data_5U0A
# 
_entry.id   5U0A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5U0A         
WWPDB D_1000225050 
EMDB  EMD-8478     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB  .                                        5U07     unspecified            
EMDB .                                        EMD-8477 'other EM volume'      
EMDB 'CRISPR RNA-guided surveillance complex' EMD-8478 'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5U0A 
_pdbx_database_status.recvd_initial_deposition_date   2016-11-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Xiao, Y.'    1 ? 
'Luo, M.'     2 ? 
'Hayes, R.P.' 3 ? 
'Kim, J.'     4 ? 
'Ng, S.'      5 ? 
'Ding, F.'    6 ? 
'Liao, M.'    7 ? 
'Ke, A.'      8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            170 
_citation.language                  ? 
_citation.page_first                48 
_citation.page_last                 60.e11 
_citation.title                     
'Structure Basis for Directional R-loop Formation and Substrate Handover Mechanisms in Type I CRISPR-Cas System.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2017.06.012 
_citation.pdbx_database_id_PubMed   28666122 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Xiao, Y.'    1 ? 
primary 'Luo, M.'     2 ? 
primary 'Hayes, R.P.' 3 ? 
primary 'Kim, J.'     4 ? 
primary 'Ng, S.'      5 ? 
primary 'Ding, F.'    6 ? 
primary 'Liao, M.'    7 ? 
primary 'Ke, A.'      8 ? 
# 
_cell.angle_alpha                  90.0 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.0 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.0 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5U0A 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5U0A 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CRISPR-associated protein, Cse3 family'  26327.938 1 ? ? ? ? 
2 polymer man 'CRISPR-associated protein, Cse1 family'  61433.297 1 ? ? ? ? 
3 polymer man 'CRISPR-associated protein, Cse4 family'  41043.043 6 ? ? ? ? 
4 polymer man Cse2                                      27446.613 2 ? ? ? ? 
5 polymer syn crRNA                                     19790.793 1 ? ? ? ? 
6 polymer syn 'Target Strand'                           15251.741 1 ? ? ? ? 
7 polymer man 'CRISPR-associated protein, Cas5e family' 28279.260 1 ? ? ? ? 
8 polymer syn 'Nontarget Strand'                        12076.723 1 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        Cas7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MTWLTKIVPDLRYRQTRADFRTAGNLHRKLIRLSSDLGEERIANPRQQSGLLFRIEETRNELYLLVQSHSPLRVDRLGPG
YHGVQMRNLDPFLARLDKGSRVRYRIVASPTKRLGRSENNTQRLGLKEPPKKPREYTWALRGAAAEEWWHSRAAANGLEL
LSTYAQTLDDVRDPGTADRSRKIRHPAVRFDGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLALIEEGEHG
;
;MTWLTKIVPDLRYRQTRADFRTAGNLHRKLIRLSSDLGEERIANPRQQSGLLFRIEETRNELYLLVQSHSPLRVDRLGPG
YHGVQMRNLDPFLARLDKGSRVRYRIVASPTKRLGRSENNTQRLGLKEPPKKPREYTWALRGAAAEEWWHSRAAANGLEL
LSTYAQTLDDVRDPGTADRSRKIRHPAVRFDGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLALIEEGEHG
;
A           ? 
2 'polypeptide(L)'        no no 
;MLSVALCFLVGGAIPSPPSFDVTIAPWLIARSRDVLAAPEMLGLRDVLIRSHELSDVEIPLPPGAAVLWRILALITARIT
GLDQPPNKNPKRKWQARRSQILSKGRLDPEAVDAYFADYSERFDLFHPERPWLQDPRLREECPKTSGVNKLAWGRTAGEN
QVWLGGHHHDLDPHPLDSAEAVWHLLATLGYGPSGMCTARVVRGRSERNVTAGPLRGTVSYHPLGRTLFESLILNIPYPG
TGAADLAFWEQPELNDPLGLPEESAGLAGILRLDHFRHAVLLHPSPDGSHVVDAWVTWAWRERNISPELDPYLIYQTSKE
GRVYPRPAEAERAIWRDLDALLHYGEDGNYRPTILDNCTPLAQVPQEVLDSLRLRAFGFDQDGQARDKQWFTATTPAVLR
WLADRETDDNENARIVRRITLARKAAEALGRRLEKACKEAWKESNSPSSTSSGTNAKTETGVGPWVQHGMSRYWAKAEPV
FWNIVYDRPAQGYTPGMAGPGNAFNLVALAAYDEVTGPYCERPRVAKVVERHRSTLFSNWTPKQDKEAA
;
;MLSVALCFLVGGAIPSPPSFDVTIAPWLIARSRDVLAAPEMLGLRDVLIRSHELSDVEIPLPPGAAVLWRILALITARIT
GLDQPPNKNPKRKWQARRSQILSKGRLDPEAVDAYFADYSERFDLFHPERPWLQDPRLREECPKTSGVNKLAWGRTAGEN
QVWLGGHHHDLDPHPLDSAEAVWHLLATLGYGPSGMCTARVVRGRSERNVTAGPLRGTVSYHPLGRTLFESLILNIPYPG
TGAADLAFWEQPELNDPLGLPEESAGLAGILRLDHFRHAVLLHPSPDGSHVVDAWVTWAWRERNISPELDPYLIYQTSKE
GRVYPRPAEAERAIWRDLDALLHYGEDGNYRPTILDNCTPLAQVPQEVLDSLRLRAFGFDQDGQARDKQWFTATTPAVLR
WLADRETDDNENARIVRRITLARKAAEALGRRLEKACKEAWKESNSPSSTSSGTNAKTETGVGPWVQHGMSRYWAKAEPV
FWNIVYDRPAQGYTPGMAGPGNAFNLVALAAYDEVTGPYCERPRVAKVVERHRSTLFSNWTPKQDKEAA
;
C           ? 
3 'polypeptide(L)'        no no 
;MTFVDIHAIQTLPYSNINRDDLGSPKTVVYGGKERTRVSSQSWKRAVRHEVEARLGDKAVRTRRIISEIAKRLRERGWDA
DLADAGARQVVLSVGKKSGIKLEKEKDSEAPATSVLFYLPVPAIDELAAIADEHRDAVAKEAAKKTPKGILPADRITEVL
KSRNVSVNLFGRMLAELPSTEVDGAVQFAHAFTVHGTTVEVDFFTAVDDIPKENDHGSGHMNAGQFSAGTFYRYANVNLD
RLVENTGDAQTARTAVAEFLRAFLSTVPSGKQNATAAMTLPDLVHIAVRFDRPISFAPAFETALYGSDGYTLRACQELNN
YAERLREVWPDDAIRGYATVENKTDLAALGERYDSYPALIDAMVAAAFEGERE
;
;MTFVDIHAIQTLPYSNINRDDLGSPKTVVYGGKERTRVSSQSWKRAVRHEVEARLGDKAVRTRRIISEIAKRLRERGWDA
DLADAGARQVVLSVGKKSGIKLEKEKDSEAPATSVLFYLPVPAIDELAAIADEHRDAVAKEAAKKTPKGILPADRITEVL
KSRNVSVNLFGRMLAELPSTEVDGAVQFAHAFTVHGTTVEVDFFTAVDDIPKENDHGSGHMNAGQFSAGTFYRYANVNLD
RLVENTGDAQTARTAVAEFLRAFLSTVPSGKQNATAAMTLPDLVHIAVRFDRPISFAPAFETALYGSDGYTLRACQELNN
YAERLREVWPDDAIRGYATVENKTDLAALGERYDSYPALIDAMVAAAFEGERE
;
D,E,F,G,H,I ? 
4 'polypeptide(L)'        no no 
;MNSDYILQHADALVKRVSKLIVNEPAARAALRRGVGLAPEDPRMLAAHRVVAPYVPVPTDYDVDRRRAASLWDVHAVERA
FYAVAAIMAAQPRSARDQEAEATEEQTGEPQDSEALTEPTPAEESSATKDGKPDRRPNLGVSLAQAVFDKGLNADSTEQR
LHLIARQNLDGVHRHLPRLVLYLRSDQVHIDWGILIRDLARWGHTPRHVAREWVQDYHRTLETLTRQAEQKNKNNTTDEE
AEAA
;
;MNSDYILQHADALVKRVSKLIVNEPAARAALRRGVGLAPEDPRMLAAHRVVAPYVPVPTDYDVDRRRAASLWDVHAVERA
FYAVAAIMAAQPRSARDQEAEATEEQTGEPQDSEALTEPTPAEESSATKDGKPDRRPNLGVSLAQAVFDKGLNADSTEQR
LHLIARQNLDGVHRHLPRLVLYLRSDQVHIDWGILIRDLARWGHTPRHVAREWVQDYHRTLETLTRQAEQKNKNNTTDEE
AEAA
;
J,L         ? 
5 polyribonucleotide      no no AUGGACCGCCAGUGAUAAGUGGAAUGCCAUGUGGGCUGUCGUGAGCCCCACGCACGUGGGG 
AUGGACCGCCAGUGAUAAGUGGAAUGCCAUGUGGGCUGUCGUGAGCCCCACGCACGUGGGG K           ? 
6 polydeoxyribonucleotide no no 
;(DG)(DC)(DC)(DT)(DG)(DG)(DC)(DG)(DA)(DC)(DA)(DG)(DC)(DC)(DC)(DA)(DC)(DA)(DT)(DG)
(DG)(DC)(DA)(DT)(DT)(DC)(DC)(DA)(DC)(DT)(DT)(DA)(DT)(DC)(DA)(DC)(DT)(DG)(DG)(DC)
(DT)(DT)(DC)(DG)(DT)(DC)(DC)(DG)(DC)(DG)
;
GCCTGGCGACAGCCCACATGGCATTCCACTTATCACTGGCTTCGTCCGCG M           ? 
7 'polypeptide(L)'        no no 
;MSGFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPLDRYKELKFTVRVDRPGVRLVDFHTIGGGL
PKERTVPTAAGERRDPKKATIVTSRSYLADAVFTVAVTGPEADTIADALAAPYWQPYLGRRAFVPDPLLVLRRRVADPVR
ELVEAVPLPHRRVEEDAATVLVDLIYEEGEYPDTRTLTVLNDVPLSFDSKSRRYSTRQIRVVPTEVPATLVAGPGRDYQN
KLFTYVKQCAEEAA
;
;MSGFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPLDRYKELKFTVRVDRPGVRLVDFHTIGGGL
PKERTVPTAAGERRDPKKATIVTSRSYLADAVFTVAVTGPEADTIADALAAPYWQPYLGRRAFVPDPLLVLRRRVADPVR
ELVEAVPLPHRRVEEDAATVLVDLIYEEGEYPDTRTLTVLNDVPLSFDSKSRRYSTRQIRVVPTEVPATLVAGPGRDYQN
KLFTYVKQCAEEAA
;
N           ? 
8 polydeoxyribonucleotide no no 
;(DC)(DG)(DC)(DG)(DG)(DA)(DC)(DG)(DA)(DA)(DG)(DC)(DC)(DA)(DG)(DT)(DG)(DA)(DC)(DC)
(DA)(DT)(DG)(DT)(DG)(DG)(DG)(DC)(DT)(DG)(DT)(DC)(DG)(DC)(DC)(DA)(DG)(DG)(DC)
;
CGCGGACGAAGCCAGTGACCATGTGGGCTGTCGCCAGGC O           ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   TRP n 
1 4   LEU n 
1 5   THR n 
1 6   LYS n 
1 7   ILE n 
1 8   VAL n 
1 9   PRO n 
1 10  ASP n 
1 11  LEU n 
1 12  ARG n 
1 13  TYR n 
1 14  ARG n 
1 15  GLN n 
1 16  THR n 
1 17  ARG n 
1 18  ALA n 
1 19  ASP n 
1 20  PHE n 
1 21  ARG n 
1 22  THR n 
1 23  ALA n 
1 24  GLY n 
1 25  ASN n 
1 26  LEU n 
1 27  HIS n 
1 28  ARG n 
1 29  LYS n 
1 30  LEU n 
1 31  ILE n 
1 32  ARG n 
1 33  LEU n 
1 34  SER n 
1 35  SER n 
1 36  ASP n 
1 37  LEU n 
1 38  GLY n 
1 39  GLU n 
1 40  GLU n 
1 41  ARG n 
1 42  ILE n 
1 43  ALA n 
1 44  ASN n 
1 45  PRO n 
1 46  ARG n 
1 47  GLN n 
1 48  GLN n 
1 49  SER n 
1 50  GLY n 
1 51  LEU n 
1 52  LEU n 
1 53  PHE n 
1 54  ARG n 
1 55  ILE n 
1 56  GLU n 
1 57  GLU n 
1 58  THR n 
1 59  ARG n 
1 60  ASN n 
1 61  GLU n 
1 62  LEU n 
1 63  TYR n 
1 64  LEU n 
1 65  LEU n 
1 66  VAL n 
1 67  GLN n 
1 68  SER n 
1 69  HIS n 
1 70  SER n 
1 71  PRO n 
1 72  LEU n 
1 73  ARG n 
1 74  VAL n 
1 75  ASP n 
1 76  ARG n 
1 77  LEU n 
1 78  GLY n 
1 79  PRO n 
1 80  GLY n 
1 81  TYR n 
1 82  HIS n 
1 83  GLY n 
1 84  VAL n 
1 85  GLN n 
1 86  MET n 
1 87  ARG n 
1 88  ASN n 
1 89  LEU n 
1 90  ASP n 
1 91  PRO n 
1 92  PHE n 
1 93  LEU n 
1 94  ALA n 
1 95  ARG n 
1 96  LEU n 
1 97  ASP n 
1 98  LYS n 
1 99  GLY n 
1 100 SER n 
1 101 ARG n 
1 102 VAL n 
1 103 ARG n 
1 104 TYR n 
1 105 ARG n 
1 106 ILE n 
1 107 VAL n 
1 108 ALA n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 LYS n 
1 113 ARG n 
1 114 LEU n 
1 115 GLY n 
1 116 ARG n 
1 117 SER n 
1 118 GLU n 
1 119 ASN n 
1 120 ASN n 
1 121 THR n 
1 122 GLN n 
1 123 ARG n 
1 124 LEU n 
1 125 GLY n 
1 126 LEU n 
1 127 LYS n 
1 128 GLU n 
1 129 PRO n 
1 130 PRO n 
1 131 LYS n 
1 132 LYS n 
1 133 PRO n 
1 134 ARG n 
1 135 GLU n 
1 136 TYR n 
1 137 THR n 
1 138 TRP n 
1 139 ALA n 
1 140 LEU n 
1 141 ARG n 
1 142 GLY n 
1 143 ALA n 
1 144 ALA n 
1 145 ALA n 
1 146 GLU n 
1 147 GLU n 
1 148 TRP n 
1 149 TRP n 
1 150 HIS n 
1 151 SER n 
1 152 ARG n 
1 153 ALA n 
1 154 ALA n 
1 155 ALA n 
1 156 ASN n 
1 157 GLY n 
1 158 LEU n 
1 159 GLU n 
1 160 LEU n 
1 161 LEU n 
1 162 SER n 
1 163 THR n 
1 164 TYR n 
1 165 ALA n 
1 166 GLN n 
1 167 THR n 
1 168 LEU n 
1 169 ASP n 
1 170 ASP n 
1 171 VAL n 
1 172 ARG n 
1 173 ASP n 
1 174 PRO n 
1 175 GLY n 
1 176 THR n 
1 177 ALA n 
1 178 ASP n 
1 179 ARG n 
1 180 SER n 
1 181 ARG n 
1 182 LYS n 
1 183 ILE n 
1 184 ARG n 
1 185 HIS n 
1 186 PRO n 
1 187 ALA n 
1 188 VAL n 
1 189 ARG n 
1 190 PHE n 
1 191 ASP n 
1 192 GLY n 
1 193 GLU n 
1 194 ALA n 
1 195 VAL n 
1 196 ILE n 
1 197 SER n 
1 198 ASP n 
1 199 VAL n 
1 200 ASP n 
1 201 ALA n 
1 202 VAL n 
1 203 ARG n 
1 204 HIS n 
1 205 ALA n 
1 206 VAL n 
1 207 LEU n 
1 208 ASN n 
1 209 GLY n 
1 210 ILE n 
1 211 GLY n 
1 212 ARG n 
1 213 GLY n 
1 214 LYS n 
1 215 SER n 
1 216 TYR n 
1 217 GLY n 
1 218 CYS n 
1 219 GLY n 
1 220 LEU n 
1 221 LEU n 
1 222 SER n 
1 223 LEU n 
1 224 ALA n 
1 225 LEU n 
1 226 ILE n 
1 227 GLU n 
1 228 GLU n 
1 229 GLY n 
1 230 GLU n 
1 231 HIS n 
1 232 GLY n 
2 1   MET n 
2 2   LEU n 
2 3   SER n 
2 4   VAL n 
2 5   ALA n 
2 6   LEU n 
2 7   CYS n 
2 8   PHE n 
2 9   LEU n 
2 10  VAL n 
2 11  GLY n 
2 12  GLY n 
2 13  ALA n 
2 14  ILE n 
2 15  PRO n 
2 16  SER n 
2 17  PRO n 
2 18  PRO n 
2 19  SER n 
2 20  PHE n 
2 21  ASP n 
2 22  VAL n 
2 23  THR n 
2 24  ILE n 
2 25  ALA n 
2 26  PRO n 
2 27  TRP n 
2 28  LEU n 
2 29  ILE n 
2 30  ALA n 
2 31  ARG n 
2 32  SER n 
2 33  ARG n 
2 34  ASP n 
2 35  VAL n 
2 36  LEU n 
2 37  ALA n 
2 38  ALA n 
2 39  PRO n 
2 40  GLU n 
2 41  MET n 
2 42  LEU n 
2 43  GLY n 
2 44  LEU n 
2 45  ARG n 
2 46  ASP n 
2 47  VAL n 
2 48  LEU n 
2 49  ILE n 
2 50  ARG n 
2 51  SER n 
2 52  HIS n 
2 53  GLU n 
2 54  LEU n 
2 55  SER n 
2 56  ASP n 
2 57  VAL n 
2 58  GLU n 
2 59  ILE n 
2 60  PRO n 
2 61  LEU n 
2 62  PRO n 
2 63  PRO n 
2 64  GLY n 
2 65  ALA n 
2 66  ALA n 
2 67  VAL n 
2 68  LEU n 
2 69  TRP n 
2 70  ARG n 
2 71  ILE n 
2 72  LEU n 
2 73  ALA n 
2 74  LEU n 
2 75  ILE n 
2 76  THR n 
2 77  ALA n 
2 78  ARG n 
2 79  ILE n 
2 80  THR n 
2 81  GLY n 
2 82  LEU n 
2 83  ASP n 
2 84  GLN n 
2 85  PRO n 
2 86  PRO n 
2 87  ASN n 
2 88  LYS n 
2 89  ASN n 
2 90  PRO n 
2 91  LYS n 
2 92  ARG n 
2 93  LYS n 
2 94  TRP n 
2 95  GLN n 
2 96  ALA n 
2 97  ARG n 
2 98  ARG n 
2 99  SER n 
2 100 GLN n 
2 101 ILE n 
2 102 LEU n 
2 103 SER n 
2 104 LYS n 
2 105 GLY n 
2 106 ARG n 
2 107 LEU n 
2 108 ASP n 
2 109 PRO n 
2 110 GLU n 
2 111 ALA n 
2 112 VAL n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 ALA n 
2 118 ASP n 
2 119 TYR n 
2 120 SER n 
2 121 GLU n 
2 122 ARG n 
2 123 PHE n 
2 124 ASP n 
2 125 LEU n 
2 126 PHE n 
2 127 HIS n 
2 128 PRO n 
2 129 GLU n 
2 130 ARG n 
2 131 PRO n 
2 132 TRP n 
2 133 LEU n 
2 134 GLN n 
2 135 ASP n 
2 136 PRO n 
2 137 ARG n 
2 138 LEU n 
2 139 ARG n 
2 140 GLU n 
2 141 GLU n 
2 142 CYS n 
2 143 PRO n 
2 144 LYS n 
2 145 THR n 
2 146 SER n 
2 147 GLY n 
2 148 VAL n 
2 149 ASN n 
2 150 LYS n 
2 151 LEU n 
2 152 ALA n 
2 153 TRP n 
2 154 GLY n 
2 155 ARG n 
2 156 THR n 
2 157 ALA n 
2 158 GLY n 
2 159 GLU n 
2 160 ASN n 
2 161 GLN n 
2 162 VAL n 
2 163 TRP n 
2 164 LEU n 
2 165 GLY n 
2 166 GLY n 
2 167 HIS n 
2 168 HIS n 
2 169 HIS n 
2 170 ASP n 
2 171 LEU n 
2 172 ASP n 
2 173 PRO n 
2 174 HIS n 
2 175 PRO n 
2 176 LEU n 
2 177 ASP n 
2 178 SER n 
2 179 ALA n 
2 180 GLU n 
2 181 ALA n 
2 182 VAL n 
2 183 TRP n 
2 184 HIS n 
2 185 LEU n 
2 186 LEU n 
2 187 ALA n 
2 188 THR n 
2 189 LEU n 
2 190 GLY n 
2 191 TYR n 
2 192 GLY n 
2 193 PRO n 
2 194 SER n 
2 195 GLY n 
2 196 MET n 
2 197 CYS n 
2 198 THR n 
2 199 ALA n 
2 200 ARG n 
2 201 VAL n 
2 202 VAL n 
2 203 ARG n 
2 204 GLY n 
2 205 ARG n 
2 206 SER n 
2 207 GLU n 
2 208 ARG n 
2 209 ASN n 
2 210 VAL n 
2 211 THR n 
2 212 ALA n 
2 213 GLY n 
2 214 PRO n 
2 215 LEU n 
2 216 ARG n 
2 217 GLY n 
2 218 THR n 
2 219 VAL n 
2 220 SER n 
2 221 TYR n 
2 222 HIS n 
2 223 PRO n 
2 224 LEU n 
2 225 GLY n 
2 226 ARG n 
2 227 THR n 
2 228 LEU n 
2 229 PHE n 
2 230 GLU n 
2 231 SER n 
2 232 LEU n 
2 233 ILE n 
2 234 LEU n 
2 235 ASN n 
2 236 ILE n 
2 237 PRO n 
2 238 TYR n 
2 239 PRO n 
2 240 GLY n 
2 241 THR n 
2 242 GLY n 
2 243 ALA n 
2 244 ALA n 
2 245 ASP n 
2 246 LEU n 
2 247 ALA n 
2 248 PHE n 
2 249 TRP n 
2 250 GLU n 
2 251 GLN n 
2 252 PRO n 
2 253 GLU n 
2 254 LEU n 
2 255 ASN n 
2 256 ASP n 
2 257 PRO n 
2 258 LEU n 
2 259 GLY n 
2 260 LEU n 
2 261 PRO n 
2 262 GLU n 
2 263 GLU n 
2 264 SER n 
2 265 ALA n 
2 266 GLY n 
2 267 LEU n 
2 268 ALA n 
2 269 GLY n 
2 270 ILE n 
2 271 LEU n 
2 272 ARG n 
2 273 LEU n 
2 274 ASP n 
2 275 HIS n 
2 276 PHE n 
2 277 ARG n 
2 278 HIS n 
2 279 ALA n 
2 280 VAL n 
2 281 LEU n 
2 282 LEU n 
2 283 HIS n 
2 284 PRO n 
2 285 SER n 
2 286 PRO n 
2 287 ASP n 
2 288 GLY n 
2 289 SER n 
2 290 HIS n 
2 291 VAL n 
2 292 VAL n 
2 293 ASP n 
2 294 ALA n 
2 295 TRP n 
2 296 VAL n 
2 297 THR n 
2 298 TRP n 
2 299 ALA n 
2 300 TRP n 
2 301 ARG n 
2 302 GLU n 
2 303 ARG n 
2 304 ASN n 
2 305 ILE n 
2 306 SER n 
2 307 PRO n 
2 308 GLU n 
2 309 LEU n 
2 310 ASP n 
2 311 PRO n 
2 312 TYR n 
2 313 LEU n 
2 314 ILE n 
2 315 TYR n 
2 316 GLN n 
2 317 THR n 
2 318 SER n 
2 319 LYS n 
2 320 GLU n 
2 321 GLY n 
2 322 ARG n 
2 323 VAL n 
2 324 TYR n 
2 325 PRO n 
2 326 ARG n 
2 327 PRO n 
2 328 ALA n 
2 329 GLU n 
2 330 ALA n 
2 331 GLU n 
2 332 ARG n 
2 333 ALA n 
2 334 ILE n 
2 335 TRP n 
2 336 ARG n 
2 337 ASP n 
2 338 LEU n 
2 339 ASP n 
2 340 ALA n 
2 341 LEU n 
2 342 LEU n 
2 343 HIS n 
2 344 TYR n 
2 345 GLY n 
2 346 GLU n 
2 347 ASP n 
2 348 GLY n 
2 349 ASN n 
2 350 TYR n 
2 351 ARG n 
2 352 PRO n 
2 353 THR n 
2 354 ILE n 
2 355 LEU n 
2 356 ASP n 
2 357 ASN n 
2 358 CYS n 
2 359 THR n 
2 360 PRO n 
2 361 LEU n 
2 362 ALA n 
2 363 GLN n 
2 364 VAL n 
2 365 PRO n 
2 366 GLN n 
2 367 GLU n 
2 368 VAL n 
2 369 LEU n 
2 370 ASP n 
2 371 SER n 
2 372 LEU n 
2 373 ARG n 
2 374 LEU n 
2 375 ARG n 
2 376 ALA n 
2 377 PHE n 
2 378 GLY n 
2 379 PHE n 
2 380 ASP n 
2 381 GLN n 
2 382 ASP n 
2 383 GLY n 
2 384 GLN n 
2 385 ALA n 
2 386 ARG n 
2 387 ASP n 
2 388 LYS n 
2 389 GLN n 
2 390 TRP n 
2 391 PHE n 
2 392 THR n 
2 393 ALA n 
2 394 THR n 
2 395 THR n 
2 396 PRO n 
2 397 ALA n 
2 398 VAL n 
2 399 LEU n 
2 400 ARG n 
2 401 TRP n 
2 402 LEU n 
2 403 ALA n 
2 404 ASP n 
2 405 ARG n 
2 406 GLU n 
2 407 THR n 
2 408 ASP n 
2 409 ASP n 
2 410 ASN n 
2 411 GLU n 
2 412 ASN n 
2 413 ALA n 
2 414 ARG n 
2 415 ILE n 
2 416 VAL n 
2 417 ARG n 
2 418 ARG n 
2 419 ILE n 
2 420 THR n 
2 421 LEU n 
2 422 ALA n 
2 423 ARG n 
2 424 LYS n 
2 425 ALA n 
2 426 ALA n 
2 427 GLU n 
2 428 ALA n 
2 429 LEU n 
2 430 GLY n 
2 431 ARG n 
2 432 ARG n 
2 433 LEU n 
2 434 GLU n 
2 435 LYS n 
2 436 ALA n 
2 437 CYS n 
2 438 LYS n 
2 439 GLU n 
2 440 ALA n 
2 441 TRP n 
2 442 LYS n 
2 443 GLU n 
2 444 SER n 
2 445 ASN n 
2 446 SER n 
2 447 PRO n 
2 448 SER n 
2 449 SER n 
2 450 THR n 
2 451 SER n 
2 452 SER n 
2 453 GLY n 
2 454 THR n 
2 455 ASN n 
2 456 ALA n 
2 457 LYS n 
2 458 THR n 
2 459 GLU n 
2 460 THR n 
2 461 GLY n 
2 462 VAL n 
2 463 GLY n 
2 464 PRO n 
2 465 TRP n 
2 466 VAL n 
2 467 GLN n 
2 468 HIS n 
2 469 GLY n 
2 470 MET n 
2 471 SER n 
2 472 ARG n 
2 473 TYR n 
2 474 TRP n 
2 475 ALA n 
2 476 LYS n 
2 477 ALA n 
2 478 GLU n 
2 479 PRO n 
2 480 VAL n 
2 481 PHE n 
2 482 TRP n 
2 483 ASN n 
2 484 ILE n 
2 485 VAL n 
2 486 TYR n 
2 487 ASP n 
2 488 ARG n 
2 489 PRO n 
2 490 ALA n 
2 491 GLN n 
2 492 GLY n 
2 493 TYR n 
2 494 THR n 
2 495 PRO n 
2 496 GLY n 
2 497 MET n 
2 498 ALA n 
2 499 GLY n 
2 500 PRO n 
2 501 GLY n 
2 502 ASN n 
2 503 ALA n 
2 504 PHE n 
2 505 ASN n 
2 506 LEU n 
2 507 VAL n 
2 508 ALA n 
2 509 LEU n 
2 510 ALA n 
2 511 ALA n 
2 512 TYR n 
2 513 ASP n 
2 514 GLU n 
2 515 VAL n 
2 516 THR n 
2 517 GLY n 
2 518 PRO n 
2 519 TYR n 
2 520 CYS n 
2 521 GLU n 
2 522 ARG n 
2 523 PRO n 
2 524 ARG n 
2 525 VAL n 
2 526 ALA n 
2 527 LYS n 
2 528 VAL n 
2 529 VAL n 
2 530 GLU n 
2 531 ARG n 
2 532 HIS n 
2 533 ARG n 
2 534 SER n 
2 535 THR n 
2 536 LEU n 
2 537 PHE n 
2 538 SER n 
2 539 ASN n 
2 540 TRP n 
2 541 THR n 
2 542 PRO n 
2 543 LYS n 
2 544 GLN n 
2 545 ASP n 
2 546 LYS n 
2 547 GLU n 
2 548 ALA n 
2 549 ALA n 
3 1   MET n 
3 2   THR n 
3 3   PHE n 
3 4   VAL n 
3 5   ASP n 
3 6   ILE n 
3 7   HIS n 
3 8   ALA n 
3 9   ILE n 
3 10  GLN n 
3 11  THR n 
3 12  LEU n 
3 13  PRO n 
3 14  TYR n 
3 15  SER n 
3 16  ASN n 
3 17  ILE n 
3 18  ASN n 
3 19  ARG n 
3 20  ASP n 
3 21  ASP n 
3 22  LEU n 
3 23  GLY n 
3 24  SER n 
3 25  PRO n 
3 26  LYS n 
3 27  THR n 
3 28  VAL n 
3 29  VAL n 
3 30  TYR n 
3 31  GLY n 
3 32  GLY n 
3 33  LYS n 
3 34  GLU n 
3 35  ARG n 
3 36  THR n 
3 37  ARG n 
3 38  VAL n 
3 39  SER n 
3 40  SER n 
3 41  GLN n 
3 42  SER n 
3 43  TRP n 
3 44  LYS n 
3 45  ARG n 
3 46  ALA n 
3 47  VAL n 
3 48  ARG n 
3 49  HIS n 
3 50  GLU n 
3 51  VAL n 
3 52  GLU n 
3 53  ALA n 
3 54  ARG n 
3 55  LEU n 
3 56  GLY n 
3 57  ASP n 
3 58  LYS n 
3 59  ALA n 
3 60  VAL n 
3 61  ARG n 
3 62  THR n 
3 63  ARG n 
3 64  ARG n 
3 65  ILE n 
3 66  ILE n 
3 67  SER n 
3 68  GLU n 
3 69  ILE n 
3 70  ALA n 
3 71  LYS n 
3 72  ARG n 
3 73  LEU n 
3 74  ARG n 
3 75  GLU n 
3 76  ARG n 
3 77  GLY n 
3 78  TRP n 
3 79  ASP n 
3 80  ALA n 
3 81  ASP n 
3 82  LEU n 
3 83  ALA n 
3 84  ASP n 
3 85  ALA n 
3 86  GLY n 
3 87  ALA n 
3 88  ARG n 
3 89  GLN n 
3 90  VAL n 
3 91  VAL n 
3 92  LEU n 
3 93  SER n 
3 94  VAL n 
3 95  GLY n 
3 96  LYS n 
3 97  LYS n 
3 98  SER n 
3 99  GLY n 
3 100 ILE n 
3 101 LYS n 
3 102 LEU n 
3 103 GLU n 
3 104 LYS n 
3 105 GLU n 
3 106 LYS n 
3 107 ASP n 
3 108 SER n 
3 109 GLU n 
3 110 ALA n 
3 111 PRO n 
3 112 ALA n 
3 113 THR n 
3 114 SER n 
3 115 VAL n 
3 116 LEU n 
3 117 PHE n 
3 118 TYR n 
3 119 LEU n 
3 120 PRO n 
3 121 VAL n 
3 122 PRO n 
3 123 ALA n 
3 124 ILE n 
3 125 ASP n 
3 126 GLU n 
3 127 LEU n 
3 128 ALA n 
3 129 ALA n 
3 130 ILE n 
3 131 ALA n 
3 132 ASP n 
3 133 GLU n 
3 134 HIS n 
3 135 ARG n 
3 136 ASP n 
3 137 ALA n 
3 138 VAL n 
3 139 ALA n 
3 140 LYS n 
3 141 GLU n 
3 142 ALA n 
3 143 ALA n 
3 144 LYS n 
3 145 LYS n 
3 146 THR n 
3 147 PRO n 
3 148 LYS n 
3 149 GLY n 
3 150 ILE n 
3 151 LEU n 
3 152 PRO n 
3 153 ALA n 
3 154 ASP n 
3 155 ARG n 
3 156 ILE n 
3 157 THR n 
3 158 GLU n 
3 159 VAL n 
3 160 LEU n 
3 161 LYS n 
3 162 SER n 
3 163 ARG n 
3 164 ASN n 
3 165 VAL n 
3 166 SER n 
3 167 VAL n 
3 168 ASN n 
3 169 LEU n 
3 170 PHE n 
3 171 GLY n 
3 172 ARG n 
3 173 MET n 
3 174 LEU n 
3 175 ALA n 
3 176 GLU n 
3 177 LEU n 
3 178 PRO n 
3 179 SER n 
3 180 THR n 
3 181 GLU n 
3 182 VAL n 
3 183 ASP n 
3 184 GLY n 
3 185 ALA n 
3 186 VAL n 
3 187 GLN n 
3 188 PHE n 
3 189 ALA n 
3 190 HIS n 
3 191 ALA n 
3 192 PHE n 
3 193 THR n 
3 194 VAL n 
3 195 HIS n 
3 196 GLY n 
3 197 THR n 
3 198 THR n 
3 199 VAL n 
3 200 GLU n 
3 201 VAL n 
3 202 ASP n 
3 203 PHE n 
3 204 PHE n 
3 205 THR n 
3 206 ALA n 
3 207 VAL n 
3 208 ASP n 
3 209 ASP n 
3 210 ILE n 
3 211 PRO n 
3 212 LYS n 
3 213 GLU n 
3 214 ASN n 
3 215 ASP n 
3 216 HIS n 
3 217 GLY n 
3 218 SER n 
3 219 GLY n 
3 220 HIS n 
3 221 MET n 
3 222 ASN n 
3 223 ALA n 
3 224 GLY n 
3 225 GLN n 
3 226 PHE n 
3 227 SER n 
3 228 ALA n 
3 229 GLY n 
3 230 THR n 
3 231 PHE n 
3 232 TYR n 
3 233 ARG n 
3 234 TYR n 
3 235 ALA n 
3 236 ASN n 
3 237 VAL n 
3 238 ASN n 
3 239 LEU n 
3 240 ASP n 
3 241 ARG n 
3 242 LEU n 
3 243 VAL n 
3 244 GLU n 
3 245 ASN n 
3 246 THR n 
3 247 GLY n 
3 248 ASP n 
3 249 ALA n 
3 250 GLN n 
3 251 THR n 
3 252 ALA n 
3 253 ARG n 
3 254 THR n 
3 255 ALA n 
3 256 VAL n 
3 257 ALA n 
3 258 GLU n 
3 259 PHE n 
3 260 LEU n 
3 261 ARG n 
3 262 ALA n 
3 263 PHE n 
3 264 LEU n 
3 265 SER n 
3 266 THR n 
3 267 VAL n 
3 268 PRO n 
3 269 SER n 
3 270 GLY n 
3 271 LYS n 
3 272 GLN n 
3 273 ASN n 
3 274 ALA n 
3 275 THR n 
3 276 ALA n 
3 277 ALA n 
3 278 MET n 
3 279 THR n 
3 280 LEU n 
3 281 PRO n 
3 282 ASP n 
3 283 LEU n 
3 284 VAL n 
3 285 HIS n 
3 286 ILE n 
3 287 ALA n 
3 288 VAL n 
3 289 ARG n 
3 290 PHE n 
3 291 ASP n 
3 292 ARG n 
3 293 PRO n 
3 294 ILE n 
3 295 SER n 
3 296 PHE n 
3 297 ALA n 
3 298 PRO n 
3 299 ALA n 
3 300 PHE n 
3 301 GLU n 
3 302 THR n 
3 303 ALA n 
3 304 LEU n 
3 305 TYR n 
3 306 GLY n 
3 307 SER n 
3 308 ASP n 
3 309 GLY n 
3 310 TYR n 
3 311 THR n 
3 312 LEU n 
3 313 ARG n 
3 314 ALA n 
3 315 CYS n 
3 316 GLN n 
3 317 GLU n 
3 318 LEU n 
3 319 ASN n 
3 320 ASN n 
3 321 TYR n 
3 322 ALA n 
3 323 GLU n 
3 324 ARG n 
3 325 LEU n 
3 326 ARG n 
3 327 GLU n 
3 328 VAL n 
3 329 TRP n 
3 330 PRO n 
3 331 ASP n 
3 332 ASP n 
3 333 ALA n 
3 334 ILE n 
3 335 ARG n 
3 336 GLY n 
3 337 TYR n 
3 338 ALA n 
3 339 THR n 
3 340 VAL n 
3 341 GLU n 
3 342 ASN n 
3 343 LYS n 
3 344 THR n 
3 345 ASP n 
3 346 LEU n 
3 347 ALA n 
3 348 ALA n 
3 349 LEU n 
3 350 GLY n 
3 351 GLU n 
3 352 ARG n 
3 353 TYR n 
3 354 ASP n 
3 355 SER n 
3 356 TYR n 
3 357 PRO n 
3 358 ALA n 
3 359 LEU n 
3 360 ILE n 
3 361 ASP n 
3 362 ALA n 
3 363 MET n 
3 364 VAL n 
3 365 ALA n 
3 366 ALA n 
3 367 ALA n 
3 368 PHE n 
3 369 GLU n 
3 370 GLY n 
3 371 GLU n 
3 372 ARG n 
3 373 GLU n 
4 1   MET n 
4 2   ASN n 
4 3   SER n 
4 4   ASP n 
4 5   TYR n 
4 6   ILE n 
4 7   LEU n 
4 8   GLN n 
4 9   HIS n 
4 10  ALA n 
4 11  ASP n 
4 12  ALA n 
4 13  LEU n 
4 14  VAL n 
4 15  LYS n 
4 16  ARG n 
4 17  VAL n 
4 18  SER n 
4 19  LYS n 
4 20  LEU n 
4 21  ILE n 
4 22  VAL n 
4 23  ASN n 
4 24  GLU n 
4 25  PRO n 
4 26  ALA n 
4 27  ALA n 
4 28  ARG n 
4 29  ALA n 
4 30  ALA n 
4 31  LEU n 
4 32  ARG n 
4 33  ARG n 
4 34  GLY n 
4 35  VAL n 
4 36  GLY n 
4 37  LEU n 
4 38  ALA n 
4 39  PRO n 
4 40  GLU n 
4 41  ASP n 
4 42  PRO n 
4 43  ARG n 
4 44  MET n 
4 45  LEU n 
4 46  ALA n 
4 47  ALA n 
4 48  HIS n 
4 49  ARG n 
4 50  VAL n 
4 51  VAL n 
4 52  ALA n 
4 53  PRO n 
4 54  TYR n 
4 55  VAL n 
4 56  PRO n 
4 57  VAL n 
4 58  PRO n 
4 59  THR n 
4 60  ASP n 
4 61  TYR n 
4 62  ASP n 
4 63  VAL n 
4 64  ASP n 
4 65  ARG n 
4 66  ARG n 
4 67  ARG n 
4 68  ALA n 
4 69  ALA n 
4 70  SER n 
4 71  LEU n 
4 72  TRP n 
4 73  ASP n 
4 74  VAL n 
4 75  HIS n 
4 76  ALA n 
4 77  VAL n 
4 78  GLU n 
4 79  ARG n 
4 80  ALA n 
4 81  PHE n 
4 82  TYR n 
4 83  ALA n 
4 84  VAL n 
4 85  ALA n 
4 86  ALA n 
4 87  ILE n 
4 88  MET n 
4 89  ALA n 
4 90  ALA n 
4 91  GLN n 
4 92  PRO n 
4 93  ARG n 
4 94  SER n 
4 95  ALA n 
4 96  ARG n 
4 97  ASP n 
4 98  GLN n 
4 99  GLU n 
4 100 ALA n 
4 101 GLU n 
4 102 ALA n 
4 103 THR n 
4 104 GLU n 
4 105 GLU n 
4 106 GLN n 
4 107 THR n 
4 108 GLY n 
4 109 GLU n 
4 110 PRO n 
4 111 GLN n 
4 112 ASP n 
4 113 SER n 
4 114 GLU n 
4 115 ALA n 
4 116 LEU n 
4 117 THR n 
4 118 GLU n 
4 119 PRO n 
4 120 THR n 
4 121 PRO n 
4 122 ALA n 
4 123 GLU n 
4 124 GLU n 
4 125 SER n 
4 126 SER n 
4 127 ALA n 
4 128 THR n 
4 129 LYS n 
4 130 ASP n 
4 131 GLY n 
4 132 LYS n 
4 133 PRO n 
4 134 ASP n 
4 135 ARG n 
4 136 ARG n 
4 137 PRO n 
4 138 ASN n 
4 139 LEU n 
4 140 GLY n 
4 141 VAL n 
4 142 SER n 
4 143 LEU n 
4 144 ALA n 
4 145 GLN n 
4 146 ALA n 
4 147 VAL n 
4 148 PHE n 
4 149 ASP n 
4 150 LYS n 
4 151 GLY n 
4 152 LEU n 
4 153 ASN n 
4 154 ALA n 
4 155 ASP n 
4 156 SER n 
4 157 THR n 
4 158 GLU n 
4 159 GLN n 
4 160 ARG n 
4 161 LEU n 
4 162 HIS n 
4 163 LEU n 
4 164 ILE n 
4 165 ALA n 
4 166 ARG n 
4 167 GLN n 
4 168 ASN n 
4 169 LEU n 
4 170 ASP n 
4 171 GLY n 
4 172 VAL n 
4 173 HIS n 
4 174 ARG n 
4 175 HIS n 
4 176 LEU n 
4 177 PRO n 
4 178 ARG n 
4 179 LEU n 
4 180 VAL n 
4 181 LEU n 
4 182 TYR n 
4 183 LEU n 
4 184 ARG n 
4 185 SER n 
4 186 ASP n 
4 187 GLN n 
4 188 VAL n 
4 189 HIS n 
4 190 ILE n 
4 191 ASP n 
4 192 TRP n 
4 193 GLY n 
4 194 ILE n 
4 195 LEU n 
4 196 ILE n 
4 197 ARG n 
4 198 ASP n 
4 199 LEU n 
4 200 ALA n 
4 201 ARG n 
4 202 TRP n 
4 203 GLY n 
4 204 HIS n 
4 205 THR n 
4 206 PRO n 
4 207 ARG n 
4 208 HIS n 
4 209 VAL n 
4 210 ALA n 
4 211 ARG n 
4 212 GLU n 
4 213 TRP n 
4 214 VAL n 
4 215 GLN n 
4 216 ASP n 
4 217 TYR n 
4 218 HIS n 
4 219 ARG n 
4 220 THR n 
4 221 LEU n 
4 222 GLU n 
4 223 THR n 
4 224 LEU n 
4 225 THR n 
4 226 ARG n 
4 227 GLN n 
4 228 ALA n 
4 229 GLU n 
4 230 GLN n 
4 231 LYS n 
4 232 ASN n 
4 233 LYS n 
4 234 ASN n 
4 235 ASN n 
4 236 THR n 
4 237 THR n 
4 238 ASP n 
4 239 GLU n 
4 240 GLU n 
4 241 ALA n 
4 242 GLU n 
4 243 ALA n 
4 244 ALA n 
5 1   A   n 
5 2   U   n 
5 3   G   n 
5 4   G   n 
5 5   A   n 
5 6   C   n 
5 7   C   n 
5 8   G   n 
5 9   C   n 
5 10  C   n 
5 11  A   n 
5 12  G   n 
5 13  U   n 
5 14  G   n 
5 15  A   n 
5 16  U   n 
5 17  A   n 
5 18  A   n 
5 19  G   n 
5 20  U   n 
5 21  G   n 
5 22  G   n 
5 23  A   n 
5 24  A   n 
5 25  U   n 
5 26  G   n 
5 27  C   n 
5 28  C   n 
5 29  A   n 
5 30  U   n 
5 31  G   n 
5 32  U   n 
5 33  G   n 
5 34  G   n 
5 35  G   n 
5 36  C   n 
5 37  U   n 
5 38  G   n 
5 39  U   n 
5 40  C   n 
5 41  G   n 
5 42  U   n 
5 43  G   n 
5 44  A   n 
5 45  G   n 
5 46  C   n 
5 47  C   n 
5 48  C   n 
5 49  C   n 
5 50  A   n 
5 51  C   n 
5 52  G   n 
5 53  C   n 
5 54  A   n 
5 55  C   n 
5 56  G   n 
5 57  U   n 
5 58  G   n 
5 59  G   n 
5 60  G   n 
5 61  G   n 
6 1   DG  n 
6 2   DC  n 
6 3   DC  n 
6 4   DT  n 
6 5   DG  n 
6 6   DG  n 
6 7   DC  n 
6 8   DG  n 
6 9   DA  n 
6 10  DC  n 
6 11  DA  n 
6 12  DG  n 
6 13  DC  n 
6 14  DC  n 
6 15  DC  n 
6 16  DA  n 
6 17  DC  n 
6 18  DA  n 
6 19  DT  n 
6 20  DG  n 
6 21  DG  n 
6 22  DC  n 
6 23  DA  n 
6 24  DT  n 
6 25  DT  n 
6 26  DC  n 
6 27  DC  n 
6 28  DA  n 
6 29  DC  n 
6 30  DT  n 
6 31  DT  n 
6 32  DA  n 
6 33  DT  n 
6 34  DC  n 
6 35  DA  n 
6 36  DC  n 
6 37  DT  n 
6 38  DG  n 
6 39  DG  n 
6 40  DC  n 
6 41  DT  n 
6 42  DT  n 
6 43  DC  n 
6 44  DG  n 
6 45  DT  n 
6 46  DC  n 
6 47  DC  n 
6 48  DG  n 
6 49  DC  n 
6 50  DG  n 
7 1   MET n 
7 2   SER n 
7 3   GLY n 
7 4   PHE n 
7 5   LEU n 
7 6   LEU n 
7 7   ARG n 
7 8   LEU n 
7 9   ALA n 
7 10  GLY n 
7 11  PRO n 
7 12  MET n 
7 13  GLN n 
7 14  SER n 
7 15  TRP n 
7 16  GLY n 
7 17  GLU n 
7 18  HIS n 
7 19  SER n 
7 20  MET n 
7 21  PHE n 
7 22  GLY n 
7 23  GLU n 
7 24  ARG n 
7 25  ASP n 
7 26  THR n 
7 27  LEU n 
7 28  PRO n 
7 29  TYR n 
7 30  PRO n 
7 31  SER n 
7 32  ARG n 
7 33  SER n 
7 34  GLY n 
7 35  LEU n 
7 36  ILE n 
7 37  GLY n 
7 38  MET n 
7 39  PHE n 
7 40  ALA n 
7 41  ALA n 
7 42  ALA n 
7 43  GLN n 
7 44  GLY n 
7 45  VAL n 
7 46  ARG n 
7 47  ARG n 
7 48  GLY n 
7 49  ASP n 
7 50  PRO n 
7 51  LEU n 
7 52  ASP n 
7 53  ARG n 
7 54  TYR n 
7 55  LYS n 
7 56  GLU n 
7 57  LEU n 
7 58  LYS n 
7 59  PHE n 
7 60  THR n 
7 61  VAL n 
7 62  ARG n 
7 63  VAL n 
7 64  ASP n 
7 65  ARG n 
7 66  PRO n 
7 67  GLY n 
7 68  VAL n 
7 69  ARG n 
7 70  LEU n 
7 71  VAL n 
7 72  ASP n 
7 73  PHE n 
7 74  HIS n 
7 75  THR n 
7 76  ILE n 
7 77  GLY n 
7 78  GLY n 
7 79  GLY n 
7 80  LEU n 
7 81  PRO n 
7 82  LYS n 
7 83  GLU n 
7 84  ARG n 
7 85  THR n 
7 86  VAL n 
7 87  PRO n 
7 88  THR n 
7 89  ALA n 
7 90  ALA n 
7 91  GLY n 
7 92  GLU n 
7 93  ARG n 
7 94  ARG n 
7 95  ASP n 
7 96  PRO n 
7 97  LYS n 
7 98  LYS n 
7 99  ALA n 
7 100 THR n 
7 101 ILE n 
7 102 VAL n 
7 103 THR n 
7 104 SER n 
7 105 ARG n 
7 106 SER n 
7 107 TYR n 
7 108 LEU n 
7 109 ALA n 
7 110 ASP n 
7 111 ALA n 
7 112 VAL n 
7 113 PHE n 
7 114 THR n 
7 115 VAL n 
7 116 ALA n 
7 117 VAL n 
7 118 THR n 
7 119 GLY n 
7 120 PRO n 
7 121 GLU n 
7 122 ALA n 
7 123 ASP n 
7 124 THR n 
7 125 ILE n 
7 126 ALA n 
7 127 ASP n 
7 128 ALA n 
7 129 LEU n 
7 130 ALA n 
7 131 ALA n 
7 132 PRO n 
7 133 TYR n 
7 134 TRP n 
7 135 GLN n 
7 136 PRO n 
7 137 TYR n 
7 138 LEU n 
7 139 GLY n 
7 140 ARG n 
7 141 ARG n 
7 142 ALA n 
7 143 PHE n 
7 144 VAL n 
7 145 PRO n 
7 146 ASP n 
7 147 PRO n 
7 148 LEU n 
7 149 LEU n 
7 150 VAL n 
7 151 LEU n 
7 152 ARG n 
7 153 ARG n 
7 154 ARG n 
7 155 VAL n 
7 156 ALA n 
7 157 ASP n 
7 158 PRO n 
7 159 VAL n 
7 160 ARG n 
7 161 GLU n 
7 162 LEU n 
7 163 VAL n 
7 164 GLU n 
7 165 ALA n 
7 166 VAL n 
7 167 PRO n 
7 168 LEU n 
7 169 PRO n 
7 170 HIS n 
7 171 ARG n 
7 172 ARG n 
7 173 VAL n 
7 174 GLU n 
7 175 GLU n 
7 176 ASP n 
7 177 ALA n 
7 178 ALA n 
7 179 THR n 
7 180 VAL n 
7 181 LEU n 
7 182 VAL n 
7 183 ASP n 
7 184 LEU n 
7 185 ILE n 
7 186 TYR n 
7 187 GLU n 
7 188 GLU n 
7 189 GLY n 
7 190 GLU n 
7 191 TYR n 
7 192 PRO n 
7 193 ASP n 
7 194 THR n 
7 195 ARG n 
7 196 THR n 
7 197 LEU n 
7 198 THR n 
7 199 VAL n 
7 200 LEU n 
7 201 ASN n 
7 202 ASP n 
7 203 VAL n 
7 204 PRO n 
7 205 LEU n 
7 206 SER n 
7 207 PHE n 
7 208 ASP n 
7 209 SER n 
7 210 LYS n 
7 211 SER n 
7 212 ARG n 
7 213 ARG n 
7 214 TYR n 
7 215 SER n 
7 216 THR n 
7 217 ARG n 
7 218 GLN n 
7 219 ILE n 
7 220 ARG n 
7 221 VAL n 
7 222 VAL n 
7 223 PRO n 
7 224 THR n 
7 225 GLU n 
7 226 VAL n 
7 227 PRO n 
7 228 ALA n 
7 229 THR n 
7 230 LEU n 
7 231 VAL n 
7 232 ALA n 
7 233 GLY n 
7 234 PRO n 
7 235 GLY n 
7 236 ARG n 
7 237 ASP n 
7 238 TYR n 
7 239 GLN n 
7 240 ASN n 
7 241 LYS n 
7 242 LEU n 
7 243 PHE n 
7 244 THR n 
7 245 TYR n 
7 246 VAL n 
7 247 LYS n 
7 248 GLN n 
7 249 CYS n 
7 250 ALA n 
7 251 GLU n 
7 252 GLU n 
7 253 ALA n 
7 254 ALA n 
8 1   DC  n 
8 2   DG  n 
8 3   DC  n 
8 4   DG  n 
8 5   DG  n 
8 6   DA  n 
8 7   DC  n 
8 8   DG  n 
8 9   DA  n 
8 10  DA  n 
8 11  DG  n 
8 12  DC  n 
8 13  DC  n 
8 14  DA  n 
8 15  DG  n 
8 16  DT  n 
8 17  DG  n 
8 18  DA  n 
8 19  DC  n 
8 20  DC  n 
8 21  DA  n 
8 22  DT  n 
8 23  DG  n 
8 24  DT  n 
8 25  DG  n 
8 26  DG  n 
8 27  DG  n 
8 28  DC  n 
8 29  DT  n 
8 30  DG  n 
8 31  DT  n 
8 32  DC  n 
8 33  DG  n 
8 34  DC  n 
8 35  DC  n 
8 36  DA  n 
8 37  DG  n 
8 38  DG  n 
8 39  DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 232 ? ? Tfu_1588 ? YX ? ? ? ? 'Thermobifida fusca (strain YX)' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 549 ? ? Tfu_1592 ? YX ? ? ? ? 'Thermobifida fusca (strain YX)' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 373 ? ? Tfu_1590 ? YX ? ? ? ? 'Thermobifida fusca (strain YX)' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 244 ? ? Tfu_1591 ? YX ? ? ? ? 'Thermobifida fusca (strain YX)' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 254 ? ? Tfu_1589 ? YX ? ? ? ? 'Thermobifida fusca (strain YX)' 269800 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ?  'Thermobifida fusca YX' ? 269800 'RNA was prepared by in vitro transcription' 
6 1 sample 1 50 'Thermobifida fusca YX' ? 269800 ?                                            
8 1 sample 1 39 'Thermobifida fusca YX' ? 269800 ?                                            
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q47PJ1_THEFY Q47PJ1 ? 2 
;MLSVALCFLVGGAIPSPPSFDVTIAPWLIARSRDVLAAPEMLGLRDVLIRSHELSDVEIPLPPGAAVLWRILALITARIT
GLDQPPNKNPKRKWQARRSQILSKGRLDPEAVDAYFADYSERFDLFHPERPWLQDPRLREECPKTSGVNKLAWGRTAGEN
QVWLGGHHHDLDPHPLDSAEAVWHLLATLGYGPSGMCTARVVRGRSERNVTAGPLRGTVSYHPLGRTLFESLILNIPYPG
TGAADLAFWEQPELNDPLGLPEESAGLAGILRLDHFRHAVLLHPSPDGSHVVDAWVTWAWRERNISPELDPYLIYQTSKE
GRVYPRPAEAERAIWRDLDALLHYGEDGNYRPTILDNCTPLAQVPQEVLDSLRLRAFGFDQDGQARDKQWFTATTPAVLR
WLADRETDDNENARIVRRITLARKAAEALGRRLEKACKEAWKESNSPSSTSSGTNAKTETGVGPWVQHGMSRYWAKAEPV
FWNIVYDRPAQGYTPGMAGPGNAFNLVALAAYDEVTGPYCERPRVAKVVERHRSTLFSNWTPKQDKEAA
;
1 
2 UNP Q47PJ3_THEFY Q47PJ3 ? 3 
;MTFVDIHAIQTLPYSNINRDDLGSPKTVVYGGKERTRVSSQSWKRAVRHEVEARLGDKAVRTRRIISEIAKRLRERGWDA
DLADAGARQVVLSVGKKSGIKLEKEKDSEAPATSVLFYLPVPAIDELAAIADEHRDAVAKEAAKKTPKGILPADRITEVL
KSRNVSVNLFGRMLAELPSTEVDGAVQFAHAFTVHGTTVEVDFFTAVDDIPKENDHGSGHMNAGQFSAGTFYRYANVNLD
RLVENTGDAQTARTAVAEFLRAFLSTVPSGKQNATAAMTLPDLVHIAVRFDRPISFAPAFETALYGSDGYTLRACQELNN
YAERLREVWPDDAIRGYATVENKTDLAALGERYDSYPALIDAMVAAAFEGERE
;
1 
3 UNP Q47PJ2_THEFY Q47PJ2 ? 4 
;MNSDYILQHADALVKRVSKLIVNEPAARAALRRGVGLAPEDPRMLAAHRVVAPYVPVPTDYDVDRRRAASLWDVHAVERA
FYAVAAIMAAQPRSARDQEAEATEEQTGEPQDSEALTEPTPAEESSATKDGKPDRRPNLGVSLAQAVFDKGLNADSTEQR
LHLIARQNLDGVHRHLPRLVLYLRSDQVHIDWGILIRDLARWGHTPRHVAREWVQDYHRTLETLTRQAEQKNKNNTTDEE
AEAA
;
1 
4 PDB 5U0A         5U0A   ? 5 ? 1 
5 PDB 5U0A         5U0A   ? 6 ? 1 
6 UNP Q47PJ4_THEFY Q47PJ4 ? 7 
;MSGFLLRLAGPMQSWGEHSMFGERDTLPYPSRSGLIGMFAAAQGVRRGDPLDRYKELKFTVRVDRPGVRLVDFHTIGGGL
PKERTVPTAAGERRDPKKATIVTSRSYLADAVFTVAVTGPEADTIADALAAPYWQPYLGRRAFVPDPLLVLRRRVADPVR
ELVEAVPLPHRRVEEDAATVLVDLIYEEGEYPDTRTLTVLNDVPLSFDSKSRRYSTRQIRVVPTEVPATLVAGPGRDYQN
KLFTYVKQCAEEAA
;
1 
7 PDB 5U0A         5U0A   ? 8 ? 1 
8 UNP Q47PJ5_THEFY Q47PJ5 ? 1 
;MTWLTKIVPDLRYRQTRADFRTAGNLHRKLIRLSSDLGEERIANPRQQSGLLFRIEETRNELYLLVQSHSPLRVDRLGPG
YHGVQMRNLDPFLARLDKGSRVRYRIVASPTKRLGRSENNTQRLGLKEPPKKPREYTWALRGAAAEEWWHSRAAANGLEL
LSTYAQTLDDVRDPGTADRSRKIRHPAVRFDGEAVISDVDAVRHAVLNGIGRGKSYGCGLLSLALIEEGEHG
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5U0A C 1 ? 549 ? Q47PJ1 1  ? 549 ? 1  549 
2  2 5U0A D 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
3  2 5U0A E 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
4  2 5U0A F 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
5  2 5U0A G 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
6  2 5U0A H 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
7  2 5U0A I 1 ? 373 ? Q47PJ3 1  ? 373 ? 1  373 
8  3 5U0A J 1 ? 244 ? Q47PJ2 1  ? 244 ? 1  244 
9  4 5U0A K 1 ? 61  ? 5U0A   1  ? 61  ? 1  61  
10 3 5U0A L 1 ? 244 ? Q47PJ2 1  ? 244 ? 1  244 
11 5 5U0A M 1 ? 50  ? 5U0A   16 ? 65  ? 16 65  
12 6 5U0A N 1 ? 254 ? Q47PJ4 1  ? 254 ? 1  254 
13 7 5U0A O 1 ? 39  ? 5U0A   1  ? 50  ? 1  50  
14 8 5U0A A 1 ? 232 ? Q47PJ5 1  ? 232 ? 1  232 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5U0A 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5U0A 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.013  ? 30167 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.420  ? 41600 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 18.354 ? 17710 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.079  ? 4700  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.008  ? 4928  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     5U0A 
_struct.title                        'CRISPR RNA-guided surveillance complex' 
_struct.pdbx_descriptor              'CRISPR RNA-guided surveillance complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5U0A 
_struct_keywords.text            'CRISPR-Cas, Cascacde, surveillance, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 4 ? 
L N N 6 ? 
