ATOM 1302  C CG2   . VAL A 1 202 ? 77.563  162.544 150.716 1.00 26.39  ? 202 VAL A CG2   1 
ATOM 1303  N N     . ARG A 1 203 ? 77.621  158.111 151.984 1.00 31.86  ? 203 ARG A N     1 
ATOM 1304  C CA    . ARG A 1 203 ? 78.104  156.867 152.572 1.00 31.86  ? 203 ARG A CA    1 
ATOM 1305  C C     . ARG A 1 203 ? 78.281  155.808 151.493 1.00 31.86  ? 203 ARG A C     1 
ATOM 1306  O O     . ARG A 1 203 ? 79.265  155.047 151.505 1.00 31.86  ? 203 ARG A O     1 
ATOM 1307  C CB    . ARG A 1 203 ? 77.103  156.387 153.623 1.00 31.86  ? 203 ARG A CB    1 
ATOM 1308  C CG    . ARG A 1 203 ? 77.458  155.098 154.310 1.00 31.86  ? 203 ARG A CG    1 
ATOM 1309  C CD    . ARG A 1 203 ? 78.768  155.241 155.067 1.00 31.86  ? 203 ARG A CD    1 
ATOM 1310  N NE    . ARG A 1 203 ? 79.088  154.043 155.846 1.00 31.86  ? 203 ARG A NE    1 
ATOM 1311  C CZ    . ARG A 1 203 ? 80.045  153.176 155.540 1.00 31.86  ? 203 ARG A CZ    1 
ATOM 1312  N NH1   . ARG A 1 203 ? 80.760  153.348 154.440 1.00 31.86  ? 203 ARG A NH1   1 
ATOM 1313  N NH2   . ARG A 1 203 ? 80.254  152.112 156.309 1.00 31.86  ? 203 ARG A NH2   1 
ATOM 1314  N N     . HIS A 1 204 ? 77.356  155.777 150.527 1.00 29.41  ? 204 HIS A N     1 
ATOM 1315  C CA    . HIS A 1 204 ? 77.497  154.860 149.401 1.00 29.41  ? 204 HIS A CA    1 
ATOM 1316  C C     . HIS A 1 204 ? 78.750  155.155 148.601 1.00 29.41  ? 204 HIS A C     1 
ATOM 1317  O O     . HIS A 1 204 ? 79.512  154.240 148.272 1.00 29.41  ? 204 HIS A O     1 
ATOM 1318  C CB    . HIS A 1 204 ? 76.285  154.937 148.484 1.00 29.41  ? 204 HIS A CB    1 
ATOM 1319  C CG    . HIS A 1 204 ? 75.029  154.396 149.082 1.00 29.41  ? 204 HIS A CG    1 
ATOM 1320  N ND1   . HIS A 1 204 ? 73.936  154.057 148.317 1.00 29.41  ? 204 HIS A ND1   1 
ATOM 1321  C CD2   . HIS A 1 204 ? 74.723  154.041 150.352 1.00 29.41  ? 204 HIS A CD2   1 
ATOM 1322  C CE1   . HIS A 1 204 ? 72.998  153.550 149.094 1.00 29.41  ? 204 HIS A CE1   1 
ATOM 1323  N NE2   . HIS A 1 204 ? 73.448  153.531 150.334 1.00 29.41  ? 204 HIS A NE2   1 
ATOM 1324  N N     . ALA A 1 205 ? 79.004  156.433 148.316 1.00 30.89  ? 205 ALA A N     1 
ATOM 1325  C CA    . ALA A 1 205 ? 80.202  156.794 147.565 1.00 30.89  ? 205 ALA A CA    1 
ATOM 1326  C C     . ALA A 1 205 ? 81.468  156.427 148.331 1.00 30.89  ? 205 ALA A C     1 
ATOM 1327  O O     . ALA A 1 205 ? 82.400  155.842 147.768 1.00 30.89  ? 205 ALA A O     1 
ATOM 1328  C CB    . ALA A 1 205 ? 80.173  158.287 147.234 1.00 30.89  ? 205 ALA A CB    1 
ATOM 1329  N N     . VAL A 1 206 ? 81.542  156.813 149.606 1.00 31.00  ? 206 VAL A N     1 
ATOM 1330  C CA    . VAL A 1 206 ? 82.751  156.566 150.388 1.00 31.00  ? 206 VAL A CA    1 
ATOM 1331  C C     . VAL A 1 206 ? 83.047  155.071 150.468 1.00 31.00  ? 206 VAL A C     1 
ATOM 1332  O O     . VAL A 1 206 ? 84.213  154.657 150.401 1.00 31.00  ? 206 VAL A O     1 
ATOM 1333  C CB    . VAL A 1 206 ? 82.653  157.213 151.783 1.00 31.00  ? 206 VAL A CB    1 
ATOM 1334  C CG1   . VAL A 1 206 ? 83.859  156.829 152.632 1.00 31.00  ? 206 VAL A CG1   1 
ATOM 1335  C CG2   . VAL A 1 206 ? 82.576  158.727 151.658 1.00 31.00  ? 206 VAL A CG2   1 
ATOM 1336  N N     . LEU A 1 207 ? 82.010  154.223 150.588 1.00 32.97  ? 207 LEU A N     1 
ATOM 1337  C CA    . LEU A 1 207 ? 82.329  152.805 150.767 1.00 32.97  ? 207 LEU A CA    1 
ATOM 1338  C C     . LEU A 1 207 ? 82.459  152.025 149.463 1.00 32.97  ? 207 LEU A C     1 
ATOM 1339  O O     . LEU A 1 207 ? 83.230  151.059 149.413 1.00 32.97  ? 207 LEU A O     1 
ATOM 1340  C CB    . LEU A 1 207 ? 81.263  152.129 151.645 1.00 32.97  ? 207 LEU A CB    1 
ATOM 1341  C CG    . LEU A 1 207 ? 81.403  150.667 152.109 1.00 32.97  ? 207 LEU A CG    1 
ATOM 1342  C CD1   . LEU A 1 207 ? 80.604  150.423 153.374 1.00 32.97  ? 207 LEU A CD1   1 
ATOM 1343  C CD2   . LEU A 1 207 ? 80.944  149.675 151.045 1.00 32.97  ? 207 LEU A CD2   1 
ATOM 1344  N N     . ASN A 1 208 ? 81.764  152.413 148.392 1.00 35.52  ? 208 ASN A N     1 
ATOM 1345  C CA    . ASN A 1 208 ? 81.924  151.642 147.161 1.00 35.52  ? 208 ASN A CA    1 
ATOM 1346  C C     . ASN A 1 208 ? 83.176  152.067 146.399 1.00 35.52  ? 208 ASN A C     1 
ATOM 1347  O O     . ASN A 1 208 ? 83.845  151.230 145.785 1.00 35.52  ? 208 ASN A O     1 
ATOM 1348  C CB    . ASN A 1 208 ? 80.659  151.705 146.292 1.00 35.52  ? 208 ASN A CB    1 
ATOM 1349  C CG    . ASN A 1 208 ? 80.308  153.103 145.841 1.00 35.52  ? 208 ASN A CG    1 
ATOM 1350  O OD1   . ASN A 1 208 ? 81.159  153.979 145.742 1.00 35.52  ? 208 ASN A OD1   1 
ATOM 1351  N ND2   . ASN A 1 208 ? 79.031  153.315 145.554 1.00 35.52  ? 208 ASN A ND2   1 
ATOM 1352  N N     . GLY A 1 209 ? 83.492  153.356 146.422 1.00 34.78  ? 209 GLY A N     1 
ATOM 1353  C CA    . GLY A 1 209 ? 84.550  153.911 145.610 1.00 34.78  ? 209 GLY A CA    1 
ATOM 1354  C C     . GLY A 1 209 ? 84.005  154.612 144.377 1.00 34.78  ? 209 GLY A C     1 
ATOM 1355  O O     . GLY A 1 209 ? 82.909  154.330 143.893 1.00 34.78  ? 209 GLY A O     1 
ATOM 1356  N N     . ILE A 1 210 ? 84.805  155.522 143.834 1.00 36.34  ? 210 ILE A N     1 
ATOM 1357  C CA    . ILE A 1 210 ? 84.390  156.312 142.684 1.00 36.34  ? 210 ILE A CA    1 
ATOM 1358  C C     . ILE A 1 210 ? 85.438  156.143 141.593 1.00 36.34  ? 210 ILE A C     1 
ATOM 1359  O O     . ILE A 1 210 ? 86.570  156.625 141.729 1.00 36.34  ? 210 ILE A O     1 
ATOM 1360  C CB    . ILE A 1 210 ? 84.189  157.796 143.030 1.00 36.34  ? 210 ILE A CB    1 
ATOM 1361  C CG1   . ILE A 1 210 ? 83.145  157.969 144.142 1.00 36.34  ? 210 ILE A CG1   1 
ATOM 1362  C CG2   . ILE A 1 210 ? 83.756  158.573 141.795 1.00 36.34  ? 210 ILE A CG2   1 
ATOM 1363  C CD1   . ILE A 1 210 ? 83.694  157.889 145.561 1.00 36.34  ? 210 ILE A CD1   1 
ATOM 1364  N N     . GLY A 1 211 ? 85.064  155.455 140.525 1.00 39.28  ? 211 GLY A N     1 
ATOM 1365  C CA    . GLY A 1 211 ? 85.870  155.297 139.333 1.00 39.28  ? 211 GLY A CA    1 
ATOM 1366  C C     . GLY A 1 211 ? 86.467  153.903 139.229 1.00 39.28  ? 211 GLY A C     1 
ATOM 1367  O O     . GLY A 1 211 ? 86.454  153.105 140.165 1.00 39.28  ? 211 GLY A O     1 
ATOM 1368  N N     . ARG A 1 212 ? 87.003  153.630 138.044 1.00 37.99  ? 212 ARG A N     1 
ATOM 1369  C CA    . ARG A 1 212 ? 87.654  152.366 137.741 1.00 37.99  ? 212 ARG A CA    1 
ATOM 1370  C C     . ARG A 1 212 ? 88.971  152.215 138.506 1.00 37.99  ? 212 ARG A C     1 
ATOM 1371  O O     . ARG A 1 212 ? 89.432  153.116 139.213 1.00 37.99  ? 212 ARG A O     1 
ATOM 1372  C CB    . ARG A 1 212 ? 87.848  152.244 136.234 1.00 37.99  ? 212 ARG A CB    1 
ATOM 1373  C CG    . ARG A 1 212 ? 86.552  151.930 135.514 1.00 37.99  ? 212 ARG A CG    1 
ATOM 1374  C CD    . ARG A 1 212 ? 86.732  151.848 134.014 1.00 37.99  ? 212 ARG A CD    1 
ATOM 1375  N NE    . ARG A 1 212 ? 85.471  151.542 133.344 1.00 37.99  ? 212 ARG A NE    1 
ATOM 1376  C CZ    . ARG A 1 212 ? 84.523  152.434 133.082 1.00 37.99  ? 212 ARG A CZ    1 
ATOM 1377  N NH1   . ARG A 1 212 ? 84.677  153.700 133.433 1.00 37.99  ? 212 ARG A NH1   1 
ATOM 1378  N NH2   . ARG A 1 212 ? 83.415  152.060 132.463 1.00 37.99  ? 212 ARG A NH2   1 
ATOM 1379  N N     . GLY A 1 213 ? 89.575  151.043 138.342 1.00 49.05  ? 213 GLY A N     1 
ATOM 1380  C CA    . GLY A 1 213 ? 90.896  150.739 138.871 1.00 49.05  ? 213 GLY A CA    1 
ATOM 1381  C C     . GLY A 1 213 ? 91.062  150.876 140.368 1.00 49.05  ? 213 GLY A C     1 
ATOM 1382  O O     . GLY A 1 213 ? 92.107  151.343 140.836 1.00 49.05  ? 213 GLY A O     1 
ATOM 1383  N N     . LYS A 1 214 ? 90.038  150.503 141.133 1.00 53.71  ? 214 LYS A N     1 
ATOM 1384  C CA    . LYS A 1 214 ? 90.144  150.549 142.586 1.00 53.71  ? 214 LYS A CA    1 
ATOM 1385  C C     . LYS A 1 214 ? 91.252  149.637 143.098 1.00 53.71  ? 214 LYS A C     1 
ATOM 1386  O O     . LYS A 1 214 ? 91.806  149.878 144.176 1.00 53.71  ? 214 LYS A O     1 
ATOM 1387  C CB    . LYS A 1 214 ? 88.790  150.223 143.205 1.00 53.71  ? 214 LYS A CB    1 
ATOM 1388  C CG    . LYS A 1 214 ? 87.723  151.182 142.703 1.00 53.71  ? 214 LYS A CG    1 
ATOM 1389  C CD    . LYS A 1 214 ? 86.419  151.043 143.448 1.00 53.71  ? 214 LYS A CD    1 
ATOM 1390  C CE    . LYS A 1 214 ? 85.304  151.749 142.707 1.00 53.71  ? 214 LYS A CE    1 
ATOM 1391  N NZ    . LYS A 1 214 ? 85.106  151.185 141.348 1.00 53.71  ? 214 LYS A NZ    1 
ATOM 1392  N N     . SER A 1 215 ? 91.592  148.597 142.337 1.00 62.63  ? 215 SER A N     1 
ATOM 1393  C CA    . SER A 1 215 ? 92.528  147.559 142.752 1.00 62.63  ? 215 SER A CA    1 
ATOM 1394  C C     . SER A 1 215 ? 93.974  147.947 142.485 1.00 62.63  ? 215 SER A C     1 
ATOM 1395  O O     . SER A 1 215 ? 94.886  147.204 142.863 1.00 62.63  ? 215 SER A O     1 
ATOM 1396  C CB    . SER A 1 215 ? 92.214  146.241 142.044 1.00 62.63  ? 215 SER A CB    1 
ATOM 1397  O OG    . SER A 1 215 ? 92.275  146.371 140.635 1.00 62.63  ? 215 SER A OG    1 
ATOM 1398  N N     . TYR A 1 216 ? 94.192  149.101 141.859 1.00 52.81  ? 216 TYR A N     1 
ATOM 1399  C CA    . TYR A 1 216 ? 95.508  149.592 141.475 1.00 52.81  ? 216 TYR A CA    1 
ATOM 1400  C C     . TYR A 1 216 ? 95.831  150.877 142.215 1.00 52.81  ? 216 TYR A C     1 
ATOM 1401  O O     . TYR A 1 216 ? 96.654  151.667 141.743 1.00 52.81  ? 216 TYR A O     1 
ATOM 1402  C CB    . TYR A 1 216 ? 95.599  149.857 139.970 1.00 52.81  ? 216 TYR A CB    1 
ATOM 1403  C CG    . TYR A 1 216 ? 95.522  148.658 139.060 1.00 52.81  ? 216 TYR A CG    1 
ATOM 1404  C CD1   . TYR A 1 216 ? 96.645  147.878 138.814 1.00 52.81  ? 216 TYR A CD1   1 
ATOM 1405  C CD2   . TYR A 1 216 ? 94.341  148.330 138.411 1.00 52.81  ? 216 TYR A CD2   1 
ATOM 1406  C CE1   . TYR A 1 216 ? 96.587  146.789 137.973 1.00 52.81  ? 216 TYR A CE1   1 
ATOM 1407  C CE2   . TYR A 1 216 ? 94.274  147.244 137.565 1.00 52.81  ? 216 TYR A CE2   1 
ATOM 1408  C CZ    . TYR A 1 216 ? 95.399  146.476 137.351 1.00 52.81  ? 216 TYR A CZ    1 
ATOM 1409  O OH    . TYR A 1 216 ? 95.330  145.394 136.504 1.00 52.81  ? 216 TYR A OH    1 
ATOM 1410  N N     . GLY A 1 217 ? 95.208  151.104 143.371 1.00 49.47  ? 217 GLY A N     1 
ATOM 1411  C CA    . GLY A 1 217 ? 95.565  152.213 144.225 1.00 49.47  ? 217 GLY A CA    1 
ATOM 1412  C C     . GLY A 1 217 ? 94.488  153.270 144.312 1.00 49.47  ? 217 GLY A C     1 
ATOM 1413  O O     . GLY A 1 217 ? 94.525  154.104 145.224 1.00 49.47  ? 217 GLY A O     1 
ATOM 1414  N N     . CYS A 1 218 ? 93.563  153.286 143.359 1.00 51.00  ? 218 CYS A N     1 
ATOM 1415  C CA    . CYS A 1 218 ? 92.546  154.313 143.235 1.00 51.00  ? 218 CYS A CA    1 
ATOM 1416  C C     . CYS A 1 218 ? 91.314  154.042 144.106 1.00 51.00  ? 218 CYS A C     1 
ATOM 1417  O O     . CYS A 1 218 ? 91.197  153.018 144.785 1.00 51.00  ? 218 CYS A O     1 
ATOM 1418  C CB    . CYS A 1 218 ? 92.134  154.438 141.768 1.00 51.00  ? 218 CYS A CB    1 
ATOM 1419  S SG    . CYS A 1 218 ? 93.490  154.789 140.624 1.00 51.00  ? 218 CYS A SG    1 
ATOM 1420  N N     . GLY A 1 219 ? 90.383  154.997 144.079 1.00 48.65  ? 219 GLY A N     1 
ATOM 1421  C CA    . GLY A 1 219 ? 89.049  154.864 144.642 1.00 48.65  ? 219 GLY A CA    1 
ATOM 1422  C C     . GLY A 1 219 ? 88.767  155.485 146.001 1.00 48.65  ? 219 GLY A C     1 
ATOM 1423  O O     . GLY A 1 219 ? 87.710  156.095 146.181 1.00 48.65  ? 219 GLY A O     1 
ATOM 1424  N N     . LEU A 1 220 ? 89.676  155.342 146.962 1.00 41.95  ? 220 LEU A N     1 
ATOM 1425  C CA    . LEU A 1 220 ? 89.423  155.812 148.324 1.00 41.95  ? 220 LEU A CA    1 
ATOM 1426  C C     . LEU A 1 220 ? 89.267  157.336 148.359 1.00 41.95  ? 220 LEU A C     1 
ATOM 1427  O O     . LEU A 1 220 ? 90.200  158.077 148.029 1.00 41.95  ? 220 LEU A O     1 
ATOM 1428  C CB    . LEU A 1 220 ? 90.516  155.342 149.276 1.00 41.95  ? 220 LEU A CB    1 
ATOM 1429  C CG    . LEU A 1 220 ? 90.324  155.841 150.706 1.00 41.95  ? 220 LEU A CG    1 
ATOM 1430  C CD1   . LEU A 1 220 ? 88.935  155.480 151.183 1.00 41.95  ? 220 LEU A CD1   1 
ATOM 1431  C CD2   . LEU A 1 220 ? 91.363  155.234 151.628 1.00 41.95  ? 220 LEU A CD2   1 
ATOM 1432  N N     . LEU A 1 221 ? 88.077  157.788 148.761 1.00 36.81  ? 221 LEU A N     1 
ATOM 1433  C CA    . LEU A 1 221 ? 87.714  159.199 148.870 1.00 36.81  ? 221 LEU A CA    1 
ATOM 1434  C C     . LEU A 1 221 ? 87.844  159.679 150.309 1.00 36.81  ? 221 LEU A C     1 
ATOM 1435  O O     . LEU A 1 221 ? 87.144  159.161 151.189 1.00 36.81  ? 221 LEU A O     1 
ATOM 1436  C CB    . LEU A 1 221 ? 86.256  159.340 148.415 1.00 36.81  ? 221 LEU A CB    1 
ATOM 1437  C CG    . LEU A 1 221 ? 85.310  160.549 148.481 1.00 36.81  ? 221 LEU A CG    1 
ATOM 1438  C CD1   . LEU A 1 221 ? 85.435  161.502 147.327 1.00 36.81  ? 221 LEU A CD1   1 
ATOM 1439  C CD2   . LEU A 1 221 ? 83.867  160.085 148.633 1.00 36.81  ? 221 LEU A CD2   1 
ATOM 1440  N N     . SER A 1 222 ? 88.733  160.649 150.572 1.00 35.04  ? 222 SER A N     1 
ATOM 1441  C CA    . SER A 1 222 ? 88.856  161.135 151.947 1.00 35.04  ? 222 SER A CA    1 
ATOM 1442  C C     . SER A 1 222 ? 88.387  162.578 152.100 1.00 35.04  ? 222 SER A C     1 
ATOM 1443  O O     . SER A 1 222 ? 88.867  163.483 151.399 1.00 35.04  ? 222 SER A O     1 
ATOM 1444  C CB    . SER A 1 222 ? 90.298  161.016 152.445 1.00 35.04  ? 222 SER A CB    1 
ATOM 1445  O OG    . SER A 1 222 ? 90.428  161.490 153.777 1.00 35.04  ? 222 SER A OG    1 
ATOM 1446  N N     . LEU A 1 223 ? 87.462  162.764 153.039 1.00 29.59  ? 223 LEU A N     1 
ATOM 1447  C CA    . LEU A 1 223 ? 86.864  164.008 153.493 1.00 29.59  ? 223 LEU A CA    1 
ATOM 1448  C C     . LEU A 1 223 ? 87.218  164.240 154.963 1.00 29.59  ? 223 LEU A C     1 
ATOM 1449  O O     . LEU A 1 223 ? 87.521  163.294 155.694 1.00 29.59  ? 223 LEU A O     1 
ATOM 1450  C CB    . LEU A 1 223 ? 85.348  163.963 153.290 1.00 29.59  ? 223 LEU A CB    1 
ATOM 1451  N N     . ALA A 1 224 ? 87.189  165.499 155.406 1.00 26.33  ? 224 ALA A N     1 
ATOM 1452  C CA    . ALA A 1 224 ? 87.455  165.796 156.813 1.00 26.33  ? 224 ALA A CA    1 
ATOM 1453  C C     . ALA A 1 224 ? 86.726  167.073 157.218 1.00 26.33  ? 224 ALA A C     1 
ATOM 1454  O O     . ALA A 1 224 ? 86.559  167.987 156.414 1.00 26.33  ? 224 ALA A O     1 
ATOM 1455  C CB    . ALA A 1 224 ? 88.956  165.928 157.101 1.00 26.33  ? 224 ALA A CB    1 
ATOM 1456  N N     . LEU A 1 225 ? 86.309  167.155 158.479 1.00 21.91  ? 225 LEU A N     1 
ATOM 1457  C CA    . LEU A 1 225 ? 85.575  168.339 158.915 1.00 21.91  ? 225 LEU A CA    1 
ATOM 1458  C C     . LEU A 1 225 ? 86.531  169.531 158.985 1.00 21.91  ? 225 LEU A C     1 
ATOM 1459  O O     . LEU A 1 225 ? 87.647  169.421 159.499 1.00 21.91  ? 225 LEU A O     1 
ATOM 1460  C CB    . LEU A 1 225 ? 84.879  168.055 160.251 1.00 21.91  ? 225 LEU A CB    1 
ATOM 1461  C CG    . LEU A 1 225 ? 83.933  169.031 160.955 1.00 21.91  ? 225 LEU A CG    1 
ATOM 1462  C CD1   . LEU A 1 225 ? 83.067  168.256 161.916 1.00 21.91  ? 225 LEU A CD1   1 
ATOM 1463  C CD2   . LEU A 1 225 ? 84.695  170.056 161.740 1.00 21.91  ? 225 LEU A CD2   1 
ATOM 1464  N N     . ILE A 1 226 ? 86.088  170.676 158.459 1.00 21.45  ? 226 ILE A N     1 
ATOM 1465  C CA    . ILE A 1 226 ? 86.881  171.916 158.471 1.00 21.45  ? 226 ILE A CA    1 
ATOM 1466  C C     . ILE A 1 226 ? 87.229  172.456 159.860 1.00 21.45  ? 226 ILE A C     1 
ATOM 1467  O O     . ILE A 1 226 ? 88.243  173.136 160.040 1.00 21.45  ? 226 ILE A O     1 
ATOM 1468  C CB    . ILE A 1 226 ? 86.152  173.024 157.658 1.00 21.45  ? 226 ILE A CB    1 
ATOM 1469  C CG1   . ILE A 1 226 ? 87.067  174.233 157.428 1.00 21.45  ? 226 ILE A CG1   1 
ATOM 1470  C CG2   . ILE A 1 226 ? 84.859  173.438 158.342 1.00 21.45  ? 226 ILE A CG2   1 
ATOM 1471  C CD1   . ILE A 1 226 ? 86.460  175.314 156.559 1.00 21.45  ? 226 ILE A CD1   1 
ATOM 1472  N N     . TYR B 2 5   ? 130.137 144.831 143.992 1.00 71.02  ? 5   TYR B N     1 
ATOM 1473  C CA    . TYR B 2 5   ? 129.076 144.634 144.968 1.00 71.02  ? 5   TYR B CA    1 
ATOM 1474  C C     . TYR B 2 5   ? 128.125 145.825 144.838 1.00 71.02  ? 5   TYR B C     1 
ATOM 1475  O O     . TYR B 2 5   ? 127.483 145.967 143.799 1.00 71.02  ? 5   TYR B O     1 
ATOM 1476  C CB    . TYR B 2 5   ? 129.666 144.499 146.378 1.00 71.02  ? 5   TYR B CB    1 
ATOM 1477  C CG    . TYR B 2 5   ? 128.701 144.051 147.457 1.00 71.02  ? 5   TYR B CG    1 
ATOM 1478  C CD1   . TYR B 2 5   ? 128.229 142.746 147.490 1.00 71.02  ? 5   TYR B CD1   1 
ATOM 1479  C CD2   . TYR B 2 5   ? 128.306 144.912 148.472 1.00 71.02  ? 5   TYR B CD2   1 
ATOM 1480  C CE1   . TYR B 2 5   ? 127.363 142.322 148.481 1.00 71.02  ? 5   TYR B CE1   1 
ATOM 1481  C CE2   . TYR B 2 5   ? 127.441 144.495 149.468 1.00 71.02  ? 5   TYR B CE2   1 
ATOM 1482  C CZ    . TYR B 2 5   ? 126.974 143.197 149.467 1.00 71.02  ? 5   TYR B CZ    1 
ATOM 1483  O OH    . TYR B 2 5   ? 126.113 142.773 150.453 1.00 71.02  ? 5   TYR B OH    1 
ATOM 1484  N N     . ILE B 2 6   ? 128.028 146.631 145.906 1.00 69.40  ? 6   ILE B N     1 
ATOM 1485  C CA    . ILE B 2 6   ? 127.151 147.806 146.020 1.00 69.40  ? 6   ILE B CA    1 
ATOM 1486  C C     . ILE B 2 6   ? 126.590 148.269 144.679 1.00 69.40  ? 6   ILE B C     1 
ATOM 1487  O O     . ILE B 2 6   ? 125.404 148.604 144.567 1.00 69.40  ? 6   ILE B O     1 
ATOM 1488  C CB    . ILE B 2 6   ? 127.902 148.957 146.711 1.00 69.40  ? 6   ILE B CB    1 
ATOM 1489  C CG1   . ILE B 2 6   ? 128.324 148.546 148.122 1.00 69.40  ? 6   ILE B CG1   1 
ATOM 1490  C CG2   . ILE B 2 6   ? 127.045 150.210 146.742 1.00 69.40  ? 6   ILE B CG2   1 
ATOM 1491  C CD1   . ILE B 2 6   ? 129.205 149.562 148.813 1.00 69.40  ? 6   ILE B CD1   1 
ATOM 1492  N N     . LEU B 2 7   ? 127.429 148.272 143.640 1.00 68.78  ? 7   LEU B N     1 
ATOM 1493  C CA    . LEU B 2 7   ? 127.015 148.771 142.334 1.00 68.78  ? 7   LEU B CA    1 
ATOM 1494  C C     . LEU B 2 7   ? 125.872 147.948 141.757 1.00 68.78  ? 7   LEU B C     1 
ATOM 1495  O O     . LEU B 2 7   ? 125.077 148.456 140.956 1.00 68.78  ? 7   LEU B O     1 
ATOM 1496  C CB    . LEU B 2 7   ? 128.213 148.756 141.391 1.00 68.78  ? 7   LEU B CB    1 
ATOM 1497  C CG    . LEU B 2 7   ? 128.094 149.416 140.023 1.00 68.78  ? 7   LEU B CG    1 
ATOM 1498  C CD1   . LEU B 2 7   ? 127.792 150.894 140.154 1.00 68.78  ? 7   LEU B CD1   1 
ATOM 1499  C CD2   . LEU B 2 7   ? 129.394 149.198 139.287 1.00 68.78  ? 7   LEU B CD2   1 
ATOM 1500  N N     . GLN B 2 8   ? 125.758 146.690 142.175 1.00 70.24  ? 8   GLN B N     1 
ATOM 1501  C CA    . GLN B 2 8   ? 124.689 145.835 141.677 1.00 70.24  ? 8   GLN B CA    1 
ATOM 1502  C C     . GLN B 2 8   ? 123.338 146.325 142.175 1.00 70.24  ? 8   GLN B C     1 
ATOM 1503  O O     . GLN B 2 8   ? 122.421 146.577 141.376 1.00 70.24  ? 8   GLN B O     1 
ATOM 1504  C CB    . GLN B 2 8   ? 124.949 144.395 142.113 1.00 70.24  ? 8   GLN B CB    1 
ATOM 1505  C CG    . GLN B 2 8   ? 126.157 143.766 141.439 1.00 70.24  ? 8   GLN B CG    1 
ATOM 1506  C CD    . GLN B 2 8   ? 126.336 142.307 141.797 1.00 70.24  ? 8   GLN B CD    1 
ATOM 1507  O OE1   . GLN B 2 8   ? 125.738 141.813 142.753 1.00 70.24  ? 8   GLN B OE1   1 
ATOM 1508  N NE2   . GLN B 2 8   ? 127.160 141.607 141.026 1.00 70.24  ? 8   GLN B NE2   1 
ATOM 1509  N N     . HIS B 2 9   ? 123.215 146.527 143.488 1.00 68.69  ? 9   HIS B N     1 
ATOM 1510  C CA    . HIS B 2 9   ? 121.977 147.074 144.017 1.00 68.69  ? 9   HIS B CA    1 
ATOM 1511  C C     . HIS B 2 9   ? 121.750 148.479 143.492 1.00 68.69  ? 9   HIS B C     1 
ATOM 1512  O O     . HIS B 2 9   ? 120.603 148.877 143.256 1.00 68.69  ? 9   HIS B O     1 
ATOM 1513  C CB    . HIS B 2 9   ? 122.039 147.113 145.542 1.00 68.69  ? 9   HIS B CB    1 
ATOM 1514  C CG    . HIS B 2 9   ? 122.016 145.766 146.187 1.00 68.69  ? 9   HIS B CG    1 
ATOM 1515  N ND1   . HIS B 2 9   ? 121.997 145.602 147.554 1.00 68.69  ? 9   HIS B ND1   1 
ATOM 1516  C CD2   . HIS B 2 9   ? 122.011 144.522 145.657 1.00 68.69  ? 9   HIS B CD2   1 
ATOM 1517  C CE1   . HIS B 2 9   ? 121.981 144.312 147.839 1.00 68.69  ? 9   HIS B CE1   1 
ATOM 1518  N NE2   . HIS B 2 9   ? 121.987 143.636 146.705 1.00 68.69  ? 9   HIS B NE2   1 
ATOM 1519  N N     . ALA B 2 10  ? 122.832 149.230 143.276 1.00 68.05  ? 10  ALA B N     1 
ATOM 1520  C CA    . ALA B 2 10  ? 122.693 150.576 142.750 1.00 68.05  ? 10  ALA B CA    1 
ATOM 1521  C C     . ALA B 2 10  ? 122.056 150.554 141.375 1.00 68.05  ? 10  ALA B C     1 
ATOM 1522  O O     . ALA B 2 10  ? 121.209 151.398 141.070 1.00 68.05  ? 10  ALA B O     1 
ATOM 1523  C CB    . ALA B 2 10  ? 124.055 151.270 142.688 1.00 68.05  ? 10  ALA B CB    1 
ATOM 1524  N N     . ASP B 2 11  ? 122.423 149.576 140.550 1.00 67.46  ? 11  ASP B N     1 
ATOM 1525  C CA    . ASP B 2 11  ? 121.832 149.483 139.226 1.00 67.46  ? 11  ASP B CA    1 
ATOM 1526  C C     . ASP B 2 11  ? 120.369 149.098 139.317 1.00 67.46  ? 11  ASP B C     1 
ATOM 1527  O O     . ASP B 2 11  ? 119.552 149.549 138.503 1.00 67.46  ? 11  ASP B O     1 
ATOM 1528  C CB    . ASP B 2 11  ? 122.600 148.469 138.387 1.00 67.46  ? 11  ASP B CB    1 
ATOM 1529  C CG    . ASP B 2 11  ? 123.925 149.007 137.911 1.00 67.46  ? 11  ASP B CG    1 
ATOM 1530  O OD1   . ASP B 2 11  ? 124.077 150.247 137.864 1.00 67.46  ? 11  ASP B OD1   1 
ATOM 1531  O OD2   . ASP B 2 11  ? 124.814 148.188 137.611 1.00 67.46  ? 11  ASP B OD2   1 
ATOM 1532  N N     . ALA B 2 12  ? 120.013 148.296 140.321 1.00 69.76  ? 12  ALA B N     1 
ATOM 1533  C CA    . ALA B 2 12  ? 118.601 147.987 140.511 1.00 69.76  ? 12  ALA B CA    1 
ATOM 1534  C C     . ALA B 2 12  ? 117.828 149.248 140.847 1.00 69.76  ? 12  ALA B C     1 
ATOM 1535  O O     . ALA B 2 12  ? 116.730 149.483 140.318 1.00 69.76  ? 12  ALA B O     1 
ATOM 1536  C CB    . ALA B 2 12  ? 118.425 146.937 141.607 1.00 69.76  ? 12  ALA B CB    1 
ATOM 1537  N N     . LEU B 2 13  ? 118.407 150.096 141.685 1.00 67.19  ? 13  LEU B N     1 
ATOM 1538  C CA    . LEU B 2 13  ? 117.748 151.353 142.000 1.00 67.19  ? 13  LEU B CA    1 
ATOM 1539  C C     . LEU B 2 13  ? 117.649 152.257 140.780 1.00 67.19  ? 13  LEU B C     1 
ATOM 1540  O O     . LEU B 2 13  ? 116.609 152.875 140.545 1.00 67.19  ? 13  LEU B O     1 
ATOM 1541  C CB    . LEU B 2 13  ? 118.475 152.070 143.131 1.00 67.19  ? 13  LEU B CB    1 
ATOM 1542  C CG    . LEU B 2 13  ? 117.835 151.945 144.513 1.00 67.19  ? 13  LEU B CG    1 
ATOM 1543  C CD1   . LEU B 2 13  ? 118.452 152.926 145.497 1.00 67.19  ? 13  LEU B CD1   1 
ATOM 1544  C CD2   . LEU B 2 13  ? 116.342 152.115 144.455 1.00 67.19  ? 13  LEU B CD2   1 
ATOM 1545  N N     . VAL B 2 14  ? 118.716 152.358 139.984 1.00 69.51  ? 14  VAL B N     1 
ATOM 1546  C CA    . VAL B 2 14  ? 118.637 153.219 138.806 1.00 69.51  ? 14  VAL B CA    1 
ATOM 1547  C C     . VAL B 2 14  ? 117.570 152.752 137.816 1.00 69.51  ? 14  VAL B C     1 
ATOM 1548  O O     . VAL B 2 14  ? 116.771 153.565 137.352 1.00 69.51  ? 14  VAL B O     1 
ATOM 1549  C CB    . VAL B 2 14  ? 120.019 153.417 138.148 1.00 69.51  ? 14  VAL B CB    1 
ATOM 1550  C CG1   . VAL B 2 14  ? 121.042 153.878 139.174 1.00 69.51  ? 14  VAL B CG1   1 
ATOM 1551  C CG2   . VAL B 2 14  ? 120.507 152.191 137.393 1.00 69.51  ? 14  VAL B CG2   1 
ATOM 1552  N N     . LYS B 2 15  ? 117.544 151.465 137.419 1.00 68.36  ? 15  LYS B N     1 
ATOM 1553  C CA    . LYS B 2 15  ? 116.441 151.100 136.521 1.00 68.36  ? 15  LYS B CA    1 
ATOM 1554  C C     . LYS B 2 15  ? 115.068 151.258 137.177 1.00 68.36  ? 15  LYS B C     1 
ATOM 1555  O O     . LYS B 2 15  ? 114.209 151.989 136.667 1.00 68.36  ? 15  LYS B O     1 
ATOM 1556  C CB    . LYS B 2 15  ? 116.605 149.720 135.859 1.00 68.36  ? 15  LYS B CB    1 
ATOM 1557  C CG    . LYS B 2 15  ? 116.505 148.409 136.624 1.00 68.36  ? 15  LYS B CG    1 
ATOM 1558  C CD    . LYS B 2 15  ? 117.859 147.714 136.624 1.00 68.36  ? 15  LYS B CD    1 
ATOM 1559  C CE    . LYS B 2 15  ? 117.826 146.396 137.371 1.00 68.36  ? 15  LYS B CE    1 
ATOM 1560  N NZ    . LYS B 2 15  ? 119.028 146.133 138.193 1.00 68.36  ? 15  LYS B NZ    1 
ATOM 1561  N N     . ARG B 2 16  ? 114.850 150.602 138.323 1.00 65.24  ? 16  ARG B N     1 
ATOM 1562  C CA    . ARG B 2 16  ? 113.534 150.629 138.966 1.00 65.24  ? 16  ARG B CA    1 
ATOM 1563  C C     . ARG B 2 16  ? 113.011 152.040 139.203 1.00 65.24  ? 16  ARG B C     1 
ATOM 1564  O O     . ARG B 2 16  ? 111.884 152.388 138.813 1.00 65.24  ? 16  ARG B O     1 
ATOM 1565  C CB    . ARG B 2 16  ? 113.624 149.911 140.305 1.00 65.24  ? 16  ARG B CB    1 
ATOM 1566  C CG    . ARG B 2 16  ? 112.346 149.943 141.108 1.00 65.24  ? 16  ARG B CG    1 
ATOM 1567  C CD    . ARG B 2 16  ? 112.588 149.311 142.449 1.00 65.24  ? 16  ARG B CD    1 
ATOM 1568  N NE    . ARG B 2 16  ? 111.428 149.402 143.321 1.00 65.24  ? 16  ARG B NE    1 
ATOM 1569  C CZ    . ARG B 2 16  ? 111.447 149.079 144.608 1.00 65.24  ? 16  ARG B CZ    1 
ATOM 1570  N NH1   . ARG B 2 16  ? 112.571 148.650 145.169 1.00 65.24  ? 16  ARG B NH1   1 
ATOM 1571  N NH2   . ARG B 2 16  ? 110.345 149.191 145.336 1.00 65.24  ? 16  ARG B NH2   1 
ATOM 1572  N N     . VAL B 2 17  ? 113.859 152.880 139.781 1.00 66.04  ? 17  VAL B N     1 
ATOM 1573  C CA    . VAL B 2 17  ? 113.501 154.249 140.123 1.00 66.04  ? 17  VAL B CA    1 
ATOM 1574  C C     . VAL B 2 17  ? 113.404 155.106 138.871 1.00 66.04  ? 17  VAL B C     1 
ATOM 1575  O O     . VAL B 2 17  ? 112.525 155.970 138.751 1.00 66.04  ? 17  VAL B O     1 
ATOM 1576  C CB    . VAL B 2 17  ? 114.521 154.766 141.147 1.00 66.04  ? 17  VAL B CB    1 
ATOM 1577  C CG1   . VAL B 2 17  ? 114.233 156.147 141.542 1.00 66.04  ? 17  VAL B CG1   1 
ATOM 1578  C CG2   . VAL B 2 17  ? 114.442 153.900 142.373 1.00 66.04  ? 17  VAL B CG2   1 
ATOM 1579  N N     . SER B 2 18  ? 114.294 154.864 137.910 1.00 66.27  ? 18  SER B N     1 
ATOM 1580  C CA    . SER B 2 18  ? 114.266 155.606 136.658 1.00 66.27  ? 18  SER B CA    1 
ATOM 1581  C C     . SER B 2 18  ? 112.940 155.380 135.961 1.00 66.27  ? 18  SER B C     1 
ATOM 1582  O O     . SER B 2 18  ? 112.453 156.250 135.229 1.00 66.27  ? 18  SER B O     1 
ATOM 1583  C CB    . SER B 2 18  ? 115.419 155.189 135.745 1.00 66.27  ? 18  SER B CB    1 
ATOM 1584  N N     . LYS B 2 19  ? 112.342 154.209 136.175 1.00 63.07  ? 19  LYS B N     1 
ATOM 1585  C CA    . LYS B 2 19  ? 111.017 153.978 135.630 1.00 63.07  ? 19  LYS B CA    1 
ATOM 1586  C C     . LYS B 2 19  ? 109.936 154.625 136.486 1.00 63.07  ? 19  LYS B C     1 
ATOM 1587  O O     . LYS B 2 19  ? 108.998 155.209 135.938 1.00 63.07  ? 19  LYS B O     1 
ATOM 1588  C CB    . LYS B 2 19  ? 110.769 152.469 135.551 1.00 63.07  ? 19  LYS B CB    1 
ATOM 1589  C CG    . LYS B 2 19  ? 109.465 152.010 134.908 1.00 63.07  ? 19  LYS B CG    1 
ATOM 1590  C CD    . LYS B 2 19  ? 109.466 152.054 133.395 1.00 63.07  ? 19  LYS B CD    1 
ATOM 1591  C CE    . LYS B 2 19  ? 108.189 151.411 132.846 1.00 63.07  ? 19  LYS B CE    1 
ATOM 1592  N NZ    . LYS B 2 19  ? 108.146 151.385 131.357 1.00 63.07  ? 19  LYS B NZ    1 
ATOM 1593  N N     . LEU B 2 20  ? 110.006 154.512 137.820 1.00 60.03  ? 20  LEU B N     1 
ATOM 1594  C CA    . LEU B 2 20  ? 108.918 155.106 138.599 1.00 60.03  ? 20  LEU B CA    1 
ATOM 1595  C C     . LEU B 2 20  ? 108.823 156.629 138.476 1.00 60.03  ? 20  LEU B C     1 
ATOM 1596  O O     . LEU B 2 20  ? 107.716 157.175 138.488 1.00 60.03  ? 20  LEU B O     1 
ATOM 1597  C CB    . LEU B 2 20  ? 109.040 154.705 140.064 1.00 60.03  ? 20  LEU B CB    1 
ATOM 1598  C CG    . LEU B 2 20  ? 108.661 153.241 140.275 1.00 60.03  ? 20  LEU B CG    1 
ATOM 1599  C CD1   . LEU B 2 20  ? 109.026 152.774 141.671 1.00 60.03  ? 20  LEU B CD1   1 
ATOM 1600  C CD2   . LEU B 2 20  ? 107.173 153.051 140.011 1.00 60.03  ? 20  LEU B CD2   1 
ATOM 1601  N N     . ILE B 2 21  ? 109.951 157.337 138.367 1.00 59.17  ? 21  ILE B N     1 
ATOM 1602  C CA    . ILE B 2 21  ? 109.886 158.798 138.251 1.00 59.17  ? 21  ILE B CA    1 
ATOM 1603  C C     . ILE B 2 21  ? 109.217 159.214 136.955 1.00 59.17  ? 21  ILE B C     1 
ATOM 1604  O O     . ILE B 2 21  ? 108.266 160.003 136.941 1.00 59.17  ? 21  ILE B O     1 
ATOM 1605  C CB    . ILE B 2 21  ? 111.267 159.445 138.415 1.00 59.17  ? 21  ILE B CB    1 
ATOM 1606  C CG1   . ILE B 2 21  ? 111.545 159.619 139.901 1.00 59.17  ? 21  ILE B CG1   1 
ATOM 1607  C CG2   . ILE B 2 21  ? 111.311 160.790 137.717 1.00 59.17  ? 21  ILE B CG2   1 
ATOM 1608  C CD1   . ILE B 2 21  ? 112.436 158.613 140.452 1.00 59.17  ? 21  ILE B CD1   1 
ATOM 1609  N N     . VAL B 2 22  ? 109.728 158.697 135.841 1.00 58.33  ? 22  VAL B N     1 
ATOM 1610  C CA    . VAL B 2 22  ? 109.237 159.072 134.525 1.00 58.33  ? 22  VAL B CA    1 
ATOM 1611  C C     . VAL B 2 22  ? 107.871 158.466 134.283 1.00 58.33  ? 22  VAL B C     1 
ATOM 1612  O O     . VAL B 2 22  ? 107.128 158.909 133.396 1.00 58.33  ? 22  VAL B O     1 
ATOM 1613  C CB    . VAL B 2 22  ? 110.260 158.610 133.467 1.00 58.33  ? 22  VAL B CB    1 
ATOM 1614  C CG1   . VAL B 2 22  ? 109.833 158.992 132.059 1.00 58.33  ? 22  VAL B CG1   1 
ATOM 1615  C CG2   . VAL B 2 22  ? 111.632 159.162 133.794 1.00 58.33  ? 22  VAL B CG2   1 
ATOM 1616  N N     . ASN B 2 23  ? 107.495 157.480 135.083 1.00 60.02  ? 23  ASN B N     1 
ATOM 1617  C CA    . ASN B 2 23  ? 106.224 156.819 134.884 1.00 60.02  ? 23  ASN B CA    1 
ATOM 1618  C C     . ASN B 2 23  ? 105.124 157.276 135.834 1.00 60.02  ? 23  ASN B C     1 
ATOM 1619  O O     . ASN B 2 23  ? 104.152 157.873 135.375 1.00 60.02  ? 23  ASN B O     1 
ATOM 1620  C CB    . ASN B 2 23  ? 106.446 155.314 135.047 1.00 60.02  ? 23  ASN B CB    1 
ATOM 1621  C CG    . ASN B 2 23  ? 105.239 154.497 134.686 1.00 60.02  ? 23  ASN B CG    1 
ATOM 1622  O OD1   . ASN B 2 23  ? 104.261 155.007 134.150 1.00 60.02  ? 23  ASN B OD1   1 
ATOM 1623  N ND2   . ASN B 2 23  ? 105.292 153.211 135.002 1.00 60.02  ? 23  ASN B ND2   1 
ATOM 1624  N N     . GLU B 2 24  ? 105.328 157.222 137.151 1.00 66.60  ? 24  GLU B N     1 
ATOM 1625  C CA    . GLU B 2 24  ? 104.241 157.540 138.085 1.00 66.60  ? 24  GLU B CA    1 
ATOM 1626  C C     . GLU B 2 24  ? 104.503 158.838 138.837 1.00 66.60  ? 24  GLU B C     1 
ATOM 1627  O O     . GLU B 2 24  ? 105.471 158.934 139.604 1.00 66.60  ? 24  GLU B O     1 
ATOM 1628  C CB    . GLU B 2 24  ? 104.027 156.371 139.047 1.00 66.60  ? 24  GLU B CB    1 
ATOM 1629  C CG    . GLU B 2 24  ? 102.671 156.330 139.753 1.00 66.60  ? 24  GLU B CG    1 
ATOM 1630  C CD    . GLU B 2 24  ? 102.500 157.354 140.832 1.00 66.60  ? 24  GLU B CD    1 
ATOM 1631  O OE1   . GLU B 2 24  ? 103.517 157.828 141.373 1.00 66.60  ? 24  GLU B OE1   1 
ATOM 1632  O OE2   . GLU B 2 24  ? 101.332 157.674 141.139 1.00 66.60  ? 24  GLU B OE2   1 
ATOM 1633  N N     . PRO B 2 25  ? 103.654 159.854 138.651 1.00 69.03  ? 25  PRO B N     1 
ATOM 1634  C CA    . PRO B 2 25  ? 103.855 161.130 139.368 1.00 69.03  ? 25  PRO B CA    1 
ATOM 1635  C C     . PRO B 2 25  ? 103.724 161.107 140.887 1.00 69.03  ? 25  PRO B C     1 
ATOM 1636  O O     . PRO B 2 25  ? 104.511 161.797 141.543 1.00 69.03  ? 25  PRO B O     1 
ATOM 1637  C CB    . PRO B 2 25  ? 102.781 162.038 138.749 1.00 69.03  ? 25  PRO B CB    1 
ATOM 1638  C CG    . PRO B 2 25  ? 102.464 161.429 137.440 1.00 69.03  ? 25  PRO B CG    1 
ATOM 1639  C CD    . PRO B 2 25  ? 102.594 159.953 137.635 1.00 69.03  ? 25  PRO B CD    1 
ATOM 1640  N N     . ALA B 2 26  ? 102.757 160.393 141.480 1.00 70.38  ? 26  ALA B N     1 
ATOM 1641  C CA    . ALA B 2 26  ? 102.623 160.455 142.940 1.00 70.38  ? 26  ALA B CA    1 
ATOM 1642  C C     . ALA B 2 26  ? 103.879 159.969 143.660 1.00 70.38  ? 26  ALA B C     1 
ATOM 1643  O O     . ALA B 2 26  ? 104.285 160.556 144.671 1.00 70.38  ? 26  ALA B O     1 
ATOM 1644  C CB    . ALA B 2 26  ? 101.406 159.658 143.406 1.00 70.38  ? 26  ALA B CB    1 
ATOM 1645  N N     . ALA B 2 27  ? 104.510 158.911 143.151 1.00 65.93  ? 27  ALA B N     1 
ATOM 1646  C CA    . ALA B 2 27  ? 105.738 158.408 143.757 1.00 65.93  ? 27  ALA B CA    1 
ATOM 1647  C C     . ALA B 2 27  ? 106.884 159.383 143.545 1.00 65.93  ? 27  ALA B C     1 
ATOM 1648  O O     . ALA B 2 27  ? 107.700 159.602 144.447 1.00 65.93  ? 27  ALA B O     1 
ATOM 1649  C CB    . ALA B 2 27  ? 106.089 157.041 143.175 1.00 65.93  ? 27  ALA B CB    1 
ATOM 1650  N N     . ARG B 2 28  ? 106.927 159.995 142.365 1.00 61.58  ? 28  ARG B N     1 
ATOM 1651  C CA    . ARG B 2 28  ? 107.957 160.964 142.011 1.00 61.58  ? 28  ARG B CA    1 
ATOM 1652  C C     . ARG B 2 28  ? 107.891 162.172 142.933 1.00 61.58  ? 28  ARG B C     1 
ATOM 1653  O O     . ARG B 2 28  ? 108.914 162.611 143.491 1.00 61.58  ? 28  ARG B O     1 
ATOM 1654  C CB    . ARG B 2 28  ? 107.672 161.309 140.540 1.00 61.58  ? 28  ARG B CB    1 
ATOM 1655  N N     . ALA B 2 29  ? 106.682 162.662 143.175 1.00 59.60  ? 29  ALA B N     1 
ATOM 1656  C CA    . ALA B 2 29  ? 106.494 163.748 144.115 1.00 59.60  ? 29  ALA B CA    1 
ATOM 1657  C C     . ALA B 2 29  ? 106.713 163.327 145.561 1.00 59.60  ? 29  ALA B C     1 
ATOM 1658  O O     . ALA B 2 29  ? 107.135 164.151 146.370 1.00 59.60  ? 29  ALA B O     1 
ATOM 1659  C CB    . ALA B 2 29  ? 105.093 164.338 143.947 1.00 59.60  ? 29  ALA B CB    1 
ATOM 1660  N N     . ALA B 2 30  ? 106.421 162.074 145.919 1.00 60.68  ? 30  ALA B N     1 
ATOM 1661  C CA    . ALA B 2 30  ? 106.673 161.638 147.291 1.00 60.68  ? 30  ALA B CA    1 
ATOM 1662  C C     . ALA B 2 30  ? 108.138 161.358 147.603 1.00 60.68  ? 30  ALA B C     1 
ATOM 1663  O O     . ALA B 2 30  ? 108.531 161.429 148.772 1.00 60.68  ? 30  ALA B O     1 
ATOM 1664  C CB    . ALA B 2 30  ? 105.850 160.386 147.598 1.00 60.68  ? 30  ALA B CB    1 
ATOM 1665  N N     . LEU B 2 31  ? 108.964 161.055 146.607 1.00 63.06  ? 31  LEU B N     1 
ATOM 1666  C CA    . LEU B 2 31  ? 110.370 160.822 146.911 1.00 63.06  ? 31  LEU B CA    1 
ATOM 1667  C C     . LEU B 2 31  ? 111.183 162.093 146.760 1.00 63.06  ? 31  LEU B C     1 
ATOM 1668  O O     . LEU B 2 31  ? 112.199 162.255 147.443 1.00 63.06  ? 31  LEU B O     1 
ATOM 1669  C CB    . LEU B 2 31  ? 110.973 159.660 146.115 1.00 63.06  ? 31  LEU B CB    1 
ATOM 1670  C CG    . LEU B 2 31  ? 111.608 159.679 144.741 1.00 63.06  ? 31  LEU B CG    1 
ATOM 1671  C CD1   . LEU B 2 31  ? 112.115 158.296 144.394 1.00 63.06  ? 31  LEU B CD1   1 
ATOM 1672  C CD2   . LEU B 2 31  ? 110.617 160.089 143.762 1.00 63.06  ? 31  LEU B CD2   1 
ATOM 1673  N N     . ARG B 2 32  ? 110.737 163.020 145.911 1.00 62.31  ? 32  ARG B N     1 
ATOM 1674  C CA    . ARG B 2 32  ? 111.520 164.223 145.671 1.00 62.31  ? 32  ARG B CA    1 
ATOM 1675  C C     . ARG B 2 32  ? 111.489 165.194 146.845 1.00 62.31  ? 32  ARG B C     1 
ATOM 1676  O O     . ARG B 2 32  ? 112.336 166.088 146.907 1.00 62.31  ? 32  ARG B O     1 
ATOM 1677  C CB    . ARG B 2 32  ? 110.962 164.933 144.443 1.00 62.31  ? 32  ARG B CB    1 
ATOM 1678  C CG    . ARG B 2 32  ? 109.659 165.637 144.793 1.00 62.31  ? 32  ARG B CG    1 
ATOM 1679  C CD    . ARG B 2 32  ? 109.046 166.381 143.647 1.00 62.31  ? 32  ARG B CD    1 
ATOM 1680  N NE    . ARG B 2 32  ? 109.902 167.467 143.214 1.00 62.31  ? 32  ARG B NE    1 
ATOM 1681  C CZ    . ARG B 2 32  ? 109.719 168.150 142.096 1.00 62.31  ? 32  ARG B CZ    1 
ATOM 1682  N NH1   . ARG B 2 32  ? 110.556 169.124 141.790 1.00 62.31  ? 32  ARG B NH1   1 
ATOM 1683  N NH2   . ARG B 2 32  ? 108.709 167.857 141.289 1.00 62.31  ? 32  ARG B NH2   1 
ATOM 1684  N N     . ARG B 2 33  ? 110.535 165.051 147.766 1.00 61.84  ? 33  ARG B N     1 
ATOM 1685  C CA    . ARG B 2 33  ? 110.432 165.960 148.902 1.00 61.84  ? 33  ARG B CA    1 
ATOM 1686  C C     . ARG B 2 33  ? 111.516 165.707 149.940 1.00 61.84  ? 33  ARG B C     1 
ATOM 1687  O O     . ARG B 2 33  ? 111.517 166.367 150.983 1.00 61.84  ? 33  ARG B O     1 
ATOM 1688  C CB    . ARG B 2 33  ? 109.080 165.841 149.603 1.00 61.84  ? 33  ARG B CB    1 
ATOM 1689  C CG    . ARG B 2 33  ? 108.188 164.740 149.099 1.00 61.84  ? 33  ARG B CG    1 
ATOM 1690  C CD    . ARG B 2 33  ? 106.822 164.730 149.763 1.00 61.84  ? 33  ARG B CD    1 
ATOM 1691  N NE    . ARG B 2 33  ? 106.655 165.782 150.765 1.00 61.84  ? 33  ARG B NE    1 
ATOM 1692  C CZ    . ARG B 2 33  ? 106.911 165.613 152.056 1.00 61.84  ? 33  ARG B CZ    1 
ATOM 1693  N NH1   . ARG B 2 33  ? 107.346 164.440 152.483 1.00 61.84  ? 33  ARG B NH1   1 
ATOM 1694  N NH2   . ARG B 2 33  ? 106.742 166.606 152.914 1.00 61.84  ? 33  ARG B NH2   1 
ATOM 1695  N N     . GLY B 2 34  ? 112.431 164.775 149.690 1.00 58.79  ? 34  GLY B N     1 
ATOM 1696  C CA    . GLY B 2 34  ? 113.454 164.470 150.670 1.00 58.79  ? 34  GLY B CA    1 
ATOM 1697  C C     . GLY B 2 34  ? 114.883 164.605 150.198 1.00 58.79  ? 34  GLY B C     1 
ATOM 1698  O O     . GLY B 2 34  ? 115.754 163.825 150.590 1.00 58.79  ? 34  GLY B O     1 
ATOM 1699  N N     . VAL B 2 35  ? 115.125 165.570 149.322 1.00 54.93  ? 35  VAL B N     1 
ATOM 1700  C CA    . VAL B 2 35  ? 116.458 165.783 148.783 1.00 54.93  ? 35  VAL B CA    1 
ATOM 1701  C C     . VAL B 2 35  ? 117.273 166.534 149.829 1.00 54.93  ? 35  VAL B C     1 
ATOM 1702  O O     . VAL B 2 35  ? 116.834 167.563 150.352 1.00 54.93  ? 35  VAL B O     1 
ATOM 1703  C CB    . VAL B 2 35  ? 116.398 166.538 147.445 1.00 54.93  ? 35  VAL B CB    1 
ATOM 1704  C CG1   . VAL B 2 35  ? 115.752 167.907 147.612 1.00 54.93  ? 35  VAL B CG1   1 
ATOM 1705  C CG2   . VAL B 2 35  ? 117.783 166.691 146.880 1.00 54.93  ? 35  VAL B CG2   1 
ATOM 1706  N N     . ASP B 2 41  ? 114.949 161.613 159.078 1.00 64.51  ? 41  ASP B N     1 
ATOM 1707  C CA    . ASP B 2 41  ? 113.912 162.633 159.068 1.00 64.51  ? 41  ASP B CA    1 
ATOM 1708  C C     . ASP B 2 41  ? 112.554 162.102 158.629 1.00 64.51  ? 41  ASP B C     1 
ATOM 1709  O O     . ASP B 2 41  ? 112.454 161.399 157.618 1.00 64.51  ? 41  ASP B O     1 
ATOM 1710  C CB    . ASP B 2 41  ? 114.315 163.773 158.142 1.00 64.51  ? 41  ASP B CB    1 
ATOM 1711  C CG    . ASP B 2 41  ? 115.395 164.643 158.728 1.00 64.51  ? 41  ASP B CG    1 
ATOM 1712  O OD1   . ASP B 2 41  ? 115.518 164.678 159.968 1.00 64.51  ? 41  ASP B OD1   1 
ATOM 1713  O OD2   . ASP B 2 41  ? 116.122 165.287 157.944 1.00 64.51  ? 41  ASP B OD2   1 
ATOM 1714  N N     . PRO B 2 42  ? 111.501 162.424 159.377 1.00 66.77  ? 42  PRO B N     1 
ATOM 1715  C CA    . PRO B 2 42  ? 110.144 161.998 159.014 1.00 66.77  ? 42  PRO B CA    1 
ATOM 1716  C C     . PRO B 2 42  ? 109.703 162.423 157.620 1.00 66.77  ? 42  PRO B C     1 
ATOM 1717  O O     . PRO B 2 42  ? 109.001 161.684 156.928 1.00 66.77  ? 42  PRO B O     1 
ATOM 1718  C CB    . PRO B 2 42  ? 109.288 162.659 160.096 1.00 66.77  ? 42  PRO B CB    1 
ATOM 1719  C CG    . PRO B 2 42  ? 110.176 162.707 161.283 1.00 66.77  ? 42  PRO B CG    1 
ATOM 1720  C CD    . PRO B 2 42  ? 111.569 162.935 160.756 1.00 66.77  ? 42  PRO B CD    1 
ATOM 1721  N N     . ARG B 2 43  ? 110.097 163.621 157.196 1.00 65.18  ? 43  ARG B N     1 
ATOM 1722  C CA    . ARG B 2 43  ? 109.606 164.133 155.920 1.00 65.18  ? 43  ARG B CA    1 
ATOM 1723  C C     . ARG B 2 43  ? 109.953 163.261 154.716 1.00 65.18  ? 43  ARG B C     1 
ATOM 1724  O O     . ARG B 2 43  ? 109.301 163.391 153.675 1.00 65.18  ? 43  ARG B O     1 
ATOM 1725  C CB    . ARG B 2 43  ? 110.094 165.572 155.700 1.00 65.18  ? 43  ARG B CB    1 
ATOM 1726  C CG    . ARG B 2 43  ? 110.399 166.363 156.976 1.00 65.18  ? 43  ARG B CG    1 
ATOM 1727  C CD    . ARG B 2 43  ? 111.830 166.172 157.475 1.00 65.18  ? 43  ARG B CD    1 
ATOM 1728  N NE    . ARG B 2 43  ? 112.744 167.331 157.534 1.00 65.18  ? 43  ARG B NE    1 
ATOM 1729  C CZ    . ARG B 2 43  ? 112.542 168.590 157.126 1.00 65.18  ? 43  ARG B CZ    1 
ATOM 1730  N NH1   . ARG B 2 43  ? 111.405 169.010 156.585 1.00 65.18  ? 43  ARG B NH1   1 
ATOM 1731  N NH2   . ARG B 2 43  ? 113.525 169.460 157.278 1.00 65.18  ? 43  ARG B NH2   1 
ATOM 1732  N N     . MET B 2 44  ? 110.981 162.420 154.790 1.00 63.58  ? 44  MET B N     1 
ATOM 1733  C CA    . MET B 2 44  ? 111.268 161.514 153.682 1.00 63.58  ? 44  MET B CA    1 
ATOM 1734  C C     . MET B 2 44  ? 110.695 160.117 153.850 1.00 63.58  ? 44  MET B C     1 
ATOM 1735  O O     . MET B 2 44  ? 110.946 159.276 152.987 1.00 63.58  ? 44  MET B O     1 
ATOM 1736  C CB    . MET B 2 44  ? 112.748 161.358 153.374 1.00 63.58  ? 44  MET B CB    1 
ATOM 1737  C CG    . MET B 2 44  ? 113.564 160.638 154.384 1.00 63.58  ? 44  MET B CG    1 
ATOM 1738  S SD    . MET B 2 44  ? 115.153 160.548 153.568 1.00 63.58  ? 44  MET B SD    1 
ATOM 1739  C CE    . MET B 2 44  ? 115.480 162.287 153.439 1.00 63.58  ? 44  MET B CE    1 
ATOM 1740  N N     . LEU B 2 45  ? 110.009 159.808 154.950 1.00 65.35  ? 45  LEU B N     1 
ATOM 1741  C CA    . LEU B 2 45  ? 109.503 158.445 155.087 1.00 65.35  ? 45  LEU B CA    1 
ATOM 1742  C C     . LEU B 2 45  ? 108.573 158.023 153.952 1.00 65.35  ? 45  LEU B C     1 
ATOM 1743  O O     . LEU B 2 45  ? 108.504 156.829 153.636 1.00 65.35  ? 45  LEU B O     1 
ATOM 1744  C CB    . LEU B 2 45  ? 108.835 158.302 156.459 1.00 65.35  ? 45  LEU B CB    1 
ATOM 1745  C CG    . LEU B 2 45  ? 107.576 159.072 156.894 1.00 65.35  ? 45  LEU B CG    1 
ATOM 1746  C CD1   . LEU B 2 45  ? 106.312 158.881 156.076 1.00 65.35  ? 45  LEU B CD1   1 
ATOM 1747  C CD2   . LEU B 2 45  ? 107.309 158.780 158.362 1.00 65.35  ? 45  LEU B CD2   1 
ATOM 1748  N N     . ALA B 2 46  ? 107.947 158.972 153.252 1.00 60.75  ? 46  ALA B N     1 
ATOM 1749  C CA    . ALA B 2 46  ? 107.083 158.572 152.147 1.00 60.75  ? 46  ALA B CA    1 
ATOM 1750  C C     . ALA B 2 46  ? 107.900 157.921 151.041 1.00 60.75  ? 46  ALA B C     1 
ATOM 1751  O O     . ALA B 2 46  ? 107.346 157.263 150.153 1.00 60.75  ? 46  ALA B O     1 
ATOM 1752  C CB    . ALA B 2 46  ? 106.316 159.779 151.609 1.00 60.75  ? 46  ALA B CB    1 
ATOM 1753  N N     . ALA B 2 47  ? 109.218 158.082 151.109 1.00 62.10  ? 47  ALA B N     1 
ATOM 1754  C CA    . ALA B 2 47  ? 110.137 157.587 150.099 1.00 62.10  ? 47  ALA B CA    1 
ATOM 1755  C C     . ALA B 2 47  ? 110.551 156.153 150.368 1.00 62.10  ? 47  ALA B C     1 
ATOM 1756  O O     . ALA B 2 47  ? 110.842 155.411 149.422 1.00 62.10  ? 47  ALA B O     1 
ATOM 1757  C CB    . ALA B 2 47  ? 111.375 158.481 150.020 1.00 62.10  ? 47  ALA B CB    1 
ATOM 1758  N N     . HIS B 2 48  ? 110.578 155.740 151.641 1.00 61.78  ? 48  HIS B N     1 
ATOM 1759  C CA    . HIS B 2 48  ? 111.024 154.390 151.965 1.00 61.78  ? 48  HIS B CA    1 
ATOM 1760  C C     . HIS B 2 48  ? 110.251 153.348 151.178 1.00 61.78  ? 48  HIS B C     1 
ATOM 1761  O O     . HIS B 2 48  ? 110.849 152.427 150.606 1.00 61.78  ? 48  HIS B O     1 
ATOM 1762  C CB    . HIS B 2 48  ? 110.876 154.122 153.461 1.00 61.78  ? 48  HIS B CB    1 
ATOM 1763  C CG    . HIS B 2 48  ? 111.805 154.922 154.317 1.00 61.78  ? 48  HIS B CG    1 
ATOM 1764  N ND1   . HIS B 2 48  ? 113.174 154.870 154.181 1.00 61.78  ? 48  HIS B ND1   1 
ATOM 1765  C CD2   . HIS B 2 48  ? 111.562 155.762 155.350 1.00 61.78  ? 48  HIS B CD2   1 
ATOM 1766  C CE1   . HIS B 2 48  ? 113.733 155.667 155.075 1.00 61.78  ? 48  HIS B CE1   1 
ATOM 1767  N NE2   . HIS B 2 48  ? 112.776 156.216 155.799 1.00 61.78  ? 48  HIS B NE2   1 
ATOM 1768  N N     . ARG B 2 49  ? 108.936 153.523 151.083 1.00 66.18  ? 49  ARG B N     1 
ATOM 1769  C CA    . ARG B 2 49  ? 108.053 152.630 150.345 1.00 66.18  ? 49  ARG B CA    1 
ATOM 1770  C C     . ARG B 2 49  ? 108.562 152.276 148.954 1.00 66.18  ? 49  ARG B C     1 
ATOM 1771  O O     . ARG B 2 49  ? 108.164 151.245 148.407 1.00 66.18  ? 49  ARG B O     1 
ATOM 1772  C CB    . ARG B 2 49  ? 106.673 153.290 150.245 1.00 66.18  ? 49  ARG B CB    1 
ATOM 1773  C CG    . ARG B 2 49  ? 105.554 152.462 149.643 1.00 66.18  ? 49  ARG B CG    1 
ATOM 1774  C CD    . ARG B 2 49  ? 104.311 153.346 149.504 1.00 66.18  ? 49  ARG B CD    1 
ATOM 1775  N NE    . ARG B 2 49  ? 104.507 154.420 148.528 1.00 66.18  ? 49  ARG B NE    1 
ATOM 1776  C CZ    . ARG B 2 49  ? 104.027 154.416 147.288 1.00 66.18  ? 49  ARG B CZ    1 
ATOM 1777  N NH1   . ARG B 2 49  ? 103.346 153.373 146.837 1.00 66.18  ? 49  ARG B NH1   1 
ATOM 1778  N NH2   . ARG B 2 49  ? 104.257 155.444 146.485 1.00 66.18  ? 49  ARG B NH2   1 
ATOM 1779  N N     . VAL B 2 50  ? 109.440 153.086 148.370 1.00 62.10  ? 50  VAL B N     1 
ATOM 1780  C CA    . VAL B 2 50  ? 110.005 152.797 147.058 1.00 62.10  ? 50  VAL B CA    1 
ATOM 1781  C C     . VAL B 2 50  ? 111.455 152.325 147.136 1.00 62.10  ? 50  VAL B C     1 
ATOM 1782  O O     . VAL B 2 50  ? 111.849 151.392 146.434 1.00 62.10  ? 50  VAL B O     1 
ATOM 1783  C CB    . VAL B 2 50  ? 109.883 154.022 146.131 1.00 62.10  ? 50  VAL B CB    1 
ATOM 1784  C CG1   . VAL B 2 50  ? 110.610 153.770 144.826 1.00 62.10  ? 50  VAL B CG1   1 
ATOM 1785  C CG2   . VAL B 2 50  ? 108.425 154.340 145.875 1.00 62.10  ? 50  VAL B CG2   1 
ATOM 1786  N N     . VAL B 2 51  ? 112.258 152.945 147.998 1.00 64.72  ? 51  VAL B N     1 
ATOM 1787  C CA    . VAL B 2 51  ? 113.697 152.718 147.964 1.00 64.72  ? 51  VAL B CA    1 
ATOM 1788  C C     . VAL B 2 51  ? 114.230 151.883 149.125 1.00 64.72  ? 51  VAL B C     1 
ATOM 1789  O O     . VAL B 2 51  ? 115.254 151.209 148.967 1.00 64.72  ? 51  VAL B O     1 
ATOM 1790  C CB    . VAL B 2 51  ? 114.418 154.074 147.880 1.00 64.72  ? 51  VAL B CB    1 
ATOM 1791  C CG1   . VAL B 2 51  ? 113.988 154.795 146.629 1.00 64.72  ? 51  VAL B CG1   1 
ATOM 1792  C CG2   . VAL B 2 51  ? 114.069 154.920 149.073 1.00 64.72  ? 51  VAL B CG2   1 
ATOM 1793  N N     . ALA B 2 52  ? 113.580 151.907 150.283 1.00 65.87  ? 52  ALA B N     1 
ATOM 1794  C CA    . ALA B 2 52  ? 114.105 151.238 151.472 1.00 65.87  ? 52  ALA B CA    1 
ATOM 1795  C C     . ALA B 2 52  ? 114.556 149.786 151.295 1.00 65.87  ? 52  ALA B C     1 
ATOM 1796  O O     . ALA B 2 52  ? 115.582 149.417 151.890 1.00 65.87  ? 52  ALA B O     1 
ATOM 1797  C CB    . ALA B 2 52  ? 113.058 151.309 152.593 1.00 65.87  ? 52  ALA B CB    1 
ATOM 1798  N N     . PRO B 2 53  ? 113.874 148.928 150.534 1.00 71.18  ? 53  PRO B N     1 
ATOM 1799  C CA    . PRO B 2 53  ? 114.259 147.505 150.486 1.00 71.18  ? 53  PRO B CA    1 
ATOM 1800  C C     . PRO B 2 53  ? 115.607 147.168 149.854 1.00 71.18  ? 53  PRO B C     1 
ATOM 1801  O O     . PRO B 2 53  ? 116.059 146.028 150.019 1.00 71.18  ? 53  PRO B O     1 
ATOM 1802  C CB    . PRO B 2 53  ? 113.123 146.870 149.697 1.00 71.18  ? 53  PRO B CB    1 
ATOM 1803  C CG    . PRO B 2 53  ? 111.994 147.816 149.798 1.00 71.18  ? 53  PRO B CG    1 
ATOM 1804  C CD    . PRO B 2 53  ? 112.611 149.153 149.809 1.00 71.18  ? 53  PRO B CD    1 
ATOM 1805  N N     . TYR B 2 54  ? 116.261 148.073 149.136 1.00 69.82  ? 54  TYR B N     1 
ATOM 1806  C CA    . TYR B 2 54  ? 117.508 147.746 148.441 1.00 69.82  ? 54  TYR B CA    1 
ATOM 1807  C C     . TYR B 2 54  ? 118.736 148.206 149.207 1.00 69.82  ? 54  TYR B C     1 
ATOM 1808  O O     . TYR B 2 54  ? 119.864 147.874 148.837 1.00 69.82  ? 54  TYR B O     1 
ATOM 1809  C CB    . TYR B 2 54  ? 117.558 148.428 147.074 1.00 69.82  ? 54  TYR B CB    1 
ATOM 1810  C CG    . TYR B 2 54  ? 116.615 147.966 146.011 1.00 69.82  ? 54  TYR B CG    1 
ATOM 1811  C CD1   . TYR B 2 54  ? 115.872 146.813 146.158 1.00 69.82  ? 54  TYR B CD1   1 
ATOM 1812  C CD2   . TYR B 2 54  ? 116.489 148.687 144.835 1.00 69.82  ? 54  TYR B CD2   1 
ATOM 1813  C CE1   . TYR B 2 54  ? 115.025 146.400 145.164 1.00 69.82  ? 54  TYR B CE1   1 
ATOM 1814  C CE2   . TYR B 2 54  ? 115.643 148.285 143.840 1.00 69.82  ? 54  TYR B CE2   1 
ATOM 1815  C CZ    . TYR B 2 54  ? 114.912 147.139 144.007 1.00 69.82  ? 54  TYR B CZ    1 
ATOM 1816  O OH    . TYR B 2 54  ? 114.067 146.729 143.006 1.00 69.82  ? 54  TYR B OH    1 
ATOM 1817  N N     . VAL B 2 55  ? 118.528 148.966 150.264 1.00 69.92  ? 55  VAL B N     1 
ATOM 1818  C CA    . VAL B 2 55  ? 119.644 149.497 151.033 1.00 69.92  ? 55  VAL B CA    1 
ATOM 1819  C C     . VAL B 2 55  ? 120.199 148.545 152.093 1.00 69.92  ? 55  VAL B C     1 
ATOM 1820  O O     . VAL B 2 55  ? 119.432 147.919 152.838 1.00 69.92  ? 55  VAL B O     1 
ATOM 1821  C CB    . VAL B 2 55  ? 119.207 150.789 151.692 1.00 69.92  ? 55  VAL B CB    1 
ATOM 1822  C CG1   . VAL B 2 55  ? 120.298 151.226 152.512 1.00 69.92  ? 55  VAL B CG1   1 
ATOM 1823  C CG2   . VAL B 2 55  ? 118.870 151.813 150.637 1.00 69.92  ? 55  VAL B CG2   1 
ATOM 1824  N N     . ALA B 2 76  ? 125.886 154.221 156.220 1.00 58.69  ? 76  ALA B N     1 
ATOM 1825  C CA    . ALA B 2 76  ? 126.431 155.295 155.383 1.00 58.69  ? 76  ALA B CA    1 
ATOM 1826  C C     . ALA B 2 76  ? 125.950 155.134 153.949 1.00 58.69  ? 76  ALA B C     1 
ATOM 1827  O O     . ALA B 2 76  ? 125.622 156.113 153.258 1.00 58.69  ? 76  ALA B O     1 
ATOM 1828  C CB    . ALA B 2 76  ? 127.956 155.296 155.458 1.00 58.69  ? 76  ALA B CB    1 
ATOM 1829  N N     . VAL B 2 77  ? 125.808 153.886 153.535 1.00 56.99  ? 77  VAL B N     1 
ATOM 1830  C CA    . VAL B 2 77  ? 125.349 153.543 152.202 1.00 56.99  ? 77  VAL B CA    1 
ATOM 1831  C C     . VAL B 2 77  ? 123.868 153.876 152.127 1.00 56.99  ? 77  VAL B C     1 
ATOM 1832  O O     . VAL B 2 77  ? 123.366 154.315 151.092 1.00 56.99  ? 77  VAL B O     1 
ATOM 1833  C CB    . VAL B 2 77  ? 125.692 152.090 151.827 1.00 56.99  ? 77  VAL B CB    1 
ATOM 1834  C CG1   . VAL B 2 77  ? 124.884 151.125 152.571 1.00 56.99  ? 77  VAL B CG1   1 
ATOM 1835  C CG2   . VAL B 2 77  ? 125.506 151.876 150.344 1.00 56.99  ? 77  VAL B CG2   1 
ATOM 1836  N N     . GLU B 2 78  ? 123.135 153.594 153.204 1.00 60.10  ? 78  GLU B N     1 
ATOM 1837  C CA    . GLU B 2 78  ? 121.721 153.943 153.269 1.00 60.10  ? 78  GLU B CA    1 
ATOM 1838  C C     . GLU B 2 78  ? 121.513 155.425 153.008 1.00 60.10  ? 78  GLU B C     1 
ATOM 1839  O O     . GLU B 2 78  ? 120.695 155.807 152.157 1.00 60.10  ? 78  GLU B O     1 
ATOM 1840  C CB    . GLU B 2 78  ? 121.174 153.578 154.650 1.00 60.10  ? 78  GLU B CB    1 
ATOM 1841  C CG    . GLU B 2 78  ? 119.689 153.800 154.821 1.00 60.10  ? 78  GLU B CG    1 
ATOM 1842  C CD    . GLU B 2 78  ? 119.236 153.601 156.255 1.00 60.10  ? 78  GLU B CD    1 
ATOM 1843  O OE1   . GLU B 2 78  ? 120.065 153.185 157.092 1.00 60.10  ? 78  GLU B OE1   1 
ATOM 1844  O OE2   . GLU B 2 78  ? 118.051 153.864 156.545 1.00 60.10  ? 78  GLU B OE2   1 
ATOM 1845  N N     . ARG B 2 79  ? 122.281 156.275 153.685 1.00 56.48  ? 79  ARG B N     1 
ATOM 1846  C CA    . ARG B 2 79  ? 122.169 157.700 153.409 1.00 56.48  ? 79  ARG B CA    1 
ATOM 1847  C C     . ARG B 2 79  ? 122.483 157.968 151.947 1.00 56.48  ? 79  ARG B C     1 
ATOM 1848  O O     . ARG B 2 79  ? 121.777 158.744 151.279 1.00 56.48  ? 79  ARG B O     1 
ATOM 1849  C CB    . ARG B 2 79  ? 123.142 158.470 154.305 1.00 56.48  ? 79  ARG B CB    1 
ATOM 1850  C CG    . ARG B 2 79  ? 123.194 159.979 154.112 1.00 56.48  ? 79  ARG B CG    1 
ATOM 1851  C CD    . ARG B 2 79  ? 121.959 160.683 154.602 1.00 56.48  ? 79  ARG B CD    1 
ATOM 1852  N NE    . ARG B 2 79  ? 122.060 162.129 154.436 1.00 56.48  ? 79  ARG B NE    1 
ATOM 1853  C CZ    . ARG B 2 79  ? 121.215 162.859 153.718 1.00 56.48  ? 79  ARG B CZ    1 
ATOM 1854  N NH1   . ARG B 2 79  ? 120.196 162.279 153.104 1.00 56.48  ? 79  ARG B NH1   1 
ATOM 1855  N NH2   . ARG B 2 79  ? 121.381 164.169 153.621 1.00 56.48  ? 79  ARG B NH2   1 
ATOM 1856  N N     . ALA B 2 80  ? 123.478 157.258 151.408 1.00 56.56  ? 80  ALA B N     1 
ATOM 1857  C CA    . ALA B 2 80  ? 123.834 157.453 150.009 1.00 56.56  ? 80  ALA B CA    1 
ATOM 1858  C C     . ALA B 2 80  ? 122.679 157.133 149.068 1.00 56.56  ? 80  ALA B C     1 
ATOM 1859  O O     . ALA B 2 80  ? 122.203 158.021 148.354 1.00 56.56  ? 80  ALA B O     1 
ATOM 1860  C CB    . ALA B 2 80  ? 125.044 156.589 149.659 1.00 56.56  ? 80  ALA B CB    1 
ATOM 1861  N N     . PHE B 2 81  ? 122.173 155.899 149.103 1.00 56.00  ? 81  PHE B N     1 
ATOM 1862  C CA    . PHE B 2 81  ? 121.051 155.480 148.269 1.00 56.00  ? 81  PHE B CA    1 
ATOM 1863  C C     . PHE B 2 81  ? 119.856 156.414 148.377 1.00 56.00  ? 81  PHE B C     1 
ATOM 1864  O O     . PHE B 2 81  ? 119.336 156.883 147.359 1.00 56.00  ? 81  PHE B O     1 
ATOM 1865  C CB    . PHE B 2 81  ? 120.613 154.063 148.635 1.00 56.00  ? 81  PHE B CB    1 
ATOM 1866  C CG    . PHE B 2 81  ? 121.469 152.985 148.051 1.00 56.00  ? 81  PHE B CG    1 
ATOM 1867  C CD1   . PHE B 2 81  ? 121.556 152.816 146.684 1.00 56.00  ? 81  PHE B CD1   1 
ATOM 1868  C CD2   . PHE B 2 81  ? 122.165 152.120 148.869 1.00 56.00  ? 81  PHE B CD2   1 
ATOM 1869  C CE1   . PHE B 2 81  ? 122.326 151.812 146.141 1.00 56.00  ? 81  PHE B CE1   1 
ATOM 1870  C CE2   . PHE B 2 81  ? 122.938 151.116 148.329 1.00 56.00  ? 81  PHE B CE2   1 
ATOM 1871  C CZ    . PHE B 2 81  ? 123.024 150.966 146.966 1.00 56.00  ? 81  PHE B CZ    1 
ATOM 1872  N N     . TYR B 2 82  ? 119.375 156.661 149.596 1.00 59.87  ? 82  TYR B N     1 
ATOM 1873  C CA    . TYR B 2 82  ? 118.155 157.450 149.709 1.00 59.87  ? 82  TYR B CA    1 
ATOM 1874  C C     . TYR B 2 82  ? 118.354 158.832 149.108 1.00 59.87  ? 82  TYR B C     1 
ATOM 1875  O O     . TYR B 2 82  ? 117.531 159.303 148.310 1.00 59.87  ? 82  TYR B O     1 
ATOM 1876  C CB    . TYR B 2 82  ? 117.739 157.576 151.171 1.00 59.87  ? 82  TYR B CB    1 
ATOM 1877  C CG    . TYR B 2 82  ? 117.220 156.308 151.796 1.00 59.87  ? 82  TYR B CG    1 
ATOM 1878  C CD1   . TYR B 2 82  ? 116.875 155.213 151.026 1.00 59.87  ? 82  TYR B CD1   1 
ATOM 1879  C CD2   . TYR B 2 82  ? 117.084 156.210 153.167 1.00 59.87  ? 82  TYR B CD2   1 
ATOM 1880  C CE1   . TYR B 2 82  ? 116.407 154.056 151.610 1.00 59.87  ? 82  TYR B CE1   1 
ATOM 1881  C CE2   . TYR B 2 82  ? 116.622 155.067 153.757 1.00 59.87  ? 82  TYR B CE2   1 
ATOM 1882  C CZ    . TYR B 2 82  ? 116.283 153.991 152.979 1.00 59.87  ? 82  TYR B CZ    1 
ATOM 1883  O OH    . TYR B 2 82  ? 115.817 152.845 153.580 1.00 59.87  ? 82  TYR B OH    1 
ATOM 1884  N N     . ALA B 2 83  ? 119.486 159.466 149.425 1.00 59.26  ? 83  ALA B N     1 
ATOM 1885  C CA    . ALA B 2 83  ? 119.717 160.815 148.925 1.00 59.26  ? 83  ALA B CA    1 
ATOM 1886  C C     . ALA B 2 83  ? 119.845 160.846 147.407 1.00 59.26  ? 83  ALA B C     1 
ATOM 1887  O O     . ALA B 2 83  ? 119.233 161.689 146.746 1.00 59.26  ? 83  ALA B O     1 
ATOM 1888  C CB    . ALA B 2 83  ? 120.954 161.412 149.580 1.00 59.26  ? 83  ALA B CB    1 
ATOM 1889  N N     . VAL B 2 84  ? 120.642 159.943 146.836 1.00 54.96  ? 84  VAL B N     1 
ATOM 1890  C CA    . VAL B 2 84  ? 120.841 159.969 145.390 1.00 54.96  ? 84  VAL B CA    1 
ATOM 1891  C C     . VAL B 2 84  ? 119.559 159.633 144.645 1.00 54.96  ? 84  VAL B C     1 
ATOM 1892  O O     . VAL B 2 84  ? 119.285 160.197 143.582 1.00 54.96  ? 84  VAL B O     1 
ATOM 1893  C CB    . VAL B 2 84  ? 121.972 159.024 144.966 1.00 54.96  ? 84  VAL B CB    1 
ATOM 1894  C CG1   . VAL B 2 84  ? 121.693 157.643 145.475 1.00 54.96  ? 84  VAL B CG1   1 
ATOM 1895  C CG2   . VAL B 2 84  ? 122.072 159.008 143.454 1.00 54.96  ? 84  VAL B CG2   1 
ATOM 1896  N N     . ALA B 2 85  ? 118.769 158.694 145.156 1.00 56.55  ? 85  ALA B N     1 
ATOM 1897  C CA    . ALA B 2 85  ? 117.504 158.428 144.490 1.00 56.55  ? 85  ALA B CA    1 
ATOM 1898  C C     . ALA B 2 85  ? 116.592 159.643 144.532 1.00 56.55  ? 85  ALA B C     1 
ATOM 1899  O O     . ALA B 2 85  ? 116.002 160.023 143.512 1.00 56.55  ? 85  ALA B O     1 
ATOM 1900  C CB    . ALA B 2 85  ? 116.824 157.222 145.133 1.00 56.55  ? 85  ALA B CB    1 
ATOM 1901  N N     . ALA B 2 86  ? 116.489 160.290 145.693 1.00 57.69  ? 86  ALA B N     1 
ATOM 1902  C CA    . ALA B 2 86  ? 115.628 161.463 145.793 1.00 57.69  ? 86  ALA B CA    1 
ATOM 1903  C C     . ALA B 2 86  ? 116.089 162.601 144.887 1.00 57.69  ? 86  ALA B C     1 
ATOM 1904  O O     . ALA B 2 86  ? 115.306 163.150 144.104 1.00 57.69  ? 86  ALA B O     1 
ATOM 1905  C CB    . ALA B 2 86  ? 115.559 161.928 147.246 1.00 57.69  ? 86  ALA B CB    1 
ATOM 1906  N N     . ILE B 2 87  ? 117.373 162.957 144.976 1.00 57.79  ? 87  ILE B N     1 
ATOM 1907  C CA    . ILE B 2 87  ? 117.938 164.014 144.141 1.00 57.79  ? 87  ILE B CA    1 
ATOM 1908  C C     . ILE B 2 87  ? 117.806 163.674 142.663 1.00 57.79  ? 87  ILE B C     1 
ATOM 1909  O O     . ILE B 2 87  ? 117.521 164.542 141.831 1.00 57.79  ? 87  ILE B O     1 
ATOM 1910  C CB    . ILE B 2 87  ? 119.397 164.251 144.575 1.00 57.79  ? 87  ILE B CB    1 
ATOM 1911  C CG1   . ILE B 2 87  ? 119.984 165.517 144.008 1.00 57.79  ? 87  ILE B CG1   1 
ATOM 1912  C CG2   . ILE B 2 87  ? 120.306 163.127 144.149 1.00 57.79  ? 87  ILE B CG2   1 
ATOM 1913  C CD1   . ILE B 2 87  ? 121.283 165.719 144.651 1.00 57.79  ? 87  ILE B CD1   1 
ATOM 1914  N N     . MET B 2 88  ? 118.038 162.410 142.314 1.00 57.47  ? 88  MET B N     1 
ATOM 1915  C CA    . MET B 2 88  ? 117.894 161.958 140.939 1.00 57.47  ? 88  MET B CA    1 
ATOM 1916  C C     . MET B 2 88  ? 116.467 162.171 140.478 1.00 57.47  ? 88  MET B C     1 
ATOM 1917  O O     . MET B 2 88  ? 116.206 162.462 139.306 1.00 57.47  ? 88  MET B O     1 
ATOM 1918  C CB    . MET B 2 88  ? 118.301 160.490 140.808 1.00 57.47  ? 88  MET B CB    1 
ATOM 1919  C CG    . MET B 2 88  ? 118.318 159.982 139.376 1.00 57.47  ? 88  MET B CG    1 
ATOM 1920  S SD    . MET B 2 88  ? 116.738 159.422 138.740 1.00 57.47  ? 88  MET B SD    1 
ATOM 1921  C CE    . MET B 2 88  ? 116.589 157.886 139.629 1.00 57.47  ? 88  MET B CE    1 
ATOM 1922  N N     . ALA B 2 89  ? 115.530 162.002 141.403 1.00 60.27  ? 89  ALA B N     1 
ATOM 1923  C CA    . ALA B 2 89  ? 114.106 162.167 141.181 1.00 60.27  ? 89  ALA B CA    1 
ATOM 1924  C C     . ALA B 2 89  ? 113.606 163.599 141.213 1.00 60.27  ? 89  ALA B C     1 
ATOM 1925  O O     . ALA B 2 89  ? 112.461 163.827 140.821 1.00 60.27  ? 89  ALA B O     1 
ATOM 1926  C CB    . ALA B 2 89  ? 113.356 161.396 142.249 1.00 60.27  ? 89  ALA B CB    1 
ATOM 1927  N N     . ALA B 2 90  ? 114.378 164.563 141.692 1.00 58.53  ? 90  ALA B N     1 
ATOM 1928  C CA    . ALA B 2 90  ? 113.844 165.914 141.785 1.00 58.53  ? 90  ALA B CA    1 
ATOM 1929  C C     . ALA B 2 90  ? 114.172 166.765 140.565 1.00 58.53  ? 90  ALA B C     1 
ATOM 1930  O O     . ALA B 2 90  ? 113.934 167.975 140.586 1.00 58.53  ? 90  ALA B O     1 
ATOM 1931  C CB    . ALA B 2 90  ? 114.362 166.596 143.052 1.00 58.53  ? 90  ALA B CB    1 
ATOM 1932  N N     . GLN B 2 91  ? 114.719 166.161 139.512 1.00 58.14  ? 91  GLN B N     1 
ATOM 1933  C CA    . GLN B 2 91  ? 115.009 166.868 138.273 1.00 58.14  ? 91  GLN B CA    1 
ATOM 1934  C C     . GLN B 2 91  ? 113.759 167.314 137.519 1.00 58.14  ? 91  GLN B C     1 
ATOM 1935  O O     . GLN B 2 91  ? 112.696 166.702 137.631 1.00 58.14  ? 91  GLN B O     1 
ATOM 1936  C CB    . GLN B 2 91  ? 115.903 166.028 137.375 1.00 58.14  ? 91  GLN B CB    1 
ATOM 1937  C CG    . GLN B 2 91  ? 117.143 165.585 138.114 1.00 58.14  ? 91  GLN B CG    1 
ATOM 1938  C CD    . GLN B 2 91  ? 117.856 166.767 138.766 1.00 58.14  ? 91  GLN B CD    1 
ATOM 1939  O OE1   . GLN B 2 91  ? 117.463 167.242 139.835 1.00 58.14  ? 91  GLN B OE1   1 
ATOM 1940  N NE2   . GLN B 2 91  ? 118.844 167.299 138.082 1.00 58.14  ? 91  GLN B NE2   1 
ATOM 1941  N N     . PRO B 2 92  ? 113.874 168.386 136.739 1.00 56.49  ? 92  PRO B N     1 
ATOM 1942  C CA    . PRO B 2 92  ? 112.820 168.728 135.783 1.00 56.49  ? 92  PRO B CA    1 
ATOM 1943  C C     . PRO B 2 92  ? 112.708 167.694 134.678 1.00 56.49  ? 92  PRO B C     1 
ATOM 1944  O O     . PRO B 2 92  ? 113.638 166.934 134.397 1.00 56.49  ? 92  PRO B O     1 
ATOM 1945  C CB    . PRO B 2 92  ? 113.283 170.072 135.209 1.00 56.49  ? 92  PRO B CB    1 
ATOM 1946  C CG    . PRO B 2 92  ? 114.201 170.609 136.211 1.00 56.49  ? 92  PRO B CG    1 
ATOM 1947  C CD    . PRO B 2 92  ? 114.896 169.437 136.816 1.00 56.49  ? 92  PRO B CD    1 
ATOM 1948  N N     . ARG B 2 93  ? 111.534 167.681 134.044 1.00 54.36  ? 93  ARG B N     1 
ATOM 1949  C CA    . ARG B 2 93  ? 111.251 166.707 132.996 1.00 54.36  ? 93  ARG B CA    1 
ATOM 1950  C C     . ARG B 2 93  ? 112.175 166.897 131.803 1.00 54.36  ? 93  ARG B C     1 
ATOM 1951  O O     . ARG B 2 93  ? 112.425 165.944 131.057 1.00 54.36  ? 93  ARG B O     1 
ATOM 1952  C CB    . ARG B 2 93  ? 109.803 166.786 132.533 1.00 54.36  ? 93  ARG B CB    1 
ATOM 1953  C CG    . ARG B 2 93  ? 109.399 168.072 131.881 1.00 54.36  ? 93  ARG B CG    1 
ATOM 1954  C CD    . ARG B 2 93  ? 109.425 167.833 130.385 1.00 54.36  ? 93  ARG B CD    1 
ATOM 1955  N NE    . ARG B 2 93  ? 108.600 166.704 129.970 1.00 54.36  ? 93  ARG B NE    1 
ATOM 1956  C CZ    . ARG B 2 93  ? 108.936 165.868 128.992 1.00 54.36  ? 93  ARG B CZ    1 
ATOM 1957  N NH1   . ARG B 2 93  ? 110.075 166.044 128.338 1.00 54.36  ? 93  ARG B NH1   1 
ATOM 1958  N NH2   . ARG B 2 93  ? 108.136 164.863 128.663 1.00 54.36  ? 93  ARG B NH2   1 
ATOM 1959  N N     . SER B 2 94  ? 112.685 168.114 131.612 1.00 55.49  ? 94  SER B N     1 
ATOM 1960  C CA    . SER B 2 94  ? 113.567 168.425 130.495 1.00 55.49  ? 94  SER B CA    1 
ATOM 1961  C C     . SER B 2 94  ? 114.853 167.631 130.564 1.00 55.49  ? 94  SER B C     1 
ATOM 1962  O O     . SER B 2 94  ? 115.548 167.495 129.551 1.00 55.49  ? 94  SER B O     1 
ATOM 1963  C CB    . SER B 2 94  ? 113.869 169.919 130.443 1.00 55.49  ? 94  SER B CB    1 
ATOM 1964  O OG    . SER B 2 94  ? 112.677 170.643 130.260 1.00 55.49  ? 94  SER B OG    1 
ATOM 1965  N N     . ALA B 2 95  ? 115.189 167.123 131.741 1.00 54.67  ? 95  ALA B N     1 
ATOM 1966  C CA    . ALA B 2 95  ? 116.401 166.351 131.917 1.00 54.67  ? 95  ALA B CA    1 
ATOM 1967  C C     . ALA B 2 95  ? 116.091 164.864 131.857 1.00 54.67  ? 95  ALA B C     1 
ATOM 1968  O O     . ALA B 2 95  ? 116.996 164.059 131.607 1.00 54.67  ? 95  ALA B O     1 
ATOM 1969  C CB    . ALA B 2 95  ? 117.054 166.711 133.247 1.00 54.67  ? 95  ALA B CB    1 
ATOM 1970  N N     . ARG B 2 96  ? 114.843 164.480 132.124 1.00 56.09  ? 96  ARG B N     1 
ATOM 1971  C CA    . ARG B 2 96  ? 114.466 163.073 132.069 1.00 56.09  ? 96  ARG B CA    1 
ATOM 1972  C C     . ARG B 2 96  ? 114.431 162.648 130.607 1.00 56.09  ? 96  ARG B C     1 
ATOM 1973  O O     . ARG B 2 96  ? 113.719 163.259 129.803 1.00 56.09  ? 96  ARG B O     1 
ATOM 1974  C CB    . ARG B 2 96  ? 113.105 162.813 132.713 1.00 56.09  ? 96  ARG B CB    1 
ATOM 1975  C CG    . ARG B 2 96  ? 113.053 163.029 134.205 1.00 56.09  ? 96  ARG B CG    1 
ATOM 1976  C CD    . ARG B 2 96  ? 111.654 162.767 134.736 1.00 56.09  ? 96  ARG B CD    1 
ATOM 1977  N NE    . ARG B 2 96  ? 110.648 163.718 134.280 1.00 56.09  ? 96  ARG B NE    1 
ATOM 1978  C CZ    . ARG B 2 96  ? 109.386 163.700 134.697 1.00 56.09  ? 96  ARG B CZ    1 
ATOM 1979  N NH1   . ARG B 2 96  ? 108.993 162.783 135.571 1.00 56.09  ? 96  ARG B NH1   1 
ATOM 1980  N NH2   . ARG B 2 96  ? 108.514 164.586 134.243 1.00 56.09  ? 96  ARG B NH2   1 
ATOM 1981  N N     . ARG B 2 136 ? 133.863 153.426 132.366 1.00 46.72  ? 136 ARG B N     1 
ATOM 1982  C CA    . ARG B 2 136 ? 132.664 153.972 132.994 1.00 46.72  ? 136 ARG B CA    1 
ATOM 1983  C C     . ARG B 2 136 ? 132.998 155.319 133.628 1.00 46.72  ? 136 ARG B C     1 
ATOM 1984  O O     . ARG B 2 136 ? 133.805 155.400 134.552 1.00 46.72  ? 136 ARG B O     1 
ATOM 1985  C CB    . ARG B 2 136 ? 132.072 152.991 134.002 1.00 46.72  ? 136 ARG B CB    1 
ATOM 1986  C CG    . ARG B 2 136 ? 130.644 153.335 134.346 1.00 46.72  ? 136 ARG B CG    1 
ATOM 1987  C CD    . ARG B 2 136 ? 129.987 152.305 135.230 1.00 46.72  ? 136 ARG B CD    1 
ATOM 1988  N NE    . ARG B 2 136 ? 129.766 151.045 134.531 1.00 46.72  ? 136 ARG B NE    1 
ATOM 1989  C CZ    . ARG B 2 136 ? 129.164 149.995 135.074 1.00 46.72  ? 136 ARG B CZ    1 
ATOM 1990  N NH1   . ARG B 2 136 ? 128.726 150.063 136.320 1.00 46.72  ? 136 ARG B NH1   1 
ATOM 1991  N NH2   . ARG B 2 136 ? 128.999 148.885 134.375 1.00 46.72  ? 136 ARG B NH2   1 
ATOM 1992  N N     . PRO B 2 137 ? 132.371 156.375 133.119 1.00 44.48  ? 137 PRO B N     1 
ATOM 1993  C CA    . PRO B 2 137 ? 132.714 157.731 133.561 1.00 44.48  ? 137 PRO B CA    1 
ATOM 1994  C C     . PRO B 2 137 ? 132.198 158.038 134.957 1.00 44.48  ? 137 PRO B C     1 
ATOM 1995  O O     . PRO B 2 137 ? 131.212 157.464 135.428 1.00 44.48  ? 137 PRO B O     1 
ATOM 1996  C CB    . PRO B 2 137 ? 132.018 158.615 132.523 1.00 44.48  ? 137 PRO B CB    1 
ATOM 1997  C CG    . PRO B 2 137 ? 130.842 157.803 132.093 1.00 44.48  ? 137 PRO B CG    1 
ATOM 1998  C CD    . PRO B 2 137 ? 131.301 156.374 132.105 1.00 44.48  ? 137 PRO B CD    1 
ATOM 1999  N N     . ASN B 2 138 ? 132.890 158.971 135.616 1.00 40.42  ? 138 ASN B N     1 
ATOM 2000  C CA    . ASN B 2 138 ? 132.542 159.444 136.948 1.00 40.42  ? 138 ASN B CA    1 
ATOM 2001  C C     . ASN B 2 138 ? 131.763 160.759 136.887 1.00 40.42  ? 138 ASN B C     1 
ATOM 2002  O O     . ASN B 2 138 ? 131.156 161.085 135.864 1.00 40.42  ? 138 ASN B O     1 
ATOM 2003  C CB    . ASN B 2 138 ? 133.861 159.587 137.715 1.00 40.42  ? 138 ASN B CB    1 
ATOM 2004  C CG    . ASN B 2 138 ? 133.680 159.743 139.188 1.00 40.42  ? 138 ASN B CG    1 
ATOM 2005  O OD1   . ASN B 2 138 ? 132.598 159.525 139.725 1.00 40.42  ? 138 ASN B OD1   1 
ATOM 2006  N ND2   . ASN B 2 138 ? 134.759 160.086 139.867 1.00 40.42  ? 138 ASN B ND2   1 
ATOM 2007  N N     . LEU B 2 139 ? 131.773 161.525 137.979 1.00 32.54  ? 139 LEU B N     1 
ATOM 2008  C CA    . LEU B 2 139 ? 131.096 162.817 138.023 1.00 32.54  ? 139 LEU B CA    1 
ATOM 2009  C C     . LEU B 2 139 ? 132.006 163.949 137.588 1.00 32.54  ? 139 LEU B C     1 
ATOM 2010  O O     . LEU B 2 139 ? 131.537 164.946 137.027 1.00 32.54  ? 139 LEU B O     1 
ATOM 2011  C CB    . LEU B 2 139 ? 130.582 163.104 139.436 1.00 32.54  ? 139 LEU B CB    1 
ATOM 2012  C CG    . LEU B 2 139 ? 129.769 164.378 139.641 1.00 32.54  ? 139 LEU B CG    1 
ATOM 2013  C CD1   . LEU B 2 139 ? 128.483 164.088 140.351 1.00 32.54  ? 139 LEU B CD1   1 
ATOM 2014  C CD2   . LEU B 2 139 ? 130.588 165.342 140.465 1.00 32.54  ? 139 LEU B CD2   1 
ATOM 2015  N N     . GLY B 2 140 ? 133.302 163.804 137.847 1.00 33.07  ? 140 GLY B N     1 
ATOM 2016  C CA    . GLY B 2 140 ? 134.253 164.807 137.412 1.00 33.07  ? 140 GLY B CA    1 
ATOM 2017  C C     . GLY B 2 140 ? 134.344 164.907 135.905 1.00 33.07  ? 140 GLY B C     1 
ATOM 2018  O O     . GLY B 2 140 ? 134.346 166.001 135.341 1.00 33.07  ? 140 GLY B O     1 
ATOM 2019  N N     . VAL B 2 141 ? 134.393 163.760 135.232 1.00 35.08  ? 141 VAL B N     1 
ATOM 2020  C CA    . VAL B 2 141 ? 134.436 163.764 133.779 1.00 35.08  ? 141 VAL B CA    1 
ATOM 2021  C C     . VAL B 2 141 ? 133.141 164.299 133.195 1.00 35.08  ? 141 VAL B C     1 
ATOM 2022  O O     . VAL B 2 141 ? 133.155 164.980 132.163 1.00 35.08  ? 141 VAL B O     1 
ATOM 2023  C CB    . VAL B 2 141 ? 134.706 162.335 133.282 1.00 35.08  ? 141 VAL B CB    1 
ATOM 2024  C CG1   . VAL B 2 141 ? 136.037 161.859 133.781 1.00 35.08  ? 141 VAL B CG1   1 
ATOM 2025  C CG2   . VAL B 2 141 ? 133.633 161.414 133.779 1.00 35.08  ? 141 VAL B CG2   1 
ATOM 2026  N N     . SER B 2 142 ? 132.017 164.054 133.870 1.00 35.02  ? 142 SER B N     1 
ATOM 2027  C CA    . SER B 2 142 ? 130.744 164.594 133.413 1.00 35.02  ? 142 SER B CA    1 
ATOM 2028  C C     . SER B 2 142 ? 130.719 166.105 133.553 1.00 35.02  ? 142 SER B C     1 
ATOM 2029  O O     . SER B 2 142 ? 130.210 166.810 132.674 1.00 35.02  ? 142 SER B O     1 
ATOM 2030  C CB    . SER B 2 142 ? 129.600 163.964 134.203 1.00 35.02  ? 142 SER B CB    1 
ATOM 2031  O OG    . SER B 2 142 ? 129.455 162.594 133.888 1.00 35.02  ? 142 SER B OG    1 
ATOM 2032  N N     . LEU B 2 143 ? 131.288 166.617 134.643 1.00 34.85  ? 143 LEU B N     1 
ATOM 2033  C CA    . LEU B 2 143 ? 131.370 168.059 134.833 1.00 34.85  ? 143 LEU B CA    1 
ATOM 2034  C C     . LEU B 2 143 ? 132.301 168.715 133.826 1.00 34.85  ? 143 LEU B C     1 
ATOM 2035  O O     . LEU B 2 143 ? 131.943 169.733 133.227 1.00 34.85  ? 143 LEU B O     1 
ATOM 2036  C CB    . LEU B 2 143 ? 131.810 168.351 136.262 1.00 34.85  ? 143 LEU B CB    1 
ATOM 2037  C CG    . LEU B 2 143 ? 130.627 168.356 137.215 1.00 34.85  ? 143 LEU B CG    1 
ATOM 2038  C CD1   . LEU B 2 143 ? 131.077 168.386 138.633 1.00 34.85  ? 143 LEU B CD1   1 
ATOM 2039  C CD2   . LEU B 2 143 ? 129.904 169.647 136.914 1.00 34.85  ? 143 LEU B CD2   1 
ATOM 2040  N N     . ALA B 2 144 ? 133.499 168.164 133.628 1.00 33.32  ? 144 ALA B N     1 
ATOM 2041  C CA    . ALA B 2 144 ? 134.405 168.759 132.652 1.00 33.32  ? 144 ALA B CA    1 
ATOM 2042  C C     . ALA B 2 144 ? 133.807 168.741 131.253 1.00 33.32  ? 144 ALA B C     1 
ATOM 2043  O O     . ALA B 2 144 ? 133.858 169.749 130.537 1.00 33.32  ? 144 ALA B O     1 
ATOM 2044  C CB    . ALA B 2 144 ? 135.745 168.033 132.667 1.00 33.32  ? 144 ALA B CB    1 
ATOM 2045  N N     . GLN B 2 145 ? 133.217 167.612 130.847 1.00 36.88  ? 145 GLN B N     1 
ATOM 2046  C CA    . GLN B 2 145 ? 132.586 167.586 129.533 1.00 36.88  ? 145 GLN B CA    1 
ATOM 2047  C C     . GLN B 2 145 ? 131.409 168.551 129.473 1.00 36.88  ? 145 GLN B C     1 
ATOM 2048  O O     . GLN B 2 145 ? 131.118 169.100 128.408 1.00 36.88  ? 145 GLN B O     1 
ATOM 2049  C CB    . GLN B 2 145 ? 132.211 166.152 129.134 1.00 36.88  ? 145 GLN B CB    1 
ATOM 2050  C CG    . GLN B 2 145 ? 131.115 165.432 129.889 1.00 36.88  ? 145 GLN B CG    1 
ATOM 2051  C CD    . GLN B 2 145 ? 129.736 165.978 129.600 1.00 36.88  ? 145 GLN B CD    1 
ATOM 2052  O OE1   . GLN B 2 145 ? 129.489 166.539 128.532 1.00 36.88  ? 145 GLN B OE1   1 
ATOM 2053  N NE2   . GLN B 2 145 ? 128.821 165.791 130.536 1.00 36.88  ? 145 GLN B NE2   1 
ATOM 2054  N N     . ALA B 2 146 ? 130.713 168.764 130.594 1.00 34.47  ? 146 ALA B N     1 
ATOM 2055  C CA    . ALA B 2 146 ? 129.625 169.736 130.600 1.00 34.47  ? 146 ALA B CA    1 
ATOM 2056  C C     . ALA B 2 146 ? 130.150 171.155 130.454 1.00 34.47  ? 146 ALA B C     1 
ATOM 2057  O O     . ALA B 2 146 ? 129.511 171.997 129.811 1.00 34.47  ? 146 ALA B O     1 
ATOM 2058  C CB    . ALA B 2 146 ? 128.820 169.616 131.887 1.00 34.47  ? 146 ALA B CB    1 
ATOM 2059  N N     . VAL B 2 147 ? 131.327 171.425 131.012 1.00 33.40  ? 147 VAL B N     1 
ATOM 2060  C CA    . VAL B 2 147 ? 131.938 172.739 130.872 1.00 33.40  ? 147 VAL B CA    1 
ATOM 2061  C C     . VAL B 2 147 ? 132.347 172.956 129.429 1.00 33.40  ? 147 VAL B C     1 
ATOM 2062  O O     . VAL B 2 147 ? 132.017 173.976 128.813 1.00 33.40  ? 147 VAL B O     1 
ATOM 2063  C CB    . VAL B 2 147 ? 133.140 172.880 131.818 1.00 33.40  ? 147 VAL B CB    1 
ATOM 2064  C CG1   . VAL B 2 147 ? 133.907 174.143 131.490 1.00 33.40  ? 147 VAL B CG1   1 
ATOM 2065  C CG2   . VAL B 2 147 ? 132.678 172.888 133.260 1.00 33.40  ? 147 VAL B CG2   1 
ATOM 2066  N N     . PHE B 2 148 ? 133.076 171.994 128.870 1.00 35.88  ? 148 PHE B N     1 
ATOM 2067  C CA    . PHE B 2 148 ? 133.607 172.168 127.530 1.00 35.88  ? 148 PHE B CA    1 
ATOM 2068  C C     . PHE B 2 148 ? 132.469 172.204 126.520 1.00 35.88  ? 148 PHE B C     1 
ATOM 2069  O O     . PHE B 2 148 ? 132.447 173.058 125.627 1.00 35.88  ? 148 PHE B O     1 
ATOM 2070  C CB    . PHE B 2 148 ? 134.592 171.041 127.225 1.00 35.88  ? 148 PHE B CB    1 
ATOM 2071  C CG    . PHE B 2 148 ? 135.288 171.187 125.915 1.00 35.88  ? 148 PHE B CG    1 
ATOM 2072  C CD1   . PHE B 2 148 ? 136.311 172.108 125.766 1.00 35.88  ? 148 PHE B CD1   1 
ATOM 2073  C CD2   . PHE B 2 148 ? 134.934 170.401 124.835 1.00 35.88  ? 148 PHE B CD2   1 
ATOM 2074  C CE1   . PHE B 2 148 ? 136.961 172.249 124.560 1.00 35.88  ? 148 PHE B CE1   1 
ATOM 2075  C CE2   . PHE B 2 148 ? 135.580 170.535 123.625 1.00 35.88  ? 148 PHE B CE2   1 
ATOM 2076  C CZ    . PHE B 2 148 ? 136.595 171.462 123.487 1.00 35.88  ? 148 PHE B CZ    1 
ATOM 2077  N N     . ASP B 2 149 ? 131.507 171.291 126.656 1.00 37.11  ? 149 ASP B N     1 
ATOM 2078  C CA    . ASP B 2 149 ? 130.438 171.195 125.667 1.00 37.11  ? 149 ASP B CA    1 
ATOM 2079  C C     . ASP B 2 149 ? 129.379 172.267 125.901 1.00 37.11  ? 149 ASP B C     1 
ATOM 2080  O O     . ASP B 2 149 ? 129.237 173.201 125.108 1.00 37.11  ? 149 ASP B O     1 
ATOM 2081  C CB    . ASP B 2 149 ? 129.798 169.808 125.715 1.00 37.11  ? 149 ASP B CB    1 
ATOM 2082  C CG    . ASP B 2 149 ? 130.638 168.756 125.038 1.00 37.11  ? 149 ASP B CG    1 
ATOM 2083  O OD1   . ASP B 2 149 ? 131.437 169.115 124.148 1.00 37.11  ? 149 ASP B OD1   1 
ATOM 2084  O OD2   . ASP B 2 149 ? 130.489 167.566 125.385 1.00 37.11  ? 149 ASP B OD2   1 
ATOM 2085  N N     . LYS B 2 150 ? 128.622 172.142 126.996 1.00 36.20  ? 150 LYS B N     1 
ATOM 2086  C CA    . LYS B 2 150 ? 127.497 173.041 127.227 1.00 36.20  ? 150 LYS B CA    1 
ATOM 2087  C C     . LYS B 2 150 ? 127.923 174.474 127.512 1.00 36.20  ? 150 LYS B C     1 
ATOM 2088  O O     . LYS B 2 150 ? 127.078 175.373 127.481 1.00 36.20  ? 150 LYS B O     1 
ATOM 2089  C CB    . LYS B 2 150 ? 126.657 172.526 128.394 1.00 36.20  ? 150 LYS B CB    1 
ATOM 2090  C CG    . LYS B 2 150 ? 126.113 171.119 128.208 1.00 36.20  ? 150 LYS B CG    1 
ATOM 2091  C CD    . LYS B 2 150 ? 125.225 171.004 126.984 1.00 36.20  ? 150 LYS B CD    1 
ATOM 2092  C CE    . LYS B 2 150 ? 124.677 169.594 126.839 1.00 36.20  ? 150 LYS B CE    1 
ATOM 2093  N NZ    . LYS B 2 150 ? 125.764 168.586 126.740 1.00 36.20  ? 150 LYS B NZ    1 
ATOM 2094  N N     . GLY B 2 151 ? 129.198 174.707 127.796 1.00 35.19  ? 151 GLY B N     1 
ATOM 2095  C CA    . GLY B 2 151 ? 129.703 176.045 128.027 1.00 35.19  ? 151 GLY B CA    1 
ATOM 2096  C C     . GLY B 2 151 ? 129.359 176.632 129.378 1.00 35.19  ? 151 GLY B C     1 
ATOM 2097  O O     . GLY B 2 151 ? 129.186 177.852 129.482 1.00 35.19  ? 151 GLY B O     1 
ATOM 2098  N N     . LEU B 2 152 ? 129.240 175.807 130.416 1.00 31.32  ? 152 LEU B N     1 
ATOM 2099  C CA    . LEU B 2 152 ? 129.006 176.339 131.751 1.00 31.32  ? 152 LEU B CA    1 
ATOM 2100  C C     . LEU B 2 152 ? 130.236 177.097 132.228 1.00 31.32  ? 152 LEU B C     1 
ATOM 2101  O O     . LEU B 2 152 ? 131.302 177.039 131.608 1.00 31.32  ? 152 LEU B O     1 
ATOM 2102  C CB    . LEU B 2 152 ? 128.682 175.215 132.731 1.00 31.32  ? 152 LEU B CB    1 
ATOM 2103  C CG    . LEU B 2 152 ? 127.429 174.400 132.429 1.00 31.32  ? 152 LEU B CG    1 
ATOM 2104  C CD1   . LEU B 2 152 ? 127.151 173.408 133.549 1.00 31.32  ? 152 LEU B CD1   1 
ATOM 2105  C CD2   . LEU B 2 152 ? 126.244 175.321 132.203 1.00 31.32  ? 152 LEU B CD2   1 
ATOM 2106  N N     . ASN B 2 153 ? 130.091 177.831 133.326 1.00 32.20  ? 153 ASN B N     1 
ATOM 2107  C CA    . ASN B 2 153 ? 131.249 178.539 133.838 1.00 32.20  ? 153 ASN B CA    1 
ATOM 2108  C C     . ASN B 2 153 ? 132.272 177.508 134.289 1.00 32.20  ? 153 ASN B C     1 
ATOM 2109  O O     . ASN B 2 153 ? 131.929 176.509 134.925 1.00 32.20  ? 153 ASN B O     1 
ATOM 2110  C CB    . ASN B 2 153 ? 130.842 179.446 135.000 1.00 32.20  ? 153 ASN B CB    1 
ATOM 2111  C CG    . ASN B 2 153 ? 131.918 180.444 135.375 1.00 32.20  ? 153 ASN B CG    1 
ATOM 2112  O OD1   . ASN B 2 153 ? 133.087 180.284 135.025 1.00 32.20  ? 153 ASN B OD1   1 
ATOM 2113  N ND2   . ASN B 2 153 ? 131.521 181.491 136.087 1.00 32.20  ? 153 ASN B ND2   1 
ATOM 2114  N N     . ALA B 2 154 ? 133.537 177.741 133.956 1.00 30.19  ? 154 ALA B N     1 
ATOM 2115  C CA    . ALA B 2 154 ? 134.527 176.747 134.343 1.00 30.19  ? 154 ALA B CA    1 
ATOM 2116  C C     . ALA B 2 154 ? 135.130 177.067 135.697 1.00 30.19  ? 154 ALA B C     1 
ATOM 2117  O O     . ALA B 2 154 ? 135.163 176.216 136.596 1.00 30.19  ? 154 ALA B O     1 
ATOM 2118  C CB    . ALA B 2 154 ? 135.630 176.664 133.286 1.00 30.19  ? 154 ALA B CB    1 
ATOM 2119  N N     . ASP B 2 155 ? 135.546 178.320 135.866 1.00 31.07  ? 155 ASP B N     1 
ATOM 2120  C CA    . ASP B 2 155 ? 136.229 178.715 137.086 1.00 31.07  ? 155 ASP B CA    1 
ATOM 2121  C C     . ASP B 2 155 ? 135.343 178.593 138.320 1.00 31.07  ? 155 ASP B C     1 
ATOM 2122  O O     . ASP B 2 155 ? 135.826 178.103 139.348 1.00 31.07  ? 155 ASP B O     1 
ATOM 2123  C CB    . ASP B 2 155 ? 136.763 180.139 136.942 1.00 31.07  ? 155 ASP B CB    1 
ATOM 2124  C CG    . ASP B 2 155 ? 137.908 180.233 135.954 1.00 31.07  ? 155 ASP B CG    1 
ATOM 2125  O OD1   . ASP B 2 155 ? 138.642 179.238 135.800 1.00 31.07  ? 155 ASP B OD1   1 
ATOM 2126  O OD2   . ASP B 2 155 ? 138.079 181.303 135.330 1.00 31.07  ? 155 ASP B OD2   1 
ATOM 2127  N N     . SER B 2 156 ? 134.019 178.775 138.167 1.00 28.80  ? 156 SER B N     1 
ATOM 2128  C CA    . SER B 2 156 ? 133.081 178.757 139.293 1.00 28.80  ? 156 SER B CA    1 
ATOM 2129  C C     . SER B 2 156 ? 132.687 177.330 139.644 1.00 28.80  ? 156 SER B C     1 
ATOM 2130  O O     . SER B 2 156 ? 132.621 176.962 140.838 1.00 28.80  ? 156 SER B O     1 
ATOM 2131  C CB    . SER B 2 156 ? 131.838 179.581 138.947 1.00 28.80  ? 156 SER B CB    1 
ATOM 2132  O OG    . SER B 2 156 ? 130.921 179.602 140.023 1.00 28.80  ? 156 SER B OG    1 
ATOM 2133  N N     . THR B 2 157 ? 132.501 176.501 138.638 1.00 30.50  ? 157 THR B N     1 
ATOM 2134  C CA    . THR B 2 157 ? 132.188 175.123 138.937 1.00 30.50  ? 157 THR B CA    1 
ATOM 2135  C C     . THR B 2 157 ? 133.423 174.511 139.556 1.00 30.50  ? 157 THR B C     1 
ATOM 2136  O O     . THR B 2 157 ? 133.333 173.560 140.337 1.00 30.50  ? 157 THR B O     1 
ATOM 2137  C CB    . THR B 2 157 ? 131.766 174.366 137.680 1.00 30.50  ? 157 THR B CB    1 
ATOM 2138  O OG1   . THR B 2 157 ? 130.575 174.953 137.144 1.00 30.50  ? 157 THR B OG1   1 
ATOM 2139  C CG2   . THR B 2 157 ? 131.505 172.906 137.995 1.00 30.50  ? 157 THR B CG2   1 
ATOM 2140  N N     . GLU B 2 158 ? 134.548 175.165 139.278 1.00 29.74  ? 158 GLU B N     1 
ATOM 2141  C CA    . GLU B 2 158 ? 135.838 174.803 139.830 1.00 29.74  ? 158 GLU B CA    1 
ATOM 2142  C C     . GLU B 2 158 ? 135.816 174.978 141.350 1.00 29.74  ? 158 GLU B C     1 
ATOM 2143  O O     . GLU B 2 158 ? 136.140 174.034 142.072 1.00 29.74  ? 158 GLU B O     1 
ATOM 2144  C CB    . GLU B 2 158 ? 136.946 175.659 139.215 1.00 29.74  ? 158 GLU B CB    1 
ATOM 2145  C CG    . GLU B 2 158 ? 138.352 175.172 139.527 1.00 29.74  ? 158 GLU B CG    1 
ATOM 2146  C CD    . GLU B 2 158 ? 138.530 173.692 139.253 1.00 29.74  ? 158 GLU B CD    1 
ATOM 2147  O OE1   . GLU B 2 158 ? 137.591 173.068 138.715 1.00 29.74  ? 158 GLU B OE1   1 
ATOM 2148  O OE2   . GLU B 2 158 ? 139.609 173.152 139.575 1.00 29.74  ? 158 GLU B OE2   1 
ATOM 2149  N N     . GLN B 2 159 ? 135.439 176.157 141.860 1.00 28.85  ? 159 GLN B N     1 
ATOM 2150  C CA    . GLN B 2 159 ? 135.423 176.278 143.334 1.00 28.85  ? 159 GLN B CA    1 
ATOM 2151  C C     . GLN B 2 159 ? 134.376 175.369 143.958 1.00 28.85  ? 159 GLN B C     1 
ATOM 2152  O O     . GLN B 2 159 ? 134.599 174.849 145.055 1.00 28.85  ? 159 GLN B O     1 
ATOM 2153  C CB    . GLN B 2 159 ? 135.279 177.689 143.970 1.00 28.85  ? 159 GLN B CB    1 
ATOM 2154  N N     . ARG B 2 160 ? 133.232 175.151 143.301 1.00 29.95  ? 160 ARG B N     1 
ATOM 2155  C CA    . ARG B 2 160 ? 132.279 174.243 143.946 1.00 29.95  ? 160 ARG B CA    1 
ATOM 2156  C C     . ARG B 2 160 ? 132.826 172.821 144.021 1.00 29.95  ? 160 ARG B C     1 
ATOM 2157  O O     . ARG B 2 160 ? 132.618 172.120 145.024 1.00 29.95  ? 160 ARG B O     1 
ATOM 2158  C CB    . ARG B 2 160 ? 130.931 174.307 143.246 1.00 29.95  ? 160 ARG B CB    1 
ATOM 2159  C CG    . ARG B 2 160 ? 129.833 173.568 143.975 1.00 29.95  ? 160 ARG B CG    1 
ATOM 2160  C CD    . ARG B 2 160 ? 128.563 173.751 143.208 1.00 29.95  ? 160 ARG B CD    1 
ATOM 2161  N NE    . ARG B 2 160 ? 128.197 175.162 143.289 1.00 29.95  ? 160 ARG B NE    1 
ATOM 2162  C CZ    . ARG B 2 160 ? 128.245 176.017 142.276 1.00 29.95  ? 160 ARG B CZ    1 
ATOM 2163  N NH1   . ARG B 2 160 ? 128.648 175.618 141.080 1.00 29.95  ? 160 ARG B NH1   1 
ATOM 2164  N NH2   . ARG B 2 160 ? 127.899 177.276 142.472 1.00 29.95  ? 160 ARG B NH2   1 
ATOM 2165  N N     . LEU B 2 161 ? 133.553 172.384 143.002 1.00 30.11  ? 161 LEU B N     1 
ATOM 2166  C CA    . LEU B 2 161 ? 134.202 171.081 143.093 1.00 30.11  ? 161 LEU B CA    1 
ATOM 2167  C C     . LEU B 2 161 ? 135.196 171.062 144.243 1.00 30.11  ? 161 LEU B C     1 
ATOM 2168  O O     . LEU B 2 161 ? 135.215 170.126 145.057 1.00 30.11  ? 161 LEU B O     1 
ATOM 2169  C CB    . LEU B 2 161 ? 134.896 170.730 141.784 1.00 30.11  ? 161 LEU B CB    1 
ATOM 2170  C CG    . LEU B 2 161 ? 134.066 169.881 140.841 1.00 30.11  ? 161 LEU B CG    1 
ATOM 2171  C CD1   . LEU B 2 161 ? 133.843 168.558 141.519 1.00 30.11  ? 161 LEU B CD1   1 
ATOM 2172  C CD2   . LEU B 2 161 ? 132.749 170.556 140.595 1.00 30.11  ? 161 LEU B CD2   1 
ATOM 2173  N N     . HIS B 2 162 ? 135.988 172.130 144.364 1.00 30.18  ? 162 HIS B N     1 
ATOM 2174  C CA    . HIS B 2 162 ? 136.964 172.165 145.435 1.00 30.18  ? 162 HIS B CA    1 
ATOM 2175  C C     . HIS B 2 162 ? 136.316 172.271 146.807 1.00 30.18  ? 162 HIS B C     1 
ATOM 2176  O O     . HIS B 2 162 ? 136.961 171.916 147.798 1.00 30.18  ? 162 HIS B O     1 
ATOM 2177  C CB    . HIS B 2 162 ? 137.857 173.397 145.266 1.00 30.18  ? 162 HIS B CB    1 
ATOM 2178  C CG    . HIS B 2 162 ? 138.824 173.313 144.128 1.00 30.18  ? 162 HIS B CG    1 
ATOM 2179  N ND1   . HIS B 2 162 ? 139.940 172.517 144.144 1.00 30.18  ? 162 HIS B ND1   1 
ATOM 2180  C CD2   . HIS B 2 162 ? 138.865 173.988 142.956 1.00 30.18  ? 162 HIS B CD2   1 
ATOM 2181  C CE1   . HIS B 2 162 ? 140.610 172.668 143.017 1.00 30.18  ? 162 HIS B CE1   1 
ATOM 2182  N NE2   . HIS B 2 162 ? 139.982 173.562 142.282 1.00 30.18  ? 162 HIS B NE2   1 
ATOM 2183  N N     . LEU B 2 163 ? 135.062 172.708 146.898 1.00 29.98  ? 163 LEU B N     1 
ATOM 2184  C CA    . LEU B 2 163 ? 134.420 172.724 148.205 1.00 29.98  ? 163 LEU B CA    1 
ATOM 2185  C C     . LEU B 2 163 ? 133.824 171.372 148.547 1.00 29.98  ? 163 LEU B C     1 
ATOM 2186  O O     . LEU B 2 163 ? 133.876 170.948 149.707 1.00 29.98  ? 163 LEU B O     1 
ATOM 2187  C CB    . LEU B 2 163 ? 133.361 173.825 148.299 1.00 29.98  ? 163 LEU B CB    1 
ATOM 2188  C CG    . LEU B 2 163 ? 132.090 173.836 147.465 1.00 29.98  ? 163 LEU B CG    1 
ATOM 2189  C CD1   . LEU B 2 163 ? 131.020 172.963 148.083 1.00 29.98  ? 163 LEU B CD1   1 
ATOM 2190  C CD2   . LEU B 2 163 ? 131.593 175.238 147.291 1.00 29.98  ? 163 LEU B CD2   1 
ATOM 2191  N N     . ILE B 2 164 ? 133.304 170.656 147.550 1.00 30.08  ? 164 ILE B N     1 
ATOM 2192  C CA    . ILE B 2 164 ? 132.778 169.335 147.859 1.00 30.08  ? 164 ILE B CA    1 
ATOM 2193  C C     . ILE B 2 164 ? 133.899 168.381 148.193 1.00 30.08  ? 164 ILE B C     1 
ATOM 2194  O O     . ILE B 2 164 ? 133.722 167.483 149.022 1.00 30.08  ? 164 ILE B O     1 
ATOM 2195  C CB    . ILE B 2 164 ? 131.885 168.795 146.738 1.00 30.08  ? 164 ILE B CB    1 
ATOM 2196  C CG1   . ILE B 2 164 ? 130.753 169.764 146.493 1.00 30.08  ? 164 ILE B CG1   1 
ATOM 2197  C CG2   . ILE B 2 164 ? 131.319 167.451 147.099 1.00 30.08  ? 164 ILE B CG2   1 
ATOM 2198  C CD1   . ILE B 2 164 ? 129.861 169.320 145.422 1.00 30.08  ? 164 ILE B CD1   1 
ATOM 2199  N N     . ALA B 2 165 ? 135.074 168.557 147.602 1.00 32.19  ? 165 ALA B N     1 
ATOM 2200  C CA    . ALA B 2 165 ? 136.085 167.537 147.817 1.00 32.19  ? 165 ALA B CA    1 
ATOM 2201  C C     . ALA B 2 165 ? 136.564 167.510 149.266 1.00 32.19  ? 165 ALA B C     1 
ATOM 2202  O O     . ALA B 2 165 ? 137.266 166.571 149.655 1.00 32.19  ? 165 ALA B O     1 
ATOM 2203  C CB    . ALA B 2 165 ? 137.263 167.759 146.873 1.00 32.19  ? 165 ALA B CB    1 
ATOM 2204  N N     . ARG B 2 166 ? 136.197 168.510 150.069 1.00 37.34  ? 166 ARG B N     1 
ATOM 2205  C CA    . ARG B 2 166 ? 136.590 168.581 151.470 1.00 37.34  ? 166 ARG B CA    1 
ATOM 2206  C C     . ARG B 2 166 ? 135.509 168.134 152.447 1.00 37.34  ? 166 ARG B C     1 
ATOM 2207  O O     . ARG B 2 166 ? 135.833 167.837 153.602 1.00 37.34  ? 166 ARG B O     1 
ATOM 2208  C CB    . ARG B 2 166 ? 137.044 169.998 151.841 1.00 37.34  ? 166 ARG B CB    1 
ATOM 2209  C CG    . ARG B 2 166 ? 138.185 170.514 150.989 1.00 37.34  ? 166 ARG B CG    1 
ATOM 2210  C CD    . ARG B 2 166 ? 138.555 171.940 151.335 1.00 37.34  ? 166 ARG B CD    1 
ATOM 2211  N NE    . ARG B 2 166 ? 137.405 172.829 151.317 1.00 37.34  ? 166 ARG B NE    1 
ATOM 2212  C CZ    . ARG B 2 166 ? 137.098 173.611 150.292 1.00 37.34  ? 166 ARG B CZ    1 
ATOM 2213  N NH1   . ARG B 2 166 ? 137.861 173.608 149.208 1.00 37.34  ? 166 ARG B NH1   1 
ATOM 2214  N NH2   . ARG B 2 166 ? 136.036 174.399 150.350 1.00 37.34  ? 166 ARG B NH2   1 
ATOM 2215  N N     . GLN B 2 167 ? 134.247 168.081 152.030 1.00 40.88  ? 167 GLN B N     1 
ATOM 2216  C CA    . GLN B 2 167 ? 133.160 167.779 152.951 1.00 40.88  ? 167 GLN B CA    1 
ATOM 2217  C C     . GLN B 2 167 ? 133.250 166.365 153.523 1.00 40.88  ? 167 GLN B C     1 
ATOM 2218  O O     . GLN B 2 167 ? 133.964 165.496 153.020 1.00 40.88  ? 167 GLN B O     1 
ATOM 2219  C CB    . GLN B 2 167 ? 131.825 167.934 152.237 1.00 40.88  ? 167 GLN B CB    1 
ATOM 2220  C CG    . GLN B 2 167 ? 131.641 169.301 151.676 1.00 40.88  ? 167 GLN B CG    1 
ATOM 2221  C CD    . GLN B 2 167 ? 131.577 170.314 152.773 1.00 40.88  ? 167 GLN B CD    1 
ATOM 2222  O OE1   . GLN B 2 167 ? 132.428 171.193 152.880 1.00 40.88  ? 167 GLN B OE1   1 
ATOM 2223  N NE2   . GLN B 2 167 ? 130.579 170.180 153.626 1.00 40.88  ? 167 GLN B NE2   1 
ATOM 2224  N N     . ASN B 2 168 ? 132.512 166.158 154.616 1.00 44.38  ? 168 ASN B N     1 
ATOM 2225  C CA    . ASN B 2 168 ? 132.336 164.852 155.231 1.00 44.38  ? 168 ASN B CA    1 
ATOM 2226  C C     . ASN B 2 168 ? 131.134 164.145 154.607 1.00 44.38  ? 168 ASN B C     1 
ATOM 2227  O O     . ASN B 2 168 ? 130.541 164.620 153.638 1.00 44.38  ? 168 ASN B O     1 
ATOM 2228  C CB    . ASN B 2 168 ? 132.156 164.999 156.740 1.00 44.38  ? 168 ASN B CB    1 
ATOM 2229  C CG    . ASN B 2 168 ? 131.116 166.036 157.101 1.00 44.38  ? 168 ASN B CG    1 
ATOM 2230  O OD1   . ASN B 2 168 ? 130.304 166.432 156.265 1.00 44.38  ? 168 ASN B OD1   1 
ATOM 2231  N ND2   . ASN B 2 168 ? 131.128 166.476 158.353 1.00 44.38  ? 168 ASN B ND2   1 
ATOM 2232  N N     . LEU B 2 169 ? 130.743 163.006 155.183 1.00 43.90  ? 169 LEU B N     1 
ATOM 2233  C CA    . LEU B 2 169 ? 129.633 162.251 154.616 1.00 43.90  ? 169 LEU B CA    1 
ATOM 2234  C C     . LEU B 2 169 ? 128.338 163.048 154.661 1.00 43.90  ? 169 LEU B C     1 
ATOM 2235  O O     . LEU B 2 169 ? 127.508 162.940 153.753 1.00 43.90  ? 169 LEU B O     1 
ATOM 2236  C CB    . LEU B 2 169 ? 129.485 160.921 155.363 1.00 43.90  ? 169 LEU B CB    1 
ATOM 2237  C CG    . LEU B 2 169 ? 128.423 159.887 154.963 1.00 43.90  ? 169 LEU B CG    1 
ATOM 2238  C CD1   . LEU B 2 169 ? 127.084 160.169 155.616 1.00 43.90  ? 169 LEU B CD1   1 
ATOM 2239  C CD2   . LEU B 2 169 ? 128.252 159.850 153.457 1.00 43.90  ? 169 LEU B CD2   1 
ATOM 2240  N N     . ASP B 2 170 ? 128.147 163.849 155.702 1.00 45.04  ? 170 ASP B N     1 
ATOM 2241  C CA    . ASP B 2 170 ? 126.935 164.644 155.803 1.00 45.04  ? 170 ASP B CA    1 
ATOM 2242  C C     . ASP B 2 170 ? 127.031 165.915 154.970 1.00 45.04  ? 170 ASP B C     1 
ATOM 2243  O O     . ASP B 2 170 ? 126.005 166.452 154.543 1.00 45.04  ? 170 ASP B O     1 
ATOM 2244  C CB    . ASP B 2 170 ? 126.645 164.955 157.274 1.00 45.04  ? 170 ASP B CB    1 
ATOM 2245  C CG    . ASP B 2 170 ? 125.210 165.406 157.518 1.00 45.04  ? 170 ASP B CG    1 
ATOM 2246  O OD1   . ASP B 2 170 ? 124.552 165.895 156.579 1.00 45.04  ? 170 ASP B OD1   1 
ATOM 2247  O OD2   . ASP B 2 170 ? 124.733 165.243 158.661 1.00 45.04  ? 170 ASP B OD2   1 
ATOM 2248  N N     . GLY B 2 171 ? 128.245 166.376 154.674 1.00 44.97  ? 171 GLY B N     1 
ATOM 2249  C CA    . GLY B 2 171 ? 128.378 167.601 153.914 1.00 44.97  ? 171 GLY B CA    1 
ATOM 2250  C C     . GLY B 2 171 ? 128.222 167.385 152.426 1.00 44.97  ? 171 GLY B C     1 
ATOM 2251  O O     . GLY B 2 171 ? 127.732 168.267 151.714 1.00 44.97  ? 171 GLY B O     1 
ATOM 2252  N N     . VAL B 2 172 ? 128.624 166.217 151.936 1.00 45.08  ? 172 VAL B N     1 
ATOM 2253  C CA    . VAL B 2 172 ? 128.498 165.944 150.511 1.00 45.08  ? 172 VAL B CA    1 
ATOM 2254  C C     . VAL B 2 172 ? 127.035 165.986 150.100 1.00 45.08  ? 172 VAL B C     1 
ATOM 2255  O O     . VAL B 2 172 ? 126.688 166.515 149.040 1.00 45.08  ? 172 VAL B O     1 
ATOM 2256  C CB    . VAL B 2 172 ? 129.171 164.609 150.150 1.00 45.08  ? 172 VAL B CB    1 
ATOM 2257  C CG1   . VAL B 2 172 ? 130.617 164.683 150.528 1.00 45.08  ? 172 VAL B CG1   1 
ATOM 2258  C CG2   . VAL B 2 172 ? 128.519 163.450 150.853 1.00 45.08  ? 172 VAL B CG2   1 
ATOM 2259  N N     . HIS B 2 173 ? 126.155 165.417 150.921 1.00 45.71  ? 173 HIS B N     1 
ATOM 2260  C CA    . HIS B 2 173 ? 124.741 165.378 150.584 1.00 45.71  ? 173 HIS B CA    1 
ATOM 2261  C C     . HIS B 2 173 ? 124.045 166.725 150.737 1.00 45.71  ? 173 HIS B C     1 
ATOM 2262  O O     . HIS B 2 173 ? 122.932 166.876 150.226 1.00 45.71  ? 173 HIS B O     1 
ATOM 2263  C CB    . HIS B 2 173 ? 124.036 164.346 151.463 1.00 45.71  ? 173 HIS B CB    1 
ATOM 2264  C CG    . HIS B 2 173 ? 124.477 162.942 151.217 1.00 45.71  ? 173 HIS B CG    1 
ATOM 2265  N ND1   . HIS B 2 173 ? 123.801 162.088 150.378 1.00 45.71  ? 173 HIS B ND1   1 
ATOM 2266  C CD2   . HIS B 2 173 ? 125.511 162.231 151.723 1.00 45.71  ? 173 HIS B CD2   1 
ATOM 2267  C CE1   . HIS B 2 173 ? 124.408 160.916 150.363 1.00 45.71  ? 173 HIS B CE1   1 
ATOM 2268  N NE2   . HIS B 2 173 ? 125.450 160.976 151.171 1.00 45.71  ? 173 HIS B NE2   1 
ATOM 2269  N N     . ARG B 2 174 ? 124.670 167.713 151.388 1.00 44.05  ? 174 ARG B N     1 
ATOM 2270  C CA    . ARG B 2 174 ? 124.091 169.050 151.466 1.00 44.05  ? 174 ARG B CA    1 
ATOM 2271  C C     . ARG B 2 174 ? 124.705 170.053 150.493 1.00 44.05  ? 174 ARG B C     1 
ATOM 2272  O O     . ARG B 2 174 ? 124.091 171.091 150.234 1.00 44.05  ? 174 ARG B O     1 
ATOM 2273  C CB    . ARG B 2 174 ? 124.207 169.554 152.910 1.00 44.05  ? 174 ARG B CB    1 
ATOM 2274  C CG    . ARG B 2 174 ? 125.622 169.492 153.396 1.00 44.05  ? 174 ARG B CG    1 
ATOM 2275  C CD    . ARG B 2 174 ? 125.836 169.892 154.833 1.00 44.05  ? 174 ARG B CD    1 
ATOM 2276  N NE    . ARG B 2 174 ? 126.090 171.311 155.022 1.00 44.05  ? 174 ARG B NE    1 
ATOM 2277  C CZ    . ARG B 2 174 ? 126.115 171.899 156.211 1.00 44.05  ? 174 ARG B CZ    1 
ATOM 2278  N NH1   . ARG B 2 174 ? 125.896 171.185 157.304 1.00 44.05  ? 174 ARG B NH1   1 
ATOM 2279  N NH2   . ARG B 2 174 ? 126.388 173.189 156.307 1.00 44.05  ? 174 ARG B NH2   1 
ATOM 2280  N N     . HIS B 2 175 ? 125.877 169.765 149.924 1.00 40.37  ? 175 HIS B N     1 
ATOM 2281  C CA    . HIS B 2 175 ? 126.511 170.679 148.979 1.00 40.37  ? 175 HIS B CA    1 
ATOM 2282  C C     . HIS B 2 175 ? 126.343 170.159 147.570 1.00 40.37  ? 175 HIS B C     1 
ATOM 2283  O O     . HIS B 2 175 ? 126.371 170.926 146.602 1.00 40.37  ? 175 HIS B O     1 
ATOM 2284  C CB    . HIS B 2 175 ? 128.011 170.828 149.258 1.00 40.37  ? 175 HIS B CB    1 
ATOM 2285  C CG    . HIS B 2 175 ? 128.348 171.757 150.381 1.00 40.37  ? 175 HIS B CG    1 
ATOM 2286  N ND1   . HIS B 2 175 ? 128.175 173.121 150.294 1.00 40.37  ? 175 HIS B ND1   1 
ATOM 2287  C CD2   . HIS B 2 175 ? 128.887 171.523 151.600 1.00 40.37  ? 175 HIS B CD2   1 
ATOM 2288  C CE1   . HIS B 2 175 ? 128.575 173.687 151.420 1.00 40.37  ? 175 HIS B CE1   1 
ATOM 2289  N NE2   . HIS B 2 175 ? 129.012 172.739 152.229 1.00 40.37  ? 175 HIS B NE2   1 
ATOM 2290  N N     . LEU B 2 176 ? 126.115 168.857 147.483 1.00 35.78  ? 176 LEU B N     1 
ATOM 2291  C CA    . LEU B 2 176 ? 125.982 168.122 146.243 1.00 35.78  ? 176 LEU B CA    1 
ATOM 2292  C C     . LEU B 2 176 ? 124.721 168.472 145.445 1.00 35.78  ? 176 LEU B C     1 
ATOM 2293  O O     . LEU B 2 176 ? 124.843 168.728 144.234 1.00 35.78  ? 176 LEU B O     1 
ATOM 2294  C CB    . LEU B 2 176 ? 126.050 166.624 146.579 1.00 35.78  ? 176 LEU B CB    1 
ATOM 2295  C CG    . LEU B 2 176 ? 126.298 165.530 145.549 1.00 35.78  ? 176 LEU B CG    1 
ATOM 2296  C CD1   . LEU B 2 176 ? 125.034 165.033 144.907 1.00 35.78  ? 176 LEU B CD1   1 
ATOM 2297  C CD2   . LEU B 2 176 ? 127.222 166.089 144.504 1.00 35.78  ? 176 LEU B CD2   1 
ATOM 2298  N N     . PRO B 2 177 ? 123.540 168.589 146.066 1.00 34.60  ? 177 PRO B N     1 
ATOM 2299  C CA    . PRO B 2 177 ? 122.323 168.780 145.255 1.00 34.60  ? 177 PRO B CA    1 
ATOM 2300  C C     . PRO B 2 177 ? 122.326 169.970 144.330 1.00 34.60  ? 177 PRO B C     1 
ATOM 2301  O O     . PRO B 2 177 ? 121.814 169.842 143.206 1.00 34.60  ? 177 PRO B O     1 
ATOM 2302  C CB    . PRO B 2 177 ? 121.228 168.936 146.326 1.00 34.60  ? 177 PRO B CB    1 
ATOM 2303  C CG    . PRO B 2 177 ? 121.942 169.337 147.562 1.00 34.60  ? 177 PRO B CG    1 
ATOM 2304  C CD    . PRO B 2 177 ? 123.234 168.613 147.500 1.00 34.60  ? 177 PRO B CD    1 
ATOM 2305  N N     . ARG B 2 178 ? 122.907 171.103 144.717 1.00 37.42  ? 178 ARG B N     1 
ATOM 2306  C CA    . ARG B 2 178 ? 122.851 172.217 143.790 1.00 37.42  ? 178 ARG B CA    1 
ATOM 2307  C C     . ARG B 2 178 ? 123.647 171.922 142.517 1.00 37.42  ? 178 ARG B C     1 
ATOM 2308  O O     . ARG B 2 178 ? 123.086 172.027 141.412 1.00 37.42  ? 178 ARG B O     1 
ATOM 2309  C CB    . ARG B 2 178 ? 123.394 173.478 144.488 1.00 37.42  ? 178 ARG B CB    1 
ATOM 2310  C CG    . ARG B 2 178 ? 124.793 173.355 145.109 1.00 37.42  ? 178 ARG B CG    1 
ATOM 2311  C CD    . ARG B 2 178 ? 125.305 174.696 145.634 1.00 37.42  ? 178 ARG B CD    1 
ATOM 2312  N NE    . ARG B 2 178 ? 126.630 174.597 146.248 1.00 37.42  ? 178 ARG B NE    1 
ATOM 2313  C CZ    . ARG B 2 178 ? 127.253 175.615 146.834 1.00 37.42  ? 178 ARG B CZ    1 
ATOM 2314  N NH1   . ARG B 2 178 ? 126.673 176.806 146.888 1.00 37.42  ? 178 ARG B NH1   1 
ATOM 2315  N NH2   . ARG B 2 178 ? 128.446 175.444 147.379 1.00 37.42  ? 178 ARG B NH2   1 
ATOM 2316  N N     . LEU B 2 179 ? 124.891 171.467 142.624 1.00 34.92  ? 179 LEU B N     1 
ATOM 2317  C CA    . LEU B 2 179 ? 125.660 171.238 141.403 1.00 34.92  ? 179 LEU B CA    1 
ATOM 2318  C C     . LEU B 2 179 ? 125.107 170.094 140.575 1.00 34.92  ? 179 LEU B C     1 
ATOM 2319  O O     . LEU B 2 179 ? 125.154 170.150 139.349 1.00 34.92  ? 179 LEU B O     1 
ATOM 2320  C CB    . LEU B 2 179 ? 127.149 171.018 141.657 1.00 34.92  ? 179 LEU B CB    1 
ATOM 2321  C CG    . LEU B 2 179 ? 127.922 169.861 142.279 1.00 34.92  ? 179 LEU B CG    1 
ATOM 2322  C CD1   . LEU B 2 179 ? 127.900 168.622 141.427 1.00 34.92  ? 179 LEU B CD1   1 
ATOM 2323  C CD2   . LEU B 2 179 ? 129.330 170.358 142.316 1.00 34.92  ? 179 LEU B CD2   1 
ATOM 2324  N N     . VAL B 2 180 ? 124.713 168.986 141.204 1.00 38.76  ? 180 VAL B N     1 
ATOM 2325  C CA    . VAL B 2 180 ? 124.239 167.876 140.379 1.00 38.76  ? 180 VAL B CA    1 
ATOM 2326  C C     . VAL B 2 180 ? 122.884 168.161 139.735 1.00 38.76  ? 180 VAL B C     1 
ATOM 2327  O O     . VAL B 2 180 ? 122.671 167.827 138.564 1.00 38.76  ? 180 VAL B O     1 
ATOM 2328  C CB    . VAL B 2 180 ? 124.175 166.573 141.189 1.00 38.76  ? 180 VAL B CB    1 
ATOM 2329  C CG1   . VAL B 2 180 ? 125.555 166.023 141.424 1.00 38.76  ? 180 VAL B CG1   1 
ATOM 2330  C CG2   . VAL B 2 180 ? 123.485 166.819 142.463 1.00 38.76  ? 180 VAL B CG2   1 
ATOM 2331  N N     . LEU B 2 181 ? 121.938 168.729 140.481 1.00 43.55  ? 181 LEU B N     1 
ATOM 2332  C CA    . LEU B 2 181 ? 120.638 169.041 139.896 1.00 43.55  ? 181 LEU B CA    1 
ATOM 2333  C C     . LEU B 2 181 ? 120.700 170.154 138.867 1.00 43.55  ? 181 LEU B C     1 
ATOM 2334  O O     . LEU B 2 181 ? 120.002 170.102 137.845 1.00 43.55  ? 181 LEU B O     1 
ATOM 2335  C CB    . LEU B 2 181 ? 119.692 169.422 141.042 1.00 43.55  ? 181 LEU B CB    1 
ATOM 2336  C CG    . LEU B 2 181 ? 118.826 170.698 141.031 1.00 43.55  ? 181 LEU B CG    1 
ATOM 2337  C CD1   . LEU B 2 181 ? 117.714 170.666 139.979 1.00 43.55  ? 181 LEU B CD1   1 
ATOM 2338  C CD2   . LEU B 2 181 ? 118.301 171.009 142.424 1.00 43.55  ? 181 LEU B CD2   1 
ATOM 2339  N N     . TYR B 2 182 ? 121.598 171.104 139.074 1.00 39.51  ? 182 TYR B N     1 
ATOM 2340  C CA    . TYR B 2 182 ? 121.827 172.155 138.104 1.00 39.51  ? 182 TYR B CA    1 
ATOM 2341  C C     . TYR B 2 182 ? 122.643 171.624 136.936 1.00 39.51  ? 182 TYR B C     1 
ATOM 2342  O O     . TYR B 2 182 ? 122.504 172.094 135.814 1.00 39.51  ? 182 TYR B O     1 
ATOM 2343  C CB    . TYR B 2 182 ? 122.488 173.311 138.825 1.00 39.51  ? 182 TYR B CB    1 
ATOM 2344  C CG    . TYR B 2 182 ? 121.474 174.025 139.689 1.00 39.51  ? 182 TYR B CG    1 
ATOM 2345  C CD1   . TYR B 2 182 ? 120.107 173.897 139.462 1.00 39.51  ? 182 TYR B CD1   1 
ATOM 2346  C CD2   . TYR B 2 182 ? 121.875 174.669 140.838 1.00 39.51  ? 182 TYR B CD2   1 
ATOM 2347  C CE1   . TYR B 2 182 ? 119.186 174.502 140.313 1.00 39.51  ? 182 TYR B CE1   1 
ATOM 2348  C CE2   . TYR B 2 182 ? 120.990 175.271 141.680 1.00 39.51  ? 182 TYR B CE2   1 
ATOM 2349  C CZ    . TYR B 2 182 ? 119.651 175.189 141.432 1.00 39.51  ? 182 TYR B CZ    1 
ATOM 2350  O OH    . TYR B 2 182 ? 118.781 175.802 142.304 1.00 39.51  ? 182 TYR B OH    1 
ATOM 2351  N N     . LEU B 2 183 ? 123.508 170.657 137.182 1.00 42.72  ? 183 LEU B N     1 
ATOM 2352  C CA    . LEU B 2 183 ? 124.257 170.057 136.101 1.00 42.72  ? 183 LEU B CA    1 
ATOM 2353  C C     . LEU B 2 183 ? 123.318 169.301 135.194 1.00 42.72  ? 183 LEU B C     1 
ATOM 2354  O O     . LEU B 2 183 ? 123.392 169.433 133.977 1.00 42.72  ? 183 LEU B O     1 
ATOM 2355  C CB    . LEU B 2 183 ? 125.283 169.095 136.695 1.00 42.72  ? 183 LEU B CB    1 
ATOM 2356  C CG    . LEU B 2 183 ? 125.578 167.821 135.871 1.00 42.72  ? 183 LEU B CG    1 
ATOM 2357  C CD1   . LEU B 2 183 ? 127.066 167.783 135.601 1.00 42.72  ? 183 LEU B CD1   1 
ATOM 2358  C CD2   . LEU B 2 183 ? 125.143 166.531 136.539 1.00 42.72  ? 183 LEU B CD2   1 
ATOM 2359  N N     . ARG B 2 184 ? 122.405 168.519 135.773 1.00 45.61  ? 184 ARG B N     1 
ATOM 2360  C CA    . ARG B 2 184 ? 121.437 167.819 134.946 1.00 45.61  ? 184 ARG B CA    1 
ATOM 2361  C C     . ARG B 2 184 ? 120.545 168.824 134.251 1.00 45.61  ? 184 ARG B C     1 
ATOM 2362  O O     . ARG B 2 184 ? 119.978 168.522 133.201 1.00 45.61  ? 184 ARG B O     1 
ATOM 2363  C CB    . ARG B 2 184 ? 120.660 166.765 135.717 1.00 45.61  ? 184 ARG B CB    1 
ATOM 2364  C CG    . ARG B 2 184 ? 119.902 165.881 134.721 1.00 45.61  ? 184 ARG B CG    1 
ATOM 2365  C CD    . ARG B 2 184 ? 120.375 164.462 134.491 1.00 45.61  ? 184 ARG B CD    1 
ATOM 2366  N NE    . ARG B 2 184 ? 119.488 163.861 133.500 1.00 45.61  ? 184 ARG B NE    1 
ATOM 2367  C CZ    . ARG B 2 184 ? 119.724 162.735 132.842 1.00 45.61  ? 184 ARG B CZ    1 
ATOM 2368  N NH1   . ARG B 2 184 ? 120.834 162.050 133.061 1.00 45.61  ? 184 ARG B NH1   1 
ATOM 2369  N NH2   . ARG B 2 184 ? 118.832 162.293 131.966 1.00 45.61  ? 184 ARG B NH2   1 
ATOM 2370  N N     . SER B 2 185 ? 120.386 170.012 134.836 1.00 44.21  ? 185 SER B N     1 
ATOM 2371  C CA    . SER B 2 185 ? 119.739 171.077 134.088 1.00 44.21  ? 185 SER B CA    1 
ATOM 2372  C C     . SER B 2 185 ? 120.640 171.405 132.909 1.00 44.21  ? 185 SER B C     1 
ATOM 2373  O O     . SER B 2 185 ? 121.865 171.398 133.056 1.00 44.21  ? 185 SER B O     1 
ATOM 2374  C CB    . SER B 2 185 ? 119.537 172.314 134.965 1.00 44.21  ? 185 SER B CB    1 
ATOM 2375  O OG    . SER B 2 185 ? 118.417 172.188 135.822 1.00 44.21  ? 185 SER B OG    1 
ATOM 2376  N N     . ASP B 2 186 ? 120.052 171.684 131.748 1.00 43.38  ? 186 ASP B N     1 
ATOM 2377  C CA    . ASP B 2 186 ? 120.792 171.800 130.495 1.00 43.38  ? 186 ASP B CA    1 
ATOM 2378  C C     . ASP B 2 186 ? 121.368 170.448 130.077 1.00 43.38  ? 186 ASP B C     1 
ATOM 2379  O O     . ASP B 2 186 ? 122.481 170.371 129.560 1.00 43.38  ? 186 ASP B O     1 
ATOM 2380  C CB    . ASP B 2 186 ? 121.904 172.846 130.601 1.00 43.38  ? 186 ASP B CB    1 
ATOM 2381  C CG    . ASP B 2 186 ? 121.369 174.236 130.826 1.00 43.38  ? 186 ASP B CG    1 
ATOM 2382  O OD1   . ASP B 2 186 ? 120.233 174.500 130.390 1.00 43.38  ? 186 ASP B OD1   1 
ATOM 2383  O OD2   . ASP B 2 186 ? 122.085 175.062 131.433 1.00 43.38  ? 186 ASP B OD2   1 
ATOM 2384  N N     . GLN B 2 187 ? 120.591 169.386 130.308 1.00 45.95  ? 187 GLN B N     1 
ATOM 2385  C CA    . GLN B 2 187 ? 120.798 167.996 129.893 1.00 45.95  ? 187 GLN B CA    1 
ATOM 2386  C C     . GLN B 2 187 ? 122.255 167.537 129.829 1.00 45.95  ? 187 GLN B C     1 
ATOM 2387  O O     . GLN B 2 187 ? 122.808 167.320 128.745 1.00 45.95  ? 187 GLN B O     1 
ATOM 2388  C CB    . GLN B 2 187 ? 120.109 167.765 128.543 1.00 45.95  ? 187 GLN B CB    1 
ATOM 2389  C CG    . GLN B 2 187 ? 120.221 166.357 127.962 1.00 45.95  ? 187 GLN B CG    1 
ATOM 2390  C CD    . GLN B 2 187 ? 119.700 165.278 128.892 1.00 45.95  ? 187 GLN B CD    1 
ATOM 2391  O OE1   . GLN B 2 187 ? 118.999 165.561 129.864 1.00 45.95  ? 187 GLN B OE1   1 
ATOM 2392  N NE2   . GLN B 2 187 ? 120.035 164.036 128.595 1.00 45.95  ? 187 GLN B NE2   1 
ATOM 2393  N N     . VAL B 2 188 ? 122.918 167.492 130.981 1.00 44.96  ? 188 VAL B N     1 
ATOM 2394  C CA    . VAL B 2 188 ? 124.253 166.913 131.110 1.00 44.96  ? 188 VAL B CA    1 
ATOM 2395  C C     . VAL B 2 188 ? 124.140 165.448 131.511 1.00 44.96  ? 188 VAL B C     1 
ATOM 2396  O O     . VAL B 2 188 ? 123.351 165.105 132.401 1.00 44.96  ? 188 VAL B O     1 
ATOM 2397  C CB    . VAL B 2 188 ? 125.112 167.699 132.107 1.00 44.96  ? 188 VAL B CB    1 
ATOM 2398  C CG1   . VAL B 2 188 ? 126.483 167.104 132.134 1.00 44.96  ? 188 VAL B CG1   1 
ATOM 2399  C CG2   . VAL B 2 188 ? 125.205 169.138 131.651 1.00 44.96  ? 188 VAL B CG2   1 
ATOM 2400  N N     . HIS B 2 189 ? 124.915 164.575 130.865 1.00 41.72  ? 189 HIS B N     1 
ATOM 2401  C CA    . HIS B 2 189 ? 124.794 163.157 131.170 1.00 41.72  ? 189 HIS B CA    1 
ATOM 2402  C C     . HIS B 2 189 ? 125.427 162.869 132.520 1.00 41.72  ? 189 HIS B C     1 
ATOM 2403  O O     . HIS B 2 189 ? 126.545 163.289 132.798 1.00 41.72  ? 189 HIS B O     1 
ATOM 2404  C CB    . HIS B 2 189 ? 125.468 162.311 130.112 1.00 41.72  ? 189 HIS B CB    1 
ATOM 2405  C CG    . HIS B 2 189 ? 125.244 160.847 130.302 1.00 41.72  ? 189 HIS B CG    1 
ATOM 2406  N ND1   . HIS B 2 189 ? 126.097 160.072 131.055 1.00 41.72  ? 189 HIS B ND1   1 
ATOM 2407  C CD2   . HIS B 2 189 ? 124.283 160.013 129.839 1.00 41.72  ? 189 HIS B CD2   1 
ATOM 2408  C CE1   . HIS B 2 189 ? 125.684 158.818 131.034 1.00 41.72  ? 189 HIS B CE1   1 
ATOM 2409  N NE2   . HIS B 2 189 ? 124.586 158.755 130.303 1.00 41.72  ? 189 HIS B NE2   1 
ATOM 2410  N N     . ILE B 2 190 ? 124.717 162.150 133.375 1.00 46.19  ? 190 ILE B N     1 
ATOM 2411  C CA    . ILE B 2 190 ? 125.265 161.775 134.674 1.00 46.19  ? 190 ILE B CA    1 
ATOM 2412  C C     . ILE B 2 190 ? 124.969 160.319 134.969 1.00 46.19  ? 190 ILE B C     1 
ATOM 2413  O O     . ILE B 2 190 ? 123.798 159.946 135.091 1.00 46.19  ? 190 ILE B O     1 
ATOM 2414  C CB    . ILE B 2 190 ? 124.745 162.674 135.818 1.00 46.19  ? 190 ILE B CB    1 
ATOM 2415  C CG1   . ILE B 2 190 ? 125.327 162.253 137.185 1.00 46.19  ? 190 ILE B CG1   1 
ATOM 2416  C CG2   . ILE B 2 190 ? 123.216 162.720 135.833 1.00 46.19  ? 190 ILE B CG2   1 
ATOM 2417  C CD1   . ILE B 2 190 ? 126.574 163.088 137.599 1.00 46.19  ? 190 ILE B CD1   1 
ATOM 2418  N N     . ASP B 2 191 ? 126.021 159.501 135.108 1.00 50.78  ? 191 ASP B N     1 
ATOM 2419  C CA    . ASP B 2 191 ? 125.901 158.086 135.484 1.00 50.78  ? 191 ASP B CA    1 
ATOM 2420  C C     . ASP B 2 191 ? 125.567 157.973 136.978 1.00 50.78  ? 191 ASP B C     1 
ATOM 2421  O O     . ASP B 2 191 ? 126.450 158.033 137.837 1.00 50.78  ? 191 ASP B O     1 
ATOM 2422  C CB    . ASP B 2 191 ? 127.192 157.333 135.154 1.00 50.78  ? 191 ASP B CB    1 
ATOM 2423  C CG    . ASP B 2 191 ? 127.024 155.811 135.221 1.00 50.78  ? 191 ASP B CG    1 
ATOM 2424  O OD1   . ASP B 2 191 ? 126.149 155.346 135.975 1.00 50.78  ? 191 ASP B OD1   1 
ATOM 2425  O OD2   . ASP B 2 191 ? 127.745 155.078 134.510 1.00 50.78  ? 191 ASP B OD2   1 
ATOM 2426  N N     . TRP B 2 192 ? 124.286 157.783 137.305 1.00 51.46  ? 192 TRP B N     1 
ATOM 2427  C CA    . TRP B 2 192 ? 123.881 157.782 138.708 1.00 51.46  ? 192 TRP B CA    1 
ATOM 2428  C C     . TRP B 2 192 ? 124.446 156.608 139.496 1.00 51.46  ? 192 TRP B C     1 
ATOM 2429  O O     . TRP B 2 192 ? 124.671 156.735 140.697 1.00 51.46  ? 192 TRP B O     1 
ATOM 2430  C CB    . TRP B 2 192 ? 122.369 157.838 138.851 1.00 51.46  ? 192 TRP B CB    1 
ATOM 2431  C CG    . TRP B 2 192 ? 121.778 159.063 138.314 1.00 51.46  ? 192 TRP B CG    1 
ATOM 2432  C CD1   . TRP B 2 192 ? 121.783 160.291 138.899 1.00 51.46  ? 192 TRP B CD1   1 
ATOM 2433  C CD2   . TRP B 2 192 ? 121.002 159.182 137.132 1.00 51.46  ? 192 TRP B CD2   1 
ATOM 2434  N NE1   . TRP B 2 192 ? 121.091 161.185 138.126 1.00 51.46  ? 192 TRP B NE1   1 
ATOM 2435  C CE2   . TRP B 2 192 ? 120.596 160.525 137.033 1.00 51.46  ? 192 TRP B CE2   1 
ATOM 2436  C CE3   . TRP B 2 192 ? 120.623 158.284 136.134 1.00 51.46  ? 192 TRP B CE3   1 
ATOM 2437  C CZ2   . TRP B 2 192 ? 119.825 160.990 135.978 1.00 51.46  ? 192 TRP B CZ2   1 
ATOM 2438  C CZ3   . TRP B 2 192 ? 119.864 158.744 135.092 1.00 51.46  ? 192 TRP B CZ3   1 
ATOM 2439  C CH2   . TRP B 2 192 ? 119.468 160.084 135.018 1.00 51.46  ? 192 TRP B CH2   1 
ATOM 2440  N N     . GLY B 2 193 ? 124.664 155.458 138.858 1.00 54.28  ? 193 GLY B N     1 
ATOM 2441  C CA    . GLY B 2 193 ? 125.208 154.325 139.597 1.00 54.28  ? 193 GLY B CA    1 
ATOM 2442  C C     . GLY B 2 193 ? 126.582 154.598 140.186 1.00 54.28  ? 193 GLY B C     1 
ATOM 2443  O O     . GLY B 2 193 ? 126.830 154.323 141.369 1.00 54.28  ? 193 GLY B O     1 
ATOM 2444  N N     . ILE B 2 194 ? 127.481 155.170 139.388 1.00 54.25  ? 194 ILE B N     1 