M N N 7 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A 22  ? ARG A 32  ? THR A 22  ARG A 32  1 ? 11 
HELX_P HELX_P2   AA2 ALA A 143 ? ALA A 154 ? ALA A 143 ALA A 154 1 ? 12 
HELX_P HELX_P3   AA3 ASP A 198 ? GLY A 209 ? ASP A 198 GLY A 209 1 ? 12 
HELX_P HELX_P4   AA4 GLY A 213 ? GLY A 217 ? GLY A 213 GLY A 217 5 ? 5  
HELX_P HELX_P5   AA5 GLY B 43  ? ARG B 50  ? GLY C 43  ARG C 50  1 ? 8  
HELX_P HELX_P6   AA6 LEU B 61  ? ALA B 73  ? LEU C 61  ALA C 73  1 ? 13 
HELX_P HELX_P7   AA7 ILE B 75  ? LEU B 82  ? ILE C 75  LEU C 82  1 ? 8  
HELX_P HELX_P8   AA8 ASN B 89  ? GLY B 105 ? ASN C 89  GLY C 105 1 ? 17 
HELX_P HELX_P9   AA9 ASP B 108 ? TYR B 119 ? ASP C 108 TYR C 119 1 ? 12 
HELX_P HELX_P10  AB1 SER B 120 ? PHE B 123 ? SER C 120 PHE C 123 5 ? 4  
HELX_P HELX_P11  AB2 ARG B 137 ? CYS B 142 ? ARG C 137 CYS C 142 1 ? 6  
HELX_P HELX_P12  AB3 GLY B 147 ? ALA B 152 ? GLY C 147 ALA C 152 1 ? 6  
HELX_P HELX_P13  AB4 SER B 178 ? TYR B 191 ? SER C 178 TYR C 191 1 ? 14 
HELX_P HELX_P14  AB5 THR B 227 ? ASN B 235 ? THR C 227 ASN C 235 1 ? 9  
HELX_P HELX_P15  AB6 GLY B 266 ? LEU B 271 ? GLY C 266 LEU C 271 1 ? 6  
HELX_P HELX_P16  AB7 LEU B 338 ? GLY B 345 ? LEU C 338 GLY C 345 5 ? 8  
HELX_P HELX_P17  AB8 PRO B 352 ? THR B 359 ? PRO C 352 THR C 359 1 ? 8  
HELX_P HELX_P18  AB9 GLU B 367 ? LEU B 372 ? GLU C 367 LEU C 372 1 ? 6  
HELX_P HELX_P19  AC1 PRO B 396 ? THR B 407 ? PRO C 396 THR C 407 1 ? 12 
HELX_P HELX_P20  AC2 ASP B 409 ? SER B 446 ? ASP C 409 SER C 446 1 ? 38 
HELX_P HELX_P21  AC3 PRO B 464 ? ASP B 487 ? PRO C 464 ASP C 487 1 ? 24 
HELX_P HELX_P22  AC4 ASN B 502 ? THR B 516 ? ASN C 502 THR C 516 1 ? 15 
HELX_P HELX_P23  AC5 GLY B 517 ? CYS B 520 ? GLY C 517 CYS C 520 5 ? 4  
HELX_P HELX_P24  AC6 ARG B 522 ? SER B 534 ? ARG C 522 SER C 534 1 ? 13 
HELX_P HELX_P25  AC7 THR B 535 ? SER B 538 ? THR C 535 SER C 538 5 ? 4  
HELX_P HELX_P26  AC8 SER C 39  ? LEU C 55  ? SER D 39  LEU D 55  1 ? 17 
HELX_P HELX_P27  AC9 VAL C 165 ? PHE C 170 ? VAL D 165 PHE D 170 1 ? 6  
HELX_P HELX_P28  AD1 LEU C 239 ? GLY C 247 ? LEU D 239 GLY D 247 1 ? 9  
HELX_P HELX_P29  AD2 ASP C 248 ? THR C 266 ? ASP D 248 THR D 266 1 ? 19 
HELX_P HELX_P30  AD3 PHE C 296 ? GLU C 301 ? PHE D 296 GLU D 301 5 ? 6  
HELX_P HELX_P31  AD4 TYR C 310 ? TRP C 329 ? TYR D 310 TRP D 329 1 ? 20 
HELX_P HELX_P32  AD5 LEU C 346 ? GLY C 350 ? LEU D 346 GLY D 350 5 ? 5  
HELX_P HELX_P33  AD6 SER C 355 ? PHE C 368 ? SER D 355 PHE D 368 1 ? 14 
HELX_P HELX_P34  AD7 SER D 39  ? GLY D 56  ? SER E 39  GLY E 56  1 ? 18 
HELX_P HELX_P35  AD8 ARG D 64  ? ARG D 76  ? ARG E 64  ARG E 76  1 ? 13 
HELX_P HELX_P36  AD9 ASP D 79  ? SER D 93  ? ASP E 79  SER E 93  1 ? 15 
HELX_P HELX_P37  AE1 VAL D 121 ? HIS D 134 ? VAL E 121 HIS E 134 1 ? 14 
HELX_P HELX_P38  AE2 HIS D 134 ? LYS D 144 ? HIS E 134 LYS E 144 1 ? 11 
HELX_P HELX_P39  AE3 PRO D 152 ? LYS D 161 ? PRO E 152 LYS E 161 1 ? 10 
HELX_P HELX_P40  AE4 ASN D 164 ? GLY D 171 ? ASN E 164 GLY E 171 1 ? 8  
HELX_P HELX_P41  AE5 LEU D 239 ? GLY D 247 ? LEU E 239 GLY E 247 1 ? 9  
HELX_P HELX_P42  AE6 ASP D 248 ? THR D 266 ? ASP E 248 THR E 266 1 ? 19 
HELX_P HELX_P43  AE7 PHE D 296 ? GLU D 301 ? PHE E 296 GLU E 301 5 ? 6  
HELX_P HELX_P44  AE8 GLY D 309 ? TRP D 329 ? GLY E 309 TRP E 329 1 ? 21 
HELX_P HELX_P45  AE9 LEU D 346 ? GLY D 350 ? LEU E 346 GLY E 350 5 ? 5  
HELX_P HELX_P46  AF1 SER D 355 ? PHE D 368 ? SER E 355 PHE E 368 1 ? 14 
HELX_P HELX_P47  AF2 SER E 39  ? GLY E 56  ? SER F 39  GLY F 56  1 ? 18 
HELX_P HELX_P48  AF3 ARG E 64  ? ARG E 76  ? ARG F 64  ARG F 76  1 ? 13 
HELX_P HELX_P49  AF4 ASP E 79  ? SER E 93  ? ASP F 79  SER F 93  1 ? 15 
HELX_P HELX_P50  AF5 VAL E 121 ? HIS E 134 ? VAL F 121 HIS F 134 1 ? 14 
HELX_P HELX_P51  AF6 HIS E 134 ? LYS E 144 ? HIS F 134 LYS F 144 1 ? 11 
HELX_P HELX_P52  AF7 PRO E 152 ? LYS E 161 ? PRO F 152 LYS F 161 1 ? 10 
HELX_P HELX_P53  AF8 ASN E 164 ? GLY E 171 ? ASN F 164 GLY F 171 1 ? 8  
HELX_P HELX_P54  AF9 LEU E 239 ? GLY E 247 ? LEU F 239 GLY F 247 1 ? 9  
HELX_P HELX_P55  AG1 ASP E 248 ? THR E 266 ? ASP F 248 THR F 266 1 ? 19 
HELX_P HELX_P56  AG2 PHE E 296 ? GLU E 301 ? PHE F 296 GLU F 301 5 ? 6  
HELX_P HELX_P57  AG3 GLY E 309 ? TRP E 329 ? GLY F 309 TRP F 329 1 ? 21 
HELX_P HELX_P58  AG4 LEU E 346 ? GLY E 350 ? LEU F 346 GLY F 350 5 ? 5  
HELX_P HELX_P59  AG5 SER E 355 ? PHE E 368 ? SER F 355 PHE F 368 1 ? 14 
HELX_P HELX_P60  AG6 SER F 39  ? GLY F 56  ? SER G 39  GLY G 56  1 ? 18 
HELX_P HELX_P61  AG7 ARG F 64  ? ARG F 76  ? ARG G 64  ARG G 76  1 ? 13 
HELX_P HELX_P62  AG8 ASP F 79  ? SER F 93  ? ASP G 79  SER G 93  1 ? 15 
HELX_P HELX_P63  AG9 VAL F 121 ? HIS F 134 ? VAL G 121 HIS G 134 1 ? 14 
HELX_P HELX_P64  AH1 HIS F 134 ? LYS F 144 ? HIS G 134 LYS G 144 1 ? 11 
HELX_P HELX_P65  AH2 PRO F 152 ? LYS F 161 ? PRO G 152 LYS G 161 1 ? 10 
HELX_P HELX_P66  AH3 ASN F 164 ? GLY F 171 ? ASN G 164 GLY G 171 1 ? 8  
HELX_P HELX_P67  AH4 LEU F 239 ? GLY F 247 ? LEU G 239 GLY G 247 1 ? 9  
HELX_P HELX_P68  AH5 ASP F 248 ? THR F 266 ? ASP G 248 THR G 266 1 ? 19 
HELX_P HELX_P69  AH6 PHE F 296 ? GLU F 301 ? PHE G 296 GLU G 301 5 ? 6  
HELX_P HELX_P70  AH7 GLY F 309 ? TRP F 329 ? GLY G 309 TRP G 329 1 ? 21 
HELX_P HELX_P71  AH8 LEU F 346 ? GLY F 350 ? LEU G 346 GLY G 350 5 ? 5  
HELX_P HELX_P72  AH9 SER F 355 ? ALA F 367 ? SER G 355 ALA G 367 1 ? 13 
HELX_P HELX_P73  AI1 SER G 39  ? GLY G 56  ? SER H 39  GLY H 56  1 ? 18 
HELX_P HELX_P74  AI2 ARG G 64  ? ARG G 76  ? ARG H 64  ARG H 76  1 ? 13 
HELX_P HELX_P75  AI3 ASP G 79  ? SER G 93  ? ASP H 79  SER H 93  1 ? 15 
HELX_P HELX_P76  AI4 VAL G 121 ? HIS G 134 ? VAL H 121 HIS H 134 1 ? 14 
HELX_P HELX_P77  AI5 HIS G 134 ? LYS G 144 ? HIS H 134 LYS H 144 1 ? 11 
HELX_P HELX_P78  AI6 PRO G 152 ? LYS G 161 ? PRO H 152 LYS H 161 1 ? 10 
HELX_P HELX_P79  AI7 ASN G 164 ? GLY G 171 ? ASN H 164 GLY H 171 1 ? 8  
HELX_P HELX_P80  AI8 LEU G 239 ? GLY G 247 ? LEU H 239 GLY H 247 1 ? 9  
HELX_P HELX_P81  AI9 ASP G 248 ? THR G 266 ? ASP H 248 THR H 266 1 ? 19 
HELX_P HELX_P82  AJ1 LYS G 271 ? ALA G 276 ? LYS H 271 ALA H 276 1 ? 6  
HELX_P HELX_P83  AJ2 PHE G 296 ? GLU G 301 ? PHE H 296 GLU H 301 5 ? 6  
HELX_P HELX_P84  AJ3 GLY G 309 ? TRP G 329 ? GLY H 309 TRP H 329 1 ? 21 
HELX_P HELX_P85  AJ4 LEU G 346 ? GLY G 350 ? LEU H 346 GLY H 350 5 ? 5  
HELX_P HELX_P86  AJ5 SER G 355 ? ALA G 367 ? SER H 355 ALA H 367 1 ? 13 
HELX_P HELX_P87  AJ6 SER H 39  ? GLY H 56  ? SER I 39  GLY I 56  1 ? 18 
HELX_P HELX_P88  AJ7 ARG H 64  ? ARG H 76  ? ARG I 64  ARG I 76  1 ? 13 
HELX_P HELX_P89  AJ8 ASP H 79  ? SER H 93  ? ASP I 79  SER I 93  1 ? 15 
HELX_P HELX_P90  AJ9 VAL H 121 ? HIS H 134 ? VAL I 121 HIS I 134 1 ? 14 
HELX_P HELX_P91  AK1 HIS H 134 ? LYS H 144 ? HIS I 134 LYS I 144 1 ? 11 
HELX_P HELX_P92  AK2 PRO H 152 ? LYS H 161 ? PRO I 152 LYS I 161 1 ? 10 
HELX_P HELX_P93  AK3 ASN H 164 ? GLY H 171 ? ASN I 164 GLY I 171 1 ? 8  
HELX_P HELX_P94  AK4 LEU H 239 ? GLY H 247 ? LEU I 239 GLY I 247 1 ? 9  
HELX_P HELX_P95  AK5 ASP H 248 ? THR H 266 ? ASP I 248 THR I 266 1 ? 19 
HELX_P HELX_P96  AK6 PHE H 296 ? GLU H 301 ? PHE I 296 GLU I 301 5 ? 6  
HELX_P HELX_P97  AK7 GLY H 309 ? TRP H 329 ? GLY I 309 TRP I 329 1 ? 21 
HELX_P HELX_P98  AK8 LEU H 346 ? GLY H 350 ? LEU I 346 GLY I 350 5 ? 5  
HELX_P HELX_P99  AK9 SER H 355 ? ALA H 367 ? SER I 355 ALA I 367 1 ? 13 
HELX_P HELX_P100 AL1 ILE I 6   ? GLU I 24  ? ILE J 6   GLU J 24  1 ? 19 
HELX_P HELX_P101 AL2 GLU I 24  ? ARG I 33  ? GLU J 24  ARG J 33  1 ? 10 
HELX_P HELX_P102 AL3 ASP I 41  ? LEU I 45  ? ASP J 41  LEU J 45  5 ? 5  
HELX_P HELX_P103 AL4 ALA I 47  ? ALA I 52  ? ALA J 47  ALA J 52  1 ? 6  
HELX_P HELX_P104 AL5 PRO I 53  ? VAL I 55  ? PRO J 53  VAL J 55  5 ? 3  
HELX_P HELX_P105 AL6 HIS I 75  ? ALA I 90  ? HIS J 75  ALA J 90  1 ? 16 
HELX_P HELX_P106 AL7 PRO I 92  ? GLN I 98  ? PRO J 92  GLN J 98  1 ? 7  
HELX_P HELX_P107 AL8 ASN I 138 ? ASP I 149 ? ASN J 138 ASP J 149 1 ? 12 
HELX_P HELX_P108 AL9 ASN I 153 ? ALA I 165 ? ASN J 153 ALA J 165 1 ? 13 
HELX_P HELX_P109 AM1 ASN I 168 ? ASP I 186 ? ASN J 168 ASP J 186 1 ? 19 
HELX_P HELX_P110 AM2 ASP I 191 ? TRP I 202 ? ASP J 191 TRP J 202 1 ? 12 
HELX_P HELX_P111 AM3 VAL I 209 ? ALA I 228 ? VAL J 209 ALA J 228 1 ? 20 
HELX_P HELX_P112 AM4 ASP K 4   ? GLU K 24  ? ASP L 4   GLU L 24  1 ? 21 
HELX_P HELX_P113 AM5 GLU K 24  ? ARG K 33  ? GLU L 24  ARG L 33  1 ? 10 
HELX_P HELX_P114 AM6 LEU K 45  ? VAL K 51  ? LEU L 45  VAL L 51  1 ? 7  
HELX_P HELX_P115 AM7 HIS K 75  ? ALA K 90  ? HIS L 75  ALA L 90  1 ? 16 
HELX_P HELX_P116 AM8 PRO K 92  ? GLN K 98  ? PRO L 92  GLN L 98  1 ? 7  
HELX_P HELX_P117 AM9 ASN K 138 ? ASP K 149 ? ASN L 138 ASP L 149 1 ? 12 
HELX_P HELX_P118 AN1 ASN K 153 ? GLN K 167 ? ASN L 153 GLN L 167 1 ? 15 
HELX_P HELX_P119 AN2 ASN K 168 ? ASP K 186 ? ASN L 168 ASP L 186 1 ? 19 
HELX_P HELX_P120 AN3 ASP K 191 ? THR K 205 ? ASP L 191 THR L 205 1 ? 15 
HELX_P HELX_P121 AN4 THR K 205 ? GLU K 229 ? THR L 205 GLU L 229 1 ? 25 
HELX_P HELX_P122 AN5 SER M 31  ? GLY M 44  ? SER N 31  GLY N 44  1 ? 14 
HELX_P HELX_P123 AN6 PRO M 81  ? THR M 85  ? PRO N 81  THR N 85  5 ? 5  
HELX_P HELX_P124 AN7 GLU M 121 ? ALA M 130 ? GLU N 121 ALA N 130 1 ? 10 
HELX_P HELX_P125 AN8 ASP M 157 ? GLU M 164 ? ASP N 157 GLU N 164 1 ? 8  
HELX_P HELX_P126 AN9 ARG M 236 ? GLN M 248 ? ARG N 236 GLN N 248 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? J C  9  N3 ? ? ? 1_555 L DG 39 N1 ? ? K C  9  M DG 54 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2   hydrog ? ? J C  9  N4 ? ? ? 1_555 L DG 39 O6 ? ? K C  9  M DG 54 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3   hydrog ? ? J C  9  O2 ? ? ? 1_555 L DG 39 N2 ? ? K C  9  M DG 54 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4   hydrog ? ? J C  10 N3 ? ? ? 1_555 L DG 38 N2 ? ? K C  10 M DG 53 1_555 ? ? ? ? ? ? 'C-DG PAIR'             ? ? 
hydrog5   hydrog ? ? J G  12 N1 ? ? ? 1_555 L DC 36 N3 ? ? K G  12 M DC 51 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6   hydrog ? ? J G  12 N2 ? ? ? 1_555 L DC 36 O2 ? ? K G  12 M DC 51 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7   hydrog ? ? J G  12 O6 ? ? ? 1_555 L DC 36 N4 ? ? K G  12 M DC 51 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8   hydrog ? ? J U  13 O4 ? ? ? 1_555 L DA 35 N6 ? ? K U  13 M DA 50 1_555 ? ? ? ? ? ? 'U-DA PAIR'             ? ? 
hydrog9   hydrog ? ? J A  15 N1 ? ? ? 1_555 L DT 33 N3 ? ? K A  15 M DT 48 1_555 ? ? ? ? ? ? 'A-DT PAIR'             ? ? 
hydrog10  hydrog ? ? J U  16 N3 ? ? ? 1_555 L DA 32 N1 ? ? K U  16 M DA 47 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11  hydrog ? ? J U  16 O4 ? ? ? 1_555 L DA 32 N6 ? ? K U  16 M DA 47 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12  hydrog ? ? J A  17 N1 ? ? ? 1_555 L DT 31 N3 ? ? K A  17 M DT 46 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13  hydrog ? ? J A  17 N6 ? ? ? 1_555 L DT 31 O4 ? ? K A  17 M DT 46 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14  hydrog ? ? J A  18 N1 ? ? ? 1_555 L DT 30 N3 ? ? K A  18 M DT 45 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15  hydrog ? ? J A  18 N6 ? ? ? 1_555 L DT 30 O4 ? ? K A  18 M DT 45 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16  hydrog ? ? J G  19 N1 ? ? ? 1_555 L DC 29 N3 ? ? K G  19 M DC 44 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17  hydrog ? ? J G  19 N2 ? ? ? 1_555 L DC 29 O2 ? ? K G  19 M DC 44 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18  hydrog ? ? J G  19 O6 ? ? ? 1_555 L DC 29 N4 ? ? K G  19 M DC 44 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19  hydrog ? ? J G  21 N1 ? ? ? 1_555 L DC 27 N3 ? ? K G  21 M DC 42 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20  hydrog ? ? J G  21 N2 ? ? ? 1_555 L DC 27 O2 ? ? K G  21 M DC 42 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog21  hydrog ? ? J G  21 O6 ? ? ? 1_555 L DC 27 N4 ? ? K G  21 M DC 42 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog22  hydrog ? ? J G  22 N1 ? ? ? 1_555 L DC 26 N3 ? ? K G  22 M DC 41 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog23  hydrog ? ? J G  22 N2 ? ? ? 1_555 L DC 26 O2 ? ? K G  22 M DC 41 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24  hydrog ? ? J G  22 O6 ? ? ? 1_555 L DC 26 N4 ? ? K G  22 M DC 41 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25  hydrog ? ? J A  23 N1 ? ? ? 1_555 L DT 25 N3 ? ? K A  23 M DT 40 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26  hydrog ? ? J A  23 N6 ? ? ? 1_555 L DT 25 O4 ? ? K A  23 M DT 40 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27  hydrog ? ? J A  24 N1 ? ? ? 1_555 L DT 24 N3 ? ? K A  24 M DT 39 1_555 ? ? ? ? ? ? 'A-DT PAIR'             ? ? 
hydrog28  hydrog ? ? J U  25 N3 ? ? ? 1_555 L DA 23 N1 ? ? K U  25 M DA 38 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29  hydrog ? ? J U  25 O4 ? ? ? 1_555 L DA 23 N6 ? ? K U  25 M DA 38 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30  hydrog ? ? J C  27 N3 ? ? ? 1_555 L DG 21 N1 ? ? K C  27 M DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31  hydrog ? ? J C  27 N4 ? ? ? 1_555 L DG 21 O6 ? ? K C  27 M DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog32  hydrog ? ? J C  27 O2 ? ? ? 1_555 L DG 21 N2 ? ? K C  27 M DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog33  hydrog ? ? J C  28 N3 ? ? ? 1_555 L DG 20 N2 ? ? K C  28 M DG 35 1_555 ? ? ? ? ? ? 'C-DG PAIR'             ? ? 
hydrog34  hydrog ? ? J A  29 N1 ? ? ? 1_555 L DT 19 N3 ? ? K A  29 M DT 34 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog35  hydrog ? ? J A  29 N6 ? ? ? 1_555 L DT 19 O4 ? ? K A  29 M DT 34 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog36  hydrog ? ? J U  30 N3 ? ? ? 1_555 L DA 18 N1 ? ? K U  30 M DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog37  hydrog ? ? J U  30 O4 ? ? ? 1_555 L DA 18 N6 ? ? K U  30 M DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog38  hydrog ? ? J G  31 N1 ? ? ? 1_555 L DC 17 N3 ? ? K G  31 M DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog39  hydrog ? ? J G  31 N2 ? ? ? 1_555 L DC 17 O2 ? ? K G  31 M DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog40  hydrog ? ? J G  31 O6 ? ? ? 1_555 L DC 17 N4 ? ? K G  31 M DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog41  hydrog ? ? J G  33 N2 ? ? ? 1_555 L DC 15 O2 ? ? K G  33 M DC 30 1_555 ? ? ? ? ? ? 'G-DC PAIR'             ? ? 
hydrog42  hydrog ? ? J G  34 N1 ? ? ? 1_555 L DC 14 N3 ? ? K G  34 M DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog43  hydrog ? ? J G  34 N2 ? ? ? 1_555 L DC 14 O2 ? ? K G  34 M DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog44  hydrog ? ? J G  34 O6 ? ? ? 1_555 L DC 14 N4 ? ? K G  34 M DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog45  hydrog ? ? J G  35 N1 ? ? ? 1_555 L DC 13 N3 ? ? K G  35 M DC 28 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog46  hydrog ? ? J G  35 N2 ? ? ? 1_555 L DC 13 O2 ? ? K G  35 M DC 28 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog47  hydrog ? ? J G  35 O6 ? ? ? 1_555 L DC 13 N4 ? ? K G  35 M DC 28 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog48  hydrog ? ? J C  36 N3 ? ? ? 1_555 L DG 12 N2 ? ? K C  36 M DG 27 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog49  hydrog ? ? J C  36 O2 ? ? ? 1_555 L DG 12 N1 ? ? K C  36 M DG 27 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog50  hydrog ? ? J U  37 N3 ? ? ? 1_555 L DA 11 N1 ? ? K U  37 M DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog51  hydrog ? ? J U  37 O4 ? ? ? 1_555 L DA 11 N6 ? ? K U  37 M DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog52  hydrog ? ? J U  39 N3 ? ? ? 1_555 L DA 9  N1 ? ? K U  39 M DA 24 1_555 ? ? ? ? ? ? 'U-DA PAIR'             ? ? 
hydrog53  hydrog ? ? J C  40 N4 ? ? ? 1_555 L DG 8  O6 ? ? K C  40 M DG 23 1_555 ? ? ? ? ? ? 'C-DG PAIR'             ? ? 
hydrog54  hydrog ? ? J C  46 N3 ? ? ? 1_555 J G  61 N1 ? ? K C  46 K G  61 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog55  hydrog ? ? J C  46 N4 ? ? ? 1_555 J G  61 O6 ? ? K C  46 K G  61 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog56  hydrog ? ? J C  46 O2 ? ? ? 1_555 J G  61 N2 ? ? K C  46 K G  61 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog57  hydrog ? ? J C  47 N3 ? ? ? 1_555 J G  60 N1 ? ? K C  47 K G  60 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog58  hydrog ? ? J C  47 N4 ? ? ? 1_555 J G  60 O6 ? ? K C  47 K G  60 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog59  hydrog ? ? J C  47 O2 ? ? ? 1_555 J G  60 N2 ? ? K C  47 K G  60 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog60  hydrog ? ? J C  48 N3 ? ? ? 1_555 J G  59 N1 ? ? K C  48 K G  59 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog61  hydrog ? ? J C  48 N4 ? ? ? 1_555 J G  59 O6 ? ? K C  48 K G  59 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog62  hydrog ? ? J C  48 O2 ? ? ? 1_555 J G  59 N2 ? ? K C  48 K G  59 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog63  hydrog ? ? J C  49 N3 ? ? ? 1_555 J G  58 N1 ? ? K C  49 K G  58 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog64  hydrog ? ? J C  49 N4 ? ? ? 1_555 J G  58 O6 ? ? K C  49 K G  58 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog65  hydrog ? ? J C  49 O2 ? ? ? 1_555 J G  58 N2 ? ? K C  49 K G  58 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog66  hydrog ? ? J A  50 N1 ? ? ? 1_555 J U  57 N3 ? ? K A  50 K U  57 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog67  hydrog ? ? J A  50 N6 ? ? ? 1_555 J U  57 O4 ? ? K A  50 K U  57 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog68  hydrog ? ? J C  51 N3 ? ? ? 1_555 J G  56 N1 ? ? K C  51 K G  56 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog69  hydrog ? ? J C  51 N4 ? ? ? 1_555 J G  56 O6 ? ? K C  51 K G  56 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog70  hydrog ? ? J C  51 O2 ? ? ? 1_555 J G  56 N2 ? ? K C  51 K G  56 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog71  hydrog ? ? L DG 1  N1 ? ? ? 1_555 N DC 39 N3 ? ? M DG 16 O DC 50 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog72  hydrog ? ? L DG 1  N2 ? ? ? 1_555 N DC 39 O2 ? ? M DG 16 O DC 50 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog73  hydrog ? ? L DG 1  O6 ? ? ? 1_555 N DC 39 N4 ? ? M DG 16 O DC 50 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog74  hydrog ? ? L DC 2  N3 ? ? ? 1_555 N DG 38 N1 ? ? M DC 17 O DG 49 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog75  hydrog ? ? L DC 2  N4 ? ? ? 1_555 N DG 38 O6 ? ? M DC 17 O DG 49 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog76  hydrog ? ? L DC 2  O2 ? ? ? 1_555 N DG 38 N2 ? ? M DC 17 O DG 49 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog77  hydrog ? ? L DC 3  N3 ? ? ? 1_555 N DG 37 N1 ? ? M DC 18 O DG 48 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog78  hydrog ? ? L DC 3  N4 ? ? ? 1_555 N DG 37 O6 ? ? M DC 18 O DG 48 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog79  hydrog ? ? L DC 3  O2 ? ? ? 1_555 N DG 37 N2 ? ? M DC 18 O DG 48 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog80  hydrog ? ? L DT 4  N3 ? ? ? 1_555 N DA 36 N1 ? ? M DT 19 O DA 47 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog81  hydrog ? ? L DT 4  O4 ? ? ? 1_555 N DA 36 N6 ? ? M DT 19 O DA 47 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog82  hydrog ? ? L DG 5  N1 ? ? ? 1_555 N DC 35 N3 ? ? M DG 20 O DC 46 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog83  hydrog ? ? L DG 5  N2 ? ? ? 1_555 N DC 35 O2 ? ? M DG 20 O DC 46 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog84  hydrog ? ? L DG 5  O6 ? ? ? 1_555 N DC 35 N4 ? ? M DG 20 O DC 46 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog85  hydrog ? ? L DG 6  N1 ? ? ? 1_555 N DC 34 N3 ? ? M DG 21 O DC 45 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog86  hydrog ? ? L DG 6  N2 ? ? ? 1_555 N DC 34 O2 ? ? M DG 21 O DC 45 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog87  hydrog ? ? L DG 6  O6 ? ? ? 1_555 N DC 34 N4 ? ? M DG 21 O DC 45 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog88  hydrog ? ? L DC 7  N3 ? ? ? 1_555 N DG 33 N1 ? ? M DC 22 O DG 44 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog89  hydrog ? ? L DC 7  N4 ? ? ? 1_555 N DG 33 O6 ? ? M DC 22 O DG 44 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog90  hydrog ? ? L DC 7  O2 ? ? ? 1_555 N DG 33 N2 ? ? M DC 22 O DG 44 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog91  hydrog ? ? L DC 40 N3 ? ? ? 1_555 N DG 11 N2 ? ? M DC 55 O DG 11 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog92  hydrog ? ? L DT 41 N3 ? ? ? 1_555 N DA 10 N1 ? ? M DT 56 O DA 10 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog93  hydrog ? ? L DT 41 O2 ? ? ? 1_555 N DG 11 N2 ? ? M DT 56 O DG 11 1_555 ? ? ? ? ? ? 'DT-DG MISPAIR'         ? ? 
hydrog94  hydrog ? ? L DT 42 N3 ? ? ? 1_555 N DA 9  N1 ? ? M DT 57 O DA 9  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog95  hydrog ? ? L DC 43 O2 ? ? ? 1_555 N DG 8  N2 ? ? M DC 58 O DG 8  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog96  hydrog ? ? L DG 44 N1 ? ? ? 1_555 N DC 7  O2 ? ? M DG 59 O DC 7  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog97  hydrog ? ? L DG 44 N2 ? ? ? 1_555 N DC 7  N3 ? ? M DG 59 O DC 7  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog98  hydrog ? ? L DT 45 N3 ? ? ? 1_555 N DA 6  N1 ? ? M DT 60 O DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog99  hydrog ? ? L DT 45 O4 ? ? ? 1_555 N DA 6  N6 ? ? M DT 60 O DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog100 hydrog ? ? L DC 46 N3 ? ? ? 1_555 N DG 5  N1 ? ? M DC 61 O DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog101 hydrog ? ? L DC 46 N4 ? ? ? 1_555 N DG 5  O6 ? ? M DC 61 O DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog102 hydrog ? ? L DC 46 O2 ? ? ? 1_555 N DG 5  N2 ? ? M DC 61 O DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog103 hydrog ? ? L DC 47 N3 ? ? ? 1_555 N DG 4  N2 ? ? M DC 62 O DG 4  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog104 hydrog ? ? L DC 47 O2 ? ? ? 1_555 N DG 4  N1 ? ? M DC 62 O DG 4  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog105 hydrog ? ? L DG 48 N1 ? ? ? 1_555 N DC 3  O2 ? ? M DG 63 O DC 3  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog106 hydrog ? ? L DG 48 N2 ? ? ? 1_555 N DC 3  N3 ? ? M DG 63 O DC 3  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog107 hydrog ? ? L DC 49 N3 ? ? ? 1_555 N DG 2  N1 ? ? M DC 64 O DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog108 hydrog ? ? L DC 49 N4 ? ? ? 1_555 N DG 2  O6 ? ? M DC 64 O DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog109 hydrog ? ? L DC 49 O2 ? ? ? 1_555 N DG 2  N2 ? ? M DC 64 O DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog110 hydrog ? ? L DG 50 N1 ? ? ? 1_555 N DC 1  N3 ? ? M DG 65 O DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog111 hydrog ? ? L DG 50 N2 ? ? ? 1_555 N DC 1  O2 ? ? M DG 65 O DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog112 hydrog ? ? L DG 50 O6 ? ? ? 1_555 N DC 1  N4 ? ? M DG 65 O DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          THR 
_struct_mon_prot_cis.label_seq_id           137 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           THR 
_struct_mon_prot_cis.auth_seq_id            137 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   TRP 
_struct_mon_prot_cis.pdbx_label_seq_id_2    138 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    TRP 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     138 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 3 ? 
AA6 ? 3 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 5 ? 
AB1 ? 6 ? 
AB2 ? 5 ? 
AB3 ? 7 ? 
AB4 ? 2 ? 
AB5 ? 2 ? 
AB6 ? 5 ? 
AB7 ? 7 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 5 ? 
AC2 ? 7 ? 
AC3 ? 2 ? 
AC4 ? 2 ? 
AC5 ? 5 ? 
AC6 ? 7 ? 
AC7 ? 2 ? 
AC8 ? 2 ? 
AC9 ? 5 ? 
AD1 ? 7 ? 
AD2 ? 2 ? 
AD3 ? 7 ? 
AD4 ? 3 ? 
AD5 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB1 5 6 ? parallel      
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB3 6 7 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB7 5 6 ? anti-parallel 
AB7 6 7 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC2 5 6 ? anti-parallel 
AC2 6 7 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? anti-parallel 
AC6 5 6 ? anti-parallel 
AC6 6 7 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? anti-parallel 
AD1 6 7 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
AD3 5 6 ? anti-parallel 
AD3 6 7 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? parallel      
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 52  ? GLU A 57  ? LEU A 52  GLU A 57  
AA1 2 TYR A 63  ? SER A 68  ? TYR A 63  SER A 68  
AA1 3 TRP A 3   ? ILE A 7   ? TRP A 3   ILE A 7   
AA1 4 MET A 86  ? ASN A 88  ? MET A 86  ASN A 88  
AA2 1 VAL A 102 ? ARG A 103 ? VAL A 102 ARG A 103 
AA2 2 ALA A 224 ? LEU A 225 ? ALA A 224 LEU A 225 
AA3 1 ILE A 106 ? ALA A 108 ? ILE A 106 ALA A 108 
AA3 2 VAL A 188 ? PHE A 190 ? VAL A 188 PHE A 190 
AA4 1 VAL A 171 ? ARG A 172 ? VAL A 171 ARG A 172 
AA4 2 LYS A 182 ? ILE A 183 ? LYS A 182 ILE A 183 
AA5 1 GLU B 40  ? LEU B 42  ? GLU C 40  LEU C 42  
AA5 2 LEU B 28  ? SER B 32  ? LEU C 28  SER C 32  
AA5 3 LEU B 54  ? GLU B 58  ? LEU C 54  GLU C 58  
AA6 1 LEU B 176 ? ASP B 177 ? LEU C 176 ASP C 177 
AA6 2 HIS B 290 ? TRP B 298 ? HIS C 290 TRP C 298 
AA6 3 HIS B 278 ? PRO B 284 ? HIS C 278 PRO C 284 
AA7 1 VAL B 219 ? LEU B 224 ? VAL C 219 LEU C 224 
AA7 2 ARG B 373 ? GLN B 381 ? ARG C 373 GLN C 381 
AA7 3 ASP B 387 ? THR B 394 ? ASP C 387 THR C 394 
AA8 1 TYR B 315 ? SER B 318 ? TYR C 315 SER C 318 
AA8 2 ARG B 322 ? PRO B 325 ? ARG C 322 PRO C 325 
AA9 1 THR C 27  ? TYR C 30  ? THR D 27  TYR D 30  
AA9 2 LYS C 33  ? VAL C 38  ? LYS D 33  VAL D 38  
AA9 3 ALA C 191 ? THR C 193 ? ALA D 191 THR D 193 
AA9 4 HIS C 220 ? ASN C 238 ? HIS D 220 ASN D 238 
AA9 5 GLU C 200 ? ALA C 206 ? GLU D 200 ALA D 206 
AB1 1 GLN C 187 ? PHE C 188 ? GLN D 187 PHE D 188 
AB1 2 HIS C 220 ? ASN C 238 ? HIS D 220 ASN D 238 
AB1 3 PHE C 3   ? SER C 15  ? PHE D 3   SER D 15  
AB1 4 LEU C 283 ? ARG C 289 ? LEU D 283 ARG D 289 
AB1 5 GLY C 336 ? THR C 339 ? GLY D 336 THR D 339 
AB1 6 GLU C 351 ? ARG C 352 ? GLU D 351 ARG D 352 
AB2 1 THR D 27  ? TYR D 30  ? THR E 27  TYR E 30  
AB2 2 LYS D 33  ? VAL D 38  ? LYS E 33  VAL E 38  
AB2 3 ALA D 191 ? THR D 193 ? ALA E 191 THR E 193 
AB2 4 GLY D 229 ? ASN D 238 ? GLY E 229 ASN E 238 
AB2 5 VAL D 186 ? PHE D 188 ? VAL E 186 PHE E 188 
AB3 1 THR D 27  ? TYR D 30  ? THR E 27  TYR E 30  
AB3 2 LYS D 33  ? VAL D 38  ? LYS E 33  VAL E 38  
AB3 3 ALA D 191 ? THR D 193 ? ALA E 191 THR E 193 
AB3 4 GLY D 229 ? ASN D 238 ? GLY E 229 ASN E 238 
AB3 5 PHE D 3   ? LEU D 12  ? PHE E 3   LEU E 12  
AB3 6 LEU D 283 ? ARG D 289 ? LEU E 283 ARG E 289 
AB3 7 TYR D 337 ? THR D 339 ? TYR E 337 THR E 339 
AB4 1 ALA D 59  ? THR D 62  ? ALA E 59  THR E 62  
AB4 2 PHE D 117 ? PRO D 120 ? PHE E 117 PRO E 120 
AB5 1 GLU D 200 ? VAL D 207 ? GLU E 200 VAL E 207 
AB5 2 SER D 218 ? PHE D 226 ? SER E 218 PHE E 226 
AB6 1 THR E 27  ? TYR E 30  ? THR F 27  TYR F 30  
AB6 2 LYS E 33  ? VAL E 38  ? LYS F 33  VAL F 38  
AB6 3 ALA E 191 ? THR E 193 ? ALA F 191 THR F 193 
AB6 4 GLY E 229 ? ASN E 238 ? GLY F 229 ASN F 238 
AB6 5 VAL E 186 ? PHE E 188 ? VAL F 186 PHE F 188 
AB7 1 THR E 27  ? TYR E 30  ? THR F 27  TYR F 30  
AB7 2 LYS E 33  ? VAL E 38  ? LYS F 33  VAL F 38  
AB7 3 ALA E 191 ? THR E 193 ? ALA F 191 THR F 193 
AB7 4 GLY E 229 ? ASN E 238 ? GLY F 229 ASN F 238 
AB7 5 PHE E 3   ? LEU E 12  ? PHE F 3   LEU F 12  
AB7 6 LEU E 283 ? ARG E 289 ? LEU F 283 ARG F 289 
AB7 7 TYR E 337 ? THR E 339 ? TYR F 337 THR F 339 
AB8 1 ALA E 59  ? THR E 62  ? ALA F 59  THR F 62  
AB8 2 PHE E 117 ? PRO E 120 ? PHE F 117 PRO F 120 
AB9 1 GLU E 200 ? ALA E 206 ? GLU F 200 ALA F 206 
AB9 2 HIS E 220 ? PHE E 226 ? HIS F 220 PHE F 226 
AC1 1 THR F 27  ? TYR F 30  ? THR G 27  TYR G 30  
AC1 2 LYS F 33  ? VAL F 38  ? LYS G 33  VAL G 38  
AC1 3 ALA F 191 ? THR F 193 ? ALA G 191 THR G 193 
AC1 4 GLY F 229 ? ASN F 238 ? GLY G 229 ASN G 238 
AC1 5 VAL F 186 ? PHE F 188 ? VAL G 186 PHE G 188 
AC2 1 THR F 27  ? TYR F 30  ? THR G 27  TYR G 30  
AC2 2 LYS F 33  ? VAL F 38  ? LYS G 33  VAL G 38  
AC2 3 ALA F 191 ? THR F 193 ? ALA G 191 THR G 193 
AC2 4 GLY F 229 ? ASN F 238 ? GLY G 229 ASN G 238 
AC2 5 PHE F 3   ? LEU F 12  ? PHE G 3   LEU G 12  
AC2 6 LEU F 283 ? ARG F 289 ? LEU G 283 ARG G 289 
AC2 7 TYR F 337 ? THR F 339 ? TYR G 337 THR G 339 
AC3 1 ALA F 59  ? THR F 62  ? ALA G 59  THR G 62  
AC3 2 PHE F 117 ? PRO F 120 ? PHE G 117 PRO G 120 
AC4 1 GLU F 200 ? THR F 205 ? GLU G 200 THR G 205 
AC4 2 MET F 221 ? PHE F 226 ? MET G 221 PHE G 226 
AC5 1 THR G 27  ? TYR G 30  ? THR H 27  TYR H 30  
AC5 2 LYS G 33  ? VAL G 38  ? LYS H 33  VAL H 38  
AC5 3 ALA G 191 ? THR G 193 ? ALA H 191 THR H 193 
AC5 4 GLY G 229 ? ASN G 238 ? GLY H 229 ASN H 238 
AC5 5 VAL G 186 ? PHE G 188 ? VAL H 186 PHE H 188 
AC6 1 THR G 27  ? TYR G 30  ? THR H 27  TYR H 30  
AC6 2 LYS G 33  ? VAL G 38  ? LYS H 33  VAL H 38  
AC6 3 ALA G 191 ? THR G 193 ? ALA H 191 THR H 193 
AC6 4 GLY G 229 ? ASN G 238 ? GLY H 229 ASN H 238 
AC6 5 PHE G 3   ? LEU G 12  ? PHE H 3   LEU H 12  
AC6 6 LEU G 283 ? ARG G 289 ? LEU H 283 ARG H 289 
AC6 7 TYR G 337 ? THR G 339 ? TYR H 337 THR H 339 
AC7 1 ALA G 59  ? THR G 62  ? ALA H 59  THR H 62  
AC7 2 PHE G 117 ? PRO G 120 ? PHE H 117 PRO H 120 
AC8 1 GLU G 200 ? VAL G 207 ? GLU H 200 VAL H 207 
AC8 2 SER G 218 ? PHE G 226 ? SER H 218 PHE H 226 
AC9 1 THR H 27  ? TYR H 30  ? THR I 27  TYR I 30  
AC9 2 LYS H 33  ? VAL H 38  ? LYS I 33  VAL I 38  
AC9 3 ALA H 191 ? THR H 193 ? ALA I 191 THR I 193 
AC9 4 GLY H 229 ? ASN H 238 ? GLY I 229 ASN I 238 
AC9 5 VAL H 186 ? PHE H 188 ? VAL I 186 PHE I 188 
AD1 1 THR H 27  ? TYR H 30  ? THR I 27  TYR I 30  
AD1 2 LYS H 33  ? VAL H 38  ? LYS I 33  VAL I 38  
AD1 3 ALA H 191 ? THR H 193 ? ALA I 191 THR I 193 
AD1 4 GLY H 229 ? ASN H 238 ? GLY I 229 ASN I 238 
AD1 5 PHE H 3   ? LEU H 12  ? PHE I 3   LEU I 12  
AD1 6 LEU H 283 ? ARG H 289 ? LEU I 283 ARG I 289 
AD1 7 TYR H 337 ? THR H 339 ? TYR I 337 THR I 339 
AD2 1 ALA H 59  ? THR H 62  ? ALA I 59  THR I 62  
AD2 2 PHE H 117 ? PRO H 120 ? PHE I 117 PRO I 120 
AD3 1 VAL M 150 ? ARG M 152 ? VAL N 150 ARG N 152 
AD3 2 PHE M 4   ? LEU M 8   ? PHE N 4   LEU N 8   
AD3 3 VAL M 112 ? THR M 118 ? VAL N 112 THR N 118 
AD3 4 LYS M 58  ? ARG M 65  ? LYS N 58  ARG N 65  
AD3 5 VAL M 180 ? TYR M 186 ? VAL N 180 TYR N 186 
AD3 6 ARG M 213 ? VAL M 226 ? ARG N 213 VAL N 226 
AD3 7 THR M 198 ? SER M 206 ? THR N 198 SER N 206 
AD4 1 MET M 12  ? GLN M 13  ? MET N 12  GLN N 13  
AD4 2 ILE M 101 ? ALA M 109 ? ILE N 101 ALA N 109 
AD4 3 GLU M 23  ? ARG M 24  ? GLU N 23  ARG N 24  
AD5 1 MET M 12  ? GLN M 13  ? MET N 12  GLN N 13  
AD5 2 ILE M 101 ? ALA M 109 ? ILE N 101 ALA N 109 
AD5 3 VAL M 68  ? ILE M 76  ? VAL N 68  ILE N 76  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 52  ? N LEU A 52  O GLN A 67  ? O GLN A 67  
AA1 2 3 O LEU A 64  ? O LEU A 64  N ILE A 7   ? N ILE A 7   
AA1 3 4 N LEU A 4   ? N LEU A 4   O ARG A 87  ? O ARG A 87  
AA2 1 2 N ARG A 103 ? N ARG A 103 O ALA A 224 ? O ALA A 224 
AA3 1 2 N ILE A 106 ? N ILE A 106 O PHE A 190 ? O PHE A 190 
AA4 1 2 N VAL A 171 ? N VAL A 171 O ILE A 183 ? O ILE A 183 
AA5 1 2 O LEU B 42  ? O LEU C 42  N LEU B 28  ? N LEU C 28  
AA5 2 3 N ARG B 31  ? N ARG C 31  O ASP B 56  ? O ASP C 56  
AA6 1 2 N LEU B 176 ? N LEU C 176 O VAL B 291 ? O VAL C 291 
AA6 2 3 O TRP B 295 ? O TRP C 295 N LEU B 281 ? N LEU C 281 
AA7 1 2 N SER B 220 ? N SER C 220 O PHE B 377 ? O PHE C 377 
AA7 2 3 N GLY B 378 ? N GLY C 378 O PHE B 391 ? O PHE C 391 
AA8 1 2 N GLN B 316 ? N GLN C 316 O TYR B 324 ? O TYR C 324 
AA9 1 2 N VAL C 28  ? N VAL D 28  O ARG C 35  ? O ARG D 35  
AA9 2 3 N VAL C 38  ? N VAL D 38  O ALA C 191 ? O ALA D 191 
AA9 3 4 N PHE C 192 ? N PHE D 192 O TYR C 232 ? O TYR D 232 
AA9 4 5 O PHE C 226 ? O PHE D 226 N GLU C 200 ? N GLU D 200 
AB1 1 2 N GLN C 187 ? N GLN D 187 O ASN C 236 ? O ASN D 236 
AB1 2 3 O GLY C 229 ? O GLY D 229 N LEU C 12  ? N LEU D 12  
AB1 3 4 N PHE C 3   ? N PHE D 3   O ARG C 289 ? O ARG D 289 
AB1 4 5 N VAL C 284 ? N VAL D 284 O ALA C 338 ? O ALA D 338 
AB1 5 6 N TYR C 337 ? N TYR D 337 O GLU C 351 ? O GLU D 351 
AB2 1 2 N VAL D 28  ? N VAL E 28  O ARG D 35  ? O ARG E 35  
AB2 2 3 N VAL D 38  ? N VAL E 38  O ALA D 191 ? O ALA E 191 
AB2 3 4 N PHE D 192 ? N PHE E 192 O TYR D 232 ? O TYR E 232 
AB2 4 5 O ASN D 236 ? O ASN E 236 N GLN D 187 ? N GLN E 187 
AB3 1 2 N VAL D 28  ? N VAL E 28  O ARG D 35  ? O ARG E 35  
AB3 2 3 N VAL D 38  ? N VAL E 38  O ALA D 191 ? O ALA E 191 
AB3 3 4 N PHE D 192 ? N PHE E 192 O TYR D 232 ? O TYR E 232 
AB3 4 5 O GLY D 229 ? O GLY E 229 N LEU D 12  ? N LEU E 12  
AB3 5 6 N ASP D 5   ? N ASP E 5   O ALA D 287 ? O ALA E 287 
AB3 6 7 N VAL D 284 ? N VAL E 284 O ALA D 338 ? O ALA E 338 
AB4 1 2 N VAL D 60  ? N VAL E 60  O LEU D 119 ? O LEU E 119 
AB5 1 2 N PHE D 204 ? N PHE E 204 O ASN D 222 ? O ASN E 222 
AB6 1 2 N VAL E 28  ? N VAL F 28  O ARG E 35  ? O ARG F 35  
AB6 2 3 N VAL E 38  ? N VAL F 38  O ALA E 191 ? O ALA F 191 
AB6 3 4 N PHE E 192 ? N PHE F 192 O TYR E 232 ? O TYR F 232 
AB6 4 5 O ASN E 236 ? O ASN F 236 N GLN E 187 ? N GLN F 187 
AB7 1 2 N VAL E 28  ? N VAL F 28  O ARG E 35  ? O ARG F 35  
AB7 2 3 N VAL E 38  ? N VAL F 38  O ALA E 191 ? O ALA F 191 
AB7 3 4 N PHE E 192 ? N PHE F 192 O TYR E 232 ? O TYR F 232 
AB7 4 5 O GLY E 229 ? O GLY F 229 N LEU E 12  ? N LEU F 12  
AB7 5 6 N ASP E 5   ? N ASP F 5   O ALA E 287 ? O ALA F 287 
AB7 6 7 N VAL E 284 ? N VAL F 284 O ALA E 338 ? O ALA F 338 
AB8 1 2 N VAL E 60  ? N VAL F 60  O LEU E 119 ? O LEU F 119 
AB9 1 2 N ASP E 202 ? N ASP F 202 O GLY E 224 ? O GLY F 224 
AC1 1 2 N VAL F 28  ? N VAL G 28  O ARG F 35  ? O ARG G 35  
AC1 2 3 N VAL F 38  ? N VAL G 38  O ALA F 191 ? O ALA G 191 
AC1 3 4 N PHE F 192 ? N PHE G 192 O TYR F 232 ? O TYR G 232 
AC1 4 5 O ASN F 236 ? O ASN G 236 N GLN F 187 ? N GLN G 187 
AC2 1 2 N VAL F 28  ? N VAL G 28  O ARG F 35  ? O ARG G 35  
AC2 2 3 N VAL F 38  ? N VAL G 38  O ALA F 191 ? O ALA G 191 
AC2 3 4 N PHE F 192 ? N PHE G 192 O TYR F 232 ? O TYR G 232 
AC2 4 5 O GLY F 229 ? O GLY G 229 N LEU F 12  ? N LEU G 12  
AC2 5 6 N ASP F 5   ? N ASP G 5   O ALA F 287 ? O ALA G 287 
AC2 6 7 N VAL F 284 ? N VAL G 284 O ALA F 338 ? O ALA G 338 
AC3 1 2 N VAL F 60  ? N VAL G 60  O LEU F 119 ? O LEU G 119 
AC4 1 2 N PHE F 204 ? N PHE G 204 O ASN F 222 ? O ASN G 222 
AC5 1 2 N VAL G 28  ? N VAL H 28  O ARG G 35  ? O ARG H 35  
AC5 2 3 N VAL G 38  ? N VAL H 38  O ALA G 191 ? O ALA H 191 
AC5 3 4 N PHE G 192 ? N PHE H 192 O TYR G 232 ? O TYR H 232 
AC5 4 5 O ASN G 236 ? O ASN H 236 N GLN G 187 ? N GLN H 187 
AC6 1 2 N VAL G 28  ? N VAL H 28  O ARG G 35  ? O ARG H 35  
AC6 2 3 N VAL G 38  ? N VAL H 38  O ALA G 191 ? O ALA H 191 
AC6 3 4 N PHE G 192 ? N PHE H 192 O TYR G 232 ? O TYR H 232 
AC6 4 5 O GLY G 229 ? O GLY H 229 N LEU G 12  ? N LEU H 12  
AC6 5 6 N ASP G 5   ? N ASP H 5   O ALA G 287 ? O ALA H 287 
AC6 6 7 N VAL G 284 ? N VAL H 284 O ALA G 338 ? O ALA H 338 
AC7 1 2 N VAL G 60  ? N VAL H 60  O LEU G 119 ? O LEU H 119 
AC8 1 2 N GLU G 200 ? N GLU H 200 O PHE G 226 ? O PHE H 226 
AC9 1 2 N VAL H 28  ? N VAL I 28  O ARG H 35  ? O ARG I 35  
AC9 2 3 N VAL H 38  ? N VAL I 38  O ALA H 191 ? O ALA I 191 
AC9 3 4 N PHE H 192 ? N PHE I 192 O TYR H 232 ? O TYR I 232 
AC9 4 5 O ASN H 236 ? O ASN I 236 N GLN H 187 ? N GLN I 187 
AD1 1 2 N VAL H 28  ? N VAL I 28  O ARG H 35  ? O ARG I 35  
AD1 2 3 N VAL H 38  ? N VAL I 38  O ALA H 191 ? O ALA I 191 
AD1 3 4 N PHE H 192 ? N PHE I 192 O TYR H 232 ? O TYR I 232 
AD1 4 5 O ARG H 233 ? O ARG I 233 N ALA H 8   ? N ALA I 8   
AD1 5 6 N ASP H 5   ? N ASP I 5   O ALA H 287 ? O ALA I 287 
AD1 6 7 N VAL H 284 ? N VAL I 284 O ALA H 338 ? O ALA I 338 
AD2 1 2 N VAL H 60  ? N VAL I 60  O LEU H 119 ? O LEU I 119 
AD3 1 2 O ARG M 152 ? O ARG N 152 N LEU M 5   ? N LEU N 5   
AD3 2 3 N LEU M 6   ? N LEU N 6   O VAL M 115 ? O VAL N 115 
AD3 3 4 O ALA M 116 ? O ALA N 116 N THR M 60  ? N THR N 60  
AD3 4 5 N VAL M 63  ? N VAL N 63  O ASP M 183 ? O ASP N 183 
AD3 5 6 N TYR M 186 ? N TYR N 186 O ARG M 220 ? O ARG N 220 
AD3 6 7 O ILE M 219 ? O ILE N 219 N THR M 198 ? N THR N 198 
AD4 1 2 N GLN M 13  ? N GLN N 13  O LEU M 108 ? O LEU N 108 
AD4 2 3 O SER M 104 ? O SER N 104 N ARG M 24  ? N ARG N 24  
AD5 1 2 N GLN M 13  ? N GLN N 13  O LEU M 108 ? O LEU N 108 
AD5 2 3 O ALA M 109 ? O ALA N 109 N VAL M 68  ? N VAL N 68  
# 
_atom_sites.entry_id                    5U0A 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . THR A 1 2   ? -121.041 150.705 213.874 1.00 36.80  ? 2   THR A N     1 
ATOM 2     C CA    . THR A 1 2   ? -121.946 151.288 212.886 1.00 36.80  ? 2   THR A CA    1 
ATOM 3     C C     . THR A 1 2   ? -122.365 150.220 211.883 1.00 36.80  ? 2   THR A C     1 
ATOM 4     O O     . THR A 1 2   ? -121.918 149.088 211.985 1.00 36.80  ? 2   THR A O     1 
ATOM 5     C CB    . THR A 1 2   ? -121.311 152.466 212.139 1.00 36.80  ? 2   THR A CB    1 
ATOM 6     O OG1   . THR A 1 2   ? -122.337 153.178 211.443 1.00 36.80  ? 2   THR A OG1   1 
ATOM 7     C CG2   . THR A 1 2   ? -120.268 151.961 211.142 1.00 36.80  ? 2   THR A CG2   1 
ATOM 8     N N     . TRP A 1 3   ? -123.228 150.566 210.927 1.00 36.59  ? 3   TRP A N     1 
ATOM 9     C CA    . TRP A 1 3   ? -123.547 149.626 209.861 1.00 36.59  ? 3   TRP A CA    1 
ATOM 10    C C     . TRP A 1 3   ? -124.030 150.380 208.617 1.00 36.59  ? 3   TRP A C     1 
ATOM 11    O O     . TRP A 1 3   ? -124.764 151.363 208.724 1.00 36.59  ? 3   TRP A O     1 
ATOM 12    C CB    . TRP A 1 3   ? -124.573 148.602 210.352 1.00 36.59  ? 3   TRP A CB    1 
ATOM 13    C CG    . TRP A 1 3   ? -125.891 149.148 210.615 1.00 36.59  ? 3   TRP A CG    1 
ATOM 14    C CD1   . TRP A 1 3   ? -126.375 149.595 211.804 1.00 36.59  ? 3   TRP A CD1   1 
ATOM 15    C CD2   . TRP A 1 3   ? -126.953 149.266 209.673 1.00 36.59  ? 3   TRP A CD2   1 
ATOM 16    N NE1   . TRP A 1 3   ? -127.673 150.018 211.652 1.00 36.59  ? 3   TRP A NE1   1 
ATOM 17    C CE2   . TRP A 1 3   ? -128.050 149.814 210.351 1.00 36.59  ? 3   TRP A CE2   1 
ATOM 18    C CE3   . TRP A 1 3   ? -127.079 148.967 208.316 1.00 36.59  ? 3   TRP A CE3   1 
ATOM 19    C CZ2   . TRP A 1 3   ? -129.250 150.082 209.710 1.00 36.59  ? 3   TRP A CZ2   1 
ATOM 20    C CZ3   . TRP A 1 3   ? -128.274 149.225 207.691 1.00 36.59  ? 3   TRP A CZ3   1 
ATOM 21    C CH2   . TRP A 1 3   ? -129.344 149.774 208.387 1.00 36.59  ? 3   TRP A CH2   1 
ATOM 22    N N     . LEU A 1 4   ? -123.634 149.881 207.445 1.00 37.98  ? 4   LEU A N     1 
ATOM 23    C CA    . LEU A 1 4   ? -123.803 150.546 206.154 1.00 37.98  ? 4   LEU A CA    1 
ATOM 24    C C     . LEU A 1 4   ? -124.833 149.849 205.267 1.00 37.98  ? 4   LEU A C     1 
ATOM 25    O O     . LEU A 1 4   ? -124.904 148.615 205.235 1.00 37.98  ? 4   LEU A O     1 
ATOM 26    C CB    . LEU A 1 4   ? -122.465 150.584 205.401 1.00 37.98  ? 4   LEU A CB    1 
ATOM 27    C CG    . LEU A 1 4   ? -122.292 151.504 204.184 1.00 37.98  ? 4   LEU A CG    1 
ATOM 28    C CD1   . LEU A 1 4   ? -122.251 152.964 204.602 1.00 37.98  ? 4   LEU A CD1   1 
ATOM 29    C CD2   . LEU A 1 4   ? -121.074 151.158 203.355 1.00 37.98  ? 4   LEU A CD2   1 
ATOM 30    N N     . THR A 1 5   ? -125.641 150.652 204.555 1.00 35.54  ? 5   THR A N     1 
ATOM 31    C CA    . THR A 1 5   ? -126.635 150.141 203.616 1.00 35.54  ? 5   THR A CA    1 
ATOM 32    C C     . THR A 1 5   ? -126.699 151.031 202.377 1.00 35.54  ? 5   THR A C     1 
ATOM 33    O O     . THR A 1 5   ? -126.430 152.233 202.443 1.00 35.54  ? 5   THR A O     1 
ATOM 34    C CB    . THR A 1 5   ? -128.034 150.055 204.245 1.00 35.54  ? 5   THR A CB    1 
ATOM 35    O OG1   . THR A 1 5   ? -128.950 149.498 203.296 1.00 35.54  ? 5   THR A OG1   1 
ATOM 36    C CG2   . THR A 1 5   ? -128.521 151.429 204.659 1.00 35.54  ? 5   THR A CG2   1 
ATOM 37    N N     . LYS A 1 6   ? -127.078 150.427 201.243 1.00 33.96  ? 6   LYS A N     1 
ATOM 38    C CA    . LYS A 1 6   ? -127.392 151.141 200.003 1.00 33.96  ? 6   LYS A CA    1 
ATOM 39    C C     . LYS A 1 6   ? -128.902 151.112 199.814 1.00 33.96  ? 6   LYS A C     1 
ATOM 40    O O     . LYS A 1 6   ? -129.484 150.042 199.616 1.00 33.96  ? 6   LYS A O     1 
ATOM 41    C CB    . LYS A 1 6   ? -126.646 150.543 198.811 1.00 33.96  ? 6   LYS A CB    1 
ATOM 42    C CG    . LYS A 1 6   ? -125.164 150.914 198.812 1.00 33.96  ? 6   LYS A CG    1 
ATOM 43    C CD    . LYS A 1 6   ? -124.375 150.290 197.674 1.00 33.96  ? 6   LYS A CD    1 
ATOM 44    C CE    . LYS A 1 6   ? -122.880 150.496 197.878 1.00 33.96  ? 6   LYS A CE    1 
ATOM 45    N NZ    . LYS A 1 6   ? -122.380 149.821 199.097 1.00 33.96  ? 6   LYS A NZ    1 
ATOM 46    N N     . ILE A 1 7   ? -129.541 152.285 199.862 1.00 33.31  ? 7   ILE A N     1 
ATOM 47    C CA    . ILE A 1 7   ? -130.994 152.340 199.824 1.00 33.31  ? 7   ILE A CA    1 
ATOM 48    C C     . ILE A 1 7   ? -131.488 153.329 198.778 1.00 33.31  ? 7   ILE A C     1 
ATOM 49    O O     . ILE A 1 7   ? -130.751 154.199 198.300 1.00 33.31  ? 7   ILE A O     1 
ATOM 50    C CB    . ILE A 1 7   ? -131.594 152.788 201.165 1.00 33.31  ? 7   ILE A CB    1 
ATOM 51    C CG1   . ILE A 1 7   ? -131.279 154.271 201.374 1.00 33.31  ? 7   ILE A CG1   1 
ATOM 52    C CG2   . ILE A 1 7   ? -131.032 151.966 202.296 1.00 33.31  ? 7   ILE A CG2   1 
ATOM 53    C CD1   . ILE A 1 7   ? -132.058 154.904 202.493 1.00 33.31  ? 7   ILE A CD1   1 
ATOM 54    N N     . VAL A 1 8   ? -132.762 153.260 198.407 1.00 30.32  ? 8   VAL A N     1 
ATOM 55    C CA    . VAL A 1 8   ? -133.228 154.213 197.396 1.00 30.32  ? 8   VAL A CA    1 
ATOM 56    C C     . VAL A 1 8   ? -134.700 154.625 197.402 1.00 30.32  ? 8   VAL A C     1 
ATOM 57    O O     . VAL A 1 8   ? -135.545 153.914 196.861 1.00 30.32  ? 8   VAL A O     1 
ATOM 58    C CB    . VAL A 1 8   ? -132.882 153.719 195.980 1.00 30.32  ? 8   VAL A CB    1 
ATOM 59    N N     . PRO A 1 9   ? -134.992 155.783 197.994 1.00 28.73  ? 9   PRO A N     1 
ATOM 60    C CA    . PRO A 1 9   ? -136.353 156.324 198.027 1.00 28.73  ? 9   PRO A CA    1 
ATOM 61    C C     . PRO A 1 9   ? -136.956 156.534 196.646 1.00 28.73  ? 9   PRO A C     1 
ATOM 62    O O     . PRO A 1 9   ? -136.266 156.916 195.692 1.00 28.73  ? 9   PRO A O     1 
ATOM 63    C CB    . PRO A 1 9   ? -136.166 157.679 198.723 1.00 28.73  ? 9   PRO A CB    1 
ATOM 64    C CG    . PRO A 1 9   ? -134.762 158.061 198.317 1.00 28.73  ? 9   PRO A CG    1 
ATOM 65    C CD    . PRO A 1 9   ? -134.017 156.775 198.479 1.00 28.73  ? 9   PRO A CD    1 
ATOM 66    N N     . ASP A 1 10  ? -138.274 156.339 196.570 1.00 24.42  ? 10  ASP A N     1 
ATOM 67    C CA    . ASP A 1 10  ? -138.980 156.649 195.336 1.00 24.42  ? 10  ASP A CA    1 
ATOM 68    C C     . ASP A 1 10  ? -140.049 157.672 195.701 1.00 24.42  ? 10  ASP A C     1 
ATOM 69    O O     . ASP A 1 10  ? -139.879 158.432 196.655 1.00 24.42  ? 10  ASP A O     1 
ATOM 70    C CB    . ASP A 1 10  ? -139.634 155.408 194.708 1.00 24.42  ? 10  ASP A CB    1 
ATOM 71    C CG    . ASP A 1 10  ? -138.672 154.273 194.504 1.00 24.42  ? 10  ASP A CG    1 
ATOM 72    O OD1   . ASP A 1 10  ? -137.492 154.556 194.251 1.00 24.42  ? 10  ASP A OD1   1 
ATOM 73    O OD2   . ASP A 1 10  ? -139.086 153.102 194.603 1.00 24.42  ? 10  ASP A OD2   1 
ATOM 74    N N     . LEU A 1 11  ? -141.136 157.699 194.940 1.00 23.76  ? 11  LEU A N     1 
ATOM 75    C CA    . LEU A 1 11  ? -142.256 158.627 195.090 1.00 23.76  ? 11  LEU A CA    1 
ATOM 76    C C     . LEU A 1 11  ? -143.549 157.837 195.206 1.00 23.76  ? 11  LEU A C     1 
ATOM 77    O O     . LEU A 1 11  ? -143.792 156.933 194.402 1.00 23.76  ? 11  LEU A O     1 
ATOM 78    C CB    . LEU A 1 11  ? -142.301 159.743 194.057 1.00 23.76  ? 11  LEU A CB    1 
ATOM 79    C CG    . LEU A 1 11  ? -141.043 160.618 194.245 1.00 23.76  ? 11  LEU A CG    1 
ATOM 80    C CD1   . LEU A 1 11  ? -139.831 160.278 193.377 1.00 23.76  ? 11  LEU A CD1   1 
ATOM 81    C CD2   . LEU A 1 11  ? -141.365 162.116 194.267 1.00 23.76  ? 11  LEU A CD2   1 
ATOM 82    N N     . PHE A 1 20  ? -139.558 162.324 197.365 1.00 27.49  ? 20  PHE A N     1 
ATOM 83    C CA    . PHE A 1 20  ? -138.240 162.922 197.203 1.00 27.49  ? 20  PHE A CA    1 
ATOM 84    C C     . PHE A 1 20  ? -138.274 164.378 196.750 1.00 27.49  ? 20  PHE A C     1 
ATOM 85    O O     . PHE A 1 20  ? -137.208 164.976 196.570 1.00 27.49  ? 20  PHE A O     1 
ATOM 86    C CB    . PHE A 1 20  ? -137.369 162.084 196.265 1.00 27.49  ? 20  PHE A CB    1 
ATOM 87    C CG    . PHE A 1 20  ? -135.976 162.625 196.122 1.00 27.49  ? 20  PHE A CG    1 
ATOM 88    C CD1   . PHE A 1 20  ? -135.115 162.656 197.206 1.00 27.49  ? 20  PHE A CD1   1 
ATOM 89    C CD2   . PHE A 1 20  ? -135.541 163.130 194.909 1.00 27.49  ? 20  PHE A CD2   1 
ATOM 90    C CE1   . PHE A 1 20  ? -133.846 163.179 197.070 1.00 27.49  ? 20  PHE A CE1   1 
ATOM 91    C CE2   . PHE A 1 20  ? -134.274 163.647 194.768 1.00 27.49  ? 20  PHE A CE2   1 
ATOM 92    C CZ    . PHE A 1 20  ? -133.426 163.672 195.845 1.00 27.49  ? 20  PHE A CZ    1 
ATOM 93    N N     . ARG A 1 21  ? -139.453 164.980 196.577 1.00 26.33  ? 21  ARG A N     1 
ATOM 94    C CA    . ARG A 1 21  ? -139.493 166.302 195.963 1.00 26.33  ? 21  ARG A CA    1 
ATOM 95    C C     . ARG A 1 21  ? -138.552 167.273 196.681 1.00 26.33  ? 21  ARG A C     1 
ATOM 96    O O     . ARG A 1 21  ? -137.944 168.136 196.034 1.00 26.33  ? 21  ARG A O     1 
ATOM 97    C CB    . ARG A 1 21  ? -140.929 166.824 195.914 1.00 26.33  ? 21  ARG A CB    1 
ATOM 98    C CG    . ARG A 1 21  ? -141.041 168.188 195.277 1.00 26.33  ? 21  ARG A CG    1 
ATOM 99    C CD    . ARG A 1 21  ? -140.476 168.195 193.871 1.00 26.33  ? 21  ARG A CD    1 
ATOM 100   N NE    . ARG A 1 21  ? -141.259 167.430 192.906 1.00 26.33  ? 21  ARG A NE    1 
ATOM 101   C CZ    . ARG A 1 21  ? -140.837 167.159 191.675 1.00 26.33  ? 21  ARG A CZ    1 
ATOM 102   N NH1   . ARG A 1 21  ? -139.646 167.588 191.281 1.00 26.33  ? 21  ARG A NH1   1 
ATOM 103   N NH2   . ARG A 1 21  ? -141.593 166.467 190.838 1.00 26.33  ? 21  ARG A NH2   1 
ATOM 104   N N     . THR A 1 22  ? -138.401 167.142 198.008 1.00 27.01  ? 22  THR A N     1 
ATOM 105   C CA    . THR A 1 22  ? -137.587 168.068 198.790 1.00 27.01  ? 22  THR A CA    1 
ATOM 106   C C     . THR A 1 22  ? -136.617 167.328 199.714 1.00 27.01  ? 22  THR A C     1 
ATOM 107   O O     . THR A 1 22  ? -136.675 166.107 199.882 1.00 27.01  ? 22  THR A O     1 
ATOM 108   C CB    . THR A 1 22  ? -138.459 168.995 199.636 1.00 27.01  ? 22  THR A CB    1 
ATOM 109   O OG1   . THR A 1 22  ? -137.623 169.943 200.306 1.00 27.01  ? 22  THR A OG1   1 
ATOM 110   C CG2   . THR A 1 22  ? -139.224 168.188 200.672 1.00 27.01  ? 22  THR A CG2   1 
ATOM 111   N N     . ALA A 1 23  ? -135.729 168.112 200.335 1.00 28.42  ? 23  ALA A N     1 
ATOM 112   C CA    . ALA A 1 23  ? -134.684 167.606 201.226 1.00 28.42  ? 23  ALA A CA    1 
ATOM 113   C C     . ALA A 1 23  ? -135.212 167.204 202.603 1.00 28.42  ? 23  ALA A C     1 
ATOM 114   O O     . ALA A 1 23  ? -134.790 166.184 203.169 1.00 28.42  ? 23  ALA A O     1 
ATOM 115   C CB    . ALA A 1 23  ? -133.571 168.643 201.364 1.00 28.42  ? 23  ALA A CB    1 
ATOM 116   N N     . GLY A 1 24  ? -136.139 167.985 203.159 1.00 27.50  ? 24  GLY A N     1 
ATOM 117   C CA    . GLY A 1 24  ? -136.716 167.616 204.440 1.00 27.50  ? 24  GLY A CA    1 
ATOM 118   C C     . GLY A 1 24  ? -137.473 166.309 204.372 1.00 27.50  ? 24  GLY A C     1 
ATOM 119   O O     . GLY A 1 24  ? -137.401 165.487 205.290 1.00 27.50  ? 24  GLY A O     1 
ATOM 120   N N     . ASN A 1 25  ? -138.217 166.095 203.290 1.00 28.01  ? 25  ASN A N     1 
ATOM 121   C CA    . ASN A 1 25  ? -138.887 164.811 203.159 1.00 28.01  ? 25  ASN A CA    1 
ATOM 122   C C     . ASN A 1 25  ? -137.863 163.688 202.993 1.00 28.01  ? 25  ASN A C     1 
ATOM 123   O O     . ASN A 1 25  ? -138.146 162.543 203.344 1.00 28.01  ? 25  ASN A O     1 
ATOM 124   C CB    . ASN A 1 25  ? -139.894 164.862 202.007 1.00 28.01  ? 25  ASN A CB    1 
ATOM 125   C CG    . ASN A 1 25  ? -140.951 163.764 202.094 1.00 28.01  ? 25  ASN A CG    1 
ATOM 126   O OD1   . ASN A 1 25  ? -140.760 162.748 202.760 1.00 28.01  ? 25  ASN A OD1   1 
ATOM 127   N ND2   . ASN A 1 25  ? -142.097 164.001 201.465 1.00 28.01  ? 25  ASN A ND2   1 
ATOM 128   N N     . LEU A 1 26  ? -136.674 163.985 202.453 1.00 27.94  ? 26  LEU A N     1 
ATOM 129   C CA    . LEU A 1 26  ? -135.581 163.012 202.495 1.00 27.94  ? 26  LEU A CA    1 
ATOM 130   C C     . LEU A 1 26  ? -135.240 162.632 203.938 1.00 27.94  ? 26  LEU A C     1 
ATOM 131   O O     . LEU A 1 26  ? -135.196 161.443 204.290 1.00 27.94  ? 26  LEU A O     1 
ATOM 132   C CB    . LEU A 1 26  ? -134.343 163.571 201.775 1.00 27.94  ? 26  LEU A CB    1 
ATOM 133   C CG    . LEU A 1 26  ? -133.111 162.732 201.372 1.00 27.94  ? 26  LEU A CG    1 
ATOM 134   C CD1   . LEU A 1 26  ? -132.231 163.539 200.446 1.00 27.94  ? 26  LEU A CD1   1 
ATOM 135   C CD2   . LEU A 1 26  ? -132.268 162.237 202.530 1.00 27.94  ? 26  LEU A CD2   1 
ATOM 136   N N     . HIS A 1 27  ? -134.990 163.644 204.787 1.00 31.50  ? 27  HIS A N     1 
ATOM 137   C CA    . HIS A 1 27  ? -134.769 163.407 206.218 1.00 31.50  ? 27  HIS A CA    1 
ATOM 138   C C     . HIS A 1 27  ? -135.848 162.521 206.822 1.00 31.50  ? 27  HIS A C     1 
ATOM 139   O O     . HIS A 1 27  ? -135.561 161.518 207.495 1.00 31.50  ? 27  HIS A O     1 
ATOM 140   C CB    . HIS A 1 27  ? -134.737 164.729 206.987 1.00 31.50  ? 27  HIS A CB    1 
ATOM 141   C CG    . HIS A 1 27  ? -134.368 164.568 208.432 1.00 31.50  ? 27  HIS A CG    1 
ATOM 142   N ND1   . HIS A 1 27  ? -135.163 163.897 209.339 1.00 31.50  ? 27  HIS A ND1   1 
ATOM 143   C CD2   . HIS A 1 27  ? -133.304 165.019 209.134 1.00 31.50  ? 27  HIS A CD2   1 
ATOM 144   C CE1   . HIS A 1 27  ? -134.587 163.915 210.528 1.00 31.50  ? 27  HIS A CE1   1 
ATOM 145   N NE2   . HIS A 1 27  ? -133.461 164.594 210.433 1.00 31.50  ? 27  HIS A NE2   1 
ATOM 146   N N     . ARG A 1 28  ? -137.104 162.888 206.582 1.00 29.20  ? 28  ARG A N     1 
ATOM 147   C CA    . ARG A 1 28  ? -138.219 162.193 207.208 1.00 29.20  ? 28  ARG A CA    1 
ATOM 148   C C     . ARG A 1 28  ? -138.287 160.758 206.706 1.00 29.20  ? 28  ARG A C     1 
ATOM 149   O O     . ARG A 1 28  ? -138.530 159.831 207.489 1.00 29.20  ? 28  ARG A O     1 
ATOM 150   C CB    . ARG A 1 28  ? -139.506 162.993 206.991 1.00 29.20  ? 28  ARG A CB    1 
ATOM 151   C CG    . ARG A 1 28  ? -140.774 162.338 207.490 1.00 29.20  ? 28  ARG A CG    1 
ATOM 152   C CD    . ARG A 1 28  ? -141.994 163.184 207.154 1.00 29.20  ? 28  ARG A CD    1 
ATOM 153   N NE    . ARG A 1 28  ? -142.307 163.212 205.731 1.00 29.20  ? 28  ARG A NE    1 
ATOM 154   C CZ    . ARG A 1 28  ? -143.062 162.309 205.111 1.00 29.20  ? 28  ARG A CZ    1 
ATOM 155   N NH1   . ARG A 1 28  ? -143.587 161.298 205.785 1.00 29.20  ? 28  ARG A NH1   1 
ATOM 156   N NH2   . ARG A 1 28  ? -143.297 162.423 203.809 1.00 29.20  ? 28  ARG A NH2   1 
ATOM 157   N N     . LYS A 1 29  ? -138.066 160.547 205.408 1.00 27.90  ? 29  LYS A N     1 
ATOM 158   C CA    . LYS A 1 29  ? -138.023 159.183 204.909 1.00 27.90  ? 29  LYS A CA    1 
ATOM 159   C C     . LYS A 1 29  ? -136.853 158.416 205.506 1.00 27.90  ? 29  LYS A C     1 
ATOM 160   O O     . LYS A 1 29  ? -136.844 157.184 205.432 1.00 27.90  ? 29  LYS A O     1 
ATOM 161   C CB    . LYS A 1 29  ? -137.880 159.139 203.387 1.00 27.90  ? 29  LYS A CB    1 
ATOM 162   C CG    . LYS A 1 29  ? -138.959 159.810 202.576 1.00 27.90  ? 29  LYS A CG    1 
ATOM 163   C CD    . LYS A 1 29  ? -140.272 159.093 202.682 1.00 27.90  ? 29  LYS A CD    1 
ATOM 164   C CE    . LYS A 1 29  ? -141.204 159.840 203.586 1.00 27.90  ? 29  LYS A CE    1 
ATOM 165   N NZ    . LYS A 1 29  ? -142.539 159.242 203.544 1.00 27.90  ? 29  LYS A NZ    1 
ATOM 166   N N     . LEU A 1 30  ? -135.842 159.103 206.058 1.00 34.65  ? 30  LEU A N     1 
ATOM 167   C CA    . LEU A 1 30  ? -134.781 158.330 206.692 1.00 34.65  ? 30  LEU A CA    1 
ATOM 168   C C     . LEU A 1 30  ? -135.142 157.975 208.128 1.00 34.65  ? 30  LEU A C     1 
ATOM 169   O O     . LEU A 1 30  ? -134.759 156.901 208.606 1.00 34.65  ? 30  LEU A O     1 
ATOM 170   C CB    . LEU A 1 30  ? -133.451 159.095 206.679 1.00 34.65  ? 30  LEU A CB    1 
ATOM 171   C CG    . LEU A 1 30  ? -132.232 158.331 207.227 1.00 34.65  ? 30  LEU A CG    1 
ATOM 172   C CD1   . LEU A 1 30  ? -131.852 157.169 206.320 1.00 34.65  ? 30  LEU A CD1   1 
ATOM 173   C CD2   . LEU A 1 30  ? -131.029 159.228 207.476 1.00 34.65  ? 30  LEU A CD2   1 
ATOM 174   N N     . ILE A 1 31  ? -135.883 158.844 208.827 1.00 33.28  ? 31  ILE A N     1 
ATOM 175   C CA    . ILE A 1 31  ? -136.290 158.518 210.198 1.00 33.28  ? 31  ILE A CA    1 
ATOM 176   C C     . ILE A 1 31  ? -137.545 157.646 210.327 1.00 33.28  ? 31  ILE A C     1 
ATOM 177   O O     . ILE A 1 31  ? -137.696 156.963 211.349 1.00 33.28  ? 31  ILE A O     1 
ATOM 178   C CB    . ILE A 1 31  ? -136.533 159.784 211.038 1.00 33.28  ? 31  ILE A CB    1 
ATOM 179   C CG1   . ILE A 1 31  ? -137.706 160.582 210.462 1.00 33.28  ? 31  ILE A CG1   1 
ATOM 180   C CG2   . ILE A 1 31  ? -135.268 160.618 211.132 1.00 33.28  ? 31  ILE A CG2   1 
ATOM 181   C CD1   . ILE A 1 31  ? -138.025 161.852 211.210 1.00 33.28  ? 31  ILE A CD1   1 
ATOM 182   N N     . ARG A 1 32  ? -138.458 157.635 209.346 1.00 29.51  ? 32  ARG A N     1 
ATOM 183   C CA    . ARG A 1 32  ? -139.678 156.856 209.553 1.00 29.51  ? 32  ARG A CA    1 
ATOM 184   C C     . ARG A 1 32  ? -139.465 155.361 209.431 1.00 29.51  ? 32  ARG A C     1 
ATOM 185   O O     . ARG A 1 32  ? -140.352 154.593 209.820 1.00 29.51  ? 32  ARG A O     1 
ATOM 186   C CB    . ARG A 1 32  ? -140.796 157.175 208.561 1.00 29.51  ? 32  ARG A CB    1 
ATOM 187   C CG    . ARG A 1 32  ? -140.539 156.818 207.112 1.00 29.51  ? 32  ARG A CG    1 
ATOM 188   C CD    . ARG A 1 32  ? -141.782 157.199 206.331 1.00 29.51  ? 32  ARG A CD    1 
ATOM 189   N NE    . ARG A 1 32  ? -141.660 157.030 204.893 1.00 29.51  ? 32  ARG A NE    1 
ATOM 190   C CZ    . ARG A 1 32  ? -141.855 155.878 204.264 1.00 29.51  ? 32  ARG A CZ    1 
ATOM 191   N NH1   . ARG A 1 32  ? -142.175 154.786 204.947 1.00 29.51  ? 32  ARG A NH1   1 
ATOM 192   N NH2   . ARG A 1 32  ? -141.720 155.807 202.948 1.00 29.51  ? 32  ARG A NH2   1 
ATOM 193   N N     . LEU A 1 33  ? -138.335 154.919 208.917 1.00 32.38  ? 33  LEU A N     1 
ATOM 194   C CA    . LEU A 1 33  ? -138.094 153.495 208.873 1.00 32.38  ? 33  LEU A CA    1 
ATOM 195   C C     . LEU A 1 33  ? -137.297 153.010 210.077 1.00 32.38  ? 33  LEU A C     1 
ATOM 196   O O     . LEU A 1 33  ? -136.896 151.850 210.141 1.00 32.38  ? 33  LEU A O     1 
ATOM 197   C CB    . LEU A 1 33  ? -137.455 153.154 207.535 1.00 32.38  ? 33  LEU A CB    1 
ATOM 198   C CG    . LEU A 1 33  ? -137.652 151.727 207.084 1.00 32.38  ? 33  LEU A CG    1 
ATOM 199   C CD1   . LEU A 1 33  ? -136.524 150.947 207.619 1.00 32.38  ? 33  LEU A CD1   1 
ATOM 200   C CD2   . LEU A 1 33  ? -138.976 151.196 207.646 1.00 32.38  ? 33  LEU A CD2   1 
ATOM 201   N N     . SER A 1 34  ? -137.159 153.829 211.098 1.00 31.79  ? 34  SER A N     1 
ATOM 202   C CA    . SER A 1 34  ? -136.435 153.384 212.272 1.00 31.79  ? 34  SER A CA    1 
ATOM 203   C C     . SER A 1 34  ? -137.305 153.824 213.430 1.00 31.79  ? 34  SER A C     1 
ATOM 204   O O     . SER A 1 34  ? -137.467 155.020 213.686 1.00 31.79  ? 34  SER A O     1 
ATOM 205   C CB    . SER A 1 34  ? -135.036 153.988 212.343 1.00 31.79  ? 34  SER A CB    1 
ATOM 206   O OG    . SER A 1 34  ? -135.120 155.396 212.254 1.00 31.79  ? 34  SER A OG    1 
ATOM 207   N N     . SER A 1 35  ? -137.847 152.829 214.126 1.00 28.90  ? 35  SER A N     1 
ATOM 208   C CA    . SER A 1 35  ? -138.728 153.059 215.262 1.00 28.90  ? 35  SER A CA    1 
ATOM 209   C C     . SER A 1 35  ? -137.888 153.493 216.452 1.00 28.90  ? 35  SER A C     1 
ATOM 210   O O     . SER A 1 35  ? -137.880 154.669 216.828 1.00 28.90  ? 35  SER A O     1 
ATOM 211   C CB    . SER A 1 35  ? -139.542 151.796 215.564 1.00 28.90  ? 35  SER A CB    1 
ATOM 212   O OG    . SER A 1 35  ? -140.406 151.995 216.665 1.00 28.90  ? 35  SER A OG    1 
ATOM 213   N N     . ASP A 1 36  ? -137.153 152.553 217.039 1.00 30.16  ? 36  ASP A N     1 
ATOM 214   C CA    . ASP A 1 36  ? -136.392 152.880 218.229 1.00 30.16  ? 36  ASP A CA    1 
ATOM 215   C C     . ASP A 1 36  ? -135.215 153.739 217.803 1.00 30.16  ? 36  ASP A C     1 
ATOM 216   O O     . ASP A 1 36  ? -134.285 153.274 217.136 1.00 30.16  ? 36  ASP A O     1 
ATOM 217   C CB    . ASP A 1 36  ? -135.921 151.598 218.908 1.00 30.16  ? 36  ASP A CB    1 
ATOM 218   C CG    . ASP A 1 36  ? -137.072 150.741 219.388 1.00 30.16  ? 36  ASP A CG    1 
ATOM 219   O OD1   . ASP A 1 36  ? -138.147 151.308 219.680 1.00 30.16  ? 36  ASP A OD1   1 
ATOM 220   O OD2   . ASP A 1 36  ? -136.915 149.502 219.439 1.00 30.16  ? 36  ASP A OD2   1 
ATOM 221   N N     . LEU A 1 37  ? -135.283 155.000 218.187 1.00 31.55  ? 37  LEU A N     1 
ATOM 222   C CA    . LEU A 1 37  ? -134.292 156.020 217.903 1.00 31.55  ? 37  LEU A CA    1 
ATOM 223   C C     . LEU A 1 37  ? -133.814 156.575 219.228 1.00 31.55  ? 37  LEU A C     1 
ATOM 224   O O     . LEU A 1 37  ? -134.591 156.682 220.185 1.00 31.55  ? 37  LEU A O     1 
ATOM 225   C CB    . LEU A 1 37  ? -134.827 157.133 216.993 1.00 31.55  ? 37  LEU A CB    1 
ATOM 226   C CG    . LEU A 1 37  ? -135.145 156.696 215.566 1.00 31.55  ? 37  LEU A CG    1 
ATOM 227   C CD1   . LEU A 1 37  ? -135.746 157.836 214.764 1.00 31.55  ? 37  LEU A CD1   1 
ATOM 228   C CD2   . LEU A 1 37  ? -133.851 156.220 214.924 1.00 31.55  ? 37  LEU A CD2   1 
ATOM 229   N N     . GLY A 1 38  ? -132.537 156.913 219.286 1.00 31.84  ? 38  GLY A N     1 
ATOM 230   C CA    . GLY A 1 38  ? -131.982 157.497 220.481 1.00 31.84  ? 38  GLY A CA    1 
ATOM 231   C C     . GLY A 1 38  ? -131.145 158.691 220.088 1.00 31.84  ? 38  GLY A C     1 
ATOM 232   O O     . GLY A 1 38  ? -130.785 158.871 218.923 1.00 31.84  ? 38  GLY A O     1 
ATOM 233   N N     . GLU A 1 39  ? -130.842 159.510 221.087 1.00 29.47  ? 39  GLU A N     1 
ATOM 234   C CA    . GLU A 1 39  ? -130.069 160.723 220.869 1.00 29.47  ? 39  GLU A CA    1 
ATOM 235   C C     . GLU A 1 39  ? -129.320 161.037 222.151 1.00 29.47  ? 39  GLU A C     1 
ATOM 236   O O     . GLU A 1 39  ? -129.932 161.319 223.185 1.00 29.47  ? 39  GLU A O     1 
ATOM 237   C CB    . GLU A 1 39  ? -130.988 161.897 220.489 1.00 29.47  ? 39  GLU A CB    1 
ATOM 238   C CG    . GLU A 1 39  ? -131.700 161.788 219.137 1.00 29.47  ? 39  GLU A CG    1 
ATOM 239   C CD    . GLU A 1 39  ? -133.001 161.006 219.205 1.00 29.47  ? 39  GLU A CD    1 
ATOM 240   O OE1   . GLU A 1 39  ? -133.419 160.641 220.321 1.00 29.47  ? 39  GLU A OE1   1 
ATOM 241   O OE2   . GLU A 1 39  ? -133.598 160.739 218.140 1.00 29.47  ? 39  GLU A OE2   1 
ATOM 242   N N     . GLU A 1 40  ? -127.994 160.988 222.065 1.00 23.40  ? 40  GLU A N     1 
ATOM 243   C CA    . GLU A 1 40  ? -127.099 161.242 223.186 1.00 23.40  ? 40  GLU A CA    1 
ATOM 244   C C     . GLU A 1 40  ? -126.373 162.540 222.872 1.00 23.40  ? 40  GLU A C     1 
ATOM 245   O O     . GLU A 1 40  ? -125.608 162.613 221.903 1.00 23.40  ? 40  GLU A O     1 
ATOM 246   C CB    . GLU A 1 40  ? -126.133 160.080 223.410 1.00 23.40  ? 40  GLU A CB    1 
ATOM 247   C CG    . GLU A 1 40  ? -125.233 160.257 224.616 1.00 23.40  ? 40  GLU A CG    1 
ATOM 248   C CD    . GLU A 1 40  ? -124.301 159.082 224.825 1.00 23.40  ? 40  GLU A CD    1 
ATOM 249   O OE1   . GLU A 1 40  ? -124.387 158.103 224.051 1.00 23.40  ? 40  GLU A OE1   1 
ATOM 250   O OE2   . GLU A 1 40  ? -123.489 159.135 225.774 1.00 23.40  ? 40  GLU A OE2   1 
ATOM 251   N N     . ARG A 1 41  ? -126.658 163.583 223.638 1.00 24.00  ? 41  ARG A N     1 
ATOM 252   C CA    . ARG A 1 41  ? -126.056 164.873 223.349 1.00 24.00  ? 41  ARG A CA    1 
ATOM 253   C C     . ARG A 1 41  ? -125.218 165.476 224.458 1.00 24.00  ? 41  ARG A C     1 
ATOM 254   O O     . ARG A 1 41  ? -125.378 165.165 225.639 1.00 24.00  ? 41  ARG A O     1 
ATOM 255   C CB    . ARG A 1 41  ? -127.136 165.873 222.921 1.00 24.00  ? 41  ARG A CB    1 
ATOM 256   N N     . ILE A 1 42  ? -124.321 166.355 224.037 1.00 23.59  ? 42  ILE A N     1 
ATOM 257   C CA    . ILE A 1 42  ? -123.426 167.073 224.932 1.00 23.59  ? 42  ILE A CA    1 
ATOM 258   C C     . ILE A 1 42  ? -123.517 168.549 224.569 1.00 23.59  ? 42  ILE A C     1 
ATOM 259   O O     . ILE A 1 42  ? -123.637 168.897 223.388 1.00 23.59  ? 42  ILE A O     1 
ATOM 260   C CB    . ILE A 1 42  ? -121.971 166.564 224.879 1.00 23.59  ? 42  ILE A CB    1 
ATOM 261   C CG1   . ILE A 1 42  ? -121.923 165.049 225.109 1.00 23.59  ? 42  ILE A CG1   1 
ATOM 262   C CG2   . ILE A 1 42  ? -121.143 167.214 225.987 1.00 23.59  ? 42  ILE A CG2   1 
ATOM 263   C CD1   . ILE A 1 42  ? -120.530 164.472 225.065 1.00 23.59  ? 42  ILE A CD1   1 
ATOM 264   N N     . ALA A 1 43  ? -123.446 169.415 225.574 1.00 21.71  ? 43  ALA A N     1 
ATOM 265   C CA    . ALA A 1 43  ? -123.650 170.850 225.376 1.00 21.71  ? 43  ALA A CA    1 
ATOM 266   C C     . ALA A 1 43  ? -122.400 171.427 224.717 1.00 21.71  ? 43  ALA A C     1 
ATOM 267   O O     . ALA A 1 43  ? -121.385 171.605 225.393 1.00 21.71  ? 43  ALA A O     1 
ATOM 268   C CB    . ALA A 1 43  ? -123.945 171.532 226.707 1.00 21.71  ? 43  ALA A CB    1 
ATOM 269   N N     . ASN A 1 44  ? -122.457 171.697 223.374 1.00 22.05  ? 44  ASN A N     1 
ATOM 270   C CA    . ASN A 1 44  ? -121.400 172.162 222.446 1.00 22.05  ? 44  ASN A CA    1 
ATOM 271   C C     . ASN A 1 44  ? -120.846 171.076 221.516 1.00 22.05  ? 44  ASN A C     1 
ATOM 272   O O     . ASN A 1 44  ? -120.732 171.325 220.309 1.00 22.05  ? 44  ASN A O     1 
ATOM 273   C CB    . ASN A 1 44  ? -120.209 172.811 223.166 1.00 22.05  ? 44  ASN A CB    1 
ATOM 274   C CG    . ASN A 1 44  ? -120.582 174.063 223.916 1.00 22.05  ? 44  ASN A CG    1 
ATOM 275   O OD1   . ASN A 1 44  ? -121.475 174.796 223.516 1.00 22.05  ? 44  ASN A OD1   1 
ATOM 276   N ND2   . ASN A 1 44  ? -119.918 174.292 225.043 1.00 22.05  ? 44  ASN A ND2   1 
ATOM 277   N N     . PRO A 1 45  ? -120.502 169.852 222.005 1.00 23.83  ? 45  PRO A N     1 
ATOM 278   C CA    . PRO A 1 45  ? -120.077 168.796 221.073 1.00 23.83  ? 45  PRO A CA    1 
ATOM 279   C C     . PRO A 1 45  ? -121.139 168.351 220.086 1.00 23.83  ? 45  PRO A C     1 
ATOM 280   O O     . PRO A 1 45  ? -122.250 168.886 220.065 1.00 23.83  ? 45  PRO A O     1 
ATOM 281   C CB    . PRO A 1 45  ? -119.685 167.648 222.007 1.00 23.83  ? 45  PRO A CB    1 
ATOM 282   C CG    . PRO A 1 45  ? -119.225 168.306 223.203 1.00 23.83  ? 45  PRO A CG    1 
ATOM 283   C CD    . PRO A 1 45  ? -120.135 169.488 223.388 1.00 23.83  ? 45  PRO A CD    1 
ATOM 284   N N     . ARG A 1 46  ? -120.792 167.360 219.268 1.00 28.02  ? 46  ARG A N     1 
ATOM 285   C CA    . ARG A 1 46  ? -121.603 166.969 218.130 1.00 28.02  ? 46  ARG A CA    1 
ATOM 286   C C     . ARG A 1 46  ? -122.635 165.961 218.589 1.00 28.02  ? 46  ARG A C     1 
ATOM 287   O O     . ARG A 1 46  ? -122.393 165.184 219.517 1.00 28.02  ? 46  ARG A O     1 
ATOM 288   C CB    . ARG A 1 46  ? -120.699 166.344 217.062 1.00 28.02  ? 46  ARG A CB    1 
ATOM 289   C CG    . ARG A 1 46  ? -119.386 167.129 216.834 1.00 28.02  ? 46  ARG A CG    1 
ATOM 290   C CD    . ARG A 1 46  ? -118.379 166.426 215.912 1.00 28.02  ? 46  ARG A CD    1 
ATOM 291   N NE    . ARG A 1 46  ? -117.568 167.380 215.142 1.00 28.02  ? 46  ARG A NE    1 
ATOM 292   C CZ    . ARG A 1 46  ? -117.938 167.947 213.993 1.00 28.02  ? 46  ARG A CZ    1 
ATOM 293   N NH1   . ARG A 1 46  ? -119.106 167.646 213.440 1.00 28.02  ? 46  ARG A NH1   1 
ATOM 294   N NH2   . ARG A 1 46  ? -117.138 168.802 213.374 1.00 28.02  ? 46  ARG A NH2   1 
ATOM 295   N N     . GLN A 1 47  ? -123.793 165.966 217.928 1.00 28.63  ? 47  GLN A N     1 
ATOM 296   C CA    . GLN A 1 47  ? -124.805 164.967 218.255 1.00 28.63  ? 47  GLN A CA    1 
ATOM 297   C C     . GLN A 1 47  ? -124.404 163.580 217.768 1.00 28.63  ? 47  GLN A C     1 
ATOM 298   O O     . GLN A 1 47  ? -123.801 163.416 216.704 1.00 28.63  ? 47  GLN A O     1 
ATOM 299   C CB    . GLN A 1 47  ? -126.184 165.386 217.729 1.00 28.63  ? 47  GLN A CB    1 
ATOM 300   C CG    . GLN A 1 47  ? -126.879 166.328 218.709 1.00 28.63  ? 47  GLN A CG    1 
ATOM 301   C CD    . GLN A 1 47  ? -128.400 166.448 218.542 1.00 28.63  ? 47  GLN A CD    1 
ATOM 302   O OE1   . GLN A 1 47  ? -129.024 165.695 217.797 1.00 28.63  ? 47  GLN A OE1   1 
ATOM 303   N NE2   . GLN A 1 47  ? -129.000 167.392 219.266 1.00 28.63  ? 47  GLN A NE2   1 
ATOM 304   N N     . GLN A 1 48  ? -124.768 162.574 218.557 1.00 28.28  ? 48  GLN A N     1 
ATOM 305   C CA    . GLN A 1 48  ? -124.630 161.165 218.203 1.00 28.28  ? 48  GLN A CA    1 
ATOM 306   C C     . GLN A 1 48  ? -125.984 160.514 218.446 1.00 28.28  ? 48  GLN A C     1 
ATOM 307   O O     . GLN A 1 48  ? -126.383 160.311 219.600 1.00 28.28  ? 48  GLN A O     1 
ATOM 308   C CB    . GLN A 1 48  ? -123.514 160.517 219.022 1.00 28.28  ? 48  GLN A CB    1 
ATOM 309   C CG    . GLN A 1 48  ? -123.313 159.049 218.801 1.00 28.28  ? 48  GLN A CG    1 
ATOM 310   C CD    . GLN A 1 48  ? -122.243 158.491 219.703 1.00 28.28  ? 48  GLN A CD    1 
ATOM 311   O OE1   . GLN A 1 48  ? -121.741 159.173 220.602 1.00 28.28  ? 48  GLN A OE1   1 
ATOM 312   N NE2   . GLN A 1 48  ? -121.882 157.240 219.467 1.00 28.28  ? 48  GLN A NE2   1 
ATOM 313   N N     . LEU A 1 51  ? -128.295 158.971 212.359 1.00 35.59  ? 51  LEU A N     1 
ATOM 314   C CA    . LEU A 1 51  ? -127.681 158.362 211.194 1.00 35.59  ? 51  LEU A CA    1 
ATOM 315   C C     . LEU A 1 51  ? -126.867 159.409 210.450 1.00 35.59  ? 51  LEU A C     1 
ATOM 316   O O     . LEU A 1 51  ? -126.931 160.605 210.748 1.00 35.59  ? 51  LEU A O     1 
ATOM 317   C CB    . LEU A 1 51  ? -128.756 157.778 210.263 1.00 35.59  ? 51  LEU A CB    1 
ATOM 318   C CG    . LEU A 1 51  ? -129.423 156.426 210.540 1.00 35.59  ? 51  LEU A CG    1 
ATOM 319   C CD1   . LEU A 1 51  ? -130.111 156.342 211.894 1.00 35.59  ? 51  LEU A CD1   1 
ATOM 320   C CD2   . LEU A 1 51  ? -130.423 156.137 209.438 1.00 35.59  ? 51  LEU A CD2   1 
ATOM 321   N N     . LEU A 1 52  ? -126.114 158.948 209.451 1.00 37.49  ? 52  LEU A N     1 
ATOM 322   C CA    . LEU A 1 52  ? -125.455 159.831 208.501 1.00 37.49  ? 52  LEU A CA    1 
ATOM 323   C C     . LEU A 1 52  ? -125.708 159.290 207.101 1.00 37.49  ? 52  LEU A C     1 
ATOM 324   O O     . LEU A 1 52  ? -125.899 158.088 206.902 1.00 37.49  ? 52  LEU A O     1 
ATOM 325   C CB    . LEU A 1 52  ? -123.952 159.936 208.794 1.00 37.49  ? 52  LEU A CB    1 
ATOM 326   C CG    . LEU A 1 52  ? -123.621 160.699 210.079 1.00 37.49  ? 52  LEU A CG    1 
ATOM 327   C CD1   . LEU A 1 52  ? -122.155 160.549 210.451 1.00 37.49  ? 52  LEU A CD1   1 
ATOM 328   C CD2   . LEU A 1 52  ? -123.994 162.155 209.941 1.00 37.49  ? 52  LEU A CD2   1 
ATOM 329   N N     . PHE A 1 53  ? -125.661 160.187 206.122 1.00 36.73  ? 53  PHE A N     1 
ATOM 330   C CA    . PHE A 1 53  ? -126.079 159.804 204.783 1.00 36.73  ? 53  PHE A CA    1 
ATOM 331   C C     . PHE A 1 53  ? -125.508 160.724 203.704 1.00 36.73  ? 53  PHE A C     1 
ATOM 332   O O     . PHE A 1 53  ? -125.165 161.881 203.954 1.00 36.73  ? 53  PHE A O     1 
ATOM 333   C CB    . PHE A 1 53  ? -127.606 159.700 204.795 1.00 36.73  ? 53  PHE A CB    1 
ATOM 334   C CG    . PHE A 1 53  ? -128.304 161.010 204.943 1.00 36.73  ? 53  PHE A CG    1 
ATOM 335   C CD1   . PHE A 1 53  ? -128.637 161.797 203.860 1.00 36.73  ? 53  PHE A CD1   1 
ATOM 336   C CD2   . PHE A 1 53  ? -128.651 161.436 206.215 1.00 36.73  ? 53  PHE A CD2   1 
ATOM 337   C CE1   . PHE A 1 53  ? -129.289 162.996 204.059 1.00 36.73  ? 53  PHE A CE1   1 
ATOM 338   C CE2   . PHE A 1 53  ? -129.290 162.622 206.416 1.00 36.73  ? 53  PHE A CE2   1 
ATOM 339   C CZ    . PHE A 1 53  ? -129.614 163.407 205.341 1.00 36.73  ? 53  PHE A CZ    1 
ATOM 340   N N     . ARG A 1 54  ? -125.399 160.165 202.496 1.00 40.55  ? 54  ARG A N     1 
ATOM 341   C CA    . ARG A 1 54  ? -124.818 160.805 201.319 1.00 40.55  ? 54  ARG A CA    1 
ATOM 342   C C     . ARG A 1 54  ? -125.720 160.589 200.109 1.00 40.55  ? 54  ARG A C     1 
ATOM 343   O O     . ARG A 1 54  ? -126.076 159.446 199.800 1.00 40.55  ? 54  ARG A O     1 
ATOM 344   C CB    . ARG A 1 54  ? -123.402 160.314 201.022 1.00 40.55  ? 54  ARG A CB    1 
ATOM 345   C CG    . ARG A 1 54  ? -122.760 161.054 199.858 1.00 40.55  ? 54  ARG A CG    1 
ATOM 346   C CD    . ARG A 1 54  ? -121.308 160.671 199.667 1.00 40.55  ? 54  ARG A CD    1 
ATOM 347   N NE    . ARG A 1 54  ? -121.156 159.302 199.196 1.00 40.55  ? 54  ARG A NE    1 
ATOM 348   C CZ    . ARG A 1 54  ? -120.598 158.327 199.902 1.00 40.55  ? 54  ARG A CZ    1 
ATOM 349   N NH1   . ARG A 1 54  ? -120.126 158.575 201.114 1.00 40.55  ? 54  ARG A NH1   1 
ATOM 350   N NH2   . ARG A 1 54  ? -120.496 157.111 199.391 1.00 40.55  ? 54  ARG A NH2   1 
ATOM 351   N N     . ILE A 1 55  ? -126.062 161.672 199.411 1.00 35.06  ? 55  ILE A N     1 
ATOM 352   C CA    . ILE A 1 55  ? -126.859 161.578 198.189 1.00 35.06  ? 55  ILE A CA    1 
ATOM 353   C C     . ILE A 1 55  ? -125.953 161.162 197.038 1.00 35.06  ? 55  ILE A C     1 
ATOM 354   O O     . ILE A 1 55  ? -124.955 161.831 196.750 1.00 35.06  ? 55  ILE A O     1 
ATOM 355   C CB    . ILE A 1 55  ? -127.480 162.955 197.892 1.00 35.06  ? 55  ILE A CB    1 
ATOM 356   C CG1   . ILE A 1 55  ? -128.613 163.304 198.858 1.00 35.06  ? 55  ILE A CG1   1 
ATOM 357   C CG2   . ILE A 1 55  ? -127.809 163.141 196.407 1.00 35.06  ? 55  ILE A CG2   1 
ATOM 358   C CD1   . ILE A 1 55  ? -129.034 164.749 198.735 1.00 35.06  ? 55  ILE A CD1   1 
ATOM 359   N N     . GLU A 1 56  ? -126.304 160.059 196.358 1.00 35.91  ? 56  GLU A N     1 
ATOM 360   C CA    . GLU A 1 56  ? -125.460 159.602 195.258 1.00 35.91  ? 56  GLU A CA    1 
ATOM 361   C C     . GLU A 1 56  ? -126.037 159.699 193.853 1.00 35.91  ? 56  GLU A C     1 
ATOM 362   O O     . GLU A 1 56  ? -125.269 159.971 192.925 1.00 35.91  ? 56  GLU A O     1 
ATOM 363   C CB    . GLU A 1 56  ? -125.070 158.142 195.515 1.00 35.91  ? 56  GLU A CB    1 
ATOM 364   C CG    . GLU A 1 56  ? -124.000 157.558 194.624 1.00 35.91  ? 56  GLU A CG    1 
ATOM 365   C CD    . GLU A 1 56  ? -124.558 156.862 193.404 1.00 35.91  ? 56  GLU A CD    1 
ATOM 366   O OE1   . GLU A 1 56  ? -125.676 156.311 193.491 1.00 35.91  ? 56  GLU A OE1   1 
ATOM 367   O OE2   . GLU A 1 56  ? -123.874 156.859 192.361 1.00 35.91  ? 56  GLU A OE2   1 
ATOM 368   N N     . GLU A 1 57  ? -127.353 159.590 193.656 1.00 37.25  ? 57  GLU A N     1 
ATOM 369   C CA    . GLU A 1 57  ? -127.932 159.804 192.318 1.00 37.25  ? 57  GLU A CA    1 
ATOM 370   C C     . GLU A 1 57  ? -129.345 160.351 192.525 1.00 37.25  ? 57  GLU A C     1 
ATOM 371   O O     . GLU A 1 57  ? -130.208 159.645 193.051 1.00 37.25  ? 57  GLU A O     1 
ATOM 372   C CB    . GLU A 1 57  ? -127.882 158.569 191.397 1.00 37.25  ? 57  GLU A CB    1 
ATOM 373   N N     . THR A 1 58  ? -129.568 161.612 192.129 1.00 36.44  ? 58  THR A N     1 
ATOM 374   C CA    . THR A 1 58  ? -130.745 162.402 192.494 1.00 36.44  ? 58  THR A CA    1 
ATOM 375   C C     . THR A 1 58  ? -131.746 162.753 191.393 1.00 36.44  ? 58  THR A C     1 
ATOM 376   O O     . THR A 1 58  ? -132.844 163.197 191.732 1.00 36.44  ? 58  THR A O     1 
ATOM 377   C CB    . THR A 1 58  ? -130.303 163.724 193.151 1.00 36.44  ? 58  THR A CB    1 
ATOM 378   O OG1   . THR A 1 58  ? -131.454 164.530 193.449 1.00 36.44  ? 58  THR A OG1   1 
ATOM 379   C CG2   . THR A 1 58  ? -129.375 164.512 192.218 1.00 36.44  ? 58  THR A CG2   1 
ATOM 380   N N     . ARG A 1 59  ? -131.443 162.579 190.102 1.00 37.35  ? 59  ARG A N     1 
ATOM 381   C CA    . ARG A 1 59  ? -132.449 163.021 189.128 1.00 37.35  ? 59  ARG A CA    1 
ATOM 382   C C     . ARG A 1 59  ? -133.659 162.085 189.080 1.00 37.35  ? 59  ARG A C     1 
ATOM 383   O O     . ARG A 1 59  ? -134.768 162.520 188.748 1.00 37.35  ? 59  ARG A O     1 
ATOM 384   C CB    . ARG A 1 59  ? -131.875 163.025 187.709 1.00 37.35  ? 59  ARG A CB    1 
ATOM 385   C CG    . ARG A 1 59  ? -131.249 161.694 187.355 1.00 37.35  ? 59  ARG A CG    1 
ATOM 386   C CD    . ARG A 1 59  ? -131.239 161.421 185.837 1.00 37.35  ? 59  ARG A CD    1 
ATOM 387   N NE    . ARG A 1 59  ? -130.710 160.097 185.503 1.00 37.35  ? 59  ARG A NE    1 
ATOM 388   C CZ    . ARG A 1 59  ? -129.481 159.660 185.775 1.00 37.35  ? 59  ARG A CZ    1 
ATOM 389   N NH1   . ARG A 1 59  ? -128.609 160.419 186.424 1.00 37.35  ? 59  ARG A NH1   1 
ATOM 390   N NH2   . ARG A 1 59  ? -129.124 158.432 185.414 1.00 37.35  ? 59  ARG A NH2   1 
ATOM 391   N N     . ASN A 1 60  ? -133.474 160.807 189.399 1.00 35.83  ? 60  ASN A N     1 
ATOM 392   C CA    . ASN A 1 60  ? -134.539 159.820 189.339 1.00 35.83  ? 60  ASN A CA    1 
ATOM 393   C C     . ASN A 1 60  ? -134.602 159.150 190.697 1.00 35.83  ? 60  ASN A C     1 
ATOM 394   O O     . ASN A 1 60  ? -133.583 158.669 191.204 1.00 35.83  ? 60  ASN A O     1 
ATOM 395   C CB    . ASN A 1 60  ? -134.378 158.809 188.215 1.00 35.83  ? 60  ASN A CB    1 
ATOM 396   C CG    . ASN A 1 60  ? -134.308 159.465 186.853 1.00 35.83  ? 60  ASN A CG    1 
ATOM 397   O OD1   . ASN A 1 60  ? -133.314 159.331 186.159 1.00 35.83  ? 60  ASN A OD1   1 
ATOM 398   N ND2   . ASN A 1 60  ? -135.352 160.210 186.480 1.00 35.83  ? 60  ASN A ND2   1 
ATOM 399   N N     . GLU A 1 61  ? -135.779 159.110 191.308 1.00 29.71  ? 61  GLU A N     1 
ATOM 400   C CA    . GLU A 1 61  ? -135.858 158.512 192.626 1.00 29.71  ? 61  GLU A CA    1 
ATOM 401   C C     . GLU A 1 61  ? -134.713 159.194 193.369 1.00 29.71  ? 61  GLU A C     1 
ATOM 402   O O     . GLU A 1 61  ? -134.730 160.418 193.509 1.00 29.71  ? 61  GLU A O     1 
ATOM 403   C CB    . GLU A 1 61  ? -135.664 156.997 192.551 1.00 29.71  ? 61  GLU A CB    1 
ATOM 404   N N     . LEU A 1 62  ? -133.718 158.424 193.814 1.00 32.03  ? 62  LEU A N     1 
ATOM 405   C CA    . LEU A 1 62  ? -132.553 158.973 194.514 1.00 32.03  ? 62  LEU A CA    1 
ATOM 406   C C     . LEU A 1 62  ? -131.738 157.927 195.265 1.00 32.03  ? 62  LEU A C     1 
ATOM 407   O O     . LEU A 1 62  ? -132.010 157.665 196.436 1.00 32.03  ? 62  LEU A O     1 
ATOM 408   C CB    . LEU A 1 62  ? -132.965 160.061 195.512 1.00 32.03  ? 62  LEU A CB    1 
ATOM 409   N N     . TYR A 1 63  ? -130.735 157.333 194.622 1.00 35.40  ? 63  TYR A N     1 
ATOM 410   C CA    . TYR A 1 63  ? -129.933 156.362 195.352 1.00 35.40  ? 63  TYR A CA    1 
ATOM 411   C C     . TYR A 1 63  ? -129.095 157.088 196.396 1.00 35.40  ? 63  TYR A C     1 
ATOM 412   O O     . TYR A 1 63  ? -128.550 158.169 196.124 1.00 35.40  ? 63  TYR A O     1 
ATOM 413   C CB    . TYR A 1 63  ? -129.013 155.563 194.442 1.00 35.40  ? 63  TYR A CB    1 
ATOM 414   C CG    . TYR A 1 63  ? -129.718 154.627 193.517 1.00 35.40  ? 63  TYR A CG    1 
ATOM 415   C CD1   . TYR A 1 63  ? -131.057 154.336 193.689 1.00 35.40  ? 63  TYR A CD1   1 
ATOM 416   C CD2   . TYR A 1 63  ? -129.026 153.980 192.505 1.00 35.40  ? 63  TYR A CD2   1 
ATOM 417   C CE1   . TYR A 1 63  ? -131.703 153.462 192.861 1.00 35.40  ? 63  TYR A CE1   1 
ATOM 418   C CE2   . TYR A 1 63  ? -129.663 153.103 191.671 1.00 35.40  ? 63  TYR A CE2   1 
ATOM 419   C CZ    . TYR A 1 63  ? -131.002 152.847 191.855 1.00 35.40  ? 63  TYR A CZ    1 
ATOM 420   O OH    . TYR A 1 63  ? -131.648 151.967 191.026 1.00 35.40  ? 63  TYR A OH    1 
ATOM 421   N N     . LEU A 1 64  ? -128.897 156.418 197.544 1.00 35.44  ? 64  LEU A N     1 
ATOM 422   C CA    . LEU A 1 64  ? -128.314 157.049 198.727 1.00 35.44  ? 64  LEU A CA    1 
ATOM 423   C C     . LEU A 1 64  ? -127.654 155.978 199.593 1.00 35.44  ? 64  LEU A C     1 
ATOM 424   O O     . LEU A 1 64  ? -128.231 154.909 199.822 1.00 35.44  ? 64  LEU A O     1 
ATOM 425   C CB    . LEU A 1 64  ? -129.376 157.798 199.539 1.00 35.44  ? 64  LEU A CB    1 
ATOM 426   C CG    . LEU A 1 64  ? -129.005 158.907 200.532 1.00 35.44  ? 64  LEU A CG    1 
ATOM 427   C CD1   . LEU A 1 64  ? -130.222 159.735 200.881 1.00 35.44  ? 64  LEU A CD1   1 
ATOM 428   C CD2   . LEU A 1 64  ? -128.397 158.358 201.780 1.00 35.44  ? 64  LEU A CD2   1 
ATOM 429   N N     . LEU A 1 65  ? -126.443 156.276 200.068 1.00 37.41  ? 65  LEU A N     1 
ATOM 430   C CA    . LEU A 1 65  ? -125.694 155.430 200.997 1.00 37.41  ? 65  LEU A CA    1 
ATOM 431   C C     . LEU A 1 65  ? -125.878 155.904 202.441 1.00 37.41  ? 65  LEU A C     1 
ATOM 432   O O     . LEU A 1 65  ? -125.578 157.059 202.761 1.00 37.41  ? 65  LEU A O     1 
ATOM 433   C CB    . LEU A 1 65  ? -124.214 155.426 200.619 1.00 37.41  ? 65  LEU A CB    1 
ATOM 434   C CG    . LEU A 1 65  ? -123.288 154.568 201.475 1.00 37.41  ? 65  LEU A CG    1 
ATOM 435   C CD1   . LEU A 1 65  ? -123.602 153.094 201.248 1.00 37.41  ? 65  LEU A CD1   1 
ATOM 436   C CD2   . LEU A 1 65  ? -121.838 154.860 201.172 1.00 37.41  ? 65  LEU A CD2   1 
ATOM 437   N N     . VAL A 1 66  ? -126.360 155.013 203.312 1.00 38.22  ? 66  VAL A N     1 
ATOM 438   C CA    . VAL A 1 66  ? -126.677 155.333 204.705 1.00 38.22  ? 66  VAL A CA    1 
ATOM 439   C C     . VAL A 1 66  ? -125.707 154.616 205.634 1.00 38.22  ? 66  VAL A C     1 
ATOM 440   O O     . VAL A 1 66  ? -125.506 153.402 205.515 1.00 38.22  ? 66  VAL A O     1 
ATOM 441   C CB    . VAL A 1 66  ? -128.124 154.943 205.051 1.00 38.22  ? 66  VAL A CB    1 
ATOM 442   C CG1   . VAL A 1 66  ? -128.479 155.411 206.455 1.00 38.22  ? 66  VAL A CG1   1 
ATOM 443   C CG2   . VAL A 1 66  ? -129.067 155.555 204.066 1.00 38.22  ? 66  VAL A CG2   1 
ATOM 444   N N     . GLN A 1 67  ? -125.221 155.366 206.620 1.00 36.37  ? 67  GLN A N     1 
ATOM 445   C CA    . GLN A 1 67  ? -124.405 154.855 207.704 1.00 36.37  ? 67  GLN A CA    1 
ATOM 446   C C     . GLN A 1 67  ? -125.495 154.859 208.776 1.00 36.37  ? 67  GLN A C     1 
ATOM 447   O O     . GLN A 1 67  ? -126.407 155.682 208.693 1.00 36.37  ? 67  GLN A O     1 
ATOM 448   C CB    . GLN A 1 67  ? -123.291 155.832 208.060 1.00 36.37  ? 67  GLN A CB    1 
ATOM 449   N N     . SER A 1 68  ? -125.456 153.968 209.764 1.00 37.14  ? 68  SER A N     1 
ATOM 450   C CA    . SER A 1 68  ? -126.542 153.968 210.738 1.00 37.14  ? 68  SER A CA    1 
ATOM 451   C C     . SER A 1 68  ? -126.190 153.135 211.973 1.00 37.14  ? 68  SER A C     1 
ATOM 452   O O     . SER A 1 68  ? -125.297 152.284 211.946 1.00 37.14  ? 68  SER A O     1 
ATOM 453   C CB    . SER A 1 68  ? -127.823 153.460 210.063 1.00 37.14  ? 68  SER A CB    1 
ATOM 454   O OG    . SER A 1 68  ? -127.513 152.352 209.236 1.00 37.14  ? 68  SER A OG    1 
ATOM 455   N N     . HIS A 1 69  ? -126.877 153.431 213.077 1.00 37.98  ? 69  HIS A N     1 
ATOM 456   C CA    . HIS A 1 69  ? -126.838 152.623 214.287 1.00 37.98  ? 69  HIS A CA    1 
ATOM 457   C C     . HIS A 1 69  ? -127.979 151.602 214.393 1.00 37.98  ? 69  HIS A C     1 
ATOM 458   O O     . HIS A 1 69  ? -127.746 150.477 214.838 1.00 37.98  ? 69  HIS A O     1 
ATOM 459   C CB    . HIS A 1 69  ? -126.749 153.563 215.485 1.00 37.98  ? 69  HIS A CB    1 
ATOM 460   C CG    . HIS A 1 69  ? -125.468 154.350 215.522 1.00 37.98  ? 69  HIS A CG    1 
ATOM 461   N ND1   . HIS A 1 69  ? -124.267 153.786 215.896 1.00 37.98  ? 69  HIS A ND1   1 
ATOM 462   C CD2   . HIS A 1 69  ? -125.189 155.639 215.198 1.00 37.98  ? 69  HIS A CD2   1 
ATOM 463   C CE1   . HIS A 1 69  ? -123.312 154.696 215.832 1.00 37.98  ? 69  HIS A CE1   1 
ATOM 464   N NE2   . HIS A 1 69  ? -123.843 155.829 215.410 1.00 37.98  ? 69  HIS A NE2   1 
ATOM 465   N N     . SER A 1 70  ? -129.223 151.969 214.046 1.00 37.97  ? 70  SER A N     1 
ATOM 466   C CA    . SER A 1 70  ? -130.388 151.095 214.224 1.00 37.97  ? 70  SER A CA    1 
ATOM 467   C C     . SER A 1 70  ? -130.736 150.459 212.887 1.00 37.97  ? 70  SER A C     1 
ATOM 468   O O     . SER A 1 70  ? -130.678 151.133 211.861 1.00 37.97  ? 70  SER A O     1 
ATOM 469   C CB    . SER A 1 70  ? -131.607 151.854 214.762 1.00 37.97  ? 70  SER A CB    1 
ATOM 470   O OG    . SER A 1 70  ? -131.678 151.788 216.191 1.00 37.97  ? 70  SER A OG    1 