ATOM 2445  C CA    . ILE B 2 194 ? 128.807 155.499 139.898 1.00 54.25  ? 194 ILE B CA    1 
ATOM 2446  C C     . ILE B 2 194 ? 128.695 156.536 140.999 1.00 54.25  ? 194 ILE B C     1 
ATOM 2447  O O     . ILE B 2 194 ? 129.377 156.444 142.027 1.00 54.25  ? 194 ILE B O     1 
ATOM 2448  C CB    . ILE B 2 194 ? 129.710 155.986 138.750 1.00 54.25  ? 194 ILE B CB    1 
ATOM 2449  C CG1   . ILE B 2 194 ? 129.833 154.877 137.722 1.00 54.25  ? 194 ILE B CG1   1 
ATOM 2450  C CG2   . ILE B 2 194 ? 131.073 156.355 139.274 1.00 54.25  ? 194 ILE B CG2   1 
ATOM 2451  C CD1   . ILE B 2 194 ? 130.504 153.668 138.309 1.00 54.25  ? 194 ILE B CD1   1 
ATOM 2452  N N     . LEU B 2 195 ? 127.827 157.523 140.815 1.00 52.80  ? 195 LEU B N     1 
ATOM 2453  C CA    . LEU B 2 195 ? 127.615 158.527 141.844 1.00 52.80  ? 195 LEU B CA    1 
ATOM 2454  C C     . LEU B 2 195 ? 127.128 157.887 143.138 1.00 52.80  ? 195 LEU B C     1 
ATOM 2455  O O     . LEU B 2 195 ? 127.568 158.256 144.227 1.00 52.80  ? 195 LEU B O     1 
ATOM 2456  C CB    . LEU B 2 195 ? 126.631 159.583 141.346 1.00 52.80  ? 195 LEU B CB    1 
ATOM 2457  C CG    . LEU B 2 195 ? 126.282 160.787 142.225 1.00 52.80  ? 195 LEU B CG    1 
ATOM 2458  C CD1   . LEU B 2 195 ? 125.807 161.914 141.335 1.00 52.80  ? 195 LEU B CD1   1 
ATOM 2459  C CD2   . LEU B 2 195 ? 125.237 160.482 143.270 1.00 52.80  ? 195 LEU B CD2   1 
ATOM 2460  N N     . ILE B 2 196 ? 126.211 156.914 143.029 1.00 53.61  ? 196 ILE B N     1 
ATOM 2461  C CA    . ILE B 2 196 ? 125.729 156.223 144.219 1.00 53.61  ? 196 ILE B CA    1 
ATOM 2462  C C     . ILE B 2 196 ? 126.872 155.525 144.926 1.00 53.61  ? 196 ILE B C     1 
ATOM 2463  O O     . ILE B 2 196 ? 127.081 155.728 146.135 1.00 53.61  ? 196 ILE B O     1 
ATOM 2464  C CB    . ILE B 2 196 ? 124.664 155.172 143.823 1.00 53.61  ? 196 ILE B CB    1 
ATOM 2465  C CG1   . ILE B 2 196 ? 123.403 155.843 143.304 1.00 53.61  ? 196 ILE B CG1   1 
ATOM 2466  C CG2   . ILE B 2 196 ? 124.334 154.324 145.027 1.00 53.61  ? 196 ILE B CG2   1 
ATOM 2467  C CD1   . ILE B 2 196 ? 122.359 154.882 142.801 1.00 53.61  ? 196 ILE B CD1   1 
ATOM 2468  N N     . ARG B 2 197 ? 127.636 154.707 144.207 1.00 54.15  ? 197 ARG B N     1 
ATOM 2469  C CA    . ARG B 2 197 ? 128.704 154.002 144.898 1.00 54.15  ? 197 ARG B CA    1 
ATOM 2470  C C     . ARG B 2 197 ? 129.710 154.990 145.454 1.00 54.15  ? 197 ARG B C     1 
ATOM 2471  O O     . ARG B 2 197 ? 130.343 154.723 146.477 1.00 54.15  ? 197 ARG B O     1 
ATOM 2472  C CB    . ARG B 2 197 ? 129.402 152.984 143.998 1.00 54.15  ? 197 ARG B CB    1 
ATOM 2473  C CG    . ARG B 2 197 ? 130.400 153.533 143.007 1.00 54.15  ? 197 ARG B CG    1 
ATOM 2474  C CD    . ARG B 2 197 ? 130.989 152.374 142.231 1.00 54.15  ? 197 ARG B CD    1 
ATOM 2475  N NE    . ARG B 2 197 ? 131.962 152.777 141.227 1.00 54.15  ? 197 ARG B NE    1 
ATOM 2476  C CZ    . ARG B 2 197 ? 132.664 151.914 140.500 1.00 54.15  ? 197 ARG B CZ    1 
ATOM 2477  N NH1   . ARG B 2 197 ? 132.494 150.611 140.677 1.00 54.15  ? 197 ARG B NH1   1 
ATOM 2478  N NH2   . ARG B 2 197 ? 133.536 152.351 139.603 1.00 54.15  ? 197 ARG B NH2   1 
ATOM 2479  N N     . ASP B 2 198 ? 129.824 156.156 144.826 1.00 46.16  ? 198 ASP B N     1 
ATOM 2480  C CA    . ASP B 2 198 ? 130.723 157.185 145.323 1.00 46.16  ? 198 ASP B CA    1 
ATOM 2481  C C     . ASP B 2 198 ? 130.234 157.731 146.650 1.00 46.16  ? 198 ASP B C     1 
ATOM 2482  O O     . ASP B 2 198 ? 131.005 157.853 147.609 1.00 46.16  ? 198 ASP B O     1 
ATOM 2483  C CB    . ASP B 2 198 ? 130.832 158.310 144.301 1.00 46.16  ? 198 ASP B CB    1 
ATOM 2484  C CG    . ASP B 2 198 ? 131.638 157.917 143.095 1.00 46.16  ? 198 ASP B CG    1 
ATOM 2485  O OD1   . ASP B 2 198 ? 132.468 156.993 143.207 1.00 46.16  ? 198 ASP B OD1   1 
ATOM 2486  O OD2   . ASP B 2 198 ? 131.430 158.522 142.027 1.00 46.16  ? 198 ASP B OD2   1 
ATOM 2487  N N     . LEU B 2 199 ? 128.937 158.024 146.738 1.00 46.77  ? 199 LEU B N     1 
ATOM 2488  C CA    . LEU B 2 199 ? 128.377 158.489 147.996 1.00 46.77  ? 199 LEU B CA    1 
ATOM 2489  C C     . LEU B 2 199 ? 128.476 157.406 149.054 1.00 46.77  ? 199 LEU B C     1 
ATOM 2490  O O     . LEU B 2 199 ? 128.488 157.706 150.250 1.00 46.77  ? 199 LEU B O     1 
ATOM 2491  C CB    . LEU B 2 199 ? 126.942 158.950 147.782 1.00 46.77  ? 199 LEU B CB    1 
ATOM 2492  C CG    . LEU B 2 199 ? 126.845 160.191 146.893 1.00 46.77  ? 199 LEU B CG    1 
ATOM 2493  C CD1   . LEU B 2 199 ? 125.460 160.802 146.947 1.00 46.77  ? 199 LEU B CD1   1 
ATOM 2494  C CD2   . LEU B 2 199 ? 127.896 161.203 147.284 1.00 46.77  ? 199 LEU B CD2   1 
ATOM 2495  N N     . ALA B 2 200 ? 128.565 156.152 148.632 1.00 46.11  ? 200 ALA B N     1 
ATOM 2496  C CA    . ALA B 2 200 ? 128.737 155.055 149.569 1.00 46.11  ? 200 ALA B CA    1 
ATOM 2497  C C     . ALA B 2 200 ? 130.180 154.987 150.038 1.00 46.11  ? 200 ALA B C     1 
ATOM 2498  O O     . ALA B 2 200 ? 130.452 154.581 151.171 1.00 46.11  ? 200 ALA B O     1 
ATOM 2499  C CB    . ALA B 2 200 ? 128.319 153.732 148.930 1.00 46.11  ? 200 ALA B CB    1 
ATOM 2500  N N     . ARG B 2 201 ? 131.108 155.392 149.176 1.00 40.92  ? 201 ARG B N     1 
ATOM 2501  C CA    . ARG B 2 201 ? 132.534 155.380 149.456 1.00 40.92  ? 201 ARG B CA    1 
ATOM 2502  C C     . ARG B 2 201 ? 132.966 156.495 150.398 1.00 40.92  ? 201 ARG B C     1 
ATOM 2503  O O     . ARG B 2 201 ? 134.130 156.511 150.813 1.00 40.92  ? 201 ARG B O     1 
ATOM 2504  C CB    . ARG B 2 201 ? 133.283 155.500 148.127 1.00 40.92  ? 201 ARG B CB    1 
ATOM 2505  C CG    . ARG B 2 201 ? 133.140 154.283 147.233 1.00 40.92  ? 201 ARG B CG    1 
ATOM 2506  C CD    . ARG B 2 201 ? 134.085 154.308 146.053 1.00 40.92  ? 201 ARG B CD    1 
ATOM 2507  N NE    . ARG B 2 201 ? 135.486 154.187 146.409 1.00 40.92  ? 201 ARG B NE    1 
ATOM 2508  C CZ    . ARG B 2 201 ? 136.474 154.384 145.547 1.00 40.92  ? 201 ARG B CZ    1 
ATOM 2509  N NH1   . ARG B 2 201 ? 136.198 154.718 144.294 1.00 40.92  ? 201 ARG B NH1   1 
ATOM 2510  N NH2   . ARG B 2 201 ? 137.732 154.253 145.935 1.00 40.92  ? 201 ARG B NH2   1 
ATOM 2511  N N     . TRP B 2 202 ? 132.063 157.410 150.763 1.00 38.50  ? 202 TRP B N     1 
ATOM 2512  C CA    . TRP B 2 202 ? 132.396 158.412 151.770 1.00 38.50  ? 202 TRP B CA    1 
ATOM 2513  C C     . TRP B 2 202 ? 132.473 157.817 153.170 1.00 38.50  ? 202 TRP B C     1 
ATOM 2514  O O     . TRP B 2 202 ? 133.156 158.372 154.032 1.00 38.50  ? 202 TRP B O     1 
ATOM 2515  C CB    . TRP B 2 202 ? 131.391 159.563 151.739 1.00 38.50  ? 202 TRP B CB    1 
ATOM 2516  C CG    . TRP B 2 202 ? 131.505 160.407 150.517 1.00 38.50  ? 202 TRP B CG    1 
ATOM 2517  C CD1   . TRP B 2 202 ? 130.805 160.260 149.369 1.00 38.50  ? 202 TRP B CD1   1 
ATOM 2518  C CD2   . TRP B 2 202 ? 132.339 161.558 150.333 1.00 38.50  ? 202 TRP B CD2   1 
ATOM 2519  N NE1   . TRP B 2 202 ? 131.166 161.225 148.463 1.00 38.50  ? 202 TRP B NE1   1 
ATOM 2520  C CE2   . TRP B 2 202 ? 132.106 162.037 149.033 1.00 38.50  ? 202 TRP B CE2   1 
ATOM 2521  C CE3   . TRP B 2 202 ? 133.265 162.221 151.134 1.00 38.50  ? 202 TRP B CE3   1 
ATOM 2522  C CZ2   . TRP B 2 202 ? 132.765 163.142 148.515 1.00 38.50  ? 202 TRP B CZ2   1 
ATOM 2523  C CZ3   . TRP B 2 202 ? 133.920 163.321 150.617 1.00 38.50  ? 202 TRP B CZ3   1 
ATOM 2524  C CH2   . TRP B 2 202 ? 133.664 163.771 149.322 1.00 38.50  ? 202 TRP B CH2   1 
ATOM 2525  N N     . GLY B 2 203 ? 131.776 156.712 153.426 1.00 39.02  ? 203 GLY B N     1 
ATOM 2526  C CA    . GLY B 2 203 ? 131.808 156.135 154.758 1.00 39.02  ? 203 GLY B CA    1 
ATOM 2527  C C     . GLY B 2 203 ? 133.154 155.541 155.117 1.00 39.02  ? 203 GLY B C     1 
ATOM 2528  O O     . GLY B 2 203 ? 133.511 155.472 156.297 1.00 39.02  ? 203 GLY B O     1 
ATOM 2529  N N     . HIS B 2 204 ? 133.914 155.106 154.117 1.00 41.01  ? 204 HIS B N     1 
ATOM 2530  C CA    . HIS B 2 204 ? 135.206 154.477 154.341 1.00 41.01  ? 204 HIS B CA    1 
ATOM 2531  C C     . HIS B 2 204 ? 136.374 155.276 153.791 1.00 41.01  ? 204 HIS B C     1 
ATOM 2532  O O     . HIS B 2 204 ? 137.368 155.440 154.500 1.00 41.01  ? 204 HIS B O     1 
ATOM 2533  C CB    . HIS B 2 204 ? 135.247 153.049 153.773 1.00 41.01  ? 204 HIS B CB    1 
ATOM 2534  C CG    . HIS B 2 204 ? 134.461 152.059 154.574 1.00 41.01  ? 204 HIS B CG    1 
ATOM 2535  N ND1   . HIS B 2 204 ? 134.269 150.756 154.168 1.00 41.01  ? 204 HIS B ND1   1 
ATOM 2536  C CD2   . HIS B 2 204 ? 133.822 152.180 155.761 1.00 41.01  ? 204 HIS B CD2   1 
ATOM 2537  C CE1   . HIS B 2 204 ? 133.542 150.119 155.068 1.00 41.01  ? 204 HIS B CE1   1 
ATOM 2538  N NE2   . HIS B 2 204 ? 133.257 150.961 156.045 1.00 41.01  ? 204 HIS B NE2   1 
ATOM 2539  N N     . THR B 2 205 ? 136.278 155.818 152.580 1.00 40.90  ? 205 THR B N     1 
ATOM 2540  C CA    . THR B 2 205 ? 137.382 156.567 151.982 1.00 40.90  ? 205 THR B CA    1 
ATOM 2541  C C     . THR B 2 205 ? 136.864 157.863 151.379 1.00 40.90  ? 205 THR B C     1 
ATOM 2542  O O     . THR B 2 205 ? 136.696 157.975 150.160 1.00 40.90  ? 205 THR B O     1 
ATOM 2543  C CB    . THR B 2 205 ? 138.077 155.727 150.906 1.00 40.90  ? 205 THR B CB    1 
ATOM 2544  O OG1   . THR B 2 205 ? 137.095 155.187 150.010 1.00 40.90  ? 205 THR B OG1   1 
ATOM 2545  C CG2   . THR B 2 205 ? 138.845 154.585 151.537 1.00 40.90  ? 205 THR B CG2   1 
ATOM 2546  N N     . PRO B 2 206 ? 136.562 158.862 152.222 1.00 38.06  ? 206 PRO B N     1 
ATOM 2547  C CA    . PRO B 2 206 ? 136.000 160.119 151.703 1.00 38.06  ? 206 PRO B CA    1 
ATOM 2548  C C     . PRO B 2 206 ? 136.999 160.849 150.840 1.00 38.06  ? 206 PRO B C     1 
ATOM 2549  O O     . PRO B 2 206 ? 136.696 161.261 149.712 1.00 38.06  ? 206 PRO B O     1 
ATOM 2550  C CB    . PRO B 2 206 ? 135.671 160.911 152.976 1.00 38.06  ? 206 PRO B CB    1 
ATOM 2551  C CG    . PRO B 2 206 ? 135.698 159.890 154.078 1.00 38.06  ? 206 PRO B CG    1 
ATOM 2552  C CD    . PRO B 2 206 ? 136.680 158.870 153.686 1.00 38.06  ? 206 PRO B CD    1 
ATOM 2553  N N     . ARG B 2 207 ? 138.204 161.007 151.381 1.00 38.67  ? 207 ARG B N     1 
ATOM 2554  C CA    . ARG B 2 207 ? 139.261 161.714 150.681 1.00 38.67  ? 207 ARG B CA    1 
ATOM 2555  C C     . ARG B 2 207 ? 139.615 161.024 149.374 1.00 38.67  ? 207 ARG B C     1 
ATOM 2556  O O     . ARG B 2 207 ? 139.856 161.692 148.368 1.00 38.67  ? 207 ARG B O     1 
ATOM 2557  C CB    . ARG B 2 207 ? 140.485 161.818 151.582 1.00 38.67  ? 207 ARG B CB    1 
ATOM 2558  C CG    . ARG B 2 207 ? 140.276 161.196 152.940 1.00 38.67  ? 207 ARG B CG    1 
ATOM 2559  C CD    . ARG B 2 207 ? 140.982 161.954 154.080 1.00 38.67  ? 207 ARG B CD    1 
ATOM 2560  N NE    . ARG B 2 207 ? 140.425 163.291 154.265 1.00 38.67  ? 207 ARG B NE    1 
ATOM 2561  C CZ    . ARG B 2 207 ? 140.843 164.163 155.178 1.00 38.67  ? 207 ARG B CZ    1 
ATOM 2562  N NH1   . ARG B 2 207 ? 141.849 163.854 155.996 1.00 38.67  ? 207 ARG B NH1   1 
ATOM 2563  N NH2   . ARG B 2 207 ? 140.263 165.353 155.257 1.00 38.67  ? 207 ARG B NH2   1 
ATOM 2564  N N     . HIS B 2 208 ? 139.583 159.690 149.345 1.00 37.09  ? 208 HIS B N     1 
ATOM 2565  C CA    . HIS B 2 208 ? 139.930 158.982 148.118 1.00 37.09  ? 208 HIS B CA    1 
ATOM 2566  C C     . HIS B 2 208 ? 138.936 159.314 147.017 1.00 37.09  ? 208 HIS B C     1 
ATOM 2567  O O     . HIS B 2 208 ? 139.321 159.759 145.929 1.00 37.09  ? 208 HIS B O     1 
ATOM 2568  C CB    . HIS B 2 208 ? 139.987 157.479 148.361 1.00 37.09  ? 208 HIS B CB    1 
ATOM 2569  C CG    . HIS B 2 208 ? 140.512 156.714 147.189 1.00 37.09  ? 208 HIS B CG    1 
ATOM 2570  N ND1   . HIS B 2 208 ? 139.778 156.498 146.043 1.00 37.09  ? 208 HIS B ND1   1 
ATOM 2571  C CD2   . HIS B 2 208 ? 141.716 156.129 146.981 1.00 37.09  ? 208 HIS B CD2   1 
ATOM 2572  C CE1   . HIS B 2 208 ? 140.507 155.814 145.179 1.00 37.09  ? 208 HIS B CE1   1 
ATOM 2573  N NE2   . HIS B 2 208 ? 141.685 155.573 145.725 1.00 37.09  ? 208 HIS B NE2   1 
ATOM 2574  N N     . VAL B 2 209 ? 137.644 159.145 147.298 1.00 34.52  ? 209 VAL B N     1 
ATOM 2575  C CA    . VAL B 2 209 ? 136.618 159.435 146.299 1.00 34.52  ? 209 VAL B CA    1 
ATOM 2576  C C     . VAL B 2 209 ? 136.689 160.899 145.884 1.00 34.52  ? 209 VAL B C     1 
ATOM 2577  O O     . VAL B 2 209 ? 136.484 161.235 144.713 1.00 34.52  ? 209 VAL B O     1 
ATOM 2578  C CB    . VAL B 2 209 ? 135.218 159.026 146.798 1.00 34.52  ? 209 VAL B CB    1 
ATOM 2579  C CG1   . VAL B 2 209 ? 134.687 159.962 147.836 1.00 34.52  ? 209 VAL B CG1   1 
ATOM 2580  C CG2   . VAL B 2 209 ? 134.251 158.971 145.637 1.00 34.52  ? 209 VAL B CG2   1 
ATOM 2581  N N     . ALA B 2 210 ? 136.903 161.800 146.839 1.00 31.12  ? 210 ALA B N     1 
ATOM 2582  C CA    . ALA B 2 210 ? 137.012 163.206 146.474 1.00 31.12  ? 210 ALA B CA    1 
ATOM 2583  C C     . ALA B 2 210 ? 138.151 163.397 145.479 1.00 31.12  ? 210 ALA B C     1 
ATOM 2584  O O     . ALA B 2 210 ? 137.978 164.037 144.430 1.00 31.12  ? 210 ALA B O     1 
ATOM 2585  C CB    . ALA B 2 210 ? 137.229 164.058 147.724 1.00 31.12  ? 210 ALA B CB    1 
ATOM 2586  N N     . ARG B 2 211 ? 139.323 162.829 145.781 1.00 28.27  ? 211 ARG B N     1 
ATOM 2587  C CA    . ARG B 2 211 ? 140.464 162.959 144.884 1.00 28.27  ? 211 ARG B CA    1 
ATOM 2588  C C     . ARG B 2 211 ? 140.153 162.402 143.508 1.00 28.27  ? 211 ARG B C     1 
ATOM 2589  O O     . ARG B 2 211 ? 140.518 163.005 142.497 1.00 28.27  ? 211 ARG B O     1 
ATOM 2590  C CB    . ARG B 2 211 ? 141.681 162.217 145.439 1.00 28.27  ? 211 ARG B CB    1 
ATOM 2591  C CG    . ARG B 2 211 ? 142.809 162.159 144.417 1.00 28.27  ? 211 ARG B CG    1 
ATOM 2592  C CD    . ARG B 2 211 ? 143.842 161.070 144.617 1.00 28.27  ? 211 ARG B CD    1 
ATOM 2593  N NE    . ARG B 2 211 ? 143.523 160.106 145.653 1.00 28.27  ? 211 ARG B NE    1 
ATOM 2594  C CZ    . ARG B 2 211 ? 144.386 159.188 146.076 1.00 28.27  ? 211 ARG B CZ    1 
ATOM 2595  N NH1   . ARG B 2 211 ? 145.599 159.135 145.539 1.00 28.27  ? 211 ARG B NH1   1 
ATOM 2596  N NH2   . ARG B 2 211 ? 144.048 158.321 147.025 1.00 28.27  ? 211 ARG B NH2   1 
ATOM 2597  N N     . GLU B 2 212 ? 139.479 161.252 143.445 1.00 33.76  ? 212 GLU B N     1 
ATOM 2598  C CA    . GLU B 2 212 ? 139.108 160.709 142.144 1.00 33.76  ? 212 GLU B CA    1 
ATOM 2599  C C     . GLU B 2 212 ? 138.203 161.678 141.394 1.00 33.76  ? 212 GLU B C     1 
ATOM 2600  O O     . GLU B 2 212 ? 138.393 161.902 140.196 1.00 33.76  ? 212 GLU B O     1 
ATOM 2601  C CB    . GLU B 2 212 ? 138.531 159.296 142.256 1.00 33.76  ? 212 GLU B CB    1 
ATOM 2602  C CG    . GLU B 2 212 ? 137.176 159.075 142.839 1.00 33.76  ? 212 GLU B CG    1 
ATOM 2603  C CD    . GLU B 2 212 ? 136.907 157.590 143.046 1.00 33.76  ? 212 GLU B CD    1 
ATOM 2604  O OE1   . GLU B 2 212 ? 137.789 156.776 142.699 1.00 33.76  ? 212 GLU B OE1   1 
ATOM 2605  O OE2   . GLU B 2 212 ? 135.824 157.226 143.547 1.00 33.76  ? 212 GLU B OE2   1 
ATOM 2606  N N     . TRP B 2 213 ? 137.188 162.234 142.057 1.00 30.45  ? 213 TRP B N     1 
ATOM 2607  C CA    . TRP B 2 213 ? 136.300 163.162 141.358 1.00 30.45  ? 213 TRP B CA    1 
ATOM 2608  C C     . TRP B 2 213 ? 137.086 164.323 140.757 1.00 30.45  ? 213 TRP B C     1 
ATOM 2609  O O     . TRP B 2 213 ? 136.983 164.611 139.558 1.00 30.45  ? 213 TRP B O     1 
ATOM 2610  C CB    . TRP B 2 213 ? 135.214 163.711 142.281 1.00 30.45  ? 213 TRP B CB    1 
ATOM 2611  C CG    . TRP B 2 213 ? 134.094 162.788 142.597 1.00 30.45  ? 213 TRP B CG    1 
ATOM 2612  C CD1   . TRP B 2 213 ? 133.990 161.474 142.267 1.00 30.45  ? 213 TRP B CD1   1 
ATOM 2613  C CD2   . TRP B 2 213 ? 132.863 163.141 143.224 1.00 30.45  ? 213 TRP B CD2   1 
ATOM 2614  N NE1   . TRP B 2 213 ? 132.792 160.968 142.699 1.00 30.45  ? 213 TRP B NE1   1 
ATOM 2615  C CE2   . TRP B 2 213 ? 132.078 161.977 143.286 1.00 30.45  ? 213 TRP B CE2   1 
ATOM 2616  C CE3   . TRP B 2 213 ? 132.355 164.324 143.760 1.00 30.45  ? 213 TRP B CE3   1 
ATOM 2617  C CZ2   . TRP B 2 213 ? 130.813 161.963 143.861 1.00 30.45  ? 213 TRP B CZ2   1 
ATOM 2618  C CZ3   . TRP B 2 213 ? 131.104 164.307 144.329 1.00 30.45  ? 213 TRP B CZ3   1 
ATOM 2619  C CH2   . TRP B 2 213 ? 130.346 163.138 144.377 1.00 30.45  ? 213 TRP B CH2   1 
ATOM 2620  N N     . VAL B 2 214 ? 137.887 165.002 141.584 1.00 28.18  ? 214 VAL B N     1 
ATOM 2621  C CA    . VAL B 2 214 ? 138.633 166.165 141.097 1.00 28.18  ? 214 VAL B CA    1 
ATOM 2622  C C     . VAL B 2 214 ? 139.597 165.762 139.985 1.00 28.18  ? 214 VAL B C     1 
ATOM 2623  O O     . VAL B 2 214 ? 139.621 166.381 138.909 1.00 28.18  ? 214 VAL B O     1 
ATOM 2624  C CB    . VAL B 2 214 ? 139.376 166.856 142.254 1.00 28.18  ? 214 VAL B CB    1 
ATOM 2625  C CG1   . VAL B 2 214 ? 140.142 168.058 141.738 1.00 28.18  ? 214 VAL B CG1   1 
ATOM 2626  C CG2   . VAL B 2 214 ? 138.403 167.283 143.315 1.00 28.18  ? 214 VAL B CG2   1 
ATOM 2627  N N     . GLN B 2 215 ? 140.408 164.730 140.216 1.00 28.00  ? 215 GLN B N     1 
ATOM 2628  C CA    . GLN B 2 215 ? 141.351 164.296 139.193 1.00 28.00  ? 215 GLN B CA    1 
ATOM 2629  C C     . GLN B 2 215 ? 140.654 163.996 137.886 1.00 28.00  ? 215 GLN B C     1 
ATOM 2630  O O     . GLN B 2 215 ? 141.097 164.427 136.823 1.00 28.00  ? 215 GLN B O     1 
ATOM 2631  C CB    . GLN B 2 215 ? 142.144 163.068 139.614 1.00 28.00  ? 215 GLN B CB    1 
ATOM 2632  C CG    . GLN B 2 215 ? 143.119 163.239 140.719 1.00 28.00  ? 215 GLN B CG    1 
ATOM 2633  C CD    . GLN B 2 215 ? 143.714 161.911 141.105 1.00 28.00  ? 215 GLN B CD    1 
ATOM 2634  O OE1   . GLN B 2 215 ? 143.292 160.864 140.613 1.00 28.00  ? 215 GLN B OE1   1 
ATOM 2635  N NE2   . GLN B 2 215 ? 144.772 161.951 141.895 1.00 28.00  ? 215 GLN B NE2   1 
ATOM 2636  N N     . ASP B 2 216 ? 139.573 163.218 137.933 1.00 30.46  ? 216 ASP B N     1 
ATOM 2637  C CA    . ASP B 2 216 ? 138.855 162.932 136.707 1.00 30.46  ? 216 ASP B CA    1 
ATOM 2638  C C     . ASP B 2 216 ? 138.442 164.214 136.015 1.00 30.46  ? 216 ASP B C     1 
ATOM 2639  O O     . ASP B 2 216 ? 138.564 164.352 134.799 1.00 30.46  ? 216 ASP B O     1 
ATOM 2640  C CB    . ASP B 2 216 ? 137.647 162.043 136.974 1.00 30.46  ? 216 ASP B CB    1 
ATOM 2641  C CG    . ASP B 2 216 ? 138.022 160.625 137.319 1.00 30.46  ? 216 ASP B CG    1 
ATOM 2642  O OD1   . ASP B 2 216 ? 139.124 160.187 136.924 1.00 30.46  ? 216 ASP B OD1   1 
ATOM 2643  O OD2   . ASP B 2 216 ? 137.205 159.935 137.959 1.00 30.46  ? 216 ASP B OD2   1 
ATOM 2644  N N     . TYR B 2 217 ? 137.951 165.190 136.803 1.00 33.52  ? 217 TYR B N     1 
ATOM 2645  C CA    . TYR B 2 217 ? 137.539 166.446 136.194 1.00 33.52  ? 217 TYR B CA    1 
ATOM 2646  C C     . TYR B 2 217 ? 138.697 167.117 135.459 1.00 33.52  ? 217 TYR B C     1 
ATOM 2647  O O     . TYR B 2 217 ? 138.595 167.363 134.248 1.00 33.52  ? 217 TYR B O     1 
ATOM 2648  C CB    . TYR B 2 217 ? 136.985 167.380 137.280 1.00 33.52  ? 217 TYR B CB    1 
ATOM 2649  C CG    . TYR B 2 217 ? 136.700 168.780 136.794 1.00 33.52  ? 217 TYR B CG    1 
ATOM 2650  C CD1   . TYR B 2 217 ? 135.529 169.091 136.119 1.00 33.52  ? 217 TYR B CD1   1 
ATOM 2651  C CD2   . TYR B 2 217 ? 137.589 169.800 137.053 1.00 33.52  ? 217 TYR B CD2   1 
ATOM 2652  C CE1   . TYR B 2 217 ? 135.281 170.382 135.690 1.00 33.52  ? 217 TYR B CE1   1 
ATOM 2653  C CE2   . TYR B 2 217 ? 137.352 171.081 136.631 1.00 33.52  ? 217 TYR B CE2   1 
ATOM 2654  C CZ    . TYR B 2 217 ? 136.202 171.372 135.955 1.00 33.52  ? 217 TYR B CZ    1 
ATOM 2655  O OH    . TYR B 2 217 ? 135.989 172.663 135.543 1.00 33.52  ? 217 TYR B OH    1 
ATOM 2656  N N     . HIS B 2 218 ? 139.791 167.427 136.139 1.00 31.45  ? 218 HIS B N     1 
ATOM 2657  C CA    . HIS B 2 218 ? 140.888 168.116 135.459 1.00 31.45  ? 218 HIS B CA    1 
ATOM 2658  C C     . HIS B 2 218 ? 141.502 167.308 134.330 1.00 31.45  ? 218 HIS B C     1 
ATOM 2659  O O     . HIS B 2 218 ? 141.810 167.847 133.269 1.00 31.45  ? 218 HIS B O     1 
ATOM 2660  C CB    . HIS B 2 218 ? 141.931 168.576 136.459 1.00 31.45  ? 218 HIS B CB    1 
ATOM 2661  C CG    . HIS B 2 218 ? 141.479 169.731 137.282 1.00 31.45  ? 218 HIS B CG    1 
ATOM 2662  N ND1   . HIS B 2 218 ? 142.053 170.082 138.478 1.00 31.45  ? 218 HIS B ND1   1 
ATOM 2663  C CD2   . HIS B 2 218 ? 140.562 170.690 137.009 1.00 31.45  ? 218 HIS B CD2   1 
ATOM 2664  C CE1   . HIS B 2 218 ? 141.450 171.158 138.951 1.00 31.45  ? 218 HIS B CE1   1 
ATOM 2665  N NE2   . HIS B 2 218 ? 140.551 171.554 138.074 1.00 31.45  ? 218 HIS B NE2   1 
ATOM 2666  N N     . ARG B 2 219 ? 141.716 166.002 134.546 1.00 32.80  ? 219 ARG B N     1 
ATOM 2667  C CA    . ARG B 2 219 ? 142.333 165.211 133.489 1.00 32.80  ? 219 ARG B CA    1 
ATOM 2668  C C     . ARG B 2 219 ? 141.461 165.197 132.241 1.00 32.80  ? 219 ARG B C     1 
ATOM 2669  O O     . ARG B 2 219 ? 141.953 165.459 131.137 1.00 32.80  ? 219 ARG B O     1 
ATOM 2670  C CB    . ARG B 2 219 ? 142.574 163.770 133.961 1.00 32.80  ? 219 ARG B CB    1 
ATOM 2671  C CG    . ARG B 2 219 ? 143.643 163.626 135.015 1.00 32.80  ? 219 ARG B CG    1 
ATOM 2672  C CD    . ARG B 2 219 ? 143.784 162.178 135.416 1.00 32.80  ? 219 ARG B CD    1 
ATOM 2673  N NE    . ARG B 2 219 ? 144.707 162.002 136.528 1.00 32.80  ? 219 ARG B NE    1 
ATOM 2674  C CZ    . ARG B 2 219 ? 145.064 160.819 137.012 1.00 32.80  ? 219 ARG B CZ    1 
ATOM 2675  N NH1   . ARG B 2 219 ? 144.573 159.711 136.479 1.00 32.80  ? 219 ARG B NH1   1 
ATOM 2676  N NH2   . ARG B 2 219 ? 145.908 160.740 138.030 1.00 32.80  ? 219 ARG B NH2   1 
ATOM 2677  N N     . THR B 2 220 ? 140.167 164.946 132.400 1.00 33.33  ? 220 THR B N     1 
ATOM 2678  C CA    . THR B 2 220 ? 139.299 164.912 131.230 1.00 33.33  ? 220 THR B CA    1 
ATOM 2679  C C     . THR B 2 220 ? 139.113 166.299 130.627 1.00 33.33  ? 220 THR B C     1 
ATOM 2680  O O     . THR B 2 220 ? 138.955 166.414 129.403 1.00 33.33  ? 220 THR B O     1 
ATOM 2681  C CB    . THR B 2 220 ? 137.952 164.303 131.619 1.00 33.33  ? 220 THR B CB    1 
ATOM 2682  O OG1   . THR B 2 220 ? 138.176 162.944 132.003 1.00 33.33  ? 220 THR B OG1   1 
ATOM 2683  C CG2   . THR B 2 220 ? 136.989 164.327 130.448 1.00 33.33  ? 220 THR B CG2   1 
ATOM 2684  N N     . LEU B 2 221 ? 139.168 167.353 131.427 1.00 33.85  ? 221 LEU B N     1 
ATOM 2685  C CA    . LEU B 2 221 ? 139.135 168.692 130.853 1.00 33.85  ? 221 LEU B CA    1 
ATOM 2686  C C     . LEU B 2 221 ? 140.362 168.943 129.993 1.00 33.85  ? 221 LEU B C     1 
ATOM 2687  O O     . LEU B 2 221 ? 140.263 169.453 128.873 1.00 33.85  ? 221 LEU B O     1 
ATOM 2688  C CB    . LEU B 2 221 ? 139.039 169.741 131.952 1.00 33.85  ? 221 LEU B CB    1 
ATOM 2689  C CG    . LEU B 2 221 ? 138.738 171.157 131.470 1.00 33.85  ? 221 LEU B CG    1 
ATOM 2690  C CD1   . LEU B 2 221 ? 137.376 171.206 130.799 1.00 33.85  ? 221 LEU B CD1   1 
ATOM 2691  C CD2   . LEU B 2 221 ? 138.823 172.151 132.609 1.00 33.85  ? 221 LEU B CD2   1 
ATOM 2692  N N     . GLU B 2 222 ? 141.539 168.591 130.516 1.00 35.64  ? 222 GLU B N     1 
ATOM 2693  C CA    . GLU B 2 222 ? 142.773 168.757 129.759 1.00 35.64  ? 222 GLU B CA    1 
ATOM 2694  C C     . GLU B 2 222 ? 142.754 167.943 128.476 1.00 35.64  ? 222 GLU B C     1 
ATOM 2695  O O     . GLU B 2 222 ? 143.078 168.458 127.404 1.00 35.64  ? 222 GLU B O     1 
ATOM 2696  C CB    . GLU B 2 222 ? 143.970 168.370 130.624 1.00 35.64  ? 222 GLU B CB    1 
ATOM 2697  C CG    . GLU B 2 222 ? 144.328 169.432 131.632 1.00 35.64  ? 222 GLU B CG    1 
ATOM 2698  C CD    . GLU B 2 222 ? 144.725 170.732 130.966 1.00 35.64  ? 222 GLU B CD    1 
ATOM 2699  O OE1   . GLU B 2 222 ? 145.362 170.681 129.893 1.00 35.64  ? 222 GLU B OE1   1 
ATOM 2700  O OE2   . GLU B 2 222 ? 144.397 171.805 131.511 1.00 35.64  ? 222 GLU B OE2   1 
ATOM 2701  N N     . THR B 2 223 ? 142.412 166.657 128.566 1.00 39.52  ? 223 THR B N     1 
ATOM 2702  C CA    . THR B 2 223 ? 142.395 165.824 127.369 1.00 39.52  ? 223 THR B CA    1 
ATOM 2703  C C     . THR B 2 223 ? 141.364 166.314 126.362 1.00 39.52  ? 223 THR B C     1 
ATOM 2704  O O     . THR B 2 223 ? 141.596 166.246 125.153 1.00 39.52  ? 223 THR B O     1 
ATOM 2705  C CB    . THR B 2 223 ? 142.133 164.367 127.735 1.00 39.52  ? 223 THR B CB    1 
ATOM 2706  O OG1   . THR B 2 223 ? 140.833 164.246 128.321 1.00 39.52  ? 223 THR B OG1   1 
ATOM 2707  C CG2   . THR B 2 223 ? 143.182 163.874 128.717 1.00 39.52  ? 223 THR B CG2   1 
ATOM 2708  N N     . LEU B 2 224 ? 140.219 166.807 126.836 1.00 39.47  ? 224 LEU B N     1 
ATOM 2709  C CA    . LEU B 2 224 ? 139.223 167.325 125.908 1.00 39.47  ? 224 LEU B CA    1 
ATOM 2710  C C     . LEU B 2 224 ? 139.694 168.615 125.257 1.00 39.47  ? 224 LEU B C     1 
ATOM 2711  O O     . LEU B 2 224 ? 139.323 168.902 124.114 1.00 39.47  ? 224 LEU B O     1 
ATOM 2712  C CB    . LEU B 2 224 ? 137.890 167.546 126.621 1.00 39.47  ? 224 LEU B CB    1 
ATOM 2713  C CG    . LEU B 2 224 ? 137.017 166.308 126.835 1.00 39.47  ? 224 LEU B CG    1 
ATOM 2714  C CD1   . LEU B 2 224 ? 135.703 166.681 127.506 1.00 39.47  ? 224 LEU B CD1   1 
ATOM 2715  C CD2   . LEU B 2 224 ? 136.758 165.587 125.521 1.00 39.47  ? 224 LEU B CD2   1 
ATOM 2716  N N     . THR B 2 225 ? 140.495 169.410 125.967 1.00 40.62  ? 225 THR B N     1 
ATOM 2717  C CA    . THR B 2 225 ? 141.040 170.620 125.363 1.00 40.62  ? 225 THR B CA    1 
ATOM 2718  C C     . THR B 2 225 ? 142.169 170.305 124.389 1.00 40.62  ? 225 THR B C     1 
ATOM 2719  O O     . THR B 2 225 ? 142.283 170.946 123.338 1.00 40.62  ? 225 THR B O     1 
ATOM 2720  C CB    . THR B 2 225 ? 141.530 171.568 126.454 1.00 40.62  ? 225 THR B CB    1 
ATOM 2721  O OG1   . THR B 2 225 ? 140.440 171.901 127.319 1.00 40.62  ? 225 THR B OG1   1 
ATOM 2722  C CG2   . THR B 2 225 ? 142.083 172.841 125.843 1.00 40.62  ? 225 THR B CG2   1 
ATOM 2723  N N     . ARG B 2 226 ? 143.004 169.317 124.714 1.00 42.19  ? 226 ARG B N     1 
ATOM 2724  C CA    . ARG B 2 226 ? 144.108 168.946 123.839 1.00 42.19  ? 226 ARG B CA    1 
ATOM 2725  C C     . ARG B 2 226 ? 143.642 168.174 122.620 1.00 42.19  ? 226 ARG B C     1 
ATOM 2726  O O     . ARG B 2 226 ? 144.287 168.232 121.568 1.00 42.19  ? 226 ARG B O     1 
ATOM 2727  C CB    . ARG B 2 226 ? 145.131 168.103 124.591 1.00 42.19  ? 226 ARG B CB    1 
ATOM 2728  C CG    . ARG B 2 226 ? 145.878 168.812 125.690 1.00 42.19  ? 226 ARG B CG    1 
ATOM 2729  C CD    . ARG B 2 226 ? 146.978 167.907 126.187 1.00 42.19  ? 226 ARG B CD    1 
ATOM 2730  N NE    . ARG B 2 226 ? 146.435 166.637 126.662 1.00 42.19  ? 226 ARG B NE    1 
ATOM 2731  C CZ    . ARG B 2 226 ? 146.615 165.473 126.046 1.00 42.19  ? 226 ARG B CZ    1 
ATOM 2732  N NH1   . ARG B 2 226 ? 147.324 165.418 124.929 1.00 42.19  ? 226 ARG B NH1   1 
ATOM 2733  N NH2   . ARG B 2 226 ? 146.086 164.365 126.545 1.00 42.19  ? 226 ARG B NH2   1 
ATOM 2734  N N     . GLN B 2 227 ? 142.529 167.459 122.725 1.00 45.20  ? 227 GLN B N     1 
ATOM 2735  C CA    . GLN B 2 227 ? 142.085 166.717 121.563 1.00 45.20  ? 227 GLN B CA    1 
ATOM 2736  C C     . GLN B 2 227 ? 141.373 167.618 120.577 1.00 45.20  ? 227 GLN B C     1 
ATOM 2737  O O     . GLN B 2 227 ? 141.101 167.195 119.449 1.00 45.20  ? 227 GLN B O     1 
ATOM 2738  C CB    . GLN B 2 227 ? 141.175 165.560 121.987 1.00 45.20  ? 227 GLN B CB    1 
ATOM 2739  C CG    . GLN B 2 227 ? 141.889 164.393 122.681 1.00 45.20  ? 227 GLN B CG    1 
ATOM 2740  C CD    . GLN B 2 227 ? 142.956 163.709 121.838 1.00 45.20  ? 227 GLN B CD    1 
ATOM 2741  O OE1   . GLN B 2 227 ? 143.902 164.336 121.362 1.00 45.20  ? 227 GLN B OE1   1 
ATOM 2742  N NE2   . GLN B 2 227 ? 142.817 162.399 121.673 1.00 45.20  ? 227 GLN B NE2   1 
ATOM 2743  N N     . ALA B 2 228 ? 141.060 168.848 120.987 1.00 51.37  ? 228 ALA B N     1 
ATOM 2744  C CA    . ALA B 2 228 ? 140.494 169.837 120.085 1.00 51.37  ? 228 ALA B CA    1 
ATOM 2745  C C     . ALA B 2 228 ? 141.575 170.555 119.295 1.00 51.37  ? 228 ALA B C     1 
ATOM 2746  O O     . ALA B 2 228 ? 141.370 171.698 118.870 1.00 51.37  ? 228 ALA B O     1 
ATOM 2747  C CB    . ALA B 2 228 ? 139.651 170.846 120.866 1.00 51.37  ? 228 ALA B CB    1 
ATOM 2748  N N     . GLU B 2 229 ? 142.733 169.923 119.131 1.00 54.33  ? 229 GLU B N     1 
ATOM 2749  C CA    . GLU B 2 229 ? 143.857 170.494 118.409 1.00 54.33  ? 229 GLU B CA    1 
ATOM 2750  C C     . GLU B 2 229 ? 143.481 170.811 116.965 1.00 54.33  ? 229 GLU B C     1 
ATOM 2751  O O     . GLU B 2 229 ? 143.141 169.911 116.195 1.00 54.33  ? 229 GLU B O     1 
ATOM 2752  C CB    . GLU B 2 229 ? 145.052 169.548 118.469 1.00 54.33  ? 229 GLU B CB    1 
ATOM 2753  C CG    . GLU B 2 229 ? 146.323 170.111 117.878 1.00 54.33  ? 229 GLU B CG    1 
ATOM 2754  C CD    . GLU B 2 229 ? 147.478 169.139 117.975 1.00 54.33  ? 229 GLU B CD    1 
ATOM 2755  O OE1   . GLU B 2 229 ? 147.260 167.999 118.440 1.00 54.33  ? 229 GLU B OE1   1 
ATOM 2756  O OE2   . GLU B 2 229 ? 148.605 169.514 117.593 1.00 54.33  ? 229 GLU B OE2   1 
ATOM 2757  N N     . PRO C 3 17  ? 216.063 86.737  139.004 1.00 73.45  ? 17  PRO C N     1 
ATOM 2758  C CA    . PRO C 3 17  ? 216.149 87.773  140.038 1.00 73.45  ? 17  PRO C CA    1 
ATOM 2759  C C     . PRO C 3 17  ? 215.487 89.061  139.590 1.00 73.45  ? 17  PRO C C     1 
ATOM 2760  O O     . PRO C 3 17  ? 215.591 89.413  138.419 1.00 73.45  ? 17  PRO C O     1 
ATOM 2761  C CB    . PRO C 3 17  ? 217.656 87.972  140.212 1.00 73.45  ? 17  PRO C CB    1 
ATOM 2762  C CG    . PRO C 3 17  ? 218.234 87.563  138.912 1.00 73.45  ? 17  PRO C CG    1 
ATOM 2763  C CD    . PRO C 3 17  ? 217.378 86.435  138.418 1.00 73.45  ? 17  PRO C CD    1 
ATOM 2764  N N     . PRO C 3 18  ? 214.808 89.754  140.503 1.00 71.59  ? 18  PRO C N     1 
ATOM 2765  C CA    . PRO C 3 18  ? 214.130 91.001  140.126 1.00 71.59  ? 18  PRO C CA    1 
ATOM 2766  C C     . PRO C 3 18  ? 215.142 92.110  139.891 1.00 71.59  ? 18  PRO C C     1 
ATOM 2767  O O     . PRO C 3 18  ? 215.954 92.424  140.764 1.00 71.59  ? 18  PRO C O     1 
ATOM 2768  C CB    . PRO C 3 18  ? 213.239 91.298  141.334 1.00 71.59  ? 18  PRO C CB    1 
ATOM 2769  C CG    . PRO C 3 18  ? 213.941 90.641  142.466 1.00 71.59  ? 18  PRO C CG    1 
ATOM 2770  C CD    . PRO C 3 18  ? 214.573 89.401  141.910 1.00 71.59  ? 18  PRO C CD    1 
ATOM 2771  N N     . SER C 3 19  ? 215.085 92.707  138.706 1.00 72.02  ? 19  SER C N     1 
ATOM 2772  C CA    . SER C 3 19  ? 215.956 93.815  138.362 1.00 72.02  ? 19  SER C CA    1 
ATOM 2773  C C     . SER C 3 19  ? 215.152 94.803  137.537 1.00 72.02  ? 19  SER C C     1 
ATOM 2774  O O     . SER C 3 19  ? 214.213 94.422  136.833 1.00 72.02  ? 19  SER C O     1 
ATOM 2775  C CB    . SER C 3 19  ? 217.183 93.357  137.569 1.00 72.02  ? 19  SER C CB    1 
ATOM 2776  O OG    . SER C 3 19  ? 216.786 92.708  136.374 1.00 72.02  ? 19  SER C OG    1 
ATOM 2777  N N     . PHE C 3 20  ? 215.528 96.074  137.621 1.00 69.60  ? 20  PHE C N     1 
ATOM 2778  C CA    . PHE C 3 20  ? 214.784 97.112  136.914 1.00 69.60  ? 20  PHE C CA    1 
ATOM 2779  C C     . PHE C 3 20  ? 215.781 98.230  136.633 1.00 69.60  ? 20  PHE C C     1 
ATOM 2780  O O     . PHE C 3 20  ? 216.146 98.978  137.545 1.00 69.60  ? 20  PHE C O     1 
ATOM 2781  C CB    . PHE C 3 20  ? 213.600 97.592  137.740 1.00 69.60  ? 20  PHE C CB    1 
ATOM 2782  C CG    . PHE C 3 20  ? 212.732 98.596  137.042 1.00 69.60  ? 20  PHE C CG    1 
ATOM 2783  C CD1   . PHE C 3 20  ? 211.732 98.179  136.187 1.00 69.60  ? 20  PHE C CD1   1 
ATOM 2784  C CD2   . PHE C 3 20  ? 212.915 99.949  137.232 1.00 69.60  ? 20  PHE C CD2   1 
ATOM 2785  C CE1   . PHE C 3 20  ? 210.923 99.091  135.552 1.00 69.60  ? 20  PHE C CE1   1 
ATOM 2786  C CE2   . PHE C 3 20  ? 212.109 100.866 136.596 1.00 69.60  ? 20  PHE C CE2   1 
ATOM 2787  C CZ    . PHE C 3 20  ? 211.115 100.438 135.755 1.00 69.60  ? 20  PHE C CZ    1 
ATOM 2788  N N     . ASP C 3 21  ? 216.241 98.307  135.389 1.00 69.72  ? 21  ASP C N     1 
ATOM 2789  C CA    . ASP C 3 21  ? 217.215 99.312  134.988 1.00 69.72  ? 21  ASP C CA    1 
ATOM 2790  C C     . ASP C 3 21  ? 216.529 100.608 134.598 1.00 69.72  ? 21  ASP C C     1 
ATOM 2791  O O     . ASP C 3 21  ? 215.636 100.620 133.751 1.00 69.72  ? 21  ASP C O     1 
ATOM 2792  C CB    . ASP C 3 21  ? 218.067 98.798  133.826 1.00 69.72  ? 21  ASP C CB    1 
ATOM 2793  N N     . VAL C 3 22  ? 216.950 101.702 135.221 1.00 65.27  ? 22  VAL C N     1 
ATOM 2794  C CA    . VAL C 3 22  ? 216.364 103.001 134.929 1.00 65.27  ? 22  VAL C CA    1 
ATOM 2795  C C     . VAL C 3 22  ? 216.697 103.439 133.510 1.00 65.27  ? 22  VAL C C     1 
ATOM 2796  O O     . VAL C 3 22  ? 215.861 104.029 132.817 1.00 65.27  ? 22  VAL C O     1 
ATOM 2797  C CB    . VAL C 3 22  ? 216.864 104.013 135.971 1.00 65.27  ? 22  VAL C CB    1 
ATOM 2798  C CG1   . VAL C 3 22  ? 216.268 105.363 135.736 1.00 65.27  ? 22  VAL C CG1   1 
ATOM 2799  C CG2   . VAL C 3 22  ? 216.537 103.517 137.363 1.00 65.27  ? 22  VAL C CG2   1 
ATOM 2800  N N     . THR C 3 23  ? 217.904 103.134 133.042 1.00 66.38  ? 23  THR C N     1 
ATOM 2801  C CA    . THR C 3 23  ? 218.301 103.530 131.696 1.00 66.38  ? 23  THR C CA    1 
ATOM 2802  C C     . THR C 3 23  ? 217.505 102.783 130.635 1.00 66.38  ? 23  THR C C     1 
ATOM 2803  O O     . THR C 3 23  ? 217.182 103.349 129.586 1.00 66.38  ? 23  THR C O     1 
ATOM 2804  C CB    . THR C 3 23  ? 219.791 103.301 131.502 1.00 66.38  ? 23  THR C CB    1 
ATOM 2805  O OG1   . THR C 3 23  ? 220.063 101.897 131.509 1.00 66.38  ? 23  THR C OG1   1 
ATOM 2806  C CG2   . THR C 3 23  ? 220.556 103.960 132.609 1.00 66.38  ? 23  THR C CG2   1 
ATOM 2807  N N     . ILE C 3 24  ? 217.164 101.524 130.897 1.00 67.48  ? 24  ILE C N     1 
ATOM 2808  C CA    . ILE C 3 24  ? 216.512 100.672 129.908 1.00 67.48  ? 24  ILE C CA    1 
ATOM 2809  C C     . ILE C 3 24  ? 214.999 100.692 130.078 1.00 67.48  ? 24  ILE C C     1 
ATOM 2810  O O     . ILE C 3 24  ? 214.271 101.043 129.144 1.00 67.48  ? 24  ILE C O     1 
ATOM 2811  C CB    . ILE C 3 24  ? 217.034 99.229  130.001 1.00 67.48  ? 24  ILE C CB    1 
ATOM 2812  C CG1   . ILE C 3 24  ? 218.540 99.185  129.760 1.00 67.48  ? 24  ILE C CG1   1 
ATOM 2813  C CG2   . ILE C 3 24  ? 216.317 98.349  129.001 1.00 67.48  ? 24  ILE C CG2   1 
ATOM 2814  C CD1   . ILE C 3 24  ? 218.946 99.637  128.382 1.00 67.48  ? 24  ILE C CD1   1 
ATOM 2815  N N     . ALA C 3 25  ? 214.517 100.287 131.245 1.00 65.88  ? 25  ALA C N     1 
ATOM 2816  C CA    . ALA C 3 25  ? 213.083 100.157 131.459 1.00 65.88  ? 25  ALA C CA    1 
ATOM 2817  C C     . ALA C 3 25  ? 212.386 101.503 131.268 1.00 65.88  ? 25  ALA C C     1 
ATOM 2818  O O     . ALA C 3 25  ? 212.848 102.521 131.803 1.00 65.88  ? 25  ALA C O     1 
ATOM 2819  C CB    . ALA C 3 25  ? 212.801 99.607  132.848 1.00 65.88  ? 25  ALA C CB    1 
ATOM 2820  N N     . PRO C 3 26  ? 211.286 101.551 130.521 1.00 63.00  ? 26  PRO C N     1 
ATOM 2821  C CA    . PRO C 3 26  ? 210.607 102.829 130.264 1.00 63.00  ? 26  PRO C CA    1 
ATOM 2822  C C     . PRO C 3 26  ? 209.894 103.386 131.488 1.00 63.00  ? 26  PRO C C     1 
ATOM 2823  O O     . PRO C 3 26  ? 209.229 102.656 132.224 1.00 63.00  ? 26  PRO C O     1 
ATOM 2824  C CB    . PRO C 3 26  ? 209.595 102.469 129.172 1.00 63.00  ? 26  PRO C CB    1 
ATOM 2825  C CG    . PRO C 3 26  ? 209.317 101.019 129.402 1.00 63.00  ? 26  PRO C CG    1 
ATOM 2826  C CD    . PRO C 3 26  ? 210.611 100.421 129.866 1.00 63.00  ? 26  PRO C CD    1 
ATOM 2827  N N     . TRP C 3 27  ? 210.022 104.698 131.691 1.00 55.83  ? 27  TRP C N     1 
ATOM 2828  C CA    . TRP C 3 27  ? 209.332 105.323 132.807 1.00 55.83  ? 27  TRP C CA    1 
ATOM 2829  C C     . TRP C 3 27  ? 209.153 106.823 132.592 1.00 55.83  ? 27  TRP C C     1 
ATOM 2830  O O     . TRP C 3 27  ? 208.279 107.427 133.217 1.00 55.83  ? 27  TRP C O     1 
ATOM 2831  C CB    . TRP C 3 27  ? 210.053 105.068 134.133 1.00 55.83  ? 27  TRP C CB    1 
ATOM 2832  C CG    . TRP C 3 27  ? 211.440 105.578 134.221 1.00 55.83  ? 27  TRP C CG    1 
ATOM 2833  C CD1   . TRP C 3 27  ? 212.534 105.065 133.612 1.00 55.83  ? 27  TRP C CD1   1 
ATOM 2834  C CD2   . TRP C 3 27  ? 211.892 106.707 134.982 1.00 55.83  ? 27  TRP C CD2   1 
ATOM 2835  N NE1   . TRP C 3 27  ? 213.643 105.804 133.938 1.00 55.83  ? 27  TRP C NE1   1 
ATOM 2836  C CE2   . TRP C 3 27  ? 213.273 106.816 134.782 1.00 55.83  ? 27  TRP C CE2   1 
ATOM 2837  C CE3   . TRP C 3 27  ? 211.260 107.637 135.806 1.00 55.83  ? 27  TRP C CE3   1 
ATOM 2838  C CZ2   . TRP C 3 27  ? 214.036 107.825 135.366 1.00 55.83  ? 27  TRP C CZ2   1 
ATOM 2839  C CZ3   . TRP C 3 27  ? 212.021 108.632 136.394 1.00 55.83  ? 27  TRP C CZ3   1 
ATOM 2840  C CH2   . TRP C 3 27  ? 213.393 108.716 136.169 1.00 55.83  ? 27  TRP C CH2   1 
ATOM 2841  N N     . LEU C 3 28  ? 209.953 107.446 131.732 1.00 59.12  ? 28  LEU C N     1 
ATOM 2842  C CA    . LEU C 3 28  ? 209.789 108.866 131.456 1.00 59.12  ? 28  LEU C CA    1 
ATOM 2843  C C     . LEU C 3 28  ? 208.845 109.058 130.280 1.00 59.12  ? 28  LEU C C     1 
ATOM 2844  O O     . LEU C 3 28  ? 209.090 108.532 129.188 1.00 59.12  ? 28  LEU C O     1 
ATOM 2845  C CB    . LEU C 3 28  ? 211.104 109.558 131.123 1.00 59.12  ? 28  LEU C CB    1 
ATOM 2846  C CG    . LEU C 3 28  ? 212.191 109.702 132.158 1.00 59.12  ? 28  LEU C CG    1 
ATOM 2847  C CD1   . LEU C 3 28  ? 213.051 108.488 132.013 1.00 59.12  ? 28  LEU C CD1   1 
ATOM 2848  C CD2   . LEU C 3 28  ? 212.965 110.983 131.895 1.00 59.12  ? 28  LEU C CD2   1 
ATOM 2849  N N     . ILE C 3 29  ? 207.752 109.783 130.501 1.00 56.75  ? 29  ILE C N     1 
ATOM 2850  C CA    . ILE C 3 29  ? 206.832 110.035 129.404 1.00 56.75  ? 29  ILE C CA    1 
ATOM 2851  C C     . ILE C 3 29  ? 207.527 110.971 128.426 1.00 56.75  ? 29  ILE C C     1 
ATOM 2852  O O     . ILE C 3 29  ? 208.185 111.932 128.831 1.00 56.75  ? 29  ILE C O     1 
ATOM 2853  C CB    . ILE C 3 29  ? 205.513 110.612 129.929 1.00 56.75  ? 29  ILE C CB    1 
ATOM 2854  C CG1   . ILE C 3 29  ? 204.716 109.532 130.652 1.00 56.75  ? 29  ILE C CG1   1 
ATOM 2855  C CG2   . ILE C 3 29  ? 204.689 111.158 128.792 1.00 56.75  ? 29  ILE C CG2   1 
ATOM 2856  C CD1   . ILE C 3 29  ? 205.120 109.346 132.085 1.00 56.75  ? 29  ILE C CD1   1 
ATOM 2857  N N     . ALA C 3 30  ? 207.449 110.679 127.139 1.00 61.35  ? 30  ALA C N     1 
ATOM 2858  C CA    . ALA C 3 30  ? 208.153 111.536 126.198 1.00 61.35  ? 30  ALA C CA    1 
ATOM 2859  C C     . ALA C 3 30  ? 207.288 111.903 125.010 1.00 61.35  ? 30  ALA C C     1 
ATOM 2860  O O     . ALA C 3 30  ? 206.749 111.021 124.334 1.00 61.35  ? 30  ALA C O     1 
ATOM 2861  C CB    . ALA C 3 30  ? 209.423 110.848 125.704 1.00 61.35  ? 30  ALA C CB    1 
ATOM 2862  N N     . ARG C 3 31  ? 207.141 113.203 124.768 1.00 64.67  ? 31  ARG C N     1 
ATOM 2863  C CA    . ARG C 3 31  ? 206.497 113.693 123.561 1.00 64.67  ? 31  ARG C CA    1 
ATOM 2864  C C     . ARG C 3 31  ? 207.546 114.449 122.759 1.00 64.67  ? 31  ARG C C     1 
ATOM 2865  O O     . ARG C 3 31  ? 208.249 115.313 123.300 1.00 64.67  ? 31  ARG C O     1 
ATOM 2866  C CB    . ARG C 3 31  ? 205.282 114.566 123.893 1.00 64.67  ? 31  ARG C CB    1 
ATOM 2867  C CG    . ARG C 3 31  ? 205.598 115.852 124.630 1.00 64.67  ? 31  ARG C CG    1 
ATOM 2868  C CD    . ARG C 3 31  ? 204.354 116.658 124.951 1.00 64.67  ? 31  ARG C CD    1 
ATOM 2869  N NE    . ARG C 3 31  ? 204.707 117.914 125.599 1.00 64.67  ? 31  ARG C NE    1 
ATOM 2870  C CZ    . ARG C 3 31  ? 204.921 118.042 126.903 1.00 64.67  ? 31  ARG C CZ    1 
ATOM 2871  N NH1   . ARG C 3 31  ? 204.819 116.984 127.698 1.00 64.67  ? 31  ARG C NH1   1 
ATOM 2872  N NH2   . ARG C 3 31  ? 205.240 119.222 127.414 1.00 64.67  ? 31  ARG C NH2   1 
ATOM 2873  N N     . SER C 3 32  ? 207.665 114.112 121.479 1.00 74.76  ? 32  SER C N     1 
ATOM 2874  C CA    . SER C 3 32  ? 208.660 114.767 120.649 1.00 74.76  ? 32  SER C CA    1 
ATOM 2875  C C     . SER C 3 32  ? 208.086 116.033 120.042 1.00 74.76  ? 32  SER C C     1 
ATOM 2876  O O     . SER C 3 32  ? 206.877 116.265 120.065 1.00 74.76  ? 32  SER C O     1 
ATOM 2877  C CB    . SER C 3 32  ? 209.122 113.830 119.537 1.00 74.76  ? 32  SER C CB    1 
ATOM 2878  O OG    . SER C 3 32  ? 208.040 113.513 118.683 1.00 74.76  ? 32  SER C OG    1 
ATOM 2879  N N     . ARG C 3 33  ? 208.969 116.869 119.488 1.00 78.77  ? 33  ARG C N     1 
ATOM 2880  C CA    . ARG C 3 33  ? 208.423 118.065 118.868 1.00 78.77  ? 33  ARG C CA    1 
ATOM 2881  C C     . ARG C 3 33  ? 207.688 117.711 117.577 1.00 78.77  ? 33  ARG C C     1 
ATOM 2882  O O     . ARG C 3 33  ? 207.093 118.581 116.931 1.00 78.77  ? 33  ARG C O     1 
ATOM 2883  C CB    . ARG C 3 33  ? 209.533 119.106 118.641 1.00 78.77  ? 33  ARG C CB    1 
ATOM 2884  C CG    . ARG C 3 33  ? 209.035 120.404 118.011 1.00 78.77  ? 33  ARG C CG    1 
ATOM 2885  C CD    . ARG C 3 33  ? 210.094 121.421 117.640 1.00 78.77  ? 33  ARG C CD    1 
ATOM 2886  N NE    . ARG C 3 33  ? 211.140 120.908 116.765 1.00 78.77  ? 33  ARG C NE    1 
ATOM 2887  C CZ    . ARG C 3 33  ? 212.418 120.854 117.117 1.00 78.77  ? 33  ARG C CZ    1 
ATOM 2888  N NH1   . ARG C 3 33  ? 212.777 121.286 118.312 1.00 78.77  ? 33  ARG C NH1   1 
ATOM 2889  N NH2   . ARG C 3 33  ? 213.335 120.383 116.282 1.00 78.77  ? 33  ARG C NH2   1 
ATOM 2890  N N     . ASP C 3 34  ? 207.684 116.429 117.225 1.00 85.02  ? 34  ASP C N     1 
ATOM 2891  C CA    . ASP C 3 34  ? 207.147 115.930 115.972 1.00 85.02  ? 34  ASP C CA    1 
ATOM 2892  C C     . ASP C 3 34  ? 205.787 115.278 116.203 1.00 85.02  ? 34  ASP C C     1 
ATOM 2893  O O     . ASP C 3 34  ? 205.451 114.882 117.321 1.00 85.02  ? 34  ASP C O     1 
ATOM 2894  C CB    . ASP C 3 34  ? 208.121 114.911 115.374 1.00 85.02  ? 34  ASP C CB    1 
ATOM 2895  C CG    . ASP C 3 34  ? 209.556 115.419 115.352 1.00 85.02  ? 34  ASP C CG    1 
ATOM 2896  O OD1   . ASP C 3 34  ? 209.759 116.619 115.090 1.00 85.02  ? 34  ASP C OD1   1 
ATOM 2897  O OD2   . ASP C 3 34  ? 210.484 114.621 115.607 1.00 85.02  ? 34  ASP C OD2   1 
ATOM 2898  N N     . VAL C 3 35  ? 205.010 115.145 115.125 1.00 87.46  ? 35  VAL C N     1 
ATOM 2899  C CA    . VAL C 3 35  ? 203.772 114.362 115.121 1.00 87.46  ? 35  VAL C CA    1 
ATOM 2900  C C     . VAL C 3 35  ? 202.771 114.921 116.125 1.00 87.46  ? 35  VAL C C     1 
ATOM 2901  O O     . VAL C 3 35  ? 201.611 115.188 115.792 1.00 87.46  ? 35  VAL C O     1 
ATOM 2902  C CB    . VAL C 3 35  ? 204.036 112.872 115.403 1.00 87.46  ? 35  VAL C CB    1 
ATOM 2903  C CG1   . VAL C 3 35  ? 202.740 112.085 115.296 1.00 87.46  ? 35  VAL C CG1   1 
ATOM 2904  C CG2   . VAL C 3 35  ? 205.054 112.321 114.426 1.00 87.46  ? 35  VAL C CG2   1 
ATOM 2905  N N     . LEU C 3 36  ? 203.231 115.073 117.369 1.00 85.94  ? 36  LEU C N     1 
ATOM 2906  C CA    . LEU C 3 36  ? 202.421 115.481 118.516 1.00 85.94  ? 36  LEU C CA    1 
ATOM 2907  C C     . LEU C 3 36  ? 201.257 114.514 118.710 1.00 85.94  ? 36  LEU C C     1 
ATOM 2908  O O     . LEU C 3 36  ? 200.136 114.914 119.028 1.00 85.94  ? 36  LEU C O     1 
ATOM 2909  C CB    . LEU C 3 36  ? 201.924 116.922 118.348 1.00 85.94  ? 36  LEU C CB    1 
ATOM 2910  C CG    . LEU C 3 36  ? 202.834 118.070 118.790 1.00 85.94  ? 36  LEU C CG    1 
ATOM 2911  C CD1   . LEU C 3 36  ? 204.039 118.168 117.878 1.00 85.94  ? 36  LEU C CD1   1 
ATOM 2912  C CD2   . LEU C 3 36  ? 202.071 119.376 118.770 1.00 85.94  ? 36  LEU C CD2   1 
ATOM 2913  N N     . ALA C 3 37  ? 201.533 113.223 118.516 1.00 82.99  ? 37  ALA C N     1 
ATOM 2914  C CA    . ALA C 3 37  ? 200.564 112.159 118.733 1.00 82.99  ? 37  ALA C CA    1 
ATOM 2915  C C     . ALA C 3 37  ? 201.200 110.974 119.443 1.00 82.99  ? 37  ALA C C     1 
ATOM 2916  O O     . ALA C 3 37  ? 202.313 110.569 119.093 1.00 82.99  ? 37  ALA C O     1 
ATOM 2917  C CB    . ALA C 3 37  ? 199.947 111.696 117.411 1.00 82.99  ? 37  ALA C CB    1 
ATOM 2918  N N     . ALA C 3 38  ? 200.501 110.423 120.447 1.00 76.89  ? 38  ALA C N     1 
ATOM 2919  C CA    . ALA C 3 38  ? 200.971 109.258 121.201 1.00 76.89  ? 38  ALA C CA    1 
ATOM 2920  C C     . ALA C 3 38  ? 202.340 109.405 121.860 1.00 76.89  ? 38  ALA C C     1 
ATOM 2921  O O     . ALA C 3 38  ? 203.332 108.884 121.340 1.00 76.89  ? 38  ALA C O     1 
ATOM 2922  C CB    . ALA C 3 38  ? 200.985 108.025 120.293 1.00 76.89  ? 38  ALA C CB    1 
ATOM 2923  N N     . PRO C 3 39  ? 202.437 110.088 122.997 1.00 71.54  ? 39  PRO C N     1 
ATOM 2924  C CA    . PRO C 3 39  ? 203.724 110.169 123.696 1.00 71.54  ? 39  PRO C CA    1 
ATOM 2925  C C     . PRO C 3 39  ? 204.131 108.801 124.225 1.00 71.54  ? 39  PRO C C     1 
ATOM 2926  O O     . PRO C 3 39  ? 203.316 108.067 124.789 1.00 71.54  ? 39  PRO C O     1 
ATOM 2927  C CB    . PRO C 3 39  ? 203.444 111.150 124.837 1.00 71.54  ? 39  PRO C CB    1 
ATOM 2928  C CG    . PRO C 3 39  ? 201.975 111.037 125.066 1.00 71.54  ? 39  PRO C CG    1 
ATOM 2929  C CD    . PRO C 3 39  ? 201.366 110.786 123.724 1.00 71.54  ? 39  PRO C CD    1 
ATOM 2930  N N     . GLU C 3 40  ? 205.406 108.462 124.036 1.00 68.67  ? 40  GLU C N     1 
ATOM 2931  C CA    . GLU C 3 40  ? 205.917 107.136 124.346 1.00 68.67  ? 40  GLU C CA    1 
ATOM 2932  C C     . GLU C 3 40  ? 206.790 107.159 125.591 1.00 68.67  ? 40  GLU C C     1 
ATOM 2933  O O     . GLU C 3 40  ? 207.524 108.117 125.838 1.00 68.67  ? 40  GLU C O     1 
ATOM 2934  C CB    . GLU C 3 40  ? 206.768 106.609 123.183 1.00 68.67  ? 40  GLU C CB    1 
ATOM 2935  C CG    . GLU C 3 40  ? 206.042 106.457 121.859 1.00 68.67  ? 40  GLU C CG    1 
ATOM 2936  C CD    . GLU C 3 40  ? 206.987 106.105 120.719 1.00 68.67  ? 40  GLU C CD    1 
ATOM 2937  O OE1   . GLU C 3 40  ? 208.213 106.040 120.955 1.00 68.67  ? 40  GLU C OE1   1 
ATOM 2938  O OE2   . GLU C 3 40  ? 206.509 105.909 119.582 1.00 68.67  ? 40  GLU C OE2   1 
ATOM 2939  N N     . MET C 3 41  ? 206.724 106.076 126.363 1.00 66.32  ? 41  MET C N     1 
ATOM 2940  C CA    . MET C 3 41  ? 207.521 105.971 127.578 1.00 66.32  ? 41  MET C CA    1 
ATOM 2941  C C     . MET C 3 41  ? 208.910 105.454 127.237 1.00 66.32  ? 41  MET C C     1 
ATOM 2942  O O     . MET C 3 41  ? 209.053 104.444 126.542 1.00 66.32  ? 41  MET C O     1 
ATOM 2943  C CB    . MET C 3 41  ? 206.837 105.071 128.604 1.00 66.32  ? 41  MET C CB    1 
ATOM 2944  C CG    . MET C 3 41  ? 205.606 105.707 129.224 1.00 66.32  ? 41  MET C CG    1 
ATOM 2945  S SD    . MET C 3 41  ? 204.949 104.773 130.615 1.00 66.32  ? 41  MET C SD    1 
ATOM 2946  C CE    . MET C 3 41  ? 203.595 105.828 131.118 1.00 66.32  ? 41  MET C CE    1 
ATOM 2947  N N     . LEU C 3 42  ? 209.933 106.138 127.731 1.00 63.94  ? 42  LEU C N     1 
ATOM 2948  C CA    . LEU C 3 42  ? 211.306 105.741 127.474 1.00 63.94  ? 42  LEU C CA    1 
ATOM 2949  C C     . LEU C 3 42  ? 212.073 105.625 128.781 1.00 63.94  ? 42  LEU C C     1 
ATOM 2950  O O     . LEU C 3 42  ? 211.656 106.147 129.816 1.00 63.94  ? 42  LEU C O     1 
ATOM 2951  C CB    . LEU C 3 42  ? 212.003 106.723 126.530 1.00 63.94  ? 42  LEU C CB    1 
ATOM 2952  C CG    . LEU C 3 42  ? 211.682 106.536 125.045 1.00 63.94  ? 42  LEU C CG    1 
ATOM 2953  C CD1   . LEU C 3 42  ? 211.802 105.068 124.679 1.00 63.94  ? 42  LEU C CD1   1 
ATOM 2954  C CD2   . LEU C 3 42  ? 210.328 107.099 124.640 1.00 63.94  ? 42  LEU C CD2   1 
ATOM 2955  N N     . GLY C 3 43  ? 213.209 104.936 128.728 1.00 64.28  ? 43  GLY C N     1 
ATOM 2956  C CA    . GLY C 3 43  ? 214.102 104.883 129.863 1.00 64.28  ? 43  GLY C CA    1 
ATOM 2957  C C     . GLY C 3 43  ? 214.973 106.119 129.955 1.00 64.28  ? 43  GLY C C     1 
ATOM 2958  O O     . GLY C 3 43  ? 214.848 107.066 129.181 1.00 64.28  ? 43  GLY C O     1 
ATOM 2959  N N     . LEU C 3 44  ? 215.880 106.112 130.936 1.00 65.08  ? 44  LEU C N     1 
ATOM 2960  C CA    . LEU C 3 44  ? 216.725 107.286 131.135 1.00 65.08  ? 44  LEU C CA    1 
ATOM 2961  C C     . LEU C 3 44  ? 217.779 107.404 130.044 1.00 65.08  ? 44  LEU C C     1 
ATOM 2962  O O     . LEU C 3 44  ? 218.048 108.506 129.552 1.00 65.08  ? 44  LEU C O     1 
ATOM 2963  C CB    . LEU C 3 44  ? 217.375 107.234 132.515 1.00 65.08  ? 44  LEU C CB    1 
ATOM 2964  C CG    . LEU C 3 44  ? 218.024 108.540 132.964 1.00 65.08  ? 44  LEU C CG    1 
ATOM 2965  C CD1   . LEU C 3 44  ? 216.986 109.616 132.915 1.00 65.08  ? 44  LEU C CD1   1 
ATOM 2966  C CD2   . LEU C 3 44  ? 218.564 108.413 134.373 1.00 65.08  ? 44  LEU C CD2   1 
ATOM 2967  N N     . ARG C 3 45  ? 218.389 106.285 129.652 1.00 70.24  ? 45  ARG C N     1 
ATOM 2968  C CA    . ARG C 3 45  ? 219.419 106.336 128.619 1.00 70.24  ? 45  ARG C CA    1 
ATOM 2969  C C     . ARG C 3 45  ? 218.822 106.736 127.282 1.00 70.24  ? 45  ARG C C     1 
ATOM 2970  O O     . ARG C 3 45  ? 219.283 107.689 126.648 1.00 70.24  ? 45  ARG C O     1 
ATOM 2971  C CB    . ARG C 3 45  ? 220.123 104.985 128.499 1.00 70.24  ? 45  ARG C CB    1 
ATOM 2972  C CG    . ARG C 3 45  ? 221.215 104.927 127.443 1.00 70.24  ? 45  ARG C CG    1 
ATOM 2973  C CD    . ARG C 3 45  ? 221.840 103.545 127.407 1.00 70.24  ? 45  ARG C CD    1 
ATOM 2974  N NE    . ARG C 3 45  ? 222.879 103.418 126.390 1.00 70.24  ? 45  ARG C NE    1 
ATOM 2975  C CZ    . ARG C 3 45  ? 222.648 103.106 125.120 1.00 70.24  ? 45  ARG C CZ    1 
ATOM 2976  N NH1   . ARG C 3 45  ? 223.659 103.011 124.268 1.00 70.24  ? 45  ARG C NH1   1 
ATOM 2977  N NH2   . ARG C 3 45  ? 221.409 102.894 124.703 1.00 70.24  ? 45  ARG C NH2   1 
ATOM 2978  N N     . ASP C 3 46  ? 217.775 106.028 126.851 1.00 67.69  ? 46  ASP C N     1 
ATOM 2979  C CA    . ASP C 3 46  ? 217.170 106.314 125.555 1.00 67.69  ? 46  ASP C CA    1 
ATOM 2980  C C     . ASP C 3 46  ? 216.687 107.756 125.478 1.00 67.69  ? 46  ASP C C     1 
ATOM 2981  O O     . ASP C 3 46  ? 216.785 108.397 124.427 1.00 67.69  ? 46  ASP C O     1 
ATOM 2982  C CB    . ASP C 3 46  ? 216.034 105.333 125.276 1.00 67.69  ? 46  ASP C CB    1 
ATOM 2983  C CG    . ASP C 3 46  ? 215.635 105.322 123.818 1.00 67.69  ? 46  ASP C CG    1 
ATOM 2984  O OD1   . ASP C 3 46  ? 216.410 105.840 122.990 1.00 67.69  ? 46  ASP C OD1   1 
ATOM 2985  O OD2   . ASP C 3 46  ? 214.569 104.772 123.484 1.00 67.69  ? 46  ASP C OD2   1 
ATOM 2986  N N     . VAL C 3 47  ? 216.139 108.280 126.572 1.00 68.96  ? 47  VAL C N     1 
ATOM 2987  C CA    . VAL C 3 47  ? 215.751 109.687 126.599 1.00 68.96  ? 47  VAL C CA    1 
ATOM 2988  C C     . VAL C 3 47  ? 216.978 110.568 126.446 1.00 68.96  ? 47  VAL C C     1 
ATOM 2989  O O     . VAL C 3 47  ? 217.013 111.485 125.618 1.00 68.96  ? 47  VAL C O     1 
ATOM 2990  C CB    . VAL C 3 47  ? 214.982 110.018 127.889 1.00 68.96  ? 47  VAL C CB    1 
ATOM 2991  C CG1   . VAL C 3 47  ? 215.014 111.490 128.140 1.00 68.96  ? 47  VAL C CG1   1 
ATOM 2992  C CG2   . VAL C 3 47  ? 213.554 109.585 127.757 1.00 68.96  ? 47  VAL C CG2   1 
ATOM 2993  N N     . LEU C 3 48  ? 218.012 110.289 127.232 1.00 69.67  ? 48  LEU C N     1 
ATOM 2994  C CA    . LEU C 3 48  ? 219.174 111.162 127.253 1.00 69.67  ? 48  LEU C CA    1 
ATOM 2995  C C     . LEU C 3 48  ? 219.898 111.144 125.909 1.00 69.67  ? 48  LEU C C     1 
ATOM 2996  O O     . LEU C 3 48  ? 220.593 112.108 125.564 1.00 69.67  ? 48  LEU C O     1 
ATOM 2997  C CB    . LEU C 3 48  ? 220.086 110.755 128.410 1.00 69.67  ? 48  LEU C CB    1 
ATOM 2998  C CG    . LEU C 3 48  ? 221.218 111.712 128.756 1.00 69.67  ? 48  LEU C CG    1 
ATOM 2999  C CD1   . LEU C 3 48  ? 220.610 113.038 129.123 1.00 69.67  ? 48  LEU C CD1   1 
ATOM 3000  C CD2   . LEU C 3 48  ? 221.996 111.164 129.929 1.00 69.67  ? 48  LEU C CD2   1 
ATOM 3001  N N     . ILE C 3 49  ? 219.746 110.064 125.142 1.00 73.29  ? 49  ILE C N     1 
ATOM 3002  C CA    . ILE C 3 49  ? 220.442 109.926 123.865 1.00 73.29  ? 49  ILE C CA    1 
ATOM 3003  C C     . ILE C 3 49  ? 219.672 110.657 122.766 1.00 73.29  ? 49  ILE C C     1 
ATOM 3004  O O     . ILE C 3 49  ? 220.258 111.389 121.961 1.00 73.29  ? 49  ILE C O     1 
ATOM 3005  C CB    . ILE C 3 49  ? 220.716 108.449 123.505 1.00 73.29  ? 49  ILE C CB    1 
ATOM 3006  C CG1   . ILE C 3 49  ? 221.652 108.371 122.299 1.00 73.29  ? 49  ILE C CG1   1 
ATOM 3007  C CG2   . ILE C 3 49  ? 219.462 107.695 123.178 1.00 73.29  ? 49  ILE C CG2   1 
ATOM 3008  C CD1   . ILE C 3 49  ? 221.870 106.951 121.801 1.00 73.29  ? 49  ILE C CD1   1 
ATOM 3009  N N     . ARG C 3 50  ? 218.346 110.472 122.705 1.00 69.51  ? 50  ARG C N     1 
ATOM 3010  C CA    . ARG C 3 50  ? 217.519 111.086 121.673 1.00 69.51  ? 50  ARG C CA    1 
ATOM 3011  C C     . ARG C 3 50  ? 216.997 112.452 122.069 1.00 69.51  ? 50  ARG C C     1 
ATOM 3012  O O     . ARG C 3 50  ? 215.938 112.862 121.580 1.00 69.51  ? 50  ARG C O     1 
ATOM 3013  C CB    . ARG C 3 50  ? 216.304 110.215 121.363 1.00 69.51  ? 50  ARG C CB    1 
ATOM 3014  C CG    . ARG C 3 50  ? 216.499 108.899 120.686 1.00 69.51  ? 50  ARG C CG    1 
ATOM 3015  C CD    . ARG C 3 50  ? 215.146 108.238 120.764 1.00 69.51  ? 50  ARG C CD    1 
ATOM 3016  N NE    . ARG C 3 50  ? 214.237 108.916 119.845 1.00 69.51  ? 50  ARG C NE    1 
ATOM 3017  C CZ    . ARG C 3 50  ? 212.995 108.531 119.583 1.00 69.51  ? 50  ARG C CZ    1 
ATOM 3018  N NH1   . ARG C 3 50  ? 212.482 107.462 120.174 1.00 69.51  ? 50  ARG C NH1   1 
ATOM 3019  N NH2   . ARG C 3 50  ? 212.258 109.227 118.730 1.00 69.51  ? 50  ARG C NH2   1 
ATOM 3020  N N     . SER C 3 51  ? 217.695 113.158 122.958 1.00 71.26  ? 51  SER C N     1 
ATOM 3021  C CA    . SER C 3 51  ? 217.209 114.445 123.440 1.00 71.26  ? 51  SER C CA    1 
ATOM 3022  C C     . SER C 3 51  ? 216.866 115.401 122.302 1.00 71.26  ? 51  SER C C     1 
ATOM 3023  O O     . SER C 3 51  ? 215.870 116.125 122.373 1.00 71.26  ? 51  SER C O     1 
ATOM 3024  C CB    . SER C 3 51  ? 218.243 115.065 124.370 1.00 71.26  ? 51  SER C CB    1 
ATOM 3025  O OG    . SER C 3 51  ? 219.414 115.375 123.654 1.00 71.26  ? 51  SER C OG    1 
ATOM 3026  N N     . HIS C 3 52  ? 217.680 115.431 121.247 1.00 73.66  ? 52  HIS C N     1 
ATOM 3027  C CA    . HIS C 3 52  ? 217.424 116.389 120.176 1.00 73.66  ? 52  HIS C CA    1 
ATOM 3028  C C     . HIS C 3 52  ? 216.145 116.093 119.407 1.00 73.66  ? 52  HIS C C     1 
ATOM 3029  O O     . HIS C 3 52  ? 215.606 116.996 118.760 1.00 73.66  ? 52  HIS C O     1 
ATOM 3030  C CB    . HIS C 3 52  ? 218.589 116.379 119.196 1.00 73.66  ? 52  HIS C CB    1 
ATOM 3031  C CG    . HIS C 3 52  ? 218.754 115.071 118.488 1.00 73.66  ? 52  HIS C CG    1 
ATOM 3032  N ND1   . HIS C 3 52  ? 219.308 113.963 119.090 1.00 73.66  ? 52  HIS C ND1   1 
ATOM 3033  C CD2   . HIS C 3 52  ? 218.446 114.697 117.224 1.00 73.66  ? 52  HIS C CD2   1 
ATOM 3034  C CE1   . HIS C 3 52  ? 219.328 112.961 118.231 1.00 73.66  ? 52  HIS C CE1   1 
ATOM 3035  N NE2   . HIS C 3 52  ? 218.812 113.380 117.090 1.00 73.66  ? 52  HIS C NE2   1 
ATOM 3036  N N     . GLU C 3 53  ? 215.649 114.860 119.460 1.00 75.92  ? 53  GLU C N     1 
ATOM 3037  C CA    . GLU C 3 53  ? 214.459 114.493 118.704 1.00 75.92  ? 53  GLU C CA    1 
ATOM 3038  C C     . GLU C 3 53  ? 213.174 114.685 119.484 1.00 75.92  ? 53  GLU C C     1 
ATOM 3039  O O     . GLU C 3 53  ? 212.118 114.901 118.880 1.00 75.92  ? 53  GLU C O     1 
ATOM 3040  C CB    . GLU C 3 53  ? 214.550 113.040 118.245 1.00 75.92  ? 53  GLU C CB    1 
ATOM 3041  C CG    . GLU C 3 53  ? 215.678 112.790 117.284 1.00 75.92  ? 53  GLU C CG    1 
ATOM 3042  C CD    . GLU C 3 53  ? 215.777 111.344 116.875 1.00 75.92  ? 53  GLU C CD    1 
ATOM 3043  O OE1   . GLU C 3 53  ? 214.986 110.527 117.390 1.00 75.92  ? 53  GLU C OE1   1 
ATOM 3044  O OE2   . GLU C 3 53  ? 216.651 111.023 116.043 1.00 75.92  ? 53  GLU C OE2   1 
ATOM 3045  N N     . LEU C 3 54  ? 213.240 114.623 120.805 1.00 69.05  ? 54  LEU C N     1 
ATOM 3046  C CA    . LEU C 3 54  ? 212.075 114.753 121.659 1.00 69.05  ? 54  LEU C CA    1 
ATOM 3047  C C     . LEU C 3 54  ? 211.916 116.180 122.159 1.00 69.05  ? 54  LEU C C     1 
ATOM 3048  O O     . LEU C 3 54  ? 212.894 116.895 122.371 1.00 69.05  ? 54  LEU C O     1 
ATOM 3049  C CB    . LEU C 3 54  ? 212.195 113.804 122.847 1.00 69.05  ? 54  LEU C CB    1 
ATOM 3050  C CG    . LEU C 3 54  ? 212.183 112.319 122.509 1.00 69.05  ? 54  LEU C CG    1 
ATOM 3051  C CD1   . LEU C 3 54  ? 212.339 111.505 123.768 1.00 69.05  ? 54  LEU C CD1   1 
ATOM 3052  C CD2   . LEU C 3 54  ? 210.919 111.944 121.782 1.00 69.05  ? 54  LEU C CD2   1 
ATOM 3053  N N     . SER C 3 55  ? 210.662 116.606 122.305 1.00 69.55  ? 55  SER C N     1 
ATOM 3054  C CA    . SER C 3 55  ? 210.430 117.962 122.772 1.00 69.55  ? 55  SER C CA    1 
ATOM 3055  C C     . SER C 3 55  ? 210.503 118.032 124.285 1.00 69.55  ? 55  SER C C     1 
ATOM 3056  O O     . SER C 3 55  ? 211.023 119.009 124.836 1.00 69.55  ? 55  SER C O     1 
ATOM 3057  C CB    . SER C 3 55  ? 209.071 118.456 122.292 1.00 69.55  ? 55  SER C CB    1 
ATOM 3058  O OG    . SER C 3 55  ? 208.029 117.699 122.879 1.00 69.55  ? 55  SER C OG    1 
ATOM 3059  N N     . ASP C 3 56  ? 209.968 117.021 124.970 1.00 59.46  ? 56  ASP C N     1 
ATOM 3060  C CA    . ASP C 3 56  ? 210.011 117.029 126.422 1.00 59.46  ? 56  ASP C CA    1 
ATOM 3061  C C     . ASP C 3 56  ? 209.700 115.633 126.951 1.00 59.46  ? 56  ASP C C     1 
ATOM 3062  O O     . ASP C 3 56  ? 209.012 114.841 126.301 1.00 59.46  ? 56  ASP C O     1 
ATOM 3063  C CB    . ASP C 3 56  ? 209.044 118.065 126.987 1.00 59.46  ? 56  ASP C CB    1 
ATOM 3064  C CG    . ASP C 3 56  ? 209.299 118.350 128.441 1.00 59.46  ? 56  ASP C CG    1 
ATOM 3065  O OD1   . ASP C 3 56  ? 210.417 118.047 128.907 1.00 59.46  ? 56  ASP C OD1   1 
ATOM 3066  O OD2   . ASP C 3 56  ? 208.392 118.877 129.117 1.00 59.46  ? 56  ASP C OD2   1 
ATOM 3067  N N     . VAL C 3 57  ? 210.181 115.365 128.167 1.00 58.65  ? 57  VAL C N     1 
ATOM 3068  C CA    . VAL C 3 57  ? 209.866 114.151 128.918 1.00 58.65  ? 57  VAL C CA    1 
ATOM 3069  C C     . VAL C 3 57  ? 209.367 114.562 130.294 1.00 58.65  ? 57  VAL C C     1 
ATOM 3070  O O     . VAL C 3 57  ? 209.976 115.414 130.951 1.00 58.65  ? 57  VAL C O     1 
ATOM 3071  C CB    . VAL C 3 57  ? 211.070 113.194 129.035 1.00 58.65  ? 57  VAL C CB    1 
ATOM 3072  C CG1   . VAL C 3 57  ? 211.562 112.811 127.664 1.00 58.65  ? 57  VAL C CG1   1 
ATOM 3073  C CG2   . VAL C 3 57  ? 212.203 113.820 129.830 1.00 58.65  ? 57  VAL C CG2   1 
ATOM 3074  N N     . GLU C 3 58  ? 208.232 114.007 130.708 1.00 52.19  ? 58  GLU C N     1 
ATOM 3075  C CA    . GLU C 3 58  ? 207.602 114.413 131.946 1.00 52.19  ? 58  GLU C CA    1 
ATOM 3076  C C     . GLU C 3 58  ? 207.140 113.223 132.773 1.00 52.19  ? 58  GLU C C     1 
ATOM 3077  O O     . GLU C 3 58  ? 207.060 112.080 132.302 1.00 52.19  ? 58  GLU C O     1 
ATOM 3078  C CB    . GLU C 3 58  ? 206.441 115.364 131.686 1.00 52.19  ? 58  GLU C CB    1 
ATOM 3079  C CG    . GLU C 3 58  ? 206.968 116.652 131.139 1.00 52.19  ? 58  GLU C CG    1 
ATOM 3080  C CD    . GLU C 3 58  ? 207.972 117.272 132.081 1.00 52.19  ? 58  GLU C CD    1 
ATOM 3081  O OE1   . GLU C 3 58  ? 207.841 117.098 133.311 1.00 52.19  ? 58  GLU C OE1   1 
ATOM 3082  O OE2   . GLU C 3 58  ? 208.919 117.920 131.592 1.00 52.19  ? 58  GLU C OE2   1 
ATOM 3083  N N     . ILE C 3 59  ? 206.870 113.541 134.037 1.00 45.65  ? 59  ILE C N     1 
ATOM 3084  C CA    . ILE C 3 59  ? 206.294 112.674 135.060 1.00 45.65  ? 59  ILE C CA    1 
ATOM 3085  C C     . ILE C 3 59  ? 205.194 113.446 135.784 1.00 45.65  ? 59  ILE C C     1 
ATOM 3086  O O     . ILE C 3 59  ? 205.346 114.646 136.059 1.00 45.65  ? 59  ILE C O     1 
ATOM 3087  C CB    . ILE C 3 59  ? 207.367 112.150 136.022 1.00 45.65  ? 59  ILE C CB    1 
ATOM 3088  C CG1   . ILE C 3 59  ? 207.920 113.271 136.887 1.00 45.65  ? 59  ILE C CG1   1 
ATOM 3089  C CG2   . ILE C 3 59  ? 208.495 111.493 135.254 1.00 45.65  ? 59  ILE C CG2   1 
ATOM 3090  C CD1   . ILE C 3 59  ? 208.977 112.792 137.795 1.00 45.65  ? 59  ILE C CD1   1 
ATOM 3091  N N     . PRO C 3 60  ? 204.056 112.807 136.055 1.00 43.76  ? 60  PRO C N     1 
ATOM 3092  C CA    . PRO C 3 60  ? 202.928 113.480 136.730 1.00 43.76  ? 60  PRO C CA    1 
ATOM 3093  C C     . PRO C 3 60  ? 203.194 114.212 138.048 1.00 43.76  ? 60  PRO C C     1 
ATOM 3094  O O     . PRO C 3 60  ? 202.433 115.134 138.356 1.00 43.76  ? 60  PRO C O     1 
ATOM 3095  C CB    . PRO C 3 60  ? 201.955 112.320 136.967 1.00 43.76  ? 60  PRO C CB    1 
ATOM 3096  C CG    . PRO C 3 60  ? 202.222 111.378 135.857 1.00 43.76  ? 60  PRO C CG    1 
ATOM 3097  C CD    . PRO C 3 60  ? 203.706 111.441 135.626 1.00 43.76  ? 60  PRO C CD    1 
ATOM 3098  N N     . LEU C 3 61  ? 204.200 113.869 138.840 1.00 42.87  ? 61  LEU C N     1 
ATOM 3099  C CA    . LEU C 3 61  ? 204.375 114.570 140.111 1.00 42.87  ? 61  LEU C CA    1 
ATOM 3100  C C     . LEU C 3 61  ? 205.382 115.699 139.991 1.00 42.87  ? 61  LEU C C     1 
ATOM 3101  O O     . LEU C 3 61  ? 206.565 115.444 139.717 1.00 42.87  ? 61  LEU C O     1 
ATOM 3102  C CB    . LEU C 3 61  ? 204.815 113.590 141.188 1.00 42.87  ? 61  LEU C CB    1 
ATOM 3103  C CG    . LEU C 3 61  ? 203.718 112.720 141.808 1.00 42.87  ? 61  LEU C CG    1 
ATOM 3104  C CD1   . LEU C 3 61  ? 203.221 111.652 140.857 1.00 42.87  ? 61  LEU C CD1   1 
ATOM 3105  C CD2   . LEU C 3 61  ? 204.222 112.083 143.080 1.00 42.87  ? 61  LEU C CD2   1 
ATOM 3106  N N     . PRO C 3 62  ? 204.955 116.943 140.184 1.00 38.75  ? 62  PRO C N     1 
ATOM 3107  C CA    . PRO C 3 62  ? 205.879 118.089 140.184 1.00 38.75  ? 62  PRO C CA    1 
ATOM 3108  C C     . PRO C 3 62  ? 207.044 117.954 141.150 1.00 38.75  ? 62  PRO C C     1 
ATOM 3109  O O     . PRO C 3 62  ? 208.104 118.529 140.874 1.00 38.75  ? 62  PRO C O     1 
ATOM 3110  C CB    . PRO C 3 62  ? 204.984 119.277 140.554 1.00 38.75  ? 62  PRO C CB    1 
ATOM 3111  C CG    . PRO C 3 62  ? 203.714 118.714 140.913 1.00 38.75  ? 62  PRO C CG    1 
ATOM 3112  C CD    . PRO C 3 62  ? 203.565 117.387 140.266 1.00 38.75  ? 62  PRO C CD    1 
ATOM 3113  N N     . PRO C 3 63  ? 206.899 117.336 142.328 1.00 40.48  ? 63  PRO C N     1 
ATOM 3114  C CA    . PRO C 3 63  ? 208.122 117.108 143.121 1.00 40.48  ? 63  PRO C CA    1 
ATOM 3115  C C     . PRO C 3 63  ? 209.076 116.162 142.416 1.00 40.48  ? 63  PRO C C     1 
ATOM 3116  O O     . PRO C 3 63  ? 210.280 116.451 142.277 1.00 40.48  ? 63  PRO C O     1 
ATOM 3117  C CB    . PRO C 3 63  ? 207.587 116.523 144.431 1.00 40.48  ? 63  PRO C CB    1 
ATOM 3118  C CG    . PRO C 3 63  ? 206.252 116.010 144.111 1.00 40.48  ? 63  PRO C CG    1 
ATOM 3119  C CD    . PRO C 3 63  ? 205.703 116.944 143.090 1.00 40.48  ? 63  PRO C CD    1 
ATOM 3120  N N     . GLY C 3 64  ? 208.534 115.050 141.909 1.00 39.59  ? 64  GLY C N     1 
ATOM 3121  C CA    . GLY C 3 64  ? 209.343 114.097 141.178 1.00 39.59  ? 64  GLY C CA    1 
ATOM 3122  C C     . GLY C 3 64  ? 210.101 114.762 140.057 1.00 39.59  ? 64  GLY C C     1 
ATOM 3123  O O     . GLY C 3 64  ? 211.279 114.487 139.838 1.00 39.59  ? 64  GLY C O     1 
ATOM 3124  N N     . ALA C 3 65  ? 209.433 115.648 139.330 1.00 36.86  ? 65  ALA C N     1 
ATOM 3125  C CA    . ALA C 3 65  ? 210.109 116.375 138.270 1.00 36.86  ? 65  ALA C CA    1 
ATOM 3126  C C     . ALA C 3 65  ? 211.095 117.378 138.847 1.00 36.86  ? 65  ALA C C     1 
ATOM 3127  O O     . ALA C 3 65  ? 212.174 117.590 138.285 1.00 36.86  ? 65  ALA C O     1 
ATOM 3128  C CB    . ALA C 3 65  ? 209.085 117.070 137.381 1.00 36.86  ? 65  ALA C CB    1 
ATOM 3129  N N     . ALA C 3 66  ? 210.749 117.999 139.975 1.00 37.73  ? 66  ALA C N     1 
ATOM 3130  C CA    . ALA C 3 66  ? 211.619 119.009 140.563 1.00 37.73  ? 66  ALA C CA    1 
ATOM 3131  C C     . ALA C 3 66  ? 212.976 118.433 140.916 1.00 37.73  ? 66  ALA C C     1 
ATOM 3132  O O     . ALA C 3 66  ? 213.978 119.156 140.886 1.00 37.73  ? 66  ALA C O     1 
ATOM 3133  C CB    . ALA C 3 66  ? 210.960 119.622 141.795 1.00 37.73  ? 66  ALA C CB    1 
ATOM 3134  N N     . VAL C 3 67  ? 213.034 117.153 141.272 1.00 40.25  ? 67  VAL C N     1 
ATOM 3135  C CA    . VAL C 3 67  ? 214.340 116.533 141.479 1.00 40.25  ? 67  VAL C CA    1 
ATOM 3136  C C     . VAL C 3 67  ? 214.845 115.906 140.179 1.00 40.25  ? 67  VAL C C     1 
ATOM 3137  O O     . VAL C 3 67  ? 216.058 115.857 139.946 1.00 40.25  ? 67  VAL C O     1 
ATOM 3138  C CB    . VAL C 3 67  ? 214.317 115.501 142.614 1.00 40.25  ? 67  VAL C CB    1 
ATOM 3139  C CG1   . VAL C 3 67  ? 213.973 116.171 143.933 1.00 40.25  ? 67  VAL C CG1   1 
ATOM 3140  C CG2   . VAL C 3 67  ? 213.366 114.397 142.294 1.00 40.25  ? 67  VAL C CG2   1 
ATOM 3141  N N     . LEU C 3 68  ? 213.932 115.443 139.324 1.00 39.69  ? 68  LEU C N     1 
ATOM 3142  C CA    . LEU C 3 68  ? 214.310 114.813 138.065 1.00 39.69  ? 68  LEU C CA    1 
ATOM 3143  C C     . LEU C 3 68  ? 215.181 115.743 137.242 1.00 39.69  ? 68  LEU C C     1 
ATOM 3144  O O     . LEU C 3 68  ? 216.227 115.338 136.727 1.00 39.69  ? 68  LEU C O     1 
ATOM 3145  C CB    . LEU C 3 68  ? 213.067 114.417 137.283 1.00 39.69  ? 68  LEU C CB    1 
ATOM 3146  C CG    . LEU C 3 68  ? 213.127 113.168 136.413 1.00 39.69  ? 68  LEU C CG    1 
ATOM 3147  C CD1   . LEU C 3 68  ? 213.491 113.565 135.006 1.00 39.69  ? 68  LEU C CD1   1 
ATOM 3148  C CD2   . LEU C 3 68  ? 214.152 112.204 136.940 1.00 39.69  ? 68  LEU C CD2   1 
ATOM 3149  N N     . TRP C 3 69  ? 214.762 116.998 137.103 1.00 43.84  ? 69  TRP C N     1 
ATOM 3150  C CA    . TRP C 3 69  ? 215.517 117.906 136.260 1.00 43.84  ? 69  TRP C CA    1 
ATOM 3151  C C     . TRP C 3 69  ? 216.876 118.183 136.873 1.00 43.84  ? 69  TRP C C     1 
ATOM 3152  O O     . TRP C 3 69  ? 217.845 118.465 136.155 1.00 43.84  ? 69  TRP C O     1 
ATOM 3153  C CB    . TRP C 3 69  ? 214.771 119.228 136.092 1.00 43.84  ? 69  TRP C CB    1 
ATOM 3154  C CG    . TRP C 3 69  ? 213.591 119.136 135.220 1.00 43.84  ? 69  TRP C CG    1 
ATOM 3155  C CD1   . TRP C 3 69  ? 212.298 119.170 135.613 1.00 43.84  ? 69  TRP C CD1   1 
ATOM 3156  C CD2   . TRP C 3 69  ? 213.578 118.940 133.805 1.00 43.84  ? 69  TRP C CD2   1 
ATOM 3157  N NE1   . TRP C 3 69  ? 211.470 119.041 134.532 1.00 43.84  ? 69  TRP C NE1   1 
ATOM 3158  C CE2   . TRP C 3 69  ? 212.233 118.891 133.407 1.00 43.84  ? 69  TRP C CE2   1 
ATOM 3159  C CE3   . TRP C 3 69  ? 214.570 118.813 132.836 1.00 43.84  ? 69  TRP C CE3   1 
ATOM 3160  C CZ2   . TRP C 3 69  ? 211.855 118.718 132.089 1.00 43.84  ? 69  TRP C CZ2   1 
ATOM 3161  C CZ3   . TRP C 3 69  ? 214.192 118.642 131.530 1.00 43.84  ? 69  TRP C CZ3   1 
ATOM 3162  C CH2   . TRP C 3 69  ? 212.846 118.597 131.165 1.00 43.84  ? 69  TRP C CH2   1 
ATOM 3163  N N     . ARG C 3 70  ? 216.979 118.045 138.191 1.00 47.22  ? 70  ARG C N     1 
ATOM 3164  C CA    . ARG C 3 70  ? 218.269 118.138 138.856 1.00 47.22  ? 70  ARG C CA    1 
ATOM 3165  C C     . ARG C 3 70  ? 219.151 116.959 138.467 1.00 47.22  ? 70  ARG C C     1 
ATOM 3166  O O     . ARG C 3 70  ? 220.315 117.140 138.089 1.00 47.22  ? 70  ARG C O     1 
ATOM 3167  C CB    . ARG C 3 70  ? 218.055 118.185 140.364 1.00 47.22  ? 70  ARG C CB    1 
ATOM 3168  C CG    . ARG C 3 70  ? 217.227 119.374 140.817 1.00 47.22  ? 70  ARG C CG    1 
ATOM 3169  C CD    . ARG C 3 70  ? 216.969 119.335 142.308 1.00 47.22  ? 70  ARG C CD    1 
ATOM 3170  N NE    . ARG C 3 70  ? 216.185 120.475 142.767 1.00 47.22  ? 70  ARG C NE    1 
ATOM 3171  C CZ    . ARG C 3 70  ? 216.710 121.612 143.199 1.00 47.22  ? 70  ARG C CZ    1 
ATOM 3172  N NH1   . ARG C 3 70  ? 218.024 121.757 143.239 1.00 47.22  ? 70  ARG C NH1   1 
ATOM 3173  N NH2   . ARG C 3 70  ? 215.924 122.602 143.598 1.00 47.22  ? 70  ARG C NH2   1 
ATOM 3174  N N     . ILE C 3 71  ? 218.597 115.747 138.519 1.00 45.34  ? 71  ILE C N     1 
ATOM 3175  C CA    . ILE C 3 71  ? 219.360 114.558 138.152 1.00 45.34  ? 71  ILE C CA    1 
ATOM 3176  C C     . ILE C 3 71  ? 219.877 114.667 136.721 1.00 45.34  ? 71  ILE C C     1 
ATOM 3177  O O     . ILE C 3 71  ? 221.071 114.479 136.455 1.00 45.34  ? 71  ILE C O     1 
ATOM 3178  C CB    . ILE C 3 71  ? 218.506 113.291 138.333 1.00 45.34  ? 71  ILE C CB    1 
ATOM 3179  C CG1   . ILE C 3 71  ? 218.381 112.917 139.807 1.00 45.34  ? 71  ILE C CG1   1 
ATOM 3180  C CG2   . ILE C 3 71  ? 219.057 112.153 137.503 1.00 45.34  ? 71  ILE C CG2   1 
ATOM 3181  C CD1   . ILE C 3 71  ? 217.774 111.548 140.025 1.00 45.34  ? 71  ILE C CD1   1 
ATOM 3182  N N     . LEU C 3 72  ? 218.994 114.995 135.776 1.00 46.93  ? 72  LEU C N     1 
ATOM 3183  C CA    . LEU C 3 72  ? 219.439 115.096 134.387 1.00 46.93  ? 72  LEU C CA    1 
ATOM 3184  C C     . LEU C 3 72  ? 220.460 116.209 134.198 1.00 46.93  ? 72  LEU C C     1 
ATOM 3185  O O     . LEU C 3 72  ? 221.460 116.041 133.484 1.00 46.93  ? 72  LEU C O     1 
ATOM 3186  C CB    . LEU C 3 72  ? 218.240 115.304 133.452 1.00 46.93  ? 72  LEU C CB    1 
ATOM 3187  C CG    . LEU C 3 72  ? 217.369 114.057 133.265 1.00 46.93  ? 72  LEU C CG    1 
ATOM 3188  C CD1   . LEU C 3 72  ? 216.315 114.297 132.195 1.00 46.93  ? 72  LEU C CD1   1 
ATOM 3189  C CD2   . LEU C 3 72  ? 218.227 112.851 132.936 1.00 46.93  ? 72  LEU C CD2   1 
ATOM 3190  N N     . ALA C 3 73  ? 220.254 117.344 134.855 1.00 51.35  ? 73  ALA C N     1 
ATOM 3191  C CA    . ALA C 3 73  ? 221.247 118.416 134.742 1.00 51.35  ? 73  ALA C CA    1 
ATOM 3192  C C     . ALA C 3 73  ? 222.632 117.997 135.257 1.00 51.35  ? 73  ALA C C     1 
ATOM 3193  O O     . ALA C 3 73  ? 223.666 118.246 134.614 1.00 51.35  ? 73  ALA C O     1 
ATOM 3194  C CB    . ALA C 3 73  ? 220.762 119.659 135.473 1.00 51.35  ? 73  ALA C CB    1 
ATOM 3195  N N     . LEU C 3 74  ? 222.673 117.335 136.407 1.00 57.57  ? 74  LEU C N     1 
ATOM 3196  C CA    . LEU C 3 74  ? 223.942 116.861 136.966 1.00 57.57  ? 74  LEU C CA    1 
ATOM 3197  C C     . LEU C 3 74  ? 224.607 115.828 136.070 1.00 57.57  ? 74  LEU C C     1 
ATOM 3198  O O     . LEU C 3 74  ? 225.809 115.890 135.803 1.00 57.57  ? 74  LEU C O     1 
ATOM 3199  C CB    . LEU C 3 74  ? 223.714 116.308 138.380 1.00 57.57  ? 74  LEU C CB    1 
ATOM 3200  C CG    . LEU C 3 74  ? 224.855 115.479 138.997 1.00 57.57  ? 74  LEU C CG    1 
ATOM 3201  C CD1   . LEU C 3 74  ? 225.009 115.606 140.472 1.00 57.57  ? 74  LEU C CD1   1 
ATOM 3202  C CD2   . LEU C 3 74  ? 224.405 114.101 138.757 1.00 57.57  ? 74  LEU C CD2   1 
ATOM 3203  N N     . ILE C 3 75  ? 223.832 114.862 135.599 1.00 57.19  ? 75  ILE C N     1 
ATOM 3204  C CA    . ILE C 3 75  ? 224.401 113.818 134.760 1.00 57.19  ? 75  ILE C CA    1 
ATOM 3205  C C     . ILE C 3 75  ? 225.011 114.425 133.509 1.00 57.19  ? 75  ILE C C     1 
ATOM 3206  O O     . ILE C 3 75  ? 226.196 114.220 133.207 1.00 57.19  ? 75  ILE C O     1 
ATOM 3207  C CB    . ILE C 3 75  ? 223.339 112.772 134.391 1.00 57.19  ? 75  ILE C CB    1 
ATOM 3208  C CG1   . ILE C 3 75  ? 222.851 112.032 135.620 1.00 57.19  ? 75  ILE C CG1   1 
ATOM 3209  C CG2   . ILE C 3 75  ? 223.883 111.838 133.369 1.00 57.19  ? 75  ILE C CG2   1 
ATOM 3210  C CD1   . ILE C 3 75  ? 221.792 111.049 135.299 1.00 57.19  ? 75  ILE C CD1   1 
ATOM 3211  N N     . THR C 3 76  ? 224.237 115.229 132.789 1.00 57.93  ? 76  THR C N     1 
ATOM 3212  C CA    . THR C 3 76  ? 224.823 115.796 131.588 1.00 57.93  ? 76  THR C CA    1 
ATOM 3213  C C     . THR C 3 76  ? 225.918 116.810 131.878 1.00 57.93  ? 76  THR C C     1 
ATOM 3214  O O     . THR C 3 76  ? 226.708 117.106 130.976 1.00 57.93  ? 76  THR C O     1 
ATOM 3215  C CB    . THR C 3 76  ? 223.748 116.472 130.763 1.00 57.93  ? 76  THR C CB    1 
ATOM 3216  O OG1   . THR C 3 76  ? 223.267 117.617 131.478 1.00 57.93  ? 76  THR C OG1   1 
ATOM 3217  C CG2   . THR C 3 76  ? 222.611 115.518 130.541 1.00 57.93  ? 76  THR C CG2   1 
ATOM 3218  N N     . ALA C 3 77  ? 226.026 117.311 133.109 1.00 62.46  ? 77  ALA C N     1 
ATOM 3219  C CA    . ALA C 3 77  ? 227.151 118.180 133.431 1.00 62.46  ? 77  ALA C CA    1 
ATOM 3220  C C     . ALA C 3 77  ? 228.410 117.367 133.700 1.00 62.46  ? 77  ALA C C     1 
ATOM 3221  O O     . ALA C 3 77  ? 229.514 117.766 133.313 1.00 62.46  ? 77  ALA C O     1 
ATOM 3222  C CB    . ALA C 3 77  ? 226.816 119.058 134.635 1.00 62.46  ? 77  ALA C CB    1 
ATOM 3223  N N     . ARG C 3 78  ? 228.263 116.251 134.408 1.00 64.99  ? 78  ARG C N     1 
ATOM 3224  C CA    . ARG C 3 78  ? 229.378 115.343 134.639 1.00 64.99  ? 78  ARG C CA    1 
ATOM 3225  C C     . ARG C 3 78  ? 229.898 114.766 133.331 1.00 64.99  ? 78  ARG C C     1 
ATOM 3226  O O     . ARG C 3 78  ? 231.106 114.552 133.180 1.00 64.99  ? 78  ARG C O     1 
ATOM 3227  C CB    . ARG C 3 78  ? 228.992 114.246 135.629 1.00 64.99  ? 78  ARG C CB    1 
ATOM 3228  C CG    . ARG C 3 78  ? 228.733 114.772 137.033 1.00 64.99  ? 78  ARG C CG    1 
ATOM 3229  C CD    . ARG C 3 78  ? 229.923 115.577 137.521 1.00 64.99  ? 78  ARG C CD    1 
ATOM 3230  N NE    . ARG C 3 78  ? 231.091 114.758 137.803 1.00 64.99  ? 78  ARG C NE    1 
ATOM 3231  C CZ    . ARG C 3 78  ? 231.279 114.082 138.928 1.00 64.99  ? 78  ARG C CZ    1 
ATOM 3232  N NH1   . ARG C 3 78  ? 230.365 114.119 139.886 1.00 64.99  ? 78  ARG C NH1   1 
ATOM 3233  N NH2   . ARG C 3 78  ? 232.384 113.372 139.094 1.00 64.99  ? 78  ARG C NH2   1 
ATOM 3234  N N     . ILE C 3 79  ? 229.009 114.479 132.380 1.00 64.69  ? 79  ILE C N     1 
ATOM 3235  C CA    . ILE C 3 79  ? 229.494 113.976 131.100 1.00 64.69  ? 79  ILE C CA    1 
ATOM 3236  C C     . ILE C 3 79  ? 230.306 115.043 130.387 1.00 64.69  ? 79  ILE C C     1 
ATOM 3237  O O     . ILE C 3 79  ? 231.369 114.763 129.822 1.00 64.69  ? 79  ILE C O     1 
ATOM 3238  C CB    . ILE C 3 79  ? 228.322 113.541 130.207 1.00 64.69  ? 79  ILE C CB    1 
ATOM 3239  C CG1   . ILE C 3 79  ? 227.490 112.449 130.856 1.00 64.69  ? 79  ILE C CG1   1 
ATOM 3240  C CG2   . ILE C 3 79  ? 228.836 113.090 128.849 1.00 64.69  ? 79  ILE C CG2   1 
ATOM 3241  C CD1   . ILE C 3 79  ? 226.388 111.950 129.969 1.00 64.69  ? 79  ILE C CD1   1 
ATOM 3242  N N     . THR C 3 80  ? 229.827 116.279 130.410 1.00 62.89  ? 80  THR C N     1 
ATOM 3243  C CA    . THR C 3 80  ? 230.426 117.381 129.677 1.00 62.89  ? 80  THR C CA    1 
ATOM 3244  C C     . THR C 3 80  ? 230.360 118.632 130.532 1.00 62.89  ? 80  THR C C     1 
ATOM 3245  O O     . THR C 3 80  ? 229.277 119.006 130.987 1.00 62.89  ? 80  THR C O     1 
ATOM 3246  C CB    . THR C 3 80  ? 229.714 117.604 128.343 1.00 62.89  ? 80  THR C CB    1 
ATOM 3247  O OG1   . THR C 3 80  ? 228.299 117.611 128.557 1.00 62.89  ? 80  THR C OG1   1 
ATOM 3248  C CG2   . THR C 3 80  ? 230.066 116.504 127.364 1.00 62.89  ? 80  THR C CG2   1 
ATOM 3249  N N     . GLY C 3 81  ? 231.482 119.317 130.706 1.00 71.09  ? 81  GLY C N     1 
ATOM 3250  C CA    . GLY C 3 81  ? 231.329 120.578 131.392 1.00 71.09  ? 81  GLY C CA    1 
ATOM 3251  C C     . GLY C 3 81  ? 231.321 120.597 132.908 1.00 71.09  ? 81  GLY C C     1 
ATOM 3252  O O     . GLY C 3 81  ? 230.290 120.886 133.516 1.00 71.09  ? 81  GLY C O     1 
ATOM 3253  N N     . LEU C 3 82  ? 232.399 120.134 133.532 1.00 77.14  ? 82  LEU C N     1 
ATOM 3254  C CA    . LEU C 3 82  ? 232.503 120.155 134.985 1.00 77.14  ? 82  LEU C CA    1 
ATOM 3255  C C     . LEU C 3 82  ? 233.805 120.854 135.391 1.00 77.14  ? 82  LEU C C     1 
ATOM 3256  O O     . LEU C 3 82  ? 234.632 121.216 134.547 1.00 77.14  ? 82  LEU C O     1 
ATOM 3257  C CB    . LEU C 3 82  ? 232.406 118.733 135.552 1.00 77.14  ? 82  LEU C CB    1 
ATOM 3258  C CG    . LEU C 3 82  ? 233.348 117.673 134.969 1.00 77.14  ? 82  LEU C CG    1 
ATOM 3259  C CD1   . LEU C 3 82  ? 234.728 117.705 135.545 1.00 77.14  ? 82  LEU C CD1   1 
ATOM 3260  C CD2   . LEU C 3 82  ? 232.754 116.310 135.219 1.00 77.14  ? 82  LEU C CD2   1 
ATOM 3261  N N     . ASP C 3 83  ? 233.981 121.043 136.701 1.00 81.53  ? 83  ASP C N     1 
ATOM 3262  C CA    . ASP C 3 83  ? 235.156 121.693 137.282 1.00 81.53  ? 83  ASP C CA    1 
ATOM 3263  C C     . ASP C 3 83  ? 235.372 123.108 136.759 1.00 81.53  ? 83  ASP C C     1 
ATOM 3264  O O     . ASP C 3 83  ? 235.178 124.086 137.490 1.00 81.53  ? 83  ASP C O     1 
ATOM 3265  C CB    . ASP C 3 83  ? 236.438 120.879 137.083 1.00 81.53  ? 83  ASP C CB    1 
ATOM 3266  C CG    . ASP C 3 83  ? 236.413 119.560 137.820 1.00 81.53  ? 83  ASP C CG    1 
ATOM 3267  O OD1   . ASP C 3 83  ? 235.901 119.542 138.960 1.00 81.53  ? 83  ASP C OD1   1 
ATOM 3268  O OD2   . ASP C 3 83  ? 236.961 118.564 137.306 1.00 81.53  ? 83  ASP C OD2   1 
ATOM 3269  N N     . GLN C 3 84  ? 235.776 123.225 135.502 1.00 81.65  ? 84  GLN C N     1 
ATOM 3270  C CA    . GLN C 3 84  ? 235.976 124.533 134.894 1.00 81.65  ? 84  GLN C CA    1 
ATOM 3271  C C     . GLN C 3 84  ? 234.648 125.161 134.498 1.00 81.65  ? 84  GLN C C     1 
ATOM 3272  O O     . GLN C 3 84  ? 233.840 125.523 135.349 1.00 81.65  ? 84  GLN C O     1 
ATOM 3273  C CB    . GLN C 3 84  ? 236.898 124.423 133.679 1.00 81.65  ? 84  GLN C CB    1 
ATOM 3274  C CG    . GLN C 3 84  ? 236.336 123.586 132.549 1.00 81.65  ? 84  GLN C CG    1 
ATOM 3275  C CD    . GLN C 3 84  ? 237.159 123.698 131.283 1.00 81.65  ? 84  GLN C CD    1 
ATOM 3276  O OE1   . GLN C 3 84  ? 238.149 124.427 131.236 1.00 81.65  ? 84  GLN C OE1   1 
ATOM 3277  N NE2   . GLN C 3 84  ? 236.770 122.953 130.255 1.00 81.65  ? 84  GLN C NE2   1 
ATOM 3278  N N     . ASN C 3 89  ? 240.891 132.269 133.746 1.00 85.23  ? 89  ASN C N     1 
ATOM 3279  C CA    . ASN C 3 89  ? 239.535 132.799 133.667 1.00 85.23  ? 89  ASN C CA    1 
ATOM 3280  C C     . ASN C 3 89  ? 238.507 131.674 133.647 1.00 85.23  ? 89  ASN C C     1 
ATOM 3281  O O     . ASN C 3 89  ? 238.102 131.217 132.581 1.00 85.23  ? 89  ASN C O     1 
ATOM 3282  C CB    . ASN C 3 89  ? 239.384 133.678 132.441 1.00 85.23  ? 89  ASN C CB    1 
ATOM 3283  N N     . PRO C 3 90  ? 238.072 131.240 134.833 1.00 84.32  ? 90  PRO C N     1 
ATOM 3284  C CA    . PRO C 3 90  ? 237.112 130.128 134.886 1.00 84.32  ? 90  PRO C CA    1 
ATOM 3285  C C     . PRO C 3 90  ? 235.764 130.505 134.310 1.00 84.32  ? 90  PRO C C     1 
ATOM 3286  O O     . PRO C 3 90  ? 235.116 129.680 133.656 1.00 84.32  ? 90  PRO C O     1 
ATOM 3287  C CB    . PRO C 3 90  ? 237.032 129.809 136.385 1.00 84.32  ? 90  PRO C CB    1 
ATOM 3288  C CG    . PRO C 3 90  ? 237.416 131.082 137.055 1.00 84.32  ? 90  PRO C CG    1 
ATOM 3289  C CD    . PRO C 3 90  ? 238.447 131.716 136.173 1.00 84.32  ? 90  PRO C CD    1 
ATOM 3290  N N     . LYS C 3 91  ? 235.327 131.740 134.541 1.00 85.76  ? 91  LYS C N     1 
ATOM 3291  C CA    . LYS C 3 91  ? 234.010 132.183 134.100 1.00 85.76  ? 91  LYS C CA    1 
ATOM 3292  C C     . LYS C 3 91  ? 233.953 132.237 132.582 1.00 85.76  ? 91  LYS C C     1 
ATOM 3293  O O     . LYS C 3 91  ? 233.054 131.660 131.960 1.00 85.76  ? 91  LYS C O     1 
ATOM 3294  C CB    . LYS C 3 91  ? 233.715 133.550 134.705 1.00 85.76  ? 91  LYS C CB    1 
ATOM 3295  C CG    . LYS C 3 91  ? 233.444 133.490 136.187 1.00 85.76  ? 91  LYS C CG    1 
ATOM 3296  C CD    . LYS C 3 91  ? 232.981 134.825 136.699 1.00 85.76  ? 91  LYS C CD    1 
ATOM 3297  C CE    . LYS C 3 91  ? 234.124 135.821 136.605 1.00 85.76  ? 91  LYS C CE    1 
ATOM 3298  N NZ    . LYS C 3 91  ? 235.304 135.401 137.411 1.00 85.76  ? 91  LYS C NZ    1 
ATOM 3299  N N     . ARG C 3 92  ? 234.918 132.921 131.973 1.00 86.26  ? 92  ARG C N     1 
ATOM 3300  C CA    . ARG C 3 92  ? 234.954 133.051 130.524 1.00 86.26  ? 92  ARG C CA    1 
ATOM 3301  C C     . ARG C 3 92  ? 235.166 131.704 129.855 1.00 86.26  ? 92  ARG C C     1 
ATOM 3302  O O     . ARG C 3 92  ? 234.629 131.461 128.769 1.00 86.26  ? 92  ARG C O     1 
ATOM 3303  C CB    . ARG C 3 92  ? 236.042 134.037 130.107 1.00 86.26  ? 92  ARG C CB    1 
ATOM 3304  C CG    . ARG C 3 92  ? 236.095 134.298 128.610 1.00 86.26  ? 92  ARG C CG    1 
ATOM 3305  C CD    . ARG C 3 92  ? 235.008 135.255 128.150 1.00 86.26  ? 92  ARG C CD    1 
ATOM 3306  N NE    . ARG C 3 92  ? 233.716 134.588 127.996 1.00 86.26  ? 92  ARG C NE    1 
ATOM 3307  C CZ    . ARG C 3 92  ? 233.388 133.825 126.957 1.00 86.26  ? 92  ARG C CZ    1 
ATOM 3308  N NH1   . ARG C 3 92  ? 234.256 133.624 125.975 1.00 86.26  ? 92  ARG C NH1   1 
ATOM 3309  N NH2   . ARG C 3 92  ? 232.191 133.263 126.895 1.00 86.26  ? 92  ARG C NH2   1 
ATOM 3310  N N     . LYS C 3 93  ? 235.915 130.808 130.494 1.00 82.83  ? 93  LYS C N     1 
ATOM 3311  C CA    . LYS C 3 93  ? 236.119 129.489 129.912 1.00 82.83  ? 93  LYS C CA    1 
ATOM 3312  C C     . LYS C 3 93  ? 234.845 128.668 130.014 1.00 82.83  ? 93  LYS C C     1 
ATOM 3313  O O     . LYS C 3 93  ? 234.529 127.885 129.110 1.00 82.83  ? 93  LYS C O     1 
ATOM 3314  C CB    . LYS C 3 93  ? 237.269 128.781 130.628 1.00 82.83  ? 93  LYS C CB    1 
ATOM 3315  C CG    . LYS C 3 93  ? 237.719 127.472 130.006 1.00 82.83  ? 93  LYS C CG    1 
ATOM 3316  C CD    . LYS C 3 93  ? 238.207 127.673 128.582 1.00 82.83  ? 93  LYS C CD    1 
ATOM 3317  C CE    . LYS C 3 93  ? 238.670 126.360 127.970 1.00 82.83  ? 93  LYS C CE    1 
ATOM 3318  N NZ    . LYS C 3 93  ? 239.106 126.533 126.557 1.00 82.83  ? 93  LYS C NZ    1 
ATOM 3319  N N     . TRP C 3 94  ? 234.095 128.835 131.102 1.00 78.02  ? 94  TRP C N     1 
ATOM 3320  C CA    . TRP C 3 94  ? 232.811 128.157 131.187 1.00 78.02  ? 94  TRP C CA    1 
ATOM 3321  C C     . TRP C 3 94  ? 231.822 128.673 130.163 1.00 78.02  ? 94  TRP C C     1 
ATOM 3322  O O     . TRP C 3 94  ? 231.132 127.885 129.514 1.00 78.02  ? 94  TRP C O     1 
ATOM 3323  C CB    . TRP C 3 94  ? 232.212 128.335 132.576 1.00 78.02  ? 94  TRP C CB    1 
ATOM 3324  C CG    . TRP C 3 94  ? 230.958 127.552 132.752 1.00 78.02  ? 94  TRP C CG    1 
ATOM 3325  C CD1   . TRP C 3 94  ? 229.692 128.066 132.813 1.00 78.02  ? 94  TRP C CD1   1 
ATOM 3326  C CD2   . TRP C 3 94  ? 230.812 126.134 132.800 1.00 78.02  ? 94  TRP C CD2   1 
ATOM 3327  N NE1   . TRP C 3 94  ? 228.776 127.060 132.943 1.00 78.02  ? 94  TRP C NE1   1 
ATOM 3328  C CE2   . TRP C 3 94  ? 229.437 125.862 132.932 1.00 78.02  ? 94  TRP C CE2   1 
ATOM 3329  C CE3   . TRP C 3 94  ? 231.707 125.069 132.764 1.00 78.02  ? 94  TRP C CE3   1 
ATOM 3330  C CZ2   . TRP C 3 94  ? 228.944 124.578 133.024 1.00 78.02  ? 94  TRP C CZ2   1 
ATOM 3331  C CZ3   . TRP C 3 94  ? 231.212 123.801 132.856 1.00 78.02  ? 94  TRP C CZ3   1 
ATOM 3332  C CH2   . TRP C 3 94  ? 229.843 123.566 132.982 1.00 78.02  ? 94  TRP C CH2   1 
ATOM 3333  N N     . GLN C 3 95  ? 231.708 129.987 130.023 1.00 84.42  ? 95  GLN C N     1 
ATOM 3334  C CA    . GLN C 3 95  ? 230.785 130.509 129.033 1.00 84.42  ? 95  GLN C CA    1 
ATOM 3335  C C     . GLN C 3 95  ? 231.229 130.206 127.609 1.00 84.42  ? 95  GLN C C     1 
ATOM 3336  O O     . GLN C 3 95  ? 230.387 130.135 126.708 1.00 84.42  ? 95  GLN C O     1 
ATOM 3337  C CB    . GLN C 3 95  ? 230.621 132.000 129.288 1.00 84.42  ? 95  GLN C CB    1 
ATOM 3338  C CG    . GLN C 3 95  ? 230.015 132.249 130.660 1.00 84.42  ? 95  GLN C CG    1 
ATOM 3339  C CD    . GLN C 3 95  ? 229.865 133.710 130.991 1.00 84.42  ? 95  GLN C CD    1 
ATOM 3340  O OE1   . GLN C 3 95  ? 230.341 134.577 130.258 1.00 84.42  ? 95  GLN C OE1   1 
ATOM 3341  N NE2   . GLN C 3 95  ? 229.210 133.995 132.110 1.00 84.42  ? 95  GLN C NE2   1 
ATOM 3342  N N     . ALA C 3 96  ? 232.531 130.014 127.393 1.00 84.89  ? 96  ALA C N     1 
ATOM 3343  C CA    . ALA C 3 96  ? 233.034 129.651 126.071 1.00 84.89  ? 96  ALA C CA    1 
ATOM 3344  C C     . ALA C 3 96  ? 232.727 128.198 125.740 1.00 84.89  ? 96  ALA C C     1 
ATOM 3345  O O     . ALA C 3 96  ? 232.172 127.884 124.677 1.00 84.89  ? 96  ALA C O     1 
ATOM 3346  C CB    . ALA C 3 96  ? 234.540 129.904 126.002 1.00 84.89  ? 96  ALA C CB    1 
ATOM 3347  N N     . ARG C 3 97  ? 233.055 127.306 126.674 1.00 82.66  ? 97  ARG C N     1 
ATOM 3348  C CA    . ARG C 3 97  ? 232.779 125.887 126.511 1.00 82.66  ? 97  ARG C CA    1 
ATOM 3349  C C     . ARG C 3 97  ? 231.275 125.699 126.352 1.00 82.66  ? 97  ARG C C     1 
ATOM 3350  O O     . ARG C 3 97  ? 230.793 124.922 125.512 1.00 82.66  ? 97  ARG C O     1 
ATOM 3351  C CB    . ARG C 3 97  ? 233.223 125.204 127.808 1.00 82.66  ? 97  ARG C CB    1 
ATOM 3352  C CG    . ARG C 3 97  ? 233.166 123.709 127.943 1.00 82.66  ? 97  ARG C CG    1 
ATOM 3353  C CD    . ARG C 3 97  ? 234.124 123.111 126.943 1.00 82.66  ? 97  ARG C CD    1 
ATOM 3354  N NE    . ARG C 3 97  ? 233.811 123.105 125.535 1.00 82.66  ? 97  ARG C NE    1 
ATOM 3355  C CZ    . ARG C 3 97  ? 233.221 122.099 124.916 1.00 82.66  ? 97  ARG C CZ    1 
ATOM 3356  N NH1   . ARG C 3 97  ? 232.875 121.009 125.586 1.00 82.66  ? 97  ARG C NH1   1 
ATOM 3357  N NH2   . ARG C 3 97  ? 233.027 122.182 123.619 1.00 82.66  ? 97  ARG C NH2   1 
ATOM 3358  N N     . ARG C 3 98  ? 230.538 126.484 127.139 1.00 77.83  ? 98  ARG C N     1 
ATOM 3359  C CA    . ARG C 3 98  ? 229.091 126.605 127.109 1.00 77.83  ? 98  ARG C CA    1 
ATOM 3360  C C     . ARG C 3 98  ? 228.602 126.992 125.724 1.00 77.83  ? 98  ARG C C     1 
ATOM 3361  O O     . ARG C 3 98  ? 227.683 126.375 125.174 1.00 77.83  ? 98  ARG C O     1 
ATOM 3362  C CB    . ARG C 3 98  ? 228.726 127.675 128.145 1.00 77.83  ? 98  ARG C CB    1 
ATOM 3363  C CG    . ARG C 3 98  ? 227.288 128.119 128.410 1.00 77.83  ? 98  ARG C CG    1 
ATOM 3364  C CD    . ARG C 3 98  ? 226.468 127.108 129.192 1.00 77.83  ? 98  ARG C CD    1 
ATOM 3365  N NE    . ARG C 3 98  ? 225.151 127.645 129.519 1.00 77.83  ? 98  ARG C NE    1 
ATOM 3366  C CZ    . ARG C 3 98  ? 224.160 126.943 130.055 1.00 77.83  ? 98  ARG C CZ    1 
ATOM 3367  N NH1   . ARG C 3 98  ? 223.012 127.537 130.330 1.00 77.83  ? 98  ARG C NH1   1 
ATOM 3368  N NH2   . ARG C 3 98  ? 224.300 125.647 130.285 1.00 77.83  ? 98  ARG C NH2   1 
ATOM 3369  N N     . SER C 3 99  ? 229.236 128.002 125.131 1.00 81.21  ? 99  SER C N     1 
ATOM 3370  C CA    . SER C 3 99  ? 228.848 128.445 123.801 1.00 81.21  ? 99  SER C CA    1 
ATOM 3371  C C     . SER C 3 99  ? 229.098 127.376 122.750 1.00 81.21  ? 99  SER C C     1 
ATOM 3372  O O     . SER C 3 99  ? 228.303 127.223 121.813 1.00 81.21  ? 99  SER C O     1 
ATOM 3373  C CB    . SER C 3 99  ? 229.607 129.721 123.439 1.00 81.21  ? 99  SER C CB    1 
ATOM 3374  O OG    . SER C 3 99  ? 231.005 129.484 123.424 1.00 81.21  ? 99  SER C OG    1 
ATOM 3375  N N     . GLN C 3 100 ? 230.179 126.608 122.888 1.00 83.03  ? 100 GLN C N     1 
ATOM 3376  C CA    . GLN C 3 100 ? 230.404 125.546 121.916 1.00 83.03  ? 100 GLN C CA    1 
ATOM 3377  C C     . GLN C 3 100 ? 229.303 124.510 122.007 1.00 83.03  ? 100 GLN C C     1 
ATOM 3378  O O     . GLN C 3 100 ? 228.707 124.123 120.998 1.00 83.03  ? 100 GLN C O     1 
ATOM 3379  C CB    . GLN C 3 100 ? 231.730 124.823 122.135 1.00 83.03  ? 100 GLN C CB    1 
ATOM 3380  C CG    . GLN C 3 100 ? 232.099 123.900 120.945 1.00 83.03  ? 100 GLN C CG    1 
ATOM 3381  C CD    . GLN C 3 100 ? 231.289 122.604 120.819 1.00 83.03  ? 100 GLN C CD    1 
ATOM 3382  O OE1   . GLN C 3 100 ? 230.723 122.343 119.762 1.00 83.03  ? 100 GLN C OE1   1 
ATOM 3383  N NE2   . GLN C 3 100 ? 231.158 121.850 121.891 1.00 83.03  ? 100 GLN C NE2   1 
ATOM 3384  N N     . ILE C 3 101 ? 229.043 124.028 123.222 1.00 78.28  ? 101 ILE C N     1 
ATOM 3385  C CA    . ILE C 3 101 ? 228.043 122.982 123.390 1.00 78.28  ? 101 ILE C CA    1 
ATOM 3386  C C     . ILE C 3 101 ? 226.659 123.448 122.957 1.00 78.28  ? 101 ILE C C     1 
ATOM 3387  O O     . ILE C 3 101 ? 225.921 122.699 122.305 1.00 78.28  ? 101 ILE C O     1 
ATOM 3388  C CB    . ILE C 3 101 ? 228.058 122.508 124.851 1.00 78.28  ? 101 ILE C CB    1 
ATOM 3389  C CG1   . ILE C 3 101 ? 229.453 121.996 125.201 1.00 78.28  ? 101 ILE C CG1   1 
ATOM 3390  C CG2   . ILE C 3 101 ? 227.083 121.380 125.040 1.00 78.28  ? 101 ILE C CG2   1 
ATOM 3391  C CD1   . ILE C 3 101 ? 229.775 122.048 126.669 1.00 78.28  ? 101 ILE C CD1   1 
ATOM 3392  N N     . LEU C 3 102 ? 226.283 124.685 123.289 1.00 81.51  ? 102 LEU C N     1 
ATOM 3393  C CA    . LEU C 3 102 ? 224.989 125.190 122.827 1.00 81.51  ? 102 LEU C CA    1 
ATOM 3394  C C     . LEU C 3 102 ? 224.938 125.385 121.319 1.00 81.51  ? 102 LEU C C     1 
ATOM 3395  O O     . LEU C 3 102 ? 223.871 125.247 120.714 1.00 81.51  ? 102 LEU C O     1 
ATOM 3396  C CB    . LEU C 3 102 ? 224.643 126.508 123.512 1.00 81.51  ? 102 LEU C CB    1 
ATOM 3397  C CG    . LEU C 3 102 ? 224.131 126.452 124.944 1.00 81.51  ? 102 LEU C CG    1 
ATOM 3398  C CD1   . LEU C 3 102 ? 223.793 127.845 125.430 1.00 81.51  ? 102 LEU C CD1   1 
ATOM 3399  C CD2   . LEU C 3 102 ? 222.916 125.552 125.008 1.00 81.51  ? 102 LEU C CD2   1 
ATOM 3400  N N     . SER C 3 103 ? 226.072 125.686 120.695 1.00 81.12  ? 103 SER C N     1 
ATOM 3401  C CA    . SER C 3 103 ? 226.076 125.901 119.255 1.00 81.12  ? 103 SER C CA    1 
ATOM 3402  C C     . SER C 3 103 ? 226.081 124.597 118.482 1.00 81.12  ? 103 SER C C     1 
ATOM 3403  O O     . SER C 3 103 ? 225.532 124.525 117.378 1.00 81.12  ? 103 SER C O     1 
ATOM 3404  C CB    . SER C 3 103 ? 227.289 126.742 118.863 1.00 81.12  ? 103 SER C CB    1 
ATOM 3405  O OG    . SER C 3 103 ? 227.437 126.796 117.456 1.00 81.12  ? 103 SER C OG    1 
ATOM 3406  N N     . LYS C 3 104 ? 226.707 123.571 119.050 1.00 82.58  ? 104 LYS C N     1 
ATOM 3407  C CA    . LYS C 3 104 ? 226.798 122.267 118.410 1.00 82.58  ? 104 LYS C CA    1 
ATOM 3408  C C     . LYS C 3 104 ? 225.446 121.562 118.291 1.00 82.58  ? 104 LYS C C     1 
ATOM 3409  O O     . LYS C 3 104 ? 225.187 120.888 117.290 1.00 82.58  ? 104 LYS C O     1 
ATOM 3410  C CB    . LYS C 3 104 ? 227.815 121.471 119.210 1.00 82.58  ? 104 LYS C CB    1 
ATOM 3411  C CG    . LYS C 3 104 ? 228.114 120.088 118.809 1.00 82.58  ? 104 LYS C CG    1 
ATOM 3412  C CD    . LYS C 3 104 ? 227.287 119.295 119.768 1.00 82.58  ? 104 LYS C CD    1 
ATOM 3413  C CE    . LYS C 3 104 ? 227.594 119.694 121.227 1.00 82.58  ? 104 LYS C CE    1 
ATOM 3414  N NZ    . LYS C 3 104 ? 226.798 118.967 122.260 1.00 82.58  ? 104 LYS C NZ    1 
ATOM 3415  N N     . GLY C 3 105 ? 224.579 121.688 119.287 1.00 83.34  ? 105 GLY C N     1 
ATOM 3416  C CA    . GLY C 3 105 ? 223.242 121.136 119.184 1.00 83.34  ? 105 GLY C CA    1 
ATOM 3417  C C     . GLY C 3 105 ? 223.047 119.648 119.430 1.00 83.34  ? 105 GLY C C     1 
ATOM 3418  O O     . GLY C 3 105 ? 221.900 119.192 119.355 1.00 83.34  ? 105 GLY C O     1 
ATOM 3419  N N     . ARG C 3 106 ? 224.090 118.868 119.731 1.00 80.48  ? 106 ARG C N     1 
ATOM 3420  C CA    . ARG C 3 106 ? 223.872 117.434 119.919 1.00 80.48  ? 106 ARG C CA    1 
ATOM 3421  C C     . ARG C 3 106 ? 225.036 116.795 120.667 1.00 80.48  ? 106 ARG C C     1 
ATOM 3422  O O     . ARG C 3 106 ? 226.155 116.790 120.158 1.00 80.48  ? 106 ARG C O     1 
ATOM 3423  C CB    . ARG C 3 106 ? 223.698 116.786 118.537 1.00 80.48  ? 106 ARG C CB    1 
ATOM 3424  C CG    . ARG C 3 106 ? 223.552 115.282 118.491 1.00 80.48  ? 106 ARG C CG    1 
ATOM 3425  C CD    . ARG C 3 106 ? 222.204 114.783 118.953 1.00 80.48  ? 106 ARG C CD    1 
ATOM 3426  N NE    . ARG C 3 106 ? 221.938 115.054 120.359 1.00 80.48  ? 106 ARG C NE    1 
ATOM 3427  C CZ    . ARG C 3 106 ? 222.273 114.234 121.346 1.00 80.48  ? 106 ARG C CZ    1 
ATOM 3428  N NH1   . ARG C 3 106 ? 222.886 113.093 121.073 1.00 80.48  ? 106 ARG C NH1   1 
ATOM 3429  N NH2   . ARG C 3 106 ? 222.001 114.545 122.603 1.00 80.48  ? 106 ARG C NH2   1 
ATOM 3430  N N     . LEU C 3 107 ? 224.765 116.123 121.784 1.00 82.36  ? 107 LEU C N     1 
ATOM 3431  C CA    . LEU C 3 107 ? 225.809 115.335 122.441 1.00 82.36  ? 107 LEU C CA    1 
ATOM 3432  C C     . LEU C 3 107 ? 226.001 113.963 121.803 1.00 82.36  ? 107 LEU C C     1 
ATOM 3433  O O     . LEU C 3 107 ? 225.037 113.261 121.486 1.00 82.36  ? 107 LEU C O     1 
ATOM 3434  C CB    . LEU C 3 107 ? 225.567 115.178 123.943 1.00 82.36  ? 107 LEU C CB    1 
ATOM 3435  C CG    . LEU C 3 107 ? 226.211 116.235 124.854 1.00 82.36  ? 107 LEU C CG    1 
ATOM 3436  C CD1   . LEU C 3 107 ? 225.357 117.485 124.892 1.00 82.36  ? 107 LEU C CD1   1 
ATOM 3437  C CD2   . LEU C 3 107 ? 226.528 115.705 126.268 1.00 82.36  ? 107 LEU C CD2   1 
ATOM 3438  N N     . ASP C 3 108 ? 227.260 113.584 121.631 1.00 81.25  ? 108 ASP C N     1 
ATOM 3439  C CA    . ASP C 3 108 ? 227.600 112.294 121.041 1.00 81.25  ? 108 ASP C CA    1 
ATOM 3440  C C     . ASP C 3 108 ? 227.183 111.153 121.967 1.00 81.25  ? 108 ASP C C     1 
ATOM 3441  O O     . ASP C 3 108 ? 227.502 111.183 123.161 1.00 81.25  ? 108 ASP C O     1 
ATOM 3442  C CB    . ASP C 3 108 ? 229.106 112.229 120.760 1.00 81.25  ? 108 ASP C CB    1 
ATOM 3443  C CG    . ASP C 3 108 ? 229.948 112.502 122.006 1.00 81.25  ? 108 ASP C CG    1 
ATOM 3444  O OD1   . ASP C 3 108 ? 229.487 113.278 122.869 1.00 81.25  ? 108 ASP C OD1   1 
ATOM 3445  O OD2   . ASP C 3 108 ? 231.063 111.943 122.133 1.00 81.25  ? 108 ASP C OD2   1 
ATOM 3446  N N     . PRO C 3 109 ? 226.437 110.159 121.473 1.00 78.81  ? 109 PRO C N     1 
ATOM 3447  C CA    . PRO C 3 109 ? 226.004 109.056 122.355 1.00 78.81  ? 109 PRO C CA    1 
ATOM 3448  C C     . PRO C 3 109 ? 227.152 108.302 123.002 1.00 78.81  ? 109 PRO C C     1 
ATOM 3449  O O     . PRO C 3 109 ? 227.000 107.812 124.131 1.00 78.81  ? 109 PRO C O     1 
ATOM 3450  C CB    . PRO C 3 109 ? 225.179 108.160 121.424 1.00 78.81  ? 109 PRO C CB    1 
ATOM 3451  C CG    . PRO C 3 109 ? 224.743 109.058 120.332 1.00 78.81  ? 109 PRO C CG    1 
ATOM 3452  C CD    . PRO C 3 109 ? 225.859 110.034 120.124 1.00 78.81  ? 109 PRO C CD    1 
ATOM 3453  N N     . GLU C 3 110 ? 228.304 108.218 122.337 1.00 81.13  ? 110 GLU C N     1 
ATOM 3454  C CA    . GLU C 3 110 ? 229.429 107.471 122.891 1.00 81.13  ? 110 GLU C CA    1 
ATOM 3455  C C     . GLU C 3 110 ? 229.909 108.066 124.204 1.00 81.13  ? 110 GLU C C     1 
ATOM 3456  O O     . GLU C 3 110 ? 230.458 107.348 125.044 1.00 81.13  ? 110 GLU C O     1 
ATOM 3457  C CB    . GLU C 3 110 ? 230.573 107.416 121.881 1.00 81.13  ? 110 GLU C CB    1 
ATOM 3458  C CG    . GLU C 3 110 ? 230.241 106.588 120.661 1.00 81.13  ? 110 GLU C CG    1 
ATOM 3459  C CD    . GLU C 3 110 ? 229.442 107.362 119.638 1.00 81.13  ? 110 GLU C CD    1 
ATOM 3460  O OE1   . GLU C 3 110 ? 229.019 108.496 119.944 1.00 81.13  ? 110 GLU C OE1   1 
ATOM 3461  O OE2   . GLU C 3 110 ? 229.215 106.832 118.532 1.00 81.13  ? 110 GLU C OE2   1 
ATOM 3462  N N     . ALA C 3 111 ? 229.713 109.364 124.411 1.00 76.64  ? 111 ALA C N     1 
ATOM 3463  C CA    . ALA C 3 111 ? 230.125 109.941 125.678 1.00 76.64  ? 111 ALA C CA    1 
ATOM 3464  C C     . ALA C 3 111 ? 229.096 109.666 126.759 1.00 76.64  ? 111 ALA C C     1 
ATOM 3465  O O     . ALA C 3 111 ? 229.439 109.685 127.944 1.00 76.64  ? 111 ALA C O     1 
ATOM 3466  C CB    . ALA C 3 111 ? 230.350 111.446 125.544 1.00 76.64  ? 111 ALA C CB    1 
ATOM 3467  N N     . VAL C 3 112 ? 227.840 109.432 126.375 1.00 75.02  ? 112 VAL C N     1 
ATOM 3468  C CA    . VAL C 3 112 ? 226.836 109.001 127.342 1.00 75.02  ? 112 VAL C CA    1 
ATOM 3469  C C     . VAL C 3 112 ? 227.096 107.564 127.768 1.00 75.02  ? 112 VAL C C     1 
ATOM 3470  O O     . VAL C 3 112 ? 227.086 107.247 128.962 1.00 75.02  ? 112 VAL C O     1 
ATOM 3471  C CB    . VAL C 3 112 ? 225.420 109.169 126.769 1.00 75.02  ? 112 VAL C CB    1 
ATOM 3472  C CG1   . VAL C 3 112 ? 224.408 108.597 127.727 1.00 75.02  ? 112 VAL C CG1   1 
ATOM 3473  C CG2   . VAL C 3 112 ? 225.124 110.638 126.541 1.00 75.02  ? 112 VAL C CG2   1 
ATOM 3474  N N     . ASP C 3 113 ? 227.336 106.669 126.807 1.00 74.47  ? 113 ASP C N     1 
ATOM 3475  C CA    . ASP C 3 113 ? 227.672 105.308 127.205 1.00 74.47  ? 113 ASP C CA    1 
ATOM 3476  C C     . ASP C 3 113 ? 229.028 105.233 127.880 1.00 74.47  ? 113 ASP C C     1 
ATOM 3477  O O     . ASP C 3 113 ? 229.274 104.298 128.650 1.00 74.47  ? 113 ASP C O     1 
ATOM 3478  C CB    . ASP C 3 113 ? 227.660 104.362 126.007 1.00 74.47  ? 113 ASP C CB    1 
ATOM 3479  C CG    . ASP C 3 113 ? 226.289 104.192 125.417 1.00 74.47  ? 113 ASP C CG    1 
ATOM 3480  O OD1   . ASP C 3 113 ? 225.306 104.293 126.176 1.00 74.47  ? 113 ASP C OD1   1 
ATOM 3481  O OD2   . ASP C 3 113 ? 226.189 103.944 124.199 1.00 74.47  ? 113 ASP C OD2   1 
ATOM 3482  N N     . ALA C 3 114 ? 229.899 106.210 127.646 1.00 77.70  ? 114 ALA C N     1 
ATOM 3483  C CA    . ALA C 3 114 ? 231.161 106.220 128.366 1.00 77.70  ? 114 ALA C CA    1 
ATOM 3484  C C     . ALA C 3 114 ? 230.989 106.782 129.763 1.00 77.70  ? 114 ALA C C     1 
ATOM 3485  O O     . ALA C 3 114 ? 231.707 106.378 130.684 1.00 77.70  ? 114 ALA C O     1 
ATOM 3486  C CB    . ALA C 3 114 ? 232.203 107.030 127.595 1.00 77.70  ? 114 ALA C CB    1 
ATOM 3487  N N     . TYR C 3 115 ? 230.050 107.709 129.943 1.00 70.64  ? 115 TYR C N     1 
ATOM 3488  C CA    . TYR C 3 115 ? 229.769 108.197 131.283 1.00 70.64  ? 115 TYR C CA    1 
ATOM 3489  C C     . TYR C 3 115 ? 229.051 107.148 132.115 1.00 70.64  ? 115 TYR C C     1 
ATOM 3490  O O     . TYR C 3 115 ? 229.280 107.049 133.321 1.00 70.64  ? 115 TYR C O     1 
ATOM 3491  C CB    . TYR C 3 115 ? 228.922 109.451 131.223 1.00 70.64  ? 115 TYR C CB    1 
ATOM 3492  C CG    . TYR C 3 115 ? 228.551 109.945 132.591 1.00 70.64  ? 115 TYR C CG    1 
ATOM 3493  C CD1   . TYR C 3 115 ? 229.455 110.677 133.332 1.00 70.64  ? 115 TYR C CD1   1 
ATOM 3494  C CD2   . TYR C 3 115 ? 227.322 109.652 133.157 1.00 70.64  ? 115 TYR C CD2   1 
ATOM 3495  C CE1   . TYR C 3 115 ? 229.145 111.126 134.576 1.00 70.64  ? 115 TYR C CE1   1 
ATOM 3496  C CE2   . TYR C 3 115 ? 227.005 110.095 134.414 1.00 70.64  ? 115 TYR C CE2   1 
ATOM 3497  C CZ    . TYR C 3 115 ? 227.923 110.836 135.115 1.00 70.64  ? 115 TYR C CZ    1 
ATOM 3498  O OH    . TYR C 3 115 ? 227.627 111.294 136.368 1.00 70.64  ? 115 TYR C OH    1 
ATOM 3499  N N     . PHE C 3 116 ? 228.148 106.386 131.502 1.00 71.40  ? 116 PHE C N     1 
ATOM 3500  C CA    . PHE C 3 116 ? 227.496 105.295 132.209 1.00 71.40  ? 116 PHE C CA    1 
ATOM 3501  C C     . PHE C 3 116 ? 228.403 104.089 132.353 1.00 71.40  ? 116 PHE C C     1 
ATOM 3502  O O     . PHE C 3 116 ? 228.143 103.226 133.196 1.00 71.40  ? 116 PHE C O     1 
ATOM 3503  C CB    . PHE C 3 116 ? 226.198 104.900 131.514 1.00 71.40  ? 116 PHE C CB    1 
ATOM 3504  C CG    . PHE C 3 116 ? 225.115 105.926 131.649 1.00 71.40  ? 116 PHE C CG    1 
ATOM 3505  C CD1   . PHE C 3 116 ? 225.118 106.810 132.713 1.00 71.40  ? 116 PHE C CD1   1 
ATOM 3506  C CD2   . PHE C 3 116 ? 224.077 105.990 130.738 1.00 71.40  ? 116 PHE C CD2   1 
ATOM 3507  C CE1   . PHE C 3 116 ? 224.125 107.755 132.847 1.00 71.40  ? 116 PHE C CE1   1 
ATOM 3508  C CE2   . PHE C 3 116 ? 223.079 106.930 130.873 1.00 71.40  ? 116 PHE C CE2   1 
ATOM 3509  C CZ    . PHE C 3 116 ? 223.104 107.813 131.929 1.00 71.40  ? 116 PHE C CZ    1 
ATOM 3510  N N     . ALA C 3 117 ? 229.451 104.005 131.536 1.00 76.82  ? 117 ALA C N     1 
ATOM 3511  C CA    . ALA C 3 117 ? 230.368 102.876 131.589 1.00 76.82  ? 117 ALA C CA    1 
ATOM 3512  C C     . ALA C 3 117 ? 231.097 102.781 132.927 1.00 76.82  ? 117 ALA C C     1 
ATOM 3513  O O     . ALA C 3 117 ? 231.648 101.722 133.244 1.00 76.82  ? 117 ALA C O     1 
ATOM 3514  C CB    . ALA C 3 117 ? 231.369 102.965 130.438 1.00 76.82  ? 117 ALA C CB    1 
ATOM 3515  N N     . ASP C 3 118 ? 231.085 103.843 133.731 1.00 78.45  ? 118 ASP C N     1 
ATOM 3516  C CA    . ASP C 3 118 ? 231.760 103.865 135.031 1.00 78.45  ? 118 ASP C CA    1 
ATOM 3517  C C     . ASP C 3 118 ? 230.891 103.332 136.172 1.00 78.45  ? 118 ASP C C     1 
ATOM 3518  O O     . ASP C 3 118 ? 231.425 102.966 137.224 1.00 78.45  ? 118 ASP C O     1 
ATOM 3519  C CB    . ASP C 3 118 ? 232.236 105.285 135.364 1.00 78.45  ? 118 ASP C CB    1 
ATOM 3520  C CG    . ASP C 3 118 ? 231.134 106.169 135.888 1.00 78.45  ? 118 ASP C CG    1 
ATOM 3521  O OD1   . ASP C 3 118 ? 229.969 105.976 135.497 1.00 78.45  ? 118 ASP C OD1   1 
ATOM 3522  O OD2   . ASP C 3 118 ? 231.441 107.080 136.684 1.00 78.45  ? 118 ASP C OD2   1 
ATOM 3523  N N     . TYR C 3 119 ? 229.574 103.308 135.959 1.00 77.22  ? 119 TYR C N     1 
ATOM 3524  C CA    . TYR C 3 119 ? 228.523 102.956 136.914 1.00 77.22  ? 119 TYR C CA    1 
ATOM 3525  C C     . TYR C 3 119 ? 227.452 102.116 136.201 1.00 77.22  ? 119 TYR C C     1 
ATOM 3526  O O     . TYR C 3 119 ? 226.242 102.299 136.390 1.00 77.22  ? 119 TYR C O     1 
ATOM 3527  C CB    . TYR C 3 119 ? 227.895 104.242 137.473 1.00 77.22  ? 119 TYR C CB    1 
ATOM 3528  C CG    . TYR C 3 119 ? 228.740 105.014 138.475 1.00 77.22  ? 119 TYR C CG    1 
ATOM 3529  C CD1   . TYR C 3 119 ? 229.578 104.367 139.342 1.00 77.22  ? 119 TYR C CD1   1 
ATOM 3530  C CD2   . TYR C 3 119 ? 228.838 106.396 138.389 1.00 77.22  ? 119 TYR C CD2   1 
ATOM 3531  C CE1   . TYR C 3 119 ? 230.343 105.053 140.274 1.00 77.22  ? 119 TYR C CE1   1 
ATOM 3532  C CE2   . TYR C 3 119 ? 229.621 107.101 139.269 1.00 77.22  ? 119 TYR C CE2   1 
ATOM 3533  C CZ    . TYR C 3 119 ? 230.384 106.430 140.207 1.00 77.22  ? 119 TYR C CZ    1 
ATOM 3534  O OH    . TYR C 3 119 ? 231.129 107.151 141.109 1.00 77.22  ? 119 TYR C OH    1 
ATOM 3535  N N     . SER C 3 120 ? 227.924 101.137 135.426 1.00 76.08  ? 120 SER C N     1 
ATOM 3536  C CA    . SER C 3 120 ? 227.048 100.299 134.622 1.00 76.08  ? 120 SER C CA    1 
ATOM 3537  C C     . SER C 3 120 ? 226.110 99.450  135.465 1.00 76.08  ? 120 SER C C     1 
ATOM 3538  O O     . SER C 3 120 ? 224.935 99.289  135.120 1.00 76.08  ? 120 SER C O     1 
ATOM 3539  C CB    . SER C 3 120 ? 227.886 99.402  133.711 1.00 76.08  ? 120 SER C CB    1 
ATOM 3540  O OG    . SER C 3 120 ? 228.740 100.172 132.879 1.00 76.08  ? 120 SER C OG    1 
ATOM 3541  N N     . GLU C 3 121 ? 226.590 98.953  136.600 1.00 75.63  ? 121 GLU C N     1 
ATOM 3542  C CA    . GLU C 3 121 ? 225.828 98.052  137.457 1.00 75.63  ? 121 GLU C CA    1 
ATOM 3543  C C     . GLU C 3 121 ? 225.128 98.789  138.577 1.00 75.63  ? 121 GLU C C     1 
ATOM 3544  O O     . GLU C 3 121 ? 224.392 98.174  139.357 1.00 75.63  ? 121 GLU C O     1 
ATOM 3545  C CB    . GLU C 3 121 ? 226.744 96.960  138.035 1.00 75.63  ? 121 GLU C CB    1 
ATOM 3546  C CG    . GLU C 3 121 ? 226.006 95.819  138.763 1.00 75.63  ? 121 GLU C CG    1 
ATOM 3547  C CD    . GLU C 3 121 ? 224.980 95.084  137.891 1.00 75.63  ? 121 GLU C CD    1 
ATOM 3548  O OE1   . GLU C 3 121 ? 224.820 95.424  136.701 1.00 75.63  ? 121 GLU C OE1   1 
ATOM 3549  O OE2   . GLU C 3 121 ? 224.263 94.214  138.429 1.00 75.63  ? 121 GLU C OE2   1 
ATOM 3550  N N     . ARG C 3 122 ? 225.352 100.096 138.662 1.00 71.89  ? 122 ARG C N     1 
ATOM 3551  C CA    . ARG C 3 122 ? 224.770 100.910 139.727 1.00 71.89  ? 122 ARG C CA    1 
ATOM 3552  C C     . ARG C 3 122 ? 223.391 101.530 139.484 1.00 71.89  ? 122 ARG C C     1 
ATOM 3553  O O     . ARG C 3 122 ? 222.841 102.154 140.391 1.00 71.89  ? 122 ARG C O     1 
ATOM 3554  C CB    . ARG C 3 122 ? 225.755 102.009 140.141 1.00 71.89  ? 122 ARG C CB    1 
ATOM 3555  C CG    . ARG C 3 122 ? 225.386 102.719 141.433 1.00 71.89  ? 122 ARG C CG    1 
ATOM 3556  C CD    . ARG C 3 122 ? 226.338 103.868 141.724 1.00 71.89  ? 122 ARG C CD    1 
ATOM 3557  N NE    . ARG C 3 122 ? 226.102 104.454 143.040 1.00 71.89  ? 122 ARG C NE    1 
ATOM 3558  C CZ    . ARG C 3 122 ? 226.806 104.155 144.127 1.00 71.89  ? 122 ARG C CZ    1 
ATOM 3559  N NH1   . ARG C 3 122 ? 227.794 103.274 144.058 1.00 71.89  ? 122 ARG C NH1   1 
ATOM 3560  N NH2   . ARG C 3 122 ? 226.522 104.737 145.284 1.00 71.89  ? 122 ARG C NH2   1 
ATOM 3561  N N     . PHE C 3 123 ? 222.819 101.379 138.292 1.00 69.98  ? 123 PHE C N     1 
ATOM 3562  C CA    . PHE C 3 123 ? 221.508 101.978 138.073 1.00 69.98  ? 123 PHE C CA    1 
ATOM 3563  C C     . PHE C 3 123 ? 220.359 100.999 138.224 1.00 69.98  ? 123 PHE C C     1 
ATOM 3564  O O     . PHE C 3 123 ? 219.295 101.206 137.632 1.00 69.98  ? 123 PHE C O     1 
ATOM 3565  C CB    . PHE C 3 123 ? 221.431 102.618 136.692 1.00 69.98  ? 123 PHE C CB    1 
ATOM 3566  C CG    . PHE C 3 123 ? 222.205 103.885 136.557 1.00 69.98  ? 123 PHE C CG    1 
ATOM 3567  C CD1   . PHE C 3 123 ? 223.216 104.213 137.440 1.00 69.98  ? 123 PHE C CD1   1 
ATOM 3568  C CD2   . PHE C 3 123 ? 221.920 104.753 135.528 1.00 69.98  ? 123 PHE C CD2   1 
ATOM 3569  C CE1   . PHE C 3 123 ? 223.914 105.370 137.272 1.00 69.98  ? 123 PHE C CE1   1 
ATOM 3570  C CE2   . PHE C 3 123 ? 222.612 105.899 135.364 1.00 69.98  ? 123 PHE C CE2   1 
ATOM 3571  C CZ    . PHE C 3 123 ? 223.609 106.205 136.228 1.00 69.98  ? 123 PHE C CZ    1 
ATOM 3572  N N     . ASP C 3 124 ? 220.523 99.944  138.999 1.00 71.89  ? 124 ASP C N     1 
ATOM 3573  C CA    . ASP C 3 124 ? 219.413 99.062  139.295 1.00 71.89  ? 124 ASP C CA    1 
ATOM 3574  C C     . ASP C 3 124 ? 218.747 99.578  140.556 1.00 71.89  ? 124 ASP C C     1 
ATOM 3575  O O     . ASP C 3 124 ? 219.429 99.892  141.534 1.00 71.89  ? 124 ASP C O     1 
ATOM 3576  C CB    . ASP C 3 124 ? 219.882 97.624  139.480 1.00 71.89  ? 124 ASP C CB    1 
ATOM 3577  C CG    . ASP C 3 124 ? 218.741 96.631  139.433 1.00 71.89  ? 124 ASP C CG    1 
ATOM 3578  O OD1   . ASP C 3 124 ? 217.593 97.026  139.725 1.00 71.89  ? 124 ASP C OD1   1 
ATOM 3579  O OD2   . ASP C 3 124 ? 218.991 95.452  139.116 1.00 71.89  ? 124 ASP C OD2   1 
ATOM 3580  N N     . LEU C 3 125 ? 217.426 99.691  140.544 1.00 69.48  ? 125 LEU C N     1 
ATOM 3581  C CA    . LEU C 3 125 ? 216.792 100.160 141.766 1.00 69.48  ? 125 LEU C CA    1 
ATOM 3582  C C     . LEU C 3 125 ? 216.677 99.022  142.774 1.00 69.48  ? 125 LEU C C     1 
ATOM 3583  O O     . LEU C 3 125 ? 216.757 99.267  143.982 1.00 69.48  ? 125 LEU C O     1 
ATOM 3584  C CB    . LEU C 3 125 ? 215.465 100.854 141.475 1.00 69.48  ? 125 LEU C CB    1 
ATOM 3585  C CG    . LEU C 3 125 ? 214.220 100.220 140.897 1.00 69.48  ? 125 LEU C CG    1 
ATOM 3586  C CD1   . LEU C 3 125 ? 213.468 99.610  142.026 1.00 69.48  ? 125 LEU C CD1   1 