ATOM 471   N N     . PRO A 1 71  ? -131.148 149.188 212.865 1.00 37.36  ? 71  PRO A N     1 
ATOM 472   C CA    . PRO A 1 71  ? -131.339 148.506 211.568 1.00 37.36  ? 71  PRO A CA    1 
ATOM 473   C C     . PRO A 1 71  ? -132.557 148.959 210.775 1.00 37.36  ? 71  PRO A C     1 
ATOM 474   O O     . PRO A 1 71  ? -133.667 149.041 211.299 1.00 37.36  ? 71  PRO A O     1 
ATOM 475   C CB    . PRO A 1 71  ? -131.463 147.030 211.970 1.00 37.36  ? 71  PRO A CB    1 
ATOM 476   C CG    . PRO A 1 71  ? -131.931 147.068 213.402 1.00 37.36  ? 71  PRO A CG    1 
ATOM 477   C CD    . PRO A 1 71  ? -131.287 148.270 214.009 1.00 37.36  ? 71  PRO A CD    1 
ATOM 478   N N     . LEU A 1 72  ? -132.320 149.256 209.489 1.00 36.29  ? 72  LEU A N     1 
ATOM 479   C CA    . LEU A 1 72  ? -133.345 149.601 208.508 1.00 36.29  ? 72  LEU A CA    1 
ATOM 480   C C     . LEU A 1 72  ? -133.885 148.330 207.833 1.00 36.29  ? 72  LEU A C     1 
ATOM 481   O O     . LEU A 1 72  ? -133.120 147.428 207.509 1.00 36.29  ? 72  LEU A O     1 
ATOM 482   C CB    . LEU A 1 72  ? -132.742 150.588 207.501 1.00 36.29  ? 72  LEU A CB    1 
ATOM 483   C CG    . LEU A 1 72  ? -133.353 151.324 206.299 1.00 36.29  ? 72  LEU A CG    1 
ATOM 484   C CD1   . LEU A 1 72  ? -132.338 152.328 205.768 1.00 36.29  ? 72  LEU A CD1   1 
ATOM 485   C CD2   . LEU A 1 72  ? -133.931 150.477 205.182 1.00 36.29  ? 72  LEU A CD2   1 
ATOM 486   N N     . ARG A 1 73  ? -135.198 148.291 207.597 1.00 34.81  ? 73  ARG A N     1 
ATOM 487   C CA    . ARG A 1 73  ? -135.991 147.349 206.791 1.00 34.81  ? 73  ARG A CA    1 
ATOM 488   C C     . ARG A 1 73  ? -136.879 148.043 205.765 1.00 34.81  ? 73  ARG A C     1 
ATOM 489   O O     . ARG A 1 73  ? -137.599 148.971 206.106 1.00 34.81  ? 73  ARG A O     1 
ATOM 490   C CB    . ARG A 1 73  ? -136.874 146.463 207.687 1.00 34.81  ? 73  ARG A CB    1 
ATOM 491   N N     . VAL A 1 74  ? -136.942 147.512 204.541 1.00 32.03  ? 74  VAL A N     1 
ATOM 492   C CA    . VAL A 1 74  ? -137.658 148.200 203.466 1.00 32.03  ? 74  VAL A CA    1 
ATOM 493   C C     . VAL A 1 74  ? -139.088 148.529 203.891 1.00 32.03  ? 74  VAL A C     1 
ATOM 494   O O     . VAL A 1 74  ? -139.728 147.775 204.635 1.00 32.03  ? 74  VAL A O     1 
ATOM 495   C CB    . VAL A 1 74  ? -137.669 147.313 202.212 1.00 32.03  ? 74  VAL A CB    1 
ATOM 496   C CG1   . VAL A 1 74  ? -138.274 145.942 202.545 1.00 32.03  ? 74  VAL A CG1   1 
ATOM 497   C CG2   . VAL A 1 74  ? -138.502 147.960 201.140 1.00 32.03  ? 74  VAL A CG2   1 
ATOM 498   N N     . ASP A 1 75  ? -139.585 149.680 203.427 1.00 30.46  ? 75  ASP A N     1 
ATOM 499   C CA    . ASP A 1 75  ? -140.931 150.190 203.676 1.00 30.46  ? 75  ASP A CA    1 
ATOM 500   C C     . ASP A 1 75  ? -141.711 150.311 202.366 1.00 30.46  ? 75  ASP A C     1 
ATOM 501   O O     . ASP A 1 75  ? -141.293 149.787 201.330 1.00 30.46  ? 75  ASP A O     1 
ATOM 502   C CB    . ASP A 1 75  ? -140.827 151.558 204.345 1.00 30.46  ? 75  ASP A CB    1 
ATOM 503   C CG    . ASP A 1 75  ? -140.106 152.565 203.466 1.00 30.46  ? 75  ASP A CG    1 
ATOM 504   O OD1   . ASP A 1 75  ? -139.433 152.138 202.507 1.00 30.46  ? 75  ASP A OD1   1 
ATOM 505   O OD2   . ASP A 1 75  ? -140.209 153.774 203.711 1.00 30.46  ? 75  ASP A OD2   1 
ATOM 506   N N     . ARG A 1 76  ? -142.859 150.999 202.417 1.00 28.42  ? 76  ARG A N     1 
ATOM 507   C CA    . ARG A 1 76  ? -143.687 151.107 201.222 1.00 28.42  ? 76  ARG A CA    1 
ATOM 508   C C     . ARG A 1 76  ? -142.877 151.818 200.168 1.00 28.42  ? 76  ARG A C     1 
ATOM 509   O O     . ARG A 1 76  ? -142.128 152.749 200.481 1.00 28.42  ? 76  ARG A O     1 
ATOM 510   C CB    . ARG A 1 76  ? -144.958 151.942 201.393 1.00 28.42  ? 76  ARG A CB    1 
ATOM 511   C CG    . ARG A 1 76  ? -144.733 153.402 201.765 1.00 28.42  ? 76  ARG A CG    1 
ATOM 512   C CD    . ARG A 1 76  ? -146.054 154.122 201.914 1.00 28.42  ? 76  ARG A CD    1 
ATOM 513   N NE    . ARG A 1 76  ? -145.882 155.509 202.321 1.00 28.42  ? 76  ARG A NE    1 
ATOM 514   C CZ    . ARG A 1 76  ? -145.686 155.889 203.575 1.00 28.42  ? 76  ARG A CZ    1 
ATOM 515   N NH1   . ARG A 1 76  ? -145.632 154.989 204.542 1.00 28.42  ? 76  ARG A NH1   1 
ATOM 516   N NH2   . ARG A 1 76  ? -145.542 157.163 203.865 1.00 28.42  ? 76  ARG A NH2   1 
ATOM 517   N N     . LEU A 1 77  ? -142.944 151.331 198.937 1.00 26.76  ? 77  LEU A N     1 
ATOM 518   C CA    . LEU A 1 77  ? -142.228 152.007 197.876 1.00 26.76  ? 77  LEU A CA    1 
ATOM 519   C C     . LEU A 1 77  ? -140.727 152.018 198.144 1.00 26.76  ? 77  LEU A C     1 
ATOM 520   O O     . LEU A 1 77  ? -139.993 152.877 197.652 1.00 26.76  ? 77  LEU A O     1 
ATOM 521   C CB    . LEU A 1 77  ? -142.768 153.432 197.775 1.00 26.76  ? 77  LEU A CB    1 
ATOM 522   C CG    . LEU A 1 77  ? -142.304 154.510 196.830 1.00 26.76  ? 77  LEU A CG    1 
ATOM 523   C CD1   . LEU A 1 77  ? -142.902 154.283 195.457 1.00 26.76  ? 77  LEU A CD1   1 
ATOM 524   C CD2   . LEU A 1 77  ? -142.633 155.840 197.470 1.00 26.76  ? 77  LEU A CD2   1 
ATOM 525   N N     . GLY A 1 78  ? -140.242 151.057 198.916 1.00 26.57  ? 78  GLY A N     1 
ATOM 526   C CA    . GLY A 1 78  ? -138.825 150.960 199.126 1.00 26.57  ? 78  GLY A CA    1 
ATOM 527   C C     . GLY A 1 78  ? -138.211 150.053 198.091 1.00 26.57  ? 78  GLY A C     1 
ATOM 528   O O     . GLY A 1 78  ? -138.766 149.841 197.010 1.00 26.57  ? 78  GLY A O     1 
ATOM 529   N N     . PRO A 1 79  ? -137.055 149.490 198.407 1.00 26.71  ? 79  PRO A N     1 
ATOM 530   C CA    . PRO A 1 79  ? -136.487 148.440 197.557 1.00 26.71  ? 79  PRO A CA    1 
ATOM 531   C C     . PRO A 1 79  ? -137.355 147.190 197.576 1.00 26.71  ? 79  PRO A C     1 
ATOM 532   O O     . PRO A 1 79  ? -138.273 147.042 198.381 1.00 26.71  ? 79  PRO A O     1 
ATOM 533   C CB    . PRO A 1 79  ? -135.108 148.191 198.179 1.00 26.71  ? 79  PRO A CB    1 
ATOM 534   C CG    . PRO A 1 79  ? -135.231 148.697 199.593 1.00 26.71  ? 79  PRO A CG    1 
ATOM 535   C CD    . PRO A 1 79  ? -136.142 149.875 199.497 1.00 26.71  ? 79  PRO A CD    1 
ATOM 536   N N     . GLY A 1 80  ? -137.095 146.296 196.626 1.00 26.53  ? 80  GLY A N     1 
ATOM 537   C CA    . GLY A 1 80  ? -137.830 145.055 196.700 1.00 26.53  ? 80  GLY A CA    1 
ATOM 538   C C     . GLY A 1 80  ? -137.186 144.051 197.622 1.00 26.53  ? 80  GLY A C     1 
ATOM 539   O O     . GLY A 1 80  ? -137.548 142.872 197.625 1.00 26.53  ? 80  GLY A O     1 
ATOM 540   N N     . TYR A 1 81  ? -136.212 144.509 198.406 1.00 29.29  ? 81  TYR A N     1 
ATOM 541   C CA    . TYR A 1 81  ? -135.443 143.689 199.326 1.00 29.29  ? 81  TYR A CA    1 
ATOM 542   C C     . TYR A 1 81  ? -135.115 144.560 200.532 1.00 29.29  ? 81  TYR A C     1 
ATOM 543   O O     . TYR A 1 81  ? -135.241 145.785 200.478 1.00 29.29  ? 81  TYR A O     1 
ATOM 544   C CB    . TYR A 1 81  ? -134.181 143.132 198.657 1.00 29.29  ? 81  TYR A CB    1 
ATOM 545   C CG    . TYR A 1 81  ? -134.499 142.148 197.557 1.00 29.29  ? 81  TYR A CG    1 
ATOM 546   C CD1   . TYR A 1 81  ? -134.733 140.808 197.837 1.00 29.29  ? 81  TYR A CD1   1 
ATOM 547   C CD2   . TYR A 1 81  ? -134.589 142.567 196.234 1.00 29.29  ? 81  TYR A CD2   1 
ATOM 548   C CE1   . TYR A 1 81  ? -135.036 139.914 196.830 1.00 29.29  ? 81  TYR A CE1   1 
ATOM 549   C CE2   . TYR A 1 81  ? -134.893 141.683 195.223 1.00 29.29  ? 81  TYR A CE2   1 
ATOM 550   C CZ    . TYR A 1 81  ? -135.114 140.359 195.525 1.00 29.29  ? 81  TYR A CZ    1 
ATOM 551   O OH    . TYR A 1 81  ? -135.417 139.473 194.519 1.00 29.29  ? 81  TYR A OH    1 
ATOM 552   N N     . HIS A 1 82  ? -134.727 143.916 201.637 1.00 29.69  ? 82  HIS A N     1 
ATOM 553   C CA    . HIS A 1 82  ? -134.473 144.651 202.873 1.00 29.69  ? 82  HIS A CA    1 
ATOM 554   C C     . HIS A 1 82  ? -133.440 145.766 202.718 1.00 29.69  ? 82  HIS A C     1 
ATOM 555   O O     . HIS A 1 82  ? -133.428 146.691 203.538 1.00 29.69  ? 82  HIS A O     1 
ATOM 556   C CB    . HIS A 1 82  ? -133.949 143.722 203.963 1.00 29.69  ? 82  HIS A CB    1 
ATOM 557   C CG    . HIS A 1 82  ? -132.716 142.973 203.567 1.00 29.69  ? 82  HIS A CG    1 
ATOM 558   N ND1   . HIS A 1 82  ? -131.466 143.555 203.565 1.00 29.69  ? 82  HIS A ND1   1 
ATOM 559   C CD2   . HIS A 1 82  ? -132.531 141.687 203.190 1.00 29.69  ? 82  HIS A CD2   1 
ATOM 560   C CE1   . HIS A 1 82  ? -130.567 142.667 203.183 1.00 29.69  ? 82  HIS A CE1   1 
ATOM 561   N NE2   . HIS A 1 82  ? -131.187 141.523 202.953 1.00 29.69  ? 82  HIS A NE2   1 
ATOM 562   N N     . GLN A 1 85  ? -128.928 146.750 199.672 1.00 33.32  ? 85  GLN A N     1 
ATOM 563   C CA    . GLN A 1 85  ? -127.948 145.952 200.396 1.00 33.32  ? 85  GLN A CA    1 
ATOM 564   C C     . GLN A 1 85  ? -127.719 146.494 201.796 1.00 33.32  ? 85  GLN A C     1 
ATOM 565   O O     . GLN A 1 85  ? -127.786 147.701 202.038 1.00 33.32  ? 85  GLN A O     1 
ATOM 566   C CB    . GLN A 1 85  ? -126.593 145.985 199.642 1.00 33.32  ? 85  GLN A CB    1 
ATOM 567   C CG    . GLN A 1 85  ? -125.509 144.984 200.059 1.00 33.32  ? 85  GLN A CG    1 
ATOM 568   C CD    . GLN A 1 85  ? -125.985 143.559 200.115 1.00 33.32  ? 85  GLN A CD    1 
ATOM 569   O OE1   . GLN A 1 85  ? -126.470 143.017 199.127 1.00 33.32  ? 85  GLN A OE1   1 
ATOM 570   N NE2   . GLN A 1 85  ? -125.825 142.928 201.271 1.00 33.32  ? 85  GLN A NE2   1 
ATOM 571   N N     . MET A 1 86  ? -127.416 145.572 202.711 1.00 35.42  ? 86  MET A N     1 
ATOM 572   C CA    . MET A 1 86  ? -127.090 145.865 204.100 1.00 35.42  ? 86  MET A CA    1 
ATOM 573   C C     . MET A 1 86  ? -125.954 145.007 204.633 1.00 35.42  ? 86  MET A C     1 
ATOM 574   O O     . MET A 1 86  ? -125.954 143.780 204.478 1.00 35.42  ? 86  MET A O     1 
ATOM 575   C CB    . MET A 1 86  ? -128.302 145.709 205.007 1.00 35.42  ? 86  MET A CB    1 
ATOM 576   C CG    . MET A 1 86  ? -129.434 146.585 204.577 1.00 35.42  ? 86  MET A CG    1 
ATOM 577   S SD    . MET A 1 86  ? -130.554 146.980 205.903 1.00 35.42  ? 86  MET A SD    1 
ATOM 578   C CE    . MET A 1 86  ? -131.332 148.383 205.139 1.00 35.42  ? 86  MET A CE    1 
ATOM 579   N N     . ARG A 1 87  ? -125.012 145.675 205.283 1.00 36.66  ? 87  ARG A N     1 
ATOM 580   C CA    . ARG A 1 87  ? -123.911 145.070 206.008 1.00 36.66  ? 87  ARG A CA    1 
ATOM 581   C C     . ARG A 1 87  ? -123.683 145.844 207.284 1.00 36.66  ? 87  ARG A C     1 
ATOM 582   O O     . ARG A 1 87  ? -123.933 147.048 207.354 1.00 36.66  ? 87  ARG A O     1 
ATOM 583   C CB    . ARG A 1 87  ? -122.597 145.049 205.189 1.00 36.66  ? 87  ARG A CB    1 
ATOM 584   C CG    . ARG A 1 87  ? -121.450 144.234 205.831 1.00 36.66  ? 87  ARG A CG    1 
ATOM 585   C CD    . ARG A 1 87  ? -121.622 142.741 206.009 1.00 36.66  ? 87  ARG A CD    1 
ATOM 586   N NE    . ARG A 1 87  ? -120.402 142.203 206.614 1.00 36.66  ? 87  ARG A NE    1 
ATOM 587   C CZ    . ARG A 1 87  ? -120.133 142.232 207.919 1.00 36.66  ? 87  ARG A CZ    1 
ATOM 588   N NH1   . ARG A 1 87  ? -120.992 142.766 208.775 1.00 36.66  ? 87  ARG A NH1   1 
ATOM 589   N NH2   . ARG A 1 87  ? -118.992 141.739 208.371 1.00 36.66  ? 87  ARG A NH2   1 
ATOM 590   N N     . ASN A 1 88  ? -123.250 145.122 208.306 1.00 36.38  ? 88  ASN A N     1 
ATOM 591   C CA    . ASN A 1 88  ? -122.931 145.724 209.580 1.00 36.38  ? 88  ASN A CA    1 
ATOM 592   C C     . ASN A 1 88  ? -121.417 145.709 209.614 1.00 36.38  ? 88  ASN A C     1 
ATOM 593   O O     . ASN A 1 88  ? -120.801 144.687 209.314 1.00 36.38  ? 88  ASN A O     1 
ATOM 594   C CB    . ASN A 1 88  ? -123.566 144.957 210.749 1.00 36.38  ? 88  ASN A CB    1 
ATOM 595   C CG    . ASN A 1 88  ? -123.422 145.689 212.080 1.00 36.38  ? 88  ASN A CG    1 
ATOM 596   O OD1   . ASN A 1 88  ? -122.693 146.667 212.178 1.00 36.38  ? 88  ASN A OD1   1 
ATOM 597   N ND2   . ASN A 1 88  ? -124.155 145.243 213.096 1.00 36.38  ? 88  ASN A ND2   1 
ATOM 598   N N     . LEU A 1 89  ? -120.812 146.820 209.960 1.00 33.69  ? 89  LEU A N     1 
ATOM 599   C CA    . LEU A 1 89  ? -119.364 146.886 209.892 1.00 33.69  ? 89  LEU A CA    1 
ATOM 600   C C     . LEU A 1 89  ? -118.864 147.412 211.219 1.00 33.69  ? 89  LEU A C     1 
ATOM 601   O O     . LEU A 1 89  ? -119.479 148.292 211.823 1.00 33.69  ? 89  LEU A O     1 
ATOM 602   C CB    . LEU A 1 89  ? -118.874 147.736 208.686 1.00 33.69  ? 89  LEU A CB    1 
ATOM 603   C CG    . LEU A 1 89  ? -117.371 147.924 208.421 1.00 33.69  ? 89  LEU A CG    1 
ATOM 604   C CD1   . LEU A 1 89  ? -117.102 148.010 206.915 1.00 33.69  ? 89  LEU A CD1   1 
ATOM 605   C CD2   . LEU A 1 89  ? -116.847 149.168 209.120 1.00 33.69  ? 89  LEU A CD2   1 
ATOM 606   N N     . ASP A 1 90  ? -117.716 146.921 211.642 1.00 33.69  ? 90  ASP A N     1 
ATOM 607   C CA    . ASP A 1 90  ? -117.091 147.554 212.764 1.00 33.69  ? 90  ASP A CA    1 
ATOM 608   C C     . ASP A 1 90  ? -115.702 147.927 212.275 1.00 33.69  ? 90  ASP A C     1 
ATOM 609   O O     . ASP A 1 90  ? -114.954 147.054 211.804 1.00 33.69  ? 90  ASP A O     1 
ATOM 610   C CB    . ASP A 1 90  ? -117.041 146.571 213.933 1.00 33.69  ? 90  ASP A CB    1 
ATOM 611   C CG    . ASP A 1 90  ? -118.364 146.469 214.651 1.00 33.69  ? 90  ASP A CG    1 
ATOM 612   O OD1   . ASP A 1 90  ? -119.032 147.507 214.821 1.00 33.69  ? 90  ASP A OD1   1 
ATOM 613   O OD2   . ASP A 1 90  ? -118.761 145.338 214.997 1.00 33.69  ? 90  ASP A OD2   1 
ATOM 614   N N     . PRO A 1 91  ? -115.320 149.195 212.386 1.00 36.71  ? 91  PRO A N     1 
ATOM 615   C CA    . PRO A 1 91  ? -113.979 149.627 211.975 1.00 36.71  ? 91  PRO A CA    1 
ATOM 616   C C     . PRO A 1 91  ? -112.894 149.157 212.919 1.00 36.71  ? 91  PRO A C     1 
ATOM 617   O O     . PRO A 1 91  ? -111.756 149.637 212.895 1.00 36.71  ? 91  PRO A O     1 
ATOM 618   C CB    . PRO A 1 91  ? -114.106 151.150 211.915 1.00 36.71  ? 91  PRO A CB    1 
ATOM 619   C CG    . PRO A 1 91  ? -115.271 151.489 212.751 1.00 36.71  ? 91  PRO A CG    1 
ATOM 620   C CD    . PRO A 1 91  ? -116.185 150.315 212.785 1.00 36.71  ? 91  PRO A CD    1 
ATOM 621   N N     . LEU A 1 96  ? -108.000 149.871 211.434 1.00 42.69  ? 96  LEU A N     1 
ATOM 622   C CA    . LEU A 1 96  ? -107.643 151.012 210.589 1.00 42.69  ? 96  LEU A CA    1 
ATOM 623   C C     . LEU A 1 96  ? -106.306 151.575 211.079 1.00 42.69  ? 96  LEU A C     1 
ATOM 624   O O     . LEU A 1 96  ? -106.282 152.423 211.971 1.00 42.69  ? 96  LEU A O     1 
ATOM 625   C CB    . LEU A 1 96  ? -108.823 151.995 210.447 1.00 42.69  ? 96  LEU A CB    1 
ATOM 626   N N     . ASP A 1 97  ? -105.205 150.967 210.609 1.00 44.76  ? 97  ASP A N     1 
ATOM 627   C CA    . ASP A 1 97  ? -103.844 151.237 211.087 1.00 44.76  ? 97  ASP A CA    1 
ATOM 628   C C     . ASP A 1 97  ? -103.318 152.603 210.645 1.00 44.76  ? 97  ASP A C     1 
ATOM 629   O O     . ASP A 1 97  ? -103.386 152.975 209.469 1.00 44.76  ? 97  ASP A O     1 
ATOM 630   C CB    . ASP A 1 97  ? -102.890 150.138 210.605 1.00 44.76  ? 97  ASP A CB    1 
ATOM 631   C CG    . ASP A 1 97  ? -101.539 150.184 211.296 1.00 44.76  ? 97  ASP A CG    1 
ATOM 632   O OD1   . ASP A 1 97  ? -101.259 151.168 212.005 1.00 44.76  ? 97  ASP A OD1   1 
ATOM 633   O OD2   . ASP A 1 97  ? -100.744 149.246 211.097 1.00 44.76  ? 97  ASP A OD2   1 
ATOM 634   N N     . LYS A 1 98  ? -102.809 153.356 211.616 1.00 46.36  ? 98  LYS A N     1 
ATOM 635   C CA    . LYS A 1 98  ? -102.200 154.651 211.344 1.00 46.36  ? 98  LYS A CA    1 
ATOM 636   C C     . LYS A 1 98  ? -100.942 154.525 210.499 1.00 46.36  ? 98  LYS A C     1 
ATOM 637   O O     . LYS A 1 98  ? -100.171 153.570 210.622 1.00 46.36  ? 98  LYS A O     1 
ATOM 638   C CB    . LYS A 1 98  ? -101.875 155.361 212.658 1.00 46.36  ? 98  LYS A CB    1 
ATOM 639   C CG    . LYS A 1 98  ? -103.013 155.342 213.681 1.00 46.36  ? 98  LYS A CG    1 
ATOM 640   C CD    . LYS A 1 98  ? -104.217 156.008 213.056 1.00 46.36  ? 98  LYS A CD    1 
ATOM 641   C CE    . LYS A 1 98  ? -105.168 154.932 212.522 1.00 46.36  ? 98  LYS A CE    1 
ATOM 642   N NZ    . LYS A 1 98  ? -106.353 155.176 211.675 1.00 46.36  ? 98  LYS A NZ    1 
ATOM 643   N N     . GLY A 1 99  ? -100.753 155.510 209.630 1.00 48.74  ? 99  GLY A N     1 
ATOM 644   C CA    . GLY A 1 99  ? -99.677  155.607 208.680 1.00 48.74  ? 99  GLY A CA    1 
ATOM 645   C C     . GLY A 1 99  ? -100.081 155.084 207.320 1.00 48.74  ? 99  GLY A C     1 
ATOM 646   O O     . GLY A 1 99  ? -99.515  155.504 206.303 1.00 48.74  ? 99  GLY A O     1 
ATOM 647   N N     . SER A 1 100 ? -101.035 154.153 207.298 1.00 50.27  ? 100 SER A N     1 
ATOM 648   C CA    . SER A 1 100 ? -101.567 153.588 206.066 1.00 50.27  ? 100 SER A CA    1 
ATOM 649   C C     . SER A 1 100 ? -102.554 154.567 205.431 1.00 50.27  ? 100 SER A C     1 
ATOM 650   O O     . SER A 1 100 ? -103.354 155.194 206.134 1.00 50.27  ? 100 SER A O     1 
ATOM 651   C CB    . SER A 1 100 ? -102.245 152.256 206.369 1.00 50.27  ? 100 SER A CB    1 
ATOM 652   O OG    . SER A 1 100 ? -103.337 152.481 207.236 1.00 50.27  ? 100 SER A OG    1 
ATOM 653   N N     . ARG A 1 101 ? -102.561 154.618 204.104 1.00 49.13  ? 101 ARG A N     1 
ATOM 654   C CA    . ARG A 1 101 ? -103.511 155.453 203.384 1.00 49.13  ? 101 ARG A CA    1 
ATOM 655   C C     . ARG A 1 101 ? -104.758 154.616 203.048 1.00 49.13  ? 101 ARG A C     1 
ATOM 656   O O     . ARG A 1 101 ? -104.664 153.413 202.806 1.00 49.13  ? 101 ARG A O     1 
ATOM 657   C CB    . ARG A 1 101 ? -102.885 156.006 202.105 1.00 49.13  ? 101 ARG A CB    1 
ATOM 658   C CG    . ARG A 1 101 ? -102.186 157.342 202.282 1.00 49.13  ? 101 ARG A CG    1 
ATOM 659   C CD    . ARG A 1 101 ? -103.013 158.301 203.119 1.00 49.13  ? 101 ARG A CD    1 
ATOM 660   N NE    . ARG A 1 101 ? -102.568 159.687 202.989 1.00 49.13  ? 101 ARG A NE    1 
ATOM 661   C CZ    . ARG A 1 101 ? -101.296 160.076 202.938 1.00 49.13  ? 101 ARG A CZ    1 
ATOM 662   N NH1   . ARG A 1 101 ? -100.313 159.189 203.002 1.00 49.13  ? 101 ARG A NH1   1 
ATOM 663   N NH2   . ARG A 1 101 ? -101.003 161.363 202.823 1.00 49.13  ? 101 ARG A NH2   1 
ATOM 664   N N     . VAL A 1 102 ? -105.920 155.262 203.041 1.00 50.20  ? 102 VAL A N     1 
ATOM 665   C CA    . VAL A 1 102 ? -107.181 154.619 202.738 1.00 50.20  ? 102 VAL A CA    1 
ATOM 666   C C     . VAL A 1 102 ? -108.036 155.693 202.096 1.00 50.20  ? 102 VAL A C     1 
ATOM 667   O O     . VAL A 1 102 ? -107.885 156.878 202.407 1.00 50.20  ? 102 VAL A O     1 
ATOM 668   C CB    . VAL A 1 102 ? -107.862 154.090 204.010 1.00 50.20  ? 102 VAL A CB    1 
ATOM 669   C CG1   . VAL A 1 102 ? -106.921 153.164 204.762 1.00 50.20  ? 102 VAL A CG1   1 
ATOM 670   C CG2   . VAL A 1 102 ? -108.304 155.244 204.899 1.00 50.20  ? 102 VAL A CG2   1 
ATOM 671   N N     . ARG A 1 103 ? -108.927 155.272 201.199 1.00 51.80  ? 103 ARG A N     1 
ATOM 672   C CA    . ARG A 1 103 ? -109.822 156.179 200.486 1.00 51.80  ? 103 ARG A CA    1 
ATOM 673   C C     . ARG A 1 103 ? -110.760 156.925 201.427 1.00 51.80  ? 103 ARG A C     1 
ATOM 674   O O     . ARG A 1 103 ? -111.287 156.346 202.376 1.00 51.80  ? 103 ARG A O     1 
ATOM 675   C CB    . ARG A 1 103 ? -110.664 155.402 199.464 1.00 51.80  ? 103 ARG A CB    1 
ATOM 676   C CG    . ARG A 1 103 ? -109.981 155.122 198.132 1.00 51.80  ? 103 ARG A CG    1 
ATOM 677   C CD    . ARG A 1 103 ? -110.104 156.289 197.160 1.00 51.80  ? 103 ARG A CD    1 
ATOM 678   N NE    . ARG A 1 103 ? -111.283 156.190 196.301 1.00 51.80  ? 103 ARG A NE    1 
ATOM 679   C CZ    . ARG A 1 103 ? -111.246 155.997 194.984 1.00 51.80  ? 103 ARG A CZ    1 
ATOM 680   N NH1   . ARG A 1 103 ? -110.084 155.868 194.355 1.00 51.80  ? 103 ARG A NH1   1 
ATOM 681   N NH2   . ARG A 1 103 ? -112.377 155.928 194.294 1.00 51.80  ? 103 ARG A NH2   1 
ATOM 682   N N     . TYR A 1 104 ? -110.968 158.209 201.152 1.00 50.76  ? 104 TYR A N     1 
ATOM 683   C CA    . TYR A 1 104 ? -111.869 159.035 201.948 1.00 50.76  ? 104 TYR A CA    1 
ATOM 684   C C     . TYR A 1 104 ? -113.077 159.355 201.079 1.00 50.76  ? 104 TYR A C     1 
ATOM 685   O O     . TYR A 1 104 ? -113.352 158.628 200.124 1.00 50.76  ? 104 TYR A O     1 
ATOM 686   C CB    . TYR A 1 104 ? -111.184 160.323 202.401 1.00 50.76  ? 104 TYR A CB    1 
ATOM 687   N N     . ARG A 1 105 ? -113.779 160.440 201.408 1.00 48.26  ? 105 ARG A N     1 
ATOM 688   C CA    . ARG A 1 105 ? -114.965 160.895 200.668 1.00 48.26  ? 105 ARG A CA    1 
ATOM 689   C C     . ARG A 1 105 ? -115.802 161.789 201.564 1.00 48.26  ? 105 ARG A C     1 
ATOM 690   O O     . ARG A 1 105 ? -115.680 161.722 202.788 1.00 48.26  ? 105 ARG A O     1 
ATOM 691   C CB    . ARG A 1 105 ? -115.820 159.708 200.204 1.00 48.26  ? 105 ARG A CB    1 
ATOM 692   C CG    . ARG A 1 105 ? -117.262 160.041 199.853 1.00 48.26  ? 105 ARG A CG    1 
ATOM 693   C CD    . ARG A 1 105 ? -117.400 160.481 198.407 1.00 48.26  ? 105 ARG A CD    1 
ATOM 694   N NE    . ARG A 1 105 ? -118.089 159.480 197.600 1.00 48.26  ? 105 ARG A NE    1 
ATOM 695   C CZ    . ARG A 1 105 ? -117.732 158.202 197.531 1.00 48.26  ? 105 ARG A CZ    1 
ATOM 696   N NH1   . ARG A 1 105 ? -116.690 157.766 198.222 1.00 48.26  ? 105 ARG A NH1   1 
ATOM 697   N NH2   . ARG A 1 105 ? -118.415 157.359 196.771 1.00 48.26  ? 105 ARG A NH2   1 
ATOM 698   N N     . ILE A 1 106 ? -116.663 162.622 200.982 1.00 44.82  ? 106 ILE A N     1 
ATOM 699   C CA    . ILE A 1 106 ? -117.492 163.435 201.863 1.00 44.82  ? 106 ILE A CA    1 
ATOM 700   C C     . ILE A 1 106 ? -118.119 164.719 201.318 1.00 44.82  ? 106 ILE A C     1 
ATOM 701   O O     . ILE A 1 106 ? -117.556 165.412 200.473 1.00 44.82  ? 106 ILE A O     1 
ATOM 702   C CB    . ILE A 1 106 ? -116.687 163.845 203.122 1.00 44.82  ? 106 ILE A CB    1 
ATOM 703   N N     . VAL A 1 107 ? -119.296 165.017 201.857 1.00 44.90  ? 107 VAL A N     1 
ATOM 704   C CA    . VAL A 1 107 ? -120.042 166.242 201.588 1.00 44.90  ? 107 VAL A CA    1 
ATOM 705   C C     . VAL A 1 107 ? -120.237 167.007 202.901 1.00 44.90  ? 107 VAL A C     1 
ATOM 706   O O     . VAL A 1 107 ? -120.518 166.409 203.947 1.00 44.90  ? 107 VAL A O     1 
ATOM 707   C CB    . VAL A 1 107 ? -121.368 165.933 200.878 1.00 44.90  ? 107 VAL A CB    1 
ATOM 708   C CG1   . VAL A 1 107 ? -122.329 165.270 201.811 1.00 44.90  ? 107 VAL A CG1   1 
ATOM 709   C CG2   . VAL A 1 107 ? -121.949 167.193 200.337 1.00 44.90  ? 107 VAL A CG2   1 
ATOM 710   N N     . ALA A 1 108 ? -119.990 168.324 202.851 1.00 44.41  ? 108 ALA A N     1 
ATOM 711   C CA    . ALA A 1 108 ? -120.051 169.225 203.998 1.00 44.41  ? 108 ALA A CA    1 
ATOM 712   C C     . ALA A 1 108 ? -120.408 170.626 203.502 1.00 44.41  ? 108 ALA A C     1 
ATOM 713   O O     . ALA A 1 108 ? -120.610 170.840 202.316 1.00 44.41  ? 108 ALA A O     1 
ATOM 714   C CB    . ALA A 1 108 ? -118.715 169.216 204.747 1.00 44.41  ? 108 ALA A CB    1 
ATOM 715   N N     . SER A 1 109 ? -120.591 171.565 204.425 1.00 42.55  ? 109 SER A N     1 
ATOM 716   C CA    . SER A 1 109 ? -120.921 172.955 204.090 1.00 42.55  ? 109 SER A CA    1 
ATOM 717   C C     . SER A 1 109 ? -119.984 173.971 204.728 1.00 42.55  ? 109 SER A C     1 
ATOM 718   O O     . SER A 1 109 ? -120.255 174.458 205.836 1.00 42.55  ? 109 SER A O     1 
ATOM 719   C CB    . SER A 1 109 ? -122.353 173.280 204.471 1.00 42.55  ? 109 SER A CB    1 
ATOM 720   O OG    . SER A 1 109 ? -122.695 174.595 204.067 1.00 42.55  ? 109 SER A OG    1 
ATOM 721   N N     . PRO A 1 110 ? -118.872 174.312 204.079 1.00 44.74  ? 110 PRO A N     1 
ATOM 722   C CA    . PRO A 1 110 ? -117.997 175.334 204.663 1.00 44.74  ? 110 PRO A CA    1 
ATOM 723   C C     . PRO A 1 110 ? -118.710 176.658 204.827 1.00 44.74  ? 110 PRO A C     1 
ATOM 724   O O     . PRO A 1 110 ? -119.493 177.077 203.970 1.00 44.74  ? 110 PRO A O     1 
ATOM 725   C CB    . PRO A 1 110 ? -116.869 175.464 203.630 1.00 44.74  ? 110 PRO A CB    1 
ATOM 726   C CG    . PRO A 1 110 ? -117.463 174.957 202.352 1.00 44.74  ? 110 PRO A CG    1 
ATOM 727   C CD    . PRO A 1 110 ? -118.409 173.872 202.758 1.00 44.74  ? 110 PRO A CD    1 
ATOM 728   N N     . THR A 1 111 ? -118.500 177.259 205.993 1.00 42.37  ? 111 THR A N     1 
ATOM 729   C CA    . THR A 1 111 ? -119.186 178.476 206.343 1.00 42.37  ? 111 THR A CA    1 
ATOM 730   C C     . THR A 1 111 ? -118.280 179.381 207.152 1.00 42.37  ? 111 THR A C     1 
ATOM 731   O O     . THR A 1 111 ? -117.246 178.970 207.673 1.00 42.37  ? 111 THR A O     1 
ATOM 732   C CB    . THR A 1 111 ? -120.434 178.180 207.169 1.00 42.37  ? 111 THR A CB    1 
ATOM 733   N N     . LYS A 1 112 ? -118.810 180.593 207.357 1.00 43.19  ? 112 LYS A N     1 
ATOM 734   C CA    . LYS A 1 112 ? -118.251 181.675 208.174 1.00 43.19  ? 112 LYS A CA    1 
ATOM 735   C C     . LYS A 1 112 ? -119.469 182.405 208.813 1.00 43.19  ? 112 LYS A C     1 
ATOM 736   O O     . LYS A 1 112 ? -120.279 182.977 208.084 1.00 43.19  ? 112 LYS A O     1 
ATOM 737   C CB    . LYS A 1 112 ? -117.381 182.608 207.312 1.00 43.19  ? 112 LYS A CB    1 
ATOM 738   C CG    . LYS A 1 112 ? -117.814 184.068 207.209 1.00 43.19  ? 112 LYS A CG    1 
ATOM 739   C CD    . LYS A 1 112 ? -116.804 184.987 207.875 1.00 43.19  ? 112 LYS A CD    1 
ATOM 740   C CE    . LYS A 1 112 ? -117.332 186.408 207.981 1.00 43.19  ? 112 LYS A CE    1 
ATOM 741   N NZ    . LYS A 1 112 ? -116.610 187.189 209.023 1.00 43.19  ? 112 LYS A NZ    1 
ATOM 742   N N     . ARG A 1 113 ? -119.613 182.391 210.144 1.00 46.69  ? 113 ARG A N     1 
ATOM 743   C CA    . ARG A 1 113 ? -120.758 183.022 210.759 1.00 46.69  ? 113 ARG A CA    1 
ATOM 744   C C     . ARG A 1 113 ? -120.359 184.420 211.190 1.00 46.69  ? 113 ARG A C     1 
ATOM 745   O O     . ARG A 1 113 ? -119.263 184.649 211.703 1.00 46.69  ? 113 ARG A O     1 
ATOM 746   C CB    . ARG A 1 113 ? -121.269 182.253 211.954 1.00 46.69  ? 113 ARG A CB    1 
ATOM 747   C CG    . ARG A 1 113 ? -120.177 182.008 212.901 1.00 46.69  ? 113 ARG A CG    1 
ATOM 748   C CD    . ARG A 1 113 ? -120.675 181.935 214.286 1.00 46.69  ? 113 ARG A CD    1 
ATOM 749   N NE    . ARG A 1 113 ? -119.545 181.809 215.195 1.00 46.69  ? 113 ARG A NE    1 
ATOM 750   C CZ    . ARG A 1 113 ? -118.531 180.956 215.052 1.00 46.69  ? 113 ARG A CZ    1 
ATOM 751   N NH1   . ARG A 1 113 ? -118.498 180.050 214.073 1.00 46.69  ? 113 ARG A NH1   1 
ATOM 752   N NH2   . ARG A 1 113 ? -117.596 180.919 216.003 1.00 46.69  ? 113 ARG A NH2   1 
ATOM 753   N N     . LEU A 1 114 ? -121.192 185.400 210.871 1.00 47.53  ? 114 LEU A N     1 
ATOM 754   C CA    . LEU A 1 114 ? -120.839 186.779 211.178 1.00 47.53  ? 114 LEU A CA    1 
ATOM 755   C C     . LEU A 1 114 ? -122.049 187.673 211.282 1.00 47.53  ? 114 LEU A C     1 
ATOM 756   O O     . LEU A 1 114 ? -123.051 187.483 210.591 1.00 47.53  ? 114 LEU A O     1 
ATOM 757   C CB    . LEU A 1 114 ? -119.884 187.335 210.122 1.00 47.53  ? 114 LEU A CB    1 
ATOM 758   N N     . GLY A 1 115 ? -121.937 188.663 212.155 1.00 47.81  ? 115 GLY A N     1 
ATOM 759   C CA    . GLY A 1 115 ? -123.029 189.584 212.403 1.00 47.81  ? 115 GLY A CA    1 
ATOM 760   C C     . GLY A 1 115 ? -123.661 190.012 211.087 1.00 47.81  ? 115 GLY A C     1 
ATOM 761   O O     . GLY A 1 115 ? -122.973 190.414 210.141 1.00 47.81  ? 115 GLY A O     1 
ATOM 762   N N     . ARG A 1 116 ? -124.985 189.935 211.032 1.00 51.75  ? 116 ARG A N     1 
ATOM 763   C CA    . ARG A 1 116 ? -125.774 190.209 209.840 1.00 51.75  ? 116 ARG A CA    1 
ATOM 764   C C     . ARG A 1 116 ? -126.537 191.506 210.057 1.00 51.75  ? 116 ARG A C     1 
ATOM 765   O O     . ARG A 1 116 ? -127.109 191.718 211.131 1.00 51.75  ? 116 ARG A O     1 
ATOM 766   C CB    . ARG A 1 116 ? -126.778 189.074 209.588 1.00 51.75  ? 116 ARG A CB    1 
ATOM 767   C CG    . ARG A 1 116 ? -127.794 189.369 208.496 1.00 51.75  ? 116 ARG A CG    1 
ATOM 768   C CD    . ARG A 1 116 ? -128.631 188.169 208.077 1.00 51.75  ? 116 ARG A CD    1 
ATOM 769   N NE    . ARG A 1 116 ? -127.890 187.011 207.613 1.00 51.75  ? 116 ARG A NE    1 
ATOM 770   C CZ    . ARG A 1 116 ? -128.442 185.815 207.463 1.00 51.75  ? 116 ARG A CZ    1 
ATOM 771   N NH1   . ARG A 1 116 ? -129.737 185.656 207.687 1.00 51.75  ? 116 ARG A NH1   1 
ATOM 772   N NH2   . ARG A 1 116 ? -127.721 184.796 207.024 1.00 51.75  ? 116 ARG A NH2   1 
ATOM 773   N N     . SER A 1 117 ? -126.521 192.378 209.053 1.00 55.08  ? 117 SER A N     1 
ATOM 774   C CA    . SER A 1 117 ? -127.364 193.565 209.093 1.00 55.08  ? 117 SER A CA    1 
ATOM 775   C C     . SER A 1 117 ? -128.830 193.165 209.259 1.00 55.08  ? 117 SER A C     1 
ATOM 776   O O     . SER A 1 117 ? -129.237 192.065 208.880 1.00 55.08  ? 117 SER A O     1 
ATOM 777   C CB    . SER A 1 117 ? -127.173 194.391 207.816 1.00 55.08  ? 117 SER A CB    1 
ATOM 778   O OG    . SER A 1 117 ? -127.931 195.585 207.861 1.00 55.08  ? 117 SER A OG    1 
ATOM 779   N N     . GLU A 1 118 ? -129.621 194.076 209.840 1.00 54.47  ? 118 GLU A N     1 
ATOM 780   C CA    . GLU A 1 118 ? -131.052 193.873 210.142 1.00 54.47  ? 118 GLU A CA    1 
ATOM 781   C C     . GLU A 1 118 ? -131.314 192.530 210.832 1.00 54.47  ? 118 GLU A C     1 
ATOM 782   O O     . GLU A 1 118 ? -132.338 191.881 210.606 1.00 54.47  ? 118 GLU A O     1 
ATOM 783   C CB    . GLU A 1 118 ? -131.953 194.028 208.901 1.00 54.47  ? 118 GLU A CB    1 
ATOM 784   C CG    . GLU A 1 118 ? -131.888 192.941 207.814 1.00 54.47  ? 118 GLU A CG    1 
ATOM 785   C CD    . GLU A 1 118 ? -132.474 193.393 206.483 1.00 54.47  ? 118 GLU A CD    1 
ATOM 786   O OE1   . GLU A 1 118 ? -132.872 194.573 206.366 1.00 54.47  ? 118 GLU A OE1   1 
ATOM 787   O OE2   . GLU A 1 118 ? -132.523 192.570 205.544 1.00 54.47  ? 118 GLU A OE2   1 
ATOM 788   N N     . THR A 1 121 ? -127.482 186.577 213.875 1.00 50.62  ? 121 THR A N     1 
ATOM 789   C CA    . THR A 1 121 ? -126.284 185.932 213.357 1.00 50.62  ? 121 THR A CA    1 
ATOM 790   C C     . THR A 1 121 ? -126.553 185.257 212.023 1.00 50.62  ? 121 THR A C     1 
ATOM 791   O O     . THR A 1 121 ? -127.696 184.961 211.658 1.00 50.62  ? 121 THR A O     1 
ATOM 792   C CB    . THR A 1 121 ? -125.749 184.895 214.350 1.00 50.62  ? 121 THR A CB    1 
ATOM 793   O OG1   . THR A 1 121 ? -124.487 184.395 213.894 1.00 50.62  ? 121 THR A OG1   1 
ATOM 794   C CG2   . THR A 1 121 ? -126.719 183.727 214.465 1.00 50.62  ? 121 THR A CG2   1 
ATOM 795   N N     . GLN A 1 122 ? -125.470 185.038 211.278 1.00 47.88  ? 122 GLN A N     1 
ATOM 796   C CA    . GLN A 1 122 ? -125.589 184.516 209.930 1.00 47.88  ? 122 GLN A CA    1 
ATOM 797   C C     . GLN A 1 122 ? -124.560 183.428 209.669 1.00 47.88  ? 122 GLN A C     1 
ATOM 798   O O     . GLN A 1 122 ? -123.375 183.586 209.977 1.00 47.88  ? 122 GLN A O     1 
ATOM 799   C CB    . GLN A 1 122 ? -125.454 185.644 208.908 1.00 47.88  ? 122 GLN A CB    1 
ATOM 800   C CG    . GLN A 1 122 ? -124.154 186.400 208.879 1.00 47.88  ? 122 GLN A CG    1 
ATOM 801   C CD    . GLN A 1 122 ? -124.090 187.322 207.692 1.00 47.88  ? 122 GLN A CD    1 
ATOM 802   O OE1   . GLN A 1 122 ? -125.006 187.350 206.873 1.00 47.88  ? 122 GLN A OE1   1 
ATOM 803   N NE2   . GLN A 1 122 ? -123.006 188.075 207.576 1.00 47.88  ? 122 GLN A NE2   1 
ATOM 804   N N     . ARG A 1 123 ? -125.039 182.333 209.092 1.00 47.65  ? 123 ARG A N     1 
ATOM 805   C CA    . ARG A 1 123 ? -124.188 181.240 208.690 1.00 47.65  ? 123 ARG A CA    1 
ATOM 806   C C     . ARG A 1 123 ? -123.871 181.779 207.316 1.00 47.65  ? 123 ARG A C     1 
ATOM 807   O O     . ARG A 1 123 ? -124.528 182.722 206.875 1.00 47.65  ? 123 ARG A O     1 
ATOM 808   C CB    . ARG A 1 123 ? -124.979 179.939 208.591 1.00 47.65  ? 123 ARG A CB    1 
ATOM 809   C CG    . ARG A 1 123 ? -124.685 178.948 209.705 1.00 47.65  ? 123 ARG A CG    1 
ATOM 810   C CD    . ARG A 1 123 ? -125.969 178.413 210.320 1.00 47.65  ? 123 ARG A CD    1 
ATOM 811   N NE    . ARG A 1 123 ? -125.786 178.027 211.717 1.00 47.65  ? 123 ARG A NE    1 
ATOM 812   C CZ    . ARG A 1 123 ? -126.249 176.901 212.247 1.00 47.65  ? 123 ARG A CZ    1 
ATOM 813   N NH1   . ARG A 1 123 ? -126.925 176.041 211.497 1.00 47.65  ? 123 ARG A NH1   1 
ATOM 814   N NH2   . ARG A 1 123 ? -126.036 176.631 213.528 1.00 47.65  ? 123 ARG A NH2   1 
ATOM 815   N N     . LEU A 1 124 ? -122.888 181.235 206.619 1.00 45.38  ? 124 LEU A N     1 
ATOM 816   C CA    . LEU A 1 124 ? -122.603 181.809 205.307 1.00 45.38  ? 124 LEU A CA    1 
ATOM 817   C C     . LEU A 1 124 ? -121.607 180.932 204.570 1.00 45.38  ? 124 LEU A C     1 
ATOM 818   O O     . LEU A 1 124 ? -120.509 180.676 205.063 1.00 45.38  ? 124 LEU A O     1 
ATOM 819   C CB    . LEU A 1 124 ? -122.133 183.257 205.448 1.00 45.38  ? 124 LEU A CB    1 
ATOM 820   C CG    . LEU A 1 124 ? -121.533 183.986 204.254 1.00 45.38  ? 124 LEU A CG    1 
ATOM 821   C CD1   . LEU A 1 124 ? -121.990 185.416 204.257 1.00 45.38  ? 124 LEU A CD1   1 
ATOM 822   C CD2   . LEU A 1 124 ? -120.043 183.984 204.445 1.00 45.38  ? 124 LEU A CD2   1 
ATOM 823   N N     . THR A 1 137 ? -109.559 184.527 201.375 1.00 49.99  ? 137 THR A N     1 
ATOM 824   C CA    . THR A 1 137 ? -108.733 183.356 201.109 1.00 49.99  ? 137 THR A CA    1 
ATOM 825   C C     . THR A 1 137 ? -109.585 182.090 201.014 1.00 49.99  ? 137 THR A C     1 
ATOM 826   O O     . THR A 1 137 ? -109.469 181.341 200.048 1.00 49.99  ? 137 THR A O     1 
ATOM 827   C CB    . THR A 1 137 ? -107.653 183.162 202.192 1.00 49.99  ? 137 THR A CB    1 
ATOM 828   O OG1   . THR A 1 137 ? -107.298 184.432 202.756 1.00 49.99  ? 137 THR A OG1   1 
ATOM 829   C CG2   . THR A 1 137 ? -106.411 182.504 201.605 1.00 49.99  ? 137 THR A CG2   1 
ATOM 830   N N     . TRP A 1 138 ? -110.439 181.846 202.009 1.00 48.36  ? 138 TRP A N     1 
ATOM 831   C CA    . TRP A 1 138 ? -110.598 182.728 203.167 1.00 48.36  ? 138 TRP A CA    1 
ATOM 832   C C     . TRP A 1 138 ? -110.627 181.943 204.479 1.00 48.36  ? 138 TRP A C     1 
ATOM 833   O O     . TRP A 1 138 ? -109.805 182.162 205.371 1.00 48.36  ? 138 TRP A O     1 
ATOM 834   C CB    . TRP A 1 138 ? -111.875 183.558 203.022 1.00 48.36  ? 138 TRP A CB    1 
ATOM 835   C CG    . TRP A 1 138 ? -111.655 185.034 203.123 1.00 48.36  ? 138 TRP A CG    1 
ATOM 836   C CD1   . TRP A 1 138 ? -110.656 185.671 203.797 1.00 48.36  ? 138 TRP A CD1   1 
ATOM 837   C CD2   . TRP A 1 138 ? -112.460 186.062 202.533 1.00 48.36  ? 138 TRP A CD2   1 
ATOM 838   N NE1   . TRP A 1 138 ? -110.787 187.032 203.662 1.00 48.36  ? 138 TRP A NE1   1 
ATOM 839   C CE2   . TRP A 1 138 ? -111.888 187.297 202.890 1.00 48.36  ? 138 TRP A CE2   1 
ATOM 840   C CE3   . TRP A 1 138 ? -113.609 186.057 201.736 1.00 48.36  ? 138 TRP A CE3   1 
ATOM 841   C CZ2   . TRP A 1 138 ? -112.425 188.512 202.479 1.00 48.36  ? 138 TRP A CZ2   1 
ATOM 842   C CZ3   . TRP A 1 138 ? -114.140 187.265 201.331 1.00 48.36  ? 138 TRP A CZ3   1 
ATOM 843   C CH2   . TRP A 1 138 ? -113.549 188.475 201.702 1.00 48.36  ? 138 TRP A CH2   1 
ATOM 844   N N     . LEU A 1 140 ? -116.360 180.299 199.324 1.00 47.12  ? 140 LEU A N     1 
ATOM 845   C CA    . LEU A 1 140 ? -115.700 181.125 198.311 1.00 47.12  ? 140 LEU A CA    1 
ATOM 846   C C     . LEU A 1 140 ? -114.660 180.360 197.476 1.00 47.12  ? 140 LEU A C     1 
ATOM 847   O O     . LEU A 1 140 ? -115.005 179.419 196.763 1.00 47.12  ? 140 LEU A O     1 
ATOM 848   C CB    . LEU A 1 140 ? -115.097 182.384 198.951 1.00 47.12  ? 140 LEU A CB    1 
ATOM 849   N N     . ARG A 1 141 ? -113.397 180.771 197.564 1.00 49.22  ? 141 ARG A N     1 
ATOM 850   C CA    . ARG A 1 141 ? -112.318 180.140 196.808 1.00 49.22  ? 141 ARG A CA    1 
ATOM 851   C C     . ARG A 1 141 ? -112.055 178.690 197.210 1.00 49.22  ? 141 ARG A C     1 
ATOM 852   O O     . ARG A 1 141 ? -112.766 178.122 198.039 1.00 49.22  ? 141 ARG A O     1 
ATOM 853   C CB    . ARG A 1 141 ? -111.030 180.958 196.936 1.00 49.22  ? 141 ARG A CB    1 
ATOM 854   C CG    . ARG A 1 141 ? -111.158 182.395 196.460 1.00 49.22  ? 141 ARG A CG    1 
ATOM 855   C CD    . ARG A 1 141 ? -111.836 183.265 197.504 1.00 49.22  ? 141 ARG A CD    1 
ATOM 856   N NE    . ARG A 1 141 ? -111.993 184.644 197.050 1.00 49.22  ? 141 ARG A NE    1 
ATOM 857   C CZ    . ARG A 1 141 ? -113.061 185.101 196.404 1.00 49.22  ? 141 ARG A CZ    1 
ATOM 858   N NH1   . ARG A 1 141 ? -114.072 184.287 196.133 1.00 49.22  ? 141 ARG A NH1   1 
ATOM 859   N NH2   . ARG A 1 141 ? -113.118 186.371 196.028 1.00 49.22  ? 141 ARG A NH2   1 
ATOM 860   N N     . GLY A 1 142 ? -111.025 178.104 196.614 1.00 49.53  ? 142 GLY A N     1 
ATOM 861   C CA    . GLY A 1 142 ? -110.675 176.730 196.899 1.00 49.53  ? 142 GLY A CA    1 
ATOM 862   C C     . GLY A 1 142 ? -109.534 176.560 197.880 1.00 49.53  ? 142 GLY A C     1 
ATOM 863   O O     . GLY A 1 142 ? -108.991 175.461 197.998 1.00 49.53  ? 142 GLY A O     1 
ATOM 864   N N     . ALA A 1 143 ? -109.154 177.621 198.589 1.00 48.26  ? 143 ALA A N     1 
ATOM 865   C CA    . ALA A 1 143 ? -108.057 177.463 199.538 1.00 48.26  ? 143 ALA A CA    1 
ATOM 866   C C     . ALA A 1 143 ? -108.470 177.570 201.001 1.00 48.26  ? 143 ALA A C     1 
ATOM 867   O O     . ALA A 1 143 ? -107.892 176.874 201.845 1.00 48.26  ? 143 ALA A O     1 
ATOM 868   C CB    . ALA A 1 143 ? -106.973 178.506 199.242 1.00 48.26  ? 143 ALA A CB    1 
ATOM 869   N N     . ALA A 1 144 ? -109.456 178.402 201.338 1.00 46.51  ? 144 ALA A N     1 
ATOM 870   C CA    . ALA A 1 144 ? -109.959 178.422 202.708 1.00 46.51  ? 144 ALA A CA    1 
ATOM 871   C C     . ALA A 1 144 ? -110.992 177.341 202.955 1.00 46.51  ? 144 ALA A C     1 
ATOM 872   O O     . ALA A 1 144 ? -111.398 177.142 204.101 1.00 46.51  ? 144 ALA A O     1 
ATOM 873   C CB    . ALA A 1 144 ? -110.559 179.772 203.061 1.00 46.51  ? 144 ALA A CB    1 
ATOM 874   N N     . ALA A 1 145 ? -111.489 176.715 201.893 1.00 46.40  ? 145 ALA A N     1 
ATOM 875   C CA    . ALA A 1 145 ? -112.268 175.497 202.034 1.00 46.40  ? 145 ALA A CA    1 
ATOM 876   C C     . ALA A 1 145 ? -111.353 174.344 202.375 1.00 46.40  ? 145 ALA A C     1 
ATOM 877   O O     . ALA A 1 145 ? -111.663 173.519 203.250 1.00 46.40  ? 145 ALA A O     1 
ATOM 878   C CB    . ALA A 1 145 ? -113.036 175.201 200.747 1.00 46.40  ? 145 ALA A CB    1 
ATOM 879   N N     . GLU A 1 146 ? -110.164 174.342 201.767 1.00 43.81  ? 146 GLU A N     1 
ATOM 880   C CA    . GLU A 1 146 ? -109.152 173.394 202.198 1.00 43.81  ? 146 GLU A CA    1 
ATOM 881   C C     . GLU A 1 146 ? -108.665 173.689 203.613 1.00 43.81  ? 146 GLU A C     1 
ATOM 882   O O     . GLU A 1 146 ? -108.541 172.765 204.439 1.00 43.81  ? 146 GLU A O     1 
ATOM 883   C CB    . GLU A 1 146 ? -108.009 173.414 201.175 1.00 43.81  ? 146 GLU A CB    1 
ATOM 884   C CG    . GLU A 1 146 ? -106.869 172.416 201.342 1.00 43.81  ? 146 GLU A CG    1 
ATOM 885   C CD    . GLU A 1 146 ? -105.889 172.760 202.439 1.00 43.81  ? 146 GLU A CD    1 
ATOM 886   O OE1   . GLU A 1 146 ? -105.669 173.962 202.695 1.00 43.81  ? 146 GLU A OE1   1 
ATOM 887   O OE2   . GLU A 1 146 ? -105.299 171.818 203.007 1.00 43.81  ? 146 GLU A OE2   1 
ATOM 888   N N     . GLU A 1 147 ? -108.468 174.966 203.942 1.00 42.65  ? 147 GLU A N     1 
ATOM 889   C CA    . GLU A 1 147 ? -108.134 175.303 205.316 1.00 42.65  ? 147 GLU A CA    1 
ATOM 890   C C     . GLU A 1 147 ? -109.229 174.860 206.283 1.00 42.65  ? 147 GLU A C     1 
ATOM 891   O O     . GLU A 1 147 ? -108.962 174.122 207.241 1.00 42.65  ? 147 GLU A O     1 
ATOM 892   C CB    . GLU A 1 147 ? -107.878 176.814 205.377 1.00 42.65  ? 147 GLU A CB    1 
ATOM 893   C CG    . GLU A 1 147 ? -107.361 177.391 206.681 1.00 42.65  ? 147 GLU A CG    1 
ATOM 894   C CD    . GLU A 1 147 ? -108.420 177.443 207.752 1.00 42.65  ? 147 GLU A CD    1 
ATOM 895   O OE1   . GLU A 1 147 ? -109.604 177.623 207.397 1.00 42.65  ? 147 GLU A OE1   1 
ATOM 896   O OE2   . GLU A 1 147 ? -108.076 177.303 208.942 1.00 42.65  ? 147 GLU A OE2   1 
ATOM 897   N N     . TRP A 1 148 ? -110.473 175.291 206.041 1.00 42.57  ? 148 TRP A N     1 
ATOM 898   C CA    . TRP A 1 148 ? -111.647 174.847 206.790 1.00 42.57  ? 148 TRP A CA    1 
ATOM 899   C C     . TRP A 1 148 ? -111.750 173.361 207.064 1.00 42.57  ? 148 TRP A C     1 
ATOM 900   O O     . TRP A 1 148 ? -112.017 172.940 208.199 1.00 42.57  ? 148 TRP A O     1 