ATOM 3587  C CD2   . LEU C 3 125 ? 213.408 101.313 140.252 1.00 69.48  ? 125 LEU C CD2   1 
ATOM 3588  N N     . PHE C 3 126 ? 216.507 97.784  142.307 1.00 71.60  ? 126 PHE C N     1 
ATOM 3589  C CA    . PHE C 3 126 ? 216.442 96.617  143.185 1.00 71.60  ? 126 PHE C CA    1 
ATOM 3590  C C     . PHE C 3 126 ? 217.762 95.868  143.174 1.00 71.60  ? 126 PHE C C     1 
ATOM 3591  O O     . PHE C 3 126 ? 217.784 94.636  143.212 1.00 71.60  ? 126 PHE C O     1 
ATOM 3592  C CB    . PHE C 3 126 ? 215.353 95.639  142.750 1.00 71.60  ? 126 PHE C CB    1 
ATOM 3593  C CG    . PHE C 3 126 ? 213.968 96.184  142.733 1.00 71.60  ? 126 PHE C CG    1 
ATOM 3594  C CD1   . PHE C 3 126 ? 213.398 96.682  143.886 1.00 71.60  ? 126 PHE C CD1   1 
ATOM 3595  C CD2   . PHE C 3 126 ? 213.206 96.120  141.585 1.00 71.60  ? 126 PHE C CD2   1 
ATOM 3596  C CE1   . PHE C 3 126 ? 212.105 97.146  143.881 1.00 71.60  ? 126 PHE C CE1   1 
ATOM 3597  C CE2   . PHE C 3 126 ? 211.916 96.583  141.567 1.00 71.60  ? 126 PHE C CE2   1 
ATOM 3598  C CZ    . PHE C 3 126 ? 211.359 97.096  142.714 1.00 71.60  ? 126 PHE C CZ    1 
ATOM 3599  N N     . HIS C 3 127 ? 218.880 96.583  143.133 1.00 75.72  ? 127 HIS C N     1 
ATOM 3600  C CA    . HIS C 3 127 ? 220.165 95.910  143.146 1.00 75.72  ? 127 HIS C CA    1 
ATOM 3601  C C     . HIS C 3 127 ? 220.442 95.275  144.505 1.00 75.72  ? 127 HIS C C     1 
ATOM 3602  O O     . HIS C 3 127 ? 220.217 95.904  145.541 1.00 75.72  ? 127 HIS C O     1 
ATOM 3603  C CB    . HIS C 3 127 ? 221.279 96.889  142.795 1.00 75.72  ? 127 HIS C CB    1 
ATOM 3604  C CG    . HIS C 3 127 ? 222.550 96.219  142.391 1.00 75.72  ? 127 HIS C CG    1 
ATOM 3605  N ND1   . HIS C 3 127 ? 223.453 95.714  143.301 1.00 75.72  ? 127 HIS C ND1   1 
ATOM 3606  C CD2   . HIS C 3 127 ? 223.052 95.938  141.167 1.00 75.72  ? 127 HIS C CD2   1 
ATOM 3607  C CE1   . HIS C 3 127 ? 224.466 95.166  142.652 1.00 75.72  ? 127 HIS C CE1   1 
ATOM 3608  N NE2   . HIS C 3 127 ? 224.247 95.289  141.356 1.00 75.72  ? 127 HIS C NE2   1 
ATOM 3609  N N     . PRO C 3 128 ? 220.969 94.053  144.526 1.00 78.65  ? 128 PRO C N     1 
ATOM 3610  C CA    . PRO C 3 128 ? 221.294 93.400  145.807 1.00 78.65  ? 128 PRO C CA    1 
ATOM 3611  C C     . PRO C 3 128 ? 222.224 94.228  146.680 1.00 78.65  ? 128 PRO C C     1 
ATOM 3612  O O     . PRO C 3 128 ? 222.085 94.231  147.909 1.00 78.65  ? 128 PRO C O     1 
ATOM 3613  C CB    . PRO C 3 128 ? 221.927 92.072  145.372 1.00 78.65  ? 128 PRO C CB    1 
ATOM 3614  C CG    . PRO C 3 128 ? 222.299 92.271  143.925 1.00 78.65  ? 128 PRO C CG    1 
ATOM 3615  C CD    . PRO C 3 128 ? 221.271 93.195  143.373 1.00 78.65  ? 128 PRO C CD    1 
ATOM 3616  N N     . GLU C 3 129 ? 223.173 94.930  146.069 1.00 81.19  ? 129 GLU C N     1 
ATOM 3617  C CA    . GLU C 3 129 ? 224.095 95.815  146.764 1.00 81.19  ? 129 GLU C CA    1 
ATOM 3618  C C     . GLU C 3 129 ? 224.092 97.157  146.059 1.00 81.19  ? 129 GLU C C     1 
ATOM 3619  O O     . GLU C 3 129 ? 224.130 97.220  144.827 1.00 81.19  ? 129 GLU C O     1 
ATOM 3620  C CB    . GLU C 3 129 ? 225.515 95.219  146.726 1.00 81.19  ? 129 GLU C CB    1 
ATOM 3621  C CG    . GLU C 3 129 ? 226.667 96.118  147.196 1.00 81.19  ? 129 GLU C CG    1 
ATOM 3622  C CD    . GLU C 3 129 ? 226.767 96.265  148.695 1.00 81.19  ? 129 GLU C CD    1 
ATOM 3623  O OE1   . GLU C 3 129 ? 225.951 95.649  149.408 1.00 81.19  ? 129 GLU C OE1   1 
ATOM 3624  O OE2   . GLU C 3 129 ? 227.671 96.992  149.159 1.00 81.19  ? 129 GLU C OE2   1 
ATOM 3625  N N     . ARG C 3 130 ? 224.073 98.228  146.848 1.00 78.74  ? 130 ARG C N     1 
ATOM 3626  C CA    . ARG C 3 130 ? 223.975 99.579  146.304 1.00 78.74  ? 130 ARG C CA    1 
ATOM 3627  C C     . ARG C 3 130 ? 222.750 99.696  145.406 1.00 78.74  ? 130 ARG C C     1 
ATOM 3628  O O     . ARG C 3 130 ? 222.889 99.784  144.180 1.00 78.74  ? 130 ARG C O     1 
ATOM 3629  C CB    . ARG C 3 130 ? 225.255 99.978  145.583 1.00 78.74  ? 130 ARG C CB    1 
ATOM 3630  C CG    . ARG C 3 130 ? 226.370 100.179 146.568 1.00 78.74  ? 130 ARG C CG    1 
ATOM 3631  C CD    . ARG C 3 130 ? 227.640 100.657 145.931 1.00 78.74  ? 130 ARG C CD    1 
ATOM 3632  N NE    . ARG C 3 130 ? 228.662 100.880 146.945 1.00 78.74  ? 130 ARG C NE    1 
ATOM 3633  C CZ    . ARG C 3 130 ? 229.503 99.948  147.374 1.00 78.74  ? 130 ARG C CZ    1 
ATOM 3634  N NH1   . ARG C 3 130 ? 229.441 98.720  146.876 1.00 78.74  ? 130 ARG C NH1   1 
ATOM 3635  N NH2   . ARG C 3 130 ? 230.396 100.237 148.302 1.00 78.74  ? 130 ARG C NH2   1 
ATOM 3636  N N     . PRO C 3 131 ? 221.544 99.671  145.968 1.00 74.28  ? 131 PRO C N     1 
ATOM 3637  C CA    . PRO C 3 131 ? 220.358 99.996  145.172 1.00 74.28  ? 131 PRO C CA    1 
ATOM 3638  C C     . PRO C 3 131 ? 220.287 101.473 144.840 1.00 74.28  ? 131 PRO C C     1 
ATOM 3639  O O     . PRO C 3 131 ? 220.783 102.333 145.574 1.00 74.28  ? 131 PRO C O     1 
ATOM 3640  C CB    . PRO C 3 131 ? 219.191 99.571  146.072 1.00 74.28  ? 131 PRO C CB    1 
ATOM 3641  C CG    . PRO C 3 131 ? 219.795 98.674  147.097 1.00 74.28  ? 131 PRO C CG    1 
ATOM 3642  C CD    . PRO C 3 131 ? 221.174 99.192  147.308 1.00 74.28  ? 131 PRO C CD    1 
ATOM 3643  N N     . TRP C 3 132 ? 219.697 101.751 143.684 1.00 68.80  ? 132 TRP C N     1 
ATOM 3644  C CA    . TRP C 3 132 ? 219.631 103.109 143.168 1.00 68.80  ? 132 TRP C CA    1 
ATOM 3645  C C     . TRP C 3 132 ? 218.873 104.027 144.111 1.00 68.80  ? 132 TRP C C     1 
ATOM 3646  O O     . TRP C 3 132 ? 217.709 103.782 144.434 1.00 68.80  ? 132 TRP C O     1 
ATOM 3647  C CB    . TRP C 3 132 ? 218.925 103.056 141.815 1.00 68.80  ? 132 TRP C CB    1 
ATOM 3648  C CG    . TRP C 3 132 ? 218.354 104.335 141.256 1.00 68.80  ? 132 TRP C CG    1 
ATOM 3649  C CD1   . TRP C 3 132 ? 217.270 105.027 141.722 1.00 68.80  ? 132 TRP C CD1   1 
ATOM 3650  C CD2   . TRP C 3 132 ? 218.770 105.007 140.069 1.00 68.80  ? 132 TRP C CD2   1 
ATOM 3651  N NE1   . TRP C 3 132 ? 217.013 106.106 140.920 1.00 68.80  ? 132 TRP C NE1   1 
ATOM 3652  C CE2   . TRP C 3 132 ? 217.922 106.119 139.896 1.00 68.80  ? 132 TRP C CE2   1 
ATOM 3653  C CE3   . TRP C 3 132 ? 219.793 104.787 139.146 1.00 68.80  ? 132 TRP C CE3   1 
ATOM 3654  C CZ2   . TRP C 3 132 ? 218.069 107.005 138.842 1.00 68.80  ? 132 TRP C CZ2   1 
ATOM 3655  C CZ3   . TRP C 3 132 ? 219.936 105.668 138.099 1.00 68.80  ? 132 TRP C CZ3   1 
ATOM 3656  C CH2   . TRP C 3 132 ? 219.079 106.764 137.954 1.00 68.80  ? 132 TRP C CH2   1 
ATOM 3657  N N     . LEU C 3 133 ? 219.531 105.112 144.522 1.00 63.78  ? 133 LEU C N     1 
ATOM 3658  C CA    . LEU C 3 133 ? 218.906 106.101 145.392 1.00 63.78  ? 133 LEU C CA    1 
ATOM 3659  C C     . LEU C 3 133 ? 218.326 105.464 146.649 1.00 63.78  ? 133 LEU C C     1 
ATOM 3660  O O     . LEU C 3 133 ? 217.293 105.898 147.156 1.00 63.78  ? 133 LEU C O     1 
ATOM 3661  C CB    . LEU C 3 133 ? 217.845 106.892 144.629 1.00 63.78  ? 133 LEU C CB    1 
ATOM 3662  C CG    . LEU C 3 133 ? 218.387 108.103 143.867 1.00 63.78  ? 133 LEU C CG    1 
ATOM 3663  C CD1   . LEU C 3 133 ? 219.241 108.950 144.767 1.00 63.78  ? 133 LEU C CD1   1 
ATOM 3664  C CD2   . LEU C 3 133 ? 219.173 107.673 142.651 1.00 63.78  ? 133 LEU C CD2   1 
ATOM 3665  N N     . GLN C 3 134 ? 218.948 104.408 147.155 1.00 66.34  ? 134 GLN C N     1 
ATOM 3666  C CA    . GLN C 3 134 ? 218.409 103.693 148.302 1.00 66.34  ? 134 GLN C CA    1 
ATOM 3667  C C     . GLN C 3 134 ? 219.529 103.362 149.271 1.00 66.34  ? 134 GLN C C     1 
ATOM 3668  O O     . GLN C 3 134 ? 220.708 103.611 149.007 1.00 66.34  ? 134 GLN C O     1 
ATOM 3669  C CB    . GLN C 3 134 ? 217.727 102.398 147.865 1.00 66.34  ? 134 GLN C CB    1 
ATOM 3670  C CG    . GLN C 3 134 ? 216.535 102.578 146.979 1.00 66.34  ? 134 GLN C CG    1 
ATOM 3671  C CD    . GLN C 3 134 ? 215.888 101.267 146.626 1.00 66.34  ? 134 GLN C CD    1 
ATOM 3672  O OE1   . GLN C 3 134 ? 216.204 100.230 147.196 1.00 66.34  ? 134 GLN C OE1   1 
ATOM 3673  N NE2   . GLN C 3 134 ? 215.011 101.295 145.639 1.00 66.34  ? 134 GLN C NE2   1 
ATOM 3674  N N     . ASP C 3 135 ? 219.144 102.804 150.415 1.00 69.08  ? 135 ASP C N     1 
ATOM 3675  C CA    . ASP C 3 135 ? 220.102 102.329 151.401 1.00 69.08  ? 135 ASP C CA    1 
ATOM 3676  C C     . ASP C 3 135 ? 219.806 100.853 151.639 1.00 69.08  ? 135 ASP C C     1 
ATOM 3677  O O     . ASP C 3 135 ? 218.718 100.512 152.133 1.00 69.08  ? 135 ASP C O     1 
ATOM 3678  C CB    . ASP C 3 135 ? 219.980 103.133 152.696 1.00 69.08  ? 135 ASP C CB    1 
ATOM 3679  C CG    . ASP C 3 135 ? 221.052 102.795 153.701 1.00 69.08  ? 135 ASP C CG    1 
ATOM 3680  O OD1   . ASP C 3 135 ? 222.196 103.251 153.516 1.00 69.08  ? 135 ASP C OD1   1 
ATOM 3681  O OD2   . ASP C 3 135 ? 220.751 102.074 154.676 1.00 69.08  ? 135 ASP C OD2   1 
ATOM 3682  N N     . PRO C 3 136 ? 220.731 99.952  151.294 1.00 74.21  ? 136 PRO C N     1 
ATOM 3683  C CA    . PRO C 3 136 ? 220.464 98.515  151.441 1.00 74.21  ? 136 PRO C CA    1 
ATOM 3684  C C     . PRO C 3 136 ? 220.485 98.016  152.870 1.00 74.21  ? 136 PRO C C     1 
ATOM 3685  O O     . PRO C 3 136 ? 219.845 96.997  153.152 1.00 74.21  ? 136 PRO C O     1 
ATOM 3686  C CB    . PRO C 3 136 ? 221.574 97.870  150.607 1.00 74.21  ? 136 PRO C CB    1 
ATOM 3687  C CG    . PRO C 3 136 ? 222.685 98.835  150.667 1.00 74.21  ? 136 PRO C CG    1 
ATOM 3688  C CD    . PRO C 3 136 ? 222.045 100.202 150.678 1.00 74.21  ? 136 PRO C CD    1 
ATOM 3689  N N     . ARG C 3 137 ? 221.176 98.696  153.782 1.00 74.60  ? 137 ARG C N     1 
ATOM 3690  C CA    . ARG C 3 137 ? 221.270 98.203  155.147 1.00 74.60  ? 137 ARG C CA    1 
ATOM 3691  C C     . ARG C 3 137 ? 220.015 98.464  155.953 1.00 74.60  ? 137 ARG C C     1 
ATOM 3692  O O     . ARG C 3 137 ? 219.943 98.063  157.120 1.00 74.60  ? 137 ARG C O     1 
ATOM 3693  C CB    . ARG C 3 137 ? 222.437 98.848  155.876 1.00 74.60  ? 137 ARG C CB    1 
ATOM 3694  C CG    . ARG C 3 137 ? 223.770 98.627  155.245 1.00 74.60  ? 137 ARG C CG    1 
ATOM 3695  C CD    . ARG C 3 137 ? 224.706 99.605  155.878 1.00 74.60  ? 137 ARG C CD    1 
ATOM 3696  N NE    . ARG C 3 137 ? 224.221 100.964 155.703 1.00 74.60  ? 137 ARG C NE    1 
ATOM 3697  C CZ    . ARG C 3 137 ? 224.683 102.008 156.378 1.00 74.60  ? 137 ARG C CZ    1 
ATOM 3698  N NH1   . ARG C 3 137 ? 224.183 103.208 156.149 1.00 74.60  ? 137 ARG C NH1   1 
ATOM 3699  N NH2   . ARG C 3 137 ? 225.633 101.853 157.289 1.00 74.60  ? 137 ARG C NH2   1 
ATOM 3700  N N     . LEU C 3 138 ? 219.046 99.138  155.361 1.00 68.44  ? 138 LEU C N     1 
ATOM 3701  C CA    . LEU C 3 138 ? 217.834 99.548  156.041 1.00 68.44  ? 138 LEU C CA    1 
ATOM 3702  C C     . LEU C 3 138 ? 216.845 98.383  156.118 1.00 68.44  ? 138 LEU C C     1 
ATOM 3703  O O     . LEU C 3 138 ? 215.948 98.396  156.963 1.00 68.44  ? 138 LEU C O     1 
ATOM 3704  C CB    . LEU C 3 138 ? 217.279 100.803 155.358 1.00 68.44  ? 138 LEU C CB    1 
ATOM 3705  C CG    . LEU C 3 138 ? 216.190 101.630 156.043 1.00 68.44  ? 138 LEU C CG    1 
ATOM 3706  C CD1   . LEU C 3 138 ? 216.263 103.070 155.533 1.00 68.44  ? 138 LEU C CD1   1 
ATOM 3707  C CD2   . LEU C 3 138 ? 214.838 101.066 155.854 1.00 68.44  ? 138 LEU C CD2   1 
ATOM 3708  N N     . ARG C 3 139 ? 217.039 97.350  155.283 1.00 72.13  ? 139 ARG C N     1 
ATOM 3709  C CA    . ARG C 3 139 ? 216.153 96.186  155.255 1.00 72.13  ? 139 ARG C CA    1 
ATOM 3710  C C     . ARG C 3 139 ? 216.245 95.370  156.528 1.00 72.13  ? 139 ARG C C     1 
ATOM 3711  O O     . ARG C 3 139 ? 215.239 94.804  156.979 1.00 72.13  ? 139 ARG C O     1 
ATOM 3712  C CB    . ARG C 3 139 ? 216.616 95.294  154.102 1.00 72.13  ? 139 ARG C CB    1 
ATOM 3713  C CG    . ARG C 3 139 ? 216.099 93.871  154.036 1.00 72.13  ? 139 ARG C CG    1 
ATOM 3714  C CD    . ARG C 3 139 ? 214.765 93.748  153.375 1.00 72.13  ? 139 ARG C CD    1 
ATOM 3715  N NE    . ARG C 3 139 ? 214.329 92.356  153.335 1.00 72.13  ? 139 ARG C NE    1 
ATOM 3716  C CZ    . ARG C 3 139 ? 213.176 91.954  152.811 1.00 72.13  ? 139 ARG C CZ    1 
ATOM 3717  N NH1   . ARG C 3 139 ? 212.342 92.833  152.271 1.00 72.13  ? 139 ARG C NH1   1 
ATOM 3718  N NH2   . ARG C 3 139 ? 212.860 90.669  152.810 1.00 72.13  ? 139 ARG C NH2   1 
ATOM 3719  N N     . GLU C 3 140 ? 217.440 95.269  157.093 1.00 74.56  ? 140 GLU C N     1 
ATOM 3720  C CA    . GLU C 3 140 ? 217.665 94.768  158.435 1.00 74.56  ? 140 GLU C CA    1 
ATOM 3721  C C     . GLU C 3 140 ? 217.481 95.946  159.368 1.00 74.56  ? 140 GLU C C     1 
ATOM 3722  O O     . GLU C 3 140 ? 217.199 97.058  158.916 1.00 74.56  ? 140 GLU C O     1 
ATOM 3723  C CB    . GLU C 3 140 ? 219.031 94.111  158.629 1.00 74.56  ? 140 GLU C CB    1 
ATOM 3724  C CG    . GLU C 3 140 ? 220.248 94.959  158.408 1.00 74.56  ? 140 GLU C CG    1 
ATOM 3725  C CD    . GLU C 3 140 ? 220.710 94.861  156.992 1.00 74.56  ? 140 GLU C CD    1 
ATOM 3726  O OE1   . GLU C 3 140 ? 220.183 93.979  156.282 1.00 74.56  ? 140 GLU C OE1   1 
ATOM 3727  O OE2   . GLU C 3 140 ? 221.588 95.646  156.569 1.00 74.56  ? 140 GLU C OE2   1 
ATOM 3728  N N     . GLU C 3 141 ? 217.409 95.674  160.666 1.00 74.12  ? 141 GLU C N     1 
ATOM 3729  C CA    . GLU C 3 141 ? 217.282 96.711  161.697 1.00 74.12  ? 141 GLU C CA    1 
ATOM 3730  C C     . GLU C 3 141 ? 215.969 97.497  161.631 1.00 74.12  ? 141 GLU C C     1 
ATOM 3731  O O     . GLU C 3 141 ? 215.789 98.445  162.398 1.00 74.12  ? 141 GLU C O     1 
ATOM 3732  C CB    . GLU C 3 141 ? 218.539 97.638  161.689 1.00 74.12  ? 141 GLU C CB    1 
ATOM 3733  C CG    . GLU C 3 141 ? 218.895 98.459  160.415 1.00 74.12  ? 141 GLU C CG    1 
ATOM 3734  C CD    . GLU C 3 141 ? 220.063 99.427  160.505 1.00 74.12  ? 141 GLU C CD    1 
ATOM 3735  O OE1   . GLU C 3 141 ? 220.467 99.846  161.602 1.00 74.12  ? 141 GLU C OE1   1 
ATOM 3736  O OE2   . GLU C 3 141 ? 220.551 99.827  159.427 1.00 74.12  ? 141 GLU C OE2   1 
ATOM 3737  N N     . CYS C 3 142 ? 215.080 97.178  160.686 1.00 73.63  ? 142 CYS C N     1 
ATOM 3738  C CA    . CYS C 3 142 ? 213.759 97.806  160.582 1.00 73.63  ? 142 CYS C CA    1 
ATOM 3739  C C     . CYS C 3 142 ? 212.713 96.702  160.673 1.00 73.63  ? 142 CYS C C     1 
ATOM 3740  O O     . CYS C 3 142 ? 212.391 96.057  159.666 1.00 73.63  ? 142 CYS C O     1 
ATOM 3741  C CB    . CYS C 3 142 ? 213.616 98.616  159.302 1.00 73.63  ? 142 CYS C CB    1 
ATOM 3742  S SG    . CYS C 3 142 ? 214.682 100.057 159.246 1.00 73.63  ? 142 CYS C SG    1 
ATOM 3743  N N     . PRO C 3 143 ? 212.176 96.433  161.866 1.00 71.17  ? 143 PRO C N     1 
ATOM 3744  C CA    . PRO C 3 143 ? 211.219 95.322  162.004 1.00 71.17  ? 143 PRO C CA    1 
ATOM 3745  C C     . PRO C 3 143 ? 209.910 95.465  161.238 1.00 71.17  ? 143 PRO C C     1 
ATOM 3746  O O     . PRO C 3 143 ? 209.407 94.466  160.709 1.00 71.17  ? 143 PRO C O     1 
ATOM 3747  C CB    . PRO C 3 143 ? 210.966 95.285  163.517 1.00 71.17  ? 143 PRO C CB    1 
ATOM 3748  C CG    . PRO C 3 143 ? 211.275 96.663  163.983 1.00 71.17  ? 143 PRO C CG    1 
ATOM 3749  C CD    . PRO C 3 143 ? 212.398 97.144  163.133 1.00 71.17  ? 143 PRO C CD    1 
ATOM 3750  N N     . LYS C 3 144 ? 209.339 96.661  161.158 1.00 63.37  ? 144 LYS C N     1 
ATOM 3751  C CA    . LYS C 3 144 ? 208.085 96.900  160.453 1.00 63.37  ? 144 LYS C CA    1 
ATOM 3752  C C     . LYS C 3 144 ? 208.312 97.638  159.142 1.00 63.37  ? 144 LYS C C     1 
ATOM 3753  O O     . LYS C 3 144 ? 209.040 98.635  159.102 1.00 63.37  ? 144 LYS C O     1 
ATOM 3754  C CB    . LYS C 3 144 ? 207.084 97.661  161.324 1.00 63.37  ? 144 LYS C CB    1 
ATOM 3755  C CG    . LYS C 3 144 ? 206.640 96.885  162.546 1.00 63.37  ? 144 LYS C CG    1 
ATOM 3756  C CD    . LYS C 3 144 ? 205.605 97.655  163.336 1.00 63.37  ? 144 LYS C CD    1 
ATOM 3757  C CE    . LYS C 3 144 ? 205.192 96.882  164.565 1.00 63.37  ? 144 LYS C CE    1 
ATOM 3758  N NZ    . LYS C 3 144 ? 204.450 95.657  164.174 1.00 63.37  ? 144 LYS C NZ    1 
ATOM 3759  N N     . THR C 3 145 ? 207.686 97.145  158.076 1.00 58.80  ? 145 THR C N     1 
ATOM 3760  C CA    . THR C 3 145 ? 207.742 97.822  156.792 1.00 58.80  ? 145 THR C CA    1 
ATOM 3761  C C     . THR C 3 145 ? 206.787 99.004  156.806 1.00 58.80  ? 145 THR C C     1 
ATOM 3762  O O     . THR C 3 145 ? 205.661 98.906  157.297 1.00 58.80  ? 145 THR C O     1 
ATOM 3763  C CB    . THR C 3 145 ? 207.330 96.869  155.675 1.00 58.80  ? 145 THR C CB    1 
ATOM 3764  O OG1   . THR C 3 145 ? 205.941 96.561  155.819 1.00 58.80  ? 145 THR C OG1   1 
ATOM 3765  C CG2   . THR C 3 145 ? 208.089 95.572  155.800 1.00 58.80  ? 145 THR C CG2   1 
ATOM 3766  N N     . SER C 3 146 ? 207.236 100.125 156.244 1.00 60.14  ? 146 SER C N     1 
ATOM 3767  C CA    . SER C 3 146 ? 206.390 101.313 156.177 1.00 60.14  ? 146 SER C CA    1 
ATOM 3768  C C     . SER C 3 146 ? 205.162 101.084 155.305 1.00 60.14  ? 146 SER C C     1 
ATOM 3769  O O     . SER C 3 146 ? 204.067 101.562 155.624 1.00 60.14  ? 146 SER C O     1 
ATOM 3770  C CB    . SER C 3 146 ? 207.204 102.500 155.674 1.00 60.14  ? 146 SER C CB    1 
ATOM 3771  O OG    . SER C 3 146 ? 208.311 102.731 156.523 1.00 60.14  ? 146 SER C OG    1 
ATOM 3772  N N     . GLY C 3 147 ? 205.323 100.374 154.208 1.00 59.19  ? 147 GLY C N     1 
ATOM 3773  C CA    . GLY C 3 147 ? 204.242 100.083 153.292 1.00 59.19  ? 147 GLY C CA    1 
ATOM 3774  C C     . GLY C 3 147 ? 204.248 101.038 152.115 1.00 59.19  ? 147 GLY C C     1 
ATOM 3775  O O     . GLY C 3 147 ? 204.715 102.177 152.203 1.00 59.19  ? 147 GLY C O     1 
ATOM 3776  N N     . VAL C 3 148 ? 203.723 100.565 150.988 1.00 57.52  ? 148 VAL C N     1 
ATOM 3777  C CA    . VAL C 3 148 ? 203.649 101.404 149.799 1.00 57.52  ? 148 VAL C CA    1 
ATOM 3778  C C     . VAL C 3 148 ? 202.828 102.658 150.065 1.00 57.52  ? 148 VAL C C     1 
ATOM 3779  O O     . VAL C 3 148 ? 203.166 103.750 149.597 1.00 57.52  ? 148 VAL C O     1 
ATOM 3780  C CB    . VAL C 3 148 ? 203.102 100.586 148.618 1.00 57.52  ? 148 VAL C CB    1 
ATOM 3781  C CG1   . VAL C 3 148 ? 204.095 99.520  148.239 1.00 57.52  ? 148 VAL C CG1   1 
ATOM 3782  C CG2   . VAL C 3 148 ? 201.814 99.917  149.013 1.00 57.52  ? 148 VAL C CG2   1 
ATOM 3783  N N     . ASN C 3 149 ? 201.763 102.533 150.852 1.00 56.00  ? 149 ASN C N     1 
ATOM 3784  C CA    . ASN C 3 149 ? 200.889 103.663 151.128 1.00 56.00  ? 149 ASN C CA    1 
ATOM 3785  C C     . ASN C 3 149 ? 201.576 104.764 151.922 1.00 56.00  ? 149 ASN C C     1 
ATOM 3786  O O     . ASN C 3 149 ? 201.130 105.914 151.870 1.00 56.00  ? 149 ASN C O     1 
ATOM 3787  C CB    . ASN C 3 149 ? 199.651 103.175 151.856 1.00 56.00  ? 149 ASN C CB    1 
ATOM 3788  C CG    . ASN C 3 149 ? 198.849 102.234 151.012 1.00 56.00  ? 149 ASN C CG    1 
ATOM 3789  O OD1   . ASN C 3 149 ? 199.004 102.200 149.796 1.00 56.00  ? 149 ASN C OD1   1 
ATOM 3790  N ND2   . ASN C 3 149 ? 197.980 101.468 151.644 1.00 56.00  ? 149 ASN C ND2   1 
ATOM 3791  N N     . LYS C 3 150 ? 202.629 104.444 152.663 1.00 52.39  ? 150 LYS C N     1 
ATOM 3792  C CA    . LYS C 3 150 ? 203.363 105.467 153.392 1.00 52.39  ? 150 LYS C CA    1 
ATOM 3793  C C     . LYS C 3 150 ? 204.383 106.169 152.511 1.00 52.39  ? 150 LYS C C     1 
ATOM 3794  O O     . LYS C 3 150 ? 204.739 107.325 152.767 1.00 52.39  ? 150 LYS C O     1 
ATOM 3795  C CB    . LYS C 3 150 ? 204.049 104.846 154.604 1.00 52.39  ? 150 LYS C CB    1 
ATOM 3796  C CG    . LYS C 3 150 ? 204.833 105.811 155.465 1.00 52.39  ? 150 LYS C CG    1 
ATOM 3797  C CD    . LYS C 3 150 ? 203.971 106.915 156.023 1.00 52.39  ? 150 LYS C CD    1 
ATOM 3798  C CE    . LYS C 3 150 ? 204.794 107.819 156.925 1.00 52.39  ? 150 LYS C CE    1 
ATOM 3799  N NZ    . LYS C 3 150 ? 205.935 108.440 156.206 1.00 52.39  ? 150 LYS C NZ    1 
ATOM 3800  N N     . LEU C 3 151 ? 204.865 105.495 151.468 1.00 52.20  ? 151 LEU C N     1 
ATOM 3801  C CA    . LEU C 3 151 ? 205.828 106.111 150.563 1.00 52.20  ? 151 LEU C CA    1 
ATOM 3802  C C     . LEU C 3 151 ? 205.163 107.043 149.565 1.00 52.20  ? 151 LEU C C     1 
ATOM 3803  O O     . LEU C 3 151 ? 205.458 108.240 149.529 1.00 52.20  ? 151 LEU C O     1 
ATOM 3804  C CB    . LEU C 3 151 ? 206.595 105.027 149.813 1.00 52.20  ? 151 LEU C CB    1 
ATOM 3805  C CG    . LEU C 3 151 ? 207.443 105.579 148.673 1.00 52.20  ? 151 LEU C CG    1 
ATOM 3806  C CD1   . LEU C 3 151 ? 208.648 106.317 149.198 1.00 52.20  ? 151 LEU C CD1   1 
ATOM 3807  C CD2   . LEU C 3 151 ? 207.840 104.462 147.733 1.00 52.20  ? 151 LEU C CD2   1 
ATOM 3808  N N     . ALA C 3 152 ? 204.266 106.506 148.747 1.00 54.07  ? 152 ALA C N     1 
ATOM 3809  C CA    . ALA C 3 152 ? 203.663 107.271 147.664 1.00 54.07  ? 152 ALA C CA    1 
ATOM 3810  C C     . ALA C 3 152 ? 202.828 108.432 148.183 1.00 54.07  ? 152 ALA C C     1 
ATOM 3811  O O     . ALA C 3 152 ? 202.126 108.319 149.190 1.00 54.07  ? 152 ALA C O     1 
ATOM 3812  C CB    . ALA C 3 152 ? 202.814 106.356 146.793 1.00 54.07  ? 152 ALA C CB    1 
ATOM 3813  N N     . TRP C 3 153 ? 202.911 109.559 147.485 1.00 48.18  ? 153 TRP C N     1 
ATOM 3814  C CA    . TRP C 3 153 ? 202.109 110.722 147.823 1.00 48.18  ? 153 TRP C CA    1 
ATOM 3815  C C     . TRP C 3 153 ? 200.715 110.619 147.225 1.00 48.18  ? 153 TRP C C     1 
ATOM 3816  O O     . TRP C 3 153 ? 200.503 110.031 146.163 1.00 48.18  ? 153 TRP C O     1 
ATOM 3817  C CB    . TRP C 3 153 ? 202.783 111.990 147.324 1.00 48.18  ? 153 TRP C CB    1 
ATOM 3818  C CG    . TRP C 3 153 ? 204.060 112.281 147.971 1.00 48.18  ? 153 TRP C CG    1 
ATOM 3819  C CD1   . TRP C 3 153 ? 205.279 111.830 147.609 1.00 48.18  ? 153 TRP C CD1   1 
ATOM 3820  C CD2   . TRP C 3 153 ? 204.272 113.218 149.026 1.00 48.18  ? 153 TRP C CD2   1 
ATOM 3821  N NE1   . TRP C 3 153 ? 206.241 112.368 148.423 1.00 48.18  ? 153 TRP C NE1   1 
ATOM 3822  C CE2   . TRP C 3 153 ? 205.643 113.235 149.297 1.00 48.18  ? 153 TRP C CE2   1 
ATOM 3823  C CE3   . TRP C 3 153 ? 203.427 114.026 149.786 1.00 48.18  ? 153 TRP C CE3   1 
ATOM 3824  C CZ2   . TRP C 3 153 ? 206.192 114.023 150.297 1.00 48.18  ? 153 TRP C CZ2   1 
ATOM 3825  C CZ3   . TRP C 3 153 ? 203.971 114.807 150.777 1.00 48.18  ? 153 TRP C CZ3   1 
ATOM 3826  C CH2   . TRP C 3 153 ? 205.338 114.803 151.025 1.00 48.18  ? 153 TRP C CH2   1 
ATOM 3827  N N     . GLY C 3 154 ? 199.759 111.195 147.939 1.00 54.42  ? 154 GLY C N     1 
ATOM 3828  C CA    . GLY C 3 154 ? 198.361 111.089 147.601 1.00 54.42  ? 154 GLY C CA    1 
ATOM 3829  C C     . GLY C 3 154 ? 197.730 109.769 147.967 1.00 54.42  ? 154 GLY C C     1 
ATOM 3830  O O     . GLY C 3 154 ? 196.545 109.563 147.676 1.00 54.42  ? 154 GLY C O     1 
ATOM 3831  N N     . ARG C 3 155 ? 198.481 108.862 148.575 1.00 54.29  ? 155 ARG C N     1 
ATOM 3832  C CA    . ARG C 3 155 ? 197.981 107.564 148.995 1.00 54.29  ? 155 ARG C CA    1 
ATOM 3833  C C     . ARG C 3 155 ? 197.929 107.565 150.517 1.00 54.29  ? 155 ARG C C     1 
ATOM 3834  O O     . ARG C 3 155 ? 198.939 107.830 151.174 1.00 54.29  ? 155 ARG C O     1 
ATOM 3835  C CB    . ARG C 3 155 ? 198.846 106.436 148.438 1.00 54.29  ? 155 ARG C CB    1 
ATOM 3836  C CG    . ARG C 3 155 ? 198.843 106.402 146.914 1.00 54.29  ? 155 ARG C CG    1 
ATOM 3837  C CD    . ARG C 3 155 ? 199.698 105.288 146.346 1.00 54.29  ? 155 ARG C CD    1 
ATOM 3838  N NE    . ARG C 3 155 ? 199.323 103.970 146.834 1.00 54.29  ? 155 ARG C NE    1 
ATOM 3839  C CZ    . ARG C 3 155 ? 198.371 103.233 146.285 1.00 54.29  ? 155 ARG C CZ    1 
ATOM 3840  N NH1   . ARG C 3 155 ? 197.708 103.691 145.234 1.00 54.29  ? 155 ARG C NH1   1 
ATOM 3841  N NH2   . ARG C 3 155 ? 198.086 102.037 146.780 1.00 54.29  ? 155 ARG C NH2   1 
ATOM 3842  N N     . THR C 3 156 ? 196.753 107.287 151.066 1.00 53.46  ? 156 THR C N     1 
ATOM 3843  C CA    . THR C 3 156 ? 196.483 107.390 152.500 1.00 53.46  ? 156 THR C CA    1 
ATOM 3844  C C     . THR C 3 156 ? 197.293 106.353 153.272 1.00 53.46  ? 156 THR C C     1 
ATOM 3845  O O     . THR C 3 156 ? 197.033 105.151 153.159 1.00 53.46  ? 156 THR C O     1 
ATOM 3846  C CB    . THR C 3 156 ? 194.992 107.217 152.750 1.00 53.46  ? 156 THR C CB    1 
ATOM 3847  O OG1   . THR C 3 156 ? 194.638 105.840 152.573 1.00 53.46  ? 156 THR C OG1   1 
ATOM 3848  C CG2   . THR C 3 156 ? 194.211 108.061 151.780 1.00 53.46  ? 156 THR C CG2   1 
ATOM 3849  N N     . ALA C 3 157 ? 198.277 106.805 154.048 1.00 53.31  ? 157 ALA C N     1 
ATOM 3850  C CA    . ALA C 3 157 ? 199.122 105.891 154.809 1.00 53.31  ? 157 ALA C CA    1 
ATOM 3851  C C     . ALA C 3 157 ? 198.341 105.293 155.982 1.00 53.31  ? 157 ALA C C     1 
ATOM 3852  O O     . ALA C 3 157 ? 197.139 105.508 156.139 1.00 53.31  ? 157 ALA C O     1 
ATOM 3853  C CB    . ALA C 3 157 ? 200.385 106.603 155.278 1.00 53.31  ? 157 ALA C CB    1 
ATOM 3854  N N     . GLY C 3 158 ? 199.043 104.523 156.821 1.00 52.87  ? 158 GLY C N     1 
ATOM 3855  C CA    . GLY C 3 158 ? 198.367 103.717 157.829 1.00 52.87  ? 158 GLY C CA    1 
ATOM 3856  C C     . GLY C 3 158 ? 197.334 104.434 158.676 1.00 52.87  ? 158 GLY C C     1 
ATOM 3857  O O     . GLY C 3 158 ? 196.198 103.979 158.797 1.00 52.87  ? 158 GLY C O     1 
ATOM 3858  N N     . GLU C 3 159 ? 197.709 105.533 159.314 1.00 55.01  ? 159 GLU C N     1 
ATOM 3859  C CA    . GLU C 3 159 ? 196.712 106.145 160.189 1.00 55.01  ? 159 GLU C CA    1 
ATOM 3860  C C     . GLU C 3 159 ? 195.904 107.242 159.497 1.00 55.01  ? 159 GLU C C     1 
ATOM 3861  O O     . GLU C 3 159 ? 194.923 107.717 160.072 1.00 55.01  ? 159 GLU C O     1 
ATOM 3862  C CB    . GLU C 3 159 ? 197.284 106.531 161.560 1.00 55.01  ? 159 GLU C CB    1 
ATOM 3863  C CG    . GLU C 3 159 ? 198.249 107.600 161.670 1.00 55.01  ? 159 GLU C CG    1 
ATOM 3864  C CD    . GLU C 3 159 ? 197.752 108.921 161.225 1.00 55.01  ? 159 GLU C CD    1 
ATOM 3865  O OE1   . GLU C 3 159 ? 196.551 109.221 161.337 1.00 55.01  ? 159 GLU C OE1   1 
ATOM 3866  O OE2   . GLU C 3 159 ? 198.576 109.627 160.665 1.00 55.01  ? 159 GLU C OE2   1 
ATOM 3867  N N     . ASN C 3 160 ? 196.316 107.703 158.319 1.00 51.75  ? 160 ASN C N     1 
ATOM 3868  C CA    . ASN C 3 160 ? 195.586 108.773 157.655 1.00 51.75  ? 160 ASN C CA    1 
ATOM 3869  C C     . ASN C 3 160 ? 194.126 108.358 157.475 1.00 51.75  ? 160 ASN C C     1 
ATOM 3870  O O     . ASN C 3 160 ? 193.754 107.195 157.638 1.00 51.75  ? 160 ASN C O     1 
ATOM 3871  C CB    . ASN C 3 160 ? 196.215 109.123 156.309 1.00 51.75  ? 160 ASN C CB    1 
ATOM 3872  C CG    . ASN C 3 160 ? 197.648 109.593 156.439 1.00 51.75  ? 160 ASN C CG    1 
ATOM 3873  O OD1   . ASN C 3 160 ? 198.566 108.968 155.922 1.00 51.75  ? 160 ASN C OD1   1 
ATOM 3874  N ND2   . ASN C 3 160 ? 197.845 110.697 157.150 1.00 51.75  ? 160 ASN C ND2   1 
ATOM 3875  N N     . GLN C 3 161 ? 193.298 109.326 157.108 1.00 47.52  ? 161 GLN C N     1 
ATOM 3876  C CA    . GLN C 3 161 ? 191.854 109.180 157.198 1.00 47.52  ? 161 GLN C CA    1 
ATOM 3877  C C     . GLN C 3 161 ? 191.201 108.488 156.004 1.00 47.52  ? 161 GLN C C     1 
ATOM 3878  O O     . GLN C 3 161 ? 189.977 108.355 155.998 1.00 47.52  ? 161 GLN C O     1 
ATOM 3879  C CB    . GLN C 3 161 ? 191.224 110.554 157.403 1.00 47.52  ? 161 GLN C CB    1 
ATOM 3880  C CG    . GLN C 3 161 ? 191.598 111.218 158.720 1.00 47.52  ? 161 GLN C CG    1 
ATOM 3881  C CD    . GLN C 3 161 ? 190.912 110.597 159.902 1.00 47.52  ? 161 GLN C CD    1 
ATOM 3882  O OE1   . GLN C 3 161 ? 189.771 110.176 159.822 1.00 47.52  ? 161 GLN C OE1   1 
ATOM 3883  N NE2   . GLN C 3 161 ? 191.605 110.554 161.021 1.00 47.52  ? 161 GLN C NE2   1 
ATOM 3884  N N     . VAL C 3 162 ? 191.965 108.055 155.001 1.00 50.85  ? 162 VAL C N     1 
ATOM 3885  C CA    . VAL C 3 162 ? 191.460 107.271 153.865 1.00 50.85  ? 162 VAL C CA    1 
ATOM 3886  C C     . VAL C 3 162 ? 190.490 108.003 152.944 1.00 50.85  ? 162 VAL C C     1 
ATOM 3887  O O     . VAL C 3 162 ? 190.196 107.533 151.837 1.00 50.85  ? 162 VAL C O     1 
ATOM 3888  C CB    . VAL C 3 162 ? 190.781 105.982 154.384 1.00 50.85  ? 162 VAL C CB    1 
ATOM 3889  C CG1   . VAL C 3 162 ? 190.452 105.028 153.276 1.00 50.85  ? 162 VAL C CG1   1 
ATOM 3890  C CG2   . VAL C 3 162 ? 191.663 105.274 155.370 1.00 50.85  ? 162 VAL C CG2   1 
ATOM 3891  N N     . TRP C 3 163 ? 189.983 109.151 153.376 1.00 48.88  ? 163 TRP C N     1 
ATOM 3892  C CA    . TRP C 3 163 ? 188.873 109.747 152.648 1.00 48.88  ? 163 TRP C CA    1 
ATOM 3893  C C     . TRP C 3 163 ? 189.202 110.037 151.194 1.00 48.88  ? 163 TRP C C     1 
ATOM 3894  O O     . TRP C 3 163 ? 188.495 109.593 150.287 1.00 48.88  ? 163 TRP C O     1 
ATOM 3895  C CB    . TRP C 3 163 ? 188.398 111.020 153.311 1.00 48.88  ? 163 TRP C CB    1 
ATOM 3896  C CG    . TRP C 3 163 ? 187.130 111.354 152.667 1.00 48.88  ? 163 TRP C CG    1 
ATOM 3897  C CD1   . TRP C 3 163 ? 186.887 112.320 151.744 1.00 48.88  ? 163 TRP C CD1   1 
ATOM 3898  C CD2   . TRP C 3 163 ? 185.915 110.637 152.829 1.00 48.88  ? 163 TRP C CD2   1 
ATOM 3899  N NE1   . TRP C 3 163 ? 185.568 112.281 151.363 1.00 48.88  ? 163 TRP C NE1   1 
ATOM 3900  C CE2   . TRP C 3 163 ? 184.954 111.247 152.014 1.00 48.88  ? 163 TRP C CE2   1 
ATOM 3901  C CE3   . TRP C 3 163 ? 185.538 109.552 153.620 1.00 48.88  ? 163 TRP C CE3   1 
ATOM 3902  C CZ2   . TRP C 3 163 ? 183.647 110.806 151.965 1.00 48.88  ? 163 TRP C CZ2   1 
ATOM 3903  C CZ3   . TRP C 3 163 ? 184.256 109.106 153.556 1.00 48.88  ? 163 TRP C CZ3   1 
ATOM 3904  C CH2   . TRP C 3 163 ? 183.317 109.734 152.742 1.00 48.88  ? 163 TRP C CH2   1 
ATOM 3905  N N     . LEU C 3 164 ? 190.288 110.747 150.946 1.00 48.16  ? 164 LEU C N     1 
ATOM 3906  C CA    . LEU C 3 164 ? 190.559 111.211 149.601 1.00 48.16  ? 164 LEU C CA    1 
ATOM 3907  C C     . LEU C 3 164 ? 191.805 110.560 149.031 1.00 48.16  ? 164 LEU C C     1 
ATOM 3908  O O     . LEU C 3 164 ? 192.605 109.936 149.729 1.00 48.16  ? 164 LEU C O     1 
ATOM 3909  C CB    . LEU C 3 164 ? 190.677 112.737 149.550 1.00 48.16  ? 164 LEU C CB    1 
ATOM 3910  C CG    . LEU C 3 164 ? 191.537 113.475 150.564 1.00 48.16  ? 164 LEU C CG    1 
ATOM 3911  C CD1   . LEU C 3 164 ? 192.962 113.512 150.066 1.00 48.16  ? 164 LEU C CD1   1 
ATOM 3912  C CD2   . LEU C 3 164 ? 191.008 114.877 150.797 1.00 48.16  ? 164 LEU C CD2   1 
ATOM 3913  N N     . GLY C 3 165 ? 191.938 110.732 147.723 1.00 50.94  ? 165 GLY C N     1 
ATOM 3914  C CA    . GLY C 3 165 ? 193.016 110.188 146.929 1.00 50.94  ? 165 GLY C CA    1 
ATOM 3915  C C     . GLY C 3 165 ? 192.942 108.688 146.795 1.00 50.94  ? 165 GLY C C     1 
ATOM 3916  O O     . GLY C 3 165 ? 193.974 108.014 146.849 1.00 50.94  ? 165 GLY C O     1 
ATOM 3917  N N     . GLY C 3 166 ? 191.741 108.149 146.613 1.00 51.93  ? 166 GLY C N     1 
ATOM 3918  C CA    . GLY C 3 166 ? 191.599 106.717 146.500 1.00 51.93  ? 166 GLY C CA    1 
ATOM 3919  C C     . GLY C 3 166 ? 191.646 106.135 147.888 1.00 51.93  ? 166 GLY C C     1 
ATOM 3920  O O     . GLY C 3 166 ? 192.500 106.519 148.688 1.00 51.93  ? 166 GLY C O     1 
ATOM 3921  N N     . HIS C 3 167 ? 190.747 105.226 148.208 1.00 53.22  ? 167 HIS C N     1 
ATOM 3922  C CA    . HIS C 3 167 ? 190.785 104.638 149.530 1.00 53.22  ? 167 HIS C CA    1 
ATOM 3923  C C     . HIS C 3 167 ? 191.768 103.473 149.532 1.00 53.22  ? 167 HIS C C     1 
ATOM 3924  O O     . HIS C 3 167 ? 191.695 102.594 148.670 1.00 53.22  ? 167 HIS C O     1 
ATOM 3925  C CB    . HIS C 3 167 ? 189.385 104.177 149.919 1.00 53.22  ? 167 HIS C CB    1 
ATOM 3926  C CG    . HIS C 3 167 ? 188.322 105.202 149.662 1.00 53.22  ? 167 HIS C CG    1 
ATOM 3927  N ND1   . HIS C 3 167 ? 188.241 106.385 150.361 1.00 53.22  ? 167 HIS C ND1   1 
ATOM 3928  C CD2   . HIS C 3 167 ? 187.306 105.225 148.767 1.00 53.22  ? 167 HIS C CD2   1 
ATOM 3929  C CE1   . HIS C 3 167 ? 187.212 107.085 149.918 1.00 53.22  ? 167 HIS C CE1   1 
ATOM 3930  N NE2   . HIS C 3 167 ? 186.630 106.404 148.949 1.00 53.22  ? 167 HIS C NE2   1 
ATOM 3931  N N     . HIS C 3 168 ? 192.690 103.470 150.494 1.00 56.66  ? 168 HIS C N     1 
ATOM 3932  C CA    . HIS C 3 168 ? 193.682 102.406 150.615 1.00 56.66  ? 168 HIS C CA    1 
ATOM 3933  C C     . HIS C 3 168 ? 193.731 102.009 152.080 1.00 56.66  ? 168 HIS C C     1 
ATOM 3934  O O     . HIS C 3 168 ? 194.257 102.755 152.912 1.00 56.66  ? 168 HIS C O     1 
ATOM 3935  C CB    . HIS C 3 168 ? 195.058 102.857 150.135 1.00 56.66  ? 168 HIS C CB    1 
ATOM 3936  C CG    . HIS C 3 168 ? 195.063 103.410 148.748 1.00 56.66  ? 168 HIS C CG    1 
ATOM 3937  N ND1   . HIS C 3 168 ? 195.046 102.608 147.628 1.00 56.66  ? 168 HIS C ND1   1 
ATOM 3938  C CD2   . HIS C 3 168 ? 195.143 104.683 148.298 1.00 56.66  ? 168 HIS C CD2   1 
ATOM 3939  C CE1   . HIS C 3 168 ? 195.070 103.366 146.548 1.00 56.66  ? 168 HIS C CE1   1 
ATOM 3940  N NE2   . HIS C 3 168 ? 195.139 104.628 146.927 1.00 56.66  ? 168 HIS C NE2   1 
ATOM 3941  N N     . HIS C 3 169 ? 193.193 100.833 152.394 1.00 59.07  ? 169 HIS C N     1 
ATOM 3942  C CA    . HIS C 3 169 ? 193.055 100.428 153.784 1.00 59.07  ? 169 HIS C CA    1 
ATOM 3943  C C     . HIS C 3 169 ? 194.349 99.996  154.422 1.00 59.07  ? 169 HIS C C     1 
ATOM 3944  O O     . HIS C 3 169 ? 194.306 99.480  155.538 1.00 59.07  ? 169 HIS C O     1 
ATOM 3945  C CB    . HIS C 3 169 ? 192.085 99.267  153.871 1.00 59.07  ? 169 HIS C CB    1 
ATOM 3946  C CG    . HIS C 3 169 ? 190.840 99.486  153.089 1.00 59.07  ? 169 HIS C CG    1 
ATOM 3947  N ND1   . HIS C 3 169 ? 189.895 100.416 153.453 1.00 59.07  ? 169 HIS C ND1   1 
ATOM 3948  C CD2   . HIS C 3 169 ? 190.387 98.903  151.956 1.00 59.07  ? 169 HIS C CD2   1 
ATOM 3949  C CE1   . HIS C 3 169 ? 188.910 100.398 152.575 1.00 59.07  ? 169 HIS C CE1   1 
ATOM 3950  N NE2   . HIS C 3 169 ? 189.181 99.486  151.659 1.00 59.07  ? 169 HIS C NE2   1 
ATOM 3951  N N     . ASP C 3 170 ? 195.469 100.063 153.720 1.00 65.68  ? 170 ASP C N     1 
ATOM 3952  C CA    . ASP C 3 170 ? 196.752 99.595  154.225 1.00 65.68  ? 170 ASP C CA    1 
ATOM 3953  C C     . ASP C 3 170 ? 196.694 98.100  154.506 1.00 65.68  ? 170 ASP C C     1 
ATOM 3954  O O     . ASP C 3 170 ? 197.627 97.538  155.086 1.00 65.68  ? 170 ASP C O     1 
ATOM 3955  C CB    . ASP C 3 170 ? 197.182 100.382 155.475 1.00 65.68  ? 170 ASP C CB    1 
ATOM 3956  C CG    . ASP C 3 170 ? 198.653 100.233 155.791 1.00 65.68  ? 170 ASP C CG    1 
ATOM 3957  O OD1   . ASP C 3 170 ? 199.485 100.819 155.067 1.00 65.68  ? 170 ASP C OD1   1 
ATOM 3958  O OD2   . ASP C 3 170 ? 198.978 99.541  156.776 1.00 65.68  ? 170 ASP C OD2   1 
ATOM 3959  N N     . LEU C 3 171 ? 195.595 97.456  154.115 1.00 71.37  ? 171 LEU C N     1 
ATOM 3960  C CA    . LEU C 3 171 ? 195.397 96.017  154.187 1.00 71.37  ? 171 LEU C CA    1 
ATOM 3961  C C     . LEU C 3 171 ? 195.122 95.535  152.771 1.00 71.37  ? 171 LEU C C     1 
ATOM 3962  O O     . LEU C 3 171 ? 194.222 96.062  152.116 1.00 71.37  ? 171 LEU C O     1 
ATOM 3963  C CB    . LEU C 3 171 ? 194.245 95.682  155.132 1.00 71.37  ? 171 LEU C CB    1 
ATOM 3964  C CG    . LEU C 3 171 ? 194.655 95.619  156.607 1.00 71.37  ? 171 LEU C CG    1 
ATOM 3965  C CD1   . LEU C 3 171 ? 193.466 95.384  157.529 1.00 71.37  ? 171 LEU C CD1   1 
ATOM 3966  C CD2   . LEU C 3 171 ? 195.703 94.541  156.813 1.00 71.37  ? 171 LEU C CD2   1 
ATOM 3967  N N     . ASP C 3 172 ? 195.961 94.622  152.280 1.00 72.91  ? 172 ASP C N     1 
ATOM 3968  C CA    . ASP C 3 172 ? 196.112 94.091  150.921 1.00 72.91  ? 172 ASP C CA    1 
ATOM 3969  C C     . ASP C 3 172 ? 196.155 95.263  149.940 1.00 72.91  ? 172 ASP C C     1 
ATOM 3970  O O     . ASP C 3 172 ? 195.290 95.391  149.066 1.00 72.91  ? 172 ASP C O     1 
ATOM 3971  C CB    . ASP C 3 172 ? 195.063 93.000  150.577 1.00 72.91  ? 172 ASP C CB    1 
ATOM 3972  C CG    . ASP C 3 172 ? 193.608 93.498  150.404 1.00 72.91  ? 172 ASP C CG    1 
ATOM 3973  O OD1   . ASP C 3 172 ? 193.287 94.691  150.460 1.00 72.91  ? 172 ASP C OD1   1 
ATOM 3974  O OD2   . ASP C 3 172 ? 192.739 92.627  150.206 1.00 72.91  ? 172 ASP C OD2   1 
ATOM 3975  N N     . PRO C 3 173 ? 197.198 96.089  149.998 1.00 68.37  ? 173 PRO C N     1 
ATOM 3976  C CA    . PRO C 3 173 ? 197.287 97.231  149.085 1.00 68.37  ? 173 PRO C CA    1 
ATOM 3977  C C     . PRO C 3 173 ? 197.760 96.806  147.708 1.00 68.37  ? 173 PRO C C     1 
ATOM 3978  O O     . PRO C 3 173 ? 198.665 95.981  147.565 1.00 68.37  ? 173 PRO C O     1 
ATOM 3979  C CB    . PRO C 3 173 ? 198.305 98.151  149.771 1.00 68.37  ? 173 PRO C CB    1 
ATOM 3980  C CG    . PRO C 3 173 ? 199.190 97.226  150.503 1.00 68.37  ? 173 PRO C CG    1 
ATOM 3981  C CD    . PRO C 3 173 ? 198.337 96.053  150.933 1.00 68.37  ? 173 PRO C CD    1 
ATOM 3982  N N     . HIS C 3 174 ? 197.117 97.349  146.689 1.00 64.26  ? 174 HIS C N     1 
ATOM 3983  C CA    . HIS C 3 174 ? 197.500 97.015  145.329 1.00 64.26  ? 174 HIS C CA    1 
ATOM 3984  C C     . HIS C 3 174 ? 198.892 97.586  145.086 1.00 64.26  ? 174 HIS C C     1 
ATOM 3985  O O     . HIS C 3 174 ? 199.115 98.783  145.316 1.00 64.26  ? 174 HIS C O     1 
ATOM 3986  C CB    . HIS C 3 174 ? 196.480 97.538  144.321 1.00 64.26  ? 174 HIS C CB    1 
ATOM 3987  C CG    . HIS C 3 174 ? 196.541 99.016  144.102 1.00 64.26  ? 174 HIS C CG    1 
ATOM 3988  N ND1   . HIS C 3 174 ? 195.951 99.921  144.958 1.00 64.26  ? 174 HIS C ND1   1 
ATOM 3989  C CD2   . HIS C 3 174 ? 197.163 99.750  143.151 1.00 64.26  ? 174 HIS C CD2   1 
ATOM 3990  C CE1   . HIS C 3 174 ? 196.175 101.146 144.521 1.00 64.26  ? 174 HIS C CE1   1 
ATOM 3991  N NE2   . HIS C 3 174 ? 196.914 101.071 143.430 1.00 64.26  ? 174 HIS C NE2   1 
ATOM 3992  N N     . PRO C 3 175 ? 199.861 96.768  144.705 1.00 61.49  ? 175 PRO C N     1 
ATOM 3993  C CA    . PRO C 3 175 ? 201.230 97.265  144.547 1.00 61.49  ? 175 PRO C CA    1 
ATOM 3994  C C     . PRO C 3 175 ? 201.405 98.206  143.369 1.00 61.49  ? 175 PRO C C     1 
ATOM 3995  O O     . PRO C 3 175 ? 200.929 97.943  142.265 1.00 61.49  ? 175 PRO C O     1 
ATOM 3996  C CB    . PRO C 3 175 ? 202.033 95.980  144.335 1.00 61.49  ? 175 PRO C CB    1 
ATOM 3997  C CG    . PRO C 3 175 ? 201.054 95.021  143.771 1.00 61.49  ? 175 PRO C CG    1 
ATOM 3998  C CD    . PRO C 3 175 ? 199.755 95.329  144.428 1.00 61.49  ? 175 PRO C CD    1 
ATOM 3999  N N     . LEU C 3 176 ? 202.126 99.297  143.614 1.00 58.32  ? 176 LEU C N     1 
ATOM 4000  C CA    . LEU C 3 176 ? 202.439 100.263 142.568 1.00 58.32  ? 176 LEU C CA    1 
ATOM 4001  C C     . LEU C 3 176 ? 203.307 99.623  141.499 1.00 58.32  ? 176 LEU C C     1 
ATOM 4002  O O     . LEU C 3 176 ? 204.156 98.781  141.790 1.00 58.32  ? 176 LEU C O     1 
ATOM 4003  C CB    . LEU C 3 176 ? 203.178 101.469 143.137 1.00 58.32  ? 176 LEU C CB    1 
ATOM 4004  C CG    . LEU C 3 176 ? 202.473 102.484 144.021 1.00 58.32  ? 176 LEU C CG    1 
ATOM 4005  C CD1   . LEU C 3 176 ? 202.213 101.916 145.392 1.00 58.32  ? 176 LEU C CD1   1 
ATOM 4006  C CD2   . LEU C 3 176 ? 203.365 103.699 144.104 1.00 58.32  ? 176 LEU C CD2   1 
ATOM 4007  N N     . ASP C 3 177 ? 203.111 100.041 140.251 1.00 62.45  ? 177 ASP C N     1 
ATOM 4008  C CA    . ASP C 3 177 ? 204.118 99.747  139.241 1.00 62.45  ? 177 ASP C CA    1 
ATOM 4009  C C     . ASP C 3 177 ? 205.414 100.483 139.547 1.00 62.45  ? 177 ASP C C     1 
ATOM 4010  O O     . ASP C 3 177 ? 205.423 101.596 140.078 1.00 62.45  ? 177 ASP C O     1 
ATOM 4011  C CB    . ASP C 3 177 ? 203.625 100.111 137.843 1.00 62.45  ? 177 ASP C CB    1 
ATOM 4012  C CG    . ASP C 3 177 ? 202.459 99.256  137.396 1.00 62.45  ? 177 ASP C CG    1 
ATOM 4013  O OD1   . ASP C 3 177 ? 202.273 98.164  137.972 1.00 62.45  ? 177 ASP C OD1   1 
ATOM 4014  O OD2   . ASP C 3 177 ? 201.743 99.656  136.454 1.00 62.45  ? 177 ASP C OD2   1 
ATOM 4015  N N     . SER C 3 178 ? 206.517 99.823  139.203 1.00 59.42  ? 178 SER C N     1 
ATOM 4016  C CA    . SER C 3 178 ? 207.854 100.316 139.504 1.00 59.42  ? 178 SER C CA    1 
ATOM 4017  C C     . SER C 3 178 ? 208.107 101.740 139.019 1.00 59.42  ? 178 SER C C     1 
ATOM 4018  O O     . SER C 3 178 ? 208.752 102.525 139.716 1.00 59.42  ? 178 SER C O     1 
ATOM 4019  C CB    . SER C 3 178 ? 208.876 99.367  138.896 1.00 59.42  ? 178 SER C CB    1 
ATOM 4020  O OG    . SER C 3 178 ? 208.714 99.338  137.493 1.00 59.42  ? 178 SER C OG    1 
ATOM 4021  N N     . ALA C 3 179 ? 207.630 102.089 137.824 1.00 57.63  ? 179 ALA C N     1 
ATOM 4022  C CA    . ALA C 3 179 ? 207.838 103.443 137.311 1.00 57.63  ? 179 ALA C CA    1 
ATOM 4023  C C     . ALA C 3 179 ? 207.246 104.492 138.237 1.00 57.63  ? 179 ALA C C     1 
ATOM 4024  O O     . ALA C 3 179 ? 207.945 105.408 138.700 1.00 57.63  ? 179 ALA C O     1 
ATOM 4025  C CB    . ALA C 3 179 ? 207.240 103.573 135.912 1.00 57.63  ? 179 ALA C CB    1 
ATOM 4026  N N     . GLU C 3 180 ? 205.964 104.353 138.554 1.00 58.50  ? 180 GLU C N     1 
ATOM 4027  C CA    . GLU C 3 180 ? 205.358 105.293 139.480 1.00 58.50  ? 180 GLU C CA    1 
ATOM 4028  C C     . GLU C 3 180 ? 206.067 105.240 140.818 1.00 58.50  ? 180 GLU C C     1 
ATOM 4029  O O     . GLU C 3 180 ? 206.172 106.260 141.511 1.00 58.50  ? 180 GLU C O     1 
ATOM 4030  C CB    . GLU C 3 180 ? 203.872 104.981 139.613 1.00 58.50  ? 180 GLU C CB    1 
ATOM 4031  C CG    . GLU C 3 180 ? 203.051 105.454 138.424 1.00 58.50  ? 180 GLU C CG    1 
ATOM 4032  C CD    . GLU C 3 180 ? 203.245 104.613 137.174 1.00 58.50  ? 180 GLU C CD    1 
ATOM 4033  O OE1   . GLU C 3 180 ? 203.991 103.611 137.222 1.00 58.50  ? 180 GLU C OE1   1 
ATOM 4034  O OE2   . GLU C 3 180 ? 202.656 104.970 136.132 1.00 58.50  ? 180 GLU C OE2   1 
ATOM 4035  N N     . ALA C 3 181 ? 206.576 104.065 141.181 1.00 52.86  ? 181 ALA C N     1 
ATOM 4036  C CA    . ALA C 3 181 ? 207.351 103.942 142.404 1.00 52.86  ? 181 ALA C CA    1 
ATOM 4037  C C     . ALA C 3 181 ? 208.575 104.842 142.349 1.00 52.86  ? 181 ALA C C     1 
ATOM 4038  O O     . ALA C 3 181 ? 208.940 105.465 143.348 1.00 52.86  ? 181 ALA C O     1 
ATOM 4039  C CB    . ALA C 3 181 ? 207.755 102.490 142.627 1.00 52.86  ? 181 ALA C CB    1 
ATOM 4040  N N     . VAL C 3 182 ? 209.244 104.895 141.197 1.00 49.81  ? 182 VAL C N     1 
ATOM 4041  C CA    . VAL C 3 182 ? 210.381 105.794 141.052 1.00 49.81  ? 182 VAL C CA    1 
ATOM 4042  C C     . VAL C 3 182 ? 209.938 107.235 141.197 1.00 49.81  ? 182 VAL C C     1 
ATOM 4043  O O     . VAL C 3 182 ? 210.613 108.041 141.842 1.00 49.81  ? 182 VAL C O     1 
ATOM 4044  C CB    . VAL C 3 182 ? 211.077 105.572 139.699 1.00 49.81  ? 182 VAL C CB    1 
ATOM 4045  C CG1   . VAL C 3 182 ? 212.363 106.374 139.633 1.00 49.81  ? 182 VAL C CG1   1 
ATOM 4046  C CG2   . VAL C 3 182 ? 211.347 104.108 139.478 1.00 49.81  ? 182 VAL C CG2   1 
ATOM 4047  N N     . TRP C 3 183 ? 208.780 107.579 140.635 1.00 49.67  ? 183 TRP C N     1 
ATOM 4048  C CA    . TRP C 3 183 ? 208.295 108.952 140.770 1.00 49.67  ? 183 TRP C CA    1 
ATOM 4049  C C     . TRP C 3 183 ? 208.097 109.322 142.234 1.00 49.67  ? 183 TRP C C     1 
ATOM 4050  O O     . TRP C 3 183 ? 208.657 110.312 142.724 1.00 49.67  ? 183 TRP C O     1 
ATOM 4051  C CB    . TRP C 3 183 ? 207.001 109.114 139.984 1.00 49.67  ? 183 TRP C CB    1 
ATOM 4052  C CG    . TRP C 3 183 ? 207.192 108.845 138.549 1.00 49.67  ? 183 TRP C CG    1 
ATOM 4053  C CD1   . TRP C 3 183 ? 208.371 108.787 137.887 1.00 49.67  ? 183 TRP C CD1   1 
ATOM 4054  C CD2   . TRP C 3 183 ? 206.177 108.549 137.591 1.00 49.67  ? 183 TRP C CD2   1 
ATOM 4055  N NE1   . TRP C 3 183 ? 208.161 108.496 136.568 1.00 49.67  ? 183 TRP C NE1   1 
ATOM 4056  C CE2   . TRP C 3 183 ? 206.818 108.343 136.361 1.00 49.67  ? 183 TRP C CE2   1 
ATOM 4057  C CE3   . TRP C 3 183 ? 204.786 108.450 137.650 1.00 49.67  ? 183 TRP C CE3   1 
ATOM 4058  C CZ2   . TRP C 3 183 ? 206.118 108.044 135.200 1.00 49.67  ? 183 TRP C CZ2   1 
ATOM 4059  C CZ3   . TRP C 3 183 ? 204.094 108.150 136.494 1.00 49.67  ? 183 TRP C CZ3   1 
ATOM 4060  C CH2   . TRP C 3 183 ? 204.760 107.950 135.289 1.00 49.67  ? 183 TRP C CH2   1 
ATOM 4061  N N     . HIS C 3 184 ? 207.325 108.511 142.956 1.00 49.62  ? 184 HIS C N     1 
ATOM 4062  C CA    . HIS C 3 184 ? 207.069 108.792 144.359 1.00 49.62  ? 184 HIS C CA    1 
ATOM 4063  C C     . HIS C 3 184 ? 208.358 108.761 145.157 1.00 49.62  ? 184 HIS C C     1 
ATOM 4064  O O     . HIS C 3 184 ? 208.526 109.526 146.115 1.00 49.62  ? 184 HIS C O     1 
ATOM 4065  C CB    . HIS C 3 184 ? 206.071 107.777 144.905 1.00 49.62  ? 184 HIS C CB    1 
ATOM 4066  C CG    . HIS C 3 184 ? 204.722 107.862 144.270 1.00 49.62  ? 184 HIS C CG    1 
ATOM 4067  N ND1   . HIS C 3 184 ? 203.917 108.974 144.378 1.00 49.62  ? 184 HIS C ND1   1 
ATOM 4068  C CD2   . HIS C 3 184 ? 204.040 106.975 143.510 1.00 49.62  ? 184 HIS C CD2   1 
ATOM 4069  C CE1   . HIS C 3 184 ? 202.798 108.768 143.707 1.00 49.62  ? 184 HIS C CE1   1 
ATOM 4070  N NE2   . HIS C 3 184 ? 202.846 107.561 143.174 1.00 49.62  ? 184 HIS C NE2   1 
ATOM 4071  N N     . LEU C 3 185 ? 209.298 107.920 144.739 1.00 47.74  ? 185 LEU C N     1 
ATOM 4072  C CA    . LEU C 3 185 ? 210.590 107.857 145.401 1.00 47.74  ? 185 LEU C CA    1 
ATOM 4073  C C     . LEU C 3 185 ? 211.297 109.194 145.272 1.00 47.74  ? 185 LEU C C     1 
ATOM 4074  O O     . LEU C 3 185 ? 211.643 109.820 146.276 1.00 47.74  ? 185 LEU C O     1 
ATOM 4075  C CB    . LEU C 3 185 ? 211.410 106.721 144.802 1.00 47.74  ? 185 LEU C CB    1 
ATOM 4076  C CG    . LEU C 3 185 ? 212.879 106.530 145.144 1.00 47.74  ? 185 LEU C CG    1 
ATOM 4077  C CD1   . LEU C 3 185 ? 213.158 105.053 145.005 1.00 47.74  ? 185 LEU C CD1   1 
ATOM 4078  C CD2   . LEU C 3 185 ? 213.827 107.321 144.273 1.00 47.74  ? 185 LEU C CD2   1 
ATOM 4079  N N     . LEU C 3 186 ? 211.443 109.682 144.040 1.00 44.45  ? 186 LEU C N     1 
ATOM 4080  C CA    . LEU C 3 186 ? 212.113 110.955 143.821 1.00 44.45  ? 186 LEU C CA    1 
ATOM 4081  C C     . LEU C 3 186 ? 211.432 112.056 144.611 1.00 44.45  ? 186 LEU C C     1 
ATOM 4082  O O     . LEU C 3 186 ? 212.098 112.925 145.191 1.00 44.45  ? 186 LEU C O     1 
ATOM 4083  C CB    . LEU C 3 186 ? 212.112 111.302 142.336 1.00 44.45  ? 186 LEU C CB    1 
ATOM 4084  C CG    . LEU C 3 186 ? 213.172 110.764 141.382 1.00 44.45  ? 186 LEU C CG    1 
ATOM 4085  C CD1   . LEU C 3 186 ? 213.325 109.281 141.430 1.00 44.45  ? 186 LEU C CD1   1 
ATOM 4086  C CD2   . LEU C 3 186 ? 212.816 111.181 139.983 1.00 44.45  ? 186 LEU C CD2   1 
ATOM 4087  N N     . ALA C 3 187 ? 210.102 112.015 144.674 1.00 45.45  ? 187 ALA C N     1 
ATOM 4088  C CA    . ALA C 3 187 ? 209.377 113.000 145.461 1.00 45.45  ? 187 ALA C CA    1 
ATOM 4089  C C     . ALA C 3 187 ? 209.819 112.943 146.914 1.00 45.45  ? 187 ALA C C     1 
ATOM 4090  O O     . ALA C 3 187 ? 210.223 113.958 147.491 1.00 45.45  ? 187 ALA C O     1 
ATOM 4091  C CB    . ALA C 3 187 ? 207.874 112.765 145.340 1.00 45.45  ? 187 ALA C CB    1 
ATOM 4092  N N     . THR C 3 188 ? 209.806 111.743 147.507 1.00 44.67  ? 188 THR C N     1 
ATOM 4093  C CA    . THR C 3 188 ? 210.175 111.602 148.914 1.00 44.67  ? 188 THR C CA    1 
ATOM 4094  C C     . THR C 3 188 ? 211.612 112.027 149.175 1.00 44.67  ? 188 THR C C     1 
ATOM 4095  O O     . THR C 3 188 ? 211.903 112.614 150.220 1.00 44.67  ? 188 THR C O     1 
ATOM 4096  C CB    . THR C 3 188 ? 209.946 110.166 149.362 1.00 44.67  ? 188 THR C CB    1 
ATOM 4097  O OG1   . THR C 3 188 ? 210.455 109.281 148.363 1.00 44.67  ? 188 THR C OG1   1 
ATOM 4098  C CG2   . THR C 3 188 ? 208.476 109.907 149.562 1.00 44.67  ? 188 THR C CG2   1 
ATOM 4099  N N     . LEU C 3 189 ? 212.530 111.763 148.249 1.00 43.90  ? 189 LEU C N     1 
ATOM 4100  C CA    . LEU C 3 189 ? 213.874 112.281 148.474 1.00 43.90  ? 189 LEU C CA    1 
ATOM 4101  C C     . LEU C 3 189 ? 213.890 113.793 148.420 1.00 43.90  ? 189 LEU C C     1 
ATOM 4102  O O     . LEU C 3 189 ? 214.627 114.434 149.178 1.00 43.90  ? 189 LEU C O     1 
ATOM 4103  C CB    . LEU C 3 189 ? 214.868 111.725 147.467 1.00 43.90  ? 189 LEU C CB    1 
ATOM 4104  C CG    . LEU C 3 189 ? 215.377 110.296 147.517 1.00 43.90  ? 189 LEU C CG    1 
ATOM 4105  C CD1   . LEU C 3 189 ? 214.405 109.248 147.089 1.00 43.90  ? 189 LEU C CD1   1 
ATOM 4106  C CD2   . LEU C 3 189 ? 216.581 110.307 146.610 1.00 43.90  ? 189 LEU C CD2   1 
ATOM 4107  N N     . GLY C 3 190 ? 213.072 114.383 147.567 1.00 45.21  ? 190 GLY C N     1 
ATOM 4108  C CA    . GLY C 3 190 ? 212.975 115.818 147.624 1.00 45.21  ? 190 GLY C CA    1 
ATOM 4109  C C     . GLY C 3 190 ? 212.158 116.222 148.827 1.00 45.21  ? 190 GLY C C     1 
ATOM 4110  O O     . GLY C 3 190 ? 212.667 116.286 149.948 1.00 45.21  ? 190 GLY C O     1 
ATOM 4111  N N     . TYR C 3 191 ? 210.877 116.466 148.606 1.00 43.37  ? 191 TYR C N     1 
ATOM 4112  C CA    . TYR C 3 191 ? 209.958 116.766 149.688 1.00 43.37  ? 191 TYR C CA    1 
ATOM 4113  C C     . TYR C 3 191 ? 209.588 115.494 150.438 1.00 43.37  ? 191 TYR C C     1 
ATOM 4114  O O     . TYR C 3 191 ? 209.225 114.486 149.830 1.00 43.37  ? 191 TYR C O     1 
ATOM 4115  C CB    . TYR C 3 191 ? 208.726 117.431 149.102 1.00 43.37  ? 191 TYR C CB    1 
ATOM 4116  C CG    . TYR C 3 191 ? 209.081 118.544 148.149 1.00 43.37  ? 191 TYR C CG    1 
ATOM 4117  C CD1   . TYR C 3 191 ? 209.453 119.787 148.620 1.00 43.37  ? 191 TYR C CD1   1 
ATOM 4118  C CD2   . TYR C 3 191 ? 209.064 118.345 146.774 1.00 43.37  ? 191 TYR C CD2   1 
ATOM 4119  C CE1   . TYR C 3 191 ? 209.784 120.811 147.750 1.00 43.37  ? 191 TYR C CE1   1 
ATOM 4120  C CE2   . TYR C 3 191 ? 209.391 119.356 145.897 1.00 43.37  ? 191 TYR C CE2   1 
ATOM 4121  C CZ    . TYR C 3 191 ? 209.753 120.590 146.393 1.00 43.37  ? 191 TYR C CZ    1 
ATOM 4122  O OH    . TYR C 3 191 ? 210.079 121.626 145.553 1.00 43.37  ? 191 TYR C OH    1 
ATOM 4123  N N     . GLY C 3 192 ? 209.635 115.554 151.758 1.00 45.75  ? 192 GLY C N     1 
ATOM 4124  C CA    . GLY C 3 192 ? 209.357 114.397 152.569 1.00 45.75  ? 192 GLY C CA    1 
ATOM 4125  C C     . GLY C 3 192 ? 208.826 114.805 153.922 1.00 45.75  ? 192 GLY C C     1 
ATOM 4126  O O     . GLY C 3 192 ? 209.232 115.826 154.482 1.00 45.75  ? 192 GLY C O     1 
ATOM 4127  N N     . PRO C 3 193 ? 207.885 114.040 154.464 1.00 46.66  ? 193 PRO C N     1 
ATOM 4128  C CA    . PRO C 3 193 ? 207.339 114.400 155.772 1.00 46.66  ? 193 PRO C CA    1 
ATOM 4129  C C     . PRO C 3 193 ? 208.440 114.490 156.813 1.00 46.66  ? 193 PRO C C     1 
ATOM 4130  O O     . PRO C 3 193 ? 209.266 113.588 156.950 1.00 46.66  ? 193 PRO C O     1 
ATOM 4131  C CB    . PRO C 3 193 ? 206.378 113.248 156.076 1.00 46.66  ? 193 PRO C CB    1 
ATOM 4132  C CG    . PRO C 3 193 ? 206.025 112.700 154.746 1.00 46.66  ? 193 PRO C CG    1 
ATOM 4133  C CD    . PRO C 3 193 ? 207.248 112.838 153.908 1.00 46.66  ? 193 PRO C CD    1 
ATOM 4134  N N     . SER C 3 194 ? 208.412 115.572 157.581 1.00 49.17  ? 194 SER C N     1 
ATOM 4135  C CA    . SER C 3 194 ? 209.352 115.798 158.668 1.00 49.17  ? 194 SER C CA    1 
ATOM 4136  C C     . SER C 3 194 ? 208.947 115.068 159.930 1.00 49.17  ? 194 SER C C     1 
ATOM 4137  O O     . SER C 3 194 ? 209.590 115.238 160.968 1.00 49.17  ? 194 SER C O     1 
ATOM 4138  C CB    . SER C 3 194 ? 209.462 117.293 158.956 1.00 49.17  ? 194 SER C CB    1 
ATOM 4139  O OG    . SER C 3 194 ? 210.363 117.542 160.018 1.00 49.17  ? 194 SER C OG    1 
ATOM 4140  N N     . GLY C 3 195 ? 207.894 114.289 159.865 1.00 51.70  ? 195 GLY C N     1 
ATOM 4141  C CA    . GLY C 3 195 ? 207.401 113.605 161.031 1.00 51.70  ? 195 GLY C CA    1 
ATOM 4142  C C     . GLY C 3 195 ? 208.140 112.336 161.318 1.00 51.70  ? 195 GLY C C     1 
ATOM 4143  O O     . GLY C 3 195 ? 208.916 111.830 160.513 1.00 51.70  ? 195 GLY C O     1 
ATOM 4144  N N     . MET C 3 196 ? 207.890 111.817 162.506 1.00 53.45  ? 196 MET C N     1 
ATOM 4145  C CA    . MET C 3 196 ? 208.520 110.580 162.912 1.00 53.45  ? 196 MET C CA    1 
ATOM 4146  C C     . MET C 3 196 ? 207.900 109.412 162.157 1.00 53.45  ? 196 MET C C     1 
ATOM 4147  O O     . MET C 3 196 ? 206.698 109.387 161.890 1.00 53.45  ? 196 MET C O     1 
ATOM 4148  C CB    . MET C 3 196 ? 208.431 110.473 164.430 1.00 53.45  ? 196 MET C CB    1 
ATOM 4149  C CG    . MET C 3 196 ? 207.078 110.817 165.006 1.00 53.45  ? 196 MET C CG    1 
ATOM 4150  S SD    . MET C 3 196 ? 206.971 110.361 166.740 1.00 53.45  ? 196 MET C SD    1 
ATOM 4151  C CE    . MET C 3 196 ? 208.232 111.412 167.451 1.00 53.45  ? 196 MET C CE    1 
ATOM 4152  N N     . CYS C 3 197 ? 208.738 108.437 161.820 1.00 59.50  ? 197 CYS C N     1 
ATOM 4153  C CA    . CYS C 3 197 ? 208.310 107.273 161.057 1.00 59.50  ? 197 CYS C CA    1 
ATOM 4154  C C     . CYS C 3 197 ? 208.820 105.969 161.635 1.00 59.50  ? 197 CYS C C     1 
ATOM 4155  O O     . CYS C 3 197 ? 209.021 105.852 162.843 1.00 59.50  ? 197 CYS C O     1 
ATOM 4156  C CB    . CYS C 3 197 ? 208.788 107.394 159.610 1.00 59.50  ? 197 CYS C CB    1 
ATOM 4157  S SG    . CYS C 3 197 ? 207.978 106.255 158.463 1.00 59.50  ? 197 CYS C SG    1 
ATOM 4158  N N     . THR C 3 198 ? 208.997 104.973 160.778 1.00 58.60  ? 198 THR C N     1 
ATOM 4159  C CA    . THR C 3 198 ? 209.422 103.668 161.252 1.00 58.60  ? 198 THR C CA    1 
ATOM 4160  C C     . THR C 3 198 ? 210.831 103.763 161.820 1.00 58.60  ? 198 THR C C     1 
ATOM 4161  O O     . THR C 3 198 ? 211.701 104.426 161.256 1.00 58.60  ? 198 THR C O     1 
ATOM 4162  C CB    . THR C 3 198 ? 209.361 102.647 160.122 1.00 58.60  ? 198 THR C CB    1 
ATOM 4163  O OG1   . THR C 3 198 ? 208.022 102.584 159.617 1.00 58.60  ? 198 THR C OG1   1 
ATOM 4164  C CG2   . THR C 3 198 ? 209.745 101.268 160.632 1.00 58.60  ? 198 THR C CG2   1 
ATOM 4165  N N     . ALA C 3 199 ? 211.046 103.091 162.949 1.00 59.28  ? 199 ALA C N     1 
ATOM 4166  C CA    . ALA C 3 199 ? 212.311 103.147 163.667 1.00 59.28  ? 199 ALA C CA    1 
ATOM 4167  C C     . ALA C 3 199 ? 213.334 102.188 163.084 1.00 59.28  ? 199 ALA C C     1 
ATOM 4168  O O     . ALA C 3 199 ? 213.002 101.104 162.591 1.00 59.28  ? 199 ALA C O     1 
ATOM 4169  C CB    . ALA C 3 199 ? 212.109 102.811 165.142 1.00 59.28  ? 199 ALA C CB    1 
ATOM 4170  N N     . ARG C 3 200 ? 214.596 102.598 163.159 1.00 66.23  ? 200 ARG C N     1 
ATOM 4171  C CA    . ARG C 3 200 ? 215.711 101.773 162.719 1.00 66.23  ? 200 ARG C CA    1 
ATOM 4172  C C     . ARG C 3 200 ? 216.794 101.793 163.790 1.00 66.23  ? 200 ARG C C     1 
ATOM 4173  O O     . ARG C 3 200 ? 217.432 102.827 164.009 1.00 66.23  ? 200 ARG C O     1 
ATOM 4174  C CB    . ARG C 3 200 ? 216.264 102.297 161.396 1.00 66.23  ? 200 ARG C CB    1 
ATOM 4175  C CG    . ARG C 3 200 ? 217.469 101.546 160.921 1.00 66.23  ? 200 ARG C CG    1 
ATOM 4176  C CD    . ARG C 3 200 ? 218.055 102.098 159.628 1.00 66.23  ? 200 ARG C CD    1 
ATOM 4177  N NE    . ARG C 3 200 ? 218.628 103.428 159.795 1.00 66.23  ? 200 ARG C NE    1 
ATOM 4178  C CZ    . ARG C 3 200 ? 219.215 104.110 158.818 1.00 66.23  ? 200 ARG C CZ    1 
ATOM 4179  N NH1   . ARG C 3 200 ? 219.709 105.314 159.050 1.00 66.23  ? 200 ARG C NH1   1 
ATOM 4180  N NH2   . ARG C 3 200 ? 219.344 103.574 157.616 1.00 66.23  ? 200 ARG C NH2   1 
ATOM 4181  N N     . VAL C 3 201 ? 217.016 100.655 164.445 1.00 71.13  ? 201 VAL C N     1 
ATOM 4182  C CA    . VAL C 3 201 ? 218.088 100.557 165.426 1.00 71.13  ? 201 VAL C CA    1 
ATOM 4183  C C     . VAL C 3 201 ? 219.412 100.537 164.675 1.00 71.13  ? 201 VAL C C     1 
ATOM 4184  O O     . VAL C 3 201 ? 219.669 99.628  163.883 1.00 71.13  ? 201 VAL C O     1 
ATOM 4185  C CB    . VAL C 3 201 ? 217.920 99.298  166.284 1.00 71.13  ? 201 VAL C CB    1 
ATOM 4186  C CG1   . VAL C 3 201 ? 216.852 99.503  167.316 1.00 71.13  ? 201 VAL C CG1   1 
ATOM 4187  C CG2   . VAL C 3 201 ? 217.544 98.113  165.420 1.00 71.13  ? 201 VAL C CG2   1 
ATOM 4188  N N     . VAL C 3 202 ? 220.278 101.506 164.945 1.00 72.08  ? 202 VAL C N     1 
ATOM 4189  C CA    . VAL C 3 202 ? 221.612 101.541 164.340 1.00 72.08  ? 202 VAL C CA    1 
ATOM 4190  C C     . VAL C 3 202 ? 222.677 101.471 165.435 1.00 72.08  ? 202 VAL C C     1 
ATOM 4191  O O     . VAL C 3 202 ? 222.884 102.423 166.195 1.00 72.08  ? 202 VAL C O     1 
ATOM 4192  C CB    . VAL C 3 202 ? 221.796 102.724 163.372 1.00 72.08  ? 202 VAL C CB    1 
ATOM 4193  C CG1   . VAL C 3 202 ? 222.276 103.999 164.025 1.00 72.08  ? 202 VAL C CG1   1 
ATOM 4194  C CG2   . VAL C 3 202 ? 222.790 102.313 162.299 1.00 72.08  ? 202 VAL C CG2   1 
ATOM 4195  N N     . ARG C 3 203 ? 223.250 100.283 165.622 1.00 75.51  ? 203 ARG C N     1 
ATOM 4196  C CA    . ARG C 3 203 ? 224.249 100.042 166.668 1.00 75.51  ? 203 ARG C CA    1 
ATOM 4197  C C     . ARG C 3 203 ? 223.710 100.378 168.053 1.00 75.51  ? 203 ARG C C     1 
ATOM 4198  O O     . ARG C 3 203 ? 224.430 100.891 168.912 1.00 75.51  ? 203 ARG C O     1 
ATOM 4199  C CB    . ARG C 3 203 ? 225.528 100.841 166.405 1.00 75.51  ? 203 ARG C CB    1 
ATOM 4200  C CG    . ARG C 3 203 ? 226.256 100.499 165.126 1.00 75.51  ? 203 ARG C CG    1 
ATOM 4201  C CD    . ARG C 3 203 ? 227.524 101.315 165.044 1.00 75.51  ? 203 ARG C CD    1 
ATOM 4202  N NE    . ARG C 3 203 ? 227.261 102.747 165.008 1.00 75.51  ? 203 ARG C NE    1 
ATOM 4203  C CZ    . ARG C 3 203 ? 227.136 103.450 163.892 1.00 75.51  ? 203 ARG C CZ    1 
ATOM 4204  N NH1   . ARG C 3 203 ? 227.262 102.859 162.710 1.00 75.51  ? 203 ARG C NH1   1 
ATOM 4205  N NH2   . ARG C 3 203 ? 226.894 104.752 163.956 1.00 75.51  ? 203 ARG C NH2   1 
ATOM 4206  N N     . GLY C 3 204 ? 222.435 100.095 168.279 1.00 73.96  ? 204 GLY C N     1 
ATOM 4207  C CA    . GLY C 3 204 ? 221.851 100.284 169.584 1.00 73.96  ? 204 GLY C CA    1 
ATOM 4208  C C     . GLY C 3 204 ? 220.980 101.512 169.707 1.00 73.96  ? 204 GLY C C     1 
ATOM 4209  O O     . GLY C 3 204 ? 220.267 101.643 170.706 1.00 73.96  ? 204 GLY C O     1 
ATOM 4210  N N     . ARG C 3 205 ? 221.012 102.409 168.725 1.00 71.83  ? 205 ARG C N     1 
ATOM 4211  C CA    . ARG C 3 205 ? 220.279 103.664 168.784 1.00 71.83  ? 205 ARG C CA    1 
ATOM 4212  C C     . ARG C 3 205 ? 219.055 103.604 167.882 1.00 71.83  ? 205 ARG C C     1 
ATOM 4213  O O     . ARG C 3 205 ? 219.182 103.429 166.666 1.00 71.83  ? 205 ARG C O     1 
ATOM 4214  C CB    . ARG C 3 205 ? 221.185 104.821 168.362 1.00 71.83  ? 205 ARG C CB    1 
ATOM 4215  C CG    . ARG C 3 205 ? 220.620 106.204 168.623 1.00 71.83  ? 205 ARG C CG    1 
ATOM 4216  C CD    . ARG C 3 205 ? 221.709 107.246 168.445 1.00 71.83  ? 205 ARG C CD    1 
ATOM 4217  N NE    . ARG C 3 205 ? 221.199 108.612 168.493 1.00 71.83  ? 205 ARG C NE    1 
ATOM 4218  C CZ    . ARG C 3 205 ? 221.927 109.683 168.202 1.00 71.83  ? 205 ARG C CZ    1 
ATOM 4219  N NH1   . ARG C 3 205 ? 223.191 109.541 167.842 1.00 71.83  ? 205 ARG C NH1   1 
ATOM 4220  N NH2   . ARG C 3 205 ? 221.392 110.893 168.269 1.00 71.83  ? 205 ARG C NH2   1 
ATOM 4221  N N     . SER C 3 206 ? 217.871 103.743 168.479 1.00 71.44  ? 206 SER C N     1 
ATOM 4222  C CA    . SER C 3 206 ? 216.612 103.739 167.741 1.00 71.44  ? 206 SER C CA    1 
ATOM 4223  C C     . SER C 3 206 ? 215.898 105.042 168.052 1.00 71.44  ? 206 SER C C     1 
ATOM 4224  O O     . SER C 3 206 ? 215.396 105.224 169.165 1.00 71.44  ? 206 SER C O     1 
ATOM 4225  C CB    . SER C 3 206 ? 215.726 102.560 168.125 1.00 71.44  ? 206 SER C CB    1 
ATOM 4226  O OG    . SER C 3 206 ? 215.288 102.675 169.465 1.00 71.44  ? 206 SER C OG    1 
ATOM 4227  N N     . GLU C 3 207 ? 215.848 105.947 167.081 1.00 67.06  ? 207 GLU C N     1 
ATOM 4228  C CA    . GLU C 3 207 ? 215.099 107.195 167.207 1.00 67.06  ? 207 GLU C CA    1 
ATOM 4229  C C     . GLU C 3 207 ? 214.218 107.287 165.966 1.00 67.06  ? 207 GLU C C     1 
ATOM 4230  O O     . GLU C 3 207 ? 214.674 107.762 164.925 1.00 67.06  ? 207 GLU C O     1 
ATOM 4231  C CB    . GLU C 3 207 ? 216.024 108.399 167.364 1.00 67.06  ? 207 GLU C CB    1 
ATOM 4232  C CG    . GLU C 3 207 ? 216.888 108.349 168.607 1.00 67.06  ? 207 GLU C CG    1 
ATOM 4233  C CD    . GLU C 3 207 ? 216.078 108.490 169.878 1.00 67.06  ? 207 GLU C CD    1 
ATOM 4234  O OE1   . GLU C 3 207 ? 214.974 109.071 169.820 1.00 67.06  ? 207 GLU C OE1   1 
ATOM 4235  O OE2   . GLU C 3 207 ? 216.538 108.010 170.935 1.00 67.06  ? 207 GLU C OE2   1 
ATOM 4236  N N     . ARG C 3 208 ? 212.978 106.809 166.056 1.00 56.34  ? 208 ARG C N     1 
ATOM 4237  C CA    . ARG C 3 208 ? 212.150 106.701 164.861 1.00 56.34  ? 208 ARG C CA    1 
ATOM 4238  C C     . ARG C 3 208 ? 211.895 108.059 164.213 1.00 56.34  ? 208 ARG C C     1 
ATOM 4239  O O     . ARG C 3 208 ? 211.247 108.146 163.166 1.00 56.34  ? 208 ARG C O     1 
ATOM 4240  C CB    . ARG C 3 208 ? 210.828 106.000 165.167 1.00 56.34  ? 208 ARG C CB    1 
ATOM 4241  C CG    . ARG C 3 208 ? 209.907 106.604 166.190 1.00 56.34  ? 208 ARG C CG    1 
ATOM 4242  C CD    . ARG C 3 208 ? 208.916 105.525 166.618 1.00 56.34  ? 208 ARG C CD    1 
ATOM 4243  N NE    . ARG C 3 208 ? 207.831 106.030 167.450 1.00 56.34  ? 208 ARG C NE    1 
ATOM 4244  C CZ    . ARG C 3 208 ? 207.923 106.242 168.755 1.00 56.34  ? 208 ARG C CZ    1 
ATOM 4245  N NH1   . ARG C 3 208 ? 209.056 105.988 169.390 1.00 56.34  ? 208 ARG C NH1   1 
ATOM 4246  N NH2   . ARG C 3 208 ? 206.875 106.707 169.421 1.00 56.34  ? 208 ARG C NH2   1 
ATOM 4247  N N     . ASN C 3 209 ? 212.414 109.114 164.830 1.00 54.36  ? 209 ASN C N     1 
ATOM 4248  C CA    . ASN C 3 209 ? 212.259 110.468 164.324 1.00 54.36  ? 209 ASN C CA    1 
ATOM 4249  C C     . ASN C 3 209 ? 212.965 110.612 162.985 1.00 54.36  ? 209 ASN C C     1 
ATOM 4250  O O     . ASN C 3 209 ? 214.054 110.073 162.778 1.00 54.36  ? 209 ASN C O     1 
ATOM 4251  C CB    . ASN C 3 209 ? 212.834 111.461 165.325 1.00 54.36  ? 209 ASN C CB    1 
ATOM 4252  C CG    . ASN C 3 209 ? 212.373 112.866 165.078 1.00 54.36  ? 209 ASN C CG    1 
ATOM 4253  O OD1   . ASN C 3 209 ? 211.956 113.212 163.975 1.00 54.36  ? 209 ASN C OD1   1 
ATOM 4254  N ND2   . ASN C 3 209 ? 212.451 113.697 166.104 1.00 54.36  ? 209 ASN C ND2   1 
ATOM 4255  N N     . VAL C 3 210 ? 212.331 111.324 162.060 1.00 52.74  ? 210 VAL C N     1 
ATOM 4256  C CA    . VAL C 3 210 ? 212.884 111.573 160.734 1.00 52.74  ? 210 VAL C CA    1 
ATOM 4257  C C     . VAL C 3 210 ? 212.859 113.070 160.472 1.00 52.74  ? 210 VAL C C     1 
ATOM 4258  O O     . VAL C 3 210 ? 211.917 113.761 160.872 1.00 52.74  ? 210 VAL C O     1 
ATOM 4259  C CB    . VAL C 3 210 ? 212.105 110.822 159.641 1.00 52.74  ? 210 VAL C CB    1 
ATOM 4260  C CG1   . VAL C 3 210 ? 212.851 110.898 158.339 1.00 52.74  ? 210 VAL C CG1   1 
ATOM 4261  C CG2   . VAL C 3 210 ? 211.860 109.385 160.059 1.00 52.74  ? 210 VAL C CG2   1 
ATOM 4262  N N     . THR C 3 211 ? 213.886 113.556 159.785 1.00 50.32  ? 211 THR C N     1 
ATOM 4263  C CA    . THR C 3 211 ? 213.986 114.968 159.457 1.00 50.32  ? 211 THR C CA    1 
ATOM 4264  C C     . THR C 3 211 ? 213.170 115.318 158.216 1.00 50.32  ? 211 THR C C     1 
ATOM 4265  O O     . THR C 3 211 ? 212.565 114.455 157.581 1.00 50.32  ? 211 THR C O     1 
ATOM 4266  C CB    . THR C 3 211 ? 215.449 115.392 159.231 1.00 50.32  ? 211 THR C CB    1 
ATOM 4267  O OG1   . THR C 3 211 ? 215.508 116.800 158.973 1.00 50.32  ? 211 THR C OG1   1 
ATOM 4268  C CG2   . THR C 3 211 ? 216.046 114.639 158.052 1.00 50.32  ? 211 THR C CG2   1 
ATOM 4269  N N     . ALA C 3 212 ? 213.169 116.604 157.890 1.00 48.65  ? 212 ALA C N     1 
ATOM 4270  C CA    . ALA C 3 212 ? 212.456 117.152 156.744 1.00 48.65  ? 212 ALA C CA    1 
ATOM 4271  C C     . ALA C 3 212 ? 213.286 117.103 155.467 1.00 48.65  ? 212 ALA C C     1 
ATOM 4272  O O     . ALA C 3 212 ? 214.515 117.028 155.490 1.00 48.65  ? 212 ALA C O     1 
ATOM 4273  C CB    . ALA C 3 212 ? 212.055 118.599 157.012 1.00 48.65  ? 212 ALA C CB    1 
ATOM 4274  N N     . GLY C 3 213 ? 212.585 117.147 154.337 1.00 46.66  ? 213 GLY C N     1 
ATOM 4275  C CA    . GLY C 3 213 ? 213.217 117.184 153.041 1.00 46.66  ? 213 GLY C CA    1 
ATOM 4276  C C     . GLY C 3 213 ? 214.062 118.434 152.897 1.00 46.66  ? 213 GLY C C     1 
ATOM 4277  O O     . GLY C 3 213 ? 213.846 119.439 153.579 1.00 46.66  ? 213 GLY C O     1 
ATOM 4278  N N     . PRO C 3 214 ? 215.057 118.390 152.011 1.00 45.03  ? 214 PRO C N     1 
ATOM 4279  C CA    . PRO C 3 214 ? 216.018 119.501 151.944 1.00 45.03  ? 214 PRO C CA    1 
ATOM 4280  C C     . PRO C 3 214 ? 215.467 120.792 151.378 1.00 45.03  ? 214 PRO C C     1 
ATOM 4281  O O     . PRO C 3 214 ? 215.937 121.867 151.768 1.00 45.03  ? 214 PRO C O     1 
ATOM 4282  C CB    . PRO C 3 214 ? 217.114 118.945 151.029 1.00 45.03  ? 214 PRO C CB    1 
ATOM 4283  C CG    . PRO C 3 214 ? 216.386 117.972 150.157 1.00 45.03  ? 214 PRO C CG    1 
ATOM 4284  C CD    . PRO C 3 214 ? 215.344 117.340 151.022 1.00 45.03  ? 214 PRO C CD    1 
ATOM 4285  N N     . LEU C 3 215 ? 214.491 120.690 150.483 1.00 44.56  ? 215 LEU C N     1 
ATOM 4286  C CA    . LEU C 3 215 ? 213.859 121.854 149.877 1.00 44.56  ? 215 LEU C CA    1 
ATOM 4287  C C     . LEU C 3 215 ? 212.355 121.647 149.972 1.00 44.56  ? 215 LEU C C     1 
ATOM 4288  O O     . LEU C 3 215 ? 211.646 121.652 148.966 1.00 44.56  ? 215 LEU C O     1 
ATOM 4289  C CB    . LEU C 3 215 ? 214.284 122.002 148.417 1.00 44.56  ? 215 LEU C CB    1 
ATOM 4290  C CG    . LEU C 3 215 ? 213.767 120.936 147.448 1.00 44.56  ? 215 LEU C CG    1 
ATOM 4291  C CD1   . LEU C 3 215 ? 214.213 121.241 146.026 1.00 44.56  ? 215 LEU C CD1   1 
ATOM 4292  C CD2   . LEU C 3 215 ? 214.230 119.552 147.875 1.00 44.56  ? 215 LEU C CD2   1 
ATOM 4293  N N     . ARG C 3 216 ? 211.881 121.457 151.199 1.00 46.47  ? 216 ARG C N     1 
ATOM 4294  C CA    . ARG C 3 216 ? 210.468 121.209 151.459 1.00 46.47  ? 216 ARG C CA    1 
ATOM 4295  C C     . ARG C 3 216 ? 209.562 122.439 151.432 1.00 46.47  ? 216 ARG C C     1 
ATOM 4296  O O     . ARG C 3 216 ? 209.565 123.253 152.355 1.00 46.47  ? 216 ARG C O     1 
ATOM 4297  C CB    . ARG C 3 216 ? 210.299 120.476 152.793 1.00 46.47  ? 216 ARG C CB    1 
ATOM 4298  C CG    . ARG C 3 216 ? 208.880 120.004 153.067 1.00 46.47  ? 216 ARG C CG    1 
ATOM 4299  C CD    . ARG C 3 216 ? 208.747 119.439 154.472 1.00 46.47  ? 216 ARG C CD    1 
ATOM 4300  N NE    . ARG C 3 216 ? 209.229 120.374 155.485 1.00 46.47  ? 216 ARG C NE    1 
ATOM 4301  C CZ    . ARG C 3 216 ? 208.618 121.511 155.802 1.00 46.47  ? 216 ARG C CZ    1 
ATOM 4302  N NH1   . ARG C 3 216 ? 207.498 121.859 155.185 1.00 46.47  ? 216 ARG C NH1   1 
ATOM 4303  N NH2   . ARG C 3 216 ? 209.128 122.301 156.737 1.00 46.47  ? 216 ARG C NH2   1 
ATOM 4304  N N     . GLY C 3 217 ? 208.779 122.549 150.364 1.00 45.16  ? 217 GLY C N     1 
ATOM 4305  C CA    . GLY C 3 217 ? 207.824 123.624 150.199 1.00 45.16  ? 217 GLY C CA    1 
ATOM 4306  C C     . GLY C 3 217 ? 208.291 124.801 149.379 1.00 45.16  ? 217 GLY C C     1 
ATOM 4307  O O     . GLY C 3 217 ? 207.942 125.945 149.693 1.00 45.16  ? 217 GLY C O     1 
ATOM 4308  N N     . THR C 3 218 ? 209.089 124.565 148.348 1.00 45.85  ? 218 THR C N     1 
ATOM 4309  C CA    . THR C 3 218 ? 209.569 125.658 147.526 1.00 45.85  ? 218 THR C CA    1 
ATOM 4310  C C     . THR C 3 218 ? 209.277 125.297 146.077 1.00 45.85  ? 218 THR C C     1 
ATOM 4311  O O     . THR C 3 218 ? 209.153 124.120 145.728 1.00 45.85  ? 218 THR C O     1 
ATOM 4312  C CB    . THR C 3 218 ? 211.047 125.937 147.775 1.00 45.85  ? 218 THR C CB    1 
ATOM 4313  O OG1   . THR C 3 218 ? 211.253 126.095 149.182 1.00 45.85  ? 218 THR C OG1   1 
ATOM 4314  C CG2   . THR C 3 218 ? 211.446 127.231 147.113 1.00 45.85  ? 218 THR C CG2   1 
ATOM 4315  N N     . VAL C 3 219 ? 209.173 126.320 145.233 1.00 40.62  ? 219 VAL C N     1 
ATOM 4316  C CA    . VAL C 3 219 ? 208.940 126.155 143.803 1.00 40.62  ? 219 VAL C CA    1 
ATOM 4317  C C     . VAL C 3 219 ? 210.254 126.251 143.031 1.00 40.62  ? 219 VAL C C     1 
ATOM 4318  O O     . VAL C 3 219 ? 210.931 127.284 143.056 1.00 40.62  ? 219 VAL C O     1 
ATOM 4319  C CB    . VAL C 3 219 ? 207.913 127.178 143.305 1.00 40.62  ? 219 VAL C CB    1 
ATOM 4320  C CG1   . VAL C 3 219 ? 208.340 128.575 143.674 1.00 40.62  ? 219 VAL C CG1   1 
ATOM 4321  C CG2   . VAL C 3 219 ? 207.736 127.050 141.820 1.00 40.62  ? 219 VAL C CG2   1 
ATOM 4322  N N     . SER C 3 220 ? 210.616 125.165 142.351 1.00 38.59  ? 220 SER C N     1 
ATOM 4323  C CA    . SER C 3 220 ? 211.808 125.095 141.521 1.00 38.59  ? 220 SER C CA    1 
ATOM 4324  C C     . SER C 3 220 ? 211.543 125.610 140.109 1.00 38.59  ? 220 SER C C     1 
ATOM 4325  O O     . SER C 3 220 ? 210.502 125.326 139.516 1.00 38.59  ? 220 SER C O     1 
ATOM 4326  C CB    . SER C 3 220 ? 212.316 123.655 141.472 1.00 38.59  ? 220 SER C CB    1 
ATOM 4327  O OG    . SER C 3 220 ? 211.339 122.798 140.914 1.00 38.59  ? 220 SER C OG    1 
ATOM 4328  N N     . TYR C 3 221 ? 212.498 126.371 139.579 1.00 40.25  ? 221 TYR C N     1 
ATOM 4329  C CA    . TYR C 3 221 ? 212.401 127.017 138.271 1.00 40.25  ? 221 TYR C CA    1 
ATOM 4330  C C     . TYR C 3 221 ? 213.423 126.464 137.294 1.00 40.25  ? 221 TYR C C     1 
ATOM 4331  O O     . TYR C 3 221 ? 214.615 126.757 137.407 1.00 40.25  ? 221 TYR C O     1 
ATOM 4332  C CB    . TYR C 3 221 ? 212.564 128.517 138.432 1.00 40.25  ? 221 TYR C CB    1 
ATOM 4333  C CG    . TYR C 3 221 ? 211.356 129.084 139.072 1.00 40.25  ? 221 TYR C CG    1 
ATOM 4334  C CD1   . TYR C 3 221 ? 210.279 129.495 138.310 1.00 40.25  ? 221 TYR C CD1   1 
ATOM 4335  C CD2   . TYR C 3 221 ? 211.214 129.052 140.433 1.00 40.25  ? 221 TYR C CD2   1 
ATOM 4336  C CE1   . TYR C 3 221 ? 209.152 129.971 138.898 1.00 40.25  ? 221 TYR C CE1   1 
ATOM 4337  C CE2   . TYR C 3 221 ? 210.092 129.505 141.021 1.00 40.25  ? 221 TYR C CE2   1 
ATOM 4338  C CZ    . TYR C 3 221 ? 209.062 129.960 140.259 1.00 40.25  ? 221 TYR C CZ    1 
ATOM 4339  O OH    . TYR C 3 221 ? 207.946 130.421 140.892 1.00 40.25  ? 221 TYR C OH    1 
ATOM 4340  N N     . HIS C 3 222 ? 212.958 125.694 136.317 1.00 42.57  ? 222 HIS C N     1 
ATOM 4341  C CA    . HIS C 3 222 ? 213.850 125.211 135.280 1.00 42.57  ? 222 HIS C CA    1 
ATOM 4342  C C     . HIS C 3 222 ? 213.500 125.879 133.961 1.00 42.57  ? 222 HIS C C     1 
ATOM 4343  O O     . HIS C 3 222 ? 212.336 125.829 133.534 1.00 42.57  ? 222 HIS C O     1 
ATOM 4344  C CB    . HIS C 3 222 ? 213.733 123.699 135.151 1.00 42.57  ? 222 HIS C CB    1 
ATOM 4345  C CG    . HIS C 3 222 ? 213.886 122.972 136.445 1.00 42.57  ? 222 HIS C CG    1 
ATOM 4346  N ND1   . HIS C 3 222 ? 215.114 122.618 136.959 1.00 42.57  ? 222 HIS C ND1   1 
ATOM 4347  C CD2   . HIS C 3 222 ? 212.966 122.530 137.332 1.00 42.57  ? 222 HIS C CD2   1 
ATOM 4348  C CE1   . HIS C 3 222 ? 214.944 121.984 138.104 1.00 42.57  ? 222 HIS C CE1   1 
ATOM 4349  N NE2   . HIS C 3 222 ? 213.648 121.919 138.353 1.00 42.57  ? 222 HIS C NE2   1 
ATOM 4350  N N     . PRO C 3 223 ? 214.452 126.543 133.313 1.00 42.85  ? 223 PRO C N     1 
ATOM 4351  C CA    . PRO C 3 223 ? 214.189 127.132 131.997 1.00 42.85  ? 223 PRO C CA    1 
ATOM 4352  C C     . PRO C 3 223 ? 214.068 126.075 130.913 1.00 42.85  ? 223 PRO C C     1 
ATOM 4353  O O     . PRO C 3 223 ? 214.641 124.987 131.007 1.00 42.85  ? 223 PRO C O     1 
ATOM 4354  C CB    . PRO C 3 223 ? 215.401 128.038 131.771 1.00 42.85  ? 223 PRO C CB    1 
ATOM 4355  C CG    . PRO C 3 223 ? 216.464 127.436 132.589 1.00 42.85  ? 223 PRO C CG    1 
ATOM 4356  C CD    . PRO C 3 223 ? 215.792 126.891 133.806 1.00 42.85  ? 223 PRO C CD    1 
ATOM 4357  N N     . LEU C 3 224 ? 213.301 126.405 129.874 1.00 49.73  ? 224 LEU C N     1 
ATOM 4358  C CA    . LEU C 3 224 ? 213.063 125.507 128.754 1.00 49.73  ? 224 LEU C CA    1 
ATOM 4359  C C     . LEU C 3 224 ? 213.483 126.128 127.430 1.00 49.73  ? 224 LEU C C     1 
ATOM 4360  O O     . LEU C 3 224 ? 213.629 127.343 127.292 1.00 49.73  ? 224 LEU C O     1 
ATOM 4361  C CB    . LEU C 3 224 ? 211.584 125.114 128.641 1.00 49.73  ? 224 LEU C CB    1 
ATOM 4362  C CG    . LEU C 3 224 ? 211.019 124.004 129.519 1.00 49.73  ? 224 LEU C CG    1 
ATOM 4363  C CD1   . LEU C 3 224 ? 209.530 123.885 129.294 1.00 49.73  ? 224 LEU C CD1   1 
ATOM 4364  C CD2   . LEU C 3 224 ? 211.697 122.699 129.173 1.00 49.73  ? 224 LEU C CD2   1 
ATOM 4365  N N     . GLY C 3 225 ? 213.648 125.247 126.451 1.00 62.21  ? 225 GLY C N     1 
ATOM 4366  C CA    . GLY C 3 225 ? 213.923 125.557 125.065 1.00 62.21  ? 225 GLY C CA    1 
ATOM 4367  C C     . GLY C 3 225 ? 212.819 125.000 124.194 1.00 62.21  ? 225 GLY C C     1 
ATOM 4368  O O     . GLY C 3 225 ? 211.642 125.065 124.559 1.00 62.21  ? 225 GLY C O     1 
ATOM 4369  N N     . ARG C 3 226 ? 213.185 124.467 123.028 1.00 74.99  ? 226 ARG C N     1 
ATOM 4370  C CA    . ARG C 3 226 ? 212.221 123.821 122.150 1.00 74.99  ? 226 ARG C CA    1 
ATOM 4371  C C     . ARG C 3 226 ? 212.254 122.303 122.273 1.00 74.99  ? 226 ARG C C     1 
ATOM 4372  O O     . ARG C 3 226 ? 211.297 121.642 121.859 1.00 74.99  ? 226 ARG C O     1 
ATOM 4373  C CB    . ARG C 3 226 ? 212.475 124.204 120.687 1.00 74.99  ? 226 ARG C CB    1 
ATOM 4374  C CG    . ARG C 3 226 ? 211.974 125.582 120.283 1.00 74.99  ? 226 ARG C CG    1 
ATOM 4375  C CD    . ARG C 3 226 ? 212.948 126.675 120.688 1.00 74.99  ? 226 ARG C CD    1 
ATOM 4376  N NE    . ARG C 3 226 ? 214.230 126.539 120.002 1.00 74.99  ? 226 ARG C NE    1 
ATOM 4377  C CZ    . ARG C 3 226 ? 215.319 127.243 120.298 1.00 74.99  ? 226 ARG C CZ    1 
ATOM 4378  N NH1   . ARG C 3 226 ? 215.287 128.145 121.271 1.00 74.99  ? 226 ARG C NH1   1 
ATOM 4379  N NH2   . ARG C 3 226 ? 216.443 127.049 119.618 1.00 74.99  ? 226 ARG C NH2   1 
ATOM 4380  N N     . THR C 3 227 ? 213.326 121.744 122.829 1.00 72.73  ? 227 THR C N     1 
ATOM 4381  C CA    . THR C 3 227 ? 213.441 120.321 123.100 1.00 72.73  ? 227 THR C CA    1 
ATOM 4382  C C     . THR C 3 227 ? 214.061 120.143 124.476 1.00 72.73  ? 227 THR C C     1 
ATOM 4383  O O     . THR C 3 227 ? 214.548 121.099 125.085 1.00 72.73  ? 227 THR C O     1 
ATOM 4384  C CB    . THR C 3 227 ? 214.288 119.611 122.049 1.00 72.73  ? 227 THR C CB    1 
ATOM 4385  O OG1   . THR C 3 227 ? 215.509 120.332 121.856 1.00 72.73  ? 227 THR C OG1   1 
ATOM 4386  C CG2   . THR C 3 227 ? 213.548 119.508 120.750 1.00 72.73  ? 227 THR C CG2   1 
ATOM 4387  N N     . LEU C 3 228 ? 214.064 118.900 124.962 1.00 66.94  ? 228 LEU C N     1 
ATOM 4388  C CA    . LEU C 3 228 ? 214.658 118.652 126.272 1.00 66.94  ? 228 LEU C CA    1 
ATOM 4389  C C     . LEU C 3 228 ? 216.157 118.892 126.259 1.00 66.94  ? 228 LEU C C     1 
ATOM 4390  O O     . LEU C 3 228 ? 216.734 119.195 127.303 1.00 66.94  ? 228 LEU C O     1 
ATOM 4391  C CB    . LEU C 3 228 ? 214.342 117.250 126.792 1.00 66.94  ? 228 LEU C CB    1 
ATOM 4392  C CG    . LEU C 3 228 ? 214.836 115.956 126.162 1.00 66.94  ? 228 LEU C CG    1 
ATOM 4393  C CD1   . LEU C 3 228 ? 214.408 114.814 127.028 1.00 66.94  ? 228 LEU C CD1   1 
ATOM 4394  C CD2   . LEU C 3 228 ? 214.188 115.787 124.848 1.00 66.94  ? 228 LEU C CD2   1 
ATOM 4395  N N     . PHE C 3 229 ? 216.804 118.735 125.107 1.00 71.10  ? 229 PHE C N     1 
ATOM 4396  C CA    . PHE C 3 229 ? 218.251 118.860 125.007 1.00 71.10  ? 229 PHE C CA    1 
ATOM 4397  C C     . PHE C 3 229 ? 218.729 120.215 125.514 1.00 71.10  ? 229 PHE C C     1 
ATOM 4398  O O     . PHE C 3 229 ? 219.315 120.321 126.601 1.00 71.10  ? 229 PHE C O     1 
ATOM 4399  C CB    . PHE C 3 229 ? 218.677 118.646 123.555 1.00 71.10  ? 229 PHE C CB    1 
ATOM 4400  C CG    . PHE C 3 229 ? 220.149 118.774 123.323 1.00 71.10  ? 229 PHE C CG    1 
ATOM 4401  C CD1   . PHE C 3 229 ? 221.014 117.762 123.662 1.00 71.10  ? 229 PHE C CD1   1 
ATOM 4402  C CD2   . PHE C 3 229 ? 220.660 119.902 122.719 1.00 71.10  ? 229 PHE C CD2   1 
ATOM 4403  C CE1   . PHE C 3 229 ? 222.360 117.883 123.427 1.00 71.10  ? 229 PHE C CE1   1 
ATOM 4404  C CE2   . PHE C 3 229 ? 222.008 120.030 122.484 1.00 71.10  ? 229 PHE C CE2   1 
ATOM 4405  C CZ    . PHE C 3 229 ? 222.859 119.018 122.837 1.00 71.10  ? 229 PHE C CZ    1 
ATOM 4406  N N     . GLU C 3 230 ? 218.478 121.265 124.743 1.00 69.25  ? 230 GLU C N     1 
ATOM 4407  C CA    . GLU C 3 230 ? 218.982 122.566 125.145 1.00 69.25  ? 230 GLU C CA    1 
ATOM 4408  C C     . GLU C 3 230 ? 218.384 123.024 126.463 1.00 69.25  ? 230 GLU C C     1 
ATOM 4409  O O     . GLU C 3 230 ? 219.028 123.779 127.194 1.00 69.25  ? 230 GLU C O     1 
ATOM 4410  C CB    . GLU C 3 230 ? 218.686 123.576 124.051 1.00 69.25  ? 230 GLU C CB    1 
ATOM 4411  C CG    . GLU C 3 230 ? 217.214 123.891 123.919 1.00 69.25  ? 230 GLU C CG    1 
ATOM 4412  C CD    . GLU C 3 230 ? 216.445 122.811 123.180 1.00 69.25  ? 230 GLU C CD    1 
ATOM 4413  O OE1   . GLU C 3 230 ? 217.062 121.810 122.767 1.00 69.25  ? 230 GLU C OE1   1 
ATOM 4414  O OE2   . GLU C 3 230 ? 215.218 122.957 123.019 1.00 69.25  ? 230 GLU C OE2   1 
ATOM 4415  N N     . SER C 3 231 ? 217.205 122.523 126.828 1.00 66.83  ? 231 SER C N     1 
ATOM 4416  C CA    . SER C 3 231 ? 216.647 122.877 128.125 1.00 66.83  ? 231 SER C CA    1 
ATOM 4417  C C     . SER C 3 231 ? 217.502 122.308 129.246 1.00 66.83  ? 231 SER C C     1 
ATOM 4418  O O     . SER C 3 231 ? 217.924 123.039 130.148 1.00 66.83  ? 231 SER C O     1 
ATOM 4419  C CB    . SER C 3 231 ? 215.211 122.373 128.233 1.00 66.83  ? 231 SER C CB    1 
ATOM 4420  O OG    . SER C 3 231 ? 215.188 120.962 128.295 1.00 66.83  ? 231 SER C OG    1 
ATOM 4421  N N     . LEU C 3 232 ? 217.793 121.007 129.185 1.00 61.45  ? 232 LEU C N     1 
ATOM 4422  C CA    . LEU C 3 232 ? 218.644 120.381 130.187 1.00 61.45  ? 232 LEU C CA    1 
ATOM 4423  C C     . LEU C 3 232 ? 219.999 121.059 130.228 1.00 61.45  ? 232 LEU C C     1 
ATOM 4424  O O     . LEU C 3 232 ? 220.611 121.154 131.295 1.00 61.45  ? 232 LEU C O     1 
ATOM 4425  C CB    . LEU C 3 232 ? 218.758 118.874 129.962 1.00 61.45  ? 232 LEU C CB    1 
ATOM 4426  C CG    . LEU C 3 232 ? 219.342 118.225 128.725 1.00 61.45  ? 232 LEU C CG    1 
ATOM 4427  C CD1   . LEU C 3 232 ? 220.836 118.160 128.822 1.00 61.45  ? 232 LEU C CD1   1 
ATOM 4428  C CD2   . LEU C 3 232 ? 218.757 116.838 128.598 1.00 61.45  ? 232 LEU C CD2   1 
ATOM 4429  N N     . ILE C 3 233 ? 220.485 121.550 129.090 1.00 64.45  ? 233 ILE C N     1 
ATOM 4430  C CA    . ILE C 3 233 ? 221.803 122.166 129.119 1.00 64.45  ? 233 ILE C CA    1 
ATOM 4431  C C     . ILE C 3 233 ? 221.714 123.504 129.833 1.00 64.45  ? 233 ILE C C     1 
ATOM 4432  O O     . ILE C 3 233 ? 222.597 123.854 130.621 1.00 64.45  ? 233 ILE C O     1 
ATOM 4433  C CB    . ILE C 3 233 ? 222.376 122.312 127.701 1.00 64.45  ? 233 ILE C CB    1 
ATOM 4434  C CG1   . ILE C 3 233 ? 222.534 120.939 127.055 1.00 64.45  ? 233 ILE C CG1   1 
ATOM 4435  C CG2   . ILE C 3 233 ? 223.707 123.038 127.753 1.00 64.45  ? 233 ILE C CG2   1 
ATOM 4436  C CD1   . ILE C 3 233 ? 223.162 120.993 125.701 1.00 64.45  ? 233 ILE C CD1   1 
ATOM 4437  N N     . LEU C 3 234 ? 220.657 124.279 129.580 1.00 62.06  ? 234 LEU C N     1 
ATOM 4438  C CA    . LEU C 3 234 ? 220.510 125.498 130.359 1.00 62.06  ? 234 LEU C CA    1 
ATOM 4439  C C     . LEU C 3 234 ? 220.186 125.200 131.818 1.00 62.06  ? 234 LEU C C     1 
ATOM 4440  O O     . LEU C 3 234 ? 220.321 126.091 132.661 1.00 62.06  ? 234 LEU C O     1 
ATOM 4441  C CB    . LEU C 3 234 ? 219.436 126.427 129.777 1.00 62.06  ? 234 LEU C CB    1 
ATOM 4442  C CG    . LEU C 3 234 ? 219.527 127.223 128.471 1.00 62.06  ? 234 LEU C CG    1 
ATOM 4443  C CD1   . LEU C 3 234 ? 220.330 128.473 128.755 1.00 62.06  ? 234 LEU C CD1   1 
ATOM 4444  C CD2   . LEU C 3 234 ? 220.186 126.482 127.348 1.00 62.06  ? 234 LEU C CD2   1 
ATOM 4445  N N     . ASN C 3 235 ? 219.765 123.973 132.136 1.00 59.11  ? 235 ASN C N     1 
ATOM 4446  C CA    . ASN C 3 235 ? 219.511 123.610 133.526 1.00 59.11  ? 235 ASN C CA    1 
ATOM 4447  C C     . ASN C 3 235 ? 220.783 123.483 134.347 1.00 59.11  ? 235 ASN C C     1 
ATOM 4448  O O     . ASN C 3 235 ? 220.723 123.603 135.573 1.00 59.11  ? 235 ASN C O     1 
ATOM 4449  C CB    . ASN C 3 235 ? 218.771 122.279 133.612 1.00 59.11  ? 235 ASN C CB    1 
ATOM 4450  C CG    . ASN C 3 235 ? 217.294 122.414 133.381 1.00 59.11  ? 235 ASN C CG    1 
ATOM 4451  O OD1   . ASN C 3 235 ? 216.690 123.426 133.732 1.00 59.11  ? 235 ASN C OD1   1 
ATOM 4452  N ND2   . ASN C 3 235 ? 216.690 121.382 132.805 1.00 59.11  ? 235 ASN C ND2   1 
ATOM 4453  N N     . ILE C 3 236 ? 221.924 123.261 133.704 1.00 63.39  ? 236 ILE C N     1 
ATOM 4454  C CA    . ILE C 3 236 ? 223.183 123.087 134.419 1.00 63.39  ? 236 ILE C CA    1 
ATOM 4455  C C     . ILE C 3 236 ? 223.599 124.371 135.118 1.00 63.39  ? 236 ILE C C     1 
ATOM 4456  O O     . ILE C 3 236 ? 223.844 125.394 134.465 1.00 63.39  ? 236 ILE C O     1 
ATOM 4457  C CB    . ILE C 3 236 ? 224.292 122.599 133.482 1.00 63.39  ? 236 ILE C CB    1 
ATOM 4458  C CG1   . ILE C 3 236 ? 223.886 121.272 132.843 1.00 63.39  ? 236 ILE C CG1   1 
ATOM 4459  C CG2   . ILE C 3 236 ? 225.590 122.472 134.246 1.00 63.39  ? 236 ILE C CG2   1 
ATOM 4460  C CD1   . ILE C 3 236 ? 224.883 120.743 131.860 1.00 63.39  ? 236 ILE C CD1   1 
ATOM 4461  N N     . PRO C 3 237 ? 223.690 124.353 136.436 1.00 65.29  ? 237 PRO C N     1 
ATOM 4462  C CA    . PRO C 3 237 ? 224.163 125.520 137.172 1.00 65.29  ? 237 PRO C CA    1 
ATOM 4463  C C     . PRO C 3 237 ? 225.666 125.616 137.054 1.00 65.29  ? 237 PRO C C     1 
ATOM 4464  O O     . PRO C 3 237 ? 226.359 124.610 136.886 1.00 65.29  ? 237 PRO C O     1 
ATOM 4465  C CB    . PRO C 3 237 ? 223.751 125.216 138.614 1.00 65.29  ? 237 PRO C CB    1 
ATOM 4466  C CG    . PRO C 3 237 ? 223.807 123.735 138.680 1.00 65.29  ? 237 PRO C CG    1 
ATOM 4467  C CD    . PRO C 3 237 ? 223.402 123.218 137.327 1.00 65.29  ? 237 PRO C CD    1 
ATOM 4468  N N     . TYR C 3 238 ? 226.172 126.830 137.126 1.00 74.91  ? 238 TYR C N     1 
ATOM 4469  C CA    . TYR C 3 238 ? 227.612 126.984 137.032 1.00 74.91  ? 238 TYR C CA    1 
ATOM 4470  C C     . TYR C 3 238 ? 228.258 126.495 138.314 1.00 74.91  ? 238 TYR C C     1 
ATOM 4471  O O     . TYR C 3 238 ? 228.004 127.061 139.386 1.00 74.91  ? 238 TYR C O     1 
ATOM 4472  C CB    . TYR C 3 238 ? 227.963 128.444 136.796 1.00 74.91  ? 238 TYR C CB    1 
ATOM 4473  C CG    . TYR C 3 238 ? 229.439 128.751 136.855 1.00 74.91  ? 238 TYR C CG    1 
ATOM 4474  C CD1   . TYR C 3 238 ? 230.322 128.291 135.898 1.00 74.91  ? 238 TYR C CD1   1 
ATOM 4475  C CD2   . TYR C 3 238 ? 229.940 129.524 137.888 1.00 74.91  ? 238 TYR C CD2   1 
ATOM 4476  C CE1   . TYR C 3 238 ? 231.669 128.592 135.977 1.00 74.91  ? 238 TYR C CE1   1 
ATOM 4477  C CE2   . TYR C 3 238 ? 231.272 129.828 137.975 1.00 74.91  ? 238 TYR C CE2   1 
ATOM 4478  C CZ    . TYR C 3 238 ? 232.134 129.364 137.020 1.00 74.91  ? 238 TYR C CZ    1 
ATOM 4479  O OH    . TYR C 3 238 ? 233.466 129.677 137.122 1.00 74.91  ? 238 TYR C OH    1 
ATOM 4480  N N     . PRO C 3 239 ? 229.116 125.478 138.247 1.00 74.90  ? 239 PRO C N     1 
ATOM 4481  C CA    . PRO C 3 239 ? 229.808 124.988 139.441 1.00 74.90  ? 239 PRO C CA    1 
ATOM 4482  C C     . PRO C 3 239 ? 230.970 125.901 139.793 1.00 74.90  ? 239 PRO C C     1 
ATOM 4483  O O     . PRO C 3 239 ? 231.878 126.111 138.987 1.00 74.90  ? 239 PRO C O     1 
ATOM 4484  C CB    . PRO C 3 239 ? 230.284 123.595 139.021 1.00 74.90  ? 239 PRO C CB    1 
ATOM 4485  C CG    . PRO C 3 239 ? 230.469 123.708 137.553 1.00 74.90  ? 239 PRO C CG    1 
ATOM 4486  C CD    . PRO C 3 239 ? 229.432 124.672 137.056 1.00 74.90  ? 239 PRO C CD    1 
ATOM 4487  N N     . GLY C 3 240 ? 230.936 126.450 140.999 1.00 82.11  ? 240 GLY C N     1 
ATOM 4488  C CA    . GLY C 3 240 ? 232.055 127.233 141.472 1.00 82.11  ? 240 GLY C CA    1 
ATOM 4489  C C     . GLY C 3 240 ? 233.288 126.371 141.659 1.00 82.11  ? 240 GLY C C     1 
ATOM 4490  O O     . GLY C 3 240 ? 233.203 125.173 141.938 1.00 82.11  ? 240 GLY C O     1 
ATOM 4491  N N     . THR C 3 241 ? 234.453 126.985 141.481 1.00 88.42  ? 241 THR C N     1 
ATOM 4492  C CA    . THR C 3 241 ? 235.693 126.242 141.628 1.00 88.42  ? 241 THR C CA    1 
ATOM 4493  C C     . THR C 3 241 ? 235.829 125.762 143.065 1.00 88.42  ? 241 THR C C     1 
ATOM 4494  O O     . THR C 3 241 ? 235.766 126.555 144.009 1.00 88.42  ? 241 THR C O     1 
ATOM 4495  C CB    . THR C 3 241 ? 236.895 127.110 141.244 1.00 88.42  ? 241 THR C CB    1 
ATOM 4496  O OG1   . THR C 3 241 ? 236.885 128.318 142.018 1.00 88.42  ? 241 THR C OG1   1 
ATOM 4497  C CG2   . THR C 3 241 ? 236.876 127.452 139.764 1.00 88.42  ? 241 THR C CG2   1 
ATOM 4498  N N     . GLY C 3 242 ? 236.020 124.463 143.224 1.00 88.42  ? 242 GLY C N     1 
ATOM 4499  C CA    . GLY C 3 242 ? 236.145 123.895 144.547 1.00 88.42  ? 242 GLY C CA    1 
ATOM 4500  C C     . GLY C 3 242 ? 236.432 122.420 144.437 1.00 88.42  ? 242 GLY C C     1 
ATOM 4501  O O     . GLY C 3 242 ? 236.883 121.939 143.396 1.00 88.42  ? 242 GLY C O     1 
ATOM 4502  N N     . ALA C 3 243 ? 236.156 121.695 145.512 1.00 91.86  ? 243 ALA C N     1 
ATOM 4503  C CA    . ALA C 3 243 ? 236.458 120.276 145.512 1.00 91.86  ? 243 ALA C CA    1 
ATOM 4504  C C     . ALA C 3 243 ? 235.529 119.523 144.572 1.00 91.86  ? 243 ALA C C     1 
ATOM 4505  O O     . ALA C 3 243 ? 234.340 119.832 144.467 1.00 91.86  ? 243 ALA C O     1 
ATOM 4506  C CB    . ALA C 3 243 ? 236.346 119.714 146.929 1.00 91.86  ? 243 ALA C CB    1 
ATOM 4507  N N     . ALA C 3 244 ? 236.081 118.545 143.862 1.00 89.63  ? 244 ALA C N     1 
ATOM 4508  C CA    . ALA C 3 244 ? 235.237 117.702 143.032 1.00 89.63  ? 244 ALA C CA    1 
ATOM 4509  C C     . ALA C 3 244 ? 234.290 116.926 143.935 1.00 89.63  ? 244 ALA C C     1 
ATOM 4510  O O     . ALA C 3 244 ? 234.671 116.486 145.023 1.00 89.63  ? 244 ALA C O     1 
ATOM 4511  C CB    . ALA C 3 244 ? 236.082 116.745 142.194 1.00 89.63  ? 244 ALA C CB    1 
ATOM 4512  N N     . ASP C 3 245 ? 233.055 116.753 143.491 1.00 79.43  ? 245 ASP C N     1 
ATOM 4513  C CA    . ASP C 3 245 ? 232.024 116.179 144.337 1.00 79.43  ? 245 ASP C CA    1 
ATOM 4514  C C     . ASP C 3 245 ? 231.356 115.054 143.571 1.00 79.43  ? 245 ASP C C     1 
ATOM 4515  O O     . ASP C 3 245 ? 231.560 114.887 142.366 1.00 79.43  ? 245 ASP C O     1 
ATOM 4516  C CB    . ASP C 3 245 ? 231.003 117.211 144.826 1.00 79.43  ? 245 ASP C CB    1 
ATOM 4517  C CG    . ASP C 3 245 ? 230.207 116.701 146.011 1.00 79.43  ? 245 ASP C CG    1 
ATOM 4518  O OD1   . ASP C 3 245 ? 230.796 116.548 147.098 1.00 79.43  ? 245 ASP C OD1   1 
ATOM 4519  O OD2   . ASP C 3 245 ? 228.998 116.450 145.863 1.00 79.43  ? 245 ASP C OD2   1 
ATOM 4520  N N     . LEU C 3 246 ? 230.551 114.271 144.279 1.00 75.43  ? 246 LEU C N     1 
ATOM 4521  C CA    . LEU C 3 246 ? 229.864 113.187 143.614 1.00 75.43  ? 246 LEU C CA    1 
ATOM 4522  C C     . LEU C 3 246 ? 228.505 113.021 144.281 1.00 75.43  ? 246 LEU C C     1 
ATOM 4523  O O     . LEU C 3 246 ? 228.344 113.318 145.467 1.00 75.43  ? 246 LEU C O     1 
ATOM 4524  C CB    . LEU C 3 246 ? 230.775 111.966 143.732 1.00 75.43  ? 246 LEU C CB    1 
ATOM 4525  N N     . ALA C 3 247 ? 227.529 112.531 143.518 1.00 69.12  ? 247 ALA C N     1 
ATOM 4526  C CA    . ALA C 3 247 ? 226.171 112.418 144.031 1.00 69.12  ? 247 ALA C CA    1 
ATOM 4527  C C     . ALA C 3 247 ? 225.984 111.208 144.940 1.00 69.12  ? 247 ALA C C     1 
ATOM 4528  O O     . ALA C 3 247 ? 226.857 110.353 145.074 1.00 69.12  ? 247 ALA C O     1 
ATOM 4529  C CB    . ALA C 3 247 ? 225.183 112.363 142.872 1.00 69.12  ? 247 ALA C CB    1 
ATOM 4530  N N     . PHE C 3 248 ? 224.772 111.102 145.493 1.00 64.84  ? 248 PHE C N     1 
ATOM 4531  C CA    . PHE C 3 248 ? 224.411 109.974 146.346 1.00 64.84  ? 248 PHE C CA    1 
ATOM 4532  C C     . PHE C 3 248 ? 224.395 108.687 145.549 1.00 64.84  ? 248 PHE C C     1 
ATOM 4533  O O     . PHE C 3 248 ? 224.794 107.629 146.045 1.00 64.84  ? 248 PHE C O     1 
ATOM 4534  C CB    . PHE C 3 248 ? 223.054 110.188 147.001 1.00 64.84  ? 248 PHE C CB    1 
ATOM 4535  C CG    . PHE C 3 248 ? 222.658 109.068 147.917 1.00 64.84  ? 248 PHE C CG    1 
ATOM 4536  C CD1   . PHE C 3 248 ? 223.026 109.081 149.247 1.00 64.84  ? 248 PHE C CD1   1 
ATOM 4537  C CD2   . PHE C 3 248 ? 221.938 107.987 147.436 1.00 64.84  ? 248 PHE C CD2   1 
ATOM 4538  C CE1   . PHE C 3 248 ? 222.667 108.051 150.080 1.00 64.84  ? 248 PHE C CE1   1 
ATOM 4539  C CE2   . PHE C 3 248 ? 221.581 106.956 148.262 1.00 64.84  ? 248 PHE C CE2   1 
ATOM 4540  C CZ    . PHE C 3 248 ? 221.942 106.986 149.586 1.00 64.84  ? 248 PHE C CZ    1 
ATOM 4541  N N     . TRP C 3 249 ? 223.912 108.762 144.327 1.00 66.88  ? 249 TRP C N     1 
ATOM 4542  C CA    . TRP C 3 249 ? 223.880 107.628 143.430 1.00 66.88  ? 249 TRP C CA    1 
ATOM 4543  C C     . TRP C 3 249 ? 225.188 107.440 142.691 1.00 66.88  ? 249 TRP C C     1 
ATOM 4544  O O     . TRP C 3 249 ? 225.323 106.472 141.939 1.00 66.88  ? 249 TRP C O     1 
ATOM 4545  C CB    . TRP C 3 249 ? 222.687 107.806 142.488 1.00 66.88  ? 249 TRP C CB    1 
ATOM 4546  C CG    . TRP C 3 249 ? 222.841 108.965 141.559 1.00 66.88  ? 249 TRP C CG    1 
ATOM 4547  C CD1   . TRP C 3 249 ? 222.510 110.263 141.840 1.00 66.88  ? 249 TRP C CD1   1 
ATOM 4548  C CD2   . TRP C 3 249 ? 223.392 108.975 140.250 1.00 66.88  ? 249 TRP C CD2   1 
ATOM 4549  N NE1   . TRP C 3 249 ? 222.797 111.070 140.778 1.00 66.88  ? 249 TRP C NE1   1 
ATOM 4550  C CE2   . TRP C 3 249 ? 223.343 110.305 139.787 1.00 66.88  ? 249 TRP C CE2   1 
ATOM 4551  C CE3   . TRP C 3 249 ? 223.913 107.995 139.416 1.00 66.88  ? 249 TRP C CE3   1 
ATOM 4552  C CZ2   . TRP C 3 249 ? 223.795 110.670 138.538 1.00 66.88  ? 249 TRP C CZ2   1 
ATOM 4553  C CZ3   . TRP C 3 249 ? 224.370 108.371 138.185 1.00 66.88  ? 249 TRP C CZ3   1 
ATOM 4554  C CH2   . TRP C 3 249 ? 224.297 109.685 137.748 1.00 66.88  ? 249 TRP C CH2   1 
ATOM 4555  N N     . GLU C 3 250 ? 226.143 108.325 142.956 1.00 70.90  ? 250 GLU C N     1 
ATOM 4556  C CA    . GLU C 3 250 ? 227.464 108.249 142.359 1.00 70.90  ? 250 GLU C CA    1 
ATOM 4557  C C     . GLU C 3 250 ? 228.501 107.933 143.439 1.00 70.90  ? 250 GLU C C     1 
ATOM 4558  O O     . GLU C 3 250 ? 229.698 107.883 143.158 1.00 70.90  ? 250 GLU C O     1 
ATOM 4559  C CB    . GLU C 3 250 ? 227.814 109.563 141.659 1.00 70.90  ? 250 GLU C CB    1 
ATOM 4560  C CG    . GLU C 3 250 ? 228.451 109.386 140.290 1.00 70.90  ? 250 GLU C CG    1 
ATOM 4561  C CD    . GLU C 3 250 ? 228.871 110.704 139.669 1.00 70.90  ? 250 GLU C CD    1 
ATOM 4562  O OE1   . GLU C 3 250 ? 229.453 111.543 140.387 1.00 70.90  ? 250 GLU C OE1   1 
ATOM 4563  O OE2   . GLU C 3 250 ? 228.619 110.899 138.461 1.00 70.90  ? 250 GLU C OE2   1 
ATOM 4564  N N     . GLN C 3 251 ? 228.041 107.719 144.672 1.00 74.25  ? 251 GLN C N     1 
ATOM 4565  C CA    . GLN C 3 251 ? 228.957 107.409 145.776 1.00 74.25  ? 251 GLN C CA    1 
ATOM 4566  C C     . GLN C 3 251 ? 229.445 105.971 145.809 1.00 74.25  ? 251 GLN C C     1 
ATOM 4567  O O     . GLN C 3 251 ? 228.641 105.057 146.002 1.00 74.25  ? 251 GLN C O     1 
ATOM 4568  C CB    . GLN C 3 251 ? 228.319 107.703 147.127 1.00 74.25  ? 251 GLN C CB    1 
ATOM 4569  C CG    . GLN C 3 251 ? 228.121 109.152 147.427 1.00 74.25  ? 251 GLN C CG    1 
ATOM 4570  C CD    . GLN C 3 251 ? 229.433 109.903 147.451 1.00 74.25  ? 251 GLN C CD    1 
ATOM 4571  O OE1   . GLN C 3 251 ? 229.737 110.675 146.542 1.00 74.25  ? 251 GLN C OE1   1 
ATOM 4572  N NE2   . GLN C 3 251 ? 230.222 109.681 148.494 1.00 74.25  ? 251 GLN C NE2   1 
ATOM 4573  N N     . PRO C 3 252 ? 230.752 105.743 145.715 1.00 77.40  ? 252 PRO C N     1 
ATOM 4574  C CA    . PRO C 3 252 ? 231.287 104.388 145.880 1.00 77.40  ? 252 PRO C CA    1 
ATOM 4575  C C     . PRO C 3 252 ? 231.127 103.858 147.294 1.00 77.40  ? 252 PRO C C     1 
ATOM 4576  O O     . PRO C 3 252 ? 231.254 102.645 147.499 1.00 77.40  ? 252 PRO C O     1 
ATOM 4577  C CB    . PRO C 3 252 ? 232.764 104.548 145.502 1.00 77.40  ? 252 PRO C CB    1 
ATOM 4578  C CG    . PRO C 3 252 ? 233.065 105.964 145.797 1.00 77.40  ? 252 PRO C CG    1 
ATOM 4579  C CD    . PRO C 3 252 ? 231.817 106.729 145.474 1.00 77.40  ? 252 PRO C CD    1 
ATOM 4580  N N     . GLU C 3 253 ? 230.837 104.724 148.263 1.00 82.20  ? 253 GLU C N     1 
ATOM 4581  C CA    . GLU C 3 253 ? 230.668 104.351 149.660 1.00 82.20  ? 253 GLU C CA    1 
ATOM 4582  C C     . GLU C 3 253 ? 229.195 104.353 150.050 1.00 82.20  ? 253 GLU C C     1 
ATOM 4583  O O     . GLU C 3 253 ? 228.415 105.186 149.581 1.00 82.20  ? 253 GLU C O     1 
ATOM 4584  C CB    . GLU C 3 253 ? 231.406 105.336 150.576 1.00 82.20  ? 253 GLU C CB    1 
ATOM 4585  C CG    . GLU C 3 253 ? 232.852 105.597 150.212 1.00 82.20  ? 253 GLU C CG    1 
ATOM 4586  C CD    . GLU C 3 253 ? 232.974 106.733 149.215 1.00 82.20  ? 253 GLU C CD    1 
ATOM 4587  O OE1   . GLU C 3 253 ? 231.977 107.460 149.034 1.00 82.20  ? 253 GLU C OE1   1 
ATOM 4588  O OE2   . GLU C 3 253 ? 234.055 106.898 148.612 1.00 82.20  ? 253 GLU C OE2   1 
ATOM 4589  N N     . LEU C 3 254 ? 228.826 103.413 150.916 1.00 81.22  ? 254 LEU C N     1 
ATOM 4590  C CA    . LEU C 3 254 ? 227.498 103.364 151.519 1.00 81.22  ? 254 LEU C CA    1 
ATOM 4591  C C     . LEU C 3 254 ? 227.475 104.171 152.814 1.00 81.22  ? 254 LEU C C     1 
ATOM 4592  O O     . LEU C 3 254 ? 228.244 103.894 153.741 1.00 81.22  ? 254 LEU C O     1 
ATOM 4593  C CB    . LEU C 3 254 ? 227.084 101.921 151.787 1.00 81.22  ? 254 LEU C CB    1 
ATOM 4594  C CG    . LEU C 3 254 ? 225.640 101.785 152.254 1.00 81.22  ? 254 LEU C CG    1 
ATOM 4595  C CD1   . LEU C 3 254 ? 224.700 102.508 151.291 1.00 81.22  ? 254 LEU C CD1   1 
ATOM 4596  C CD2   . LEU C 3 254 ? 225.276 100.324 152.393 1.00 81.22  ? 254 LEU C CD2   1 
ATOM 4597  N N     . ASN C 3 255 ? 226.598 105.171 152.862 1.00 76.81  ? 255 ASN C N     1 
ATOM 4598  C CA    . ASN C 3 255 ? 226.640 106.195 153.897 1.00 76.81  ? 255 ASN C CA    1 
ATOM 4599  C C     . ASN C 3 255 ? 226.566 105.586 155.291 1.00 76.81  ? 255 ASN C C     1 
ATOM 4600  O O     . ASN C 3 255 ? 225.873 104.592 155.514 1.00 76.81  ? 255 ASN C O     1 
ATOM 4601  C CB    . ASN C 3 255 ? 225.442 107.124 153.687 1.00 76.81  ? 255 ASN C CB    1 
ATOM 4602  C CG    . ASN C 3 255 ? 225.460 108.344 154.570 1.00 76.81  ? 255 ASN C CG    1 
ATOM 4603  O OD1   . ASN C 3 255 ? 226.070 108.369 155.633 1.00 76.81  ? 255 ASN C OD1   1 
ATOM 4604  N ND2   . ASN C 3 255 ? 224.740 109.363 154.135 1.00 76.81  ? 255 ASN C ND2   1 
ATOM 4605  N N     . ASP C 3 256 ? 227.308 106.177 156.232 1.00 76.09  ? 256 ASP C N     1 
ATOM 4606  C CA    . ASP C 3 256 ? 227.173 105.813 157.636 1.00 76.09  ? 256 ASP C CA    1 
ATOM 4607  C C     . ASP C 3 256 ? 226.156 106.744 158.286 1.00 76.09  ? 256 ASP C C     1 
ATOM 4608  O O     . ASP C 3 256 ? 226.394 107.956 158.338 1.00 76.09  ? 256 ASP C O     1 
ATOM 4609  C CB    . ASP C 3 256 ? 228.506 105.890 158.350 1.00 76.09  ? 256 ASP C CB    1 
ATOM 4610  C CG    . ASP C 3 256 ? 228.371 105.692 159.837 1.00 76.09  ? 256 ASP C CG    1 
ATOM 4611  O OD1   . ASP C 3 256 ? 228.155 104.538 160.264 1.00 76.09  ? 256 ASP C OD1   1 
ATOM 4612  O OD2   . ASP C 3 256 ? 228.498 106.676 160.582 1.00 76.09  ? 256 ASP C OD2   1 
ATOM 4613  N N     . PRO C 3 257 ? 225.040 106.235 158.803 1.00 73.28  ? 257 PRO C N     1 
ATOM 4614  C CA    . PRO C 3 257 ? 224.004 107.127 159.358 1.00 73.28  ? 257 PRO C CA    1 
ATOM 4615  C C     . PRO C 3 257 ? 224.465 108.130 160.405 1.00 73.28  ? 257 PRO C C     1 
ATOM 4616  O O     . PRO C 3 257 ? 223.936 109.246 160.446 1.00 73.28  ? 257 PRO C O     1 
ATOM 4617  C CB    . PRO C 3 257 ? 222.991 106.140 159.952 1.00 73.28  ? 257 PRO C CB    1 
ATOM 4618  C CG    . PRO C 3 257 ? 223.704 104.843 160.036 1.00 73.28  ? 257 PRO C CG    1 
ATOM 4619  C CD    . PRO C 3 257 ? 224.661 104.823 158.913 1.00 73.28  ? 257 PRO C CD    1 
ATOM 4620  N N     . LEU C 3 258 ? 225.425 107.786 161.245 1.00 73.38  ? 258 LEU C N     1 
ATOM 4621  C CA    . LEU C 3 258 ? 225.926 108.709 162.254 1.00 73.38  ? 258 LEU C CA    1 
ATOM 4622  C C     . LEU C 3 258 ? 227.137 109.496 161.772 1.00 73.38  ? 258 LEU C C     1 
ATOM 4623  O O     . LEU C 3 258 ? 227.850 109.087 160.853 1.00 73.38  ? 258 LEU C O     1 
ATOM 4624  C CB    . LEU C 3 258 ? 226.231 107.996 163.571 1.00 73.38  ? 258 LEU C CB    1 
ATOM 4625  C CG    . LEU C 3 258 ? 224.978 107.882 164.450 1.00 73.38  ? 258 LEU C CG    1 
ATOM 4626  C CD1   . LEU C 3 258 ? 223.954 106.974 163.848 1.00 73.38  ? 258 LEU C CD1   1 
ATOM 4627  C CD2   . LEU C 3 258 ? 225.302 107.430 165.849 1.00 73.38  ? 258 LEU C CD2   1 
ATOM 4628  N N     . GLY C 3 259 ? 227.305 110.676 162.339 1.00 74.08  ? 259 GLY C N     1 
ATOM 4629  C CA    . GLY C 3 259 ? 228.372 111.576 161.953 1.00 74.08  ? 259 GLY C CA    1 
ATOM 4630  C C     . GLY C 3 259 ? 227.844 112.804 161.239 1.00 74.08  ? 259 GLY C C     1 
ATOM 4631  O O     . GLY C 3 259 ? 226.644 112.975 161.023 1.00 74.08  ? 259 GLY C O     1 
ATOM 4632  N N     . LEU C 3 260 ? 228.761 113.663 160.908 1.00 77.30  ? 260 LEU C N     1 
ATOM 4633  C CA    . LEU C 3 260 ? 228.342 114.898 160.271 1.00 77.30  ? 260 LEU C CA    1 
ATOM 4634  C C     . LEU C 3 260 ? 228.232 114.683 158.766 1.00 77.30  ? 260 LEU C C     1 
ATOM 4635  O O     . LEU C 3 260 ? 229.139 114.099 158.163 1.00 77.30  ? 260 LEU C O     1 
ATOM 4636  C CB    . LEU C 3 260 ? 229.336 116.013 160.586 1.00 77.30  ? 260 LEU C CB    1 
ATOM 4637  C CG    . LEU C 3 260 ? 229.102 117.484 160.210 1.00 77.30  ? 260 LEU C CG    1 
ATOM 4638  C CD1   . LEU C 3 260 ? 229.370 117.791 158.747 1.00 77.30  ? 260 LEU C CD1   1 
ATOM 4639  C CD2   . LEU C 3 260 ? 227.705 117.930 160.609 1.00 77.30  ? 260 LEU C CD2   1 
ATOM 4640  N N     . PRO C 3 261 ? 227.135 115.109 158.138 1.00 75.84  ? 261 PRO C N     1 
ATOM 4641  C CA    . PRO C 3 261 ? 227.078 115.123 156.672 1.00 75.84  ? 261 PRO C CA    1 
ATOM 4642  C C     . PRO C 3 261 ? 228.055 116.150 156.133 1.00 75.84  ? 261 PRO C C     1 
ATOM 4643  O O     . PRO C 3 261 ? 227.723 117.334 156.037 1.00 75.84  ? 261 PRO C O     1 
ATOM 4644  C CB    . PRO C 3 261 ? 225.625 115.510 156.375 1.00 75.84  ? 261 PRO C CB    1 
ATOM 4645  C CG    . PRO C 3 261 ? 224.884 115.201 157.623 1.00 75.84  ? 261 PRO C CG    1 
ATOM 4646  C CD    . PRO C 3 261 ? 225.839 115.450 158.741 1.00 75.84  ? 261 PRO C CD    1 
ATOM 4647  N N     . GLU C 3 262 ? 229.254 115.707 155.779 1.00 82.32  ? 262 GLU C N     1 
ATOM 4648  C CA    . GLU C 3 262 ? 230.315 116.621 155.379 1.00 82.32  ? 262 GLU C CA    1 
ATOM 4649  C C     . GLU C 3 262 ? 229.878 117.511 154.220 1.00 82.32  ? 262 GLU C C     1 
ATOM 4650  O O     . GLU C 3 262 ? 229.129 117.093 153.336 1.00 82.32  ? 262 GLU C O     1 
ATOM 4651  C CB    . GLU C 3 262 ? 231.567 115.816 155.028 1.00 82.32  ? 262 GLU C CB    1 
ATOM 4652  C CG    . GLU C 3 262 ? 231.385 114.801 153.921 1.00 82.32  ? 262 GLU C CG    1 
ATOM 4653  C CD    . GLU C 3 262 ? 231.995 115.267 152.623 1.00 82.32  ? 262 GLU C CD    1 
ATOM 4654  O OE1   . GLU C 3 262 ? 232.492 116.406 152.588 1.00 82.32  ? 262 GLU C OE1   1 
ATOM 4655  O OE2   . GLU C 3 262 ? 231.986 114.497 151.644 1.00 82.32  ? 262 GLU C OE2   1 
ATOM 4656  N N     . GLU C 3 263 ? 230.368 118.752 154.232 1.00 84.70  ? 263 GLU C N     1 
ATOM 4657  C CA    . GLU C 3 263 ? 230.001 119.773 153.259 1.00 84.70  ? 263 GLU C CA    1 
ATOM 4658  C C     . GLU C 3 263 ? 230.498 119.379 151.868 1.00 84.70  ? 263 GLU C C     1 
ATOM 4659  O O     . GLU C 3 263 ? 231.274 118.436 151.706 1.00 84.70  ? 263 GLU C O     1 
ATOM 4660  C CB    . GLU C 3 263 ? 230.589 121.107 153.748 1.00 84.70  ? 263 GLU C CB    1 
ATOM 4661  C CG    . GLU C 3 263 ? 230.427 122.380 152.923 1.00 84.70  ? 263 GLU C CG    1 
ATOM 4662  C CD    . GLU C 3 263 ? 231.386 122.443 151.736 1.00 84.70  ? 263 GLU C CD    1 
ATOM 4663  O OE1   . GLU C 3 263 ? 232.358 121.661 151.711 1.00 84.70  ? 263 GLU C OE1   1 
ATOM 4664  O OE2   . GLU C 3 263 ? 231.171 123.272 150.826 1.00 84.70  ? 263 GLU C OE2   1 
ATOM 4665  N N     . SER C 3 264 ? 230.062 120.112 150.841 1.00 83.07  ? 264 SER C N     1 
ATOM 4666  C CA    . SER C 3 264 ? 230.483 119.756 149.487 1.00 83.07  ? 264 SER C CA    1 
ATOM 4667  C C     . SER C 3 264 ? 230.383 120.957 148.555 1.00 83.07  ? 264 SER C C     1 
ATOM 4668  O O     . SER C 3 264 ? 229.281 121.343 148.156 1.00 83.07  ? 264 SER C O     1 
ATOM 4669  C CB    . SER C 3 264 ? 229.630 118.606 148.967 1.00 83.07  ? 264 SER C CB    1 
ATOM 4670  O OG    . SER C 3 264 ? 229.842 117.417 149.711 1.00 83.07  ? 264 SER C OG    1 
ATOM 4671  N N     . ALA C 3 265 ? 231.532 121.543 148.218 1.00 83.07  ? 265 ALA C N     1 
ATOM 4672  C CA    . ALA C 3 265 ? 231.565 122.710 147.348 1.00 83.07  ? 265 ALA C CA    1 
ATOM 4673  C C     . ALA C 3 265 ? 231.250 122.364 145.896 1.00 83.07  ? 265 ALA C C     1 
ATOM 4674  O O     . ALA C 3 265 ? 230.830 123.245 145.138 1.00 83.07  ? 265 ALA C O     1 
ATOM 4675  C CB    . ALA C 3 265 ? 232.928 123.396 147.436 1.00 83.07  ? 265 ALA C CB    1 
ATOM 4676  N N     . GLY C 3 266 ? 231.447 121.105 145.501 1.00 78.62  ? 266 GLY C N     1 
ATOM 4677  C CA    . GLY C 3 266 ? 231.161 120.692 144.140 1.00 78.62  ? 266 GLY C CA    1 
ATOM 4678  C C     . GLY C 3 266 ? 229.700 120.833 143.773 1.00 78.62  ? 266 GLY C C     1 
ATOM 4679  O O     . GLY C 3 266 ? 228.826 120.988 144.623 1.00 78.62  ? 266 GLY C O     1 
ATOM 4680  N N     . LEU C 3 267 ? 229.434 120.771 142.463 1.00 73.17  ? 267 LEU C N     1 
ATOM 4681  C CA    . LEU C 3 267 ? 228.072 121.012 142.010 1.00 73.17  ? 267 LEU C CA    1 
ATOM 4682  C C     . LEU C 3 267 ? 227.112 119.932 142.469 1.00 73.17  ? 267 LEU C C     1 
ATOM 4683  O O     . LEU C 3 267 ? 225.914 120.199 142.580 1.00 73.17  ? 267 LEU C O     1 
ATOM 4684  C CB    . LEU C 3 267 ? 228.020 121.099 140.481 1.00 73.17  ? 267 LEU C CB    1 
ATOM 4685  C CG    . LEU C 3 267 ? 228.466 119.880 139.659 1.00 73.17  ? 267 LEU C CG    1 
ATOM 4686  C CD1   . LEU C 3 267 ? 227.348 118.851 139.468 1.00 73.17  ? 267 LEU C CD1   1 
ATOM 4687  C CD2   . LEU C 3 267 ? 228.997 120.336 138.306 1.00 73.17  ? 267 LEU C CD2   1 
ATOM 4688  N N     . ALA C 3 268 ? 227.607 118.736 142.779 1.00 71.42  ? 268 ALA C N     1 
ATOM 4689  C CA    . ALA C 3 268 ? 226.725 117.705 143.303 1.00 71.42  ? 268 ALA C CA    1 
ATOM 4690  C C     . ALA C 3 268 ? 226.307 117.992 144.734 1.00 71.42  ? 268 ALA C C     1 
ATOM 4691  O O     . ALA C 3 268 ? 225.397 117.329 145.242 1.00 71.42  ? 268 ALA C O     1 
ATOM 4692  C CB    . ALA C 3 268 ? 227.387 116.332 143.204 1.00 71.42  ? 268 ALA C CB    1 
ATOM 4693  N N     . GLY C 3 269 ? 226.956 118.949 145.394 1.00 73.75  ? 269 GLY C N     1 
ATOM 4694  C CA    . GLY C 3 269 ? 226.582 119.327 146.739 1.00 73.75  ? 269 GLY C CA    1 
ATOM 4695  C C     . GLY C 3 269 ? 225.717 120.564 146.770 1.00 73.75  ? 269 GLY C C     1 
ATOM 4696  O O     . GLY C 3 269 ? 225.046 120.835 147.769 1.00 73.75  ? 269 GLY C O     1 
ATOM 4697  N N     . ILE C 3 270 ? 225.709 121.317 145.674 1.00 70.11  ? 270 ILE C N     1 
ATOM 4698  C CA    . ILE C 3 270 ? 224.848 122.483 145.549 1.00 70.11  ? 270 ILE C CA    1 
ATOM 4699  C C     . ILE C 3 270 ? 223.686 122.208 144.630 1.00 70.11  ? 270 ILE C C     1 
ATOM 4700  O O     . ILE C 3 270 ? 222.835 123.086 144.430 1.00 70.11  ? 270 ILE C O     1 
ATOM 4701  C CB    . ILE C 3 270 ? 225.630 123.720 145.073 1.00 70.11  ? 270 ILE C CB    1 
ATOM 4702  C CG1   . ILE C 3 270 ? 225.965 123.589 143.590 1.00 70.11  ? 270 ILE C CG1   1 
ATOM 4703  C CG2   . ILE C 3 270 ? 226.881 123.909 145.903 1.00 70.11  ? 270 ILE C CG2   1 
ATOM 4704  C CD1   . ILE C 3 270 ? 226.771 124.737 143.049 1.00 70.11  ? 270 ILE C CD1   1 
ATOM 4705  N N     . LEU C 3 271 ? 223.625 121.011 144.064 1.00 65.34  ? 271 LEU C N     1 
ATOM 4706  C CA    . LEU C 3 271 ? 222.472 120.522 143.338 1.00 65.34  ? 271 LEU C CA    1 
ATOM 4707  C C     . LEU C 3 271 ? 221.636 119.627 144.243 1.00 65.34  ? 271 LEU C C     1 
ATOM 4708  O O     . LEU C 3 271 ? 220.720 118.946 143.778 1.00 65.34  ? 271 LEU C O     1 
ATOM 4709  C CB    . LEU C 3 271 ? 222.932 119.830 142.057 1.00 65.34  ? 271 LEU C CB    1 
ATOM 4710  C CG    . LEU C 3 271 ? 221.978 119.489 140.924 1.00 65.34  ? 271 LEU C CG    1 
ATOM 4711  C CD1   . LEU C 3 271 ? 222.673 119.767 139.613 1.00 65.34  ? 271 LEU C CD1   1 
ATOM 4712  C CD2   . LEU C 3 271 ? 221.664 118.043 140.988 1.00 65.34  ? 271 LEU C CD2   1 
ATOM 4713  N N     . ARG C 3 272 ? 221.964 119.624 145.537 1.00 66.31  ? 272 ARG C N     1 
ATOM 4714  C CA    . ARG C 3 272 ? 221.267 118.897 146.597 1.00 66.31  ? 272 ARG C CA    1 
ATOM 4715  C C     . ARG C 3 272 ? 221.146 117.393 146.350 1.00 66.31  ? 272 ARG C C     1 
ATOM 4716  O O     . ARG C 3 272 ? 220.156 116.772 146.742 1.00 66.31  ? 272 ARG C O     1 
ATOM 4717  C CB    . ARG C 3 272 ? 219.886 119.505 146.865 1.00 66.31  ? 272 ARG C CB    1 
ATOM 4718  C CG    . ARG C 3 272 ? 219.899 120.671 147.852 1.00 66.31  ? 272 ARG C CG    1 
ATOM 4719  C CD    . ARG C 3 272 ? 220.603 121.886 147.281 1.00 66.31  ? 272 ARG C CD    1 
ATOM 4720  N NE    . ARG C 3 272 ? 220.645 123.002 148.217 1.00 66.31  ? 272 ARG C NE    1 
ATOM 4721  C CZ    . ARG C 3 272 ? 221.365 124.100 148.025 1.00 66.31  ? 272 ARG C CZ    1 
ATOM 4722  N NH1   . ARG C 3 272 ? 222.106 124.226 146.935 1.00 66.31  ? 272 ARG C NH1   1 
ATOM 4723  N NH2   . ARG C 3 272 ? 221.349 125.070 148.925 1.00 66.31  ? 272 ARG C NH2   1 
ATOM 4724  N N     . LEU C 3 273 ? 222.133 116.794 145.696 1.00 64.36  ? 273 LEU C N     1 
ATOM 4725  C CA    . LEU C 3 273 ? 222.119 115.358 145.448 1.00 64.36  ? 273 LEU C CA    1 
ATOM 4726  C C     . LEU C 3 273 ? 223.319 114.656 146.069 1.00 64.36  ? 273 LEU C C     1 
ATOM 4727  O O     . LEU C 3 273 ? 223.612 113.510 145.712 1.00 64.36  ? 273 LEU C O     1 
ATOM 4728  C CB    . LEU C 3 273 ? 221.988 114.996 143.972 1.00 64.36  ? 273 LEU C CB    1 
ATOM 4729  C CG    . LEU C 3 273 ? 220.602 115.344 143.452 1.00 64.36  ? 273 LEU C CG    1 