ATOM 901   C CB    . TRP A 1 148 ? -112.903 175.308 206.043 1.00 42.57  ? 148 TRP A CB    1 
ATOM 902   C CG    . TRP A 1 148 ? -114.240 174.970 206.671 1.00 42.57  ? 148 TRP A CG    1 
ATOM 903   C CD1   . TRP A 1 148 ? -114.953 175.692 207.585 1.00 42.57  ? 148 TRP A CD1   1 
ATOM 904   C CD2   . TRP A 1 148 ? -115.076 173.875 206.297 1.00 42.57  ? 148 TRP A CD2   1 
ATOM 905   N NE1   . TRP A 1 148 ? -116.152 175.078 207.846 1.00 42.57  ? 148 TRP A NE1   1 
ATOM 906   C CE2   . TRP A 1 148 ? -116.251 173.956 207.068 1.00 42.57  ? 148 TRP A CE2   1 
ATOM 907   C CE3   . TRP A 1 148 ? -114.930 172.811 205.400 1.00 42.57  ? 148 TRP A CE3   1 
ATOM 908   C CZ2   . TRP A 1 148 ? -117.275 173.014 206.970 1.00 42.57  ? 148 TRP A CZ2   1 
ATOM 909   C CZ3   . TRP A 1 148 ? -115.946 171.876 205.300 1.00 42.57  ? 148 TRP A CZ3   1 
ATOM 910   C CH2   . TRP A 1 148 ? -117.105 171.985 206.079 1.00 42.57  ? 148 TRP A CH2   1 
ATOM 911   N N     . TRP A 1 149 ? -111.561 172.565 206.017 1.00 43.20  ? 149 TRP A N     1 
ATOM 912   C CA    . TRP A 1 149 ? -111.661 171.113 206.114 1.00 43.20  ? 149 TRP A CA    1 
ATOM 913   C C     . TRP A 1 149 ? -110.569 170.462 206.957 1.00 43.20  ? 149 TRP A C     1 
ATOM 914   O O     . TRP A 1 149 ? -110.861 169.657 207.841 1.00 43.20  ? 149 TRP A O     1 
ATOM 915   C CB    . TRP A 1 149 ? -111.678 170.488 204.716 1.00 43.20  ? 149 TRP A CB    1 
ATOM 916   N N     . HIS A 1 150 ? -109.315 170.802 206.681 1.00 42.46  ? 150 HIS A N     1 
ATOM 917   C CA    . HIS A 1 150 ? -108.200 170.207 207.424 1.00 42.46  ? 150 HIS A CA    1 
ATOM 918   C C     . HIS A 1 150 ? -108.265 170.705 208.869 1.00 42.46  ? 150 HIS A C     1 
ATOM 919   O O     . HIS A 1 150 ? -107.685 170.089 209.771 1.00 42.46  ? 150 HIS A O     1 
ATOM 920   C CB    . HIS A 1 150 ? -106.813 170.426 206.785 1.00 42.46  ? 150 HIS A CB    1 
ATOM 921   C CG    . HIS A 1 150 ? -106.341 171.842 206.721 1.00 42.46  ? 150 HIS A CG    1 
ATOM 922   N ND1   . HIS A 1 150 ? -106.116 172.610 207.844 1.00 42.46  ? 150 HIS A ND1   1 
ATOM 923   C CD2   . HIS A 1 150 ? -105.904 172.579 205.676 1.00 42.46  ? 150 HIS A CD2   1 
ATOM 924   C CE1   . HIS A 1 150 ? -105.653 173.793 207.483 1.00 42.46  ? 150 HIS A CE1   1 
ATOM 925   N NE2   . HIS A 1 150 ? -105.504 173.794 206.171 1.00 42.46  ? 150 HIS A NE2   1 
ATOM 926   N N     . SER A 1 151 ? -108.961 171.828 209.080 1.00 40.32  ? 151 SER A N     1 
ATOM 927   C CA    . SER A 1 151 ? -109.332 172.249 210.425 1.00 40.32  ? 151 SER A CA    1 
ATOM 928   C C     . SER A 1 151 ? -110.328 171.247 211.022 1.00 40.32  ? 151 SER A C     1 
ATOM 929   O O     . SER A 1 151 ? -110.152 170.805 212.162 1.00 40.32  ? 151 SER A O     1 
ATOM 930   C CB    . SER A 1 151 ? -109.905 173.664 210.383 1.00 40.32  ? 151 SER A CB    1 
ATOM 931   O OG    . SER A 1 151 ? -109.041 174.514 209.647 1.00 40.32  ? 151 SER A OG    1 
ATOM 932   N N     . ARG A 1 152 ? -111.321 170.854 210.232 1.00 40.86  ? 152 ARG A N     1 
ATOM 933   C CA    . ARG A 1 152 ? -112.311 169.880 210.672 1.00 40.86  ? 152 ARG A CA    1 
ATOM 934   C C     . ARG A 1 152 ? -111.665 168.558 211.101 1.00 40.86  ? 152 ARG A C     1 
ATOM 935   O O     . ARG A 1 152 ? -111.965 168.041 212.177 1.00 40.86  ? 152 ARG A O     1 
ATOM 936   C CB    . ARG A 1 152 ? -113.341 169.627 209.568 1.00 40.86  ? 152 ARG A CB    1 
ATOM 937   C CG    . ARG A 1 152 ? -114.356 170.745 209.398 1.00 40.86  ? 152 ARG A CG    1 
ATOM 938   C CD    . ARG A 1 152 ? -115.231 170.889 210.632 1.00 40.86  ? 152 ARG A CD    1 
ATOM 939   N NE    . ARG A 1 152 ? -116.398 171.730 210.380 1.00 40.86  ? 152 ARG A NE    1 
ATOM 940   C CZ    . ARG A 1 152 ? -116.355 173.054 210.268 1.00 40.86  ? 152 ARG A CZ    1 
ATOM 941   N NH1   . ARG A 1 152 ? -115.200 173.694 210.386 1.00 40.86  ? 152 ARG A NH1   1 
ATOM 942   N NH2   . ARG A 1 152 ? -117.467 173.738 210.039 1.00 40.86  ? 152 ARG A NH2   1 
ATOM 943   N N     . ALA A 1 153 ? -110.783 168.011 210.264 1.00 43.76  ? 153 ALA A N     1 
ATOM 944   C CA    . ALA A 1 153 ? -110.123 166.751 210.588 1.00 43.76  ? 153 ALA A CA    1 
ATOM 945   C C     . ALA A 1 153 ? -109.123 166.901 211.724 1.00 43.76  ? 153 ALA A C     1 
ATOM 946   O O     . ALA A 1 153 ? -109.054 166.038 212.606 1.00 43.76  ? 153 ALA A O     1 
ATOM 947   C CB    . ALA A 1 153 ? -109.426 166.198 209.348 1.00 43.76  ? 153 ALA A CB    1 
ATOM 948   N N     . ALA A 1 154 ? -108.350 167.979 211.728 1.00 42.52  ? 154 ALA A N     1 
ATOM 949   C CA    . ALA A 1 154 ? -107.459 168.296 212.854 1.00 42.52  ? 154 ALA A CA    1 
ATOM 950   C C     . ALA A 1 154 ? -106.463 167.146 213.028 1.00 42.52  ? 154 ALA A C     1 
ATOM 951   O O     . ALA A 1 154 ? -105.860 166.724 212.028 1.00 42.52  ? 154 ALA A O     1 
ATOM 952   C CB    . ALA A 1 154 ? -108.313 168.639 214.074 1.00 42.52  ? 154 ALA A CB    1 
ATOM 953   N N     . ALA A 1 155 ? -106.249 166.630 214.249 1.00 43.06  ? 155 ALA A N     1 
ATOM 954   C CA    . ALA A 1 155 ? -105.291 165.566 214.561 1.00 43.06  ? 155 ALA A CA    1 
ATOM 955   C C     . ALA A 1 155 ? -105.751 164.183 214.121 1.00 43.06  ? 155 ALA A C     1 
ATOM 956   O O     . ALA A 1 155 ? -104.967 163.229 214.206 1.00 43.06  ? 155 ALA A O     1 
ATOM 957   C CB    . ALA A 1 155 ? -105.003 165.534 216.066 1.00 43.06  ? 155 ALA A CB    1 
ATOM 958   N N     . ASN A 1 156 ? -106.988 164.063 213.638 1.00 44.87  ? 156 ASN A N     1 
ATOM 959   C CA    . ASN A 1 156 ? -107.543 162.782 213.221 1.00 44.87  ? 156 ASN A CA    1 
ATOM 960   C C     . ASN A 1 156 ? -106.857 162.147 212.030 1.00 44.87  ? 156 ASN A C     1 
ATOM 961   O O     . ASN A 1 156 ? -105.804 161.522 212.175 1.00 44.87  ? 156 ASN A O     1 
ATOM 962   C CB    . ASN A 1 156 ? -109.062 162.874 212.981 1.00 44.87  ? 156 ASN A CB    1 
ATOM 963   C CG    . ASN A 1 156 ? -109.794 163.465 214.167 1.00 44.87  ? 156 ASN A CG    1 
ATOM 964   O OD1   . ASN A 1 156 ? -109.287 163.369 215.281 1.00 44.87  ? 156 ASN A OD1   1 
ATOM 965   N ND2   . ASN A 1 156 ? -111.026 163.958 213.969 1.00 44.87  ? 156 ASN A ND2   1 
ATOM 966   N N     . GLY A 1 157 ? -107.459 162.283 210.866 1.00 47.25  ? 157 GLY A N     1 
ATOM 967   C CA    . GLY A 1 157 ? -106.915 161.752 209.644 1.00 47.25  ? 157 GLY A CA    1 
ATOM 968   C C     . GLY A 1 157 ? -106.560 162.864 208.695 1.00 47.25  ? 157 GLY A C     1 
ATOM 969   O O     . GLY A 1 157 ? -107.370 163.751 208.392 1.00 47.25  ? 157 GLY A O     1 
ATOM 970   N N     . LEU A 1 158 ? -105.316 162.816 208.231 1.00 49.35  ? 158 LEU A N     1 
ATOM 971   C CA    . LEU A 1 158 ? -104.859 163.818 207.304 1.00 49.35  ? 158 LEU A CA    1 
ATOM 972   C C     . LEU A 1 158 ? -105.361 163.482 205.917 1.00 49.35  ? 158 LEU A C     1 
ATOM 973   O O     . LEU A 1 158 ? -105.224 162.343 205.450 1.00 49.35  ? 158 LEU A O     1 
ATOM 974   C CB    . LEU A 1 158 ? -103.329 163.720 207.291 1.00 49.35  ? 158 LEU A CB    1 
ATOM 975   C CG    . LEU A 1 158 ? -102.212 164.258 206.377 1.00 49.35  ? 158 LEU A CG    1 
ATOM 976   C CD1   . LEU A 1 158 ? -101.835 165.731 206.536 1.00 49.35  ? 158 LEU A CD1   1 
ATOM 977   C CD2   . LEU A 1 158 ? -100.974 163.352 206.505 1.00 49.35  ? 158 LEU A CD2   1 
ATOM 978   N N     . GLU A 1 159 ? -105.850 164.509 205.221 1.00 50.06  ? 159 GLU A N     1 
ATOM 979   C CA    . GLU A 1 159 ? -106.551 164.265 203.972 1.00 50.06  ? 159 GLU A CA    1 
ATOM 980   C C     . GLU A 1 159 ? -106.510 165.525 203.122 1.00 50.06  ? 159 GLU A C     1 
ATOM 981   O O     . GLU A 1 159 ? -106.159 166.606 203.593 1.00 50.06  ? 159 GLU A O     1 
ATOM 982   C CB    . GLU A 1 159 ? -108.000 163.764 204.192 1.00 50.06  ? 159 GLU A CB    1 
ATOM 983   N N     . LEU A 1 160 ? -106.961 165.371 201.879 1.00 46.65  ? 160 LEU A N     1 
ATOM 984   C CA    . LEU A 1 160 ? -107.079 166.461 200.919 1.00 46.65  ? 160 LEU A CA    1 
ATOM 985   C C     . LEU A 1 160 ? -108.573 166.562 200.611 1.00 46.65  ? 160 LEU A C     1 
ATOM 986   O O     . LEU A 1 160 ? -109.215 165.552 200.336 1.00 46.65  ? 160 LEU A O     1 
ATOM 987   C CB    . LEU A 1 160 ? -106.281 166.159 199.654 1.00 46.65  ? 160 LEU A CB    1 
ATOM 988   N N     . LEU A 1 161 ? -109.132 167.767 200.670 1.00 46.37  ? 161 LEU A N     1 
ATOM 989   C CA    . LEU A 1 161 ? -110.565 167.948 200.431 1.00 46.37  ? 161 LEU A CA    1 
ATOM 990   C C     . LEU A 1 161 ? -110.953 168.603 199.107 1.00 46.37  ? 161 LEU A C     1 
ATOM 991   O O     . LEU A 1 161 ? -110.656 169.771 198.864 1.00 46.37  ? 161 LEU A O     1 
ATOM 992   C CB    . LEU A 1 161 ? -111.200 168.725 201.586 1.00 46.37  ? 161 LEU A CB    1 
ATOM 993   N N     . SER A 1 162 ? -111.641 167.847 198.256 1.00 47.55  ? 162 SER A N     1 
ATOM 994   C CA    . SER A 1 162 ? -112.089 168.379 196.976 1.00 47.55  ? 162 SER A CA    1 
ATOM 995   C C     . SER A 1 162 ? -112.808 169.694 197.249 1.00 47.55  ? 162 SER A C     1 
ATOM 996   O O     . SER A 1 162 ? -113.819 169.722 197.951 1.00 47.55  ? 162 SER A O     1 
ATOM 997   C CB    . SER A 1 162 ? -113.028 167.393 196.280 1.00 47.55  ? 162 SER A CB    1 
ATOM 998   N N     . THR A 1 163 ? -112.279 170.782 196.702 1.00 49.60  ? 163 THR A N     1 
ATOM 999   C CA    . THR A 1 163 ? -112.862 172.103 196.919 1.00 49.60  ? 163 THR A CA    1 
ATOM 1000  C C     . THR A 1 163 ? -113.978 172.488 195.949 1.00 49.60  ? 163 THR A C     1 
ATOM 1001  O O     . THR A 1 163 ? -113.773 172.549 194.736 1.00 49.60  ? 163 THR A O     1 
ATOM 1002  C CB    . THR A 1 163 ? -111.780 173.201 196.884 1.00 49.60  ? 163 THR A CB    1 
ATOM 1003  O OG1   . THR A 1 163 ? -110.900 172.974 195.776 1.00 49.60  ? 163 THR A OG1   1 
ATOM 1004  C CG2   . THR A 1 163 ? -110.975 173.197 198.175 1.00 49.60  ? 163 THR A CG2   1 
ATOM 1005  N N     . TYR A 1 164 ? -115.156 172.756 196.504 1.00 50.07  ? 164 TYR A N     1 
ATOM 1006  C CA    . TYR A 1 164 ? -116.313 173.175 195.723 1.00 50.07  ? 164 TYR A CA    1 
ATOM 1007  C C     . TYR A 1 164 ? -116.454 174.641 196.093 1.00 50.07  ? 164 TYR A C     1 
ATOM 1008  O O     . TYR A 1 164 ? -115.837 175.057 197.069 1.00 50.07  ? 164 TYR A O     1 
ATOM 1009  C CB    . TYR A 1 164 ? -117.498 172.434 196.332 1.00 50.07  ? 164 TYR A CB    1 
ATOM 1010  C CG    . TYR A 1 164 ? -118.702 172.156 195.468 1.00 50.07  ? 164 TYR A CG    1 
ATOM 1011  C CD1   . TYR A 1 164 ? -119.916 172.778 195.727 1.00 50.07  ? 164 TYR A CD1   1 
ATOM 1012  C CD2   . TYR A 1 164 ? -118.652 171.220 194.446 1.00 50.07  ? 164 TYR A CD2   1 
ATOM 1013  C CE1   . TYR A 1 164 ? -121.035 172.508 194.966 1.00 50.07  ? 164 TYR A CE1   1 
ATOM 1014  C CE2   . TYR A 1 164 ? -119.769 170.943 193.680 1.00 50.07  ? 164 TYR A CE2   1 
ATOM 1015  C CZ    . TYR A 1 164 ? -120.956 171.590 193.945 1.00 50.07  ? 164 TYR A CZ    1 
ATOM 1016  O OH    . TYR A 1 164 ? -122.071 171.321 193.185 1.00 50.07  ? 164 TYR A OH    1 
ATOM 1017  N N     . ALA A 1 165 ? -117.242 175.449 195.380 1.00 47.52  ? 165 ALA A N     1 
ATOM 1018  C CA    . ALA A 1 165 ? -117.328 176.834 195.842 1.00 47.52  ? 165 ALA A CA    1 
ATOM 1019  C C     . ALA A 1 165 ? -118.581 177.444 195.233 1.00 47.52  ? 165 ALA A C     1 
ATOM 1020  O O     . ALA A 1 165 ? -118.555 178.474 194.564 1.00 47.52  ? 165 ALA A O     1 
ATOM 1021  C CB    . ALA A 1 165 ? -116.070 177.615 195.469 1.00 47.52  ? 165 ALA A CB    1 
ATOM 1022  N N     . GLN A 1 166 ? -119.708 176.782 195.477 1.00 44.79  ? 166 GLN A N     1 
ATOM 1023  C CA    . GLN A 1 166 ? -120.992 177.241 194.962 1.00 44.79  ? 166 GLN A CA    1 
ATOM 1024  C C     . GLN A 1 166 ? -122.045 177.282 196.064 1.00 44.79  ? 166 GLN A C     1 
ATOM 1025  O O     . GLN A 1 166 ? -121.751 177.643 197.204 1.00 44.79  ? 166 GLN A O     1 
ATOM 1026  C CB    . GLN A 1 166 ? -121.463 176.342 193.818 1.00 44.79  ? 166 GLN A CB    1 
ATOM 1027  C CG    . GLN A 1 166 ? -120.522 176.310 192.625 1.00 44.79  ? 166 GLN A CG    1 
ATOM 1028  C CD    . GLN A 1 166 ? -120.079 177.696 192.196 1.00 44.79  ? 166 GLN A CD    1 
ATOM 1029  O OE1   . GLN A 1 166 ? -120.896 178.526 191.798 1.00 44.79  ? 166 GLN A OE1   1 
ATOM 1030  N NE2   . GLN A 1 166 ? -118.779 177.952 192.275 1.00 44.79  ? 166 GLN A NE2   1 
ATOM 1031  N N     . ASP A 1 169 ? -128.451 173.876 197.104 1.00 28.49  ? 169 ASP A N     1 
ATOM 1032  C CA    . ASP A 1 169 ? -129.603 173.011 197.238 1.00 28.49  ? 169 ASP A CA    1 
ATOM 1033  C C     . ASP A 1 169 ? -130.653 173.809 197.987 1.00 28.49  ? 169 ASP A C     1 
ATOM 1034  O O     . ASP A 1 169 ? -130.335 174.547 198.920 1.00 28.49  ? 169 ASP A O     1 
ATOM 1035  C CB    . ASP A 1 169 ? -129.247 171.715 197.967 1.00 28.49  ? 169 ASP A CB    1 
ATOM 1036  C CG    . ASP A 1 169 ? -130.424 170.778 198.084 1.00 28.49  ? 169 ASP A CG    1 
ATOM 1037  O OD1   . ASP A 1 169 ? -131.455 171.039 197.426 1.00 28.49  ? 169 ASP A OD1   1 
ATOM 1038  O OD2   . ASP A 1 169 ? -130.315 169.770 198.815 1.00 28.49  ? 169 ASP A OD2   1 
ATOM 1039  N N     . ASP A 1 170 ? -131.898 173.691 197.558 1.00 24.75  ? 170 ASP A N     1 
ATOM 1040  C CA    . ASP A 1 170 ? -132.960 174.432 198.206 1.00 24.75  ? 170 ASP A CA    1 
ATOM 1041  C C     . ASP A 1 170 ? -133.920 173.457 198.865 1.00 24.75  ? 170 ASP A C     1 
ATOM 1042  O O     . ASP A 1 170 ? -134.039 172.293 198.467 1.00 24.75  ? 170 ASP A O     1 
ATOM 1043  C CB    . ASP A 1 170 ? -133.680 175.355 197.206 1.00 24.75  ? 170 ASP A CB    1 
ATOM 1044  C CG    . ASP A 1 170 ? -134.654 176.310 197.877 1.00 24.75  ? 170 ASP A CG    1 
ATOM 1045  O OD1   . ASP A 1 170 ? -135.196 175.976 198.950 1.00 24.75  ? 170 ASP A OD1   1 
ATOM 1046  O OD2   . ASP A 1 170 ? -134.841 177.427 197.350 1.00 24.75  ? 170 ASP A OD2   1 
ATOM 1047  N N     . VAL A 1 171 ? -134.598 173.958 199.893 1.00 24.43  ? 171 VAL A N     1 
ATOM 1048  C CA    . VAL A 1 171 ? -135.527 173.150 200.660 1.00 24.43  ? 171 VAL A CA    1 
ATOM 1049  C C     . VAL A 1 171 ? -136.588 174.066 201.240 1.00 24.43  ? 171 VAL A C     1 
ATOM 1050  O O     . VAL A 1 171 ? -136.338 175.245 201.521 1.00 24.43  ? 171 VAL A O     1 
ATOM 1051  C CB    . VAL A 1 171 ? -134.777 172.363 201.766 1.00 24.43  ? 171 VAL A CB    1 
ATOM 1052  C CG1   . VAL A 1 171 ? -134.224 173.314 202.811 1.00 24.43  ? 171 VAL A CG1   1 
ATOM 1053  C CG2   . VAL A 1 171 ? -135.677 171.317 202.418 1.00 24.43  ? 171 VAL A CG2   1 
ATOM 1054  N N     . ARG A 1 172 ? -137.778 173.504 201.428 1.00 23.74  ? 172 ARG A N     1 
ATOM 1055  C CA    . ARG A 1 172 ? -138.871 174.223 202.051 1.00 23.74  ? 172 ARG A CA    1 
ATOM 1056  C C     . ARG A 1 172 ? -139.669 173.220 202.865 1.00 23.74  ? 172 ARG A C     1 
ATOM 1057  O O     . ARG A 1 172 ? -139.556 172.004 202.686 1.00 23.74  ? 172 ARG A O     1 
ATOM 1058  C CB    . ARG A 1 172 ? -139.838 174.875 201.050 1.00 23.74  ? 172 ARG A CB    1 
ATOM 1059  C CG    . ARG A 1 172 ? -140.610 173.854 200.214 1.00 23.74  ? 172 ARG A CG    1 
ATOM 1060  C CD    . ARG A 1 172 ? -141.540 174.495 199.190 1.00 23.74  ? 172 ARG A CD    1 
ATOM 1061  N NE    . ARG A 1 172 ? -142.200 173.498 198.340 1.00 23.74  ? 172 ARG A NE    1 
ATOM 1062  C CZ    . ARG A 1 172 ? -141.682 172.987 197.225 1.00 23.74  ? 172 ARG A CZ    1 
ATOM 1063  N NH1   . ARG A 1 172 ? -140.489 173.379 196.805 1.00 23.74  ? 172 ARG A NH1   1 
ATOM 1064  N NH2   . ARG A 1 172 ? -142.362 172.089 196.521 1.00 23.74  ? 172 ARG A NH2   1 
ATOM 1065  N N     . ASP A 1 173 ? -140.454 173.753 203.789 1.00 23.44  ? 173 ASP A N     1 
ATOM 1066  C CA    . ASP A 1 173 ? -141.267 172.919 204.643 1.00 23.44  ? 173 ASP A CA    1 
ATOM 1067  C C     . ASP A 1 173 ? -142.427 172.329 203.842 1.00 23.44  ? 173 ASP A C     1 
ATOM 1068  O O     . ASP A 1 173 ? -142.943 172.968 202.922 1.00 23.44  ? 173 ASP A O     1 
ATOM 1069  C CB    . ASP A 1 173 ? -141.757 173.739 205.828 1.00 23.44  ? 173 ASP A CB    1 
ATOM 1070  C CG    . ASP A 1 173 ? -142.624 174.915 205.411 1.00 23.44  ? 173 ASP A CG    1 
ATOM 1071  O OD1   . ASP A 1 173 ? -142.663 175.254 204.208 1.00 23.44  ? 173 ASP A OD1   1 
ATOM 1072  O OD2   . ASP A 1 173 ? -143.241 175.529 206.308 1.00 23.44  ? 173 ASP A OD2   1 
ATOM 1073  N N     . PRO A 1 174 ? -142.842 171.096 204.150 1.00 22.28  ? 174 PRO A N     1 
ATOM 1074  C CA    . PRO A 1 174 ? -143.974 170.521 203.413 1.00 22.28  ? 174 PRO A CA    1 
ATOM 1075  C C     . PRO A 1 174 ? -145.317 170.943 203.980 1.00 22.28  ? 174 PRO A C     1 
ATOM 1076  O O     . PRO A 1 174 ? -146.351 170.344 203.671 1.00 22.28  ? 174 PRO A O     1 
ATOM 1077  C CB    . PRO A 1 174 ? -143.756 169.013 203.577 1.00 22.28  ? 174 PRO A CB    1 
ATOM 1078  C CG    . PRO A 1 174 ? -143.060 168.892 204.900 1.00 22.28  ? 174 PRO A CG    1 
ATOM 1079  C CD    . PRO A 1 174 ? -142.176 170.105 205.016 1.00 22.28  ? 174 PRO A CD    1 
ATOM 1080  N N     . GLY A 1 175 ? -145.306 171.972 204.816 1.00 21.46  ? 175 GLY A N     1 
ATOM 1081  C CA    . GLY A 1 175 ? -146.499 172.506 205.425 1.00 21.46  ? 175 GLY A CA    1 
ATOM 1082  C C     . GLY A 1 175 ? -146.783 171.961 206.808 1.00 21.46  ? 175 GLY A C     1 
ATOM 1083  O O     . GLY A 1 175 ? -147.589 172.547 207.539 1.00 21.46  ? 175 GLY A O     1 
ATOM 1084  N N     . THR A 1 176 ? -146.142 170.850 207.176 1.00 18.52  ? 176 THR A N     1 
ATOM 1085  C CA    . THR A 1 176 ? -146.352 170.251 208.487 1.00 18.52  ? 176 THR A CA    1 
ATOM 1086  C C     . THR A 1 176 ? -145.923 171.222 209.577 1.00 18.52  ? 176 THR A C     1 
ATOM 1087  O O     . THR A 1 176 ? -144.874 171.866 209.477 1.00 18.52  ? 176 THR A O     1 
ATOM 1088  C CB    . THR A 1 176 ? -145.587 168.932 208.606 1.00 18.52  ? 176 THR A CB    1 
ATOM 1089  O OG1   . THR A 1 176 ? -146.045 168.027 207.597 1.00 18.52  ? 176 THR A OG1   1 
ATOM 1090  C CG2   . THR A 1 176 ? -145.823 168.299 209.970 1.00 18.52  ? 176 THR A CG2   1 
ATOM 1091  N N     . ALA A 1 177 ? -146.735 171.319 210.625 1.00 20.01  ? 177 ALA A N     1 
ATOM 1092  C CA    . ALA A 1 177 ? -146.405 172.208 211.726 1.00 20.01  ? 177 ALA A CA    1 
ATOM 1093  C C     . ALA A 1 177 ? -145.154 171.729 212.457 1.00 20.01  ? 177 ALA A C     1 
ATOM 1094  O O     . ALA A 1 177 ? -144.912 170.527 212.596 1.00 20.01  ? 177 ALA A O     1 
ATOM 1095  C CB    . ALA A 1 177 ? -147.587 172.306 212.691 1.00 20.01  ? 177 ALA A CB    1 
ATOM 1096  N N     . ASP A 1 178 ? -144.362 172.694 212.919 1.00 18.66  ? 178 ASP A N     1 
ATOM 1097  C CA    . ASP A 1 178 ? -143.092 172.494 213.617 1.00 18.66  ? 178 ASP A CA    1 
ATOM 1098  C C     . ASP A 1 178 ? -142.067 171.703 212.789 1.00 18.66  ? 178 ASP A C     1 
ATOM 1099  O O     . ASP A 1 178 ? -141.110 171.150 213.343 1.00 18.66  ? 178 ASP A O     1 
ATOM 1100  C CB    . ASP A 1 178 ? -143.331 171.836 214.988 1.00 18.66  ? 178 ASP A CB    1 
ATOM 1101  C CG    . ASP A 1 178 ? -142.071 171.759 215.845 1.00 18.66  ? 178 ASP A CG    1 
ATOM 1102  O OD1   . ASP A 1 178 ? -141.588 172.814 216.302 1.00 18.66  ? 178 ASP A OD1   1 
ATOM 1103  O OD2   . ASP A 1 178 ? -141.566 170.640 216.061 1.00 18.66  ? 178 ASP A OD2   1 
ATOM 1104  N N     . ARG A 1 179 ? -142.253 171.700 211.469 1.00 18.74  ? 179 ARG A N     1 
ATOM 1105  C CA    . ARG A 1 179 ? -141.357 170.993 210.552 1.00 18.74  ? 179 ARG A CA    1 
ATOM 1106  C C     . ARG A 1 179 ? -140.480 171.885 209.655 1.00 18.74  ? 179 ARG A C     1 
ATOM 1107  O O     . ARG A 1 179 ? -140.605 171.862 208.430 1.00 18.74  ? 179 ARG A O     1 
ATOM 1108  C CB    . ARG A 1 179 ? -142.155 170.014 209.684 1.00 18.74  ? 179 ARG A CB    1 
ATOM 1109  C CG    . ARG A 1 179 ? -141.301 168.973 208.978 1.00 18.74  ? 179 ARG A CG    1 
ATOM 1110  C CD    . ARG A 1 179 ? -142.160 167.879 208.366 1.00 18.74  ? 179 ARG A CD    1 
ATOM 1111  N NE    . ARG A 1 179 ? -142.438 166.805 209.316 1.00 18.74  ? 179 ARG A NE    1 
ATOM 1112  C CZ    . ARG A 1 179 ? -141.544 165.902 209.704 1.00 18.74  ? 179 ARG A CZ    1 
ATOM 1113  N NH1   . ARG A 1 179 ? -140.309 165.939 209.224 1.00 18.74  ? 179 ARG A NH1   1 
ATOM 1114  N NH2   . ARG A 1 179 ? -141.885 164.960 210.573 1.00 18.74  ? 179 ARG A NH2   1 
ATOM 1115  N N     . SER A 1 180 ? -139.591 172.656 210.276 1.00 19.29  ? 180 SER A N     1 
ATOM 1116  C CA    . SER A 1 180 ? -138.645 173.536 209.576 1.00 19.29  ? 180 SER A CA    1 
ATOM 1117  C C     . SER A 1 180 ? -139.450 174.648 208.893 1.00 19.29  ? 180 SER A C     1 
ATOM 1118  O O     . SER A 1 180 ? -140.481 175.065 209.437 1.00 19.29  ? 180 SER A O     1 
ATOM 1119  C CB    . SER A 1 180 ? -137.777 172.728 208.639 1.00 19.29  ? 180 SER A CB    1 
ATOM 1120  O OG    . SER A 1 180 ? -137.210 173.554 207.635 1.00 19.29  ? 180 SER A OG    1 
ATOM 1121  N N     . ARG A 1 181 ? -138.916 175.134 207.765 1.00 22.06  ? 181 ARG A N     1 
ATOM 1122  C CA    . ARG A 1 181 ? -139.490 176.226 206.971 1.00 22.06  ? 181 ARG A CA    1 
ATOM 1123  C C     . ARG A 1 181 ? -138.938 176.296 205.529 1.00 22.06  ? 181 ARG A C     1 
ATOM 1124  O O     . ARG A 1 181 ? -139.381 175.535 204.669 1.00 22.06  ? 181 ARG A O     1 
ATOM 1125  C CB    . ARG A 1 181 ? -139.279 177.567 207.678 1.00 22.06  ? 181 ARG A CB    1 
ATOM 1126  C CG    . ARG A 1 181 ? -140.500 178.072 208.428 1.00 22.06  ? 181 ARG A CG    1 
ATOM 1127  C CD    . ARG A 1 181 ? -140.444 177.688 209.898 1.00 22.06  ? 181 ARG A CD    1 
ATOM 1128  N NE    . ARG A 1 181 ? -139.091 177.791 210.438 1.00 22.06  ? 181 ARG A NE    1 
ATOM 1129  C CZ    . ARG A 1 181 ? -138.604 178.877 211.029 1.00 22.06  ? 181 ARG A CZ    1 
ATOM 1130  N NH1   . ARG A 1 181 ? -139.358 179.959 211.159 1.00 22.06  ? 181 ARG A NH1   1 
ATOM 1131  N NH2   . ARG A 1 181 ? -137.361 178.881 211.492 1.00 22.06  ? 181 ARG A NH2   1 
ATOM 1132  N N     . LYS A 1 182 ? -137.986 177.198 205.257 1.00 24.15  ? 182 LYS A N     1 
ATOM 1133  C CA    . LYS A 1 182 ? -137.444 177.319 203.911 1.00 24.15  ? 182 LYS A CA    1 
ATOM 1134  C C     . LYS A 1 182 ? -136.049 177.918 204.000 1.00 24.15  ? 182 LYS A C     1 
ATOM 1135  O O     . LYS A 1 182 ? -135.819 178.863 204.760 1.00 24.15  ? 182 LYS A O     1 
ATOM 1136  C CB    . LYS A 1 182 ? -138.359 178.170 203.018 1.00 24.15  ? 182 LYS A CB    1 
ATOM 1137  C CG    . LYS A 1 182 ? -138.538 179.625 203.441 1.00 24.15  ? 182 LYS A CG    1 
ATOM 1138  C CD    . LYS A 1 182 ? -139.355 180.372 202.401 1.00 24.15  ? 182 LYS A CD    1 
ATOM 1139  C CE    . LYS A 1 182 ? -139.433 181.854 202.680 1.00 24.15  ? 182 LYS A CE    1 
ATOM 1140  N NZ    . LYS A 1 182 ? -138.097 182.489 202.594 1.00 24.15  ? 182 LYS A NZ    1 
ATOM 1141  N N     . ILE A 1 183 ? -135.118 177.371 203.222 1.00 25.95  ? 183 ILE A N     1 
ATOM 1142  C CA    . ILE A 1 183 ? -133.742 177.855 203.224 1.00 25.95  ? 183 ILE A CA    1 
ATOM 1143  C C     . ILE A 1 183 ? -133.075 177.782 201.847 1.00 25.95  ? 183 ILE A C     1 
ATOM 1144  O O     . ILE A 1 183 ? -133.746 177.797 200.814 1.00 25.95  ? 183 ILE A O     1 
ATOM 1145  C CB    . ILE A 1 183 ? -132.881 177.089 204.248 1.00 25.95  ? 183 ILE A CB    1 
ATOM 1146  N N     . ARG A 1 184 ? -131.746 177.712 201.847 1.00 28.15  ? 184 ARG A N     1 
ATOM 1147  C CA    . ARG A 1 184 ? -130.964 177.651 200.619 1.00 28.15  ? 184 ARG A CA    1 
ATOM 1148  C C     . ARG A 1 184 ? -129.862 176.597 200.760 1.00 28.15  ? 184 ARG A C     1 
ATOM 1149  O O     . ARG A 1 184 ? -130.106 175.411 200.549 1.00 28.15  ? 184 ARG A O     1 
ATOM 1150  C CB    . ARG A 1 184 ? -130.360 179.026 200.321 1.00 28.15  ? 184 ARG A CB    1 
ATOM 1151  C CG    . ARG A 1 184 ? -131.345 180.040 199.764 1.00 28.15  ? 184 ARG A CG    1 
ATOM 1152  C CD    . ARG A 1 184 ? -132.470 180.341 200.738 1.00 28.15  ? 184 ARG A CD    1 
ATOM 1153  N NE    . ARG A 1 184 ? -132.192 181.511 201.567 1.00 28.15  ? 184 ARG A NE    1 
ATOM 1154  C CZ    . ARG A 1 184 ? -133.092 182.439 201.871 1.00 28.15  ? 184 ARG A CZ    1 
ATOM 1155  N NH1   . ARG A 1 184 ? -134.330 182.340 201.411 1.00 28.15  ? 184 ARG A NH1   1 
ATOM 1156  N NH2   . ARG A 1 184 ? -132.756 183.468 202.633 1.00 28.15  ? 184 ARG A NH2   1 
ATOM 1157  N N     . HIS A 1 185 ? -128.659 177.050 201.117 1.00 32.89  ? 185 HIS A N     1 
ATOM 1158  C CA    . HIS A 1 185 ? -127.480 176.196 201.336 1.00 32.89  ? 185 HIS A CA    1 
ATOM 1159  C C     . HIS A 1 185 ? -126.498 176.002 200.169 1.00 32.89  ? 185 HIS A C     1 
ATOM 1160  O O     . HIS A 1 185 ? -126.727 176.438 199.040 1.00 32.89  ? 185 HIS A O     1 
ATOM 1161  C CB    . HIS A 1 185 ? -127.863 174.834 201.938 1.00 32.89  ? 185 HIS A CB    1 
ATOM 1162  C CG    . HIS A 1 185 ? -126.704 174.085 202.524 1.00 32.89  ? 185 HIS A CG    1 
ATOM 1163  N ND1   . HIS A 1 185 ? -126.840 173.196 203.569 1.00 32.89  ? 185 HIS A ND1   1 
ATOM 1164  C CD2   . HIS A 1 185 ? -125.386 174.095 202.211 1.00 32.89  ? 185 HIS A CD2   1 
ATOM 1165  C CE1   . HIS A 1 185 ? -125.658 172.690 203.872 1.00 32.89  ? 185 HIS A CE1   1 
ATOM 1166  N NE2   . HIS A 1 185 ? -124.759 173.219 203.063 1.00 32.89  ? 185 HIS A NE2   1 
ATOM 1167  N N     . PRO A 1 186 ? -125.399 175.333 200.503 1.00 36.88  ? 186 PRO A N     1 
ATOM 1168  C CA    . PRO A 1 186 ? -124.284 174.995 199.600 1.00 36.88  ? 186 PRO A CA    1 
ATOM 1169  C C     . PRO A 1 186 ? -123.390 173.890 200.154 1.00 36.88  ? 186 PRO A C     1 
ATOM 1170  O O     . PRO A 1 186 ? -122.751 174.067 201.194 1.00 36.88  ? 186 PRO A O     1 
ATOM 1171  C CB    . PRO A 1 186 ? -123.527 176.324 199.471 1.00 36.88  ? 186 PRO A CB    1 
ATOM 1172  C CG    . PRO A 1 186 ? -123.812 177.036 200.748 1.00 36.88  ? 186 PRO A CG    1 
ATOM 1173  C CD    . PRO A 1 186 ? -125.221 176.655 201.125 1.00 36.88  ? 186 PRO A CD    1 
ATOM 1174  N N     . ALA A 1 187 ? -123.366 172.738 199.480 1.00 41.39  ? 187 ALA A N     1 
ATOM 1175  C CA    . ALA A 1 187 ? -122.516 171.619 199.870 1.00 41.39  ? 187 ALA A CA    1 
ATOM 1176  C C     . ALA A 1 187 ? -121.180 171.646 199.121 1.00 41.39  ? 187 ALA A C     1 
ATOM 1177  O O     . ALA A 1 187 ? -121.027 172.358 198.142 1.00 41.39  ? 187 ALA A O     1 
ATOM 1178  C CB    . ALA A 1 187 ? -123.234 170.301 199.598 1.00 41.39  ? 187 ALA A CB    1 
ATOM 1179  N N     . VAL A 1 188 ? -120.195 170.895 199.631 1.00 47.68  ? 188 VAL A N     1 
ATOM 1180  C CA    . VAL A 1 188 ? -118.912 170.612 198.982 1.00 47.68  ? 188 VAL A CA    1 
ATOM 1181  C C     . VAL A 1 188 ? -118.546 169.145 199.221 1.00 47.68  ? 188 VAL A C     1 
ATOM 1182  O O     . VAL A 1 188 ? -118.613 168.660 200.355 1.00 47.68  ? 188 VAL A O     1 
ATOM 1183  C CB    . VAL A 1 188 ? -117.810 171.542 199.529 1.00 47.68  ? 188 VAL A CB    1 
ATOM 1184  C CG1   . VAL A 1 188 ? -116.658 171.534 198.661 1.00 47.68  ? 188 VAL A CG1   1 
ATOM 1185  C CG2   . VAL A 1 188 ? -118.307 172.958 199.528 1.00 47.68  ? 188 VAL A CG2   1 
ATOM 1186  N N     . ARG A 1 189 ? -118.135 168.487 198.141 1.00 49.62  ? 189 ARG A N     1 
ATOM 1187  C CA    . ARG A 1 189 ? -117.698 167.104 198.171 1.00 49.62  ? 189 ARG A CA    1 
ATOM 1188  C C     . ARG A 1 189 ? -116.175 167.130 198.228 1.00 49.62  ? 189 ARG A C     1 
ATOM 1189  O O     . ARG A 1 189 ? -115.539 168.018 197.661 1.00 49.62  ? 189 ARG A O     1 
ATOM 1190  C CB    . ARG A 1 189 ? -118.173 166.359 196.925 1.00 49.62  ? 189 ARG A CB    1 
ATOM 1191  N N     . PHE A 1 190 ? -115.599 166.156 198.918 1.00 46.31  ? 190 PHE A N     1 
ATOM 1192  C CA    . PHE A 1 190 ? -114.135 166.059 199.086 1.00 46.31  ? 190 PHE A CA    1 
ATOM 1193  C C     . PHE A 1 190 ? -113.644 164.605 198.939 1.00 46.31  ? 190 PHE A C     1 
ATOM 1194  O O     . PHE A 1 190 ? -114.403 163.678 199.220 1.00 46.31  ? 190 PHE A O     1 
ATOM 1195  C CB    . PHE A 1 190 ? -113.715 166.608 200.458 1.00 46.31  ? 190 PHE A CB    1 
ATOM 1196  N N     . ASP A 1 191 ? -112.391 164.383 198.468 1.00 49.47  ? 191 ASP A N     1 
ATOM 1197  C CA    . ASP A 1 191 ? -111.982 162.998 198.144 1.00 49.47  ? 191 ASP A CA    1 
ATOM 1198  C C     . ASP A 1 191 ? -110.454 162.708 198.061 1.00 49.47  ? 191 ASP A C     1 
ATOM 1199  O O     . ASP A 1 191 ? -109.656 163.613 197.781 1.00 49.47  ? 191 ASP A O     1 
ATOM 1200  C CB    . ASP A 1 191 ? -112.644 162.650 196.809 1.00 49.47  ? 191 ASP A CB    1 
ATOM 1201  C CG    . ASP A 1 191 ? -112.535 161.189 196.436 1.00 49.47  ? 191 ASP A CG    1 
ATOM 1202  O OD1   . ASP A 1 191 ? -111.785 160.434 197.079 1.00 49.47  ? 191 ASP A OD1   1 
ATOM 1203  O OD2   . ASP A 1 191 ? -113.211 160.801 195.458 1.00 49.47  ? 191 ASP A OD2   1 
ATOM 1204  N N     . GLY A 1 192 ? -110.076 161.413 198.336 1.00 49.66  ? 192 GLY A N     1 
ATOM 1205  C CA    . GLY A 1 192 ? -108.790 160.669 198.172 1.00 49.66  ? 192 GLY A CA    1 
ATOM 1206  C C     . GLY A 1 192 ? -108.443 159.578 199.214 1.00 49.66  ? 192 GLY A C     1 
ATOM 1207  O O     . GLY A 1 192 ? -109.392 158.854 199.521 1.00 49.66  ? 192 GLY A O     1 
ATOM 1208  N N     . GLU A 1 193 ? -107.201 159.498 199.679 1.00 49.78  ? 193 GLU A N     1 
ATOM 1209  C CA    . GLU A 1 193 ? -106.786 158.542 200.686 1.00 49.78  ? 193 GLU A CA    1 
ATOM 1210  C C     . GLU A 1 193 ? -106.397 159.435 201.848 1.00 49.78  ? 193 GLU A C     1 
ATOM 1211  O O     . GLU A 1 193 ? -105.785 160.487 201.646 1.00 49.78  ? 193 GLU A O     1 
ATOM 1212  C CB    . GLU A 1 193 ? -105.592 157.720 200.207 1.00 49.78  ? 193 GLU A CB    1 
ATOM 1213  N N     . ALA A 1 194 ? -106.758 159.045 203.063 1.00 51.54  ? 194 ALA A N     1 
ATOM 1214  C CA    . ALA A 1 194 ? -106.444 159.895 204.200 1.00 51.54  ? 194 ALA A CA    1 
ATOM 1215  C C     . ALA A 1 194 ? -105.715 159.238 205.358 1.00 51.54  ? 194 ALA A C     1 
ATOM 1216  O O     . ALA A 1 194 ? -106.340 158.635 206.230 1.00 51.54  ? 194 ALA A O     1 
ATOM 1217  C CB    . ALA A 1 194 ? -107.711 160.576 204.706 1.00 51.54  ? 194 ALA A CB    1 
ATOM 1218  N N     . VAL A 1 195 ? -104.394 159.366 205.382 1.00 49.25  ? 195 VAL A N     1 
ATOM 1219  C CA    . VAL A 1 195 ? -103.660 158.824 206.503 1.00 49.25  ? 195 VAL A CA    1 
ATOM 1220  C C     . VAL A 1 195 ? -104.196 159.453 207.756 1.00 49.25  ? 195 VAL A C     1 
ATOM 1221  O O     . VAL A 1 195 ? -104.323 160.677 207.875 1.00 49.25  ? 195 VAL A O     1 
ATOM 1222  C CB    . VAL A 1 195 ? -102.132 158.987 206.441 1.00 49.25  ? 195 VAL A CB    1 
ATOM 1223  C CG1   . VAL A 1 195 ? -101.522 159.199 207.860 1.00 49.25  ? 195 VAL A CG1   1 
ATOM 1224  C CG2   . VAL A 1 195 ? -101.593 157.678 206.078 1.00 49.25  ? 195 VAL A CG2   1 
ATOM 1225  N N     . ILE A 1 196 ? -104.521 158.559 208.684 1.00 46.31  ? 196 ILE A N     1 
ATOM 1226  C CA    . ILE A 1 196 ? -105.051 158.903 209.984 1.00 46.31  ? 196 ILE A CA    1 
ATOM 1227  C C     . ILE A 1 196 ? -103.900 158.920 210.974 1.00 46.31  ? 196 ILE A C     1 
ATOM 1228  O O     . ILE A 1 196 ? -102.977 158.108 210.905 1.00 46.31  ? 196 ILE A O     1 
ATOM 1229  C CB    . ILE A 1 196 ? -106.110 157.890 210.452 1.00 46.31  ? 196 ILE A CB    1 
ATOM 1230  N N     . SER A 1 197 ? -103.977 159.867 211.891 1.00 45.11  ? 197 SER A N     1 
ATOM 1231  C CA    . SER A 1 197 ? -102.987 160.081 212.916 1.00 45.11  ? 197 SER A CA    1 
ATOM 1232  C C     . SER A 1 197 ? -103.487 159.697 214.300 1.00 45.11  ? 197 SER A C     1 
ATOM 1233  O O     . SER A 1 197 ? -102.667 159.669 215.217 1.00 45.11  ? 197 SER A O     1 
ATOM 1234  C CB    . SER A 1 197 ? -102.531 161.550 212.917 1.00 45.11  ? 197 SER A CB    1 
ATOM 1235  O OG    . SER A 1 197 ? -101.551 161.799 213.900 1.00 45.11  ? 197 SER A OG    1 
ATOM 1236  N N     . ASP A 1 198 ? -104.784 159.456 214.426 1.00 46.06  ? 198 ASP A N     1 
ATOM 1237  C CA    . ASP A 1 198 ? -105.432 159.066 215.665 1.00 46.06  ? 198 ASP A CA    1 
ATOM 1238  C C     . ASP A 1 198 ? -106.547 158.227 215.097 1.00 46.06  ? 198 ASP A C     1 
ATOM 1239  O O     . ASP A 1 198 ? -107.320 158.714 214.271 1.00 46.06  ? 198 ASP A O     1 
ATOM 1240  C CB    . ASP A 1 198 ? -105.991 160.283 216.396 1.00 46.06  ? 198 ASP A CB    1 
ATOM 1241  N N     . VAL A 1 199 ? -106.637 156.965 215.490 1.00 45.33  ? 199 VAL A N     1 
ATOM 1242  C CA    . VAL A 1 199 ? -107.676 156.135 214.868 1.00 45.33  ? 199 VAL A CA    1 
ATOM 1243  C C     . VAL A 1 199 ? -109.010 156.287 215.566 1.00 45.33  ? 199 VAL A C     1 
ATOM 1244  O O     . VAL A 1 199 ? -110.044 156.516 214.925 1.00 45.33  ? 199 VAL A O     1 
ATOM 1245  C CB    . VAL A 1 199 ? -107.240 154.665 214.905 1.00 45.33  ? 199 VAL A CB    1 
ATOM 1246  C CG1   . VAL A 1 199 ? -106.488 154.388 216.215 1.00 45.33  ? 199 VAL A CG1   1 
ATOM 1247  C CG2   . VAL A 1 199 ? -108.417 153.759 214.680 1.00 45.33  ? 199 VAL A CG2   1 
ATOM 1248  N N     . ASP A 1 200 ? -109.025 156.094 216.875 1.00 46.80  ? 200 ASP A N     1 
ATOM 1249  C CA    . ASP A 1 200 ? -110.276 156.157 217.601 1.00 46.80  ? 200 ASP A CA    1 
ATOM 1250  C C     . ASP A 1 200 ? -110.952 157.501 217.387 1.00 46.80  ? 200 ASP A C     1 
ATOM 1251  O O     . ASP A 1 200 ? -112.182 157.581 217.375 1.00 46.80  ? 200 ASP A O     1 
ATOM 1252  C CB    . ASP A 1 200 ? -109.995 155.857 219.075 1.00 46.80  ? 200 ASP A CB    1 
ATOM 1253  C CG    . ASP A 1 200 ? -108.958 156.807 219.674 1.00 46.80  ? 200 ASP A CG    1 
ATOM 1254  O OD1   . ASP A 1 200 ? -108.806 157.944 219.173 1.00 46.80  ? 200 ASP A OD1   1 
ATOM 1255  O OD2   . ASP A 1 200 ? -108.293 156.414 220.661 1.00 46.80  ? 200 ASP A OD2   1 
ATOM 1256  N N     . ALA A 1 201 ? -110.160 158.559 217.197 1.00 44.32  ? 201 ALA A N     1 
ATOM 1257  C CA    . ALA A 1 201 ? -110.704 159.902 217.032 1.00 44.32  ? 201 ALA A CA    1 
ATOM 1258  C C     . ALA A 1 201 ? -111.145 160.238 215.608 1.00 44.32  ? 201 ALA A C     1 
ATOM 1259  O O     . ALA A 1 201 ? -112.098 160.999 215.431 1.00 44.32  ? 201 ALA A O     1 
ATOM 1260  C CB    . ALA A 1 201 ? -109.666 160.927 217.472 1.00 44.32  ? 201 ALA A CB    1 
ATOM 1261  N N     . VAL A 1 202 ? -110.480 159.713 214.580 1.00 45.66  ? 202 VAL A N     1 
ATOM 1262  C CA    . VAL A 1 202 ? -111.013 159.890 213.234 1.00 45.66  ? 202 VAL A CA    1 
ATOM 1263  C C     . VAL A 1 202 ? -112.251 159.042 213.044 1.00 45.66  ? 202 VAL A C     1 
ATOM 1264  O O     . VAL A 1 202 ? -113.176 159.427 212.328 1.00 45.66  ? 202 VAL A O     1 
ATOM 1265  C CB    . VAL A 1 202 ? -109.957 159.534 212.178 1.00 45.66  ? 202 VAL A CB    1 
ATOM 1266  C CG1   . VAL A 1 202 ? -109.555 158.075 212.336 1.00 45.66  ? 202 VAL A CG1   1 
ATOM 1267  C CG2   . VAL A 1 202 ? -110.512 159.773 210.785 1.00 45.66  ? 202 VAL A CG2   1 
ATOM 1268  N N     . ARG A 1 203 ? -112.260 157.847 213.644 1.00 45.44  ? 203 ARG A N     1 
ATOM 1269  C CA    . ARG A 1 203 ? -113.439 156.999 213.631 1.00 45.44  ? 203 ARG A CA    1 
ATOM 1270  C C     . ARG A 1 203 ? -114.549 157.663 214.408 1.00 45.44  ? 203 ARG A C     1 
ATOM 1271  O O     . ARG A 1 203 ? -115.722 157.612 214.021 1.00 45.44  ? 203 ARG A O     1 
ATOM 1272  C CB    . ARG A 1 203 ? -113.110 155.644 214.244 1.00 45.44  ? 203 ARG A CB    1 
ATOM 1273  C CG    . ARG A 1 203 ? -114.336 154.793 214.449 1.00 45.44  ? 203 ARG A CG    1 
ATOM 1274  C CD    . ARG A 1 203 ? -113.993 153.540 215.203 1.00 45.44  ? 203 ARG A CD    1 
ATOM 1275  N NE    . ARG A 1 203 ? -113.012 152.715 214.502 1.00 45.44  ? 203 ARG A NE    1 
ATOM 1276  C CZ    . ARG A 1 203 ? -111.745 152.580 214.874 1.00 45.44  ? 203 ARG A CZ    1 
ATOM 1277  N NH1   . ARG A 1 203 ? -111.298 153.197 215.955 1.00 45.44  ? 203 ARG A NH1   1 
ATOM 1278  N NH2   . ARG A 1 203 ? -110.940 151.797 214.176 1.00 45.44  ? 203 ARG A NH2   1 
ATOM 1279  N N     . HIS A 1 204 ? -114.172 158.295 215.512 1.00 43.84  ? 204 HIS A N     1 
ATOM 1280  C CA    . HIS A 1 204 ? -115.084 159.141 216.248 1.00 43.84  ? 204 HIS A CA    1 
ATOM 1281  C C     . HIS A 1 204 ? -115.656 160.200 215.321 1.00 43.84  ? 204 HIS A C     1 
ATOM 1282  O O     . HIS A 1 204 ? -116.851 160.506 215.381 1.00 43.84  ? 204 HIS A O     1 
ATOM 1283  C CB    . HIS A 1 204 ? -114.363 159.777 217.424 1.00 43.84  ? 204 HIS A CB    1 
ATOM 1284  C CG    . HIS A 1 204 ? -115.264 160.593 218.276 1.00 43.84  ? 204 HIS A CG    1 
ATOM 1285  N ND1   . HIS A 1 204 ? -114.812 161.577 219.127 1.00 43.84  ? 204 HIS A ND1   1 
ATOM 1286  C CD2   . HIS A 1 204 ? -116.606 160.537 218.435 1.00 43.84  ? 204 HIS A CD2   1 
ATOM 1287  C CE1   . HIS A 1 204 ? -115.843 162.104 219.762 1.00 43.84  ? 204 HIS A CE1   1 
ATOM 1288  N NE2   . HIS A 1 204 ? -116.942 161.491 219.360 1.00 43.84  ? 204 HIS A NE2   1 
ATOM 1289  N N     . ALA A 1 205 ? -114.810 160.773 214.450 1.00 44.67  ? 205 ALA A N     1 
ATOM 1290  C CA    . ALA A 1 205 ? -115.280 161.786 213.510 1.00 44.67  ? 205 ALA A CA    1 
ATOM 1291  C C     . ALA A 1 205 ? -116.157 161.148 212.435 1.00 44.67  ? 205 ALA A C     1 
ATOM 1292  O O     . ALA A 1 205 ? -117.097 161.778 211.939 1.00 44.67  ? 205 ALA A O     1 
ATOM 1293  C CB    . ALA A 1 205 ? -114.095 162.530 212.887 1.00 44.67  ? 205 ALA A CB    1 
ATOM 1294  N N     . VAL A 1 206 ? -115.865 159.900 212.067 1.00 44.89  ? 206 VAL A N     1 
ATOM 1295  C CA    . VAL A 1 206 ? -116.630 159.204 211.041 1.00 44.89  ? 206 VAL A CA    1 
ATOM 1296  C C     . VAL A 1 206 ? -118.036 158.946 211.553 1.00 44.89  ? 206 VAL A C     1 
ATOM 1297  O O     . VAL A 1 206 ? -119.018 159.046 210.805 1.00 44.89  ? 206 VAL A O     1 
ATOM 1298  C CB    . VAL A 1 206 ? -115.922 157.902 210.618 1.00 44.89  ? 206 VAL A CB    1 
ATOM 1299  C CG1   . VAL A 1 206 ? -116.842 157.065 209.734 1.00 44.89  ? 206 VAL A CG1   1 
ATOM 1300  C CG2   . VAL A 1 206 ? -114.630 158.224 209.881 1.00 44.89  ? 206 VAL A CG2   1 
ATOM 1301  N N     . LEU A 1 207 ? -118.156 158.622 212.842 1.00 41.19  ? 207 LEU A N     1 
ATOM 1302  C CA    . LEU A 1 207 ? -119.452 158.308 213.418 1.00 41.19  ? 207 LEU A CA    1 
ATOM 1303  C C     . LEU A 1 207 ? -120.210 159.580 213.771 1.00 41.19  ? 207 LEU A C     1 
ATOM 1304  O O     . LEU A 1 207 ? -121.443 159.610 213.682 1.00 41.19  ? 207 LEU A O     1 
ATOM 1305  C CB    . LEU A 1 207 ? -119.243 157.440 214.660 1.00 41.19  ? 207 LEU A CB    1 
ATOM 1306  C CG    . LEU A 1 207 ? -120.452 156.793 215.318 1.00 41.19  ? 207 LEU A CG    1 
ATOM 1307  C CD1   . LEU A 1 207 ? -120.083 155.416 215.836 1.00 41.19  ? 207 LEU A CD1   1 
ATOM 1308  C CD2   . LEU A 1 207 ? -120.947 157.675 216.437 1.00 41.19  ? 207 LEU A CD2   1 
ATOM 1309  N N     . ASN A 1 208 ? -119.498 160.631 214.189 1.00 40.89  ? 208 ASN A N     1 
ATOM 1310  C CA    . ASN A 1 208 ? -120.192 161.858 214.560 1.00 40.89  ? 208 ASN A CA    1 
ATOM 1311  C C     . ASN A 1 208 ? -120.571 162.653 213.313 1.00 40.89  ? 208 ASN A C     1 
ATOM 1312  O O     . ASN A 1 208 ? -121.668 163.219 213.247 1.00 40.89  ? 208 ASN A O     1 
ATOM 1313  C CB    . ASN A 1 208 ? -119.367 162.670 215.576 1.00 40.89  ? 208 ASN A CB    1 
ATOM 1314  C CG    . ASN A 1 208 ? -118.025 163.137 215.045 1.00 40.89  ? 208 ASN A CG    1 
ATOM 1315  O OD1   . ASN A 1 208 ? -117.855 163.346 213.850 1.00 40.89  ? 208 ASN A OD1   1 
ATOM 1316  N ND2   . ASN A 1 208 ? -117.067 163.335 215.953 1.00 40.89  ? 208 ASN A ND2   1 
ATOM 1317  N N     . GLY A 1 209 ? -119.700 162.684 212.313 1.00 38.87  ? 209 GLY A N     1 
ATOM 1318  C CA    . GLY A 1 209 ? -119.997 163.511 211.161 1.00 38.87  ? 209 GLY A CA    1 
ATOM 1319  C C     . GLY A 1 209 ? -119.190 164.800 211.135 1.00 38.87  ? 209 GLY A C     1 
ATOM 1320  O O     . GLY A 1 209 ? -118.843 165.371 212.174 1.00 38.87  ? 209 GLY A O     1 
ATOM 1321  N N     . ILE A 1 210 ? -118.886 165.268 209.924 1.00 39.44  ? 210 ILE A N     1 
ATOM 1322  C CA    . ILE A 1 210 ? -118.050 166.447 209.719 1.00 39.44  ? 210 ILE A CA    1 
ATOM 1323  C C     . ILE A 1 210 ? -118.894 167.494 209.006 1.00 39.44  ? 210 ILE A C     1 
ATOM 1324  O O     . ILE A 1 210 ? -119.355 167.279 207.878 1.00 39.44  ? 210 ILE A O     1 
ATOM 1325  C CB    . ILE A 1 210 ? -116.773 166.142 208.917 1.00 39.44  ? 210 ILE A CB    1 
ATOM 1326  C CG1   . ILE A 1 210 ? -115.981 164.975 209.510 1.00 39.44  ? 210 ILE A CG1   1 
ATOM 1327  C CG2   . ILE A 1 210 ? -115.923 167.359 208.782 1.00 39.44  ? 210 ILE A CG2   1 
ATOM 1328  C CD1   . ILE A 1 210 ? -114.709 164.676 208.725 1.00 39.44  ? 210 ILE A CD1   1 
ATOM 1329  N N     . GLY A 1 211 ? -119.094 168.618 209.673 1.00 38.70  ? 211 GLY A N     1 
ATOM 1330  C CA    . GLY A 1 211 ? -119.771 169.795 209.181 1.00 38.70  ? 211 GLY A CA    1 
ATOM 1331  C C     . GLY A 1 211 ? -121.222 169.820 209.631 1.00 38.70  ? 211 GLY A C     1 