ATOM 4730  C CD1   . LEU C 3 273 ? 220.470 115.105 141.966 1.00 64.36  ? 273 LEU C CD1   1 
ATOM 4731  C CD2   . LEU C 3 273 ? 219.603 114.511 144.227 1.00 64.36  ? 273 LEU C CD2   1 
ATOM 4732  N N     . ASP C 3 274 ? 224.023 115.299 146.997 1.00 70.06  ? 274 ASP C N     1 
ATOM 4733  C CA    . ASP C 3 274 ? 225.147 114.599 147.599 1.00 70.06  ? 274 ASP C CA    1 
ATOM 4734  C C     . ASP C 3 274 ? 224.640 113.614 148.644 1.00 70.06  ? 274 ASP C C     1 
ATOM 4735  O O     . ASP C 3 274 ? 225.201 112.526 148.810 1.00 70.06  ? 274 ASP C O     1 
ATOM 4736  C CB    . ASP C 3 274 ? 226.159 115.592 148.187 1.00 70.06  ? 274 ASP C CB    1 
ATOM 4737  C CG    . ASP C 3 274 ? 225.557 116.511 149.236 1.00 70.06  ? 274 ASP C CG    1 
ATOM 4738  O OD1   . ASP C 3 274 ? 224.596 116.113 149.919 1.00 70.06  ? 274 ASP C OD1   1 
ATOM 4739  O OD2   . ASP C 3 274 ? 226.067 117.637 149.397 1.00 70.06  ? 274 ASP C OD2   1 
ATOM 4740  N N     . HIS C 3 275 ? 223.588 113.982 149.363 1.00 66.46  ? 275 HIS C N     1 
ATOM 4741  C CA    . HIS C 3 275 ? 222.992 113.071 150.320 1.00 66.46  ? 275 HIS C CA    1 
ATOM 4742  C C     . HIS C 3 275 ? 221.587 113.574 150.595 1.00 66.46  ? 275 HIS C C     1 
ATOM 4743  O O     . HIS C 3 275 ? 221.376 114.779 150.746 1.00 66.46  ? 275 HIS C O     1 
ATOM 4744  C CB    . HIS C 3 275 ? 223.807 113.026 151.605 1.00 66.46  ? 275 HIS C CB    1 
ATOM 4745  C CG    . HIS C 3 275 ? 223.884 114.346 152.297 1.00 66.46  ? 275 HIS C CG    1 
ATOM 4746  N ND1   . HIS C 3 275 ? 224.821 115.304 151.985 1.00 66.46  ? 275 HIS C ND1   1 
ATOM 4747  C CD2   . HIS C 3 275 ? 223.117 114.874 153.278 1.00 66.46  ? 275 HIS C CD2   1 
ATOM 4748  C CE1   . HIS C 3 275 ? 224.640 116.360 152.757 1.00 66.46  ? 275 HIS C CE1   1 
ATOM 4749  N NE2   . HIS C 3 275 ? 223.611 116.125 153.550 1.00 66.46  ? 275 HIS C NE2   1 
ATOM 4750  N N     . PHE C 3 276 ? 220.643 112.655 150.708 1.00 57.56  ? 276 PHE C N     1 
ATOM 4751  C CA    . PHE C 3 276 ? 219.288 113.058 151.030 1.00 57.56  ? 276 PHE C CA    1 
ATOM 4752  C C     . PHE C 3 276 ? 219.012 112.693 152.486 1.00 57.56  ? 276 PHE C C     1 
ATOM 4753  O O     . PHE C 3 276 ? 219.458 111.661 152.990 1.00 57.56  ? 276 PHE C O     1 
ATOM 4754  C CB    . PHE C 3 276 ? 218.281 112.526 150.003 1.00 57.56  ? 276 PHE C CB    1 
ATOM 4755  C CG    . PHE C 3 276 ? 218.267 111.058 149.833 1.00 57.56  ? 276 PHE C CG    1 
ATOM 4756  C CD1   . PHE C 3 276 ? 219.168 110.437 149.002 1.00 57.56  ? 276 PHE C CD1   1 
ATOM 4757  C CD2   . PHE C 3 276 ? 217.231 110.322 150.350 1.00 57.56  ? 276 PHE C CD2   1 
ATOM 4758  C CE1   . PHE C 3 276 ? 219.116 109.075 148.818 1.00 57.56  ? 276 PHE C CE1   1 
ATOM 4759  C CE2   . PHE C 3 276 ? 217.167 108.961 150.158 1.00 57.56  ? 276 PHE C CE2   1 
ATOM 4760  C CZ    . PHE C 3 276 ? 218.110 108.338 149.389 1.00 57.56  ? 276 PHE C CZ    1 
ATOM 4761  N N     . ARG C 3 277 ? 218.210 113.546 153.121 1.00 49.37  ? 277 ARG C N     1 
ATOM 4762  C CA    . ARG C 3 277 ? 217.793 113.390 154.509 1.00 49.37  ? 277 ARG C CA    1 
ATOM 4763  C C     . ARG C 3 277 ? 217.006 112.113 154.773 1.00 49.37  ? 277 ARG C C     1 
ATOM 4764  O O     . ARG C 3 277 ? 217.173 111.491 155.816 1.00 49.37  ? 277 ARG C O     1 
ATOM 4765  C CB    . ARG C 3 277 ? 216.954 114.589 154.942 1.00 49.37  ? 277 ARG C CB    1 
ATOM 4766  C CG    . ARG C 3 277 ? 217.589 115.419 156.041 1.00 49.37  ? 277 ARG C CG    1 
ATOM 4767  C CD    . ARG C 3 277 ? 217.898 116.821 155.551 1.00 49.37  ? 277 ARG C CD    1 
ATOM 4768  N NE    . ARG C 3 277 ? 217.375 117.836 156.458 1.00 49.37  ? 277 ARG C NE    1 
ATOM 4769  C CZ    . ARG C 3 277 ? 217.343 119.134 156.183 1.00 49.37  ? 277 ARG C CZ    1 
ATOM 4770  N NH1   . ARG C 3 277 ? 217.803 119.578 155.022 1.00 49.37  ? 277 ARG C NH1   1 
ATOM 4771  N NH2   . ARG C 3 277 ? 216.849 119.988 157.067 1.00 49.37  ? 277 ARG C NH2   1 
ATOM 4772  N N     . HIS C 3 278 ? 216.142 111.719 153.845 1.00 47.20  ? 278 HIS C N     1 
ATOM 4773  C CA    . HIS C 3 278 ? 215.375 110.500 154.058 1.00 47.20  ? 278 HIS C CA    1 
ATOM 4774  C C     . HIS C 3 278 ? 216.129 109.323 153.450 1.00 47.20  ? 278 HIS C C     1 
ATOM 4775  O O     . HIS C 3 278 ? 217.270 109.459 153.022 1.00 47.20  ? 278 HIS C O     1 
ATOM 4776  C CB    . HIS C 3 278 ? 213.969 110.631 153.475 1.00 47.20  ? 278 HIS C CB    1 
ATOM 4777  C CG    . HIS C 3 278 ? 213.135 111.675 154.147 1.00 47.20  ? 278 HIS C CG    1 
ATOM 4778  N ND1   . HIS C 3 278 ? 212.219 111.376 155.129 1.00 47.20  ? 278 HIS C ND1   1 
ATOM 4779  C CD2   . HIS C 3 278 ? 213.096 113.018 153.992 1.00 47.20  ? 278 HIS C CD2   1 
ATOM 4780  C CE1   . HIS C 3 278 ? 211.639 112.489 155.538 1.00 47.20  ? 278 HIS C CE1   1 
ATOM 4781  N NE2   . HIS C 3 278 ? 212.155 113.500 154.866 1.00 47.20  ? 278 HIS C NE2   1 
ATOM 4782  N N     . ALA C 3 279 ? 215.582 108.124 153.617 1.00 53.49  ? 279 ALA C N     1 
ATOM 4783  C CA    . ALA C 3 279 ? 216.148 106.935 152.989 1.00 53.49  ? 279 ALA C CA    1 
ATOM 4784  C C     . ALA C 3 279 ? 215.038 105.925 152.749 1.00 53.49  ? 279 ALA C C     1 
ATOM 4785  O O     . ALA C 3 279 ? 214.388 105.486 153.696 1.00 53.49  ? 279 ALA C O     1 
ATOM 4786  C CB    . ALA C 3 279 ? 217.247 106.328 153.854 1.00 53.49  ? 279 ALA C CB    1 
ATOM 4787  N N     . VAL C 3 280 ? 214.835 105.547 151.495 1.00 53.91  ? 280 VAL C N     1 
ATOM 4788  C CA    . VAL C 3 280 ? 213.726 104.694 151.084 1.00 53.91  ? 280 VAL C CA    1 
ATOM 4789  C C     . VAL C 3 280 ? 214.262 103.353 150.599 1.00 53.91  ? 280 VAL C C     1 
ATOM 4790  O O     . VAL C 3 280 ? 215.342 103.285 150.005 1.00 53.91  ? 280 VAL C O     1 
ATOM 4791  C CB    . VAL C 3 280 ? 212.876 105.380 150.001 1.00 53.91  ? 280 VAL C CB    1 
ATOM 4792  C CG1   . VAL C 3 280 ? 213.714 105.661 148.776 1.00 53.91  ? 280 VAL C CG1   1 
ATOM 4793  C CG2   . VAL C 3 280 ? 211.705 104.517 149.636 1.00 53.91  ? 280 VAL C CG2   1 
ATOM 4794  N N     . LEU C 3 281 ? 213.531 102.280 150.894 1.00 59.01  ? 281 LEU C N     1 
ATOM 4795  C CA    . LEU C 3 281 ? 213.821 100.961 150.347 1.00 59.01  ? 281 LEU C CA    1 
ATOM 4796  C C     . LEU C 3 281 ? 212.546 100.366 149.765 1.00 59.01  ? 281 LEU C C     1 
ATOM 4797  O O     . LEU C 3 281 ? 211.484 100.436 150.388 1.00 59.01  ? 281 LEU C O     1 
ATOM 4798  C CB    . LEU C 3 281 ? 214.382 100.042 151.420 1.00 59.01  ? 281 LEU C CB    1 
ATOM 4799  C CG    . LEU C 3 281 ? 214.758 98.657  150.921 1.00 59.01  ? 281 LEU C CG    1 
ATOM 4800  C CD1   . LEU C 3 281 ? 215.771 98.775  149.825 1.00 59.01  ? 281 LEU C CD1   1 
ATOM 4801  C CD2   . LEU C 3 281 ? 215.289 97.806  152.044 1.00 59.01  ? 281 LEU C CD2   1 
ATOM 4802  N N     . LEU C 3 282 ? 212.644 99.825  148.559 1.00 59.78  ? 282 LEU C N     1 
ATOM 4803  C CA    . LEU C 3 282 ? 211.514 99.276  147.822 1.00 59.78  ? 282 LEU C CA    1 
ATOM 4804  C C     . LEU C 3 282 ? 211.612 97.760  147.714 1.00 59.78  ? 282 LEU C C     1 
ATOM 4805  O O     . LEU C 3 282 ? 212.595 97.239  147.182 1.00 59.78  ? 282 LEU C O     1 
ATOM 4806  C CB    . LEU C 3 282 ? 211.394 99.903  146.432 1.00 59.78  ? 282 LEU C CB    1 
ATOM 4807  C CG    . LEU C 3 282 ? 211.233 101.417 146.227 1.00 59.78  ? 282 LEU C CG    1 
ATOM 4808  C CD1   . LEU C 3 282 ? 212.234 102.286 146.958 1.00 59.78  ? 282 LEU C CD1   1 
ATOM 4809  C CD2   . LEU C 3 282 ? 211.292 101.719 144.754 1.00 59.78  ? 282 LEU C CD2   1 
ATOM 4810  N N     . HIS C 3 283 ? 210.622 97.068  148.226 1.00 64.03  ? 283 HIS C N     1 
ATOM 4811  C CA    . HIS C 3 283 ? 210.593 95.618  148.100 1.00 64.03  ? 283 HIS C CA    1 
ATOM 4812  C C     . HIS C 3 283 ? 210.058 95.229  146.727 1.00 64.03  ? 283 HIS C C     1 
ATOM 4813  O O     . HIS C 3 283 ? 208.965 95.658  146.351 1.00 64.03  ? 283 HIS C O     1 
ATOM 4814  C CB    . HIS C 3 283 ? 209.701 95.001  149.161 1.00 64.03  ? 283 HIS C CB    1 
ATOM 4815  C CG    . HIS C 3 283 ? 209.747 93.508  149.181 1.00 64.03  ? 283 HIS C CG    1 
ATOM 4816  N ND1   . HIS C 3 283 ? 208.830 92.732  148.510 1.00 64.03  ? 283 HIS C ND1   1 
ATOM 4817  C CD2   . HIS C 3 283 ? 210.576 92.648  149.815 1.00 64.03  ? 283 HIS C CD2   1 
ATOM 4818  C CE1   . HIS C 3 283 ? 209.109 91.455  148.707 1.00 64.03  ? 283 HIS C CE1   1 
ATOM 4819  N NE2   . HIS C 3 283 ? 210.161 91.377  149.500 1.00 64.03  ? 283 HIS C NE2   1 
ATOM 4820  N N     . PRO C 3 284 ? 210.782 94.425  145.963 1.00 67.74  ? 284 PRO C N     1 
ATOM 4821  C CA    . PRO C 3 284 ? 210.367 94.134  144.592 1.00 67.74  ? 284 PRO C CA    1 
ATOM 4822  C C     . PRO C 3 284 ? 209.318 93.040  144.522 1.00 67.74  ? 284 PRO C C     1 
ATOM 4823  O O     . PRO C 3 284 ? 209.223 92.170  145.389 1.00 67.74  ? 284 PRO C O     1 
ATOM 4824  C CB    . PRO C 3 284 ? 211.669 93.679  143.930 1.00 67.74  ? 284 PRO C CB    1 
ATOM 4825  C CG    . PRO C 3 284 ? 212.401 93.023  145.033 1.00 67.74  ? 284 PRO C CG    1 
ATOM 4826  C CD    . PRO C 3 284 ? 212.068 93.796  146.288 1.00 67.74  ? 284 PRO C CD    1 
ATOM 4827  N N     . SER C 3 285 ? 208.525 93.104  143.469 1.00 72.90  ? 285 SER C N     1 
ATOM 4828  C CA    . SER C 3 285 ? 207.666 92.000  143.107 1.00 72.90  ? 285 SER C CA    1 
ATOM 4829  C C     . SER C 3 285 ? 208.513 90.940  142.411 1.00 72.90  ? 285 SER C C     1 
ATOM 4830  O O     . SER C 3 285 ? 209.570 91.255  141.863 1.00 72.90  ? 285 SER C O     1 
ATOM 4831  C CB    . SER C 3 285 ? 206.560 92.507  142.182 1.00 72.90  ? 285 SER C CB    1 
ATOM 4832  O OG    . SER C 3 285 ? 205.712 91.475  141.717 1.00 72.90  ? 285 SER C OG    1 
ATOM 4833  N N     . PRO C 3 286 ? 208.097 89.669  142.444 1.00 75.62  ? 286 PRO C N     1 
ATOM 4834  C CA    . PRO C 3 286 ? 208.940 88.618  141.847 1.00 75.62  ? 286 PRO C CA    1 
ATOM 4835  C C     . PRO C 3 286 ? 209.310 88.887  140.401 1.00 75.62  ? 286 PRO C C     1 
ATOM 4836  O O     . PRO C 3 286 ? 210.396 88.494  139.957 1.00 75.62  ? 286 PRO C O     1 
ATOM 4837  C CB    . PRO C 3 286 ? 208.079 87.356  141.996 1.00 75.62  ? 286 PRO C CB    1 
ATOM 4838  C CG    . PRO C 3 286 ? 206.702 87.840  142.280 1.00 75.62  ? 286 PRO C CG    1 
ATOM 4839  C CD    . PRO C 3 286 ? 206.883 89.102  143.048 1.00 75.62  ? 286 PRO C CD    1 
ATOM 4840  N N     . ASP C 3 287 ? 208.430 89.539  139.649 1.00 81.20  ? 287 ASP C N     1 
ATOM 4841  C CA    . ASP C 3 287 ? 208.691 89.893  138.263 1.00 81.20  ? 287 ASP C CA    1 
ATOM 4842  C C     . ASP C 3 287 ? 209.433 91.211  138.127 1.00 81.20  ? 287 ASP C C     1 
ATOM 4843  O O     . ASP C 3 287 ? 210.105 91.433  137.114 1.00 81.20  ? 287 ASP C O     1 
ATOM 4844  C CB    . ASP C 3 287 ? 207.381 89.997  137.479 1.00 81.20  ? 287 ASP C CB    1 
ATOM 4845  C CG    . ASP C 3 287 ? 206.688 88.669  137.322 1.00 81.20  ? 287 ASP C CG    1 
ATOM 4846  O OD1   . ASP C 3 287 ? 207.386 87.634  137.293 1.00 81.20  ? 287 ASP C OD1   1 
ATOM 4847  O OD2   . ASP C 3 287 ? 205.442 88.662  137.234 1.00 81.20  ? 287 ASP C OD2   1 
ATOM 4848  N N     . GLY C 3 288 ? 209.334 92.074  139.128 1.00 74.03  ? 288 GLY C N     1 
ATOM 4849  C CA    . GLY C 3 288 ? 209.882 93.406  139.082 1.00 74.03  ? 288 GLY C CA    1 
ATOM 4850  C C     . GLY C 3 288 ? 208.907 94.397  138.501 1.00 74.03  ? 288 GLY C C     1 
ATOM 4851  O O     . GLY C 3 288 ? 209.297 95.522  138.171 1.00 74.03  ? 288 GLY C O     1 
ATOM 4852  N N     . SER C 3 289 ? 207.642 94.006  138.389 1.00 70.01  ? 289 SER C N     1 
ATOM 4853  C CA    . SER C 3 289 ? 206.575 94.826  137.848 1.00 70.01  ? 289 SER C CA    1 
ATOM 4854  C C     . SER C 3 289 ? 205.968 95.737  138.895 1.00 70.01  ? 289 SER C C     1 
ATOM 4855  O O     . SER C 3 289 ? 205.356 96.749  138.537 1.00 70.01  ? 289 SER C O     1 
ATOM 4856  C CB    . SER C 3 289 ? 205.485 93.949  137.237 1.00 70.01  ? 289 SER C CB    1 
ATOM 4857  O OG    . SER C 3 289 ? 206.021 93.133  136.215 1.00 70.01  ? 289 SER C OG    1 
ATOM 4858  N N     . HIS C 3 290 ? 206.126 95.418  140.175 1.00 67.39  ? 290 HIS C N     1 
ATOM 4859  C CA    . HIS C 3 290 ? 205.459 96.191  141.201 1.00 67.39  ? 290 HIS C CA    1 
ATOM 4860  C C     . HIS C 3 290 ? 206.376 96.349  142.403 1.00 67.39  ? 290 HIS C C     1 
ATOM 4861  O O     . HIS C 3 290 ? 207.361 95.627  142.561 1.00 67.39  ? 290 HIS C O     1 
ATOM 4862  C CB    . HIS C 3 290 ? 204.222 95.433  141.700 1.00 67.39  ? 290 HIS C CB    1 
ATOM 4863  C CG    . HIS C 3 290 ? 203.213 95.107  140.644 1.00 67.39  ? 290 HIS C CG    1 
ATOM 4864  N ND1   . HIS C 3 290 ? 202.532 96.064  139.926 1.00 67.39  ? 290 HIS C ND1   1 
ATOM 4865  C CD2   . HIS C 3 290 ? 202.786 93.912  140.175 1.00 67.39  ? 290 HIS C CD2   1 
ATOM 4866  C CE1   . HIS C 3 290 ? 201.710 95.471  139.077 1.00 67.39  ? 290 HIS C CE1   1 
ATOM 4867  N NE2   . HIS C 3 290 ? 201.852 94.165  139.203 1.00 67.39  ? 290 HIS C NE2   1 
ATOM 4868  N N     . VAL C 3 291 ? 206.028 97.295  143.271 1.00 63.06  ? 291 VAL C N     1 
ATOM 4869  C CA    . VAL C 3 291 ? 206.627 97.420  144.593 1.00 63.06  ? 291 VAL C CA    1 
ATOM 4870  C C     . VAL C 3 291 ? 205.596 96.924  145.591 1.00 63.06  ? 291 VAL C C     1 
ATOM 4871  O O     . VAL C 3 291 ? 204.435 97.340  145.532 1.00 63.06  ? 291 VAL C O     1 
ATOM 4872  C CB    . VAL C 3 291 ? 207.040 98.871  144.885 1.00 63.06  ? 291 VAL C CB    1 
ATOM 4873  C CG1   . VAL C 3 291 ? 207.518 99.012  146.307 1.00 63.06  ? 291 VAL C CG1   1 
ATOM 4874  C CG2   . VAL C 3 291 ? 208.124 99.288  143.934 1.00 63.06  ? 291 VAL C CG2   1 
ATOM 4875  N N     . VAL C 3 292 ? 206.007 96.097  146.542 1.00 62.51  ? 292 VAL C N     1 
ATOM 4876  C CA    . VAL C 3 292 ? 205.055 95.511  147.476 1.00 62.51  ? 292 VAL C CA    1 
ATOM 4877  C C     . VAL C 3 292 ? 205.129 96.162  148.849 1.00 62.51  ? 292 VAL C C     1 
ATOM 4878  O O     . VAL C 3 292 ? 204.103 96.490  149.439 1.00 62.51  ? 292 VAL C O     1 
ATOM 4879  C CB    . VAL C 3 292 ? 205.263 93.986  147.553 1.00 62.51  ? 292 VAL C CB    1 
ATOM 4880  C CG1   . VAL C 3 292 ? 204.264 93.373  148.493 1.00 62.51  ? 292 VAL C CG1   1 
ATOM 4881  C CG2   . VAL C 3 292 ? 205.111 93.383  146.173 1.00 62.51  ? 292 VAL C CG2   1 
ATOM 4882  N N     . ASP C 3 293 ? 206.330 96.355  149.382 1.00 59.37  ? 293 ASP C N     1 
ATOM 4883  C CA    . ASP C 3 293 ? 206.508 97.058  150.644 1.00 59.37  ? 293 ASP C CA    1 
ATOM 4884  C C     . ASP C 3 293 ? 207.546 98.150  150.467 1.00 59.37  ? 293 ASP C C     1 
ATOM 4885  O O     . ASP C 3 293 ? 208.271 98.193  149.475 1.00 59.37  ? 293 ASP C O     1 
ATOM 4886  C CB    . ASP C 3 293 ? 206.888 96.120  151.789 1.00 59.37  ? 293 ASP C CB    1 
ATOM 4887  C CG    . ASP C 3 293 ? 205.698 95.345  152.316 1.00 59.37  ? 293 ASP C CG    1 
ATOM 4888  O OD1   . ASP C 3 293 ? 204.565 95.842  152.163 1.00 59.37  ? 293 ASP C OD1   1 
ATOM 4889  O OD2   . ASP C 3 293 ? 205.888 94.262  152.907 1.00 59.37  ? 293 ASP C OD2   1 
ATOM 4890  N N     . ALA C 3 294 ? 207.621 99.036  151.451 1.00 55.93  ? 294 ALA C N     1 
ATOM 4891  C CA    . ALA C 3 294 ? 208.569 100.132 151.376 1.00 55.93  ? 294 ALA C CA    1 
ATOM 4892  C C     . ALA C 3 294 ? 208.993 100.503 152.781 1.00 55.93  ? 294 ALA C C     1 
ATOM 4893  O O     . ALA C 3 294 ? 208.248 100.309 153.743 1.00 55.93  ? 294 ALA C O     1 
ATOM 4894  C CB    . ALA C 3 294 ? 207.972 101.341 150.658 1.00 55.93  ? 294 ALA C CB    1 
ATOM 4895  N N     . TRP C 3 295 ? 210.205 101.034 152.891 1.00 57.32  ? 295 TRP C N     1 
ATOM 4896  C CA    . TRP C 3 295 ? 210.750 101.502 154.157 1.00 57.32  ? 295 TRP C CA    1 
ATOM 4897  C C     . TRP C 3 295 ? 211.227 102.934 153.976 1.00 57.32  ? 295 TRP C C     1 
ATOM 4898  O O     . TRP C 3 295 ? 212.212 103.172 153.274 1.00 57.32  ? 295 TRP C O     1 
ATOM 4899  C CB    . TRP C 3 295 ? 211.904 100.608 154.577 1.00 57.32  ? 295 TRP C CB    1 
ATOM 4900  C CG    . TRP C 3 295 ? 211.548 99.217  154.935 1.00 57.32  ? 295 TRP C CG    1 
ATOM 4901  C CD1   . TRP C 3 295 ? 211.138 98.764  156.145 1.00 57.32  ? 295 TRP C CD1   1 
ATOM 4902  C CD2   . TRP C 3 295 ? 211.573 98.080  154.069 1.00 57.32  ? 295 TRP C CD2   1 
ATOM 4903  N NE1   . TRP C 3 295 ? 210.909 97.412  156.092 1.00 57.32  ? 295 TRP C NE1   1 
ATOM 4904  C CE2   . TRP C 3 295 ? 211.168 96.971  154.822 1.00 57.32  ? 295 TRP C CE2   1 
ATOM 4905  C CE3   . TRP C 3 295 ? 211.897 97.896  152.728 1.00 57.32  ? 295 TRP C CE3   1 
ATOM 4906  C CZ2   . TRP C 3 295 ? 211.082 95.701  154.282 1.00 57.32  ? 295 TRP C CZ2   1 
ATOM 4907  C CZ3   . TRP C 3 295 ? 211.810 96.634  152.196 1.00 57.32  ? 295 TRP C CZ3   1 
ATOM 4908  C CH2   . TRP C 3 295 ? 211.396 95.556  152.967 1.00 57.32  ? 295 TRP C CH2   1 
ATOM 4909  N N     . VAL C 3 296 ? 210.563 103.884 154.623 1.00 54.95  ? 296 VAL C N     1 
ATOM 4910  C CA    . VAL C 3 296 ? 210.993 105.277 154.635 1.00 54.95  ? 296 VAL C CA    1 
ATOM 4911  C C     . VAL C 3 296 ? 211.553 105.572 156.011 1.00 54.95  ? 296 VAL C C     1 
ATOM 4912  O O     . VAL C 3 296 ? 210.842 105.442 157.012 1.00 54.95  ? 296 VAL C O     1 
ATOM 4913  C CB    . VAL C 3 296 ? 209.847 106.233 154.291 1.00 54.95  ? 296 VAL C CB    1 
ATOM 4914  C CG1   . VAL C 3 296 ? 210.317 107.666 154.404 1.00 54.95  ? 296 VAL C CG1   1 
ATOM 4915  C CG2   . VAL C 3 296 ? 209.338 105.951 152.897 1.00 54.95  ? 296 VAL C CG2   1 
ATOM 4916  N N     . THR C 3 297 ? 212.821 105.965 156.080 1.00 57.64  ? 297 THR C N     1 
ATOM 4917  C CA    . THR C 3 297 ? 213.454 106.035 157.386 1.00 57.64  ? 297 THR C CA    1 
ATOM 4918  C C     . THR C 3 297 ? 214.601 107.037 157.365 1.00 57.64  ? 297 THR C C     1 
ATOM 4919  O O     . THR C 3 297 ? 215.233 107.266 156.334 1.00 57.64  ? 297 THR C O     1 
ATOM 4920  C CB    . THR C 3 297 ? 213.943 104.647 157.808 1.00 57.64  ? 297 THR C CB    1 
ATOM 4921  O OG1   . THR C 3 297 ? 212.841 103.734 157.796 1.00 57.64  ? 297 THR C OG1   1 
ATOM 4922  C CG2   . THR C 3 297 ? 214.507 104.663 159.200 1.00 57.64  ? 297 THR C CG2   1 
ATOM 4923  N N     . TRP C 3 298 ? 214.863 107.606 158.536 1.00 62.61  ? 298 TRP C N     1 
ATOM 4924  C CA    . TRP C 3 298 ? 215.917 108.591 158.746 1.00 62.61  ? 298 TRP C CA    1 
ATOM 4925  C C     . TRP C 3 298 ? 217.293 108.085 158.323 1.00 62.61  ? 298 TRP C C     1 
ATOM 4926  O O     . TRP C 3 298 ? 217.609 106.902 158.469 1.00 62.61  ? 298 TRP C O     1 
ATOM 4927  C CB    . TRP C 3 298 ? 215.927 108.928 160.233 1.00 62.61  ? 298 TRP C CB    1 
ATOM 4928  C CG    . TRP C 3 298 ? 216.344 107.728 161.028 1.00 62.61  ? 298 TRP C CG    1 
ATOM 4929  C CD1   . TRP C 3 298 ? 215.526 106.780 161.561 1.00 62.61  ? 298 TRP C CD1   1 
ATOM 4930  C CD2   . TRP C 3 298 ? 217.671 107.374 161.415 1.00 62.61  ? 298 TRP C CD2   1 
ATOM 4931  N NE1   . TRP C 3 298 ? 216.264 105.831 162.217 1.00 62.61  ? 298 TRP C NE1   1 
ATOM 4932  C CE2   . TRP C 3 298 ? 217.586 106.173 162.139 1.00 62.61  ? 298 TRP C CE2   1 
ATOM 4933  C CE3   . TRP C 3 298 ? 218.926 107.945 161.200 1.00 62.61  ? 298 TRP C CE3   1 
ATOM 4934  C CZ2   . TRP C 3 298 ? 218.698 105.548 162.667 1.00 62.61  ? 298 TRP C CZ2   1 
ATOM 4935  C CZ3   . TRP C 3 298 ? 220.026 107.320 161.714 1.00 62.61  ? 298 TRP C CZ3   1 
ATOM 4936  C CH2   . TRP C 3 298 ? 219.909 106.134 162.442 1.00 62.61  ? 298 TRP C CH2   1 
ATOM 4937  N N     . ALA C 3 299 ? 218.107 108.986 157.764 1.00 64.79  ? 299 ALA C N     1 
ATOM 4938  C CA    . ALA C 3 299 ? 219.486 108.661 157.427 1.00 64.79  ? 299 ALA C CA    1 
ATOM 4939  C C     . ALA C 3 299 ? 220.535 109.418 158.233 1.00 64.79  ? 299 ALA C C     1 
ATOM 4940  O O     . ALA C 3 299 ? 221.662 108.936 158.335 1.00 64.79  ? 299 ALA C O     1 
ATOM 4941  C CB    . ALA C 3 299 ? 219.750 108.901 155.936 1.00 64.79  ? 299 ALA C CB    1 
ATOM 4942  N N     . TRP C 3 300 ? 220.208 110.578 158.793 1.00 69.63  ? 300 TRP C N     1 
ATOM 4943  C CA    . TRP C 3 300 ? 221.143 111.350 159.604 1.00 69.63  ? 300 TRP C CA    1 
ATOM 4944  C C     . TRP C 3 300 ? 220.416 111.919 160.810 1.00 69.63  ? 300 TRP C C     1 
ATOM 4945  O O     . TRP C 3 300 ? 219.236 112.259 160.729 1.00 69.63  ? 300 TRP C O     1 
ATOM 4946  C CB    . TRP C 3 300 ? 221.782 112.496 158.815 1.00 69.63  ? 300 TRP C CB    1 
ATOM 4947  C CG    . TRP C 3 300 ? 222.634 112.101 157.643 1.00 69.63  ? 300 TRP C CG    1 
ATOM 4948  C CD1   . TRP C 3 300 ? 222.234 111.944 156.354 1.00 69.63  ? 300 TRP C CD1   1 
ATOM 4949  C CD2   . TRP C 3 300 ? 224.062 111.935 157.640 1.00 69.63  ? 300 TRP C CD2   1 
ATOM 4950  N NE1   . TRP C 3 300 ? 223.310 111.631 155.558 1.00 69.63  ? 300 TRP C NE1   1 
ATOM 4951  C CE2   . TRP C 3 300 ? 224.444 111.627 156.325 1.00 69.63  ? 300 TRP C CE2   1 
ATOM 4952  C CE3   . TRP C 3 300 ? 225.048 111.993 158.630 1.00 69.63  ? 300 TRP C CE3   1 
ATOM 4953  C CZ2   . TRP C 3 300 ? 225.771 111.387 155.973 1.00 69.63  ? 300 TRP C CZ2   1 
ATOM 4954  C CZ3   . TRP C 3 300 ? 226.364 111.750 158.275 1.00 69.63  ? 300 TRP C CZ3   1 
ATOM 4955  C CH2   . TRP C 3 300 ? 226.711 111.446 156.961 1.00 69.63  ? 300 TRP C CH2   1 
ATOM 4956  N N     . ARG C 3 301 ? 221.120 112.013 161.935 1.00 66.11  ? 301 ARG C N     1 
ATOM 4957  C CA    . ARG C 3 301 ? 220.494 112.589 163.118 1.00 66.11  ? 301 ARG C CA    1 
ATOM 4958  C C     . ARG C 3 301 ? 220.679 114.084 163.342 1.00 66.11  ? 301 ARG C C     1 
ATOM 4959  O O     . ARG C 3 301 ? 219.717 114.760 163.722 1.00 66.11  ? 301 ARG C O     1 
ATOM 4960  C CB    . ARG C 3 301 ? 220.977 111.847 164.356 1.00 66.11  ? 301 ARG C CB    1 
ATOM 4961  C CG    . ARG C 3 301 ? 220.696 110.384 164.303 1.00 66.11  ? 301 ARG C CG    1 
ATOM 4962  C CD    . ARG C 3 301 ? 219.194 110.254 164.252 1.00 66.11  ? 301 ARG C CD    1 
ATOM 4963  N NE    . ARG C 3 301 ? 218.735 108.904 164.521 1.00 66.11  ? 301 ARG C NE    1 
ATOM 4964  C CZ    . ARG C 3 301 ? 217.475 108.519 164.399 1.00 66.11  ? 301 ARG C CZ    1 
ATOM 4965  N NH1   . ARG C 3 301 ? 216.553 109.386 164.008 1.00 66.11  ? 301 ARG C NH1   1 
ATOM 4966  N NH2   . ARG C 3 301 ? 217.131 107.274 164.687 1.00 66.11  ? 301 ARG C NH2   1 
ATOM 4967  N N     . GLU C 3 302 ? 221.857 114.650 163.130 1.00 69.81  ? 302 GLU C N     1 
ATOM 4968  C CA    . GLU C 3 302 ? 222.036 116.077 163.377 1.00 69.81  ? 302 GLU C CA    1 
ATOM 4969  C C     . GLU C 3 302 ? 222.079 116.821 162.044 1.00 69.81  ? 302 GLU C C     1 
ATOM 4970  O O     . GLU C 3 302 ? 222.885 116.485 161.169 1.00 69.81  ? 302 GLU C O     1 
ATOM 4971  C CB    . GLU C 3 302 ? 223.286 116.326 164.218 1.00 69.81  ? 302 GLU C CB    1 
ATOM 4972  C CG    . GLU C 3 302 ? 223.432 117.751 164.764 1.00 69.81  ? 302 GLU C CG    1 
ATOM 4973  C CD    . GLU C 3 302 ? 223.872 118.779 163.758 1.00 69.81  ? 302 GLU C CD    1 
ATOM 4974  O OE1   . GLU C 3 302 ? 224.477 118.407 162.736 1.00 69.81  ? 302 GLU C OE1   1 
ATOM 4975  O OE2   . GLU C 3 302 ? 223.629 119.979 164.010 1.00 69.81  ? 302 GLU C OE2   1 
ATOM 4976  N N     . ARG C 3 303 ? 221.217 117.823 161.900 1.00 65.61  ? 303 ARG C N     1 
ATOM 4977  C CA    . ARG C 3 303 ? 221.135 118.617 160.678 1.00 65.61  ? 303 ARG C CA    1 
ATOM 4978  C C     . ARG C 3 303 ? 222.299 119.595 160.524 1.00 65.61  ? 303 ARG C C     1 
ATOM 4979  O O     . ARG C 3 303 ? 222.708 120.246 161.483 1.00 65.61  ? 303 ARG C O     1 
ATOM 4980  C CB    . ARG C 3 303 ? 219.818 119.407 160.644 1.00 65.61  ? 303 ARG C CB    1 
ATOM 4981  C CG    . ARG C 3 303 ? 218.581 118.614 160.241 1.00 65.61  ? 303 ARG C CG    1 
ATOM 4982  C CD    . ARG C 3 303 ? 217.326 119.476 160.335 1.00 65.61  ? 303 ARG C CD    1 
ATOM 4983  N NE    . ARG C 3 303 ? 216.104 118.748 159.988 1.00 65.61  ? 303 ARG C NE    1 
ATOM 4984  C CZ    . ARG C 3 303 ? 214.872 119.158 160.283 1.00 65.61  ? 303 ARG C CZ    1 
ATOM 4985  N NH1   . ARG C 3 303 ? 214.681 120.297 160.934 1.00 65.61  ? 303 ARG C NH1   1 
ATOM 4986  N NH2   . ARG C 3 303 ? 213.826 118.427 159.926 1.00 65.61  ? 303 ARG C NH2   1 
ATOM 4987  N N     . ASN C 3 304 ? 222.818 119.694 159.305 1.00 76.36  ? 304 ASN C N     1 
ATOM 4988  C CA    . ASN C 3 304 ? 223.899 120.606 158.980 1.00 76.36  ? 304 ASN C CA    1 
ATOM 4989  C C     . ASN C 3 304 ? 223.480 121.458 157.789 1.00 76.36  ? 304 ASN C C     1 
ATOM 4990  O O     . ASN C 3 304 ? 222.728 121.011 156.916 1.00 76.36  ? 304 ASN C O     1 
ATOM 4991  C CB    . ASN C 3 304 ? 225.214 119.863 158.713 1.00 76.36  ? 304 ASN C CB    1 
ATOM 4992  N N     . ILE C 3 305 ? 223.963 122.700 157.776 1.00 81.31  ? 305 ILE C N     1 
ATOM 4993  C CA    . ILE C 3 305 ? 223.629 123.641 156.713 1.00 81.31  ? 305 ILE C CA    1 
ATOM 4994  C C     . ILE C 3 305 ? 224.352 123.291 155.420 1.00 81.31  ? 305 ILE C C     1 
ATOM 4995  O O     . ILE C 3 305 ? 225.571 123.080 155.400 1.00 81.31  ? 305 ILE C O     1 
ATOM 4996  C CB    . ILE C 3 305 ? 223.966 125.068 157.161 1.00 81.31  ? 305 ILE C CB    1 
ATOM 4997  C CG1   . ILE C 3 305 ? 223.187 125.425 158.428 1.00 81.31  ? 305 ILE C CG1   1 
ATOM 4998  C CG2   . ILE C 3 305 ? 223.640 126.064 156.070 1.00 81.31  ? 305 ILE C CG2   1 
ATOM 4999  C CD1   . ILE C 3 305 ? 224.019 125.423 159.692 1.00 81.31  ? 305 ILE C CD1   1 
ATOM 5000  N N     . SER C 3 306 ? 223.596 123.246 154.325 1.00 82.09  ? 306 SER C N     1 
ATOM 5001  C CA    . SER C 3 306 ? 224.150 122.940 153.009 1.00 82.09  ? 306 SER C CA    1 
ATOM 5002  C C     . SER C 3 306 ? 224.732 124.214 152.401 1.00 82.09  ? 306 SER C C     1 
ATOM 5003  O O     . SER C 3 306 ? 224.046 125.243 152.361 1.00 82.09  ? 306 SER C O     1 
ATOM 5004  C CB    . SER C 3 306 ? 223.096 122.334 152.095 1.00 82.09  ? 306 SER C CB    1 
ATOM 5005  O OG    . SER C 3 306 ? 223.678 121.869 150.891 1.00 82.09  ? 306 SER C OG    1 
ATOM 5006  N N     . PRO C 3 307 ? 225.983 124.202 151.950 1.00 83.64  ? 307 PRO C N     1 
ATOM 5007  C CA    . PRO C 3 307 ? 226.584 125.432 151.425 1.00 83.64  ? 307 PRO C CA    1 
ATOM 5008  C C     . PRO C 3 307 ? 225.937 125.916 150.137 1.00 83.64  ? 307 PRO C C     1 
ATOM 5009  O O     . PRO C 3 307 ? 225.536 125.128 149.277 1.00 83.64  ? 307 PRO C O     1 
ATOM 5010  C CB    . PRO C 3 307 ? 228.038 125.029 151.172 1.00 83.64  ? 307 PRO C CB    1 
ATOM 5011  C CG    . PRO C 3 307 ? 227.966 123.577 150.939 1.00 83.64  ? 307 PRO C CG    1 
ATOM 5012  C CD    . PRO C 3 307 ? 226.895 123.056 151.844 1.00 83.64  ? 307 PRO C CD    1 
ATOM 5013  N N     . GLU C 3 308 ? 225.835 127.242 150.029 1.00 81.98  ? 308 GLU C N     1 
ATOM 5014  C CA    . GLU C 3 308 ? 225.313 127.971 148.871 1.00 81.98  ? 308 GLU C CA    1 
ATOM 5015  C C     . GLU C 3 308 ? 223.831 127.773 148.568 1.00 81.98  ? 308 GLU C C     1 
ATOM 5016  O O     . GLU C 3 308 ? 223.271 126.691 148.761 1.00 81.98  ? 308 GLU C O     1 
ATOM 5017  C CB    . GLU C 3 308 ? 226.135 127.674 147.615 1.00 81.98  ? 308 GLU C CB    1 
ATOM 5018  C CG    . GLU C 3 308 ? 227.597 128.100 147.742 1.00 81.98  ? 308 GLU C CG    1 
ATOM 5019  C CD    . GLU C 3 308 ? 228.527 126.971 148.113 1.00 81.98  ? 308 GLU C CD    1 
ATOM 5020  O OE1   . GLU C 3 308 ? 228.063 125.818 148.197 1.00 81.98  ? 308 GLU C OE1   1 
ATOM 5021  O OE2   . GLU C 3 308 ? 229.727 127.244 148.321 1.00 81.98  ? 308 GLU C OE2   1 
ATOM 5022  N N     . LEU C 3 309 ? 223.204 128.843 148.096 1.00 71.13  ? 309 LEU C N     1 
ATOM 5023  C CA    . LEU C 3 309 ? 221.793 128.834 147.748 1.00 71.13  ? 309 LEU C CA    1 
ATOM 5024  C C     . LEU C 3 309 ? 221.528 127.925 146.550 1.00 71.13  ? 309 LEU C C     1 
ATOM 5025  O O     . LEU C 3 309 ? 222.337 127.842 145.624 1.00 71.13  ? 309 LEU C O     1 
ATOM 5026  C CB    . LEU C 3 309 ? 221.330 130.249 147.417 1.00 71.13  ? 309 LEU C CB    1 
ATOM 5027  C CG    . LEU C 3 309 ? 221.425 131.448 148.370 1.00 71.13  ? 309 LEU C CG    1 
ATOM 5028  C CD1   . LEU C 3 309 ? 220.371 131.306 149.470 1.00 71.13  ? 309 LEU C CD1   1 
ATOM 5029  C CD2   . LEU C 3 309 ? 222.822 131.712 148.963 1.00 71.13  ? 309 LEU C CD2   1 
ATOM 5030  N N     . ASP C 3 310 ? 220.407 127.219 146.588 1.00 62.31  ? 310 ASP C N     1 
ATOM 5031  C CA    . ASP C 3 310 ? 219.977 126.380 145.481 1.00 62.31  ? 310 ASP C CA    1 
ATOM 5032  C C     . ASP C 3 310 ? 219.711 127.290 144.288 1.00 62.31  ? 310 ASP C C     1 
ATOM 5033  O O     . ASP C 3 310 ? 218.873 128.194 144.391 1.00 62.31  ? 310 ASP C O     1 
ATOM 5034  C CB    . ASP C 3 310 ? 218.741 125.566 145.857 1.00 62.31  ? 310 ASP C CB    1 
ATOM 5035  C CG    . ASP C 3 310 ? 218.524 124.361 144.953 1.00 62.31  ? 310 ASP C CG    1 
ATOM 5036  O OD1   . ASP C 3 310 ? 218.921 124.407 143.775 1.00 62.31  ? 310 ASP C OD1   1 
ATOM 5037  O OD2   . ASP C 3 310 ? 217.979 123.346 145.441 1.00 62.31  ? 310 ASP C OD2   1 
ATOM 5038  N N     . PRO C 3 311 ? 220.406 127.107 143.164 1.00 56.81  ? 311 PRO C N     1 
ATOM 5039  C CA    . PRO C 3 311 ? 220.240 128.028 142.025 1.00 56.81  ? 311 PRO C CA    1 
ATOM 5040  C C     . PRO C 3 311 ? 218.824 128.150 141.514 1.00 56.81  ? 311 PRO C C     1 
ATOM 5041  O O     . PRO C 3 311 ? 218.453 129.202 140.983 1.00 56.81  ? 311 PRO C O     1 
ATOM 5042  C CB    . PRO C 3 311 ? 221.143 127.413 140.949 1.00 56.81  ? 311 PRO C CB    1 
ATOM 5043  C CG    . PRO C 3 311 ? 221.319 125.992 141.365 1.00 56.81  ? 311 PRO C CG    1 
ATOM 5044  C CD    . PRO C 3 311 ? 221.329 126.003 142.849 1.00 56.81  ? 311 PRO C CD    1 
ATOM 5045  N N     . TYR C 3 312 ? 217.993 127.140 141.720 1.00 49.31  ? 312 TYR C N     1 
ATOM 5046  C CA    . TYR C 3 312 ? 216.670 127.138 141.121 1.00 49.31  ? 312 TYR C CA    1 
ATOM 5047  C C     . TYR C 3 312 ? 215.685 128.032 141.872 1.00 49.31  ? 312 TYR C C     1 
ATOM 5048  O O     . TYR C 3 312 ? 214.895 128.744 141.247 1.00 49.31  ? 312 TYR C O     1 
ATOM 5049  C CB    . TYR C 3 312 ? 216.147 125.715 141.080 1.00 49.31  ? 312 TYR C CB    1 
ATOM 5050  C CG    . TYR C 3 312 ? 216.918 124.839 140.143 1.00 49.31  ? 312 TYR C CG    1 
ATOM 5051  C CD1   . TYR C 3 312 ? 217.300 125.288 138.893 1.00 49.31  ? 312 TYR C CD1   1 
ATOM 5052  C CD2   . TYR C 3 312 ? 217.251 123.550 140.503 1.00 49.31  ? 312 TYR C CD2   1 
ATOM 5053  C CE1   . TYR C 3 312 ? 218.006 124.469 138.038 1.00 49.31  ? 312 TYR C CE1   1 
ATOM 5054  C CE2   . TYR C 3 312 ? 217.951 122.732 139.661 1.00 49.31  ? 312 TYR C CE2   1 
ATOM 5055  C CZ    . TYR C 3 312 ? 218.324 123.191 138.431 1.00 49.31  ? 312 TYR C CZ    1 
ATOM 5056  O OH    . TYR C 3 312 ? 219.029 122.362 137.597 1.00 49.31  ? 312 TYR C OH    1 
ATOM 5057  N N     . LEU C 3 313 ? 215.708 128.002 143.197 1.00 52.57  ? 313 LEU C N     1 
ATOM 5058  C CA    . LEU C 3 313 ? 214.716 128.649 144.041 1.00 52.57  ? 313 LEU C CA    1 
ATOM 5059  C C     . LEU C 3 313 ? 214.944 130.153 144.137 1.00 52.57  ? 313 LEU C C     1 
ATOM 5060  O O     . LEU C 3 313 ? 216.047 130.658 143.927 1.00 52.57  ? 313 LEU C O     1 
ATOM 5061  C CB    . LEU C 3 313 ? 214.763 128.048 145.436 1.00 52.57  ? 313 LEU C CB    1 
ATOM 5062  C CG    . LEU C 3 313 ? 214.725 126.525 145.338 1.00 52.57  ? 313 LEU C CG    1 
ATOM 5063  C CD1   . LEU C 3 313 ? 214.828 125.863 146.708 1.00 52.57  ? 313 LEU C CD1   1 
ATOM 5064  C CD2   . LEU C 3 313 ? 213.538 126.018 144.541 1.00 52.57  ? 313 LEU C CD2   1 
ATOM 5065  N N     . ILE C 3 314 ? 213.865 130.872 144.438 1.00 55.76  ? 314 ILE C N     1 
ATOM 5066  C CA    . ILE C 3 314 ? 213.930 132.303 144.724 1.00 55.76  ? 314 ILE C CA    1 
ATOM 5067  C C     . ILE C 3 314 ? 214.135 132.483 146.211 1.00 55.76  ? 314 ILE C C     1 
ATOM 5068  O O     . ILE C 3 314 ? 213.376 131.932 147.014 1.00 55.76  ? 314 ILE C O     1 
ATOM 5069  C CB    . ILE C 3 314 ? 212.654 133.054 144.311 1.00 55.76  ? 314 ILE C CB    1 
ATOM 5070  C CG1   . ILE C 3 314 ? 212.437 133.079 142.816 1.00 55.76  ? 314 ILE C CG1   1 
ATOM 5071  C CG2   . ILE C 3 314 ? 212.713 134.478 144.803 1.00 55.76  ? 314 ILE C CG2   1 
ATOM 5072  C CD1   . ILE C 3 314 ? 211.947 131.822 142.263 1.00 55.76  ? 314 ILE C CD1   1 
ATOM 5073  N N     . TYR C 3 315 ? 215.172 133.197 146.598 1.00 65.71  ? 315 TYR C N     1 
ATOM 5074  C CA    . TYR C 3 315 ? 215.355 133.333 148.025 1.00 65.71  ? 315 TYR C CA    1 
ATOM 5075  C C     . TYR C 3 315 ? 214.821 134.695 148.435 1.00 65.71  ? 315 TYR C C     1 
ATOM 5076  O O     . TYR C 3 315 ? 214.580 135.569 147.604 1.00 65.71  ? 315 TYR C O     1 
ATOM 5077  C CB    . TYR C 3 315 ? 216.823 133.159 148.382 1.00 65.71  ? 315 TYR C CB    1 
ATOM 5078  C CG    . TYR C 3 315 ? 217.190 131.711 148.333 1.00 65.71  ? 315 TYR C CG    1 
ATOM 5079  C CD1   . TYR C 3 315 ? 216.923 130.872 149.397 1.00 65.71  ? 315 TYR C CD1   1 
ATOM 5080  C CD2   . TYR C 3 315 ? 217.737 131.164 147.187 1.00 65.71  ? 315 TYR C CD2   1 
ATOM 5081  C CE1   . TYR C 3 315 ? 217.239 129.532 149.339 1.00 65.71  ? 315 TYR C CE1   1 
ATOM 5082  C CE2   . TYR C 3 315 ? 218.052 129.826 147.119 1.00 65.71  ? 315 TYR C CE2   1 
ATOM 5083  C CZ    . TYR C 3 315 ? 217.804 129.015 148.199 1.00 65.71  ? 315 TYR C CZ    1 
ATOM 5084  O OH    . TYR C 3 315 ? 218.119 127.681 148.133 1.00 65.71  ? 315 TYR C OH    1 
ATOM 5085  N N     . GLN C 3 316 ? 214.643 134.873 149.735 1.00 67.32  ? 316 GLN C N     1 
ATOM 5086  C CA    . GLN C 3 316 ? 214.128 136.127 150.251 1.00 67.32  ? 316 GLN C CA    1 
ATOM 5087  C C     . GLN C 3 316 ? 214.462 136.203 151.728 1.00 67.32  ? 316 GLN C C     1 
ATOM 5088  O O     . GLN C 3 316 ? 214.513 135.170 152.403 1.00 67.32  ? 316 GLN C O     1 
ATOM 5089  C CB    . GLN C 3 316 ? 212.617 136.286 150.052 1.00 67.32  ? 316 GLN C CB    1 
ATOM 5090  C CG    . GLN C 3 316 ? 211.769 135.289 150.792 1.00 67.32  ? 316 GLN C CG    1 
ATOM 5091  C CD    . GLN C 3 316 ? 210.297 135.559 150.603 1.00 67.32  ? 316 GLN C CD    1 
ATOM 5092  O OE1   . GLN C 3 316 ? 209.912 136.535 149.962 1.00 67.32  ? 316 GLN C OE1   1 
ATOM 5093  N NE2   . GLN C 3 316 ? 209.462 134.715 151.187 1.00 67.32  ? 316 GLN C NE2   1 
ATOM 5094  N N     . THR C 3 317 ? 214.788 137.400 152.198 1.00 79.74  ? 317 THR C N     1 
ATOM 5095  C CA    . THR C 3 317 ? 215.136 137.615 153.595 1.00 79.74  ? 317 THR C CA    1 
ATOM 5096  C C     . THR C 3 317 ? 214.071 138.466 154.262 1.00 79.74  ? 317 THR C C     1 
ATOM 5097  O O     . THR C 3 317 ? 213.766 139.571 153.802 1.00 79.74  ? 317 THR C O     1 
ATOM 5098  C CB    . THR C 3 317 ? 216.501 138.266 153.759 1.00 79.74  ? 317 THR C CB    1 
ATOM 5099  O OG1   . THR C 3 317 ? 216.498 139.567 153.161 1.00 79.74  ? 317 THR C OG1   1 
ATOM 5100  C CG2   . THR C 3 317 ? 217.541 137.402 153.167 1.00 79.74  ? 317 THR C CG2   1 
ATOM 5101  N N     . SER C 3 318 ? 213.541 137.945 155.364 1.00 86.50  ? 318 SER C N     1 
ATOM 5102  C CA    . SER C 3 318 ? 212.536 138.623 156.166 1.00 86.50  ? 318 SER C CA    1 
ATOM 5103  C C     . SER C 3 318 ? 213.241 139.110 157.426 1.00 86.50  ? 318 SER C C     1 
ATOM 5104  O O     . SER C 3 318 ? 214.322 138.622 157.754 1.00 86.50  ? 318 SER C O     1 
ATOM 5105  C CB    . SER C 3 318 ? 211.415 137.656 156.532 1.00 86.50  ? 318 SER C CB    1 
ATOM 5106  O OG    . SER C 3 318 ? 211.838 136.313 156.377 1.00 86.50  ? 318 SER C OG    1 
ATOM 5107  N N     . LYS C 3 319 ? 212.648 140.064 158.136 1.00 94.30  ? 319 LYS C N     1 
ATOM 5108  C CA    . LYS C 3 319 ? 213.286 140.565 159.328 1.00 94.30  ? 319 LYS C CA    1 
ATOM 5109  C C     . LYS C 3 319 ? 213.758 139.350 160.118 1.00 94.30  ? 319 LYS C C     1 
ATOM 5110  O O     . LYS C 3 319 ? 213.275 138.231 159.906 1.00 94.30  ? 319 LYS C O     1 
ATOM 5111  C CB    . LYS C 3 319 ? 212.286 141.394 160.134 1.00 94.30  ? 319 LYS C CB    1 
ATOM 5112  C CG    . LYS C 3 319 ? 211.867 142.697 159.475 1.00 94.30  ? 319 LYS C CG    1 
ATOM 5113  C CD    . LYS C 3 319 ? 212.965 143.732 159.530 1.00 94.30  ? 319 LYS C CD    1 
ATOM 5114  C CE    . LYS C 3 319 ? 213.089 144.258 160.947 1.00 94.30  ? 319 LYS C CE    1 
ATOM 5115  N NZ    . LYS C 3 319 ? 214.102 145.334 161.077 1.00 94.30  ? 319 LYS C NZ    1 
ATOM 5116  N N     . GLU C 3 320 ? 214.733 139.578 161.007 1.00 95.66  ? 320 GLU C N     1 
ATOM 5117  C CA    . GLU C 3 320 ? 215.605 138.583 161.641 1.00 95.66  ? 320 GLU C CA    1 
ATOM 5118  C C     . GLU C 3 320 ? 216.783 138.235 160.734 1.00 95.66  ? 320 GLU C C     1 
ATOM 5119  O O     . GLU C 3 320 ? 217.790 137.692 161.199 1.00 95.66  ? 320 GLU C O     1 
ATOM 5120  C CB    . GLU C 3 320 ? 214.825 137.291 161.949 1.00 95.66  ? 320 GLU C CB    1 
ATOM 5121  C CG    . GLU C 3 320 ? 215.551 136.135 162.623 1.00 95.66  ? 320 GLU C CG    1 
ATOM 5122  C CD    . GLU C 3 320 ? 214.713 134.849 162.597 1.00 95.66  ? 320 GLU C CD    1 
ATOM 5123  O OE1   . GLU C 3 320 ? 213.720 134.794 161.836 1.00 95.66  ? 320 GLU C OE1   1 
ATOM 5124  O OE2   . GLU C 3 320 ? 215.062 133.882 163.303 1.00 95.66  ? 320 GLU C OE2   1 
ATOM 5125  N N     . GLY C 3 321 ? 216.681 138.540 159.446 1.00 85.01  ? 321 GLY C N     1 
ATOM 5126  C CA    . GLY C 3 321 ? 217.803 138.439 158.534 1.00 85.01  ? 321 GLY C CA    1 
ATOM 5127  C C     . GLY C 3 321 ? 217.970 137.061 157.950 1.00 85.01  ? 321 GLY C C     1 
ATOM 5128  O O     . GLY C 3 321 ? 218.962 136.800 157.261 1.00 85.01  ? 321 GLY C O     1 
ATOM 5129  N N     . ARG C 3 322 ? 217.018 136.181 158.216 1.00 85.00  ? 322 ARG C N     1 
ATOM 5130  C CA    . ARG C 3 322 ? 217.015 134.803 157.754 1.00 85.00  ? 322 ARG C CA    1 
ATOM 5131  C C     . ARG C 3 322 ? 216.880 134.740 156.241 1.00 85.00  ? 322 ARG C C     1 
ATOM 5132  O O     . ARG C 3 322 ? 215.988 135.376 155.673 1.00 85.00  ? 322 ARG C O     1 
ATOM 5133  C CB    . ARG C 3 322 ? 215.879 134.047 158.443 1.00 85.00  ? 322 ARG C CB    1 
ATOM 5134  C CG    . ARG C 3 322 ? 215.708 132.596 158.053 1.00 85.00  ? 322 ARG C CG    1 
ATOM 5135  C CD    . ARG C 3 322 ? 214.653 131.965 158.947 1.00 85.00  ? 322 ARG C CD    1 
ATOM 5136  N NE    . ARG C 3 322 ? 214.347 130.579 158.608 1.00 85.00  ? 322 ARG C NE    1 
ATOM 5137  C CZ    . ARG C 3 322 ? 215.078 129.534 158.989 1.00 85.00  ? 322 ARG C CZ    1 
ATOM 5138  N NH1   . ARG C 3 322 ? 214.718 128.310 158.634 1.00 85.00  ? 322 ARG C NH1   1 
ATOM 5139  N NH2   . ARG C 3 322 ? 216.169 129.708 159.724 1.00 85.00  ? 322 ARG C NH2   1 
ATOM 5140  N N     . VAL C 3 323 ? 217.757 134.001 155.573 1.00 77.06  ? 323 VAL C N     1 
ATOM 5141  C CA    . VAL C 3 323 ? 217.673 133.894 154.124 1.00 77.06  ? 323 VAL C CA    1 
ATOM 5142  C C     . VAL C 3 323 ? 216.970 132.574 153.875 1.00 77.06  ? 323 VAL C C     1 
ATOM 5143  O O     . VAL C 3 323 ? 217.503 131.502 154.182 1.00 77.06  ? 323 VAL C O     1 
ATOM 5144  C CB    . VAL C 3 323 ? 219.058 133.900 153.460 1.00 77.06  ? 323 VAL C CB    1 
ATOM 5145  C CG1   . VAL C 3 323 ? 218.917 133.828 151.950 1.00 77.06  ? 323 VAL C CG1   1 
ATOM 5146  C CG2   . VAL C 3 323 ? 219.884 135.090 153.901 1.00 77.06  ? 323 VAL C CG2   1 
ATOM 5147  N N     . TYR C 3 324 ? 215.766 132.656 153.321 1.00 68.35  ? 324 TYR C N     1 
ATOM 5148  C CA    . TYR C 3 324 ? 214.946 131.491 153.075 1.00 68.35  ? 324 TYR C CA    1 
ATOM 5149  C C     . TYR C 3 324 ? 214.250 131.526 151.726 1.00 68.35  ? 324 TYR C C     1 
ATOM 5150  O O     . TYR C 3 324 ? 213.827 132.599 151.273 1.00 68.35  ? 324 TYR C O     1 
ATOM 5151  C CB    . TYR C 3 324 ? 213.911 131.348 154.191 1.00 68.35  ? 324 TYR C CB    1 
ATOM 5152  C CG    . TYR C 3 324 ? 212.905 132.447 154.150 1.00 68.35  ? 324 TYR C CG    1 
ATOM 5153  C CD1   . TYR C 3 324 ? 213.244 133.709 154.591 1.00 68.35  ? 324 TYR C CD1   1 
ATOM 5154  C CD2   . TYR C 3 324 ? 211.621 132.234 153.688 1.00 68.35  ? 324 TYR C CD2   1 
ATOM 5155  C CE1   . TYR C 3 324 ? 212.359 134.725 154.551 1.00 68.35  ? 324 TYR C CE1   1 
ATOM 5156  C CE2   . TYR C 3 324 ? 210.709 133.257 153.656 1.00 68.35  ? 324 TYR C CE2   1 
ATOM 5157  C CZ    . TYR C 3 324 ? 211.085 134.504 154.091 1.00 68.35  ? 324 TYR C CZ    1 
ATOM 5158  O OH    . TYR C 3 324 ? 210.192 135.548 154.064 1.00 68.35  ? 324 TYR C OH    1 
ATOM 5159  N N     . PRO C 3 325 ? 214.113 130.379 151.071 1.00 60.38  ? 325 PRO C N     1 
ATOM 5160  C CA    . PRO C 3 325 ? 213.373 130.332 149.806 1.00 60.38  ? 325 PRO C CA    1 
ATOM 5161  C C     . PRO C 3 325 ? 211.911 130.661 150.061 1.00 60.38  ? 325 PRO C C     1 
ATOM 5162  O O     . PRO C 3 325 ? 211.318 130.157 151.016 1.00 60.38  ? 325 PRO C O     1 
ATOM 5163  C CB    . PRO C 3 325 ? 213.541 128.879 149.356 1.00 60.38  ? 325 PRO C CB    1 
ATOM 5164  C CG    . PRO C 3 325 ? 213.815 128.132 150.612 1.00 60.38  ? 325 PRO C CG    1 
ATOM 5165  C CD    . PRO C 3 325 ? 214.598 129.053 151.480 1.00 60.38  ? 325 PRO C CD    1 
ATOM 5166  N N     . ARG C 3 326 ? 211.335 131.533 149.232 1.00 55.60  ? 326 ARG C N     1 
ATOM 5167  C CA    . ARG C 3 326 ? 209.946 131.903 149.460 1.00 55.60  ? 326 ARG C CA    1 
ATOM 5168  C C     . ARG C 3 326 ? 209.072 130.666 149.336 1.00 55.60  ? 326 ARG C C     1 
ATOM 5169  O O     . ARG C 3 326 ? 209.110 129.988 148.301 1.00 55.60  ? 326 ARG C O     1 
ATOM 5170  C CB    . ARG C 3 326 ? 209.411 132.960 148.497 1.00 55.60  ? 326 ARG C CB    1 
ATOM 5171  C CG    . ARG C 3 326 ? 209.450 132.600 147.028 1.00 55.60  ? 326 ARG C CG    1 
ATOM 5172  C CD    . ARG C 3 326 ? 208.884 133.726 146.188 1.00 55.60  ? 326 ARG C CD    1 
ATOM 5173  N NE    . ARG C 3 326 ? 209.739 134.897 146.089 1.00 55.60  ? 326 ARG C NE    1 
ATOM 5174  C CZ    . ARG C 3 326 ? 209.522 136.019 146.761 1.00 55.60  ? 326 ARG C CZ    1 
ATOM 5175  N NH1   . ARG C 3 326 ? 208.487 136.108 147.577 1.00 55.60  ? 326 ARG C NH1   1 
ATOM 5176  N NH2   . ARG C 3 326 ? 210.334 137.053 146.615 1.00 55.60  ? 326 ARG C NH2   1 
ATOM 5177  N N     . PRO C 3 327 ? 208.338 130.295 150.374 1.00 50.44  ? 327 PRO C N     1 
ATOM 5178  C CA    . PRO C 3 327 ? 207.533 129.078 150.296 1.00 50.44  ? 327 PRO C CA    1 
ATOM 5179  C C     . PRO C 3 327 ? 206.465 129.254 149.237 1.00 50.44  ? 327 PRO C C     1 
ATOM 5180  O O     . PRO C 3 327 ? 205.909 130.342 149.084 1.00 50.44  ? 327 PRO C O     1 
ATOM 5181  C CB    . PRO C 3 327 ? 206.925 128.968 151.693 1.00 50.44  ? 327 PRO C CB    1 
ATOM 5182  C CG    . PRO C 3 327 ? 206.908 130.374 152.189 1.00 50.44  ? 327 PRO C CG    1 
ATOM 5183  C CD    . PRO C 3 327 ? 208.132 131.019 151.634 1.00 50.44  ? 327 PRO C CD    1 
ATOM 5184  N N     . ALA C 3 328 ? 206.233 128.206 148.447 1.00 46.79  ? 328 ALA C N     1 
ATOM 5185  C CA    . ALA C 3 328 ? 205.216 128.331 147.414 1.00 46.79  ? 328 ALA C CA    1 
ATOM 5186  C C     . ALA C 3 328 ? 203.894 128.765 148.032 1.00 46.79  ? 328 ALA C C     1 
ATOM 5187  O O     . ALA C 3 328 ? 203.751 128.763 149.258 1.00 46.79  ? 328 ALA C O     1 
ATOM 5188  C CB    . ALA C 3 328 ? 205.048 127.012 146.664 1.00 46.79  ? 328 ALA C CB    1 
ATOM 5189  N N     . GLU C 3 329 ? 202.881 128.975 147.201 1.00 49.68  ? 329 GLU C N     1 
ATOM 5190  C CA    . GLU C 3 329 ? 201.562 129.405 147.659 1.00 49.68  ? 329 GLU C CA    1 
ATOM 5191  C C     . GLU C 3 329 ? 200.568 129.147 146.544 1.00 49.68  ? 329 GLU C C     1 
ATOM 5192  O O     . GLU C 3 329 ? 200.704 129.707 145.454 1.00 49.68  ? 329 GLU C O     1 
ATOM 5193  C CB    . GLU C 3 329 ? 201.510 130.888 148.067 1.00 49.68  ? 329 GLU C CB    1 
ATOM 5194  C CG    . GLU C 3 329 ? 202.307 131.303 149.285 1.00 49.68  ? 329 GLU C CG    1 
ATOM 5195  C CD    . GLU C 3 329 ? 202.309 132.797 149.495 1.00 49.68  ? 329 GLU C CD    1 
ATOM 5196  O OE1   . GLU C 3 329 ? 201.768 133.518 148.634 1.00 49.68  ? 329 GLU C OE1   1 
ATOM 5197  O OE2   . GLU C 3 329 ? 202.835 133.249 150.532 1.00 49.68  ? 329 GLU C OE2   1 
ATOM 5198  N N     . ALA C 3 330 ? 199.595 128.286 146.804 1.00 49.20  ? 330 ALA C N     1 
ATOM 5199  C CA    . ALA C 3 330 ? 198.578 127.999 145.802 1.00 49.20  ? 330 ALA C CA    1 
ATOM 5200  C C     . ALA C 3 330 ? 197.795 129.262 145.466 1.00 49.20  ? 330 ALA C C     1 
ATOM 5201  O O     . ALA C 3 330 ? 197.456 129.506 144.302 1.00 49.20  ? 330 ALA C O     1 
ATOM 5202  C CB    . ALA C 3 330 ? 197.646 126.892 146.295 1.00 49.20  ? 330 ALA C CB    1 
ATOM 5203  N N     . GLU C 3 331 ? 197.507 130.077 146.484 1.00 56.43  ? 331 GLU C N     1 
ATOM 5204  C CA    . GLU C 3 331 ? 196.711 131.287 146.302 1.00 56.43  ? 331 GLU C CA    1 
ATOM 5205  C C     . GLU C 3 331 ? 197.388 132.338 145.423 1.00 56.43  ? 331 GLU C C     1 
ATOM 5206  O O     . GLU C 3 331 ? 196.723 132.959 144.589 1.00 56.43  ? 331 GLU C O     1 
ATOM 5207  C CB    . GLU C 3 331 ? 196.447 131.877 147.694 1.00 56.43  ? 331 GLU C CB    1 
ATOM 5208  C CG    . GLU C 3 331 ? 197.768 132.159 148.453 1.00 56.43  ? 331 GLU C CG    1 
ATOM 5209  C CD    . GLU C 3 331 ? 197.599 132.596 149.896 1.00 56.43  ? 331 GLU C CD    1 
ATOM 5210  O OE1   . GLU C 3 331 ? 196.453 132.694 150.380 1.00 56.43  ? 331 GLU C OE1   1 
ATOM 5211  O OE2   . GLU C 3 331 ? 198.635 132.837 150.551 1.00 56.43  ? 331 GLU C OE2   1 
ATOM 5212  N N     . ARG C 3 332 ? 198.686 132.571 145.589 1.00 48.45  ? 332 ARG C N     1 
ATOM 5213  C CA    . ARG C 3 332 ? 199.345 133.609 144.805 1.00 48.45  ? 332 ARG C CA    1 
ATOM 5214  C C     . ARG C 3 332 ? 199.336 133.288 143.316 1.00 48.45  ? 332 ARG C C     1 
ATOM 5215  O O     . ARG C 3 332 ? 199.584 132.149 142.913 1.00 48.45  ? 332 ARG C O     1 
ATOM 5216  C CB    . ARG C 3 332 ? 200.789 133.834 145.279 1.00 48.45  ? 332 ARG C CB    1 
ATOM 5217  C CG    . ARG C 3 332 ? 201.716 132.641 145.139 1.00 48.45  ? 332 ARG C CG    1 
ATOM 5218  C CD    . ARG C 3 332 ? 202.493 132.711 143.842 1.00 48.45  ? 332 ARG C CD    1 
ATOM 5219  N NE    . ARG C 3 332 ? 203.205 133.972 143.680 1.00 48.45  ? 332 ARG C NE    1 
ATOM 5220  C CZ    . ARG C 3 332 ? 204.289 134.319 144.366 1.00 48.45  ? 332 ARG C CZ    1 
ATOM 5221  N NH1   . ARG C 3 332 ? 204.856 135.500 144.153 1.00 48.45  ? 332 ARG C NH1   1 
ATOM 5222  N NH2   . ARG C 3 332 ? 204.855 133.461 145.199 1.00 48.45  ? 332 ARG C NH2   1 
ATOM 5223  N N     . ALA C 3 333 ? 199.033 134.285 142.488 1.00 42.72  ? 333 ALA C N     1 
ATOM 5224  C CA    . ALA C 3 333 ? 199.108 134.035 141.058 1.00 42.72  ? 333 ALA C CA    1 
ATOM 5225  C C     . ALA C 3 333 ? 200.597 133.982 140.758 1.00 42.72  ? 333 ALA C C     1 
ATOM 5226  O O     . ALA C 3 333 ? 201.385 134.730 141.344 1.00 42.72  ? 333 ALA C O     1 
ATOM 5227  C CB    . ALA C 3 333 ? 198.403 135.108 140.234 1.00 42.72  ? 333 ALA C CB    1 
ATOM 5228  N N     . ILE C 3 334 ? 200.988 133.114 139.834 1.00 38.44  ? 334 ILE C N     1 
ATOM 5229  C CA    . ILE C 3 334 ? 202.411 132.934 139.570 1.00 38.44  ? 334 ILE C CA    1 
ATOM 5230  C C     . ILE C 3 334 ? 203.073 134.192 139.023 1.00 38.44  ? 334 ILE C C     1 
ATOM 5231  O O     . ILE C 3 334 ? 204.223 134.474 139.349 1.00 38.44  ? 334 ILE C O     1 
ATOM 5232  C CB    . ILE C 3 334 ? 202.637 131.747 138.628 1.00 38.44  ? 334 ILE C CB    1 
ATOM 5233  C CG1   . ILE C 3 334 ? 204.129 131.626 138.383 1.00 38.44  ? 334 ILE C CG1   1 
ATOM 5234  C CG2   . ILE C 3 334 ? 201.902 131.973 137.318 1.00 38.44  ? 334 ILE C CG2   1 
ATOM 5235  C CD1   . ILE C 3 334 ? 204.498 130.496 137.589 1.00 38.44  ? 334 ILE C CD1   1 
ATOM 5236  N N     . TRP C 3 335 ? 202.373 134.972 138.205 1.00 37.55  ? 335 TRP C N     1 
ATOM 5237  C CA    . TRP C 3 335 ? 203.047 136.043 137.473 1.00 37.55  ? 335 TRP C CA    1 
ATOM 5238  C C     . TRP C 3 335 ? 203.936 136.947 138.341 1.00 37.55  ? 335 TRP C C     1 
ATOM 5239  O O     . TRP C 3 335 ? 205.035 137.311 137.908 1.00 37.55  ? 335 TRP C O     1 
ATOM 5240  C CB    . TRP C 3 335 ? 202.025 136.848 136.666 1.00 37.55  ? 335 TRP C CB    1 
ATOM 5241  C CG    . TRP C 3 335 ? 200.920 137.486 137.423 1.00 37.55  ? 335 TRP C CG    1 
ATOM 5242  C CD1   . TRP C 3 335 ? 199.688 136.968 137.647 1.00 37.55  ? 335 TRP C CD1   1 
ATOM 5243  C CD2   . TRP C 3 335 ? 200.909 138.803 137.982 1.00 37.55  ? 335 TRP C CD2   1 
ATOM 5244  N NE1   . TRP C 3 335 ? 198.920 137.857 138.350 1.00 37.55  ? 335 TRP C NE1   1 
ATOM 5245  C CE2   . TRP C 3 335 ? 199.648 138.995 138.566 1.00 37.55  ? 335 TRP C CE2   1 
ATOM 5246  C CE3   . TRP C 3 335 ? 201.851 139.831 138.061 1.00 37.55  ? 335 TRP C CE3   1 
ATOM 5247  C CZ2   . TRP C 3 335 ? 199.300 140.169 139.222 1.00 37.55  ? 335 TRP C CZ2   1 
ATOM 5248  C CZ3   . TRP C 3 335 ? 201.505 140.996 138.715 1.00 37.55  ? 335 TRP C CZ3   1 
ATOM 5249  C CH2   . TRP C 3 335 ? 200.239 141.156 139.286 1.00 37.55  ? 335 TRP C CH2   1 
ATOM 5250  N N     . ARG C 3 336 ? 203.545 137.248 139.588 1.00 40.48  ? 336 ARG C N     1 
ATOM 5251  C CA    . ARG C 3 336 ? 204.394 138.130 140.400 1.00 40.48  ? 336 ARG C CA    1 
ATOM 5252  C C     . ARG C 3 336 ? 205.778 137.556 140.613 1.00 40.48  ? 336 ARG C C     1 
ATOM 5253  O O     . ARG C 3 336 ? 206.780 138.275 140.502 1.00 40.48  ? 336 ARG C O     1 
ATOM 5254  C CB    . ARG C 3 336 ? 203.812 138.366 141.785 1.00 40.48  ? 336 ARG C CB    1 
ATOM 5255  C CG    . ARG C 3 336 ? 202.889 139.506 141.899 1.00 40.48  ? 336 ARG C CG    1 
ATOM 5256  C CD    . ARG C 3 336 ? 201.496 139.050 141.775 1.00 40.48  ? 336 ARG C CD    1 
ATOM 5257  N NE    . ARG C 3 336 ? 201.161 138.210 142.912 1.00 40.48  ? 336 ARG C NE    1 
ATOM 5258  C CZ    . ARG C 3 336 ? 200.054 137.492 142.983 1.00 40.48  ? 336 ARG C CZ    1 
ATOM 5259  N NH1   . ARG C 3 336 ? 199.803 136.755 144.050 1.00 40.48  ? 336 ARG C NH1   1 
ATOM 5260  N NH2   . ARG C 3 336 ? 199.187 137.527 141.988 1.00 40.48  ? 336 ARG C NH2   1 
ATOM 5261  N N     . ASP C 3 337 ? 205.861 136.248 140.807 1.00 46.34  ? 337 ASP C N     1 
ATOM 5262  C CA    . ASP C 3 337 ? 207.150 135.627 141.052 1.00 46.34  ? 337 ASP C CA    1 
ATOM 5263  C C     . ASP C 3 337 ? 208.020 135.779 139.822 1.00 46.34  ? 337 ASP C C     1 
ATOM 5264  O O     . ASP C 3 337 ? 209.233 135.980 139.933 1.00 46.34  ? 337 ASP C O     1 
ATOM 5265  C CB    . ASP C 3 337 ? 206.963 134.169 141.484 1.00 46.34  ? 337 ASP C CB    1 
ATOM 5266  N N     . LEU C 3 338 ? 207.417 135.668 138.639 1.00 47.20  ? 338 LEU C N     1 
ATOM 5267  C CA    . LEU C 3 338 ? 208.196 135.815 137.419 1.00 47.20  ? 338 LEU C CA    1 
ATOM 5268  C C     . LEU C 3 338 ? 208.927 137.150 137.417 1.00 47.20  ? 338 LEU C C     1 
ATOM 5269  O O     . LEU C 3 338 ? 210.089 137.223 137.000 1.00 47.20  ? 338 LEU C O     1 
ATOM 5270  C CB    . LEU C 3 338 ? 207.303 135.635 136.195 1.00 47.20  ? 338 LEU C CB    1 
ATOM 5271  C CG    . LEU C 3 338 ? 207.913 135.833 134.811 1.00 47.20  ? 338 LEU C CG    1 
ATOM 5272  C CD1   . LEU C 3 338 ? 207.232 134.898 133.826 1.00 47.20  ? 338 LEU C CD1   1 
ATOM 5273  C CD2   . LEU C 3 338 ? 207.748 137.274 134.364 1.00 47.20  ? 338 LEU C CD2   1 
ATOM 5274  N N     . ASP C 3 339 ? 208.281 138.213 137.906 1.00 45.21  ? 339 ASP C N     1 
ATOM 5275  C CA    . ASP C 3 339 ? 208.968 139.498 137.938 1.00 45.21  ? 339 ASP C CA    1 
ATOM 5276  C C     . ASP C 3 339 ? 210.227 139.397 138.786 1.00 45.21  ? 339 ASP C C     1 
ATOM 5277  O O     . ASP C 3 339 ? 211.295 139.878 138.388 1.00 45.21  ? 339 ASP C O     1 
ATOM 5278  C CB    . ASP C 3 339 ? 208.053 140.588 138.486 1.00 45.21  ? 339 ASP C CB    1 
ATOM 5279  C CG    . ASP C 3 339 ? 208.707 141.957 138.480 1.00 45.21  ? 339 ASP C CG    1 
ATOM 5280  O OD1   . ASP C 3 339 ? 209.861 142.078 138.040 1.00 45.21  ? 339 ASP C OD1   1 
ATOM 5281  O OD2   . ASP C 3 339 ? 208.069 142.921 138.925 1.00 45.21  ? 339 ASP C OD2   1 
ATOM 5282  N N     . ALA C 3 340 ? 210.135 138.727 139.930 1.00 48.41  ? 340 ALA C N     1 
ATOM 5283  C CA    . ALA C 3 340 ? 211.314 138.559 140.766 1.00 48.41  ? 340 ALA C CA    1 
ATOM 5284  C C     . ALA C 3 340 ? 212.432 137.898 139.975 1.00 48.41  ? 340 ALA C C     1 
ATOM 5285  O O     . ALA C 3 340 ? 213.598 138.281 140.106 1.00 48.41  ? 340 ALA C O     1 
ATOM 5286  C CB    . ALA C 3 340 ? 210.981 137.742 142.014 1.00 48.41  ? 340 ALA C CB    1 
ATOM 5287  N N     . LEU C 3 341 ? 212.077 136.934 139.134 1.00 48.10  ? 341 LEU C N     1 
ATOM 5288  C CA    . LEU C 3 341 ? 213.056 136.231 138.313 1.00 48.10  ? 341 LEU C CA    1 
ATOM 5289  C C     . LEU C 3 341 ? 213.994 137.166 137.548 1.00 48.10  ? 341 LEU C C     1 
ATOM 5290  O O     . LEU C 3 341 ? 214.791 136.707 136.734 1.00 48.10  ? 341 LEU C O     1 
ATOM 5291  C CB    . LEU C 3 341 ? 212.354 135.305 137.320 1.00 48.10  ? 341 LEU C CB    1 
ATOM 5292  C CG    . LEU C 3 341 ? 211.684 134.037 137.852 1.00 48.10  ? 341 LEU C CG    1 
ATOM 5293  C CD1   . LEU C 3 341 ? 211.865 132.888 136.873 1.00 48.10  ? 341 LEU C CD1   1 
ATOM 5294  C CD2   . LEU C 3 341 ? 212.212 133.663 139.225 1.00 48.10  ? 341 LEU C CD2   1 
ATOM 5295  N N     . LEU C 3 342 ? 213.903 138.468 137.799 1.00 50.56  ? 342 LEU C N     1 
ATOM 5296  C CA    . LEU C 3 342 ? 214.763 139.432 137.110 1.00 50.56  ? 342 LEU C CA    1 
ATOM 5297  C C     . LEU C 3 342 ? 215.504 140.346 138.086 1.00 50.56  ? 342 LEU C C     1 
ATOM 5298  O O     . LEU C 3 342 ? 215.080 140.522 139.225 1.00 50.56  ? 342 LEU C O     1 
ATOM 5299  C CB    . LEU C 3 342 ? 213.955 140.268 136.116 1.00 50.56  ? 342 LEU C CB    1 
ATOM 5300  C CG    . LEU C 3 342 ? 212.915 139.537 135.265 1.00 50.56  ? 342 LEU C CG    1 
ATOM 5301  C CD1   . LEU C 3 342 ? 212.612 140.317 133.996 1.00 50.56  ? 342 LEU C CD1   1 
ATOM 5302  C CD2   . LEU C 3 342 ? 213.356 138.122 134.933 1.00 50.56  ? 342 LEU C CD2   1 
ATOM 5303  N N     . HIS C 3 343 ? 216.672 140.853 137.732 1.00 59.76  ? 343 HIS C N     1 
ATOM 5304  C CA    . HIS C 3 343 ? 217.351 141.610 138.775 1.00 59.76  ? 343 HIS C CA    1 
ATOM 5305  C C     . HIS C 3 343 ? 218.209 142.826 138.441 1.00 59.76  ? 343 HIS C C     1 
ATOM 5306  O O     . HIS C 3 343 ? 217.690 143.843 137.979 1.00 59.76  ? 343 HIS C O     1 
ATOM 5307  C CB    . HIS C 3 343 ? 218.105 140.638 139.704 1.00 59.76  ? 343 HIS C CB    1 
ATOM 5308  N N     . TYR C 3 344 ? 219.509 142.741 138.711 1.00 67.49  ? 344 TYR C N     1 
ATOM 5309  C CA    . TYR C 3 344 ? 220.380 143.886 138.509 1.00 67.49  ? 344 TYR C CA    1 
ATOM 5310  C C     . TYR C 3 344 ? 219.771 145.052 139.302 1.00 67.49  ? 344 TYR C C     1 
ATOM 5311  O O     . TYR C 3 344 ? 220.064 146.218 139.040 1.00 67.49  ? 344 TYR C O     1 
ATOM 5312  C CB    . TYR C 3 344 ? 220.482 144.240 137.027 1.00 67.49  ? 344 TYR C CB    1 
ATOM 5313  N N     . GLY C 3 345 ? 218.916 144.715 140.272 1.00 77.71  ? 345 GLY C N     1 
ATOM 5314  C CA    . GLY C 3 345 ? 218.229 145.686 141.094 1.00 77.71  ? 345 GLY C CA    1 
ATOM 5315  C C     . GLY C 3 345 ? 217.991 145.284 142.539 1.00 77.71  ? 345 GLY C C     1 
ATOM 5316  O O     . GLY C 3 345 ? 218.345 146.053 143.433 1.00 77.71  ? 345 GLY C O     1 
ATOM 5317  N N     . GLU C 3 346 ? 217.401 144.115 142.807 1.00 83.16  ? 346 GLU C N     1 
ATOM 5318  C CA    . GLU C 3 346 ? 217.182 143.800 144.215 1.00 83.16  ? 346 GLU C CA    1 
ATOM 5319  C C     . GLU C 3 346 ? 215.928 144.499 144.723 1.00 83.16  ? 346 GLU C C     1 
ATOM 5320  O O     . GLU C 3 346 ? 215.917 145.714 144.916 1.00 83.16  ? 346 GLU C O     1 
ATOM 5321  C CB    . GLU C 3 346 ? 218.390 144.206 145.062 1.00 83.16  ? 346 GLU C CB    1 
ATOM 5322  N N     . ASP C 3 347 ? 214.875 143.721 144.939 1.00 85.84  ? 347 ASP C N     1 
ATOM 5323  C CA    . ASP C 3 347 ? 213.608 144.258 145.421 1.00 85.84  ? 347 ASP C CA    1 
ATOM 5324  C C     . ASP C 3 347 ? 213.294 143.741 146.823 1.00 85.84  ? 347 ASP C C     1 
ATOM 5325  O O     . ASP C 3 347 ? 212.131 143.595 147.197 1.00 85.84  ? 347 ASP C O     1 
ATOM 5326  C CB    . ASP C 3 347 ? 212.468 143.899 144.460 1.00 85.84  ? 347 ASP C CB    1 
ATOM 5327  C CG    . ASP C 3 347 ? 212.936 143.755 143.023 1.00 85.84  ? 347 ASP C CG    1 
ATOM 5328  O OD1   . ASP C 3 347 ? 214.148 143.920 142.772 1.00 85.84  ? 347 ASP C OD1   1 
ATOM 5329  O OD2   . ASP C 3 347 ? 212.093 143.474 142.146 1.00 85.84  ? 347 ASP C OD2   1 
ATOM 5330  N N     . GLY C 3 348 ? 214.341 143.466 147.592 1.00 82.39  ? 348 GLY C N     1 
ATOM 5331  C CA    . GLY C 3 348 ? 214.189 142.965 148.934 1.00 82.39  ? 348 GLY C CA    1 
ATOM 5332  C C     . GLY C 3 348 ? 214.489 141.489 149.052 1.00 82.39  ? 348 GLY C C     1 
ATOM 5333  O O     . GLY C 3 348 ? 214.411 140.941 150.162 1.00 82.39  ? 348 GLY C O     1 
ATOM 5334  N N     . ASN C 3 349 ? 214.855 140.832 147.946 1.00 77.25  ? 349 ASN C N     1 
ATOM 5335  C CA    . ASN C 3 349 ? 215.156 139.408 147.948 1.00 77.25  ? 349 ASN C CA    1 
ATOM 5336  C C     . ASN C 3 349 ? 216.459 139.090 147.214 1.00 77.25  ? 349 ASN C C     1 
ATOM 5337  O O     . ASN C 3 349 ? 216.844 139.761 146.257 1.00 77.25  ? 349 ASN C O     1 
ATOM 5338  C CB    . ASN C 3 349 ? 213.986 138.629 147.363 1.00 77.25  ? 349 ASN C CB    1 
ATOM 5339  C CG    . ASN C 3 349 ? 213.787 138.857 145.885 1.00 77.25  ? 349 ASN C CG    1 
ATOM 5340  O OD1   . ASN C 3 349 ? 214.555 139.526 145.217 1.00 77.25  ? 349 ASN C OD1   1 
ATOM 5341  N ND2   . ASN C 3 349 ? 212.704 138.301 145.370 1.00 77.25  ? 349 ASN C ND2   1 
ATOM 5342  N N     . TYR C 3 350 ? 217.164 138.062 147.673 1.00 83.40  ? 350 TYR C N     1 
ATOM 5343  C CA    . TYR C 3 350 ? 218.431 137.684 147.051 1.00 83.40  ? 350 TYR C CA    1 
ATOM 5344  C C     . TYR C 3 350 ? 218.237 137.232 145.605 1.00 83.40  ? 350 TYR C C     1 
ATOM 5345  O O     . TYR C 3 350 ? 218.943 137.673 144.698 1.00 83.40  ? 350 TYR C O     1 
ATOM 5346  C CB    . TYR C 3 350 ? 219.117 136.580 147.859 1.00 83.40  ? 350 TYR C CB    1 
ATOM 5347  C CG    . TYR C 3 350 ? 219.908 137.091 149.042 1.00 83.40  ? 350 TYR C CG    1 
ATOM 5348  C CD1   . TYR C 3 350 ? 221.203 137.565 148.884 1.00 83.40  ? 350 TYR C CD1   1 
ATOM 5349  C CD2   . TYR C 3 350 ? 219.360 137.098 150.318 1.00 83.40  ? 350 TYR C CD2   1 
ATOM 5350  C CE1   . TYR C 3 350 ? 221.930 138.033 149.962 1.00 83.40  ? 350 TYR C CE1   1 
ATOM 5351  C CE2   . TYR C 3 350 ? 220.079 137.564 151.402 1.00 83.40  ? 350 TYR C CE2   1 
ATOM 5352  C CZ    . TYR C 3 350 ? 221.363 138.030 151.219 1.00 83.40  ? 350 TYR C CZ    1 
ATOM 5353  O OH    . TYR C 3 350 ? 222.083 138.495 152.295 1.00 83.40  ? 350 TYR C OH    1 
ATOM 5354  N N     . ARG C 3 351 ? 217.268 136.347 145.412 1.00 74.71  ? 351 ARG C N     1 
ATOM 5355  C CA    . ARG C 3 351 ? 216.920 135.780 144.080 1.00 74.71  ? 351 ARG C CA    1 
ATOM 5356  C C     . ARG C 3 351 ? 217.567 134.469 143.624 1.00 74.71  ? 351 ARG C C     1 
ATOM 5357  O O     . ARG C 3 351 ? 218.170 133.788 144.453 1.00 74.71  ? 351 ARG C O     1 
ATOM 5358  C CB    . ARG C 3 351 ? 217.046 136.922 143.032 1.00 74.71  ? 351 ARG C CB    1 
ATOM 5359  N N     . PRO C 3 352 ? 217.419 134.039 142.298 1.00 60.34  ? 352 PRO C N     1 
ATOM 5360  C CA    . PRO C 3 352 ? 218.006 132.769 141.850 1.00 60.34  ? 352 PRO C CA    1 
ATOM 5361  C C     . PRO C 3 352 ? 219.259 132.926 140.996 1.00 60.34  ? 352 PRO C C     1 
ATOM 5362  O O     . PRO C 3 352 ? 219.275 133.662 140.009 1.00 60.34  ? 352 PRO C O     1 
ATOM 5363  C CB    . PRO C 3 352 ? 216.874 132.139 141.034 1.00 60.34  ? 352 PRO C CB    1 
ATOM 5364  C CG    . PRO C 3 352 ? 216.196 133.310 140.452 1.00 60.34  ? 352 PRO C CG    1 
ATOM 5365  C CD    . PRO C 3 352 ? 216.567 134.547 141.209 1.00 60.34  ? 352 PRO C CD    1 
ATOM 5366  N N     . THR C 3 353 ? 220.327 132.216 141.358 1.00 60.20  ? 353 THR C N     1 
ATOM 5367  C CA    . THR C 3 353 ? 221.588 132.323 140.626 1.00 60.20  ? 353 THR C CA    1 
ATOM 5368  C C     . THR C 3 353 ? 221.536 131.732 139.222 1.00 60.20  ? 353 THR C C     1 
ATOM 5369  O O     . THR C 3 353 ? 222.079 132.334 138.292 1.00 60.20  ? 353 THR C O     1 
ATOM 5370  C CB    . THR C 3 353 ? 222.699 131.630 141.408 1.00 60.20  ? 353 THR C CB    1 
ATOM 5371  O OG1   . THR C 3 353 ? 222.173 130.446 142.015 1.00 60.20  ? 353 THR C OG1   1 
ATOM 5372  C CG2   . THR C 3 353 ? 223.265 132.562 142.477 1.00 60.20  ? 353 THR C CG2   1 
ATOM 5373  N N     . ILE C 3 354 ? 220.874 130.585 139.023 1.00 59.65  ? 354 ILE C N     1 
ATOM 5374  C CA    . ILE C 3 354 ? 220.881 130.005 137.678 1.00 59.65  ? 354 ILE C CA    1 
ATOM 5375  C C     . ILE C 3 354 ? 220.236 130.948 136.686 1.00 59.65  ? 354 ILE C C     1 
ATOM 5376  O O     . ILE C 3 354 ? 220.697 131.092 135.552 1.00 59.65  ? 354 ILE C O     1 
ATOM 5377  C CB    . ILE C 3 354 ? 220.188 128.633 137.637 1.00 59.65  ? 354 ILE C CB    1 
ATOM 5378  C CG1   . ILE C 3 354 ? 220.082 128.160 136.194 1.00 59.65  ? 354 ILE C CG1   1 
ATOM 5379  C CG2   . ILE C 3 354 ? 218.767 128.717 138.078 1.00 59.65  ? 354 ILE C CG2   1 
ATOM 5380  C CD1   . ILE C 3 354 ? 219.606 126.755 136.056 1.00 59.65  ? 354 ILE C CD1   1 
ATOM 5381  N N     . LEU C 3 355 ? 219.148 131.588 137.081 1.00 67.26  ? 355 LEU C N     1 
ATOM 5382  C CA    . LEU C 3 355 ? 218.499 132.514 136.166 1.00 67.26  ? 355 LEU C CA    1 
ATOM 5383  C C     . LEU C 3 355 ? 219.423 133.688 135.843 1.00 67.26  ? 355 LEU C C     1 
ATOM 5384  O O     . LEU C 3 355 ? 219.543 134.098 134.683 1.00 67.26  ? 355 LEU C O     1 
ATOM 5385  C CB    . LEU C 3 355 ? 217.171 132.979 136.746 1.00 67.26  ? 355 LEU C CB    1 
ATOM 5386  C CG    . LEU C 3 355 ? 216.061 133.145 135.705 1.00 67.26  ? 355 LEU C CG    1 
ATOM 5387  C CD1   . LEU C 3 355 ? 216.005 134.501 135.084 1.00 67.26  ? 355 LEU C CD1   1 
ATOM 5388  C CD2   . LEU C 3 355 ? 216.198 132.053 134.656 1.00 67.26  ? 355 LEU C CD2   1 
ATOM 5389  N N     . ASP C 3 356 ? 220.114 134.208 136.866 1.00 72.14  ? 356 ASP C N     1 
ATOM 5390  C CA    . ASP C 3 356 ? 221.021 135.337 136.697 1.00 72.14  ? 356 ASP C CA    1 
ATOM 5391  C C     . ASP C 3 356 ? 222.164 134.964 135.763 1.00 72.14  ? 356 ASP C C     1 
ATOM 5392  O O     . ASP C 3 356 ? 222.555 135.758 134.906 1.00 72.14  ? 356 ASP C O     1 
ATOM 5393  C CB    . ASP C 3 356 ? 221.560 135.728 138.087 1.00 72.14  ? 356 ASP C CB    1 
ATOM 5394  C CG    . ASP C 3 356 ? 222.704 136.726 138.060 1.00 72.14  ? 356 ASP C CG    1 
ATOM 5395  O OD1   . ASP C 3 356 ? 223.078 137.240 136.992 1.00 72.14  ? 356 ASP C OD1   1 
ATOM 5396  O OD2   . ASP C 3 356 ? 223.269 136.965 139.145 1.00 72.14  ? 356 ASP C OD2   1 
ATOM 5397  N N     . ASN C 3 357 ? 222.758 133.793 135.944 1.00 74.43  ? 357 ASN C N     1 
ATOM 5398  C CA    . ASN C 3 357 ? 223.854 133.400 135.062 1.00 74.43  ? 357 ASN C CA    1 
ATOM 5399  C C     . ASN C 3 357 ? 223.338 133.094 133.646 1.00 74.43  ? 357 ASN C C     1 
ATOM 5400  O O     . ASN C 3 357 ? 223.845 133.613 132.643 1.00 74.43  ? 357 ASN C O     1 
ATOM 5401  C CB    . ASN C 3 357 ? 224.611 132.222 135.678 1.00 74.43  ? 357 ASN C CB    1 
ATOM 5402  C CG    . ASN C 3 357 ? 225.688 131.652 134.718 1.00 74.43  ? 357 ASN C CG    1 
ATOM 5403  O OD1   . ASN C 3 357 ? 225.952 132.200 133.618 1.00 74.43  ? 357 ASN C OD1   1 
ATOM 5404  N ND2   . ASN C 3 357 ? 226.175 130.477 135.043 1.00 74.43  ? 357 ASN C ND2   1 
ATOM 5405  N N     . CYS C 3 358 ? 222.293 132.285 133.573 1.00 75.92  ? 358 CYS C N     1 
ATOM 5406  C CA    . CYS C 3 358 ? 221.748 131.738 132.331 1.00 75.92  ? 358 CYS C CA    1 
ATOM 5407  C C     . CYS C 3 358 ? 221.072 132.741 131.381 1.00 75.92  ? 358 CYS C C     1 
ATOM 5408  O O     . CYS C 3 358 ? 221.100 132.554 130.161 1.00 75.92  ? 358 CYS C O     1 
ATOM 5409  C CB    . CYS C 3 358 ? 220.793 130.591 132.657 1.00 75.92  ? 358 CYS C CB    1 
ATOM 5410  S SG    . CYS C 3 358 ? 221.393 128.963 132.231 1.00 75.92  ? 358 CYS C SG    1 
ATOM 5411  N N     . THR C 3 359 ? 220.342 133.700 131.874 1.00 83.79  ? 359 THR C N     1 
ATOM 5412  C CA    . THR C 3 359 ? 219.645 134.390 130.801 1.00 83.79  ? 359 THR C CA    1 
ATOM 5413  C C     . THR C 3 359 ? 220.080 135.755 130.300 1.00 83.79  ? 359 THR C C     1 
ATOM 5414  O O     . THR C 3 359 ? 219.737 136.045 129.160 1.00 83.79  ? 359 THR C O     1 
ATOM 5415  C CB    . THR C 3 359 ? 218.157 134.540 131.175 1.00 83.79  ? 359 THR C CB    1 
ATOM 5416  N N     . PRO C 3 360 ? 220.822 136.600 131.007 1.00 83.42  ? 360 PRO C N     1 
ATOM 5417  C CA    . PRO C 3 360 ? 221.197 137.892 130.420 1.00 83.42  ? 360 PRO C CA    1 
ATOM 5418  C C     . PRO C 3 360 ? 222.154 137.759 129.253 1.00 83.42  ? 360 PRO C C     1 
ATOM 5419  O O     . PRO C 3 360 ? 222.726 136.705 128.995 1.00 83.42  ? 360 PRO C O     1 
ATOM 5420  C CB    . PRO C 3 360 ? 221.866 138.625 131.584 1.00 83.42  ? 360 PRO C CB    1 
ATOM 5421  C CG    . PRO C 3 360 ? 222.348 137.555 132.446 1.00 83.42  ? 360 PRO C CG    1 
ATOM 5422  C CD    . PRO C 3 360 ? 221.312 136.495 132.381 1.00 83.42  ? 360 PRO C CD    1 
ATOM 5423  N N     . LEU C 3 361 ? 222.264 138.846 128.493 1.00 87.78  ? 361 LEU C N     1 
ATOM 5424  C CA    . LEU C 3 361 ? 223.081 138.816 127.287 1.00 87.78  ? 361 LEU C CA    1 
ATOM 5425  C C     . LEU C 3 361 ? 224.579 138.721 127.566 1.00 87.78  ? 361 LEU C C     1 
ATOM 5426  O O     . LEU C 3 361 ? 225.340 138.514 126.617 1.00 87.78  ? 361 LEU C O     1 
ATOM 5427  C CB    . LEU C 3 361 ? 222.810 140.043 126.412 1.00 87.78  ? 361 LEU C CB    1 
ATOM 5428  C CG    . LEU C 3 361 ? 223.245 141.459 126.806 1.00 87.78  ? 361 LEU C CG    1 
ATOM 5429  C CD1   . LEU C 3 361 ? 222.862 142.433 125.701 1.00 87.78  ? 361 LEU C CD1   1 
ATOM 5430  C CD2   . LEU C 3 361 ? 222.626 141.895 128.128 1.00 87.78  ? 361 LEU C CD2   1 
ATOM 5431  N N     . ALA C 3 362 ? 225.038 138.907 128.812 1.00 86.93  ? 362 ALA C N     1 
ATOM 5432  C CA    . ALA C 3 362 ? 226.469 138.755 129.055 1.00 86.93  ? 362 ALA C CA    1 
ATOM 5433  C C     . ALA C 3 362 ? 226.922 137.326 128.784 1.00 86.93  ? 362 ALA C C     1 
ATOM 5434  O O     . ALA C 3 362 ? 228.010 137.108 128.242 1.00 86.93  ? 362 ALA C O     1 
ATOM 5435  C CB    . ALA C 3 362 ? 226.811 139.170 130.483 1.00 86.93  ? 362 ALA C CB    1 
ATOM 5436  N N     . GLN C 3 363 ? 226.048 136.372 129.096 1.00 87.48  ? 363 GLN C N     1 
ATOM 5437  C CA    . GLN C 3 363 ? 226.311 134.957 128.857 1.00 87.48  ? 363 GLN C CA    1 
ATOM 5438  C C     . GLN C 3 363 ? 226.930 134.731 127.472 1.00 87.48  ? 363 GLN C C     1 
ATOM 5439  O O     . GLN C 3 363 ? 228.060 135.151 127.233 1.00 87.48  ? 363 GLN C O     1 
ATOM 5440  C CB    . GLN C 3 363 ? 225.025 134.141 129.019 1.00 87.48  ? 363 GLN C CB    1 
ATOM 5441  N N     . VAL C 3 364 ? 226.205 134.077 126.563 1.00 92.40  ? 364 VAL C N     1 
ATOM 5442  C CA    . VAL C 3 364 ? 226.749 133.822 125.225 1.00 92.40  ? 364 VAL C CA    1 
ATOM 5443  C C     . VAL C 3 364 ? 225.770 133.333 124.147 1.00 92.40  ? 364 VAL C C     1 
ATOM 5444  O O     . VAL C 3 364 ? 225.939 133.671 122.972 1.00 92.40  ? 364 VAL C O     1 
ATOM 5445  C CB    . VAL C 3 364 ? 227.917 132.813 125.278 1.00 92.40  ? 364 VAL C CB    1 
ATOM 5446  C CG1   . VAL C 3 364 ? 229.248 133.534 125.423 1.00 92.40  ? 364 VAL C CG1   1 
ATOM 5447  C CG2   . VAL C 3 364 ? 227.711 131.808 126.401 1.00 92.40  ? 364 VAL C CG2   1 
ATOM 5448  N N     . PRO C 3 365 ? 224.731 132.505 124.560 1.00 86.78  ? 365 PRO C N     1 
ATOM 5449  C CA    . PRO C 3 365 ? 223.844 132.045 123.467 1.00 86.78  ? 365 PRO C CA    1 
ATOM 5450  C C     . PRO C 3 365 ? 223.313 133.172 122.582 1.00 86.78  ? 365 PRO C C     1 
ATOM 5451  O O     . PRO C 3 365 ? 222.985 134.233 123.107 1.00 86.78  ? 365 PRO C O     1 
ATOM 5452  C CB    . PRO C 3 365 ? 222.679 131.354 124.198 1.00 86.78  ? 365 PRO C CB    1 
ATOM 5453  C CG    . PRO C 3 365 ? 222.723 131.855 125.595 1.00 86.78  ? 365 PRO C CG    1 
ATOM 5454  C CD    . PRO C 3 365 ? 224.186 131.918 125.862 1.00 86.78  ? 365 PRO C CD    1 
ATOM 5455  N N     . GLN C 3 366 ? 223.227 132.952 121.268 1.00 87.50  ? 366 GLN C N     1 
ATOM 5456  C CA    . GLN C 3 366 ? 222.729 134.011 120.391 1.00 87.50  ? 366 GLN C CA    1 
ATOM 5457  C C     . GLN C 3 366 ? 221.206 134.124 120.364 1.00 87.50  ? 366 GLN C C     1 
ATOM 5458  O O     . GLN C 3 366 ? 220.645 135.175 120.696 1.00 87.50  ? 366 GLN C O     1 
ATOM 5459  C CB    . GLN C 3 366 ? 223.276 133.834 118.969 1.00 87.50  ? 366 GLN C CB    1 
ATOM 5460  C CG    . GLN C 3 366 ? 224.797 133.993 118.822 1.00 87.50  ? 366 GLN C CG    1 
ATOM 5461  C CD    . GLN C 3 366 ? 225.621 132.850 119.395 1.00 87.50  ? 366 GLN C CD    1 
ATOM 5462  O OE1   . GLN C 3 366 ? 226.456 133.053 120.281 1.00 87.50  ? 366 GLN C OE1   1 
ATOM 5463  N NE2   . GLN C 3 366 ? 225.409 131.649 118.874 1.00 87.50  ? 366 GLN C NE2   1 
ATOM 5464  N N     . GLU C 3 367 ? 220.515 133.045 120.011 1.00 80.97  ? 367 GLU C N     1 
ATOM 5465  C CA    . GLU C 3 367 ? 219.088 133.145 119.753 1.00 80.97  ? 367 GLU C CA    1 
ATOM 5466  C C     . GLU C 3 367 ? 218.241 132.324 120.697 1.00 80.97  ? 367 GLU C C     1 
ATOM 5467  O O     . GLU C 3 367 ? 217.056 132.627 120.839 1.00 80.97  ? 367 GLU C O     1 
ATOM 5468  C CB    . GLU C 3 367 ? 218.767 132.710 118.312 1.00 80.97  ? 367 GLU C CB    1 
ATOM 5469  C CG    . GLU C 3 367 ? 219.075 131.255 117.988 1.00 80.97  ? 367 GLU C CG    1 
ATOM 5470  C CD    . GLU C 3 367 ? 217.852 130.361 118.138 1.00 80.97  ? 367 GLU C CD    1 
ATOM 5471  O OE1   . GLU C 3 367 ? 216.851 130.816 118.722 1.00 80.97  ? 367 GLU C OE1   1 
ATOM 5472  O OE2   . GLU C 3 367 ? 217.890 129.196 117.697 1.00 80.97  ? 367 GLU C OE2   1 
ATOM 5473  N N     . VAL C 3 368 ? 218.784 131.254 121.277 1.00 73.43  ? 368 VAL C N     1 
ATOM 5474  C CA    . VAL C 3 368 ? 217.961 130.368 122.093 1.00 73.43  ? 368 VAL C CA    1 
ATOM 5475  C C     . VAL C 3 368 ? 217.268 131.166 123.186 1.00 73.43  ? 368 VAL C C     1 
ATOM 5476  O O     . VAL C 3 368 ? 216.169 130.815 123.626 1.00 73.43  ? 368 VAL C O     1 
ATOM 5477  C CB    . VAL C 3 368 ? 218.824 129.226 122.660 1.00 73.43  ? 368 VAL C CB    1 
ATOM 5478  C CG1   . VAL C 3 368 ? 217.950 128.172 123.311 1.00 73.43  ? 368 VAL C CG1   1 
ATOM 5479  C CG2   . VAL C 3 368 ? 219.694 128.630 121.558 1.00 73.43  ? 368 VAL C CG2   1 
ATOM 5480  N N     . LEU C 3 369 ? 217.892 132.261 123.632 1.00 71.01  ? 369 LEU C N     1 
ATOM 5481  C CA    . LEU C 3 369 ? 217.278 133.085 124.665 1.00 71.01  ? 369 LEU C CA    1 
ATOM 5482  C C     . LEU C 3 369 ? 215.953 133.663 124.201 1.00 71.01  ? 369 LEU C C     1 
ATOM 5483  O O     . LEU C 3 369 ? 215.037 133.838 125.007 1.00 71.01  ? 369 LEU C O     1 
ATOM 5484  C CB    . LEU C 3 369 ? 218.197 134.239 125.041 1.00 71.01  ? 369 LEU C CB    1 
ATOM 5485  C CG    . LEU C 3 369 ? 219.557 133.959 125.653 1.00 71.01  ? 369 LEU C CG    1 
ATOM 5486  C CD1   . LEU C 3 369 ? 220.214 135.286 125.977 1.00 71.01  ? 369 LEU C CD1   1 
ATOM 5487  C CD2   . LEU C 3 369 ? 219.417 133.108 126.897 1.00 71.01  ? 369 LEU C CD2   1 
ATOM 5488  N N     . ASP C 3 370 ? 215.807 133.910 122.901 1.00 72.28  ? 370 ASP C N     1 
ATOM 5489  C CA    . ASP C 3 370 ? 214.576 134.528 122.433 1.00 72.28  ? 370 ASP C CA    1 
ATOM 5490  C C     . ASP C 3 370 ? 213.402 133.580 122.575 1.00 72.28  ? 370 ASP C C     1 
ATOM 5491  O O     . ASP C 3 370 ? 212.273 134.025 122.800 1.00 72.28  ? 370 ASP C O     1 
ATOM 5492  C CB    . ASP C 3 370 ? 214.730 134.976 120.980 1.00 72.28  ? 370 ASP C CB    1 
ATOM 5493  C CG    . ASP C 3 370 ? 215.764 136.074 120.818 1.00 72.28  ? 370 ASP C CG    1 
ATOM 5494  O OD1   . ASP C 3 370 ? 215.930 136.881 121.758 1.00 72.28  ? 370 ASP C OD1   1 
ATOM 5495  O OD2   . ASP C 3 370 ? 216.407 136.139 119.750 1.00 72.28  ? 370 ASP C OD2   1 
ATOM 5496  N N     . SER C 3 371 ? 213.651 132.279 122.466 1.00 66.99  ? 371 SER C N     1 
ATOM 5497  C CA    . SER C 3 371 ? 212.589 131.291 122.469 1.00 66.99  ? 371 SER C CA    1 
ATOM 5498  C C     . SER C 3 371 ? 212.559 130.451 123.735 1.00 66.99  ? 371 SER C C     1 
ATOM 5499  O O     . SER C 3 371 ? 211.767 129.507 123.810 1.00 66.99  ? 371 SER C O     1 
ATOM 5500  C CB    . SER C 3 371 ? 212.706 130.387 121.246 1.00 66.99  ? 371 SER C CB    1 
ATOM 5501  O OG    . SER C 3 371 ? 211.656 129.442 121.242 1.00 66.99  ? 371 SER C OG    1 
ATOM 5502  N N     . LEU C 3 372 ? 213.388 130.754 124.730 1.00 58.36  ? 372 LEU C N     1 
ATOM 5503  C CA    . LEU C 3 372 ? 213.343 129.969 125.954 1.00 58.36  ? 372 LEU C CA    1 
ATOM 5504  C C     . LEU C 3 372 ? 212.115 130.362 126.754 1.00 58.36  ? 372 LEU C C     1 
ATOM 5505  O O     . LEU C 3 372 ? 211.708 131.524 126.768 1.00 58.36  ? 372 LEU C O     1 
ATOM 5506  C CB    . LEU C 3 372 ? 214.594 130.154 126.815 1.00 58.36  ? 372 LEU C CB    1 
ATOM 5507  C CG    . LEU C 3 372 ? 214.769 131.374 127.713 1.00 58.36  ? 372 LEU C CG    1 
ATOM 5508  C CD1   . LEU C 3 372 ? 214.153 131.192 129.087 1.00 58.36  ? 372 LEU C CD1   1 
ATOM 5509  C CD2   . LEU C 3 372 ? 216.254 131.595 127.877 1.00 58.36  ? 372 LEU C CD2   1 
ATOM 5510  N N     . ARG C 3 373 ? 211.567 129.399 127.484 1.00 46.64  ? 373 ARG C N     1 
ATOM 5511  C CA    . ARG C 3 373 ? 210.393 129.673 128.295 1.00 46.64  ? 373 ARG C CA    1 
ATOM 5512  C C     . ARG C 3 373 ? 210.483 128.905 129.602 1.00 46.64  ? 373 ARG C C     1 
ATOM 5513  O O     . ARG C 3 373 ? 210.740 127.698 129.625 1.00 46.64  ? 373 ARG C O     1 
ATOM 5514  C CB    . ARG C 3 373 ? 209.112 129.337 127.517 1.00 46.64  ? 373 ARG C CB    1 
ATOM 5515  C CG    . ARG C 3 373 ? 209.019 127.901 127.056 1.00 46.64  ? 373 ARG C CG    1 
ATOM 5516  C CD    . ARG C 3 373 ? 207.695 127.633 126.391 1.00 46.64  ? 373 ARG C CD    1 
ATOM 5517  N NE    . ARG C 3 373 ? 206.598 127.925 127.294 1.00 46.64  ? 373 ARG C NE    1 
ATOM 5518  C CZ    . ARG C 3 373 ? 205.321 127.910 126.937 1.00 46.64  ? 373 ARG C CZ    1 
ATOM 5519  N NH1   . ARG C 3 373 ? 204.982 127.616 125.690 1.00 46.64  ? 373 ARG C NH1   1 
ATOM 5520  N NH2   . ARG C 3 373 ? 204.387 128.186 127.830 1.00 46.64  ? 373 ARG C NH2   1 
ATOM 5521  N N     . LEU C 3 374 ? 210.233 129.639 130.676 1.00 42.19  ? 374 LEU C N     1 
ATOM 5522  C CA    . LEU C 3 374 ? 210.452 129.219 132.051 1.00 42.19  ? 374 LEU C CA    1 
ATOM 5523  C C     . LEU C 3 374 ? 209.388 128.254 132.545 1.00 42.19  ? 374 LEU C C     1 
ATOM 5524  O O     . LEU C 3 374 ? 208.217 128.361 132.180 1.00 42.19  ? 374 LEU C O     1 
ATOM 5525  C CB    . LEU C 3 374 ? 210.472 130.462 132.921 1.00 42.19  ? 374 LEU C CB    1 
ATOM 5526  C CG    . LEU C 3 374 ? 210.832 130.363 134.377 1.00 42.19  ? 374 LEU C CG    1 
ATOM 5527  C CD1   . LEU C 3 374 ? 212.219 129.806 134.509 1.00 42.19  ? 374 LEU C CD1   1 
ATOM 5528  C CD2   . LEU C 3 374 ? 210.771 131.772 134.858 1.00 42.19  ? 374 LEU C CD2   1 
ATOM 5529  N N     . ARG C 3 375 ? 209.798 127.302 133.380 1.00 37.63  ? 375 ARG C N     1 
ATOM 5530  C CA    . ARG C 3 375 ? 208.865 126.342 133.952 1.00 37.63  ? 375 ARG C CA    1 
ATOM 5531  C C     . ARG C 3 375 ? 209.019 126.266 135.468 1.00 37.63  ? 375 ARG C C     1 
ATOM 5532  O O     . ARG C 3 375 ? 210.142 126.292 135.978 1.00 37.63  ? 375 ARG C O     1 
ATOM 5533  C CB    . ARG C 3 375 ? 209.091 125.004 133.306 1.00 37.63  ? 375 ARG C CB    1 
ATOM 5534  C CG    . ARG C 3 375 ? 208.271 123.922 133.852 1.00 37.63  ? 375 ARG C CG    1 
ATOM 5535  C CD    . ARG C 3 375 ? 208.530 122.703 133.053 1.00 37.63  ? 375 ARG C CD    1 
ATOM 5536  N NE    . ARG C 3 375 ? 207.689 121.622 133.509 1.00 37.63  ? 375 ARG C NE    1 
ATOM 5537  C CZ    . ARG C 3 375 ? 207.681 120.418 132.967 1.00 37.63  ? 375 ARG C CZ    1 
ATOM 5538  N NH1   . ARG C 3 375 ? 208.485 120.147 131.950 1.00 37.63  ? 375 ARG C NH1   1 
ATOM 5539  N NH2   . ARG C 3 375 ? 206.866 119.493 133.447 1.00 37.63  ? 375 ARG C NH2   1 
ATOM 5540  N N     . ALA C 3 376 ? 207.896 126.182 136.196 1.00 34.72  ? 376 ALA C N     1 
ATOM 5541  C CA    . ALA C 3 376 ? 207.925 126.161 137.660 1.00 34.72  ? 376 ALA C CA    1 
ATOM 5542  C C     . ALA C 3 376 ? 207.188 124.971 138.260 1.00 34.72  ? 376 ALA C C     1 
ATOM 5543  O O     . ALA C 3 376 ? 206.061 124.671 137.863 1.00 34.72  ? 376 ALA C O     1 
ATOM 5544  C CB    . ALA C 3 376 ? 207.304 127.436 138.211 1.00 34.72  ? 376 ALA C CB    1 
ATOM 5545  N N     . PHE C 3 377 ? 207.811 124.323 139.246 1.00 35.85  ? 377 PHE C N     1 
ATOM 5546  C CA    . PHE C 3 377 ? 207.204 123.264 140.057 1.00 35.85  ? 377 PHE C CA    1 
ATOM 5547  C C     . PHE C 3 377 ? 207.086 123.696 141.512 1.00 35.85  ? 377 PHE C C     1 
ATOM 5548  O O     . PHE C 3 377 ? 208.101 123.862 142.190 1.00 35.85  ? 377 PHE C O     1 
ATOM 5549  C CB    . PHE C 3 377 ? 208.011 121.971 140.006 1.00 35.85  ? 377 PHE C CB    1 
ATOM 5550  C CG    . PHE C 3 377 ? 208.134 121.377 138.658 1.00 35.85  ? 377 PHE C CG    1 
ATOM 5551  C CD1   . PHE C 3 377 ? 207.040 120.839 138.030 1.00 35.85  ? 377 PHE C CD1   1 
ATOM 5552  C CD2   . PHE C 3 377 ? 209.360 121.299 138.044 1.00 35.85  ? 377 PHE C CD2   1 
ATOM 5553  C CE1   . PHE C 3 377 ? 207.160 120.268 136.796 1.00 35.85  ? 377 PHE C CE1   1 
ATOM 5554  C CE2   . PHE C 3 377 ? 209.484 120.728 136.812 1.00 35.85  ? 377 PHE C CE2   1 
ATOM 5555  C CZ    . PHE C 3 377 ? 208.383 120.213 136.187 1.00 35.85  ? 377 PHE C CZ    1 
ATOM 5556  N N     . GLY C 3 378 ? 205.873 123.874 142.007 1.00 34.32  ? 378 GLY C N     1 
ATOM 5557  C CA    . GLY C 3 378 ? 205.772 124.332 143.376 1.00 34.32  ? 378 GLY C CA    1 
ATOM 5558  C C     . GLY C 3 378 ? 204.856 123.439 144.180 1.00 34.32  ? 378 GLY C C     1 
ATOM 5559  O O     . GLY C 3 378 ? 203.654 123.357 143.908 1.00 34.32  ? 378 GLY C O     1 
ATOM 5560  N N     . PHE C 3 379 ? 205.428 122.727 145.141 1.00 39.16  ? 379 PHE C N     1 
ATOM 5561  C CA    . PHE C 3 379 ? 204.681 121.864 146.051 1.00 39.16  ? 379 PHE C CA    1 
ATOM 5562  C C     . PHE C 3 379 ? 204.581 122.540 147.412 1.00 39.16  ? 379 PHE C C     1 
ATOM 5563  O O     . PHE C 3 379 ? 205.492 122.437 148.226 1.00 39.16  ? 379 PHE C O     1 
ATOM 5564  C CB    . PHE C 3 379 ? 205.358 120.502 146.121 1.00 39.16  ? 379 PHE C CB    1 
ATOM 5565  C CG    . PHE C 3 379 ? 204.619 119.481 146.920 1.00 39.16  ? 379 PHE C CG    1 
ATOM 5566  C CD1   . PHE C 3 379 ? 203.419 118.974 146.493 1.00 39.16  ? 379 PHE C CD1   1 
ATOM 5567  C CD2   . PHE C 3 379 ? 205.182 118.949 148.051 1.00 39.16  ? 379 PHE C CD2   1 
ATOM 5568  C CE1   . PHE C 3 379 ? 202.758 118.019 147.228 1.00 39.16  ? 379 PHE C CE1   1 
ATOM 5569  C CE2   . PHE C 3 379 ? 204.521 117.998 148.788 1.00 39.16  ? 379 PHE C CE2   1 
ATOM 5570  C CZ    . PHE C 3 379 ? 203.313 117.529 148.369 1.00 39.16  ? 379 PHE C CZ    1 
ATOM 5571  N N     . ASP C 3 380 ? 203.578 123.398 147.576 1.00 44.61  ? 380 ASP C N     1 
ATOM 5572  C CA    . ASP C 3 380 ? 203.313 124.048 148.859 1.00 44.61  ? 380 ASP C CA    1 
ATOM 5573  C C     . ASP C 3 380 ? 202.638 123.128 149.895 1.00 44.61  ? 380 ASP C C     1 
ATOM 5574  O O     . ASP C 3 380 ? 201.601 122.510 149.605 1.00 44.61  ? 380 ASP C O     1 
ATOM 5575  C CB    . ASP C 3 380 ? 202.541 125.358 148.678 1.00 44.61  ? 380 ASP C CB    1 
ATOM 5576  C CG    . ASP C 3 380 ? 201.173 125.195 148.063 1.00 44.61  ? 380 ASP C CG    1 
ATOM 5577  O OD1   . ASP C 3 380 ? 200.639 124.085 148.003 1.00 44.61  ? 380 ASP C OD1   1 
ATOM 5578  O OD2   . ASP C 3 380 ? 200.613 126.227 147.635 1.00 44.61  ? 380 ASP C OD2   1 
ATOM 5579  N N     . GLN C 3 381 ? 203.288 122.928 151.047 1.00 48.13  ? 381 GLN C N     1 
ATOM 5580  C CA    . GLN C 3 381 ? 202.704 122.109 152.107 1.00 48.13  ? 381 GLN C CA    1 
ATOM 5581  C C     . GLN C 3 381 ? 203.311 122.522 153.440 1.00 48.13  ? 381 GLN C C     1 
ATOM 5582  O O     . GLN C 3 381 ? 204.316 123.235 153.497 1.00 48.13  ? 381 GLN C O     1 
ATOM 5583  C CB    . GLN C 3 381 ? 202.927 120.602 151.941 1.00 48.13  ? 381 GLN C CB    1 
ATOM 5584  C CG    . GLN C 3 381 ? 204.363 120.145 151.951 1.00 48.13  ? 381 GLN C CG    1 
ATOM 5585  C CD    . GLN C 3 381 ? 205.069 120.576 150.729 1.00 48.13  ? 381 GLN C CD    1 
ATOM 5586  O OE1   . GLN C 3 381 ? 204.425 121.014 149.799 1.00 48.13  ? 381 GLN C OE1   1 
ATOM 5587  N NE2   . GLN C 3 381 ? 206.390 120.461 150.703 1.00 48.13  ? 381 GLN C NE2   1 
ATOM 5588  N N     . ASP C 3 382 ? 202.641 122.087 154.514 1.00 55.80  ? 382 ASP C N     1 
ATOM 5589  C CA    . ASP C 3 382 ? 202.983 122.250 155.928 1.00 55.80  ? 382 ASP C CA    1 
ATOM 5590  C C     . ASP C 3 382 ? 204.477 122.282 156.223 1.00 55.80  ? 382 ASP C C     1 
ATOM 5591  O O     . ASP C 3 382 ? 205.283 121.771 155.445 1.00 55.80  ? 382 ASP C O     1 
ATOM 5592  C CB    . ASP C 3 382 ? 202.323 121.166 156.783 1.00 55.80  ? 382 ASP C CB    1 
ATOM 5593  C CG    . ASP C 3 382 ? 202.325 121.502 158.275 1.00 55.80  ? 382 ASP C CG    1 
ATOM 5594  O OD1   . ASP C 3 382 ? 203.097 122.383 158.711 1.00 55.80  ? 382 ASP C OD1   1 
ATOM 5595  O OD2   . ASP C 3 382 ? 201.530 120.893 159.018 1.00 55.80  ? 382 ASP C OD2   1 
ATOM 5596  N N     . GLY C 3 383 ? 204.861 122.833 157.376 1.00 56.34  ? 383 GLY C N     1 
ATOM 5597  C CA    . GLY C 3 383 ? 206.260 122.671 157.699 1.00 56.34  ? 383 GLY C CA    1 
ATOM 5598  C C     . GLY C 3 383 ? 206.553 121.296 158.259 1.00 56.34  ? 383 GLY C C     1 
ATOM 5599  O O     . GLY C 3 383 ? 207.714 120.900 158.401 1.00 56.34  ? 383 GLY C O     1 
ATOM 5600  N N     . GLN C 3 384 ? 205.486 120.586 158.614 1.00 56.76  ? 384 GLN C N     1 
ATOM 5601  C CA    . GLN C 3 384 ? 205.470 119.210 159.083 1.00 56.76  ? 384 GLN C CA    1 
ATOM 5602  C C     . GLN C 3 384 ? 205.231 118.194 157.975 1.00 56.76  ? 384 GLN C C     1 
ATOM 5603  O O     . GLN C 3 384 ? 205.892 118.208 156.935 1.00 56.76  ? 384 GLN C O     1 
ATOM 5604  C CB    . GLN C 3 384 ? 204.436 119.061 160.179 1.00 56.76  ? 384 GLN C CB    1 
ATOM 5605  C CG    . GLN C 3 384 ? 204.770 119.900 161.373 1.00 56.76  ? 384 GLN C CG    1 
ATOM 5606  C CD    . GLN C 3 384 ? 205.958 119.322 162.100 1.00 56.76  ? 384 GLN C CD    1 
ATOM 5607  O OE1   . GLN C 3 384 ? 206.134 118.107 162.134 1.00 56.76  ? 384 GLN C OE1   1 
ATOM 5608  N NE2   . GLN C 3 384 ? 206.792 120.183 162.662 1.00 56.76  ? 384 GLN C NE2   1 
ATOM 5609  N N     . ALA C 3 385 ? 204.258 117.316 158.212 1.00 54.51  ? 385 ALA C N     1 
ATOM 5610  C CA    . ALA C 3 385 ? 203.862 116.260 157.297 1.00 54.51  ? 385 ALA C CA    1 
ATOM 5611  C C     . ALA C 3 385 ? 202.552 116.523 156.569 1.00 54.51  ? 385 ALA C C     1 
ATOM 5612  O O     . ALA C 3 385 ? 202.098 115.650 155.822 1.00 54.51  ? 385 ALA C O     1 
ATOM 5613  C CB    . ALA C 3 385 ? 203.764 114.929 158.045 1.00 54.51  ? 385 ALA C CB    1 
ATOM 5614  N N     . ARG C 3 386 ? 201.911 117.666 156.775 1.00 57.63  ? 386 ARG C N     1 
ATOM 5615  C CA    . ARG C 3 386 ? 200.655 117.930 156.088 1.00 57.63  ? 386 ARG C CA    1 
ATOM 5616  C C     . ARG C 3 386 ? 200.948 118.475 154.700 1.00 57.63  ? 386 ARG C C     1 
ATOM 5617  O O     . ARG C 3 386 ? 201.942 119.171 154.484 1.00 57.63  ? 386 ARG C O     1 
ATOM 5618  C CB    . ARG C 3 386 ? 199.829 118.971 156.838 1.00 57.63  ? 386 ARG C CB    1 
ATOM 5619  C CG    . ARG C 3 386 ? 199.416 118.609 158.231 1.00 57.63  ? 386 ARG C CG    1 
ATOM 5620  C CD    . ARG C 3 386 ? 198.575 119.726 158.829 1.00 57.63  ? 386 ARG C CD    1 
ATOM 5621  N NE    . ARG C 3 386 ? 198.168 119.435 160.199 1.00 57.63  ? 386 ARG C NE    1 
ATOM 5622  C CZ    . ARG C 3 386 ? 197.394 120.228 160.929 1.00 57.63  ? 386 ARG C CZ    1 
ATOM 5623  N NH1   . ARG C 3 386 ? 196.946 121.365 160.419 1.00 57.63  ? 386 ARG C NH1   1 
ATOM 5624  N NH2   . ARG C 3 386 ? 197.076 119.894 162.170 1.00 57.63  ? 386 ARG C NH2   1 
ATOM 5625  N N     . ASP C 3 387 ? 200.083 118.154 153.749 1.00 55.43  ? 387 ASP C N     1 
ATOM 5626  C CA    . ASP C 3 387 ? 200.252 118.684 152.410 1.00 55.43  ? 387 ASP C CA    1 
ATOM 5627  C C     . ASP C 3 387 ? 198.955 119.226 151.843 1.00 55.43  ? 387 ASP C C     1 
ATOM 5628  O O     . ASP C 3 387 ? 197.870 118.711 152.108 1.00 55.43  ? 387 ASP C O     1 
ATOM 5629  C CB    . ASP C 3 387 ? 200.810 117.621 151.511 1.00 55.43  ? 387 ASP C CB    1 
ATOM 5630  C CG    . ASP C 3 387 ? 200.246 116.276 151.822 1.00 55.43  ? 387 ASP C CG    1 
ATOM 5631  O OD1   . ASP C 3 387 ? 199.112 116.221 152.323 1.00 55.43  ? 387 ASP C OD1   1 
ATOM 5632  O OD2   . ASP C 3 387 ? 200.946 115.272 151.599 1.00 55.43  ? 387 ASP C OD2   1 
ATOM 5633  N N     . LYS C 3 388 ? 199.097 120.282 151.048 1.00 43.97  ? 388 LYS C N     1 
ATOM 5634  C CA    . LYS C 3 388 ? 197.956 120.996 150.504 1.00 43.97  ? 388 LYS C CA    1 
ATOM 5635  C C     . LYS C 3 388 ? 197.945 121.029 148.987 1.00 43.97  ? 388 LYS C C     1 
ATOM 5636  O O     . LYS C 3 388 ? 196.957 120.602 148.385 1.00 43.97  ? 388 LYS C O     1 
ATOM 5637  C CB    . LYS C 3 388 ? 197.863 122.411 151.101 1.00 43.97  ? 388 LYS C CB    1 
ATOM 5638  C CG    . LYS C 3 388 ? 199.016 123.339 150.872 1.00 43.97  ? 388 LYS C CG    1 
ATOM 5639  C CD    . LYS C 3 388 ? 198.867 124.575 151.755 1.00 43.97  ? 388 LYS C CD    1 
ATOM 5640  C CE    . LYS C 3 388 ? 197.728 125.499 151.334 1.00 43.97  ? 388 LYS C CE    1 
ATOM 5641  N NZ    . LYS C 3 388 ? 198.004 126.230 150.067 1.00 43.97  ? 388 LYS C NZ    1 
ATOM 5642  N N     . GLN C 3 389 ? 199.023 121.464 148.330 1.00 37.25  ? 389 GLN C N     1 
ATOM 5643  C CA    . GLN C 3 389 ? 198.837 121.660 146.900 1.00 37.25  ? 389 GLN C CA    1 
ATOM 5644  C C     . GLN C 3 389 ? 200.166 121.632 146.154 1.00 37.25  ? 389 GLN C C     1 
ATOM 5645  O O     . GLN C 3 389 ? 201.194 122.028 146.700 1.00 37.25  ? 389 GLN C O     1 
ATOM 5646  C CB    . GLN C 3 389 ? 198.133 123.005 146.678 1.00 37.25  ? 389 GLN C CB    1 
ATOM 5647  C CG    . GLN C 3 389 ? 197.595 123.261 145.309 1.00 37.25  ? 389 GLN C CG    1 
ATOM 5648  C CD    . GLN C 3 389 ? 196.572 122.228 144.919 1.00 37.25  ? 389 GLN C CD    1 
ATOM 5649  O OE1   . GLN C 3 389 ? 196.907 121.146 144.448 1.00 37.25  ? 389 GLN C OE1   1 
ATOM 5650  N NE2   . GLN C 3 389 ? 195.308 122.552 145.139 1.00 37.25  ? 389 GLN C NE2   1 
ATOM 5651  N N     . TRP C 3 390 ? 200.151 121.105 144.929 1.00 32.18  ? 390 TRP C N     1 
ATOM 5652  C CA    . TRP C 3 390 ? 201.279 121.250 144.019 1.00 32.18  ? 390 TRP C CA    1 
ATOM 5653  C C     . TRP C 3 390 ? 200.812 121.847 142.705 1.00 32.18  ? 390 TRP C C     1 
ATOM 5654  O O     . TRP C 3 390 ? 199.623 121.835 142.394 1.00 32.18  ? 390 TRP C O     1 
ATOM 5655  C CB    . TRP C 3 390 ? 201.986 119.953 143.644 1.00 32.18  ? 390 TRP C CB    1 
ATOM 5656  C CG    . TRP C 3 390 ? 201.154 118.914 142.978 1.00 32.18  ? 390 TRP C CG    1 
ATOM 5657  C CD1   . TRP C 3 390 ? 200.691 118.943 141.702 1.00 32.18  ? 390 TRP C CD1   1 
ATOM 5658  C CD2   . TRP C 3 390 ? 200.994 117.561 143.407 1.00 32.18  ? 390 TRP C CD2   1 
ATOM 5659  N NE1   . TRP C 3 390 ? 200.085 117.763 141.380 1.00 32.18  ? 390 TRP C NE1   1 
ATOM 5660  C CE2   . TRP C 3 390 ? 200.278 116.886 142.408 1.00 32.18  ? 390 TRP C CE2   1 
ATOM 5661  C CE3   . TRP C 3 390 ? 201.324 116.876 144.568 1.00 32.18  ? 390 TRP C CE3   1 
ATOM 5662  C CZ2   . TRP C 3 390 ? 199.885 115.567 142.539 1.00 32.18  ? 390 TRP C CZ2   1 
ATOM 5663  C CZ3   . TRP C 3 390 ? 200.934 115.570 144.695 1.00 32.18  ? 390 TRP C CZ3   1 
ATOM 5664  C CH2   . TRP C 3 390 ? 200.221 114.927 143.690 1.00 32.18  ? 390 TRP C CH2   1 
ATOM 5665  N N     . PHE C 3 391 ? 201.761 122.346 141.913 1.00 28.16  ? 391 PHE C N     1 
ATOM 5666  C CA    . PHE C 3 391 ? 201.354 122.955 140.655 1.00 28.16  ? 391 PHE C CA    1 
ATOM 5667  C C     . PHE C 3 391 ? 202.557 123.143 139.752 1.00 28.16  ? 391 PHE C C     1 
ATOM 5668  O O     . PHE C 3 391 ? 203.634 123.505 140.222 1.00 28.16  ? 391 PHE C O     1 
ATOM 5669  C CB    . PHE C 3 391 ? 200.699 124.322 140.862 1.00 28.16  ? 391 PHE C CB    1 
ATOM 5670  C CG    . PHE C 3 391 ? 201.538 125.294 141.638 1.00 28.16  ? 391 PHE C CG    1 
ATOM 5671  C CD1   . PHE C 3 391 ? 201.526 125.305 143.011 1.00 28.16  ? 391 PHE C CD1   1 
ATOM 5672  C CD2   . PHE C 3 391 ? 202.329 126.216 140.977 1.00 28.16  ? 391 PHE C CD2   1 
ATOM 5673  C CE1   . PHE C 3 391 ? 202.290 126.211 143.708 1.00 28.16  ? 391 PHE C CE1   1 
ATOM 5674  C CE2   . PHE C 3 391 ? 203.094 127.121 141.671 1.00 28.16  ? 391 PHE C CE2   1 
ATOM 5675  C CZ    . PHE C 3 391 ? 203.075 127.119 143.035 1.00 28.16  ? 391 PHE C CZ    1 
ATOM 5676  N N     . THR C 3 392 ? 202.360 122.907 138.461 1.00 29.02  ? 392 THR C N     1 
ATOM 5677  C CA    . THR C 3 392 ? 203.350 123.235 137.451 1.00 29.02  ? 392 THR C CA    1 
ATOM 5678  C C     . THR C 3 392 ? 202.932 124.536 136.787 1.00 29.02  ? 392 THR C C     1 
ATOM 5679  O O     . THR C 3 392 ? 201.790 124.976 136.922 1.00 29.02  ? 392 THR C O     1 
ATOM 5680  C CB    . THR C 3 392 ? 203.461 122.128 136.406 1.00 29.02  ? 392 THR C CB    1 
ATOM 5681  O OG1   . THR C 3 392 ? 204.556 122.407 135.532 1.00 29.02  ? 392 THR C OG1   1 
ATOM 5682  C CG2   . THR C 3 392 ? 202.196 122.061 135.585 1.00 29.02  ? 392 THR C CG2   1 
ATOM 5683  N N     . ALA C 3 393 ? 203.870 125.170 136.086 1.00 33.59  ? 393 ALA C N     1 
ATOM 5684  C CA    . ALA C 3 393 ? 203.565 126.476 135.500 1.00 33.59  ? 393 ALA C CA    1 
ATOM 5685  C C     . ALA C 3 393 ? 204.597 126.813 134.418 1.00 33.59  ? 393 ALA C C     1 
ATOM 5686  O O     . ALA C 3 393 ? 205.646 127.385 134.712 1.00 33.59  ? 393 ALA C O     1 
ATOM 5687  C CB    . ALA C 3 393 ? 203.515 127.539 136.564 1.00 33.59  ? 393 ALA C CB    1 
ATOM 5688  N N     . THR C 3 394 ? 204.296 126.423 133.182 1.00 36.68  ? 394 THR C N     1 
ATOM 5689  C CA    . THR C 3 394 ? 205.146 126.723 132.029 1.00 36.68  ? 394 THR C CA    1 
ATOM 5690  C C     . THR C 3 394 ? 204.881 128.136 131.506 1.00 36.68  ? 394 THR C C     1 
ATOM 5691  O O     . THR C 3 394 ? 204.240 128.352 130.478 1.00 36.68  ? 394 THR C O     1 
ATOM 5692  C CB    . THR C 3 394 ? 204.975 125.665 130.955 1.00 36.68  ? 394 THR C CB    1 
ATOM 5693  O OG1   . THR C 3 394 ? 203.739 125.870 130.263 1.00 36.68  ? 394 THR C OG1   1 
ATOM 5694  C CG2   . THR C 3 394 ? 205.038 124.290 131.576 1.00 36.68  ? 394 THR C CG2   1 
ATOM 5695  N N     . THR C 3 395 ? 205.379 129.108 132.251 1.00 39.49  ? 395 THR C N     1 
ATOM 5696  C CA    . THR C 3 395 ? 205.175 130.507 131.904 1.00 39.49  ? 395 THR C CA    1 
ATOM 5697  C C     . THR C 3 395 ? 205.877 130.847 130.590 1.00 39.49  ? 395 THR C C     1 
ATOM 5698  O O     . THR C 3 395 ? 206.901 130.240 130.277 1.00 39.49  ? 395 THR C O     1 
ATOM 5699  C CB    . THR C 3 395 ? 205.713 131.404 133.009 1.00 39.49  ? 395 THR C CB    1 
ATOM 5700  O OG1   . THR C 3 395 ? 207.129 131.229 133.105 1.00 39.49  ? 395 THR C OG1   1 
ATOM 5701  C CG2   . THR C 3 395 ? 205.085 131.038 134.312 1.00 39.49  ? 395 THR C CG2   1 
ATOM 5702  N N     . PRO C 3 396 ? 205.260 131.713 129.738 1.00 44.76  ? 396 PRO C N     1 
ATOM 5703  C CA    . PRO C 3 396 ? 205.848 132.139 128.451 1.00 44.76  ? 396 PRO C CA    1 
ATOM 5704  C C     . PRO C 3 396 ? 207.350 132.381 128.361 1.00 44.76  ? 396 PRO C C     1 
ATOM 5705  O O     . PRO C 3 396 ? 208.161 131.901 129.155 1.00 44.76  ? 396 PRO C O     1 
ATOM 5706  C CB    . PRO C 3 396 ? 205.080 133.427 128.133 1.00 44.76  ? 396 PRO C CB    1 
ATOM 5707  C CG    . PRO C 3 396 ? 204.652 133.944 129.412 1.00 44.76  ? 396 PRO C CG    1 
ATOM 5708  C CD    . PRO C 3 396 ? 204.351 132.741 130.262 1.00 44.76  ? 396 PRO C CD    1 
ATOM 5709  N N     . ALA C 3 397 ? 207.737 133.203 127.394 1.00 50.90  ? 397 ALA C N     1 
ATOM 5710  C CA    . ALA C 3 397 ? 209.143 133.498 127.174 1.00 50.90  ? 397 ALA C CA    1 
ATOM 5711  C C     . ALA C 3 397 ? 209.421 134.946 127.529 1.00 50.90  ? 397 ALA C C     1 
ATOM 5712  O O     . ALA C 3 397 ? 208.714 135.844 127.070 1.00 50.90  ? 397 ALA C O     1 
ATOM 5713  C CB    . ALA C 3 397 ? 209.508 133.255 125.709 1.00 50.90  ? 397 ALA C CB    1 
ATOM 5714  N N     . VAL C 3 398 ? 210.439 135.158 128.370 1.00 54.56  ? 398 VAL C N     1 
ATOM 5715  C CA    . VAL C 3 398 ? 210.834 136.486 128.815 1.00 54.56  ? 398 VAL C CA    1 
ATOM 5716  C C     . VAL C 3 398 ? 212.352 136.531 128.950 1.00 54.56  ? 398 VAL C C     1 
ATOM 5717  O O     . VAL C 3 398 ? 212.994 135.538 129.304 1.00 54.56  ? 398 VAL C O     1 
ATOM 5718  C CB    . VAL C 3 398 ? 210.174 136.860 130.168 1.00 54.56  ? 398 VAL C CB    1 
ATOM 5719  C CG1   . VAL C 3 398 ? 210.169 138.358 130.346 1.00 54.56  ? 398 VAL C CG1   1 
ATOM 5720  C CG2   . VAL C 3 398 ? 208.765 136.312 130.280 1.00 54.56  ? 398 VAL C CG2   1 
ATOM 5721  N N     . LEU C 3 399 ? 212.922 137.697 128.658 1.00 58.62  ? 399 LEU C N     1 
ATOM 5722  C CA    . LEU C 3 399 ? 214.359 137.956 128.748 1.00 58.62  ? 399 LEU C CA    1 
ATOM 5723  C C     . LEU C 3 399 ? 214.689 139.098 129.694 1.00 58.62  ? 399 LEU C C     1 
ATOM 5724  O O     . LEU C 3 399 ? 214.562 140.264 129.339 1.00 58.62  ? 399 LEU C O     1 
ATOM 5725  C CB    . LEU C 3 399 ? 214.972 138.187 127.367 1.00 58.62  ? 399 LEU C CB    1 
ATOM 5726  C CG    . LEU C 3 399 ? 214.694 137.046 126.406 1.00 58.62  ? 399 LEU C CG    1 
ATOM 5727  C CD1   . LEU C 3 399 ? 215.556 137.183 125.180 1.00 58.62  ? 399 LEU C CD1   1 
ATOM 5728  C CD2   . LEU C 3 399 ? 215.160 135.832 127.175 1.00 58.62  ? 399 LEU C CD2   1 
ATOM 5729  N N     . ASP C 3 409 ? 220.324 145.823 126.736 1.00 63.55  ? 409 ASP C N     1 
ATOM 5730  C CA    . ASP C 3 409 ? 220.666 145.970 128.145 1.00 63.55  ? 409 ASP C CA    1 
ATOM 5731  C C     . ASP C 3 409 ? 219.867 147.117 128.735 1.00 63.55  ? 409 ASP C C     1 
ATOM 5732  O O     . ASP C 3 409 ? 218.932 146.883 129.499 1.00 63.55  ? 409 ASP C O     1 
ATOM 5733  C CB    . ASP C 3 409 ? 222.166 146.204 128.340 1.00 63.55  ? 409 ASP C CB    1 
ATOM 5734  C CG    . ASP C 3 409 ? 222.579 146.180 129.808 1.00 63.55  ? 409 ASP C CG    1 
ATOM 5735  O OD1   . ASP C 3 409 ? 221.699 146.062 130.685 1.00 63.55  ? 409 ASP C OD1   1 
ATOM 5736  O OD2   . ASP C 3 409 ? 223.792 146.271 130.089 1.00 63.55  ? 409 ASP C OD2   1 
ATOM 5737  N N     . ASN C 3 410 ? 220.235 148.356 128.390 1.00 60.20  ? 410 ASN C N     1 
ATOM 5738  C CA    . ASN C 3 410 ? 219.490 149.491 128.924 1.00 60.20  ? 410 ASN C CA    1 
ATOM 5739  C C     . ASN C 3 410 ? 218.045 149.435 128.460 1.00 60.20  ? 410 ASN C C     1 
ATOM 5740  O O     . ASN C 3 410 ? 217.133 149.746 129.230 1.00 60.20  ? 410 ASN C O     1 
ATOM 5741  C CB    . ASN C 3 410 ? 220.158 150.801 128.520 1.00 60.20  ? 410 ASN C CB    1 
ATOM 5742  C CG    . ASN C 3 410 ? 221.445 151.047 129.275 1.00 60.20  ? 410 ASN C CG    1 
ATOM 5743  O OD1   . ASN C 3 410 ? 221.522 150.816 130.479 1.00 60.20  ? 410 ASN C OD1   1 
ATOM 5744  N ND2   . ASN C 3 410 ? 222.466 151.509 128.567 1.00 60.20  ? 410 ASN C ND2   1 
ATOM 5745  N N     . GLU C 3 411 ? 217.814 149.088 127.191 1.00 60.64  ? 411 GLU C N     1 
ATOM 5746  C CA    . GLU C 3 411 ? 216.436 148.955 126.737 1.00 60.64  ? 411 GLU C CA    1 
ATOM 5747  C C     . GLU C 3 411 ? 215.765 147.842 127.522 1.00 60.64  ? 411 GLU C C     1 
ATOM 5748  O O     . GLU C 3 411 ? 214.619 147.973 127.980 1.00 60.64  ? 411 GLU C O     1 
ATOM 5749  C CB    . GLU C 3 411 ? 216.393 148.660 125.242 1.00 60.64  ? 411 GLU C CB    1 
ATOM 5750  C CG    . GLU C 3 411 ? 215.004 148.717 124.660 1.00 60.64  ? 411 GLU C CG    1 
ATOM 5751  C CD    . GLU C 3 411 ? 214.270 147.409 124.833 1.00 60.64  ? 411 GLU C CD    1 
ATOM 5752  O OE1   . GLU C 3 411 ? 214.940 146.358 124.869 1.00 60.64  ? 411 GLU C OE1   1 
ATOM 5753  O OE2   . GLU C 3 411 ? 213.031 147.434 124.970 1.00 60.64  ? 411 GLU C OE2   1 
ATOM 5754  N N     . ASN C 3 412 ? 216.504 146.745 127.714 1.00 56.63  ? 412 ASN C N     1 
ATOM 5755  C CA    . ASN C 3 412 ? 216.026 145.630 128.514 1.00 56.63  ? 412 ASN C CA    1 
ATOM 5756  C C     . ASN C 3 412 ? 215.826 146.101 129.943 1.00 56.63  ? 412 ASN C C     1 
ATOM 5757  O O     . ASN C 3 412 ? 214.883 145.688 130.618 1.00 56.63  ? 412 ASN C O     1 
ATOM 5758  C CB    . ASN C 3 412 ? 216.998 144.454 128.428 1.00 56.63  ? 412 ASN C CB    1 
ATOM 5759  C CG    . ASN C 3 412 ? 216.442 143.188 129.037 1.00 56.63  ? 412 ASN C CG    1 
ATOM 5760  O OD1   . ASN C 3 412 ? 215.424 143.202 129.719 1.00 56.63  ? 412 ASN C OD1   1 
ATOM 5761  N ND2   . ASN C 3 412 ? 217.105 142.074 128.769 1.00 56.63  ? 412 ASN C ND2   1 
ATOM 5762  N N     . ALA C 3 413 ? 216.721 146.962 130.425 1.00 57.03  ? 413 ALA C N     1 
ATOM 5763  C CA    . ALA C 3 413 ? 216.581 147.464 131.782 1.00 57.03  ? 413 ALA C CA    1 
ATOM 5764  C C     . ALA C 3 413 ? 215.275 148.219 131.910 1.00 57.03  ? 413 ALA C C     1 
ATOM 5765  O O     . ALA C 3 413 ? 214.613 148.148 132.948 1.00 57.03  ? 413 ALA C O     1 
ATOM 5766  C CB    . ALA C 3 413 ? 217.757 148.359 132.151 1.00 57.03  ? 413 ALA C CB    1 
ATOM 5767  N N     . ARG C 3 414 ? 214.920 149.007 130.895 1.00 54.98  ? 414 ARG C N     1 
ATOM 5768  C CA    . ARG C 3 414 ? 213.634 149.681 130.940 1.00 54.98  ? 414 ARG C CA    1 
ATOM 5769  C C     . ARG C 3 414 ? 212.477 148.693 130.922 1.00 54.98  ? 414 ARG C C     1 
ATOM 5770  O O     . ARG C 3 414 ? 211.497 148.887 131.646 1.00 54.98  ? 414 ARG C O     1 
ATOM 5771  C CB    . ARG C 3 414 ? 213.500 150.657 129.776 1.00 54.98  ? 414 ARG C CB    1 
ATOM 5772  C CG    . ARG C 3 414 ? 214.621 151.703 129.700 1.00 54.98  ? 414 ARG C CG    1 
ATOM 5773  C CD    . ARG C 3 414 ? 214.332 152.789 130.726 1.00 54.98  ? 414 ARG C CD    1 
ATOM 5774  N NE    . ARG C 3 414 ? 215.193 153.969 130.628 1.00 54.98  ? 414 ARG C NE    1 
ATOM 5775  C CZ    . ARG C 3 414 ? 216.364 154.106 131.247 1.00 54.98  ? 414 ARG C CZ    1 
ATOM 5776  N NH1   . ARG C 3 414 ? 216.831 153.136 132.027 1.00 54.98  ? 414 ARG C NH1   1 
ATOM 5777  N NH2   . ARG C 3 414 ? 217.070 155.221 131.094 1.00 54.98  ? 414 ARG C NH2   1 
ATOM 5778  N N     . ILE C 3 415 ? 212.541 147.637 130.102 1.00 50.51  ? 415 ILE C N     1 
ATOM 5779  C CA    . ILE C 3 415 ? 211.411 146.706 130.117 1.00 50.51  ? 415 ILE C CA    1 
ATOM 5780  C C     . ILE C 3 415 ? 211.259 146.063 131.490 1.00 50.51  ? 415 ILE C C     1 
ATOM 5781  O O     . ILE C 3 415 ? 210.143 145.966 132.028 1.00 50.51  ? 415 ILE C O     1 
ATOM 5782  C CB    . ILE C 3 415 ? 211.522 145.664 128.982 1.00 50.51  ? 415 ILE C CB    1 
ATOM 5783  C CG1   . ILE C 3 415 ? 210.162 145.026 128.730 1.00 50.51  ? 415 ILE C CG1   1 
ATOM 5784  C CG2   . ILE C 3 415 ? 212.479 144.526 129.313 1.00 50.51  ? 415 ILE C CG2   1 
ATOM 5785  C CD1   . ILE C 3 415 ? 210.198 143.740 127.916 1.00 50.51  ? 415 ILE C CD1   1 
ATOM 5786  N N     . VAL C 3 416 ? 212.373 145.654 132.102 1.00 49.68  ? 416 VAL C N     1 
ATOM 5787  C CA    . VAL C 3 416 ? 212.273 145.071 133.433 1.00 49.68  ? 416 VAL C CA    1 
ATOM 5788  C C     . VAL C 3 416 ? 211.790 146.110 134.428 1.00 49.68  ? 416 VAL C C     1 
ATOM 5789  O O     . VAL C 3 416 ? 211.023 145.795 135.336 1.00 49.68  ? 416 VAL C O     1 
ATOM 5790  C CB    . VAL C 3 416 ? 213.594 144.407 133.862 1.00 49.68  ? 416 VAL C CB    1 
ATOM 5791  C CG1   . VAL C 3 416 ? 213.318 143.390 134.895 1.00 49.68  ? 416 VAL C CG1   1 
ATOM 5792  C CG2   . VAL C 3 416 ? 214.217 143.702 132.697 1.00 49.68  ? 416 VAL C CG2   1 
ATOM 5793  N N     . ARG C 3 417 ? 212.242 147.356 134.289 1.00 48.61  ? 417 ARG C N     1 
ATOM 5794  C CA    . ARG C 3 417 ? 211.808 148.394 135.212 1.00 48.61  ? 417 ARG C CA    1 
ATOM 5795  C C     . ARG C 3 417 ? 210.300 148.558 135.149 1.00 48.61  ? 417 ARG C C     1 
ATOM 5796  O O     . ARG C 3 417 ? 209.642 148.729 136.182 1.00 48.61  ? 417 ARG C O     1 
ATOM 5797  C CB    . ARG C 3 417 ? 212.522 149.703 134.902 1.00 48.61  ? 417 ARG C CB    1 
ATOM 5798  C CG    . ARG C 3 417 ? 212.451 150.687 136.018 1.00 48.61  ? 417 ARG C CG    1 
ATOM 5799  C CD    . ARG C 3 417 ? 213.108 151.952 135.584 1.00 48.61  ? 417 ARG C CD    1 
ATOM 5800  N NE    . ARG C 3 417 ? 212.809 153.031 136.503 1.00 48.61  ? 417 ARG C NE    1 
ATOM 5801  C CZ    . ARG C 3 417 ? 211.821 153.892 136.321 1.00 48.61  ? 417 ARG C CZ    1 
ATOM 5802  N NH1   . ARG C 3 417 ? 211.039 153.800 135.257 1.00 48.61  ? 417 ARG C NH1   1 
ATOM 5803  N NH2   . ARG C 3 417 ? 211.617 154.841 137.215 1.00 48.61  ? 417 ARG C NH2   1 
ATOM 5804  N N     . ARG C 3 418 ? 209.729 148.492 133.945 1.00 44.23  ? 418 ARG C N     1 
ATOM 5805  C CA    . ARG C 3 418 ? 208.280 148.564 133.839 1.00 44.23  ? 418 ARG C CA    1 
ATOM 5806  C C     . ARG C 3 418 ? 207.644 147.380 134.543 1.00 44.23  ? 418 ARG C C     1 
ATOM 5807  O O     . ARG C 3 418 ? 206.656 147.535 135.274 1.00 44.23  ? 418 ARG C O     1 
ATOM 5808  C CB    . ARG C 3 418 ? 207.843 148.582 132.377 1.00 44.23  ? 418 ARG C CB    1 
ATOM 5809  C CG    . ARG C 3 418 ? 206.339 148.829 132.209 1.00 44.23  ? 418 ARG C CG    1 
ATOM 5810  C CD    . ARG C 3 418 ? 205.967 149.062 130.755 1.00 44.23  ? 418 ARG C CD    1 
ATOM 5811  N NE    . ARG C 3 418 ? 206.027 147.823 129.981 1.00 44.23  ? 418 ARG C NE    1 
ATOM 5812  C CZ    . ARG C 3 418 ? 206.843 147.609 128.959 1.00 44.23  ? 418 ARG C CZ    1 
ATOM 5813  N NH1   . ARG C 3 418 ? 207.680 148.557 128.566 1.00 44.23  ? 418 ARG C NH1   1 
ATOM 5814  N NH2   . ARG C 3 418 ? 206.807 146.446 128.323 1.00 44.23  ? 418 ARG C NH2   1 
ATOM 5815  N N     . ILE C 3 419 ? 208.234 146.192 134.380 1.00 42.55  ? 419 ILE C N     1 
ATOM 5816  C CA    . ILE C 3 419 ? 207.660 145.004 135.008 1.00 42.55  ? 419 ILE C CA    1 
ATOM 5817  C C     . ILE C 3 419 ? 207.690 145.130 136.530 1.00 42.55  ? 419 ILE C C     1 
ATOM 5818  O O     . ILE C 3 419 ? 206.711 144.820 137.215 1.00 42.55  ? 419 ILE C O     1 
ATOM 5819  C CB    . ILE C 3 419 ? 208.383 143.734 134.542 1.00 42.55  ? 419 ILE C CB    1 
ATOM 5820  C CG1   . ILE C 3 419 ? 208.158 143.511 133.052 1.00 42.55  ? 419 ILE C CG1   1 
ATOM 5821  C CG2   . ILE C 3 419 ? 207.856 142.552 135.296 1.00 42.55  ? 419 ILE C CG2   1 
ATOM 5822  C CD1   . ILE C 3 419 ? 208.568 142.137 132.600 1.00 42.55  ? 419 ILE C CD1   1 
ATOM 5823  N N     . THR C 3 420 ? 208.816 145.569 137.086 1.00 45.16  ? 420 THR C N     1 
ATOM 5824  C CA    . THR C 3 420 ? 208.884 145.758 138.532 1.00 45.16  ? 420 THR C CA    1 
ATOM 5825  C C     . THR C 3 420 ? 207.880 146.813 138.996 1.00 45.16  ? 420 THR C C     1 
ATOM 5826  O O     . THR C 3 420 ? 207.035 146.538 139.848 1.00 45.16  ? 420 THR C O     1 
ATOM 5827  C CB    . THR C 3 420 ? 210.302 146.135 138.969 1.00 45.16  ? 420 THR C CB    1 
ATOM 5828  O OG1   . THR C 3 420 ? 210.540 147.519 138.687 1.00 45.16  ? 420 THR C OG1   1 
ATOM 5829  C CG2   . THR C 3 420 ? 211.330 145.273 138.277 1.00 45.16  ? 420 THR C CG2   1 
ATOM 5830  N N     . LEU C 3 421 ? 207.975 148.042 138.485 1.00 42.73  ? 421 LEU C N     1 
ATOM 5831  C CA    . LEU C 3 421 ? 207.044 149.090 138.913 1.00 42.73  ? 421 LEU C CA    1 
ATOM 5832  C C     . LEU C 3 421 ? 205.585 148.670 138.731 1.00 42.73  ? 421 LEU C C     1 
ATOM 5833  O O     . LEU C 3 421 ? 204.691 149.155 139.447 1.00 42.73  ? 421 LEU C O     1 
ATOM 5834  C CB    . LEU C 3 421 ? 207.331 150.374 138.150 1.00 42.73  ? 421 LEU C CB    1 
ATOM 5835  C CG    . LEU C 3 421 ? 208.347 151.345 138.747 1.00 42.73  ? 421 LEU C CG    1 
ATOM 5836  C CD1   . LEU C 3 421 ? 208.068 152.749 138.266 1.00 42.73  ? 421 LEU C CD1   1 
ATOM 5837  C CD2   . LEU C 3 421 ? 208.340 151.289 140.253 1.00 42.73  ? 421 LEU C CD2   1 
ATOM 5838  N N     . ALA C 3 422 ? 205.378 147.584 137.983 1.00 41.48  ? 422 ALA C N     1 
ATOM 5839  C CA    . ALA C 3 422 ? 204.028 147.079 137.714 1.00 41.48  ? 422 ALA C CA    1 
ATOM 5840  C C     . ALA C 3 422 ? 203.699 146.102 138.834 1.00 41.48  ? 422 ALA C C     1 
ATOM 5841  O O     . ALA C 3 422 ? 202.775 146.349 139.611 1.00 41.48  ? 422 ALA C O     1 
ATOM 5842  C CB    . ALA C 3 422 ? 203.928 146.439 136.329 1.00 41.48  ? 422 ALA C CB    1 
ATOM 5843  N N     . ARG C 3 423 ? 204.402 144.970 138.898 1.00 40.83  ? 423 ARG C N     1 
ATOM 5844  C CA    . ARG C 3 423 ? 204.161 144.028 139.985 1.00 40.83  ? 423 ARG C CA    1 
ATOM 5845  C C     . ARG C 3 423 ? 204.113 144.714 141.342 1.00 40.83  ? 423 ARG C C     1 
ATOM 5846  O O     . ARG C 3 423 ? 203.298 144.347 142.191 1.00 40.83  ? 423 ARG C O     1 
ATOM 5847  C CB    . ARG C 3 423 ? 205.306 143.029 139.996 1.00 40.83  ? 423 ARG C CB    1 
ATOM 5848  C CG    . ARG C 3 423 ? 205.056 141.660 140.495 1.00 40.83  ? 423 ARG C CG    1 
ATOM 5849  C CD    . ARG C 3 423 ? 205.725 141.624 141.863 1.00 40.83  ? 423 ARG C CD    1 
ATOM 5850  N NE    . ARG C 3 423 ? 207.091 142.142 141.817 1.00 40.83  ? 423 ARG C NE    1 
ATOM 5851  C CZ    . ARG C 3 423 ? 207.743 142.653 142.863 1.00 40.83  ? 423 ARG C CZ    1 
ATOM 5852  N NH1   . ARG C 3 423 ? 207.149 142.759 144.042 1.00 40.83  ? 423 ARG C NH1   1 
ATOM 5853  N NH2   . ARG C 3 423 ? 208.975 143.100 142.715 1.00 40.83  ? 423 ARG C NH2   1 
ATOM 5854  N N     . LYS C 3 424 ? 204.847 145.810 141.498 1.00 40.14  ? 424 LYS C N     1 
ATOM 5855  C CA    . LYS C 3 424 ? 204.886 146.569 142.738 1.00 40.14  ? 424 LYS C CA    1 
ATOM 5856  C C     . LYS C 3 424 ? 203.536 147.226 142.918 1.00 40.14  ? 424 LYS C C     1 
ATOM 5857  O O     . LYS C 3 424 ? 202.808 146.867 143.850 1.00 40.14  ? 424 LYS C O     1 
ATOM 5858  C CB    . LYS C 3 424 ? 206.027 147.584 142.772 1.00 40.14  ? 424 LYS C CB    1 
ATOM 5859  C CG    . LYS C 3 424 ? 207.372 146.941 143.065 1.00 40.14  ? 424 LYS C CG    1 
ATOM 5860  C CD    . LYS C 3 424 ? 208.520 147.925 142.984 1.00 40.14  ? 424 LYS C CD    1 
ATOM 5861  C CE    . LYS C 3 424 ? 208.885 148.462 144.362 1.00 40.14  ? 424 LYS C CE    1 
ATOM 5862  N NZ    . LYS C 3 424 ? 207.838 149.344 144.944 1.00 40.14  ? 424 LYS C NZ    1 
ATOM 5863  N N     . ALA C 3 425 ? 203.214 148.216 142.076 1.00 36.52  ? 425 ALA C N     1 
ATOM 5864  C CA    . ALA C 3 425 ? 201.912 148.853 142.232 1.00 36.52  ? 425 ALA C CA    1 
ATOM 5865  C C     . ALA C 3 425 ? 200.807 147.811 142.389 1.00 36.52  ? 425 ALA C C     1 
ATOM 5866  O O     . ALA C 3 425 ? 199.946 147.937 143.266 1.00 36.52  ? 425 ALA C O     1 
ATOM 5867  C CB    . ALA C 3 425 ? 201.625 149.765 141.038 1.00 36.52  ? 425 ALA C CB    1 
ATOM 5868  N N     . ALA C 3 426 ? 200.847 146.753 141.581 1.00 35.07  ? 426 ALA C N     1 
ATOM 5869  C CA    . ALA C 3 426 ? 199.859 145.681 141.603 1.00 35.07  ? 426 ALA C CA    1 
ATOM 5870  C C     . ALA C 3 426 ? 199.637 145.029 142.961 1.00 35.07  ? 426 ALA C C     1 
ATOM 5871  O O     . ALA C 3 426 ? 198.581 145.240 143.568 1.00 35.07  ? 426 ALA C O     1 
ATOM 5872  C CB    . ALA C 3 426 ? 200.247 144.593 140.602 1.00 35.07  ? 426 ALA C CB    1 
ATOM 5873  N N     . GLU C 3 427 ? 200.590 144.237 143.470 1.00 37.26  ? 427 GLU C N     1 
ATOM 5874  C CA    . GLU C 3 427 ? 200.300 143.631 144.768 1.00 37.26  ? 427 GLU C CA    1 
ATOM 5875  C C     . GLU C 3 427 ? 200.133 144.690 145.849 1.00 37.26  ? 427 GLU C C     1 
ATOM 5876  O O     . GLU C 3 427 ? 199.332 144.509 146.767 1.00 37.26  ? 427 GLU C O     1 
ATOM 5877  C CB    . GLU C 3 427 ? 201.287 142.543 145.221 1.00 37.26  ? 427 GLU C CB    1 
ATOM 5878  C CG    . GLU C 3 427 ? 202.697 142.919 145.606 1.00 37.26  ? 427 GLU C CG    1 
ATOM 5879  C CD    . GLU C 3 427 ? 203.670 142.702 144.485 1.00 37.26  ? 427 GLU C CD    1 
ATOM 5880  O OE1   . GLU C 3 427 ? 203.226 142.233 143.423 1.00 37.26  ? 427 GLU C OE1   1 
ATOM 5881  O OE2   . GLU C 3 427 ? 204.871 142.983 144.662 1.00 37.26  ? 427 GLU C OE2   1 
ATOM 5882  N N     . ALA C 3 428 ? 200.911 145.776 145.799 1.00 35.57  ? 428 ALA C N     1 
ATOM 5883  C CA    . ALA C 3 428 ? 200.805 146.774 146.861 1.00 35.57  ? 428 ALA C CA    1 
ATOM 5884  C C     . ALA C 3 428 ? 199.377 147.289 147.013 1.00 35.57  ? 428 ALA C C     1 
ATOM 5885  O O     . ALA C 3 428 ? 198.787 147.210 148.100 1.00 35.57  ? 428 ALA C O     1 
ATOM 5886  C CB    . ALA C 3 428 ? 201.762 147.931 146.584 1.00 35.57  ? 428 ALA C CB    1 
ATOM 5887  N N     . LEU C 3 429 ? 198.784 147.793 145.929 1.00 32.39  ? 429 LEU C N     1 
ATOM 5888  C CA    . LEU C 3 429 ? 197.403 148.241 146.042 1.00 32.39  ? 429 LEU C CA    1 
ATOM 5889  C C     . LEU C 3 429 ? 196.480 147.074 146.340 1.00 32.39  ? 429 LEU C C     1 
ATOM 5890  O O     . LEU C 3 429 ? 195.426 147.266 146.946 1.00 32.39  ? 429 LEU C O     1 
ATOM 5891  C CB    . LEU C 3 429 ? 196.922 149.024 144.826 1.00 32.39  ? 429 LEU C CB    1 
ATOM 5892  C CG    . LEU C 3 429 ? 196.854 148.518 143.409 1.00 32.39  ? 429 LEU C CG    1 
ATOM 5893  C CD1   . LEU C 3 429 ? 195.573 147.755 143.259 1.00 32.39  ? 429 LEU C CD1   1 
ATOM 5894  C CD2   . LEU C 3 429 ? 196.858 149.738 142.501 1.00 32.39  ? 429 LEU C CD2   1 
ATOM 5895  N N     . GLY C 3 430 ? 196.803 145.877 145.852 1.00 32.70  ? 430 GLY C N     1 
ATOM 5896  C CA    . GLY C 3 430 ? 195.940 144.743 146.144 1.00 32.70  ? 430 GLY C CA    1 
ATOM 5897  C C     . GLY C 3 430 ? 195.836 144.449 147.631 1.00 32.70  ? 430 GLY C C     1 
ATOM 5898  O O     . GLY C 3 430 ? 194.736 144.301 148.173 1.00 32.70  ? 430 GLY C O     1 
ATOM 5899  N N     . ARG C 3 431 ? 196.977 144.405 148.326 1.00 36.31  ? 431 ARG C N     1 
ATOM 5900  C CA    . ARG C 3 431 ? 196.922 144.164 149.763 1.00 36.31  ? 431 ARG C CA    1 
ATOM 5901  C C     . ARG C 3 431 ? 196.322 145.358 150.471 1.00 36.31  ? 431 ARG C C     1 
ATOM 5902  O O     . ARG C 3 431 ? 195.684 145.204 151.520 1.00 36.31  ? 431 ARG C O     1 
ATOM 5903  C CB    . ARG C 3 431 ? 198.305 143.868 150.340 1.00 36.31  ? 431 ARG C CB    1 
ATOM 5904  C CG    . ARG C 3 431 ? 199.242 145.065 150.390 1.00 36.31  ? 431 ARG C CG    1 
ATOM 5905  C CD    . ARG C 3 431 ? 200.663 144.698 150.780 1.00 36.31  ? 431 ARG C CD    1 
ATOM 5906  N NE    . ARG C 3 431 ? 201.513 145.885 150.840 1.00 36.31  ? 431 ARG C NE    1 
ATOM 5907  C CZ    . ARG C 3 431 ? 202.480 146.151 149.972 1.00 36.31  ? 431 ARG C CZ    1 
ATOM 5908  N NH1   . ARG C 3 431 ? 202.720 145.315 148.976 1.00 36.31  ? 431 ARG C NH1   1 
ATOM 5909  N NH2   . ARG C 3 431 ? 203.199 147.258 150.094 1.00 36.31  ? 431 ARG C NH2   1 
ATOM 5910  N N     . ARG C 3 432 ? 196.470 146.549 149.892 1.00 33.96  ? 432 ARG C N     1 
ATOM 5911  C CA    . ARG C 3 432 ? 195.868 147.698 150.544 1.00 33.96  ? 432 ARG C CA    1 
ATOM 5912  C C     . ARG C 3 432 ? 194.361 147.556 150.424 1.00 33.96  ? 432 ARG C C     1 
ATOM 5913  O O     . ARG C 3 432 ? 193.610 148.019 151.294 1.00 33.96  ? 432 ARG C O     1 
ATOM 5914  C CB    . ARG C 3 432 ? 196.416 149.013 149.992 1.00 33.96  ? 432 ARG C CB    1 
ATOM 5915  C CG    . ARG C 3 432 ? 195.741 149.628 148.816 1.00 33.96  ? 432 ARG C CG    1 
ATOM 5916  C CD    . ARG C 3 432 ? 196.226 151.057 148.667 1.00 33.96  ? 432 ARG C CD    1 
ATOM 5917  N NE    . ARG C 3 432 ? 197.619 151.053 148.229 1.00 33.96  ? 432 ARG C NE    1 
ATOM 5918  C CZ    . ARG C 3 432 ? 198.646 151.417 148.989 1.00 33.96  ? 432 ARG C CZ    1 
ATOM 5919  N NH1   . ARG C 3 432 ? 198.447 151.822 150.239 1.00 33.96  ? 432 ARG C NH1   1 
ATOM 5920  N NH2   . ARG C 3 432 ? 199.882 151.360 148.506 1.00 33.96  ? 432 ARG C NH2   1 
ATOM 5921  N N     . LEU C 3 433 ? 193.907 146.920 149.340 1.00 30.43  ? 433 LEU C N     1 
ATOM 5922  C CA    . LEU C 3 433 ? 192.490 146.640 149.191 1.00 30.43  ? 433 LEU C CA    1 
ATOM 5923  C C     . LEU C 3 433 ? 192.085 145.573 150.189 1.00 30.43  ? 433 LEU C C     1 
ATOM 5924  O O     . LEU C 3 433 ? 190.944 145.566 150.657 1.00 30.43  ? 433 LEU C O     1 
ATOM 5925  C CB    . LEU C 3 433 ? 192.185 146.179 147.771 1.00 30.43  ? 433 LEU C CB    1 
ATOM 5926  C CG    . LEU C 3 433 ? 190.904 145.376 147.573 1.00 30.43  ? 433 LEU C CG    1 
ATOM 5927  C CD1   . LEU C 3 433 ? 189.739 146.293 147.683 1.00 30.43  ? 433 LEU C CD1   1 
ATOM 5928  C CD2   . LEU C 3 433 ? 190.894 144.733 146.219 1.00 30.43  ? 433 LEU C CD2   1 
ATOM 5929  N N     . GLU C 3 434 ? 193.000 144.665 150.535 1.00 34.43  ? 434 GLU C N     1 
ATOM 5930  C CA    . GLU C 3 434 ? 192.686 143.683 151.570 1.00 34.43  ? 434 GLU C CA    1 
ATOM 5931  C C     . GLU C 3 434 ? 192.427 144.360 152.899 1.00 34.43  ? 434 GLU C C     1 
ATOM 5932  O O     . GLU C 3 434 ? 191.356 144.187 153.491 1.00 34.43  ? 434 GLU C O     1 
ATOM 5933  C CB    . GLU C 3 434 ? 193.755 142.612 151.672 1.00 34.43  ? 434 GLU C CB    1 
ATOM 5934  C CG    . GLU C 3 434 ? 193.476 141.659 150.604 1.00 34.43  ? 434 GLU C CG    1 
ATOM 5935  C CD    . GLU C 3 434 ? 192.105 141.085 150.889 1.00 34.43  ? 434 GLU C CD    1 
ATOM 5936  O OE1   . GLU C 3 434 ? 191.887 140.710 152.056 1.00 34.43  ? 434 GLU C OE1   1 
ATOM 5937  O OE2   . GLU C 3 434 ? 191.220 141.087 150.017 1.00 34.43  ? 434 GLU C OE2   1 
ATOM 5938  N N     . LYS C 3 435 ? 193.406 145.110 153.405 1.00 33.75  ? 435 LYS C N     1 
ATOM 5939  C CA    . LYS C 3 435 ? 193.176 145.810 154.660 1.00 33.75  ? 435 LYS C CA    1 
ATOM 5940  C C     . LYS C 3 435 ? 191.892 146.614 154.543 1.00 33.75  ? 435 LYS C C     1 
ATOM 5941  O O     . LYS C 3 435 ? 191.068 146.631 155.463 1.00 33.75  ? 435 LYS C O     1 
ATOM 5942  C CB    . LYS C 3 435 ? 194.380 146.688 155.017 1.00 33.75  ? 435 LYS C CB    1 
ATOM 5943  C CG    . LYS C 3 435 ? 194.130 147.728 156.095 1.00 33.75  ? 435 LYS C CG    1 
ATOM 5944  C CD    . LYS C 3 435 ? 193.632 149.070 155.579 1.00 33.75  ? 435 LYS C CD    1 
ATOM 5945  C CE    . LYS C 3 435 ? 194.777 149.926 155.076 1.00 33.75  ? 435 LYS C CE    1 
ATOM 5946  N NZ    . LYS C 3 435 ? 194.286 151.306 154.795 1.00 33.75  ? 435 LYS C NZ    1 
ATOM 5947  N N     . ALA C 3 436 ? 191.738 147.342 153.444 1.00 33.00  ? 436 ALA C N     1 
ATOM 5948  C CA    . ALA C 3 436 ? 190.522 148.109 153.225 1.00 33.00  ? 436 ALA C CA    1 
ATOM 5949  C C     . ALA C 3 436 ? 189.271 147.270 153.469 1.00 33.00  ? 436 ALA C C     1 
ATOM 5950  O O     . ALA C 3 436 ? 188.497 147.570 154.374 1.00 33.00  ? 436 ALA C O     1 
ATOM 5951  C CB    . ALA C 3 436 ? 190.513 148.679 151.812 1.00 33.00  ? 436 ALA C CB    1 
ATOM 5952  N N     . CYS C 3 437 ? 189.030 146.261 152.629 1.00 33.28  ? 437 CYS C N     1 
ATOM 5953  C CA    . CYS C 3 437 ? 187.862 145.391 152.785 1.00 33.28  ? 437 CYS C CA    1 
ATOM 5954  C C     . CYS C 3 437 ? 187.681 144.874 154.212 1.00 33.28  ? 437 CYS C C     1 
ATOM 5955  O O     . CYS C 3 437 ? 186.595 144.986 154.794 1.00 33.28  ? 437 CYS C O     1 
ATOM 5956  C CB    . CYS C 3 437 ? 187.959 144.214 151.822 1.00 33.28  ? 437 CYS C CB    1 
ATOM 5957  S SG    . CYS C 3 437 ? 187.788 144.635 150.101 1.00 33.28  ? 437 CYS C SG    1 
ATOM 5958  N N     . LYS C 3 438 ? 188.724 144.254 154.765 1.00 34.12  ? 438 LYS C N     1 
ATOM 5959  C CA    . LYS C 3 438 ? 188.663 143.694 156.113 1.00 34.12  ? 438 LYS C CA    1 
ATOM 5960  C C     . LYS C 3 438 ? 188.206 144.728 157.134 1.00 34.12  ? 438 LYS C C     1 
ATOM 5961  O O     . LYS C 3 438 ? 187.151 144.582 157.772 1.00 34.12  ? 438 LYS C O     1 
ATOM 5962  C CB    . LYS C 3 438 ? 190.028 143.127 156.475 1.00 34.12  ? 438 LYS C CB    1 
ATOM 5963  C CG    . LYS C 3 438 ? 190.065 142.352 157.754 1.00 34.12  ? 438 LYS C CG    1 
ATOM 5964  C CD    . LYS C 3 438 ? 191.505 141.999 158.075 1.00 34.12  ? 438 LYS C CD    1 
ATOM 5965  C CE    . LYS C 3 438 ? 191.846 140.603 157.567 1.00 34.12  ? 438 LYS C CE    1 
ATOM 5966  N NZ    . LYS C 3 438 ? 193.310 140.407 157.383 1.00 34.12  ? 438 LYS C NZ    1 
ATOM 5967  N N     . GLU C 3 439 ? 189.005 145.784 157.303 1.00 36.29  ? 439 GLU C N     1 
ATOM 5968  C CA    . GLU C 3 439 ? 188.654 146.849 158.231 1.00 36.29  ? 439 GLU C CA    1 
ATOM 5969  C C     . GLU C 3 439 ? 187.243 147.334 157.976 1.00 36.29  ? 439 GLU C C     1 
ATOM 5970  O O     . GLU C 3 439 ? 186.438 147.446 158.905 1.00 36.29  ? 439 GLU C O     1 
ATOM 5971  C CB    . GLU C 3 439 ? 189.638 148.005 158.143 1.00 36.29  ? 439 GLU C CB    1 
ATOM 5972  C CG    . GLU C 3 439 ? 189.365 149.019 159.245 1.00 36.29  ? 439 GLU C CG    1 
ATOM 5973  C CD    . GLU C 3 439 ? 190.520 149.961 159.491 1.00 36.29  ? 439 GLU C CD    1 
ATOM 5974  O OE1   . GLU C 3 439 ? 191.498 149.922 158.715 1.00 36.29  ? 439 GLU C OE1   1 
ATOM 5975  O OE2   . GLU C 3 439 ? 190.450 150.739 160.468 1.00 36.29  ? 439 GLU C OE2   1 
ATOM 5976  N N     . ALA C 3 440 ? 186.949 147.686 156.724 1.00 33.62  ? 440 ALA C N     1 
ATOM 5977  C CA    . ALA C 3 440 ? 185.625 148.148 156.333 1.00 33.62  ? 440 ALA C CA    1 
ATOM 5978  C C     . ALA C 3 440 ? 184.557 147.279 156.975 1.00 33.62  ? 440 ALA C C     1 
ATOM 5979  O O     . ALA C 3 440 ? 183.740 147.768 157.760 1.00 33.62  ? 440 ALA C O     1 
ATOM 5980  C CB    . ALA C 3 440 ? 185.497 148.145 154.806 1.00 33.62  ? 440 ALA C CB    1 
ATOM 5981  N N     . TRP C 3 441 ? 184.535 145.989 156.643 1.00 30.86  ? 441 TRP C N     1 
ATOM 5982  C CA    . TRP C 3 441 ? 183.533 145.120 157.247 1.00 30.86  ? 441 TRP C CA    1 
ATOM 5983  C C     . TRP C 3 441 ? 183.542 145.150 158.769 1.00 30.86  ? 441 TRP C C     1 
ATOM 5984  O O     . TRP C 3 441 ? 182.470 145.117 159.386 1.00 30.86  ? 441 TRP C O     1 
ATOM 5985  C CB    . TRP C 3 441 ? 183.698 143.680 156.762 1.00 30.86  ? 441 TRP C CB    1 
ATOM 5986  C CG    . TRP C 3 441 ? 182.812 142.742 157.509 1.00 30.86  ? 441 TRP C CG    1 
ATOM 5987  C CD1   . TRP C 3 441 ? 182.999 142.255 158.763 1.00 30.86  ? 441 TRP C CD1   1 
ATOM 5988  C CD2   . TRP C 3 441 ? 181.520 142.297 157.097 1.00 30.86  ? 441 TRP C CD2   1 
ATOM 5989  N NE1   . TRP C 3 441 ? 181.936 141.475 159.131 1.00 30.86  ? 441 TRP C NE1   1 
ATOM 5990  C CE2   . TRP C 3 441 ? 181.013 141.493 158.121 1.00 30.86  ? 441 TRP C CE2   1 
ATOM 5991  C CE3   . TRP C 3 441 ? 180.758 142.476 155.946 1.00 30.86  ? 441 TRP C CE3   1 
ATOM 5992  C CZ2   . TRP C 3 441 ? 179.778 140.866 158.033 1.00 30.86  ? 441 TRP C CZ2   1 
ATOM 5993  C CZ3   . TRP C 3 441 ? 179.533 141.857 155.858 1.00 30.86  ? 441 TRP C CZ3   1 
ATOM 5994  C CH2   . TRP C 3 441 ? 179.057 141.065 156.893 1.00 30.86  ? 441 TRP C CH2   1 
ATOM 5995  N N     . LYS C 3 442 ? 184.709 145.285 159.403 1.00 34.73  ? 442 LYS C N     1 
ATOM 5996  C CA    . LYS C 3 442 ? 184.647 145.299 160.864 1.00 34.73  ? 442 LYS C CA    1 
ATOM 5997  C C     . LYS C 3 442 ? 183.999 146.598 161.327 1.00 34.73  ? 442 LYS C C     1 
ATOM 5998  O O     . LYS C 3 442 ? 182.914 146.548 161.913 1.00 34.73  ? 442 LYS C O     1 
ATOM 5999  C CB    . LYS C 3 442 ? 185.992 145.012 161.546 1.00 34.73  ? 442 LYS C CB    1 
ATOM 6000  C CG    . LYS C 3 442 ? 187.113 146.007 161.485 1.00 34.73  ? 442 LYS C CG    1 
ATOM 6001  C CD    . LYS C 3 442 ? 188.193 145.523 162.445 1.00 34.73  ? 442 LYS C CD    1 
ATOM 6002  C CE    . LYS C 3 442 ? 189.427 146.390 162.424 1.00 34.73  ? 442 LYS C CE    1 
ATOM 6003  N NZ    . LYS C 3 442 ? 189.129 147.690 163.072 1.00 34.73  ? 442 LYS C NZ    1 
ATOM 6004  N N     . GLU C 3 443 ? 184.639 147.746 161.100 1.00 35.38  ? 443 GLU C N     1 
ATOM 6005  C CA    . GLU C 3 443 ? 184.080 149.024 161.538 1.00 35.38  ? 443 GLU C CA    1 
ATOM 6006  C C     . GLU C 3 443 ? 182.605 149.141 161.197 1.00 35.38  ? 443 GLU C C     1 
ATOM 6007  O O     . GLU C 3 443 ? 181.851 149.792 161.926 1.00 35.38  ? 443 GLU C O     1 
ATOM 6008  C CB    . GLU C 3 443 ? 184.832 150.174 160.879 1.00 35.38  ? 443 GLU C CB    1 
ATOM 6009  C CG    . GLU C 3 443 ? 186.194 150.444 161.440 1.00 35.38  ? 443 GLU C CG    1 
ATOM 6010  C CD    . GLU C 3 443 ? 186.891 151.544 160.686 1.00 35.38  ? 443 GLU C CD    1 
ATOM 6011  O OE1   . GLU C 3 443 ? 186.299 152.046 159.712 1.00 35.38  ? 443 GLU C OE1   1 
ATOM 6012  O OE2   . GLU C 3 443 ? 188.025 151.907 161.058 1.00 35.38  ? 443 GLU C OE2   1 
ATOM 6013  N N     . SER C 3 444 ? 182.184 148.551 160.081 1.00 33.89  ? 444 SER C N     1 
ATOM 6014  C CA    . SER C 3 444 ? 180.777 148.560 159.723 1.00 33.89  ? 444 SER C CA    1 
ATOM 6015  C C     . SER C 3 444 ? 180.091 147.832 160.856 1.00 33.89  ? 444 SER C C     1 
ATOM 6016  O O     . SER C 3 444 ? 179.395 148.434 161.675 1.00 33.89  ? 444 SER C O     1 
ATOM 6017  C CB    . SER C 3 444 ? 180.511 147.839 158.409 1.00 33.89  ? 444 SER C CB    1 
ATOM 6018  O OG    . SER C 3 444 ? 180.681 146.447 158.577 1.00 33.89  ? 444 SER C OG    1 
ATOM 6019  N N     . ASN C 3 445 ? 180.293 146.520 160.895 1.00 35.73  ? 445 ASN C N     1 
ATOM 6020  C CA    . ASN C 3 445 ? 179.747 145.687 161.952 1.00 35.73  ? 445 ASN C CA    1 
ATOM 6021  C C     . ASN C 3 445 ? 180.305 146.083 163.326 1.00 35.73  ? 445 ASN C C     1 
ATOM 6022  O O     . ASN C 3 445 ? 179.963 145.476 164.344 1.00 35.73  ? 445 ASN C O     1 
ATOM 6023  C CB    . ASN C 3 445 ? 180.091 144.239 161.609 1.00 35.73  ? 445 ASN C CB    1 
ATOM 6024  C CG    . ASN C 3 445 ? 179.454 143.242 162.524 1.00 35.73  ? 445 ASN C CG    1 
ATOM 6025  O OD1   . ASN C 3 445 ? 178.683 143.589 163.410 1.00 35.73  ? 445 ASN C OD1   1 
ATOM 6026  N ND2   . ASN C 3 445 ? 179.793 141.977 162.325 1.00 35.73  ? 445 ASN C ND2   1 
ATOM 6027  N N     . SER C 3 446 ? 181.138 147.120 163.378 1.00 34.27  ? 446 SER C N     1 
ATOM 6028  C CA    . SER C 3 446 ? 181.726 147.608 164.631 1.00 34.27  ? 446 SER C CA    1 
ATOM 6029  C C     . SER C 3 446 ? 182.423 146.506 165.410 1.00 34.27  ? 446 SER C C     1 
ATOM 6030  O O     . SER C 3 446 ? 181.908 146.058 166.434 1.00 34.27  ? 446 SER C O     1 
ATOM 6031  C CB    . SER C 3 446 ? 180.685 148.257 165.524 1.00 34.27  ? 446 SER C CB    1 
ATOM 6032  O OG    . SER C 3 446 ? 181.265 148.617 166.766 1.00 34.27  ? 446 SER C OG    1 
ATOM 6033  N N     . GLY C 3 463 ? 186.313 138.772 157.709 1.00 31.21  ? 463 GLY C N     1 
ATOM 6034  C CA    . GLY C 3 463 ? 185.200 139.267 156.920 1.00 31.21  ? 463 GLY C CA    1 
ATOM 6035  C C     . GLY C 3 463 ? 185.018 138.520 155.617 1.00 31.21  ? 463 GLY C C     1 
ATOM 6036  O O     . GLY C 3 463 ? 185.992 138.192 154.957 1.00 31.21  ? 463 GLY C O     1 
ATOM 6037  N N     . PRO C 3 464 ? 183.767 138.252 155.240 1.00 29.24  ? 464 PRO C N     1 
ATOM 6038  C CA    . PRO C 3 464 ? 183.510 137.521 153.986 1.00 29.24  ? 464 PRO C CA    1 
ATOM 6039  C C     . PRO C 3 464 ? 183.887 138.287 152.728 1.00 29.24  ? 464 PRO C C     1 
ATOM 6040  O O     . PRO C 3 464 ? 183.957 137.684 151.651 1.00 29.24  ? 464 PRO C O     1 
ATOM 6041  C CB    . PRO C 3 464 ? 181.996 137.272 154.034 1.00 29.24  ? 464 PRO C CB    1 
ATOM 6042  C CG    . PRO C 3 464 ? 181.476 138.336 154.926 1.00 29.24  ? 464 PRO C CG    1 
ATOM 6043  C CD    . PRO C 3 464 ? 182.528 138.554 155.966 1.00 29.24  ? 464 PRO C CD    1 
ATOM 6044  N N     . TRP C 3 465 ? 184.105 139.594 152.828 1.00 26.54  ? 465 TRP C N     1 
ATOM 6045  C CA    . TRP C 3 465 ? 184.442 140.412 151.671 1.00 26.54  ? 465 TRP C CA    1 
ATOM 6046  C C     . TRP C 3 465 ? 185.858 140.194 151.153 1.00 26.54  ? 465 TRP C C     1 
ATOM 6047  O O     . TRP C 3 465 ? 186.095 140.330 149.949 1.00 26.54  ? 465 TRP C O     1 
ATOM 6048  C CB    . TRP C 3 465 ? 184.297 141.868 152.071 1.00 26.54  ? 465 TRP C CB    1 
ATOM 6049  C CG    . TRP C 3 465 ? 182.914 142.291 152.193 1.00 26.54  ? 465 TRP C CG    1 
ATOM 6050  C CD1   . TRP C 3 465 ? 181.811 141.531 152.006 1.00 26.54  ? 465 TRP C CD1   1 
ATOM 6051  C CD2   . TRP C 3 465 ? 182.463 143.549 152.671 1.00 26.54  ? 465 TRP C CD2   1 
ATOM 6052  N NE1   . TRP C 3 465 ? 180.687 142.266 152.269 1.00 26.54  ? 465 TRP C NE1   1 
ATOM 6053  C CE2   . TRP C 3 465 ? 181.067 143.510 152.689 1.00 26.54  ? 465 TRP C CE2   1 
ATOM 6054  C CE3   . TRP C 3 465 ? 183.107 144.721 153.056 1.00 26.54  ? 465 TRP C CE3   1 
ATOM 6055  C CZ2   . TRP C 3 465 ? 180.305 144.591 153.073 1.00 26.54  ? 465 TRP C CZ2   1 
ATOM 6056  C CZ3   . TRP C 3 465 ? 182.352 145.788 153.437 1.00 26.54  ? 465 TRP C CZ3   1 
ATOM 6057  C CH2   . TRP C 3 465 ? 180.965 145.719 153.445 1.00 26.54  ? 465 TRP C CH2   1 
ATOM 6058  N N     . VAL C 3 466 ? 186.808 139.862 152.024 1.00 30.93  ? 466 VAL C N     1 
ATOM 6059  C CA    . VAL C 3 466 ? 188.192 139.735 151.579 1.00 30.93  ? 466 VAL C CA    1 
ATOM 6060  C C     . VAL C 3 466 ? 188.399 138.543 150.653 1.00 30.93  ? 466 VAL C C     1 
ATOM 6061  O O     . VAL C 3 466 ? 189.126 138.644 149.657 1.00 30.93  ? 466 VAL C O     1 
ATOM 6062  C CB    . VAL C 3 466 ? 189.122 139.677 152.801 1.00 30.93  ? 466 VAL C CB    1 
ATOM 6063  C CG1   . VAL C 3 466 ? 188.984 140.951 153.593 1.00 30.93  ? 466 VAL C CG1   1 
ATOM 6064  C CG2   . VAL C 3 466 ? 188.796 138.485 153.672 1.00 30.93  ? 466 VAL C CG2   1 
ATOM 6065  N N     . GLN C 3 467 ? 187.764 137.410 150.938 1.00 32.72  ? 467 GLN C N     1 
ATOM 6066  C CA    . GLN C 3 467 ? 187.986 136.229 150.113 1.00 32.72  ? 467 GLN C CA    1 
ATOM 6067  C C     . GLN C 3 467 ? 187.531 136.460 148.677 1.00 32.72  ? 467 GLN C C     1 
ATOM 6068  O O     . GLN C 3 467 ? 188.314 136.333 147.728 1.00 32.72  ? 467 GLN C O     1 
ATOM 6069  C CB    . GLN C 3 467 ? 187.273 135.029 150.731 1.00 32.72  ? 467 GLN C CB    1 
ATOM 6070  C CG    . GLN C 3 467 ? 187.538 133.704 150.025 1.00 32.72  ? 467 GLN C CG    1 
ATOM 6071  C CD    . GLN C 3 467 ? 186.788 133.541 148.723 1.00 32.72  ? 467 GLN C CD    1 
ATOM 6072  O OE1   . GLN C 3 467 ? 187.379 133.249 147.688 1.00 32.72  ? 467 GLN C OE1   1 
ATOM 6073  N NE2   . GLN C 3 467 ? 185.476 133.710 148.772 1.00 32.72  ? 467 GLN C NE2   1 
ATOM 6074  N N     . HIS C 3 468 ? 186.264 136.829 148.509 1.00 31.30  ? 468 HIS C N     1 
ATOM 6075  C CA    . HIS C 3 468 ? 185.706 137.069 147.185 1.00 31.30  ? 468 HIS C CA    1 
ATOM 6076  C C     . HIS C 3 468 ? 186.376 138.263 146.512 1.00 31.30  ? 468 HIS C C     1 
ATOM 6077  O O     . HIS C 3 468 ? 186.643 138.240 145.299 1.00 31.30  ? 468 HIS C O     1 
ATOM 6078  C CB    . HIS C 3 468 ? 184.206 137.277 147.368 1.00 31.30  ? 468 HIS C CB    1 
ATOM 6079  C CG    . HIS C 3 468 ? 183.428 137.420 146.105 1.00 31.30  ? 468 HIS C CG    1 
ATOM 6080  N ND1   . HIS C 3 468 ? 183.450 138.566 145.346 1.00 31.30  ? 468 HIS C ND1   1 
ATOM 6081  C CD2   . HIS C 3 468 ? 182.548 136.586 145.507 1.00 31.30  ? 468 HIS C CD2   1 
ATOM 6082  C CE1   . HIS C 3 468 ? 182.633 138.422 144.318 1.00 31.30  ? 468 HIS C CE1   1 
ATOM 6083  N NE2   . HIS C 3 468 ? 182.078 137.227 144.389 1.00 31.30  ? 468 HIS C NE2   1 
ATOM 6084  N N     . GLY C 3 469 ? 186.719 139.277 147.309 1.00 30.34  ? 469 GLY C N     1 
ATOM 6085  C CA    . GLY C 3 469 ? 187.445 140.423 146.791 1.00 30.34  ? 469 GLY C CA    1 
ATOM 6086  C C     . GLY C 3 469 ? 188.728 140.016 146.101 1.00 30.34  ? 469 GLY C C     1 
ATOM 6087  O O     . GLY C 3 469 ? 188.977 140.389 144.956 1.00 30.34  ? 469 GLY C O     1 
ATOM 6088  N N     . MET C 3 470 ? 189.570 139.251 146.796 1.00 30.72  ? 470 MET C N     1 
ATOM 6089  C CA    . MET C 3 470 ? 190.799 138.772 146.176 1.00 30.72  ? 470 MET C CA    1 
ATOM 6090  C C     . MET C 3 470 ? 190.532 137.858 144.998 1.00 30.72  ? 470 MET C C     1 
ATOM 6091  O O     . MET C 3 470 ? 191.237 137.936 143.987 1.00 30.72  ? 470 MET C O     1 
ATOM 6092  C CB    . MET C 3 470 ? 191.690 138.088 147.201 1.00 30.72  ? 470 MET C CB    1 
ATOM 6093  C CG    . MET C 3 470 ? 192.273 139.074 148.145 1.00 30.72  ? 470 MET C CG    1 
ATOM 6094  S SD    . MET C 3 470 ? 193.226 140.235 147.140 1.00 30.72  ? 470 MET C SD    1 
ATOM 6095  C CE    . MET C 3 470 ? 192.312 141.753 147.306 1.00 30.72  ? 470 MET C CE    1 
ATOM 6096  N N     . SER C 3 471 ? 189.538 136.981 145.096 1.00 29.86  ? 471 SER C N     1 
ATOM 6097  C CA    . SER C 3 471 ? 189.271 136.100 143.966 1.00 29.86  ? 471 SER C CA    1 
ATOM 6098  C C     . SER C 3 471 ? 189.081 136.897 142.677 1.00 29.86  ? 471 SER C C     1 
ATOM 6099  O O     . SER C 3 471 ? 189.888 136.792 141.740 1.00 29.86  ? 471 SER C O     1 
ATOM 6100  C CB    . SER C 3 471 ? 188.050 135.233 144.253 1.00 29.86  ? 471 SER C CB    1 
ATOM 6101  O OG    . SER C 3 471 ? 187.840 134.310 143.200 1.00 29.86  ? 471 SER C OG    1 
ATOM 6102  N N     . ARG C 3 472 ? 188.028 137.720 142.612 1.00 29.93  ? 472 ARG C N     1 
ATOM 6103  C CA    . ARG C 3 472 ? 187.868 138.557 141.422 1.00 29.93  ? 472 ARG C CA    1 
ATOM 6104  C C     . ARG C 3 472 ? 189.079 139.437 141.167 1.00 29.93  ? 472 ARG C C     1 
ATOM 6105  O O     . ARG C 3 472 ? 189.432 139.682 140.013 1.00 29.93  ? 472 ARG C O     1 
ATOM 6106  C CB    . ARG C 3 472 ? 186.600 139.402 141.461 1.00 29.93  ? 472 ARG C CB    1 
ATOM 6107  C CG    . ARG C 3 472 ? 185.368 138.581 141.612 1.00 29.93  ? 472 ARG C CG    1 
ATOM 6108  C CD    . ARG C 3 472 ? 184.143 139.336 141.174 1.00 29.93  ? 472 ARG C CD    1 
ATOM 6109  N NE    . ARG C 3 472 ? 182.916 138.601 141.447 1.00 29.93  ? 472 ARG C NE    1 
ATOM 6110  C CZ    . ARG C 3 472 ? 181.695 139.100 141.285 1.00 29.93  ? 472 ARG C CZ    1 
ATOM 6111  N NH1   . ARG C 3 472 ? 181.531 140.340 140.851 1.00 29.93  ? 472 ARG C NH1   1 
ATOM 6112  N NH2   . ARG C 3 472 ? 180.638 138.364 141.574 1.00 29.93  ? 472 ARG C NH2   1 
ATOM 6113  N N     . TYR C 3 473 ? 189.701 139.966 142.216 1.00 27.65  ? 473 TYR C N     1 
ATOM 6114  C CA    . TYR C 3 473 ? 190.809 140.885 141.999 1.00 27.65  ? 473 TYR C CA    1 
ATOM 6115  C C     . TYR C 3 473 ? 191.931 140.247 141.201 1.00 27.65  ? 473 TYR C C     1 
ATOM 6116  O O     . TYR C 3 473 ? 192.238 140.697 140.100 1.00 27.65  ? 473 TYR C O     1 
ATOM 6117  C CB    . TYR C 3 473 ? 191.351 141.411 143.312 1.00 27.65  ? 473 TYR C CB    1 
ATOM 6118  C CG    . TYR C 3 473 ? 192.518 142.318 143.068 1.00 27.65  ? 473 TYR C CG    1 
ATOM 6119  C CD1   . TYR C 3 473 ? 192.370 143.466 142.334 1.00 27.65  ? 473 TYR C CD1   1 
ATOM 6120  C CD2   . TYR C 3 473 ? 193.767 142.027 143.574 1.00 27.65  ? 473 TYR C CD2   1 
ATOM 6121  C CE1   . TYR C 3 473 ? 193.427 144.295 142.105 1.00 27.65  ? 473 TYR C CE1   1 
ATOM 6122  C CE2   . TYR C 3 473 ? 194.826 142.857 143.356 1.00 27.65  ? 473 TYR C CE2   1 
ATOM 6123  C CZ    . TYR C 3 473 ? 194.650 143.987 142.623 1.00 27.65  ? 473 TYR C CZ    1 
ATOM 6124  O OH    . TYR C 3 473 ? 195.716 144.808 142.399 1.00 27.65  ? 473 TYR C OH    1 
ATOM 6125  N N     . TRP C 3 474 ? 192.577 139.215 141.742 1.00 30.56  ? 474 TRP C N     1 
ATOM 6126  C CA    . TRP C 3 474 ? 193.677 138.598 141.001 1.00 30.56  ? 474 TRP C CA    1 
ATOM 6127  C C     . TRP C 3 474 ? 193.213 138.001 139.676 1.00 30.56  ? 474 TRP C C     1 
ATOM 6128  O O     . TRP C 3 474 ? 193.909 138.125 138.655 1.00 30.56  ? 474 TRP C O     1 
ATOM 6129  C CB    . TRP C 3 474 ? 194.377 137.542 141.856 1.00 30.56  ? 474 TRP C CB    1 
ATOM 6130  C CG    . TRP C 3 474 ? 195.024 138.113 143.079 1.00 30.56  ? 474 TRP C CG    1 
ATOM 6131  C CD1   . TRP C 3 474 ? 194.678 137.876 144.368 1.00 30.56  ? 474 TRP C CD1   1 
ATOM 6132  C CD2   . TRP C 3 474 ? 196.120 139.029 143.122 1.00 30.56  ? 474 TRP C CD2   1 
ATOM 6133  N NE1   . TRP C 3 474 ? 195.490 138.580 145.217 1.00 30.56  ? 474 TRP C NE1   1 
ATOM 6134  C CE2   . TRP C 3 474 ? 196.387 139.296 144.473 1.00 30.56  ? 474 TRP C CE2   1 
ATOM 6135  C CE3   . TRP C 3 474 ? 196.901 139.646 142.150 1.00 30.56  ? 474 TRP C CE3   1 
ATOM 6136  C CZ2   . TRP C 3 474 ? 197.398 140.147 144.873 1.00 30.56  ? 474 TRP C CZ2   1 
ATOM 6137  C CZ3   . TRP C 3 474 ? 197.902 140.495 142.548 1.00 30.56  ? 474 TRP C CZ3   1 
ATOM 6138  C CH2   . TRP C 3 474 ? 198.148 140.734 143.898 1.00 30.56  ? 474 TRP C CH2   1 
ATOM 6139  N N     . ALA C 3 475 ? 192.034 137.369 139.663 1.00 28.93  ? 475 ALA C N     1 
ATOM 6140  C CA    . ALA C 3 475 ? 191.522 136.815 138.410 1.00 28.93  ? 475 ALA C CA    1 
ATOM 6141  C C     . ALA C 3 475 ? 191.392 137.883 137.327 1.00 28.93  ? 475 ALA C C     1 
ATOM 6142  O O     . ALA C 3 475 ? 191.605 137.605 136.143 1.00 28.93  ? 475 ALA C O     1 
ATOM 6143  C CB    . ALA C 3 475 ? 190.181 136.131 138.655 1.00 28.93  ? 475 ALA C CB    1 
ATOM 6144  N N     . LYS C 3 476 ? 191.028 139.103 137.714 1.00 30.91  ? 476 LYS C N     1 
ATOM 6145  C CA    . LYS C 3 476 ? 190.918 140.223 136.792 1.00 30.91  ? 476 LYS C CA    1 
ATOM 6146  C C     . LYS C 3 476 ? 192.248 140.913 136.567 1.00 30.91  ? 476 LYS C C     1 
ATOM 6147  O O     . LYS C 3 476 ? 192.387 141.664 135.598 1.00 30.91  ? 476 LYS C O     1 
ATOM 6148  C CB    . LYS C 3 476 ? 189.924 141.256 137.323 1.00 30.91  ? 476 LYS C CB    1 
ATOM 6149  C CG    . LYS C 3 476 ? 188.473 140.813 137.311 1.00 30.91  ? 476 LYS C CG    1 
ATOM 6150  C CD    . LYS C 3 476 ? 187.852 140.729 135.930 1.00 30.91  ? 476 LYS C CD    1 
ATOM 6151  C CE    . LYS C 3 476 ? 187.398 142.092 135.451 1.00 30.91  ? 476 LYS C CE    1 
ATOM 6152  N NZ    . LYS C 3 476 ? 186.599 141.960 134.201 1.00 30.91  ? 476 LYS C NZ    1 
ATOM 6153  N N     . ALA C 3 477 ? 193.202 140.708 137.466 1.00 29.39  ? 477 ALA C N     1 
ATOM 6154  C CA    . ALA C 3 477 ? 194.451 141.448 137.488 1.00 29.39  ? 477 ALA C CA    1 
ATOM 6155  C C     . ALA C 3 477 ? 195.537 140.806 136.650 1.00 29.39  ? 477 ALA C C     1 
ATOM 6156  O O     . ALA C 3 477 ? 196.411 141.521 136.154 1.00 29.39  ? 477 ALA C O     1 
ATOM 6157  C CB    . ALA C 3 477 ? 194.955 141.611 138.920 1.00 29.39  ? 477 ALA C CB    1 
ATOM 6158  N N     . GLU C 3 478 ? 195.541 139.480 136.503 1.00 32.58  ? 478 GLU C N     1 
ATOM 6159  C CA    . GLU C 3 478 ? 196.580 138.884 135.663 1.00 32.58  ? 478 GLU C CA    1 
ATOM 6160  C C     . GLU C 3 478 ? 196.523 139.387 134.222 1.00 32.58  ? 478 GLU C C     1 
ATOM 6161  O O     . GLU C 3 478 ? 197.568 139.836 133.719 1.00 32.58  ? 478 GLU C O     1 
ATOM 6162  C CB    . GLU C 3 478 ? 196.596 137.349 135.768 1.00 32.58  ? 478 GLU C CB    1 
ATOM 6163  C CG    . GLU C 3 478 ? 195.396 136.560 135.334 1.00 32.58  ? 478 GLU C CG    1 
ATOM 6164  C CD    . GLU C 3 478 ? 195.625 135.078 135.454 1.00 32.58  ? 478 GLU C CD    1 
ATOM 6165  O OE1   . GLU C 3 478 ? 196.712 134.684 135.921 1.00 32.58  ? 478 GLU C OE1   1 
ATOM 6166  O OE2   . GLU C 3 478 ? 194.725 134.305 135.069 1.00 32.58  ? 478 GLU C OE2   1 
ATOM 6167  N N     . PRO C 3 479 ? 195.385 139.383 133.513 1.00 31.55  ? 479 PRO C N     1 
ATOM 6168  C CA    . PRO C 3 479 ? 195.434 139.830 132.116 1.00 31.55  ? 479 PRO C CA    1 
ATOM 6169  C C     . PRO C 3 479 ? 195.827 141.283 131.990 1.00 31.55  ? 479 PRO C C     1 
ATOM 6170  O O     . PRO C 3 479 ? 196.483 141.650 131.010 1.00 31.55  ? 479 PRO C O     1 
ATOM 6171  C CB    . PRO C 3 479 ? 194.007 139.592 131.613 1.00 31.55  ? 479 PRO C CB    1 
ATOM 6172  C CG    . PRO C 3 479 ? 193.408 138.649 132.557 1.00 31.55  ? 479 PRO C CG    1 
ATOM 6173  C CD    . PRO C 3 479 ? 194.011 139.001 133.875 1.00 31.55  ? 479 PRO C CD    1 
ATOM 6174  N N     . VAL C 3 480 ? 195.467 142.123 132.958 1.00 30.39  ? 480 VAL C N     1 
ATOM 6175  C CA    . VAL C 3 480 ? 195.852 143.525 132.877 1.00 30.39  ? 480 VAL C CA    1 
ATOM 6176  C C     . VAL C 3 480 ? 197.363 143.656 132.981 1.00 30.39  ? 480 VAL C C     1 
ATOM 6177  O O     . VAL C 3 480 ? 197.992 144.417 132.231 1.00 30.39  ? 480 VAL C O     1 
ATOM 6178  C CB    . VAL C 3 480 ? 195.138 144.335 133.970 1.00 30.39  ? 480 VAL C CB    1 
ATOM 6179  C CG1   . VAL C 3 480 ? 195.648 145.749 133.992 1.00 30.39  ? 480 VAL C CG1   1 
ATOM 6180  C CG2   . VAL C 3 480 ? 193.652 144.326 133.724 1.00 30.39  ? 480 VAL C CG2   1 
ATOM 6181  N N     . PHE C 3 481 ? 197.973 142.913 133.900 1.00 30.67  ? 481 PHE C N     1 
ATOM 6182  C CA    . PHE C 3 481 ? 199.427 142.884 133.971 1.00 30.67  ? 481 PHE C CA    1 
ATOM 6183  C C     . PHE C 3 481 ? 200.017 142.415 132.649 1.00 30.67  ? 481 PHE C C     1 
ATOM 6184  O O     . PHE C 3 481 ? 200.868 143.097 132.066 1.00 30.67  ? 481 PHE C O     1 
ATOM 6185  C CB    . PHE C 3 481 ? 199.890 142.005 135.125 1.00 30.67  ? 481 PHE C CB    1 
ATOM 6186  C CG    . PHE C 3 481 ? 201.379 141.837 135.207 1.00 30.67  ? 481 PHE C CG    1 
ATOM 6187  C CD1   . PHE C 3 481 ? 202.143 142.786 135.855 1.00 30.67  ? 481 PHE C CD1   1 
ATOM 6188  C CD2   . PHE C 3 481 ? 202.004 140.719 134.699 1.00 30.67  ? 481 PHE C CD2   1 
ATOM 6189  C CE1   . PHE C 3 481 ? 203.496 142.644 135.964 1.00 30.67  ? 481 PHE C CE1   1 
ATOM 6190  C CE2   . PHE C 3 481 ? 203.364 140.572 134.811 1.00 30.67  ? 481 PHE C CE2   1 
ATOM 6191  C CZ    . PHE C 3 481 ? 204.108 141.535 135.445 1.00 30.67  ? 481 PHE C CZ    1 
ATOM 6192  N N     . TRP C 3 482 ? 199.562 141.263 132.144 1.00 32.76  ? 482 TRP C N     1 
ATOM 6193  C CA    . TRP C 3 482 ? 200.140 140.759 130.904 1.00 32.76  ? 482 TRP C CA    1 
ATOM 6194  C C     . TRP C 3 482 ? 199.956 141.734 129.755 1.00 32.76  ? 482 TRP C C     1 
ATOM 6195  O O     . TRP C 3 482 ? 200.716 141.680 128.787 1.00 32.76  ? 482 TRP C O     1 
ATOM 6196  C CB    . TRP C 3 482 ? 199.498 139.447 130.471 1.00 32.76  ? 482 TRP C CB    1 
ATOM 6197  C CG    . TRP C 3 482 ? 199.849 138.250 131.248 1.00 32.76  ? 482 TRP C CG    1 
ATOM 6198  C CD1   . TRP C 3 482 ? 199.011 137.531 132.032 1.00 32.76  ? 482 TRP C CD1   1 
ATOM 6199  C CD2   . TRP C 3 482 ? 201.130 137.627 131.347 1.00 32.76  ? 482 TRP C CD2   1 
ATOM 6200  N NE1   . TRP C 3 482 ? 199.676 136.478 132.595 1.00 32.76  ? 482 TRP C NE1   1 
ATOM 6201  C CE2   . TRP C 3 482 ? 200.984 136.517 132.195 1.00 32.76  ? 482 TRP C CE2   1 
ATOM 6202  C CE3   . TRP C 3 482 ? 202.383 137.893 130.799 1.00 32.76  ? 482 TRP C CE3   1 
ATOM 6203  C CZ2   . TRP C 3 482 ? 202.041 135.674 132.510 1.00 32.76  ? 482 TRP C CZ2   1 
ATOM 6204  C CZ3   . TRP C 3 482 ? 203.433 137.053 131.112 1.00 32.76  ? 482 TRP C CZ3   1 
ATOM 6205  C CH2   . TRP C 3 482 ? 203.255 135.958 131.960 1.00 32.76  ? 482 TRP C CH2   1 
ATOM 6206  N N     . ASN C 3 483 ? 198.966 142.614 129.827 1.00 34.82  ? 483 ASN C N     1 
ATOM 6207  C CA    . ASN C 3 483 ? 198.846 143.631 128.796 1.00 34.82  ? 483 ASN C CA    1 
ATOM 6208  C C     . ASN C 3 483 ? 199.861 144.733 129.024 1.00 34.82  ? 483 ASN C C     1 
ATOM 6209  O O     . ASN C 3 483 ? 200.338 145.344 128.065 1.00 34.82  ? 483 ASN C O     1 
ATOM 6210  C CB    . ASN C 3 483 ? 197.427 144.196 128.756 1.00 34.82  ? 483 ASN C CB    1 
ATOM 6211  C CG    . ASN C 3 483 ? 196.446 143.233 128.129 1.00 34.82  ? 483 ASN C CG    1 
ATOM 6212  O OD1   . ASN C 3 483 ? 196.846 142.276 127.469 1.00 34.82  ? 483 ASN C OD1   1 
ATOM 6213  N ND2   . ASN C 3 483 ? 195.158 143.489 128.318 1.00 34.82  ? 483 ASN C ND2   1 
ATOM 6214  N N     . ILE C 3 484 ? 200.192 144.997 130.286 1.00 37.12  ? 484 ILE C N     1 
ATOM 6215  C CA    . ILE C 3 484 ? 201.196 146.007 130.601 1.00 37.12  ? 484 ILE C CA    1 
ATOM 6216  C C     . ILE C 3 484 ? 202.584 145.550 130.173 1.00 37.12  ? 484 ILE C C     1 
ATOM 6217  O O     . ILE C 3 484 ? 203.387 146.349 129.678 1.00 37.12  ? 484 ILE C O     1 
ATOM 6218  C CB    . ILE C 3 484 ? 201.147 146.359 132.092 1.00 37.12  ? 484 ILE C CB    1 
ATOM 6219  C CG1   . ILE C 3 484 ? 199.882 147.156 132.390 1.00 37.12  ? 484 ILE C CG1   1 
ATOM 6220  C CG2   . ILE C 3 484 ? 202.356 147.187 132.476 1.00 37.12  ? 484 ILE C CG2   1 
ATOM 6221  C CD1   . ILE C 3 484 ? 199.767 147.601 133.822 1.00 37.12  ? 484 ILE C CD1   1 
ATOM 6222  N N     . VAL C 3 485 ? 202.903 144.268 130.363 1.00 36.24  ? 485 VAL C N     1 
ATOM 6223  C CA    . VAL C 3 485 ? 204.232 143.793 129.983 1.00 36.24  ? 485 VAL C CA    1 
ATOM 6224  C C     . VAL C 3 485 ? 204.422 143.831 128.470 1.00 36.24  ? 485 VAL C C     1 
ATOM 6225  O O     . VAL C 3 485 ? 205.489 144.219 127.982 1.00 36.24  ? 485 VAL C O     1 
ATOM 6226  C CB    . VAL C 3 485 ? 204.499 142.388 130.550 1.00 36.24  ? 485 VAL C CB    1 
ATOM 6227  C CG1   . VAL C 3 485 ? 203.567 141.365 129.959 1.00 36.24  ? 485 VAL C CG1   1 
ATOM 6228  C CG2   . VAL C 3 485 ? 205.911 141.985 130.252 1.00 36.24  ? 485 VAL C CG2   1 
ATOM 6229  N N     . TYR C 3 486 ? 203.396 143.485 127.702 1.00 37.86  ? 486 TYR C N     1 
ATOM 6230  C CA    . TYR C 3 486 ? 203.555 143.459 126.258 1.00 37.86  ? 486 TYR C CA    1 
ATOM 6231  C C     . TYR C 3 486 ? 203.374 144.837 125.646 1.00 37.86  ? 486 TYR C C     1 
ATOM 6232  O O     . TYR C 3 486 ? 203.299 144.966 124.421 1.00 37.86  ? 486 TYR C O     1 
ATOM 6233  C CB    . TYR C 3 486 ? 202.554 142.491 125.633 1.00 37.86  ? 486 TYR C CB    1 
ATOM 6234  C CG    . TYR C 3 486 ? 202.913 141.039 125.811 1.00 37.86  ? 486 TYR C CG    1 
ATOM 6235  C CD1   . TYR C 3 486 ? 204.229 140.627 125.814 1.00 37.86  ? 486 TYR C CD1   1 
ATOM 6236  C CD2   . TYR C 3 486 ? 201.925 140.072 125.920 1.00 37.86  ? 486 TYR C CD2   1 
ATOM 6237  C CE1   . TYR C 3 486 ? 204.553 139.296 125.964 1.00 37.86  ? 486 TYR C CE1   1 
ATOM 6238  C CE2   . TYR C 3 486 ? 202.238 138.747 126.065 1.00 37.86  ? 486 TYR C CE2   1 
ATOM 6239  C CZ    . TYR C 3 486 ? 203.551 138.362 126.084 1.00 37.86  ? 486 TYR C CZ    1 
ATOM 6240  O OH    . TYR C 3 486 ? 203.857 137.033 126.232 1.00 37.86  ? 486 TYR C OH    1 
ATOM 6241  N N     . ASP C 3 487 ? 203.253 145.845 126.501 1.00 44.34  ? 487 ASP C N     1 
ATOM 6242  C CA    . ASP C 3 487 ? 203.000 147.242 126.147 1.00 44.34  ? 487 ASP C CA    1 
ATOM 6243  C C     . ASP C 3 487 ? 201.743 147.408 125.295 1.00 44.34  ? 487 ASP C C     1 
ATOM 6244  O O     . ASP C 3 487 ? 201.626 148.346 124.505 1.00 44.34  ? 487 ASP C O     1 
ATOM 6245  C CB    . ASP C 3 487 ? 204.220 147.851 125.447 1.00 44.34  ? 487 ASP C CB    1 
ATOM 6246  C CG    . ASP C 3 487 ? 204.110 149.353 125.272 1.00 44.34  ? 487 ASP C CG    1 
ATOM 6247  O OD1   . ASP C 3 487 ? 204.199 150.074 126.286 1.00 44.34  ? 487 ASP C OD1   1 
ATOM 6248  O OD2   . ASP C 3 487 ? 203.944 149.812 124.122 1.00 44.34  ? 487 ASP C OD2   1 
ATOM 6249  N N     . ARG C 3 488 ? 200.771 146.533 125.472 1.00 39.77  ? 488 ARG C N     1 
ATOM 6250  C CA    . ARG C 3 488 ? 199.518 146.697 124.760 1.00 39.77  ? 488 ARG C CA    1 
ATOM 6251  C C     . ARG C 3 488 ? 198.669 147.723 125.499 1.00 39.77  ? 488 ARG C C     1 
ATOM 6252  O O     . ARG C 3 488 ? 198.929 148.025 126.664 1.00 39.77  ? 488 ARG C O     1 
ATOM 6253  C CB    . ARG C 3 488 ? 198.822 145.362 124.522 1.00 39.77  ? 488 ARG C CB    1 
ATOM 6254  C CG    . ARG C 3 488 ? 199.798 144.287 124.077 1.00 39.77  ? 488 ARG C CG    1 
ATOM 6255  C CD    . ARG C 3 488 ? 199.151 142.927 123.842 1.00 39.77  ? 488 ARG C CD    1 
ATOM 6256  N NE    . ARG C 3 488 ? 198.921 142.125 125.029 1.00 39.77  ? 488 ARG C NE    1 
ATOM 6257  C CZ    . ARG C 3 488 ? 198.310 140.947 125.002 1.00 39.77  ? 488 ARG C CZ    1 
ATOM 6258  N NH1   . ARG C 3 488 ? 197.874 140.452 123.852 1.00 39.77  ? 488 ARG C NH1   1 
ATOM 6259  N NH2   . ARG C 3 488 ? 198.137 140.259 126.120 1.00 39.77  ? 488 ARG C NH2   1 
ATOM 6260  N N     . PRO C 3 489 ? 197.668 148.308 124.846 1.00 45.76  ? 489 PRO C N     1 
ATOM 6261  C CA    . PRO C 3 489 ? 196.862 149.315 125.536 1.00 45.76  ? 489 PRO C CA    1 
ATOM 6262  C C     . PRO C 3 489 ? 195.827 148.676 126.448 1.00 45.76  ? 489 PRO C C     1 
ATOM 6263  O O     . PRO C 3 489 ? 195.073 147.787 126.050 1.00 45.76  ? 489 PRO C O     1 
ATOM 6264  C CB    . PRO C 3 489 ? 196.200 150.069 124.381 1.00 45.76  ? 489 PRO C CB    1 
ATOM 6265  C CG    . PRO C 3 489 ? 195.924 148.963 123.414 1.00 45.76  ? 489 PRO C CG    1 
ATOM 6266  C CD    . PRO C 3 489 ? 197.185 148.107 123.469 1.00 45.76  ? 489 PRO C CD    1 
ATOM 6267  N N     . ALA C 3 490 ? 195.822 149.147 127.689 1.00 47.82  ? 490 ALA C N     1 
ATOM 6268  C CA    . ALA C 3 490 ? 194.933 148.707 128.753 1.00 47.82  ? 490 ALA C CA    1 
ATOM 6269  C C     . ALA C 3 490 ? 194.234 149.953 129.272 1.00 47.82  ? 490 ALA C C     1 
ATOM 6270  O O     . ALA C 3 490 ? 194.885 150.979 129.494 1.00 47.82  ? 490 ALA C O     1 
ATOM 6271  C CB    . ALA C 3 490 ? 195.688 147.989 129.867 1.00 47.82  ? 490 ALA C CB    1 
ATOM 6272  N N     . GLN C 3 491 ? 192.921 149.866 129.478 1.00 51.11  ? 491 GLN C N     1 
ATOM 6273  C CA    . GLN C 3 491 ? 192.179 151.034 129.935 1.00 51.11  ? 491 GLN C CA    1 
ATOM 6274  C C     . GLN C 3 491 ? 192.695 151.492 131.290 1.00 51.11  ? 491 GLN C C     1 
ATOM 6275  O O     . GLN C 3 491 ? 193.014 150.689 132.168 1.00 51.11  ? 491 GLN C O     1 
ATOM 6276  C CB    . GLN C 3 491 ? 190.676 150.740 129.992 1.00 51.11  ? 491 GLN C CB    1 
ATOM 6277  C CG    . GLN C 3 491 ? 190.229 149.711 131.013 1.00 51.11  ? 491 GLN C CG    1 
ATOM 6278  C CD    . GLN C 3 491 ? 189.980 150.336 132.369 1.00 51.11  ? 491 GLN C CD    1 
ATOM 6279  O OE1   . GLN C 3 491 ? 189.667 151.520 132.462 1.00 51.11  ? 491 GLN C OE1   1 
ATOM 6280  N NE2   . GLN C 3 491 ? 190.109 149.546 133.425 1.00 51.11  ? 491 GLN C NE2   1 
ATOM 6281  N N     . GLY C 3 492 ? 192.808 152.807 131.429 1.00 51.46  ? 492 GLY C N     1 
ATOM 6282  C CA    . GLY C 3 492 ? 193.339 153.432 132.615 1.00 51.46  ? 492 GLY C CA    1 
ATOM 6283  C C     . GLY C 3 492 ? 194.843 153.370 132.676 1.00 51.46  ? 492 GLY C C     1 
ATOM 6284  O O     . GLY C 3 492 ? 195.431 153.794 133.676 1.00 51.46  ? 492 GLY C O     1 
ATOM 6285  N N     . TYR C 3 493 ? 195.480 152.909 131.607 1.00 49.75  ? 493 TYR C N     1 
ATOM 6286  C CA    . TYR C 3 493 ? 196.920 152.791 131.518 1.00 49.75  ? 493 TYR C CA    1 
ATOM 6287  C C     . TYR C 3 493 ? 197.370 153.419 130.211 1.00 49.75  ? 493 TYR C C     1 
ATOM 6288  O O     . TYR C 3 493 ? 196.679 153.331 129.194 1.00 49.75  ? 493 TYR C O     1 
ATOM 6289  C CB    . TYR C 3 493 ? 197.333 151.326 131.576 1.00 49.75  ? 493 TYR C CB    1 
ATOM 6290  C CG    . TYR C 3 493 ? 198.769 151.021 131.231 1.00 49.75  ? 493 TYR C CG    1 
ATOM 6291  C CD1   . TYR C 3 493 ? 199.763 151.113 132.191 1.00 49.75  ? 493 TYR C CD1   1 
ATOM 6292  C CD2   . TYR C 3 493 ? 199.127 150.607 129.963 1.00 49.75  ? 493 TYR C CD2   1 
ATOM 6293  C CE1   . TYR C 3 493 ? 201.071 150.813 131.891 1.00 49.75  ? 493 TYR C CE1   1 
ATOM 6294  C CE2   . TYR C 3 493 ? 200.436 150.307 129.654 1.00 49.75  ? 493 TYR C CE2   1 
ATOM 6295  C CZ    . TYR C 3 493 ? 201.404 150.417 130.623 1.00 49.75  ? 493 TYR C CZ    1 
ATOM 6296  O OH    . TYR C 3 493 ? 202.715 150.121 130.335 1.00 49.75  ? 493 TYR C OH    1 
ATOM 6297  N N     . THR C 3 494 ? 198.547 154.036 130.237 1.00 52.31  ? 494 THR C N     1 
ATOM 6298  C CA    . THR C 3 494 ? 199.089 154.703 129.062 1.00 52.31  ? 494 THR C CA    1 
ATOM 6299  C C     . THR C 3 494 ? 200.202 153.851 128.481 1.00 52.31  ? 494 THR C C     1 
ATOM 6300  O O     . THR C 3 494 ? 201.130 153.481 129.212 1.00 52.31  ? 494 THR C O     1 
ATOM 6301  C CB    . THR C 3 494 ? 199.605 156.100 129.399 1.00 52.31  ? 494 THR C CB    1 
ATOM 6302  O OG1   . THR C 3 494 ? 198.548 156.892 129.955 1.00 52.31  ? 494 THR C OG1   1 
ATOM 6303  C CG2   . THR C 3 494 ? 200.146 156.777 128.155 1.00 52.31  ? 494 THR C CG2   1 
ATOM 6304  N N     . PRO C 3 495 ? 200.134 153.462 127.214 1.00 50.21  ? 495 PRO C N     1 
ATOM 6305  C CA    . PRO C 3 495 ? 201.209 152.645 126.646 1.00 50.21  ? 495 PRO C CA    1 
ATOM 6306  C C     . PRO C 3 495 ? 202.531 153.394 126.560 1.00 50.21  ? 495 PRO C C     1 
ATOM 6307  O O     . PRO C 3 495 ? 202.579 154.603 126.330 1.00 50.21  ? 495 PRO C O     1 
ATOM 6308  C CB    . PRO C 3 495 ? 200.671 152.281 125.256 1.00 50.21  ? 495 PRO C CB    1 
ATOM 6309  C CG    . PRO C 3 495 ? 199.180 152.410 125.414 1.00 50.21  ? 495 PRO C CG    1 
ATOM 6310  C CD    . PRO C 3 495 ? 199.042 153.640 126.250 1.00 50.21  ? 495 PRO C CD    1 
ATOM 6311  N N     . GLY C 3 496 ? 203.602 152.642 126.782 1.00 54.29  ? 496 GLY C N     1 
ATOM 6312  C CA    . GLY C 3 496 ? 204.989 153.094 126.750 1.00 54.29  ? 496 GLY C CA    1 
ATOM 6313  C C     . GLY C 3 496 ? 205.379 154.238 127.662 1.00 54.29  ? 496 GLY C C     1 
ATOM 6314  O O     . GLY C 3 496 ? 206.195 155.085 127.279 1.00 54.29  ? 496 GLY C O     1 
ATOM 6315  N N     . MET C 3 497 ? 204.812 154.287 128.859 1.00 54.36  ? 497 MET C N     1 
ATOM 6316  C CA    . MET C 3 497 ? 205.138 155.292 129.861 1.00 54.36  ? 497 MET C CA    1 
ATOM 6317  C C     . MET C 3 497 ? 205.753 154.569 131.054 1.00 54.36  ? 497 MET C C     1 
ATOM 6318  O O     . MET C 3 497 ? 205.211 153.563 131.521 1.00 54.36  ? 497 MET C O     1 
ATOM 6319  C CB    . MET C 3 497 ? 203.954 156.196 130.201 1.00 54.36  ? 497 MET C CB    1 
ATOM 6320  C CG    . MET C 3 497 ? 202.698 155.566 130.644 1.00 54.36  ? 497 MET C CG    1 
ATOM 6321  S SD    . MET C 3 497 ? 202.393 155.549 132.396 1.00 54.36  ? 497 MET C SD    1 
ATOM 6322  C CE    . MET C 3 497 ? 201.367 154.097 132.435 1.00 54.36  ? 497 MET C CE    1 
ATOM 6323  N N     . ALA C 3 498 ? 206.889 155.078 131.531 1.00 55.17  ? 498 ALA C N     1 
ATOM 6324  C CA    . ALA C 3 498 ? 207.620 154.445 132.627 1.00 55.17  ? 498 ALA C CA    1 
ATOM 6325  C C     . ALA C 3 498 ? 206.790 154.314 133.902 1.00 55.17  ? 498 ALA C C     1 
ATOM 6326  O O     . ALA C 3 498 ? 206.902 153.311 134.614 1.00 55.17  ? 498 ALA C O     1 
ATOM 6327  C CB    . ALA C 3 498 ? 208.899 155.225 132.912 1.00 55.17  ? 498 ALA C CB    1 
ATOM 6328  N N     . GLY C 3 499 ? 205.952 155.298 134.211 1.00 57.49  ? 499 GLY C N     1 
ATOM 6329  C CA    . GLY C 3 499 ? 205.159 155.229 135.415 1.00 57.49  ? 499 GLY C CA    1 
ATOM 6330  C C     . GLY C 3 499 ? 204.122 154.121 135.373 1.00 57.49  ? 499 GLY C C     1 
ATOM 6331  O O     . GLY C 3 499 ? 203.774 153.601 134.310 1.00 57.49  ? 499 GLY C O     1 
ATOM 6332  N N     . PRO C 3 500 ? 203.677 153.673 136.551 1.00 50.84  ? 500 PRO C N     1 
ATOM 6333  C CA    . PRO C 3 500 ? 202.690 152.578 136.596 1.00 50.84  ? 500 PRO C CA    1 
ATOM 6334  C C     . PRO C 3 500 ? 201.379 152.881 135.890 1.00 50.84  ? 500 PRO C C     1 
ATOM 6335  O O     . PRO C 3 500 ? 200.790 151.986 135.274 1.00 50.84  ? 500 PRO C O     1 
ATOM 6336  C CB    . PRO C 3 500 ? 202.492 152.380 138.105 1.00 50.84  ? 500 PRO C CB    1 
ATOM 6337  C CG    . PRO C 3 500 ? 203.797 152.857 138.699 1.00 50.84  ? 500 PRO C CG    1 
ATOM 6338  C CD    . PRO C 3 500 ? 204.083 154.089 137.901 1.00 50.84  ? 500 PRO C CD    1 
ATOM 6339  N N     . GLY C 3 501 ? 200.899 154.119 135.974 1.00 48.14  ? 501 GLY C N     1 
ATOM 6340  C CA    . GLY C 3 501 ? 199.670 154.538 135.334 1.00 48.14  ? 501 GLY C CA    1 
ATOM 6341  C C     . GLY C 3 501 ? 198.403 154.245 136.098 1.00 48.14  ? 501 GLY C C     1 
ATOM 6342  O O     . GLY C 3 501 ? 197.320 154.431 135.542 1.00 48.14  ? 501 GLY C O     1 
ATOM 6343  N N     . ASN C 3 502 ? 198.518 153.706 137.306 1.00 43.21  ? 502 ASN C N     1 
ATOM 6344  C CA    . ASN C 3 502 ? 197.414 153.405 138.222 1.00 43.21  ? 502 ASN C CA    1 
ATOM 6345  C C     . ASN C 3 502 ? 196.302 152.591 137.563 1.00 43.21  ? 502 ASN C C     1 
ATOM 6346  O O     . ASN C 3 502 ? 195.120 152.758 137.864 1.00 43.21  ? 502 ASN C O     1 
ATOM 6347  C CB    . ASN C 3 502 ? 196.873 154.676 138.904 1.00 43.21  ? 502 ASN C CB    1 
ATOM 6348  C CG    . ASN C 3 502 ? 196.030 155.583 138.006 1.00 43.21  ? 502 ASN C CG    1 
ATOM 6349  O OD1   . ASN C 3 502 ? 195.524 155.201 136.956 1.00 43.21  ? 502 ASN C OD1   1 
ATOM 6350  N ND2   . ASN C 3 502 ? 195.864 156.816 138.457 1.00 43.21  ? 502 ASN C ND2   1 
ATOM 6351  N N     . ALA C 3 503 ? 196.684 151.662 136.693 1.00 41.28  ? 503 ALA C N     1 
ATOM 6352  C CA    . ALA C 3 503 ? 195.692 150.791 136.073 1.00 41.28  ? 503 ALA C CA    1 
ATOM 6353  C C     . ALA C 3 503 ? 195.080 149.873 137.120 1.00 41.28  ? 503 ALA C C     1 
ATOM 6354  O O     . ALA C 3 503 ? 193.853 149.686 137.186 1.00 41.28  ? 503 ALA C O     1 
ATOM 6355  C CB    . ALA C 3 503 ? 196.327 149.986 134.942 1.00 41.28  ? 503 ALA C CB    1 
ATOM 6356  N N     . PHE C 3 504 ? 195.936 149.298 137.963 1.00 34.08  ? 504 PHE C N     1 
ATOM 6357  C CA    . PHE C 3 504 ? 195.463 148.403 138.999 1.00 34.08  ? 504 PHE C CA    1 
ATOM 6358  C C     . PHE C 3 504 ? 194.576 149.122 140.001 1.00 34.08  ? 504 PHE C C     1 
ATOM 6359  O O     . PHE C 3 504 ? 193.811 148.467 140.713 1.00 34.08  ? 504 PHE C O     1 
ATOM 6360  C CB    . PHE C 3 504 ? 196.642 147.730 139.688 1.00 34.08  ? 504 PHE C CB    1 
ATOM 6361  C CG    . PHE C 3 504 ? 197.403 146.794 138.795 1.00 34.08  ? 504 PHE C CG    1 
ATOM 6362  C CD1   . PHE C 3 504 ? 196.942 145.516 138.547 1.00 34.08  ? 504 PHE C CD1   1 
ATOM 6363  C CD2   . PHE C 3 504 ? 198.593 147.188 138.224 1.00 34.08  ? 504 PHE C CD2   1 
ATOM 6364  C CE1   . PHE C 3 504 ? 197.645 144.668 137.730 1.00 34.08  ? 504 PHE C CE1   1 
ATOM 6365  C CE2   . PHE C 3 504 ? 199.296 146.344 137.412 1.00 34.08  ? 504 PHE C CE2   1 
ATOM 6366  C CZ    . PHE C 3 504 ? 198.825 145.083 137.163 1.00 34.08  ? 504 PHE C CZ    1 
ATOM 6367  N N     . ASN C 3 505 ? 194.642 150.448 140.074 1.00 33.46  ? 505 ASN C N     1 
ATOM 6368  C CA    . ASN C 3 505 ? 193.658 151.152 140.882 1.00 33.46  ? 505 ASN C CA    1 
ATOM 6369  C C     . ASN C 3 505 ? 192.268 150.906 140.327 1.00 33.46  ? 505 ASN C C     1 
ATOM 6370  O O     . ASN C 3 505 ? 191.358 150.516 141.060 1.00 33.46  ? 505 ASN C O     1 
ATOM 6371  C CB    . ASN C 3 505 ? 193.944 152.648 140.956 1.00 33.46  ? 505 ASN C CB    1 
ATOM 6372  C CG    . ASN C 3 505 ? 194.966 152.991 142.011 1.00 33.46  ? 505 ASN C CG    1 
ATOM 6373  O OD1   . ASN C 3 505 ? 194.972 152.403 143.088 1.00 33.46  ? 505 ASN C OD1   1 
ATOM 6374  N ND2   . ASN C 3 505 ? 195.784 153.998 141.742 1.00 33.46  ? 505 ASN C ND2   1 
ATOM 6375  N N     . LEU C 3 506 ? 192.086 151.115 139.022 1.00 35.57  ? 506 LEU C N     1 
ATOM 6376  C CA    . LEU C 3 506 ? 190.773 150.883 138.439 1.00 35.57  ? 506 LEU C CA    1 
ATOM 6377  C C     . LEU C 3 506 ? 190.362 149.419 138.508 1.00 35.57  ? 506 LEU C C     1 
ATOM 6378  O O     . LEU C 3 506 ? 189.173 149.131 138.708 1.00 35.57  ? 506 LEU C O     1 
ATOM 6379  C CB    . LEU C 3 506 ? 190.755 151.337 136.977 1.00 35.57  ? 506 LEU C CB    1 
ATOM 6380  C CG    . LEU C 3 506 ? 190.928 152.805 136.569 1.00 35.57  ? 506 LEU C CG    1 
ATOM 6381  C CD1   . LEU C 3 506 ? 189.843 153.666 137.176 1.00 35.57  ? 506 LEU C CD1   1 
ATOM 6382  C CD2   . LEU C 3 506 ? 192.295 153.369 136.895 1.00 35.57  ? 506 LEU C CD2   1 
ATOM 6383  N N     . VAL C 3 507 ? 191.307 148.477 138.419 1.00 30.84  ? 507 VAL C N     1 
ATOM 6384  C CA    . VAL C 3 507 ? 190.893 147.079 138.558 1.00 30.84  ? 507 VAL C CA    1 
ATOM 6385  C C     . VAL C 3 507 ? 190.423 146.807 139.984 1.00 30.84  ? 507 VAL C C     1 
ATOM 6386  O O     . VAL C 3 507 ? 189.348 146.236 140.199 1.00 30.84  ? 507 VAL C O     1 
ATOM 6387  C CB    . VAL C 3 507 ? 191.974 146.082 138.096 1.00 30.84  ? 507 VAL C CB    1 
ATOM 6388  C CG1   . VAL C 3 507 ? 193.137 146.013 139.024 1.00 30.84  ? 507 VAL C CG1   1 
ATOM 6389  C CG2   . VAL C 3 507 ? 191.356 144.702 137.955 1.00 30.84  ? 507 VAL C CG2   1 
ATOM 6390  N N     . ALA C 3 508 ? 191.237 147.173 140.976 1.00 30.18  ? 508 ALA C N     1 
ATOM 6391  C CA    . ALA C 3 508 ? 190.858 146.956 142.366 1.00 30.18  ? 508 ALA C CA    1 
ATOM 6392  C C     . ALA C 3 508 ? 189.560 147.661 142.720 1.00 30.18  ? 508 ALA C C     1 
ATOM 6393  O O     . ALA C 3 508 ? 188.760 147.136 143.497 1.00 30.18  ? 508 ALA C O     1 
ATOM 6394  C CB    . ALA C 3 508 ? 191.971 147.428 143.295 1.00 30.18  ? 508 ALA C CB    1 
ATOM 6395  N N     . LEU C 3 509 ? 189.333 148.854 142.181 1.00 30.43  ? 509 LEU C N     1 
ATOM 6396  C CA    . LEU C 3 509 ? 188.092 149.549 142.493 1.00 30.43  ? 509 LEU C CA    1 
ATOM 6397  C C     . LEU C 3 509 ? 186.910 148.821 141.892 1.00 30.43  ? 509 LEU C C     1 
ATOM 6398  O O     . LEU C 3 509 ? 185.856 148.707 142.526 1.00 30.43  ? 509 LEU C O     1 
ATOM 6399  C CB    . LEU C 3 509 ? 188.142 150.970 141.959 1.00 30.43  ? 509 LEU C CB    1 
ATOM 6400  C CG    . LEU C 3 509 ? 189.013 151.952 142.716 1.00 30.43  ? 509 LEU C CG    1 
ATOM 6401  C CD1   . LEU C 3 509 ? 189.127 153.194 141.886 1.00 30.43  ? 509 LEU C CD1   1 
ATOM 6402  C CD2   . LEU C 3 509 ? 188.394 152.251 144.042 1.00 30.43  ? 509 LEU C CD2   1 
ATOM 6403  N N     . ALA C 3 510 ? 187.084 148.274 140.691 1.00 31.60  ? 510 ALA C N     1 
ATOM 6404  C CA    . ALA C 3 510 ? 185.984 147.538 140.090 1.00 31.60  ? 510 ALA C CA    1 
ATOM 6405  C C     . ALA C 3 510 ? 185.690 146.276 140.877 1.00 31.60  ? 510 ALA C C     1 
ATOM 6406  O O     . ALA C 3 510 ? 184.526 145.969 141.150 1.00 31.60  ? 510 ALA C O     1 
ATOM 6407  C CB    . ALA C 3 510 ? 186.307 147.198 138.638 1.00 31.60  ? 510 ALA C CB    1 
ATOM 6408  N N     . ALA C 3 511 ? 186.733 145.572 141.314 1.00 30.30  ? 511 ALA C N     1 
ATOM 6409  C CA    . ALA C 3 511 ? 186.532 144.378 142.127 1.00 30.30  ? 511 ALA C CA    1 
ATOM 6410  C C     . ALA C 3 511 ? 185.870 144.720 143.453 1.00 30.30  ? 511 ALA C C     1 
ATOM 6411  O O     . ALA C 3 511 ? 184.901 144.073 143.868 1.00 30.30  ? 511 ALA C O     1 
ATOM 6412  C CB    . ALA C 3 511 ? 187.868 143.678 142.363 1.00 30.30  ? 511 ALA C CB    1 
ATOM 6413  N N     . TYR C 3 512 ? 186.376 145.753 144.123 1.00 30.68  ? 512 TYR C N     1 
ATOM 6414  C CA    . TYR C 3 512 ? 185.813 146.180 145.395 1.00 30.68  ? 512 TYR C CA    1 
ATOM 6415  C C     . TYR C 3 512 ? 184.331 146.493 145.273 1.00 30.68  ? 512 TYR C C     1 
ATOM 6416  O O     . TYR C 3 512 ? 183.526 146.044 146.091 1.00 30.68  ? 512 TYR C O     1 
ATOM 6417  C CB    . TYR C 3 512 ? 186.578 147.397 145.899 1.00 30.68  ? 512 TYR C CB    1 
ATOM 6418  C CG    . TYR C 3 512 ? 186.095 147.906 147.218 1.00 30.68  ? 512 TYR C CG    1 
ATOM 6419  C CD1   . TYR C 3 512 ? 186.554 147.357 148.390 1.00 30.68  ? 512 TYR C CD1   1 
ATOM 6420  C CD2   . TYR C 3 512 ? 185.196 148.948 147.294 1.00 30.68  ? 512 TYR C CD2   1 
ATOM 6421  C CE1   . TYR C 3 512 ? 186.128 147.815 149.600 1.00 30.68  ? 512 TYR C CE1   1 
ATOM 6422  C CE2   . TYR C 3 512 ? 184.763 149.411 148.502 1.00 30.68  ? 512 TYR C CE2   1 
ATOM 6423  C CZ    . TYR C 3 512 ? 185.237 148.841 149.653 1.00 30.68  ? 512 TYR C CZ    1 
ATOM 6424  O OH    . TYR C 3 512 ? 184.815 149.295 150.873 1.00 30.68  ? 512 TYR C OH    1 
ATOM 6425  N N     . ASP C 3 513 ? 183.942 147.237 144.244 1.00 29.16  ? 513 ASP C N     1 
ATOM 6426  C CA    . ASP C 3 513 ? 182.525 147.535 144.114 1.00 29.16  ? 513 ASP C CA    1 
ATOM 6427  C C     . ASP C 3 513 ? 181.729 146.293 143.750 1.00 29.16  ? 513 ASP C C     1 
ATOM 6428  O O     . ASP C 3 513 ? 180.581 146.144 144.184 1.00 29.16  ? 513 ASP C O     1 
ATOM 6429  C CB    . ASP C 3 513 ? 182.316 148.639 143.090 1.00 29.16  ? 513 ASP C CB    1 
ATOM 6430  C CG    . ASP C 3 513 ? 182.775 149.984 143.603 1.00 29.16  ? 513 ASP C CG    1 
ATOM 6431  O OD1   . ASP C 3 513 ? 182.813 150.153 144.839 1.00 29.16  ? 513 ASP C OD1   1 
ATOM 6432  O OD2   . ASP C 3 513 ? 183.104 150.869 142.784 1.00 29.16  ? 513 ASP C OD2   1 
ATOM 6433  N N     . GLU C 3 514 ? 182.342 145.364 143.020 1.00 33.77  ? 514 GLU C N     1 
ATOM 6434  C CA    . GLU C 3 514 ? 181.655 144.123 142.692 1.00 33.77  ? 514 GLU C CA    1 
ATOM 6435  C C     . GLU C 3 514 ? 181.384 143.282 143.930 1.00 33.77  ? 514 GLU C C     1 
ATOM 6436  O O     . GLU C 3 514 ? 180.370 142.580 143.984 1.00 33.77  ? 514 GLU C O     1 
ATOM 6437  C CB    . GLU C 3 514 ? 182.493 143.327 141.691 1.00 33.77  ? 514 GLU C CB    1 
ATOM 6438  C CG    . GLU C 3 514 ? 182.587 143.958 140.305 1.00 33.77  ? 514 GLU C CG    1 
ATOM 6439  C CD    . GLU C 3 514 ? 183.393 143.129 139.322 1.00 33.77  ? 514 GLU C CD    1 
ATOM 6440  O OE1   . GLU C 3 514 ? 183.854 142.033 139.695 1.00 33.77  ? 514 GLU C OE1   1 
ATOM 6441  O OE2   . GLU C 3 514 ? 183.583 143.583 138.176 1.00 33.77  ? 514 GLU C OE2   1 
ATOM 6442  N N     . VAL C 3 515 ? 182.270 143.325 144.923 1.00 29.89  ? 515 VAL C N     1 
ATOM 6443  C CA    . VAL C 3 515 ? 182.051 142.550 146.142 1.00 29.89  ? 515 VAL C CA    1 
ATOM 6444  C C     . VAL C 3 515 ? 181.110 143.275 147.102 1.00 29.89  ? 515 VAL C C     1 
ATOM 6445  O O     . VAL C 3 515 ? 180.129 142.696 147.578 1.00 29.89  ? 515 VAL C O     1 
ATOM 6446  C CB    . VAL C 3 515 ? 183.382 142.161 146.812 1.00 29.89  ? 515 VAL C CB    1 
ATOM 6447  C CG1   . VAL C 3 515 ? 184.170 143.358 147.281 1.00 29.89  ? 515 VAL C CG1   1 
ATOM 6448  C CG2   . VAL C 3 515 ? 183.103 141.234 147.963 1.00 29.89  ? 515 VAL C CG2   1 
ATOM 6449  N N     . THR C 3 516 ? 181.395 144.539 147.414 1.00 29.13  ? 516 THR C N     1 
ATOM 6450  C CA    . THR C 3 516 ? 180.672 145.289 148.434 1.00 29.13  ? 516 THR C CA    1 
ATOM 6451  C C     . THR C 3 516 ? 179.397 145.958 147.946 1.00 29.13  ? 516 THR C C     1 
ATOM 6452  O O     . THR C 3 516 ? 178.769 146.674 148.730 1.00 29.13  ? 516 THR C O     1 
ATOM 6453  C CB    . THR C 3 516 ? 181.570 146.366 149.035 1.00 29.13  ? 516 THR C CB    1 
ATOM 6454  O OG1   . THR C 3 516 ? 180.943 146.905 150.201 1.00 29.13  ? 516 THR C OG1   1 
ATOM 6455  C CG2   . THR C 3 516 ? 181.753 147.486 148.054 1.00 29.13  ? 516 THR C CG2   1 
ATOM 6456  N N     . GLY C 3 517 ? 179.022 145.794 146.683 1.00 29.41  ? 517 GLY C N     1 
ATOM 6457  C CA    . GLY C 3 517 ? 177.838 146.435 146.154 1.00 29.41  ? 517 GLY C CA    1 
ATOM 6458  C C     . GLY C 3 517 ? 176.580 146.313 146.997 1.00 29.41  ? 517 GLY C C     1 
ATOM 6459  O O     . GLY C 3 517 ? 176.032 147.311 147.471 1.00 29.41  ? 517 GLY C O     1 
ATOM 6460  N N     . PRO C 3 518 ? 176.088 145.087 147.192 1.00 29.18  ? 518 PRO C N     1 
ATOM 6461  C CA    . PRO C 3 518 ? 174.844 144.900 147.957 1.00 29.18  ? 518 PRO C CA    1 
ATOM 6462  C C     . PRO C 3 518 ? 174.919 145.265 149.427 1.00 29.18  ? 518 PRO C C     1 
ATOM 6463  O O     . PRO C 3 518 ? 173.870 145.279 150.080 1.00 29.18  ? 518 PRO C O     1 
ATOM 6464  C CB    . PRO C 3 518 ? 174.554 143.411 147.784 1.00 29.18  ? 518 PRO C CB    1 
ATOM 6465  C CG    . PRO C 3 518 ? 175.310 143.021 146.571 1.00 29.18  ? 518 PRO C CG    1 
ATOM 6466  C CD    . PRO C 3 518 ? 176.537 143.838 146.567 1.00 29.18  ? 518 PRO C CD    1 
ATOM 6467  N N     . TYR C 3 519 ? 176.088 145.576 149.979 1.00 31.29  ? 519 TYR C N     1 
ATOM 6468  C CA    . TYR C 3 519 ? 176.175 145.885 151.399 1.00 31.29  ? 519 TYR C CA    1 
ATOM 6469  C C     . TYR C 3 519 ? 176.494 147.341 151.634 1.00 31.29  ? 519 TYR C C     1 
ATOM 6470  O O     . TYR C 3 519 ? 176.755 147.736 152.771 1.00 31.29  ? 519 TYR C O     1 
ATOM 6471  C CB    . TYR C 3 519 ? 177.160 144.997 152.157 1.00 31.29  ? 519 TYR C CB    1 
ATOM 6472  C CG    . TYR C 3 519 ? 176.924 143.535 151.997 1.00 31.29  ? 519 TYR C CG    1 
ATOM 6473  C CD1   . TYR C 3 519 ? 176.031 142.893 152.828 1.00 31.29  ? 519 TYR C CD1   1 
ATOM 6474  C CD2   . TYR C 3 519 ? 177.589 142.788 151.051 1.00 31.29  ? 519 TYR C CD2   1 
ATOM 6475  C CE1   . TYR C 3 519 ? 175.792 141.567 152.715 1.00 31.29  ? 519 TYR C CE1   1 
ATOM 6476  C CE2   . TYR C 3 519 ? 177.352 141.435 150.928 1.00 31.29  ? 519 TYR C CE2   1 
ATOM 6477  C CZ    . TYR C 3 519 ? 176.447 140.833 151.765 1.00 31.29  ? 519 TYR C CZ    1 
ATOM 6478  O OH    . TYR C 3 519 ? 176.194 139.488 151.655 1.00 31.29  ? 519 TYR C OH    1 
ATOM 6479  N N     . CYS C 3 520 ? 176.432 148.157 150.592 1.00 35.04  ? 520 CYS C N     1 
ATOM 6480  C CA    . CYS C 3 520 ? 176.603 149.587 150.751 1.00 35.04  ? 520 CYS C CA    1 
ATOM 6481  C C     . CYS C 3 520 ? 175.216 150.170 150.826 1.00 35.04  ? 520 CYS C C     1 
ATOM 6482  O O     . CYS C 3 520 ? 174.972 151.340 150.523 1.00 35.04  ? 520 CYS C O     1 
ATOM 6483  C CB    . CYS C 3 520 ? 177.393 150.156 149.572 1.00 35.04  ? 520 CYS C CB    1 
ATOM 6484  S SG    . CYS C 3 520 ? 178.166 151.765 149.809 1.00 35.04  ? 520 CYS C SG    1 
ATOM 6485  N N     . GLU C 3 521 ? 174.311 149.290 151.262 1.00 35.18  ? 521 GLU C N     1 
ATOM 6486  C CA    . GLU C 3 521 ? 172.871 149.496 151.339 1.00 35.18  ? 521 GLU C CA    1 
ATOM 6487  C C     . GLU C 3 521 ? 172.420 150.338 152.520 1.00 35.18  ? 521 GLU C C     1 
ATOM 6488  O O     . GLU C 3 521 ? 171.962 151.470 152.351 1.00 35.18  ? 521 GLU C O     1 
ATOM 6489  C CB    . GLU C 3 521 ? 172.190 148.131 151.390 1.00 35.18  ? 521 GLU C CB    1 
ATOM 6490  C CG    . GLU C 3 521 ? 170.739 148.265 151.241 1.00 35.18  ? 521 GLU C CG    1 
ATOM 6491  C CD    . GLU C 3 521 ? 170.421 148.789 149.878 1.00 35.18  ? 521 GLU C CD    1 
ATOM 6492  O OE1   . GLU C 3 521 ? 171.288 148.776 148.988 1.00 35.18  ? 521 GLU C OE1   1 
ATOM 6493  O OE2   . GLU C 3 521 ? 169.317 149.264 149.690 1.00 35.18  ? 521 GLU C OE2   1 
ATOM 6494  N N     . ARG C 3 522 ? 172.523 149.791 153.723 1.00 34.67  ? 522 ARG C N     1 
ATOM 6495  C CA    . ARG C 3 522 ? 172.128 150.568 154.876 1.00 34.67  ? 522 ARG C CA    1 
ATOM 6496  C C     . ARG C 3 522 ? 173.110 151.722 155.009 1.00 34.67  ? 522 ARG C C     1 
ATOM 6497  O O     . ARG C 3 522 ? 174.311 151.543 154.819 1.00 34.67  ? 522 ARG C O     1 
ATOM 6498  C CB    . ARG C 3 522 ? 172.082 149.717 156.145 1.00 34.67  ? 522 ARG C CB    1 
ATOM 6499  C CG    . ARG C 3 522 ? 173.371 149.052 156.550 1.00 34.67  ? 522 ARG C CG    1 
ATOM 6500  C CD    . ARG C 3 522 ? 173.762 147.921 155.617 1.00 34.67  ? 522 ARG C CD    1 
ATOM 6501  N NE    . ARG C 3 522 ? 172.821 146.813 155.603 1.00 34.67  ? 522 ARG C NE    1 
ATOM 6502  C CZ    . ARG C 3 522 ? 172.881 145.782 156.442 1.00 34.67  ? 522 ARG C CZ    1 
ATOM 6503  N NH1   . ARG C 3 522 ? 173.839 145.725 157.359 1.00 34.67  ? 522 ARG C NH1   1 
ATOM 6504  N NH2   . ARG C 3 522 ? 171.991 144.808 156.360 1.00 34.67  ? 522 ARG C NH2   1 
ATOM 6505  N N     . PRO C 3 523 ? 172.627 152.907 155.336 1.00 34.96  ? 523 PRO C N     1 
ATOM 6506  C CA    . PRO C 3 523 ? 173.473 154.101 155.271 1.00 34.96  ? 523 PRO C CA    1 
ATOM 6507  C C     . PRO C 3 523 ? 174.761 154.027 156.078 1.00 34.96  ? 523 PRO C C     1 
ATOM 6508  O O     . PRO C 3 523 ? 175.787 154.546 155.622 1.00 34.96  ? 523 PRO C O     1 
ATOM 6509  C CB    . PRO C 3 523 ? 172.527 155.193 155.779 1.00 34.96  ? 523 PRO C CB    1 
ATOM 6510  C CG    . PRO C 3 523 ? 171.496 154.484 156.555 1.00 34.96  ? 523 PRO C CG    1 
ATOM 6511  C CD    . PRO C 3 523 ? 171.290 153.198 155.857 1.00 34.96  ? 523 PRO C CD    1 
ATOM 6512  N N     . ARG C 3 524 ? 174.757 153.363 157.233 1.00 33.56  ? 524 ARG C N     1 
ATOM 6513  C CA    . ARG C 3 524 ? 175.959 153.280 158.062 1.00 33.56  ? 524 ARG C CA    1 
ATOM 6514  C C     . ARG C 3 524 ? 177.065 152.517 157.338 1.00 33.56  ? 524 ARG C C     1 
ATOM 6515  O O     . ARG C 3 524 ? 178.159 153.045 157.080 1.00 33.56  ? 524 ARG C O     1 
ATOM 6516  C CB    . ARG C 3 524 ? 175.619 152.605 159.386 1.00 33.56  ? 524 ARG C CB    1 
ATOM 6517  C CG    . ARG C 3 524 ? 176.803 152.329 160.281 1.00 33.56  ? 524 ARG C CG    1 
ATOM 6518  C CD    . ARG C 3 524 ? 176.309 151.552 161.479 1.00 33.56  ? 524 ARG C CD    1 
ATOM 6519  N NE    . ARG C 3 524 ? 177.370 151.144 162.386 1.00 33.56  ? 524 ARG C NE    1 
ATOM 6520  C CZ    . ARG C 3 524 ? 177.181 150.320 163.409 1.00 33.56  ? 524 ARG C CZ    1 
ATOM 6521  N NH1   . ARG C 3 524 ? 175.974 149.820 163.640 1.00 33.56  ? 524 ARG C NH1   1 
ATOM 6522  N NH2   . ARG C 3 524 ? 178.190 149.995 164.197 1.00 33.56  ? 524 ARG C NH2   1 
ATOM 6523  N N     . VAL C 3 525 ? 176.779 151.262 156.996 1.00 31.36  ? 525 VAL C N     1 
ATOM 6524  C CA    . VAL C 3 525 ? 177.730 150.425 156.277 1.00 31.36  ? 525 VAL C CA    1 
ATOM 6525  C C     . VAL C 3 525 ? 178.171 151.105 154.998 1.00 31.36  ? 525 VAL C C     1 
ATOM 6526  O O     . VAL C 3 525 ? 179.319 150.968 154.566 1.00 31.36  ? 525 VAL C O     1 
ATOM 6527  C CB    . VAL C 3 525 ? 177.128 149.043 156.015 1.00 31.36  ? 525 VAL C CB    1 
ATOM 6528  C CG1   . VAL C 3 525 ? 178.162 148.156 155.393 1.00 31.36  ? 525 VAL C CG1   1 
ATOM 6529  C CG2   . VAL C 3 525 ? 176.702 148.467 157.334 1.00 31.36  ? 525 VAL C CG2   1 
ATOM 6530  N N     . ALA C 3 526 ? 177.270 151.824 154.354 1.00 33.11  ? 526 ALA C N     1 
ATOM 6531  C CA    . ALA C 3 526 ? 177.683 152.553 153.170 1.00 33.11  ? 526 ALA C CA    1 
ATOM 6532  C C     . ALA C 3 526 ? 178.715 153.605 153.540 1.00 33.11  ? 526 ALA C C     1 
ATOM 6533  O O     . ALA C 3 526 ? 179.688 153.817 152.805 1.00 33.11  ? 526 ALA C O     1 
ATOM 6534  C CB    . ALA C 3 526 ? 176.476 153.203 152.504 1.00 33.11  ? 526 ALA C CB    1 
ATOM 6535  N N     . LYS C 3 527 ? 178.549 154.244 154.701 1.00 35.76  ? 527 LYS C N     1 
ATOM 6536  C CA    . LYS C 3 527 ? 179.503 155.265 155.116 1.00 35.76  ? 527 LYS C CA    1 
ATOM 6537  C C     . LYS C 3 527 ? 180.892 154.696 155.325 1.00 35.76  ? 527 LYS C C     1 
ATOM 6538  O O     . LYS C 3 527 ? 181.879 155.209 154.779 1.00 35.76  ? 527 LYS C O     1 
ATOM 6539  C CB    . LYS C 3 527 ? 179.034 155.914 156.419 1.00 35.76  ? 527 LYS C CB    1 
ATOM 6540  C CG    . LYS C 3 527 ? 180.080 156.833 157.045 1.00 35.76  ? 527 LYS C CG    1 
ATOM 6541  C CD    . LYS C 3 527 ? 179.524 157.607 158.234 1.00 35.76  ? 527 LYS C CD    1 
ATOM 6542  C CE    . LYS C 3 527 ? 180.441 158.761 158.617 1.00 35.76  ? 527 LYS C CE    1 
ATOM 6543  N NZ    . LYS C 3 527 ? 181.748 158.298 159.134 1.00 35.76  ? 527 LYS C NZ    1 
ATOM 6544  N N     . VAL C 3 528 ? 180.988 153.619 156.094 1.00 32.63  ? 528 VAL C N     1 
ATOM 6545  C CA    . VAL C 3 528 ? 182.290 152.988 156.291 1.00 32.63  ? 528 VAL C CA    1 
ATOM 6546  C C     . VAL C 3 528 ? 182.869 152.470 154.977 1.00 32.63  ? 528 VAL C C     1 
ATOM 6547  O O     . VAL C 3 528 ? 184.013 152.776 154.622 1.00 32.63  ? 528 VAL C O     1 
ATOM 6548  C CB    . VAL C 3 528 ? 182.210 151.893 157.366 1.00 32.63  ? 528 VAL C CB    1 
ATOM 6549  C CG1   . VAL C 3 528 ? 181.277 150.809 156.972 1.00 32.63  ? 528 VAL C CG1   1 
ATOM 6550  C CG2   . VAL C 3 528 ? 183.574 151.323 157.606 1.00 32.63  ? 528 VAL C CG2   1 
ATOM 6551  N N     . VAL C 3 529 ? 182.076 151.705 154.223 1.00 30.25  ? 529 VAL C N     1 
ATOM 6552  C CA    . VAL C 3 529 ? 182.573 151.078 153.004 1.00 30.25  ? 529 VAL C CA    1 
ATOM 6553  C C     . VAL C 3 529 ? 183.118 152.088 152.018 1.00 30.25  ? 529 VAL C C     1 
ATOM 6554  O O     . VAL C 3 529 ? 184.202 151.896 151.454 1.00 30.25  ? 529 VAL C O     1 
ATOM 6555  C CB    . VAL C 3 529 ? 181.436 150.274 152.356 1.00 30.25  ? 529 VAL C CB    1 
ATOM 6556  C CG1   . VAL C 3 529 ? 181.746 149.989 150.921 1.00 30.25  ? 529 VAL C CG1   1 
ATOM 6557  C CG2   . VAL C 3 529 ? 181.216 149.011 153.095 1.00 30.25  ? 529 VAL C CG2   1 
ATOM 6558  N N     . GLU C 3 530 ? 182.427 153.195 151.822 1.00 33.03  ? 530 GLU C N     1 
ATOM 6559  C CA    . GLU C 3 530 ? 182.983 154.166 150.894 1.00 33.03  ? 530 GLU C CA    1 
ATOM 6560  C C     . GLU C 3 530 ? 184.150 154.926 151.501 1.00 33.03  ? 530 GLU C C     1 
ATOM 6561  O O     . GLU C 3 530 ? 185.160 155.146 150.821 1.00 33.03  ? 530 GLU C O     1 
ATOM 6562  C CB    . GLU C 3 530 ? 181.882 155.029 150.309 1.00 33.03  ? 530 GLU C CB    1 
ATOM 6563  C CG    . GLU C 3 530 ? 181.086 154.094 149.390 1.00 33.03  ? 530 GLU C CG    1 
ATOM 6564  C CD    . GLU C 3 530 ? 180.163 154.786 148.449 1.00 33.03  ? 530 GLU C CD    1 
ATOM 6565  O OE1   . GLU C 3 530 ? 179.732 155.899 148.784 1.00 33.03  ? 530 GLU C OE1   1 
ATOM 6566  O OE2   . GLU C 3 530 ? 179.879 154.216 147.371 1.00 33.03  ? 530 GLU C OE2   1 
ATOM 6567  N N     . ARG C 3 531 ? 184.064 155.298 152.782 1.00 33.32  ? 531 ARG C N     1 
ATOM 6568  C CA    . ARG C 3 531 ? 185.182 156.042 153.350 1.00 33.32  ? 531 ARG C CA    1 
ATOM 6569  C C     . ARG C 3 531 ? 186.454 155.202 153.361 1.00 33.32  ? 531 ARG C C     1 
ATOM 6570  O O     . ARG C 3 531 ? 187.553 155.761 153.406 1.00 33.32  ? 531 ARG C O     1 
ATOM 6571  C CB    . ARG C 3 531 ? 184.822 156.538 154.752 1.00 33.32  ? 531 ARG C CB    1 
ATOM 6572  C CG    . ARG C 3 531 ? 185.897 157.377 155.442 1.00 33.32  ? 531 ARG C CG    1 
ATOM 6573  C CD    . ARG C 3 531 ? 186.886 156.552 156.240 1.00 33.32  ? 531 ARG C CD    1 
ATOM 6574  N NE    . ARG C 3 531 ? 186.232 155.743 157.255 1.00 33.32  ? 531 ARG C NE    1 
ATOM 6575  C CZ    . ARG C 3 531 ? 185.924 156.185 158.466 1.00 33.32  ? 531 ARG C CZ    1 
ATOM 6576  N NH1   . ARG C 3 531 ? 186.206 157.435 158.802 1.00 33.32  ? 531 ARG C NH1   1 
ATOM 6577  N NH2   . ARG C 3 531 ? 185.328 155.383 159.336 1.00 33.32  ? 531 ARG C NH2   1 
ATOM 6578  N N     . HIS C 3 532 ? 186.340 153.880 153.242 1.00 33.19  ? 532 HIS C N     1 
ATOM 6579  C CA    . HIS C 3 532 ? 187.519 153.042 153.094 1.00 33.19  ? 532 HIS C CA    1 
ATOM 6580  C C     . HIS C 3 532 ? 187.786 152.710 151.641 1.00 33.19  ? 532 HIS C C     1 
ATOM 6581  O O     . HIS C 3 532 ? 188.868 152.214 151.325 1.00 33.19  ? 532 HIS C O     1 
ATOM 6582  C CB    . HIS C 3 532 ? 187.414 151.742 153.898 1.00 33.19  ? 532 HIS C CB    1 
ATOM 6583  C CG    . HIS C 3 532 ? 187.508 151.931 155.378 1.00 33.19  ? 532 HIS C CG    1 
ATOM 6584  N ND1   . HIS C 3 532 ? 188.644 152.406 155.993 1.00 33.19  ? 532 HIS C ND1   1 
ATOM 6585  C CD2   . HIS C 3 532 ? 186.619 151.689 156.367 1.00 33.19  ? 532 HIS C CD2   1 
ATOM 6586  C CE1   . HIS C 3 532 ? 188.445 152.462 157.298 1.00 33.19  ? 532 HIS C CE1   1 
ATOM 6587  N NE2   . HIS C 3 532 ? 187.223 152.032 157.551 1.00 33.19  ? 532 HIS C NE2   1 
ATOM 6588  N N     . ARG C 3 533 ? 186.828 152.969 150.754 1.00 30.75  ? 533 ARG C N     1 
ATOM 6589  C CA    . ARG C 3 533 ? 187.093 152.767 149.340 1.00 30.75  ? 533 ARG C CA    1 
ATOM 6590  C C     . ARG C 3 533 ? 187.920 153.916 148.810 1.00 30.75  ? 533 ARG C C     1 
ATOM 6591  O O     . ARG C 3 533 ? 188.709 153.735 147.881 1.00 30.75  ? 533 ARG C O     1 
ATOM 6592  C CB    . ARG C 3 533 ? 185.783 152.668 148.570 1.00 30.75  ? 533 ARG C CB    1 
ATOM 6593  C CG    . ARG C 3 533 ? 185.907 152.542 147.067 1.00 30.75  ? 533 ARG C CG    1 
ATOM 6594  C CD    . ARG C 3 533 ? 184.517 152.478 146.466 1.00 30.75  ? 533 ARG C CD    1 
ATOM 6595  N NE    . ARG C 3 533 ? 184.499 152.450 145.009 1.00 30.75  ? 533 ARG C NE    1 
ATOM 6596  C CZ    . ARG C 3 533 ? 184.454 153.531 144.244 1.00 30.75  ? 533 ARG C CZ    1 
ATOM 6597  N NH1   . ARG C 3 533 ? 184.417 154.731 144.798 1.00 30.75  ? 533 ARG C NH1   1 
ATOM 6598  N NH2   . ARG C 3 533 ? 184.434 153.410 142.927 1.00 30.75  ? 533 ARG C NH2   1 
ATOM 6599  N N     . SER C 3 534 ? 187.757 155.095 149.408 1.00 31.89  ? 534 SER C N     1 
ATOM 6600  C CA    . SER C 3 534 ? 188.500 156.267 148.970 1.00 31.89  ? 534 SER C CA    1 
ATOM 6601  C C     . SER C 3 534 ? 190.001 156.035 148.988 1.00 31.89  ? 534 SER C C     1 
ATOM 6602  O O     . SER C 3 534 ? 190.733 156.690 148.242 1.00 31.89  ? 534 SER C O     1 
ATOM 6603  C CB    . SER C 3 534 ? 188.156 157.454 149.855 1.00 31.89  ? 534 SER C CB    1 
ATOM 6604  O OG    . SER C 3 534 ? 188.576 157.204 151.181 1.00 31.89  ? 534 SER C OG    1 
ATOM 6605  N N     . THR C 3 535 ? 190.484 155.122 149.835 1.00 32.21  ? 535 THR C N     1 
ATOM 6606  C CA    . THR C 3 535 ? 191.927 154.943 149.953 1.00 32.21  ? 535 THR C CA    1 
ATOM 6607  C C     . THR C 3 535 ? 192.515 154.310 148.706 1.00 32.21  ? 535 THR C C     1 
ATOM 6608  O O     . THR C 3 535 ? 193.685 154.545 148.392 1.00 32.21  ? 535 THR C O     1 
ATOM 6609  C CB    . THR C 3 535 ? 192.283 154.086 151.169 1.00 32.21  ? 535 THR C CB    1 
ATOM 6610  O OG1   . THR C 3 535 ? 191.811 152.746 150.975 1.00 32.21  ? 535 THR C OG1   1 
ATOM 6611  C CG2   . THR C 3 535 ? 191.677 154.664 152.430 1.00 32.21  ? 535 THR C CG2   1 
ATOM 6612  N N     . LEU C 3 536 ? 191.730 153.516 147.979 1.00 30.68  ? 536 LEU C N     1 
ATOM 6613  C CA    . LEU C 3 536 ? 192.271 152.852 146.803 1.00 30.68  ? 536 LEU C CA    1 
ATOM 6614  C C     . LEU C 3 536 ? 192.459 153.816 145.648 1.00 30.68  ? 536 LEU C C     1 
ATOM 6615  O O     . LEU C 3 536 ? 192.998 153.423 144.612 1.00 30.68  ? 536 LEU C O     1 
ATOM 6616  C CB    . LEU C 3 536 ? 191.340 151.740 146.336 1.00 30.68  ? 536 LEU C CB    1 
ATOM 6617  C CG    . LEU C 3 536 ? 191.478 150.351 146.925 1.00 30.68  ? 536 LEU C CG    1 
ATOM 6618  C CD1   . LEU C 3 536 ? 191.154 150.418 148.394 1.00 30.68  ? 536 LEU C CD1   1 
ATOM 6619  C CD2   . LEU C 3 536 ? 190.557 149.417 146.215 1.00 30.68  ? 536 LEU C CD2   1 
ATOM 6620  N N     . PHE C 3 537 ? 192.002 155.057 145.800 1.00 32.66  ? 537 PHE C N     1 
ATOM 6621  C CA    . PHE C 3 537 ? 192.112 156.056 144.745 1.00 32.66  ? 537 PHE C CA    1 
ATOM 6622  C C     . PHE C 3 537 ? 193.550 156.497 144.500 1.00 32.66  ? 537 PHE C C     1 
ATOM 6623  O O     . PHE C 3 537 ? 193.883 156.903 143.382 1.00 32.66  ? 537 PHE C O     1 
ATOM 6624  C CB    . PHE C 3 537 ? 191.217 157.230 145.112 1.00 32.66  ? 537 PHE C CB    1 
ATOM 6625  C CG    . PHE C 3 537 ? 189.768 156.983 144.821 1.00 32.66  ? 537 PHE C CG    1 
ATOM 6626  C CD1   . PHE C 3 537 ? 189.393 156.046 143.883 1.00 32.66  ? 537 PHE C CD1   1 
ATOM 6627  C CD2   . PHE C 3 537 ? 188.783 157.588 145.576 1.00 32.66  ? 537 PHE C CD2   1 
ATOM 6628  C CE1   . PHE C 3 537 ? 188.063 155.800 143.633 1.00 32.66  ? 537 PHE C CE1   1 
ATOM 6629  C CE2   . PHE C 3 537 ? 187.451 157.338 145.331 1.00 32.66  ? 537 PHE C CE2   1 
ATOM 6630  C CZ    . PHE C 3 537 ? 187.093 156.437 144.361 1.00 32.66  ? 537 PHE C CZ    1 
ATOM 6631  N N     . SER C 3 538 ? 194.407 156.422 145.514 1.00 31.73  ? 538 SER C N     1 
ATOM 6632  C CA    . SER C 3 538 ? 195.813 156.808 145.384 1.00 31.73  ? 538 SER C CA    1 
ATOM 6633  C C     . SER C 3 538 ? 195.993 158.229 144.856 1.00 31.73  ? 538 SER C C     1 
ATOM 6634  O O     . SER C 3 538 ? 195.084 159.050 144.928 1.00 31.73  ? 538 SER C O     1 
ATOM 6635  C CB    . SER C 3 538 ? 196.559 155.827 144.475 1.00 31.73  ? 538 SER C CB    1 
ATOM 6636  O OG    . SER C 3 538 ? 197.923 156.196 144.356 1.00 31.73  ? 538 SER C OG    1 
ATOM 6637  N N     . THR D 4 2   ? 164.645 105.582 134.175 1.00 50.83  ? 2   THR D N     1 
ATOM 6638  C CA    . THR D 4 2   ? 163.596 106.223 134.950 1.00 50.83  ? 2   THR D CA    1 
ATOM 6639  C C     . THR D 4 2   ? 164.184 106.979 136.118 1.00 50.83  ? 2   THR D C     1 
ATOM 6640  O O     . THR D 4 2   ? 164.711 106.379 137.046 1.00 50.83  ? 2   THR D O     1 
ATOM 6641  C CB    . THR D 4 2   ? 162.605 105.210 135.474 1.00 50.83  ? 2   THR D CB    1 
ATOM 6642  O OG1   . THR D 4 2   ? 162.183 104.364 134.399 1.00 50.83  ? 2   THR D OG1   1 
ATOM 6643  C CG2   . THR D 4 2   ? 161.416 105.913 136.061 1.00 50.83  ? 2   THR D CG2   1 
ATOM 6644  N N     . PHE D 4 3   ? 164.070 108.298 136.082 1.00 45.53  ? 3   PHE D N     1 
ATOM 6645  C CA    . PHE D 4 3   ? 164.605 109.159 137.120 1.00 45.53  ? 3   PHE D CA    1 
ATOM 6646  C C     . PHE D 4 3   ? 163.465 109.950 137.724 1.00 45.53  ? 3   PHE D C     1 
ATOM 6647  O O     . PHE D 4 3   ? 162.725 110.603 136.988 1.00 45.53  ? 3   PHE D O     1 
ATOM 6648  C CB    . PHE D 4 3   ? 165.582 110.161 136.525 1.00 45.53  ? 3   PHE D CB    1 
ATOM 6649  C CG    . PHE D 4 3   ? 166.771 109.553 135.872 1.00 45.53  ? 3   PHE D CG    1 
ATOM 6650  C CD1   . PHE D 4 3   ? 167.122 108.245 136.078 1.00 45.53  ? 3   PHE D CD1   1 
ATOM 6651  C CD2   . PHE D 4 3   ? 167.509 110.290 134.997 1.00 45.53  ? 3   PHE D CD2   1 
ATOM 6652  C CE1   . PHE D 4 3   ? 168.210 107.716 135.435 1.00 45.53  ? 3   PHE D CE1   1 
ATOM 6653  C CE2   . PHE D 4 3   ? 168.590 109.772 134.366 1.00 45.53  ? 3   PHE D CE2   1 
ATOM 6654  C CZ    . PHE D 4 3   ? 168.945 108.481 134.585 1.00 45.53  ? 3   PHE D CZ    1 
ATOM 6655  N N     . VAL D 4 4   ? 163.325 109.923 139.044 1.00 38.96  ? 4   VAL D N     1 
ATOM 6656  C CA    . VAL D 4 4   ? 162.294 110.720 139.699 1.00 38.96  ? 4   VAL D CA    1 
ATOM 6657  C C     . VAL D 4 4   ? 163.021 111.838 140.415 1.00 38.96  ? 4   VAL D C     1 
ATOM 6658  O O     . VAL D 4 4   ? 163.941 111.589 141.198 1.00 38.96  ? 4   VAL D O     1 
ATOM 6659  C CB    . VAL D 4 4   ? 161.371 109.907 140.619 1.00 38.96  ? 4   VAL D CB    1 
ATOM 6660  C CG1   . VAL D 4 4   ? 160.846 108.695 139.890 1.00 38.96  ? 4   VAL D CG1   1 
ATOM 6661  C CG2   . VAL D 4 4   ? 161.987 109.541 141.898 1.00 38.96  ? 4   VAL D CG2   1 
ATOM 6662  N N     . ASP D 4 5   ? 162.654 113.068 140.118 1.00 35.48  ? 5   ASP D N     1 
ATOM 6663  C CA    . ASP D 4 5   ? 163.328 114.207 140.703 1.00 35.48  ? 5   ASP D CA    1 
ATOM 6664  C C     . ASP D 4 5   ? 162.307 115.117 141.352 1.00 35.48  ? 5   ASP D C     1 
ATOM 6665  O O     . ASP D 4 5   ? 161.139 115.161 140.957 1.00 35.48  ? 5   ASP D O     1 
ATOM 6666  C CB    . ASP D 4 5   ? 164.158 114.958 139.670 1.00 35.48  ? 5   ASP D CB    1 
ATOM 6667  C CG    . ASP D 4 5   ? 163.348 115.427 138.503 1.00 35.48  ? 5   ASP D CG    1 
ATOM 6668  O OD1   . ASP D 4 5   ? 162.151 115.100 138.447 1.00 35.48  ? 5   ASP D OD1   1 
ATOM 6669  O OD2   . ASP D 4 5   ? 163.900 116.130 137.635 1.00 35.48  ? 5   ASP D OD2   1 
ATOM 6670  N N     . ILE D 4 6   ? 162.771 115.828 142.365 1.00 33.96  ? 6   ILE D N     1 
ATOM 6671  C CA    . ILE D 4 6   ? 161.933 116.656 143.204 1.00 33.96  ? 6   ILE D CA    1 
ATOM 6672  C C     . ILE D 4 6   ? 162.483 118.056 143.229 1.00 33.96  ? 6   ILE D C     1 
ATOM 6673  O O     . ILE D 4 6   ? 163.698 118.258 143.336 1.00 33.96  ? 6   ILE D O     1 
ATOM 6674  C CB    . ILE D 4 6   ? 161.913 116.108 144.638 1.00 33.96  ? 6   ILE D CB    1 
ATOM 6675  C CG1   . ILE D 4 6   ? 161.465 114.660 144.653 1.00 33.96  ? 6   ILE D CG1   1 
ATOM 6676  C CG2   . ILE D 4 6   ? 161.067 116.960 145.520 1.00 33.96  ? 6   ILE D CG2   1 
ATOM 6677  C CD1   . ILE D 4 6   ? 162.593 113.698 144.364 1.00 33.96  ? 6   ILE D CD1   1 
ATOM 6678  N N     . HIS D 4 7   ? 161.584 119.022 143.130 1.00 33.49  ? 7   HIS D N     1 
ATOM 6679  C CA    . HIS D 4 7   ? 161.929 120.421 143.243 1.00 33.49  ? 7   HIS D CA    1 
ATOM 6680  C C     . HIS D 4 7   ? 161.096 120.964 144.384 1.00 33.49  ? 7   HIS D C     1 
ATOM 6681  O O     . HIS D 4 7   ? 159.894 120.705 144.440 1.00 33.49  ? 7   HIS D O     1 
ATOM 6682  C CB    . HIS D 4 7   ? 161.606 121.129 141.940 1.00 33.49  ? 7   HIS D CB    1 
ATOM 6683  C CG    . HIS D 4 7   ? 162.088 120.397 140.725 1.00 33.49  ? 7   HIS D CG    1 
ATOM 6684  N ND1   . HIS D 4 7   ? 161.728 119.096 140.450 1.00 33.49  ? 7   HIS D ND1   1 
ATOM 6685  C CD2   . HIS D 4 7   ? 162.876 120.788 139.699 1.00 33.49  ? 7   HIS D CD2   1 
ATOM 6686  C CE1   . HIS D 4 7   ? 162.287 118.711 139.320 1.00 33.49  ? 7   HIS D CE1   1 
ATOM 6687  N NE2   . HIS D 4 7   ? 162.985 119.722 138.841 1.00 33.49  ? 7   HIS D NE2   1 
ATOM 6688  N N     . ALA D 4 8   ? 161.707 121.711 145.283 1.00 28.04  ? 8   ALA D N     1 
ATOM 6689  C CA    . ALA D 4 8   ? 160.968 122.280 146.392 1.00 28.04  ? 8   ALA D CA    1 
ATOM 6690  C C     . ALA D 4 8   ? 161.322 123.740 146.564 1.00 28.04  ? 8   ALA D C     1 
ATOM 6691  O O     . ALA D 4 8   ? 162.422 124.158 146.210 1.00 28.04  ? 8   ALA D O     1 
ATOM 6692  C CB    . ALA D 4 8   ? 161.240 121.527 147.677 1.00 28.04  ? 8   ALA D CB    1 
ATOM 6693  N N     . ILE D 4 9   ? 160.382 124.525 147.077 1.00 30.02  ? 9   ILE D N     1 
ATOM 6694  C CA    . ILE D 4 9   ? 160.692 125.932 147.291 1.00 30.02  ? 9   ILE D CA    1 
ATOM 6695  C C     . ILE D 4 9   ? 160.483 126.174 148.775 1.00 30.02  ? 9   ILE D C     1 
ATOM 6696  O O     . ILE D 4 9   ? 159.473 126.737 149.195 1.00 30.02  ? 9   ILE D O     1 
ATOM 6697  C CB    . ILE D 4 9   ? 159.850 126.878 146.432 1.00 30.02  ? 9   ILE D CB    1 
ATOM 6698  C CG1   . ILE D 4 9   ? 160.347 126.817 145.008 1.00 30.02  ? 9   ILE D CG1   1 
ATOM 6699  C CG2   . ILE D 4 9   ? 160.054 128.309 146.852 1.00 30.02  ? 9   ILE D CG2   1 
ATOM 6700  C CD1   . ILE D 4 9   ? 159.799 127.916 144.166 1.00 30.02  ? 9   ILE D CD1   1 
ATOM 6701  N N     . GLN D 4 10  ? 161.417 125.709 149.584 1.00 32.80  ? 10  GLN D N     1 
ATOM 6702  C CA    . GLN D 4 10  ? 161.289 125.804 151.027 1.00 32.80  ? 10  GLN D CA    1 
ATOM 6703  C C     . GLN D 4 10  ? 161.904 127.085 151.538 1.00 32.80  ? 10  GLN D C     1 
ATOM 6704  O O     . GLN D 4 10  ? 163.057 127.383 151.235 1.00 32.80  ? 10  GLN D O     1 
ATOM 6705  C CB    . GLN D 4 10  ? 161.958 124.622 151.708 1.00 32.80  ? 10  GLN D CB    1 
ATOM 6706  C CG    . GLN D 4 10  ? 161.843 124.686 153.193 1.00 32.80  ? 10  GLN D CG    1 
ATOM 6707  C CD    . GLN D 4 10  ? 162.406 123.469 153.845 1.00 32.80  ? 10  GLN D CD    1 
ATOM 6708  O OE1   . GLN D 4 10  ? 162.825 122.532 153.173 1.00 32.80  ? 10  GLN D OE1   1 
ATOM 6709  N NE2   . GLN D 4 10  ? 162.386 123.448 155.159 1.00 32.80  ? 10  GLN D NE2   1 
ATOM 6710  N N     . THR D 4 11  ? 161.144 127.837 152.313 1.00 32.88  ? 11  THR D N     1 
ATOM 6711  C CA    . THR D 4 11  ? 161.658 129.080 152.851 1.00 32.88  ? 11  THR D CA    1 
ATOM 6712  C C     . THR D 4 11  ? 162.128 128.871 154.277 1.00 32.88  ? 11  THR D C     1 
ATOM 6713  O O     . THR D 4 11  ? 161.663 127.973 154.978 1.00 32.88  ? 11  THR D O     1 
ATOM 6714  C CB    . THR D 4 11  ? 160.596 130.168 152.838 1.00 32.88  ? 11  THR D CB    1 
ATOM 6715  O OG1   . THR D 4 11  ? 161.098 131.313 153.530 1.00 32.88  ? 11  THR D OG1   1 
ATOM 6716  C CG2   . THR D 4 11  ? 159.372 129.682 153.518 1.00 32.88  ? 11  THR D CG2   1 
ATOM 6717  N N     . LEU D 4 12  ? 163.086 129.690 154.694 1.00 33.59  ? 12  LEU D N     1 
ATOM 6718  C CA    . LEU D 4 12  ? 163.645 129.608 156.025 1.00 33.59  ? 12  LEU D CA    1 
ATOM 6719  C C     . LEU D 4 12  ? 163.726 131.007 156.612 1.00 33.59  ? 12  LEU D C     1 
ATOM 6720  O O     . LEU D 4 12  ? 164.310 131.921 155.986 1.00 33.59  ? 12  LEU D O     1 
ATOM 6721  C CB    . LEU D 4 12  ? 165.017 128.951 156.051 1.00 33.59  ? 12  LEU D CB    1 
ATOM 6722  C CG    . LEU D 4 12  ? 165.017 127.502 155.597 1.00 33.59  ? 12  LEU D CG    1 
ATOM 6723  C CD1   . LEU D 4 12  ? 166.413 127.074 155.337 1.00 33.59  ? 12  LEU D CD1   1 
ATOM 6724  C CD2   . LEU D 4 12  ? 164.393 126.614 156.636 1.00 33.59  ? 12  LEU D CD2   1 
ATOM 6725  N N     . PRO D 4 13  ? 163.173 131.207 157.787 1.00 32.20  ? 13  PRO D N     1 
ATOM 6726  C CA    . PRO D 4 13  ? 163.354 132.463 158.504 1.00 32.20  ? 13  PRO D CA    1 
ATOM 6727  C C     . PRO D 4 13  ? 164.796 132.687 158.895 1.00 32.20  ? 13  PRO D C     1 
ATOM 6728  O O     . PRO D 4 13  ? 165.663 131.851 158.640 1.00 32.20  ? 13  PRO D O     1 
ATOM 6729  C CB    . PRO D 4 13  ? 162.463 132.289 159.735 1.00 32.20  ? 13  PRO D CB    1 
ATOM 6730  C CG    . PRO D 4 13  ? 162.306 130.840 159.883 1.00 32.20  ? 13  PRO D CG    1 
ATOM 6731  C CD    . PRO D 4 13  ? 162.313 130.272 158.517 1.00 32.20  ? 13  PRO D CD    1 
ATOM 6732  N N     . TYR D 4 14  ? 165.041 133.833 159.517 1.00 34.35  ? 14  TYR D N     1 
ATOM 6733  C CA    . TYR D 4 14  ? 166.348 134.278 159.974 1.00 34.35  ? 14  TYR D CA    1 
ATOM 6734  C C     . TYR D 4 14  ? 167.136 133.150 160.605 1.00 34.35  ? 14  TYR D C     1 
ATOM 6735  O O     . TYR D 4 14  ? 166.850 132.748 161.731 1.00 34.35  ? 14  TYR D O     1 
ATOM 6736  C CB    . TYR D 4 14  ? 166.130 135.406 160.960 1.00 34.35  ? 14  TYR D CB    1 
ATOM 6737  C CG    . TYR D 4 14  ? 167.313 136.227 161.334 1.00 34.35  ? 14  TYR D CG    1 
ATOM 6738  C CD1   . TYR D 4 14  ? 167.775 137.199 160.480 1.00 34.35  ? 14  TYR D CD1   1 
ATOM 6739  C CD2   . TYR D 4 14  ? 167.887 136.129 162.574 1.00 34.35  ? 14  TYR D CD2   1 
ATOM 6740  C CE1   . TYR D 4 14  ? 168.815 137.996 160.816 1.00 34.35  ? 14  TYR D CE1   1 
ATOM 6741  C CE2   . TYR D 4 14  ? 168.924 136.937 162.923 1.00 34.35  ? 14  TYR D CE2   1 
ATOM 6742  C CZ    . TYR D 4 14  ? 169.387 137.863 162.033 1.00 34.35  ? 14  TYR D CZ    1 
ATOM 6743  O OH    . TYR D 4 14  ? 170.434 138.668 162.369 1.00 34.35  ? 14  TYR D OH    1 
ATOM 6744  N N     . SER D 4 15  ? 168.150 132.652 159.907 1.00 32.79  ? 15  SER D N     1 
ATOM 6745  C CA    . SER D 4 15  ? 168.862 131.472 160.371 1.00 32.79  ? 15  SER D CA    1 
ATOM 6746  C C     . SER D 4 15  ? 170.251 131.441 159.757 1.00 32.79  ? 15  SER D C     1 
ATOM 6747  O O     . SER D 4 15  ? 170.574 132.215 158.862 1.00 32.79  ? 15  SER D O     1 
ATOM 6748  C CB    . SER D 4 15  ? 168.110 130.202 160.006 1.00 32.79  ? 15  SER D CB    1 
ATOM 6749  O OG    . SER D 4 15  ? 167.848 130.199 158.622 1.00 32.79  ? 15  SER D OG    1 
ATOM 6750  N N     . ASN D 4 16  ? 171.078 130.551 160.280 1.00 30.90  ? 16  ASN D N     1 
ATOM 6751  C CA    . ASN D 4 16  ? 172.415 130.302 159.799 1.00 30.90  ? 16  ASN D CA    1 
ATOM 6752  C C     . ASN D 4 16  ? 172.603 128.793 159.828 1.00 30.90  ? 16  ASN D C     1 
ATOM 6753  O O     . ASN D 4 16  ? 173.368 128.271 160.620 1.00 30.90  ? 16  ASN D O     1 
ATOM 6754  C CB    . ASN D 4 16  ? 173.449 131.011 160.652 1.00 30.90  ? 16  ASN D CB    1 
ATOM 6755  C CG    . ASN D 4 16  ? 174.766 131.077 159.991 1.00 30.90  ? 16  ASN D CG    1 
ATOM 6756  O OD1   . ASN D 4 16  ? 174.971 130.468 158.948 1.00 30.90  ? 16  ASN D OD1   1 
ATOM 6757  N ND2   . ASN D 4 16  ? 175.693 131.797 160.596 1.00 30.90  ? 16  ASN D ND2   1 
ATOM 6758  N N     . ILE D 4 17  ? 171.878 128.074 158.974 1.00 30.94  ? 17  ILE D N     1 
ATOM 6759  C CA    . ILE D 4 17  ? 171.876 126.619 159.087 1.00 30.94  ? 17  ILE D CA    1 
ATOM 6760  C C     . ILE D 4 17  ? 173.267 126.030 158.928 1.00 30.94  ? 17  ILE D C     1 
ATOM 6761  O O     . ILE D 4 17  ? 173.702 125.225 159.755 1.00 30.94  ? 17  ILE D O     1 
ATOM 6762  C CB    . ILE D 4 17  ? 170.918 126.027 158.046 1.00 30.94  ? 17  ILE D CB    1 
ATOM 6763  C CG1   . ILE D 4 17  ? 169.504 126.457 158.363 1.00 30.94  ? 17  ILE D CG1   1 
ATOM 6764  C CG2   . ILE D 4 17  ? 171.033 124.563 158.016 1.00 30.94  ? 17  ILE D CG2   1 
ATOM 6765  C CD1   . ILE D 4 17  ? 168.486 125.577 157.746 1.00 30.94  ? 17  ILE D CD1   1 
ATOM 6766  N N     . ASN D 4 18  ? 173.997 126.428 157.897 1.00 30.28  ? 18  ASN D N     1 
ATOM 6767  C CA    . ASN D 4 18  ? 175.377 126.009 157.709 1.00 30.28  ? 18  ASN D CA    1 
ATOM 6768  C C     . ASN D 4 18  ? 176.221 127.266 157.602 1.00 30.28  ? 18  ASN D C     1 
ATOM 6769  O O     . ASN D 4 18  ? 175.733 128.314 157.184 1.00 30.28  ? 18  ASN D O     1 
ATOM 6770  C CB    . ASN D 4 18  ? 175.607 125.061 156.541 1.00 30.28  ? 18  ASN D CB    1 
ATOM 6771  C CG    . ASN D 4 18  ? 175.482 125.709 155.221 1.00 30.28  ? 18  ASN D CG    1 
ATOM 6772  O OD1   . ASN D 4 18  ? 175.182 126.887 155.102 1.00 30.28  ? 18  ASN D OD1   1 
ATOM 6773  N ND2   . ASN D 4 18  ? 175.783 124.942 154.189 1.00 30.28  ? 18  ASN D ND2   1 
ATOM 6774  N N     . ARG D 4 19  ? 177.485 127.190 157.979 1.00 29.54  ? 19  ARG D N     1 
ATOM 6775  C CA    . ARG D 4 19  ? 178.308 128.364 157.778 1.00 29.54  ? 19  ARG D CA    1 
ATOM 6776  C C     . ARG D 4 19  ? 179.722 127.994 157.370 1.00 29.54  ? 19  ARG D C     1 
ATOM 6777  O O     . ARG D 4 19  ? 180.173 126.864 157.532 1.00 29.54  ? 19  ARG D O     1 
ATOM 6778  C CB    . ARG D 4 19  ? 178.353 129.202 159.045 1.00 29.54  ? 19  ARG D CB    1 
ATOM 6779  C CG    . ARG D 4 19  ? 178.866 128.447 160.215 1.00 29.54  ? 19  ARG D CG    1 
ATOM 6780  C CD    . ARG D 4 19  ? 179.061 129.377 161.377 1.00 29.54  ? 19  ARG D CD    1 
ATOM 6781  N NE    . ARG D 4 19  ? 179.322 128.666 162.615 1.00 29.54  ? 19  ARG D NE    1 
ATOM 6782  C CZ    . ARG D 4 19  ? 178.402 127.999 163.287 1.00 29.54  ? 19  ARG D CZ    1 
ATOM 6783  N NH1   . ARG D 4 19  ? 177.172 127.937 162.824 1.00 29.54  ? 19  ARG D NH1   1 
ATOM 6784  N NH2   . ARG D 4 19  ? 178.715 127.387 164.410 1.00 29.54  ? 19  ARG D NH2   1 
ATOM 6785  N N     . ASP D 4 20  ? 180.401 128.990 156.820 1.00 32.98  ? 20  ASP D N     1 
ATOM 6786  C CA    . ASP D 4 20  ? 181.744 128.890 156.269 1.00 32.98  ? 20  ASP D CA    1 
ATOM 6787  C C     . ASP D 4 20  ? 182.743 128.619 157.395 1.00 32.98  ? 20  ASP D C     1 
ATOM 6788  O O     . ASP D 4 20  ? 182.372 128.331 158.535 1.00 32.98  ? 20  ASP D O     1 
ATOM 6789  C CB    . ASP D 4 20  ? 182.030 130.182 155.512 1.00 32.98  ? 20  ASP D CB    1 
ATOM 6790  C CG    . ASP D 4 20  ? 183.015 130.004 154.386 1.00 32.98  ? 20  ASP D CG    1 
ATOM 6791  O OD1   . ASP D 4 20  ? 183.266 128.859 153.978 1.00 32.98  ? 20  ASP D OD1   1 
ATOM 6792  O OD2   . ASP D 4 20  ? 183.517 131.020 153.872 1.00 32.98  ? 20  ASP D OD2   1 
ATOM 6793  N N     . ASP D 4 21  ? 184.040 128.744 157.100 1.00 33.90  ? 21  ASP D N     1 
ATOM 6794  C CA    . ASP D 4 21  ? 185.020 128.707 158.177 1.00 33.90  ? 21  ASP D CA    1 
ATOM 6795  C C     . ASP D 4 21  ? 184.909 129.922 159.068 1.00 33.90  ? 21  ASP D C     1 
ATOM 6796  O O     . ASP D 4 21  ? 185.283 129.859 160.243 1.00 33.90  ? 21  ASP D O     1 
ATOM 6797  C CB    . ASP D 4 21  ? 186.438 128.637 157.628 1.00 33.90  ? 21  ASP D CB    1 
ATOM 6798  C CG    . ASP D 4 21  ? 186.786 129.845 156.810 1.00 33.90  ? 21  ASP D CG    1 
ATOM 6799  O OD1   . ASP D 4 21  ? 185.836 130.483 156.315 1.00 33.90  ? 21  ASP D OD1   1 
ATOM 6800  O OD2   . ASP D 4 21  ? 187.987 130.164 156.666 1.00 33.90  ? 21  ASP D OD2   1 
ATOM 6801  N N     . LEU D 4 22  ? 184.380 131.006 158.550 1.00 34.04  ? 22  LEU D N     1 
ATOM 6802  C CA    . LEU D 4 22  ? 184.021 132.138 159.374 1.00 34.04  ? 22  LEU D CA    1 
ATOM 6803  C C     . LEU D 4 22  ? 182.573 131.939 159.798 1.00 34.04  ? 22  LEU D C     1 
ATOM 6804  O O     . LEU D 4 22  ? 182.005 130.854 159.655 1.00 34.04  ? 22  LEU D O     1 
ATOM 6805  C CB    . LEU D 4 22  ? 184.218 133.419 158.583 1.00 34.04  ? 22  LEU D CB    1 
ATOM 6806  C CG    . LEU D 4 22  ? 185.618 133.508 157.995 1.00 34.04  ? 22  LEU D CG    1 
ATOM 6807  C CD1   . LEU D 4 22  ? 185.682 134.665 157.017 1.00 34.04  ? 22  LEU D CD1   1 
ATOM 6808  C CD2   . LEU D 4 22  ? 186.655 133.662 159.092 1.00 34.04  ? 22  LEU D CD2   1 
ATOM 6809  N N     . GLY D 4 23  ? 181.949 132.988 160.322 1.00 32.58  ? 23  GLY D N     1 
ATOM 6810  C CA    . GLY D 4 23  ? 180.589 132.852 160.794 1.00 32.58  ? 23  GLY D CA    1 
ATOM 6811  C C     . GLY D 4 23  ? 179.579 132.923 159.673 1.00 32.58  ? 23  GLY D C     1 
ATOM 6812  O O     . GLY D 4 23  ? 178.489 132.357 159.783 1.00 32.58  ? 23  GLY D O     1 
ATOM 6813  N N     . SER D 4 24  ? 179.924 133.595 158.581 1.00 32.17  ? 24  SER D N     1 
ATOM 6814  C CA    . SER D 4 24  ? 178.962 133.858 157.527 1.00 32.17  ? 24  SER D CA    1 
ATOM 6815  C C     . SER D 4 24  ? 178.480 132.575 156.857 1.00 32.17  ? 24  SER D C     1 
ATOM 6816  O O     . SER D 4 24  ? 179.200 131.578 156.805 1.00 32.17  ? 24  SER D O     1 
ATOM 6817  C CB    . SER D 4 24  ? 179.583 134.763 156.475 1.00 32.17  ? 24  SER D CB    1 
ATOM 6818  O OG    . SER D 4 24  ? 180.818 134.222 156.053 1.00 32.17  ? 24  SER D OG    1 
ATOM 6819  N N     . PRO D 4 25  ? 177.244 132.574 156.377 1.00 29.03  ? 25  PRO D N     1 
ATOM 6820  C CA    . PRO D 4 25  ? 176.708 131.408 155.685 1.00 29.03  ? 25  PRO D CA    1 
ATOM 6821  C C     . PRO D 4 25  ? 177.315 131.277 154.300 1.00 29.03  ? 25  PRO D C     1 
ATOM 6822  O O     . PRO D 4 25  ? 177.883 132.217 153.746 1.00 29.03  ? 25  PRO D O     1 
ATOM 6823  C CB    . PRO D 4 25  ? 175.214 131.700 155.613 1.00 29.03  ? 25  PRO D CB    1 
ATOM 6824  C CG    . PRO D 4 25  ? 175.132 133.141 155.651 1.00 29.03  ? 25  PRO D CG    1 
ATOM 6825  C CD    . PRO D 4 25  ? 176.220 133.617 156.543 1.00 29.03  ? 25  PRO D CD    1 
ATOM 6826  N N     . LYS D 4 26  ? 177.195 130.084 153.736 1.00 29.98  ? 26  LYS D N     1 
ATOM 6827  C CA    . LYS D 4 26  ? 177.801 129.809 152.445 1.00 29.98  ? 26  LYS D CA    1 
ATOM 6828  C C     . LYS D 4 26  ? 177.016 130.538 151.372 1.00 29.98  ? 26  LYS D C     1 
ATOM 6829  O O     . LYS D 4 26  ? 175.795 130.626 151.458 1.00 29.98  ? 26  LYS D O     1 
ATOM 6830  C CB    . LYS D 4 26  ? 177.803 128.321 152.175 1.00 29.98  ? 26  LYS D CB    1 
ATOM 6831  C CG    . LYS D 4 26  ? 178.637 127.498 153.116 1.00 29.98  ? 26  LYS D CG    1 
ATOM 6832  C CD    . LYS D 4 26  ? 178.642 126.083 152.645 1.00 29.98  ? 26  LYS D CD    1 
ATOM 6833  C CE    . LYS D 4 26  ? 179.885 125.391 153.062 1.00 29.98  ? 26  LYS D CE    1 
ATOM 6834  N NZ    . LYS D 4 26  ? 179.636 124.541 154.234 1.00 29.98  ? 26  LYS D NZ    1 
ATOM 6835  N N     . THR D 4 27  ? 177.703 131.108 150.380 1.00 33.41  ? 27  THR D N     1 
ATOM 6836  C CA    . THR D 4 27  ? 176.992 131.886 149.365 1.00 33.41  ? 27  THR D CA    1 
ATOM 6837  C C     . THR D 4 27  ? 177.482 131.604 147.950 1.00 33.41  ? 27  THR D C     1 
ATOM 6838  O O     . THR D 4 27  ? 178.688 131.619 147.696 1.00 33.41  ? 27  THR D O     1 
ATOM 6839  C CB    . THR D 4 27  ? 177.156 133.380 149.614 1.00 33.41  ? 27  THR D CB    1 
ATOM 6840  O OG1   . THR D 4 27  ? 178.521 133.732 149.373 1.00 33.41  ? 27  THR D OG1   1 
ATOM 6841  C CG2   . THR D 4 27  ? 176.807 133.751 151.035 1.00 33.41  ? 27  THR D CG2   1 
ATOM 6842  N N     . VAL D 4 28  ? 176.546 131.465 147.013 1.00 34.04  ? 28  VAL D N     1 
ATOM 6843  C CA    . VAL D 4 28  ? 176.876 131.273 145.600 1.00 34.04  ? 28  VAL D CA    1 
ATOM 6844  C C     . VAL D 4 28  ? 176.473 132.524 144.797 1.00 34.04  ? 28  VAL D C     1 
ATOM 6845  O O     . VAL D 4 28  ? 175.296 132.880 144.752 1.00 34.04  ? 28  VAL D O     1 
ATOM 6846  C CB    . VAL D 4 28  ? 176.166 130.040 145.013 1.00 34.04  ? 28  VAL D CB    1 
ATOM 6847  C CG1   . VAL D 4 28  ? 176.514 129.878 143.541 1.00 34.04  ? 28  VAL D CG1   1 
ATOM 6848  C CG2   . VAL D 4 28  ? 176.540 128.791 145.797 1.00 34.04  ? 28  VAL D CG2   1 
ATOM 6849  N N     . VAL D 4 29  ? 177.449 133.187 144.173 1.00 36.07  ? 29  VAL D N     1 
ATOM 6850  C CA    . VAL D 4 29  ? 177.207 134.393 143.393 1.00 36.07  ? 29  VAL D CA    1 
ATOM 6851  C C     . VAL D 4 29  ? 176.619 133.972 142.053 1.00 36.07  ? 29  VAL D C     1 
ATOM 6852  O O     . VAL D 4 29  ? 177.337 133.508 141.170 1.00 36.07  ? 29  VAL D O     1 
ATOM 6853  C CB    . VAL D 4 29  ? 178.475 135.222 143.256 1.00 36.07  ? 29  VAL D CB    1 
ATOM 6854  C CG1   . VAL D 4 29  ? 179.585 134.311 142.970 1.00 36.07  ? 29  VAL D CG1   1 
ATOM 6855  C CG2   . VAL D 4 29  ? 178.320 136.209 142.120 1.00 36.07  ? 29  VAL D CG2   1 
ATOM 6856  N N     . TYR D 4 30  ? 175.309 134.091 141.893 1.00 38.35  ? 30  TYR D N     1 
ATOM 6857  C CA    . TYR D 4 30  ? 174.651 133.540 140.710 1.00 38.35  ? 30  TYR D CA    1 
ATOM 6858  C C     . TYR D 4 30  ? 173.663 134.527 140.135 1.00 38.35  ? 30  TYR D C     1 
ATOM 6859  O O     . TYR D 4 30  ? 172.793 135.025 140.848 1.00 38.35  ? 30  TYR D O     1 
ATOM 6860  C CB    . TYR D 4 30  ? 173.972 132.217 141.024 1.00 38.35  ? 30  TYR D CB    1 
ATOM 6861  C CG    . TYR D 4 30  ? 173.278 131.585 139.863 1.00 38.35  ? 30  TYR D CG    1 
ATOM 6862  C CD1   . TYR D 4 30  ? 173.803 131.586 138.592 1.00 38.35  ? 30  TYR D CD1   1 
ATOM 6863  C CD2   . TYR D 4 30  ? 172.090 130.943 140.070 1.00 38.35  ? 30  TYR D CD2   1 
ATOM 6864  C CE1   . TYR D 4 30  ? 173.122 130.993 137.561 1.00 38.35  ? 30  TYR D CE1   1 
ATOM 6865  C CE2   . TYR D 4 30  ? 171.414 130.338 139.062 1.00 38.35  ? 30  TYR D CE2   1 
ATOM 6866  C CZ    . TYR D 4 30  ? 171.925 130.364 137.813 1.00 38.35  ? 30  TYR D CZ    1 
ATOM 6867  O OH    . TYR D 4 30  ? 171.230 129.747 136.810 1.00 38.35  ? 30  TYR D OH    1 
ATOM 6868  N N     . GLY D 4 31  ? 173.788 134.773 138.836 1.00 40.50  ? 31  GLY D N     1 
ATOM 6869  C CA    . GLY D 4 31  ? 172.918 135.720 138.189 1.00 40.50  ? 31  GLY D CA    1 
ATOM 6870  C C     . GLY D 4 31  ? 173.382 137.115 138.464 1.00 40.50  ? 31  GLY D C     1 
ATOM 6871  O O     . GLY D 4 31  ? 172.617 138.068 138.305 1.00 40.50  ? 31  GLY D O     1 
ATOM 6872  N N     . GLY D 4 32  ? 174.649 137.257 138.840 1.00 40.90  ? 32  GLY D N     1 
ATOM 6873  C CA    . GLY D 4 32  ? 175.221 138.525 139.196 1.00 40.90  ? 32  GLY D CA    1 
ATOM 6874  C C     . GLY D 4 32  ? 174.924 138.943 140.617 1.00 40.90  ? 32  GLY D C     1 
ATOM 6875  O O     . GLY D 4 32  ? 175.559 139.879 141.120 1.00 40.90  ? 32  GLY D O     1 
ATOM 6876  N N     . LYS D 4 33  ? 174.007 138.257 141.292 1.00 41.84  ? 33  LYS D N     1 
ATOM 6877  C CA    . LYS D 4 33  ? 173.616 138.550 142.662 1.00 41.84  ? 33  LYS D CA    1 
ATOM 6878  C C     . LYS D 4 33  ? 174.003 137.406 143.587 1.00 41.84  ? 33  LYS D C     1 
ATOM 6879  O O     . LYS D 4 33  ? 173.685 136.244 143.307 1.00 41.84  ? 33  LYS D O     1 
ATOM 6880  C CB    . LYS D 4 33  ? 172.115 138.808 142.741 1.00 41.84  ? 33  LYS D CB    1 
ATOM 6881  C CG    . LYS D 4 33  ? 171.704 140.151 142.224 1.00 41.84  ? 33  LYS D CG    1 
ATOM 6882  C CD    . LYS D 4 33  ? 170.228 140.356 142.416 1.00 41.84  ? 33  LYS D CD    1 
ATOM 6883  C CE    . LYS D 4 33  ? 169.678 141.384 141.452 1.00 41.84  ? 33  LYS D CE    1 
ATOM 6884  N NZ    . LYS D 4 33  ? 170.181 142.757 141.737 1.00 41.84  ? 33  LYS D NZ    1 
ATOM 6885  N N     . GLU D 4 34  ? 174.853 137.710 144.565 1.00 44.03  ? 34  GLU D N     1 
ATOM 6886  C CA    . GLU D 4 34  ? 175.165 136.763 145.625 1.00 44.03  ? 34  GLU D CA    1 
ATOM 6887  C C     . GLU D 4 34  ? 173.864 136.293 146.255 1.00 44.03  ? 34  GLU D C     1 
ATOM 6888  O O     . GLU D 4 34  ? 172.911 137.061 146.390 1.00 44.03  ? 34  GLU D O     1 
ATOM 6889  C CB    . GLU D 4 34  ? 176.044 137.394 146.703 1.00 44.03  ? 34  GLU D CB    1 
ATOM 6890  C CG    . GLU D 4 34  ? 175.281 138.313 147.605 1.00 44.03  ? 34  GLU D CG    1 
ATOM 6891  C CD    . GLU D 4 34  ? 175.037 139.667 147.021 1.00 44.03  ? 34  GLU D CD    1 
ATOM 6892  O OE1   . GLU D 4 34  ? 175.558 139.956 145.927 1.00 44.03  ? 34  GLU D OE1   1 
ATOM 6893  O OE2   . GLU D 4 34  ? 174.247 140.413 147.633 1.00 44.03  ? 34  GLU D OE2   1 
ATOM 6894  N N     . ARG D 4 35  ? 173.804 135.019 146.594 1.00 34.57  ? 35  ARG D N     1 
ATOM 6895  C CA    . ARG D 4 35  ? 172.627 134.423 147.189 1.00 34.57  ? 35  ARG D CA    1 
ATOM 6896  C C     . ARG D 4 35  ? 173.074 133.289 148.094 1.00 34.57  ? 35  ARG D C     1 
ATOM 6897  O O     . ARG D 4 35  ? 173.911 132.475 147.702 1.00 34.57  ? 35  ARG D O     1 
ATOM 6898  C CB    . ARG D 4 35  ? 171.667 133.932 146.120 1.00 34.57  ? 35  ARG D CB    1 
ATOM 6899  C CG    . ARG D 4 35  ? 172.253 132.968 145.176 1.00 34.57  ? 35  ARG D CG    1 
ATOM 6900  C CD    . ARG D 4 35  ? 171.273 132.754 144.065 1.00 34.57  ? 35  ARG D CD    1 
ATOM 6901  N NE    . ARG D 4 35  ? 171.112 133.950 143.265 1.00 34.57  ? 35  ARG D NE    1 
ATOM 6902  C CZ    . ARG D 4 35  ? 170.140 134.115 142.387 1.00 34.57  ? 35  ARG D CZ    1 
ATOM 6903  N NH1   . ARG D 4 35  ? 169.252 133.159 142.208 1.00 34.57  ? 35  ARG D NH1   1 
ATOM 6904  N NH2   . ARG D 4 35  ? 170.059 135.230 141.691 1.00 34.57  ? 35  ARG D NH2   1 
ATOM 6905  N N     . THR D 4 36  ? 172.538 133.269 149.309 1.00 32.55  ? 36  THR D N     1 
ATOM 6906  C CA    . THR D 4 36  ? 172.904 132.284 150.313 1.00 32.55  ? 36  THR D CA    1 
ATOM 6907  C C     . THR D 4 36  ? 172.542 130.879 149.869 1.00 32.55  ? 36  THR D C     1 
ATOM 6908  O O     . THR D 4 36  ? 171.601 130.669 149.108 1.00 32.55  ? 36  THR D O     1 
ATOM 6909  C CB    . THR D 4 36  ? 172.176 132.618 151.611 1.00 32.55  ? 36  THR D CB    1 
ATOM 6910  O OG1   . THR D 4 36  ? 172.639 133.878 152.107 1.00 32.55  ? 36  THR D OG1   1 
ATOM 6911  C CG2   . THR D 4 36  ? 172.351 131.565 152.657 1.00 32.55  ? 36  THR D CG2   1 
ATOM 6912  N N     . ARG D 4 37  ? 173.316 129.910 150.340 1.00 29.74  ? 37  ARG D N     1 
ATOM 6913  C CA    . ARG D 4 37  ? 173.079 128.520 150.012 1.00 29.74  ? 37  ARG D CA    1 
ATOM 6914  C C     . ARG D 4 37  ? 173.321 127.666 151.241 1.00 29.74  ? 37  ARG D C     1 
ATOM 6915  O O     . ARG D 4 37  ? 174.030 128.062 152.162 1.00 29.74  ? 37  ARG D O     1 
ATOM 6916  C CB    . ARG D 4 37  ? 173.973 128.051 148.872 1.00 29.74  ? 37  ARG D CB    1 
ATOM 6917  C CG    . ARG D 4 37  ? 175.419 127.934 149.196 1.00 29.74  ? 37  ARG D CG    1 
ATOM 6918  C CD    . ARG D 4 37  ? 176.109 127.156 148.120 1.00 29.74  ? 37  ARG D CD    1 
ATOM 6919  N NE    . ARG D 4 37  ? 177.542 127.372 148.145 1.00 29.74  ? 37  ARG D NE    1 
ATOM 6920  C CZ    . ARG D 4 37  ? 178.422 126.453 148.490 1.00 29.74  ? 37  ARG D CZ    1 
ATOM 6921  N NH1   . ARG D 4 37  ? 178.013 125.247 148.838 1.00 29.74  ? 37  ARG D NH1   1 
ATOM 6922  N NH2   . ARG D 4 37  ? 179.709 126.746 148.492 1.00 29.74  ? 37  ARG D NH2   1 
ATOM 6923  N N     . VAL D 4 38  ? 172.738 126.477 151.238 1.00 29.87  ? 38  VAL D N     1 
ATOM 6924  C CA    . VAL D 4 38  ? 173.040 125.449 152.217 1.00 29.87  ? 38  VAL D CA    1 
ATOM 6925  C C     . VAL D 4 38  ? 173.599 124.284 151.429 1.00 29.87  ? 38  VAL D C     1 
ATOM 6926  O O     . VAL D 4 38  ? 172.918 123.729 150.562 1.00 29.87  ? 38  VAL D O     1 
ATOM 6927  C CB    . VAL D 4 38  ? 171.833 125.042 153.066 1.00 29.87  ? 38  VAL D CB    1 
ATOM 6928  C CG1   . VAL D 4 38  ? 171.439 126.191 153.948 1.00 29.87  ? 38  VAL D CG1   1 
ATOM 6929  C CG2   . VAL D 4 38  ? 170.683 124.600 152.233 1.00 29.87  ? 38  VAL D CG2   1 
ATOM 6930  N N     . SER D 4 39  ? 174.863 123.975 151.657 1.00 36.19  ? 39  SER D N     1 
ATOM 6931  C CA    . SER D 4 39  ? 175.555 123.055 150.785 1.00 36.19  ? 39  SER D CA    1 
ATOM 6932  C C     . SER D 4 39  ? 174.843 121.713 150.742 1.00 36.19  ? 39  SER D C     1 
ATOM 6933  O O     . SER D 4 39  ? 174.116 121.333 151.655 1.00 36.19  ? 39  SER D O     1 
ATOM 6934  C CB    . SER D 4 39  ? 176.990 122.866 151.248 1.00 36.19  ? 39  SER D CB    1 
ATOM 6935  O OG    . SER D 4 39  ? 177.626 121.939 150.403 1.00 36.19  ? 39  SER D OG    1 
ATOM 6936  N N     . SER D 4 40  ? 175.087 120.986 149.660 1.00 37.76  ? 40  SER D N     1 
ATOM 6937  C CA    . SER D 4 40  ? 174.376 119.742 149.416 1.00 37.76  ? 40  SER D CA    1 
ATOM 6938  C C     . SER D 4 40  ? 174.704 118.676 150.440 1.00 37.76  ? 40  SER D C     1 
ATOM 6939  O O     . SER D 4 40  ? 173.806 117.966 150.903 1.00 37.76  ? 40  SER D O     1 
ATOM 6940  C CB    . SER D 4 40  ? 174.698 119.216 148.030 1.00 37.76  ? 40  SER D CB    1 
ATOM 6941  O OG    . SER D 4 40  ? 174.467 117.822 147.992 1.00 37.76  ? 40  SER D OG    1 
ATOM 6942  N N     . GLN D 4 41  ? 175.977 118.525 150.795 1.00 39.85  ? 41  GLN D N     1 
ATOM 6943  C CA    . GLN D 4 41  ? 176.318 117.469 151.731 1.00 39.85  ? 41  GLN D CA    1 
ATOM 6944  C C     . GLN D 4 41  ? 175.664 117.673 153.083 1.00 39.85  ? 41  GLN D C     1 
ATOM 6945  O O     . GLN D 4 41  ? 175.296 116.694 153.723 1.00 39.85  ? 41  GLN D O     1 
ATOM 6946  C CB    . GLN D 4 41  ? 177.827 117.386 151.896 1.00 39.85  ? 41  GLN D CB    1 
ATOM 6947  C CG    . GLN D 4 41  ? 178.430 118.571 152.612 1.00 39.85  ? 41  GLN D CG    1 
ATOM 6948  C CD    . GLN D 4 41  ? 178.614 119.762 151.735 1.00 39.85  ? 41  GLN D CD    1 
ATOM 6949  O OE1   . GLN D 4 41  ? 178.121 119.801 150.617 1.00 39.85  ? 41  GLN D OE1   1 
ATOM 6950  N NE2   . GLN D 4 41  ? 179.275 120.781 152.259 1.00 39.85  ? 41  GLN D NE2   1 
ATOM 6951  N N     . SER D 4 42  ? 175.513 118.912 153.547 1.00 41.12  ? 42  SER D N     1 
ATOM 6952  C CA    . SER D 4 42  ? 174.949 119.091 154.877 1.00 41.12  ? 42  SER D CA    1 
ATOM 6953  C C     . SER D 4 42  ? 173.503 118.660 154.932 1.00 41.12  ? 42  SER D C     1 
ATOM 6954  O O     . SER D 4 42  ? 173.094 117.869 155.800 1.00 41.12  ? 42  SER D O     1 
ATOM 6955  C CB    . SER D 4 42  ? 174.999 120.552 155.274 1.00 41.12  ? 42  SER D CB    1 
ATOM 6956  O OG    . SER D 4 42  ? 174.110 121.286 154.471 1.00 41.12  ? 42  SER D OG    1 
ATOM 6957  N N     . TRP D 4 43  ? 172.748 119.065 153.934 1.00 42.09  ? 43  TRP D N     1 
ATOM 6958  C CA    . TRP D 4 43  ? 171.353 118.709 153.947 1.00 42.09  ? 43  TRP D CA    1 
ATOM 6959  C C     . TRP D 4 43  ? 171.231 117.213 153.720 1.00 42.09  ? 43  TRP D C     1 
ATOM 6960  O O     . TRP D 4 43  ? 170.387 116.547 154.328 1.00 42.09  ? 43  TRP D O     1 
ATOM 6961  C CB    . TRP D 4 43  ? 170.602 119.538 152.924 1.00 42.09  ? 43  TRP D CB    1 
ATOM 6962  C CG    . TRP D 4 43  ? 169.214 119.372 153.152 1.00 42.09  ? 43  TRP D CG    1 
ATOM 6963  C CD1   . TRP D 4 43  ? 168.510 119.964 154.134 1.00 42.09  ? 43  TRP D CD1   1 
ATOM 6964  C CD2   . TRP D 4 43  ? 168.333 118.500 152.502 1.00 42.09  ? 43  TRP D CD2   1 
ATOM 6965  N NE1   . TRP D 4 43  ? 167.219 119.562 154.115 1.00 42.09  ? 43  TRP D NE1   1 
ATOM 6966  C CE2   . TRP D 4 43  ? 167.083 118.649 153.113 1.00 42.09  ? 43  TRP D CE2   1 
ATOM 6967  C CE3   . TRP D 4 43  ? 168.459 117.632 151.437 1.00 42.09  ? 43  TRP D CE3   1 
ATOM 6968  C CZ2   . TRP D 4 43  ? 165.985 117.936 152.721 1.00 42.09  ? 43  TRP D CZ2   1 
ATOM 6969  C CZ3   . TRP D 4 43  ? 167.356 116.948 151.029 1.00 42.09  ? 43  TRP D CZ3   1 
ATOM 6970  C CH2   . TRP D 4 43  ? 166.135 117.103 151.665 1.00 42.09  ? 43  TRP D CH2   1 
ATOM 6971  N N     . LYS D 4 44  ? 172.087 116.669 152.854 1.00 43.83  ? 44  LYS D N     1 
ATOM 6972  C CA    . LYS D 4 44  ? 172.050 115.244 152.565 1.00 43.83  ? 44  LYS D CA    1 
ATOM 6973  C C     . LYS D 4 44  ? 172.387 114.423 153.800 1.00 43.83  ? 44  LYS D C     1 
ATOM 6974  O O     . LYS D 4 44  ? 171.764 113.387 154.041 1.00 43.83  ? 44  LYS D O     1 
ATOM 6975  C CB    . LYS D 4 44  ? 173.035 114.908 151.458 1.00 43.83  ? 44  LYS D CB    1 
ATOM 6976  C CG    . LYS D 4 44  ? 172.970 113.485 150.954 1.00 43.83  ? 44  LYS D CG    1 
ATOM 6977  C CD    . LYS D 4 44  ? 173.934 113.336 149.794 1.00 43.83  ? 44  LYS D CD    1 
ATOM 6978  C CE    . LYS D 4 44  ? 173.944 111.948 149.214 1.00 43.83  ? 44  LYS D CE    1 
ATOM 6979  N NZ    . LYS D 4 44  ? 174.687 111.933 147.936 1.00 43.83  ? 44  LYS D NZ    1 
ATOM 6980  N N     . ARG D 4 45  ? 173.362 114.859 154.605 1.00 46.45  ? 45  ARG D N     1 
ATOM 6981  C CA    . ARG D 4 45  ? 173.677 114.080 155.795 1.00 46.45  ? 45  ARG D CA    1 
ATOM 6982  C C     . ARG D 4 45  ? 172.458 114.080 156.695 1.00 46.45  ? 45  ARG D C     1 
ATOM 6983  O O     . ARG D 4 45  ? 172.103 113.045 157.282 1.00 46.45  ? 45  ARG D O     1 
ATOM 6984  C CB    . ARG D 4 45  ? 174.938 114.565 156.519 1.00 46.45  ? 45  ARG D CB    1 
ATOM 6985  C CG    . ARG D 4 45  ? 174.950 115.939 157.129 1.00 46.45  ? 45  ARG D CG    1 
ATOM 6986  C CD    . ARG D 4 45  ? 174.361 115.904 158.544 1.00 46.45  ? 45  ARG D CD    1 
ATOM 6987  N NE    . ARG D 4 45  ? 174.965 114.986 159.527 1.00 46.45  ? 45  ARG D NE    1 
ATOM 6988  C CZ    . ARG D 4 45  ? 176.269 114.830 159.763 1.00 46.45  ? 45  ARG D CZ    1 
ATOM 6989  N NH1   . ARG D 4 45  ? 177.175 115.527 159.100 1.00 46.45  ? 45  ARG D NH1   1 
ATOM 6990  N NH2   . ARG D 4 45  ? 176.675 113.973 160.686 1.00 46.45  ? 45  ARG D NH2   1 
ATOM 6991  N N     . ALA D 4 46  ? 171.773 115.224 156.790 1.00 46.95  ? 46  ALA D N     1 
ATOM 6992  C CA    . ALA D 4 46  ? 170.593 115.224 157.640 1.00 46.95  ? 46  ALA D CA    1 
ATOM 6993  C C     . ALA D 4 46  ? 169.595 114.209 157.104 1.00 46.95  ? 46  ALA D C     1 
ATOM 6994  O O     . ALA D 4 46  ? 169.174 113.307 157.841 1.00 46.95  ? 46  ALA D O     1 
ATOM 6995  C CB    . ALA D 4 46  ? 169.960 116.609 157.700 1.00 46.95  ? 46  ALA D CB    1 
ATOM 6996  N N     . VAL D 4 47  ? 169.430 114.173 155.780 1.00 49.66  ? 47  VAL D N     1 
ATOM 6997  C CA    . VAL D 4 47  ? 168.470 113.263 155.168 1.00 49.66  ? 47  VAL D CA    1 
ATOM 6998  C C     . VAL D 4 47  ? 168.830 111.826 155.466 1.00 49.66  ? 47  VAL D C     1 
ATOM 6999  O O     . VAL D 4 47  ? 167.949 110.993 155.691 1.00 49.66  ? 47  VAL D O     1 
ATOM 7000  C CB    . VAL D 4 47  ? 168.412 113.496 153.652 1.00 49.66  ? 47  VAL D CB    1 
ATOM 7001  C CG1   . VAL D 4 47  ? 167.460 112.540 153.032 1.00 49.66  ? 47  VAL D CG1   1 
ATOM 7002  C CG2   . VAL D 4 47  ? 167.955 114.855 153.414 1.00 49.66  ? 47  VAL D CG2   1 
ATOM 7003  N N     . ARG D 4 48  ? 170.133 111.560 155.464 1.00 57.85  ? 48  ARG D N     1 
ATOM 7004  C CA    . ARG D 4 48  ? 170.662 110.238 155.736 1.00 57.85  ? 48  ARG D CA    1 
ATOM 7005  C C     . ARG D 4 48  ? 170.281 109.804 157.141 1.00 57.85  ? 48  ARG D C     1 
ATOM 7006  O O     . ARG D 4 48  ? 169.980 108.633 157.370 1.00 57.85  ? 48  ARG D O     1 
ATOM 7007  C CB    . ARG D 4 48  ? 172.183 110.225 155.575 1.00 57.85  ? 48  ARG D CB    1 
ATOM 7008  C CG    . ARG D 4 48  ? 172.656 110.323 154.134 1.00 57.85  ? 48  ARG D CG    1 
ATOM 7009  C CD    . ARG D 4 48  ? 174.021 109.680 153.955 1.00 57.85  ? 48  ARG D CD    1 
ATOM 7010  N NE    . ARG D 4 48  ? 174.061 108.323 154.494 1.00 57.85  ? 48  ARG D NE    1 
ATOM 7011  C CZ    . ARG D 4 48  ? 175.077 107.483 154.328 1.00 57.85  ? 48  ARG D CZ    1 
ATOM 7012  N NH1   . ARG D 4 48  ? 176.144 107.858 153.635 1.00 57.85  ? 48  ARG D NH1   1 
ATOM 7013  N NH2   . ARG D 4 48  ? 175.028 106.267 154.855 1.00 57.85  ? 48  ARG D NH2   1 
ATOM 7014  N N     . HIS D 4 49  ? 170.289 110.740 158.088 1.00 56.18  ? 49  HIS D N     1 