ATOM 1332  O O     . GLY A 1 211 ? -121.795 168.812 210.058 1.00 38.70  ? 211 GLY A O     1 
ATOM 1333  N N     . ARG A 1 212 ? -121.827 170.994 209.504 1.00 41.11  ? 212 ARG A N     1 
ATOM 1334  C CA    . ARG A 1 212 ? -123.220 171.174 209.868 1.00 41.11  ? 212 ARG A CA    1 
ATOM 1335  C C     . ARG A 1 212 ? -124.123 170.572 208.798 1.00 41.11  ? 212 ARG A C     1 
ATOM 1336  O O     . ARG A 1 212 ? -123.657 170.104 207.759 1.00 41.11  ? 212 ARG A O     1 
ATOM 1337  C CB    . ARG A 1 212 ? -123.539 172.659 210.053 1.00 41.11  ? 212 ARG A CB    1 
ATOM 1338  C CG    . ARG A 1 212 ? -123.526 173.462 208.762 1.00 41.11  ? 212 ARG A CG    1 
ATOM 1339  C CD    . ARG A 1 212 ? -122.682 174.718 208.902 1.00 41.11  ? 212 ARG A CD    1 
ATOM 1340  N NE    . ARG A 1 212 ? -122.506 175.404 207.625 1.00 41.11  ? 212 ARG A NE    1 
ATOM 1341  C CZ    . ARG A 1 212 ? -123.115 176.539 207.297 1.00 41.11  ? 212 ARG A CZ    1 
ATOM 1342  N NH1   . ARG A 1 212 ? -123.943 177.121 208.153 1.00 41.11  ? 212 ARG A NH1   1 
ATOM 1343  N NH2   . ARG A 1 212 ? -122.896 177.092 206.112 1.00 41.11  ? 212 ARG A NH2   1 
ATOM 1344  N N     . GLY A 1 213 ? -125.420 170.592 209.070 1.00 38.90  ? 213 GLY A N     1 
ATOM 1345  C CA    . GLY A 1 213 ? -126.441 170.062 208.172 1.00 38.90  ? 213 GLY A CA    1 
ATOM 1346  C C     . GLY A 1 213 ? -126.326 168.591 207.853 1.00 38.90  ? 213 GLY A C     1 
ATOM 1347  O O     . GLY A 1 213 ? -126.645 168.175 206.732 1.00 38.90  ? 213 GLY A O     1 
ATOM 1348  N N     . LYS A 1 214 ? -125.882 167.786 208.821 1.00 35.11  ? 214 LYS A N     1 
ATOM 1349  C CA    . LYS A 1 214 ? -125.774 166.347 208.600 1.00 35.11  ? 214 LYS A CA    1 
ATOM 1350  C C     . LYS A 1 214 ? -127.122 165.761 208.212 1.00 35.11  ? 214 LYS A C     1 
ATOM 1351  O O     . LYS A 1 214 ? -127.182 164.752 207.494 1.00 35.11  ? 214 LYS A O     1 
ATOM 1352  C CB    . LYS A 1 214 ? -125.155 165.640 209.810 1.00 35.11  ? 214 LYS A CB    1 
ATOM 1353  C CG    . LYS A 1 214 ? -123.818 166.259 210.225 1.00 35.11  ? 214 LYS A CG    1 
ATOM 1354  C CD    . LYS A 1 214 ? -123.140 165.565 211.399 1.00 35.11  ? 214 LYS A CD    1 
ATOM 1355  C CE    . LYS A 1 214 ? -122.073 166.475 211.990 1.00 35.11  ? 214 LYS A CE    1 
ATOM 1356  N NZ    . LYS A 1 214 ? -122.654 167.769 212.462 1.00 35.11  ? 214 LYS A NZ    1 
ATOM 1357  N N     . SER A 1 215 ? -128.212 166.383 208.667 1.00 34.75  ? 215 SER A N     1 
ATOM 1358  C CA    . SER A 1 215 ? -129.539 165.840 208.437 1.00 34.75  ? 215 SER A CA    1 
ATOM 1359  C C     . SER A 1 215 ? -130.059 166.187 207.055 1.00 34.75  ? 215 SER A C     1 
ATOM 1360  O O     . SER A 1 215 ? -131.158 165.760 206.689 1.00 34.75  ? 215 SER A O     1 
ATOM 1361  C CB    . SER A 1 215 ? -130.502 166.398 209.483 1.00 34.75  ? 215 SER A CB    1 
ATOM 1362  O OG    . SER A 1 215 ? -130.418 167.814 209.552 1.00 34.75  ? 215 SER A OG    1 
ATOM 1363  N N     . TYR A 1 216 ? -129.297 166.971 206.298 1.00 34.81  ? 216 TYR A N     1 
ATOM 1364  C CA    . TYR A 1 216 ? -129.679 167.480 204.986 1.00 34.81  ? 216 TYR A CA    1 
ATOM 1365  C C     . TYR A 1 216 ? -128.683 167.047 203.919 1.00 34.81  ? 216 TYR A C     1 
ATOM 1366  O O     . TYR A 1 216 ? -128.548 167.710 202.886 1.00 34.81  ? 216 TYR A O     1 
ATOM 1367  C CB    . TYR A 1 216 ? -129.910 168.989 205.005 1.00 34.81  ? 216 TYR A CB    1 
ATOM 1368  C CG    . TYR A 1 216 ? -131.192 169.304 205.732 1.00 34.81  ? 216 TYR A CG    1 
ATOM 1369  C CD1   . TYR A 1 216 ? -132.410 169.182 205.074 1.00 34.81  ? 216 TYR A CD1   1 
ATOM 1370  C CD2   . TYR A 1 216 ? -131.205 169.667 207.072 1.00 34.81  ? 216 TYR A CD2   1 
ATOM 1371  C CE1   . TYR A 1 216 ? -133.599 169.445 205.708 1.00 34.81  ? 216 TYR A CE1   1 
ATOM 1372  C CE2   . TYR A 1 216 ? -132.405 169.936 207.724 1.00 34.81  ? 216 TYR A CE2   1 
ATOM 1373  C CZ    . TYR A 1 216 ? -133.595 169.819 207.029 1.00 34.81  ? 216 TYR A CZ    1 
ATOM 1374  O OH    . TYR A 1 216 ? -134.795 170.074 207.640 1.00 34.81  ? 216 TYR A OH    1 
ATOM 1375  N N     . GLY A 1 217 ? -127.985 165.933 204.157 1.00 34.95  ? 217 GLY A N     1 
ATOM 1376  C CA    . GLY A 1 217 ? -127.066 165.348 203.200 1.00 34.95  ? 217 GLY A CA    1 
ATOM 1377  C C     . GLY A 1 217 ? -125.620 165.335 203.656 1.00 34.95  ? 217 GLY A C     1 
ATOM 1378  O O     . GLY A 1 217 ? -124.850 164.478 203.211 1.00 34.95  ? 217 GLY A O     1 
ATOM 1379  N N     . CYS A 1 218 ? -125.239 166.242 204.551 1.00 35.70  ? 218 CYS A N     1 
ATOM 1380  C CA    . CYS A 1 218 ? -123.828 166.372 204.881 1.00 35.70  ? 218 CYS A CA    1 
ATOM 1381  C C     . CYS A 1 218 ? -123.372 165.431 205.997 1.00 35.70  ? 218 CYS A C     1 
ATOM 1382  O O     . CYS A 1 218 ? -124.139 164.643 206.553 1.00 35.70  ? 218 CYS A O     1 
ATOM 1383  C CB    . CYS A 1 218 ? -123.508 167.824 205.226 1.00 35.70  ? 218 CYS A CB    1 
ATOM 1384  S SG    . CYS A 1 218 ? -124.034 168.972 203.943 1.00 35.70  ? 218 CYS A SG    1 
ATOM 1385  N N     . GLY A 1 219 ? -122.080 165.529 206.315 1.00 40.49  ? 219 GLY A N     1 
ATOM 1386  C CA    . GLY A 1 219 ? -121.463 164.812 207.413 1.00 40.49  ? 219 GLY A CA    1 
ATOM 1387  C C     . GLY A 1 219 ? -120.688 163.545 207.084 1.00 40.49  ? 219 GLY A C     1 
ATOM 1388  O O     . GLY A 1 219 ? -119.568 163.378 207.574 1.00 40.49  ? 219 GLY A O     1 
ATOM 1389  N N     . LEU A 1 220 ? -121.258 162.644 206.288 1.00 41.32  ? 220 LEU A N     1 
ATOM 1390  C CA    . LEU A 1 220 ? -120.705 161.299 206.111 1.00 41.32  ? 220 LEU A CA    1 
ATOM 1391  C C     . LEU A 1 220 ? -119.342 161.279 205.397 1.00 41.32  ? 220 LEU A C     1 
ATOM 1392  O O     . LEU A 1 220 ? -119.222 161.726 204.253 1.00 41.32  ? 220 LEU A O     1 
ATOM 1393  C CB    . LEU A 1 220 ? -121.741 160.445 205.385 1.00 41.32  ? 220 LEU A CB    1 
ATOM 1394  C CG    . LEU A 1 220 ? -121.413 159.011 204.989 1.00 41.32  ? 220 LEU A CG    1 
ATOM 1395  C CD1   . LEU A 1 220 ? -120.854 158.249 206.156 1.00 41.32  ? 220 LEU A CD1   1 
ATOM 1396  C CD2   . LEU A 1 220 ? -122.697 158.339 204.494 1.00 41.32  ? 220 LEU A CD2   1 
ATOM 1397  N N     . LEU A 1 221 ? -118.314 160.779 206.090 1.00 43.28  ? 221 LEU A N     1 
ATOM 1398  C CA    . LEU A 1 221 ? -116.982 160.542 205.533 1.00 43.28  ? 221 LEU A CA    1 
ATOM 1399  C C     . LEU A 1 221 ? -116.830 159.059 205.218 1.00 43.28  ? 221 LEU A C     1 
ATOM 1400  O O     . LEU A 1 221 ? -116.906 158.237 206.135 1.00 43.28  ? 221 LEU A O     1 
ATOM 1401  C CB    . LEU A 1 221 ? -115.955 160.983 206.580 1.00 43.28  ? 221 LEU A CB    1 
ATOM 1402  C CG    . LEU A 1 221 ? -114.479 160.617 206.703 1.00 43.28  ? 221 LEU A CG    1 
ATOM 1403  C CD1   . LEU A 1 221 ? -113.816 160.805 205.377 1.00 43.28  ? 221 LEU A CD1   1 
ATOM 1404  C CD2   . LEU A 1 221 ? -113.819 161.472 207.754 1.00 43.28  ? 221 LEU A CD2   1 
ATOM 1405  N N     . SER A 1 222 ? -116.584 158.692 203.955 1.00 46.27  ? 222 SER A N     1 
ATOM 1406  C CA    . SER A 1 222 ? -116.386 157.275 203.626 1.00 46.27  ? 222 SER A CA    1 
ATOM 1407  C C     . SER A 1 222 ? -114.929 156.924 203.307 1.00 46.27  ? 222 SER A C     1 
ATOM 1408  O O     . SER A 1 222 ? -114.338 157.549 202.420 1.00 46.27  ? 222 SER A O     1 
ATOM 1409  C CB    . SER A 1 222 ? -117.285 156.891 202.450 1.00 46.27  ? 222 SER A CB    1 
ATOM 1410  O OG    . SER A 1 222 ? -118.637 157.179 202.759 1.00 46.27  ? 222 SER A OG    1 
ATOM 1411  N N     . LEU A 1 223 ? -114.407 155.852 203.942 1.00 50.70  ? 223 LEU A N     1 
ATOM 1412  C CA    . LEU A 1 223 ? -113.054 155.297 203.773 1.00 50.70  ? 223 LEU A CA    1 
ATOM 1413  C C     . LEU A 1 223 ? -113.049 153.866 203.206 1.00 50.70  ? 223 LEU A C     1 
ATOM 1414  O O     . LEU A 1 223 ? -114.008 153.111 203.385 1.00 50.70  ? 223 LEU A O     1 
ATOM 1415  C CB    . LEU A 1 223 ? -112.245 155.353 205.081 1.00 50.70  ? 223 LEU A CB    1 
ATOM 1416  C CG    . LEU A 1 223 ? -111.933 156.768 205.596 1.00 50.70  ? 223 LEU A CG    1 
ATOM 1417  C CD1   . LEU A 1 223 ? -113.141 157.405 206.219 1.00 50.70  ? 223 LEU A CD1   1 
ATOM 1418  C CD2   . LEU A 1 223 ? -110.776 156.816 206.581 1.00 50.70  ? 223 LEU A CD2   1 
ATOM 1419  N N     . ALA A 1 224 ? -111.944 153.497 202.534 1.00 50.95  ? 224 ALA A N     1 
ATOM 1420  C CA    . ALA A 1 224 ? -111.704 152.207 201.874 1.00 50.95  ? 224 ALA A CA    1 
ATOM 1421  C C     . ALA A 1 224 ? -110.198 151.914 201.809 1.00 50.95  ? 224 ALA A C     1 
ATOM 1422  O O     . ALA A 1 224 ? -109.413 152.836 201.692 1.00 50.95  ? 224 ALA A O     1 
ATOM 1423  C CB    . ALA A 1 224 ? -112.310 152.189 200.470 1.00 50.95  ? 224 ALA A CB    1 
ATOM 1424  N N     . LEU A 1 225 ? -109.764 150.658 201.895 1.00 51.59  ? 225 LEU A N     1 
ATOM 1425  C CA    . LEU A 1 225 ? -108.316 150.405 201.852 1.00 51.59  ? 225 LEU A CA    1 
ATOM 1426  C C     . LEU A 1 225 ? -107.690 150.687 200.481 1.00 51.59  ? 225 LEU A C     1 
ATOM 1427  O O     . LEU A 1 225 ? -108.299 150.415 199.445 1.00 51.59  ? 225 LEU A O     1 
ATOM 1428  C CB    . LEU A 1 225 ? -108.043 148.945 202.225 1.00 51.59  ? 225 LEU A CB    1 
ATOM 1429  C CG    . LEU A 1 225 ? -106.581 148.500 202.349 1.00 51.59  ? 225 LEU A CG    1 
ATOM 1430  C CD1   . LEU A 1 225 ? -106.378 147.621 203.563 1.00 51.59  ? 225 LEU A CD1   1 
ATOM 1431  C CD2   . LEU A 1 225 ? -106.188 147.740 201.083 1.00 51.59  ? 225 LEU A CD2   1 
ATOM 1432  N N     . ILE A 1 226 ? -106.447 151.212 200.484 1.00 51.57  ? 226 ILE A N     1 
ATOM 1433  C CA    . ILE A 1 226 ? -105.738 151.613 199.242 1.00 51.57  ? 226 ILE A CA    1 
ATOM 1434  C C     . ILE A 1 226 ? -105.177 150.515 198.339 1.00 51.57  ? 226 ILE A C     1 
ATOM 1435  O O     . ILE A 1 226 ? -104.983 150.730 197.140 1.00 51.57  ? 226 ILE A O     1 
ATOM 1436  C CB    . ILE A 1 226 ? -104.610 152.596 199.487 1.00 51.57  ? 226 ILE A CB    1 
ATOM 1437  C CG1   . ILE A 1 226 ? -103.602 152.065 200.498 1.00 51.57  ? 226 ILE A CG1   1 
ATOM 1438  C CG2   . ILE A 1 226 ? -105.224 153.882 199.921 1.00 51.57  ? 226 ILE A CG2   1 
ATOM 1439  C CD1   . ILE A 1 226 ? -102.314 152.874 200.513 1.00 51.57  ? 226 ILE A CD1   1 
ATOM 1440  N N     . PRO B 2 17  ? -245.648 162.547 144.333 1.00 97.56  ? 17  PRO C N     1 
ATOM 1441  C CA    . PRO B 2 17  ? -244.752 161.614 143.646 1.00 97.56  ? 17  PRO C CA    1 
ATOM 1442  C C     . PRO B 2 17  ? -243.366 162.195 143.422 1.00 97.56  ? 17  PRO C C     1 
ATOM 1443  O O     . PRO B 2 17  ? -243.234 163.387 143.156 1.00 97.56  ? 17  PRO C O     1 
ATOM 1444  C CB    . PRO B 2 17  ? -245.452 161.373 142.308 1.00 97.56  ? 17  PRO C CB    1 
ATOM 1445  C CG    . PRO B 2 17  ? -246.331 162.551 142.118 1.00 97.56  ? 17  PRO C CG    1 
ATOM 1446  C CD    . PRO B 2 17  ? -246.778 162.955 143.485 1.00 97.56  ? 17  PRO C CD    1 
ATOM 1447  N N     . PRO B 2 18  ? -242.341 161.356 143.534 1.00 91.34  ? 18  PRO C N     1 
ATOM 1448  C CA    . PRO B 2 18  ? -240.970 161.843 143.362 1.00 91.34  ? 18  PRO C CA    1 
ATOM 1449  C C     . PRO B 2 18  ? -240.696 162.160 141.905 1.00 91.34  ? 18  PRO C C     1 
ATOM 1450  O O     . PRO B 2 18  ? -241.028 161.379 141.011 1.00 91.34  ? 18  PRO C O     1 
ATOM 1451  C CB    . PRO B 2 18  ? -240.113 160.673 143.846 1.00 91.34  ? 18  PRO C CB    1 
ATOM 1452  C CG    . PRO B 2 18  ? -240.968 159.486 143.640 1.00 91.34  ? 18  PRO C CG    1 
ATOM 1453  C CD    . PRO B 2 18  ? -242.375 159.931 143.888 1.00 91.34  ? 18  PRO C CD    1 
ATOM 1454  N N     . SER B 2 19  ? -240.084 163.314 141.673 1.00 94.00  ? 19  SER C N     1 
ATOM 1455  C CA    . SER B 2 19  ? -239.758 163.738 140.323 1.00 94.00  ? 19  SER C CA    1 
ATOM 1456  C C     . SER B 2 19  ? -238.538 164.640 140.372 1.00 94.00  ? 19  SER C C     1 
ATOM 1457  O O     . SER B 2 19  ? -238.297 165.337 141.360 1.00 94.00  ? 19  SER C O     1 
ATOM 1458  C CB    . SER B 2 19  ? -240.944 164.453 139.680 1.00 94.00  ? 19  SER C CB    1 
ATOM 1459  O OG    . SER B 2 19  ? -241.364 165.524 140.504 1.00 94.00  ? 19  SER C OG    1 
ATOM 1460  N N     . PHE B 2 20  ? -237.741 164.532 139.320 1.00 88.84  ? 20  PHE C N     1 
ATOM 1461  C CA    . PHE B 2 20  ? -236.529 165.290 139.175 1.00 88.84  ? 20  PHE C CA    1 
ATOM 1462  C C     . PHE B 2 20  ? -236.414 165.545 137.694 1.00 88.84  ? 20  PHE C C     1 
ATOM 1463  O O     . PHE B 2 20  ? -236.691 164.652 136.899 1.00 88.84  ? 20  PHE C O     1 
ATOM 1464  C CB    . PHE B 2 20  ? -235.362 164.422 139.629 1.00 88.84  ? 20  PHE C CB    1 
ATOM 1465  C CG    . PHE B 2 20  ? -234.137 165.189 140.015 1.00 88.84  ? 20  PHE C CG    1 
ATOM 1466  C CD1   . PHE B 2 20  ? -233.965 165.635 141.308 1.00 88.84  ? 20  PHE C CD1   1 
ATOM 1467  C CD2   . PHE B 2 20  ? -233.147 165.441 139.088 1.00 88.84  ? 20  PHE C CD2   1 
ATOM 1468  C CE1   . PHE B 2 20  ? -232.834 166.332 141.666 1.00 88.84  ? 20  PHE C CE1   1 
ATOM 1469  C CE2   . PHE B 2 20  ? -232.012 166.137 139.439 1.00 88.84  ? 20  PHE C CE2   1 
ATOM 1470  C CZ    . PHE B 2 20  ? -231.855 166.583 140.730 1.00 88.84  ? 20  PHE C CZ    1 
ATOM 1471  N N     . ASP B 2 21  ? -236.015 166.751 137.312 1.00 88.30  ? 21  ASP C N     1 
ATOM 1472  C CA    . ASP B 2 21  ? -235.861 167.067 135.904 1.00 88.30  ? 21  ASP C CA    1 
ATOM 1473  C C     . ASP B 2 21  ? -234.476 167.607 135.603 1.00 88.30  ? 21  ASP C C     1 
ATOM 1474  O O     . ASP B 2 21  ? -234.042 168.571 136.225 1.00 88.30  ? 21  ASP C O     1 
ATOM 1475  C CB    . ASP B 2 21  ? -236.904 168.090 135.481 1.00 88.30  ? 21  ASP C CB    1 
ATOM 1476  C CG    . ASP B 2 21  ? -238.063 167.466 134.749 1.00 88.30  ? 21  ASP C CG    1 
ATOM 1477  O OD1   . ASP B 2 21  ? -237.857 166.420 134.099 1.00 88.30  ? 21  ASP C OD1   1 
ATOM 1478  O OD2   . ASP B 2 21  ? -239.178 168.023 134.825 1.00 88.30  ? 21  ASP C OD2   1 
ATOM 1479  N N     . VAL B 2 22  ? -233.792 167.003 134.636 1.00 85.40  ? 22  VAL C N     1 
ATOM 1480  C CA    . VAL B 2 22  ? -232.469 167.464 134.263 1.00 85.40  ? 22  VAL C CA    1 
ATOM 1481  C C     . VAL B 2 22  ? -232.574 168.891 133.759 1.00 85.40  ? 22  VAL C C     1 
ATOM 1482  O O     . VAL B 2 22  ? -231.723 169.731 134.045 1.00 85.40  ? 22  VAL C O     1 
ATOM 1483  C CB    . VAL B 2 22  ? -231.868 166.594 133.146 1.00 85.40  ? 22  VAL C CB    1 
ATOM 1484  C CG1   . VAL B 2 22  ? -230.365 166.790 133.070 1.00 85.40  ? 22  VAL C CG1   1 
ATOM 1485  C CG2   . VAL B 2 22  ? -232.208 165.132 133.373 1.00 85.40  ? 22  VAL C CG2   1 
ATOM 1486  N N     . THR B 2 23  ? -233.627 169.157 133.000 1.00 86.69  ? 23  THR C N     1 
ATOM 1487  C CA    . THR B 2 23  ? -233.837 170.480 132.441 1.00 86.69  ? 23  THR C CA    1 
ATOM 1488  C C     . THR B 2 23  ? -234.042 171.577 133.480 1.00 86.69  ? 23  THR C C     1 
ATOM 1489  O O     . THR B 2 23  ? -233.502 172.670 133.335 1.00 86.69  ? 23  THR C O     1 
ATOM 1490  C CB    . THR B 2 23  ? -235.034 170.476 131.486 1.00 86.69  ? 23  THR C CB    1 
ATOM 1491  O OG1   . THR B 2 23  ? -235.681 169.204 131.553 1.00 86.69  ? 23  THR C OG1   1 
ATOM 1492  C CG2   . THR B 2 23  ? -234.574 170.717 130.067 1.00 86.69  ? 23  THR C CG2   1 
ATOM 1493  N N     . ILE B 2 24  ? -234.824 171.300 134.518 1.00 84.54  ? 24  ILE C N     1 
ATOM 1494  C CA    . ILE B 2 24  ? -235.084 172.315 135.538 1.00 84.54  ? 24  ILE C CA    1 
ATOM 1495  C C     . ILE B 2 24  ? -234.357 172.193 136.886 1.00 84.54  ? 24  ILE C C     1 
ATOM 1496  O O     . ILE B 2 24  ? -233.965 173.201 137.465 1.00 84.54  ? 24  ILE C O     1 
ATOM 1497  C CB    . ILE B 2 24  ? -236.597 172.488 135.754 1.00 84.54  ? 24  ILE C CB    1 
ATOM 1498  C CG1   . ILE B 2 24  ? -237.257 172.915 134.444 1.00 84.54  ? 24  ILE C CG1   1 
ATOM 1499  C CG2   . ILE B 2 24  ? -236.878 173.521 136.834 1.00 84.54  ? 24  ILE C CG2   1 
ATOM 1500  C CD1   . ILE B 2 24  ? -237.230 171.860 133.361 1.00 84.54  ? 24  ILE C CD1   1 
ATOM 1501  N N     . ALA B 2 25  ? -234.177 170.978 137.388 1.00 85.66  ? 25  ALA C N     1 
ATOM 1502  C CA    . ALA B 2 25  ? -233.505 170.795 138.675 1.00 85.66  ? 25  ALA C CA    1 
ATOM 1503  C C     . ALA B 2 25  ? -232.029 171.145 138.602 1.00 85.66  ? 25  ALA C C     1 
ATOM 1504  O O     . ALA B 2 25  ? -231.391 170.963 137.566 1.00 85.66  ? 25  ALA C O     1 
ATOM 1505  C CB    . ALA B 2 25  ? -233.693 169.381 139.185 1.00 85.66  ? 25  ALA C CB    1 
ATOM 1506  N N     . PRO B 2 26  ? -231.481 171.647 139.701 1.00 83.37  ? 26  PRO C N     1 
ATOM 1507  C CA    . PRO B 2 26  ? -230.068 172.035 139.732 1.00 83.37  ? 26  PRO C CA    1 
ATOM 1508  C C     . PRO B 2 26  ? -229.095 170.936 140.112 1.00 83.37  ? 26  PRO C C     1 
ATOM 1509  O O     . PRO B 2 26  ? -229.150 170.377 141.212 1.00 83.37  ? 26  PRO C O     1 
ATOM 1510  C CB    . PRO B 2 26  ? -230.056 173.152 140.774 1.00 83.37  ? 26  PRO C CB    1 
ATOM 1511  C CG    . PRO B 2 26  ? -231.099 172.760 141.717 1.00 83.37  ? 26  PRO C CG    1 
ATOM 1512  C CD    . PRO B 2 26  ? -232.172 172.033 140.937 1.00 83.37  ? 26  PRO C CD    1 
ATOM 1513  N N     . TRP B 2 27  ? -228.197 170.621 139.181 1.00 78.46  ? 27  TRP C N     1 
ATOM 1514  C CA    . TRP B 2 27  ? -227.157 169.629 139.399 1.00 78.46  ? 27  TRP C CA    1 
ATOM 1515  C C     . TRP B 2 27  ? -225.866 170.066 138.731 1.00 78.46  ? 27  TRP C C     1 
ATOM 1516  O O     . TRP B 2 27  ? -224.785 169.880 139.292 1.00 78.46  ? 27  TRP C O     1 
ATOM 1517  C CB    . TRP B 2 27  ? -227.541 168.240 138.900 1.00 78.46  ? 27  TRP C CB    1 
ATOM 1518  C CG    . TRP B 2 27  ? -227.873 168.128 137.465 1.00 78.46  ? 27  TRP C CG    1 
ATOM 1519  C CD1   . TRP B 2 27  ? -228.944 168.657 136.833 1.00 78.46  ? 27  TRP C CD1   1 
ATOM 1520  C CD2   . TRP B 2 27  ? -227.103 167.459 136.458 1.00 78.46  ? 27  TRP C CD2   1 
ATOM 1521  N NE1   . TRP B 2 27  ? -228.913 168.333 135.500 1.00 78.46  ? 27  TRP C NE1   1 
ATOM 1522  C CE2   . TRP B 2 27  ? -227.783 167.605 135.246 1.00 78.46  ? 27  TRP C CE2   1 
ATOM 1523  C CE3   . TRP B 2 27  ? -225.904 166.751 136.469 1.00 78.46  ? 27  TRP C CE3   1 
ATOM 1524  C CZ2   . TRP B 2 27  ? -227.308 167.072 134.058 1.00 78.46  ? 27  TRP C CZ2   1 
ATOM 1525  C CZ3   . TRP B 2 27  ? -225.439 166.217 135.294 1.00 78.46  ? 27  TRP C CZ3   1 
ATOM 1526  C CH2   . TRP B 2 27  ? -226.136 166.380 134.103 1.00 78.46  ? 27  TRP C CH2   1 
ATOM 1527  N N     . LEU B 2 28  ? -225.962 170.663 137.553 1.00 78.11  ? 28  LEU C N     1 
ATOM 1528  C CA    . LEU B 2 28  ? -224.764 171.080 136.843 1.00 78.11  ? 28  LEU C CA    1 
ATOM 1529  C C     . LEU B 2 28  ? -224.119 172.293 137.499 1.00 78.11  ? 28  LEU C C     1 
ATOM 1530  O O     . LEU B 2 28  ? -224.699 173.379 137.524 1.00 78.11  ? 28  LEU C O     1 
ATOM 1531  C CB    . LEU B 2 28  ? -225.124 171.416 135.406 1.00 78.11  ? 28  LEU C CB    1 
ATOM 1532  C CG    . LEU B 2 28  ? -225.527 170.279 134.494 1.00 78.11  ? 28  LEU C CG    1 
ATOM 1533  C CD1   . LEU B 2 28  ? -225.895 170.876 133.189 1.00 78.11  ? 28  LEU C CD1   1 
ATOM 1534  C CD2   . LEU B 2 28  ? -224.384 169.359 134.317 1.00 78.11  ? 28  LEU C CD2   1 
ATOM 1535  N N     . ILE B 2 29  ? -222.922 172.106 138.052 1.00 79.40  ? 29  ILE C N     1 
ATOM 1536  C CA    . ILE B 2 29  ? -222.157 173.241 138.539 1.00 79.40  ? 29  ILE C CA    1 
ATOM 1537  C C     . ILE B 2 29  ? -221.806 174.111 137.338 1.00 79.40  ? 29  ILE C C     1 
ATOM 1538  O O     . ILE B 2 29  ? -221.372 173.617 136.286 1.00 79.40  ? 29  ILE C O     1 
ATOM 1539  C CB    . ILE B 2 29  ? -220.897 172.805 139.301 1.00 79.40  ? 29  ILE C CB    1 
ATOM 1540  C CG1   . ILE B 2 29  ? -221.251 171.938 140.503 1.00 79.40  ? 29  ILE C CG1   1 
ATOM 1541  C CG2   . ILE B 2 29  ? -220.130 174.018 139.770 1.00 79.40  ? 29  ILE C CG2   1 
ATOM 1542  C CD1   . ILE B 2 29  ? -221.010 170.474 140.262 1.00 79.40  ? 29  ILE C CD1   1 
ATOM 1543  N N     . ALA B 2 30  ? -221.948 175.422 137.506 1.00 84.25  ? 30  ALA C N     1 
ATOM 1544  C CA    . ALA B 2 30  ? -221.718 176.350 136.412 1.00 84.25  ? 30  ALA C CA    1 
ATOM 1545  C C     . ALA B 2 30  ? -220.865 177.513 136.885 1.00 84.25  ? 30  ALA C C     1 
ATOM 1546  O O     . ALA B 2 30  ? -221.146 178.110 137.938 1.00 84.25  ? 30  ALA C O     1 
ATOM 1547  C CB    . ALA B 2 30  ? -223.048 176.867 135.863 1.00 84.25  ? 30  ALA C CB    1 
ATOM 1548  N N     . ARG B 2 31  ? -219.862 177.836 136.067 1.00 88.62  ? 31  ARG C N     1 
ATOM 1549  C CA    . ARG B 2 31  ? -218.927 178.929 136.298 1.00 88.62  ? 31  ARG C CA    1 
ATOM 1550  C C     . ARG B 2 31  ? -219.204 180.023 135.273 1.00 88.62  ? 31  ARG C C     1 
ATOM 1551  O O     . ARG B 2 31  ? -219.372 179.750 134.088 1.00 88.62  ? 31  ARG C O     1 
ATOM 1552  C CB    . ARG B 2 31  ? -217.489 178.445 136.172 1.00 88.62  ? 31  ARG C CB    1 
ATOM 1553  C CG    . ARG B 2 31  ? -217.247 177.059 136.733 1.00 88.62  ? 31  ARG C CG    1 
ATOM 1554  C CD    . ARG B 2 31  ? -215.868 176.962 137.360 1.00 88.62  ? 31  ARG C CD    1 
ATOM 1555  N NE    . ARG B 2 31  ? -215.825 177.607 138.665 1.00 88.62  ? 31  ARG C NE    1 
ATOM 1556  C CZ    . ARG B 2 31  ? -215.710 176.953 139.813 1.00 88.62  ? 31  ARG C CZ    1 
ATOM 1557  N NH1   . ARG B 2 31  ? -215.619 175.631 139.816 1.00 88.62  ? 31  ARG C NH1   1 
ATOM 1558  N NH2   . ARG B 2 31  ? -215.683 177.617 140.959 1.00 88.62  ? 31  ARG C NH2   1 
ATOM 1559  N N     . SER B 2 32  ? -219.261 181.263 135.747 1.00 99.08  ? 32  SER C N     1 
ATOM 1560  C CA    . SER B 2 32  ? -219.589 182.415 134.925 1.00 99.08  ? 32  SER C CA    1 
ATOM 1561  C C     . SER B 2 32  ? -218.359 183.003 134.240 1.00 99.08  ? 32  SER C C     1 
ATOM 1562  O O     . SER B 2 32  ? -217.214 182.715 134.590 1.00 99.08  ? 32  SER C O     1 
ATOM 1563  C CB    . SER B 2 32  ? -220.257 183.491 135.770 1.00 99.08  ? 32  SER C CB    1 
ATOM 1564  O OG    . SER B 2 32  ? -219.336 183.986 136.721 1.00 99.08  ? 32  SER C OG    1 
ATOM 1565  N N     . ARG B 2 33  ? -218.622 183.852 133.245 1.00 103.68 ? 33  ARG C N     1 
ATOM 1566  C CA    . ARG B 2 33  ? -217.540 184.530 132.541 1.00 103.68 ? 33  ARG C CA    1 
ATOM 1567  C C     . ARG B 2 33  ? -216.792 185.490 133.457 1.00 103.68 ? 33  ARG C C     1 
ATOM 1568  O O     . ARG B 2 33  ? -215.579 185.681 133.311 1.00 103.68 ? 33  ARG C O     1 
ATOM 1569  C CB    . ARG B 2 33  ? -218.084 185.323 131.350 1.00 103.68 ? 33  ARG C CB    1 
ATOM 1570  C CG    . ARG B 2 33  ? -219.165 186.325 131.743 1.00 103.68 ? 33  ARG C CG    1 
ATOM 1571  C CD    . ARG B 2 33  ? -219.865 186.979 130.555 1.00 103.68 ? 33  ARG C CD    1 
ATOM 1572  N NE    . ARG B 2 33  ? -218.894 187.624 129.670 1.00 103.68 ? 33  ARG C NE    1 
ATOM 1573  C CZ    . ARG B 2 33  ? -219.190 188.173 128.500 1.00 103.68 ? 33  ARG C CZ    1 
ATOM 1574  N NH1   . ARG B 2 33  ? -220.436 188.159 128.054 1.00 103.68 ? 33  ARG C NH1   1 
ATOM 1575  N NH2   . ARG B 2 33  ? -218.237 188.740 127.776 1.00 103.68 ? 33  ARG C NH2   1 
ATOM 1576  N N     . ASP B 2 34  ? -217.503 186.103 134.391 1.00 111.55 ? 34  ASP C N     1 
ATOM 1577  C CA    . ASP B 2 34  ? -216.998 187.147 135.268 1.00 111.55 ? 34  ASP C CA    1 
ATOM 1578  C C     . ASP B 2 34  ? -216.744 186.655 136.686 1.00 111.55 ? 34  ASP C C     1 
ATOM 1579  O O     . ASP B 2 34  ? -217.193 185.580 137.092 1.00 111.55 ? 34  ASP C O     1 
ATOM 1580  C CB    . ASP B 2 34  ? -217.976 188.331 135.274 1.00 111.55 ? 34  ASP C CB    1 
ATOM 1581  C CG    . ASP B 2 34  ? -219.377 187.947 135.733 1.00 111.55 ? 34  ASP C CG    1 
ATOM 1582  O OD1   . ASP B 2 34  ? -219.537 186.928 136.431 1.00 111.55 ? 34  ASP C OD1   1 
ATOM 1583  O OD2   . ASP B 2 34  ? -220.338 188.647 135.354 1.00 111.55 ? 34  ASP C OD2   1 
ATOM 1584  N N     . VAL B 2 35  ? -215.968 187.451 137.423 1.00 115.46 ? 35  VAL C N     1 
ATOM 1585  C CA    . VAL B 2 35  ? -215.793 187.278 138.861 1.00 115.46 ? 35  VAL C CA    1 
ATOM 1586  C C     . VAL B 2 35  ? -215.012 186.007 139.160 1.00 115.46 ? 35  VAL C C     1 
ATOM 1587  O O     . VAL B 2 35  ? -213.984 186.044 139.845 1.00 115.46 ? 35  VAL C O     1 
ATOM 1588  C CB    . VAL B 2 35  ? -217.153 187.285 139.584 1.00 115.46 ? 35  VAL C CB    1 
ATOM 1589  C CG1   . VAL B 2 35  ? -216.968 187.157 141.075 1.00 115.46 ? 35  VAL C CG1   1 
ATOM 1590  C CG2   . VAL B 2 35  ? -217.912 188.546 139.248 1.00 115.46 ? 35  VAL C CG2   1 
ATOM 1591  N N     . LEU B 2 36  ? -215.513 184.875 138.668 1.00 115.39 ? 36  LEU C N     1 
ATOM 1592  C CA    . LEU B 2 36  ? -214.942 183.556 138.949 1.00 115.39 ? 36  LEU C CA    1 
ATOM 1593  C C     . LEU B 2 36  ? -215.029 183.247 140.441 1.00 115.39 ? 36  LEU C C     1 
ATOM 1594  O O     . LEU B 2 36  ? -214.090 182.728 141.050 1.00 115.39 ? 36  LEU C O     1 
ATOM 1595  C CB    . LEU B 2 36  ? -213.492 183.466 138.460 1.00 115.39 ? 36  LEU C CB    1 
ATOM 1596  C CG    . LEU B 2 36  ? -213.145 183.109 137.019 1.00 115.39 ? 36  LEU C CG    1 
ATOM 1597  C CD1   . LEU B 2 36  ? -213.566 184.216 136.075 1.00 115.39 ? 36  LEU C CD1   1 
ATOM 1598  C CD2   . LEU B 2 36  ? -211.642 182.896 136.938 1.00 115.39 ? 36  LEU C CD2   1 
ATOM 1599  N N     . ALA B 2 37  ? -216.176 183.591 141.028 1.00 111.49 ? 37  ALA C N     1 
ATOM 1600  C CA    . ALA B 2 37  ? -216.499 183.349 142.426 1.00 111.49 ? 37  ALA C CA    1 
ATOM 1601  C C     . ALA B 2 37  ? -217.927 182.834 142.564 1.00 111.49 ? 37  ALA C C     1 
ATOM 1602  O O     . ALA B 2 37  ? -218.838 183.336 141.901 1.00 111.49 ? 37  ALA C O     1 
ATOM 1603  C CB    . ALA B 2 37  ? -216.317 184.609 143.283 1.00 111.49 ? 37  ALA C CB    1 
ATOM 1604  N N     . ALA B 2 38  ? -218.108 181.818 143.410 1.00 103.85 ? 38  ALA C N     1 
ATOM 1605  C CA    . ALA B 2 38  ? -219.399 181.188 143.682 1.00 103.85 ? 38  ALA C CA    1 
ATOM 1606  C C     . ALA B 2 38  ? -220.103 180.587 142.472 1.00 103.85 ? 38  ALA C C     1 
ATOM 1607  O O     . ALA B 2 38  ? -221.045 181.182 141.934 1.00 103.85 ? 38  ALA C O     1 
ATOM 1608  C CB    . ALA B 2 38  ? -220.335 182.197 144.349 1.00 103.85 ? 38  ALA C CB    1 
ATOM 1609  N N     . PRO B 2 39  ? -219.660 179.420 142.012 1.00 97.65  ? 39  PRO C N     1 
ATOM 1610  C CA    . PRO B 2 39  ? -220.340 178.755 140.898 1.00 97.65  ? 39  PRO C CA    1 
ATOM 1611  C C     . PRO B 2 39  ? -221.675 178.211 141.374 1.00 97.65  ? 39  PRO C C     1 
ATOM 1612  O O     . PRO B 2 39  ? -221.771 177.614 142.448 1.00 97.65  ? 39  PRO C O     1 
ATOM 1613  C CB    . PRO B 2 39  ? -219.386 177.621 140.524 1.00 97.65  ? 39  PRO C CB    1 
ATOM 1614  C CG    . PRO B 2 39  ? -218.640 177.337 141.791 1.00 97.65  ? 39  PRO C CG    1 
ATOM 1615  C CD    . PRO B 2 39  ? -218.513 178.647 142.511 1.00 97.65  ? 39  PRO C CD    1 
ATOM 1616  N N     . GLU B 2 40  ? -222.707 178.429 140.582 1.00 93.26  ? 40  GLU C N     1 
ATOM 1617  C CA    . GLU B 2 40  ? -224.029 178.019 141.025 1.00 93.26  ? 40  GLU C CA    1 
ATOM 1618  C C     . GLU B 2 40  ? -224.458 176.754 140.294 1.00 93.26  ? 40  GLU C C     1 
ATOM 1619  O O     . GLU B 2 40  ? -224.086 176.547 139.136 1.00 93.26  ? 40  GLU C O     1 
ATOM 1620  C CB    . GLU B 2 40  ? -224.994 179.175 140.770 1.00 93.26  ? 40  GLU C CB    1 
ATOM 1621  C CG    . GLU B 2 40  ? -226.396 179.035 141.271 1.00 93.26  ? 40  GLU C CG    1 
ATOM 1622  C CD    . GLU B 2 40  ? -227.299 178.415 140.233 1.00 93.26  ? 40  GLU C CD    1 
ATOM 1623  O OE1   . GLU B 2 40  ? -226.840 178.205 139.089 1.00 93.26  ? 40  GLU C OE1   1 
ATOM 1624  O OE2   . GLU B 2 40  ? -228.488 178.183 140.530 1.00 93.26  ? 40  GLU C OE2   1 
ATOM 1625  N N     . MET B 2 41  ? -225.219 175.881 140.971 1.00 91.41  ? 41  MET C N     1 
ATOM 1626  C CA    . MET B 2 41  ? -225.701 174.711 140.254 1.00 91.41  ? 41  MET C CA    1 
ATOM 1627  C C     . MET B 2 41  ? -227.003 175.068 139.549 1.00 91.41  ? 41  MET C C     1 
ATOM 1628  O O     . MET B 2 41  ? -227.895 175.664 140.144 1.00 91.41  ? 41  MET C O     1 
ATOM 1629  C CB    . MET B 2 41  ? -225.923 173.541 141.220 1.00 91.41  ? 41  MET C CB    1 
ATOM 1630  C CG    . MET B 2 41  ? -224.657 172.955 141.854 1.00 91.41  ? 41  MET C CG    1 
ATOM 1631  S SD    . MET B 2 41  ? -224.966 171.549 142.949 1.00 91.41  ? 41  MET C SD    1 
ATOM 1632  C CE    . MET B 2 41  ? -223.303 171.118 143.454 1.00 91.41  ? 41  MET C CE    1 
ATOM 1633  N N     . LEU B 2 42  ? -227.140 174.619 138.315 1.00 83.49  ? 42  LEU C N     1 
ATOM 1634  C CA    . LEU B 2 42  ? -228.276 174.920 137.457 1.00 83.49  ? 42  LEU C CA    1 
ATOM 1635  C C     . LEU B 2 42  ? -228.737 173.638 136.777 1.00 83.49  ? 42  LEU C C     1 
ATOM 1636  O O     . LEU B 2 42  ? -228.035 172.625 136.797 1.00 83.49  ? 42  LEU C O     1 
ATOM 1637  C CB    . LEU B 2 42  ? -227.999 176.079 136.500 1.00 83.49  ? 42  LEU C CB    1 
ATOM 1638  C CG    . LEU B 2 42  ? -226.716 176.208 135.699 1.00 83.49  ? 42  LEU C CG    1 
ATOM 1639  C CD1   . LEU B 2 42  ? -226.620 175.177 134.641 1.00 83.49  ? 42  LEU C CD1   1 
ATOM 1640  C CD2   . LEU B 2 42  ? -226.623 177.607 135.128 1.00 83.49  ? 42  LEU C CD2   1 
ATOM 1641  N N     . GLY B 2 43  ? -229.928 173.678 136.183 1.00 85.41  ? 43  GLY C N     1 
ATOM 1642  C CA    . GLY B 2 43  ? -230.351 172.570 135.349 1.00 85.41  ? 43  GLY C CA    1 
ATOM 1643  C C     . GLY B 2 43  ? -229.738 172.575 133.953 1.00 85.41  ? 43  GLY C C     1 
ATOM 1644  O O     . GLY B 2 43  ? -229.045 173.501 133.544 1.00 85.41  ? 43  GLY C O     1 
ATOM 1645  N N     . LEU B 2 44  ? -230.023 171.494 133.215 1.00 85.09  ? 44  LEU C N     1 
ATOM 1646  C CA    . LEU B 2 44  ? -229.561 171.336 131.831 1.00 85.09  ? 44  LEU C CA    1 
ATOM 1647  C C     . LEU B 2 44  ? -230.143 172.362 130.869 1.00 85.09  ? 44  LEU C C     1 
ATOM 1648  O O     . LEU B 2 44  ? -229.451 172.845 129.962 1.00 85.09  ? 44  LEU C O     1 
ATOM 1649  C CB    . LEU B 2 44  ? -229.888 169.924 131.351 1.00 85.09  ? 44  LEU C CB    1 
ATOM 1650  C CG    . LEU B 2 44  ? -229.322 169.475 130.012 1.00 85.09  ? 44  LEU C CG    1 
ATOM 1651  C CD1   . LEU B 2 44  ? -228.937 168.017 130.033 1.00 85.09  ? 44  LEU C CD1   1 
ATOM 1652  C CD2   . LEU B 2 44  ? -230.417 169.674 129.004 1.00 85.09  ? 44  LEU C CD2   1 
ATOM 1653  N N     . ARG B 2 45  ? -231.412 172.704 131.067 1.00 93.25  ? 45  ARG C N     1 
ATOM 1654  C CA    . ARG B 2 45  ? -232.081 173.681 130.215 1.00 93.25  ? 45  ARG C CA    1 
ATOM 1655  C C     . ARG B 2 45  ? -231.494 175.077 130.407 1.00 93.25  ? 45  ARG C C     1 
ATOM 1656  O O     . ARG B 2 45  ? -231.277 175.809 129.442 1.00 93.25  ? 45  ARG C O     1 
ATOM 1657  C CB    . ARG B 2 45  ? -233.584 173.699 130.497 1.00 93.25  ? 45  ARG C CB    1 
ATOM 1658  C CG    . ARG B 2 45  ? -234.392 174.526 129.511 1.00 93.25  ? 45  ARG C CG    1 
ATOM 1659  C CD    . ARG B 2 45  ? -235.885 174.355 129.738 1.00 93.25  ? 45  ARG C CD    1 
ATOM 1660  N NE    . ARG B 2 45  ? -236.656 175.448 129.152 1.00 93.25  ? 45  ARG C NE    1 
ATOM 1661  C CZ    . ARG B 2 45  ? -236.979 176.563 129.797 1.00 93.25  ? 45  ARG C CZ    1 
ATOM 1662  N NH1   . ARG B 2 45  ? -237.684 177.505 129.185 1.00 93.25  ? 45  ARG C NH1   1 
ATOM 1663  N NH2   . ARG B 2 45  ? -236.597 176.739 131.055 1.00 93.25  ? 45  ARG C NH2   1 
ATOM 1664  N N     . ASP B 2 46  ? -231.242 175.439 131.661 1.00 92.23  ? 46  ASP C N     1 
ATOM 1665  C CA    . ASP B 2 46  ? -230.681 176.745 131.995 1.00 92.23  ? 46  ASP C CA    1 
ATOM 1666  C C     . ASP B 2 46  ? -229.266 176.872 131.453 1.00 92.23  ? 46  ASP C C     1 
ATOM 1667  O O     . ASP B 2 46  ? -228.948 177.871 130.824 1.00 92.23  ? 46  ASP C O     1 
ATOM 1668  C CB    . ASP B 2 46  ? -230.670 176.961 133.503 1.00 92.23  ? 46  ASP C CB    1 
ATOM 1669  C CG    . ASP B 2 46  ? -232.030 177.340 134.045 1.00 92.23  ? 46  ASP C CG    1 
ATOM 1670  O OD1   . ASP B 2 46  ? -232.490 178.467 133.769 1.00 92.23  ? 46  ASP C OD1   1 
ATOM 1671  O OD2   . ASP B 2 46  ? -232.639 176.510 134.752 1.00 92.23  ? 46  ASP C OD2   1 
ATOM 1672  N N     . VAL B 2 47  ? -228.423 175.862 131.645 1.00 90.57  ? 47  VAL C N     1 
ATOM 1673  C CA    . VAL B 2 47  ? -227.091 175.921 131.042 1.00 90.57  ? 47  VAL C CA    1 
ATOM 1674  C C     . VAL B 2 47  ? -227.207 176.078 129.541 1.00 90.57  ? 47  VAL C C     1 
ATOM 1675  O O     . VAL B 2 47  ? -226.414 176.792 128.911 1.00 90.57  ? 47  VAL C O     1 
ATOM 1676  C CB    . VAL B 2 47  ? -226.229 174.705 131.414 1.00 90.57  ? 47  VAL C CB    1 
ATOM 1677  C CG1   . VAL B 2 47  ? -226.847 173.448 130.963 1.00 90.57  ? 47  VAL C CG1   1 
ATOM 1678  C CG2   . VAL B 2 47  ? -224.873 174.849 130.773 1.00 90.57  ? 47  VAL C CG2   1 
ATOM 1679  N N     . LEU B 2 48  ? -228.189 175.416 128.938 1.00 88.96  ? 48  LEU C N     1 
ATOM 1680  C CA    . LEU B 2 48  ? -228.259 175.435 127.487 1.00 88.96  ? 48  LEU C CA    1 
ATOM 1681  C C     . LEU B 2 48  ? -228.544 176.846 127.003 1.00 88.96  ? 48  LEU C C     1 
ATOM 1682  O O     . LEU B 2 48  ? -227.946 177.305 126.026 1.00 88.96  ? 48  LEU C O     1 
ATOM 1683  C CB    . LEU B 2 48  ? -229.280 174.440 126.967 1.00 88.96  ? 48  LEU C CB    1 
ATOM 1684  C CG    . LEU B 2 48  ? -228.690 173.036 127.026 1.00 88.96  ? 48  LEU C CG    1 
ATOM 1685  C CD1   . LEU B 2 48  ? -229.610 172.036 126.400 1.00 88.96  ? 48  LEU C CD1   1 
ATOM 1686  C CD2   . LEU B 2 48  ? -227.323 172.979 126.370 1.00 88.96  ? 48  LEU C CD2   1 
ATOM 1687  N N     . ILE B 2 49  ? -229.500 177.487 127.668 1.00 93.28  ? 49  ILE C N     1 
ATOM 1688  C CA    . ILE B 2 49  ? -229.956 178.851 127.396 1.00 93.28  ? 49  ILE C CA    1 
ATOM 1689  C C     . ILE B 2 49  ? -228.972 179.989 127.678 1.00 93.28  ? 49  ILE C C     1 
ATOM 1690  O O     . ILE B 2 49  ? -228.928 180.975 126.947 1.00 93.28  ? 49  ILE C O     1 
ATOM 1691  C CB    . ILE B 2 49  ? -231.282 179.130 128.126 1.00 93.28  ? 49  ILE C CB    1 
ATOM 1692  C CG1   . ILE B 2 49  ? -232.310 178.060 127.752 1.00 93.28  ? 49  ILE C CG1   1 
ATOM 1693  C CG2   . ILE B 2 49  ? -231.775 180.524 127.797 1.00 93.28  ? 49  ILE C CG2   1 
ATOM 1694  C CD1   . ILE B 2 49  ? -233.751 178.472 127.922 1.00 93.28  ? 49  ILE C CD1   1 
ATOM 1695  N N     . ARG B 2 50  ? -228.209 179.843 128.756 1.00 93.99  ? 50  ARG C N     1 
ATOM 1696  C CA    . ARG B 2 50  ? -227.246 180.843 129.217 1.00 93.99  ? 50  ARG C CA    1 
ATOM 1697  C C     . ARG B 2 50  ? -225.817 180.483 128.860 1.00 93.99  ? 50  ARG C C     1 
ATOM 1698  O O     . ARG B 2 50  ? -224.885 180.890 129.546 1.00 93.99  ? 50  ARG C O     1 
ATOM 1699  C CB    . ARG B 2 50  ? -227.323 180.997 130.737 1.00 93.99  ? 50  ARG C CB    1 
ATOM 1700  C CG    . ARG B 2 50  ? -228.659 181.479 131.260 1.00 93.99  ? 50  ARG C CG    1 
ATOM 1701  C CD    . ARG B 2 50  ? -228.942 180.900 132.630 1.00 93.99  ? 50  ARG C CD    1 
ATOM 1702  N NE    . ARG B 2 50  ? -228.046 181.426 133.651 1.00 93.99  ? 50  ARG C NE    1 
ATOM 1703  C CZ    . ARG B 2 50  ? -228.183 181.180 134.949 1.00 93.99  ? 50  ARG C CZ    1 
ATOM 1704  N NH1   . ARG B 2 50  ? -229.179 180.419 135.373 1.00 93.99  ? 50  ARG C NH1   1 
ATOM 1705  N NH2   . ARG B 2 50  ? -227.330 181.693 135.824 1.00 93.99  ? 50  ARG C NH2   1 
ATOM 1706  N N     . SER B 2 51  ? -225.632 179.713 127.801 1.00 92.55  ? 51  SER C N     1 
ATOM 1707  C CA    . SER B 2 51  ? -224.296 179.259 127.466 1.00 92.55  ? 51  SER C CA    1 
ATOM 1708  C C     . SER B 2 51  ? -223.216 180.310 127.217 1.00 92.55  ? 51  SER C C     1 
ATOM 1709  O O     . SER B 2 51  ? -222.123 180.164 127.746 1.00 92.55  ? 51  SER C O     1 
ATOM 1710  C CB    . SER B 2 51  ? -224.368 178.292 126.275 1.00 92.55  ? 51  SER C CB    1 
ATOM 1711  O OG    . SER B 2 51  ? -223.971 178.896 125.051 1.00 92.55  ? 51  SER C OG    1 
ATOM 1712  N N     . HIS B 2 52  ? -223.474 181.364 126.455 1.00 95.54  ? 52  HIS C N     1 
ATOM 1713  C CA    . HIS B 2 52  ? -222.388 182.328 126.245 1.00 95.54  ? 52  HIS C CA    1 
ATOM 1714  C C     . HIS B 2 52  ? -221.992 183.065 127.521 1.00 95.54  ? 52  HIS C C     1 
ATOM 1715  O O     . HIS B 2 52  ? -220.877 183.590 127.596 1.00 95.54  ? 52  HIS C O     1 
ATOM 1716  C CB    . HIS B 2 52  ? -222.723 183.433 125.258 1.00 95.54  ? 52  HIS C CB    1 
ATOM 1717  C CG    . HIS B 2 52  ? -223.987 184.151 125.574 1.00 95.54  ? 52  HIS C CG    1 
ATOM 1718  N ND1   . HIS B 2 52  ? -225.239 183.667 125.272 1.00 95.54  ? 52  HIS C ND1   1 
ATOM 1719  C CD2   . HIS B 2 52  ? -224.178 185.351 126.166 1.00 95.54  ? 52  HIS C CD2   1 
ATOM 1720  C CE1   . HIS B 2 52  ? -226.148 184.538 125.669 1.00 95.54  ? 52  HIS C CE1   1 
ATOM 1721  N NE2   . HIS B 2 52  ? -225.530 185.569 126.213 1.00 95.54  ? 52  HIS C NE2   1 
ATOM 1722  N N     . GLU B 2 53  ? -222.902 183.084 128.482 1.00 97.45  ? 53  GLU C N     1 
ATOM 1723  C CA    . GLU B 2 53  ? -222.692 183.681 129.789 1.00 97.45  ? 53  GLU C CA    1 
ATOM 1724  C C     . GLU B 2 53  ? -221.674 182.961 130.686 1.00 97.45  ? 53  GLU C C     1 
ATOM 1725  O O     . GLU B 2 53  ? -220.979 183.596 131.476 1.00 97.45  ? 53  GLU C O     1 
ATOM 1726  C CB    . GLU B 2 53  ? -224.026 183.790 130.535 1.00 97.45  ? 53  GLU C CB    1 
ATOM 1727  C CG    . GLU B 2 53  ? -224.877 184.987 130.145 1.00 97.45  ? 53  GLU C CG    1 
ATOM 1728  C CD    . GLU B 2 53  ? -226.198 184.586 129.511 1.00 97.45  ? 53  GLU C CD    1 
ATOM 1729  O OE1   . GLU B 2 53  ? -226.482 183.374 129.429 1.00 97.45  ? 53  GLU C OE1   1 
ATOM 1730  O OE2   . GLU B 2 53  ? -226.953 185.483 129.087 1.00 97.45  ? 53  GLU C OE2   1 
ATOM 1731  N N     . LEU B 2 54  ? -221.630 181.632 130.592 1.00 91.52  ? 54  LEU C N     1 
ATOM 1732  C CA    . LEU B 2 54  ? -220.840 180.806 131.483 1.00 91.52  ? 54  LEU C CA    1 
ATOM 1733  C C     . LEU B 2 54  ? -219.600 180.332 130.750 1.00 91.52  ? 54  LEU C C     1 
ATOM 1734  O O     . LEU B 2 54  ? -219.654 180.021 129.555 1.00 91.52  ? 54  LEU C O     1 
ATOM 1735  C CB    . LEU B 2 54  ? -221.659 179.615 131.966 1.00 91.52  ? 54  LEU C CB    1 
ATOM 1736  C CG    . LEU B 2 54  ? -222.947 180.012 132.678 1.00 91.52  ? 54  LEU C CG    1 
ATOM 1737  C CD1   . LEU B 2 54  ? -223.853 178.818 132.849 1.00 91.52  ? 54  LEU C CD1   1 
ATOM 1738  C CD2   . LEU B 2 54  ? -222.654 180.648 134.013 1.00 91.52  ? 54  LEU C CD2   1 
ATOM 1739  N N     . SER B 2 55  ? -218.484 180.239 131.470 1.00 88.28  ? 55  SER C N     1 
ATOM 1740  C CA    . SER B 2 55  ? -217.312 179.759 130.765 1.00 88.28  ? 55  SER C CA    1 
ATOM 1741  C C     . SER B 2 55  ? -217.442 178.262 130.582 1.00 88.28  ? 55  SER C C     1 
ATOM 1742  O O     . SER B 2 55  ? -217.161 177.740 129.499 1.00 88.28  ? 55  SER C O     1 
ATOM 1743  C CB    . SER B 2 55  ? -216.025 180.123 131.509 1.00 88.28  ? 55  SER C CB    1 
ATOM 1744  O OG    . SER B 2 55  ? -215.710 181.502 131.360 1.00 88.28  ? 55  SER C OG    1 
ATOM 1745  N N     . ASP B 2 56  ? -217.863 177.560 131.629 1.00 82.89  ? 56  ASP C N     1 
ATOM 1746  C CA    . ASP B 2 56  ? -217.972 176.115 131.531 1.00 82.89  ? 56  ASP C CA    1 
ATOM 1747  C C     . ASP B 2 56  ? -218.868 175.584 132.644 1.00 82.89  ? 56  ASP C C     1 
ATOM 1748  O O     . ASP B 2 56  ? -219.172 176.275 133.623 1.00 82.89  ? 56  ASP C O     1 
ATOM 1749  C CB    . ASP B 2 56  ? -216.611 175.439 131.502 1.00 82.89  ? 56  ASP C CB    1 
ATOM 1750  C CG    . ASP B 2 56  ? -216.684 174.039 130.924 1.00 82.89  ? 56  ASP C CG    1 
ATOM 1751  O OD1   . ASP B 2 56  ? -216.937 173.899 129.704 1.00 82.89  ? 56  ASP C OD1   1 
ATOM 1752  O OD2   . ASP B 2 56  ? -216.449 173.081 131.681 1.00 82.89  ? 56  ASP C OD2   1 
ATOM 1753  N N     . VAL B 2 57  ? -219.309 174.346 132.443 1.00 80.41  ? 57  VAL C N     1 
ATOM 1754  C CA    . VAL B 2 57  ? -220.067 173.552 133.401 1.00 80.41  ? 57  VAL C CA    1 
ATOM 1755  C C     . VAL B 2 57  ? -219.220 172.345 133.746 1.00 80.41  ? 57  VAL C C     1 
ATOM 1756  O O     . VAL B 2 57  ? -218.626 171.716 132.861 1.00 80.41  ? 57  VAL C O     1 
ATOM 1757  C CB    . VAL B 2 57  ? -221.438 173.129 132.862 1.00 80.41  ? 57  VAL C CB    1 
ATOM 1758  C CG1   . VAL B 2 57  ? -221.926 171.910 133.593 1.00 80.41  ? 57  VAL C CG1   1 
ATOM 1759  C CG2   . VAL B 2 57  ? -222.421 174.242 133.110 1.00 80.41  ? 57  VAL C CG2   1 
ATOM 1760  N N     . GLU B 2 58  ? -219.127 172.060 135.038 1.00 78.17  ? 58  GLU C N     1 
ATOM 1761  C CA    . GLU B 2 58  ? -218.211 171.065 135.559 1.00 78.17  ? 58  GLU C CA    1 