ATOM 7015  C CA    . HIS D 4 49  ? 169.924 110.366 159.446 1.00 56.18  ? 49  HIS D CA    1 
ATOM 7016  C C     . HIS D 4 49  ? 168.423 110.130 159.581 1.00 56.18  ? 49  HIS D C     1 
ATOM 7017  O O     . HIS D 4 49  ? 168.021 109.190 160.271 1.00 56.18  ? 49  HIS D O     1 
ATOM 7018  C CB    . HIS D 4 49  ? 170.353 111.446 160.429 1.00 56.18  ? 49  HIS D CB    1 
ATOM 7019  C CG    . HIS D 4 49  ? 171.832 111.582 160.568 1.00 56.18  ? 49  HIS D CG    1 
ATOM 7020  N ND1   . HIS D 4 49  ? 172.416 112.597 161.293 1.00 56.18  ? 49  HIS D ND1   1 
ATOM 7021  C CD2   . HIS D 4 49  ? 172.848 110.836 160.074 1.00 56.18  ? 49  HIS D CD2   1 
ATOM 7022  C CE1   . HIS D 4 49  ? 173.728 112.471 161.241 1.00 56.18  ? 49  HIS D CE1   1 
ATOM 7023  N NE2   . HIS D 4 49  ? 174.017 111.411 160.508 1.00 56.18  ? 49  HIS D NE2   1 
ATOM 7024  N N     . GLU D 4 50  ? 167.562 110.943 158.951 1.00 58.12  ? 50  GLU D N     1 
ATOM 7025  C CA    . GLU D 4 50  ? 166.146 110.563 159.066 1.00 58.12  ? 50  GLU D CA    1 
ATOM 7026  C C     . GLU D 4 50  ? 165.820 109.272 158.330 1.00 58.12  ? 50  GLU D C     1 
ATOM 7027  O O     . GLU D 4 50  ? 165.051 108.454 158.840 1.00 58.12  ? 50  GLU D O     1 
ATOM 7028  C CB    . GLU D 4 50  ? 165.125 111.649 158.705 1.00 58.12  ? 50  GLU D CB    1 
ATOM 7029  C CG    . GLU D 4 50  ? 165.137 112.881 159.588 1.00 58.12  ? 50  GLU D CG    1 
ATOM 7030  C CD    . GLU D 4 50  ? 166.343 113.701 159.463 1.00 58.12  ? 50  GLU D CD    1 
ATOM 7031  O OE1   . GLU D 4 50  ? 166.968 113.567 158.417 1.00 58.12  ? 50  GLU D OE1   1 
ATOM 7032  O OE2   . GLU D 4 50  ? 166.683 114.440 160.410 1.00 58.12  ? 50  GLU D OE2   1 
ATOM 7033  N N     . VAL D 4 51  ? 166.338 109.080 157.120 1.00 60.70  ? 51  VAL D N     1 
ATOM 7034  C CA    . VAL D 4 51  ? 166.031 107.851 156.389 1.00 60.70  ? 51  VAL D CA    1 
ATOM 7035  C C     . VAL D 4 51  ? 166.495 106.620 157.153 1.00 60.70  ? 51  VAL D C     1 
ATOM 7036  O O     . VAL D 4 51  ? 165.730 105.675 157.367 1.00 60.70  ? 51  VAL D O     1 
ATOM 7037  C CB    . VAL D 4 51  ? 166.657 107.886 154.989 1.00 60.70  ? 51  VAL D CB    1 
ATOM 7038  C CG1   . VAL D 4 51  ? 166.518 106.543 154.349 1.00 60.70  ? 51  VAL D CG1   1 
ATOM 7039  C CG2   . VAL D 4 51  ? 165.972 108.905 154.153 1.00 60.70  ? 51  VAL D CG2   1 
ATOM 7040  N N     . GLU D 4 52  ? 167.741 106.629 157.615 1.00 65.37  ? 52  GLU D N     1 
ATOM 7041  C CA    . GLU D 4 52  ? 168.260 105.489 158.356 1.00 65.37  ? 52  GLU D CA    1 
ATOM 7042  C C     . GLU D 4 52  ? 167.603 105.338 159.718 1.00 65.37  ? 52  GLU D C     1 
ATOM 7043  O O     . GLU D 4 52  ? 167.454 104.215 160.207 1.00 65.37  ? 52  GLU D O     1 
ATOM 7044  C CB    . GLU D 4 52  ? 169.773 105.633 158.500 1.00 65.37  ? 52  GLU D CB    1 
ATOM 7045  C CG    . GLU D 4 52  ? 170.520 105.556 157.170 1.00 65.37  ? 52  GLU D CG    1 
ATOM 7046  C CD    . GLU D 4 52  ? 172.026 105.700 157.318 1.00 65.37  ? 52  GLU D CD    1 
ATOM 7047  O OE1   . GLU D 4 52  ? 172.484 106.083 158.413 1.00 65.37  ? 52  GLU D OE1   1 
ATOM 7048  O OE2   . GLU D 4 52  ? 172.752 105.440 156.335 1.00 65.37  ? 52  GLU D OE2   1 
ATOM 7049  N N     . ALA D 4 53  ? 167.188 106.437 160.338 1.00 62.66  ? 53  ALA D N     1 
ATOM 7050  C CA    . ALA D 4 53  ? 166.500 106.329 161.617 1.00 62.66  ? 53  ALA D CA    1 
ATOM 7051  C C     . ALA D 4 53  ? 165.118 105.730 161.436 1.00 62.66  ? 53  ALA D C     1 
ATOM 7052  O O     . ALA D 4 53  ? 164.703 104.854 162.201 1.00 62.66  ? 53  ALA D O     1 
ATOM 7053  C CB    . ALA D 4 53  ? 166.402 107.696 162.287 1.00 62.66  ? 53  ALA D CB    1 
ATOM 7054  N N     . ARG D 4 54  ? 164.406 106.187 160.413 1.00 63.51  ? 54  ARG D N     1 
ATOM 7055  C CA    . ARG D 4 54  ? 163.075 105.690 160.110 1.00 63.51  ? 54  ARG D CA    1 
ATOM 7056  C C     . ARG D 4 54  ? 163.121 104.254 159.599 1.00 63.51  ? 54  ARG D C     1 
ATOM 7057  O O     . ARG D 4 54  ? 162.181 103.490 159.839 1.00 63.51  ? 54  ARG D O     1 
ATOM 7058  C CB    . ARG D 4 54  ? 162.367 106.654 159.161 1.00 63.51  ? 54  ARG D CB    1 
ATOM 7059  C CG    . ARG D 4 54  ? 160.975 106.222 158.822 1.00 63.51  ? 54  ARG D CG    1 
ATOM 7060  C CD    . ARG D 4 54  ? 160.251 107.228 157.977 1.00 63.51  ? 54  ARG D CD    1 
ATOM 7061  N NE    . ARG D 4 54  ? 158.918 106.731 157.672 1.00 63.51  ? 54  ARG D NE    1 
ATOM 7062  C CZ    . ARG D 4 54  ? 157.839 106.973 158.405 1.00 63.51  ? 54  ARG D CZ    1 
ATOM 7063  N NH1   . ARG D 4 54  ? 157.929 107.714 159.499 1.00 63.51  ? 54  ARG D NH1   1 
ATOM 7064  N NH2   . ARG D 4 54  ? 156.671 106.462 158.043 1.00 63.51  ? 54  ARG D NH2   1 
ATOM 7065  N N     . LEU D 4 55  ? 164.190 103.858 158.905 1.00 63.92  ? 55  LEU D N     1 
ATOM 7066  C CA    . LEU D 4 55  ? 164.273 102.478 158.448 1.00 63.92  ? 55  LEU D CA    1 
ATOM 7067  C C     . LEU D 4 55  ? 164.671 101.533 159.572 1.00 63.92  ? 55  LEU D C     1 
ATOM 7068  O O     . LEU D 4 55  ? 164.778 100.326 159.337 1.00 63.92  ? 55  LEU D O     1 
ATOM 7069  C CB    . LEU D 4 55  ? 165.327 102.303 157.342 1.00 63.92  ? 55  LEU D CB    1 
ATOM 7070  C CG    . LEU D 4 55  ? 165.164 102.277 155.816 1.00 63.92  ? 55  LEU D CG    1 
ATOM 7071  C CD1   . LEU D 4 55  ? 164.625 103.548 155.266 1.00 63.92  ? 55  LEU D CD1   1 
ATOM 7072  C CD2   . LEU D 4 55  ? 166.486 101.966 155.165 1.00 63.92  ? 55  LEU D CD2   1 
ATOM 7073  N N     . GLY D 4 56  ? 164.900 102.045 160.775 1.00 66.03  ? 56  GLY D N     1 
ATOM 7074  C CA    . GLY D 4 56  ? 165.225 101.202 161.910 1.00 66.03  ? 56  GLY D CA    1 
ATOM 7075  C C     . GLY D 4 56  ? 166.577 100.528 161.769 1.00 66.03  ? 56  GLY D C     1 
ATOM 7076  O O     . GLY D 4 56  ? 167.330 100.832 160.842 1.00 66.03  ? 56  GLY D O     1 
ATOM 7077  N N     . ASN D 4 164 ? 171.361 96.232  152.060 1.00 77.67  ? 164 ASN D N     1 
ATOM 7078  C CA    . ASN D 4 164 ? 171.726 97.514  152.652 1.00 77.67  ? 164 ASN D CA    1 
ATOM 7079  C C     . ASN D 4 164 ? 171.257 98.665  151.774 1.00 77.67  ? 164 ASN D C     1 
ATOM 7080  O O     . ASN D 4 164 ? 171.998 99.133  150.912 1.00 77.67  ? 164 ASN D O     1 
ATOM 7081  C CB    . ASN D 4 164 ? 173.229 97.622  152.903 1.00 77.67  ? 164 ASN D CB    1 
ATOM 7082  C CG    . ASN D 4 164 ? 173.548 98.515  154.097 1.00 77.67  ? 164 ASN D CG    1 
ATOM 7083  O OD1   . ASN D 4 164 ? 172.784 99.430  154.418 1.00 77.67  ? 164 ASN D OD1   1 
ATOM 7084  N ND2   . ASN D 4 164 ? 174.667 98.250  154.752 1.00 77.67  ? 164 ASN D ND2   1 
ATOM 7085  N N     . VAL D 4 165 ? 170.008 99.094  151.964 1.00 74.43  ? 165 VAL D N     1 
ATOM 7086  C CA    . VAL D 4 165 ? 169.443 100.081 151.063 1.00 74.43  ? 165 VAL D CA    1 
ATOM 7087  C C     . VAL D 4 165 ? 170.076 101.459 151.257 1.00 74.43  ? 165 VAL D C     1 
ATOM 7088  O O     . VAL D 4 165 ? 169.930 102.324 150.392 1.00 74.43  ? 165 VAL D O     1 
ATOM 7089  C CB    . VAL D 4 165 ? 167.919 100.148 151.258 1.00 74.43  ? 165 VAL D CB    1 
ATOM 7090  C CG1   . VAL D 4 165 ? 167.261 100.665 150.016 1.00 74.43  ? 165 VAL D CG1   1 
ATOM 7091  C CG2   . VAL D 4 165 ? 167.364 98.799  151.565 1.00 74.43  ? 165 VAL D CG2   1 
ATOM 7092  N N     . SER D 4 166 ? 170.736 101.709 152.386 1.00 72.89  ? 166 SER D N     1 
ATOM 7093  C CA    . SER D 4 166 ? 171.349 103.014 152.590 1.00 72.89  ? 166 SER D CA    1 
ATOM 7094  C C     . SER D 4 166 ? 172.691 103.151 151.871 1.00 72.89  ? 166 SER D C     1 
ATOM 7095  O O     . SER D 4 166 ? 173.085 104.266 151.511 1.00 72.89  ? 166 SER D O     1 
ATOM 7096  C CB    . SER D 4 166 ? 171.514 103.278 154.083 1.00 72.89  ? 166 SER D CB    1 
ATOM 7097  O OG    . SER D 4 166 ? 172.128 104.531 154.307 1.00 72.89  ? 166 SER D OG    1 
ATOM 7098  N N     . VAL D 4 167 ? 173.398 102.038 151.642 1.00 73.92  ? 167 VAL D N     1 
ATOM 7099  C CA    . VAL D 4 167 ? 174.646 102.067 150.872 1.00 73.92  ? 167 VAL D CA    1 
ATOM 7100  C C     . VAL D 4 167 ? 174.355 102.011 149.387 1.00 73.92  ? 167 VAL D C     1 
ATOM 7101  O O     . VAL D 4 167 ? 175.256 102.191 148.560 1.00 73.92  ? 167 VAL D O     1 
ATOM 7102  C CB    . VAL D 4 167 ? 175.616 100.921 151.212 1.00 73.92  ? 167 VAL D CB    1 
ATOM 7103  C CG1   . VAL D 4 167 ? 175.137 99.624  150.616 1.00 73.92  ? 167 VAL D CG1   1 
ATOM 7104  C CG2   . VAL D 4 167 ? 177.031 101.244 150.749 1.00 73.92  ? 167 VAL D CG2   1 
ATOM 7105  N N     . ASN D 4 168 ? 173.100 101.768 149.040 1.00 70.58  ? 168 ASN D N     1 
ATOM 7106  C CA    . ASN D 4 168 ? 172.627 101.716 147.673 1.00 70.58  ? 168 ASN D CA    1 
ATOM 7107  C C     . ASN D 4 168 ? 172.001 103.037 147.255 1.00 70.58  ? 168 ASN D C     1 
ATOM 7108  O O     . ASN D 4 168 ? 172.383 103.620 146.239 1.00 70.58  ? 168 ASN D O     1 
ATOM 7109  C CB    . ASN D 4 168 ? 171.603 100.585 147.607 1.00 70.58  ? 168 ASN D CB    1 
ATOM 7110  C CG    . ASN D 4 168 ? 171.548 99.938  146.286 1.00 70.58  ? 168 ASN D CG    1 
ATOM 7111  O OD1   . ASN D 4 168 ? 171.623 100.599 145.255 1.00 70.58  ? 168 ASN D OD1   1 
ATOM 7112  N ND2   . ASN D 4 168 ? 171.446 98.612  146.289 1.00 70.58  ? 168 ASN D ND2   1 
ATOM 7113  N N     . LEU D 4 169 ? 171.006 103.489 148.012 1.00 66.25  ? 169 LEU D N     1 
ATOM 7114  C CA    . LEU D 4 169 ? 170.346 104.755 147.725 1.00 66.25  ? 169 LEU D CA    1 
ATOM 7115  C C     . LEU D 4 169 ? 171.321 105.921 147.837 1.00 66.25  ? 169 LEU D C     1 
ATOM 7116  O O     . LEU D 4 169 ? 171.372 106.786 146.959 1.00 66.25  ? 169 LEU D O     1 
ATOM 7117  C CB    . LEU D 4 169 ? 169.155 104.930 148.667 1.00 66.25  ? 169 LEU D CB    1 
ATOM 7118  C CG    . LEU D 4 169 ? 168.281 106.188 148.648 1.00 66.25  ? 169 LEU D CG    1 
ATOM 7119  C CD1   . LEU D 4 169 ? 168.937 107.474 149.076 1.00 66.25  ? 169 LEU D CD1   1 
ATOM 7120  C CD2   . LEU D 4 169 ? 167.743 106.342 147.250 1.00 66.25  ? 169 LEU D CD2   1 
ATOM 7121  N N     . PHE D 4 170 ? 172.053 105.999 148.942 1.00 65.31  ? 170 PHE D N     1 
ATOM 7122  C CA    . PHE D 4 170 ? 173.187 106.898 149.069 1.00 65.31  ? 170 PHE D CA    1 
ATOM 7123  C C     . PHE D 4 170 ? 174.467 106.106 148.872 1.00 65.31  ? 170 PHE D C     1 
ATOM 7124  O O     . PHE D 4 170 ? 174.514 104.904 149.128 1.00 65.31  ? 170 PHE D O     1 
ATOM 7125  C CB    . PHE D 4 170 ? 173.246 107.580 150.433 1.00 65.31  ? 170 PHE D CB    1 
ATOM 7126  C CG    . PHE D 4 170 ? 172.002 108.319 150.808 1.00 65.31  ? 170 PHE D CG    1 
ATOM 7127  C CD1   . PHE D 4 170 ? 171.766 109.595 150.359 1.00 65.31  ? 170 PHE D CD1   1 
ATOM 7128  C CD2   . PHE D 4 170 ? 171.114 107.759 151.700 1.00 65.31  ? 170 PHE D CD2   1 
ATOM 7129  C CE1   . PHE D 4 170 ? 170.636 110.265 150.735 1.00 65.31  ? 170 PHE D CE1   1 
ATOM 7130  C CE2   . PHE D 4 170 ? 169.990 108.432 152.086 1.00 65.31  ? 170 PHE D CE2   1 
ATOM 7131  C CZ    . PHE D 4 170 ? 169.751 109.685 151.602 1.00 65.31  ? 170 PHE D CZ    1 
ATOM 7132  N N     . GLY D 4 171 ? 175.502 106.795 148.419 1.00 76.26  ? 171 GLY D N     1 
ATOM 7133  C CA    . GLY D 4 171 ? 176.747 106.174 148.022 1.00 76.26  ? 171 GLY D CA    1 
ATOM 7134  C C     . GLY D 4 171 ? 177.374 105.169 148.966 1.00 76.26  ? 171 GLY D C     1 
ATOM 7135  O O     . GLY D 4 171 ? 177.456 103.985 148.635 1.00 76.26  ? 171 GLY D O     1 
ATOM 7136  N N     . ARG D 4 172 ? 177.845 105.617 150.120 1.00 81.71  ? 172 ARG D N     1 
ATOM 7137  C CA    . ARG D 4 172 ? 178.475 104.691 151.047 1.00 81.71  ? 172 ARG D CA    1 
ATOM 7138  C C     . ARG D 4 172 ? 178.464 105.215 152.468 1.00 81.71  ? 172 ARG D C     1 
ATOM 7139  O O     . ARG D 4 172 ? 178.567 106.420 152.702 1.00 81.71  ? 172 ARG D O     1 
ATOM 7140  C CB    . ARG D 4 172 ? 179.911 104.393 150.611 1.00 81.71  ? 172 ARG D CB    1 
ATOM 7141  C CG    . ARG D 4 172 ? 180.733 103.645 151.648 1.00 81.71  ? 172 ARG D CG    1 
ATOM 7142  C CD    . ARG D 4 172 ? 182.197 103.575 151.246 1.00 81.71  ? 172 ARG D CD    1 
ATOM 7143  N NE    . ARG D 4 172 ? 182.880 104.850 151.442 1.00 81.71  ? 172 ARG D NE    1 
ATOM 7144  C CZ    . ARG D 4 172 ? 183.867 105.043 152.311 1.00 81.71  ? 172 ARG D CZ    1 
ATOM 7145  N NH1   . ARG D 4 172 ? 184.430 106.238 152.423 1.00 81.71  ? 172 ARG D NH1   1 
ATOM 7146  N NH2   . ARG D 4 172 ? 184.291 104.041 153.069 1.00 81.71  ? 172 ARG D NH2   1 
ATOM 7147  N N     . MET D 4 173 ? 178.341 104.299 153.419 1.00 83.55  ? 173 MET D N     1 
ATOM 7148  C CA    . MET D 4 173 ? 178.324 104.680 154.823 1.00 83.55  ? 173 MET D CA    1 
ATOM 7149  C C     . MET D 4 173 ? 179.608 105.407 155.170 1.00 83.55  ? 173 MET D C     1 
ATOM 7150  O O     . MET D 4 173 ? 180.695 105.004 154.758 1.00 83.55  ? 173 MET D O     1 
ATOM 7151  C CB    . MET D 4 173 ? 178.183 103.445 155.709 1.00 83.55  ? 173 MET D CB    1 
ATOM 7152  C CG    . MET D 4 173 ? 176.799 102.841 155.734 1.00 83.55  ? 173 MET D CG    1 
ATOM 7153  S SD    . MET D 4 173 ? 175.610 103.855 156.625 1.00 83.55  ? 173 MET D SD    1 
ATOM 7154  C CE    . MET D 4 173 ? 176.009 103.430 158.317 1.00 83.55  ? 173 MET D CE    1 
ATOM 7155  N N     . LEU D 4 174 ? 179.481 106.503 155.911 1.00 85.85  ? 174 LEU D N     1 
ATOM 7156  C CA    . LEU D 4 174 ? 180.657 107.310 156.202 1.00 85.85  ? 174 LEU D CA    1 
ATOM 7157  C C     . LEU D 4 174 ? 181.689 106.519 156.993 1.00 85.85  ? 174 LEU D C     1 
ATOM 7158  O O     . LEU D 4 174 ? 182.896 106.680 156.787 1.00 85.85  ? 174 LEU D O     1 
ATOM 7159  C CB    . LEU D 4 174 ? 180.269 108.594 156.924 1.00 85.85  ? 174 LEU D CB    1 
ATOM 7160  C CG    . LEU D 4 174 ? 181.462 109.451 157.341 1.00 85.85  ? 174 LEU D CG    1 
ATOM 7161  C CD1   . LEU D 4 174 ? 181.144 110.900 157.183 1.00 85.85  ? 174 LEU D CD1   1 
ATOM 7162  C CD2   . LEU D 4 174 ? 181.807 109.184 158.779 1.00 85.85  ? 174 LEU D CD2   1 
ATOM 7163  N N     . ALA D 4 175 ? 181.242 105.667 157.907 1.00 90.78  ? 175 ALA D N     1 
ATOM 7164  C CA    . ALA D 4 175 ? 182.134 104.994 158.837 1.00 90.78  ? 175 ALA D CA    1 
ATOM 7165  C C     . ALA D 4 175 ? 182.479 103.578 158.414 1.00 90.78  ? 175 ALA D C     1 
ATOM 7166  O O     . ALA D 4 175 ? 183.211 102.892 159.132 1.00 90.78  ? 175 ALA D O     1 
ATOM 7167  C CB    . ALA D 4 175 ? 181.512 104.957 160.230 1.00 90.78  ? 175 ALA D CB    1 
ATOM 7168  N N     . GLU D 4 176 ? 182.003 103.139 157.263 1.00 93.04  ? 176 GLU D N     1 
ATOM 7169  C CA    . GLU D 4 176 ? 182.295 101.818 156.738 1.00 93.04  ? 176 GLU D CA    1 
ATOM 7170  C C     . GLU D 4 176 ? 183.354 101.913 155.655 1.00 93.04  ? 176 GLU D C     1 
ATOM 7171  O O     . GLU D 4 176 ? 183.488 102.937 154.987 1.00 93.04  ? 176 GLU D O     1 
ATOM 7172  C CB    . GLU D 4 176 ? 181.026 101.188 156.160 1.00 93.04  ? 176 GLU D CB    1 
ATOM 7173  C CG    . GLU D 4 176 ? 181.213 99.849  155.474 1.00 93.04  ? 176 GLU D CG    1 
ATOM 7174  C CD    . GLU D 4 176 ? 179.931 99.335  154.850 1.00 93.04  ? 176 GLU D CD    1 
ATOM 7175  O OE1   . GLU D 4 176 ? 178.845 99.668  155.364 1.00 93.04  ? 176 GLU D OE1   1 
ATOM 7176  O OE2   . GLU D 4 176 ? 180.001 98.604  153.842 1.00 93.04  ? 176 GLU D OE2   1 
ATOM 7177  N N     . LEU D 4 177 ? 184.114 100.841 155.492 1.00 94.39  ? 177 LEU D N     1 
ATOM 7178  C CA    . LEU D 4 177 ? 185.115 100.806 154.444 1.00 94.39  ? 177 LEU D CA    1 
ATOM 7179  C C     . LEU D 4 177 ? 184.439 100.623 153.085 1.00 94.39  ? 177 LEU D C     1 
ATOM 7180  O O     . LEU D 4 177 ? 183.361 100.027 152.997 1.00 94.39  ? 177 LEU D O     1 
ATOM 7181  C CB    . LEU D 4 177 ? 186.102 99.672  154.690 1.00 94.39  ? 177 LEU D CB    1 
ATOM 7182  C CG    . LEU D 4 177 ? 186.936 99.768  155.966 1.00 94.39  ? 177 LEU D CG    1 
ATOM 7183  C CD1   . LEU D 4 177 ? 187.853 98.568  156.096 1.00 94.39  ? 177 LEU D CD1   1 
ATOM 7184  C CD2   . LEU D 4 177 ? 187.719 101.054 156.010 1.00 94.39  ? 177 LEU D CD2   1 
ATOM 7185  N N     . PRO D 4 178 ? 185.030 101.158 152.018 1.00 94.12  ? 178 PRO D N     1 
ATOM 7186  C CA    . PRO D 4 178 ? 184.401 101.056 150.696 1.00 94.12  ? 178 PRO D CA    1 
ATOM 7187  C C     . PRO D 4 178 ? 184.039 99.625  150.336 1.00 94.12  ? 178 PRO D C     1 
ATOM 7188  O O     . PRO D 4 178 ? 184.872 98.720  150.386 1.00 94.12  ? 178 PRO D O     1 
ATOM 7189  C CB    . PRO D 4 178 ? 185.469 101.628 149.760 1.00 94.12  ? 178 PRO D CB    1 
ATOM 7190  C CG    . PRO D 4 178 ? 186.194 102.593 150.617 1.00 94.12  ? 178 PRO D CG    1 
ATOM 7191  C CD    . PRO D 4 178 ? 186.259 101.964 151.972 1.00 94.12  ? 178 PRO D CD    1 
ATOM 7192  N N     . SER D 4 179 ? 182.768 99.425  149.995 1.00 93.83  ? 179 SER D N     1 
ATOM 7193  C CA    . SER D 4 179 ? 182.260 98.107  149.643 1.00 93.83  ? 179 SER D CA    1 
ATOM 7194  C C     . SER D 4 179 ? 181.938 98.002  148.159 1.00 93.83  ? 179 SER D C     1 
ATOM 7195  O O     . SER D 4 179 ? 180.840 97.575  147.794 1.00 93.83  ? 179 SER D O     1 
ATOM 7196  C CB    . SER D 4 179 ? 181.017 97.772  150.468 1.00 93.83  ? 179 SER D CB    1 
ATOM 7197  O OG    . SER D 4 179 ? 180.528 96.481  150.150 1.00 93.83  ? 179 SER D OG    1 
ATOM 7198  N N     . THR D 4 180 ? 182.852 98.492  147.321 1.00 93.23  ? 180 THR D N     1 
ATOM 7199  C CA    . THR D 4 180 ? 182.802 98.496  145.857 1.00 93.23  ? 180 THR D CA    1 
ATOM 7200  C C     . THR D 4 180 ? 181.609 99.239  145.264 1.00 93.23  ? 180 THR D C     1 
ATOM 7201  O O     . THR D 4 180 ? 181.484 99.305  144.038 1.00 93.23  ? 180 THR D O     1 
ATOM 7202  C CB    . THR D 4 180 ? 182.850 97.074  145.272 1.00 93.23  ? 180 THR D CB    1 
ATOM 7203  O OG1   . THR D 4 180 ? 183.261 97.159  143.903 1.00 93.23  ? 180 THR D OG1   1 
ATOM 7204  C CG2   . THR D 4 180 ? 181.481 96.410  145.251 1.00 93.23  ? 180 THR D CG2   1 
ATOM 7205  N N     . GLU D 4 181 ? 180.727 99.799  146.092 1.00 86.04  ? 181 GLU D N     1 
ATOM 7206  C CA    . GLU D 4 181 ? 179.660 100.673 145.599 1.00 86.04  ? 181 GLU D CA    1 
ATOM 7207  C C     . GLU D 4 181 ? 179.745 101.994 146.351 1.00 86.04  ? 181 GLU D C     1 
ATOM 7208  O O     . GLU D 4 181 ? 179.090 102.186 147.375 1.00 86.04  ? 181 GLU D O     1 
ATOM 7209  C CB    . GLU D 4 181 ? 178.292 100.022 145.747 1.00 86.04  ? 181 GLU D CB    1 
ATOM 7210  C CG    . GLU D 4 181 ? 177.132 100.920 145.350 1.00 86.04  ? 181 GLU D CG    1 
ATOM 7211  C CD    . GLU D 4 181 ? 177.050 101.146 143.856 1.00 86.04  ? 181 GLU D CD    1 
ATOM 7212  O OE1   . GLU D 4 181 ? 177.526 100.280 143.099 1.00 86.04  ? 181 GLU D OE1   1 
ATOM 7213  O OE2   . GLU D 4 181 ? 176.500 102.185 143.434 1.00 86.04  ? 181 GLU D OE2   1 
ATOM 7214  N N     . VAL D 4 182 ? 180.582 102.894 145.841 1.00 82.71  ? 182 VAL D N     1 
ATOM 7215  C CA    . VAL D 4 182 ? 180.737 104.214 146.435 1.00 82.71  ? 182 VAL D CA    1 
ATOM 7216  C C     . VAL D 4 182 ? 179.733 105.211 145.864 1.00 82.71  ? 182 VAL D C     1 
ATOM 7217  O O     . VAL D 4 182 ? 179.405 106.199 146.532 1.00 82.71  ? 182 VAL D O     1 
ATOM 7218  C CB    . VAL D 4 182 ? 182.182 104.708 146.249 1.00 82.71  ? 182 VAL D CB    1 
ATOM 7219  C CG1   . VAL D 4 182 ? 182.376 106.104 146.817 1.00 82.71  ? 182 VAL D CG1   1 
ATOM 7220  C CG2   . VAL D 4 182 ? 183.149 103.734 146.891 1.00 82.71  ? 182 VAL D CG2   1 
ATOM 7221  N N     . ASP D 4 183 ? 179.220 104.972 144.660 1.00 79.51  ? 183 ASP D N     1 
ATOM 7222  C CA    . ASP D 4 183 ? 178.194 105.834 144.105 1.00 79.51  ? 183 ASP D CA    1 
ATOM 7223  C C     . ASP D 4 183 ? 176.835 105.471 144.686 1.00 79.51  ? 183 ASP D C     1 
ATOM 7224  O O     . ASP D 4 183 ? 176.662 104.432 145.323 1.00 79.51  ? 183 ASP D O     1 
ATOM 7225  C CB    . ASP D 4 183 ? 178.164 105.721 142.582 1.00 79.51  ? 183 ASP D CB    1 
ATOM 7226  C CG    . ASP D 4 183 ? 179.425 106.248 141.927 1.00 79.51  ? 183 ASP D CG    1 
ATOM 7227  O OD1   . ASP D 4 183 ? 179.820 107.392 142.228 1.00 79.51  ? 183 ASP D OD1   1 
ATOM 7228  O OD2   . ASP D 4 183 ? 180.026 105.516 141.116 1.00 79.51  ? 183 ASP D OD2   1 
ATOM 7229  N N     . GLY D 4 184 ? 175.863 106.348 144.470 1.00 63.50  ? 184 GLY D N     1 
ATOM 7230  C CA    . GLY D 4 184 ? 174.605 106.205 145.168 1.00 63.50  ? 184 GLY D CA    1 
ATOM 7231  C C     . GLY D 4 184 ? 173.351 106.297 144.330 1.00 63.50  ? 184 GLY D C     1 
ATOM 7232  O O     . GLY D 4 184 ? 172.285 105.875 144.771 1.00 63.50  ? 184 GLY D O     1 
ATOM 7233  N N     . ALA D 4 185 ? 173.458 106.837 143.122 1.00 49.90  ? 185 ALA D N     1 
ATOM 7234  C CA    . ALA D 4 185 ? 172.296 107.053 142.264 1.00 49.90  ? 185 ALA D CA    1 
ATOM 7235  C C     . ALA D 4 185 ? 171.312 108.033 142.901 1.00 49.90  ? 185 ALA D C     1 
ATOM 7236  O O     . ALA D 4 185 ? 170.104 107.927 142.714 1.00 49.90  ? 185 ALA D O     1 
ATOM 7237  C CB    . ALA D 4 185 ? 171.596 105.734 141.920 1.00 49.90  ? 185 ALA D CB    1 
ATOM 7238  N N     . VAL D 4 186 ? 171.823 108.965 143.702 1.00 41.88  ? 186 VAL D N     1 
ATOM 7239  C CA    . VAL D 4 186 ? 171.067 110.101 144.216 1.00 41.88  ? 186 VAL D CA    1 
ATOM 7240  C C     . VAL D 4 186 ? 171.913 111.361 144.101 1.00 41.88  ? 186 VAL D C     1 
ATOM 7241  O O     . VAL D 4 186 ? 173.088 111.350 144.473 1.00 41.88  ? 186 VAL D O     1 
ATOM 7242  C CB    . VAL D 4 186 ? 170.634 109.876 145.668 1.00 41.88  ? 186 VAL D CB    1 
ATOM 7243  C CG1   . VAL D 4 186 ? 170.474 111.203 146.362 1.00 41.88  ? 186 VAL D CG1   1 
ATOM 7244  C CG2   . VAL D 4 186 ? 169.370 109.097 145.701 1.00 41.88  ? 186 VAL D CG2   1 
ATOM 7245  N N     . GLN D 4 187 ? 171.341 112.430 143.558 1.00 33.95  ? 187 GLN D N     1 
ATOM 7246  C CA    . GLN D 4 187 ? 172.106 113.624 143.209 1.00 33.95  ? 187 GLN D CA    1 
ATOM 7247  C C     . GLN D 4 187 ? 171.434 114.834 143.843 1.00 33.95  ? 187 GLN D C     1 
ATOM 7248  O O     . GLN D 4 187 ? 170.371 115.272 143.391 1.00 33.95  ? 187 GLN D O     1 
ATOM 7249  C CB    . GLN D 4 187 ? 172.212 113.789 141.701 1.00 33.95  ? 187 GLN D CB    1 
ATOM 7250  C CG    . GLN D 4 187 ? 173.080 114.911 141.211 1.00 33.95  ? 187 GLN D CG    1 
ATOM 7251  C CD    . GLN D 4 187 ? 172.950 115.097 139.720 1.00 33.95  ? 187 GLN D CD    1 
ATOM 7252  O OE1   . GLN D 4 187 ? 172.029 114.574 139.101 1.00 33.95  ? 187 GLN D OE1   1 
ATOM 7253  N NE2   . GLN D 4 187 ? 173.877 115.831 139.132 1.00 33.95  ? 187 GLN D NE2   1 
ATOM 7254  N N     . PHE D 4 188 ? 171.990 115.294 144.951 1.00 35.70  ? 188 PHE D N     1 
ATOM 7255  C CA    . PHE D 4 188 ? 171.491 116.471 145.648 1.00 35.70  ? 188 PHE D CA    1 
ATOM 7256  C C     . PHE D 4 188 ? 172.121 117.731 145.094 1.00 35.70  ? 188 PHE D C     1 
ATOM 7257  O O     . PHE D 4 188 ? 173.327 117.927 145.219 1.00 35.70  ? 188 PHE D O     1 
ATOM 7258  C CB    . PHE D 4 188 ? 171.762 116.381 147.135 1.00 35.70  ? 188 PHE D CB    1 
ATOM 7259  C CG    . PHE D 4 188 ? 170.719 115.680 147.873 1.00 35.70  ? 188 PHE D CG    1 
ATOM 7260  C CD1   . PHE D 4 188 ? 169.927 114.741 147.268 1.00 35.70  ? 188 PHE D CD1   1 
ATOM 7261  C CD2   . PHE D 4 188 ? 170.545 115.943 149.194 1.00 35.70  ? 188 PHE D CD2   1 
ATOM 7262  C CE1   . PHE D 4 188 ? 168.953 114.111 147.983 1.00 35.70  ? 188 PHE D CE1   1 
ATOM 7263  C CE2   . PHE D 4 188 ? 169.627 115.296 149.890 1.00 35.70  ? 188 PHE D CE2   1 
ATOM 7264  C CZ    . PHE D 4 188 ? 168.804 114.398 149.296 1.00 35.70  ? 188 PHE D CZ    1 
ATOM 7265  N N     . ALA D 4 189 ? 171.306 118.601 144.534 1.00 30.36  ? 189 ALA D N     1 
ATOM 7266  C CA    . ALA D 4 189 ? 171.782 119.920 144.174 1.00 30.36  ? 189 ALA D CA    1 
ATOM 7267  C C     . ALA D 4 189 ? 171.855 120.833 145.386 1.00 30.36  ? 189 ALA D C     1 
ATOM 7268  O O     . ALA D 4 189 ? 171.060 120.724 146.317 1.00 30.36  ? 189 ALA D O     1 
ATOM 7269  C CB    . ALA D 4 189 ? 170.877 120.546 143.127 1.00 30.36  ? 189 ALA D CB    1 
ATOM 7270  N N     . HIS D 4 190 ? 172.851 121.712 145.383 1.00 30.57  ? 190 HIS D N     1 
ATOM 7271  C CA    . HIS D 4 190 ? 172.997 122.708 146.437 1.00 30.57  ? 190 HIS D CA    1 
ATOM 7272  C C     . HIS D 4 190 ? 171.835 123.695 146.410 1.00 30.57  ? 190 HIS D C     1 
ATOM 7273  O O     . HIS D 4 190 ? 171.622 124.380 145.408 1.00 30.57  ? 190 HIS D O     1 
ATOM 7274  C CB    . HIS D 4 190 ? 174.308 123.464 146.260 1.00 30.57  ? 190 HIS D CB    1 
ATOM 7275  C CG    . HIS D 4 190 ? 175.537 122.613 146.350 1.00 30.57  ? 190 HIS D CG    1 
ATOM 7276  N ND1   . HIS D 4 190 ? 176.324 122.562 147.478 1.00 30.57  ? 190 HIS D ND1   1 
ATOM 7277  C CD2   . HIS D 4 190 ? 176.146 121.828 145.434 1.00 30.57  ? 190 HIS D CD2   1 
ATOM 7278  C CE1   . HIS D 4 190 ? 177.343 121.753 147.264 1.00 30.57  ? 190 HIS D CE1   1 
ATOM 7279  N NE2   . HIS D 4 190 ? 177.260 121.297 146.031 1.00 30.57  ? 190 HIS D NE2   1 
ATOM 7280  N N     . ALA D 4 191 ? 171.071 123.750 147.495 1.00 28.41  ? 191 ALA D N     1 
ATOM 7281  C CA    . ALA D 4 191 ? 170.008 124.736 147.658 1.00 28.41  ? 191 ALA D CA    1 
ATOM 7282  C C     . ALA D 4 191 ? 170.544 126.158 147.651 1.00 28.41  ? 191 ALA D C     1 
ATOM 7283  O O     . ALA D 4 191 ? 171.553 126.440 148.287 1.00 28.41  ? 191 ALA D O     1 
ATOM 7284  C CB    . ALA D 4 191 ? 169.269 124.486 148.961 1.00 28.41  ? 191 ALA D CB    1 
ATOM 7285  N N     . PHE D 4 192 ? 169.872 127.060 146.934 1.00 29.05  ? 192 PHE D N     1 
ATOM 7286  C CA    . PHE D 4 192 ? 170.281 128.461 146.860 1.00 29.05  ? 192 PHE D CA    1 
ATOM 7287  C C     . PHE D 4 192 ? 169.050 129.360 146.854 1.00 29.05  ? 192 PHE D C     1 
ATOM 7288  O O     . PHE D 4 192 ? 167.991 128.967 146.366 1.00 29.05  ? 192 PHE D O     1 
ATOM 7289  C CB    . PHE D 4 192 ? 171.135 128.735 145.632 1.00 29.05  ? 192 PHE D CB    1 
ATOM 7290  C CG    . PHE D 4 192 ? 170.407 128.568 144.352 1.00 29.05  ? 192 PHE D CG    1 
ATOM 7291  C CD1   . PHE D 4 192 ? 170.190 127.318 143.830 1.00 29.05  ? 192 PHE D CD1   1 
ATOM 7292  C CD2   . PHE D 4 192 ? 169.954 129.661 143.659 1.00 29.05  ? 192 PHE D CD2   1 
ATOM 7293  C CE1   . PHE D 4 192 ? 169.519 127.165 142.652 1.00 29.05  ? 192 PHE D CE1   1 
ATOM 7294  C CE2   . PHE D 4 192 ? 169.285 129.511 142.475 1.00 29.05  ? 192 PHE D CE2   1 
ATOM 7295  C CZ    . PHE D 4 192 ? 169.069 128.264 141.971 1.00 29.05  ? 192 PHE D CZ    1 
ATOM 7296  N N     . THR D 4 193 ? 169.196 130.582 147.362 1.00 32.31  ? 193 THR D N     1 
ATOM 7297  C CA    . THR D 4 193 ? 168.043 131.466 147.478 1.00 32.31  ? 193 THR D CA    1 
ATOM 7298  C C     . THR D 4 193 ? 167.535 131.939 146.134 1.00 32.31  ? 193 THR D C     1 
ATOM 7299  O O     . THR D 4 193 ? 168.298 132.191 145.202 1.00 32.31  ? 193 THR D O     1 
ATOM 7300  C CB    . THR D 4 193 ? 168.358 132.718 148.291 1.00 32.31  ? 193 THR D CB    1 
ATOM 7301  O OG1   . THR D 4 193 ? 169.725 133.084 148.125 1.00 32.31  ? 193 THR D OG1   1 
ATOM 7302  C CG2   . THR D 4 193 ? 167.995 132.581 149.715 1.00 32.31  ? 193 THR D CG2   1 
ATOM 7303  N N     . VAL D 4 194 ? 166.217 132.058 146.051 1.00 34.07  ? 194 VAL D N     1 
ATOM 7304  C CA    . VAL D 4 194 ? 165.565 132.567 144.862 1.00 34.07  ? 194 VAL D CA    1 
ATOM 7305  C C     . VAL D 4 194 ? 165.951 134.012 144.609 1.00 34.07  ? 194 VAL D C     1 
ATOM 7306  O O     . VAL D 4 194 ? 166.103 134.432 143.460 1.00 34.07  ? 194 VAL D O     1 
ATOM 7307  C CB    . VAL D 4 194 ? 164.051 132.399 145.023 1.00 34.07  ? 194 VAL D CB    1 
ATOM 7308  C CG1   . VAL D 4 194 ? 163.330 133.205 144.020 1.00 34.07  ? 194 VAL D CG1   1 
ATOM 7309  C CG2   . VAL D 4 194 ? 163.696 130.969 144.870 1.00 34.07  ? 194 VAL D CG2   1 
ATOM 7310  N N     . HIS D 4 195 ? 166.156 134.784 145.661 1.00 37.48  ? 195 HIS D N     1 
ATOM 7311  C CA    . HIS D 4 195 ? 166.451 136.199 145.547 1.00 37.48  ? 195 HIS D CA    1 
ATOM 7312  C C     . HIS D 4 195 ? 167.842 136.508 146.066 1.00 37.48  ? 195 HIS D C     1 
ATOM 7313  O O     . HIS D 4 195 ? 168.490 135.678 146.697 1.00 37.48  ? 195 HIS D O     1 
ATOM 7314  C CB    . HIS D 4 195 ? 165.413 136.987 146.325 1.00 37.48  ? 195 HIS D CB    1 
ATOM 7315  C CG    . HIS D 4 195 ? 165.380 136.631 147.769 1.00 37.48  ? 195 HIS D CG    1 
ATOM 7316  N ND1   . HIS D 4 195 ? 164.753 135.497 148.233 1.00 37.48  ? 195 HIS D ND1   1 
ATOM 7317  C CD2   . HIS D 4 195 ? 165.903 137.242 148.853 1.00 37.48  ? 195 HIS D CD2   1 
ATOM 7318  C CE1   . HIS D 4 195 ? 164.890 135.427 149.543 1.00 37.48  ? 195 HIS D CE1   1 
ATOM 7319  N NE2   . HIS D 4 195 ? 165.581 136.477 149.944 1.00 37.48  ? 195 HIS D NE2   1 
ATOM 7320  N N     . GLY D 4 196 ? 168.297 137.732 145.819 1.00 40.08  ? 196 GLY D N     1 
ATOM 7321  C CA    . GLY D 4 196 ? 169.566 138.151 146.369 1.00 40.08  ? 196 GLY D CA    1 
ATOM 7322  C C     . GLY D 4 196 ? 169.421 138.489 147.837 1.00 40.08  ? 196 GLY D C     1 
ATOM 7323  O O     . GLY D 4 196 ? 168.464 139.134 148.256 1.00 40.08  ? 196 GLY D O     1 
ATOM 7324  N N     . THR D 4 197 ? 170.398 138.056 148.622 1.00 42.30  ? 197 THR D N     1 
ATOM 7325  C CA    . THR D 4 197 ? 170.337 138.219 150.065 1.00 42.30  ? 197 THR D CA    1 
ATOM 7326  C C     . THR D 4 197 ? 171.627 138.790 150.623 1.00 42.30  ? 197 THR D C     1 
ATOM 7327  O O     . THR D 4 197 ? 172.705 138.224 150.426 1.00 42.30  ? 197 THR D O     1 
ATOM 7328  C CB    . THR D 4 197 ? 169.995 136.895 150.742 1.00 42.30  ? 197 THR D CB    1 
ATOM 7329  O OG1   . THR D 4 197 ? 169.963 137.083 152.160 1.00 42.30  ? 197 THR D OG1   1 
ATOM 7330  C CG2   . THR D 4 197 ? 170.972 135.824 150.375 1.00 42.30  ? 197 THR D CG2   1 
ATOM 7331  N N     . THR D 4 198 ? 171.516 139.930 151.287 1.00 46.07  ? 198 THR D N     1 
ATOM 7332  C CA    . THR D 4 198 ? 172.632 140.486 152.029 1.00 46.07  ? 198 THR D CA    1 
ATOM 7333  C C     . THR D 4 198 ? 172.769 139.764 153.360 1.00 46.07  ? 198 THR D C     1 
ATOM 7334  O O     . THR D 4 198 ? 171.782 139.591 154.080 1.00 46.07  ? 198 THR D O     1 
ATOM 7335  C CB    . THR D 4 198 ? 172.417 141.971 152.262 1.00 46.07  ? 198 THR D CB    1 
ATOM 7336  O OG1   . THR D 4 198 ? 171.205 142.157 153.001 1.00 46.07  ? 198 THR D OG1   1 
ATOM 7337  C CG2   . THR D 4 198 ? 172.310 142.687 150.942 1.00 46.07  ? 198 THR D CG2   1 
ATOM 7338  N N     . VAL D 4 199 ? 173.985 139.333 153.686 1.00 41.32  ? 199 VAL D N     1 
ATOM 7339  C CA    . VAL D 4 199 ? 174.215 138.688 154.970 1.00 41.32  ? 199 VAL D CA    1 
ATOM 7340  C C     . VAL D 4 199 ? 173.901 139.694 156.067 1.00 41.32  ? 199 VAL D C     1 
ATOM 7341  O O     . VAL D 4 199 ? 174.429 140.810 156.088 1.00 41.32  ? 199 VAL D O     1 
ATOM 7342  C CB    . VAL D 4 199 ? 175.632 138.127 155.061 1.00 41.32  ? 199 VAL D CB    1 
ATOM 7343  C CG1   . VAL D 4 199 ? 176.670 139.221 155.002 1.00 41.32  ? 199 VAL D CG1   1 
ATOM 7344  C CG2   . VAL D 4 199 ? 175.773 137.324 156.303 1.00 41.32  ? 199 VAL D CG2   1 
ATOM 7345  N N     . GLU D 4 200 ? 173.008 139.314 156.966 1.00 45.01  ? 200 GLU D N     1 
ATOM 7346  C CA    . GLU D 4 200 ? 172.497 140.189 158.013 1.00 45.01  ? 200 GLU D CA    1 
ATOM 7347  C C     . GLU D 4 200 ? 173.206 139.899 159.327 1.00 45.01  ? 200 GLU D C     1 
ATOM 7348  O O     . GLU D 4 200 ? 173.042 138.818 159.904 1.00 45.01  ? 200 GLU D O     1 
ATOM 7349  C CB    . GLU D 4 200 ? 170.985 140.018 158.175 1.00 45.01  ? 200 GLU D CB    1 
ATOM 7350  C CG    . GLU D 4 200 ? 170.393 140.971 159.197 1.00 45.01  ? 200 GLU D CG    1 
ATOM 7351  C CD    . GLU D 4 200 ? 170.337 142.417 158.715 1.00 45.01  ? 200 GLU D CD    1 
ATOM 7352  O OE1   . GLU D 4 200 ? 170.826 142.717 157.608 1.00 45.01  ? 200 GLU D OE1   1 
ATOM 7353  O OE2   . GLU D 4 200 ? 169.837 143.278 159.471 1.00 45.01  ? 200 GLU D OE2   1 
ATOM 7354  N N     . VAL D 4 201 ? 174.028 140.844 159.758 1.00 42.44  ? 201 VAL D N     1 
ATOM 7355  C CA    . VAL D 4 201 ? 174.811 140.728 160.982 1.00 42.44  ? 201 VAL D CA    1 
ATOM 7356  C C     . VAL D 4 201 ? 173.941 140.918 162.215 1.00 42.44  ? 201 VAL D C     1 
ATOM 7357  O O     . VAL D 4 201 ? 173.169 141.875 162.309 1.00 42.44  ? 201 VAL D O     1 
ATOM 7358  C CB    . VAL D 4 201 ? 175.944 141.752 160.990 1.00 42.44  ? 201 VAL D CB    1 
ATOM 7359  C CG1   . VAL D 4 201 ? 176.646 141.650 162.281 1.00 42.44  ? 201 VAL D CG1   1 
ATOM 7360  C CG2   . VAL D 4 201 ? 176.877 141.483 159.863 1.00 42.44  ? 201 VAL D CG2   1 
ATOM 7361  N N     . ASP D 4 202 ? 174.116 140.030 163.187 1.00 43.24  ? 202 ASP D N     1 
ATOM 7362  C CA    . ASP D 4 202 ? 173.444 140.057 164.481 1.00 43.24  ? 202 ASP D CA    1 
ATOM 7363  C C     . ASP D 4 202 ? 174.482 140.259 165.575 1.00 43.24  ? 202 ASP D C     1 
ATOM 7364  O O     . ASP D 4 202 ? 175.256 139.347 165.877 1.00 43.24  ? 202 ASP D O     1 
ATOM 7365  C CB    . ASP D 4 202 ? 172.665 138.781 164.730 1.00 43.24  ? 202 ASP D CB    1 
ATOM 7366  C CG    . ASP D 4 202 ? 172.164 138.690 166.144 1.00 43.24  ? 202 ASP D CG    1 
ATOM 7367  O OD1   . ASP D 4 202 ? 171.167 139.365 166.461 1.00 43.24  ? 202 ASP D OD1   1 
ATOM 7368  O OD2   . ASP D 4 202 ? 172.765 137.951 166.945 1.00 43.24  ? 202 ASP D OD2   1 
ATOM 7369  N N     . PHE D 4 203 ? 174.542 141.459 166.131 1.00 45.82  ? 203 PHE D N     1 
ATOM 7370  C CA    . PHE D 4 203 ? 175.488 141.758 167.196 1.00 45.82  ? 203 PHE D CA    1 
ATOM 7371  C C     . PHE D 4 203 ? 174.983 141.163 168.497 1.00 45.82  ? 203 PHE D C     1 
ATOM 7372  O O     . PHE D 4 203 ? 173.839 141.403 168.876 1.00 45.82  ? 203 PHE D O     1 
ATOM 7373  C CB    . PHE D 4 203 ? 175.610 143.265 167.355 1.00 45.82  ? 203 PHE D CB    1 
ATOM 7374  C CG    . PHE D 4 203 ? 176.452 143.688 168.508 1.00 45.82  ? 203 PHE D CG    1 
ATOM 7375  C CD1   . PHE D 4 203 ? 177.817 143.724 168.399 1.00 45.82  ? 203 PHE D CD1   1 
ATOM 7376  C CD2   . PHE D 4 203 ? 175.882 144.029 169.705 1.00 45.82  ? 203 PHE D CD2   1 
ATOM 7377  C CE1   . PHE D 4 203 ? 178.595 144.119 169.452 1.00 45.82  ? 203 PHE D CE1   1 
ATOM 7378  C CE2   . PHE D 4 203 ? 176.655 144.417 170.764 1.00 45.82  ? 203 PHE D CE2   1 
ATOM 7379  C CZ    . PHE D 4 203 ? 178.012 144.461 170.637 1.00 45.82  ? 203 PHE D CZ    1 
ATOM 7380  N N     . PHE D 4 204 ? 175.830 140.415 169.205 1.00 46.12  ? 204 PHE D N     1 
ATOM 7381  C CA    . PHE D 4 204 ? 175.365 139.781 170.432 1.00 46.12  ? 204 PHE D CA    1 
ATOM 7382  C C     . PHE D 4 204 ? 176.425 139.909 171.509 1.00 46.12  ? 204 PHE D C     1 
ATOM 7383  O O     . PHE D 4 204 ? 177.622 139.944 171.222 1.00 46.12  ? 204 PHE D O     1 
ATOM 7384  C CB    . PHE D 4 204 ? 175.012 138.315 170.241 1.00 46.12  ? 204 PHE D CB    1 
ATOM 7385  C CG    . PHE D 4 204 ? 176.175 137.437 169.968 1.00 46.12  ? 204 PHE D CG    1 
ATOM 7386  C CD1   . PHE D 4 204 ? 176.602 137.229 168.688 1.00 46.12  ? 204 PHE D CD1   1 
ATOM 7387  C CD2   . PHE D 4 204 ? 176.790 136.754 170.991 1.00 46.12  ? 204 PHE D CD2   1 
ATOM 7388  C CE1   . PHE D 4 204 ? 177.655 136.400 168.433 1.00 46.12  ? 204 PHE D CE1   1 
ATOM 7389  C CE2   . PHE D 4 204 ? 177.843 135.916 170.739 1.00 46.12  ? 204 PHE D CE2   1 
ATOM 7390  C CZ    . PHE D 4 204 ? 178.275 135.740 169.458 1.00 46.12  ? 204 PHE D CZ    1 
ATOM 7391  N N     . THR D 4 205 ? 175.968 139.942 172.758 1.00 53.91  ? 205 THR D N     1 
ATOM 7392  C CA    . THR D 4 205 ? 176.856 140.075 173.900 1.00 53.91  ? 205 THR D CA    1 
ATOM 7393  C C     . THR D 4 205 ? 176.485 139.116 175.020 1.00 53.91  ? 205 THR D C     1 
ATOM 7394  O O     . THR D 4 205 ? 175.342 139.117 175.475 1.00 53.91  ? 205 THR D O     1 
ATOM 7395  C CB    . THR D 4 205 ? 176.785 141.508 174.397 1.00 53.91  ? 205 THR D CB    1 
ATOM 7396  O OG1   . THR D 4 205 ? 177.014 142.383 173.293 1.00 53.91  ? 205 THR D OG1   1 
ATOM 7397  C CG2   . THR D 4 205 ? 177.861 141.742 175.362 1.00 53.91  ? 205 THR D CG2   1 
ATOM 7398  N N     . ALA D 4 206 ? 177.434 138.299 175.455 1.00 61.98  ? 206 ALA D N     1 
ATOM 7399  C CA    . ALA D 4 206 ? 177.239 137.428 176.608 1.00 61.98  ? 206 ALA D CA    1 
ATOM 7400  C C     . ALA D 4 206 ? 177.356 138.203 177.919 1.00 61.98  ? 206 ALA D C     1 
ATOM 7401  O O     . ALA D 4 206 ? 178.313 138.965 178.109 1.00 61.98  ? 206 ALA D O     1 
ATOM 7402  C CB    . ALA D 4 206 ? 178.250 136.288 176.577 1.00 61.98  ? 206 ALA D CB    1 
ATOM 7403  N N     . VAL D 4 207 ? 176.386 138.000 178.822 1.00 64.56  ? 207 VAL D N     1 
ATOM 7404  C CA    . VAL D 4 207 ? 176.264 138.770 180.060 1.00 64.56  ? 207 VAL D CA    1 
ATOM 7405  C C     . VAL D 4 207 ? 177.017 138.095 181.199 1.00 64.56  ? 207 VAL D C     1 
ATOM 7406  O O     . VAL D 4 207 ? 176.939 136.876 181.384 1.00 64.56  ? 207 VAL D O     1 
ATOM 7407  C CB    . VAL D 4 207 ? 174.795 138.993 180.445 1.00 64.56  ? 207 VAL D CB    1 
ATOM 7408  C CG1   . VAL D 4 207 ? 174.176 137.741 181.020 1.00 64.56  ? 207 VAL D CG1   1 
ATOM 7409  C CG2   . VAL D 4 207 ? 174.710 140.108 181.462 1.00 64.56  ? 207 VAL D CG2   1 
ATOM 7410  N N     . ASP D 4 208 ? 177.795 138.883 181.930 1.00 72.35  ? 208 ASP D N     1 
ATOM 7411  C CA    . ASP D 4 208 ? 178.506 138.412 183.113 1.00 72.35  ? 208 ASP D CA    1 
ATOM 7412  C C     . ASP D 4 208 ? 177.585 138.477 184.326 1.00 72.35  ? 208 ASP D C     1 
ATOM 7413  O O     . ASP D 4 208 ? 177.080 139.553 184.659 1.00 72.35  ? 208 ASP D O     1 
ATOM 7414  C CB    . ASP D 4 208 ? 179.754 139.252 183.344 1.00 72.35  ? 208 ASP D CB    1 
ATOM 7415  C CG    . ASP D 4 208 ? 180.747 138.567 184.242 1.00 72.35  ? 208 ASP D CG    1 
ATOM 7416  O OD1   . ASP D 4 208 ? 180.447 137.450 184.705 1.00 72.35  ? 208 ASP D OD1   1 
ATOM 7417  O OD2   . ASP D 4 208 ? 181.816 139.157 184.502 1.00 72.35  ? 208 ASP D OD2   1 
ATOM 7418  N N     . ASP D 4 209 ? 177.351 137.340 184.987 1.00 74.84  ? 209 ASP D N     1 
ATOM 7419  C CA    . ASP D 4 209 ? 176.363 137.324 186.065 1.00 74.84  ? 209 ASP D CA    1 
ATOM 7420  C C     . ASP D 4 209 ? 176.877 137.975 187.341 1.00 74.84  ? 209 ASP D C     1 
ATOM 7421  O O     . ASP D 4 209 ? 176.138 138.720 187.992 1.00 74.84  ? 209 ASP D O     1 
ATOM 7422  C CB    . ASP D 4 209 ? 175.953 135.895 186.398 1.00 74.84  ? 209 ASP D CB    1 
ATOM 7423  C CG    . ASP D 4 209 ? 174.884 135.371 185.494 1.00 74.84  ? 209 ASP D CG    1 
ATOM 7424  O OD1   . ASP D 4 209 ? 174.114 136.180 184.951 1.00 74.84  ? 209 ASP D OD1   1 
ATOM 7425  O OD2   . ASP D 4 209 ? 174.830 134.139 185.314 1.00 74.84  ? 209 ASP D OD2   1 
ATOM 7426  N N     . ILE D 4 210 ? 178.114 137.709 187.730 1.00 78.67  ? 210 ILE D N     1 
ATOM 7427  C CA    . ILE D 4 210 ? 178.650 138.336 188.941 1.00 78.67  ? 210 ILE D CA    1 
ATOM 7428  C C     . ILE D 4 210 ? 179.092 139.758 188.607 1.00 78.67  ? 210 ILE D C     1 
ATOM 7429  O O     . ILE D 4 210 ? 179.897 139.946 187.678 1.00 78.67  ? 210 ILE D O     1 
ATOM 7430  C CB    . ILE D 4 210 ? 179.799 137.516 189.503 1.00 78.67  ? 210 ILE D CB    1 
ATOM 7431  C CG1   . ILE D 4 210 ? 179.459 136.022 189.460 1.00 78.67  ? 210 ILE D CG1   1 
ATOM 7432  C CG2   . ILE D 4 210 ? 180.102 137.953 190.919 1.00 78.67  ? 210 ILE D CG2   1 
ATOM 7433  C CD1   . ILE D 4 210 ? 178.106 135.657 190.055 1.00 78.67  ? 210 ILE D CD1   1 
ATOM 7434  N N     . PRO D 4 211 ? 178.628 140.768 189.344 1.00 85.07  ? 211 PRO D N     1 
ATOM 7435  C CA    . PRO D 4 211 ? 178.979 142.151 189.002 1.00 85.07  ? 211 PRO D CA    1 
ATOM 7436  C C     . PRO D 4 211 ? 179.883 142.885 189.984 1.00 85.07  ? 211 PRO D C     1 
ATOM 7437  O O     . PRO D 4 211 ? 179.597 142.903 191.185 1.00 85.07  ? 211 PRO D O     1 
ATOM 7438  C CB    . PRO D 4 211 ? 177.607 142.827 188.956 1.00 85.07  ? 211 PRO D CB    1 
ATOM 7439  C CG    . PRO D 4 211 ? 176.836 142.107 190.010 1.00 85.07  ? 211 PRO D CG    1 
ATOM 7440  C CD    . PRO D 4 211 ? 177.352 140.693 190.070 1.00 85.07  ? 211 PRO D CD    1 
ATOM 7441  N N     . LYS D 4 212 ? 180.966 143.502 189.512 1.00 99.70  ? 212 LYS D N     1 
ATOM 7442  C CA    . LYS D 4 212 ? 181.835 144.237 190.427 1.00 99.70  ? 212 LYS D CA    1 
ATOM 7443  C C     . LYS D 4 212 ? 181.287 145.649 190.627 1.00 99.70  ? 212 LYS D C     1 
ATOM 7444  O O     . LYS D 4 212 ? 180.234 146.014 190.098 1.00 99.70  ? 212 LYS D O     1 
ATOM 7445  C CB    . LYS D 4 212 ? 183.279 144.327 189.947 1.00 99.70  ? 212 LYS D CB    1 
ATOM 7446  C CG    . LYS D 4 212 ? 183.482 144.581 188.491 1.00 99.70  ? 212 LYS D CG    1 
ATOM 7447  C CD    . LYS D 4 212 ? 184.952 144.450 188.153 1.00 99.70  ? 212 LYS D CD    1 
ATOM 7448  C CE    . LYS D 4 212 ? 185.387 143.028 188.110 1.00 99.70  ? 212 LYS D CE    1 
ATOM 7449  N NZ    . LYS D 4 212 ? 186.859 142.846 188.186 1.00 99.70  ? 212 LYS D NZ    1 
ATOM 7450  N N     . GLU D 4 213 ? 182.004 146.476 191.394 1.00 108.31 ? 213 GLU D N     1 
ATOM 7451  C CA    . GLU D 4 213 ? 181.557 147.851 191.620 1.00 108.31 ? 213 GLU D CA    1 
ATOM 7452  C C     . GLU D 4 213 ? 181.936 148.729 190.419 1.00 108.31 ? 213 GLU D C     1 
ATOM 7453  O O     . GLU D 4 213 ? 182.725 149.665 190.491 1.00 108.31 ? 213 GLU D O     1 
ATOM 7454  C CB    . GLU D 4 213 ? 182.123 148.384 192.931 1.00 108.31 ? 213 GLU D CB    1 
ATOM 7455  C CG    . GLU D 4 213 ? 181.401 149.618 193.447 1.00 108.31 ? 213 GLU D CG    1 
ATOM 7456  C CD    . GLU D 4 213 ? 181.806 150.910 192.784 1.00 108.31 ? 213 GLU D CD    1 
ATOM 7457  O OE1   . GLU D 4 213 ? 183.001 151.305 192.816 1.00 108.31 ? 213 GLU D OE1   1 
ATOM 7458  O OE2   . GLU D 4 213 ? 180.915 151.531 192.192 1.00 108.31 ? 213 GLU D OE2   1 
ATOM 7459  N N     . ASN D 4 214 ? 181.393 148.319 189.282 1.00 107.40 ? 214 ASN D N     1 
ATOM 7460  C CA    . ASN D 4 214 ? 181.521 148.919 187.963 1.00 107.40 ? 214 ASN D CA    1 
ATOM 7461  C C     . ASN D 4 214 ? 180.263 148.435 187.272 1.00 107.40 ? 214 ASN D C     1 
ATOM 7462  O O     . ASN D 4 214 ? 179.640 147.472 187.722 1.00 107.40 ? 214 ASN D O     1 
ATOM 7463  C CB    . ASN D 4 214 ? 182.824 148.612 187.195 1.00 107.40 ? 214 ASN D CB    1 
ATOM 7464  C CG    . ASN D 4 214 ? 182.859 147.246 186.521 1.00 107.40 ? 214 ASN D CG    1 
ATOM 7465  O OD1   . ASN D 4 214 ? 181.843 146.614 186.221 1.00 107.40 ? 214 ASN D OD1   1 
ATOM 7466  N ND2   . ASN D 4 214 ? 184.065 146.835 186.183 1.00 107.40 ? 214 ASN D ND2   1 
ATOM 7467  N N     . ASP D 4 215 ? 179.871 149.080 186.189 1.00 104.95 ? 215 ASP D N     1 
ATOM 7468  C CA    . ASP D 4 215 ? 178.610 148.655 185.607 1.00 104.95 ? 215 ASP D CA    1 
ATOM 7469  C C     . ASP D 4 215 ? 178.640 148.306 184.133 1.00 104.95 ? 215 ASP D C     1 
ATOM 7470  O O     . ASP D 4 215 ? 179.162 149.057 183.304 1.00 104.95 ? 215 ASP D O     1 
ATOM 7471  C CB    . ASP D 4 215 ? 177.560 149.757 185.797 1.00 104.95 ? 215 ASP D CB    1 
ATOM 7472  C CG    . ASP D 4 215 ? 176.244 149.423 185.130 1.00 104.95 ? 215 ASP D CG    1 
ATOM 7473  O OD1   . ASP D 4 215 ? 175.533 148.533 185.630 1.00 104.95 ? 215 ASP D OD1   1 
ATOM 7474  O OD2   . ASP D 4 215 ? 175.924 150.058 184.104 1.00 104.95 ? 215 ASP D OD2   1 
ATOM 7475  N N     . HIS D 4 216 ? 178.118 147.109 183.857 1.00 102.09 ? 216 HIS D N     1 
ATOM 7476  C CA    . HIS D 4 216 ? 177.814 146.558 182.546 1.00 102.09 ? 216 HIS D CA    1 
ATOM 7477  C C     . HIS D 4 216 ? 179.004 146.106 181.714 1.00 102.09 ? 216 HIS D C     1 
ATOM 7478  O O     . HIS D 4 216 ? 178.824 145.806 180.531 1.00 102.09 ? 216 HIS D O     1 
ATOM 7479  C CB    . HIS D 4 216 ? 176.939 147.563 181.806 1.00 102.09 ? 216 HIS D CB    1 
ATOM 7480  C CG    . HIS D 4 216 ? 175.580 147.677 182.421 1.00 102.09 ? 216 HIS D CG    1 
ATOM 7481  N ND1   . HIS D 4 216 ? 174.767 148.775 182.258 1.00 102.09 ? 216 HIS D ND1   1 
ATOM 7482  C CD2   . HIS D 4 216 ? 174.915 146.835 183.244 1.00 102.09 ? 216 HIS D CD2   1 
ATOM 7483  C CE1   . HIS D 4 216 ? 173.655 148.599 182.948 1.00 102.09 ? 216 HIS D CE1   1 
ATOM 7484  N NE2   . HIS D 4 216 ? 173.715 147.425 183.547 1.00 102.09 ? 216 HIS D NE2   1 
ATOM 7485  N N     . GLY D 4 217 ? 180.207 146.041 182.270 1.00 92.87  ? 217 GLY D N     1 
ATOM 7486  C CA    . GLY D 4 217 ? 181.299 145.567 181.442 1.00 92.87  ? 217 GLY D CA    1 
ATOM 7487  C C     . GLY D 4 217 ? 181.120 144.099 181.103 1.00 92.87  ? 217 GLY D C     1 
ATOM 7488  O O     . GLY D 4 217 ? 181.862 143.241 181.583 1.00 92.87  ? 217 GLY D O     1 
ATOM 7489  N N     . SER D 4 218 ? 180.118 143.822 180.266 1.00 78.50  ? 218 SER D N     1 
ATOM 7490  C CA    . SER D 4 218 ? 179.695 142.503 179.799 1.00 78.50  ? 218 SER D CA    1 
ATOM 7491  C C     . SER D 4 218 ? 180.766 141.457 179.538 1.00 78.50  ? 218 SER D C     1 
ATOM 7492  O O     . SER D 4 218 ? 181.928 141.772 179.274 1.00 78.50  ? 218 SER D O     1 
ATOM 7493  C CB    . SER D 4 218 ? 178.879 142.596 178.535 1.00 78.50  ? 218 SER D CB    1 
ATOM 7494  O OG    . SER D 4 218 ? 178.557 141.268 178.170 1.00 78.50  ? 218 SER D OG    1 
ATOM 7495  N N     . GLY D 4 219 ? 180.349 140.193 179.570 1.00 71.24  ? 219 GLY D N     1 
ATOM 7496  C CA    . GLY D 4 219 ? 181.290 139.099 179.425 1.00 71.24  ? 219 GLY D CA    1 
ATOM 7497  C C     . GLY D 4 219 ? 181.878 138.944 178.034 1.00 71.24  ? 219 GLY D C     1 
ATOM 7498  O O     . GLY D 4 219 ? 183.060 138.625 177.899 1.00 71.24  ? 219 GLY D O     1 
ATOM 7499  N N     . HIS D 4 220 ? 181.089 139.162 176.981 1.00 62.79  ? 220 HIS D N     1 
ATOM 7500  C CA    . HIS D 4 220 ? 181.658 138.911 175.651 1.00 62.79  ? 220 HIS D CA    1 
ATOM 7501  C C     . HIS D 4 220 ? 180.915 139.640 174.539 1.00 62.79  ? 220 HIS D C     1 
ATOM 7502  O O     . HIS D 4 220 ? 179.789 139.273 174.203 1.00 62.79  ? 220 HIS D O     1 
ATOM 7503  C CB    . HIS D 4 220 ? 181.659 137.413 175.387 1.00 62.79  ? 220 HIS D CB    1 
ATOM 7504  C CG    . HIS D 4 220 ? 182.249 137.029 174.072 1.00 62.79  ? 220 HIS D CG    1 
ATOM 7505  N ND1   . HIS D 4 220 ? 183.587 137.175 173.780 1.00 62.79  ? 220 HIS D ND1   1 
ATOM 7506  C CD2   . HIS D 4 220 ? 181.680 136.481 172.974 1.00 62.79  ? 220 HIS D CD2   1 
ATOM 7507  C CE1   . HIS D 4 220 ? 183.816 136.742 172.554 1.00 62.79  ? 220 HIS D CE1   1 
ATOM 7508  N NE2   . HIS D 4 220 ? 182.675 136.313 172.044 1.00 62.79  ? 220 HIS D NE2   1 
ATOM 7509  N N     . MET D 4 221 ? 181.579 140.610 173.919 1.00 56.62  ? 221 MET D N     1 
ATOM 7510  C CA    . MET D 4 221 ? 181.050 141.311 172.758 1.00 56.62  ? 221 MET D CA    1 
ATOM 7511  C C     . MET D 4 221 ? 181.403 140.533 171.497 1.00 56.62  ? 221 MET D C     1 
ATOM 7512  O O     . MET D 4 221 ? 182.514 140.015 171.375 1.00 56.62  ? 221 MET D O     1 
ATOM 7513  C CB    . MET D 4 221 ? 181.642 142.713 172.690 1.00 56.62  ? 221 MET D CB    1 
ATOM 7514  C CG    . MET D 4 221 ? 181.169 143.611 173.789 1.00 56.62  ? 221 MET D CG    1 
ATOM 7515  S SD    . MET D 4 221 ? 181.871 145.253 173.642 1.00 56.62  ? 221 MET D SD    1 
ATOM 7516  C CE    . MET D 4 221 ? 181.473 145.655 171.946 1.00 56.62  ? 221 MET D CE    1 
ATOM 7517  N N     . ASN D 4 222 ? 180.463 140.438 170.564 1.00 51.39  ? 222 ASN D N     1 
ATOM 7518  C CA    . ASN D 4 222 ? 180.746 139.779 169.289 1.00 51.39  ? 222 ASN D CA    1 
ATOM 7519  C C     . ASN D 4 222 ? 179.638 140.105 168.306 1.00 51.39  ? 222 ASN D C     1 
ATOM 7520  O O     . ASN D 4 222 ? 178.660 140.774 168.647 1.00 51.39  ? 222 ASN D O     1 
ATOM 7521  C CB    . ASN D 4 222 ? 180.865 138.269 169.461 1.00 51.39  ? 222 ASN D CB    1 
ATOM 7522  C CG    . ASN D 4 222 ? 181.721 137.636 168.401 1.00 51.39  ? 222 ASN D CG    1 
ATOM 7523  O OD1   . ASN D 4 222 ? 182.440 138.320 167.683 1.00 51.39  ? 222 ASN D OD1   1 
ATOM 7524  N ND2   . ASN D 4 222 ? 181.651 136.315 168.293 1.00 51.39  ? 222 ASN D ND2   1 
ATOM 7525  N N     . ALA D 4 223 ? 179.802 139.642 167.068 1.00 46.02  ? 223 ALA D N     1 
ATOM 7526  C CA    . ALA D 4 223 ? 178.760 139.754 166.055 1.00 46.02  ? 223 ALA D CA    1 
ATOM 7527  C C     . ALA D 4 223 ? 178.776 138.517 165.170 1.00 46.02  ? 223 ALA D C     1 
ATOM 7528  O O     . ALA D 4 223 ? 179.821 138.179 164.612 1.00 46.02  ? 223 ALA D O     1 
ATOM 7529  C CB    . ALA D 4 223 ? 178.949 141.013 165.217 1.00 46.02  ? 223 ALA D CB    1 
ATOM 7530  N N     . GLY D 4 224 ? 177.639 137.842 165.033 1.00 41.76  ? 224 GLY D N     1 
ATOM 7531  C CA    . GLY D 4 224 ? 177.537 136.665 164.187 1.00 41.76  ? 224 GLY D CA    1 
ATOM 7532  C C     . GLY D 4 224 ? 176.621 136.917 163.005 1.00 41.76  ? 224 GLY D C     1 
ATOM 7533  O O     . GLY D 4 224 ? 175.626 137.621 163.130 1.00 41.76  ? 224 GLY D O     1 
ATOM 7534  N N     . GLN D 4 225 ? 176.944 136.327 161.856 1.00 36.86  ? 225 GLN D N     1 
ATOM 7535  C CA    . GLN D 4 225 ? 176.173 136.581 160.646 1.00 36.86  ? 225 GLN D CA    1 
ATOM 7536  C C     . GLN D 4 225 ? 175.072 135.545 160.476 1.00 36.86  ? 225 GLN D C     1 
ATOM 7537  O O     . GLN D 4 225 ? 175.305 134.354 160.669 1.00 36.86  ? 225 GLN D O     1 
ATOM 7538  C CB    . GLN D 4 225 ? 177.055 136.554 159.399 1.00 36.86  ? 225 GLN D CB    1 
ATOM 7539  C CG    . GLN D 4 225 ? 178.139 137.603 159.282 1.00 36.86  ? 225 GLN D CG    1 
ATOM 7540  C CD    . GLN D 4 225 ? 179.325 137.299 160.144 1.00 36.86  ? 225 GLN D CD    1 
ATOM 7541  O OE1   . GLN D 4 225 ? 179.470 136.189 160.641 1.00 36.86  ? 225 GLN D OE1   1 
ATOM 7542  N NE2   . GLN D 4 225 ? 180.212 138.268 160.292 1.00 36.86  ? 225 GLN D NE2   1 
ATOM 7543  N N     . PHE D 4 226 ? 173.918 135.994 159.978 1.00 34.25  ? 226 PHE D N     1 
ATOM 7544  C CA    . PHE D 4 226 ? 172.740 135.168 159.719 1.00 34.25  ? 226 PHE D CA    1 
ATOM 7545  C C     . PHE D 4 226 ? 172.072 135.657 158.444 1.00 34.25  ? 226 PHE D C     1 
ATOM 7546  O O     . PHE D 4 226 ? 172.396 136.723 157.931 1.00 34.25  ? 226 PHE D O     1 
ATOM 7547  C CB    . PHE D 4 226 ? 171.685 135.236 160.840 1.00 34.25  ? 226 PHE D CB    1 
ATOM 7548  C CG    . PHE D 4 226 ? 172.103 134.672 162.168 1.00 34.25  ? 226 PHE D CG    1 
ATOM 7549  C CD1   . PHE D 4 226 ? 173.161 133.836 162.293 1.00 34.25  ? 226 PHE D CD1   1 
ATOM 7550  C CD2   . PHE D 4 226 ? 171.400 134.982 163.294 1.00 34.25  ? 226 PHE D CD2   1 
ATOM 7551  C CE1   . PHE D 4 226 ? 173.516 133.323 163.507 1.00 34.25  ? 226 PHE D CE1   1 
ATOM 7552  C CE2   . PHE D 4 226 ? 171.752 134.478 164.506 1.00 34.25  ? 226 PHE D CE2   1 
ATOM 7553  C CZ    . PHE D 4 226 ? 172.812 133.647 164.612 1.00 34.25  ? 226 PHE D CZ    1 
ATOM 7554  N N     . SER D 4 227 ? 171.123 134.877 157.932 1.00 32.52  ? 227 SER D N     1 
ATOM 7555  C CA    . SER D 4 227 ? 170.399 135.271 156.730 1.00 32.52  ? 227 SER D CA    1 
ATOM 7556  C C     . SER D 4 227 ? 169.121 134.461 156.623 1.00 32.52  ? 227 SER D C     1 
ATOM 7557  O O     . SER D 4 227 ? 169.005 133.376 157.189 1.00 32.52  ? 227 SER D O     1 
ATOM 7558  C CB    . SER D 4 227 ? 171.235 135.071 155.477 1.00 32.52  ? 227 SER D CB    1 
ATOM 7559  O OG    . SER D 4 227 ? 171.727 133.748 155.419 1.00 32.52  ? 227 SER D OG    1 
ATOM 7560  N N     . ALA D 4 228 ? 168.172 134.982 155.850 1.00 32.86  ? 228 ALA D N     1 
ATOM 7561  C CA    . ALA D 4 228 ? 166.889 134.320 155.663 1.00 32.86  ? 228 ALA D CA    1 
ATOM 7562  C C     . ALA D 4 228 ? 166.474 134.400 154.207 1.00 32.86  ? 228 ALA D C     1 
ATOM 7563  O O     . ALA D 4 228 ? 166.796 135.366 153.520 1.00 32.86  ? 228 ALA D O     1 
ATOM 7564  C CB    . ALA D 4 228 ? 165.806 134.957 156.524 1.00 32.86  ? 228 ALA D CB    1 
ATOM 7565  N N     . GLY D 4 229 ? 165.735 133.401 153.743 1.00 34.18  ? 229 GLY D N     1 
ATOM 7566  C CA    . GLY D 4 229 ? 165.308 133.465 152.355 1.00 34.18  ? 229 GLY D CA    1 
ATOM 7567  C C     . GLY D 4 229 ? 164.513 132.244 151.963 1.00 34.18  ? 229 GLY D C     1 
ATOM 7568  O O     . GLY D 4 229 ? 164.323 131.322 152.752 1.00 34.18  ? 229 GLY D O     1 
ATOM 7569  N N     . THR D 4 230 ? 164.085 132.230 150.706 1.00 33.34  ? 230 THR D N     1 
ATOM 7570  C CA    . THR D 4 230 ? 163.333 131.110 150.148 1.00 33.34  ? 230 THR D CA    1 
ATOM 7571  C C     . THR D 4 230 ? 164.232 130.254 149.278 1.00 33.34  ? 230 THR D C     1 
ATOM 7572  O O     . THR D 4 230 ? 164.422 130.545 148.098 1.00 33.34  ? 230 THR D O     1 
ATOM 7573  C CB    . THR D 4 230 ? 162.167 131.615 149.325 1.00 33.34  ? 230 THR D CB    1 
ATOM 7574  O OG1   . THR D 4 230 ? 162.685 132.320 148.200 1.00 33.34  ? 230 THR D OG1   1 
ATOM 7575  C CG2   . THR D 4 230 ? 161.378 132.571 150.138 1.00 33.34  ? 230 THR D CG2   1 
ATOM 7576  N N     . PHE D 4 231 ? 164.768 129.184 149.841 1.00 31.56  ? 231 PHE D N     1 
ATOM 7577  C CA    . PHE D 4 231 ? 165.683 128.349 149.088 1.00 31.56  ? 231 PHE D CA    1 
ATOM 7578  C C     . PHE D 4 231 ? 164.943 127.491 148.078 1.00 31.56  ? 231 PHE D C     1 
ATOM 7579  O O     . PHE D 4 231 ? 163.888 126.926 148.377 1.00 31.56  ? 231 PHE D O     1 
ATOM 7580  C CB    . PHE D 4 231 ? 166.455 127.426 150.014 1.00 31.56  ? 231 PHE D CB    1 
ATOM 7581  C CG    . PHE D 4 231 ? 167.285 128.123 151.010 1.00 31.56  ? 231 PHE D CG    1 
ATOM 7582  C CD1   . PHE D 4 231 ? 167.616 129.436 150.863 1.00 31.56  ? 231 PHE D CD1   1 
ATOM 7583  C CD2   . PHE D 4 231 ? 167.783 127.444 152.074 1.00 31.56  ? 231 PHE D CD2   1 
ATOM 7584  C CE1   . PHE D 4 231 ? 168.391 130.057 151.783 1.00 31.56  ? 231 PHE D CE1   1 
ATOM 7585  C CE2   . PHE D 4 231 ? 168.563 128.072 152.981 1.00 31.56  ? 231 PHE D CE2   1 
ATOM 7586  C CZ    . PHE D 4 231 ? 168.863 129.378 152.836 1.00 31.56  ? 231 PHE D CZ    1 
ATOM 7587  N N     . TYR D 4 232 ? 165.503 127.413 146.873 1.00 31.61  ? 232 TYR D N     1 
ATOM 7588  C CA    . TYR D 4 232 ? 165.049 126.495 145.831 1.00 31.61  ? 232 TYR D CA    1 
ATOM 7589  C C     . TYR D 4 232 ? 165.870 125.223 145.920 1.00 31.61  ? 232 TYR D C     1 
ATOM 7590  O O     . TYR D 4 232 ? 167.003 125.167 145.452 1.00 31.61  ? 232 TYR D O     1 
ATOM 7591  C CB    . TYR D 4 232 ? 165.173 127.112 144.450 1.00 31.61  ? 232 TYR D CB    1 
ATOM 7592  C CG    . TYR D 4 232 ? 164.917 126.097 143.369 1.00 31.61  ? 232 TYR D CG    1 
ATOM 7593  C CD1   . TYR D 4 232 ? 163.650 125.635 143.091 1.00 31.61  ? 232 TYR D CD1   1 
ATOM 7594  C CD2   . TYR D 4 232 ? 165.963 125.580 142.643 1.00 31.61  ? 232 TYR D CD2   1 
ATOM 7595  C CE1   . TYR D 4 232 ? 163.439 124.691 142.111 1.00 31.61  ? 232 TYR D CE1   1 
ATOM 7596  C CE2   . TYR D 4 232 ? 165.760 124.644 141.670 1.00 31.61  ? 232 TYR D CE2   1 
ATOM 7597  C CZ    . TYR D 4 232 ? 164.501 124.202 141.407 1.00 31.61  ? 232 TYR D CZ    1 
ATOM 7598  O OH    . TYR D 4 232 ? 164.309 123.264 140.428 1.00 31.61  ? 232 TYR D OH    1 
ATOM 7599  N N     . ARG D 4 233 ? 165.295 124.193 146.498 1.00 31.58  ? 233 ARG D N     1 
ATOM 7600  C CA    . ARG D 4 233 ? 165.970 122.922 146.661 1.00 31.58  ? 233 ARG D CA    1 
ATOM 7601  C C     . ARG D 4 233 ? 165.644 121.940 145.547 1.00 31.58  ? 233 ARG D C     1 
ATOM 7602  O O     . ARG D 4 233 ? 164.578 122.005 144.937 1.00 31.58  ? 233 ARG D O     1 
ATOM 7603  C CB    . ARG D 4 233 ? 165.591 122.421 148.038 1.00 31.58  ? 233 ARG D CB    1 
ATOM 7604  C CG    . ARG D 4 233 ? 165.978 123.524 148.996 1.00 31.58  ? 233 ARG D CG    1 
ATOM 7605  C CD    . ARG D 4 233 ? 165.502 123.372 150.388 1.00 31.58  ? 233 ARG D CD    1 
ATOM 7606  N NE    . ARG D 4 233 ? 165.678 122.021 150.846 1.00 31.58  ? 233 ARG D NE    1 
ATOM 7607  C CZ    . ARG D 4 233 ? 164.631 121.246 151.037 1.00 31.58  ? 233 ARG D CZ    1 
ATOM 7608  N NH1   . ARG D 4 233 ? 163.433 121.731 150.808 1.00 31.58  ? 233 ARG D NH1   1 
ATOM 7609  N NH2   . ARG D 4 233 ? 164.762 120.017 151.449 1.00 31.58  ? 233 ARG D NH2   1 
ATOM 7610  N N     . TYR D 4 234 ? 166.572 121.018 145.290 1.00 32.01  ? 234 TYR D N     1 
ATOM 7611  C CA    . TYR D 4 234 ? 166.422 120.077 144.184 1.00 32.01  ? 234 TYR D CA    1 
ATOM 7612  C C     . TYR D 4 234 ? 167.230 118.801 144.317 1.00 32.01  ? 234 TYR D C     1 
ATOM 7613  O O     . TYR D 4 234 ? 168.398 118.840 144.693 1.00 32.01  ? 234 TYR D O     1 
ATOM 7614  C CB    . TYR D 4 234 ? 166.843 120.730 142.870 1.00 32.01  ? 234 TYR D CB    1 
ATOM 7615  C CG    . TYR D 4 234 ? 166.906 119.722 141.752 1.00 32.01  ? 234 TYR D CG    1 
ATOM 7616  C CD1   . TYR D 4 234 ? 165.776 119.224 141.151 1.00 32.01  ? 234 TYR D CD1   1 
ATOM 7617  C CD2   . TYR D 4 234 ? 168.128 119.249 141.319 1.00 32.01  ? 234 TYR D CD2   1 
ATOM 7618  C CE1   . TYR D 4 234 ? 165.873 118.283 140.149 1.00 32.01  ? 234 TYR D CE1   1 
ATOM 7619  C CE2   . TYR D 4 234 ? 168.227 118.321 140.326 1.00 32.01  ? 234 TYR D CE2   1 
ATOM 7620  C CZ    . TYR D 4 234 ? 167.104 117.843 139.745 1.00 32.01  ? 234 TYR D CZ    1 
ATOM 7621  O OH    . TYR D 4 234 ? 167.211 116.916 138.748 1.00 32.01  ? 234 TYR D OH    1 
ATOM 7622  N N     . ALA D 4 235 ? 166.615 117.675 143.952 1.00 31.72  ? 235 ALA D N     1 
ATOM 7623  C CA    . ALA D 4 235 ? 167.333 116.411 144.015 1.00 31.72  ? 235 ALA D CA    1 
ATOM 7624  C C     . ALA D 4 235 ? 166.781 115.453 142.974 1.00 31.72  ? 235 ALA D C     1 
ATOM 7625  O O     . ALA D 4 235 ? 165.636 115.596 142.552 1.00 31.72  ? 235 ALA D O     1 
ATOM 7626  C CB    . ALA D 4 235 ? 167.201 115.782 145.389 1.00 31.72  ? 235 ALA D CB    1 
ATOM 7627  N N     . ASN D 4 236 ? 167.579 114.458 142.565 1.00 35.23  ? 236 ASN D N     1 
ATOM 7628  C CA    . ASN D 4 236 ? 167.062 113.434 141.654 1.00 35.23  ? 236 ASN D CA    1 
ATOM 7629  C C     . ASN D 4 236 ? 167.502 112.065 142.147 1.00 35.23  ? 236 ASN D C     1 
ATOM 7630  O O     . ASN D 4 236 ? 168.559 111.931 142.763 1.00 35.23  ? 236 ASN D O     1 
ATOM 7631  C CB    . ASN D 4 236 ? 167.430 113.653 140.184 1.00 35.23  ? 236 ASN D CB    1 
ATOM 7632  C CG    . ASN D 4 236 ? 168.882 113.547 139.909 1.00 35.23  ? 236 ASN D CG    1 
ATOM 7633  O OD1   . ASN D 4 236 ? 169.646 113.043 140.703 1.00 35.23  ? 236 ASN D OD1   1 
ATOM 7634  N ND2   . ASN D 4 236 ? 169.288 114.049 138.759 1.00 35.23  ? 236 ASN D ND2   1 
ATOM 7635  N N     . VAL D 4 237 ? 166.687 111.048 141.890 1.00 40.18  ? 237 VAL D N     1 
ATOM 7636  C CA    . VAL D 4 237 ? 167.030 109.662 142.202 1.00 40.18  ? 237 VAL D CA    1 
ATOM 7637  C C     . VAL D 4 237 ? 166.799 108.734 141.015 1.00 40.18  ? 237 VAL D C     1 
ATOM 7638  O O     . VAL D 4 237 ? 165.696 108.685 140.453 1.00 40.18  ? 237 VAL D O     1 
ATOM 7639  C CB    . VAL D 4 237 ? 166.326 109.139 143.461 1.00 40.18  ? 237 VAL D CB    1 
ATOM 7640  C CG1   . VAL D 4 237 ? 164.897 109.296 143.361 1.00 40.18  ? 237 VAL D CG1   1 
ATOM 7641  C CG2   . VAL D 4 237 ? 166.648 107.682 143.655 1.00 40.18  ? 237 VAL D CG2   1 
ATOM 7642  N N     . ASN D 4 238 ? 167.874 108.072 140.590 1.00 50.56  ? 238 ASN D N     1 
ATOM 7643  C CA    . ASN D 4 238 ? 167.962 107.082 139.520 1.00 50.56  ? 238 ASN D CA    1 
ATOM 7644  C C     . ASN D 4 238 ? 167.368 105.732 139.859 1.00 50.56  ? 238 ASN D C     1 
ATOM 7645  O O     . ASN D 4 238 ? 168.071 104.855 140.363 1.00 50.56  ? 238 ASN D O     1 
ATOM 7646  C CB    . ASN D 4 238 ? 169.420 106.850 139.145 1.00 50.56  ? 238 ASN D CB    1 
ATOM 7647  C CG    . ASN D 4 238 ? 169.584 106.158 137.823 1.00 50.56  ? 238 ASN D CG    1 
ATOM 7648  O OD1   . ASN D 4 238 ? 168.652 105.553 137.310 1.00 50.56  ? 238 ASN D OD1   1 
ATOM 7649  N ND2   . ASN D 4 238 ? 170.756 106.297 137.227 1.00 50.56  ? 238 ASN D ND2   1 
ATOM 7650  N N     . LEU D 4 239 ? 166.090 105.542 139.549 1.00 54.07  ? 239 LEU D N     1 
ATOM 7651  C CA    . LEU D 4 239 ? 165.392 104.338 139.977 1.00 54.07  ? 239 LEU D CA    1 
ATOM 7652  C C     . LEU D 4 239 ? 166.034 103.098 139.392 1.00 54.07  ? 239 LEU D C     1 
ATOM 7653  O O     . LEU D 4 239 ? 166.173 102.088 140.083 1.00 54.07  ? 239 LEU D O     1 
ATOM 7654  C CB    . LEU D 4 239 ? 163.926 104.401 139.594 1.00 54.07  ? 239 LEU D CB    1 
ATOM 7655  C CG    . LEU D 4 239 ? 163.128 104.910 140.775 1.00 54.07  ? 239 LEU D CG    1 
ATOM 7656  C CD1   . LEU D 4 239 ? 163.353 106.390 140.951 1.00 54.07  ? 239 LEU D CD1   1 
ATOM 7657  C CD2   . LEU D 4 239 ? 161.694 104.602 140.570 1.00 54.07  ? 239 LEU D CD2   1 
ATOM 7658  N N     . ASP D 4 240 ? 166.436 103.155 138.125 1.00 59.32  ? 240 ASP D N     1 
ATOM 7659  C CA    . ASP D 4 240 ? 166.931 101.966 137.437 1.00 59.32  ? 240 ASP D CA    1 
ATOM 7660  C C     . ASP D 4 240 ? 168.127 101.361 138.159 1.00 59.32  ? 240 ASP D C     1 
ATOM 7661  O O     . ASP D 4 240 ? 168.143 100.160 138.452 1.00 59.32  ? 240 ASP D O     1 
ATOM 7662  C CB    . ASP D 4 240 ? 167.303 102.324 136.000 1.00 59.32  ? 240 ASP D CB    1 
ATOM 7663  C CG    . ASP D 4 240 ? 166.099 102.706 135.163 1.00 59.32  ? 240 ASP D CG    1 
ATOM 7664  O OD1   . ASP D 4 240 ? 164.984 102.288 135.521 1.00 59.32  ? 240 ASP D OD1   1 
ATOM 7665  O OD2   . ASP D 4 240 ? 166.257 103.420 134.148 1.00 59.32  ? 240 ASP D OD2   1 
ATOM 7666  N N     . ARG D 4 241 ? 169.129 102.174 138.479 1.00 61.80  ? 241 ARG D N     1 
ATOM 7667  C CA    . ARG D 4 241 ? 170.256 101.634 139.223 1.00 61.80  ? 241 ARG D CA    1 
ATOM 7668  C C     . ARG D 4 241 ? 169.830 101.146 140.587 1.00 61.80  ? 241 ARG D C     1 
ATOM 7669  O O     . ARG D 4 241 ? 170.388 100.176 141.110 1.00 61.80  ? 241 ARG D O     1 
ATOM 7670  C CB    . ARG D 4 241 ? 171.296 102.723 139.419 1.00 61.80  ? 241 ARG D CB    1 
ATOM 7671  C CG    . ARG D 4 241 ? 171.727 103.363 138.158 1.00 61.80  ? 241 ARG D CG    1 
ATOM 7672  C CD    . ARG D 4 241 ? 172.525 102.404 137.350 1.00 61.80  ? 241 ARG D CD    1 
ATOM 7673  N NE    . ARG D 4 241 ? 172.519 102.818 135.960 1.00 61.80  ? 241 ARG D NE    1 
ATOM 7674  C CZ    . ARG D 4 241 ? 171.623 102.422 135.071 1.00 61.80  ? 241 ARG D CZ    1 
ATOM 7675  N NH1   . ARG D 4 241 ? 170.665 101.578 135.438 1.00 61.80  ? 241 ARG D NH1   1 
ATOM 7676  N NH2   . ARG D 4 241 ? 171.681 102.863 133.826 1.00 61.80  ? 241 ARG D NH2   1 
ATOM 7677  N N     . LEU D 4 242 ? 168.819 101.776 141.159 1.00 64.02  ? 242 LEU D N     1 
ATOM 7678  C CA    . LEU D 4 242 ? 168.360 101.345 142.466 1.00 64.02  ? 242 LEU D CA    1 
ATOM 7679  C C     . LEU D 4 242 ? 167.722 99.966  142.402 1.00 64.02  ? 242 LEU D C     1 
ATOM 7680  O O     . LEU D 4 242 ? 167.943 99.134  143.284 1.00 64.02  ? 242 LEU D O     1 
ATOM 7681  C CB    . LEU D 4 242 ? 167.401 102.381 143.029 1.00 64.02  ? 242 LEU D CB    1 
ATOM 7682  C CG    . LEU D 4 242 ? 167.183 102.296 144.525 1.00 64.02  ? 242 LEU D CG    1 
ATOM 7683  C CD1   . LEU D 4 242 ? 168.494 102.501 145.222 1.00 64.02  ? 242 LEU D CD1   1 
ATOM 7684  C CD2   . LEU D 4 242 ? 166.226 103.382 144.904 1.00 64.02  ? 242 LEU D CD2   1 
ATOM 7685  N N     . VAL D 4 243 ? 166.937 99.702  141.361 1.00 66.54  ? 243 VAL D N     1 
ATOM 7686  C CA    . VAL D 4 243 ? 166.347 98.384  141.186 1.00 66.54  ? 243 VAL D CA    1 
ATOM 7687  C C     . VAL D 4 243 ? 167.411 97.348  140.865 1.00 66.54  ? 243 VAL D C     1 
ATOM 7688  O O     . VAL D 4 243 ? 167.417 96.249  141.429 1.00 66.54  ? 243 VAL D O     1 
ATOM 7689  C CB    . VAL D 4 243 ? 165.273 98.437  140.089 1.00 66.54  ? 243 VAL D CB    1 
ATOM 7690  C CG1   . VAL D 4 243 ? 164.782 97.050  139.766 1.00 66.54  ? 243 VAL D CG1   1 
ATOM 7691  C CG2   . VAL D 4 243 ? 164.132 99.322  140.516 1.00 66.54  ? 243 VAL D CG2   1 
ATOM 7692  N N     . GLU D 4 244 ? 168.335 97.681  139.966 1.00 68.70  ? 244 GLU D N     1 
ATOM 7693  C CA    . GLU D 4 244 ? 169.393 96.737  139.633 1.00 68.70  ? 244 GLU D CA    1 
ATOM 7694  C C     . GLU D 4 244 ? 170.269 96.409  140.825 1.00 68.70  ? 244 GLU D C     1 
ATOM 7695  O O     . GLU D 4 244 ? 170.797 95.296  140.918 1.00 68.70  ? 244 GLU D O     1 
ATOM 7696  C CB    . GLU D 4 244 ? 170.286 97.315  138.541 1.00 68.70  ? 244 GLU D CB    1 
ATOM 7697  C CG    . GLU D 4 244 ? 169.657 97.428  137.183 1.00 68.70  ? 244 GLU D CG    1 
ATOM 7698  C CD    . GLU D 4 244 ? 170.611 98.043  136.192 1.00 68.70  ? 244 GLU D CD    1 
ATOM 7699  O OE1   . GLU D 4 244 ? 171.703 98.460  136.619 1.00 68.70  ? 244 GLU D OE1   1 
ATOM 7700  O OE2   . GLU D 4 244 ? 170.281 98.107  134.991 1.00 68.70  ? 244 GLU D OE2   1 
ATOM 7701  N N     . ASN D 4 245 ? 170.428 97.343  141.749 1.00 71.82  ? 245 ASN D N     1 
ATOM 7702  C CA    . ASN D 4 245 ? 171.314 97.060  142.863 1.00 71.82  ? 245 ASN D CA    1 
ATOM 7703  C C     . ASN D 4 245 ? 170.610 96.469  144.073 1.00 71.82  ? 245 ASN D C     1 
ATOM 7704  O O     . ASN D 4 245 ? 171.118 95.523  144.679 1.00 71.82  ? 245 ASN D O     1 
ATOM 7705  C CB    . ASN D 4 245 ? 172.035 98.342  143.265 1.00 71.82  ? 245 ASN D CB    1 
ATOM 7706  C CG    . ASN D 4 245 ? 172.967 98.834  142.195 1.00 71.82  ? 245 ASN D CG    1 
ATOM 7707  O OD1   . ASN D 4 245 ? 173.480 98.047  141.405 1.00 71.82  ? 245 ASN D OD1   1 
ATOM 7708  N ND2   . ASN D 4 245 ? 173.207 100.140 142.165 1.00 71.82  ? 245 ASN D ND2   1 
ATOM 7709  N N     . THR D 4 246 ? 169.432 96.983  144.417 1.00 73.60  ? 246 THR D N     1 
ATOM 7710  C CA    . THR D 4 246 ? 168.719 96.449  145.568 1.00 73.60  ? 246 THR D CA    1 
ATOM 7711  C C     . THR D 4 246 ? 168.090 95.091  145.294 1.00 73.60  ? 246 THR D C     1 
ATOM 7712  O O     . THR D 4 246 ? 168.018 94.257  146.202 1.00 73.60  ? 246 THR D O     1 
ATOM 7713  C CB    . THR D 4 246 ? 167.636 97.432  146.015 1.00 73.60  ? 246 THR D CB    1 
ATOM 7714  O OG1   . THR D 4 246 ? 166.798 97.756  144.901 1.00 73.60  ? 246 THR D OG1   1 
ATOM 7715  C CG2   . THR D 4 246 ? 168.235 98.695  146.564 1.00 73.60  ? 246 THR D CG2   1 
ATOM 7716  N N     . GLY D 4 247 ? 167.639 94.836  144.072 1.00 76.82  ? 247 GLY D N     1 
ATOM 7717  C CA    . GLY D 4 247 ? 167.008 93.556  143.837 1.00 76.82  ? 247 GLY D CA    1 
ATOM 7718  C C     . GLY D 4 247 ? 165.496 93.631  143.911 1.00 76.82  ? 247 GLY D C     1 
ATOM 7719  O O     . GLY D 4 247 ? 164.808 93.848  142.910 1.00 76.82  ? 247 GLY D O     1 
ATOM 7720  N N     . ASP D 4 248 ? 164.978 93.455  145.123 1.00 81.92  ? 248 ASP D N     1 
ATOM 7721  C CA    . ASP D 4 248 ? 163.543 93.506  145.373 1.00 81.92  ? 248 ASP D CA    1 
ATOM 7722  C C     . ASP D 4 248 ? 162.965 94.883  145.065 1.00 81.92  ? 248 ASP D C     1 
ATOM 7723  O O     . ASP D 4 248 ? 163.478 95.906  145.523 1.00 81.92  ? 248 ASP D O     1 
ATOM 7724  C CB    . ASP D 4 248 ? 163.257 93.141  146.830 1.00 81.92  ? 248 ASP D CB    1 
ATOM 7725  C CG    . ASP D 4 248 ? 163.484 91.671  147.118 1.00 81.92  ? 248 ASP D CG    1 
ATOM 7726  O OD1   . ASP D 4 248 ? 163.423 90.865  146.170 1.00 81.92  ? 248 ASP D OD1   1 
ATOM 7727  O OD2   . ASP D 4 248 ? 163.713 91.317  148.293 1.00 81.92  ? 248 ASP D OD2   1 
ATOM 7728  N N     . ALA D 4 249 ? 161.884 94.899  144.287 1.00 80.45  ? 249 ALA D N     1 
ATOM 7729  C CA    . ALA D 4 249 ? 161.240 96.149  143.907 1.00 80.45  ? 249 ALA D CA    1 
ATOM 7730  C C     . ALA D 4 249 ? 160.529 96.802  145.084 1.00 80.45  ? 249 ALA D C     1 
ATOM 7731  O O     . ALA D 4 249 ? 160.307 98.018  145.070 1.00 80.45  ? 249 ALA D O     1 
ATOM 7732  C CB    . ALA D 4 249 ? 160.253 95.912  142.768 1.00 80.45  ? 249 ALA D CB    1 
ATOM 7733  N N     . GLN D 4 250 ? 160.204 96.034  146.120 1.00 81.21  ? 250 GLN D N     1 
ATOM 7734  C CA    . GLN D 4 250 ? 159.481 96.600  147.248 1.00 81.21  ? 250 GLN D CA    1 
ATOM 7735  C C     . GLN D 4 250 ? 160.453 97.356  148.133 1.00 81.21  ? 250 GLN D C     1 
ATOM 7736  O O     . GLN D 4 250 ? 160.111 98.407  148.694 1.00 81.21  ? 250 GLN D O     1 
ATOM 7737  C CB    . GLN D 4 250 ? 158.777 95.495  148.028 1.00 81.21  ? 250 GLN D CB    1 
ATOM 7738  C CG    . GLN D 4 250 ? 157.679 94.813  147.239 1.00 81.21  ? 250 GLN D CG    1 
ATOM 7739  C CD    . GLN D 4 250 ? 158.224 93.811  146.241 1.00 81.21  ? 250 GLN D CD    1 
ATOM 7740  O OE1   . GLN D 4 250 ? 159.400 93.450  146.288 1.00 81.21  ? 250 GLN D OE1   1 
ATOM 7741  N NE2   . GLN D 4 250 ? 157.378 93.374  145.317 1.00 81.21  ? 250 GLN D NE2   1 
ATOM 7742  N N     . THR D 4 251 ? 161.673 96.835  148.253 1.00 78.16  ? 251 THR D N     1 
ATOM 7743  C CA    . THR D 4 251 ? 162.711 97.589  148.930 1.00 78.16  ? 251 THR D CA    1 
ATOM 7744  C C     . THR D 4 251 ? 162.882 98.923  148.227 1.00 78.16  ? 251 THR D C     1 
ATOM 7745  O O     . THR D 4 251 ? 163.071 99.959  148.871 1.00 78.16  ? 251 THR D O     1 
ATOM 7746  C CB    . THR D 4 251 ? 164.016 96.802  148.936 1.00 78.16  ? 251 THR D CB    1 
ATOM 7747  O OG1   . THR D 4 251 ? 164.443 96.592  147.586 1.00 78.16  ? 251 THR D OG1   1 
ATOM 7748  C CG2   . THR D 4 251 ? 163.809 95.458  149.599 1.00 78.16  ? 251 THR D CG2   1 
ATOM 7749  N N     . ALA D 4 252 ? 162.804 98.913  146.894 1.00 74.21  ? 252 ALA D N     1 
ATOM 7750  C CA    . ALA D 4 252 ? 162.817 100.162 146.151 1.00 74.21  ? 252 ALA D CA    1 
ATOM 7751  C C     . ALA D 4 252 ? 161.632 101.029 146.547 1.00 74.21  ? 252 ALA D C     1 
ATOM 7752  O O     . ALA D 4 252 ? 161.762 102.255 146.647 1.00 74.21  ? 252 ALA D O     1 
ATOM 7753  C CB    . ALA D 4 252 ? 162.809 99.889  144.651 1.00 74.21  ? 252 ALA D CB    1 
ATOM 7754  N N     . ARG D 4 253 ? 160.466 100.417 146.784 1.00 73.12  ? 253 ARG D N     1 
ATOM 7755  C CA    . ARG D 4 253 ? 159.316 101.215 147.193 1.00 73.12  ? 253 ARG D CA    1 
ATOM 7756  C C     . ARG D 4 253 ? 159.611 101.976 148.471 1.00 73.12  ? 253 ARG D C     1 
ATOM 7757  O O     . ARG D 4 253 ? 159.553 103.207 148.510 1.00 73.12  ? 253 ARG D O     1 
ATOM 7758  C CB    . ARG D 4 253 ? 158.073 100.365 147.461 1.00 73.12  ? 253 ARG D CB    1 
ATOM 7759  C CG    . ARG D 4 253 ? 156.846 101.278 147.573 1.00 73.12  ? 253 ARG D CG    1 
ATOM 7760  C CD    . ARG D 4 253 ? 155.452 100.664 147.491 1.00 73.12  ? 253 ARG D CD    1 
ATOM 7761  N NE    . ARG D 4 253 ? 155.062 99.972  146.279 1.00 73.12  ? 253 ARG D NE    1 
ATOM 7762  C CZ    . ARG D 4 253 ? 153.972 99.214  146.216 1.00 73.12  ? 253 ARG D CZ    1 
ATOM 7763  N NH1   . ARG D 4 253 ? 153.199 99.070  147.289 1.00 73.12  ? 253 ARG D NH1   1 
ATOM 7764  N NH2   . ARG D 4 253 ? 153.650 98.602  145.089 1.00 73.12  ? 253 ARG D NH2   1 
ATOM 7765  N N     . THR D 4 254 ? 159.924 101.246 149.537 1.00 69.25  ? 254 THR D N     1 
ATOM 7766  C CA    . THR D 4 254 ? 160.192 101.899 150.809 1.00 69.25  ? 254 THR D CA    1 
ATOM 7767  C C     . THR D 4 254 ? 161.353 102.873 150.717 1.00 69.25  ? 254 THR D C     1 
ATOM 7768  O O     . THR D 4 254 ? 161.333 103.930 151.354 1.00 69.25  ? 254 THR D O     1 
ATOM 7769  C CB    . THR D 4 254 ? 160.470 100.848 151.875 1.00 69.25  ? 254 THR D CB    1 
ATOM 7770  O OG1   . THR D 4 254 ? 161.540 100.004 151.436 1.00 69.25  ? 254 THR D OG1   1 
ATOM 7771  C CG2   . THR D 4 254 ? 159.241 99.994  152.097 1.00 69.25  ? 254 THR D CG2   1 
ATOM 7772  N N     . ALA D 4 255 ? 162.380 102.536 149.943 1.00 66.17  ? 255 ALA D N     1 
ATOM 7773  C CA    . ALA D 4 255 ? 163.519 103.437 149.841 1.00 66.17  ? 255 ALA D CA    1 
ATOM 7774  C C     . ALA D 4 255 ? 163.151 104.756 149.183 1.00 66.17  ? 255 ALA D C     1 
ATOM 7775  O O     . ALA D 4 255 ? 163.520 105.827 149.674 1.00 66.17  ? 255 ALA D O     1 
ATOM 7776  C CB    . ALA D 4 255 ? 164.640 102.762 149.062 1.00 66.17  ? 255 ALA D CB    1 
ATOM 7777  N N     . VAL D 4 256 ? 162.409 104.710 148.084 1.00 60.07  ? 256 VAL D N     1 
ATOM 7778  C CA    . VAL D 4 256 ? 162.099 105.958 147.404 1.00 60.07  ? 256 VAL D CA    1 
ATOM 7779  C C     . VAL D 4 256 ? 160.996 106.727 148.117 1.00 60.07  ? 256 VAL D C     1 
ATOM 7780  O O     . VAL D 4 256 ? 161.092 107.941 148.290 1.00 60.07  ? 256 VAL D O     1 
ATOM 7781  C CB    . VAL D 4 256 ? 161.751 105.689 145.935 1.00 60.07  ? 256 VAL D CB    1 
ATOM 7782  C CG1   . VAL D 4 256 ? 161.208 106.932 145.303 1.00 60.07  ? 256 VAL D CG1   1 
ATOM 7783  C CG2   . VAL D 4 256 ? 162.988 105.244 145.210 1.00 60.07  ? 256 VAL D CG2   1 
ATOM 7784  N N     . ALA D 4 257 ? 159.918 106.051 148.505 1.00 60.16  ? 257 ALA D N     1 
ATOM 7785  C CA    . ALA D 4 257 ? 158.855 106.716 149.255 1.00 60.16  ? 257 ALA D CA    1 
ATOM 7786  C C     . ALA D 4 257 ? 159.366 107.321 150.553 1.00 60.16  ? 257 ALA D C     1 
ATOM 7787  O O     . ALA D 4 257 ? 159.200 108.521 150.810 1.00 60.16  ? 257 ALA D O     1 
ATOM 7788  C CB    . ALA D 4 257 ? 157.726 105.730 149.540 1.00 60.16  ? 257 ALA D CB    1 
ATOM 7789  N N     . GLU D 4 258 ? 160.035 106.507 151.361 1.00 60.49  ? 258 GLU D N     1 
ATOM 7790  C CA    . GLU D 4 258 ? 160.536 106.970 152.644 1.00 60.49  ? 258 GLU D CA    1 
ATOM 7791  C C     . GLU D 4 258 ? 161.619 108.010 152.447 1.00 60.49  ? 258 GLU D C     1 
ATOM 7792  O O     . GLU D 4 258 ? 161.719 108.968 153.226 1.00 60.49  ? 258 GLU D O     1 
ATOM 7793  C CB    . GLU D 4 258 ? 160.985 105.758 153.452 1.00 60.49  ? 258 GLU D CB    1 
ATOM 7794  C CG    . GLU D 4 258 ? 161.359 106.020 154.882 1.00 60.49  ? 258 GLU D CG    1 
ATOM 7795  C CD    . GLU D 4 258 ? 161.720 104.740 155.602 1.00 60.49  ? 258 GLU D CD    1 
ATOM 7796  O OE1   . GLU D 4 258 ? 161.397 103.657 155.076 1.00 60.49  ? 258 GLU D OE1   1 
ATOM 7797  O OE2   . GLU D 4 258 ? 162.328 104.796 156.686 1.00 60.49  ? 258 GLU D OE2   1 
ATOM 7798  N N     . PHE D 4 259 ? 162.393 107.876 151.379 1.00 52.25  ? 259 PHE D N     1 
ATOM 7799  C CA    . PHE D 4 259 ? 163.401 108.879 151.085 1.00 52.25  ? 259 PHE D CA    1 
ATOM 7800  C C     . PHE D 4 259 ? 162.768 110.190 150.675 1.00 52.25  ? 259 PHE D C     1 
ATOM 7801  O O     . PHE D 4 259 ? 163.290 111.260 150.983 1.00 52.25  ? 259 PHE D O     1 
ATOM 7802  C CB    . PHE D 4 259 ? 164.307 108.417 149.958 1.00 52.25  ? 259 PHE D CB    1 
ATOM 7803  C CG    . PHE D 4 259 ? 165.141 109.523 149.389 1.00 52.25  ? 259 PHE D CG    1 
ATOM 7804  C CD1   . PHE D 4 259 ? 166.273 109.968 150.019 1.00 52.25  ? 259 PHE D CD1   1 
ATOM 7805  C CD2   . PHE D 4 259 ? 164.756 110.140 148.222 1.00 52.25  ? 259 PHE D CD2   1 
ATOM 7806  C CE1   . PHE D 4 259 ? 167.015 110.995 149.482 1.00 52.25  ? 259 PHE D CE1   1 
ATOM 7807  C CE2   . PHE D 4 259 ? 165.491 111.164 147.686 1.00 52.25  ? 259 PHE D CE2   1 
ATOM 7808  C CZ    . PHE D 4 259 ? 166.622 111.593 148.312 1.00 52.25  ? 259 PHE D CZ    1 
ATOM 7809  N N     . LEU D 4 260 ? 161.687 110.124 149.921 1.00 50.61  ? 260 LEU D N     1 
ATOM 7810  C CA    . LEU D 4 260 ? 161.024 111.333 149.471 1.00 50.61  ? 260 LEU D CA    1 
ATOM 7811  C C     . LEU D 4 260 ? 160.399 112.092 150.628 1.00 50.61  ? 260 LEU D C     1 
ATOM 7812  O O     . LEU D 4 260 ? 160.631 113.298 150.798 1.00 50.61  ? 260 LEU D O     1 
ATOM 7813  C CB    . LEU D 4 260 ? 159.985 110.952 148.432 1.00 50.61  ? 260 LEU D CB    1 
ATOM 7814  C CG    . LEU D 4 260 ? 160.761 110.876 147.130 1.00 50.61  ? 260 LEU D CG    1 
ATOM 7815  C CD1   . LEU D 4 260 ? 159.863 110.772 145.925 1.00 50.61  ? 260 LEU D CD1   1 
ATOM 7816  C CD2   . LEU D 4 260 ? 161.664 112.062 147.051 1.00 50.61  ? 260 LEU D CD2   1 
ATOM 7817  N N     . ARG D 4 261 ? 159.618 111.400 151.458 1.00 53.98  ? 261 ARG D N     1 
ATOM 7818  C CA    . ARG D 4 261 ? 159.050 112.086 152.608 1.00 53.98  ? 261 ARG D CA    1 
ATOM 7819  C C     . ARG D 4 261 ? 160.163 112.642 153.475 1.00 53.98  ? 261 ARG D C     1 
ATOM 7820  O O     . ARG D 4 261 ? 160.047 113.748 154.011 1.00 53.98  ? 261 ARG D O     1 
ATOM 7821  C CB    . ARG D 4 261 ? 158.111 111.182 153.396 1.00 53.98  ? 261 ARG D CB    1 
ATOM 7822  C CG    . ARG D 4 261 ? 158.706 110.053 154.150 1.00 53.98  ? 261 ARG D CG    1 
ATOM 7823  C CD    . ARG D 4 261 ? 157.573 109.341 154.850 1.00 53.98  ? 261 ARG D CD    1 
ATOM 7824  N NE    . ARG D 4 261 ? 156.909 110.241 155.791 1.00 53.98  ? 261 ARG D NE    1 
ATOM 7825  C CZ    . ARG D 4 261 ? 157.327 110.505 157.020 1.00 53.98  ? 261 ARG D CZ    1 
ATOM 7826  N NH1   . ARG D 4 261 ? 158.433 109.947 157.484 1.00 53.98  ? 261 ARG D NH1   1 
ATOM 7827  N NH2   . ARG D 4 261 ? 156.641 111.344 157.782 1.00 53.98  ? 261 ARG D NH2   1 
ATOM 7828  N N     . ALA D 4 262 ? 161.253 111.887 153.633 1.00 47.99  ? 262 ALA D N     1 
ATOM 7829  C CA    . ALA D 4 262 ? 162.373 112.411 154.399 1.00 47.99  ? 262 ALA D CA    1 
ATOM 7830  C C     . ALA D 4 262 ? 162.927 113.660 153.734 1.00 47.99  ? 262 ALA D C     1 
ATOM 7831  O O     . ALA D 4 262 ? 163.282 114.631 154.411 1.00 47.99  ? 262 ALA D O     1 
ATOM 7832  C CB    . ALA D 4 262 ? 163.458 111.353 154.543 1.00 47.99  ? 262 ALA D CB    1 
ATOM 7833  N N     . PHE D 4 263 ? 163.016 113.648 152.407 1.00 42.96  ? 263 PHE D N     1 
ATOM 7834  C CA    . PHE D 4 263 ? 163.505 114.807 151.677 1.00 42.96  ? 263 PHE D CA    1 
ATOM 7835  C C     . PHE D 4 263 ? 162.686 116.035 152.019 1.00 42.96  ? 263 PHE D C     1 
ATOM 7836  O O     . PHE D 4 263 ? 163.215 117.141 152.138 1.00 42.96  ? 263 PHE D O     1 
ATOM 7837  C CB    . PHE D 4 263 ? 163.376 114.562 150.180 1.00 42.96  ? 263 PHE D CB    1 
ATOM 7838  C CG    . PHE D 4 263 ? 163.866 115.692 149.346 1.00 42.96  ? 263 PHE D CG    1 
ATOM 7839  C CD1   . PHE D 4 263 ? 165.191 115.809 149.030 1.00 42.96  ? 263 PHE D CD1   1 
ATOM 7840  C CD2   . PHE D 4 263 ? 163.019 116.715 149.000 1.00 42.96  ? 263 PHE D CD2   1 
ATOM 7841  C CE1   . PHE D 4 263 ? 165.638 116.868 148.292 1.00 42.96  ? 263 PHE D CE1   1 
ATOM 7842  C CE2   . PHE D 4 263 ? 163.469 117.782 148.284 1.00 42.96  ? 263 PHE D CE2   1 
ATOM 7843  C CZ    . PHE D 4 263 ? 164.779 117.860 147.932 1.00 42.96  ? 263 PHE D CZ    1 
ATOM 7844  N N     . LEU D 4 264 ? 161.377 115.869 152.132 1.00 44.00  ? 264 LEU D N     1 
ATOM 7845  C CA    . LEU D 4 264 ? 160.533 117.005 152.473 1.00 44.00  ? 264 LEU D CA    1 
ATOM 7846  C C     . LEU D 4 264 ? 160.717 117.428 153.921 1.00 44.00  ? 264 LEU D C     1 
ATOM 7847  O O     . LEU D 4 264 ? 160.942 118.605 154.218 1.00 44.00  ? 264 LEU D O     1 
ATOM 7848  C CB    . LEU D 4 264 ? 159.077 116.648 152.207 1.00 44.00  ? 264 LEU D CB    1 
ATOM 7849  C CG    . LEU D 4 264 ? 158.799 116.333 150.747 1.00 44.00  ? 264 LEU D CG    1 
ATOM 7850  C CD1   . LEU D 4 264 ? 157.316 116.337 150.481 1.00 44.00  ? 264 LEU D CD1   1 
ATOM 7851  C CD2   . LEU D 4 264 ? 159.487 117.359 149.874 1.00 44.00  ? 264 LEU D CD2   1 
ATOM 7852  N N     . SER D 4 265 ? 160.619 116.472 154.836 1.00 46.65  ? 265 SER D N     1 
ATOM 7853  C CA    . SER D 4 265 ? 160.501 116.802 156.247 1.00 46.65  ? 265 SER D CA    1 
ATOM 7854  C C     . SER D 4 265 ? 161.785 117.343 156.865 1.00 46.65  ? 265 SER D C     1 
ATOM 7855  O O     . SER D 4 265 ? 161.726 118.234 157.713 1.00 46.65  ? 265 SER D O     1 
ATOM 7856  C CB    . SER D 4 265 ? 160.033 115.574 157.016 1.00 46.65  ? 265 SER D CB    1 
ATOM 7857  O OG    . SER D 4 265 ? 160.984 114.537 156.926 1.00 46.65  ? 265 SER D OG    1 
ATOM 7858  N N     . THR D 4 266 ? 162.949 116.864 156.461 1.00 42.02  ? 266 THR D N     1 
ATOM 7859  C CA    . THR D 4 266 ? 164.084 117.251 157.282 1.00 42.02  ? 266 THR D CA    1 
ATOM 7860  C C     . THR D 4 266 ? 164.654 118.613 156.921 1.00 42.02  ? 266 THR D C     1 
ATOM 7861  O O     . THR D 4 266 ? 164.428 119.154 155.843 1.00 42.02  ? 266 THR D O     1 
ATOM 7862  C CB    . THR D 4 266 ? 165.189 116.222 157.188 1.00 42.02  ? 266 THR D CB    1 
ATOM 7863  O OG1   . THR D 4 266 ? 166.048 116.371 158.319 1.00 42.02  ? 266 THR D OG1   1 
ATOM 7864  C CG2   . THR D 4 266 ? 165.973 116.433 155.934 1.00 42.02  ? 266 THR D CG2   1 
ATOM 7865  N N     . VAL D 4 267 ? 165.369 119.180 157.886 1.00 36.51  ? 267 VAL D N     1 
ATOM 7866  C CA    . VAL D 4 267 ? 166.044 120.471 157.782 1.00 36.51  ? 267 VAL D CA    1 
ATOM 7867  C C     . VAL D 4 267 ? 167.350 120.328 158.552 1.00 36.51  ? 267 VAL D C     1 
ATOM 7868  O O     . VAL D 4 267 ? 167.336 119.763 159.652 1.00 36.51  ? 267 VAL D O     1 
ATOM 7869  C CB    . VAL D 4 267 ? 165.170 121.606 158.330 1.00 36.51  ? 267 VAL D CB    1 
ATOM 7870  C CG1   . VAL D 4 267 ? 165.979 122.853 158.560 1.00 36.51  ? 267 VAL D CG1   1 
ATOM 7871  C CG2   . VAL D 4 267 ? 164.051 121.899 157.383 1.00 36.51  ? 267 VAL D CG2   1 
ATOM 7872  N N     . PRO D 4 268 ? 168.486 120.787 158.038 1.00 35.72  ? 268 PRO D N     1 
ATOM 7873  C CA    . PRO D 4 268 ? 169.745 120.579 158.747 1.00 35.72  ? 268 PRO D CA    1 
ATOM 7874  C C     . PRO D 4 268 ? 169.706 121.201 160.129 1.00 35.72  ? 268 PRO D C     1 
ATOM 7875  O O     . PRO D 4 268 ? 168.991 122.167 160.387 1.00 35.72  ? 268 PRO D O     1 
ATOM 7876  C CB    . PRO D 4 268 ? 170.771 121.278 157.868 1.00 35.72  ? 268 PRO D CB    1 
ATOM 7877  C CG    . PRO D 4 268 ? 170.160 121.349 156.567 1.00 35.72  ? 268 PRO D CG    1 
ATOM 7878  C CD    . PRO D 4 268 ? 168.698 121.519 156.791 1.00 35.72  ? 268 PRO D CD    1 
ATOM 7879  N N     . SER D 4 269 ? 170.535 120.663 161.008 1.00 34.12  ? 269 SER D N     1 
ATOM 7880  C CA    . SER D 4 269 ? 170.641 121.118 162.388 1.00 34.12  ? 269 SER D CA    1 
ATOM 7881  C C     . SER D 4 269 ? 171.910 121.938 162.521 1.00 34.12  ? 269 SER D C     1 
ATOM 7882  O O     . SER D 4 269 ? 172.991 121.390 162.722 1.00 34.12  ? 269 SER D O     1 
ATOM 7883  C CB    . SER D 4 269 ? 170.646 119.933 163.344 1.00 34.12  ? 269 SER D CB    1 
ATOM 7884  O OG    . SER D 4 269 ? 171.774 119.107 163.114 1.00 34.12  ? 269 SER D OG    1 
ATOM 7885  N N     . GLY D 4 270 ? 171.777 123.249 162.424 1.00 32.02  ? 270 GLY D N     1 
ATOM 7886  C CA    . GLY D 4 270 ? 172.923 124.119 162.556 1.00 32.02  ? 270 GLY D CA    1 
ATOM 7887  C C     . GLY D 4 270 ? 172.524 125.458 163.123 1.00 32.02  ? 270 GLY D C     1 
ATOM 7888  O O     . GLY D 4 270 ? 171.777 126.203 162.492 1.00 32.02  ? 270 GLY D O     1 
ATOM 7889  N N     . LYS D 4 271 ? 173.024 125.780 164.312 1.00 33.18  ? 271 LYS D N     1 
ATOM 7890  C CA    . LYS D 4 271 ? 172.612 126.979 165.034 1.00 33.18  ? 271 LYS D CA    1 
ATOM 7891  C C     . LYS D 4 271 ? 171.113 127.017 165.232 1.00 33.18  ? 271 LYS D C     1 
ATOM 7892  O O     . LYS D 4 271 ? 170.524 128.088 165.354 1.00 33.18  ? 271 LYS D O     1 
ATOM 7893  C CB    . LYS D 4 271 ? 173.067 128.250 164.322 1.00 33.18  ? 271 LYS D CB    1 
ATOM 7894  C CG    . LYS D 4 271 ? 174.526 128.535 164.446 1.00 33.18  ? 271 LYS D CG    1 
ATOM 7895  C CD    . LYS D 4 271 ? 174.878 128.964 165.846 1.00 33.18  ? 271 LYS D CD    1 
ATOM 7896  C CE    . LYS D 4 271 ? 174.375 130.370 166.060 1.00 33.18  ? 271 LYS D CE    1 
ATOM 7897  N NZ    . LYS D 4 271 ? 175.097 131.313 165.164 1.00 33.18  ? 271 LYS D NZ    1 
ATOM 7898  N N     . GLN D 4 272 ? 170.480 125.854 165.257 1.00 33.94  ? 272 GLN D N     1 
ATOM 7899  C CA    . GLN D 4 272 ? 169.033 125.839 165.388 1.00 33.94  ? 272 GLN D CA    1 
ATOM 7900  C C     . GLN D 4 272 ? 168.566 126.167 166.793 1.00 33.94  ? 272 GLN D C     1 
ATOM 7901  O O     . GLN D 4 272 ? 167.470 126.704 166.957 1.00 33.94  ? 272 GLN D O     1 
ATOM 7902  C CB    . GLN D 4 272 ? 168.448 124.535 164.896 1.00 33.94  ? 272 GLN D CB    1 
ATOM 7903  C CG    . GLN D 4 272 ? 168.344 124.571 163.414 1.00 33.94  ? 272 GLN D CG    1 
ATOM 7904  C CD    . GLN D 4 272 ? 167.725 123.348 162.864 1.00 33.94  ? 272 GLN D CD    1 
ATOM 7905  O OE1   . GLN D 4 272 ? 167.555 122.358 163.563 1.00 33.94  ? 272 GLN D OE1   1 
ATOM 7906  N NE2   . GLN D 4 272 ? 167.340 123.407 161.605 1.00 33.94  ? 272 GLN D NE2   1 
ATOM 7907  N N     . ASN D 4 273 ? 169.347 125.861 167.819 1.00 33.47  ? 273 ASN D N     1 
ATOM 7908  C CA    . ASN D 4 273 ? 168.849 126.216 169.137 1.00 33.47  ? 273 ASN D CA    1 
ATOM 7909  C C     . ASN D 4 273 ? 168.771 127.721 169.303 1.00 33.47  ? 273 ASN D C     1 
ATOM 7910  O O     . ASN D 4 273 ? 167.916 128.213 170.041 1.00 33.47  ? 273 ASN D O     1 
ATOM 7911  C CB    . ASN D 4 273 ? 169.717 125.607 170.227 1.00 33.47  ? 273 ASN D CB    1 
ATOM 7912  C CG    . ASN D 4 273 ? 169.690 124.112 170.205 1.00 33.47  ? 273 ASN D CG    1 
ATOM 7913  O OD1   . ASN D 4 273 ? 170.727 123.458 170.183 1.00 33.47  ? 273 ASN D OD1   1 
ATOM 7914  N ND2   . ASN D 4 273 ? 168.495 123.554 170.205 1.00 33.47  ? 273 ASN D ND2   1 
ATOM 7915  N N     . ALA D 4 274 ? 169.624 128.466 168.624 1.00 31.45  ? 274 ALA D N     1 
ATOM 7916  C CA    . ALA D 4 274 ? 169.487 129.908 168.680 1.00 31.45  ? 274 ALA D CA    1 
ATOM 7917  C C     . ALA D 4 274 ? 168.473 130.424 167.672 1.00 31.45  ? 274 ALA D C     1 
ATOM 7918  O O     . ALA D 4 274 ? 167.941 131.519 167.858 1.00 31.45  ? 274 ALA D O     1 
ATOM 7919  C CB    . ALA D 4 274 ? 170.837 130.586 168.459 1.00 31.45  ? 274 ALA D CB    1 
ATOM 7920  N N     . THR D 4 275 ? 168.233 129.699 166.578 1.00 32.87  ? 275 THR D N     1 
ATOM 7921  C CA    . THR D 4 275 ? 167.220 130.072 165.598 1.00 32.87  ? 275 THR D CA    1 
ATOM 7922  C C     . THR D 4 275 ? 166.393 128.853 165.253 1.00 32.87  ? 275 THR D C     1 
ATOM 7923  O O     . THR D 4 275 ? 166.930 127.870 164.743 1.00 32.87  ? 275 THR D O     1 
ATOM 7924  C CB    . THR D 4 275 ? 167.845 130.608 164.325 1.00 32.87  ? 275 THR D CB    1 
ATOM 7925  O OG1   . THR D 4 275 ? 168.466 129.526 163.629 1.00 32.87  ? 275 THR D OG1   1 
ATOM 7926  C CG2   . THR D 4 275 ? 168.905 131.613 164.657 1.00 32.87  ? 275 THR D CG2   1 
ATOM 7927  N N     . ALA D 4 276 ? 165.083 128.961 165.392 1.00 32.03  ? 276 ALA D N     1 
ATOM 7928  C CA    . ALA D 4 276 ? 164.190 127.843 165.090 1.00 32.03  ? 276 ALA D CA    1 
ATOM 7929  C C     . ALA D 4 276 ? 163.780 127.930 163.635 1.00 32.03  ? 276 ALA D C     1 
ATOM 7930  O O     . ALA D 4 276 ? 162.778 128.546 163.279 1.00 32.03  ? 276 ALA D O     1 
ATOM 7931  C CB    . ALA D 4 276 ? 162.987 127.832 166.016 1.00 32.03  ? 276 ALA D CB    1 
ATOM 7932  N N     . ALA D 4 277 ? 164.586 127.325 162.781 1.00 35.24  ? 277 ALA D N     1 
ATOM 7933  C CA    . ALA D 4 277 ? 164.355 127.378 161.354 1.00 35.24  ? 277 ALA D CA    1 
ATOM 7934  C C     . ALA D 4 277 ? 163.498 126.227 160.851 1.00 35.24  ? 277 ALA D C     1 
ATOM 7935  O O     . ALA D 4 277 ? 163.418 126.032 159.638 1.00 35.24  ? 277 ALA D O     1 
ATOM 7936  C CB    . ALA D 4 277 ? 165.687 127.392 160.602 1.00 35.24  ? 277 ALA D CB    1 
ATOM 7937  N N     . MET D 4 278 ? 162.908 125.428 161.739 1.00 36.48  ? 278 MET D N     1 
ATOM 7938  C CA    . MET D 4 278 ? 162.067 124.317 161.307 1.00 36.48  ? 278 MET D CA    1 
ATOM 7939  C C     . MET D 4 278 ? 160.938 124.831 160.422 1.00 36.48  ? 278 MET D C     1 
ATOM 7940  O O     . MET D 4 278 ? 160.282 125.820 160.758 1.00 36.48  ? 278 MET D O     1 
ATOM 7941  C CB    . MET D 4 278 ? 161.504 123.589 162.522 1.00 36.48  ? 278 MET D CB    1 
ATOM 7942  C CG    . MET D 4 278 ? 162.472 122.680 163.248 1.00 36.48  ? 278 MET D CG    1 
ATOM 7943  S SD    . MET D 4 278 ? 163.110 121.370 162.172 1.00 36.48  ? 278 MET D SD    1 
ATOM 7944  C CE    . MET D 4 278 ? 164.848 121.524 162.432 1.00 36.48  ? 278 MET D CE    1 
ATOM 7945  N N     . THR D 4 279 ? 160.722 124.174 159.283 1.00 32.99  ? 279 THR D N     1 
ATOM 7946  C CA    . THR D 4 279 ? 159.685 124.587 158.347 1.00 32.99  ? 279 THR D CA    1 
ATOM 7947  C C     . THR D 4 279 ? 159.388 123.464 157.369 1.00 32.99  ? 279 THR D C     1 
ATOM 7948  O O     . THR D 4 279 ? 160.161 122.509 157.237 1.00 32.99  ? 279 THR D O     1 
ATOM 7949  C CB    . THR D 4 279 ? 160.118 125.819 157.560 1.00 32.99  ? 279 THR D CB    1 
ATOM 7950  O OG1   . THR D 4 279 ? 160.730 126.770 158.429 1.00 32.99  ? 279 THR D OG1   1 
ATOM 7951  C CG2   . THR D 4 279 ? 158.955 126.442 156.901 1.00 32.99  ? 279 THR D CG2   1 
ATOM 7952  N N     . LEU D 4 280 ? 158.217 123.574 156.698 1.00 32.97  ? 280 LEU D N     1 
ATOM 7953  C CA    . LEU D 4 280 ? 157.783 122.705 155.618 1.00 32.97  ? 280 LEU D CA    1 
ATOM 7954  C C     . LEU D 4 280 ? 157.901 123.414 154.280 1.00 32.97  ? 280 LEU D C     1 
ATOM 7955  O O     . LEU D 4 280 ? 157.636 124.615 154.188 1.00 32.97  ? 280 LEU D O     1 
ATOM 7956  C CB    . LEU D 4 280 ? 156.346 122.214 155.774 1.00 32.97  ? 280 LEU D CB    1 
ATOM 7957  C CG    . LEU D 4 280 ? 156.118 121.060 156.725 1.00 32.97  ? 280 LEU D CG    1 
ATOM 7958  C CD1   . LEU D 4 280 ? 154.648 120.806 156.809 1.00 32.97  ? 280 LEU D CD1   1 
ATOM 7959  C CD2   . LEU D 4 280 ? 156.830 119.865 156.205 1.00 32.97  ? 280 LEU D CD2   1 
ATOM 7960  N N     . PRO D 4 281 ? 158.320 122.700 153.246 1.00 35.12  ? 281 PRO D N     1 
ATOM 7961  C CA    . PRO D 4 281 ? 158.379 123.293 151.911 1.00 35.12  ? 281 PRO D CA    1 
ATOM 7962  C C     . PRO D 4 281 ? 157.035 123.852 151.483 1.00 35.12  ? 281 PRO D C     1 
ATOM 7963  O O     . PRO D 4 281 ? 155.984 123.290 151.787 1.00 35.12  ? 281 PRO D O     1 
ATOM 7964  C CB    . PRO D 4 281 ? 158.790 122.114 151.031 1.00 35.12  ? 281 PRO D CB    1 
ATOM 7965  C CG    . PRO D 4 281 ? 159.486 121.202 151.938 1.00 35.12  ? 281 PRO D CG    1 
ATOM 7966  C CD    . PRO D 4 281 ? 158.796 121.308 153.248 1.00 35.12  ? 281 PRO D CD    1 
ATOM 7967  N N     . ASP D 4 282 ? 157.072 124.977 150.778 1.00 38.44  ? 282 ASP D N     1 
ATOM 7968  C CA    . ASP D 4 282 ? 155.834 125.606 150.331 1.00 38.44  ? 282 ASP D CA    1 
ATOM 7969  C C     . ASP D 4 282 ? 155.338 124.949 149.061 1.00 38.44  ? 282 ASP D C     1 
ATOM 7970  O O     . ASP D 4 282 ? 154.130 124.821 148.850 1.00 38.44  ? 282 ASP D O     1 
ATOM 7971  C CB    . ASP D 4 282 ? 156.032 127.099 150.098 1.00 38.44  ? 282 ASP D CB    1 
ATOM 7972  C CG    . ASP D 4 282 ? 156.534 127.818 151.320 1.00 38.44  ? 282 ASP D CG    1 
ATOM 7973  O OD1   . ASP D 4 282 ? 156.293 127.323 152.434 1.00 38.44  ? 282 ASP D OD1   1 
ATOM 7974  O OD2   . ASP D 4 282 ? 157.128 128.905 151.167 1.00 38.44  ? 282 ASP D OD2   1 
ATOM 7975  N N     . LEU D 4 283 ? 156.262 124.538 148.207 1.00 35.95  ? 283 LEU D N     1 
ATOM 7976  C CA    . LEU D 4 283 ? 155.961 123.890 146.947 1.00 35.95  ? 283 LEU D CA    1 
ATOM 7977  C C     . LEU D 4 283 ? 156.796 122.637 146.850 1.00 35.95  ? 283 LEU D C     1 
ATOM 7978  O O     . LEU D 4 283 ? 158.009 122.677 147.082 1.00 35.95  ? 283 LEU D O     1 
ATOM 7979  C CB    . LEU D 4 283 ? 156.301 124.774 145.768 1.00 35.95  ? 283 LEU D CB    1 
ATOM 7980  C CG    . LEU D 4 283 ? 155.487 124.579 144.501 1.00 35.95  ? 283 LEU D CG    1 
ATOM 7981  C CD1   . LEU D 4 283 ? 155.595 125.783 143.613 1.00 35.95  ? 283 LEU D CD1   1 
ATOM 7982  C CD2   . LEU D 4 283 ? 156.019 123.361 143.776 1.00 35.95  ? 283 LEU D CD2   1 
ATOM 7983  N N     . VAL D 4 284 ? 156.167 121.557 146.424 1.00 35.96  ? 284 VAL D N     1 
ATOM 7984  C CA    . VAL D 4 284 ? 156.880 120.340 146.082 1.00 35.96  ? 284 VAL D CA    1 
ATOM 7985  C C     . VAL D 4 284 ? 156.399 119.871 144.729 1.00 35.96  ? 284 VAL D C     1 
ATOM 7986  O O     . VAL D 4 284 ? 155.196 119.879 144.452 1.00 35.96  ? 284 VAL D O     1 
ATOM 7987  C CB    . VAL D 4 284 ? 156.650 119.244 147.127 1.00 35.96  ? 284 VAL D CB    1 
ATOM 7988  C CG1   . VAL D 4 284 ? 157.326 117.988 146.708 1.00 35.96  ? 284 VAL D CG1   1 
ATOM 7989  C CG2   . VAL D 4 284 ? 157.173 119.676 148.442 1.00 35.96  ? 284 VAL D CG2   1 
ATOM 7990  N N     . HIS D 4 285 ? 157.336 119.461 143.884 1.00 38.10  ? 285 HIS D N     1 
ATOM 7991  C CA    . HIS D 4 285 ? 157.018 119.006 142.541 1.00 38.10  ? 285 HIS D CA    1 
ATOM 7992  C C     . HIS D 4 285 ? 157.865 117.797 142.214 1.00 38.10  ? 285 HIS D C     1 
ATOM 7993  O O     . HIS D 4 285 ? 159.075 117.926 142.021 1.00 38.10  ? 285 HIS D O     1 
ATOM 7994  C CB    . HIS D 4 285 ? 157.255 120.108 141.531 1.00 38.10  ? 285 HIS D CB    1 
ATOM 7995  C CG    . HIS D 4 285 ? 157.095 119.663 140.120 1.00 38.10  ? 285 HIS D CG    1 
ATOM 7996  N ND1   . HIS D 4 285 ? 157.882 120.143 139.098 1.00 38.10  ? 285 HIS D ND1   1 
ATOM 7997  C CD2   . HIS D 4 285 ? 156.266 118.750 139.564 1.00 38.10  ? 285 HIS D CD2   1 
ATOM 7998  C CE1   . HIS D 4 285 ? 157.523 119.568 137.966 1.00 38.10  ? 285 HIS D CE1   1 
ATOM 7999  N NE2   . HIS D 4 285 ? 156.544 118.719 138.221 1.00 38.10  ? 285 HIS D NE2   1 
ATOM 8000  N N     . ILE D 4 286 ? 157.235 116.638 142.135 1.00 37.70  ? 286 ILE D N     1 
ATOM 8001  C CA    . ILE D 4 286 ? 157.911 115.392 141.818 1.00 37.70  ? 286 ILE D CA    1 
ATOM 8002  C C     . ILE D 4 286 ? 157.557 115.019 140.395 1.00 37.70  ? 286 ILE D C     1 
ATOM 8003  O O     . ILE D 4 286 ? 156.384 114.783 140.091 1.00 37.70  ? 286 ILE D O     1 
ATOM 8004  C CB    . ILE D 4 286 ? 157.519 114.273 142.789 1.00 37.70  ? 286 ILE D CB    1 
ATOM 8005  C CG1   . ILE D 4 286 ? 157.813 114.700 144.215 1.00 37.70  ? 286 ILE D CG1   1 
ATOM 8006  C CG2   . ILE D 4 286 ? 158.218 112.992 142.437 1.00 37.70  ? 286 ILE D CG2   1 
ATOM 8007  C CD1   . ILE D 4 286 ? 157.662 113.587 145.200 1.00 37.70  ? 286 ILE D CD1   1 
ATOM 8008  N N     . ALA D 4 287 ? 158.557 114.955 139.522 1.00 39.52  ? 287 ALA D N     1 
ATOM 8009  C CA    . ALA D 4 287 ? 158.318 114.667 138.113 1.00 39.52  ? 287 ALA D CA    1 
ATOM 8010  C C     . ALA D 4 287 ? 159.020 113.373 137.741 1.00 39.52  ? 287 ALA D C     1 
ATOM 8011  O O     . ALA D 4 287 ? 160.238 113.361 137.569 1.00 39.52  ? 287 ALA D O     1 
ATOM 8012  C CB    . ALA D 4 287 ? 158.820 115.820 137.249 1.00 39.52  ? 287 ALA D CB    1 
ATOM 8013  N N     . VAL D 4 288 ? 158.259 112.304 137.557 1.00 43.01  ? 288 VAL D N     1 
ATOM 8014  C CA    . VAL D 4 288 ? 158.845 111.049 137.115 1.00 43.01  ? 288 VAL D CA    1 
ATOM 8015  C C     . VAL D 4 288 ? 159.202 111.160 135.640 1.00 43.01  ? 288 VAL D C     1 
ATOM 8016  O O     . VAL D 4 288 ? 158.339 111.036 134.766 1.00 43.01  ? 288 VAL D O     1 
ATOM 8017  C CB    . VAL D 4 288 ? 157.891 109.877 137.363 1.00 43.01  ? 288 VAL D CB    1 
ATOM 8018  C CG1   . VAL D 4 288 ? 158.497 108.608 136.823 1.00 43.01  ? 288 VAL D CG1   1 
ATOM 8019  C CG2   . VAL D 4 288 ? 157.619 109.746 138.822 1.00 43.01  ? 288 VAL D CG2   1 
ATOM 8020  N N     . ARG D 4 289 ? 160.472 111.400 135.353 1.00 47.96  ? 289 ARG D N     1 
ATOM 8021  C CA    . ARG D 4 289 ? 160.957 111.631 134.001 1.00 47.96  ? 289 ARG D CA    1 
ATOM 8022  C C     . ARG D 4 289 ? 161.724 110.421 133.505 1.00 47.96  ? 289 ARG D C     1 
ATOM 8023  O O     . ARG D 4 289 ? 162.540 109.864 134.241 1.00 47.96  ? 289 ARG D O     1 
ATOM 8024  C CB    . ARG D 4 289 ? 161.860 112.858 133.933 1.00 47.96  ? 289 ARG D CB    1 
ATOM 8025  C CG    . ARG D 4 289 ? 161.266 114.083 134.537 1.00 47.96  ? 289 ARG D CG    1 
ATOM 8026  C CD    . ARG D 4 289 ? 161.990 115.284 134.033 1.00 47.96  ? 289 ARG D CD    1 
ATOM 8027  N NE    . ARG D 4 289 ? 162.220 115.162 132.604 1.00 47.96  ? 289 ARG D NE    1 
ATOM 8028  C CZ    . ARG D 4 289 ? 161.487 115.786 131.701 1.00 47.96  ? 289 ARG D CZ    1 
ATOM 8029  N NH1   . ARG D 4 289 ? 161.747 115.643 130.413 1.00 47.96  ? 289 ARG D NH1   1 
ATOM 8030  N NH2   . ARG D 4 289 ? 160.497 116.566 132.093 1.00 47.96  ? 289 ARG D NH2   1 
ATOM 8031  N N     . PHE D 4 290 ? 161.456 110.001 132.273 1.00 51.53  ? 290 PHE D N     1 
ATOM 8032  C CA    . PHE D 4 290 ? 162.193 108.879 131.709 1.00 51.53  ? 290 PHE D CA    1 
ATOM 8033  C C     . PHE D 4 290 ? 163.339 109.332 130.824 1.00 51.53  ? 290 PHE D C     1 
ATOM 8034  O O     . PHE D 4 290 ? 164.352 108.631 130.738 1.00 51.53  ? 290 PHE D O     1 
ATOM 8035  C CB    . PHE D 4 290 ? 161.268 107.992 130.877 1.00 51.53  ? 290 PHE D CB    1 
ATOM 8036  C CG    . PHE D 4 290 ? 160.151 107.397 131.656 1.00 51.53  ? 290 PHE D CG    1 
ATOM 8037  C CD1   . PHE D 4 290 ? 160.336 106.237 132.376 1.00 51.53  ? 290 PHE D CD1   1 
ATOM 8038  C CD2   . PHE D 4 290 ? 158.914 108.003 131.676 1.00 51.53  ? 290 PHE D CD2   1 
ATOM 8039  C CE1   . PHE D 4 290 ? 159.298 105.688 133.099 1.00 51.53  ? 290 PHE D CE1   1 
ATOM 8040  C CE2   . PHE D 4 290 ? 157.874 107.461 132.394 1.00 51.53  ? 290 PHE D CE2   1 
ATOM 8041  C CZ    . PHE D 4 290 ? 158.064 106.301 133.108 1.00 51.53  ? 290 PHE D CZ    1 
ATOM 8042  N N     . ASP D 4 291 ? 163.199 110.478 130.164 1.00 52.91  ? 291 ASP D N     1 
ATOM 8043  C CA    . ASP D 4 291 ? 164.262 111.012 129.323 1.00 52.91  ? 291 ASP D CA    1 
ATOM 8044  C C     . ASP D 4 291 ? 165.496 111.402 130.134 1.00 52.91  ? 291 ASP D C     1 
ATOM 8045  O O     . ASP D 4 291 ? 166.527 110.733 130.031 1.00 52.91  ? 291 ASP D O     1 
ATOM 8046  C CB    . ASP D 4 291 ? 163.724 112.181 128.497 1.00 52.91  ? 291 ASP D CB    1 
ATOM 8047  C CG    . ASP D 4 291 ? 163.166 113.288 129.349 1.00 52.91  ? 291 ASP D CG    1 
ATOM 8048  O OD1   . ASP D 4 291 ? 162.855 113.034 130.533 1.00 52.91  ? 291 ASP D OD1   1 
ATOM 8049  O OD2   . ASP D 4 291 ? 163.036 114.416 128.839 1.00 52.91  ? 291 ASP D OD2   1 
ATOM 8050  N N     . ARG D 4 292 ? 165.423 112.439 130.965 1.00 49.26  ? 292 ARG D N     1 
ATOM 8051  C CA    . ARG D 4 292 ? 166.604 112.862 131.707 1.00 49.26  ? 292 ARG D CA    1 
ATOM 8052  C C     . ARG D 4 292 ? 166.172 113.773 132.844 1.00 49.26  ? 292 ARG D C     1 
ATOM 8053  O O     . ARG D 4 292 ? 165.106 114.388 132.779 1.00 49.26  ? 292 ARG D O     1 
ATOM 8054  C CB    . ARG D 4 292 ? 167.591 113.601 130.798 1.00 49.26  ? 292 ARG D CB    1 
ATOM 8055  C CG    . ARG D 4 292 ? 167.021 114.842 130.151 1.00 49.26  ? 292 ARG D CG    1 
ATOM 8056  C CD    . ARG D 4 292 ? 168.036 115.418 129.198 1.00 49.26  ? 292 ARG D CD    1 
ATOM 8057  N NE    . ARG D 4 292 ? 167.589 116.663 128.594 1.00 49.26  ? 292 ARG D NE    1 
ATOM 8058  C CZ    . ARG D 4 292 ? 167.824 117.863 129.100 1.00 49.26  ? 292 ARG D CZ    1 
ATOM 8059  N NH1   . ARG D 4 292 ? 167.377 118.945 128.480 1.00 49.26  ? 292 ARG D NH1   1 
ATOM 8060  N NH2   . ARG D 4 292 ? 168.527 117.985 130.212 1.00 49.26  ? 292 ARG D NH2   1 
ATOM 8061  N N     . PRO D 4 293 ? 166.985 113.884 133.894 1.00 44.59  ? 293 PRO D N     1 
ATOM 8062  C CA    . PRO D 4 293 ? 166.676 114.807 134.984 1.00 44.59  ? 293 PRO D CA    1 
ATOM 8063  C C     . PRO D 4 293 ? 166.889 116.239 134.548 1.00 44.59  ? 293 PRO D C     1 
ATOM 8064  O O     . PRO D 4 293 ? 167.823 116.541 133.805 1.00 44.59  ? 293 PRO D O     1 
ATOM 8065  C CB    . PRO D 4 293 ? 167.681 114.420 136.070 1.00 44.59  ? 293 PRO D CB    1 
ATOM 8066  C CG    . PRO D 4 293 ? 168.800 113.888 135.320 1.00 44.59  ? 293 PRO D CG    1 
ATOM 8067  C CD    . PRO D 4 293 ? 168.234 113.165 134.159 1.00 44.59  ? 293 PRO D CD    1 
ATOM 8068  N N     . ILE D 4 294 ? 166.025 117.130 135.010 1.00 41.21  ? 294 ILE D N     1 
ATOM 8069  C CA    . ILE D 4 294 ? 166.146 118.540 134.674 1.00 41.21  ? 294 ILE D CA    1 
ATOM 8070  C C     . ILE D 4 294 ? 165.886 119.320 135.948 1.00 41.21  ? 294 ILE D C     1 
ATOM 8071  O O     . ILE D 4 294 ? 164.934 119.026 136.674 1.00 41.21  ? 294 ILE D O     1 
ATOM 8072  C CB    . ILE D 4 294 ? 165.190 118.991 133.554 1.00 41.21  ? 294 ILE D CB    1 
ATOM 8073  C CG1   . ILE D 4 294 ? 163.734 118.787 133.963 1.00 41.21  ? 294 ILE D CG1   1 
ATOM 8074  C CG2   . ILE D 4 294 ? 165.464 118.208 132.280 1.00 41.21  ? 294 ILE D CG2   1 
ATOM 8075  C CD1   . ILE D 4 294 ? 162.772 118.855 132.816 1.00 41.21  ? 294 ILE D CD1   1 
ATOM 8076  N N     . SER D 4 295 ? 166.748 120.279 136.243 1.00 39.36  ? 295 SER D N     1 
ATOM 8077  C CA    . SER D 4 295 ? 166.569 121.145 137.392 1.00 39.36  ? 295 SER D CA    1 
ATOM 8078  C C     . SER D 4 295 ? 165.995 122.452 136.901 1.00 39.36  ? 295 SER D C     1 
ATOM 8079  O O     . SER D 4 295 ? 166.412 122.969 135.869 1.00 39.36  ? 295 SER D O     1 
ATOM 8080  C CB    . SER D 4 295 ? 167.879 121.417 138.115 1.00 39.36  ? 295 SER D CB    1 
ATOM 8081  O OG    . SER D 4 295 ? 168.730 122.192 137.296 1.00 39.36  ? 295 SER D OG    1 
ATOM 8082  N N     . PHE D 4 296 ? 165.089 123.028 137.666 1.00 40.17  ? 296 PHE D N     1 
ATOM 8083  C CA    . PHE D 4 296 ? 164.551 124.309 137.255 1.00 40.17  ? 296 PHE D CA    1 
ATOM 8084  C C     . PHE D 4 296 ? 165.334 125.446 137.860 1.00 40.17  ? 296 PHE D C     1 
ATOM 8085  O O     . PHE D 4 296 ? 164.807 126.549 138.038 1.00 40.17  ? 296 PHE D O     1 
ATOM 8086  C CB    . PHE D 4 296 ? 163.088 124.392 137.661 1.00 40.17  ? 296 PHE D CB    1 
ATOM 8087  C CG    . PHE D 4 296 ? 162.226 123.446 136.923 1.00 40.17  ? 296 PHE D CG    1 
ATOM 8088  C CD1   . PHE D 4 296 ? 162.652 122.902 135.739 1.00 40.17  ? 296 PHE D CD1   1 
ATOM 8089  C CD2   . PHE D 4 296 ? 161.014 123.055 137.436 1.00 40.17  ? 296 PHE D CD2   1 
ATOM 8090  C CE1   . PHE D 4 296 ? 161.867 122.003 135.066 1.00 40.17  ? 296 PHE D CE1   1 
ATOM 8091  C CE2   . PHE D 4 296 ? 160.226 122.159 136.767 1.00 40.17  ? 296 PHE D CE2   1 
ATOM 8092  C CZ    . PHE D 4 296 ? 160.654 121.632 135.579 1.00 40.17  ? 296 PHE D CZ    1 
ATOM 8093  N N     . ALA D 4 297 ? 166.601 125.200 138.168 1.00 40.18  ? 297 ALA D N     1 
ATOM 8094  C CA    . ALA D 4 297 ? 167.421 126.250 138.745 1.00 40.18  ? 297 ALA D CA    1 
ATOM 8095  C C     . ALA D 4 297 ? 167.528 127.474 137.856 1.00 40.18  ? 297 ALA D C     1 
ATOM 8096  O O     . ALA D 4 297 ? 167.374 128.589 138.381 1.00 40.18  ? 297 ALA D O     1 
ATOM 8097  C CB    . ALA D 4 297 ? 168.804 125.690 139.078 1.00 40.18  ? 297 ALA D CB    1 
ATOM 8098  N N     . PRO D 4 298 ? 167.716 127.370 136.540 1.00 41.35  ? 298 PRO D N     1 
ATOM 8099  C CA    . PRO D 4 298 ? 167.856 128.593 135.748 1.00 41.35  ? 298 PRO D CA    1 
ATOM 8100  C C     . PRO D 4 298 ? 166.597 129.419 135.699 1.00 41.35  ? 298 PRO D C     1 
ATOM 8101  O O     . PRO D 4 298 ? 166.640 130.543 135.188 1.00 41.35  ? 298 PRO D O     1 
ATOM 8102  C CB    . PRO D 4 298 ? 168.223 128.071 134.359 1.00 41.35  ? 298 PRO D CB    1 
ATOM 8103  C CG    . PRO D 4 298 ? 168.811 126.752 134.609 1.00 41.35  ? 298 PRO D CG    1 
ATOM 8104  C CD    . PRO D 4 298 ? 168.028 126.184 135.733 1.00 41.35  ? 298 PRO D CD    1 
ATOM 8105  N N     . ALA D 4 299 ? 165.484 128.912 136.220 1.00 41.29  ? 299 ALA D N     1 
ATOM 8106  C CA    . ALA D 4 299 ? 164.293 129.737 136.330 1.00 41.29  ? 299 ALA D CA    1 
ATOM 8107  C C     . ALA D 4 299 ? 164.555 130.935 137.212 1.00 41.29  ? 299 ALA D C     1 
ATOM 8108  O O     . ALA D 4 299 ? 163.962 131.997 137.009 1.00 41.29  ? 299 ALA D O     1 
ATOM 8109  C CB    . ALA D 4 299 ? 163.130 128.922 136.878 1.00 41.29  ? 299 ALA D CB    1 
ATOM 8110  N N     . PHE D 4 300 ? 165.472 130.796 138.165 1.00 38.39  ? 300 PHE D N     1 
ATOM 8111  C CA    . PHE D 4 300 ? 165.786 131.851 139.110 1.00 38.39  ? 300 PHE D CA    1 
ATOM 8112  C C     . PHE D 4 300 ? 167.178 132.412 138.872 1.00 38.39  ? 300 PHE D C     1 
ATOM 8113  O O     . PHE D 4 300 ? 167.799 132.947 139.787 1.00 38.39  ? 300 PHE D O     1 
ATOM 8114  C CB    . PHE D 4 300 ? 165.689 131.322 140.533 1.00 38.39  ? 300 PHE D CB    1 
ATOM 8115  C CG    . PHE D 4 300 ? 164.425 130.593 140.818 1.00 38.39  ? 300 PHE D CG    1 
ATOM 8116  C CD1   . PHE D 4 300 ? 163.247 131.266 140.939 1.00 38.39  ? 300 PHE D CD1   1 
ATOM 8117  C CD2   . PHE D 4 300 ? 164.423 129.232 140.978 1.00 38.39  ? 300 PHE D CD2   1 
ATOM 8118  C CE1   . PHE D 4 300 ? 162.091 130.596 141.213 1.00 38.39  ? 300 PHE D CE1   1 
ATOM 8119  C CE2   . PHE D 4 300 ? 163.272 128.560 141.251 1.00 38.39  ? 300 PHE D CE2   1 
ATOM 8120  C CZ    . PHE D 4 300 ? 162.105 129.240 141.368 1.00 38.39  ? 300 PHE D CZ    1 
ATOM 8121  N N     . GLU D 4 301 ? 167.660 132.338 137.635 1.00 42.20  ? 301 GLU D N     1 
ATOM 8122  C CA    . GLU D 4 301 ? 168.944 132.945 137.327 1.00 42.20  ? 301 GLU D CA    1 
ATOM 8123  C C     . GLU D 4 301 ? 168.856 134.456 137.373 1.00 42.20  ? 301 GLU D C     1 
ATOM 8124  O O     . GLU D 4 301 ? 169.876 135.131 137.526 1.00 42.20  ? 301 GLU D O     1 
ATOM 8125  C CB    . GLU D 4 301 ? 169.456 132.481 135.969 1.00 42.20  ? 301 GLU D CB    1 
ATOM 8126  C CG    . GLU D 4 301 ? 170.891 132.906 135.722 1.00 42.20  ? 301 GLU D CG    1 
ATOM 8127  C CD    . GLU D 4 301 ? 171.474 132.416 134.414 1.00 42.20  ? 301 GLU D CD    1 
ATOM 8128  O OE1   . GLU D 4 301 ? 170.743 131.805 133.612 1.00 42.20  ? 301 GLU D OE1   1 
ATOM 8129  O OE2   . GLU D 4 301 ? 172.679 132.649 134.188 1.00 42.20  ? 301 GLU D OE2   1 
ATOM 8130  N N     . THR D 4 302 ? 167.664 135.000 137.247 1.00 44.57  ? 302 THR D N     1 
ATOM 8131  C CA    . THR D 4 302 ? 167.432 136.414 137.473 1.00 44.57  ? 302 THR D CA    1 
ATOM 8132  C C     . THR D 4 302 ? 166.745 136.521 138.825 1.00 44.57  ? 302 THR D C     1 
ATOM 8133  O O     . THR D 4 302 ? 165.572 136.166 138.961 1.00 44.57  ? 302 THR D O     1 
ATOM 8134  C CB    . THR D 4 302 ? 166.577 137.005 136.363 1.00 44.57  ? 302 THR D CB    1 
ATOM 8135  O OG1   . THR D 4 302 ? 165.289 136.383 136.379 1.00 44.57  ? 302 THR D OG1   1 
ATOM 8136  C CG2   . THR D 4 302 ? 167.216 136.723 135.035 1.00 44.57  ? 302 THR D CG2   1 
ATOM 8137  N N     . ALA D 4 303 ? 167.482 136.985 139.826 1.00 43.06  ? 303 ALA D N     1 
ATOM 8138  C CA    . ALA D 4 303 ? 166.942 137.080 141.174 1.00 43.06  ? 303 ALA D CA    1 
ATOM 8139  C C     . ALA D 4 303 ? 165.668 137.904 141.181 1.00 43.06  ? 303 ALA D C     1 
ATOM 8140  O O     . ALA D 4 303 ? 165.607 138.974 140.573 1.00 43.06  ? 303 ALA D O     1 
ATOM 8141  C CB    . ALA D 4 303 ? 167.971 137.704 142.102 1.00 43.06  ? 303 ALA D CB    1 
ATOM 8142  N N     . LEU D 4 304 ? 164.649 137.407 141.870 1.00 44.85  ? 304 LEU D N     1 
ATOM 8143  C CA    . LEU D 4 304 ? 163.386 138.120 141.925 1.00 44.85  ? 304 LEU D CA    1 
ATOM 8144  C C     . LEU D 4 304 ? 163.500 139.394 142.748 1.00 44.85  ? 304 LEU D C     1 
ATOM 8145  O O     . LEU D 4 304 ? 164.242 139.462 143.729 1.00 44.85  ? 304 LEU D O     1 
ATOM 8146  C CB    . LEU D 4 304 ? 162.345 137.239 142.591 1.00 44.85  ? 304 LEU D CB    1 
ATOM 8147  C CG    . LEU D 4 304 ? 162.060 135.904 141.942 1.00 44.85  ? 304 LEU D CG    1 
ATOM 8148  C CD1   . LEU D 4 304 ? 160.840 135.315 142.591 1.00 44.85  ? 304 LEU D CD1   1 
ATOM 8149  C CD2   . LEU D 4 304 ? 161.858 136.090 140.456 1.00 44.85  ? 304 LEU D CD2   1 
ATOM 8150  N N     . TYR D 4 305 ? 162.765 140.417 142.337 1.00 53.95  ? 305 TYR D N     1 
ATOM 8151  C CA    . TYR D 4 305 ? 162.751 141.628 143.131 1.00 53.95  ? 305 TYR D CA    1 
ATOM 8152  C C     . TYR D 4 305 ? 161.918 141.397 144.390 1.00 53.95  ? 305 TYR D C     1 
ATOM 8153  O O     . TYR D 4 305 ? 161.022 140.552 144.424 1.00 53.95  ? 305 TYR D O     1 
ATOM 8154  C CB    . TYR D 4 305 ? 162.274 142.852 142.366 1.00 53.95  ? 305 TYR D CB    1 
ATOM 8155  C CG    . TYR D 4 305 ? 162.665 144.043 143.195 1.00 53.95  ? 305 TYR D CG    1 
ATOM 8156  C CD1   . TYR D 4 305 ? 163.991 144.458 143.253 1.00 53.95  ? 305 TYR D CD1   1 