ATOM 1762  C C     . GLU B 2 58  ? -218.942 169.986 136.337 1.00 78.17  ? 58  GLU C C     1 
ATOM 1763  O O     . GLU B 2 58  ? -219.905 170.260 137.059 1.00 78.17  ? 58  GLU C O     1 
ATOM 1764  C CB    . GLU B 2 58  ? -217.235 171.783 136.489 1.00 78.17  ? 58  GLU C CB    1 
ATOM 1765  C CG    . GLU B 2 58  ? -216.244 170.941 137.251 1.00 78.17  ? 58  GLU C CG    1 
ATOM 1766  C CD    . GLU B 2 58  ? -215.509 171.763 138.301 1.00 78.17  ? 58  GLU C CD    1 
ATOM 1767  O OE1   . GLU B 2 58  ? -215.561 173.012 138.242 1.00 78.17  ? 58  GLU C OE1   1 
ATOM 1768  O OE2   . GLU B 2 58  ? -214.916 171.150 139.209 1.00 78.17  ? 58  GLU C OE2   1 
ATOM 1769  N N     . ILE B 2 59  ? -218.436 168.766 136.195 1.00 67.94  ? 59  ILE C N     1 
ATOM 1770  C CA    . ILE B 2 59  ? -218.861 167.607 136.966 1.00 67.94  ? 59  ILE C CA    1 
ATOM 1771  C C     . ILE B 2 59  ? -217.666 167.024 137.704 1.00 67.94  ? 59  ILE C C     1 
ATOM 1772  O O     . ILE B 2 59  ? -216.606 166.850 137.100 1.00 67.94  ? 59  ILE C O     1 
ATOM 1773  C CB    . ILE B 2 59  ? -219.494 166.526 136.076 1.00 67.94  ? 59  ILE C CB    1 
ATOM 1774  C CG1   . ILE B 2 59  ? -220.941 166.837 135.806 1.00 67.94  ? 59  ILE C CG1   1 
ATOM 1775  C CG2   . ILE B 2 59  ? -219.301 165.153 136.662 1.00 67.94  ? 59  ILE C CG2   1 
ATOM 1776  C CD1   . ILE B 2 59  ? -221.642 165.671 135.264 1.00 67.94  ? 59  ILE C CD1   1 
ATOM 1777  N N     . PRO B 2 60  ? -217.786 166.740 139.001 1.00 64.17  ? 60  PRO C N     1 
ATOM 1778  C CA    . PRO B 2 60  ? -216.636 166.218 139.752 1.00 64.17  ? 60  PRO C CA    1 
ATOM 1779  C C     . PRO B 2 60  ? -216.095 164.887 139.256 1.00 64.17  ? 60  PRO C C     1 
ATOM 1780  O O     . PRO B 2 60  ? -214.902 164.615 139.435 1.00 64.17  ? 60  PRO C O     1 
ATOM 1781  C CB    . PRO B 2 60  ? -217.192 166.080 141.172 1.00 64.17  ? 60  PRO C CB    1 
ATOM 1782  C CG    . PRO B 2 60  ? -218.319 167.021 141.222 1.00 64.17  ? 60  PRO C CG    1 
ATOM 1783  C CD    . PRO B 2 60  ? -218.925 167.055 139.875 1.00 64.17  ? 60  PRO C CD    1 
ATOM 1784  N N     . LEU B 2 61  ? -216.926 164.045 138.641 1.00 58.37  ? 61  LEU C N     1 
ATOM 1785  C CA    . LEU B 2 61  ? -216.472 162.744 138.172 1.00 58.37  ? 61  LEU C CA    1 
ATOM 1786  C C     . LEU B 2 61  ? -216.088 162.800 136.710 1.00 58.37  ? 61  LEU C C     1 
ATOM 1787  O O     . LEU B 2 61  ? -216.967 162.997 135.862 1.00 58.37  ? 61  LEU C O     1 
ATOM 1788  C CB    . LEU B 2 61  ? -217.567 161.706 138.357 1.00 58.37  ? 61  LEU C CB    1 
ATOM 1789  C CG    . LEU B 2 61  ? -217.850 161.071 139.703 1.00 58.37  ? 61  LEU C CG    1 
ATOM 1790  C CD1   . LEU B 2 61  ? -218.253 162.113 140.695 1.00 58.37  ? 61  LEU C CD1   1 
ATOM 1791  C CD2   . LEU B 2 61  ? -218.955 160.061 139.502 1.00 58.37  ? 61  LEU C CD2   1 
ATOM 1792  N N     . PRO B 2 62  ? -214.827 162.606 136.365 1.00 52.65  ? 62  PRO C N     1 
ATOM 1793  C CA    . PRO B 2 62  ? -214.424 162.617 134.966 1.00 52.65  ? 62  PRO C CA    1 
ATOM 1794  C C     . PRO B 2 62  ? -215.168 161.597 134.120 1.00 52.65  ? 62  PRO C C     1 
ATOM 1795  O O     . PRO B 2 62  ? -215.352 161.835 132.921 1.00 52.65  ? 62  PRO C O     1 
ATOM 1796  C CB    . PRO B 2 62  ? -212.922 162.320 135.018 1.00 52.65  ? 62  PRO C CB    1 
ATOM 1797  C CG    . PRO B 2 62  ? -212.624 162.024 136.422 1.00 52.65  ? 62  PRO C CG    1 
ATOM 1798  C CD    . PRO B 2 62  ? -213.671 162.652 137.252 1.00 52.65  ? 62  PRO C CD    1 
ATOM 1799  N N     . PRO B 2 63  ? -215.539 160.421 134.635 1.00 54.70  ? 63  PRO C N     1 
ATOM 1800  C CA    . PRO B 2 63  ? -216.462 159.593 133.837 1.00 54.70  ? 63  PRO C CA    1 
ATOM 1801  C C     . PRO B 2 63  ? -217.797 160.282 133.606 1.00 54.70  ? 63  PRO C C     1 
ATOM 1802  O O     . PRO B 2 63  ? -218.292 160.346 132.468 1.00 54.70  ? 63  PRO C O     1 
ATOM 1803  C CB    . PRO B 2 63  ? -216.587 158.309 134.667 1.00 54.70  ? 63  PRO C CB    1 
ATOM 1804  C CG    . PRO B 2 63  ? -216.146 158.698 136.013 1.00 54.70  ? 63  PRO C CG    1 
ATOM 1805  C CD    . PRO B 2 63  ? -215.060 159.667 135.798 1.00 54.70  ? 63  PRO C CD    1 
ATOM 1806  N N     . GLY B 2 64  ? -218.369 160.860 134.663 1.00 55.14  ? 64  GLY C N     1 
ATOM 1807  C CA    . GLY B 2 64  ? -219.624 161.571 134.516 1.00 55.14  ? 64  GLY C CA    1 
ATOM 1808  C C     . GLY B 2 64  ? -219.519 162.676 133.491 1.00 55.14  ? 64  GLY C C     1 
ATOM 1809  O O     . GLY B 2 64  ? -220.409 162.862 132.664 1.00 55.14  ? 64  GLY C O     1 
ATOM 1810  N N     . ALA B 2 65  ? -218.420 163.408 133.509 1.00 54.70  ? 65  ALA C N     1 
ATOM 1811  C CA    . ALA B 2 65  ? -218.257 164.437 132.504 1.00 54.70  ? 65  ALA C CA    1 
ATOM 1812  C C     . ALA B 2 65  ? -217.987 163.841 131.130 1.00 54.70  ? 65  ALA C C     1 
ATOM 1813  O O     . ALA B 2 65  ? -218.417 164.402 130.125 1.00 54.70  ? 65  ALA C O     1 
ATOM 1814  C CB    . ALA B 2 65  ? -217.148 165.393 132.920 1.00 54.70  ? 65  ALA C CB    1 
ATOM 1815  N N     . ALA B 2 66  ? -217.301 162.702 131.057 1.00 51.76  ? 66  ALA C N     1 
ATOM 1816  C CA    . ALA B 2 66  ? -217.013 162.111 129.755 1.00 51.76  ? 66  ALA C CA    1 
ATOM 1817  C C     . ALA B 2 66  ? -218.270 161.675 129.030 1.00 51.76  ? 66  ALA C C     1 
ATOM 1818  O O     . ALA B 2 66  ? -218.341 161.787 127.805 1.00 51.76  ? 66  ALA C O     1 
ATOM 1819  C CB    . ALA B 2 66  ? -216.066 160.928 129.916 1.00 51.76  ? 66  ALA C CB    1 
ATOM 1820  N N     . VAL B 2 67  ? -219.276 161.188 129.750 1.00 56.89  ? 67  VAL C N     1 
ATOM 1821  C CA    . VAL B 2 67  ? -220.519 160.890 129.049 1.00 56.89  ? 67  VAL C CA    1 
ATOM 1822  C C     . VAL B 2 67  ? -221.329 162.166 128.914 1.00 56.89  ? 67  VAL C C     1 
ATOM 1823  O O     . VAL B 2 67  ? -222.083 162.339 127.947 1.00 56.89  ? 67  VAL C O     1 
ATOM 1824  C CB    . VAL B 2 67  ? -221.308 159.779 129.752 1.00 56.89  ? 67  VAL C CB    1 
ATOM 1825  C CG1   . VAL B 2 67  ? -222.441 159.310 128.884 1.00 56.89  ? 67  VAL C CG1   1 
ATOM 1826  C CG2   . VAL B 2 67  ? -220.413 158.629 130.075 1.00 56.89  ? 67  VAL C CG2   1 
ATOM 1827  N N     . LEU B 2 68  ? -221.151 163.091 129.856 1.00 57.27  ? 68  LEU C N     1 
ATOM 1828  C CA    . LEU B 2 68  ? -221.932 164.320 129.872 1.00 57.27  ? 68  LEU C CA    1 
ATOM 1829  C C     . LEU B 2 68  ? -221.666 165.125 128.616 1.00 57.27  ? 68  LEU C C     1 
ATOM 1830  O O     . LEU B 2 68  ? -222.588 165.634 127.982 1.00 57.27  ? 68  LEU C O     1 
ATOM 1831  C CB    . LEU B 2 68  ? -221.579 165.125 131.117 1.00 57.27  ? 68  LEU C CB    1 
ATOM 1832  C CG    . LEU B 2 68  ? -222.473 166.246 131.633 1.00 57.27  ? 68  LEU C CG    1 
ATOM 1833  C CD1   . LEU B 2 68  ? -222.259 167.514 130.864 1.00 57.27  ? 68  LEU C CD1   1 
ATOM 1834  C CD2   . LEU B 2 68  ? -223.879 165.801 131.504 1.00 57.27  ? 68  LEU C CD2   1 
ATOM 1835  N N     . TRP B 2 69  ? -220.404 165.309 128.280 1.00 61.98  ? 69  TRP C N     1 
ATOM 1836  C CA    . TRP B 2 69  ? -220.093 166.117 127.124 1.00 61.98  ? 69  TRP C CA    1 
ATOM 1837  C C     . TRP B 2 69  ? -220.529 165.444 125.834 1.00 61.98  ? 69  TRP C C     1 
ATOM 1838  O O     . TRP B 2 69  ? -220.709 166.129 124.827 1.00 61.98  ? 69  TRP C O     1 
ATOM 1839  C CB    . TRP B 2 69  ? -218.597 166.387 127.119 1.00 61.98  ? 69  TRP C CB    1 
ATOM 1840  C CG    . TRP B 2 69  ? -218.243 167.352 128.160 1.00 61.98  ? 69  TRP C CG    1 
ATOM 1841  C CD1   . TRP B 2 69  ? -217.602 167.102 129.329 1.00 61.98  ? 69  TRP C CD1   1 
ATOM 1842  C CD2   . TRP B 2 69  ? -218.506 168.741 128.133 1.00 61.98  ? 69  TRP C CD2   1 
ATOM 1843  N NE1   . TRP B 2 69  ? -217.462 168.261 130.045 1.00 61.98  ? 69  TRP C NE1   1 
ATOM 1844  C CE2   . TRP B 2 69  ? -218.005 169.286 129.321 1.00 61.98  ? 69  TRP C CE2   1 
ATOM 1845  C CE3   . TRP B 2 69  ? -219.113 169.585 127.210 1.00 61.98  ? 69  TRP C CE3   1 
ATOM 1846  C CZ2   . TRP B 2 69  ? -218.101 170.637 129.610 1.00 61.98  ? 69  TRP C CZ2   1 
ATOM 1847  C CZ3   . TRP B 2 69  ? -219.204 170.917 127.497 1.00 61.98  ? 69  TRP C CZ3   1 
ATOM 1848  C CH2   . TRP B 2 69  ? -218.703 171.434 128.686 1.00 61.98  ? 69  TRP C CH2   1 
ATOM 1849  N N     . ARG B 2 70  ? -220.711 164.128 125.911 1.00 63.69  ? 70  ARG C N     1 
ATOM 1850  C CA    . ARG B 2 70  ? -221.249 163.317 124.834 1.00 63.69  ? 70  ARG C CA    1 
ATOM 1851  C C     . ARG B 2 70  ? -222.744 163.582 124.632 1.00 63.69  ? 70  ARG C C     1 
ATOM 1852  O O     . ARG B 2 70  ? -223.203 163.724 123.509 1.00 63.69  ? 70  ARG C O     1 
ATOM 1853  C CB    . ARG B 2 70  ? -221.026 161.841 125.129 1.00 63.69  ? 70  ARG C CB    1 
ATOM 1854  C CG    . ARG B 2 70  ? -220.436 161.074 123.969 1.00 63.69  ? 70  ARG C CG    1 
ATOM 1855  C CD    . ARG B 2 70  ? -219.624 159.894 124.456 1.00 63.69  ? 70  ARG C CD    1 
ATOM 1856  N NE    . ARG B 2 70  ? -218.331 160.305 124.978 1.00 63.69  ? 70  ARG C NE    1 
ATOM 1857  C CZ    . ARG B 2 70  ? -217.174 159.890 124.484 1.00 63.69  ? 70  ARG C CZ    1 
ATOM 1858  N NH1   . ARG B 2 70  ? -217.160 159.052 123.462 1.00 63.69  ? 70  ARG C NH1   1 
ATOM 1859  N NH2   . ARG B 2 70  ? -216.037 160.306 125.012 1.00 63.69  ? 70  ARG C NH2   1 
ATOM 1860  N N     . ILE B 2 71  ? -223.501 163.657 125.732 1.00 63.72  ? 71  ILE C N     1 
ATOM 1861  C CA    . ILE B 2 71  ? -224.938 163.911 125.665 1.00 63.72  ? 71  ILE C CA    1 
ATOM 1862  C C     . ILE B 2 71  ? -225.209 165.377 125.337 1.00 63.72  ? 71  ILE C C     1 
ATOM 1863  O O     . ILE B 2 71  ? -226.061 165.686 124.499 1.00 63.72  ? 71  ILE C O     1 
ATOM 1864  C CB    . ILE B 2 71  ? -225.659 163.418 126.932 1.00 63.72  ? 71  ILE C CB    1 
ATOM 1865  C CG1   . ILE B 2 71  ? -225.206 164.134 128.187 1.00 63.72  ? 71  ILE C CG1   1 
ATOM 1866  C CG2   . ILE B 2 71  ? -225.470 161.923 127.081 1.00 63.72  ? 71  ILE C CG2   1 
ATOM 1867  C CD1   . ILE B 2 71  ? -226.080 165.304 128.537 1.00 63.72  ? 71  ILE C CD1   1 
ATOM 1868  N N     . LEU B 2 72  ? -224.520 166.303 126.010 1.00 63.95  ? 72  LEU C N     1 
ATOM 1869  C CA    . LEU B 2 72  ? -224.643 167.720 125.681 1.00 63.95  ? 72  LEU C CA    1 
ATOM 1870  C C     . LEU B 2 72  ? -224.255 167.988 124.240 1.00 63.95  ? 72  LEU C C     1 
ATOM 1871  O O     . LEU B 2 72  ? -224.788 168.906 123.618 1.00 63.95  ? 72  LEU C O     1 
ATOM 1872  C CB    . LEU B 2 72  ? -223.749 168.553 126.593 1.00 63.95  ? 72  LEU C CB    1 
ATOM 1873  C CG    . LEU B 2 72  ? -224.253 168.990 127.951 1.00 63.95  ? 72  LEU C CG    1 
ATOM 1874  C CD1   . LEU B 2 72  ? -223.427 170.149 128.441 1.00 63.95  ? 72  LEU C CD1   1 
ATOM 1875  C CD2   . LEU B 2 72  ? -225.691 169.370 127.901 1.00 63.95  ? 72  LEU C CD2   1 
ATOM 1876  N N     . ALA B 2 73  ? -223.340 167.196 123.686 1.00 69.26  ? 73  ALA C N     1 
ATOM 1877  C CA    . ALA B 2 73  ? -223.040 167.356 122.276 1.00 69.26  ? 73  ALA C CA    1 
ATOM 1878  C C     . ALA B 2 73  ? -224.165 166.848 121.402 1.00 69.26  ? 73  ALA C C     1 
ATOM 1879  O O     . ALA B 2 73  ? -224.170 167.129 120.201 1.00 69.26  ? 73  ALA C O     1 
ATOM 1880  C CB    . ALA B 2 73  ? -221.756 166.618 121.914 1.00 69.26  ? 73  ALA C CB    1 
ATOM 1881  N N     . LEU B 2 74  ? -225.088 166.067 121.951 1.00 75.80  ? 74  LEU C N     1 
ATOM 1882  C CA    . LEU B 2 74  ? -226.200 165.568 121.164 1.00 75.80  ? 74  LEU C CA    1 
ATOM 1883  C C     . LEU B 2 74  ? -227.438 166.437 121.327 1.00 75.80  ? 74  LEU C C     1 
ATOM 1884  O O     . LEU B 2 74  ? -228.431 166.203 120.660 1.00 75.80  ? 74  LEU C O     1 
ATOM 1885  C CB    . LEU B 2 74  ? -226.504 164.101 121.470 1.00 75.80  ? 74  LEU C CB    1 
ATOM 1886  C CG    . LEU B 2 74  ? -227.542 163.459 120.537 1.00 75.80  ? 74  LEU C CG    1 
ATOM 1887  C CD1   . LEU B 2 74  ? -227.119 163.745 119.104 1.00 75.80  ? 74  LEU C CD1   1 
ATOM 1888  C CD2   . LEU B 2 74  ? -227.705 161.981 120.749 1.00 75.80  ? 74  LEU C CD2   1 
ATOM 1889  N N     . ILE B 2 75  ? -227.431 167.412 122.223 1.00 79.62  ? 75  ILE C N     1 
ATOM 1890  C CA    . ILE B 2 75  ? -228.616 168.251 122.376 1.00 79.62  ? 75  ILE C CA    1 
ATOM 1891  C C     . ILE B 2 75  ? -228.407 169.593 121.700 1.00 79.62  ? 75  ILE C C     1 
ATOM 1892  O O     . ILE B 2 75  ? -228.896 169.788 120.579 1.00 79.62  ? 75  ILE C O     1 
ATOM 1893  C CB    . ILE B 2 75  ? -228.960 168.449 123.864 1.00 79.62  ? 75  ILE C CB    1 
ATOM 1894  C CG1   . ILE B 2 75  ? -229.208 167.089 124.504 1.00 79.62  ? 75  ILE C CG1   1 
ATOM 1895  C CG2   . ILE B 2 75  ? -230.160 169.354 124.037 1.00 79.62  ? 75  ILE C CG2   1 
ATOM 1896  C CD1   . ILE B 2 75  ? -229.820 167.133 125.867 1.00 79.62  ? 75  ILE C CD1   1 
ATOM 1897  N N     . THR B 2 76  ? -227.716 170.529 122.362 1.00 88.06  ? 76  THR C N     1 
ATOM 1898  C CA    . THR B 2 76  ? -227.420 171.807 121.733 1.00 88.06  ? 76  THR C CA    1 
ATOM 1899  C C     . THR B 2 76  ? -226.869 171.577 120.349 1.00 88.06  ? 76  THR C C     1 
ATOM 1900  O O     . THR B 2 76  ? -227.302 172.202 119.374 1.00 88.06  ? 76  THR C O     1 
ATOM 1901  C CB    . THR B 2 76  ? -226.463 172.629 122.584 1.00 88.06  ? 76  THR C CB    1 
ATOM 1902  O OG1   . THR B 2 76  ? -226.157 173.838 121.890 1.00 88.06  ? 76  THR C OG1   1 
ATOM 1903  C CG2   . THR B 2 76  ? -225.200 171.863 122.855 1.00 88.06  ? 76  THR C CG2   1 
ATOM 1904  N N     . ALA B 2 77  ? -225.869 170.699 120.318 1.00 88.17  ? 77  ALA C N     1 
ATOM 1905  C CA    . ALA B 2 77  ? -225.151 170.326 119.115 1.00 88.17  ? 77  ALA C CA    1 
ATOM 1906  C C     . ALA B 2 77  ? -226.098 169.780 118.075 1.00 88.17  ? 77  ALA C C     1 
ATOM 1907  O O     . ALA B 2 77  ? -226.138 170.280 116.951 1.00 88.17  ? 77  ALA C O     1 
ATOM 1908  C CB    . ALA B 2 77  ? -224.070 169.305 119.439 1.00 88.17  ? 77  ALA C CB    1 
ATOM 1909  N N     . ARG B 2 78  ? -226.868 168.755 118.427 1.00 88.58  ? 78  ARG C N     1 
ATOM 1910  C CA    . ARG B 2 78  ? -227.782 168.237 117.411 1.00 88.58  ? 78  ARG C CA    1 
ATOM 1911  C C     . ARG B 2 78  ? -228.576 169.341 116.718 1.00 88.58  ? 78  ARG C C     1 
ATOM 1912  O O     . ARG B 2 78  ? -228.685 169.367 115.485 1.00 88.58  ? 78  ARG C O     1 
ATOM 1913  C CB    . ARG B 2 78  ? -228.668 167.100 117.940 1.00 88.58  ? 78  ARG C CB    1 
ATOM 1914  C CG    . ARG B 2 78  ? -230.032 166.758 117.333 1.00 88.58  ? 78  ARG C CG    1 
ATOM 1915  C CD    . ARG B 2 78  ? -230.884 166.125 118.462 1.00 88.58  ? 78  ARG C CD    1 
ATOM 1916  N NE    . ARG B 2 78  ? -231.857 165.149 117.931 1.00 88.58  ? 78  ARG C NE    1 
ATOM 1917  C CZ    . ARG B 2 78  ? -231.564 163.916 117.495 1.00 88.58  ? 78  ARG C CZ    1 
ATOM 1918  N NH1   . ARG B 2 78  ? -232.516 163.114 117.020 1.00 88.58  ? 78  ARG C NH1   1 
ATOM 1919  N NH2   . ARG B 2 78  ? -230.314 163.491 117.489 1.00 88.58  ? 78  ARG C NH2   1 
ATOM 1920  N N     . ILE B 2 79  ? -229.177 170.241 117.503 1.00 86.22  ? 79  ILE C N     1 
ATOM 1921  C CA    . ILE B 2 79  ? -229.978 171.309 116.897 1.00 86.22  ? 79  ILE C CA    1 
ATOM 1922  C C     . ILE B 2 79  ? -229.109 172.144 115.964 1.00 86.22  ? 79  ILE C C     1 
ATOM 1923  O O     . ILE B 2 79  ? -229.518 172.519 114.853 1.00 86.22  ? 79  ILE C O     1 
ATOM 1924  C CB    . ILE B 2 79  ? -230.544 172.211 118.001 1.00 86.22  ? 79  ILE C CB    1 
ATOM 1925  C CG1   . ILE B 2 79  ? -231.403 171.448 118.979 1.00 86.22  ? 79  ILE C CG1   1 
ATOM 1926  C CG2   . ILE B 2 79  ? -231.250 173.381 117.395 1.00 86.22  ? 79  ILE C CG2   1 
ATOM 1927  C CD1   . ILE B 2 79  ? -231.896 172.316 120.087 1.00 86.22  ? 79  ILE C CD1   1 
ATOM 1928  N N     . THR B 2 80  ? -227.879 172.424 116.403 1.00 94.23  ? 80  THR C N     1 
ATOM 1929  C CA    . THR B 2 80  ? -226.923 173.184 115.604 1.00 94.23  ? 80  THR C CA    1 
ATOM 1930  C C     . THR B 2 80  ? -226.257 172.331 114.528 1.00 94.23  ? 80  THR C C     1 
ATOM 1931  O O     . THR B 2 80  ? -225.922 172.840 113.452 1.00 94.23  ? 80  THR C O     1 
ATOM 1932  C CB    . THR B 2 80  ? -225.873 173.876 116.480 1.00 94.23  ? 80  THR C CB    1 
ATOM 1933  O OG1   . THR B 2 80  ? -225.432 172.997 117.511 1.00 94.23  ? 80  THR C OG1   1 
ATOM 1934  C CG2   . THR B 2 80  ? -226.452 175.110 117.104 1.00 94.23  ? 80  THR C CG2   1 
ATOM 1935  N N     . GLY B 2 81  ? -226.025 171.048 114.809 1.00 98.77  ? 81  GLY C N     1 
ATOM 1936  C CA    . GLY B 2 81  ? -225.441 170.172 113.810 1.00 98.77  ? 81  GLY C CA    1 
ATOM 1937  C C     . GLY B 2 81  ? -226.360 169.787 112.674 1.00 98.77  ? 81  GLY C C     1 
ATOM 1938  O O     . GLY B 2 81  ? -225.883 169.439 111.594 1.00 98.77  ? 81  GLY C O     1 
ATOM 1939  N N     . LEU B 2 82  ? -227.665 169.767 112.912 1.00 104.57 ? 82  LEU C N     1 
ATOM 1940  C CA    . LEU B 2 82  ? -228.742 169.581 111.948 1.00 104.57 ? 82  LEU C CA    1 
ATOM 1941  C C     . LEU B 2 82  ? -228.976 168.143 111.497 1.00 104.57 ? 82  LEU C C     1 
ATOM 1942  O O     . LEU B 2 82  ? -230.013 167.889 110.884 1.00 104.57 ? 82  LEU C O     1 
ATOM 1943  C CB    . LEU B 2 82  ? -228.594 170.453 110.684 1.00 104.57 ? 82  LEU C CB    1 
ATOM 1944  C CG    . LEU B 2 82  ? -229.250 171.832 110.796 1.00 104.57 ? 82  LEU C CG    1 
ATOM 1945  C CD1   . LEU B 2 82  ? -230.732 171.692 111.102 1.00 104.57 ? 82  LEU C CD1   1 
ATOM 1946  C CD2   . LEU B 2 82  ? -228.585 172.696 111.832 1.00 104.57 ? 82  LEU C CD2   1 
ATOM 1947  N N     . ASP B 2 83  ? -228.085 167.189 111.765 1.00 107.52 ? 83  ASP C N     1 
ATOM 1948  C CA    . ASP B 2 83  ? -228.393 165.813 111.405 1.00 107.52 ? 83  ASP C CA    1 
ATOM 1949  C C     . ASP B 2 83  ? -228.694 165.689 109.908 1.00 107.52 ? 83  ASP C C     1 
ATOM 1950  O O     . ASP B 2 83  ? -229.568 164.919 109.500 1.00 107.52 ? 83  ASP C O     1 
ATOM 1951  C CB    . ASP B 2 83  ? -229.552 165.286 112.258 1.00 107.52 ? 83  ASP C CB    1 
ATOM 1952  C CG    . ASP B 2 83  ? -229.230 165.312 113.756 1.00 107.52 ? 83  ASP C CG    1 
ATOM 1953  O OD1   . ASP B 2 83  ? -228.033 165.358 114.109 1.00 107.52 ? 83  ASP C OD1   1 
ATOM 1954  O OD2   . ASP B 2 83  ? -230.173 165.279 114.574 1.00 107.52 ? 83  ASP C OD2   1 
ATOM 1955  N N     . GLN B 2 84  ? -228.002 166.442 109.059 1.00 114.43 ? 84  GLN C N     1 
ATOM 1956  C CA    . GLN B 2 84  ? -228.313 166.323 107.632 1.00 114.43 ? 84  GLN C CA    1 
ATOM 1957  C C     . GLN B 2 84  ? -227.419 167.051 106.627 1.00 114.43 ? 84  GLN C C     1 
ATOM 1958  O O     . GLN B 2 84  ? -227.750 168.151 106.176 1.00 114.43 ? 84  GLN C O     1 
ATOM 1959  C CB    . GLN B 2 84  ? -229.775 166.714 107.385 1.00 114.43 ? 84  GLN C CB    1 
ATOM 1960  N N     . PRO B 2 85  ? -226.257 166.389 106.260 1.00 118.34 ? 85  PRO C N     1 
ATOM 1961  C CA    . PRO B 2 85  ? -225.446 167.086 105.260 1.00 118.34 ? 85  PRO C CA    1 
ATOM 1962  C C     . PRO B 2 85  ? -225.596 166.343 103.933 1.00 118.34 ? 85  PRO C C     1 
ATOM 1963  O O     . PRO B 2 85  ? -224.717 165.562 103.565 1.00 118.34 ? 85  PRO C O     1 
ATOM 1964  C CB    . PRO B 2 85  ? -224.030 166.913 105.802 1.00 118.34 ? 85  PRO C CB    1 
ATOM 1965  C CG    . PRO B 2 85  ? -224.036 165.554 106.438 1.00 118.34 ? 85  PRO C CG    1 
ATOM 1966  C CD    . PRO B 2 85  ? -225.472 165.132 106.636 1.00 118.34 ? 85  PRO C CD    1 
ATOM 1967  N N     . PRO B 2 86  ? -226.703 166.571 103.230 1.00 121.16 ? 86  PRO C N     1 
ATOM 1968  C CA    . PRO B 2 86  ? -226.956 165.871 101.959 1.00 121.16 ? 86  PRO C CA    1 
ATOM 1969  C C     . PRO B 2 86  ? -226.494 166.711 100.786 1.00 121.16 ? 86  PRO C C     1 
ATOM 1970  O O     . PRO B 2 86  ? -226.866 167.891 100.734 1.00 121.16 ? 86  PRO C O     1 
ATOM 1971  C CB    . PRO B 2 86  ? -228.482 165.737 101.933 1.00 121.16 ? 86  PRO C CB    1 
ATOM 1972  C CG    . PRO B 2 86  ? -228.989 166.938 102.835 1.00 121.16 ? 86  PRO C CG    1 
ATOM 1973  C CD    . PRO B 2 86  ? -227.763 167.539 103.527 1.00 121.16 ? 86  PRO C CD    1 
ATOM 1974  N N     . ASN B 2 87  ? -225.796 166.151 99.787  1.00 122.23 ? 87  ASN C N     1 
ATOM 1975  C CA    . ASN B 2 87  ? -225.359 166.903 98.613  1.00 122.23 ? 87  ASN C CA    1 
ATOM 1976  C C     . ASN B 2 87  ? -224.541 168.105 99.074  1.00 122.23 ? 87  ASN C C     1 
ATOM 1977  O O     . ASN B 2 87  ? -224.058 168.130 100.211 1.00 122.23 ? 87  ASN C O     1 
ATOM 1978  C CB    . ASN B 2 87  ? -226.512 167.348 97.723  1.00 122.23 ? 87  ASN C CB    1 
ATOM 1979  C CG    . ASN B 2 87  ? -227.723 166.494 97.875  1.00 122.23 ? 87  ASN C CG    1 
ATOM 1980  O OD1   . ASN B 2 87  ? -227.778 165.365 97.399  1.00 122.23 ? 87  ASN C OD1   1 
ATOM 1981  N ND2   . ASN B 2 87  ? -228.760 167.081 98.432  1.00 122.23 ? 87  ASN C ND2   1 
ATOM 1982  N N     . LYS B 2 88  ? -224.277 169.055 98.168  1.00 119.06 ? 88  LYS C N     1 
ATOM 1983  C CA    . LYS B 2 88  ? -223.630 170.332 98.507  1.00 119.06 ? 88  LYS C CA    1 
ATOM 1984  C C     . LYS B 2 88  ? -222.292 170.167 99.232  1.00 119.06 ? 88  LYS C C     1 
ATOM 1985  O O     . LYS B 2 88  ? -221.985 170.922 100.169 1.00 119.06 ? 88  LYS C O     1 
ATOM 1986  C CB    . LYS B 2 88  ? -224.646 171.150 99.337  1.00 119.06 ? 88  LYS C CB    1 
ATOM 1987  C CG    . LYS B 2 88  ? -224.321 172.509 99.987  1.00 119.06 ? 88  LYS C CG    1 
ATOM 1988  C CD    . LYS B 2 88  ? -224.193 173.674 99.037  1.00 119.06 ? 88  LYS C CD    1 
ATOM 1989  C CE    . LYS B 2 88  ? -224.239 174.947 99.856  1.00 119.06 ? 88  LYS C CE    1 
ATOM 1990  N NZ    . LYS B 2 88  ? -223.132 174.921 100.848 1.00 119.06 ? 88  LYS C NZ    1 
ATOM 1991  N N     . ASN B 2 89  ? -221.451 169.201 98.767  1.00 120.24 ? 89  ASN C N     1 
ATOM 1992  C CA    . ASN B 2 89  ? -220.247 169.040 99.583  1.00 120.24 ? 89  ASN C CA    1 
ATOM 1993  C C     . ASN B 2 89  ? -220.486 168.883 101.062 1.00 120.24 ? 89  ASN C C     1 
ATOM 1994  O O     . ASN B 2 89  ? -220.002 169.720 101.826 1.00 120.24 ? 89  ASN C O     1 
ATOM 1995  C CB    . ASN B 2 89  ? -219.224 170.148 99.341  1.00 120.24 ? 89  ASN C CB    1 
ATOM 1996  C CG    . ASN B 2 89  ? -217.781 169.676 99.530  1.00 120.24 ? 89  ASN C CG    1 
ATOM 1997  O OD1   . ASN B 2 89  ? -217.493 168.484 99.679  1.00 120.24 ? 89  ASN C OD1   1 
ATOM 1998  N ND2   . ASN B 2 89  ? -216.863 170.632 99.497  1.00 120.24 ? 89  ASN C ND2   1 
ATOM 1999  N N     . PRO B 2 90  ? -221.158 167.823 101.494 1.00 118.04 ? 90  PRO C N     1 
ATOM 2000  C CA    . PRO B 2 90  ? -221.644 167.766 102.876 1.00 118.04 ? 90  PRO C CA    1 
ATOM 2001  C C     . PRO B 2 90  ? -220.749 168.400 103.937 1.00 118.04 ? 90  PRO C C     1 
ATOM 2002  O O     . PRO B 2 90  ? -221.183 169.273 104.697 1.00 118.04 ? 90  PRO C O     1 
ATOM 2003  C CB    . PRO B 2 90  ? -221.812 166.263 103.105 1.00 118.04 ? 90  PRO C CB    1 
ATOM 2004  C CG    . PRO B 2 90  ? -222.204 165.752 101.789 1.00 118.04 ? 90  PRO C CG    1 
ATOM 2005  C CD    . PRO B 2 90  ? -221.410 166.552 100.785 1.00 118.04 ? 90  PRO C CD    1 
ATOM 2006  N N     . LYS B 2 91  ? -219.473 167.999 103.951 1.00 115.75 ? 91  LYS C N     1 
ATOM 2007  C CA    . LYS B 2 91  ? -218.541 168.516 104.946 1.00 115.75 ? 91  LYS C CA    1 
ATOM 2008  C C     . LYS B 2 91  ? -218.400 170.025 104.830 1.00 115.75 ? 91  LYS C C     1 
ATOM 2009  O O     . LYS B 2 91  ? -218.400 170.751 105.838 1.00 115.75 ? 91  LYS C O     1 
ATOM 2010  C CB    . LYS B 2 91  ? -217.170 167.873 104.710 1.00 115.75 ? 91  LYS C CB    1 
ATOM 2011  C CG    . LYS B 2 91  ? -217.098 166.375 104.945 1.00 115.75 ? 91  LYS C CG    1 
ATOM 2012  C CD    . LYS B 2 91  ? -215.666 165.869 104.935 1.00 115.75 ? 91  LYS C CD    1 
ATOM 2013  C CE    . LYS B 2 91  ? -215.619 164.379 105.245 1.00 115.75 ? 91  LYS C CE    1 
ATOM 2014  N NZ    . LYS B 2 91  ? -216.124 164.092 106.620 1.00 115.75 ? 91  LYS C NZ    1 
ATOM 2015  N N     . ARG B 2 92  ? -218.423 170.522 103.598 1.00 114.98 ? 92  ARG C N     1 
ATOM 2016  C CA    . ARG B 2 92  ? -218.296 171.951 103.377 1.00 114.98 ? 92  ARG C CA    1 
ATOM 2017  C C     . ARG B 2 92  ? -219.516 172.710 103.871 1.00 114.98 ? 92  ARG C C     1 
ATOM 2018  O O     . ARG B 2 92  ? -219.386 173.766 104.502 1.00 114.98 ? 92  ARG C O     1 
ATOM 2019  C CB    . ARG B 2 92  ? -218.047 172.231 101.902 1.00 114.98 ? 92  ARG C CB    1 
ATOM 2020  C CG    . ARG B 2 92  ? -217.828 173.692 101.590 1.00 114.98 ? 92  ARG C CG    1 
ATOM 2021  C CD    . ARG B 2 92  ? -216.423 174.156 101.943 1.00 114.98 ? 92  ARG C CD    1 
ATOM 2022  N NE    . ARG B 2 92  ? -216.263 174.440 103.368 1.00 114.98 ? 92  ARG C NE    1 
ATOM 2023  C CZ    . ARG B 2 92  ? -216.696 175.540 103.978 1.00 114.98 ? 92  ARG C CZ    1 
ATOM 2024  N NH1   . ARG B 2 92  ? -216.493 175.693 105.275 1.00 114.98 ? 92  ARG C NH1   1 
ATOM 2025  N NH2   . ARG B 2 92  ? -217.339 176.481 103.302 1.00 114.98 ? 92  ARG C NH2   1 
ATOM 2026  N N     . LYS B 2 93  ? -220.714 172.215 103.574 1.00 114.34 ? 93  LYS C N     1 
ATOM 2027  C CA    . LYS B 2 93  ? -221.883 172.955 104.027 1.00 114.34 ? 93  LYS C CA    1 
ATOM 2028  C C     . LYS B 2 93  ? -222.117 172.855 105.529 1.00 114.34 ? 93  LYS C C     1 
ATOM 2029  O O     . LYS B 2 93  ? -222.576 173.826 106.134 1.00 114.34 ? 93  LYS C O     1 
ATOM 2030  C CB    . LYS B 2 93  ? -223.146 172.436 103.357 1.00 114.34 ? 93  LYS C CB    1 
ATOM 2031  N N     . TRP B 2 94  ? -221.812 171.717 106.161 1.00 106.63 ? 94  TRP C N     1 
ATOM 2032  C CA    . TRP B 2 94  ? -221.961 171.681 107.607 1.00 106.63 ? 94  TRP C CA    1 
ATOM 2033  C C     . TRP B 2 94  ? -220.981 172.663 108.218 1.00 106.63 ? 94  TRP C C     1 
ATOM 2034  O O     . TRP B 2 94  ? -221.297 173.333 109.202 1.00 106.63 ? 94  TRP C O     1 
ATOM 2035  C CB    . TRP B 2 94  ? -221.931 170.274 108.198 1.00 106.63 ? 94  TRP C CB    1 
ATOM 2036  C CG    . TRP B 2 94  ? -222.266 170.358 109.672 1.00 106.63 ? 94  TRP C CG    1 
ATOM 2037  C CD1   . TRP B 2 94  ? -223.539 170.489 110.134 1.00 106.63 ? 94  TRP C CD1   1 
ATOM 2038  C CD2   . TRP B 2 94  ? -221.479 170.029 110.826 1.00 106.63 ? 94  TRP C CD2   1 
ATOM 2039  N NE1   . TRP B 2 94  ? -223.573 170.464 111.485 1.00 106.63 ? 94  TRP C NE1   1 
ATOM 2040  C CE2   . TRP B 2 94  ? -222.328 170.153 111.943 1.00 106.63 ? 94  TRP C CE2   1 
ATOM 2041  C CE3   . TRP B 2 94  ? -220.139 169.739 111.039 1.00 106.63 ? 94  TRP C CE3   1 
ATOM 2042  C CZ2   . TRP B 2 94  ? -221.886 169.976 113.233 1.00 106.63 ? 94  TRP C CZ2   1 
ATOM 2043  C CZ3   . TRP B 2 94  ? -219.709 169.542 112.325 1.00 106.63 ? 94  TRP C CZ3   1 
ATOM 2044  C CH2   . TRP B 2 94  ? -220.572 169.673 113.405 1.00 106.63 ? 94  TRP C CH2   1 
ATOM 2045  N N     . GLN B 2 95  ? -219.763 172.721 107.675 1.00 109.38 ? 95  GLN C N     1 
ATOM 2046  C CA    . GLN B 2 95  ? -218.828 173.715 108.173 1.00 109.38 ? 95  GLN C CA    1 
ATOM 2047  C C     . GLN B 2 95  ? -219.305 175.131 107.852 1.00 109.38 ? 95  GLN C C     1 
ATOM 2048  O O     . GLN B 2 95  ? -218.874 176.081 108.515 1.00 109.38 ? 95  GLN C O     1 
ATOM 2049  C CB    . GLN B 2 95  ? -217.438 173.497 107.573 1.00 109.38 ? 95  GLN C CB    1 
ATOM 2050  C CG    . GLN B 2 95  ? -216.726 172.228 108.002 1.00 109.38 ? 95  GLN C CG    1 
ATOM 2051  C CD    . GLN B 2 95  ? -215.439 172.001 107.232 1.00 109.38 ? 95  GLN C CD    1 
ATOM 2052  O OE1   . GLN B 2 95  ? -215.144 172.715 106.277 1.00 109.38 ? 95  GLN C OE1   1 
ATOM 2053  N NE2   . GLN B 2 95  ? -214.659 171.013 107.653 1.00 109.38 ? 95  GLN C NE2   1 
ATOM 2054  N N     . ALA B 2 96  ? -220.179 175.293 106.854 1.00 109.76 ? 96  ALA C N     1 
ATOM 2055  C CA    . ALA B 2 96  ? -220.736 176.608 106.548 1.00 109.76 ? 96  ALA C CA    1 
ATOM 2056  C C     . ALA B 2 96  ? -221.795 177.021 107.571 1.00 109.76 ? 96  ALA C C     1 
ATOM 2057  O O     . ALA B 2 96  ? -221.721 178.117 108.143 1.00 109.76 ? 96  ALA C O     1 
ATOM 2058  C CB    . ALA B 2 96  ? -221.329 176.597 105.137 1.00 109.76 ? 96  ALA C CB    1 
ATOM 2059  N N     . ARG B 2 97  ? -222.767 176.140 107.841 1.00 108.25 ? 97  ARG C N     1 
ATOM 2060  C CA    . ARG B 2 97  ? -223.726 176.384 108.920 1.00 108.25 ? 97  ARG C CA    1 
ATOM 2061  C C     . ARG B 2 97  ? -223.008 176.544 110.249 1.00 108.25 ? 97  ARG C C     1 
ATOM 2062  O O     . ARG B 2 97  ? -223.363 177.388 111.080 1.00 108.25 ? 97  ARG C O     1 
ATOM 2063  C CB    . ARG B 2 97  ? -224.704 175.219 109.062 1.00 108.25 ? 97  ARG C CB    1 
ATOM 2064  C CG    . ARG B 2 97  ? -225.861 175.126 108.105 1.00 108.25 ? 97  ARG C CG    1 
ATOM 2065  C CD    . ARG B 2 97  ? -225.440 174.987 106.668 1.00 108.25 ? 97  ARG C CD    1 
ATOM 2066  N NE    . ARG B 2 97  ? -226.600 174.706 105.832 1.00 108.25 ? 97  ARG C NE    1 
ATOM 2067  C CZ    . ARG B 2 97  ? -226.577 174.662 104.507 1.00 108.25 ? 97  ARG C CZ    1 
ATOM 2068  N NH1   . ARG B 2 97  ? -225.446 174.883 103.855 1.00 108.25 ? 97  ARG C NH1   1 
ATOM 2069  N NH2   . ARG B 2 97  ? -227.686 174.391 103.836 1.00 108.25 ? 97  ARG C NH2   1 
ATOM 2070  N N     . ARG B 2 98  ? -221.985 175.733 110.444 1.00 106.30 ? 98  ARG C N     1 
ATOM 2071  C CA    . ARG B 2 98  ? -221.125 175.812 111.608 1.00 106.30 ? 98  ARG C CA    1 
ATOM 2072  C C     . ARG B 2 98  ? -220.532 177.197 111.748 1.00 106.30 ? 98  ARG C C     1 
ATOM 2073  O O     . ARG B 2 98  ? -220.574 177.792 112.828 1.00 106.30 ? 98  ARG C O     1 
ATOM 2074  C CB    . ARG B 2 98  ? -220.013 174.798 111.373 1.00 106.30 ? 98  ARG C CB    1 
ATOM 2075  C CG    . ARG B 2 98  ? -218.841 174.611 112.307 1.00 106.30 ? 98  ARG C CG    1 
ATOM 2076  C CD    . ARG B 2 98  ? -218.083 173.526 111.549 1.00 106.30 ? 98  ARG C CD    1 
ATOM 2077  N NE    . ARG B 2 98  ? -216.848 172.963 112.061 1.00 106.30 ? 98  ARG C NE    1 
ATOM 2078  C CZ    . ARG B 2 98  ? -216.783 171.950 112.912 1.00 106.30 ? 98  ARG C CZ    1 
ATOM 2079  N NH1   . ARG B 2 98  ? -215.613 171.490 113.325 1.00 106.30 ? 98  ARG C NH1   1 
ATOM 2080  N NH2   . ARG B 2 98  ? -217.885 171.445 113.412 1.00 106.30 ? 98  ARG C NH2   1 
ATOM 2081  N N     . SER B 2 99  ? -219.988 177.740 110.658 1.00 109.30 ? 99  SER C N     1 
ATOM 2082  C CA    . SER B 2 99  ? -219.450 179.088 110.748 1.00 109.30 ? 99  SER C CA    1 
ATOM 2083  C C     . SER B 2 99  ? -220.527 180.127 111.006 1.00 109.30 ? 99  SER C C     1 
ATOM 2084  O O     . SER B 2 99  ? -220.254 181.129 111.667 1.00 109.30 ? 99  SER C O     1 
ATOM 2085  C CB    . SER B 2 99  ? -218.682 179.433 109.476 1.00 109.30 ? 99  SER C CB    1 
ATOM 2086  O OG    . SER B 2 99  ? -218.123 180.732 109.553 1.00 109.30 ? 99  SER C OG    1 
ATOM 2087  N N     . GLN B 2 100 ? -221.729 179.869 110.487 1.00 109.83 ? 100 GLN C N     1 
ATOM 2088  C CA    . GLN B 2 100 ? -222.893 180.745 110.656 1.00 109.83 ? 100 GLN C CA    1 
ATOM 2089  C C     . GLN B 2 100 ? -223.389 180.864 112.105 1.00 109.83 ? 100 GLN C C     1 
ATOM 2090  O O     . GLN B 2 100 ? -223.665 181.963 112.579 1.00 109.83 ? 100 GLN C O     1 
ATOM 2091  C CB    . GLN B 2 100 ? -224.030 180.259 109.749 1.00 109.83 ? 100 GLN C CB    1 
ATOM 2092  C CG    . GLN B 2 100 ? -225.249 181.164 109.699 1.00 109.83 ? 100 GLN C CG    1 
ATOM 2093  C CD    . GLN B 2 100 ? -226.274 180.710 108.676 1.00 109.83 ? 100 GLN C CD    1 
ATOM 2094  O OE1   . GLN B 2 100 ? -227.170 181.464 108.300 1.00 109.83 ? 100 GLN C OE1   1 
ATOM 2095  N NE2   . GLN B 2 100 ? -226.148 179.472 108.219 1.00 109.83 ? 100 GLN C NE2   1 
ATOM 2096  N N     . ILE B 2 101 ? -223.483 179.735 112.805 1.00 105.11 ? 101 ILE C N     1 
ATOM 2097  C CA    . ILE B 2 101 ? -223.904 179.720 114.211 1.00 105.11 ? 101 ILE C CA    1 
ATOM 2098  C C     . ILE B 2 101 ? -222.734 180.091 115.117 1.00 105.11 ? 101 ILE C C     1 
ATOM 2099  O O     . ILE B 2 101 ? -222.908 180.767 116.138 1.00 105.11 ? 101 ILE C O     1 
ATOM 2100  C CB    . ILE B 2 101 ? -224.504 178.363 114.624 1.00 105.11 ? 101 ILE C CB    1 
ATOM 2101  C CG1   . ILE B 2 101 ? -225.663 177.966 113.733 1.00 105.11 ? 101 ILE C CG1   1 
ATOM 2102  C CG2   . ILE B 2 101 ? -225.024 178.447 116.035 1.00 105.11 ? 101 ILE C CG2   1 
ATOM 2103  C CD1   . ILE B 2 101 ? -225.647 176.497 113.428 1.00 105.11 ? 101 ILE C CD1   1 
ATOM 2104  N N     . LEU B 2 102 ? -221.524 179.662 114.764 1.00 106.77 ? 102 LEU C N     1 
ATOM 2105  C CA    . LEU B 2 102 ? -220.355 180.112 115.501 1.00 106.77 ? 102 LEU C CA    1 
ATOM 2106  C C     . LEU B 2 102 ? -220.216 181.615 115.390 1.00 106.77 ? 102 LEU C C     1 
ATOM 2107  O O     . LEU B 2 102 ? -219.721 182.259 116.317 1.00 106.77 ? 102 LEU C O     1 
ATOM 2108  C CB    . LEU B 2 102 ? -219.098 179.422 114.977 1.00 106.77 ? 102 LEU C CB    1 
ATOM 2109  C CG    . LEU B 2 102 ? -218.765 177.999 115.433 1.00 106.77 ? 102 LEU C CG    1 
ATOM 2110  C CD1   . LEU B 2 102 ? -217.429 177.520 114.866 1.00 106.77 ? 102 LEU C CD1   1 
ATOM 2111  C CD2   . LEU B 2 102 ? -218.747 177.955 116.942 1.00 106.77 ? 102 LEU C CD2   1 
ATOM 2112  N N     . SER B 2 103 ? -220.652 182.195 114.270 1.00 109.57 ? 103 SER C N     1 
ATOM 2113  C CA    . SER B 2 103 ? -220.572 183.643 114.156 1.00 109.57 ? 103 SER C CA    1 
ATOM 2114  C C     . SER B 2 103 ? -221.630 184.347 115.001 1.00 109.57 ? 103 SER C C     1 
ATOM 2115  O O     . SER B 2 103 ? -221.346 185.415 115.556 1.00 109.57 ? 103 SER C O     1 
ATOM 2116  C CB    . SER B 2 103 ? -220.709 184.043 112.688 1.00 109.57 ? 103 SER C CB    1 
ATOM 2117  O OG    . SER B 2 103 ? -222.005 183.742 112.204 1.00 109.57 ? 103 SER C OG    1 
ATOM 2118  N N     . LYS B 2 104 ? -222.808 183.743 115.133 1.00 107.93 ? 104 LYS C N     1 
ATOM 2119  C CA    . LYS B 2 104 ? -223.879 184.329 115.931 1.00 107.93 ? 104 LYS C CA    1 
ATOM 2120  C C     . LYS B 2 104 ? -223.401 184.447 117.372 1.00 107.93 ? 104 LYS C C     1 
ATOM 2121  O O     . LYS B 2 104 ? -223.674 185.435 118.051 1.00 107.93 ? 104 LYS C O     1 
ATOM 2122  C CB    . LYS B 2 104 ? -225.152 183.468 115.837 1.00 107.93 ? 104 LYS C CB    1 
ATOM 2123  C CG    . LYS B 2 104 ? -226.041 183.444 117.077 1.00 107.93 ? 104 LYS C CG    1 
ATOM 2124  C CD    . LYS B 2 104 ? -227.509 183.620 116.735 1.00 107.93 ? 104 LYS C CD    1 
ATOM 2125  C CE    . LYS B 2 104 ? -228.313 183.960 117.977 1.00 107.93 ? 104 LYS C CE    1 
ATOM 2126  N NZ    . LYS B 2 104 ? -229.739 183.557 117.853 1.00 107.93 ? 104 LYS C NZ    1 
ATOM 2127  N N     . GLY B 2 105 ? -222.692 183.427 117.831 1.00 104.77 ? 105 GLY C N     1 
ATOM 2128  C CA    . GLY B 2 105 ? -222.162 183.416 119.179 1.00 104.77 ? 105 GLY C CA    1 
ATOM 2129  C C     . GLY B 2 105 ? -223.147 182.955 120.230 1.00 104.77 ? 105 GLY C C     1 
ATOM 2130  O O     . GLY B 2 105 ? -222.833 182.940 121.419 1.00 104.77 ? 105 GLY C O     1 
ATOM 2131  N N     . ARG B 2 106 ? -224.351 182.591 119.810 1.00 102.41 ? 106 ARG C N     1 
ATOM 2132  C CA    . ARG B 2 106 ? -225.324 182.105 120.770 1.00 102.41 ? 106 ARG C CA    1 
ATOM 2133  C C     . ARG B 2 106 ? -226.481 181.345 120.138 1.00 102.41 ? 106 ARG C C     1 
ATOM 2134  O O     . ARG B 2 106 ? -226.805 181.540 118.970 1.00 102.41 ? 106 ARG C O     1 
ATOM 2135  C CB    . ARG B 2 106 ? -225.853 183.260 121.617 1.00 102.41 ? 106 ARG C CB    1 
ATOM 2136  C CG    . ARG B 2 106 ? -227.024 182.889 122.505 1.00 102.41 ? 106 ARG C CG    1 
ATOM 2137  C CD    . ARG B 2 106 ? -228.332 183.408 121.931 1.00 102.41 ? 106 ARG C CD    1 
ATOM 2138  N NE    . ARG B 2 106 ? -228.781 184.634 122.587 1.00 102.41 ? 106 ARG C NE    1 
ATOM 2139  C CZ    . ARG B 2 106 ? -228.031 185.720 122.732 1.00 102.41 ? 106 ARG C CZ    1 
ATOM 2140  N NH1   . ARG B 2 106 ? -226.791 185.738 122.271 1.00 102.41 ? 106 ARG C NH1   1 
ATOM 2141  N NH2   . ARG B 2 106 ? -228.523 186.786 123.338 1.00 102.41 ? 106 ARG C NH2   1 
ATOM 2142  N N     . LEU B 2 107 ? -227.112 180.494 120.936 1.00 102.45 ? 107 LEU C N     1 
ATOM 2143  C CA    . LEU B 2 107 ? -228.302 179.737 120.521 1.00 102.45 ? 107 LEU C CA    1 
ATOM 2144  C C     . LEU B 2 107 ? -229.622 180.333 121.015 1.00 102.45 ? 107 LEU C C     1 
ATOM 2145  O O     . LEU B 2 107 ? -229.746 180.683 122.189 1.00 102.45 ? 107 LEU C O     1 
ATOM 2146  C CB    . LEU B 2 107 ? -228.171 178.280 120.935 1.00 102.45 ? 107 LEU C CB    1 
ATOM 2147  C CG    . LEU B 2 107 ? -227.818 178.000 122.381 1.00 102.45 ? 107 LEU C CG    1 
ATOM 2148  C CD1   . LEU B 2 107 ? -229.042 177.961 123.255 1.00 102.45 ? 107 LEU C CD1   1 
ATOM 2149  C CD2   . LEU B 2 107 ? -227.121 176.683 122.403 1.00 102.45 ? 107 LEU C CD2   1 
ATOM 2150  N N     . ASP B 2 108 ? -230.560 180.548 120.091 1.00 104.72 ? 108 ASP C N     1 
ATOM 2151  C CA    . ASP B 2 108 ? -231.867 181.135 120.370 1.00 104.72 ? 108 ASP C CA    1 
ATOM 2152  C C     . ASP B 2 108 ? -232.640 180.202 121.323 1.00 104.72 ? 108 ASP C C     1 
ATOM 2153  O O     . ASP B 2 108 ? -232.823 179.011 120.997 1.00 104.72 ? 108 ASP C O     1 
ATOM 2154  C CB    . ASP B 2 108 ? -232.646 181.301 119.082 1.00 104.72 ? 108 ASP C CB    1 
ATOM 2155  C CG    . ASP B 2 108 ? -232.752 180.024 118.304 1.00 104.72 ? 108 ASP C CG    1 
ATOM 2156  O OD1   . ASP B 2 108 ? -231.785 179.258 118.299 1.00 104.72 ? 108 ASP C OD1   1 
ATOM 2157  O OD2   . ASP B 2 108 ? -233.664 179.960 117.438 1.00 104.72 ? 108 ASP C OD2   1 
ATOM 2158  N N     . PRO B 2 109 ? -233.112 180.677 122.474 1.00 104.18 ? 109 PRO C N     1 
ATOM 2159  C CA    . PRO B 2 109 ? -233.750 179.792 123.465 1.00 104.18 ? 109 PRO C CA    1 
ATOM 2160  C C     . PRO B 2 109 ? -234.982 179.088 122.947 1.00 104.18 ? 109 PRO C C     1 
ATOM 2161  O O     . PRO B 2 109 ? -235.345 178.009 123.441 1.00 104.18 ? 109 PRO C O     1 
ATOM 2162  C CB    . PRO B 2 109 ? -234.135 180.761 124.590 1.00 104.18 ? 109 PRO C CB    1 
ATOM 2163  C CG    . PRO B 2 109 ? -233.285 181.956 124.387 1.00 104.18 ? 109 PRO C CG    1 
ATOM 2164  C CD    . PRO B 2 109 ? -233.067 182.072 122.917 1.00 104.18 ? 109 PRO C CD    1 
ATOM 2165  N N     . GLU B 2 110 ? -235.656 179.695 121.975 1.00 109.44 ? 110 GLU C N     1 
ATOM 2166  C CA    . GLU B 2 110 ? -236.882 179.129 121.436 1.00 109.44 ? 110 GLU C CA    1 
ATOM 2167  C C     . GLU B 2 110 ? -236.644 177.809 120.722 1.00 109.44 ? 110 GLU C C     1 
ATOM 2168  O O     . GLU B 2 110 ? -237.519 176.940 120.733 1.00 109.44 ? 110 GLU C O     1 
ATOM 2169  C CB    . GLU B 2 110 ? -237.547 180.127 120.490 1.00 109.44 ? 110 GLU C CB    1 
ATOM 2170  C CG    . GLU B 2 110 ? -238.030 181.395 121.176 1.00 109.44 ? 110 GLU C CG    1 
ATOM 2171  C CD    . GLU B 2 110 ? -239.142 181.149 122.184 1.00 109.44 ? 110 GLU C CD    1 
ATOM 2172  O OE1   . GLU B 2 110 ? -239.652 180.010 122.265 1.00 109.44 ? 110 GLU C OE1   1 
ATOM 2173  O OE2   . GLU B 2 110 ? -239.501 182.099 122.911 1.00 109.44 ? 110 GLU C OE2   1 
ATOM 2174  N N     . ALA B 2 111 ? -235.491 177.644 120.083 1.00 107.02 ? 111 ALA C N     1 
ATOM 2175  C CA    . ALA B 2 111 ? -235.176 176.360 119.472 1.00 107.02 ? 111 ALA C CA    1 
ATOM 2176  C C     . ALA B 2 111 ? -234.809 175.311 120.511 1.00 107.02 ? 111 ALA C C     1 
ATOM 2177  O O     . ALA B 2 111 ? -234.977 174.112 120.261 1.00 107.02 ? 111 ALA C O     1 
ATOM 2178  C CB    . ALA B 2 111 ? -234.041 176.528 118.464 1.00 107.02 ? 111 ALA C CB    1 
ATOM 2179  N N     . VAL B 2 112 ? -234.333 175.733 121.681 1.00 103.41 ? 112 VAL C N     1 
ATOM 2180  C CA    . VAL B 2 112 ? -234.104 174.798 122.779 1.00 103.41 ? 112 VAL C CA    1 
ATOM 2181  C C     . VAL B 2 112 ? -235.422 174.291 123.346 1.00 103.41 ? 112 VAL C C     1 
ATOM 2182  O O     . VAL B 2 112 ? -235.662 173.074 123.437 1.00 103.41 ? 112 VAL C O     1 
ATOM 2183  C CB    . VAL B 2 112 ? -233.262 175.482 123.871 1.00 103.41 ? 112 VAL C CB    1 
ATOM 2184  C CG1   . VAL B 2 112 ? -233.112 174.587 125.073 1.00 103.41 ? 112 VAL C CG1   1 
ATOM 2185  C CG2   . VAL B 2 112 ? -231.907 175.849 123.329 1.00 103.41 ? 112 VAL C CG2   1 
ATOM 2186  N N     . ASP B 2 113 ? -236.307 175.208 123.699 1.00 101.26 ? 113 ASP C N     1 
ATOM 2187  C CA    . ASP B 2 113 ? -237.576 174.811 124.280 1.00 101.26 ? 113 ASP C CA    1 
ATOM 2188  C C     . ASP B 2 113 ? -238.311 173.904 123.313 1.00 101.26 ? 113 ASP C C     1 
ATOM 2189  O O     . ASP B 2 113 ? -239.004 172.978 123.726 1.00 101.26 ? 113 ASP C O     1 
ATOM 2190  C CB    . ASP B 2 113 ? -238.404 176.031 124.655 1.00 101.26 ? 113 ASP C CB    1 
ATOM 2191  C CG    . ASP B 2 113 ? -237.756 176.846 125.748 1.00 101.26 ? 113 ASP C CG    1 
ATOM 2192  O OD1   . ASP B 2 113 ? -236.851 177.646 125.428 1.00 101.26 ? 113 ASP C OD1   1 