ATOM 8157  C CD2   . TYR D 4 305 ? 161.744 144.687 144.003 1.00 53.95  ? 305 TYR D CD2   1 
ATOM 8158  C CE1   . TYR D 4 305 ? 164.374 145.514 144.055 1.00 53.95  ? 305 TYR D CE1   1 
ATOM 8159  C CE2   . TYR D 4 305 ? 162.118 145.731 144.814 1.00 53.95  ? 305 TYR D CE2   1 
ATOM 8160  C CZ    . TYR D 4 305 ? 163.429 146.149 144.835 1.00 53.95  ? 305 TYR D CZ    1 
ATOM 8161  O OH    . TYR D 4 305 ? 163.788 147.204 145.643 1.00 53.95  ? 305 TYR D OH    1 
ATOM 8162  N N     . GLY D 4 306 ? 162.180 142.204 145.408 1.00 53.52  ? 306 GLY D N     1 
ATOM 8163  C CA    . GLY D 4 306 ? 161.571 142.080 146.711 1.00 53.52  ? 306 GLY D CA    1 
ATOM 8164  C C     . GLY D 4 306 ? 160.408 143.002 147.011 1.00 53.52  ? 306 GLY D C     1 
ATOM 8165  O O     . GLY D 4 306 ? 159.711 143.499 146.122 1.00 53.52  ? 306 GLY D O     1 
ATOM 8166  N N     . SER D 4 307 ? 160.200 143.212 148.309 1.00 54.54  ? 307 SER D N     1 
ATOM 8167  C CA    . SER D 4 307 ? 159.274 144.079 149.023 1.00 54.54  ? 307 SER D CA    1 
ATOM 8168  C C     . SER D 4 307 ? 157.859 143.532 149.116 1.00 54.54  ? 307 SER D C     1 
ATOM 8169  O O     . SER D 4 307 ? 157.033 144.160 149.771 1.00 54.54  ? 307 SER D O     1 
ATOM 8170  C CB    . SER D 4 307 ? 159.191 145.492 148.421 1.00 54.54  ? 307 SER D CB    1 
ATOM 8171  O OG    . SER D 4 307 ? 158.475 145.439 147.206 1.00 54.54  ? 307 SER D OG    1 
ATOM 8172  N N     . ASP D 4 308 ? 157.517 142.425 148.469 1.00 52.89  ? 308 ASP D N     1 
ATOM 8173  C CA    . ASP D 4 308 ? 156.170 141.899 148.638 1.00 52.89  ? 308 ASP D CA    1 
ATOM 8174  C C     . ASP D 4 308 ? 156.165 140.417 148.985 1.00 52.89  ? 308 ASP D C     1 
ATOM 8175  O O     . ASP D 4 308 ? 155.097 139.804 149.020 1.00 52.89  ? 308 ASP D O     1 
ATOM 8176  C CB    . ASP D 4 308 ? 155.301 142.157 147.412 1.00 52.89  ? 308 ASP D CB    1 
ATOM 8177  C CG    . ASP D 4 308 ? 153.821 142.005 147.719 1.00 52.89  ? 308 ASP D CG    1 
ATOM 8178  O OD1   . ASP D 4 308 ? 153.266 142.896 148.396 1.00 52.89  ? 308 ASP D OD1   1 
ATOM 8179  O OD2   . ASP D 4 308 ? 153.219 140.994 147.302 1.00 52.89  ? 308 ASP D OD2   1 
ATOM 8180  N N     . GLY D 4 309 ? 157.314 139.829 149.246 1.00 47.86  ? 309 GLY D N     1 
ATOM 8181  C CA    . GLY D 4 309 ? 157.418 138.403 149.443 1.00 47.86  ? 309 GLY D CA    1 
ATOM 8182  C C     . GLY D 4 309 ? 157.692 137.665 148.150 1.00 47.86  ? 309 GLY D C     1 
ATOM 8183  O O     . GLY D 4 309 ? 157.592 138.205 147.049 1.00 47.86  ? 309 GLY D O     1 
ATOM 8184  N N     . TYR D 4 310 ? 158.030 136.384 148.290 1.00 46.51  ? 310 TYR D N     1 
ATOM 8185  C CA    . TYR D 4 310 ? 158.449 135.603 147.140 1.00 46.51  ? 310 TYR D CA    1 
ATOM 8186  C C     . TYR D 4 310 ? 157.736 134.283 146.921 1.00 46.51  ? 310 TYR D C     1 
ATOM 8187  O O     . TYR D 4 310 ? 157.825 133.753 145.808 1.00 46.51  ? 310 TYR D O     1 
ATOM 8188  C CB    . TYR D 4 310 ? 159.939 135.296 147.235 1.00 46.51  ? 310 TYR D CB    1 
ATOM 8189  C CG    . TYR D 4 310 ? 160.796 136.514 147.276 1.00 46.51  ? 310 TYR D CG    1 
ATOM 8190  C CD1   . TYR D 4 310 ? 161.084 137.226 146.142 1.00 46.51  ? 310 TYR D CD1   1 
ATOM 8191  C CD2   . TYR D 4 310 ? 161.372 136.914 148.456 1.00 46.51  ? 310 TYR D CD2   1 
ATOM 8192  C CE1   . TYR D 4 310 ? 161.890 138.327 146.199 1.00 46.51  ? 310 TYR D CE1   1 
ATOM 8193  C CE2   . TYR D 4 310 ? 162.175 138.003 148.519 1.00 46.51  ? 310 TYR D CE2   1 
ATOM 8194  C CZ    . TYR D 4 310 ? 162.433 138.706 147.395 1.00 46.51  ? 310 TYR D CZ    1 
ATOM 8195  O OH    . TYR D 4 310 ? 163.245 139.801 147.482 1.00 46.51  ? 310 TYR D OH    1 
ATOM 8196  N N     . THR D 4 311 ? 157.074 133.712 147.925 1.00 50.55  ? 311 THR D N     1 
ATOM 8197  C CA    . THR D 4 311 ? 156.460 132.400 147.749 1.00 50.55  ? 311 THR D CA    1 
ATOM 8198  C C     . THR D 4 311 ? 155.609 132.332 146.489 1.00 50.55  ? 311 THR D C     1 
ATOM 8199  O O     . THR D 4 311 ? 155.875 131.530 145.590 1.00 50.55  ? 311 THR D O     1 
ATOM 8200  C CB    . THR D 4 311 ? 155.621 132.050 148.973 1.00 50.55  ? 311 THR D CB    1 
ATOM 8201  O OG1   . THR D 4 311 ? 154.549 132.990 149.094 1.00 50.55  ? 311 THR D OG1   1 
ATOM 8202  C CG2   . THR D 4 311 ? 156.468 132.098 150.218 1.00 50.55  ? 311 THR D CG2   1 
ATOM 8203  N N     . LEU D 4 312 ? 154.576 133.169 146.407 1.00 51.75  ? 312 LEU D N     1 
ATOM 8204  C CA    . LEU D 4 312 ? 153.713 133.156 145.234 1.00 51.75  ? 312 LEU D CA    1 
ATOM 8205  C C     . LEU D 4 312 ? 154.510 133.436 143.964 1.00 51.75  ? 312 LEU D C     1 
ATOM 8206  O O     . LEU D 4 312 ? 154.425 132.685 142.987 1.00 51.75  ? 312 LEU D O     1 
ATOM 8207  C CB    . LEU D 4 312 ? 152.561 134.145 145.403 1.00 51.75  ? 312 LEU D CB    1 
ATOM 8208  C CG    . LEU D 4 312 ? 152.753 135.660 145.347 1.00 51.75  ? 312 LEU D CG    1 
ATOM 8209  C CD1   . LEU D 4 312 ? 151.413 136.332 145.143 1.00 51.75  ? 312 LEU D CD1   1 
ATOM 8210  C CD2   . LEU D 4 312 ? 153.410 136.190 146.605 1.00 51.75  ? 312 LEU D CD2   1 
ATOM 8211  N N     . ARG D 4 313 ? 155.301 134.513 143.960 1.00 51.88  ? 313 ARG D N     1 
ATOM 8212  C CA    . ARG D 4 313 ? 156.044 134.880 142.761 1.00 51.88  ? 313 ARG D CA    1 
ATOM 8213  C C     . ARG D 4 313 ? 156.993 133.780 142.327 1.00 51.88  ? 313 ARG D C     1 
ATOM 8214  O O     . ARG D 4 313 ? 157.121 133.499 141.132 1.00 51.88  ? 313 ARG D O     1 
ATOM 8215  C CB    . ARG D 4 313 ? 156.817 136.164 143.013 1.00 51.88  ? 313 ARG D CB    1 
ATOM 8216  C CG    . ARG D 4 313 ? 155.949 137.195 143.677 1.00 51.88  ? 313 ARG D CG    1 
ATOM 8217  C CD    . ARG D 4 313 ? 156.521 138.590 143.637 1.00 51.88  ? 313 ARG D CD    1 
ATOM 8218  N NE    . ARG D 4 313 ? 157.246 138.854 142.405 1.00 51.88  ? 313 ARG D NE    1 
ATOM 8219  C CZ    . ARG D 4 313 ? 158.301 139.655 142.335 1.00 51.88  ? 313 ARG D CZ    1 
ATOM 8220  N NH1   . ARG D 4 313 ? 158.738 140.269 143.423 1.00 51.88  ? 313 ARG D NH1   1 
ATOM 8221  N NH2   . ARG D 4 313 ? 158.906 139.848 141.172 1.00 51.88  ? 313 ARG D NH2   1 
ATOM 8222  N N     . ALA D 4 314 ? 157.662 133.131 143.278 1.00 47.47  ? 314 ALA D N     1 
ATOM 8223  C CA    . ALA D 4 314 ? 158.558 132.045 142.906 1.00 47.47  ? 314 ALA D CA    1 
ATOM 8224  C C     . ALA D 4 314 ? 157.779 130.870 142.346 1.00 47.47  ? 314 ALA D C     1 
ATOM 8225  O O     . ALA D 4 314 ? 158.200 130.247 141.365 1.00 47.47  ? 314 ALA D O     1 
ATOM 8226  C CB    . ALA D 4 314 ? 159.393 131.610 144.103 1.00 47.47  ? 314 ALA D CB    1 
ATOM 8227  N N     . CYS D 4 315 ? 156.631 130.566 142.950 1.00 51.07  ? 315 CYS D N     1 
ATOM 8228  C CA    . CYS D 4 315 ? 155.753 129.535 142.411 1.00 51.07  ? 315 CYS D CA    1 
ATOM 8229  C C     . CYS D 4 315 ? 155.438 129.795 140.945 1.00 51.07  ? 315 CYS D C     1 
ATOM 8230  O O     . CYS D 4 315 ? 155.690 128.947 140.083 1.00 51.07  ? 315 CYS D O     1 
ATOM 8231  C CB    . CYS D 4 315 ? 154.468 129.476 143.238 1.00 51.07  ? 315 CYS D CB    1 
ATOM 8232  S SG    . CYS D 4 315 ? 154.659 128.803 144.909 1.00 51.07  ? 315 CYS D SG    1 
ATOM 8233  N N     . GLN D 4 316 ? 154.918 130.984 140.635 1.00 51.13  ? 316 GLN D N     1 
ATOM 8234  C CA    . GLN D 4 316 ? 154.535 131.269 139.256 1.00 51.13  ? 316 GLN D CA    1 
ATOM 8235  C C     . GLN D 4 316 ? 155.730 131.302 138.320 1.00 51.13  ? 316 GLN D C     1 
ATOM 8236  O O     . GLN D 4 316 ? 155.605 130.911 137.155 1.00 51.13  ? 316 GLN D O     1 
ATOM 8237  C CB    . GLN D 4 316 ? 153.778 132.581 139.187 1.00 51.13  ? 316 GLN D CB    1 
ATOM 8238  C CG    . GLN D 4 316 ? 152.630 132.637 140.142 1.00 51.13  ? 316 GLN D CG    1 
ATOM 8239  C CD    . GLN D 4 316 ? 151.808 133.875 139.957 1.00 51.13  ? 316 GLN D CD    1 
ATOM 8240  O OE1   . GLN D 4 316 ? 152.196 134.787 139.229 1.00 51.13  ? 316 GLN D OE1   1 
ATOM 8241  N NE2   . GLN D 4 316 ? 150.652 133.919 140.606 1.00 51.13  ? 316 GLN D NE2   1 
ATOM 8242  N N     . GLU D 4 317 ? 156.883 131.772 138.789 1.00 50.13  ? 317 GLU D N     1 
ATOM 8243  C CA    . GLU D 4 317 ? 158.065 131.761 137.935 1.00 50.13  ? 317 GLU D CA    1 
ATOM 8244  C C     . GLU D 4 317 ? 158.431 130.332 137.552 1.00 50.13  ? 317 GLU D C     1 
ATOM 8245  O O     . GLU D 4 317 ? 158.627 130.014 136.369 1.00 50.13  ? 317 GLU D O     1 
ATOM 8246  C CB    . GLU D 4 317 ? 159.233 132.439 138.639 1.00 50.13  ? 317 GLU D CB    1 
ATOM 8247  C CG    . GLU D 4 317 ? 160.465 132.531 137.792 1.00 50.13  ? 317 GLU D CG    1 
ATOM 8248  C CD    . GLU D 4 317 ? 160.338 133.614 136.748 1.00 50.13  ? 317 GLU D CD    1 
ATOM 8249  O OE1   . GLU D 4 317 ? 159.388 134.415 136.849 1.00 50.13  ? 317 GLU D OE1   1 
ATOM 8250  O OE2   . GLU D 4 317 ? 161.180 133.673 135.827 1.00 50.13  ? 317 GLU D OE2   1 
ATOM 8251  N N     . LEU D 4 318 ? 158.494 129.449 138.545 1.00 46.94  ? 318 LEU D N     1 
ATOM 8252  C CA    . LEU D 4 318 ? 158.761 128.050 138.261 1.00 46.94  ? 318 LEU D CA    1 
ATOM 8253  C C     . LEU D 4 318 ? 157.717 127.485 137.314 1.00 46.94  ? 318 LEU D C     1 
ATOM 8254  O O     . LEU D 4 318 ? 158.026 126.626 136.483 1.00 46.94  ? 318 LEU D O     1 
ATOM 8255  C CB    . LEU D 4 318 ? 158.802 127.261 139.560 1.00 46.94  ? 318 LEU D CB    1 
ATOM 8256  C CG    . LEU D 4 318 ? 159.308 125.834 139.466 1.00 46.94  ? 318 LEU D CG    1 
ATOM 8257  C CD1   . LEU D 4 318 ? 160.244 125.584 140.597 1.00 46.94  ? 318 LEU D CD1   1 
ATOM 8258  C CD2   . LEU D 4 318 ? 158.167 124.885 139.566 1.00 46.94  ? 318 LEU D CD2   1 
ATOM 8259  N N     . ASN D 4 319 ? 156.475 127.947 137.427 1.00 50.80  ? 319 ASN D N     1 
ATOM 8260  C CA    . ASN D 4 319 ? 155.445 127.518 136.486 1.00 50.80  ? 319 ASN D CA    1 
ATOM 8261  C C     . ASN D 4 319 ? 155.761 127.945 135.066 1.00 50.80  ? 319 ASN D C     1 
ATOM 8262  O O     . ASN D 4 319 ? 155.571 127.168 134.129 1.00 50.80  ? 319 ASN D O     1 
ATOM 8263  C CB    . ASN D 4 319 ? 154.097 128.096 136.889 1.00 50.80  ? 319 ASN D CB    1 
ATOM 8264  C CG    . ASN D 4 319 ? 152.962 127.552 136.078 1.00 50.80  ? 319 ASN D CG    1 
ATOM 8265  O OD1   . ASN D 4 319 ? 152.983 126.405 135.648 1.00 50.80  ? 319 ASN D OD1   1 
ATOM 8266  N ND2   . ASN D 4 319 ? 151.934 128.374 135.870 1.00 50.80  ? 319 ASN D ND2   1 
ATOM 8267  N N     . ASN D 4 320 ? 156.234 129.175 134.878 1.00 50.07  ? 320 ASN D N     1 
ATOM 8268  C CA    . ASN D 4 320 ? 156.594 129.604 133.534 1.00 50.07  ? 320 ASN D CA    1 
ATOM 8269  C C     . ASN D 4 320 ? 157.713 128.769 132.956 1.00 50.07  ? 320 ASN D C     1 
ATOM 8270  O O     . ASN D 4 320 ? 157.609 128.266 131.831 1.00 50.07  ? 320 ASN D O     1 
ATOM 8271  C CB    . ASN D 4 320 ? 156.998 131.065 133.553 1.00 50.07  ? 320 ASN D CB    1 
ATOM 8272  C CG    . ASN D 4 320 ? 155.849 131.946 133.889 1.00 50.07  ? 320 ASN D CG    1 
ATOM 8273  O OD1   . ASN D 4 320 ? 154.705 131.539 133.742 1.00 50.07  ? 320 ASN D OD1   1 
ATOM 8274  N ND2   . ASN D 4 320 ? 156.129 133.151 134.348 1.00 50.07  ? 320 ASN D ND2   1 
ATOM 8275  N N     . TYR D 4 321 ? 158.759 128.542 133.740 1.00 45.58  ? 321 TYR D N     1 
ATOM 8276  C CA    . TYR D 4 321 ? 159.866 127.741 133.239 1.00 45.58  ? 321 TYR D CA    1 
ATOM 8277  C C     . TYR D 4 321 ? 159.442 126.312 132.921 1.00 45.58  ? 321 TYR D C     1 
ATOM 8278  O O     . TYR D 4 321 ? 159.859 125.743 131.905 1.00 45.58  ? 321 TYR D O     1 
ATOM 8279  C CB    . TYR D 4 321 ? 160.985 127.744 134.256 1.00 45.58  ? 321 TYR D CB    1 
ATOM 8280  C CG    . TYR D 4 321 ? 162.286 127.261 133.718 1.00 45.58  ? 321 TYR D CG    1 
ATOM 8281  C CD1   . TYR D 4 321 ? 163.010 128.042 132.842 1.00 45.58  ? 321 TYR D CD1   1 
ATOM 8282  C CD2   . TYR D 4 321 ? 162.787 126.035 134.066 1.00 45.58  ? 321 TYR D CD2   1 
ATOM 8283  C CE1   . TYR D 4 321 ? 164.205 127.622 132.346 1.00 45.58  ? 321 TYR D CE1   1 
ATOM 8284  C CE2   . TYR D 4 321 ? 163.984 125.606 133.576 1.00 45.58  ? 321 TYR D CE2   1 
ATOM 8285  C CZ    . TYR D 4 321 ? 164.685 126.401 132.713 1.00 45.58  ? 321 TYR D CZ    1 
ATOM 8286  O OH    . TYR D 4 321 ? 165.887 125.973 132.220 1.00 45.58  ? 321 TYR D OH    1 
ATOM 8287  N N     . ALA D 4 322 ? 158.587 125.726 133.748 1.00 48.28  ? 322 ALA D N     1 
ATOM 8288  C CA    . ALA D 4 322 ? 158.112 124.381 133.449 1.00 48.28  ? 322 ALA D CA    1 
ATOM 8289  C C     . ALA D 4 322 ? 157.295 124.365 132.167 1.00 48.28  ? 322 ALA D C     1 
ATOM 8290  O O     . ALA D 4 322 ? 157.475 123.486 131.320 1.00 48.28  ? 322 ALA D O     1 
ATOM 8291  C CB    . ALA D 4 322 ? 157.298 123.832 134.617 1.00 48.28  ? 322 ALA D CB    1 
ATOM 8292  N N     . GLU D 4 323 ? 156.395 125.335 132.010 1.00 54.30  ? 323 GLU D N     1 
ATOM 8293  C CA    . GLU D 4 323 ? 155.646 125.479 130.766 1.00 54.30  ? 323 GLU D CA    1 
ATOM 8294  C C     . GLU D 4 323 ? 156.559 125.492 129.552 1.00 54.30  ? 323 GLU D C     1 
ATOM 8295  O O     . GLU D 4 323 ? 156.382 124.707 128.614 1.00 54.30  ? 323 GLU D O     1 
ATOM 8296  C CB    . GLU D 4 323 ? 154.845 126.777 130.820 1.00 54.30  ? 323 GLU D CB    1 
ATOM 8297  C CG    . GLU D 4 323 ? 154.017 127.077 129.589 1.00 54.30  ? 323 GLU D CG    1 
ATOM 8298  C CD    . GLU D 4 323 ? 153.309 128.420 129.682 1.00 54.30  ? 323 GLU D CD    1 
ATOM 8299  O OE1   . GLU D 4 323 ? 153.518 129.141 130.678 1.00 54.30  ? 323 GLU D OE1   1 
ATOM 8300  O OE2   . GLU D 4 323 ? 152.537 128.754 128.763 1.00 54.30  ? 323 GLU D OE2   1 
ATOM 8301  N N     . ARG D 4 324 ? 157.561 126.360 129.566 1.00 52.89  ? 324 ARG D N     1 
ATOM 8302  C CA    . ARG D 4 324 ? 158.415 126.517 128.394 1.00 52.89  ? 324 ARG D CA    1 
ATOM 8303  C C     . ARG D 4 324 ? 159.249 125.264 128.132 1.00 52.89  ? 324 ARG D C     1 
ATOM 8304  O O     . ARG D 4 324 ? 159.297 124.780 126.995 1.00 52.89  ? 324 ARG D O     1 
ATOM 8305  C CB    . ARG D 4 324 ? 159.215 127.800 128.498 1.00 52.89  ? 324 ARG D CB    1 
ATOM 8306  C CG    . ARG D 4 324 ? 160.351 127.843 129.401 1.00 52.89  ? 324 ARG D CG    1 
ATOM 8307  C CD    . ARG D 4 324 ? 161.118 129.077 129.016 1.00 52.89  ? 324 ARG D CD    1 
ATOM 8308  N NE    . ARG D 4 324 ? 160.393 130.281 129.418 1.00 52.89  ? 324 ARG D NE    1 
ATOM 8309  C CZ    . ARG D 4 324 ? 159.723 131.058 128.578 1.00 52.89  ? 324 ARG D CZ    1 
ATOM 8310  N NH1   . ARG D 4 324 ? 159.694 130.761 127.290 1.00 52.89  ? 324 ARG D NH1   1 
ATOM 8311  N NH2   . ARG D 4 324 ? 159.089 132.134 129.018 1.00 52.89  ? 324 ARG D NH2   1 
ATOM 8312  N N     . LEU D 4 325 ? 159.934 124.727 129.146 1.00 52.65  ? 325 LEU D N     1 
ATOM 8313  C CA    . LEU D 4 325 ? 160.716 123.521 128.878 1.00 52.65  ? 325 LEU D CA    1 
ATOM 8314  C C     . LEU D 4 325 ? 159.826 122.397 128.395 1.00 52.65  ? 325 LEU D C     1 
ATOM 8315  O O     . LEU D 4 325 ? 160.231 121.608 127.535 1.00 52.65  ? 325 LEU D O     1 
ATOM 8316  C CB    . LEU D 4 325 ? 161.469 123.018 130.099 1.00 52.65  ? 325 LEU D CB    1 
ATOM 8317  C CG    . LEU D 4 325 ? 162.815 123.578 130.479 1.00 52.65  ? 325 LEU D CG    1 
ATOM 8318  C CD1   . LEU D 4 325 ? 163.256 122.874 131.731 1.00 52.65  ? 325 LEU D CD1   1 
ATOM 8319  C CD2   . LEU D 4 325 ? 163.760 123.308 129.351 1.00 52.65  ? 325 LEU D CD2   1 
ATOM 8320  N N     . ARG D 4 326 ? 158.621 122.283 128.943 1.00 58.71  ? 326 ARG D N     1 
ATOM 8321  C CA    . ARG D 4 326 ? 157.759 121.233 128.435 1.00 58.71  ? 326 ARG D CA    1 
ATOM 8322  C C     . ARG D 4 326 ? 157.387 121.523 126.998 1.00 58.71  ? 326 ARG D C     1 
ATOM 8323  O O     . ARG D 4 326 ? 157.125 120.600 126.220 1.00 58.71  ? 326 ARG D O     1 
ATOM 8324  C CB    . ARG D 4 326 ? 156.502 121.094 129.280 1.00 58.71  ? 326 ARG D CB    1 
ATOM 8325  C CG    . ARG D 4 326 ? 155.661 119.954 128.796 1.00 58.71  ? 326 ARG D CG    1 
ATOM 8326  C CD    . ARG D 4 326 ? 154.507 119.644 129.689 1.00 58.71  ? 326 ARG D CD    1 
ATOM 8327  N NE    . ARG D 4 326 ? 153.616 118.672 129.063 1.00 58.71  ? 326 ARG D NE    1 
ATOM 8328  C CZ    . ARG D 4 326 ? 153.860 117.366 128.977 1.00 58.71  ? 326 ARG D CZ    1 
ATOM 8329  N NH1   . ARG D 4 326 ? 154.979 116.855 129.473 1.00 58.71  ? 326 ARG D NH1   1 
ATOM 8330  N NH2   . ARG D 4 326 ? 152.981 116.567 128.391 1.00 58.71  ? 326 ARG D NH2   1 
ATOM 8331  N N     . GLU D 4 327 ? 157.384 122.798 126.622 1.00 57.23  ? 327 GLU D N     1 
ATOM 8332  C CA    . GLU D 4 327 ? 157.067 123.135 125.247 1.00 57.23  ? 327 GLU D CA    1 
ATOM 8333  C C     . GLU D 4 327 ? 158.184 122.667 124.324 1.00 57.23  ? 327 GLU D C     1 
ATOM 8334  O O     . GLU D 4 327 ? 157.928 122.028 123.298 1.00 57.23  ? 327 GLU D O     1 
ATOM 8335  C CB    . GLU D 4 327 ? 156.837 124.635 125.117 1.00 57.23  ? 327 GLU D CB    1 
ATOM 8336  C CG    . GLU D 4 327 ? 156.264 125.049 123.792 1.00 57.23  ? 327 GLU D CG    1 
ATOM 8337  C CD    . GLU D 4 327 ? 157.335 125.309 122.769 1.00 57.23  ? 327 GLU D CD    1 
ATOM 8338  O OE1   . GLU D 4 327 ? 158.501 125.493 123.170 1.00 57.23  ? 327 GLU D OE1   1 
ATOM 8339  O OE2   . GLU D 4 327 ? 157.012 125.329 121.565 1.00 57.23  ? 327 GLU D OE2   1 
ATOM 8340  N N     . VAL D 4 328 ? 159.433 122.993 124.664 1.00 54.72  ? 328 VAL D N     1 
ATOM 8341  C CA    . VAL D 4 328 ? 160.559 122.586 123.825 1.00 54.72  ? 328 VAL D CA    1 
ATOM 8342  C C     . VAL D 4 328 ? 160.675 121.068 123.743 1.00 54.72  ? 328 VAL D C     1 
ATOM 8343  O O     . VAL D 4 328 ? 160.923 120.510 122.669 1.00 54.72  ? 328 VAL D O     1 
ATOM 8344  C CB    . VAL D 4 328 ? 161.860 123.210 124.350 1.00 54.72  ? 328 VAL D CB    1 
ATOM 8345  C CG1   . VAL D 4 328 ? 163.030 122.714 123.549 1.00 54.72  ? 328 VAL D CG1   1 
ATOM 8346  C CG2   . VAL D 4 328 ? 161.782 124.711 124.277 1.00 54.72  ? 328 VAL D CG2   1 
ATOM 8347  N N     . TRP D 4 329 ? 160.502 120.372 124.867 1.00 59.63  ? 329 TRP D N     1 
ATOM 8348  C CA    . TRP D 4 329 ? 160.541 118.910 124.900 1.00 59.63  ? 329 TRP D CA    1 
ATOM 8349  C C     . TRP D 4 329 ? 159.237 118.357 125.449 1.00 59.63  ? 329 TRP D C     1 
ATOM 8350  O O     . TRP D 4 329 ? 159.111 118.140 126.664 1.00 59.63  ? 329 TRP D O     1 
ATOM 8351  C CB    . TRP D 4 329 ? 161.706 118.394 125.736 1.00 59.63  ? 329 TRP D CB    1 
ATOM 8352  C CG    . TRP D 4 329 ? 163.034 118.632 125.145 1.00 59.63  ? 329 TRP D CG    1 
ATOM 8353  C CD1   . TRP D 4 329 ? 163.621 117.913 124.154 1.00 59.63  ? 329 TRP D CD1   1 
ATOM 8354  C CD2   . TRP D 4 329 ? 163.988 119.614 125.548 1.00 59.63  ? 329 TRP D CD2   1 
ATOM 8355  N NE1   . TRP D 4 329 ? 164.869 118.409 123.885 1.00 59.63  ? 329 TRP D NE1   1 
ATOM 8356  C CE2   . TRP D 4 329 ? 165.119 119.454 124.731 1.00 59.63  ? 329 TRP D CE2   1 
ATOM 8357  C CE3   . TRP D 4 329 ? 163.991 120.622 126.510 1.00 59.63  ? 329 TRP D CE3   1 
ATOM 8358  C CZ2   . TRP D 4 329 ? 166.236 120.263 124.845 1.00 59.63  ? 329 TRP D CZ2   1 
ATOM 8359  C CZ3   . TRP D 4 329 ? 165.101 121.423 126.619 1.00 59.63  ? 329 TRP D CZ3   1 
ATOM 8360  C CH2   . TRP D 4 329 ? 166.208 121.239 125.794 1.00 59.63  ? 329 TRP D CH2   1 
ATOM 8361  N N     . PRO D 4 330 ? 158.244 118.110 124.607 1.00 61.50  ? 330 PRO D N     1 
ATOM 8362  C CA    . PRO D 4 330 ? 157.045 117.416 125.086 1.00 61.50  ? 330 PRO D CA    1 
ATOM 8363  C C     . PRO D 4 330 ? 157.375 115.966 125.405 1.00 61.50  ? 330 PRO D C     1 
ATOM 8364  O O     . PRO D 4 330 ? 157.937 115.255 124.571 1.00 61.50  ? 330 PRO D O     1 
ATOM 8365  C CB    . PRO D 4 330 ? 156.080 117.524 123.904 1.00 61.50  ? 330 PRO D CB    1 
ATOM 8366  C CG    . PRO D 4 330 ? 156.972 117.687 122.718 1.00 61.50  ? 330 PRO D CG    1 
ATOM 8367  C CD    . PRO D 4 330 ? 158.151 118.473 123.188 1.00 61.50  ? 330 PRO D CD    1 
ATOM 8368  N N     . ASP D 4 331 ? 157.064 115.534 126.626 1.00 63.03  ? 331 ASP D N     1 
ATOM 8369  C CA    . ASP D 4 331 ? 157.430 114.190 127.045 1.00 63.03  ? 331 ASP D CA    1 
ATOM 8370  C C     . ASP D 4 331 ? 156.260 113.513 127.741 1.00 63.03  ? 331 ASP D C     1 
ATOM 8371  O O     . ASP D 4 331 ? 155.237 114.132 128.038 1.00 63.03  ? 331 ASP D O     1 
ATOM 8372  C CB    . ASP D 4 331 ? 158.652 114.190 127.960 1.00 63.03  ? 331 ASP D CB    1 
ATOM 8373  C CG    . ASP D 4 331 ? 159.362 112.858 127.961 1.00 63.03  ? 331 ASP D CG    1 
ATOM 8374  O OD1   . ASP D 4 331 ? 159.836 112.450 126.881 1.00 63.03  ? 331 ASP D OD1   1 
ATOM 8375  O OD2   . ASP D 4 331 ? 159.421 112.205 129.022 1.00 63.03  ? 331 ASP D OD2   1 
ATOM 8376  N N     . ASP D 4 332 ? 156.444 112.221 128.027 1.00 63.50  ? 332 ASP D N     1 
ATOM 8377  C CA    . ASP D 4 332 ? 155.502 111.402 128.782 1.00 63.50  ? 332 ASP D CA    1 
ATOM 8378  C C     . ASP D 4 332 ? 155.747 111.468 130.282 1.00 63.50  ? 332 ASP D C     1 
ATOM 8379  O O     . ASP D 4 332 ? 155.409 110.526 131.008 1.00 63.50  ? 332 ASP D O     1 
ATOM 8380  C CB    . ASP D 4 332 ? 155.562 109.956 128.292 1.00 63.50  ? 332 ASP D CB    1 
ATOM 8381  C CG    . ASP D 4 332 ? 156.900 109.292 128.573 1.00 63.50  ? 332 ASP D CG    1 
ATOM 8382  O OD1   . ASP D 4 332 ? 157.781 109.922 129.193 1.00 63.50  ? 332 ASP D OD1   1 
ATOM 8383  O OD2   . ASP D 4 332 ? 157.078 108.128 128.162 1.00 63.50  ? 332 ASP D OD2   1 
ATOM 8384  N N     . ALA D 4 333 ? 156.337 112.557 130.760 1.00 55.15  ? 333 ALA D N     1 
ATOM 8385  C CA    . ALA D 4 333 ? 156.689 112.669 132.165 1.00 55.15  ? 333 ALA D CA    1 
ATOM 8386  C C     . ALA D 4 333 ? 155.447 112.747 133.035 1.00 55.15  ? 333 ALA D C     1 
ATOM 8387  O O     . ALA D 4 333 ? 154.559 113.566 132.797 1.00 55.15  ? 333 ALA D O     1 
ATOM 8388  C CB    . ALA D 4 333 ? 157.552 113.907 132.386 1.00 55.15  ? 333 ALA D CB    1 
ATOM 8389  N N     . ILE D 4 334 ? 155.389 111.894 134.047 1.00 50.78  ? 334 ILE D N     1 
ATOM 8390  C CA    . ILE D 4 334 ? 154.295 111.910 135.003 1.00 50.78  ? 334 ILE D CA    1 
ATOM 8391  C C     . ILE D 4 334 ? 154.646 112.931 136.066 1.00 50.78  ? 334 ILE D C     1 
ATOM 8392  O O     . ILE D 4 334 ? 155.733 112.883 136.646 1.00 50.78  ? 334 ILE D O     1 
ATOM 8393  C CB    . ILE D 4 334 ? 154.089 110.527 135.628 1.00 50.78  ? 334 ILE D CB    1 
ATOM 8394  C CG1   . ILE D 4 334 ? 153.892 109.484 134.543 1.00 50.78  ? 334 ILE D CG1   1 
ATOM 8395  C CG2   . ILE D 4 334 ? 152.924 110.548 136.576 1.00 50.78  ? 334 ILE D CG2   1 
ATOM 8396  C CD1   . ILE D 4 334 ? 153.869 108.086 135.081 1.00 50.78  ? 334 ILE D CD1   1 
ATOM 8397  N N     . ARG D 4 335 ? 153.740 113.863 136.314 1.00 51.05  ? 335 ARG D N     1 
ATOM 8398  C CA    . ARG D 4 335 ? 154.033 114.984 137.183 1.00 51.05  ? 335 ARG D CA    1 
ATOM 8399  C C     . ARG D 4 335 ? 152.914 115.201 138.182 1.00 51.05  ? 335 ARG D C     1 
ATOM 8400  O O     . ARG D 4 335 ? 151.854 114.580 138.117 1.00 51.05  ? 335 ARG D O     1 
ATOM 8401  C CB    . ARG D 4 335 ? 154.257 116.261 136.389 1.00 51.05  ? 335 ARG D CB    1 
ATOM 8402  C CG    . ARG D 4 335 ? 155.536 116.256 135.621 1.00 51.05  ? 335 ARG D CG    1 
ATOM 8403  C CD    . ARG D 4 335 ? 155.690 117.590 134.984 1.00 51.05  ? 335 ARG D CD    1 
ATOM 8404  N NE    . ARG D 4 335 ? 154.637 117.764 134.009 1.00 51.05  ? 335 ARG D NE    1 
ATOM 8405  C CZ    . ARG D 4 335 ? 154.771 117.538 132.716 1.00 51.05  ? 335 ARG D CZ    1 
ATOM 8406  N NH1   . ARG D 4 335 ? 155.936 117.141 132.226 1.00 51.05  ? 335 ARG D NH1   1 
ATOM 8407  N NH2   . ARG D 4 335 ? 153.728 117.718 131.925 1.00 51.05  ? 335 ARG D NH2   1 
ATOM 8408  N N     . GLY D 4 336 ? 153.192 116.084 139.130 1.00 46.85  ? 336 GLY D N     1 
ATOM 8409  C CA    . GLY D 4 336 ? 152.267 116.430 140.183 1.00 46.85  ? 336 GLY D CA    1 
ATOM 8410  C C     . GLY D 4 336 ? 152.962 117.290 141.207 1.00 46.85  ? 336 GLY D C     1 
ATOM 8411  O O     . GLY D 4 336 ? 154.166 117.159 141.420 1.00 46.85  ? 336 GLY D O     1 
ATOM 8412  N N     . TYR D 4 337 ? 152.219 118.193 141.832 1.00 47.05  ? 337 TYR D N     1 
ATOM 8413  C CA    . TYR D 4 337 ? 152.817 119.144 142.746 1.00 47.05  ? 337 TYR D CA    1 
ATOM 8414  C C     . TYR D 4 337 ? 151.830 119.439 143.850 1.00 47.05  ? 337 TYR D C     1 
ATOM 8415  O O     . TYR D 4 337 ? 150.620 119.362 143.649 1.00 47.05  ? 337 TYR D O     1 
ATOM 8416  C CB    . TYR D 4 337 ? 153.175 120.438 142.039 1.00 47.05  ? 337 TYR D CB    1 
ATOM 8417  C CG    . TYR D 4 337 ? 151.968 121.202 141.591 1.00 47.05  ? 337 TYR D CG    1 
ATOM 8418  C CD1   . TYR D 4 337 ? 151.195 120.757 140.539 1.00 47.05  ? 337 TYR D CD1   1 
ATOM 8419  C CD2   . TYR D 4 337 ? 151.606 122.374 142.211 1.00 47.05  ? 337 TYR D CD2   1 
ATOM 8420  C CE1   . TYR D 4 337 ? 150.091 121.460 140.124 1.00 47.05  ? 337 TYR D CE1   1 
ATOM 8421  C CE2   . TYR D 4 337 ? 150.515 123.086 141.797 1.00 47.05  ? 337 TYR D CE2   1 
ATOM 8422  C CZ    . TYR D 4 337 ? 149.755 122.621 140.758 1.00 47.05  ? 337 TYR D CZ    1 
ATOM 8423  O OH    . TYR D 4 337 ? 148.655 123.328 140.351 1.00 47.05  ? 337 TYR D OH    1 
ATOM 8424  N N     . ALA D 4 338 ? 152.351 119.773 145.018 1.00 44.15  ? 338 ALA D N     1 
ATOM 8425  C CA    . ALA D 4 338 ? 151.513 120.160 146.138 1.00 44.15  ? 338 ALA D CA    1 
ATOM 8426  C C     . ALA D 4 338 ? 152.024 121.446 146.756 1.00 44.15  ? 338 ALA D C     1 
ATOM 8427  O O     . ALA D 4 338 ? 153.235 121.639 146.892 1.00 44.15  ? 338 ALA D O     1 
ATOM 8428  C CB    . ALA D 4 338 ? 151.472 119.070 147.186 1.00 44.15  ? 338 ALA D CB    1 
ATOM 8429  N N     . THR D 4 339 ? 151.106 122.334 147.107 1.00 46.59  ? 339 THR D N     1 
ATOM 8430  C CA    . THR D 4 339 ? 151.454 123.640 147.633 1.00 46.59  ? 339 THR D CA    1 
ATOM 8431  C C     . THR D 4 339 ? 150.659 123.885 148.906 1.00 46.59  ? 339 THR D C     1 
ATOM 8432  O O     . THR D 4 339 ? 149.693 123.184 149.203 1.00 46.59  ? 339 THR D O     1 
ATOM 8433  C CB    . THR D 4 339 ? 151.198 124.759 146.628 1.00 46.59  ? 339 THR D CB    1 
ATOM 8434  O OG1   . THR D 4 339 ? 149.790 124.897 146.426 1.00 46.59  ? 339 THR D OG1   1 
ATOM 8435  C CG2   . THR D 4 339 ? 151.870 124.456 145.313 1.00 46.59  ? 339 THR D CG2   1 
ATOM 8436  N N     . VAL D 4 340 ? 151.064 124.901 149.662 1.00 48.59  ? 340 VAL D N     1 
ATOM 8437  C CA    . VAL D 4 340 ? 150.287 125.352 150.803 1.00 48.59  ? 340 VAL D CA    1 
ATOM 8438  C C     . VAL D 4 340 ? 149.404 126.533 150.448 1.00 48.59  ? 340 VAL D C     1 
ATOM 8439  O O     . VAL D 4 340 ? 148.924 127.227 151.340 1.00 48.59  ? 340 VAL D O     1 
ATOM 8440  C CB    . VAL D 4 340 ? 151.179 125.704 151.995 1.00 48.59  ? 340 VAL D CB    1 
ATOM 8441  C CG1   . VAL D 4 340 ? 151.904 124.486 152.479 1.00 48.59  ? 340 VAL D CG1   1 
ATOM 8442  C CG2   . VAL D 4 340 ? 152.136 126.793 151.609 1.00 48.59  ? 340 VAL D CG2   1 
ATOM 8443  N N     . GLU D 4 341 ? 149.235 126.819 149.170 1.00 55.40  ? 341 GLU D N     1 
ATOM 8444  C CA    . GLU D 4 341 ? 148.306 127.842 148.732 1.00 55.40  ? 341 GLU D CA    1 
ATOM 8445  C C     . GLU D 4 341 ? 147.381 127.264 147.680 1.00 55.40  ? 341 GLU D C     1 
ATOM 8446  O O     . GLU D 4 341 ? 147.794 126.463 146.838 1.00 55.40  ? 341 GLU D O     1 
ATOM 8447  C CB    . GLU D 4 341 ? 149.040 129.068 148.201 1.00 55.40  ? 341 GLU D CB    1 
ATOM 8448  C CG    . GLU D 4 341 ? 149.764 128.853 146.901 1.00 55.40  ? 341 GLU D CG    1 
ATOM 8449  C CD    . GLU D 4 341 ? 151.096 128.158 147.102 1.00 55.40  ? 341 GLU D CD    1 
ATOM 8450  O OE1   . GLU D 4 341 ? 151.309 127.580 148.190 1.00 55.40  ? 341 GLU D OE1   1 
ATOM 8451  O OE2   . GLU D 4 341 ? 151.935 128.190 146.177 1.00 55.40  ? 341 GLU D OE2   1 
ATOM 8452  N N     . ASN D 4 342 ? 146.122 127.669 147.752 1.00 63.61  ? 342 ASN D N     1 
ATOM 8453  C CA    . ASN D 4 342 ? 145.090 127.189 146.858 1.00 63.61  ? 342 ASN D CA    1 
ATOM 8454  C C     . ASN D 4 342 ? 144.638 128.289 145.923 1.00 63.61  ? 342 ASN D C     1 
ATOM 8455  O O     . ASN D 4 342 ? 143.761 128.069 145.084 1.00 63.61  ? 342 ASN D O     1 
ATOM 8456  C CB    . ASN D 4 342 ? 143.901 126.695 147.677 1.00 63.61  ? 342 ASN D CB    1 
ATOM 8457  C CG    . ASN D 4 342 ? 144.310 125.717 148.734 1.00 63.61  ? 342 ASN D CG    1 
ATOM 8458  O OD1   . ASN D 4 342 ? 145.122 124.831 148.486 1.00 63.61  ? 342 ASN D OD1   1 
ATOM 8459  N ND2   . ASN D 4 342 ? 143.754 125.867 149.926 1.00 63.61  ? 342 ASN D ND2   1 
ATOM 8460  N N     . LYS D 4 343 ? 145.232 129.467 146.059 1.00 66.31  ? 343 LYS D N     1 
ATOM 8461  C CA    . LYS D 4 343 ? 144.803 130.669 145.371 1.00 66.31  ? 343 LYS D CA    1 
ATOM 8462  C C     . LYS D 4 343 ? 145.233 130.700 143.916 1.00 66.31  ? 343 LYS D C     1 
ATOM 8463  O O     . LYS D 4 343 ? 144.537 131.292 143.085 1.00 66.31  ? 343 LYS D O     1 
ATOM 8464  C CB    . LYS D 4 343 ? 145.341 131.888 146.109 1.00 66.31  ? 343 LYS D CB    1 
ATOM 8465  C CG    . LYS D 4 343 ? 144.481 132.283 147.290 1.00 66.31  ? 343 LYS D CG    1 
ATOM 8466  C CD    . LYS D 4 343 ? 144.746 131.386 148.483 1.00 66.31  ? 343 LYS D CD    1 
ATOM 8467  C CE    . LYS D 4 343 ? 146.178 131.515 148.953 1.00 66.31  ? 343 LYS D CE    1 
ATOM 8468  N NZ    . LYS D 4 343 ? 146.475 130.588 150.077 1.00 66.31  ? 343 LYS D NZ    1 
ATOM 8469  N N     . THR D 4 344 ? 146.344 130.059 143.579 1.00 67.91  ? 344 THR D N     1 
ATOM 8470  C CA    . THR D 4 344 ? 146.895 130.146 142.238 1.00 67.91  ? 344 THR D CA    1 
ATOM 8471  C C     . THR D 4 344 ? 147.096 128.765 141.635 1.00 67.91  ? 344 THR D C     1 
ATOM 8472  O O     . THR D 4 344 ? 147.599 127.849 142.290 1.00 67.91  ? 344 THR D O     1 
ATOM 8473  C CB    . THR D 4 344 ? 148.215 130.912 142.260 1.00 67.91  ? 344 THR D CB    1 
ATOM 8474  O OG1   . THR D 4 344 ? 148.955 130.557 143.436 1.00 67.91  ? 344 THR D OG1   1 
ATOM 8475  C CG2   . THR D 4 344 ? 147.954 132.416 142.262 1.00 67.91  ? 344 THR D CG2   1 
ATOM 8476  N N     . ASP D 4 345 ? 146.708 128.640 140.371 1.00 64.38  ? 345 ASP D N     1 
ATOM 8477  C CA    . ASP D 4 345 ? 146.887 127.416 139.610 1.00 64.38  ? 345 ASP D CA    1 
ATOM 8478  C C     . ASP D 4 345 ? 148.225 127.432 138.888 1.00 64.38  ? 345 ASP D C     1 
ATOM 8479  O O     . ASP D 4 345 ? 148.679 128.476 138.410 1.00 64.38  ? 345 ASP D O     1 
ATOM 8480  C CB    . ASP D 4 345 ? 145.755 127.237 138.601 1.00 64.38  ? 345 ASP D CB    1 
ATOM 8481  C CG    . ASP D 4 345 ? 145.556 125.788 138.207 1.00 64.38  ? 345 ASP D CG    1 
ATOM 8482  O OD1   . ASP D 4 345 ? 146.396 124.955 138.600 1.00 64.38  ? 345 ASP D OD1   1 
ATOM 8483  O OD2   . ASP D 4 345 ? 144.578 125.481 137.492 1.00 64.38  ? 345 ASP D OD2   1 
ATOM 8484  N N     . LEU D 4 346 ? 148.850 126.254 138.810 1.00 55.28  ? 346 LEU D N     1 
ATOM 8485  C CA    . LEU D 4 346 ? 150.131 126.061 138.137 1.00 55.28  ? 346 LEU D CA    1 
ATOM 8486  C C     . LEU D 4 346 ? 149.987 124.881 137.178 1.00 55.28  ? 346 LEU D C     1 
ATOM 8487  O O     . LEU D 4 346 ? 150.456 123.776 137.442 1.00 55.28  ? 346 LEU D O     1 
ATOM 8488  C CB    . LEU D 4 346 ? 151.233 125.817 139.155 1.00 55.28  ? 346 LEU D CB    1 
ATOM 8489  C CG    . LEU D 4 346 ? 151.266 126.833 140.287 1.00 55.28  ? 346 LEU D CG    1 
ATOM 8490  C CD1   . LEU D 4 346 ? 152.284 126.421 141.312 1.00 55.28  ? 346 LEU D CD1   1 
ATOM 8491  C CD2   . LEU D 4 346 ? 151.584 128.202 139.735 1.00 55.28  ? 346 LEU D CD2   1 
ATOM 8492  N N     . ALA D 4 347 ? 149.303 125.124 136.065 1.00 53.42  ? 347 ALA D N     1 
ATOM 8493  C CA    . ALA D 4 347 ? 148.933 124.034 135.173 1.00 53.42  ? 347 ALA D CA    1 
ATOM 8494  C C     . ALA D 4 347 ? 150.132 123.279 134.616 1.00 53.42  ? 347 ALA D C     1 
ATOM 8495  O O     . ALA D 4 347 ? 150.026 122.083 134.332 1.00 53.42  ? 347 ALA D O     1 
ATOM 8496  C CB    . ALA D 4 347 ? 148.086 124.577 134.026 1.00 53.42  ? 347 ALA D CB    1 
ATOM 8497  N N     . ALA D 4 348 ? 151.275 123.940 134.461 1.00 49.68  ? 348 ALA D N     1 
ATOM 8498  C CA    . ALA D 4 348 ? 152.414 123.281 133.827 1.00 49.68  ? 348 ALA D CA    1 
ATOM 8499  C C     . ALA D 4 348 ? 153.033 122.183 134.679 1.00 49.68  ? 348 ALA D C     1 
ATOM 8500  O O     . ALA D 4 348 ? 153.736 121.325 134.143 1.00 49.68  ? 348 ALA D O     1 
ATOM 8501  C CB    . ALA D 4 348 ? 153.477 124.309 133.454 1.00 49.68  ? 348 ALA D CB    1 
ATOM 8502  N N     . LEU D 4 349 ? 152.799 122.192 135.981 1.00 48.90  ? 349 LEU D N     1 
ATOM 8503  C CA    . LEU D 4 349 ? 153.440 121.257 136.894 1.00 48.90  ? 349 LEU D CA    1 
ATOM 8504  C C     . LEU D 4 349 ? 152.703 119.936 137.047 1.00 48.90  ? 349 LEU D C     1 
ATOM 8505  O O     . LEU D 4 349 ? 153.197 119.051 137.748 1.00 48.90  ? 349 LEU D O     1 
ATOM 8506  C CB    . LEU D 4 349 ? 153.601 121.910 138.262 1.00 48.90  ? 349 LEU D CB    1 
ATOM 8507  C CG    . LEU D 4 349 ? 154.533 123.110 138.211 1.00 48.90  ? 349 LEU D CG    1 
ATOM 8508  C CD1   . LEU D 4 349 ? 154.525 123.850 139.521 1.00 48.90  ? 349 LEU D CD1   1 
ATOM 8509  C CD2   . LEU D 4 349 ? 155.905 122.594 137.908 1.00 48.90  ? 349 LEU D CD2   1 
ATOM 8510  N N     . GLY D 4 350 ? 151.550 119.775 136.427 1.00 51.68  ? 350 GLY D N     1 
ATOM 8511  C CA    . GLY D 4 350 ? 150.826 118.535 136.519 1.00 51.68  ? 350 GLY D CA    1 
ATOM 8512  C C     . GLY D 4 350 ? 149.526 118.693 137.277 1.00 51.68  ? 350 GLY D C     1 
ATOM 8513  O O     . GLY D 4 350 ? 148.997 119.790 137.457 1.00 51.68  ? 350 GLY D O     1 
ATOM 8514  N N     . GLU D 4 351 ? 149.010 117.564 137.734 1.00 52.94  ? 351 GLU D N     1 
ATOM 8515  C CA    . GLU D 4 351 ? 147.779 117.548 138.504 1.00 52.94  ? 351 GLU D CA    1 
ATOM 8516  C C     . GLU D 4 351 ? 148.048 117.916 139.953 1.00 52.94  ? 351 GLU D C     1 
ATOM 8517  O O     . GLU D 4 351 ? 149.082 117.560 140.518 1.00 52.94  ? 351 GLU D O     1 
ATOM 8518  C CB    . GLU D 4 351 ? 147.120 116.175 138.411 1.00 52.94  ? 351 GLU D CB    1 
ATOM 8519  C CG    . GLU D 4 351 ? 147.986 115.028 138.878 1.00 52.94  ? 351 GLU D CG    1 
ATOM 8520  C CD    . GLU D 4 351 ? 147.301 113.690 138.707 1.00 52.94  ? 351 GLU D CD    1 
ATOM 8521  O OE1   . GLU D 4 351 ? 146.322 113.616 137.937 1.00 52.94  ? 351 GLU D OE1   1 
ATOM 8522  O OE2   . GLU D 4 351 ? 147.740 112.707 139.331 1.00 52.94  ? 351 GLU D OE2   1 
ATOM 8523  N N     . ARG D 4 352 ? 147.101 118.619 140.560 1.00 49.92  ? 352 ARG D N     1 
ATOM 8524  C CA    . ARG D 4 352 ? 147.269 119.057 141.932 1.00 49.92  ? 352 ARG D CA    1 
ATOM 8525  C C     . ARG D 4 352 ? 146.897 117.939 142.881 1.00 49.92  ? 352 ARG D C     1 
ATOM 8526  O O     . ARG D 4 352 ? 146.019 117.129 142.593 1.00 49.92  ? 352 ARG D O     1 
ATOM 8527  C CB    . ARG D 4 352 ? 146.320 120.216 142.229 1.00 49.92  ? 352 ARG D CB    1 
ATOM 8528  C CG    . ARG D 4 352 ? 146.502 120.903 143.570 1.00 49.92  ? 352 ARG D CG    1 
ATOM 8529  C CD    . ARG D 4 352 ? 147.854 121.497 143.740 1.00 49.92  ? 352 ARG D CD    1 
ATOM 8530  N NE    . ARG D 4 352 ? 147.877 122.801 143.095 1.00 49.92  ? 352 ARG D NE    1 
ATOM 8531  C CZ    . ARG D 4 352 ? 147.258 123.873 143.571 1.00 49.92  ? 352 ARG D CZ    1 
ATOM 8532  N NH1   . ARG D 4 352 ? 146.565 123.797 144.694 1.00 49.92  ? 352 ARG D NH1   1 
ATOM 8533  N NH2   . ARG D 4 352 ? 147.323 125.024 142.918 1.00 49.92  ? 352 ARG D NH2   1 
ATOM 8534  N N     . TYR D 4 353 ? 147.545 117.930 144.044 1.00 48.58  ? 353 TYR D N     1 
ATOM 8535  C CA    . TYR D 4 353 ? 147.280 116.949 145.093 1.00 48.58  ? 353 TYR D CA    1 
ATOM 8536  C C     . TYR D 4 353 ? 146.996 117.708 146.391 1.00 48.58  ? 353 TYR D C     1 
ATOM 8537  O O     . TYR D 4 353 ? 147.560 118.778 146.616 1.00 48.58  ? 353 TYR D O     1 
ATOM 8538  C CB    . TYR D 4 353 ? 148.475 116.014 145.274 1.00 48.58  ? 353 TYR D CB    1 
ATOM 8539  C CG    . TYR D 4 353 ? 148.614 114.980 144.179 1.00 48.58  ? 353 TYR D CG    1 
ATOM 8540  C CD1   . TYR D 4 353 ? 147.572 114.731 143.296 1.00 48.58  ? 353 TYR D CD1   1 
ATOM 8541  C CD2   . TYR D 4 353 ? 149.787 114.253 144.028 1.00 48.58  ? 353 TYR D CD2   1 
ATOM 8542  C CE1   . TYR D 4 353 ? 147.694 113.787 142.294 1.00 48.58  ? 353 TYR D CE1   1 
ATOM 8543  C CE2   . TYR D 4 353 ? 149.919 113.307 143.029 1.00 48.58  ? 353 TYR D CE2   1 
ATOM 8544  C CZ    . TYR D 4 353 ? 148.870 113.079 142.165 1.00 48.58  ? 353 TYR D CZ    1 
ATOM 8545  O OH    . TYR D 4 353 ? 148.997 112.138 141.169 1.00 48.58  ? 353 TYR D OH    1 
ATOM 8546  N N     . ASP D 4 354 ? 146.125 117.169 147.243 1.00 51.55  ? 354 ASP D N     1 
ATOM 8547  C CA    . ASP D 4 354 ? 145.798 117.846 148.487 1.00 51.55  ? 354 ASP D CA    1 
ATOM 8548  C C     . ASP D 4 354 ? 146.973 117.901 149.449 1.00 51.55  ? 354 ASP D C     1 
ATOM 8549  O O     . ASP D 4 354 ? 147.043 118.821 150.267 1.00 51.55  ? 354 ASP D O     1 
ATOM 8550  C CB    . ASP D 4 354 ? 144.618 117.160 149.157 1.00 51.55  ? 354 ASP D CB    1 
ATOM 8551  C CG    . ASP D 4 354 ? 144.947 115.757 149.584 1.00 51.55  ? 354 ASP D CG    1 
ATOM 8552  O OD1   . ASP D 4 354 ? 145.892 115.175 149.007 1.00 51.55  ? 354 ASP D OD1   1 
ATOM 8553  O OD2   . ASP D 4 354 ? 144.279 115.251 150.508 1.00 51.55  ? 354 ASP D OD2   1 
ATOM 8554  N N     . SER D 4 355 ? 147.915 116.965 149.367 1.00 48.70  ? 355 SER D N     1 
ATOM 8555  C CA    . SER D 4 355 ? 148.924 116.891 150.413 1.00 48.70  ? 355 SER D CA    1 
ATOM 8556  C C     . SER D 4 355 ? 150.218 116.279 149.897 1.00 48.70  ? 355 SER D C     1 
ATOM 8557  O O     . SER D 4 355 ? 150.255 115.638 148.848 1.00 48.70  ? 355 SER D O     1 
ATOM 8558  C CB    . SER D 4 355 ? 148.398 116.087 151.595 1.00 48.70  ? 355 SER D CB    1 
ATOM 8559  O OG    . SER D 4 355 ? 148.177 114.749 151.197 1.00 48.70  ? 355 SER D OG    1 
ATOM 8560  N N     . TYR D 4 356 ? 151.279 116.444 150.696 1.00 43.89  ? 356 TYR D N     1 
ATOM 8561  C CA    . TYR D 4 356 ? 152.583 115.889 150.332 1.00 43.89  ? 356 TYR D CA    1 
ATOM 8562  C C     . TYR D 4 356 ? 152.630 114.369 150.343 1.00 43.89  ? 356 TYR D C     1 
ATOM 8563  O O     . TYR D 4 356 ? 153.070 113.783 149.339 1.00 43.89  ? 356 TYR D O     1 
ATOM 8564  C CB    . TYR D 4 356 ? 153.666 116.466 151.240 1.00 43.89  ? 356 TYR D CB    1 
ATOM 8565  C CG    . TYR D 4 356 ? 153.878 117.939 151.078 1.00 43.89  ? 356 TYR D CG    1 
ATOM 8566  C CD1   . TYR D 4 356 ? 153.436 118.602 149.961 1.00 43.89  ? 356 TYR D CD1   1 
ATOM 8567  C CD2   . TYR D 4 356 ? 154.506 118.669 152.059 1.00 43.89  ? 356 TYR D CD2   1 
ATOM 8568  C CE1   . TYR D 4 356 ? 153.625 119.945 149.826 1.00 43.89  ? 356 TYR D CE1   1 
ATOM 8569  C CE2   . TYR D 4 356 ? 154.692 120.006 151.929 1.00 43.89  ? 356 TYR D CE2   1 
ATOM 8570  C CZ    . TYR D 4 356 ? 154.251 120.639 150.814 1.00 43.89  ? 356 TYR D CZ    1 
ATOM 8571  O OH    . TYR D 4 356 ? 154.443 121.986 150.688 1.00 43.89  ? 356 TYR D OH    1 
ATOM 8572  N N     . PRO D 4 357 ? 152.210 113.668 151.400 1.00 47.99  ? 357 PRO D N     1 
ATOM 8573  C CA    . PRO D 4 357 ? 152.326 112.206 151.360 1.00 47.99  ? 357 PRO D CA    1 
ATOM 8574  C C     . PRO D 4 357 ? 151.445 111.584 150.303 1.00 47.99  ? 357 PRO D C     1 
ATOM 8575  O O     . PRO D 4 357 ? 151.807 110.542 149.747 1.00 47.99  ? 357 PRO D O     1 
ATOM 8576  C CB    . PRO D 4 357 ? 151.914 111.781 152.771 1.00 47.99  ? 357 PRO D CB    1 
ATOM 8577  C CG    . PRO D 4 357 ? 151.070 112.867 153.243 1.00 47.99  ? 357 PRO D CG    1 
ATOM 8578  C CD    . PRO D 4 357 ? 151.656 114.116 152.684 1.00 47.99  ? 357 PRO D CD    1 
ATOM 8579  N N     . ALA D 4 358 ? 150.308 112.199 149.998 1.00 46.44  ? 358 ALA D N     1 
ATOM 8580  C CA    . ALA D 4 358 ? 149.492 111.709 148.899 1.00 46.44  ? 358 ALA D CA    1 
ATOM 8581  C C     . ALA D 4 358 ? 150.265 111.789 147.596 1.00 46.44  ? 358 ALA D C     1 
ATOM 8582  O O     . ALA D 4 358 ? 150.270 110.842 146.802 1.00 46.44  ? 358 ALA D O     1 
ATOM 8583  C CB    . ALA D 4 358 ? 148.199 112.510 148.804 1.00 46.44  ? 358 ALA D CB    1 
ATOM 8584  N N     . LEU D 4 359 ? 150.941 112.911 147.372 1.00 45.74  ? 359 LEU D N     1 
ATOM 8585  C CA    . LEU D 4 359 ? 151.737 113.080 146.165 1.00 45.74  ? 359 LEU D CA    1 
ATOM 8586  C C     . LEU D 4 359 ? 152.829 112.036 146.075 1.00 45.74  ? 359 LEU D C     1 
ATOM 8587  O O     . LEU D 4 359 ? 152.986 111.371 145.047 1.00 45.74  ? 359 LEU D O     1 
ATOM 8588  C CB    . LEU D 4 359 ? 152.354 114.471 146.160 1.00 45.74  ? 359 LEU D CB    1 
ATOM 8589  C CG    . LEU D 4 359 ? 152.956 115.016 144.880 1.00 45.74  ? 359 LEU D CG    1 
ATOM 8590  C CD1   . LEU D 4 359 ? 153.065 116.502 145.029 1.00 45.74  ? 359 LEU D CD1   1 
ATOM 8591  C CD2   . LEU D 4 359 ? 154.308 114.429 144.624 1.00 45.74  ? 359 LEU D CD2   1 
ATOM 8592  N N     . ILE D 4 360 ? 153.612 111.900 147.138 1.00 49.94  ? 360 ILE D N     1 
ATOM 8593  C CA    . ILE D 4 360 ? 154.687 110.919 147.151 1.00 49.94  ? 360 ILE D CA    1 
ATOM 8594  C C     . ILE D 4 360 ? 154.156 109.520 146.879 1.00 49.94  ? 360 ILE D C     1 
ATOM 8595  O O     . ILE D 4 360 ? 154.773 108.737 146.149 1.00 49.94  ? 360 ILE D O     1 
ATOM 8596  C CB    . ILE D 4 360 ? 155.429 110.999 148.489 1.00 49.94  ? 360 ILE D CB    1 
ATOM 8597  C CG1   . ILE D 4 360 ? 156.112 112.353 148.588 1.00 49.94  ? 360 ILE D CG1   1 
ATOM 8598  C CG2   . ILE D 4 360 ? 156.437 109.894 148.584 1.00 49.94  ? 360 ILE D CG2   1 
ATOM 8599  C CD1   . ILE D 4 360 ? 156.809 112.571 149.875 1.00 49.94  ? 360 ILE D CD1   1 
ATOM 8600  N N     . ASP D 4 361 ? 153.004 109.185 147.451 1.00 53.13  ? 361 ASP D N     1 
ATOM 8601  C CA    . ASP D 4 361 ? 152.398 107.891 147.173 1.00 53.13  ? 361 ASP D CA    1 
ATOM 8602  C C     . ASP D 4 361 ? 152.072 107.742 145.695 1.00 53.13  ? 361 ASP D C     1 
ATOM 8603  O O     . ASP D 4 361 ? 152.392 106.722 145.075 1.00 53.13  ? 361 ASP D O     1 
ATOM 8604  C CB    . ASP D 4 361 ? 151.149 107.707 148.023 1.00 53.13  ? 361 ASP D CB    1 
ATOM 8605  C CG    . ASP D 4 361 ? 151.480 107.474 149.476 1.00 53.13  ? 361 ASP D CG    1 
ATOM 8606  O OD1   . ASP D 4 361 ? 152.584 106.964 149.752 1.00 53.13  ? 361 ASP D OD1   1 
ATOM 8607  O OD2   . ASP D 4 361 ? 150.648 107.810 150.342 1.00 53.13  ? 361 ASP D OD2   1 
ATOM 8608  N N     . ALA D 4 362 ? 151.420 108.747 145.112 1.00 51.73  ? 362 ALA D N     1 
ATOM 8609  C CA    . ALA D 4 362 ? 151.066 108.654 143.702 1.00 51.73  ? 362 ALA D CA    1 
ATOM 8610  C C     . ALA D 4 362 ? 152.292 108.538 142.809 1.00 51.73  ? 362 ALA D C     1 
ATOM 8611  O O     . ALA D 4 362 ? 152.243 107.859 141.780 1.00 51.73  ? 362 ALA D O     1 
ATOM 8612  C CB    . ALA D 4 362 ? 150.226 109.859 143.290 1.00 51.73  ? 362 ALA D CB    1 
ATOM 8613  N N     . MET D 4 363 ? 153.395 109.188 143.167 1.00 51.65  ? 363 MET D N     1 
ATOM 8614  C CA    . MET D 4 363 ? 154.555 109.121 142.285 1.00 51.65  ? 363 MET D CA    1 
ATOM 8615  C C     . MET D 4 363 ? 155.352 107.840 142.465 1.00 51.65  ? 363 MET D C     1 
ATOM 8616  O O     . MET D 4 363 ? 155.873 107.298 141.485 1.00 51.65  ? 363 MET D O     1 
ATOM 8617  C CB    . MET D 4 363 ? 155.450 110.325 142.512 1.00 51.65  ? 363 MET D CB    1 
ATOM 8618  C CG    . MET D 4 363 ? 154.790 111.614 142.147 1.00 51.65  ? 363 MET D CG    1 
ATOM 8619  S SD    . MET D 4 363 ? 154.012 111.530 140.545 1.00 51.65  ? 363 MET D SD    1 
ATOM 8620  C CE    . MET D 4 363 ? 153.021 113.004 140.635 1.00 51.65  ? 363 MET D CE    1 
ATOM 8621  N N     . VAL D 4 364 ? 155.456 107.325 143.691 1.00 56.83  ? 364 VAL D N     1 
ATOM 8622  C CA    . VAL D 4 364 ? 156.091 106.021 143.850 1.00 56.83  ? 364 VAL D CA    1 
ATOM 8623  C C     . VAL D 4 364 ? 155.264 104.954 143.148 1.00 56.83  ? 364 VAL D C     1 
ATOM 8624  O O     . VAL D 4 364 ? 155.808 104.032 142.532 1.00 56.83  ? 364 VAL D O     1 
ATOM 8625  C CB    . VAL D 4 364 ? 156.328 105.694 145.337 1.00 56.83  ? 364 VAL D CB    1 
ATOM 8626  C CG1   . VAL D 4 364 ? 155.029 105.524 146.084 1.00 56.83  ? 364 VAL D CG1   1 
ATOM 8627  C CG2   . VAL D 4 364 ? 157.151 104.427 145.464 1.00 56.83  ? 364 VAL D CG2   1 
ATOM 8628  N N     . ALA D 4 365 ? 153.938 105.067 143.223 1.00 56.55  ? 365 ALA D N     1 
ATOM 8629  C CA    . ALA D 4 365 ? 153.073 104.171 142.469 1.00 56.55  ? 365 ALA D CA    1 
ATOM 8630  C C     . ALA D 4 365 ? 153.307 104.336 140.975 1.00 56.55  ? 365 ALA D C     1 
ATOM 8631  O O     . ALA D 4 365 ? 153.359 103.353 140.227 1.00 56.55  ? 365 ALA D O     1 
ATOM 8632  C CB    . ALA D 4 365 ? 151.612 104.421 142.824 1.00 56.55  ? 365 ALA D CB    1 
ATOM 8633  N N     . ALA D 4 366 ? 153.490 105.579 140.534 1.00 56.51  ? 366 ALA D N     1 
ATOM 8634  C CA    . ALA D 4 366 ? 153.705 105.871 139.123 1.00 56.51  ? 366 ALA D CA    1 
ATOM 8635  C C     . ALA D 4 366 ? 155.005 105.268 138.626 1.00 56.51  ? 366 ALA D C     1 
ATOM 8636  O O     . ALA D 4 366 ? 155.121 104.943 137.442 1.00 56.51  ? 366 ALA D O     1 
ATOM 8637  C CB    . ALA D 4 366 ? 153.699 107.378 138.889 1.00 56.51  ? 366 ALA D CB    1 
ATOM 8638  N N     . ALA D 4 367 ? 155.990 105.118 139.504 1.00 59.95  ? 367 ALA D N     1 
ATOM 8639  C CA    . ALA D 4 367 ? 157.274 104.608 139.055 1.00 59.95  ? 367 ALA D CA    1 
ATOM 8640  C C     . ALA D 4 367 ? 157.183 103.131 138.710 1.00 59.95  ? 367 ALA D C     1 
ATOM 8641  O O     . ALA D 4 367 ? 157.894 102.661 137.817 1.00 59.95  ? 367 ALA D O     1 
ATOM 8642  C CB    . ALA D 4 367 ? 158.327 104.836 140.127 1.00 59.95  ? 367 ALA D CB    1 
ATOM 8643  N N     . PHE D 4 368 ? 156.331 102.385 139.402 1.00 63.52  ? 368 PHE D N     1 
ATOM 8644  C CA    . PHE D 4 368 ? 156.150 100.968 139.120 1.00 63.52  ? 368 PHE D CA    1 
ATOM 8645  C C     . PHE D 4 368 ? 154.702 100.661 138.744 1.00 63.52  ? 368 PHE D C     1 
ATOM 8646  O O     . PHE D 4 368 ? 154.327 100.727 137.573 1.00 63.52  ? 368 PHE D O     1 
ATOM 8647  C CB    . PHE D 4 368 ? 156.568 100.132 140.324 1.00 63.52  ? 368 PHE D CB    1 
ATOM 8648  C CG    . PHE D 4 368 ? 157.964 100.400 140.790 1.00 63.52  ? 368 PHE D CG    1 
ATOM 8649  C CD1   . PHE D 4 368 ? 159.038 99.862  140.112 1.00 63.52  ? 368 PHE D CD1   1 
ATOM 8650  C CD2   . PHE D 4 368 ? 158.206 101.210 141.884 1.00 63.52  ? 368 PHE D CD2   1 
ATOM 8651  C CE1   . PHE D 4 368 ? 160.326 100.102 140.534 1.00 63.52  ? 368 PHE D CE1   1 
ATOM 8652  C CE2   . PHE D 4 368 ? 159.491 101.458 142.305 1.00 63.52  ? 368 PHE D CE2   1 
ATOM 8653  C CZ    . PHE D 4 368 ? 160.553 100.904 141.631 1.00 63.52  ? 368 PHE D CZ    1 
ATOM 8654  N N     . THR E 4 2   ? 128.688 206.097 170.324 1.00 38.89  ? 2   THR E N     1 
ATOM 8655  C CA    . THR E 4 2   ? 129.493 206.276 169.130 1.00 38.89  ? 2   THR E CA    1 
ATOM 8656  C C     . THR E 4 2   ? 129.263 205.137 168.155 1.00 38.89  ? 2   THR E C     1 
ATOM 8657  O O     . THR E 4 2   ? 129.732 205.183 167.025 1.00 38.89  ? 2   THR E O     1 
ATOM 8658  C CB    . THR E 4 2   ? 130.983 206.368 169.467 1.00 38.89  ? 2   THR E CB    1 
ATOM 8659  O OG1   . THR E 4 2   ? 131.425 205.134 170.042 1.00 38.89  ? 2   THR E OG1   1 
ATOM 8660  C CG2   . THR E 4 2   ? 131.226 207.491 170.449 1.00 38.89  ? 2   THR E CG2   1 
ATOM 8661  N N     . PHE E 4 3   ? 128.554 204.103 168.584 1.00 32.14  ? 3   PHE E N     1 
ATOM 8662  C CA    . PHE E 4 3   ? 128.218 202.977 167.723 1.00 32.14  ? 3   PHE E CA    1 
ATOM 8663  C C     . PHE E 4 3   ? 126.710 202.944 167.569 1.00 32.14  ? 3   PHE E C     1 
ATOM 8664  O O     . PHE E 4 3   ? 126.008 202.474 168.465 1.00 32.14  ? 3   PHE E O     1 
ATOM 8665  C CB    . PHE E 4 3   ? 128.696 201.668 168.326 1.00 32.14  ? 3   PHE E CB    1 
ATOM 8666  C CG    . PHE E 4 3   ? 130.163 201.484 168.302 1.00 32.14  ? 3   PHE E CG    1 
ATOM 8667  C CD1   . PHE E 4 3   ? 130.795 201.061 167.161 1.00 32.14  ? 3   PHE E CD1   1 
ATOM 8668  C CD2   . PHE E 4 3   ? 130.918 201.763 169.417 1.00 32.14  ? 3   PHE E CD2   1 
ATOM 8669  C CE1   . PHE E 4 3   ? 132.148 200.888 167.139 1.00 32.14  ? 3   PHE E CE1   1 
ATOM 8670  C CE2   . PHE E 4 3   ? 132.272 201.601 169.401 1.00 32.14  ? 3   PHE E CE2   1 
ATOM 8671  C CZ    . PHE E 4 3   ? 132.891 201.164 168.261 1.00 32.14  ? 3   PHE E CZ    1 
ATOM 8672  N N     . VAL E 4 4   ? 126.198 203.445 166.456 1.00 27.49  ? 4   VAL E N     1 
ATOM 8673  C CA    . VAL E 4 4   ? 124.775 203.309 166.184 1.00 27.49  ? 4   VAL E CA    1 
ATOM 8674  C C     . VAL E 4 4   ? 124.561 201.944 165.563 1.00 27.49  ? 4   VAL E C     1 
ATOM 8675  O O     . VAL E 4 4   ? 125.035 201.691 164.458 1.00 27.49  ? 4   VAL E O     1 
ATOM 8676  C CB    . VAL E 4 4   ? 124.276 204.411 165.246 1.00 27.49  ? 4   VAL E CB    1 
ATOM 8677  C CG1   . VAL E 4 4   ? 122.814 204.224 164.991 1.00 27.49  ? 4   VAL E CG1   1 
ATOM 8678  C CG2   . VAL E 4 4   ? 124.548 205.767 165.833 1.00 27.49  ? 4   VAL E CG2   1 
ATOM 8679  N N     . ASP E 4 5   ? 123.805 201.083 166.212 1.00 29.01  ? 5   ASP E N     1 
ATOM 8680  C CA    . ASP E 4 5   ? 123.540 199.793 165.601 1.00 29.01  ? 5   ASP E CA    1 
ATOM 8681  C C     . ASP E 4 5   ? 122.044 199.632 165.438 1.00 29.01  ? 5   ASP E C     1 
ATOM 8682  O O     . ASP E 4 5   ? 121.282 199.979 166.332 1.00 29.01  ? 5   ASP E O     1 
ATOM 8683  C CB    . ASP E 4 5   ? 124.141 198.642 166.417 1.00 29.01  ? 5   ASP E CB    1 
ATOM 8684  C CG    . ASP E 4 5   ? 123.691 198.643 167.840 1.00 29.01  ? 5   ASP E CG    1 
ATOM 8685  O OD1   . ASP E 4 5   ? 123.315 199.713 168.320 1.00 29.01  ? 5   ASP E OD1   1 
ATOM 8686  O OD2   . ASP E 4 5   ? 123.695 197.569 168.481 1.00 29.01  ? 5   ASP E OD2   1 
ATOM 8687  N N     . ILE E 4 6   ? 121.626 199.131 164.280 1.00 25.53  ? 6   ILE E N     1 
ATOM 8688  C CA    . ILE E 4 6   ? 120.219 199.006 163.930 1.00 25.53  ? 6   ILE E CA    1 
ATOM 8689  C C     . ILE E 4 6   ? 119.879 197.556 163.649 1.00 25.53  ? 6   ILE E C     1 
ATOM 8690  O O     . ILE E 4 6   ? 120.590 196.881 162.898 1.00 25.53  ? 6   ILE E O     1 
ATOM 8691  C CB    . ILE E 4 6   ? 119.877 199.906 162.735 1.00 25.53  ? 6   ILE E CB    1 
ATOM 8692  C CG1   . ILE E 4 6   ? 118.458 199.665 162.256 1.00 25.53  ? 6   ILE E CG1   1 
ATOM 8693  C CG2   . ILE E 4 6   ? 120.855 199.691 161.631 1.00 25.53  ? 6   ILE E CG2   1 
ATOM 8694  C CD1   . ILE E 4 6   ? 117.988 200.743 161.330 1.00 25.53  ? 6   ILE E CD1   1 
ATOM 8695  N N     . HIS E 4 7   ? 118.814 197.080 164.280 1.00 24.67  ? 7   HIS E N     1 
ATOM 8696  C CA    . HIS E 4 7   ? 118.281 195.742 164.108 1.00 24.67  ? 7   HIS E CA    1 
ATOM 8697  C C     . HIS E 4 7   ? 116.947 195.844 163.397 1.00 24.67  ? 7   HIS E C     1 
ATOM 8698  O O     . HIS E 4 7   ? 116.272 196.865 163.494 1.00 24.67  ? 7   HIS E O     1 
ATOM 8699  C CB    . HIS E 4 7   ? 118.076 195.069 165.450 1.00 24.67  ? 7   HIS E CB    1 
ATOM 8700  C CG    . HIS E 4 7   ? 119.253 195.175 166.349 1.00 24.67  ? 7   HIS E CG    1 
ATOM 8701  N ND1   . HIS E 4 7   ? 120.152 194.148 166.508 1.00 24.67  ? 7   HIS E ND1   1 
ATOM 8702  C CD2   . HIS E 4 7   ? 119.726 196.205 167.081 1.00 24.67  ? 7   HIS E CD2   1 
ATOM 8703  C CE1   . HIS E 4 7   ? 121.101 194.526 167.343 1.00 24.67  ? 7   HIS E CE1   1 
ATOM 8704  N NE2   . HIS E 4 7   ? 120.871 195.774 167.698 1.00 24.67  ? 7   HIS E NE2   1 
ATOM 8705  N N     . ALA E 4 8   ? 116.560 194.795 162.684 1.00 25.02  ? 8   ALA E N     1 
ATOM 8706  C CA    . ALA E 4 8   ? 115.306 194.855 161.949 1.00 25.02  ? 8   ALA E CA    1 
ATOM 8707  C C     . ALA E 4 8   ? 114.827 193.451 161.640 1.00 25.02  ? 8   ALA E C     1 
ATOM 8708  O O     . ALA E 4 8   ? 115.639 192.586 161.336 1.00 25.02  ? 8   ALA E O     1 
ATOM 8709  C CB    . ALA E 4 8   ? 115.460 195.651 160.657 1.00 25.02  ? 8   ALA E CB    1 
ATOM 8710  N N     . ILE E 4 9   ? 113.527 193.220 161.741 1.00 22.03  ? 9   ILE E N     1 
ATOM 8711  C CA    . ILE E 4 9   ? 112.918 191.982 161.282 1.00 22.03  ? 9   ILE E CA    1 
ATOM 8712  C C     . ILE E 4 9   ? 112.060 192.344 160.086 1.00 22.03  ? 9   ILE E C     1 
ATOM 8713  O O     . ILE E 4 9   ? 111.216 193.249 160.174 1.00 22.03  ? 9   ILE E O     1 
ATOM 8714  C CB    . ILE E 4 9   ? 112.078 191.306 162.367 1.00 22.03  ? 9   ILE E CB    1 
ATOM 8715  C CG1   . ILE E 4 9   ? 112.920 191.075 163.595 1.00 22.03  ? 9   ILE E CG1   1 
ATOM 8716  C CG2   . ILE E 4 9   ? 111.571 189.991 161.869 1.00 22.03  ? 9   ILE E CG2   1 
ATOM 8717  C CD1   . ILE E 4 9   ? 113.943 190.071 163.387 1.00 22.03  ? 9   ILE E CD1   1 
ATOM 8718  N N     . GLN E 4 10  ? 112.262 191.621 158.981 1.00 26.28  ? 10  GLN E N     1 
ATOM 8719  C CA    . GLN E 4 10  ? 111.585 191.916 157.721 1.00 26.28  ? 10  GLN E CA    1 
ATOM 8720  C C     . GLN E 4 10  ? 111.307 190.645 156.940 1.00 26.28  ? 10  GLN E C     1 
ATOM 8721  O O     . GLN E 4 10  ? 112.245 189.973 156.516 1.00 26.28  ? 10  GLN E O     1 
ATOM 8722  C CB    . GLN E 4 10  ? 112.435 192.842 156.882 1.00 26.28  ? 10  GLN E CB    1 
ATOM 8723  C CG    . GLN E 4 10  ? 111.850 193.082 155.547 1.00 26.28  ? 10  GLN E CG    1 
ATOM 8724  C CD    . GLN E 4 10  ? 112.554 194.177 154.824 1.00 26.28  ? 10  GLN E CD    1 
ATOM 8725  O OE1   . GLN E 4 10  ? 113.489 194.772 155.345 1.00 26.28  ? 10  GLN E OE1   1 
ATOM 8726  N NE2   . GLN E 4 10  ? 112.094 194.481 153.625 1.00 26.28  ? 10  GLN E NE2   1 
ATOM 8727  N N     . THR E 4 11  ? 110.037 190.313 156.752 1.00 26.53  ? 11  THR E N     1 
ATOM 8728  C CA    . THR E 4 11  ? 109.662 189.137 155.983 1.00 26.53  ? 11  THR E CA    1 
ATOM 8729  C C     . THR E 4 11  ? 109.708 189.406 154.487 1.00 26.53  ? 11  THR E C     1 
ATOM 8730  O O     . THR E 4 11  ? 109.479 190.525 154.032 1.00 26.53  ? 11  THR E O     1 
ATOM 8731  C CB    . THR E 4 11  ? 108.266 188.675 156.345 1.00 26.53  ? 11  THR E CB    1 
ATOM 8732  O OG1   . THR E 4 11  ? 107.324 189.466 155.628 1.00 26.53  ? 11  THR E OG1   1 
ATOM 8733  C CG2   . THR E 4 11  ? 108.028 188.868 157.797 1.00 26.53  ? 11  THR E CG2   1 
ATOM 8734  N N     . LEU E 4 12  ? 110.002 188.362 153.716 1.00 30.76  ? 12  LEU E N     1 
ATOM 8735  C CA    . LEU E 4 12  ? 110.020 188.492 152.271 1.00 30.76  ? 12  LEU E CA    1 
ATOM 8736  C C     . LEU E 4 12  ? 109.310 187.258 151.735 1.00 30.76  ? 12  LEU E C     1 
ATOM 8737  O O     . LEU E 4 12  ? 109.650 186.118 152.126 1.00 30.76  ? 12  LEU E O     1 
ATOM 8738  C CB    . LEU E 4 12  ? 111.398 188.618 151.634 1.00 30.76  ? 12  LEU E CB    1 
ATOM 8739  C CG    . LEU E 4 12  ? 112.101 189.904 152.011 1.00 30.76  ? 12  LEU E CG    1 
ATOM 8740  C CD1   . LEU E 4 12  ? 113.530 189.854 151.578 1.00 30.76  ? 12  LEU E CD1   1 
ATOM 8741  C CD2   . LEU E 4 12  ? 111.396 191.057 151.387 1.00 30.76  ? 12  LEU E CD2   1 
ATOM 8742  N N     . PRO E 4 13  ? 108.313 187.460 150.878 1.00 33.84  ? 13  PRO E N     1 
ATOM 8743  C CA    . PRO E 4 13  ? 107.521 186.343 150.368 1.00 33.84  ? 13  PRO E CA    1 
ATOM 8744  C C     . PRO E 4 13  ? 107.919 185.798 149.018 1.00 33.84  ? 13  PRO E C     1 
ATOM 8745  O O     . PRO E 4 13  ? 107.750 186.479 148.005 1.00 33.84  ? 13  PRO E O     1 
ATOM 8746  C CB    . PRO E 4 13  ? 106.127 186.954 150.262 1.00 33.84  ? 13  PRO E CB    1 
ATOM 8747  C CG    . PRO E 4 13  ? 106.394 188.385 149.974 1.00 33.84  ? 13  PRO E CG    1 
ATOM 8748  C CD    . PRO E 4 13  ? 107.679 188.758 150.616 1.00 33.84  ? 13  PRO E CD    1 
ATOM 8749  N N     . TYR E 4 14  ? 108.440 184.578 148.988 1.00 42.43  ? 14  TYR E N     1 
ATOM 8750  C CA    . TYR E 4 14  ? 108.777 183.906 147.739 1.00 42.43  ? 14  TYR E CA    1 
ATOM 8751  C C     . TYR E 4 14  ? 109.708 184.805 146.922 1.00 42.43  ? 14  TYR E C     1 
ATOM 8752  O O     . TYR E 4 14  ? 109.571 184.963 145.712 1.00 42.43  ? 14  TYR E O     1 
ATOM 8753  C CB    . TYR E 4 14  ? 107.472 183.567 147.027 1.00 42.43  ? 14  TYR E CB    1 
ATOM 8754  C CG    . TYR E 4 14  ? 107.534 182.620 145.895 1.00 42.43  ? 14  TYR E CG    1 
ATOM 8755  C CD1   . TYR E 4 14  ? 107.611 181.273 146.137 1.00 42.43  ? 14  TYR E CD1   1 
ATOM 8756  C CD2   . TYR E 4 14  ? 107.435 183.043 144.599 1.00 42.43  ? 14  TYR E CD2   1 
ATOM 8757  C CE1   . TYR E 4 14  ? 107.626 180.382 145.126 1.00 42.43  ? 14  TYR E CE1   1 
ATOM 8758  C CE2   . TYR E 4 14  ? 107.447 182.142 143.571 1.00 42.43  ? 14  TYR E CE2   1 
ATOM 8759  C CZ    . TYR E 4 14  ? 107.567 180.810 143.843 1.00 42.43  ? 14  TYR E CZ    1 
ATOM 8760  O OH    . TYR E 4 14  ? 107.588 179.907 142.813 1.00 42.43  ? 14  TYR E OH    1 
ATOM 8761  N N     . SER E 4 15  ? 110.655 185.405 147.637 1.00 37.37  ? 15  SER E N     1 
ATOM 8762  C CA    . SER E 4 15  ? 111.550 186.444 147.139 1.00 37.37  ? 15  SER E CA    1 
ATOM 8763  C C     . SER E 4 15  ? 112.639 185.969 146.183 1.00 37.37  ? 15  SER E C     1 
ATOM 8764  O O     . SER E 4 15  ? 112.729 186.449 145.049 1.00 37.37  ? 15  SER E O     1 
ATOM 8765  C CB    . SER E 4 15  ? 112.194 187.119 148.340 1.00 37.37  ? 15  SER E CB    1 
ATOM 8766  O OG    . SER E 4 15  ? 112.732 186.135 149.205 1.00 37.37  ? 15  SER E OG    1 
ATOM 8767  N N     . ASN E 4 16  ? 113.487 185.043 146.627 1.00 31.71  ? 16  ASN E N     1 
ATOM 8768  C CA    . ASN E 4 16  ? 114.687 184.639 145.886 1.00 31.71  ? 16  ASN E CA    1 
ATOM 8769  C C     . ASN E 4 16  ? 115.507 185.861 145.467 1.00 31.71  ? 16  ASN E C     1 
ATOM 8770  O O     . ASN E 4 16  ? 115.822 186.074 144.297 1.00 31.71  ? 16  ASN E O     1 
ATOM 8771  C CB    . ASN E 4 16  ? 114.357 183.784 144.670 1.00 31.71  ? 16  ASN E CB    1 
ATOM 8772  C CG    . ASN E 4 16  ? 115.580 183.107 144.112 1.00 31.71  ? 16  ASN E CG    1 
ATOM 8773  O OD1   . ASN E 4 16  ? 116.643 183.148 144.712 1.00 31.71  ? 16  ASN E OD1   1 
ATOM 8774  N ND2   . ASN E 4 16  ? 115.449 182.513 142.939 1.00 31.71  ? 16  ASN E ND2   1 
ATOM 8775  N N     . ILE E 4 17  ? 115.835 186.677 146.468 1.00 29.33  ? 17  ILE E N     1 
ATOM 8776  C CA    . ILE E 4 17  ? 116.503 187.955 146.259 1.00 29.33  ? 17  ILE E CA    1 
ATOM 8777  C C     . ILE E 4 17  ? 117.911 187.761 145.720 1.00 29.33  ? 17  ILE E C     1 
ATOM 8778  O O     . ILE E 4 17  ? 118.345 188.498 144.832 1.00 29.33  ? 17  ILE E O     1 
ATOM 8779  C CB    . ILE E 4 17  ? 116.521 188.771 147.558 1.00 29.33  ? 17  ILE E CB    1 
ATOM 8780  C CG1   . ILE E 4 17  ? 115.114 189.022 148.037 1.00 29.33  ? 17  ILE E CG1   1 
ATOM 8781  C CG2   . ILE E 4 17  ? 117.137 190.094 147.311 1.00 29.33  ? 17  ILE E CG2   1 
ATOM 8782  C CD1   . ILE E 4 17  ? 114.327 189.788 147.044 1.00 29.33  ? 17  ILE E CD1   1 
ATOM 8783  N N     . ASN E 4 18  ? 118.651 186.778 146.232 1.00 26.90  ? 18  ASN E N     1 
ATOM 8784  C CA    . ASN E 4 18  ? 120.012 186.568 145.756 1.00 26.90  ? 18  ASN E CA    1 
ATOM 8785  C C     . ASN E 4 18  ? 120.318 185.109 145.502 1.00 26.90  ? 18  ASN E C     1 
ATOM 8786  O O     . ASN E 4 18  ? 120.169 184.268 146.388 1.00 26.90  ? 18  ASN E O     1 
ATOM 8787  C CB    . ASN E 4 18  ? 121.055 187.084 146.734 1.00 26.90  ? 18  ASN E CB    1 
ATOM 8788  C CG    . ASN E 4 18  ? 121.211 188.549 146.663 1.00 26.90  ? 18  ASN E CG    1 
ATOM 8789  O OD1   . ASN E 4 18  ? 120.998 189.145 145.622 1.00 26.90  ? 18  ASN E OD1   1 
ATOM 8790  N ND2   . ASN E 4 18  ? 121.674 189.139 147.739 1.00 26.90  ? 18  ASN E ND2   1 
ATOM 8791  N N     . ARG E 4 19  ? 120.760 184.844 144.285 1.00 30.10  ? 19  ARG E N     1 
ATOM 8792  C CA    . ARG E 4 19  ? 121.022 183.527 143.746 1.00 30.10  ? 19  ARG E CA    1 
ATOM 8793  C C     . ARG E 4 19  ? 122.506 183.223 143.784 1.00 30.10  ? 19  ARG E C     1 
ATOM 8794  O O     . ARG E 4 19  ? 123.337 184.123 143.690 1.00 30.10  ? 19  ARG E O     1 
ATOM 8795  C CB    . ARG E 4 19  ? 120.550 183.456 142.303 1.00 30.10  ? 19  ARG E CB    1 
ATOM 8796  C CG    . ARG E 4 19  ? 119.091 183.699 142.116 1.00 30.10  ? 19  ARG E CG    1 
ATOM 8797  C CD    . ARG E 4 19  ? 118.777 183.649 140.650 1.00 30.10  ? 19  ARG E CD    1 
ATOM 8798  N NE    . ARG E 4 19  ? 119.333 184.801 139.957 1.00 30.10  ? 19  ARG E NE    1 
ATOM 8799  C CZ    . ARG E 4 19  ? 119.303 184.950 138.642 1.00 30.10  ? 19  ARG E CZ    1 
ATOM 8800  N NH1   . ARG E 4 19  ? 118.756 184.013 137.888 1.00 30.10  ? 19  ARG E NH1   1 
ATOM 8801  N NH2   . ARG E 4 19  ? 119.812 186.028 138.080 1.00 30.10  ? 19  ARG E NH2   1 
ATOM 8802  N N     . ASP E 4 20  ? 122.844 181.944 143.906 1.00 39.36  ? 20  ASP E N     1 
ATOM 8803  C CA    . ASP E 4 20  ? 124.244 181.593 143.721 1.00 39.36  ? 20  ASP E CA    1 
ATOM 8804  C C     . ASP E 4 20  ? 124.511 181.670 142.232 1.00 39.36  ? 20  ASP E C     1 
ATOM 8805  O O     . ASP E 4 20  ? 123.708 182.229 141.481 1.00 39.36  ? 20  ASP E O     1 
ATOM 8806  C CB    . ASP E 4 20  ? 124.544 180.165 144.168 1.00 39.36  ? 20  ASP E CB    1 
ATOM 8807  C CG    . ASP E 4 20  ? 124.464 179.990 145.641 1.00 39.36  ? 20  ASP E CG    1 
ATOM 8808  O OD1   . ASP E 4 20  ? 124.638 180.991 146.346 1.00 39.36  ? 20  ASP E OD1   1 
ATOM 8809  O OD2   . ASP E 4 20  ? 124.249 178.848 146.098 1.00 39.36  ? 20  ASP E OD2   1 
ATOM 8810  N N     . ASP E 4 21  ? 125.620 181.106 141.777 1.00 44.82  ? 21  ASP E N     1 
ATOM 8811  C CA    . ASP E 4 21  ? 125.861 181.132 140.345 1.00 44.82  ? 21  ASP E CA    1 
ATOM 8812  C C     . ASP E 4 21  ? 124.878 180.220 139.636 1.00 44.82  ? 21  ASP E C     1 
ATOM 8813  O O     . ASP E 4 21  ? 124.655 180.367 138.429 1.00 44.82  ? 21  ASP E O     1 
ATOM 8814  C CB    . ASP E 4 21  ? 127.279 180.712 140.002 1.00 44.82  ? 21  ASP E CB    1 
ATOM 8815  C CG    . ASP E 4 21  ? 127.584 179.339 140.476 1.00 44.82  ? 21  ASP E CG    1 
ATOM 8816  O OD1   . ASP E 4 21  ? 126.830 178.847 141.340 1.00 44.82  ? 21  ASP E OD1   1 
ATOM 8817  O OD2   . ASP E 4 21  ? 128.548 178.735 139.974 1.00 44.82  ? 21  ASP E OD2   1 
ATOM 8818  N N     . LEU E 4 22  ? 124.267 179.308 140.382 1.00 46.90  ? 22  LEU E N     1 
ATOM 8819  C CA    . LEU E 4 22  ? 123.356 178.309 139.862 1.00 46.90  ? 22  LEU E CA    1 
ATOM 8820  C C     . LEU E 4 22  ? 121.882 178.580 140.121 1.00 46.90  ? 22  LEU E C     1 
ATOM 8821  O O     . LEU E 4 22  ? 121.045 177.761 139.735 1.00 46.90  ? 22  LEU E O     1 
ATOM 8822  C CB    . LEU E 4 22  ? 123.728 176.982 140.492 1.00 46.90  ? 22  LEU E CB    1 
ATOM 8823  C CG    . LEU E 4 22  ? 125.086 176.346 140.269 1.00 46.90  ? 22  LEU E CG    1 
ATOM 8824  C CD1   . LEU E 4 22  ? 125.197 175.111 141.118 1.00 46.90  ? 22  LEU E CD1   1 
ATOM 8825  C CD2   . LEU E 4 22  ? 125.227 175.967 138.813 1.00 46.90  ? 22  LEU E CD2   1 
ATOM 8826  N N     . GLY E 4 23  ? 121.540 179.675 140.778 1.00 38.32  ? 23  GLY E N     1 
ATOM 8827  C CA    . GLY E 4 23  ? 120.162 180.067 140.984 1.00 38.32  ? 23  GLY E CA    1 
ATOM 8828  C C     . GLY E 4 23  ? 119.566 179.719 142.326 1.00 38.32  ? 23  GLY E C     1 
ATOM 8829  O O     . GLY E 4 23  ? 118.466 180.189 142.627 1.00 38.32  ? 23  GLY E O     1 
ATOM 8830  N N     . SER E 4 24  ? 120.244 178.951 143.138 1.00 33.92  ? 24  SER E N     1 
ATOM 8831  C CA    . SER E 4 24  ? 119.634 178.688 144.429 1.00 33.92  ? 24  SER E CA    1 
ATOM 8832  C C     . SER E 4 24  ? 119.871 179.877 145.352 1.00 33.92  ? 24  SER E C     1 
ATOM 8833  O O     . SER E 4 24  ? 120.915 180.524 145.266 1.00 33.92  ? 24  SER E O     1 
ATOM 8834  C CB    . SER E 4 24  ? 120.195 177.424 145.055 1.00 33.92  ? 24  SER E CB    1 
ATOM 8835  O OG    . SER E 4 24  ? 121.589 177.527 145.245 1.00 33.92  ? 24  SER E OG    1 
ATOM 8836  N N     . PRO E 4 25  ? 118.920 180.206 146.214 1.00 29.33  ? 25  PRO E N     1 
ATOM 8837  C CA    . PRO E 4 25  ? 119.155 181.285 147.176 1.00 29.33  ? 25  PRO E CA    1 
ATOM 8838  C C     . PRO E 4 25  ? 120.276 180.892 148.128 1.00 29.33  ? 25  PRO E C     1 
ATOM 8839  O O     . PRO E 4 25  ? 120.406 179.731 148.512 1.00 29.33  ? 25  PRO E O     1 
ATOM 8840  C CB    . PRO E 4 25  ? 117.815 181.410 147.899 1.00 29.33  ? 25  PRO E CB    1 
ATOM 8841  C CG    . PRO E 4 25  ? 117.173 180.091 147.705 1.00 29.33  ? 25  PRO E CG    1 
ATOM 8842  C CD    . PRO E 4 25  ? 117.600 179.596 146.379 1.00 29.33  ? 25  PRO E CD    1 
ATOM 8843  N N     . LYS E 4 26  ? 121.096 181.862 148.503 1.00 25.12  ? 26  LYS E N     1 
ATOM 8844  C CA    . LYS E 4 26  ? 122.225 181.569 149.371 1.00 25.12  ? 26  LYS E CA    1 
ATOM 8845  C C     . LYS E 4 26  ? 121.743 181.131 150.746 1.00 25.12  ? 26  LYS E C     1 
ATOM 8846  O O     . LYS E 4 26  ? 120.797 181.698 151.290 1.00 25.12  ? 26  LYS E O     1 
ATOM 8847  C CB    . LYS E 4 26  ? 123.103 182.805 149.467 1.00 25.12  ? 26  LYS E CB    1 
ATOM 8848  C CG    . LYS E 4 26  ? 123.703 183.158 148.140 1.00 25.12  ? 26  LYS E CG    1 
ATOM 8849  C CD    . LYS E 4 26  ? 124.495 184.422 148.160 1.00 25.12  ? 26  LYS E CD    1 
ATOM 8850  C CE    . LYS E 4 26  ? 125.089 184.686 146.799 1.00 25.12  ? 26  LYS E CE    1 
ATOM 8851  N NZ    . LYS E 4 26  ? 125.815 185.980 146.713 1.00 25.12  ? 26  LYS E NZ    1 
ATOM 8852  N N     . THR E 4 27  ? 122.388 180.108 151.313 1.00 25.51  ? 27  THR E N     1 
ATOM 8853  C CA    . THR E 4 27  ? 121.947 179.551 152.585 1.00 25.51  ? 27  THR E CA    1 
ATOM 8854  C C     . THR E 4 27  ? 123.073 179.454 153.606 1.00 25.51  ? 27  THR E C     1 
ATOM 8855  O O     . THR E 4 27  ? 124.216 179.163 153.262 1.00 25.51  ? 27  THR E O     1 
ATOM 8856  C CB    . THR E 4 27  ? 121.377 178.163 152.369 1.00 25.51  ? 27  THR E CB    1 
ATOM 8857  O OG1   . THR E 4 27  ? 122.394 177.326 151.811 1.00 25.51  ? 27  THR E OG1   1 
ATOM 8858  C CG2   . THR E 4 27  ? 120.215 178.214 151.405 1.00 25.51  ? 27  THR E CG2   1 
ATOM 8859  N N     . VAL E 4 28  ? 122.724 179.675 154.873 1.00 23.19  ? 28  VAL E N     1 
ATOM 8860  C CA    . VAL E 4 28  ? 123.599 179.440 156.017 1.00 23.19  ? 28  VAL E CA    1 
ATOM 8861  C C     . VAL E 4 28  ? 123.054 178.273 156.808 1.00 23.19  ? 28  VAL E C     1 
ATOM 8862  O O     . VAL E 4 28  ? 121.901 178.313 157.234 1.00 23.19  ? 28  VAL E O     1 
ATOM 8863  C CB    . VAL E 4 28  ? 123.663 180.659 156.945 1.00 23.19  ? 28  VAL E CB    1 
ATOM 8864  C CG1   . VAL E 4 28  ? 124.718 180.456 157.985 1.00 23.19  ? 28  VAL E CG1   1 
ATOM 8865  C CG2   . VAL E 4 28  ? 123.940 181.866 156.185 1.00 23.19  ? 28  VAL E CG2   1 
ATOM 8866  N N     . VAL E 4 29  ? 123.893 177.292 157.113 1.00 23.00  ? 29  VAL E N     1 
ATOM 8867  C CA    . VAL E 4 29  ? 123.519 176.249 158.064 1.00 23.00  ? 29  VAL E CA    1 
ATOM 8868  C C     . VAL E 4 29  ? 123.906 176.770 159.438 1.00 23.00  ? 29  VAL E C     1 
ATOM 8869  O O     . VAL E 4 29  ? 125.003 176.541 159.930 1.00 23.00  ? 29  VAL E O     1 
ATOM 8870  C CB    . VAL E 4 29  ? 124.148 174.916 157.737 1.00 23.00  ? 29  VAL E CB    1 
ATOM 8871  C CG1   . VAL E 4 29  ? 123.639 173.890 158.701 1.00 23.00  ? 29  VAL E CG1   1 
ATOM 8872  C CG2   . VAL E 4 29  ? 123.736 174.545 156.345 1.00 23.00  ? 29  VAL E CG2   1 
ATOM 8873  N N     . TYR E 4 30  ? 122.981 177.475 160.058 1.00 19.57  ? 30  TYR E N     1 
ATOM 8874  C CA    . TYR E 4 30  ? 123.217 178.172 161.309 1.00 19.57  ? 30  TYR E CA    1 
ATOM 8875  C C     . TYR E 4 30  ? 122.344 177.583 162.403 1.00 19.57  ? 30  TYR E C     1 
ATOM 8876  O O     . TYR E 4 30  ? 121.198 177.191 162.144 1.00 19.57  ? 30  TYR E O     1 
ATOM 8877  C CB    . TYR E 4 30  ? 122.998 179.662 161.141 1.00 19.57  ? 30  TYR E CB    1 
ATOM 8878  C CG    . TYR E 4 30  ? 123.167 180.450 162.398 1.00 19.57  ? 30  TYR E CG    1 
ATOM 8879  C CD1   . TYR E 4 30  ? 124.374 180.502 163.041 1.00 19.57  ? 30  TYR E CD1   1 
ATOM 8880  C CD2   . TYR E 4 30  ? 122.153 181.220 162.885 1.00 19.57  ? 30  TYR E CD2   1 
ATOM 8881  C CE1   . TYR E 4 30  ? 124.529 181.244 164.172 1.00 19.57  ? 30  TYR E CE1   1 
ATOM 8882  C CE2   . TYR E 4 30  ? 122.297 181.955 164.005 1.00 19.57  ? 30  TYR E CE2   1 
ATOM 8883  C CZ    . TYR E 4 30  ? 123.483 181.970 164.642 1.00 19.57  ? 30  TYR E CZ    1 
ATOM 8884  O OH    . TYR E 4 30  ? 123.607 182.722 165.773 1.00 19.57  ? 30  TYR E OH    1 
ATOM 8885  N N     . GLY E 4 31  ? 122.981 177.230 163.510 1.00 23.14  ? 31  GLY E N     1 
ATOM 8886  C CA    . GLY E 4 31  ? 122.230 176.607 164.566 1.00 23.14  ? 31  GLY E CA    1 
ATOM 8887  C C     . GLY E 4 31  ? 121.915 175.187 164.241 1.00 23.14  ? 31  GLY E C     1 
ATOM 8888  O O     . GLY E 4 31  ? 121.007 174.605 164.831 1.00 23.14  ? 31  GLY E O     1 
ATOM 8889  N N     . GLY E 4 32  ? 122.619 174.632 163.276 1.00 25.03  ? 32  GLY E N     1 
ATOM 8890  C CA    . GLY E 4 32  ? 122.436 173.281 162.848 1.00 25.03  ? 32  GLY E CA    1 
ATOM 8891  C C     . GLY E 4 32  ? 121.404 173.120 161.762 1.00 25.03  ? 32  GLY E C     1 
ATOM 8892  O O     . GLY E 4 32  ? 121.262 172.015 161.236 1.00 25.03  ? 32  GLY E O     1 
ATOM 8893  N N     . LYS E 4 33  ? 120.669 174.174 161.408 1.00 29.93  ? 33  LYS E N     1 
ATOM 8894  C CA    . LYS E 4 33  ? 119.649 174.047 160.374 1.00 29.93  ? 33  LYS E CA    1 
ATOM 8895  C C     . LYS E 4 33  ? 119.896 175.044 159.256 1.00 29.93  ? 33  LYS E C     1 
ATOM 8896  O O     . LYS E 4 33  ? 120.403 176.131 159.519 1.00 29.93  ? 33  LYS E O     1 
ATOM 8897  C CB    . LYS E 4 33  ? 118.252 174.207 160.944 1.00 29.93  ? 33  LYS E CB    1 
ATOM 8898  C CG    . LYS E 4 33  ? 117.206 173.945 159.897 1.00 29.93  ? 33  LYS E CG    1 
ATOM 8899  C CD    . LYS E 4 33  ? 115.820 174.184 160.411 1.00 29.93  ? 33  LYS E CD    1 
ATOM 8900  C CE    . LYS E 4 33  ? 115.491 173.215 161.510 1.00 29.93  ? 33  LYS E CE    1 
ATOM 8901  N NZ    . LYS E 4 33  ? 114.159 173.514 162.074 1.00 29.93  ? 33  LYS E NZ    1 
ATOM 8902  N N     . GLU E 4 34  ? 119.803 174.584 158.014 1.00 32.37  ? 34  GLU E N     1 
ATOM 8903  C CA    . GLU E 4 34  ? 119.979 175.478 156.874 1.00 32.37  ? 34  GLU E CA    1 
ATOM 8904  C C     . GLU E 4 34  ? 118.848 176.503 156.732 1.00 32.37  ? 34  GLU E C     1 
ATOM 8905  O O     . GLU E 4 34  ? 117.667 176.160 156.789 1.00 32.37  ? 34  GLU E O     1 
ATOM 8906  C CB    . GLU E 4 34  ? 120.187 174.667 155.597 1.00 32.37  ? 34  GLU E CB    1 
ATOM 8907  C CG    . GLU E 4 34  ? 118.993 174.342 154.773 1.00 32.37  ? 34  GLU E CG    1 
ATOM 8908  C CD    . GLU E 4 34  ? 118.439 172.976 155.146 1.00 32.37  ? 34  GLU E CD    1 
ATOM 8909  O OE1   . GLU E 4 34  ? 119.036 172.320 156.032 1.00 32.37  ? 34  GLU E OE1   1 
ATOM 8910  O OE2   . GLU E 4 34  ? 117.442 172.530 154.534 1.00 32.37  ? 34  GLU E OE2   1 
ATOM 8911  N N     . ARG E 4 35  ? 119.231 177.772 156.614 1.00 24.10  ? 35  ARG E N     1 
ATOM 8912  C CA    . ARG E 4 35  ? 118.368 178.947 156.488 1.00 24.10  ? 35  ARG E CA    1 
ATOM 8913  C C     . ARG E 4 35  ? 118.884 179.906 155.429 1.00 24.10  ? 35  ARG E C     1 
ATOM 8914  O O     . ARG E 4 35  ? 120.014 180.385 155.527 1.00 24.10  ? 35  ARG E O     1 
ATOM 8915  C CB    . ARG E 4 35  ? 118.127 179.669 157.808 1.00 24.10  ? 35  ARG E CB    1 
ATOM 8916  C CG    . ARG E 4 35  ? 117.539 178.812 158.880 1.00 24.10  ? 35  ARG E CG    1 
ATOM 8917  C CD    . ARG E 4 35  ? 118.429 178.023 159.692 1.00 24.10  ? 35  ARG E CD    1 
ATOM 8918  N NE    . ARG E 4 35  ? 119.261 178.814 160.562 1.00 24.10  ? 35  ARG E NE    1 
ATOM 8919  C CZ    . ARG E 4 35  ? 118.830 179.281 161.716 1.00 24.10  ? 35  ARG E CZ    1 
ATOM 8920  N NH1   . ARG E 4 35  ? 117.604 179.023 162.108 1.00 24.10  ? 35  ARG E NH1   1 
ATOM 8921  N NH2   . ARG E 4 35  ? 119.622 179.979 162.487 1.00 24.10  ? 35  ARG E NH2   1 
ATOM 8922  N N     . THR E 4 36  ? 118.045 180.206 154.441 1.00 24.72  ? 36  THR E N     1 
ATOM 8923  C CA    . THR E 4 36  ? 118.411 181.104 153.349 1.00 24.72  ? 36  THR E CA    1 
ATOM 8924  C C     . THR E 4 36  ? 118.751 182.506 153.839 1.00 24.72  ? 36  THR E C     1 
ATOM 8925  O O     . THR E 4 36  ? 118.178 183.009 154.803 1.00 24.72  ? 36  THR E O     1 
ATOM 8926  C CB    . THR E 4 36  ? 117.277 181.214 152.350 1.00 24.72  ? 36  THR E CB    1 
ATOM 8927  O OG1   . THR E 4 36  ? 116.134 181.755 153.010 1.00 24.72  ? 36  THR E OG1   1 
ATOM 8928  C CG2   . THR E 4 36  ? 116.928 179.849 151.821 1.00 24.72  ? 36  THR E CG2   1 
ATOM 8929  N N     . ARG E 4 37  ? 119.703 183.133 153.151 1.00 18.59  ? 37  ARG E N     1 
ATOM 8930  C CA    . ARG E 4 37  ? 120.251 184.436 153.505 1.00 18.59  ? 37  ARG E CA    1 
ATOM 8931  C C     . ARG E 4 37  ? 120.401 185.335 152.289 1.00 18.59  ? 37  ARG E C     1 
ATOM 8932  O O     . ARG E 4 37  ? 120.545 184.869 151.163 1.00 18.59  ? 37  ARG E O     1 
ATOM 8933  C CB    . ARG E 4 37  ? 121.600 184.324 154.170 1.00 18.59  ? 37  ARG E CB    1 
ATOM 8934  C CG    . ARG E 4 37  ? 122.616 183.755 153.274 1.00 18.59  ? 37  ARG E CG    1 
ATOM 8935  C CD    . ARG E 4 37  ? 123.975 184.029 153.794 1.00 18.59  ? 37  ARG E CD    1 
ATOM 8936  N NE    . ARG E 4 37  ? 124.927 183.190 153.098 1.00 18.59  ? 37  ARG E NE    1 
ATOM 8937  C CZ    . ARG E 4 37  ? 125.614 183.560 152.035 1.00 18.59  ? 37  ARG E CZ    1 
ATOM 8938  N NH1   . ARG E 4 37  ? 125.468 184.774 151.540 1.00 18.59  ? 37  ARG E NH1   1 
ATOM 8939  N NH2   . ARG E 4 37  ? 126.452 182.709 151.475 1.00 18.59  ? 37  ARG E NH2   1 
ATOM 8940  N N     . VAL E 4 38  ? 120.360 186.634 152.534 1.00 17.65  ? 38  VAL E N     1 
ATOM 8941  C CA    . VAL E 4 38  ? 120.715 187.639 151.546 1.00 17.65  ? 38  VAL E CA    1 
ATOM 8942  C C     . VAL E 4 38  ? 122.087 188.183 151.873 1.00 17.65  ? 38  VAL E C     1 
ATOM 8943  O O     . VAL E 4 38  ? 122.293 188.791 152.927 1.00 17.65  ? 38  VAL E O     1 
ATOM 8944  C CB    . VAL E 4 38  ? 119.683 188.767 151.519 1.00 17.65  ? 38  VAL E CB    1 
ATOM 8945  C CG1   . VAL E 4 38  ? 120.055 189.788 150.512 1.00 17.65  ? 38  VAL E CG1   1 
ATOM 8946  C CG2   . VAL E 4 38  ? 118.385 188.197 151.122 1.00 17.65  ? 38  VAL E CG2   1 
ATOM 8947  N N     . SER E 4 39  ? 123.011 188.007 150.941 1.00 24.73  ? 39  SER E N     1 
ATOM 8948  C CA    . SER E 4 39  ? 124.388 188.405 151.159 1.00 24.73  ? 39  SER E CA    1 
ATOM 8949  C C     . SER E 4 39  ? 124.512 189.874 151.503 1.00 24.73  ? 39  SER E C     1 
ATOM 8950  O O     . SER E 4 39  ? 123.768 190.719 151.017 1.00 24.73  ? 39  SER E O     1 
ATOM 8951  C CB    . SER E 4 39  ? 125.226 188.105 149.933 1.00 24.73  ? 39  SER E CB    1 
ATOM 8952  O OG    . SER E 4 39  ? 125.391 186.716 149.794 1.00 24.73  ? 39  SER E OG    1 
ATOM 8953  N N     . SER E 4 40  ? 125.482 190.165 152.356 1.00 26.00  ? 40  SER E N     1 
ATOM 8954  C CA    . SER E 4 40  ? 125.660 191.525 152.818 1.00 26.00  ? 40  SER E CA    1 
ATOM 8955  C C     . SER E 4 40  ? 126.105 192.437 151.695 1.00 26.00  ? 40  SER E C     1 
ATOM 8956  O O     . SER E 4 40  ? 125.719 193.604 151.658 1.00 26.00  ? 40  SER E O     1 
ATOM 8957  C CB    . SER E 4 40  ? 126.685 191.555 153.931 1.00 26.00  ? 40  SER E CB    1 
ATOM 8958  O OG    . SER E 4 40  ? 127.974 191.378 153.389 1.00 26.00  ? 40  SER E OG    1 
ATOM 8959  N N     . GLN E 4 41  ? 126.952 191.949 150.790 1.00 24.42  ? 41  GLN E N     1 
ATOM 8960  C CA    . GLN E 4 41  ? 127.429 192.846 149.745 1.00 24.42  ? 41  GLN E CA    1 
ATOM 8961  C C     . GLN E 4 41  ? 126.317 193.308 148.816 1.00 24.42  ? 41  GLN E C     1 
ATOM 8962  O O     . GLN E 4 41  ? 126.332 194.456 148.360 1.00 24.42  ? 41  GLN E O     1 
ATOM 8963  C CB    . GLN E 4 41  ? 128.530 192.202 148.910 1.00 24.42  ? 41  GLN E CB    1 
ATOM 8964  C CG    . GLN E 4 41  ? 128.137 190.925 148.223 1.00 24.42  ? 41  GLN E CG    1 
ATOM 8965  C CD    . GLN E 4 41  ? 128.550 189.701 148.980 1.00 24.42  ? 41  GLN E CD    1 
ATOM 8966  O OE1   . GLN E 4 41  ? 129.212 189.788 150.007 1.00 24.42  ? 41  GLN E OE1   1 
ATOM 8967  N NE2   . GLN E 4 41  ? 128.129 188.542 148.498 1.00 24.42  ? 41  GLN E NE2   1 
ATOM 8968  N N     . SER E 4 42  ? 125.338 192.449 148.530 1.00 26.99  ? 42  SER E N     1 
ATOM 8969  C CA    . SER E 4 42  ? 124.270 192.851 147.619 1.00 26.99  ? 42  SER E CA    1 
ATOM 8970  C C     . SER E 4 42  ? 123.413 193.933 148.232 1.00 26.99  ? 42  SER E C     1 
ATOM 8971  O O     . SER E 4 42  ? 123.225 195.003 147.645 1.00 26.99  ? 42  SER E O     1 
ATOM 8972  C CB    . SER E 4 42  ? 123.415 191.653 147.251 1.00 26.99  ? 42  SER E CB    1 
ATOM 8973  O OG    . SER E 4 42  ? 122.619 191.269 148.341 1.00 26.99  ? 42  SER E OG    1 
ATOM 8974  N N     . TRP E 4 43  ? 122.899 193.675 149.423 1.00 27.57  ? 43  TRP E N     1 
ATOM 8975  C CA    . TRP E 4 43  ? 122.103 194.684 150.090 1.00 27.57  ? 43  TRP E CA    1 
ATOM 8976  C C     . TRP E 4 43  ? 122.909 195.930 150.338 1.00 27.57  ? 43  TRP E C     1 
ATOM 8977  O O     . TRP E 4 43  ? 122.384 197.036 150.237 1.00 27.57  ? 43  TRP E O     1 
ATOM 8978  C CB    . TRP E 4 43  ? 121.588 194.168 151.409 1.00 27.57  ? 43  TRP E CB    1 
ATOM 8979  C CG    . TRP E 4 43  ? 120.571 195.029 151.994 1.00 27.57  ? 43  TRP E CG    1 
ATOM 8980  C CD1   . TRP E 4 43  ? 120.731 196.324 152.369 1.00 27.57  ? 43  TRP E CD1   1 
ATOM 8981  C CD2   . TRP E 4 43  ? 119.249 194.678 152.348 1.00 27.57  ? 43  TRP E CD2   1 
ATOM 8982  N NE1   . TRP E 4 43  ? 119.581 196.808 152.906 1.00 27.57  ? 43  TRP E NE1   1 
ATOM 8983  C CE2   . TRP E 4 43  ? 118.647 195.813 152.907 1.00 27.57  ? 43  TRP E CE2   1 
ATOM 8984  C CE3   . TRP E 4 43  ? 118.501 193.510 152.234 1.00 27.57  ? 43  TRP E CE3   1 
ATOM 8985  C CZ2   . TRP E 4 43  ? 117.347 195.812 153.342 1.00 27.57  ? 43  TRP E CZ2   1 
ATOM 8986  C CZ3   . TRP E 4 43  ? 117.220 193.515 152.668 1.00 27.57  ? 43  TRP E CZ3   1 
ATOM 8987  C CH2   . TRP E 4 43  ? 116.649 194.653 153.229 1.00 27.57  ? 43  TRP E CH2   1 
ATOM 8988  N N     . LYS E 4 44  ? 124.200 195.777 150.576 1.00 28.65  ? 44  LYS E N     1 
ATOM 8989  C CA    . LYS E 4 44  ? 125.023 196.949 150.766 1.00 28.65  ? 44  LYS E CA    1 
ATOM 8990  C C     . LYS E 4 44  ? 125.052 197.767 149.494 1.00 28.65  ? 44  LYS E C     1 
ATOM 8991  O O     . LYS E 4 44  ? 125.052 199.000 149.532 1.00 28.65  ? 44  LYS E O     1 
ATOM 8992  C CB    . LYS E 4 44  ? 126.428 196.541 151.182 1.00 28.65  ? 44  LYS E CB    1 
ATOM 8993  C CG    . LYS E 4 44  ? 127.351 197.703 151.333 1.00 28.65  ? 44  LYS E CG    1 
ATOM 8994  C CD    . LYS E 4 44  ? 128.744 197.271 151.713 1.00 28.65  ? 44  LYS E CD    1 
ATOM 8995  C CE    . LYS E 4 44  ? 128.757 196.578 153.039 1.00 28.65  ? 44  LYS E CE    1 
ATOM 8996  N NZ    . LYS E 4 44  ? 130.136 196.264 153.445 1.00 28.65  ? 44  LYS E NZ    1 
ATOM 8997  N N     . ARG E 4 45  ? 125.042 197.096 148.351 1.00 30.94  ? 45  ARG E N     1 
ATOM 8998  C CA    . ARG E 4 45  ? 124.988 197.826 147.099 1.00 30.94  ? 45  ARG E CA    1 
ATOM 8999  C C     . ARG E 4 45  ? 123.651 198.528 146.947 1.00 30.94  ? 45  ARG E C     1 
ATOM 9000  O O     . ARG E 4 45  ? 123.605 199.690 146.545 1.00 30.94  ? 45  ARG E O     1 
ATOM 9001  C CB    . ARG E 4 45  ? 125.273 196.898 145.933 1.00 30.94  ? 45  ARG E CB    1 
ATOM 9002  C CG    . ARG E 4 45  ? 125.191 197.569 144.602 1.00 30.94  ? 45  ARG E CG    1 
ATOM 9003  C CD    . ARG E 4 45  ? 125.523 196.583 143.535 1.00 30.94  ? 45  ARG E CD    1 
ATOM 9004  N NE    . ARG E 4 45  ? 125.446 197.193 142.226 1.00 30.94  ? 45  ARG E NE    1 
ATOM 9005  C CZ    . ARG E 4 45  ? 124.346 197.188 141.494 1.00 30.94  ? 45  ARG E CZ    1 
ATOM 9006  N NH1   . ARG E 4 45  ? 124.338 197.764 140.309 1.00 30.94  ? 45  ARG E NH1   1 
ATOM 9007  N NH2   . ARG E 4 45  ? 123.264 196.579 141.948 1.00 30.94  ? 45  ARG E NH2   1 
ATOM 9008  N N     . ALA E 4 46  ? 122.550 197.857 147.269 1.00 30.03  ? 46  ALA E N     1 
ATOM 9009  C CA    . ALA E 4 46  ? 121.266 198.545 147.180 1.00 30.03  ? 46  ALA E CA    1 
ATOM 9010  C C     . ALA E 4 46  ? 121.244 199.783 148.068 1.00 30.03  ? 46  ALA E C     1 
ATOM 9011  O O     . ALA E 4 46  ? 120.812 200.862 147.637 1.00 30.03  ? 46  ALA E O     1 
ATOM 9012  C CB    . ALA E 4 46  ? 120.138 197.593 147.548 1.00 30.03  ? 46  ALA E CB    1 
ATOM 9013  N N     . VAL E 4 47  ? 121.768 199.668 149.288 1.00 32.27  ? 47  VAL E N     1 
ATOM 9014  C CA    . VAL E 4 47  ? 121.779 200.807 150.195 1.00 32.27  ? 47  VAL E CA    1 
ATOM 9015  C C     . VAL E 4 47  ? 122.650 201.906 149.627 1.00 32.27  ? 47  VAL E C     1 
ATOM 9016  O O     . VAL E 4 47  ? 122.282 203.084 149.657 1.00 32.27  ? 47  VAL E O     1 
ATOM 9017  C CB    . VAL E 4 47  ? 122.260 200.400 151.597 1.00 32.27  ? 47  VAL E CB    1 
ATOM 9018  C CG1   . VAL E 4 47  ? 122.604 201.627 152.375 1.00 32.27  ? 47  VAL E CG1   1 
ATOM 9019  C CG2   . VAL E 4 47  ? 121.195 199.674 152.329 1.00 32.27  ? 47  VAL E CG2   1 
ATOM 9020  N N     . ARG E 4 48  ? 123.805 201.548 149.077 1.00 39.19  ? 48  ARG E N     1 
ATOM 9021  C CA    . ARG E 4 48  ? 124.676 202.589 148.559 1.00 39.19  ? 48  ARG E CA    1 
ATOM 9022  C C     . ARG E 4 48  ? 124.060 203.264 147.350 1.00 39.19  ? 48  ARG E C     1 
ATOM 9023  O O     . ARG E 4 48  ? 124.296 204.455 147.138 1.00 39.19  ? 48  ARG E O     1 
ATOM 9024  C CB    . ARG E 4 48  ? 126.065 202.042 148.233 1.00 39.19  ? 48  ARG E CB    1 
ATOM 9025  C CG    . ARG E 4 48  ? 126.170 201.168 147.010 1.00 39.19  ? 48  ARG E CG    1 
ATOM 9026  C CD    . ARG E 4 48  ? 127.623 200.845 146.689 1.00 39.19  ? 48  ARG E CD    1 
ATOM 9027  N NE    . ARG E 4 48  ? 128.297 201.970 146.060 1.00 39.19  ? 48  ARG E NE    1 
ATOM 9028  C CZ    . ARG E 4 48  ? 128.415 202.120 144.746 1.00 39.19  ? 48  ARG E CZ    1 
ATOM 9029  N NH1   . ARG E 4 48  ? 127.906 201.214 143.926 1.00 39.19  ? 48  ARG E NH1   1 
ATOM 9030  N NH2   . ARG E 4 48  ? 129.035 203.176 144.251 1.00 39.19  ? 48  ARG E NH2   1 
ATOM 9031  N N     . HIS E 4 49  ? 123.257 202.548 146.561 1.00 38.47  ? 49  HIS E N     1 
ATOM 9032  C CA    . HIS E 4 49  ? 122.625 203.206 145.428 1.00 38.47  ? 49  HIS E CA    1 
ATOM 9033  C C     . HIS E 4 49  ? 121.531 204.153 145.882 1.00 38.47  ? 49  HIS E C     1 
ATOM 9034  O O     . HIS E 4 49  ? 121.381 205.241 145.318 1.00 38.47  ? 49  HIS E O     1 
ATOM 9035  C CB    . HIS E 4 49  ? 122.011 202.184 144.482 1.00 38.47  ? 49  HIS E CB    1 
ATOM 9036  C CG    . HIS E 4 49  ? 122.964 201.627 143.484 1.00 38.47  ? 49  HIS E CG    1 
ATOM 9037  N ND1   . HIS E 4 49  ? 123.560 202.396 142.514 1.00 38.47  ? 49  HIS E ND1   1 
ATOM 9038  C CD2   . HIS E 4 49  ? 123.369 200.356 143.261 1.00 38.47  ? 49  HIS E CD2   1 
ATOM 9039  C CE1   . HIS E 4 49  ? 124.337 201.634 141.768 1.00 38.47  ? 49  HIS E CE1   1 
ATOM 9040  N NE2   . HIS E 4 49  ? 124.233 200.389 142.196 1.00 38.47  ? 49  HIS E NE2   1 
ATOM 9041  N N     . GLU E 4 50  ? 120.748 203.769 146.890 1.00 41.72  ? 50  GLU E N     1 
ATOM 9042  C CA    . GLU E 4 50  ? 119.771 204.730 147.388 1.00 41.72  ? 50  GLU E CA    1 
ATOM 9043  C C     . GLU E 4 50  ? 120.440 205.936 148.026 1.00 41.72  ? 50  GLU E C     1 
ATOM 9044  O O     . GLU E 4 50  ? 119.967 207.063 147.866 1.00 41.72  ? 50  GLU E O     1 
ATOM 9045  C CB    . GLU E 4 50  ? 118.760 204.103 148.332 1.00 41.72  ? 50  GLU E CB    1 
ATOM 9046  C CG    . GLU E 4 50  ? 117.507 204.951 148.299 1.00 41.72  ? 50  GLU E CG    1 
ATOM 9047  C CD    . GLU E 4 50  ? 116.245 204.199 148.563 1.00 41.72  ? 50  GLU E CD    1 
ATOM 9048  O OE1   . GLU E 4 50  ? 116.269 202.968 148.406 1.00 41.72  ? 50  GLU E OE1   1 
ATOM 9049  O OE2   . GLU E 4 50  ? 115.221 204.836 148.888 1.00 41.72  ? 50  GLU E OE2   1 
ATOM 9050  N N     . VAL E 4 51  ? 121.510 205.724 148.788 1.00 41.01  ? 51  VAL E N     1 
ATOM 9051  C CA    . VAL E 4 51  ? 122.177 206.853 149.428 1.00 41.01  ? 51  VAL E CA    1 
ATOM 9052  C C     . VAL E 4 51  ? 122.774 207.792 148.390 1.00 41.01  ? 51  VAL E C     1 
ATOM 9053  O O     . VAL E 4 51  ? 122.568 209.008 148.449 1.00 41.01  ? 51  VAL E O     1 
ATOM 9054  C CB    . VAL E 4 51  ? 123.257 206.358 150.405 1.00 41.01  ? 51  VAL E CB    1 
ATOM 9055  C CG1   . VAL E 4 51  ? 124.218 207.472 150.740 1.00 41.01  ? 51  VAL E CG1   1 
ATOM 9056  C CG2   . VAL E 4 51  ? 122.630 205.845 151.661 1.00 41.01  ? 51  VAL E CG2   1 
ATOM 9057  N N     . GLU E 4 52  ? 123.497 207.253 147.405 1.00 48.85  ? 52  GLU E N     1 
ATOM 9058  C CA    . GLU E 4 52  ? 124.050 208.131 146.373 1.00 48.85  ? 52  GLU E CA    1 
ATOM 9059  C C     . GLU E 4 52  ? 122.946 208.813 145.570 1.00 48.85  ? 52  GLU E C     1 
ATOM 9060  O O     . GLU E 4 52  ? 123.051 209.997 145.233 1.00 48.85  ? 52  GLU E O     1 
ATOM 9061  C CB    . GLU E 4 52  ? 124.998 207.367 145.444 1.00 48.85  ? 52  GLU E CB    1 
ATOM 9062  C CG    . GLU E 4 52  ? 124.432 206.155 144.763 1.00 48.85  ? 52  GLU E CG    1 
ATOM 9063  C CD    . GLU E 4 52  ? 125.344 205.637 143.673 1.00 48.85  ? 52  GLU E CD    1 
ATOM 9064  O OE1   . GLU E 4 52  ? 126.422 206.237 143.467 1.00 48.85  ? 52  GLU E OE1   1 
ATOM 9065  O OE2   . GLU E 4 52  ? 124.985 204.637 143.016 1.00 48.85  ? 52  GLU E OE2   1 
ATOM 9066  N N     . ALA E 4 53  ? 121.862 208.091 145.287 1.00 45.48  ? 53  ALA E N     1 
ATOM 9067  C CA    . ALA E 4 53  ? 120.771 208.663 144.508 1.00 45.48  ? 53  ALA E CA    1 
ATOM 9068  C C     . ALA E 4 53  ? 120.027 209.747 145.268 1.00 45.48  ? 53  ALA E C     1 
ATOM 9069  O O     . ALA E 4 53  ? 119.570 210.722 144.667 1.00 45.48  ? 53  ALA E O     1 
ATOM 9070  C CB    . ALA E 4 53  ? 119.799 207.560 144.092 1.00 45.48  ? 53  ALA E CB    1 
ATOM 9071  N N     . ARG E 4 54  ? 119.915 209.612 146.578 1.00 44.47  ? 54  ARG E N     1 
ATOM 9072  C CA    . ARG E 4 54  ? 119.162 210.543 147.400 1.00 44.47  ? 54  ARG E CA    1 
ATOM 9073  C C     . ARG E 4 54  ? 119.980 211.740 147.826 1.00 44.47  ? 54  ARG E C     1 
ATOM 9074  O O     . ARG E 4 54  ? 119.440 212.840 147.962 1.00 44.47  ? 54  ARG E O     1 
ATOM 9075  C CB    . ARG E 4 54  ? 118.638 209.837 148.645 1.00 44.47  ? 54  ARG E CB    1 
ATOM 9076  C CG    . ARG E 4 54  ? 117.692 210.660 149.474 1.00 44.47  ? 54  ARG E CG    1 
ATOM 9077  C CD    . ARG E 4 54  ? 117.234 209.885 150.691 1.00 44.47  ? 54  ARG E CD    1 
ATOM 9078  N NE    . ARG E 4 54  ? 116.460 210.730 151.591 1.00 44.47  ? 54  ARG E NE    1 
ATOM 9079  C CZ    . ARG E 4 54  ? 115.167 210.985 151.444 1.00 44.47  ? 54  ARG E CZ    1 
ATOM 9080  N NH1   . ARG E 4 54  ? 114.503 210.463 150.424 1.00 44.47  ? 54  ARG E NH1   1 
ATOM 9081  N NH2   . ARG E 4 54  ? 114.539 211.769 152.309 1.00 44.47  ? 54  ARG E NH2   1 
ATOM 9082  N N     . LEU E 4 55  ? 121.264 211.549 148.045 1.00 50.31  ? 55  LEU E N     1 
ATOM 9083  C CA    . LEU E 4 55  ? 122.127 212.622 148.493 1.00 50.31  ? 55  LEU E CA    1 
ATOM 9084  C C     . LEU E 4 55  ? 122.803 213.348 147.335 1.00 50.31  ? 55  LEU E C     1 
ATOM 9085  O O     . LEU E 4 55  ? 123.490 214.348 147.560 1.00 50.31  ? 55  LEU E O     1 
ATOM 9086  C CB    . LEU E 4 55  ? 123.126 212.041 149.487 1.00 50.31  ? 55  LEU E CB    1 
ATOM 9087  C CG    . LEU E 4 55  ? 123.865 212.978 150.411 1.00 50.31  ? 55  LEU E CG    1 
ATOM 9088  C CD1   . LEU E 4 55  ? 122.830 213.771 151.161 1.00 50.31  ? 55  LEU E CD1   1 
ATOM 9089  C CD2   . LEU E 4 55  ? 124.623 212.119 151.373 1.00 50.31  ? 55  LEU E CD2   1 
ATOM 9090  N N     . GLY E 4 56  ? 122.630 212.850 146.110 1.00 53.31  ? 56  GLY E N     1 
ATOM 9091  C CA    . GLY E 4 56  ? 123.076 213.487 144.888 1.00 53.31  ? 56  GLY E CA    1 
ATOM 9092  C C     . GLY E 4 56  ? 124.493 213.202 144.437 1.00 53.31  ? 56  GLY E C     1 
ATOM 9093  O O     . GLY E 4 56  ? 124.782 213.351 143.246 1.00 53.31  ? 56  GLY E O     1 
ATOM 9094  N N     . ASP E 4 57  ? 125.391 212.825 145.332 1.00 56.98  ? 57  ASP E N     1 
ATOM 9095  C CA    . ASP E 4 57  ? 126.758 212.515 144.939 1.00 56.98  ? 57  ASP E CA    1 
ATOM 9096  C C     . ASP E 4 57  ? 126.823 211.049 144.536 1.00 56.98  ? 57  ASP E C     1 
ATOM 9097  O O     . ASP E 4 57  ? 126.419 210.174 145.303 1.00 56.98  ? 57  ASP E O     1 
ATOM 9098  C CB    . ASP E 4 57  ? 127.743 212.856 146.050 1.00 56.98  ? 57  ASP E CB    1 
ATOM 9099  C CG    . ASP E 4 57  ? 127.378 212.240 147.359 1.00 56.98  ? 57  ASP E CG    1 
ATOM 9100  O OD1   . ASP E 4 57  ? 126.224 211.794 147.515 1.00 56.98  ? 57  ASP E OD1   1 
ATOM 9101  O OD2   . ASP E 4 57  ? 128.241 212.255 148.252 1.00 56.98  ? 57  ASP E OD2   1 
ATOM 9102  N N     . LYS E 4 58  ? 127.334 210.781 143.341 1.00 58.77  ? 58  LYS E N     1 
ATOM 9103  C CA    . LYS E 4 58  ? 127.377 209.432 142.798 1.00 58.77  ? 58  LYS E CA    1 
ATOM 9104  C C     . LYS E 4 58  ? 128.817 208.962 142.695 1.00 58.77  ? 58  LYS E C     1 
ATOM 9105  O O     . LYS E 4 58  ? 129.673 209.664 142.148 1.00 58.77  ? 58  LYS E O     1 
ATOM 9106  C CB    . LYS E 4 58  ? 126.695 209.373 141.436 1.00 58.77  ? 58  LYS E CB    1 
ATOM 9107  C CG    . LYS E 4 58  ? 125.210 209.640 141.511 1.00 58.77  ? 58  LYS E CG    1 
ATOM 9108  C CD    . LYS E 4 58  ? 124.538 209.500 140.161 1.00 58.77  ? 58  LYS E CD    1 
ATOM 9109  C CE    . LYS E 4 58  ? 124.460 208.066 139.701 1.00 58.77  ? 58  LYS E CE    1 
ATOM 9110  N NZ    . LYS E 4 58  ? 123.692 207.973 138.428 1.00 58.77  ? 58  LYS E NZ    1 
ATOM 9111  N N     . ALA E 4 59  ? 129.060 207.762 143.195 1.00 55.73  ? 59  ALA E N     1 
ATOM 9112  C CA    . ALA E 4 59  ? 130.348 207.102 143.116 1.00 55.73  ? 59  ALA E CA    1 
ATOM 9113  C C     . ALA E 4 59  ? 130.318 206.052 142.025 1.00 55.73  ? 59  ALA E C     1 
ATOM 9114  O O     . ALA E 4 59  ? 129.271 205.498 141.693 1.00 55.73  ? 59  ALA E O     1 
ATOM 9115  C CB    . ALA E 4 59  ? 130.711 206.445 144.446 1.00 55.73  ? 59  ALA E CB    1 
ATOM 9116  N N     . VAL E 4 60  ? 131.484 205.790 141.460 1.00 53.76  ? 60  VAL E N     1 
ATOM 9117  C CA    . VAL E 4 60  ? 131.605 204.886 140.334 1.00 53.76  ? 60  VAL E CA    1 
ATOM 9118  C C     . VAL E 4 60  ? 132.696 203.879 140.632 1.00 53.76  ? 60  VAL E C     1 
ATOM 9119  O O     . VAL E 4 60  ? 133.850 204.260 140.874 1.00 53.76  ? 60  VAL E O     1 
ATOM 9120  C CB    . VAL E 4 60  ? 131.912 205.643 139.039 1.00 53.76  ? 60  VAL E CB    1 
ATOM 9121  C CG1   . VAL E 4 60  ? 132.317 204.680 137.972 1.00 53.76  ? 60  VAL E CG1   1 
ATOM 9122  C CG2   . VAL E 4 60  ? 130.694 206.418 138.605 1.00 53.76  ? 60  VAL E CG2   1 
ATOM 9123  N N     . ARG E 4 61  ? 132.304 202.618 140.728 1.00 53.48  ? 61  ARG E N     1 
ATOM 9124  C CA    . ARG E 4 61  ? 133.213 201.499 140.917 1.00 53.48  ? 61  ARG E CA    1 
ATOM 9125  C C     . ARG E 4 61  ? 133.336 200.852 139.549 1.00 53.48  ? 61  ARG E C     1 
ATOM 9126  O O     . ARG E 4 61  ? 132.452 200.105 139.131 1.00 53.48  ? 61  ARG E O     1 
ATOM 9127  C CB    . ARG E 4 61  ? 132.670 200.517 141.948 1.00 53.48  ? 61  ARG E CB    1 
ATOM 9128  C CG    . ARG E 4 61  ? 133.537 199.306 142.197 1.00 53.48  ? 61  ARG E CG    1 
ATOM 9129  C CD    . ARG E 4 61  ? 132.892 198.395 143.213 1.00 53.48  ? 61  ARG E CD    1 
ATOM 9130  N NE    . ARG E 4 61  ? 132.593 199.129 144.429 1.00 53.48  ? 61  ARG E NE    1 
ATOM 9131  C CZ    . ARG E 4 61  ? 133.469 199.340 145.401 1.00 53.48  ? 61  ARG E CZ    1 
ATOM 9132  N NH1   . ARG E 4 61  ? 134.700 198.869 145.296 1.00 53.48  ? 61  ARG E NH1   1 
ATOM 9133  N NH2   . ARG E 4 61  ? 133.115 200.034 146.475 1.00 53.48  ? 61  ARG E NH2   1 
ATOM 9134  N N     . THR E 4 62  ? 134.433 201.119 138.856 1.00 56.60  ? 62  THR E N     1 
ATOM 9135  C CA    . THR E 4 62  ? 134.571 200.669 137.488 1.00 56.60  ? 62  THR E CA    1 
ATOM 9136  C C     . THR E 4 62  ? 135.984 200.190 137.245 1.00 56.60  ? 62  THR E C     1 
ATOM 9137  O O     . THR E 4 62  ? 136.951 200.718 137.798 1.00 56.60  ? 62  THR E O     1 
ATOM 9138  C CB    . THR E 4 62  ? 134.245 201.766 136.492 1.00 56.60  ? 62  THR E CB    1 
ATOM 9139  O OG1   . THR E 4 62  ? 134.390 201.250 135.166 1.00 56.60  ? 62  THR E OG1   1 
ATOM 9140  C CG2   . THR E 4 62  ? 135.172 202.942 136.682 1.00 56.60  ? 62  THR E CG2   1 
ATOM 9141  N N     . ARG E 4 63  ? 136.084 199.183 136.397 1.00 61.23  ? 63  ARG E N     1 
ATOM 9142  C CA    . ARG E 4 63  ? 137.352 198.669 135.921 1.00 61.23  ? 63  ARG E CA    1 
ATOM 9143  C C     . ARG E 4 63  ? 137.812 199.307 134.628 1.00 61.23  ? 63  ARG E C     1 
ATOM 9144  O O     . ARG E 4 63  ? 138.976 199.143 134.253 1.00 61.23  ? 63  ARG E O     1 
ATOM 9145  C CB    . ARG E 4 63  ? 137.245 197.157 135.742 1.00 61.23  ? 63  ARG E CB    1 
ATOM 9146  C CG    . ARG E 4 63  ? 138.558 196.460 135.686 1.00 61.23  ? 63  ARG E CG    1 
ATOM 9147  C CD    . ARG E 4 63  ? 138.361 194.982 135.608 1.00 61.23  ? 63  ARG E CD    1 
ATOM 9148  N NE    . ARG E 4 63  ? 137.703 194.491 136.810 1.00 61.23  ? 63  ARG E NE    1 
ATOM 9149  C CZ    . ARG E 4 63  ? 136.530 193.873 136.814 1.00 61.23  ? 63  ARG E CZ    1 
ATOM 9150  N NH1   . ARG E 4 63  ? 135.890 193.691 135.672 1.00 61.23  ? 63  ARG E NH1   1 
ATOM 9151  N NH2   . ARG E 4 63  ? 135.996 193.447 137.950 1.00 61.23  ? 63  ARG E NH2   1 
ATOM 9152  N N     . ARG E 4 64  ? 136.955 200.056 133.956 1.00 60.83  ? 64  ARG E N     1 
ATOM 9153  C CA    . ARG E 4 64  ? 137.294 200.656 132.675 1.00 60.83  ? 64  ARG E CA    1 
ATOM 9154  C C     . ARG E 4 64  ? 137.175 202.168 132.783 1.00 60.83  ? 64  ARG E C     1 
ATOM 9155  O O     . ARG E 4 64  ? 136.296 202.794 132.191 1.00 60.83  ? 64  ARG E O     1 
ATOM 9156  C CB    . ARG E 4 64  ? 136.422 200.083 131.602 1.00 60.83  ? 64  ARG E CB    1 
ATOM 9157  C CG    . ARG E 4 64  ? 134.968 200.084 131.948 1.00 60.83  ? 64  ARG E CG    1 
ATOM 9158  C CD    . ARG E 4 64  ? 134.169 199.469 130.833 1.00 60.83  ? 64  ARG E CD    1 
ATOM 9159  N NE    . ARG E 4 64  ? 134.483 198.067 130.648 1.00 60.83  ? 64  ARG E NE    1 
ATOM 9160  C CZ    . ARG E 4 64  ? 133.775 197.089 131.197 1.00 60.83  ? 64  ARG E CZ    1 
ATOM 9161  N NH1   . ARG E 4 64  ? 132.730 197.381 131.954 1.00 60.83  ? 64  ARG E NH1   1 
ATOM 9162  N NH2   . ARG E 4 64  ? 134.113 195.832 130.990 1.00 60.83  ? 64  ARG E NH2   1 
ATOM 9163  N N     . ILE E 4 65  ? 138.077 202.746 133.569 1.00 67.85  ? 65  ILE E N     1 
ATOM 9164  C CA    . ILE E 4 65  ? 138.109 204.190 133.749 1.00 67.85  ? 65  ILE E CA    1 
ATOM 9165  C C     . ILE E 4 65  ? 138.687 204.870 132.518 1.00 67.85  ? 65  ILE E C     1 
ATOM 9166  O O     . ILE E 4 65  ? 138.232 205.949 132.120 1.00 67.85  ? 65  ILE E O     1 
ATOM 9167  C CB    . ILE E 4 65  ? 138.880 204.551 135.025 1.00 67.85  ? 65  ILE E CB    1 
ATOM 9168  C CG1   . ILE E 4 65  ? 138.680 206.022 135.343 1.00 67.85  ? 65  ILE E CG1   1 
ATOM 9169  C CG2   . ILE E 4 65  ? 140.338 204.212 134.891 1.00 67.85  ? 65  ILE E CG2   1 
ATOM 9170  C CD1   . ILE E 4 65  ? 137.479 206.266 136.180 1.00 67.85  ? 65  ILE E CD1   1 
ATOM 9171  N N     . ILE E 4 66  ? 139.679 204.243 131.883 1.00 74.76  ? 66  ILE E N     1 
ATOM 9172  C CA    . ILE E 4 66  ? 140.323 204.826 130.711 1.00 74.76  ? 66  ILE E CA    1 
ATOM 9173  C C     . ILE E 4 66  ? 139.288 205.144 129.651 1.00 74.76  ? 66  ILE E C     1 
ATOM 9174  O O     . ILE E 4 66  ? 139.319 206.206 129.028 1.00 74.76  ? 66  ILE E O     1 
ATOM 9175  C CB    . ILE E 4 66  ? 141.384 203.867 130.155 1.00 74.76  ? 66  ILE E CB    1 
ATOM 9176  C CG1   . ILE E 4 66  ? 142.486 203.628 131.165 1.00 74.76  ? 66  ILE E CG1   1 
ATOM 9177  C CG2   . ILE E 4 66  ? 141.988 204.449 128.909 1.00 74.76  ? 66  ILE E CG2   1 
ATOM 9178  C CD1   . ILE E 4 66  ? 143.493 202.636 130.680 1.00 74.76  ? 66  ILE E CD1   1 
ATOM 9179  N N     . SER E 4 67  ? 138.374 204.211 129.410 1.00 78.90  ? 67  SER E N     1 
ATOM 9180  C CA    . SER E 4 67  ? 137.336 204.440 128.417 1.00 78.90  ? 67  SER E CA    1 
ATOM 9181  C C     . SER E 4 67  ? 136.467 205.636 128.770 1.00 78.90  ? 67  SER E C     1 
ATOM 9182  O O     . SER E 4 67  ? 136.122 206.434 127.894 1.00 78.90  ? 67  SER E O     1 
ATOM 9183  C CB    . SER E 4 67  ? 136.482 203.186 128.261 1.00 78.90  ? 67  SER E CB    1 
ATOM 9184  O OG    . SER E 4 67  ? 135.421 203.410 127.357 1.00 78.90  ? 67  SER E OG    1 
ATOM 9185  N N     . GLU E 4 68  ? 136.105 205.794 130.043 1.00 79.05  ? 68  GLU E N     1 
ATOM 9186  C CA    . GLU E 4 68  ? 135.226 206.900 130.404 1.00 79.05  ? 68  GLU E CA    1 
ATOM 9187  C C     . GLU E 4 68  ? 135.957 208.233 130.293 1.00 79.05  ? 68  GLU E C     1 
ATOM 9188  O O     . GLU E 4 68  ? 135.440 209.189 129.700 1.00 79.05  ? 68  GLU E O     1 
ATOM 9189  C CB    . GLU E 4 68  ? 134.671 206.680 131.808 1.00 79.05  ? 68  GLU E CB    1 
ATOM 9190  C CG    . GLU E 4 68  ? 133.475 207.566 132.262 1.00 79.05  ? 68  GLU E CG    1 
ATOM 9191  C CD    . GLU E 4 68  ? 133.640 209.094 132.175 1.00 79.05  ? 68  GLU E CD    1 
ATOM 9192  O OE1   . GLU E 4 68  ? 134.765 209.619 132.277 1.00 79.05  ? 68  GLU E OE1   1 
ATOM 9193  O OE2   . GLU E 4 68  ? 132.607 209.786 132.075 1.00 79.05  ? 68  GLU E OE2   1 
ATOM 9194  N N     . ILE E 4 69  ? 137.182 208.306 130.815 1.00 79.82  ? 69  ILE E N     1 
ATOM 9195  C CA    . ILE E 4 69  ? 137.972 209.525 130.667 1.00 79.82  ? 69  ILE E CA    1 
ATOM 9196  C C     . ILE E 4 69  ? 138.186 209.833 129.194 1.00 79.82  ? 69  ILE E C     1 
ATOM 9197  O O     . ILE E 4 69  ? 138.185 210.995 128.779 1.00 79.82  ? 69  ILE E O     1 
ATOM 9198  C CB    . ILE E 4 69  ? 139.310 209.380 131.404 1.00 79.82  ? 69  ILE E CB    1 
ATOM 9199  C CG1   . ILE E 4 69  ? 139.082 209.243 132.898 1.00 79.82  ? 69  ILE E CG1   1 
ATOM 9200  C CG2   . ILE E 4 69  ? 140.147 210.602 131.187 1.00 79.82  ? 69  ILE E CG2   1 
ATOM 9201  C CD1   . ILE E 4 69  ? 140.366 209.165 133.681 1.00 79.82  ? 69  ILE E CD1   1 
ATOM 9202  N N     . ALA E 4 70  ? 138.358 208.792 128.384 1.00 80.45  ? 70  ALA E N     1 
ATOM 9203  C CA    . ALA E 4 70  ? 138.453 208.968 126.944 1.00 80.45  ? 70  ALA E CA    1 
ATOM 9204  C C     . ALA E 4 70  ? 137.181 209.578 126.392 1.00 80.45  ? 70  ALA E C     1 
ATOM 9205  O O     . ALA E 4 70  ? 137.230 210.439 125.508 1.00 80.45  ? 70  ALA E O     1 
ATOM 9206  C CB    . ALA E 4 70  ? 138.754 207.635 126.269 1.00 80.45  ? 70  ALA E CB    1 
ATOM 9207  N N     . LYS E 4 71  ? 136.029 209.165 126.913 1.00 83.36  ? 71  LYS E N     1 
ATOM 9208  C CA    . LYS E 4 71  ? 134.792 209.776 126.456 1.00 83.36  ? 71  LYS E CA    1 
ATOM 9209  C C     . LYS E 4 71  ? 134.743 211.251 126.818 1.00 83.36  ? 71  LYS E C     1 
ATOM 9210  O O     . LYS E 4 71  ? 134.343 212.083 125.995 1.00 83.36  ? 71  LYS E O     1 
ATOM 9211  C CB    . LYS E 4 71  ? 133.587 209.064 127.057 1.00 83.36  ? 71  LYS E CB    1 
ATOM 9212  C CG    . LYS E 4 71  ? 132.285 209.682 126.601 1.00 83.36  ? 71  LYS E CG    1 
ATOM 9213  C CD    . LYS E 4 71  ? 131.075 208.956 127.144 1.00 83.36  ? 71  LYS E CD    1 
ATOM 9214  C CE    . LYS E 4 71  ? 130.914 209.228 128.622 1.00 83.36  ? 71  LYS E CE    1 
ATOM 9215  N NZ    . LYS E 4 71  ? 130.549 210.657 128.825 1.00 83.36  ? 71  LYS E NZ    1 
ATOM 9216  N N     . ARG E 4 72  ? 135.155 211.607 128.033 1.00 83.56  ? 72  ARG E N     1 
ATOM 9217  C CA    . ARG E 4 72  ? 135.148 213.023 128.384 1.00 83.56  ? 72  ARG E CA    1 
ATOM 9218  C C     . ARG E 4 72  ? 136.113 213.823 127.526 1.00 83.56  ? 72  ARG E C     1 
ATOM 9219  O O     . ARG E 4 72  ? 135.783 214.923 127.075 1.00 83.56  ? 72  ARG E O     1 
ATOM 9220  C CB    . ARG E 4 72  ? 135.374 213.240 129.869 1.00 83.56  ? 72  ARG E CB    1 
ATOM 9221  C CG    . ARG E 4 72  ? 134.291 212.523 130.609 1.00 83.56  ? 72  ARG E CG    1 
ATOM 9222  C CD    . ARG E 4 72  ? 134.234 212.845 132.063 1.00 83.56  ? 72  ARG E CD    1 
ATOM 9223  N NE    . ARG E 4 72  ? 133.178 212.059 132.676 1.00 83.56  ? 72  ARG E NE    1 
ATOM 9224  C CZ    . ARG E 4 72  ? 132.821 212.147 133.946 1.00 83.56  ? 72  ARG E CZ    1 
ATOM 9225  N NH1   . ARG E 4 72  ? 133.433 212.999 134.755 1.00 83.56  ? 72  ARG E NH1   1 
ATOM 9226  N NH2   . ARG E 4 72  ? 131.850 211.375 134.402 1.00 83.56  ? 72  ARG E NH2   1 
ATOM 9227  N N     . LEU E 4 73  ? 137.324 213.321 127.315 1.00 89.53  ? 73  LEU E N     1 
ATOM 9228  C CA    . LEU E 4 73  ? 138.218 214.095 126.469 1.00 89.53  ? 73  LEU E CA    1 
ATOM 9229  C C     . LEU E 4 73  ? 137.670 214.199 125.057 1.00 89.53  ? 73  LEU E C     1 
ATOM 9230  O O     . LEU E 4 73  ? 137.875 215.218 124.390 1.00 89.53  ? 73  LEU E O     1 
ATOM 9231  C CB    . LEU E 4 73  ? 139.613 213.485 126.449 1.00 89.53  ? 73  LEU E CB    1 
ATOM 9232  C CG    . LEU E 4 73  ? 140.374 213.596 127.761 1.00 89.53  ? 73  LEU E CG    1 
ATOM 9233  C CD1   . LEU E 4 73  ? 141.779 213.050 127.603 1.00 89.53  ? 73  LEU E CD1   1 
ATOM 9234  C CD2   . LEU E 4 73  ? 140.396 215.036 128.223 1.00 89.53  ? 73  LEU E CD2   1 
ATOM 9235  N N     . ARG E 4 74  ? 136.952 213.179 124.586 1.00 88.85  ? 74  ARG E N     1 
ATOM 9236  C CA    . ARG E 4 74  ? 136.349 213.308 123.267 1.00 88.85  ? 74  ARG E CA    1 
ATOM 9237  C C     . ARG E 4 74  ? 135.248 214.354 123.250 1.00 88.85  ? 74  ARG E C     1 
ATOM 9238  O O     . ARG E 4 74  ? 135.065 215.040 122.239 1.00 88.85  ? 74  ARG E O     1 
ATOM 9239  C CB    . ARG E 4 74  ? 135.795 211.973 122.791 1.00 88.85  ? 74  ARG E CB    1 
ATOM 9240  C CG    . ARG E 4 74  ? 135.364 212.018 121.343 1.00 88.85  ? 74  ARG E CG    1 
ATOM 9241  C CD    . ARG E 4 74  ? 134.889 210.673 120.853 1.00 88.85  ? 74  ARG E CD    1 
ATOM 9242  N NE    . ARG E 4 74  ? 135.934 209.665 120.970 1.00 88.85  ? 74  ARG E NE    1 
ATOM 9243  C CZ    . ARG E 4 74  ? 135.964 208.740 121.920 1.00 88.85  ? 74  ARG E CZ    1 
ATOM 9244  N NH1   . ARG E 4 74  ? 135.013 208.714 122.842 1.00 88.85  ? 74  ARG E NH1   1 
ATOM 9245  N NH2   . ARG E 4 74  ? 136.949 207.858 121.961 1.00 88.85  ? 74  ARG E NH2   1 
ATOM 9246  N N     . GLU E 4 75  ? 134.509 214.505 124.347 1.00 91.32  ? 75  GLU E N     1 
ATOM 9247  C CA    . GLU E 4 75  ? 133.521 215.577 124.401 1.00 91.32  ? 75  GLU E CA    1 
ATOM 9248  C C     . GLU E 4 75  ? 134.178 216.929 124.643 1.00 91.32  ? 75  GLU E C     1 
ATOM 9249  O O     . GLU E 4 75  ? 133.528 217.960 124.453 1.00 91.32  ? 75  GLU E O     1 
ATOM 9250  C CB    . GLU E 4 75  ? 132.421 215.288 125.428 1.00 91.32  ? 75  GLU E CB    1 
ATOM 9251  C CG    . GLU E 4 75  ? 132.857 215.125 126.858 1.00 91.32  ? 75  GLU E CG    1 
ATOM 9252  C CD    . GLU E 4 75  ? 132.884 216.422 127.637 1.00 91.32  ? 75  GLU E CD    1 
ATOM 9253  O OE1   . GLU E 4 75  ? 132.672 217.495 127.037 1.00 91.32  ? 75  GLU E OE1   1 
ATOM 9254  O OE2   . GLU E 4 75  ? 133.152 216.367 128.856 1.00 91.32  ? 75  GLU E OE2   1 
ATOM 9255  N N     . ARG E 4 76  ? 135.442 216.948 125.053 1.00 90.16  ? 76  ARG E N     1 
ATOM 9256  C CA    . ARG E 4 76  ? 136.168 218.197 125.241 1.00 90.16  ? 76  ARG E CA    1 
ATOM 9257  C C     . ARG E 4 76  ? 136.776 218.726 123.950 1.00 90.16  ? 76  ARG E C     1 
ATOM 9258  O O     . ARG E 4 76  ? 137.404 219.787 123.964 1.00 90.16  ? 76  ARG E O     1 
ATOM 9259  C CB    . ARG E 4 76  ? 137.273 218.010 126.276 1.00 90.16  ? 76  ARG E CB    1 
ATOM 9260  C CG    . ARG E 4 76  ? 136.751 217.819 127.676 1.00 90.16  ? 76  ARG E CG    1 
ATOM 9261  C CD    . ARG E 4 76  ? 137.878 217.665 128.668 1.00 90.16  ? 76  ARG E CD    1 
ATOM 9262  N NE    . ARG E 4 76  ? 137.381 217.513 130.032 1.00 90.16  ? 76  ARG E NE    1 
ATOM 9263  C CZ    . ARG E 4 76  ? 137.167 218.523 130.868 1.00 90.16  ? 76  ARG E CZ    1 
ATOM 9264  N NH1   . ARG E 4 76  ? 137.405 219.767 130.480 1.00 90.16  ? 76  ARG E NH1   1 
ATOM 9265  N NH2   . ARG E 4 76  ? 136.718 218.292 132.094 1.00 90.16  ? 76  ARG E NH2   1 
ATOM 9266  N N     . GLY E 4 77  ? 136.632 217.998 122.851 1.00 96.12  ? 77  GLY E N     1 
ATOM 9267  C CA    . GLY E 4 77  ? 137.058 218.427 121.538 1.00 96.12  ? 77  GLY E CA    1 
ATOM 9268  C C     . GLY E 4 77  ? 138.266 217.716 120.990 1.00 96.12  ? 77  GLY E C     1 
ATOM 9269  O O     . GLY E 4 77  ? 138.742 218.078 119.909 1.00 96.12  ? 77  GLY E O     1 
ATOM 9270  N N     . TRP E 4 78  ? 138.777 216.721 121.694 1.00 95.79  ? 78  TRP E N     1 
ATOM 9271  C CA    . TRP E 4 78  ? 139.898 215.916 121.246 1.00 95.79  ? 78  TRP E CA    1 
ATOM 9272  C C     . TRP E 4 78  ? 139.454 214.903 120.204 1.00 95.79  ? 78  TRP E C     1 
ATOM 9273  O O     . TRP E 4 78  ? 138.317 214.429 120.218 1.00 95.79  ? 78  TRP E O     1 
ATOM 9274  C CB    . TRP E 4 78  ? 140.519 215.242 122.455 1.00 95.79  ? 78  TRP E CB    1 
ATOM 9275  C CG    . TRP E 4 78  ? 141.286 216.179 123.321 1.00 95.79  ? 78  TRP E CG    1 
ATOM 9276  C CD1   . TRP E 4 78  ? 140.816 217.292 123.950 1.00 95.79  ? 78  TRP E CD1   1 
ATOM 9277  C CD2   . TRP E 4 78  ? 142.588 215.947 123.840 1.00 95.79  ? 78  TRP E CD2   1 
ATOM 9278  N NE1   . TRP E 4 78  ? 141.803 217.848 124.721 1.00 95.79  ? 78  TRP E NE1   1 
ATOM 9279  C CE2   . TRP E 4 78  ? 142.896 217.024 124.685 1.00 95.79  ? 78  TRP E CE2   1 
ATOM 9280  C CE3   . TRP E 4 78  ? 143.541 214.958 123.633 1.00 95.79  ? 78  TRP E CE3   1 
ATOM 9281  C CZ2   . TRP E 4 78  ? 144.117 217.135 125.324 1.00 95.79  ? 78  TRP E CZ2   1 
ATOM 9282  C CZ3   . TRP E 4 78  ? 144.746 215.068 124.260 1.00 95.79  ? 78  TRP E CZ3   1 
ATOM 9283  C CH2   . TRP E 4 78  ? 145.030 216.145 125.100 1.00 95.79  ? 78  TRP E CH2   1 
ATOM 9284  N N     . ASP E 4 79  ? 140.367 214.548 119.311 1.00 100.46 ? 79  ASP E N     1 
ATOM 9285  C CA    . ASP E 4 79  ? 140.078 213.446 118.413 1.00 100.46 ? 79  ASP E CA    1 
ATOM 9286  C C     . ASP E 4 79  ? 140.152 212.151 119.214 1.00 100.46 ? 79  ASP E C     1 
ATOM 9287  O O     . ASP E 4 79  ? 140.760 212.092 120.290 1.00 100.46 ? 79  ASP E O     1 
ATOM 9288  C CB    . ASP E 4 79  ? 141.001 213.443 117.200 1.00 100.46 ? 79  ASP E CB    1 
ATOM 9289  C CG    . ASP E 4 79  ? 142.456 213.359 117.564 1.00 100.46 ? 79  ASP E CG    1 
ATOM 9290  O OD1   . ASP E 4 79  ? 142.744 212.984 118.711 1.00 100.46 ? 79  ASP E OD1   1 
ATOM 9291  O OD2   . ASP E 4 79  ? 143.309 213.663 116.704 1.00 100.46 ? 79  ASP E OD2   1 
ATOM 9292  N N     . ALA E 4 80  ? 139.503 211.112 118.700 1.00 97.68  ? 80  ALA E N     1 
ATOM 9293  C CA    . ALA E 4 80  ? 139.410 209.863 119.450 1.00 97.68  ? 80  ALA E CA    1 
ATOM 9294  C C     . ALA E 4 80  ? 140.777 209.292 119.827 1.00 97.68  ? 80  ALA E C     1 
ATOM 9295  O O     . ALA E 4 80  ? 140.989 208.900 120.982 1.00 97.68  ? 80  ALA E O     1 
ATOM 9296  C CB    . ALA E 4 80  ? 138.616 208.835 118.639 1.00 97.68  ? 80  ALA E CB    1 
ATOM 9297  N N     . ASP E 4 81  ? 141.733 209.265 118.892 1.00 95.76  ? 81  ASP E N     1 
ATOM 9298  C CA    . ASP E 4 81  ? 143.031 208.689 119.237 1.00 95.76  ? 81  ASP E CA    1 
ATOM 9299  C C     . ASP E 4 81  ? 143.792 209.496 120.290 1.00 95.76  ? 81  ASP E C     1 
ATOM 9300  O O     . ASP E 4 81  ? 144.419 208.909 121.182 1.00 95.76  ? 81  ASP E O     1 
ATOM 9301  C CB    . ASP E 4 81  ? 143.888 208.519 117.991 1.00 95.76  ? 81  ASP E CB    1 
ATOM 9302  C CG    . ASP E 4 81  ? 145.086 207.631 118.245 1.00 95.76  ? 81  ASP E CG    1 
ATOM 9303  O OD1   . ASP E 4 81  ? 144.898 206.400 118.327 1.00 95.76  ? 81  ASP E OD1   1 
ATOM 9304  O OD2   . ASP E 4 81  ? 146.206 208.157 118.392 1.00 95.76  ? 81  ASP E OD2   1 
ATOM 9305  N N     . LEU E 4 82  ? 143.747 210.828 120.232 1.00 95.39  ? 82  LEU E N     1 
ATOM 9306  C CA    . LEU E 4 82  ? 144.439 211.587 121.273 1.00 95.39  ? 82  LEU E CA    1 
ATOM 9307  C C     . LEU E 4 82  ? 143.728 211.465 122.607 1.00 95.39  ? 82  LEU E C     1 
ATOM 9308  O O     . LEU E 4 82  ? 144.369 211.561 123.659 1.00 95.39  ? 82  LEU E O     1 
ATOM 9309  C CB    . LEU E 4 82  ? 144.636 213.047 120.880 1.00 95.39  ? 82  LEU E CB    1 
ATOM 9310  C CG    . LEU E 4 82  ? 145.809 213.331 119.932 1.00 95.39  ? 82  LEU E CG    1 
ATOM 9311  C CD1   . LEU E 4 82  ? 145.710 212.690 118.554 1.00 95.39  ? 82  LEU E CD1   1 
ATOM 9312  C CD2   . LEU E 4 82  ? 145.989 214.839 119.799 1.00 95.39  ? 82  LEU E CD2   1 
ATOM 9313  N N     . ALA E 4 83  ? 142.410 211.298 122.590 1.00 91.99  ? 83  ALA E N     1 
ATOM 9314  C CA    . ALA E 4 83  ? 141.702 211.110 123.846 1.00 91.99  ? 83  ALA E CA    1 
ATOM 9315  C C     . ALA E 4 83  ? 142.109 209.788 124.473 1.00 91.99  ? 83  ALA E C     1 
ATOM 9316  O O     . ALA E 4 83  ? 142.392 209.718 125.676 1.00 91.99  ? 83  ALA E O     1 
ATOM 9317  C CB    . ALA E 4 83  ? 140.196 211.165 123.617 1.00 91.99  ? 83  ALA E CB    1 
ATOM 9318  N N     . ASP E 4 84  ? 142.205 208.742 123.655 1.00 89.01  ? 84  ASP E N     1 
ATOM 9319  C CA    . ASP E 4 84  ? 142.619 207.443 124.166 1.00 89.01  ? 84  ASP E CA    1 
ATOM 9320  C C     . ASP E 4 84  ? 144.037 207.496 124.711 1.00 89.01  ? 84  ASP E C     1 
ATOM 9321  O O     . ASP E 4 84  ? 144.312 207.005 125.812 1.00 89.01  ? 84  ASP E O     1 
ATOM 9322  C CB    . ASP E 4 84  ? 142.515 206.401 123.058 1.00 89.01  ? 84  ASP E CB    1 
ATOM 9323  C CG    . ASP E 4 84  ? 142.763 205.005 123.558 1.00 89.01  ? 84  ASP E CG    1 
ATOM 9324  O OD1   . ASP E 4 84  ? 142.666 204.793 124.782 1.00 89.01  ? 84  ASP E OD1   1 
ATOM 9325  O OD2   . ASP E 4 84  ? 143.056 204.119 122.730 1.00 89.01  ? 84  ASP E OD2   1 
ATOM 9326  N N     . ALA E 4 85  ? 144.945 208.123 123.969 1.00 89.95  ? 85  ALA E N     1 
ATOM 9327  C CA    . ALA E 4 85  ? 146.327 208.220 124.427 1.00 89.95  ? 85  ALA E CA    1 
ATOM 9328  C C     . ALA E 4 85  ? 146.443 209.062 125.691 1.00 89.95  ? 85  ALA E C     1 
ATOM 9329  O O     . ALA E 4 85  ? 147.231 208.737 126.585 1.00 89.95  ? 85  ALA E O     1 
ATOM 9330  C CB    . ALA E 4 85  ? 147.204 208.793 123.319 1.00 89.95  ? 85  ALA E CB    1 
ATOM 9331  N N     . GLY E 4 86  ? 145.671 210.146 125.786 1.00 88.39  ? 86  GLY E N     1 
ATOM 9332  C CA    . GLY E 4 86  ? 145.728 210.970 126.982 1.00 88.39  ? 86  GLY E CA    1 
ATOM 9333  C C     . GLY E 4 86  ? 145.211 210.251 128.210 1.00 88.39  ? 86  GLY E C     1 
ATOM 9334  O O     . GLY E 4 86  ? 145.812 210.330 129.284 1.00 88.39  ? 86  GLY E O     1 
ATOM 9335  N N     . ALA E 4 87  ? 144.118 209.503 128.064 1.00 84.91  ? 87  ALA E N     1 
ATOM 9336  C CA    . ALA E 4 87  ? 143.619 208.753 129.207 1.00 84.91  ? 87  ALA E CA    1 
ATOM 9337  C C     . ALA E 4 87  ? 144.592 207.648 129.586 1.00 84.91  ? 87  ALA E C     1 
ATOM 9338  O O     . ALA E 4 87  ? 144.825 207.395 130.781 1.00 84.91  ? 87  ALA E O     1 
ATOM 9339  C CB    . ALA E 4 87  ? 142.242 208.177 128.896 1.00 84.91  ? 87  ALA E CB    1 
ATOM 9340  N N     . ARG E 4 88  ? 145.253 207.065 128.587 1.00 82.89  ? 88  ARG E N     1 
ATOM 9341  C CA    . ARG E 4 88  ? 146.262 206.064 128.882 1.00 82.89  ? 88  ARG E CA    1 
ATOM 9342  C C     . ARG E 4 88  ? 147.387 206.706 129.659 1.00 82.89  ? 88  ARG E C     1 
ATOM 9343  O O     . ARG E 4 88  ? 148.029 206.057 130.488 1.00 82.89  ? 88  ARG E O     1 
ATOM 9344  C CB    . ARG E 4 88  ? 146.800 205.473 127.585 1.00 82.89  ? 88  ARG E CB    1 
ATOM 9345  C CG    . ARG E 4 88  ? 145.861 204.560 126.832 1.00 82.89  ? 88  ARG E CG    1 
ATOM 9346  C CD    . ARG E 4 88  ? 146.538 204.099 125.553 1.00 82.89  ? 88  ARG E CD    1 
ATOM 9347  N NE    . ARG E 4 88  ? 145.706 203.210 124.752 1.00 82.89  ? 88  ARG E NE    1 
ATOM 9348  C CZ    . ARG E 4 88  ? 145.702 201.888 124.860 1.00 82.89  ? 88  ARG E CZ    1 
ATOM 9349  N NH1   . ARG E 4 88  ? 146.489 201.293 125.744 1.00 82.89  ? 88  ARG E NH1   1 
ATOM 9350  N NH2   . ARG E 4 88  ? 144.911 201.160 124.082 1.00 82.89  ? 88  ARG E NH2   1 
ATOM 9351  N N     . GLN E 4 89  ? 147.698 207.961 129.342 1.00 90.06  ? 89  GLN E N     1 
ATOM 9352  C CA    . GLN E 4 89  ? 148.714 208.665 130.109 1.00 90.06  ? 89  GLN E CA    1 
ATOM 9353  C C     . GLN E 4 89  ? 148.243 208.898 131.535 1.00 90.06  ? 89  GLN E C     1 
ATOM 9354  O O     . GLN E 4 89  ? 149.043 208.857 132.477 1.00 90.06  ? 89  GLN E O     1 
ATOM 9355  C CB    . GLN E 4 89  ? 149.081 209.982 129.439 1.00 90.06  ? 89  GLN E CB    1 
ATOM 9356  C CG    . GLN E 4 89  ? 149.793 209.782 128.131 1.00 90.06  ? 89  GLN E CG    1 
ATOM 9357  C CD    . GLN E 4 89  ? 151.065 208.994 128.313 1.00 90.06  ? 89  GLN E CD    1 
ATOM 9358  O OE1   . GLN E 4 89  ? 151.743 209.120 129.329 1.00 90.06  ? 89  GLN E OE1   1 
ATOM 9359  N NE2   . GLN E 4 89  ? 151.402 208.182 127.323 1.00 90.06  ? 89  GLN E NE2   1 
ATOM 9360  N N     . VAL E 4 90  ? 146.944 209.159 131.710 1.00 86.25  ? 90  VAL E N     1 
ATOM 9361  C CA    . VAL E 4 90  ? 146.403 209.381 133.047 1.00 86.25  ? 90  VAL E CA    1 
ATOM 9362  C C     . VAL E 4 90  ? 146.639 208.160 133.918 1.00 86.25  ? 90  VAL E C     1 
ATOM 9363  O O     . VAL E 4 90  ? 147.068 208.273 135.070 1.00 86.25  ? 90  VAL E O     1 
ATOM 9364  C CB    . VAL E 4 90  ? 144.912 209.740 132.986 1.00 86.25  ? 90  VAL E CB    1 
ATOM 9365  C CG1   . VAL E 4 90  ? 144.392 209.956 134.384 1.00 86.25  ? 90  VAL E CG1   1 
ATOM 9366  C CG2   . VAL E 4 90  ? 144.708 210.979 132.162 1.00 86.25  ? 90  VAL E CG2   1 
ATOM 9367  N N     . VAL E 4 91  ? 146.381 206.973 133.374 1.00 85.15  ? 91  VAL E N     1 
ATOM 9368  C CA    . VAL E 4 91  ? 146.555 205.755 134.160 1.00 85.15  ? 91  VAL E CA    1 
ATOM 9369  C C     . VAL E 4 91  ? 147.989 205.260 134.121 1.00 85.15  ? 91  VAL E C     1 
ATOM 9370  O O     . VAL E 4 91  ? 148.352 204.371 134.901 1.00 85.15  ? 91  VAL E O     1 
ATOM 9371  C CB    . VAL E 4 91  ? 145.640 204.623 133.693 1.00 85.15  ? 91  VAL E CB    1 
ATOM 9372  C CG1   . VAL E 4 91  ? 144.205 205.054 133.822 1.00 85.15  ? 91  VAL E CG1   1 
ATOM 9373  C CG2   . VAL E 4 91  ? 146.003 204.245 132.287 1.00 85.15  ? 91  VAL E CG2   1 
ATOM 9374  N N     . LEU E 4 92  ? 148.792 205.756 133.192 1.00 87.61  ? 92  LEU E N     1 
ATOM 9375  C CA    . LEU E 4 92  ? 150.179 205.341 133.095 1.00 87.61  ? 92  LEU E CA    1 
ATOM 9376  C C     . LEU E 4 92  ? 151.004 206.075 134.133 1.00 87.61  ? 92  LEU E C     1 
ATOM 9377  O O     . LEU E 4 92  ? 152.023 205.564 134.599 1.00 87.61  ? 92  LEU E O     1 
ATOM 9378  C CB    . LEU E 4 92  ? 150.710 205.601 131.686 1.00 87.61  ? 92  LEU E CB    1 
ATOM 9379  C CG    . LEU E 4 92  ? 151.907 204.791 131.191 1.00 87.61  ? 92  LEU E CG    1 
ATOM 9380  C CD1   . LEU E 4 92  ? 153.224 205.262 131.778 1.00 87.61  ? 92  LEU E CD1   1 
ATOM 9381  C CD2   . LEU E 4 92  ? 151.674 203.320 131.496 1.00 87.61  ? 92  LEU E CD2   1 
ATOM 9382  N N     . SER E 4 93  ? 150.552 207.252 134.535 1.00 88.33  ? 93  SER E N     1 
ATOM 9383  C CA    . SER E 4 93  ? 151.278 208.144 135.419 1.00 88.33  ? 93  SER E CA    1 
ATOM 9384  C C     . SER E 4 93  ? 151.159 207.762 136.890 1.00 88.33  ? 93  SER E C     1 
ATOM 9385  O O     . SER E 4 93  ? 151.505 208.579 137.747 1.00 88.33  ? 93  SER E O     1 
ATOM 9386  C CB    . SER E 4 93  ? 150.789 209.574 135.217 1.00 88.33  ? 93  SER E CB    1 
ATOM 9387  O OG    . SER E 4 93  ? 149.403 209.649 135.477 1.00 88.33  ? 93  SER E OG    1 
ATOM 9388  N N     . VAL E 4 94  ? 150.691 206.555 137.213 1.00 89.47  ? 94  VAL E N     1 
ATOM 9389  C CA    . VAL E 4 94  ? 150.412 206.180 138.593 1.00 89.47  ? 94  VAL E CA    1 
ATOM 9390  C C     . VAL E 4 94  ? 151.035 204.835 138.912 1.00 89.47  ? 94  VAL E C     1 
ATOM 9391  O O     . VAL E 4 94  ? 151.280 204.005 138.037 1.00 89.47  ? 94  VAL E O     1 
ATOM 9392  C CB    . VAL E 4 94  ? 148.907 206.076 138.884 1.00 89.47  ? 94  VAL E CB    1 
ATOM 9393  C CG1   . VAL E 4 94  ? 148.326 207.389 139.051 1.00 89.47  ? 94  VAL E CG1   1 
ATOM 9394  C CG2   . VAL E 4 94  ? 148.217 205.405 137.750 1.00 89.47  ? 94  VAL E CG2   1 
ATOM 9395  N N     . GLY E 4 95  ? 151.275 204.633 140.200 1.00 94.49  ? 95  GLY E N     1 
ATOM 9396  C CA    . GLY E 4 95  ? 151.842 203.406 140.706 1.00 94.49  ? 95  GLY E CA    1 
ATOM 9397  C C     . GLY E 4 95  ? 153.348 203.475 140.877 1.00 94.49  ? 95  GLY E C     1 
ATOM 9398  O O     . GLY E 4 95  ? 154.038 204.335 140.322 1.00 94.49  ? 95  GLY E O     1 
ATOM 9399  N N     . LYS E 4 96  ? 153.854 202.544 141.684 1.00 100.74 ? 96  LYS E N     1 
ATOM 9400  C CA    . LYS E 4 96  ? 155.288 202.440 141.925 1.00 100.74 ? 96  LYS E CA    1 
ATOM 9401  C C     . LYS E 4 96  ? 156.000 202.203 140.596 1.00 100.74 ? 96  LYS E C     1 
ATOM 9402  O O     . LYS E 4 96  ? 156.841 203.000 140.160 1.00 100.74 ? 96  LYS E O     1 
ATOM 9403  C CB    . LYS E 4 96  ? 155.576 201.382 143.017 1.00 100.74 ? 96  LYS E CB    1 
ATOM 9404  C CG    . LYS E 4 96  ? 155.601 199.839 142.772 1.00 100.74 ? 96  LYS E CG    1 
ATOM 9405  C CD    . LYS E 4 96  ? 156.707 199.311 141.834 1.00 100.74 ? 96  LYS E CD    1 
ATOM 9406  C CE    . LYS E 4 96  ? 156.678 197.794 141.659 1.00 100.74 ? 96  LYS E CE    1 
ATOM 9407  N NZ    . LYS E 4 96  ? 157.737 197.315 140.713 1.00 100.74 ? 96  LYS E NZ    1 
ATOM 9408  N N     . LYS E 4 97  ? 155.650 201.113 139.930 1.00 100.65 ? 97  LYS E N     1 
ATOM 9409  C CA    . LYS E 4 97  ? 156.224 200.714 138.656 1.00 100.65 ? 97  LYS E CA    1 
ATOM 9410  C C     . LYS E 4 97  ? 155.754 201.697 137.595 1.00 100.65 ? 97  LYS E C     1 
ATOM 9411  O O     . LYS E 4 97  ? 155.111 202.710 137.888 1.00 100.65 ? 97  LYS E O     1 
ATOM 9412  C CB    . LYS E 4 97  ? 155.817 199.287 138.306 1.00 100.65 ? 97  LYS E CB    1 
ATOM 9413  C CG    . LYS E 4 97  ? 154.320 199.061 138.020 1.00 100.65 ? 97  LYS E CG    1 
ATOM 9414  C CD    . LYS E 4 97  ? 153.395 199.229 139.222 1.00 100.65 ? 97  LYS E CD    1 
ATOM 9415  C CE    . LYS E 4 97  ? 152.199 198.303 139.118 1.00 100.65 ? 97  LYS E CE    1 
ATOM 9416  N NZ    . LYS E 4 97  ? 151.226 198.574 140.190 1.00 100.65 ? 97  LYS E NZ    1 
ATOM 9417  N N     . SER E 4 98  ? 156.082 201.398 136.339 1.00 101.83 ? 98  SER E N     1 
ATOM 9418  C CA    . SER E 4 98  ? 155.772 202.315 135.254 1.00 101.83 ? 98  SER E CA    1 
ATOM 9419  C C     . SER E 4 98  ? 154.303 202.711 135.235 1.00 101.83 ? 98  SER E C     1 
ATOM 9420  O O     . SER E 4 98  ? 153.975 203.843 134.860 1.00 101.83 ? 98  SER E O     1 
ATOM 9421  C CB    . SER E 4 98  ? 156.163 201.676 133.920 1.00 101.83 ? 98  SER E CB    1 
ATOM 9422  O OG    . SER E 4 98  ? 155.222 200.693 133.532 1.00 101.83 ? 98  SER E OG    1 
ATOM 9423  N N     . GLY E 4 99  ? 153.406 201.820 135.632 1.00 98.48  ? 99  GLY E N     1 
ATOM 9424  C CA    . GLY E 4 99  ? 152.008 202.200 135.651 1.00 98.48  ? 99  GLY E CA    1 
ATOM 9425  C C     . GLY E 4 99  ? 151.134 201.100 136.200 1.00 98.48  ? 99  GLY E C     1 
ATOM 9426  O O     . GLY E 4 99  ? 151.590 199.994 136.505 1.00 98.48  ? 99  GLY E O     1 
ATOM 9427  N N     . ILE E 4 100 ? 149.849 201.437 136.314 1.00 88.48  ? 100 ILE E N     1 
ATOM 9428  C CA    . ILE E 4 100 ? 148.834 200.473 136.711 1.00 88.48  ? 100 ILE E CA    1 
ATOM 9429  C C     . ILE E 4 100 ? 148.731 199.377 135.669 1.00 88.48  ? 100 ILE E C     1 
ATOM 9430  O O     . ILE E 4 100 ? 148.680 199.649 134.462 1.00 88.48  ? 100 ILE E O     1 
ATOM 9431  C CB    . ILE E 4 100 ? 147.479 201.155 136.929 1.00 88.48  ? 100 ILE E CB    1 
ATOM 9432  C CG1   . ILE E 4 100 ? 147.544 202.059 138.144 1.00 88.48  ? 100 ILE E CG1   1 
ATOM 9433  C CG2   . ILE E 4 100 ? 146.414 200.121 137.150 1.00 88.48  ? 100 ILE E CG2   1 
ATOM 9434  C CD1   . ILE E 4 100 ? 147.898 201.324 139.378 1.00 88.48  ? 100 ILE E CD1   1 
ATOM 9435  N N     . LYS E 4 101 ? 148.727 198.134 136.127 1.00 83.50  ? 101 LYS E N     1 
ATOM 9436  C CA    . LYS E 4 101 ? 148.682 197.008 135.213 1.00 83.50  ? 101 LYS E CA    1 
ATOM 9437  C C     . LYS E 4 101 ? 147.369 197.072 134.449 1.00 83.50  ? 101 LYS E C     1 
ATOM 9438  O O     . LYS E 4 101 ? 146.340 197.471 134.996 1.00 83.50  ? 101 LYS E O     1 
ATOM 9439  C CB    . LYS E 4 101 ? 148.797 195.696 135.985 1.00 83.50  ? 101 LYS E CB    1 
ATOM 9440  C CG    . LYS E 4 101 ? 148.967 194.471 135.113 1.00 83.50  ? 101 LYS E CG    1 
ATOM 9441  C CD    . LYS E 4 101 ? 149.064 193.212 135.953 1.00 83.50  ? 101 LYS E CD    1 
ATOM 9442  C CE    . LYS E 4 101 ? 150.508 192.851 136.239 1.00 83.50  ? 101 LYS E CE    1 
ATOM 9443  N NZ    . LYS E 4 101 ? 151.226 193.941 136.953 1.00 83.50  ? 101 LYS E NZ    1 
ATOM 9444  N N     . LEU E 4 102 ? 147.412 196.743 133.165 1.00 80.89  ? 102 LEU E N     1 
ATOM 9445  C CA    . LEU E 4 102 ? 146.215 196.770 132.342 1.00 80.89  ? 102 LEU E CA    1 
ATOM 9446  C C     . LEU E 4 102 ? 145.863 195.383 131.823 1.00 80.89  ? 102 LEU E C     1 
ATOM 9447  O O     . LEU E 4 102 ? 146.733 194.607 131.419 1.00 80.89  ? 102 LEU E O     1 
ATOM 9448  C CB    . LEU E 4 102 ? 146.408 197.730 131.161 1.00 80.89  ? 102 LEU E CB    1 
ATOM 9449  C CG    . LEU E 4 102 ? 146.794 199.162 131.533 1.00 80.89  ? 102 LEU E CG    1 
ATOM 9450  C CD1   . LEU E 4 102 ? 147.076 200.000 130.299 1.00 80.89  ? 102 LEU E CD1   1 
ATOM 9451  C CD2   . LEU E 4 102 ? 145.699 199.815 132.331 1.00 80.89  ? 102 LEU E CD2   1 
ATOM 9452  N N     . GLU E 4 103 ? 144.562 195.111 131.815 1.00 88.44  ? 103 GLU E N     1 
ATOM 9453  C CA    . GLU E 4 103 ? 143.974 193.913 131.244 1.00 88.44  ? 103 GLU E CA    1 
ATOM 9454  C C     . GLU E 4 103 ? 144.133 193.905 129.737 1.00 88.44  ? 103 GLU E C     1 
ATOM 9455  O O     . GLU E 4 103 ? 144.287 194.944 129.092 1.00 88.44  ? 103 GLU E O     1 
ATOM 9456  C CB    . GLU E 4 103 ? 142.474 193.817 131.527 1.00 88.44  ? 103 GLU E CB    1 
ATOM 9457  C CG    . GLU E 4 103 ? 142.080 193.008 132.735 1.00 88.44  ? 103 GLU E CG    1 
ATOM 9458  C CD    . GLU E 4 103 ? 142.489 193.701 134.016 1.00 88.44  ? 103 GLU E CD    1 
ATOM 9459  O OE1   . GLU E 4 103 ? 143.010 194.823 133.915 1.00 88.44  ? 103 GLU E OE1   1 
ATOM 9460  O OE2   . GLU E 4 103 ? 142.283 193.141 135.116 1.00 88.44  ? 103 GLU E OE2   1 
ATOM 9461  N N     . LYS E 4 104 ? 144.070 192.704 129.182 1.00 108.94 ? 104 LYS E N     1 
ATOM 9462  C CA    . LYS E 4 104 ? 144.270 192.518 127.759 1.00 108.94 ? 104 LYS E CA    1 
ATOM 9463  C C     . LYS E 4 104 ? 143.324 193.432 126.991 1.00 108.94 ? 104 LYS E C     1 
ATOM 9464  O O     . LYS E 4 104 ? 142.149 193.588 127.336 1.00 108.94 ? 104 LYS E O     1 
ATOM 9465  C CB    . LYS E 4 104 ? 144.044 191.049 127.419 1.00 108.94 ? 104 LYS E CB    1 
ATOM 9466  C CG    . LYS E 4 104 ? 142.641 190.540 127.723 1.00 108.94 ? 104 LYS E CG    1 
ATOM 9467  C CD    . LYS E 4 104 ? 141.852 190.466 126.438 1.00 108.94 ? 104 LYS E CD    1 
ATOM 9468  C CE    . LYS E 4 104 ? 140.420 190.016 126.590 1.00 108.94 ? 104 LYS E CE    1 
ATOM 9469  N NZ    . LYS E 4 104 ? 139.846 189.948 125.217 1.00 108.94 ? 104 LYS E NZ    1 
ATOM 9470  N N     . GLU E 4 105 ? 143.863 194.048 125.949 1.00 117.43 ? 105 GLU E N     1 
ATOM 9471  C CA    . GLU E 4 105 ? 143.142 195.041 125.173 1.00 117.43 ? 105 GLU E CA    1 
ATOM 9472  C C     . GLU E 4 105 ? 141.940 194.436 124.459 1.00 117.43 ? 105 GLU E C     1 
ATOM 9473  O O     . GLU E 4 105 ? 142.008 193.346 123.885 1.00 117.43 ? 105 GLU E O     1 
ATOM 9474  C CB    . GLU E 4 105 ? 144.116 195.673 124.171 1.00 117.43 ? 105 GLU E CB    1 
ATOM 9475  C CG    . GLU E 4 105 ? 143.610 196.847 123.348 1.00 117.43 ? 105 GLU E CG    1 
ATOM 9476  C CD    . GLU E 4 105 ? 142.806 196.455 122.133 1.00 117.43 ? 105 GLU E CD    1 
ATOM 9477  O OE1   . GLU E 4 105 ? 142.678 195.248 121.853 1.00 117.43 ? 105 GLU E OE1   1 
ATOM 9478  O OE2   . GLU E 4 105 ? 142.303 197.366 121.449 1.00 117.43 ? 105 GLU E OE2   1 
ATOM 9479  N N     . LYS E 4 106 ? 140.828 195.162 124.507 1.00 118.41 ? 106 LYS E N     1 
ATOM 9480  C CA    . LYS E 4 106 ? 139.593 194.759 123.852 1.00 118.41 ? 106 LYS E CA    1 
ATOM 9481  C C     . LYS E 4 106 ? 139.519 195.480 122.520 1.00 118.41 ? 106 LYS E C     1 
ATOM 9482  O O     . LYS E 4 106 ? 139.835 196.668 122.429 1.00 118.41 ? 106 LYS E O     1 
ATOM 9483  C CB    . LYS E 4 106 ? 138.384 195.143 124.717 1.00 118.41 ? 106 LYS E CB    1 
ATOM 9484  C CG    . LYS E 4 106 ? 138.342 194.606 126.148 1.00 118.41 ? 106 LYS E CG    1 
ATOM 9485  C CD    . LYS E 4 106 ? 138.540 193.116 126.173 1.00 118.41 ? 106 LYS E CD    1 
ATOM 9486  C CE    . LYS E 4 106 ? 137.347 192.529 125.421 1.00 118.41 ? 106 LYS E CE    1 
ATOM 9487  N NZ    . LYS E 4 106 ? 137.363 191.071 125.230 1.00 118.41 ? 106 LYS E NZ    1 
ATOM 9488  N N     . ASP E 4 107 ? 139.063 194.768 121.498 1.00 123.68 ? 107 ASP E N     1 
ATOM 9489  C CA    . ASP E 4 107 ? 139.040 195.359 120.171 1.00 123.68 ? 107 ASP E CA    1 
ATOM 9490  C C     . ASP E 4 107 ? 138.126 196.577 120.141 1.00 123.68 ? 107 ASP E C     1 
ATOM 9491  O O     . ASP E 4 107 ? 137.002 196.535 120.643 1.00 123.68 ? 107 ASP E O     1 
ATOM 9492  C CB    . ASP E 4 107 ? 138.569 194.320 119.165 1.00 123.68 ? 107 ASP E CB    1 
ATOM 9493  C CG    . ASP E 4 107 ? 139.357 193.038 119.256 1.00 123.68 ? 107 ASP E CG    1 
ATOM 9494  O OD1   . ASP E 4 107 ? 140.504 193.061 119.755 1.00 123.68 ? 107 ASP E OD1   1 
ATOM 9495  O OD2   . ASP E 4 107 ? 138.812 191.999 118.833 1.00 123.68 ? 107 ASP E OD2   1 
ATOM 9496  N N     . SER E 4 108 ? 138.612 197.662 119.539 1.00 124.27 ? 108 SER E N     1 
ATOM 9497  C CA    . SER E 4 108 ? 137.926 198.932 119.315 1.00 124.27 ? 108 SER E CA    1 
ATOM 9498  C C     . SER E 4 108 ? 137.807 199.816 120.565 1.00 124.27 ? 108 SER E C     1 
ATOM 9499  O O     . SER E 4 108 ? 137.390 200.968 120.434 1.00 124.27 ? 108 SER E O     1 
ATOM 9500  C CB    . SER E 4 108 ? 136.520 198.756 118.708 1.00 124.27 ? 108 SER E CB    1 
ATOM 9501  O OG    . SER E 4 108 ? 136.596 198.102 117.455 1.00 124.27 ? 108 SER E OG    1 
ATOM 9502  N N     . GLU E 4 109 ? 138.159 199.336 121.761 1.00 114.27 ? 109 GLU E N     1 
ATOM 9503  C CA    . GLU E 4 109 ? 138.041 200.122 122.985 1.00 114.27 ? 109 GLU E CA    1 
ATOM 9504  C C     . GLU E 4 109 ? 139.310 200.121 123.833 1.00 114.27 ? 109 GLU E C     1 
ATOM 9505  O O     . GLU E 4 109 ? 140.128 199.197 123.785 1.00 114.27 ? 109 GLU E O     1 
ATOM 9506  C CB    . GLU E 4 109 ? 136.844 199.675 123.841 1.00 114.27 ? 109 GLU E CB    1 
ATOM 9507  C CG    . GLU E 4 109 ? 136.850 198.227 124.235 1.00 114.27 ? 109 GLU E CG    1 
ATOM 9508  C CD    . GLU E 4 109 ? 135.898 197.428 123.388 1.00 114.27 ? 109 GLU E CD    1 
ATOM 9509  O OE1   . GLU E 4 109 ? 135.490 197.935 122.323 1.00 114.27 ? 109 GLU E OE1   1 
ATOM 9510  O OE2   . GLU E 4 109 ? 135.553 196.301 123.788 1.00 114.27 ? 109 GLU E OE2   1 
ATOM 9511  N N     . ALA E 4 110 ? 139.433 201.179 124.630 1.00 92.75  ? 110 ALA E N     1 
ATOM 9512  C CA    . ALA E 4 110 ? 140.557 201.365 125.536 1.00 92.75  ? 110 ALA E CA    1 
ATOM 9513  C C     . ALA E 4 110 ? 140.617 200.265 126.594 1.00 92.75  ? 110 ALA E C     1 
ATOM 9514  O O     . ALA E 4 110 ? 139.577 199.779 127.055 1.00 92.75  ? 110 ALA E O     1 
ATOM 9515  C CB    . ALA E 4 110 ? 140.467 202.739 126.200 1.00 92.75  ? 110 ALA E CB    1 
ATOM 9516  N N     . PRO E 4 111 ? 141.816 199.859 127.006 1.00 86.75  ? 111 PRO E N     1 
ATOM 9517  C CA    . PRO E 4 111 ? 141.957 198.754 127.958 1.00 86.75  ? 111 PRO E CA    1 
ATOM 9518  C C     . PRO E 4 111 ? 141.455 199.083 129.350 1.00 86.75  ? 111 PRO E C     1 
ATOM 9519  O O     . PRO E 4 111 ? 141.507 200.223 129.812 1.00 86.75  ? 111 PRO E O     1 
ATOM 9520  C CB    . PRO E 4 111 ? 143.466 198.501 127.979 1.00 86.75  ? 111 PRO E CB    1 
ATOM 9521  C CG    . PRO E 4 111 ? 144.037 199.832 127.678 1.00 86.75  ? 111 PRO E CG    1 
ATOM 9522  C CD    . PRO E 4 111 ? 143.117 200.467 126.687 1.00 86.75  ? 111 PRO E CD    1 
ATOM 9523  N N     . ALA E 4 112 ? 140.927 198.050 130.000 1.00 76.19  ? 112 ALA E N     1 
ATOM 9524  C CA    . ALA E 4 112 ? 140.459 198.148 131.374 1.00 76.19  ? 112 ALA E CA    1 
ATOM 9525  C C     . ALA E 4 112 ? 141.624 198.005 132.348 1.00 76.19  ? 112 ALA E C     1 
ATOM 9526  O O     . ALA E 4 112 ? 142.559 197.240 132.102 1.00 76.19  ? 112 ALA E O     1 
ATOM 9527  C CB    . ALA E 4 112 ? 139.413 197.071 131.658 1.00 76.19  ? 112 ALA E CB    1 
ATOM 9528  N N     . THR E 4 113 ? 141.585 198.785 133.429 1.00 71.12  ? 113 THR E N     1 
ATOM 9529  C CA    . THR E 4 113 ? 142.602 198.726 134.472 1.00 71.12  ? 113 THR E CA    1 
ATOM 9530  C C     . THR E 4 113 ? 142.518 197.414 135.242 1.00 71.12  ? 113 THR E C     1 
ATOM 9531  O O     . THR E 4 113 ? 141.471 196.778 135.320 1.00 71.12  ? 113 THR E O     1 
ATOM 9532  C CB    . THR E 4 113 ? 142.462 199.895 135.444 1.00 71.12  ? 113 THR E CB    1 
ATOM 9533  O OG1   . THR E 4 113 ? 141.201 199.799 136.113 1.00 71.12  ? 113 THR E OG1   1 
ATOM 9534  C CG2   . THR E 4 113 ? 142.552 201.198 134.713 1.00 71.12  ? 113 THR E CG2   1 
ATOM 9535  N N     . SER E 4 114 ? 143.647 197.020 135.828 1.00 74.92  ? 114 SER E N     1 
ATOM 9536  C CA    . SER E 4 114 ? 143.724 195.771 136.582 1.00 74.92  ? 114 SER E CA    1 
ATOM 9537  C C     . SER E 4 114 ? 142.859 195.784 137.831 1.00 74.92  ? 114 SER E C     1 
ATOM 9538  O O     . SER E 4 114 ? 142.259 194.761 138.183 1.00 74.92  ? 114 SER E O     1 
ATOM 9539  C CB    . SER E 4 114 ? 145.164 195.466 136.944 1.00 74.92  ? 114 SER E CB    1 
ATOM 9540  O OG    . SER E 4 114 ? 145.781 194.765 135.896 1.00 74.92  ? 114 SER E OG    1 
ATOM 9541  N N     . VAL E 4 115 ? 142.792 196.900 138.528 1.00 63.23  ? 115 VAL E N     1 
ATOM 9542  C CA    . VAL E 4 115 ? 142.015 196.951 139.753 1.00 63.23  ? 115 VAL E CA    1 
ATOM 9543  C C     . VAL E 4 115 ? 140.823 197.876 139.568 1.00 63.23  ? 115 VAL E C     1 
ATOM 9544  O O     . VAL E 4 115 ? 140.860 198.836 138.788 1.00 63.23  ? 115 VAL E O     1 
ATOM 9545  C CB    . VAL E 4 115 ? 142.931 197.416 140.905 1.00 63.23  ? 115 VAL E CB    1 
ATOM 9546  C CG1   . VAL E 4 115 ? 143.747 198.620 140.460 1.00 63.23  ? 115 VAL E CG1   1 
ATOM 9547  C CG2   . VAL E 4 115 ? 142.180 197.686 142.167 1.00 63.23  ? 115 VAL E CG2   1 
ATOM 9548  N N     . LEU E 4 116 ? 139.754 197.564 140.290 1.00 55.51  ? 116 LEU E N     1 
ATOM 9549  C CA    . LEU E 4 116 ? 138.550 198.367 140.249 1.00 55.51  ? 116 LEU E CA    1 
ATOM 9550  C C     . LEU E 4 116 ? 138.767 199.682 140.978 1.00 55.51  ? 116 LEU E C     1 
ATOM 9551  O O     . LEU E 4 116 ? 139.394 199.733 142.037 1.00 55.51  ? 116 LEU E O     1 
ATOM 9552  C CB    . LEU E 4 116 ? 137.385 197.625 140.870 1.00 55.51  ? 116 LEU E CB    1 
ATOM 9553  C CG    . LEU E 4 116 ? 137.008 196.389 140.068 1.00 55.51  ? 116 LEU E CG    1 
ATOM 9554  C CD1   . LEU E 4 116 ? 137.617 195.156 140.638 1.00 55.51  ? 116 LEU E CD1   1 
ATOM 9555  C CD2   . LEU E 4 116 ? 135.494 196.247 140.143 1.00 55.51  ? 116 LEU E CD2   1 
ATOM 9556  N N     . PHE E 4 117 ? 138.235 200.748 140.405 1.00 56.20  ? 117 PHE E N     1 
ATOM 9557  C CA    . PHE E 4 117 ? 138.330 202.079 140.978 1.00 56.20  ? 117 PHE E CA    1 
ATOM 9558  C C     . PHE E 4 117 ? 136.990 202.460 141.567 1.00 56.20  ? 117 PHE E C     1 
ATOM 9559  O O     . PHE E 4 117 ? 135.940 202.091 141.042 1.00 56.20  ? 117 PHE E O     1 
ATOM 9560  C CB    . PHE E 4 117 ? 138.731 203.106 139.917 1.00 56.20  ? 117 PHE E CB    1 
ATOM 9561  C CG    . PHE E 4 117 ? 140.178 203.081 139.569 1.00 56.20  ? 117 PHE E CG    1 
ATOM 9562  C CD1   . PHE E 4 117 ? 141.105 203.707 140.372 1.00 56.20  ? 117 PHE E CD1   1 
ATOM 9563  C CD2   . PHE E 4 117 ? 140.612 202.419 138.444 1.00 56.20  ? 117 PHE E CD2   1 
ATOM 9564  C CE1   . PHE E 4 117 ? 142.437 203.686 140.046 1.00 56.20  ? 117 PHE E CE1   1 
ATOM 9565  C CE2   . PHE E 4 117 ? 141.945 202.394 138.118 1.00 56.20  ? 117 PHE E CE2   1 
ATOM 9566  C CZ    . PHE E 4 117 ? 142.856 203.026 138.918 1.00 56.20  ? 117 PHE E CZ    1 
ATOM 9567  N N     . TYR E 4 118 ? 137.025 203.181 142.675 1.00 52.50  ? 118 TYR E N     1 
ATOM 9568  C CA    . TYR E 4 118 ? 135.813 203.581 143.378 1.00 52.50  ? 118 TYR E CA    1 
ATOM 9569  C C     . TYR E 4 118 ? 135.919 205.065 143.687 1.00 52.50  ? 118 TYR E C     1 
ATOM 9570  O O     . TYR E 4 118 ? 136.381 205.440 144.763 1.00 52.50  ? 118 TYR E O     1 
ATOM 9571  C CB    . TYR E 4 118 ? 135.676 202.744 144.611 1.00 52.50  ? 118 TYR E CB    1 
ATOM 9572  C CG    . TYR E 4 118 ? 134.392 202.903 145.351 1.00 52.50  ? 118 TYR E CG    1 
ATOM 9573  C CD1   . TYR E 4 118 ? 133.180 202.787 144.715 1.00 52.50  ? 118 TYR E CD1   1 
ATOM 9574  C CD2   . TYR E 4 118 ? 134.400 203.109 146.710 1.00 52.50  ? 118 TYR E CD2   1 
ATOM 9575  C CE1   . TYR E 4 118 ? 132.013 202.913 145.411 1.00 52.50  ? 118 TYR E CE1   1 
ATOM 9576  C CE2   . TYR E 4 118 ? 133.248 203.228 147.406 1.00 52.50  ? 118 TYR E CE2   1 
ATOM 9577  C CZ    . TYR E 4 118 ? 132.060 203.134 146.760 1.00 52.50  ? 118 TYR E CZ    1 
ATOM 9578  O OH    . TYR E 4 118 ? 130.914 203.265 147.493 1.00 52.50  ? 118 TYR E OH    1 
ATOM 9579  N N     . LEU E 4 119 ? 135.508 205.908 142.750 1.00 56.03  ? 119 LEU E N     1 
ATOM 9580  C CA    . LEU E 4 119 ? 135.686 207.335 142.952 1.00 56.03  ? 119 LEU E CA    1 
ATOM 9581  C C     . LEU E 4 119 ? 134.477 208.117 142.462 1.00 56.03  ? 119 LEU E C     1 
ATOM 9582  O O     . LEU E 4 119 ? 133.729 207.634 141.608 1.00 56.03  ? 119 LEU E O     1 
ATOM 9583  C CB    . LEU E 4 119 ? 136.978 207.803 142.274 1.00 56.03  ? 119 LEU E CB    1 
ATOM 9584  C CG    . LEU E 4 119 ? 137.136 207.337 140.839 1.00 56.03  ? 119 LEU E CG    1 
ATOM 9585  C CD1   . LEU E 4 119 ? 136.675 208.415 139.941 1.00 56.03  ? 119 LEU E CD1   1 
ATOM 9586  C CD2   . LEU E 4 119 ? 138.580 206.964 140.551 1.00 56.03  ? 119 LEU E CD2   1 
ATOM 9587  N N     . PRO E 4 120 ? 134.240 209.308 143.013 1.00 61.46  ? 120 PRO E N     1 
ATOM 9588  C CA    . PRO E 4 120 ? 133.107 210.127 142.564 1.00 61.46  ? 120 PRO E CA    1 
ATOM 9589  C C     . PRO E 4 120 ? 133.204 210.537 141.105 1.00 61.46  ? 120 PRO E C     1 
ATOM 9590  O O     . PRO E 4 120 ? 134.289 210.663 140.541 1.00 61.46  ? 120 PRO E O     1 
ATOM 9591  C CB    . PRO E 4 120 ? 133.190 211.358 143.467 1.00 61.46  ? 120 PRO E CB    1 
ATOM 9592  C CG    . PRO E 4 120 ? 133.939 210.912 144.649 1.00 61.46  ? 120 PRO E CG    1 
ATOM 9593  C CD    . PRO E 4 120 ? 134.941 209.927 144.145 1.00 61.46  ? 120 PRO E CD    1 
ATOM 9594  N N     . VAL E 4 121 ? 132.039 210.768 140.504 1.00 69.43  ? 121 VAL E N     1 
ATOM 9595  C CA    . VAL E 4 121 ? 131.993 211.195 139.104 1.00 69.43  ? 121 VAL E CA    1 
ATOM 9596  C C     . VAL E 4 121 ? 132.730 212.511 138.875 1.00 69.43  ? 121 VAL E C     1 
ATOM 9597  O O     . VAL E 4 121 ? 133.538 212.593 137.928 1.00 69.43  ? 121 VAL E O     1 
ATOM 9598  C CB    . VAL E 4 121 ? 130.531 211.249 138.627 1.00 69.43  ? 121 VAL E CB    1 
ATOM 9599  C CG1   . VAL E 4 121 ? 130.463 211.602 137.175 1.00 69.43  ? 121 VAL E CG1   1 
ATOM 9600  C CG2   . VAL E 4 121 ? 129.854 209.927 138.877 1.00 69.43  ? 121 VAL E CG2   1 
ATOM 9601  N N     . PRO E 4 122 ? 132.545 213.552 139.694 1.00 74.74  ? 122 PRO E N     1 
ATOM 9602  C CA    . PRO E 4 122 ? 133.279 214.793 139.441 1.00 74.74  ? 122 PRO E CA    1 
ATOM 9603  C C     . PRO E 4 122 ? 134.765 214.611 139.534 1.00 74.74  ? 122 PRO E C     1 
ATOM 9604  O O     . PRO E 4 122 ? 135.496 215.365 138.887 1.00 74.74  ? 122 PRO E O     1 
ATOM 9605  C CB    . PRO E 4 122 ? 132.752 215.742 140.522 1.00 74.74  ? 122 PRO E CB    1 
ATOM 9606  C CG    . PRO E 4 122 ? 132.250 214.857 141.572 1.00 74.74  ? 122 PRO E CG    1 
ATOM 9607  C CD    . PRO E 4 122 ? 131.657 213.697 140.856 1.00 74.74  ? 122 PRO E CD    1 
ATOM 9608  N N     . ALA E 4 123 ? 135.240 213.609 140.274 1.00 74.15  ? 123 ALA E N     1 
ATOM 9609  C CA    . ALA E 4 123 ? 136.675 213.362 140.294 1.00 74.15  ? 123 ALA E CA    1 
ATOM 9610  C C     . ALA E 4 123 ? 137.137 212.927 138.919 1.00 74.15  ? 123 ALA E C     1 
ATOM 9611  O O     . ALA E 4 123 ? 138.225 213.304 138.468 1.00 74.15  ? 123 ALA E O     1 
ATOM 9612  C CB    . ALA E 4 123 ? 137.030 212.316 141.345 1.00 74.15  ? 123 ALA E CB    1 
ATOM 9613  N N     . ILE E 4 124 ? 136.308 212.153 138.225 1.00 74.81  ? 124 ILE E N     1 
ATOM 9614  C CA    . ILE E 4 124 ? 136.635 211.808 136.854 1.00 74.81  ? 124 ILE E CA    1 
ATOM 9615  C C     . ILE E 4 124 ? 136.716 213.070 136.026 1.00 74.81  ? 124 ILE E C     1 
ATOM 9616  O O     . ILE E 4 124 ? 137.646 213.251 135.233 1.00 74.81  ? 124 ILE E O     1 
ATOM 9617  C CB    . ILE E 4 124 ? 135.601 210.841 136.261 1.00 74.81  ? 124 ILE E CB    1 
ATOM 9618  C CG1   . ILE E 4 124 ? 135.641 209.495 136.948 1.00 74.81  ? 124 ILE E CG1   1 
ATOM 9619  C CG2   . ILE E 4 124 ? 135.898 210.623 134.829 1.00 74.81  ? 124 ILE E CG2   1 
ATOM 9620  C CD1   . ILE E 4 124 ? 134.620 208.530 136.411 1.00 74.81  ? 124 ILE E CD1   1 
ATOM 9621  N N     . ASP E 4 125 ? 135.769 213.990 136.228 1.00 81.63  ? 125 ASP E N     1 
ATOM 9622  C CA    . ASP E 4 125 ? 135.849 215.229 135.458 1.00 81.63  ? 125 ASP E CA    1 
ATOM 9623  C C     . ASP E 4 125 ? 137.140 216.000 135.736 1.00 81.63  ? 125 ASP E C     1 
ATOM 9624  O O     . ASP E 4 125 ? 137.768 216.521 134.804 1.00 81.63  ? 125 ASP E O     1 
ATOM 9625  C CB    . ASP E 4 125 ? 134.634 216.098 135.756 1.00 81.63  ? 125 ASP E CB    1 
ATOM 9626  C CG    . ASP E 4 125 ? 134.590 217.339 134.902 1.00 81.63  ? 125 ASP E CG    1 
ATOM 9627  O OD1   . ASP E 4 125 ? 135.254 217.357 133.845 1.00 81.63  ? 125 ASP E OD1   1 
ATOM 9628  O OD2   . ASP E 4 125 ? 133.894 218.300 135.288 1.00 81.63  ? 125 ASP E OD2   1 
ATOM 9629  N N     . GLU E 4 126 ? 137.592 216.042 136.993 1.00 80.97  ? 126 GLU E N     1 
ATOM 9630  C CA    . GLU E 4 126 ? 138.851 216.741 137.254 1.00 80.97  ? 126 GLU E CA    1 
ATOM 9631  C C     . GLU E 4 126 ? 140.026 216.024 136.609 1.00 80.97  ? 126 GLU E C     1 
ATOM 9632  O O     . GLU E 4 126 ? 140.953 216.673 136.108 1.00 80.97  ? 126 GLU E O     1 
ATOM 9633  C CB    . GLU E 4 126 ? 139.099 217.021 138.738 1.00 80.97  ? 126 GLU E CB    1 
ATOM 9634  C CG    . GLU E 4 126 ? 138.170 218.090 139.340 1.00 80.97  ? 126 GLU E CG    1 
ATOM 9635  C CD    . GLU E 4 126 ? 137.116 217.590 140.293 1.00 80.97  ? 126 GLU E CD    1 
ATOM 9636  O OE1   . GLU E 4 126 ? 137.077 216.386 140.578 1.00 80.97  ? 126 GLU E OE1   1 
ATOM 9637  O OE2   . GLU E 4 126 ? 136.326 218.422 140.778 1.00 80.97  ? 126 GLU E OE2   1 
ATOM 9638  N N     . LEU E 4 127 ? 140.018 214.690 136.607 1.00 80.22  ? 127 LEU E N     1 
ATOM 9639  C CA    . LEU E 4 127 ? 141.088 213.987 135.909 1.00 80.22  ? 127 LEU E CA    1 
ATOM 9640  C C     . LEU E 4 127 ? 141.095 214.361 134.440 1.00 80.22  ? 127 LEU E C     1 
ATOM 9641  O O     . LEU E 4 127 ? 142.161 214.544 133.838 1.00 80.22  ? 127 LEU E O     1 
ATOM 9642  C CB    . LEU E 4 127 ? 140.937 212.473 136.044 1.00 80.22  ? 127 LEU E CB    1 
ATOM 9643  C CG    . LEU E 4 127 ? 141.203 211.773 137.370 1.00 80.22  ? 127 LEU E CG    1 
ATOM 9644  C CD1   . LEU E 4 127 ? 140.908 210.300 137.230 1.00 80.22  ? 127 LEU E CD1   1 
ATOM 9645  C CD2   . LEU E 4 127 ? 142.625 211.981 137.801 1.00 80.22  ? 127 LEU E CD2   1 
ATOM 9646  N N     . ALA E 4 128 ? 139.917 214.491 133.844 1.00 85.41  ? 128 ALA E N     1 
ATOM 9647  C CA    . ALA E 4 128 ? 139.870 214.931 132.461 1.00 85.41  ? 128 ALA E CA    1 
ATOM 9648  C C     . ALA E 4 128 ? 140.485 216.316 132.294 1.00 85.41  ? 128 ALA E C     1 
ATOM 9649  O O     . ALA E 4 128 ? 141.239 216.553 131.344 1.00 85.41  ? 128 ALA E O     1 
ATOM 9650  C CB    . ALA E 4 128 ? 138.428 214.921 131.963 1.00 85.41  ? 128 ALA E CB    1 
ATOM 9651  N N     . ALA E 4 129 ? 140.198 217.240 133.215 1.00 85.07  ? 129 ALA E N     1 
ATOM 9652  C CA    . ALA E 4 129 ? 140.778 218.578 133.092 1.00 85.07  ? 129 ALA E CA    1 
ATOM 9653  C C     . ALA E 4 129 ? 142.301 218.581 133.227 1.00 85.07  ? 129 ALA E C     1 
ATOM 9654  O O     . ALA E 4 129 ? 143.000 219.241 132.440 1.00 85.07  ? 129 ALA E O     1 
ATOM 9655  C CB    . ALA E 4 129 ? 140.155 219.508 134.131 1.00 85.07  ? 129 ALA E CB    1 
ATOM 9656  N N     . ILE E 4 130 ? 142.842 217.822 134.183 1.00 85.83  ? 130 ILE E N     1 
ATOM 9657  C CA    . ILE E 4 130 ? 144.296 217.774 134.320 1.00 85.83  ? 130 ILE E CA    1 
ATOM 9658  C C     . ILE E 4 130 ? 144.916 217.177 133.068 1.00 85.83  ? 130 ILE E C     1 
ATOM 9659  O O     . ILE E 4 130 ? 145.974 217.619 132.609 1.00 85.83  ? 130 ILE E O     1 
ATOM 9660  C CB    . ILE E 4 130 ? 144.738 217.056 135.611 1.00 85.83  ? 130 ILE E CB    1 
ATOM 9661  C CG1   . ILE E 4 130 ? 144.274 215.608 135.666 1.00 85.83  ? 130 ILE E CG1   1 
ATOM 9662  C CG2   . ILE E 4 130 ? 144.269 217.834 136.833 1.00 85.83  ? 130 ILE E CG2   1 
ATOM 9663  C CD1   . ILE E 4 130 ? 145.245 214.639 135.037 1.00 85.83  ? 130 ILE E CD1   1 
ATOM 9664  N N     . ALA E 4 131 ? 144.272 216.160 132.496 1.00 89.73  ? 131 ALA E N     1 
ATOM 9665  C CA    . ALA E 4 131 ? 144.790 215.606 131.254 1.00 89.73  ? 131 ALA E CA    1 
ATOM 9666  C C     . ALA E 4 131 ? 144.626 216.592 130.114 1.00 89.73  ? 131 ALA E C     1 
ATOM 9667  O O     . ALA E 4 131 ? 145.297 216.459 129.087 1.00 89.73  ? 131 ALA E O     1 
ATOM 9668  C CB    . ALA E 4 131 ? 144.088 214.298 130.915 1.00 89.73  ? 131 ALA E CB    1 
ATOM 9669  N N     . ASP E 4 132 ? 143.739 217.572 130.278 1.00 91.30  ? 132 ASP E N     1 
ATOM 9670  C CA    . ASP E 4 132 ? 143.454 218.529 129.220 1.00 91.30  ? 132 ASP E CA    1 
ATOM 9671  C C     . ASP E 4 132 ? 144.518 219.608 129.150 1.00 91.30  ? 132 ASP E C     1 
ATOM 9672  O O     . ASP E 4 132 ? 144.941 219.996 128.057 1.00 91.30  ? 132 ASP E O     1 
ATOM 9673  C CB    . ASP E 4 132 ? 142.093 219.172 129.443 1.00 91.30  ? 132 ASP E CB    1 
ATOM 9674  C CG    . ASP E 4 132 ? 141.674 220.034 128.292 1.00 91.30  ? 132 ASP E CG    1 
ATOM 9675  O OD1   . ASP E 4 132 ? 142.176 219.800 127.177 1.00 91.30  ? 132 ASP E OD1   1 
ATOM 9676  O OD2   . ASP E 4 132 ? 140.853 220.948 128.502 1.00 91.30  ? 132 ASP E OD2   1 
ATOM 9677  N N     . GLU E 4 133 ? 144.963 220.111 130.299 1.00 91.48  ? 133 GLU E N     1 
ATOM 9678  C CA    . GLU E 4 133 ? 145.915 221.216 130.270 1.00 91.48  ? 133 GLU E CA    1 
ATOM 9679  C C     . GLU E 4 133 ? 147.277 220.825 129.689 1.00 91.48  ? 133 GLU E C     1 
ATOM 9680  O O     . GLU E 4 133 ? 148.055 221.714 129.340 1.00 91.48  ? 133 GLU E O     1 
ATOM 9681  C CB    . GLU E 4 133 ? 146.036 221.845 131.657 1.00 91.48  ? 133 GLU E CB    1 
ATOM 9682  C CG    . GLU E 4 133 ? 146.569 220.974 132.751 1.00 91.48  ? 133 GLU E CG    1 
ATOM 9683  C CD    . GLU E 4 133 ? 148.055 221.124 132.928 1.00 91.48  ? 133 GLU E CD    1 
ATOM 9684  O OE1   . GLU E 4 133 ? 148.680 221.869 132.146 1.00 91.48  ? 133 GLU E OE1   1 
ATOM 9685  O OE2   . GLU E 4 133 ? 148.592 220.533 133.882 1.00 91.48  ? 133 GLU E OE2   1 
ATOM 9686  N N     . HIS E 4 134 ? 147.588 219.537 129.573 1.00 92.12  ? 134 HIS E N     1 
ATOM 9687  C CA    . HIS E 4 134 ? 148.844 219.079 128.967 1.00 92.12  ? 134 HIS E CA    1 
ATOM 9688  C C     . HIS E 4 134 ? 148.668 218.574 127.540 1.00 92.12  ? 134 HIS E C     1 
ATOM 9689  O O     . HIS E 4 134 ? 149.190 217.516 127.190 1.00 92.12  ? 134 HIS E O     1 
ATOM 9690  C CB    . HIS E 4 134 ? 149.501 217.992 129.810 1.00 92.12  ? 134 HIS E CB    1 
ATOM 9691  C CG    . HIS E 4 134 ? 149.824 218.407 131.206 1.00 92.12  ? 134 HIS E CG    1 
ATOM 9692  N ND1   . HIS E 4 134 ? 150.893 219.220 131.509 1.00 92.12  ? 134 HIS E ND1   1 
ATOM 9693  C CD2   . HIS E 4 134 ? 149.256 218.075 132.388 1.00 92.12  ? 134 HIS E CD2   1 
ATOM 9694  C CE1   . HIS E 4 134 ? 150.958 219.388 132.817 1.00 92.12  ? 134 HIS E CE1   1 
ATOM 9695  N NE2   . HIS E 4 134 ? 149.973 218.708 133.373 1.00 92.12  ? 134 HIS E NE2   1 
ATOM 9696  N N     . ARG E 4 135 ? 147.921 219.291 126.700 1.00 90.95  ? 135 ARG E N     1 
ATOM 9697  C CA    . ARG E 4 135 ? 147.607 218.781 125.368 1.00 90.95  ? 135 ARG E CA    1 
ATOM 9698  C C     . ARG E 4 135 ? 148.833 218.623 124.474 1.00 90.95  ? 135 ARG E C     1 
ATOM 9699  O O     . ARG E 4 135 ? 148.955 217.622 123.761 1.00 90.95  ? 135 ARG E O     1 
ATOM 9700  C CB    . ARG E 4 135 ? 146.639 219.740 124.680 1.00 90.95  ? 135 ARG E CB    1 
ATOM 9701  C CG    . ARG E 4 135 ? 146.167 219.291 123.316 1.00 90.95  ? 135 ARG E CG    1 
ATOM 9702  C CD    . ARG E 4 135 ? 145.049 220.188 122.829 1.00 90.95  ? 135 ARG E CD    1 
ATOM 9703  N NE    . ARG E 4 135 ? 144.506 219.760 121.545 1.00 90.95  ? 135 ARG E NE    1 
ATOM 9704  C CZ    . ARG E 4 135 ? 143.444 220.312 120.971 1.00 90.95  ? 135 ARG E CZ    1 
ATOM 9705  N NH1   . ARG E 4 135 ? 143.010 219.866 119.801 1.00 90.95  ? 135 ARG E NH1   1 
ATOM 9706  N NH2   . ARG E 4 135 ? 142.825 221.323 121.562 1.00 90.95  ? 135 ARG E NH2   1 
ATOM 9707  N N     . ASP E 4 136 ? 149.746 219.595 124.485 1.00 94.37  ? 136 ASP E N     1 
ATOM 9708  C CA    . ASP E 4 136 ? 150.924 219.491 123.624 1.00 94.37  ? 136 ASP E CA    1 
ATOM 9709  C C     . ASP E 4 136 ? 151.898 218.409 124.063 1.00 94.37  ? 136 ASP E C     1 
ATOM 9710  O O     . ASP E 4 136 ? 152.397 217.646 123.223 1.00 94.37  ? 136 ASP E O     1 
ATOM 9711  C CB    . ASP E 4 136 ? 151.645 220.833 123.568 1.00 94.37  ? 136 ASP E CB    1 
ATOM 9712  C CG    . ASP E 4 136 ? 150.898 221.862 122.759 1.00 94.37  ? 136 ASP E CG    1 
ATOM 9713  O OD1   . ASP E 4 136 ? 150.113 221.470 121.871 1.00 94.37  ? 136 ASP E OD1   1 
ATOM 9714  O OD2   . ASP E 4 136 ? 151.087 223.066 123.023 1.00 94.37  ? 136 ASP E OD2   1 
ATOM 9715  N N     . ALA E 4 137 ? 152.158 218.295 125.366 1.00 93.07  ? 137 ALA E N     1 
ATOM 9716  C CA    . ALA E 4 137 ? 153.044 217.232 125.828 1.00 93.07  ? 137 ALA E CA    1 
ATOM 9717  C C     . ALA E 4 137 ? 152.494 215.876 125.432 1.00 93.07  ? 137 ALA E C     1 
ATOM 9718  O O     . ALA E 4 137 ? 153.237 214.985 125.001 1.00 93.07  ? 137 ALA E O     1 
ATOM 9719  C CB    . ALA E 4 137 ? 153.231 217.323 127.339 1.00 93.07  ? 137 ALA E CB    1 
ATOM 9720  N N     . VAL E 4 138 ? 151.184 215.711 125.570 1.00 92.50  ? 138 VAL E N     1 
ATOM 9721  C CA    . VAL E 4 138 ? 150.528 214.488 125.145 1.00 92.50  ? 138 VAL E CA    1 
ATOM 9722  C C     . VAL E 4 138 ? 150.651 214.302 123.638 1.00 92.50  ? 138 VAL E C     1 
ATOM 9723  O O     . VAL E 4 138 ? 150.848 213.184 123.157 1.00 92.50  ? 138 VAL E O     1 
ATOM 9724  C CB    . VAL E 4 138 ? 149.064 214.494 125.610 1.00 92.50  ? 138 VAL E CB    1 
ATOM 9725  C CG1   . VAL E 4 138 ? 148.312 213.345 124.991 1.00 92.50  ? 138 VAL E CG1   1 
ATOM 9726  C CG2   . VAL E 4 138 ? 149.009 214.407 127.115 1.00 92.50  ? 138 VAL E CG2   1 
ATOM 9727  N N     . ALA E 4 139 ? 150.505 215.383 122.865 1.00 92.29  ? 139 ALA E N     1 
ATOM 9728  C CA    . ALA E 4 139 ? 150.612 215.253 121.413 1.00 92.29  ? 139 ALA E CA    1 
ATOM 9729  C C     . ALA E 4 139 ? 151.989 214.776 120.977 1.00 92.29  ? 139 ALA E C     1 
ATOM 9730  O O     . ALA E 4 139 ? 152.101 213.956 120.058 1.00 92.29  ? 139 ALA E O     1 
ATOM 9731  C CB    . ALA E 4 139 ? 150.285 216.589 120.752 1.00 92.29  ? 139 ALA E CB    1 
ATOM 9732  N N     . LYS E 4 140 ? 153.050 215.272 121.610 1.00 94.33  ? 140 LYS E N     1 
ATOM 9733  C CA    . LYS E 4 140 ? 154.380 214.812 121.226 1.00 94.33  ? 140 LYS E CA    1 
ATOM 9734  C C     . LYS E 4 140 ? 154.618 213.398 121.732 1.00 94.33  ? 140 LYS E C     1 
ATOM 9735  O O     . LYS E 4 140 ? 155.275 212.587 121.069 1.00 94.33  ? 140 LYS E O     1 
ATOM 9736  C CB    . LYS E 4 140 ? 155.491 215.756 121.708 1.00 94.33  ? 140 LYS E CB    1 
ATOM 9737  C CG    . LYS E 4 140 ? 155.653 215.924 123.201 1.00 94.33  ? 140 LYS E CG    1 
ATOM 9738  C CD    . LYS E 4 140 ? 156.781 216.920 123.467 1.00 94.33  ? 140 LYS E CD    1 
ATOM 9739  C CE    . LYS E 4 140 ? 156.472 218.281 122.883 1.00 94.33  ? 140 LYS E CE    1 
ATOM 9740  N NZ    . LYS E 4 140 ? 155.150 218.790 123.322 1.00 94.33  ? 140 LYS E NZ    1 
ATOM 9741  N N     . GLU E 4 141 ? 154.093 213.105 122.921 1.00 93.38  ? 141 GLU E N     1 
ATOM 9742  C CA    . GLU E 4 141 ? 154.319 211.858 123.627 1.00 93.38  ? 141 GLU E CA    1 
ATOM 9743  C C     . GLU E 4 141 ? 153.490 210.693 123.092 1.00 93.38  ? 141 GLU E C     1 
ATOM 9744  O O     . GLU E 4 141 ? 153.853 209.539 123.325 1.00 93.38  ? 141 GLU E O     1 
ATOM 9745  C CB    . GLU E 4 141 ? 154.030 212.126 125.104 1.00 93.38  ? 141 GLU E CB    1 
ATOM 9746  N N     . ALA E 4 142 ? 152.402 210.957 122.371 1.00 87.18  ? 142 ALA E N     1 
ATOM 9747  C CA    . ALA E 4 142 ? 151.592 209.877 121.815 1.00 87.18  ? 142 ALA E CA    1 
ATOM 9748  C C     . ALA E 4 142 ? 152.298 209.123 120.697 1.00 87.18  ? 142 ALA E C     1 
ATOM 9749  O O     . ALA E 4 142 ? 151.989 207.950 120.455 1.00 87.18  ? 142 ALA E O     1 
ATOM 9750  C CB    . ALA E 4 142 ? 150.274 210.438 121.293 1.00 87.18  ? 142 ALA E CB    1 
ATOM 9751  N N     . ALA E 4 143 ? 153.247 209.767 120.021 1.00 86.39  ? 143 ALA E N     1 
ATOM 9752  C CA    . ALA E 4 143 ? 153.933 209.151 118.890 1.00 86.39  ? 143 ALA E CA    1 
ATOM 9753  C C     . ALA E 4 143 ? 154.941 208.066 119.273 1.00 86.39  ? 143 ALA E C     1 
ATOM 9754  O O     . ALA E 4 143 ? 155.173 207.148 118.477 1.00 86.39  ? 143 ALA E O     1 
ATOM 9755  C CB    . ALA E 4 143 ? 154.625 210.236 118.070 1.00 86.39  ? 143 ALA E CB    1 
ATOM 9756  N N     . LYS E 4 144 ? 155.542 208.126 120.454 1.00 92.97  ? 144 LYS E N     1 
ATOM 9757  C CA    . LYS E 4 144 ? 156.535 207.115 120.791 1.00 92.97  ? 144 LYS E CA    1 
ATOM 9758  C C     . LYS E 4 144 ? 155.922 205.732 120.980 1.00 92.97  ? 144 LYS E C     1 
ATOM 9759  O O     . LYS E 4 144 ? 154.745 205.578 121.316 1.00 92.97  ? 144 LYS E O     1 
ATOM 9760  C CB    . LYS E 4 144 ? 157.313 207.526 122.036 1.00 92.97  ? 144 LYS E CB    1 
ATOM 9761  C CG    . LYS E 4 144 ? 158.156 208.766 121.809 1.00 92.97  ? 144 LYS E CG    1 
ATOM 9762  C CD    . LYS E 4 144 ? 158.966 209.124 123.030 1.00 92.97  ? 144 LYS E CD    1 
ATOM 9763  C CE    . LYS E 4 144 ? 158.298 210.235 123.790 1.00 92.97  ? 144 LYS E CE    1 
ATOM 9764  N NZ    . LYS E 4 144 ? 157.089 209.718 124.424 1.00 92.97  ? 144 LYS E NZ    1 
ATOM 9765  N N     . LYS E 4 145 ? 156.758 204.716 120.750 1.00 96.60  ? 145 LYS E N     1 
ATOM 9766  C CA    . LYS E 4 145 ? 156.316 203.327 120.802 1.00 96.60  ? 145 LYS E CA    1 
ATOM 9767  C C     . LYS E 4 145 ? 155.998 202.883 122.223 1.00 96.60  ? 145 LYS E C     1 
ATOM 9768  O O     . LYS E 4 145 ? 155.032 202.145 122.445 1.00 96.60  ? 145 LYS E O     1 
ATOM 9769  C CB    . LYS E 4 145 ? 157.374 202.413 120.185 1.00 96.60  ? 145 LYS E CB    1 
ATOM 9770  C CG    . LYS E 4 145 ? 157.585 202.617 118.693 1.00 96.60  ? 145 LYS E CG    1 
ATOM 9771  C CD    . LYS E 4 145 ? 158.572 201.599 118.138 1.00 96.60  ? 145 LYS E CD    1 
ATOM 9772  C CE    . LYS E 4 145 ? 158.808 201.799 116.650 1.00 96.60  ? 145 LYS E CE    1 
ATOM 9773  N NZ    . LYS E 4 145 ? 159.548 203.059 116.379 1.00 96.60  ? 145 LYS E NZ    1 
ATOM 9774  N N     . THR E 4 146 ? 156.791 203.319 123.199 1.00 100.73 ? 146 THR E N     1 
ATOM 9775  C CA    . THR E 4 146 ? 156.605 202.954 124.601 1.00 100.73 ? 146 THR E CA    1 
ATOM 9776  C C     . THR E 4 146 ? 156.438 204.254 125.377 1.00 100.73 ? 146 THR E C     1 
ATOM 9777  O O     . THR E 4 146 ? 157.380 204.753 126.012 1.00 100.73 ? 146 THR E O     1 
ATOM 9778  C CB    . THR E 4 146 ? 157.769 202.123 125.136 1.00 100.73 ? 146 THR E CB    1 
ATOM 9779  O OG1   . THR E 4 146 ? 158.980 202.885 125.053 1.00 100.73 ? 146 THR E OG1   1 
ATOM 9780  C CG2   . THR E 4 146 ? 157.924 200.845 124.334 1.00 100.73 ? 146 THR E CG2   1 
ATOM 9781  N N     . PRO E 4 147 ? 155.240 204.828 125.341 1.00 99.17  ? 147 PRO E N     1 
ATOM 9782  C CA    . PRO E 4 147 ? 155.017 206.142 125.947 1.00 99.17  ? 147 PRO E CA    1 
ATOM 9783  C C     . PRO E 4 147 ? 155.187 206.097 127.454 1.00 99.17  ? 147 PRO E C     1 
ATOM 9784  O O     . PRO E 4 147 ? 154.812 205.123 128.109 1.00 99.17  ? 147 PRO E O     1 
ATOM 9785  C CB    . PRO E 4 147 ? 153.570 206.460 125.562 1.00 99.17  ? 147 PRO E CB    1 
ATOM 9786  C CG    . PRO E 4 147 ? 152.944 205.136 125.349 1.00 99.17  ? 147 PRO E CG    1 
ATOM 9787  C CD    . PRO E 4 147 ? 154.005 204.259 124.779 1.00 99.17  ? 147 PRO E CD    1 
ATOM 9788  N N     . LYS E 4 148 ? 155.777 207.152 127.998 1.00 97.12  ? 148 LYS E N     1 
ATOM 9789  C CA    . LYS E 4 148 ? 155.951 207.269 129.435 1.00 97.12  ? 148 LYS E CA    1 
ATOM 9790  C C     . LYS E 4 148 ? 154.937 208.244 130.024 1.00 97.12  ? 148 LYS E C     1 
ATOM 9791  O O     . LYS E 4 148 ? 154.358 209.072 129.324 1.00 97.12  ? 148 LYS E O     1 
ATOM 9792  C CB    . LYS E 4 148 ? 157.373 207.720 129.768 1.00 97.12  ? 148 LYS E CB    1 
ATOM 9793  C CG    . LYS E 4 148 ? 158.487 206.768 129.297 1.00 97.12  ? 148 LYS E CG    1 
ATOM 9794  C CD    . LYS E 4 148 ? 158.593 205.473 130.113 1.00 97.12  ? 148 LYS E CD    1 
ATOM 9795  C CE    . LYS E 4 148 ? 157.658 204.367 129.632 1.00 97.12  ? 148 LYS E CE    1 
ATOM 9796  N NZ    . LYS E 4 148 ? 157.945 203.068 130.296 1.00 97.12  ? 148 LYS E NZ    1 
ATOM 9797  N N     . GLY E 4 149 ? 154.745 208.138 131.336 1.00 94.22  ? 149 GLY E N     1 
ATOM 9798  C CA    . GLY E 4 149 ? 153.822 209.018 132.045 1.00 94.22  ? 149 GLY E CA    1 
ATOM 9799  C C     . GLY E 4 149 ? 154.334 210.444 132.145 1.00 94.22  ? 149 GLY E C     1 
ATOM 9800  O O     . GLY E 4 149 ? 155.511 210.675 132.444 1.00 94.22  ? 149 GLY E O     1 
ATOM 9801  N N     . ILE E 4 150 ? 153.454 211.415 131.884 1.00 93.42  ? 150 ILE E N     1 
ATOM 9802  C CA    . ILE E 4 150 ? 153.828 212.821 131.861 1.00 93.42  ? 150 ILE E CA    1 
ATOM 9803  C C     . ILE E 4 150 ? 153.116 213.611 132.947 1.00 93.42  ? 150 ILE E C     1 
ATOM 9804  O O     . ILE E 4 150 ? 153.708 214.507 133.563 1.00 93.42  ? 150 ILE E O     1 
ATOM 9805  C CB    . ILE E 4 150 ? 153.513 213.461 130.496 1.00 93.42  ? 150 ILE E CB    1 
ATOM 9806  C CG1   . ILE E 4 150 ? 154.129 212.688 129.348 1.00 93.42  ? 150 ILE E CG1   1 
ATOM 9807  C CG2   . ILE E 4 150 ? 153.932 214.926 130.476 1.00 93.42  ? 150 ILE E CG2   1 
ATOM 9808  C CD1   . ILE E 4 150 ? 153.137 211.733 128.777 1.00 93.42  ? 150 ILE E CD1   1 
ATOM 9809  N N     . LEU E 4 151 ? 151.854 213.289 133.201 1.00 91.12  ? 151 LEU E N     1 
ATOM 9810  C CA    . LEU E 4 151 ? 151.064 214.019 134.173 1.00 91.12  ? 151 LEU E CA    1 
ATOM 9811  C C     . LEU E 4 151 ? 151.726 213.995 135.548 1.00 91.12  ? 151 LEU E C     1 
ATOM 9812  O O     . LEU E 4 151 ? 152.380 213.018 135.916 1.00 91.12  ? 151 LEU E O     1 
ATOM 9813  C CB    . LEU E 4 151 ? 149.680 213.387 134.280 1.00 91.12  ? 151 LEU E CB    1 
ATOM 9814  C CG    . LEU E 4 151 ? 148.710 213.407 133.091 1.00 91.12  ? 151 LEU E CG    1 
ATOM 9815  C CD1   . LEU E 4 151 ? 148.441 214.809 132.577 1.00 91.12  ? 151 LEU E CD1   1 
ATOM 9816  C CD2   . LEU E 4 151 ? 149.158 212.476 131.957 1.00 91.12  ? 151 LEU E CD2   1 
ATOM 9817  N N     . PRO E 4 152 ? 151.574 215.063 136.325 1.00 92.79  ? 152 PRO E N     1 
ATOM 9818  C CA    . PRO E 4 152 ? 152.156 215.077 137.668 1.00 92.79  ? 152 PRO E CA    1 
ATOM 9819  C C     . PRO E 4 152 ? 151.504 213.999 138.512 1.00 92.79  ? 152 PRO E C     1 
ATOM 9820  O O     . PRO E 4 152 ? 150.280 213.879 138.538 1.00 92.79  ? 152 PRO E O     1 
ATOM 9821  C CB    . PRO E 4 152 ? 151.834 216.481 138.183 1.00 92.79  ? 152 PRO E CB    1 
ATOM 9822  C CG    . PRO E 4 152 ? 150.686 216.931 137.359 1.00 92.79  ? 152 PRO E CG    1 
ATOM 9823  C CD    . PRO E 4 152 ? 150.890 216.325 136.012 1.00 92.79  ? 152 PRO E CD    1 
ATOM 9824  N N     . ALA E 4 153 ? 152.316 213.249 139.250 1.00 87.84  ? 153 ALA E N     1 
ATOM 9825  C CA    . ALA E 4 153 ? 151.737 212.165 140.029 1.00 87.84  ? 153 ALA E CA    1 
ATOM 9826  C C     . ALA E 4 153 ? 151.035 212.694 141.269 1.00 87.84  ? 153 ALA E C     1 
ATOM 9827  O O     . ALA E 4 153 ? 150.012 212.148 141.686 1.00 87.84  ? 153 ALA E O     1 
ATOM 9828  C CB    . ALA E 4 153 ? 152.817 211.157 140.417 1.00 87.84  ? 153 ALA E CB    1 
ATOM 9829  N N     . ASP E 4 154 ? 151.584 213.733 141.891 1.00 88.67  ? 154 ASP E N     1 
ATOM 9830  C CA    . ASP E 4 154 ? 150.998 214.240 143.127 1.00 88.67  ? 154 ASP E CA    1 
ATOM 9831  C C     . ASP E 4 154 ? 149.595 214.808 142.921 1.00 88.67  ? 154 ASP E C     1 
ATOM 9832  O O     . ASP E 4 154 ? 148.701 214.570 143.736 1.00 88.67  ? 154 ASP E O     1 
ATOM 9833  C CB    . ASP E 4 154 ? 151.950 215.245 143.791 1.00 88.67  ? 154 ASP E CB    1 
ATOM 9834  C CG    . ASP E 4 154 ? 151.798 216.673 143.271 1.00 88.67  ? 154 ASP E CG    1 
ATOM 9835  O OD1   . ASP E 4 154 ? 151.198 216.892 142.202 1.00 88.67  ? 154 ASP E OD1   1 
ATOM 9836  O OD2   . ASP E 4 154 ? 152.302 217.596 143.945 1.00 88.67  ? 154 ASP E OD2   1 
ATOM 9837  N N     . ARG E 4 155 ? 149.392 215.607 141.870 1.00 84.63  ? 155 ARG E N     1 
ATOM 9838  C CA    . ARG E 4 155 ? 148.061 216.163 141.638 1.00 84.63  ? 155 ARG E CA    1 
ATOM 9839  C C     . ARG E 4 155 ? 147.012 215.097 141.359 1.00 84.63  ? 155 ARG E C     1 
ATOM 9840  O O     . ARG E 4 155 ? 145.920 215.122 141.941 1.00 84.63  ? 155 ARG E O     1 
ATOM 9841  C CB    . ARG E 4 155 ? 148.112 217.120 140.454 1.00 84.63  ? 155 ARG E CB    1 
ATOM 9842  C CG    . ARG E 4 155 ? 148.920 218.375 140.646 1.00 84.63  ? 155 ARG E CG    1 
ATOM 9843  C CD    . ARG E 4 155 ? 148.796 219.204 139.389 1.00 84.63  ? 155 ARG E CD    1 
ATOM 9844  N NE    . ARG E 4 155 ? 147.445 219.717 139.203 1.00 84.63  ? 155 ARG E NE    1 
ATOM 9845  C CZ    . ARG E 4 155 ? 147.031 220.313 138.093 1.00 84.63  ? 155 ARG E CZ    1 
ATOM 9846  N NH1   . ARG E 4 155 ? 145.786 220.754 138.002 1.00 84.63  ? 155 ARG E NH1   1 
ATOM 9847  N NH2   . ARG E 4 155 ? 147.860 220.454 137.070 1.00 84.63  ? 155 ARG E NH2   1 
ATOM 9848  N N     . ILE E 4 156 ? 147.322 214.140 140.489 1.00 79.01  ? 156 ILE E N     1 
ATOM 9849  C CA    . ILE E 4 156 ? 146.348 213.094 140.197 1.00 79.01  ? 156 ILE E CA    1 
ATOM 9850  C C     . ILE E 4 156 ? 146.095 212.229 141.424 1.00 79.01  ? 156 ILE E C     1 
ATOM 9851  O O     . ILE E 4 156 ? 144.947 211.935 141.765 1.00 79.01  ? 156 ILE E O     1 
ATOM 9852  C CB    . ILE E 4 156 ? 146.765 212.283 138.958 1.00 79.01  ? 156 ILE E CB    1 
ATOM 9853  C CG1   . ILE E 4 156 ? 148.199 211.813 139.040 1.00 79.01  ? 156 ILE E CG1   1 
ATOM 9854  C CG2   . ILE E 4 156 ? 146.645 213.128 137.745 1.00 79.01  ? 156 ILE E CG2   1 
ATOM 9855  C CD1   . ILE E 4 156 ? 148.350 210.524 139.657 1.00 79.01  ? 156 ILE E CD1   1 
ATOM 9856  N N     . THR E 4 157 ? 147.157 211.826 142.117 1.00 76.87  ? 157 THR E N     1 
ATOM 9857  C CA    . THR E 4 157 ? 146.968 211.024 143.315 1.00 76.87  ? 157 THR E CA    1 
ATOM 9858  C C     . THR E 4 157 ? 146.163 211.778 144.359 1.00 76.87  ? 157 THR E C     1 
ATOM 9859  O O     . THR E 4 157 ? 145.405 211.168 145.117 1.00 76.87  ? 157 THR E O     1 
ATOM 9860  C CB    . THR E 4 157 ? 148.320 210.597 143.866 1.00 76.87  ? 157 THR E CB    1 
ATOM 9861  O OG1   . THR E 4 157 ? 149.085 210.004 142.812 1.00 76.87  ? 157 THR E OG1   1 
ATOM 9862  C CG2   . THR E 4 157 ? 148.141 209.582 144.963 1.00 76.87  ? 157 THR E CG2   1 
ATOM 9863  N N     . GLU E 4 158 ? 146.323 213.093 144.433 1.00 76.46  ? 158 GLU E N     1 
ATOM 9864  C CA    . GLU E 4 158 ? 145.516 213.856 145.368 1.00 76.46  ? 158 GLU E CA    1 
ATOM 9865  C C     . GLU E 4 158 ? 144.070 213.879 144.903 1.00 76.46  ? 158 GLU E C     1 
ATOM 9866  O O     . GLU E 4 158 ? 143.153 213.866 145.728 1.00 76.46  ? 158 GLU E O     1 
ATOM 9867  C CB    . GLU E 4 158 ? 146.086 215.270 145.523 1.00 76.46  ? 158 GLU E CB    1 
ATOM 9868  C CG    . GLU E 4 158 ? 145.487 216.170 146.632 1.00 76.46  ? 158 GLU E CG    1 
ATOM 9869  C CD    . GLU E 4 158 ? 143.994 216.418 146.531 1.00 76.46  ? 158 GLU E CD    1 
ATOM 9870  O OE1   . GLU E 4 158 ? 143.494 216.610 145.403 1.00 76.46  ? 158 GLU E OE1   1 
ATOM 9871  O OE2   . GLU E 4 158 ? 143.313 216.396 147.579 1.00 76.46  ? 158 GLU E OE2   1 
ATOM 9872  N N     . VAL E 4 159 ? 143.846 213.829 143.589 1.00 71.94  ? 159 VAL E N     1 
ATOM 9873  C CA    . VAL E 4 159 ? 142.484 213.782 143.061 1.00 71.94  ? 159 VAL E CA    1 
ATOM 9874  C C     . VAL E 4 159 ? 141.828 212.440 143.346 1.00 71.94  ? 159 VAL E C     1 
ATOM 9875  O O     . VAL E 4 159 ? 140.639 212.379 143.674 1.00 71.94  ? 159 VAL E O     1 
ATOM 9876  C CB    . VAL E 4 159 ? 142.470 214.098 141.558 1.00 71.94  ? 159 VAL E CB    1 
ATOM 9877  C CG1   . VAL E 4 159 ? 141.128 213.741 140.964 1.00 71.94  ? 159 VAL E CG1   1 
ATOM 9878  C CG2   . VAL E 4 159 ? 142.743 215.558 141.337 1.00 71.94  ? 159 VAL E CG2   1 
ATOM 9879  N N     . LEU E 4 160 ? 142.581 211.353 143.256 1.00 62.75  ? 160 LEU E N     1 
ATOM 9880  C CA    . LEU E 4 160 ? 142.010 210.044 143.526 1.00 62.75  ? 160 LEU E CA    1 
ATOM 9881  C C     . LEU E 4 160 ? 141.646 209.862 144.987 1.00 62.75  ? 160 LEU E C     1 
ATOM 9882  O O     . LEU E 4 160 ? 140.959 208.893 145.316 1.00 62.75  ? 160 LEU E O     1 
ATOM 9883  C CB    . LEU E 4 160 ? 142.966 208.937 143.105 1.00 62.75  ? 160 LEU E CB    1 
ATOM 9884  C CG    . LEU E 4 160 ? 143.289 208.927 141.622 1.00 62.75  ? 160 LEU E CG    1 
ATOM 9885  C CD1   . LEU E 4 160 ? 144.262 207.821 141.309 1.00 62.75  ? 160 LEU E CD1   1 
ATOM 9886  C CD2   . LEU E 4 160 ? 142.016 208.758 140.841 1.00 62.75  ? 160 LEU E CD2   1 
ATOM 9887  N N     . LYS E 4 161 ? 142.070 210.759 145.862 1.00 58.32  ? 161 LYS E N     1 
ATOM 9888  C CA    . LYS E 4 161 ? 141.741 210.640 147.271 1.00 58.32  ? 161 LYS E CA    1 
ATOM 9889  C C     . LYS E 4 161 ? 140.378 211.214 147.613 1.00 58.32  ? 161 LYS E C     1 
ATOM 9890  O O     . LYS E 4 161 ? 139.927 211.028 148.745 1.00 58.32  ? 161 LYS E O     1 
ATOM 9891  C CB    . LYS E 4 161 ? 142.783 211.347 148.133 1.00 58.32  ? 161 LYS E CB    1 
ATOM 9892  C CG    . LYS E 4 161 ? 144.068 210.598 148.332 1.00 58.32  ? 161 LYS E CG    1 
ATOM 9893  C CD    . LYS E 4 161 ? 144.987 211.406 149.218 1.00 58.32  ? 161 LYS E CD    1 
ATOM 9894  C CE    . LYS E 4 161 ? 146.341 210.759 149.314 1.00 58.32  ? 161 LYS E CE    1 
ATOM 9895  N NZ    . LYS E 4 161 ? 147.266 211.522 150.187 1.00 58.32  ? 161 LYS E NZ    1 
ATOM 9896  N N     . SER E 4 162 ? 139.729 211.918 146.687 1.00 58.17  ? 162 SER E N     1 
ATOM 9897  C CA    . SER E 4 162 ? 138.433 212.511 146.980 1.00 58.17  ? 162 SER E CA    1 
ATOM 9898  C C     . SER E 4 162 ? 137.453 211.419 147.386 1.00 58.17  ? 162 SER E C     1 
ATOM 9899  O O     . SER E 4 162 ? 137.405 210.347 146.781 1.00 58.17  ? 162 SER E O     1 
ATOM 9900  C CB    . SER E 4 162 ? 137.896 213.265 145.770 1.00 58.17  ? 162 SER E CB    1 
ATOM 9901  O OG    . SER E 4 162 ? 137.608 212.369 144.716 1.00 58.17  ? 162 SER E OG    1 
ATOM 9902  N N     . ARG E 4 163 ? 136.666 211.701 148.419 1.00 54.64  ? 163 ARG E N     1 
ATOM 9903  C CA    . ARG E 4 163 ? 135.766 210.729 149.020 1.00 54.64  ? 163 ARG E CA    1 
ATOM 9904  C C     . ARG E 4 163 ? 134.316 211.083 148.740 1.00 54.64  ? 163 ARG E C     1 
ATOM 9905  O O     . ARG E 4 163 ? 133.908 212.235 148.909 1.00 54.64  ? 163 ARG E O     1 
ATOM 9906  C CB    . ARG E 4 163 ? 135.970 210.666 150.530 1.00 54.64  ? 163 ARG E CB    1 
ATOM 9907  C CG    . ARG E 4 163 ? 137.342 210.262 150.975 1.00 54.64  ? 163 ARG E CG    1 
ATOM 9908  C CD    . ARG E 4 163 ? 137.372 210.253 152.475 1.00 54.64  ? 163 ARG E CD    1 
ATOM 9909  N NE    . ARG E 4 163 ? 138.682 209.895 152.982 1.00 54.64  ? 163 ARG E NE    1 
ATOM 9910  C CZ    . ARG E 4 163 ? 139.644 210.781 153.201 1.00 54.64  ? 163 ARG E CZ    1 
ATOM 9911  N NH1   . ARG E 4 163 ? 139.422 212.063 152.950 1.00 54.64  ? 163 ARG E NH1   1 
ATOM 9912  N NH2   . ARG E 4 163 ? 140.818 210.391 153.669 1.00 54.64  ? 163 ARG E NH2   1 
ATOM 9913  N N     . ASN E 4 164 ? 133.545 210.085 148.330 1.00 51.10  ? 164 ASN E N     1 
ATOM 9914  C CA    . ASN E 4 164 ? 132.100 210.190 148.268 1.00 51.10  ? 164 ASN E CA    1 
ATOM 9915  C C     . ASN E 4 164 ? 131.492 209.819 149.612 1.00 51.10  ? 164 ASN E C     1 
ATOM 9916  O O     . ASN E 4 164 ? 132.153 209.272 150.495 1.00 51.10  ? 164 ASN E O     1 
ATOM 9917  C CB    . ASN E 4 164 ? 131.565 209.261 147.179 1.00 51.10  ? 164 ASN E CB    1 
ATOM 9918  C CG    . ASN E 4 164 ? 130.093 209.448 146.911 1.00 51.10  ? 164 ASN E CG    1 
ATOM 9919  O OD1   . ASN E 4 164 ? 129.331 209.840 147.789 1.00 51.10  ? 164 ASN E OD1   1 
ATOM 9920  N ND2   . ASN E 4 164 ? 129.675 209.171 145.686 1.00 51.10  ? 164 ASN E ND2   1 
ATOM 9921  N N     . VAL E 4 165 ? 130.207 210.134 149.768 1.00 48.24  ? 165 VAL E N     1 
ATOM 9922  C CA    . VAL E 4 165 ? 129.473 209.649 150.929 1.00 48.24  ? 165 VAL E CA    1 
ATOM 9923  C C     . VAL E 4 165 ? 129.519 208.138 150.975 1.00 48.24  ? 165 VAL E C     1 
ATOM 9924  O O     . VAL E 4 165 ? 129.712 207.542 152.035 1.00 48.24  ? 165 VAL E O     1 
ATOM 9925  C CB    . VAL E 4 165 ? 128.032 210.175 150.922 1.00 48.24  ? 165 VAL E CB    1 
ATOM 9926  C CG1   . VAL E 4 165 ? 127.248 209.522 152.011 1.00 48.24  ? 165 VAL E CG1   1 
ATOM 9927  C CG2   . VAL E 4 165 ? 128.063 211.646 151.187 1.00 48.24  ? 165 VAL E CG2   1 
ATOM 9928  N N     . SER E 4 166 ? 129.367 207.493 149.824 1.00 49.65  ? 166 SER E N     1 
ATOM 9929  C CA    . SER E 4 166 ? 129.443 206.042 149.794 1.00 49.65  ? 166 SER E CA    1 
ATOM 9930  C C     . SER E 4 166 ? 130.834 205.575 150.188 1.00 49.65  ? 166 SER E C     1 
ATOM 9931  O O     . SER E 4 166 ? 130.992 204.524 150.815 1.00 49.65  ? 166 SER E O     1 
ATOM 9932  C CB    . SER E 4 166 ? 129.067 205.525 148.414 1.00 49.65  ? 166 SER E CB    1 
ATOM 9933  O OG    . SER E 4 166 ? 127.715 205.813 148.124 1.00 49.65  ? 166 SER E OG    1 
ATOM 9934  N N     . VAL E 4 167 ? 131.861 206.327 149.793 1.00 49.56  ? 167 VAL E N     1 
ATOM 9935  C CA    . VAL E 4 167 ? 133.218 205.980 150.186 1.00 49.56  ? 167 VAL E CA    1 
ATOM 9936  C C     . VAL E 4 167 ? 133.435 206.256 151.663 1.00 49.56  ? 167 VAL E C     1 
ATOM 9937  O O     . VAL E 4 167 ? 134.055 205.458 152.368 1.00 49.56  ? 167 VAL E O     1 
ATOM 9938  C CB    . VAL E 4 167 ? 134.230 206.761 149.339 1.00 49.56  ? 167 VAL E CB    1 
ATOM 9939  C CG1   . VAL E 4 167 ? 135.645 206.400 149.746 1.00 49.56  ? 167 VAL E CG1   1 
ATOM 9940  C CG2   . VAL E 4 167 ? 133.986 206.548 147.877 1.00 49.56  ? 167 VAL E CG2   1 
ATOM 9941  N N     . ASN E 4 168 ? 132.912 207.381 152.163 1.00 48.90  ? 168 ASN E N     1 
ATOM 9942  C CA    . ASN E 4 168 ? 133.051 207.696 153.583 1.00 48.90  ? 168 ASN E CA    1 
ATOM 9943  C C     . ASN E 4 168 ? 132.374 206.654 154.436 1.00 48.90  ? 168 ASN E C     1 
ATOM 9944  O O     . ASN E 4 168 ? 132.859 206.301 155.512 1.00 48.90  ? 168 ASN E O     1 
ATOM 9945  C CB    . ASN E 4 168 ? 132.440 209.061 153.900 1.00 48.90  ? 168 ASN E CB    1 
ATOM 9946  C CG    . ASN E 4 168 ? 133.236 210.215 153.334 1.00 48.90  ? 168 ASN E CG    1 
ATOM 9947  O OD1   . ASN E 4 168 ? 134.346 210.486 153.783 1.00 48.90  ? 168 ASN E OD1   1 
ATOM 9948  N ND2   . ASN E 4 168 ? 132.660 210.915 152.362 1.00 48.90  ? 168 ASN E ND2   1 
ATOM 9949  N N     . LEU E 4 169 ? 131.261 206.133 153.954 1.00 38.06  ? 169 LEU E N     1 
ATOM 9950  C CA    . LEU E 4 169 ? 130.449 205.221 154.732 1.00 38.06  ? 169 LEU E CA    1 
ATOM 9951  C C     . LEU E 4 169 ? 130.939 203.788 154.625 1.00 38.06  ? 169 LEU E C     1 
ATOM 9952  O O     . LEU E 4 169 ? 131.038 203.087 155.635 1.00 38.06  ? 169 LEU E O     1 
ATOM 9953  C CB    . LEU E 4 169 ? 129.015 205.338 154.242 1.00 38.06  ? 169 LEU E CB    1 
ATOM 9954  C CG    . LEU E 4 169 ? 127.864 205.082 155.181 1.00 38.06  ? 169 LEU E CG    1 
ATOM 9955  C CD1   . LEU E 4 169 ? 128.003 205.975 156.353 1.00 38.06  ? 169 LEU E CD1   1 
ATOM 9956  C CD2   . LEU E 4 169 ? 126.614 205.424 154.435 1.00 38.06  ? 169 LEU E CD2   1 
ATOM 9957  N N     . PHE E 4 170 ? 131.243 203.328 153.415 1.00 36.47  ? 170 PHE E N     1 
ATOM 9958  C CA    . PHE E 4 170 ? 131.642 201.944 153.211 1.00 36.47  ? 170 PHE E CA    1 
ATOM 9959  C C     . PHE E 4 170 ? 133.131 201.749 152.988 1.00 36.47  ? 170 PHE E C     1 
ATOM 9960  O O     . PHE E 4 170 ? 133.596 200.610 153.054 1.00 36.47  ? 170 PHE E O     1 
ATOM 9961  C CB    . PHE E 4 170 ? 130.873 201.356 152.030 1.00 36.47  ? 170 PHE E CB    1 
ATOM 9962  C CG    . PHE E 4 170 ? 129.400 201.317 152.246 1.00 36.47  ? 170 PHE E CG    1 
ATOM 9963  C CD1   . PHE E 4 170 ? 128.854 200.439 153.141 1.00 36.47  ? 170 PHE E CD1   1 
ATOM 9964  C CD2   . PHE E 4 170 ? 128.565 202.166 151.568 1.00 36.47  ? 170 PHE E CD2   1 
ATOM 9965  C CE1   . PHE E 4 170 ? 127.514 200.413 153.348 1.00 36.47  ? 170 PHE E CE1   1 
ATOM 9966  C CE2   . PHE E 4 170 ? 127.225 202.131 151.779 1.00 36.47  ? 170 PHE E CE2   1 
ATOM 9967  C CZ    . PHE E 4 170 ? 126.703 201.254 152.670 1.00 36.47  ? 170 PHE E CZ    1 
ATOM 9968  N N     . GLY E 4 171 ? 133.885 202.808 152.722 1.00 45.84  ? 171 GLY E N     1 
ATOM 9969  C CA    . GLY E 4 171 ? 135.314 202.678 152.542 1.00 45.84  ? 171 GLY E CA    1 
ATOM 9970  C C     . GLY E 4 171 ? 135.691 202.150 151.172 1.00 45.84  ? 171 GLY E C     1 
ATOM 9971  O O     . GLY E 4 171 ? 134.868 201.651 150.410 1.00 45.84  ? 171 GLY E O     1 
ATOM 9972  N N     . ARG E 4 172 ? 136.981 202.235 150.869 1.00 49.88  ? 172 ARG E N     1 
ATOM 9973  C CA    . ARG E 4 172 ? 137.481 201.773 149.590 1.00 49.88  ? 172 ARG E CA    1 
ATOM 9974  C C     . ARG E 4 172 ? 138.834 201.136 149.830 1.00 49.88  ? 172 ARG E C     1 
ATOM 9975  O O     . ARG E 4 172 ? 139.442 201.299 150.890 1.00 49.88  ? 172 ARG E O     1 
ATOM 9976  C CB    . ARG E 4 172 ? 137.631 202.913 148.582 1.00 49.88  ? 172 ARG E CB    1 
ATOM 9977  C CG    . ARG E 4 172 ? 138.910 203.676 148.779 1.00 49.88  ? 172 ARG E CG    1 
ATOM 9978  C CD    . ARG E 4 172 ? 139.208 204.672 147.691 1.00 49.88  ? 172 ARG E CD    1 
ATOM 9979  N NE    . ARG E 4 172 ? 138.343 205.831 147.789 1.00 49.88  ? 172 ARG E NE    1 
ATOM 9980  C CZ    . ARG E 4 172 ? 138.304 206.788 146.878 1.00 49.88  ? 172 ARG E CZ    1 
ATOM 9981  N NH1   . ARG E 4 172 ? 137.492 207.821 147.025 1.00 49.88  ? 172 ARG E NH1   1 
ATOM 9982  N NH2   . ARG E 4 172 ? 139.085 206.706 145.819 1.00 49.88  ? 172 ARG E NH2   1 
ATOM 9983  N N     . MET E 4 173 ? 139.304 200.399 148.834 1.00 52.18  ? 173 MET E N     1 
ATOM 9984  C CA    . MET E 4 173 ? 140.632 199.818 148.884 1.00 52.18  ? 173 MET E CA    1 
ATOM 9985  C C     . MET E 4 173 ? 141.266 199.881 147.513 1.00 52.18  ? 173 MET E C     1 
ATOM 9986  O O     . MET E 4 173 ? 140.633 199.523 146.519 1.00 52.18  ? 173 MET E O     1 
ATOM 9987  C CB    . MET E 4 173 ? 140.588 198.369 149.343 1.00 52.18  ? 173 MET E CB    1 
ATOM 9988  C CG    . MET E 4 173 ? 141.888 197.673 149.107 1.00 52.18  ? 173 MET E CG    1 
ATOM 9989  S SD    . MET E 4 173 ? 141.837 195.944 149.535 1.00 52.18  ? 173 MET E SD    1 
ATOM 9990  C CE    . MET E 4 173 ? 143.428 195.424 148.936 1.00 52.18  ? 173 MET E CE    1 
ATOM 9991  N N     . LEU E 4 174 ? 142.511 200.334 147.461 1.00 56.26  ? 174 LEU E N     1 
ATOM 9992  C CA    . LEU E 4 174 ? 143.273 200.324 146.222 1.00 56.26  ? 174 LEU E CA    1 
ATOM 9993  C C     . LEU E 4 174 ? 144.691 199.938 146.605 1.00 56.26  ? 174 LEU E C     1 
ATOM 9994  O O     . LEU E 4 174 ? 145.407 200.729 147.224 1.00 56.26  ? 174 LEU E O     1 
ATOM 9995  C CB    . LEU E 4 174 ? 143.200 201.690 145.553 1.00 56.26  ? 174 LEU E CB    1 
ATOM 9996  C CG    . LEU E 4 174 ? 143.677 201.844 144.125 1.00 56.26  ? 174 LEU E CG    1 
ATOM 9997  C CD1   . LEU E 4 174 ? 142.999 200.822 143.301 1.00 56.26  ? 174 LEU E CD1   1 
ATOM 9998  C CD2   . LEU E 4 174 ? 143.282 203.203 143.627 1.00 56.26  ? 174 LEU E CD2   1 
ATOM 9999  N N     . ALA E 4 175 ? 145.094 198.724 146.238 1.00 59.44  ? 175 ALA E N     1 
ATOM 10000 C CA    . ALA E 4 175 ? 146.377 198.195 146.688 1.00 59.44  ? 175 ALA E CA    1 
ATOM 10001 C C     . ALA E 4 175 ? 147.551 198.959 146.096 1.00 59.44  ? 175 ALA E C     1 
ATOM 10002 O O     . ALA E 4 175 ? 148.547 199.211 146.783 1.00 59.44  ? 175 ALA E O     1 
ATOM 10003 C CB    . ALA E 4 175 ? 146.473 196.714 146.340 1.00 59.44  ? 175 ALA E CB    1 
ATOM 10004 N N     . GLU E 4 176 ? 147.447 199.344 144.828 1.00 66.31  ? 176 GLU E N     1 
ATOM 10005 C CA    . GLU E 4 176 ? 148.516 200.071 144.159 1.00 66.31  ? 176 GLU E CA    1 
ATOM 10006 C C     . GLU E 4 176 ? 148.667 201.500 144.651 1.00 66.31  ? 176 GLU E C     1 
ATOM 10007 O O     . GLU E 4 176 ? 149.754 202.068 144.524 1.00 66.31  ? 176 GLU E O     1 
ATOM 10008 C CB    . GLU E 4 176 ? 148.275 200.036 142.656 1.00 66.31  ? 176 GLU E CB    1 
ATOM 10009 C CG    . GLU E 4 176 ? 148.462 198.652 142.046 1.00 66.31  ? 176 GLU E CG    1 
ATOM 10010 C CD    . GLU E 4 176 ? 147.294 197.715 142.297 1.00 66.31  ? 176 GLU E CD    1 
ATOM 10011 O OE1   . GLU E 4 176 ? 146.382 198.088 143.062 1.00 66.31  ? 176 GLU E OE1   1 
ATOM 10012 O OE2   . GLU E 4 176 ? 147.289 196.600 141.735 1.00 66.31  ? 176 GLU E OE2   1 
ATOM 10013 N N     . LEU E 4 177 ? 147.618 202.099 145.198 1.00 58.22  ? 177 LEU E N     1 
ATOM 10014 C CA    . LEU E 4 177 ? 147.672 203.468 145.697 1.00 58.22  ? 177 LEU E CA    1 
ATOM 10015 C C     . LEU E 4 177 ? 147.198 203.434 147.137 1.00 58.22  ? 177 LEU E C     1 
ATOM 10016 O O     . LEU E 4 177 ? 146.056 203.793 147.446 1.00 58.22  ? 177 LEU E O     1 
ATOM 10017 C CB    . LEU E 4 177 ? 146.815 204.393 144.842 1.00 58.22  ? 177 LEU E CB    1 
ATOM 10018 C CG    . LEU E 4 177 ? 147.406 204.565 143.456 1.00 58.22  ? 177 LEU E CG    1 
ATOM 10019 C CD1   . LEU E 4 177 ? 146.401 205.203 142.543 1.00 58.22  ? 177 LEU E CD1   1 
ATOM 10020 C CD2   . LEU E 4 177 ? 148.652 205.405 143.562 1.00 58.22  ? 177 LEU E CD2   1 
ATOM 10021 N N     . PRO E 4 178 ? 148.072 203.033 148.057 1.00 57.57  ? 178 PRO E N     1 
ATOM 10022 C CA    . PRO E 4 178 ? 147.685 202.958 149.467 1.00 57.57  ? 178 PRO E CA    1 
ATOM 10023 C C     . PRO E 4 178 ? 147.368 204.296 150.094 1.00 57.57  ? 178 PRO E C     1 
ATOM 10024 O O     . PRO E 4 178 ? 146.804 204.322 151.192 1.00 57.57  ? 178 PRO E O     1 
ATOM 10025 C CB    . PRO E 4 178 ? 148.904 202.313 150.124 1.00 57.57  ? 178 PRO E CB    1 
ATOM 10026 C CG    . PRO E 4 178 ? 150.027 202.641 149.222 1.00 57.57  ? 178 PRO E CG    1 
ATOM 10027 C CD    . PRO E 4 178 ? 149.467 202.629 147.843 1.00 57.57  ? 178 PRO E CD    1 
ATOM 10028 N N     . SER E 4 179 ? 147.708 205.405 149.452 1.00 58.85  ? 179 SER E N     1 
ATOM 10029 C CA    . SER E 4 179 ? 147.363 206.690 150.040 1.00 58.85  ? 179 SER E CA    1 
ATOM 10030 C C     . SER E 4 179 ? 145.868 206.965 149.972 1.00 58.85  ? 179 SER E C     1 
ATOM 10031 O O     . SER E 4 179 ? 145.347 207.731 150.787 1.00 58.85  ? 179 SER E O     1 
ATOM 10032 C CB    . SER E 4 179 ? 148.147 207.798 149.347 1.00 58.85  ? 179 SER E CB    1 
ATOM 10033 O OG    . SER E 4 179 ? 147.829 207.850 147.970 1.00 58.85  ? 179 SER E OG    1 
ATOM 10034 N N     . THR E 4 180 ? 145.168 206.371 149.011 1.00 58.20  ? 180 THR E N     1 
ATOM 10035 C CA    . THR E 4 180 ? 143.749 206.632 148.803 1.00 58.20  ? 180 THR E CA    1 
ATOM 10036 C C     . THR E 4 180 ? 142.830 205.716 149.602 1.00 58.20  ? 180 THR E C     1 
ATOM 10037 O O     . THR E 4 180 ? 141.638 206.013 149.713 1.00 58.20  ? 180 THR E O     1 
ATOM 10038 C CB    . THR E 4 180 ? 143.397 206.509 147.324 1.00 58.20  ? 180 THR E CB    1 
ATOM 10039 O OG1   . THR E 4 180 ? 143.633 205.165 146.895 1.00 58.20  ? 180 THR E OG1   1 
ATOM 10040 C CG2   . THR E 4 180 ? 144.238 207.459 146.499 1.00 58.20  ? 180 THR E CG2   1 
ATOM 10041 N N     . GLU E 4 181 ? 143.345 204.626 150.157 1.00 55.60  ? 181 GLU E N     1 
ATOM 10042 C CA    . GLU E 4 181 ? 142.506 203.674 150.873 1.00 55.60  ? 181 GLU E CA    1 
ATOM 10043 C C     . GLU E 4 181 ? 141.843 204.307 152.088 1.00 55.60  ? 181 GLU E C     1 
ATOM 10044 O O     . GLU E 4 181 ? 142.495 204.989 152.879 1.00 55.60  ? 181 GLU E O     1 
ATOM 10045 C CB    . GLU E 4 181 ? 143.367 202.502 151.324 1.00 55.60  ? 181 GLU E CB    1 
ATOM 10046 C CG    . GLU E 4 181 ? 143.909 201.665 150.200 1.00 55.60  ? 181 GLU E CG    1 
ATOM 10047 C CD    . GLU E 4 181 ? 144.735 200.497 150.699 1.00 55.60  ? 181 GLU E CD    1 
ATOM 10048 O OE1   . GLU E 4 181 ? 144.957 200.401 151.923 1.00 55.60  ? 181 GLU E OE1   1 
ATOM 10049 O OE2   . GLU E 4 181 ? 145.179 199.683 149.864 1.00 55.60  ? 181 GLU E OE2   1 
ATOM 10050 N N     . VAL E 4 182 ? 140.538 204.084 152.228 1.00 51.12  ? 182 VAL E N     1 
ATOM 10051 C CA    . VAL E 4 182 ? 139.751 204.614 153.335 1.00 51.12  ? 182 VAL E CA    1 
ATOM 10052 C C     . VAL E 4 182 ? 139.062 203.455 154.036 1.00 51.12  ? 182 VAL E C     1 
ATOM 10053 O O     . VAL E 4 182 ? 138.402 202.640 153.385 1.00 51.12  ? 182 VAL E O     1 
ATOM 10054 C CB    . VAL E 4 182 ? 138.712 205.642 152.862 1.00 51.12  ? 182 VAL E CB    1 
ATOM 10055 C CG1   . VAL E 4 182 ? 137.911 206.133 154.033 1.00 51.12  ? 182 VAL E CG1   1 
ATOM 10056 C CG2   . VAL E 4 182 ? 139.394 206.794 152.174 1.00 51.12  ? 182 VAL E CG2   1 
ATOM 10057 N N     . ASP E 4 183 ? 139.222 203.373 155.352 1.00 50.97  ? 183 ASP E N     1 
ATOM 10058 C CA    . ASP E 4 183 ? 138.557 202.335 156.127 1.00 50.97  ? 183 ASP E CA    1 
ATOM 10059 C C     . ASP E 4 183 ? 137.060 202.590 156.226 1.00 50.97  ? 183 ASP E C     1 
ATOM 10060 O O     . ASP E 4 183 ? 136.631 203.693 156.570 1.00 50.97  ? 183 ASP E O     1 
ATOM 10061 C CB    . ASP E 4 183 ? 139.181 202.257 157.512 1.00 50.97  ? 183 ASP E CB    1 
ATOM 10062 C CG    . ASP E 4 183 ? 140.623 201.819 157.463 1.00 50.97  ? 183 ASP E CG    1 
ATOM 10063 O OD1   . ASP E 4 183 ? 141.015 201.195 156.454 1.00 50.97  ? 183 ASP E OD1   1 
ATOM 10064 O OD2   . ASP E 4 183 ? 141.371 202.101 158.420 1.00 50.97  ? 183 ASP E OD2   1 
ATOM 10065 N N     . GLY E 4 184 ? 136.262 201.570 155.934 1.00 45.20  ? 184 GLY E N     1 
ATOM 10066 C CA    . GLY E 4 184 ? 134.822 201.718 156.019 1.00 45.20  ? 184 GLY E CA    1 
ATOM 10067 C C     . GLY E 4 184 ? 134.327 201.893 157.442 1.00 45.20  ? 184 GLY E C     1 
ATOM 10068 O O     . GLY E 4 184 ? 134.892 201.363 158.394 1.00 45.20  ? 184 GLY E O     1 
ATOM 10069 N N     . ALA E 4 185 ? 133.247 202.656 157.583 1.00 37.32  ? 185 ALA E N     1 
ATOM 10070 C CA    . ALA E 4 185 ? 132.638 202.925 158.877 1.00 37.32  ? 185 ALA E CA    1 
ATOM 10071 C C     . ALA E 4 185 ? 131.347 202.163 159.146 1.00 37.32  ? 185 ALA E C     1 
ATOM 10072 O O     . ALA E 4 185 ? 130.739 202.391 160.190 1.00 37.32  ? 185 ALA E O     1 
ATOM 10073 C CB    . ALA E 4 185 ? 132.370 204.418 159.027 1.00 37.32  ? 185 ALA E CB    1 
ATOM 10074 N N     . VAL E 4 186 ? 130.907 201.261 158.271 1.00 30.33  ? 186 VAL E N     1 
ATOM 10075 C CA    . VAL E 4 186 ? 129.614 200.604 158.443 1.00 30.33  ? 186 VAL E CA    1 
ATOM 10076 C C     . VAL E 4 186 ? 129.781 199.105 158.340 1.00 30.33  ? 186 VAL E C     1 
ATOM 10077 O O     . VAL E 4 186 ? 130.363 198.611 157.372 1.00 30.33  ? 186 VAL E O     1 
ATOM 10078 C CB    . VAL E 4 186 ? 128.604 201.083 157.394 1.00 30.33  ? 186 VAL E CB    1 
ATOM 10079 C CG1   . VAL E 4 186 ? 127.459 200.121 157.306 1.00 30.33  ? 186 VAL E CG1   1 
ATOM 10080 C CG2   . VAL E 4 186 ? 128.111 202.450 157.762 1.00 30.33  ? 186 VAL E CG2   1 
ATOM 10081 N N     . GLN E 4 187 ? 129.244 198.379 159.312 1.00 31.62  ? 187 GLN E N     1 
ATOM 10082 C CA    . GLN E 4 187 ? 129.217 196.923 159.263 1.00 31.62  ? 187 GLN E CA    1 
ATOM 10083 C C     . GLN E 4 187 ? 127.832 196.386 158.924 1.00 31.62  ? 187 GLN E C     1 
ATOM 10084 O O     . GLN E 4 187 ? 126.860 196.700 159.604 1.00 31.62  ? 187 GLN E O     1 
ATOM 10085 C CB    . GLN E 4 187 ? 129.675 196.367 160.606 1.00 31.62  ? 187 GLN E CB    1 
ATOM 10086 C CG    . GLN E 4 187 ? 131.073 196.799 160.966 1.00 31.62  ? 187 GLN E CG    1 
ATOM 10087 C CD    . GLN E 4 187 ? 131.496 196.295 162.317 1.00 31.62  ? 187 GLN E CD    1 
ATOM 10088 O OE1   . GLN E 4 187 ? 130.665 195.892 163.123 1.00 31.62  ? 187 GLN E OE1   1 
ATOM 10089 N NE2   . GLN E 4 187 ? 132.788 196.339 162.588 1.00 31.62  ? 187 GLN E NE2   1 
ATOM 10090 N N     . PHE E 4 188 ? 127.738 195.568 157.890 1.00 25.47  ? 188 PHE E N     1 
ATOM 10091 C CA    . PHE E 4 188 ? 126.452 195.059 157.429 1.00 25.47  ? 188 PHE E CA    1 
ATOM 10092 C C     . PHE E 4 188 ? 126.439 193.541 157.524 1.00 25.47  ? 188 PHE E C     1 
ATOM 10093 O O     . PHE E 4 188 ? 127.144 192.866 156.775 1.00 25.47  ? 188 PHE E O     1 
ATOM 10094 C CB    . PHE E 4 188 ? 126.113 195.535 156.020 1.00 25.47  ? 188 PHE E CB    1 
ATOM 10095 C CG    . PHE E 4 188 ? 124.727 195.181 155.611 1.00 25.47  ? 188 PHE E CG    1 
ATOM 10096 C CD1   . PHE E 4 188 ? 123.628 195.837 156.110 1.00 25.47  ? 188 PHE E CD1   1 
ATOM 10097 C CD2   . PHE E 4 188 ? 124.525 194.121 154.760 1.00 25.47  ? 188 PHE E CD2   1 
ATOM 10098 C CE1   . PHE E 4 188 ? 122.355 195.440 155.742 1.00 25.47  ? 188 PHE E CE1   1 
ATOM 10099 C CE2   . PHE E 4 188 ? 123.254 193.729 154.388 1.00 25.47  ? 188 PHE E CE2   1 
ATOM 10100 C CZ    . PHE E 4 188 ? 122.169 194.391 154.885 1.00 25.47  ? 188 PHE E CZ    1 
ATOM 10101 N N     . ALA E 4 189 ? 125.649 193.006 158.446 1.00 22.38  ? 189 ALA E N     1 
ATOM 10102 C CA    . ALA E 4 189 ? 125.567 191.571 158.658 1.00 22.38  ? 189 ALA E CA    1 
ATOM 10103 C C     . ALA E 4 189 ? 124.742 190.895 157.578 1.00 22.38  ? 189 ALA E C     1 
ATOM 10104 O O     . ALA E 4 189 ? 123.851 191.496 156.983 1.00 22.38  ? 189 ALA E O     1 
ATOM 10105 C CB    . ALA E 4 189 ? 124.950 191.252 160.013 1.00 22.38  ? 189 ALA E CB    1 
ATOM 10106 N N     . HIS E 4 190 ? 125.042 189.620 157.341 1.00 20.87  ? 190 HIS E N     1 
ATOM 10107 C CA    . HIS E 4 190 ? 124.267 188.790 156.425 1.00 20.87  ? 190 HIS E CA    1 
ATOM 10108 C C     . HIS E 4 190 ? 122.907 188.457 157.015 1.00 20.87  ? 190 HIS E C     1 
ATOM 10109 O O     . HIS E 4 190 ? 122.805 187.689 157.973 1.00 20.87  ? 190 HIS E O     1 
ATOM 10110 C CB    . HIS E 4 190 ? 125.029 187.509 156.126 1.00 20.87  ? 190 HIS E CB    1 
ATOM 10111 C CG    . HIS E 4 190 ? 126.208 187.701 155.234 1.00 20.87  ? 190 HIS E CG    1 
ATOM 10112 N ND1   . HIS E 4 190 ? 126.136 187.551 153.870 1.00 20.87  ? 190 HIS E ND1   1 
ATOM 10113 C CD2   . HIS E 4 190 ? 127.485 188.035 155.507 1.00 20.87  ? 190 HIS E CD2   1 
ATOM 10114 C CE1   . HIS E 4 190 ? 127.320 187.786 153.340 1.00 20.87  ? 190 HIS E CE1   1 
ATOM 10115 N NE2   . HIS E 4 190 ? 128.158 188.080 154.313 1.00 20.87  ? 190 HIS E NE2   1 
ATOM 10116 N N     . ALA E 4 191 ? 121.868 189.015 156.417 1.00 18.47  ? 191 ALA E N     1 
ATOM 10117 C CA    . ALA E 4 191 ? 120.481 188.798 156.807 1.00 18.47  ? 191 ALA E CA    1 
ATOM 10118 C C     . ALA E 4 191 ? 120.056 187.363 156.547 1.00 18.47  ? 191 ALA E C     1 
ATOM 10119 O O     . ALA E 4 191 ? 119.912 186.965 155.394 1.00 18.47  ? 191 ALA E O     1 
ATOM 10120 C CB    . ALA E 4 191 ? 119.591 189.768 156.050 1.00 18.47  ? 191 ALA E CB    1 
ATOM 10121 N N     . PHE E 4 192 ? 119.836 186.579 157.591 1.00 19.06  ? 192 PHE E N     1 
ATOM 10122 C CA    . PHE E 4 192 ? 119.378 185.208 157.424 1.00 19.06  ? 192 PHE E CA    1 
ATOM 10123 C C     . PHE E 4 192 ? 117.957 185.052 157.945 1.00 19.06  ? 192 PHE E C     1 
ATOM 10124 O O     . PHE E 4 192 ? 117.450 185.905 158.673 1.00 19.06  ? 192 PHE E O     1 
ATOM 10125 C CB    . PHE E 4 192 ? 120.307 184.241 158.150 1.00 19.06  ? 192 PHE E CB    1 
ATOM 10126 C CG    . PHE E 4 192 ? 120.398 184.486 159.617 1.00 19.06  ? 192 PHE E CG    1 
ATOM 10127 C CD1   . PHE E 4 192 ? 121.315 185.378 160.117 1.00 19.06  ? 192 PHE E CD1   1 
ATOM 10128 C CD2   . PHE E 4 192 ? 119.598 183.808 160.497 1.00 19.06  ? 192 PHE E CD2   1 
ATOM 10129 C CE1   . PHE E 4 192 ? 121.402 185.609 161.457 1.00 19.06  ? 192 PHE E CE1   1 
ATOM 10130 C CE2   . PHE E 4 192 ? 119.690 184.036 161.842 1.00 19.06  ? 192 PHE E CE2   1 
ATOM 10131 C CZ    . PHE E 4 192 ? 120.592 184.938 162.320 1.00 19.06  ? 192 PHE E CZ    1 
ATOM 10132 N N     . THR E 4 193 ? 117.304 183.956 157.564 1.00 25.87  ? 193 THR E N     1 
ATOM 10133 C CA    . THR E 4 193 ? 115.945 183.722 158.030 1.00 25.87  ? 193 THR E CA    1 
ATOM 10134 C C     . THR E 4 193 ? 115.965 183.273 159.470 1.00 25.87  ? 193 THR E C     1 
ATOM 10135 O O     . THR E 4 193 ? 116.848 182.528 159.894 1.00 25.87  ? 193 THR E O     1 
ATOM 10136 C CB    . THR E 4 193 ? 115.230 182.642 157.238 1.00 25.87  ? 193 THR E CB    1 
ATOM 10137 O OG1   . THR E 4 193 ? 116.030 181.474 157.224 1.00 25.87  ? 193 THR E OG1   1 
ATOM 10138 C CG2   . THR E 4 193 ? 114.972 183.037 155.862 1.00 25.87  ? 193 THR E CG2   1 
ATOM 10139 N N     . VAL E 4 194 ? 114.954 183.696 160.209 1.00 22.24  ? 194 VAL E N     1 
ATOM 10140 C CA    . VAL E 4 194 ? 114.794 183.241 161.576 1.00 22.24  ? 194 VAL E CA    1 
ATOM 10141 C C     . VAL E 4 194 ? 114.507 181.752 161.622 1.00 22.24  ? 194 VAL E C     1 
ATOM 10142 O O     . VAL E 4 194 ? 115.010 181.038 162.492 1.00 22.24  ? 194 VAL E O     1 
ATOM 10143 C CB    . VAL E 4 194 ? 113.681 184.050 162.242 1.00 22.24  ? 194 VAL E CB    1 
ATOM 10144 C CG1   . VAL E 4 194 ? 113.386 183.483 163.563 1.00 22.24  ? 194 VAL E CG1   1 
ATOM 10145 C CG2   . VAL E 4 194 ? 114.106 185.466 162.368 1.00 22.24  ? 194 VAL E CG2   1 
ATOM 10146 N N     . HIS E 4 195 ? 113.728 181.254 160.678 1.00 28.77  ? 195 HIS E N     1 
ATOM 10147 C CA    . HIS E 4 195 ? 113.305 179.867 160.631 1.00 28.77  ? 195 HIS E CA    1 
ATOM 10148 C C     . HIS E 4 195 ? 113.950 179.104 159.488 1.00 28.77  ? 195 HIS E C     1 
ATOM 10149 O O     . HIS E 4 195 ? 114.349 179.677 158.479 1.00 28.77  ? 195 HIS E O     1 
ATOM 10150 C CB    . HIS E 4 195 ? 111.800 179.822 160.477 1.00 28.77  ? 195 HIS E CB    1 
ATOM 10151 C CG    . HIS E 4 195 ? 111.336 180.475 159.224 1.00 28.77  ? 195 HIS E CG    1 
ATOM 10152 N ND1   . HIS E 4 195 ? 111.231 181.841 159.112 1.00 28.77  ? 195 HIS E ND1   1 
ATOM 10153 C CD2   . HIS E 4 195 ? 111.003 179.971 158.017 1.00 28.77  ? 195 HIS E CD2   1 
ATOM 10154 C CE1   . HIS E 4 195 ? 110.825 182.151 157.896 1.00 28.77  ? 195 HIS E CE1   1 
ATOM 10155 N NE2   . HIS E 4 195 ? 110.681 181.034 157.210 1.00 28.77  ? 195 HIS E NE2   1 
ATOM 10156 N N     . GLY E 4 196 ? 113.979 177.784 159.632 1.00 28.60  ? 196 GLY E N     1 
ATOM 10157 C CA    . GLY E 4 196 ? 114.524 176.934 158.587 1.00 28.60  ? 196 GLY E CA    1 
ATOM 10158 C C     . GLY E 4 196 ? 113.640 176.919 157.362 1.00 28.60  ? 196 GLY E C     1 
ATOM 10159 O O     . GLY E 4 196 ? 112.420 176.759 157.465 1.00 28.60  ? 196 GLY E O     1 
ATOM 10160 N N     . THR E 4 197 ? 114.250 177.075 156.189 1.00 38.75  ? 197 THR E N     1 
ATOM 10161 C CA    . THR E 4 197 ? 113.507 177.146 154.938 1.00 38.75  ? 197 THR E CA    1 
ATOM 10162 C C     . THR E 4 197 ? 114.081 176.176 153.922 1.00 38.75  ? 197 THR E C     1 
ATOM 10163 O O     . THR E 4 197 ? 115.268 176.253 153.595 1.00 38.75  ? 197 THR E O     1 
ATOM 10164 C CB    . THR E 4 197 ? 113.563 178.553 154.352 1.00 38.75  ? 197 THR E CB    1 
ATOM 10165 O OG1   . THR E 4 197 ? 114.927 178.892 154.096 1.00 38.75  ? 197 THR E OG1   1 
ATOM 10166 C CG2   . THR E 4 197 ? 113.002 179.556 155.321 1.00 38.75  ? 197 THR E CG2   1 
ATOM 10167 N N     . THR E 4 198 ? 113.245 175.269 153.424 1.00 56.31  ? 198 THR E N     1 
ATOM 10168 C CA    . THR E 4 198 ? 113.626 174.398 152.322 1.00 56.31  ? 198 THR E CA    1 
ATOM 10169 C C     . THR E 4 198 ? 113.347 175.123 151.016 1.00 56.31  ? 198 THR E C     1 
ATOM 10170 O O     . THR E 4 198 ? 112.307 175.770 150.866 1.00 56.31  ? 198 THR E O     1 
ATOM 10171 C CB    . THR E 4 198 ? 112.855 173.081 152.357 1.00 56.31  ? 198 THR E CB    1 
ATOM 10172 O OG1   . THR E 4 198 ? 111.454 173.354 152.268 1.00 56.31  ? 198 THR E OG1   1 
ATOM 10173 C CG2   . THR E 4 198 ? 113.134 172.342 153.644 1.00 56.31  ? 198 THR E CG2   1 
ATOM 10174 N N     . VAL E 4 199 ? 114.286 175.031 150.081 1.00 53.46  ? 199 VAL E N     1 
ATOM 10175 C CA    . VAL E 4 199 ? 114.132 175.715 148.805 1.00 53.46  ? 199 VAL E CA    1 
ATOM 10176 C C     . VAL E 4 199 ? 113.019 175.058 148.001 1.00 53.46  ? 199 VAL E C     1 
ATOM 10177 O O     . VAL E 4 199 ? 113.030 173.846 147.759 1.00 53.46  ? 199 VAL E O     1 
ATOM 10178 C CB    . VAL E 4 199 ? 115.456 175.737 148.034 1.00 53.46  ? 199 VAL E CB    1 
ATOM 10179 C CG1   . VAL E 4 199 ? 115.925 174.334 147.697 1.00 53.46  ? 199 VAL E CG1   1 
ATOM 10180 C CG2   . VAL E 4 199 ? 115.316 176.563 146.791 1.00 53.46  ? 199 VAL E CG2   1 
ATOM 10181 N N     . GLU E 4 200 ? 112.018 175.844 147.634 1.00 54.94  ? 200 GLU E N     1 
ATOM 10182 C CA    . GLU E 4 200 ? 110.895 175.351 146.849 1.00 54.94  ? 200 GLU E CA    1 
ATOM 10183 C C     . GLU E 4 200 ? 111.133 175.695 145.381 1.00 54.94  ? 200 GLU E C     1 
ATOM 10184 O O     . GLU E 4 200 ? 111.422 176.846 145.048 1.00 54.94  ? 200 GLU E O     1 
ATOM 10185 C CB    . GLU E 4 200 ? 109.576 175.876 147.421 1.00 54.94  ? 200 GLU E CB    1 
ATOM 10186 C CG    . GLU E 4 200 ? 109.397 177.358 147.406 1.00 54.94  ? 200 GLU E CG    1 
ATOM 10187 C CD    . GLU E 4 200 ? 109.114 177.893 146.053 1.00 54.94  ? 200 GLU E CD    1 
ATOM 10188 O OE1   . GLU E 4 200 ? 108.234 177.354 145.362 1.00 54.94  ? 200 GLU E OE1   1 
ATOM 10189 O OE2   . GLU E 4 200 ? 109.822 178.830 145.654 1.00 54.94  ? 200 GLU E OE2   1 
ATOM 10190 N N     . VAL E 4 201 ? 111.159 174.672 144.540 1.00 55.84  ? 201 VAL E N     1 
ATOM 10191 C CA    . VAL E 4 201 ? 111.401 174.803 143.108 1.00 55.84  ? 201 VAL E CA    1 
ATOM 10192 C C     . VAL E 4 201 ? 110.096 174.839 142.311 1.00 55.84  ? 201 VAL E C     1 
ATOM 10193 O O     . VAL E 4 201 ? 109.271 173.926 142.421 1.00 55.84  ? 201 VAL E O     1 
ATOM 10194 C CB    . VAL E 4 201 ? 112.337 173.696 142.613 1.00 55.84  ? 201 VAL E CB    1 
ATOM 10195 C CG1   . VAL E 4 201 ? 111.752 172.342 142.886 1.00 55.84  ? 201 VAL E CG1   1 
ATOM 10196 C CG2   . VAL E 4 201 ? 112.571 173.868 141.156 1.00 55.84  ? 201 VAL E CG2   1 
ATOM 10197 N N     . ASP E 4 202 ? 109.875 175.914 141.549 1.00 62.74  ? 202 ASP E N     1 
ATOM 10198 C CA    . ASP E 4 202 ? 108.708 176.032 140.673 1.00 62.74  ? 202 ASP E CA    1 
ATOM 10199 C C     . ASP E 4 202 ? 109.127 175.755 139.231 1.00 62.74  ? 202 ASP E C     1 
ATOM 10200 O O     . ASP E 4 202 ? 110.006 176.427 138.684 1.00 62.74  ? 202 ASP E O     1 
ATOM 10201 C CB    . ASP E 4 202 ? 107.972 177.366 140.791 1.00 62.74  ? 202 ASP E CB    1 
ATOM 10202 C CG    . ASP E 4 202 ? 108.783 178.567 140.376 1.00 62.74  ? 202 ASP E CG    1 
ATOM 10203 O OD1   . ASP E 4 202 ? 109.965 178.455 140.038 1.00 62.74  ? 202 ASP E OD1   1 
ATOM 10204 O OD2   . ASP E 4 202 ? 108.191 179.661 140.342 1.00 62.74  ? 202 ASP E OD2   1 
ATOM 10205 N N     . PHE E 4 203 ? 108.586 174.689 138.665 1.00 64.16  ? 203 PHE E N     1 
ATOM 10206 C CA    . PHE E 4 203 ? 108.813 174.376 137.263 1.00 64.16  ? 203 PHE E CA    1 
ATOM 10207 C C     . PHE E 4 203 ? 108.078 175.369 136.382 1.00 64.16  ? 203 PHE E C     1 
ATOM 10208 O O     . PHE E 4 203 ? 106.855 175.492 136.469 1.00 64.16  ? 203 PHE E O     1 
ATOM 10209 C CB    . PHE E 4 203 ? 108.332 172.976 136.952 1.00 64.16  ? 203 PHE E CB    1 
ATOM 10210 C CG    . PHE E 4 203 ? 109.087 171.937 137.656 1.00 64.16  ? 203 PHE E CG    1 
ATOM 10211 C CD1   . PHE E 4 203 ? 110.306 171.512 137.193 1.00 64.16  ? 203 PHE E CD1   1 
ATOM 10212 C CD2   . PHE E 4 203 ? 108.554 171.350 138.777 1.00 64.16  ? 203 PHE E CD2   1 
ATOM 10213 C CE1   . PHE E 4 203 ? 110.990 170.541 137.857 1.00 64.16  ? 203 PHE E CE1   1 
ATOM 10214 C CE2   . PHE E 4 203 ? 109.227 170.376 139.430 1.00 64.16  ? 203 PHE E CE2   1 
ATOM 10215 C CZ    . PHE E 4 203 ? 110.449 169.966 138.969 1.00 64.16  ? 203 PHE E CZ    1 
ATOM 10216 N N     . PHE E 4 204 ? 108.810 176.073 135.534 1.00 71.60  ? 204 PHE E N     1 
ATOM 10217 C CA    . PHE E 4 204 ? 108.212 177.068 134.663 1.00 71.60  ? 204 PHE E CA    1 
ATOM 10218 C C     . PHE E 4 204 ? 108.598 176.754 133.229 1.00 71.60  ? 204 PHE E C     1 
ATOM 10219 O O     . PHE E 4 204 ? 109.687 176.248 132.962 1.00 71.60  ? 204 PHE E O     1 
ATOM 10220 C CB    . PHE E 4 204 ? 108.655 178.470 135.037 1.00 71.60  ? 204 PHE E CB    1 
ATOM 10221 C CG    . PHE E 4 204 ? 110.091 178.734 134.766 1.00 71.60  ? 204 PHE E CG    1 
ATOM 10222 C CD1   . PHE E 4 204 ? 110.500 179.232 133.551 1.00 71.60  ? 204 PHE E CD1   1 
ATOM 10223 C CD2   . PHE E 4 204 ? 111.035 178.486 135.733 1.00 71.60  ? 204 PHE E CD2   1 
ATOM 10224 C CE1   . PHE E 4 204 ? 111.821 179.469 133.307 1.00 71.60  ? 204 PHE E CE1   1 
ATOM 10225 C CE2   . PHE E 4 204 ? 112.357 178.728 135.496 1.00 71.60  ? 204 PHE E CE2   1 
ATOM 10226 C CZ    . PHE E 4 204 ? 112.752 179.223 134.283 1.00 71.60  ? 204 PHE E CZ    1 
ATOM 10227 N N     . THR E 4 205 ? 107.703 177.107 132.310 1.00 77.34  ? 205 THR E N     1 
ATOM 10228 C CA    . THR E 4 205 ? 107.878 176.871 130.888 1.00 77.34  ? 205 THR E CA    1 
ATOM 10229 C C     . THR E 4 205 ? 107.586 178.150 130.125 1.00 77.34  ? 205 THR E C     1 
ATOM 10230 O O     . THR E 4 205 ? 106.960 179.077 130.643 1.00 77.34  ? 205 THR E O     1 
ATOM 10231 C CB    . THR E 4 205 ? 106.915 175.788 130.387 1.00 77.34  ? 205 THR E CB    1 
ATOM 10232 O OG1   . THR E 4 205 ? 106.868 174.719 131.330 1.00 77.34  ? 205 THR E OG1   1 
ATOM 10233 C CG2   . THR E 4 205 ? 107.369 175.219 129.051 1.00 77.34  ? 205 THR E CG2   1 
ATOM 10234 N N     . ALA E 4 206 ? 108.052 178.202 128.886 1.00 76.65  ? 206 ALA E N     1 
ATOM 10235 C CA    . ALA E 4 206 ? 107.901 179.384 128.059 1.00 76.65  ? 206 ALA E CA    1 
ATOM 10236 C C     . ALA E 4 206 ? 107.081 178.981 126.847 1.00 76.65  ? 206 ALA E C     1 
ATOM 10237 O O     . ALA E 4 206 ? 107.474 178.079 126.103 1.00 76.65  ? 206 ALA E O     1 
ATOM 10238 C CB    . ALA E 4 206 ? 109.260 179.934 127.635 1.00 76.65  ? 206 ALA E CB    1 
ATOM 10239 N N     . VAL E 4 207 ? 105.946 179.636 126.654 1.00 79.24  ? 207 VAL E N     1 
ATOM 10240 C CA    . VAL E 4 207 ? 105.017 179.247 125.602 1.00 79.24  ? 207 VAL E CA    1 
ATOM 10241 C C     . VAL E 4 207 ? 105.497 179.800 124.271 1.00 79.24  ? 207 VAL E C     1 
ATOM 10242 O O     . VAL E 4 207 ? 105.794 180.993 124.155 1.00 79.24  ? 207 VAL E O     1 
ATOM 10243 C CB    . VAL E 4 207 ? 103.596 179.727 125.922 1.00 79.24  ? 207 VAL E CB    1 
ATOM 10244 C CG1   . VAL E 4 207 ? 102.688 179.440 124.765 1.00 79.24  ? 207 VAL E CG1   1 
ATOM 10245 C CG2   . VAL E 4 207 ? 103.077 179.014 127.143 1.00 79.24  ? 207 VAL E CG2   1 
ATOM 10246 N N     . ASP E 4 208 ? 105.571 178.939 123.264 1.00 85.27  ? 208 ASP E N     1 
ATOM 10247 C CA    . ASP E 4 208 ? 105.808 179.381 121.895 1.00 85.27  ? 208 ASP E CA    1 
ATOM 10248 C C     . ASP E 4 208 ? 104.466 179.783 121.299 1.00 85.27  ? 208 ASP E C     1 
ATOM 10249 O O     . ASP E 4 208 ? 103.531 178.979 121.275 1.00 85.27  ? 208 ASP E O     1 
ATOM 10250 C CB    . ASP E 4 208 ? 106.479 178.286 121.081 1.00 85.27  ? 208 ASP E CB    1 
ATOM 10251 C CG    . ASP E 4 208 ? 107.158 178.823 119.849 1.00 85.27  ? 208 ASP E CG    1 
ATOM 10252 O OD1   . ASP E 4 208 ? 106.619 179.769 119.252 1.00 85.27  ? 208 ASP E OD1   1 
ATOM 10253 O OD2   . ASP E 4 208 ? 108.222 178.290 119.469 1.00 85.27  ? 208 ASP E OD2   1 
ATOM 10254 N N     . ASP E 4 209 ? 104.373 181.019 120.805 1.00 86.15  ? 209 ASP E N     1 
ATOM 10255 C CA    . ASP E 4 209 ? 103.070 181.583 120.471 1.00 86.15  ? 209 ASP E CA    1 
ATOM 10256 C C     . ASP E 4 209 ? 102.446 180.952 119.232 1.00 86.15  ? 209 ASP E C     1 
ATOM 10257 O O     . ASP E 4 209 ? 101.239 180.692 119.216 1.00 86.15  ? 209 ASP E O     1 
ATOM 10258 C CB    . ASP E 4 209 ? 103.189 183.091 120.279 1.00 86.15  ? 209 ASP E CB    1 
ATOM 10259 C CG    . ASP E 4 209 ? 103.177 183.846 121.590 1.00 86.15  ? 209 ASP E CG    1 
ATOM 10260 O OD1   . ASP E 4 209 ? 102.584 183.339 122.562 1.00 86.15  ? 209 ASP E OD1   1 
ATOM 10261 O OD2   . ASP E 4 209 ? 103.752 184.955 121.647 1.00 86.15  ? 209 ASP E OD2   1 
ATOM 10262 N N     . ILE E 4 210 ? 103.222 180.689 118.189 1.00 89.50  ? 210 ILE E N     1 
ATOM 10263 C CA    . ILE E 4 210 ? 102.701 180.050 116.985 1.00 89.50  ? 210 ILE E CA    1 
ATOM 10264 C C     . ILE E 4 210 ? 102.739 178.532 117.168 1.00 89.50  ? 210 ILE E C     1 
ATOM 10265 O O     . ILE E 4 210 ? 103.816 177.973 117.416 1.00 89.50  ? 210 ILE E O     1 
ATOM 10266 C CB    . ILE E 4 210 ? 103.446 180.522 115.731 1.00 89.50  ? 210 ILE E CB    1 
ATOM 10267 C CG1   . ILE E 4 210 ? 104.915 180.126 115.733 1.00 89.50  ? 210 ILE E CG1   1 
ATOM 10268 C CG2   . ILE E 4 210 ? 103.324 182.019 115.615 1.00 89.50  ? 210 ILE E CG2   1 
ATOM 10269 C CD1   . ILE E 4 210 ? 105.630 180.616 114.505 1.00 89.50  ? 210 ILE E CD1   1 
ATOM 10270 N N     . PRO E 4 211 ? 101.596 177.858 117.089 1.00 98.10  ? 211 PRO E N     1 
ATOM 10271 C CA    . PRO E 4 211 ? 101.495 176.428 117.407 1.00 98.10  ? 211 PRO E CA    1 
ATOM 10272 C C     . PRO E 4 211 ? 102.343 175.501 116.546 1.00 98.10  ? 211 PRO E C     1 
ATOM 10273 O O     . PRO E 4 211 ? 102.389 175.628 115.321 1.00 98.10  ? 211 PRO E O     1 
ATOM 10274 C CB    . PRO E 4 211 ? 100.001 176.151 117.228 1.00 98.10  ? 211 PRO E CB    1 
ATOM 10275 C CG    . PRO E 4 211 ? 99.577  177.115 116.168 1.00 98.10  ? 211 PRO E CG    1 
ATOM 10276 C CD    . PRO E 4 211 ? 100.434 178.341 116.326 1.00 98.10  ? 211 PRO E CD    1 
ATOM 10277 N N     . LYS E 4 212 ? 103.034 174.574 117.208 1.00 112.08 ? 212 LYS E N     1 
ATOM 10278 C CA    . LYS E 4 212 ? 103.793 173.510 116.558 1.00 112.08 ? 212 LYS E CA    1 
ATOM 10279 C C     . LYS E 4 212 ? 103.434 172.238 117.312 1.00 112.08 ? 212 LYS E C     1 
ATOM 10280 O O     . LYS E 4 212 ? 103.503 172.208 118.544 1.00 112.08 ? 212 LYS E O     1 
ATOM 10281 C CB    . LYS E 4 212 ? 105.295 173.758 116.559 1.00 112.08 ? 212 LYS E CB    1 
ATOM 10282 C CG    . LYS E 4 212 ? 106.057 172.764 115.698 1.00 112.08 ? 212 LYS E CG    1 
ATOM 10283 C CD    . LYS E 4 212 ? 107.501 173.178 115.506 1.00 112.08 ? 212 LYS E CD    1 
ATOM 10284 C CE    . LYS E 4 212 ? 108.289 172.104 114.808 1.00 112.08 ? 212 LYS E CE    1 
ATOM 10285 N NZ    . LYS E 4 212 ? 107.714 171.869 113.464 1.00 112.08 ? 212 LYS E NZ    1 
ATOM 10286 N N     . GLU E 4 213 ? 103.072 171.188 116.575 1.00 115.90 ? 213 GLU E N     1 
ATOM 10287 C CA    . GLU E 4 213 ? 102.600 169.966 117.223 1.00 115.90 ? 213 GLU E CA    1 
ATOM 10288 C C     . GLU E 4 213 ? 103.648 169.269 118.085 1.00 115.90 ? 213 GLU E C     1 
ATOM 10289 O O     . GLU E 4 213 ? 103.350 168.865 119.215 1.00 115.90 ? 213 GLU E O     1 
ATOM 10290 C CB    . GLU E 4 213 ? 102.106 168.990 116.156 1.00 115.90 ? 213 GLU E CB    1 
ATOM 10291 C CG    . GLU E 4 213 ? 100.891 169.448 115.389 1.00 115.90 ? 213 GLU E CG    1 
ATOM 10292 C CD    . GLU E 4 213 ? 99.639  169.433 116.231 1.00 115.90 ? 213 GLU E CD    1 
ATOM 10293 O OE1   . GLU E 4 213 ? 99.551  168.596 117.154 1.00 115.90 ? 213 GLU E OE1   1 
ATOM 10294 O OE2   . GLU E 4 213 ? 98.735  170.248 115.961 1.00 115.90 ? 213 GLU E OE2   1 
ATOM 10295 N N     . ASN E 4 214 ? 104.873 169.104 117.590 1.00 118.32 ? 214 ASN E N     1 
ATOM 10296 C CA    . ASN E 4 214 ? 105.837 168.339 118.375 1.00 118.32 ? 214 ASN E CA    1 
ATOM 10297 C C     . ASN E 4 214 ? 106.273 169.068 119.643 1.00 118.32 ? 214 ASN E C     1 
ATOM 10298 O O     . ASN E 4 214 ? 106.289 168.482 120.734 1.00 118.32 ? 214 ASN E O     1 
ATOM 10299 C CB    . ASN E 4 214 ? 107.037 167.967 117.500 1.00 118.32 ? 214 ASN E CB    1 
ATOM 10300 C CG    . ASN E 4 214 ? 107.797 169.174 116.995 1.00 118.32 ? 214 ASN E CG    1 
ATOM 10301 O OD1   . ASN E 4 214 ? 107.532 170.306 117.399 1.00 118.32 ? 214 ASN E OD1   1 
ATOM 10302 N ND2   . ASN E 4 214 ? 108.730 168.943 116.079 1.00 118.32 ? 214 ASN E ND2   1 
ATOM 10303 N N     . ASP E 4 215 ? 106.610 170.356 119.524 1.00 118.44 ? 215 ASP E N     1 
ATOM 10304 C CA    . ASP E 4 215 ? 107.133 171.077 120.682 1.00 118.44 ? 215 ASP E CA    1 
ATOM 10305 C C     . ASP E 4 215 ? 106.099 171.254 121.790 1.00 118.44 ? 215 ASP E C     1 
ATOM 10306 O O     . ASP E 4 215 ? 106.420 171.063 122.968 1.00 118.44 ? 215 ASP E O     1 
ATOM 10307 C CB    . ASP E 4 215 ? 107.700 172.426 120.237 1.00 118.44 ? 215 ASP E CB    1 
ATOM 10308 C CG    . ASP E 4 215 ? 109.106 172.305 119.684 1.00 118.44 ? 215 ASP E CG    1 
ATOM 10309 O OD1   . ASP E 4 215 ? 109.804 171.336 120.047 1.00 118.44 ? 215 ASP E OD1   1 
ATOM 10310 O OD2   . ASP E 4 215 ? 109.510 173.162 118.873 1.00 118.44 ? 215 ASP E OD2   1 
ATOM 10311 N N     . HIS E 4 216 ? 104.863 171.635 121.449 1.00 114.99 ? 216 HIS E N     1 
ATOM 10312 C CA    . HIS E 4 216 ? 103.878 171.848 122.507 1.00 114.99 ? 216 HIS E CA    1 
ATOM 10313 C C     . HIS E 4 216 ? 103.608 170.552 123.258 1.00 114.99 ? 216 HIS E C     1 
ATOM 10314 O O     . HIS E 4 216 ? 103.529 170.540 124.492 1.00 114.99 ? 216 HIS E O     1 
ATOM 10315 C CB    . HIS E 4 216 ? 102.576 172.454 121.974 1.00 114.99 ? 216 HIS E CB    1 
ATOM 10316 C CG    . HIS E 4 216 ? 101.601 171.453 121.442 1.00 114.99 ? 216 HIS E CG    1 
ATOM 10317 N ND1   . HIS E 4 216 ? 101.819 170.728 120.294 1.00 114.99 ? 216 HIS E ND1   1 
ATOM 10318 C CD2   . HIS E 4 216 ? 100.426 171.010 121.946 1.00 114.99 ? 216 HIS E CD2   1 
ATOM 10319 C CE1   . HIS E 4 216 ? 100.797 169.918 120.087 1.00 114.99 ? 216 HIS E CE1   1 
ATOM 10320 N NE2   . HIS E 4 216 ? 99.943  170.061 121.081 1.00 114.99 ? 216 HIS E NE2   1 
ATOM 10321 N N     . GLY E 4 217 ? 103.471 169.449 122.520 1.00 112.62 ? 217 GLY E N     1 
ATOM 10322 C CA    . GLY E 4 217 ? 103.257 168.155 123.145 1.00 112.62 ? 217 GLY E CA    1 
ATOM 10323 C C     . GLY E 4 217 ? 104.426 167.718 124.003 1.00 112.62 ? 217 GLY E C     1 
ATOM 10324 O O     . GLY E 4 217 ? 104.237 167.126 125.068 1.00 112.62 ? 217 GLY E O     1 
ATOM 10325 N N     . SER E 4 218 ? 105.651 168.026 123.561 1.00 111.53 ? 218 SER E N     1 
ATOM 10326 C CA    . SER E 4 218 ? 106.825 167.662 124.346 1.00 111.53 ? 218 SER E CA    1 
ATOM 10327 C C     . SER E 4 218 ? 106.785 168.302 125.727 1.00 111.53 ? 218 SER E C     1 
ATOM 10328 O O     . SER E 4 218 ? 107.045 167.625 126.729 1.00 111.53 ? 218 SER E O     1 
ATOM 10329 C CB    . SER E 4 218 ? 108.100 168.066 123.607 1.00 111.53 ? 218 SER E CB    1 
ATOM 10330 O OG    . SER E 4 218 ? 108.210 167.386 122.370 1.00 111.53 ? 218 SER E OG    1 
ATOM 10331 N N     . GLY E 4 219 ? 106.426 169.588 125.810 1.00 108.94 ? 219 GLY E N     1 
ATOM 10332 C CA    . GLY E 4 219 ? 106.299 170.206 127.115 1.00 108.94 ? 219 GLY E CA    1 
ATOM 10333 C C     . GLY E 4 219 ? 107.537 170.031 127.965 1.00 108.94 ? 219 GLY E C     1 
ATOM 10334 O O     . GLY E 4 219 ? 107.436 169.549 129.092 1.00 108.94 ? 219 GLY E O     1 
ATOM 10335 N N     . HIS E 4 220 ? 108.699 170.429 127.455 1.00 101.94 ? 220 HIS E N     1 
ATOM 10336 C CA    . HIS E 4 220 ? 109.968 170.252 128.146 1.00 101.94 ? 220 HIS E CA    1 
ATOM 10337 C C     . HIS E 4 220 ? 110.378 171.627 128.676 1.00 101.94 ? 220 HIS E C     1 
ATOM 10338 O O     . HIS E 4 220 ? 110.430 172.593 127.909 1.00 101.94 ? 220 HIS E O     1 
ATOM 10339 C CB    . HIS E 4 220 ? 110.873 169.674 127.037 1.00 101.94 ? 220 HIS E CB    1 
ATOM 10340 N N     . MET E 4 221 ? 110.668 171.718 129.987 1.00 84.94  ? 221 MET E N     1 
ATOM 10341 C CA    . MET E 4 221 ? 111.040 173.004 130.590 1.00 84.94  ? 221 MET E CA    1 
ATOM 10342 C C     . MET E 4 221 ? 111.993 172.920 131.783 1.00 84.94  ? 221 MET E C     1 
ATOM 10343 O O     . MET E 4 221 ? 112.106 171.893 132.458 1.00 84.94  ? 221 MET E O     1 
ATOM 10344 C CB    . MET E 4 221 ? 109.802 173.744 131.072 1.00 84.94  ? 221 MET E CB    1 
ATOM 10345 C CG    . MET E 4 221 ? 109.163 173.093 132.283 1.00 84.94  ? 221 MET E CG    1 
ATOM 10346 S SD    . MET E 4 221 ? 108.332 171.556 131.850 1.00 84.94  ? 221 MET E SD    1 
ATOM 10347 C CE    . MET E 4 221 ? 107.214 171.371 133.234 1.00 84.94  ? 221 MET E CE    1 
ATOM 10348 N N     . ASN E 4 222 ? 112.666 174.049 132.023 1.00 77.93  ? 222 ASN E N     1 
ATOM 10349 C CA    . ASN E 4 222 ? 113.598 174.317 133.119 1.00 77.93  ? 222 ASN E CA    1 
ATOM 10350 C C     . ASN E 4 222 ? 112.878 174.578 134.456 1.00 77.93  ? 222 ASN E C     1 
ATOM 10351 O O     . ASN E 4 222 ? 111.697 174.934 134.497 1.00 77.93  ? 222 ASN E O     1 
ATOM 10352 C CB    . ASN E 4 222 ? 114.501 175.483 132.745 1.00 77.93  ? 222 ASN E CB    1 
ATOM 10353 C CG    . ASN E 4 222 ? 113.722 176.716 132.405 1.00 77.93  ? 222 ASN E CG    1 
ATOM 10354 O OD1   . ASN E 4 222 ? 112.494 176.721 132.472 1.00 77.93  ? 222 ASN E OD1   1 
ATOM 10355 N ND2   . ASN E 4 222 ? 114.421 177.775 132.022 1.00 77.93  ? 222 ASN E ND2   1 
ATOM 10356 N N     . ALA E 4 223 ? 113.615 174.391 135.559 1.00 63.38  ? 223 ALA E N     1 
ATOM 10357 C CA    . ALA E 4 223 ? 113.148 174.581 136.938 1.00 63.38  ? 223 ALA E CA    1 
ATOM 10358 C C     . ALA E 4 223 ? 113.770 175.792 137.627 1.00 63.38  ? 223 ALA E C     1 
ATOM 10359 O O     . ALA E 4 223 ? 114.989 175.960 137.588 1.00 63.38  ? 223 ALA E O     1 
ATOM 10360 C CB    . ALA E 4 223 ? 113.431 173.355 137.791 1.00 63.38  ? 223 ALA E CB    1 
ATOM 10361 N N     . GLY E 4 224 ? 112.941 176.642 138.250 1.00 56.59  ? 224 GLY E N     1 
ATOM 10362 C CA    . GLY E 4 224 ? 113.441 177.822 138.956 1.00 56.59  ? 224 GLY E CA    1 
ATOM 10363 C C     . GLY E 4 224 ? 113.250 177.754 140.469 1.00 56.59  ? 224 GLY E C     1 
ATOM 10364 O O     . GLY E 4 224 ? 112.121 177.577 140.918 1.00 56.59  ? 224 GLY E O     1 
ATOM 10365 N N     . GLN E 4 225 ? 114.307 177.870 141.279 1.00 47.92  ? 225 GLN E N     1 
ATOM 10366 C CA    . GLN E 4 225 ? 114.196 177.727 142.733 1.00 47.92  ? 225 GLN E CA    1 
ATOM 10367 C C     . GLN E 4 225 ? 114.043 179.052 143.462 1.00 47.92  ? 225 GLN E C     1 
ATOM 10368 O O     . GLN E 4 225 ? 114.873 179.948 143.297 1.00 47.92  ? 225 GLN E O     1 
ATOM 10369 C CB    . GLN E 4 225 ? 115.403 176.991 143.303 1.00 47.92  ? 225 GLN E CB    1 
ATOM 10370 C CG    . GLN E 4 225 ? 115.475 175.566 142.896 1.00 47.92  ? 225 GLN E CG    1 
ATOM 10371 C CD    . GLN E 4 225 ? 116.207 175.393 141.617 1.00 47.92  ? 225 GLN E CD    1 
ATOM 10372 O OE1   . GLN E 4 225 ? 116.888 176.304 141.161 1.00 47.92  ? 225 GLN E OE1   1 
ATOM 10373 N NE2   . GLN E 4 225 ? 116.097 174.215 141.024 1.00 47.92  ? 225 GLN E NE2   1 
ATOM 10374 N N     . PHE E 4 226 ? 112.986 179.173 144.266 1.00 42.68  ? 226 PHE E N     1 
ATOM 10375 C CA    . PHE E 4 226 ? 112.751 180.328 145.126 1.00 42.68  ? 226 PHE E CA    1 
ATOM 10376 C C     . PHE E 4 226 ? 112.595 179.867 146.571 1.00 42.68  ? 226 PHE E C     1 
ATOM 10377 O O     . PHE E 4 226 ? 112.540 178.668 146.868 1.00 42.68  ? 226 PHE E O     1 
ATOM 10378 C CB    . PHE E 4 226 ? 111.524 181.164 144.727 1.00 42.68  ? 226 PHE E CB    1 
ATOM 10379 C CG    . PHE E 4 226 ? 111.502 181.644 143.299 1.00 42.68  ? 226 PHE E CG    1 
ATOM 10380 C CD1   . PHE E 4 226 ? 112.562 181.494 142.459 1.00 42.68  ? 226 PHE E CD1   1 
ATOM 10381 C CD2   . PHE E 4 226 ? 110.417 182.330 142.837 1.00 42.68  ? 226 PHE E CD2   1 
ATOM 10382 C CE1   . PHE E 4 226 ? 112.510 181.956 141.181 1.00 42.68  ? 226 PHE E CE1   1 
ATOM 10383 C CE2   . PHE E 4 226 ? 110.362 182.795 141.568 1.00 42.68  ? 226 PHE E CE2   1 
ATOM 10384 C CZ    . PHE E 4 226 ? 111.408 182.612 140.739 1.00 42.68  ? 226 PHE E CZ    1 
ATOM 10385 N N     . SER E 4 227 ? 112.506 180.846 147.472 1.00 38.98  ? 227 SER E N     1 
ATOM 10386 C CA    . SER E 4 227 ? 112.308 180.595 148.894 1.00 38.98  ? 227 SER E CA    1 
ATOM 10387 C C     . SER E 4 227 ? 111.703 181.832 149.536 1.00 38.98  ? 227 SER E C     1 
ATOM 10388 O O     . SER E 4 227 ? 111.729 182.921 148.960 1.00 38.98  ? 227 SER E O     1 
ATOM 10389 C CB    . SER E 4 227 ? 113.611 180.247 149.598 1.00 38.98  ? 227 SER E CB    1 
ATOM 10390 O OG    . SER E 4 227 ? 114.459 181.379 149.639 1.00 38.98  ? 227 SER E OG    1 
ATOM 10391 N N     . ALA E 4 228 ? 111.139 181.645 150.731 1.00 33.68  ? 228 ALA E N     1 
ATOM 10392 C CA    . ALA E 4 228 ? 110.492 182.728 151.460 1.00 33.68  ? 228 ALA E CA    1 
ATOM 10393 C C     . ALA E 4 228 ? 110.794 182.642 152.946 1.00 33.68  ? 228 ALA E C     1 
ATOM 10394 O O     . ALA E 4 228 ? 111.111 181.574 153.470 1.00 33.68  ? 228 ALA E O     1 
ATOM 10395 C CB    . ALA E 4 228 ? 108.979 182.678 151.283 1.00 33.68  ? 228 ALA E CB    1 
ATOM 10396 N N     . GLY E 4 229 ? 110.657 183.767 153.634 1.00 31.25  ? 229 GLY E N     1 
ATOM 10397 C CA    . GLY E 4 229 ? 110.865 183.750 155.070 1.00 31.25  ? 229 GLY E CA    1 
ATOM 10398 C C     . GLY E 4 229 ? 111.100 185.126 155.645 1.00 31.25  ? 229 GLY E C     1 
ATOM 10399 O O     . GLY E 4 229 ? 111.234 186.110 154.932 1.00 31.25  ? 229 GLY E O     1 
ATOM 10400 N N     . THR E 4 230 ? 111.143 185.167 156.978 1.00 26.05  ? 230 THR E N     1 
ATOM 10401 C CA    . THR E 4 230 ? 111.339 186.386 157.767 1.00 26.05  ? 230 THR E CA    1 
ATOM 10402 C C     . THR E 4 230 ? 112.800 186.634 158.138 1.00 26.05  ? 230 THR E C     1 
ATOM 10403 O O     . THR E 4 230 ? 113.314 186.062 159.097 1.00 26.05  ? 230 THR E O     1 
ATOM 10404 C CB    . THR E 4 230 ? 110.466 186.334 159.008 1.00 26.05  ? 230 THR E CB    1 
ATOM 10405 O OG1   . THR E 4 230 ? 110.857 187.375 159.906 1.00 26.05  ? 230 THR E OG1   1 
ATOM 10406 C CG2   . THR E 4 230 ? 110.554 184.994 159.659 1.00 26.05  ? 230 THR E CG2   1 
ATOM 10407 N N     . PHE E 4 231 ? 113.460 187.527 157.411 1.00 22.16  ? 231 PHE E N     1 
ATOM 10408 C CA    . PHE E 4 231 ? 114.876 187.798 157.626 1.00 22.16  ? 231 PHE E CA    1 
ATOM 10409 C C     . PHE E 4 231 ? 115.148 188.676 158.836 1.00 22.16  ? 231 PHE E C     1 
ATOM 10410 O O     . PHE E 4 231 ? 114.416 189.632 159.097 1.00 22.16  ? 231 PHE E O     1 
ATOM 10411 C CB    . PHE E 4 231 ? 115.450 188.510 156.414 1.00 22.16  ? 231 PHE E CB    1 
ATOM 10412 C CG    . PHE E 4 231 ? 115.471 187.691 155.195 1.00 22.16  ? 231 PHE E CG    1 
ATOM 10413 C CD1   . PHE E 4 231 ? 115.420 186.334 155.251 1.00 22.16  ? 231 PHE E CD1   1 
ATOM 10414 C CD2   . PHE E 4 231 ? 115.540 188.285 153.984 1.00 22.16  ? 231 PHE E CD2   1 
ATOM 10415 C CE1   . PHE E 4 231 ? 115.434 185.602 154.115 1.00 22.16  ? 231 PHE E CE1   1 
ATOM 10416 C CE2   . PHE E 4 231 ? 115.555 187.541 152.860 1.00 22.16  ? 231 PHE E CE2   1 
ATOM 10417 C CZ    . PHE E 4 231 ? 115.502 186.197 152.929 1.00 22.16  ? 231 PHE E CZ    1 
ATOM 10418 N N     . TYR E 4 232 ? 116.228 188.365 159.554 1.00 25.82  ? 232 TYR E N     1 
ATOM 10419 C CA    . TYR E 4 232 ? 116.795 189.244 160.575 1.00 25.82  ? 232 TYR E CA    1 
ATOM 10420 C C     . TYR E 4 232 ? 117.935 190.049 159.966 1.00 25.82  ? 232 TYR E C     1 
ATOM 10421 O O     . TYR E 4 232 ? 118.803 189.488 159.301 1.00 25.82  ? 232 TYR E O     1 
ATOM 10422 C CB    . TYR E 4 232 ? 117.306 188.458 161.778 1.00 25.82  ? 232 TYR E CB    1 
ATOM 10423 C CG    . TYR E 4 232 ? 118.097 189.315 162.731 1.00 25.82  ? 232 TYR E CG    1 
ATOM 10424 C CD1   . TYR E 4 232 ? 117.481 190.226 163.551 1.00 25.82  ? 232 TYR E CD1   1 
ATOM 10425 C CD2   . TYR E 4 232 ? 119.466 189.211 162.806 1.00 25.82  ? 232 TYR E CD2   1 
ATOM 10426 C CE1   . TYR E 4 232 ? 118.202 191.008 164.408 1.00 25.82  ? 232 TYR E CE1   1 
ATOM 10427 C CE2   . TYR E 4 232 ? 120.189 189.991 163.666 1.00 25.82  ? 232 TYR E CE2   1 
ATOM 10428 C CZ    . TYR E 4 232 ? 119.552 190.885 164.459 1.00 25.82  ? 232 TYR E CZ    1 
ATOM 10429 O OH    . TYR E 4 232 ? 120.271 191.668 165.316 1.00 25.82  ? 232 TYR E OH    1 
ATOM 10430 N N     . ARG E 4 233 ? 117.956 191.342 160.222 1.00 23.31  ? 233 ARG E N     1 
ATOM 10431 C CA    . ARG E 4 233 ? 118.909 192.268 159.627 1.00 23.31  ? 233 ARG E CA    1 
ATOM 10432 C C     . ARG E 4 233 ? 119.602 193.115 160.683 1.00 23.31  ? 233 ARG E C     1 
ATOM 10433 O O     . ARG E 4 233 ? 118.964 193.546 161.644 1.00 23.31  ? 233 ARG E O     1 
ATOM 10434 C CB    . ARG E 4 233 ? 118.180 193.135 158.659 1.00 23.31  ? 233 ARG E CB    1 
ATOM 10435 C CG    . ARG E 4 233 ? 117.471 192.392 157.571 1.00 23.31  ? 233 ARG E CG    1 
ATOM 10436 C CD    . ARG E 4 233 ? 116.661 193.396 156.849 1.00 23.31  ? 233 ARG E CD    1 
ATOM 10437 N NE    . ARG E 4 233 ? 117.430 194.599 156.631 1.00 23.31  ? 233 ARG E NE    1 
ATOM 10438 C CZ    . ARG E 4 233 ? 116.868 195.764 156.360 1.00 23.31  ? 233 ARG E CZ    1 
ATOM 10439 N NH1   . ARG E 4 233 ? 115.556 195.837 156.279 1.00 23.31  ? 233 ARG E NH1   1 
ATOM 10440 N NH2   . ARG E 4 233 ? 117.603 196.845 156.176 1.00 23.31  ? 233 ARG E NH2   1 
ATOM 10441 N N     . TYR E 4 234 ? 120.900 193.364 160.503 1.00 43.99  ? 234 TYR E N     1 
ATO