ATOM 2193  O OD2   . ASP B 2 113 ? -238.137 176.678 126.926 1.00 101.26 ? 113 ASP C OD2   1 
ATOM 2194  N N     . ALA B 2 114 ? -238.171 174.169 122.024 1.00 107.63 ? 114 ALA C N     1 
ATOM 2195  C CA    . ALA B 2 114 ? -238.829 173.324 121.052 1.00 107.63 ? 114 ALA C CA    1 
ATOM 2196  C C     . ALA B 2 114 ? -238.301 171.895 121.170 1.00 107.63 ? 114 ALA C C     1 
ATOM 2197  O O     . ALA B 2 114 ? -239.086 170.951 121.174 1.00 107.63 ? 114 ALA C O     1 
ATOM 2198  C CB    . ALA B 2 114 ? -238.594 173.859 119.650 1.00 107.63 ? 114 ALA C CB    1 
ATOM 2199  N N     . TYR B 2 115 ? -236.986 171.737 121.275 1.00 102.99 ? 115 TYR C N     1 
ATOM 2200  C CA    . TYR B 2 115 ? -236.395 170.409 121.407 1.00 102.99 ? 115 TYR C CA    1 
ATOM 2201  C C     . TYR B 2 115 ? -236.865 169.768 122.710 1.00 102.99 ? 115 TYR C C     1 
ATOM 2202  O O     . TYR B 2 115 ? -237.258 168.602 122.741 1.00 102.99 ? 115 TYR C O     1 
ATOM 2203  C CB    . TYR B 2 115 ? -234.869 170.492 121.379 1.00 102.99 ? 115 TYR C CB    1 
ATOM 2204  C CG    . TYR B 2 115 ? -234.181 169.147 121.438 1.00 102.99 ? 115 TYR C CG    1 
ATOM 2205  C CD1   . TYR B 2 115 ? -234.292 168.337 122.559 1.00 102.99 ? 115 TYR C CD1   1 
ATOM 2206  C CD2   . TYR B 2 115 ? -233.420 168.687 120.370 1.00 102.99 ? 115 TYR C CD2   1 
ATOM 2207  C CE1   . TYR B 2 115 ? -233.665 167.106 122.617 1.00 102.99 ? 115 TYR C CE1   1 
ATOM 2208  C CE2   . TYR B 2 115 ? -232.790 167.459 120.419 1.00 102.99 ? 115 TYR C CE2   1 
ATOM 2209  C CZ    . TYR B 2 115 ? -232.915 166.672 121.545 1.00 102.99 ? 115 TYR C CZ    1 
ATOM 2210  O OH    . TYR B 2 115 ? -232.290 165.448 121.598 1.00 102.99 ? 115 TYR C OH    1 
ATOM 2211  N N     . PHE B 2 116 ? -236.822 170.553 123.781 1.00 98.89  ? 116 PHE C N     1 
ATOM 2212  C CA    . PHE B 2 116 ? -237.241 170.119 125.099 1.00 98.89  ? 116 PHE C CA    1 
ATOM 2213  C C     . PHE B 2 116 ? -238.727 169.846 125.019 1.00 98.89  ? 116 PHE C C     1 
ATOM 2214  O O     . PHE B 2 116 ? -239.245 168.926 125.640 1.00 98.89  ? 116 PHE C O     1 
ATOM 2215  C CB    . PHE B 2 116 ? -236.935 171.186 126.147 1.00 98.89  ? 116 PHE C CB    1 
ATOM 2216  C CG    . PHE B 2 116 ? -235.503 171.187 126.614 1.00 98.89  ? 116 PHE C CG    1 
ATOM 2217  C CD1   . PHE B 2 116 ? -234.632 170.170 126.248 1.00 98.89  ? 116 PHE C CD1   1 
ATOM 2218  C CD2   . PHE B 2 116 ? -235.029 172.207 127.420 1.00 98.89  ? 116 PHE C CD2   1 
ATOM 2219  C CE1   . PHE B 2 116 ? -233.321 170.171 126.680 1.00 98.89  ? 116 PHE C CE1   1 
ATOM 2220  C CE2   . PHE B 2 116 ? -233.718 172.215 127.855 1.00 98.89  ? 116 PHE C CE2   1 
ATOM 2221  C CZ    . PHE B 2 116 ? -232.863 171.196 127.484 1.00 98.89  ? 116 PHE C CZ    1 
ATOM 2222  N N     . ALA B 2 117 ? -239.405 170.671 124.233 1.00 102.70 ? 117 ALA C N     1 
ATOM 2223  C CA    . ALA B 2 117 ? -240.840 170.577 124.052 1.00 102.70 ? 117 ALA C CA    1 
ATOM 2224  C C     . ALA B 2 117 ? -241.257 169.235 123.477 1.00 102.70 ? 117 ALA C C     1 
ATOM 2225  O O     . ALA B 2 117 ? -242.279 168.686 123.862 1.00 102.70 ? 117 ALA C O     1 
ATOM 2226  C CB    . ALA B 2 117 ? -241.316 171.699 123.150 1.00 102.70 ? 117 ALA C CB    1 
ATOM 2227  N N     . ASP B 2 118 ? -240.474 168.703 122.552 1.00 105.46 ? 118 ASP C N     1 
ATOM 2228  C CA    . ASP B 2 118 ? -240.819 167.425 121.952 1.00 105.46 ? 118 ASP C CA    1 
ATOM 2229  C C     . ASP B 2 118 ? -240.864 166.301 122.985 1.00 105.46 ? 118 ASP C C     1 
ATOM 2230  O O     . ASP B 2 118 ? -241.765 165.468 122.960 1.00 105.46 ? 118 ASP C O     1 
ATOM 2231  C CB    . ASP B 2 118 ? -239.810 167.075 120.862 1.00 105.46 ? 118 ASP C CB    1 
ATOM 2232  C CG    . ASP B 2 118 ? -240.467 166.734 119.548 1.00 105.46 ? 118 ASP C CG    1 
ATOM 2233  O OD1   . ASP B 2 118 ? -240.901 167.667 118.846 1.00 105.46 ? 118 ASP C OD1   1 
ATOM 2234  O OD2   . ASP B 2 118 ? -240.547 165.533 119.213 1.00 105.46 ? 118 ASP C OD2   1 
ATOM 2235  N N     . TYR B 2 119 ? -239.893 166.282 123.891 1.00 102.28 ? 119 TYR C N     1 
ATOM 2236  C CA    . TYR B 2 119 ? -239.822 165.256 124.931 1.00 102.28 ? 119 TYR C CA    1 
ATOM 2237  C C     . TYR B 2 119 ? -239.767 165.864 126.325 1.00 102.28 ? 119 TYR C C     1 
ATOM 2238  O O     . TYR B 2 119 ? -239.102 165.330 127.206 1.00 102.28 ? 119 TYR C O     1 
ATOM 2239  C CB    . TYR B 2 119 ? -238.600 164.358 124.737 1.00 102.28 ? 119 TYR C CB    1 
ATOM 2240  C CG    . TYR B 2 119 ? -238.162 164.156 123.309 1.00 102.28 ? 119 TYR C CG    1 
ATOM 2241  C CD1   . TYR B 2 119 ? -237.732 165.219 122.539 1.00 102.28 ? 119 TYR C CD1   1 
ATOM 2242  C CD2   . TYR B 2 119 ? -238.156 162.894 122.743 1.00 102.28 ? 119 TYR C CD2   1 
ATOM 2243  C CE1   . TYR B 2 119 ? -237.321 165.030 121.237 1.00 102.28 ? 119 TYR C CE1   1 
ATOM 2244  C CE2   . TYR B 2 119 ? -237.750 162.696 121.442 1.00 102.28 ? 119 TYR C CE2   1 
ATOM 2245  C CZ    . TYR B 2 119 ? -237.334 163.765 120.698 1.00 102.28 ? 119 TYR C CZ    1 
ATOM 2246  O OH    . TYR B 2 119 ? -236.925 163.567 119.404 1.00 102.28 ? 119 TYR C OH    1 
ATOM 2247  N N     . SER B 2 120 ? -240.456 166.977 126.534 1.00 105.47 ? 120 SER C N     1 
ATOM 2248  C CA    . SER B 2 120 ? -240.400 167.657 127.821 1.00 105.47 ? 120 SER C CA    1 
ATOM 2249  C C     . SER B 2 120 ? -240.861 166.787 128.978 1.00 105.47 ? 120 SER C C     1 
ATOM 2250  O O     . SER B 2 120 ? -240.249 166.780 130.045 1.00 105.47 ? 120 SER C O     1 
ATOM 2251  C CB    . SER B 2 120 ? -241.267 168.910 127.765 1.00 105.47 ? 120 SER C CB    1 
ATOM 2252  O OG    . SER B 2 120 ? -242.280 168.763 126.787 1.00 105.47 ? 120 SER C OG    1 
ATOM 2253  N N     . GLU B 2 121 ? -241.935 166.044 128.773 1.00 105.24 ? 121 GLU C N     1 
ATOM 2254  C CA    . GLU B 2 121 ? -242.451 165.193 129.831 1.00 105.24 ? 121 GLU C CA    1 
ATOM 2255  C C     . GLU B 2 121 ? -241.718 163.862 129.976 1.00 105.24 ? 121 GLU C C     1 
ATOM 2256  O O     . GLU B 2 121 ? -241.962 163.129 130.930 1.00 105.24 ? 121 GLU C O     1 
ATOM 2257  C CB    . GLU B 2 121 ? -243.945 164.950 129.627 1.00 105.24 ? 121 GLU C CB    1 
ATOM 2258  C CG    . GLU B 2 121 ? -244.271 163.789 128.706 1.00 105.24 ? 121 GLU C CG    1 
ATOM 2259  C CD    . GLU B 2 121 ? -244.800 162.587 129.458 1.00 105.24 ? 121 GLU C CD    1 
ATOM 2260  O OE1   . GLU B 2 121 ? -244.379 162.373 130.613 1.00 105.24 ? 121 GLU C OE1   1 
ATOM 2261  O OE2   . GLU B 2 121 ? -245.639 161.859 128.894 1.00 105.24 ? 121 GLU C OE2   1 
ATOM 2262  N N     . ARG B 2 122 ? -240.741 163.611 129.111 1.00 98.30  ? 122 ARG C N     1 
ATOM 2263  C CA    . ARG B 2 122 ? -239.955 162.376 129.172 1.00 98.30  ? 122 ARG C CA    1 
ATOM 2264  C C     . ARG B 2 122 ? -238.578 162.425 129.882 1.00 98.30  ? 122 ARG C C     1 
ATOM 2265  O O     . ARG B 2 122 ? -237.891 161.410 129.946 1.00 98.30  ? 122 ARG C O     1 
ATOM 2266  C CB    . ARG B 2 122 ? -239.773 161.836 127.752 1.00 98.30  ? 122 ARG C CB    1 
ATOM 2267  C CG    . ARG B 2 122 ? -239.029 160.518 127.664 1.00 98.30  ? 122 ARG C CG    1 
ATOM 2268  C CD    . ARG B 2 122 ? -237.848 160.625 126.718 1.00 98.30  ? 122 ARG C CD    1 
ATOM 2269  N NE    . ARG B 2 122 ? -238.100 159.935 125.456 1.00 98.30  ? 122 ARG C NE    1 
ATOM 2270  C CZ    . ARG B 2 122 ? -238.441 158.654 125.356 1.00 98.30  ? 122 ARG C CZ    1 
ATOM 2271  N NH1   . ARG B 2 122 ? -238.574 157.913 126.448 1.00 98.30  ? 122 ARG C NH1   1 
ATOM 2272  N NH2   . ARG B 2 122 ? -238.645 158.114 124.163 1.00 98.30  ? 122 ARG C NH2   1 
ATOM 2273  N N     . PHE B 2 123 ? -238.165 163.574 130.414 1.00 94.90  ? 123 PHE C N     1 
ATOM 2274  C CA    . PHE B 2 123 ? -236.844 163.663 131.063 1.00 94.90  ? 123 PHE C CA    1 
ATOM 2275  C C     . PHE B 2 123 ? -236.713 163.277 132.538 1.00 94.90  ? 123 PHE C C     1 
ATOM 2276  O O     . PHE B 2 123 ? -235.766 162.583 132.889 1.00 94.90  ? 123 PHE C O     1 
ATOM 2277  C CB    . PHE B 2 123 ? -236.216 165.040 130.849 1.00 94.90  ? 123 PHE C CB    1 
ATOM 2278  C CG    . PHE B 2 123 ? -235.244 165.096 129.705 1.00 94.90  ? 123 PHE C CG    1 
ATOM 2279  C CD1   . PHE B 2 123 ? -235.126 164.043 128.819 1.00 94.90  ? 123 PHE C CD1   1 
ATOM 2280  C CD2   . PHE B 2 123 ? -234.459 166.212 129.509 1.00 94.90  ? 123 PHE C CD2   1 
ATOM 2281  C CE1   . PHE B 2 123 ? -234.239 164.099 127.764 1.00 94.90  ? 123 PHE C CE1   1 
ATOM 2282  C CE2   . PHE B 2 123 ? -233.572 166.274 128.456 1.00 94.90  ? 123 PHE C CE2   1 
ATOM 2283  C CZ    . PHE B 2 123 ? -233.461 165.215 127.583 1.00 94.90  ? 123 PHE C CZ    1 
ATOM 2284  N N     . ASP B 2 124 ? -237.632 163.736 133.390 1.00 96.48  ? 124 ASP C N     1 
ATOM 2285  C CA    . ASP B 2 124 ? -237.599 163.436 134.826 1.00 96.48  ? 124 ASP C CA    1 
ATOM 2286  C C     . ASP B 2 124 ? -237.237 161.983 135.059 1.00 96.48  ? 124 ASP C C     1 
ATOM 2287  O O     . ASP B 2 124 ? -238.074 161.099 134.941 1.00 96.48  ? 124 ASP C O     1 
ATOM 2288  C CB    . ASP B 2 124 ? -238.944 163.753 135.485 1.00 96.48  ? 124 ASP C CB    1 
ATOM 2289  C CG    . ASP B 2 124 ? -240.133 163.364 134.621 1.00 96.48  ? 124 ASP C CG    1 
ATOM 2290  O OD1   . ASP B 2 124 ? -240.324 162.155 134.364 1.00 96.48  ? 124 ASP C OD1   1 
ATOM 2291  O OD2   . ASP B 2 124 ? -240.889 164.270 134.206 1.00 96.48  ? 124 ASP C OD2   1 
ATOM 2292  N N     . LEU B 2 125 ? -235.973 161.740 135.376 1.00 88.23  ? 125 LEU C N     1 
ATOM 2293  C CA    . LEU B 2 125 ? -235.500 160.378 135.565 1.00 88.23  ? 125 LEU C CA    1 
ATOM 2294  C C     . LEU B 2 125 ? -236.425 159.456 136.349 1.00 88.23  ? 125 LEU C C     1 
ATOM 2295  O O     . LEU B 2 125 ? -236.586 158.290 135.992 1.00 88.23  ? 125 LEU C O     1 
ATOM 2296  C CB    . LEU B 2 125 ? -234.108 160.386 136.202 1.00 88.23  ? 125 LEU C CB    1 
ATOM 2297  C CG    . LEU B 2 125 ? -234.027 160.600 137.714 1.00 88.23  ? 125 LEU C CG    1 
ATOM 2298  C CD1   . LEU B 2 125 ? -232.758 161.352 138.079 1.00 88.23  ? 125 LEU C CD1   1 
ATOM 2299  C CD2   . LEU B 2 125 ? -235.258 161.315 138.248 1.00 88.23  ? 125 LEU C CD2   1 
ATOM 2300  N N     . PHE B 2 126 ? -237.031 159.961 137.415 1.00 87.77  ? 126 PHE C N     1 
ATOM 2301  C CA    . PHE B 2 126 ? -237.888 159.102 138.226 1.00 87.77  ? 126 PHE C CA    1 
ATOM 2302  C C     . PHE B 2 126 ? -239.214 158.759 137.550 1.00 87.77  ? 126 PHE C C     1 
ATOM 2303  O O     . PHE B 2 126 ? -240.226 158.617 138.240 1.00 87.77  ? 126 PHE C O     1 
ATOM 2304  C CB    . PHE B 2 126 ? -238.255 159.786 139.545 1.00 87.77  ? 126 PHE C CB    1 
ATOM 2305  C CG    . PHE B 2 126 ? -237.113 160.076 140.455 1.00 87.77  ? 126 PHE C CG    1 
ATOM 2306  C CD1   . PHE B 2 126 ? -235.845 159.635 140.194 1.00 87.77  ? 126 PHE C CD1   1 
ATOM 2307  C CD2   . PHE B 2 126 ? -237.354 160.737 141.649 1.00 87.77  ? 126 PHE C CD2   1 
ATOM 2308  C CE1   . PHE B 2 126 ? -234.821 159.933 141.067 1.00 87.77  ? 126 PHE C CE1   1 
ATOM 2309  C CE2   . PHE B 2 126 ? -236.338 161.006 142.530 1.00 87.77  ? 126 PHE C CE2   1 
ATOM 2310  C CZ    . PHE B 2 126 ? -235.073 160.600 142.243 1.00 87.77  ? 126 PHE C CZ    1 
ATOM 2311  N N     . HIS B 2 127 ? -239.263 158.680 136.229 1.00 88.34  ? 127 HIS C N     1 
ATOM 2312  C CA    . HIS B 2 127 ? -240.543 158.470 135.564 1.00 88.34  ? 127 HIS C CA    1 
ATOM 2313  C C     . HIS B 2 127 ? -241.066 157.071 135.864 1.00 88.34  ? 127 HIS C C     1 
ATOM 2314  O O     . HIS B 2 127 ? -240.273 156.140 136.030 1.00 88.34  ? 127 HIS C O     1 
ATOM 2315  C CB    . HIS B 2 127 ? -240.453 158.629 134.053 1.00 88.34  ? 127 HIS C CB    1 
ATOM 2316  N N     . PRO B 2 128 ? -242.381 156.897 136.000 1.00 82.00  ? 128 PRO C N     1 
ATOM 2317  C CA    . PRO B 2 128 ? -242.904 155.544 136.226 1.00 82.00  ? 128 PRO C CA    1 
ATOM 2318  C C     . PRO B 2 128 ? -242.627 154.663 135.029 1.00 82.00  ? 128 PRO C C     1 
ATOM 2319  O O     . PRO B 2 128 ? -242.363 153.465 135.165 1.00 82.00  ? 128 PRO C O     1 
ATOM 2320  C CB    . PRO B 2 128 ? -244.400 155.770 136.437 1.00 82.00  ? 128 PRO C CB    1 
ATOM 2321  C CG    . PRO B 2 128 ? -244.673 157.055 135.769 1.00 82.00  ? 128 PRO C CG    1 
ATOM 2322  C CD    . PRO B 2 128 ? -243.459 157.895 135.985 1.00 82.00  ? 128 PRO C CD    1 
ATOM 2323  N N     . GLU B 2 129 ? -242.649 155.308 133.875 1.00 87.07  ? 129 GLU C N     1 
ATOM 2324  C CA    . GLU B 2 129 ? -242.358 154.697 132.604 1.00 87.07  ? 129 GLU C CA    1 
ATOM 2325  C C     . GLU B 2 129 ? -241.403 155.687 131.941 1.00 87.07  ? 129 GLU C C     1 
ATOM 2326  O O     . GLU B 2 129 ? -241.463 156.887 132.201 1.00 87.07  ? 129 GLU C O     1 
ATOM 2327  C CB    . GLU B 2 129 ? -243.658 154.496 131.810 1.00 87.07  ? 129 GLU C CB    1 
ATOM 2328  C CG    . GLU B 2 129 ? -243.658 154.966 130.362 1.00 87.07  ? 129 GLU C CG    1 
ATOM 2329  C CD    . GLU B 2 129 ? -244.978 155.583 129.947 1.00 87.07  ? 129 GLU C CD    1 
ATOM 2330  O OE1   . GLU B 2 129 ? -245.310 156.674 130.449 1.00 87.07  ? 129 GLU C OE1   1 
ATOM 2331  O OE2   . GLU B 2 129 ? -245.678 154.976 129.114 1.00 87.07  ? 129 GLU C OE2   1 
ATOM 2332  N N     . ARG B 2 130 ? -240.522 155.196 131.084 1.00 90.61  ? 130 ARG C N     1 
ATOM 2333  C CA    . ARG B 2 130 ? -239.586 156.079 130.410 1.00 90.61  ? 130 ARG C CA    1 
ATOM 2334  C C     . ARG B 2 130 ? -238.631 156.902 131.285 1.00 90.61  ? 130 ARG C C     1 
ATOM 2335  O O     . ARG B 2 130 ? -238.411 158.082 131.009 1.00 90.61  ? 130 ARG C O     1 
ATOM 2336  C CB    . ARG B 2 130 ? -240.362 157.004 129.477 1.00 90.61  ? 130 ARG C CB    1 
ATOM 2337  C CG    . ARG B 2 130 ? -240.879 156.323 128.220 1.00 90.61  ? 130 ARG C CG    1 
ATOM 2338  C CD    . ARG B 2 130 ? -241.329 154.897 128.494 1.00 90.61  ? 130 ARG C CD    1 
ATOM 2339  N NE    . ARG B 2 130 ? -240.858 153.953 127.487 1.00 90.61  ? 130 ARG C NE    1 
ATOM 2340  C CZ    . ARG B 2 130 ? -239.644 153.963 126.948 1.00 90.61  ? 130 ARG C CZ    1 
ATOM 2341  N NH1   . ARG B 2 130 ? -239.321 153.054 126.037 1.00 90.61  ? 130 ARG C NH1   1 
ATOM 2342  N NH2   . ARG B 2 130 ? -238.755 154.876 127.314 1.00 90.61  ? 130 ARG C NH2   1 
ATOM 2343  N N     . PRO B 2 131 ? -238.053 156.251 132.369 1.00 88.66  ? 131 PRO C N     1 
ATOM 2344  C CA    . PRO B 2 131 ? -237.104 157.077 133.137 1.00 88.66  ? 131 PRO C CA    1 
ATOM 2345  C C     . PRO B 2 131 ? -235.831 157.361 132.320 1.00 88.66  ? 131 PRO C C     1 
ATOM 2346  O O     . PRO B 2 131 ? -235.475 156.596 131.430 1.00 88.66  ? 131 PRO C O     1 
ATOM 2347  C CB    . PRO B 2 131 ? -236.783 156.227 134.368 1.00 88.66  ? 131 PRO C CB    1 
ATOM 2348  C CG    . PRO B 2 131 ? -237.939 155.311 134.517 1.00 88.66  ? 131 PRO C CG    1 
ATOM 2349  C CD    . PRO B 2 131 ? -238.171 154.915 133.100 1.00 88.66  ? 131 PRO C CD    1 
ATOM 2350  N N     . TRP B 2 132 ? -235.188 158.476 132.645 1.00 86.25  ? 132 TRP C N     1 
ATOM 2351  C CA    . TRP B 2 132 ? -233.984 158.958 131.978 1.00 86.25  ? 132 TRP C CA    1 
ATOM 2352  C C     . TRP B 2 132 ? -232.835 157.974 131.895 1.00 86.25  ? 132 TRP C C     1 
ATOM 2353  O O     . TRP B 2 132 ? -232.190 157.683 132.894 1.00 86.25  ? 132 TRP C O     1 
ATOM 2354  C CB    . TRP B 2 132 ? -233.496 160.220 132.690 1.00 86.25  ? 132 TRP C CB    1 
ATOM 2355  C CG    . TRP B 2 132 ? -232.476 161.015 131.933 1.00 86.25  ? 132 TRP C CG    1 
ATOM 2356  C CD1   . TRP B 2 132 ? -231.436 161.719 132.461 1.00 86.25  ? 132 TRP C CD1   1 
ATOM 2357  C CD2   . TRP B 2 132 ? -232.408 161.203 130.517 1.00 86.25  ? 132 TRP C CD2   1 
ATOM 2358  N NE1   . TRP B 2 132 ? -230.720 162.328 131.463 1.00 86.25  ? 132 TRP C NE1   1 
ATOM 2359  C CE2   . TRP B 2 132 ? -231.297 162.026 130.259 1.00 86.25  ? 132 TRP C CE2   1 
ATOM 2360  C CE3   . TRP B 2 132 ? -233.175 160.754 129.442 1.00 86.25  ? 132 TRP C CE3   1 
ATOM 2361  C CZ2   . TRP B 2 132 ? -230.936 162.405 128.975 1.00 86.25  ? 132 TRP C CZ2   1 
ATOM 2362  C CZ3   . TRP B 2 132 ? -232.814 161.131 128.167 1.00 86.25  ? 132 TRP C CZ3   1 
ATOM 2363  C CH2   . TRP B 2 132 ? -231.705 161.948 127.943 1.00 86.25  ? 132 TRP C CH2   1 
ATOM 2364  N N     . LEU B 2 133 ? -232.568 157.472 130.697 1.00 82.33  ? 133 LEU C N     1 
ATOM 2365  C CA    . LEU B 2 133 ? -231.449 156.562 130.496 1.00 82.33  ? 133 LEU C CA    1 
ATOM 2366  C C     . LEU B 2 133 ? -231.626 155.323 131.360 1.00 82.33  ? 133 LEU C C     1 
ATOM 2367  O O     . LEU B 2 133 ? -230.663 154.778 131.895 1.00 82.33  ? 133 LEU C O     1 
ATOM 2368  C CB    . LEU B 2 133 ? -230.115 157.250 130.761 1.00 82.33  ? 133 LEU C CB    1 
ATOM 2369  C CG    . LEU B 2 133 ? -229.463 157.881 129.538 1.00 82.33  ? 133 LEU C CG    1 
ATOM 2370  C CD1   . LEU B 2 133 ? -230.434 158.809 128.919 1.00 82.33  ? 133 LEU C CD1   1 
ATOM 2371  C CD2   . LEU B 2 133 ? -228.228 158.642 129.957 1.00 82.33  ? 133 LEU C CD2   1 
ATOM 2372  N N     . GLN B 2 134 ? -232.862 154.873 131.510 1.00 82.89  ? 134 GLN C N     1 
ATOM 2373  C CA    . GLN B 2 134 ? -233.138 153.742 132.374 1.00 82.89  ? 134 GLN C CA    1 
ATOM 2374  C C     . GLN B 2 134 ? -234.179 152.837 131.758 1.00 82.89  ? 134 GLN C C     1 
ATOM 2375  O O     . GLN B 2 134 ? -234.799 153.163 130.745 1.00 82.89  ? 134 GLN C O     1 
ATOM 2376  C CB    . GLN B 2 134 ? -233.681 154.241 133.699 1.00 82.89  ? 134 GLN C CB    1 
ATOM 2377  C CG    . GLN B 2 134 ? -232.704 155.023 134.467 1.00 82.89  ? 134 GLN C CG    1 
ATOM 2378  C CD    . GLN B 2 134 ? -233.288 155.507 135.729 1.00 82.89  ? 134 GLN C CD    1 
ATOM 2379  O OE1   . GLN B 2 134 ? -234.371 155.100 136.108 1.00 82.89  ? 134 GLN C OE1   1 
ATOM 2380  N NE2   . GLN B 2 134 ? -232.627 156.456 136.352 1.00 82.89  ? 134 GLN C NE2   1 
ATOM 2381  N N     . ASP B 2 135 ? -234.356 151.679 132.388 1.00 83.54  ? 135 ASP C N     1 
ATOM 2382  C CA    . ASP B 2 135 ? -235.390 150.737 132.000 1.00 83.54  ? 135 ASP C CA    1 
ATOM 2383  C C     . ASP B 2 135 ? -236.339 150.617 133.181 1.00 83.54  ? 135 ASP C C     1 
ATOM 2384  O O     . ASP B 2 135 ? -235.925 150.172 134.261 1.00 83.54  ? 135 ASP C O     1 
ATOM 2385  C CB    . ASP B 2 135 ? -234.806 149.379 131.644 1.00 83.54  ? 135 ASP C CB    1 
ATOM 2386  C CG    . ASP B 2 135 ? -234.019 149.414 130.362 1.00 83.54  ? 135 ASP C CG    1 
ATOM 2387  O OD1   . ASP B 2 135 ? -234.147 150.406 129.622 1.00 83.54  ? 135 ASP C OD1   1 
ATOM 2388  O OD2   . ASP B 2 135 ? -233.273 148.452 130.093 1.00 83.54  ? 135 ASP C OD2   1 
ATOM 2389  N N     . PRO B 2 136 ? -237.593 151.040 133.032 1.00 86.62  ? 136 PRO C N     1 
ATOM 2390  C CA    . PRO B 2 136 ? -238.534 151.021 134.162 1.00 86.62  ? 136 PRO C CA    1 
ATOM 2391  C C     . PRO B 2 136 ? -239.061 149.641 134.529 1.00 86.62  ? 136 PRO C C     1 
ATOM 2392  O O     . PRO B 2 136 ? -239.343 149.402 135.708 1.00 86.62  ? 136 PRO C O     1 
ATOM 2393  C CB    . PRO B 2 136 ? -239.663 151.937 133.675 1.00 86.62  ? 136 PRO C CB    1 
ATOM 2394  C CG    . PRO B 2 136 ? -239.615 151.802 132.187 1.00 86.62  ? 136 PRO C CG    1 
ATOM 2395  C CD    . PRO B 2 136 ? -238.179 151.622 131.822 1.00 86.62  ? 136 PRO C CD    1 
ATOM 2396  N N     . ARG B 2 137 ? -239.163 148.760 133.550 1.00 89.45  ? 137 ARG C N     1 
ATOM 2397  C CA    . ARG B 2 137 ? -239.638 147.409 133.770 1.00 89.45  ? 137 ARG C CA    1 
ATOM 2398  C C     . ARG B 2 137 ? -238.704 146.638 134.680 1.00 89.45  ? 137 ARG C C     1 
ATOM 2399  O O     . ARG B 2 137 ? -239.113 145.732 135.399 1.00 89.45  ? 137 ARG C O     1 
ATOM 2400  C CB    . ARG B 2 137 ? -239.752 146.676 132.434 1.00 89.45  ? 137 ARG C CB    1 
ATOM 2401  C CG    . ARG B 2 137 ? -238.416 146.274 131.837 1.00 89.45  ? 137 ARG C CG    1 
ATOM 2402  C CD    . ARG B 2 137 ? -238.230 146.888 130.466 1.00 89.45  ? 137 ARG C CD    1 
ATOM 2403  N NE    . ARG B 2 137 ? -237.498 146.004 129.570 1.00 89.45  ? 137 ARG C NE    1 
ATOM 2404  C CZ    . ARG B 2 137 ? -237.426 146.173 128.254 1.00 89.45  ? 137 ARG C CZ    1 
ATOM 2405  N NH1   . ARG B 2 137 ? -236.737 145.321 127.511 1.00 89.45  ? 137 ARG C NH1   1 
ATOM 2406  N NH2   . ARG B 2 137 ? -238.046 147.194 127.687 1.00 89.45  ? 137 ARG C NH2   1 
ATOM 2407  N N     . LEU B 2 138 ? -237.430 146.983 134.606 1.00 84.42  ? 138 LEU C N     1 
ATOM 2408  C CA    . LEU B 2 138 ? -236.390 146.269 135.330 1.00 84.42  ? 138 LEU C CA    1 
ATOM 2409  C C     . LEU B 2 138 ? -236.707 145.986 136.785 1.00 84.42  ? 138 LEU C C     1 
ATOM 2410  O O     . LEU B 2 138 ? -236.306 144.953 137.304 1.00 84.42  ? 138 LEU C O     1 
ATOM 2411  C CB    . LEU B 2 138 ? -235.069 147.039 135.233 1.00 84.42  ? 138 LEU C CB    1 
ATOM 2412  C CG    . LEU B 2 138 ? -233.763 146.262 135.355 1.00 84.42  ? 138 LEU C CG    1 
ATOM 2413  C CD1   . LEU B 2 138 ? -233.237 146.345 136.776 1.00 84.42  ? 138 LEU C CD1   1 
ATOM 2414  C CD2   . LEU B 2 138 ? -233.965 144.815 134.944 1.00 84.42  ? 138 LEU C CD2   1 
ATOM 2415  N N     . ARG B 2 139 ? -237.416 146.891 137.445 1.00 84.55  ? 139 ARG C N     1 
ATOM 2416  C CA    . ARG B 2 139 ? -237.722 146.720 138.860 1.00 84.55  ? 139 ARG C CA    1 
ATOM 2417  C C     . ARG B 2 139 ? -238.494 145.448 139.174 1.00 84.55  ? 139 ARG C C     1 
ATOM 2418  O O     . ARG B 2 139 ? -238.194 144.769 140.152 1.00 84.55  ? 139 ARG C O     1 
ATOM 2419  C CB    . ARG B 2 139 ? -238.541 147.923 139.341 1.00 84.55  ? 139 ARG C CB    1 
ATOM 2420  C CG    . ARG B 2 139 ? -239.251 147.746 140.678 1.00 84.55  ? 139 ARG C CG    1 
ATOM 2421  C CD    . ARG B 2 139 ? -240.435 148.689 140.802 1.00 84.55  ? 139 ARG C CD    1 
ATOM 2422  N NE    . ARG B 2 139 ? -240.014 150.065 141.048 1.00 84.55  ? 139 ARG C NE    1 
ATOM 2423  C CZ    . ARG B 2 139 ? -240.089 151.043 140.149 1.00 84.55  ? 139 ARG C CZ    1 
ATOM 2424  N NH1   . ARG B 2 139 ? -240.570 150.800 138.938 1.00 84.55  ? 139 ARG C NH1   1 
ATOM 2425  N NH2   . ARG B 2 139 ? -239.680 152.265 140.462 1.00 84.55  ? 139 ARG C NH2   1 
ATOM 2426  N N     . GLU B 2 140 ? -239.487 145.124 138.360 1.00 91.27  ? 140 GLU C N     1 
ATOM 2427  C CA    . GLU B 2 140 ? -240.294 143.930 138.601 1.00 91.27  ? 140 GLU C CA    1 
ATOM 2428  C C     . GLU B 2 140 ? -239.590 142.578 138.517 1.00 91.27  ? 140 GLU C C     1 
ATOM 2429  O O     . GLU B 2 140 ? -239.839 141.709 139.347 1.00 91.27  ? 140 GLU C O     1 
ATOM 2430  C CB    . GLU B 2 140 ? -241.527 143.911 137.694 1.00 91.27  ? 140 GLU C CB    1 
ATOM 2431  C CG    . GLU B 2 140 ? -241.414 144.784 136.461 1.00 91.27  ? 140 GLU C CG    1 
ATOM 2432  C CD    . GLU B 2 140 ? -241.651 146.244 136.772 1.00 91.27  ? 140 GLU C CD    1 
ATOM 2433  O OE1   . GLU B 2 140 ? -240.816 146.840 137.487 1.00 91.27  ? 140 GLU C OE1   1 
ATOM 2434  O OE2   . GLU B 2 140 ? -242.673 146.789 136.306 1.00 91.27  ? 140 GLU C OE2   1 
ATOM 2435  N N     . GLU B 2 141 ? -238.726 142.384 137.528 1.00 91.29  ? 141 GLU C N     1 
ATOM 2436  C CA    . GLU B 2 141 ? -238.072 141.081 137.379 1.00 91.29  ? 141 GLU C CA    1 
ATOM 2437  C C     . GLU B 2 141 ? -236.743 140.796 138.087 1.00 91.29  ? 141 GLU C C     1 
ATOM 2438  O O     . GLU B 2 141 ? -236.249 139.672 138.007 1.00 91.29  ? 141 GLU C O     1 
ATOM 2439  C CB    . GLU B 2 141 ? -237.981 140.672 135.908 1.00 91.29  ? 141 GLU C CB    1 
ATOM 2440  C CG    . GLU B 2 141 ? -236.774 141.225 135.197 1.00 91.29  ? 141 GLU C CG    1 
ATOM 2441  C CD    . GLU B 2 141 ? -237.073 142.564 134.578 1.00 91.29  ? 141 GLU C CD    1 
ATOM 2442  O OE1   . GLU B 2 141 ? -237.618 143.428 135.294 1.00 91.29  ? 141 GLU C OE1   1 
ATOM 2443  O OE2   . GLU B 2 141 ? -236.777 142.738 133.378 1.00 91.29  ? 141 GLU C OE2   1 
ATOM 2444  N N     . CYS B 2 142 ? -236.147 141.761 138.770 1.00 89.25  ? 142 CYS C N     1 
ATOM 2445  C CA    . CYS B 2 142 ? -234.881 141.472 139.445 1.00 89.25  ? 142 CYS C CA    1 
ATOM 2446  C C     . CYS B 2 142 ? -235.114 141.303 140.939 1.00 89.25  ? 142 CYS C C     1 
ATOM 2447  O O     . CYS B 2 142 ? -235.536 142.253 141.598 1.00 89.25  ? 142 CYS C O     1 
ATOM 2448  C CB    . CYS B 2 142 ? -233.868 142.589 139.190 1.00 89.25  ? 142 CYS C CB    1 
ATOM 2449  S SG    . CYS B 2 142 ? -232.978 142.446 137.622 1.00 89.25  ? 142 CYS C SG    1 
ATOM 2450  N N     . PRO B 2 143 ? -234.852 140.119 141.499 1.00 82.92  ? 143 PRO C N     1 
ATOM 2451  C CA    . PRO B 2 143 ? -235.102 140.008 142.949 1.00 82.92  ? 143 PRO C CA    1 
ATOM 2452  C C     . PRO B 2 143 ? -234.229 140.827 143.903 1.00 82.92  ? 143 PRO C C     1 
ATOM 2453  O O     . PRO B 2 143 ? -234.759 141.405 144.846 1.00 82.92  ? 143 PRO C O     1 
ATOM 2454  C CB    . PRO B 2 143 ? -234.907 138.514 143.232 1.00 82.92  ? 143 PRO C CB    1 
ATOM 2455  C CG    . PRO B 2 143 ? -233.911 138.074 142.241 1.00 82.92  ? 143 PRO C CG    1 
ATOM 2456  C CD    . PRO B 2 143 ? -234.372 138.754 140.997 1.00 82.92  ? 143 PRO C CD    1 
ATOM 2457  N N     . LYS B 2 144 ? -232.923 140.877 143.666 1.00 81.47  ? 144 LYS C N     1 
ATOM 2458  C CA    . LYS B 2 144 ? -232.006 141.593 144.533 1.00 81.47  ? 144 LYS C CA    1 
ATOM 2459  C C     . LYS B 2 144 ? -231.680 142.946 143.916 1.00 81.47  ? 144 LYS C C     1 
ATOM 2460  O O     . LYS B 2 144 ? -231.280 143.019 142.749 1.00 81.47  ? 144 LYS C O     1 
ATOM 2461  C CB    . LYS B 2 144 ? -230.734 140.785 144.795 1.00 81.47  ? 144 LYS C CB    1 
ATOM 2462  C CG    . LYS B 2 144 ? -230.990 139.482 145.526 1.00 81.47  ? 144 LYS C CG    1 
ATOM 2463  C CD    . LYS B 2 144 ? -229.706 138.748 145.814 1.00 81.47  ? 144 LYS C CD    1 
ATOM 2464  C CE    . LYS B 2 144 ? -229.984 137.446 146.531 1.00 81.47  ? 144 LYS C CE    1 
ATOM 2465  N NZ    . LYS B 2 144 ? -230.831 136.545 145.702 1.00 81.47  ? 144 LYS C NZ    1 
ATOM 2466  N N     . THR B 2 145 ? -231.852 144.011 144.688 1.00 75.10  ? 145 THR C N     1 
ATOM 2467  C CA    . THR B 2 145 ? -231.401 145.308 144.221 1.00 75.10  ? 145 THR C CA    1 
ATOM 2468  C C     . THR B 2 145 ? -229.887 145.341 144.329 1.00 75.10  ? 145 THR C C     1 
ATOM 2469  O O     . THR B 2 145 ? -229.314 144.911 145.333 1.00 75.10  ? 145 THR C O     1 
ATOM 2470  C CB    . THR B 2 145 ? -232.006 146.436 145.052 1.00 75.10  ? 145 THR C CB    1 
ATOM 2471  O OG1   . THR B 2 145 ? -231.483 146.374 146.381 1.00 75.10  ? 145 THR C OG1   1 
ATOM 2472  C CG2   . THR B 2 145 ? -233.506 146.314 145.119 1.00 75.10  ? 145 THR C CG2   1 
ATOM 2473  N N     . SER B 2 146 ? -229.236 145.877 143.301 1.00 71.45  ? 146 SER C N     1 
ATOM 2474  C CA    . SER B 2 146 ? -227.794 146.042 143.377 1.00 71.45  ? 146 SER C CA    1 
ATOM 2475  C C     . SER B 2 146 ? -227.425 146.949 144.537 1.00 71.45  ? 146 SER C C     1 
ATOM 2476  O O     . SER B 2 146 ? -226.395 146.748 145.188 1.00 71.45  ? 146 SER C O     1 
ATOM 2477  C CB    . SER B 2 146 ? -227.261 146.595 142.062 1.00 71.45  ? 146 SER C CB    1 
ATOM 2478  O OG    . SER B 2 146 ? -227.795 145.869 140.970 1.00 71.45  ? 146 SER C OG    1 
ATOM 2479  N N     . GLY B 2 147 ? -228.250 147.947 144.810 1.00 69.15  ? 147 GLY C N     1 
ATOM 2480  C CA    . GLY B 2 147 ? -227.941 148.899 145.849 1.00 69.15  ? 147 GLY C CA    1 
ATOM 2481  C C     . GLY B 2 147 ? -227.210 150.108 145.299 1.00 69.15  ? 147 GLY C C     1 
ATOM 2482  O O     . GLY B 2 147 ? -226.550 150.056 144.267 1.00 69.15  ? 147 GLY C O     1 
ATOM 2483  N N     . VAL B 2 148 ? -227.309 151.212 146.030 1.00 70.14  ? 148 VAL C N     1 
ATOM 2484  C CA    . VAL B 2 148 ? -226.588 152.415 145.634 1.00 70.14  ? 148 VAL C CA    1 
ATOM 2485  C C     . VAL B 2 148 ? -225.089 152.166 145.662 1.00 70.14  ? 148 VAL C C     1 
ATOM 2486  O O     . VAL B 2 148 ? -224.351 152.629 144.784 1.00 70.14  ? 148 VAL C O     1 
ATOM 2487  C CB    . VAL B 2 148 ? -226.969 153.585 146.550 1.00 70.14  ? 148 VAL C CB    1 
ATOM 2488  C CG1   . VAL B 2 148 ? -228.403 153.969 146.361 1.00 70.14  ? 148 VAL C CG1   1 
ATOM 2489  C CG2   . VAL B 2 148 ? -226.732 153.203 147.985 1.00 70.14  ? 148 VAL C CG2   1 
ATOM 2490  N N     . ASN B 2 149 ? -224.622 151.400 146.644 1.00 68.33  ? 149 ASN C N     1 
ATOM 2491  C CA    . ASN B 2 149 ? -223.193 151.185 146.766 1.00 68.33  ? 149 ASN C CA    1 
ATOM 2492  C C     . ASN B 2 149 ? -222.629 150.439 145.569 1.00 68.33  ? 149 ASN C C     1 
ATOM 2493  O O     . ASN B 2 149 ? -221.471 150.655 145.199 1.00 68.33  ? 149 ASN C O     1 
ATOM 2494  C CB    . ASN B 2 149 ? -222.900 150.433 148.061 1.00 68.33  ? 149 ASN C CB    1 
ATOM 2495  C CG    . ASN B 2 149 ? -223.285 151.230 149.289 1.00 68.33  ? 149 ASN C CG    1 
ATOM 2496  O OD1   . ASN B 2 149 ? -223.425 152.443 149.225 1.00 68.33  ? 149 ASN C OD1   1 
ATOM 2497  N ND2   . ASN B 2 149 ? -223.473 150.545 150.409 1.00 68.33  ? 149 ASN C ND2   1 
ATOM 2498  N N     . LYS B 2 150 ? -223.410 149.567 144.946 1.00 67.10  ? 150 LYS C N     1 
ATOM 2499  C CA    . LYS B 2 150 ? -222.929 148.917 143.735 1.00 67.10  ? 150 LYS C CA    1 
ATOM 2500  C C     . LYS B 2 150 ? -222.979 149.828 142.529 1.00 67.10  ? 150 LYS C C     1 
ATOM 2501  O O     . LYS B 2 150 ? -222.234 149.608 141.569 1.00 67.10  ? 150 LYS C O     1 
ATOM 2502  C CB    . LYS B 2 150 ? -223.740 147.652 143.455 1.00 67.10  ? 150 LYS C CB    1 
ATOM 2503  C CG    . LYS B 2 150 ? -223.316 146.848 142.234 1.00 67.10  ? 150 LYS C CG    1 
ATOM 2504  C CD    . LYS B 2 150 ? -221.918 146.308 142.346 1.00 67.10  ? 150 LYS C CD    1 
ATOM 2505  C CE    . LYS B 2 150 ? -221.589 145.445 141.144 1.00 67.10  ? 150 LYS C CE    1 
ATOM 2506  N NZ    . LYS B 2 150 ? -221.650 146.195 139.864 1.00 67.10  ? 150 LYS C NZ    1 
ATOM 2507  N N     . LEU B 2 151 ? -223.834 150.843 142.554 1.00 65.34  ? 151 LEU C N     1 
ATOM 2508  C CA    . LEU B 2 151 ? -223.903 151.772 141.437 1.00 65.34  ? 151 LEU C CA    1 
ATOM 2509  C C     . LEU B 2 151 ? -222.833 152.850 141.524 1.00 65.34  ? 151 LEU C C     1 
ATOM 2510  O O     . LEU B 2 151 ? -222.061 153.051 140.582 1.00 65.34  ? 151 LEU C O     1 
ATOM 2511  C CB    . LEU B 2 151 ? -225.292 152.395 141.378 1.00 65.34  ? 151 LEU C CB    1 
ATOM 2512  C CG    . LEU B 2 151 ? -225.416 153.601 140.458 1.00 65.34  ? 151 LEU C CG    1 
ATOM 2513  C CD1   . LEU B 2 151 ? -225.510 153.170 139.016 1.00 65.34  ? 151 LEU C CD1   1 
ATOM 2514  C CD2   . LEU B 2 151 ? -226.631 154.402 140.849 1.00 65.34  ? 151 LEU C CD2   1 
ATOM 2515  N N     . ALA B 2 152 ? -222.755 153.528 142.663 1.00 66.64  ? 152 ALA C N     1 
ATOM 2516  C CA    . ALA B 2 152 ? -221.903 154.699 142.807 1.00 66.64  ? 152 ALA C CA    1 
ATOM 2517  C C     . ALA B 2 152 ? -220.424 154.347 142.828 1.00 66.64  ? 152 ALA C C     1 
ATOM 2518  O O     . ALA B 2 152 ? -220.008 153.358 143.433 1.00 66.64  ? 152 ALA C O     1 
ATOM 2519  C CB    . ALA B 2 152 ? -222.270 155.451 144.079 1.00 66.64  ? 152 ALA C CB    1 
ATOM 2520  N N     . TRP B 2 153 ? -219.630 155.180 142.169 1.00 61.42  ? 153 TRP C N     1 
ATOM 2521  C CA    . TRP B 2 153 ? -218.184 155.030 142.165 1.00 61.42  ? 153 TRP C CA    1 
ATOM 2522  C C     . TRP B 2 153 ? -217.551 155.635 143.410 1.00 61.42  ? 153 TRP C C     1 
ATOM 2523  O O     . TRP B 2 153 ? -218.107 156.527 144.051 1.00 61.42  ? 153 TRP C O     1 
ATOM 2524  C CB    . TRP B 2 153 ? -217.564 155.635 140.914 1.00 61.42  ? 153 TRP C CB    1 
ATOM 2525  C CG    . TRP B 2 153 ? -218.029 154.947 139.723 1.00 61.42  ? 153 TRP C CG    1 
ATOM 2526  C CD1   . TRP B 2 153 ? -219.124 155.232 138.991 1.00 61.42  ? 153 TRP C CD1   1 
ATOM 2527  C CD2   . TRP B 2 153 ? -217.527 153.717 139.230 1.00 61.42  ? 153 TRP C CD2   1 
ATOM 2528  N NE1   . TRP B 2 153 ? -219.271 154.319 137.988 1.00 61.42  ? 153 TRP C NE1   1 
ATOM 2529  C CE2   . TRP B 2 153 ? -218.306 153.362 138.127 1.00 61.42  ? 153 TRP C CE2   1 
ATOM 2530  C CE3   . TRP B 2 153 ? -216.464 152.899 139.593 1.00 61.42  ? 153 TRP C CE3   1 
ATOM 2531  C CZ2   . TRP B 2 153 ? -218.060 152.231 137.382 1.00 61.42  ? 153 TRP C CZ2   1 
ATOM 2532  C CZ3   . TRP B 2 153 ? -216.226 151.779 138.860 1.00 61.42  ? 153 TRP C CZ3   1 
ATOM 2533  C CH2   . TRP B 2 153 ? -217.013 151.453 137.763 1.00 61.42  ? 153 TRP C CH2   1 
ATOM 2534  N N     . GLY B 2 154 ? -216.373 155.123 143.753 1.00 63.95  ? 154 GLY C N     1 
ATOM 2535  C CA    . GLY B 2 154 ? -215.754 155.388 145.031 1.00 63.95  ? 154 GLY C CA    1 
ATOM 2536  C C     . GLY B 2 154 ? -216.498 154.792 146.194 1.00 63.95  ? 154 GLY C C     1 
ATOM 2537  O O     . GLY B 2 154 ? -216.121 155.024 147.347 1.00 63.95  ? 154 GLY C O     1 
ATOM 2538  N N     . ARG B 2 155 ? -217.543 154.029 145.888 1.00 68.73  ? 155 ARG C N     1 
ATOM 2539  C CA    . ARG B 2 155 ? -218.361 153.375 146.898 1.00 68.73  ? 155 ARG C CA    1 
ATOM 2540  C C     . ARG B 2 155 ? -218.147 151.865 146.856 1.00 68.73  ? 155 ARG C C     1 
ATOM 2541  O O     . ARG B 2 155 ? -218.143 151.254 145.788 1.00 68.73  ? 155 ARG C O     1 
ATOM 2542  C CB    . ARG B 2 155 ? -219.840 153.704 146.689 1.00 68.73  ? 155 ARG C CB    1 
ATOM 2543  C CG    . ARG B 2 155 ? -220.126 155.186 146.507 1.00 68.73  ? 155 ARG C CG    1 
ATOM 2544  C CD    . ARG B 2 155 ? -220.352 155.872 147.844 1.00 68.73  ? 155 ARG C CD    1 
ATOM 2545  N NE    . ARG B 2 155 ? -221.395 156.890 147.767 1.00 68.73  ? 155 ARG C NE    1 
ATOM 2546  C CZ    . ARG B 2 155 ? -222.269 157.140 148.737 1.00 68.73  ? 155 ARG C CZ    1 
ATOM 2547  N NH1   . ARG B 2 155 ? -222.226 156.444 149.865 1.00 68.73  ? 155 ARG C NH1   1 
ATOM 2548  N NH2   . ARG B 2 155 ? -223.185 158.086 148.580 1.00 68.73  ? 155 ARG C NH2   1 
ATOM 2549  N N     . THR B 2 156 ? -217.967 151.277 148.032 1.00 67.01  ? 156 THR C N     1 
ATOM 2550  C CA    . THR B 2 156 ? -217.743 149.846 148.172 1.00 67.01  ? 156 THR C CA    1 
ATOM 2551  C C     . THR B 2 156 ? -218.946 148.963 147.857 1.00 67.01  ? 156 THR C C     1 
ATOM 2552  O O     . THR B 2 156 ? -220.048 149.186 148.344 1.00 67.01  ? 156 THR C O     1 
ATOM 2553  C CB    . THR B 2 156 ? -217.287 149.528 149.598 1.00 67.01  ? 156 THR C CB    1 
ATOM 2554  O OG1   . THR B 2 156 ? -218.202 150.126 150.518 1.00 67.01  ? 156 THR C OG1   1 
ATOM 2555  C CG2   . THR B 2 156 ? -215.910 150.093 149.848 1.00 67.01  ? 156 THR C CG2   1 
ATOM 2556  N N     . ALA B 2 157 ? -218.691 147.931 147.059 1.00 71.26  ? 157 ALA C N     1 
ATOM 2557  C CA    . ALA B 2 157 ? -219.691 146.959 146.625 1.00 71.26  ? 157 ALA C CA    1 
ATOM 2558  C C     . ALA B 2 157 ? -219.855 145.836 147.635 1.00 71.26  ? 157 ALA C C     1 
ATOM 2559  O O     . ALA B 2 157 ? -219.337 145.910 148.744 1.00 71.26  ? 157 ALA C O     1 
ATOM 2560  C CB    . ALA B 2 157 ? -219.325 146.397 145.263 1.00 71.26  ? 157 ALA C CB    1 
ATOM 2561  N N     . GLY B 2 158 ? -220.600 144.806 147.264 1.00 73.84  ? 158 GLY C N     1 
ATOM 2562  C CA    . GLY B 2 158 ? -220.807 143.698 148.169 1.00 73.84  ? 158 GLY C CA    1 
ATOM 2563  C C     . GLY B 2 158 ? -219.550 142.941 148.550 1.00 73.84  ? 158 GLY C C     1 
ATOM 2564  O O     . GLY B 2 158 ? -219.357 142.623 149.717 1.00 73.84  ? 158 GLY C O     1 
ATOM 2565  N N     . GLU B 2 159 ? -218.689 142.650 147.582 1.00 76.54  ? 159 GLU C N     1 
ATOM 2566  C CA    . GLU B 2 159 ? -217.455 141.924 147.879 1.00 76.54  ? 159 GLU C CA    1 
ATOM 2567  C C     . GLU B 2 159 ? -216.270 142.829 148.198 1.00 76.54  ? 159 GLU C C     1 
ATOM 2568  O O     . GLU B 2 159 ? -215.262 142.375 148.728 1.00 76.54  ? 159 GLU C O     1 
ATOM 2569  C CB    . GLU B 2 159 ? -217.092 140.986 146.736 1.00 76.54  ? 159 GLU C CB    1 
ATOM 2570  C CG    . GLU B 2 159 ? -216.082 139.923 147.120 1.00 76.54  ? 159 GLU C CG    1 
ATOM 2571  C CD    . GLU B 2 159 ? -216.581 139.028 148.231 1.00 76.54  ? 159 GLU C CD    1 
ATOM 2572  O OE1   . GLU B 2 159 ? -217.535 139.430 148.921 1.00 76.54  ? 159 GLU C OE1   1 
ATOM 2573  O OE2   . GLU B 2 159 ? -216.022 137.926 148.415 1.00 76.54  ? 159 GLU C OE2   1 
ATOM 2574  N N     . ASN B 2 160 ? -216.397 144.110 147.882 1.00 69.31  ? 160 ASN C N     1 
ATOM 2575  C CA    . ASN B 2 160 ? -215.337 145.065 148.136 1.00 69.31  ? 160 ASN C CA    1 
ATOM 2576  C C     . ASN B 2 160 ? -215.116 145.249 149.619 1.00 69.31  ? 160 ASN C C     1 
ATOM 2577  O O     . ASN B 2 160 ? -216.054 145.203 150.396 1.00 69.31  ? 160 ASN C O     1 
ATOM 2578  C CB    . ASN B 2 160 ? -215.662 146.405 147.488 1.00 69.31  ? 160 ASN C CB    1 
ATOM 2579  C CG    . ASN B 2 160 ? -216.104 146.258 146.051 1.00 69.31  ? 160 ASN C CG    1 
ATOM 2580  O OD1   . ASN B 2 160 ? -216.739 147.147 145.493 1.00 69.31  ? 160 ASN C OD1   1 
ATOM 2581  N ND2   . ASN B 2 160 ? -215.771 145.129 145.444 1.00 69.31  ? 160 ASN C ND2   1 
ATOM 2582  N N     . GLN B 2 161 ? -213.861 145.444 150.002 1.00 65.06  ? 161 GLN C N     1 
ATOM 2583  C CA    . GLN B 2 161 ? -213.479 145.651 151.396 1.00 65.06  ? 161 GLN C CA    1 
ATOM 2584  C C     . GLN B 2 161 ? -213.866 147.057 151.852 1.00 65.06  ? 161 GLN C C     1 
ATOM 2585  O O     . GLN B 2 161 ? -214.177 147.915 151.038 1.00 65.06  ? 161 GLN C O     1 
ATOM 2586  C CB    . GLN B 2 161 ? -212.004 145.350 151.608 1.00 65.06  ? 161 GLN C CB    1 
ATOM 2587  C CG    . GLN B 2 161 ? -211.514 144.212 150.737 1.00 65.06  ? 161 GLN C CG    1 
ATOM 2588  C CD    . GLN B 2 161 ? -210.799 143.134 151.512 1.00 65.06  ? 161 GLN C CD    1 
ATOM 2589  O OE1   . GLN B 2 161 ? -209.914 142.474 150.988 1.00 65.06  ? 161 GLN C OE1   1 
ATOM 2590  N NE2   . GLN B 2 161 ? -211.177 142.949 152.763 1.00 65.06  ? 161 GLN C NE2   1 
ATOM 2591  N N     . VAL B 2 162 ? -213.873 147.276 153.159 1.00 66.54  ? 162 VAL C N     1 
ATOM 2592  C CA    . VAL B 2 162 ? -214.326 148.534 153.755 1.00 66.54  ? 162 VAL C CA    1 
ATOM 2593  C C     . VAL B 2 162 ? -213.280 149.625 153.979 1.00 66.54  ? 162 VAL C C     1 
ATOM 2594  O O     . VAL B 2 162 ? -213.537 150.616 154.655 1.00 66.54  ? 162 VAL C O     1 
ATOM 2595  C CB    . VAL B 2 162 ? -215.040 148.249 155.087 1.00 66.54  ? 162 VAL C CB    1 
ATOM 2596  C CG1   . VAL B 2 162 ? -215.805 149.463 155.563 1.00 66.54  ? 162 VAL C CG1   1 
ATOM 2597  C CG2   . VAL B 2 162 ? -215.999 147.093 154.919 1.00 66.54  ? 162 VAL C CG2   1 
ATOM 2598  N N     . TRP B 2 163 ? -212.093 149.444 153.432 1.00 66.70  ? 163 TRP C N     1 
ATOM 2599  C CA    . TRP B 2 163 ? -211.024 150.410 153.647 1.00 66.70  ? 163 TRP C CA    1 
ATOM 2600  C C     . TRP B 2 163 ? -211.113 151.872 153.200 1.00 66.70  ? 163 TRP C C     1 
ATOM 2601  O O     . TRP B 2 163 ? -210.682 152.748 153.947 1.00 66.70  ? 163 TRP C O     1 
ATOM 2602  C CB    . TRP B 2 163 ? -209.718 149.849 153.099 1.00 66.70  ? 163 TRP C CB    1 
ATOM 2603  C CG    . TRP B 2 163 ? -208.651 149.931 154.093 1.00 66.70  ? 163 TRP C CG    1 
ATOM 2604  C CD1   . TRP B 2 163 ? -207.408 150.435 153.920 1.00 66.70  ? 163 TRP C CD1   1 
ATOM 2605  C CD2   . TRP B 2 163 ? -208.734 149.505 155.447 1.00 66.70  ? 163 TRP C CD2   1 
ATOM 2606  N NE1   . TRP B 2 163 ? -206.700 150.341 155.087 1.00 66.70  ? 163 TRP C NE1   1 
ATOM 2607  C CE2   . TRP B 2 163 ? -207.498 149.771 156.041 1.00 66.70  ? 163 TRP C CE2   1 
ATOM 2608  C CE3   . TRP B 2 163 ? -209.734 148.914 156.212 1.00 66.70  ? 163 TRP C CE3   1 
ATOM 2609  C CZ2   . TRP B 2 163 ? -207.235 149.469 157.364 1.00 66.70  ? 163 TRP C CZ2   1 
ATOM 2610  C CZ3   . TRP B 2 163 ? -209.473 148.622 157.517 1.00 66.70  ? 163 TRP C CZ3   1 
ATOM 2611  C CH2   . TRP B 2 163 ? -208.234 148.897 158.083 1.00 66.70  ? 163 TRP C CH2   1 
ATOM 2612  N N     . LEU B 2 164 ? -211.638 152.157 152.015 1.00 65.50  ? 164 LEU C N     1 
ATOM 2613  C CA    . LEU B 2 164 ? -211.623 153.542 151.529 1.00 65.50  ? 164 LEU C CA    1 
ATOM 2614  C C     . LEU B 2 164 ? -212.911 154.302 151.222 1.00 65.50  ? 164 LEU C C     1 
ATOM 2615  O O     . LEU B 2 164 ? -213.978 153.728 151.064 1.00 65.50  ? 164 LEU C O     1 
ATOM 2616  C CB    . LEU B 2 164 ? -210.676 153.650 150.328 1.00 65.50  ? 164 LEU C CB    1 
ATOM 2617  C CG    . LEU B 2 164 ? -209.739 152.466 150.084 1.00 65.50  ? 164 LEU C CG    1 
ATOM 2618  C CD1   . LEU B 2 164 ? -209.896 151.945 148.670 1.00 65.50  ? 164 LEU C CD1   1 
ATOM 2619  C CD2   . LEU B 2 164 ? -208.291 152.832 150.350 1.00 65.50  ? 164 LEU C CD2   1 
ATOM 2620  N N     . GLY B 2 165 ? -212.762 155.623 151.149 1.00 70.88  ? 165 GLY C N     1 
ATOM 2621  C CA    . GLY B 2 165 ? -213.833 156.558 150.852 1.00 70.88  ? 165 GLY C CA    1 
ATOM 2622  C C     . GLY B 2 165 ? -214.987 156.561 151.827 1.00 70.88  ? 165 GLY C C     1 
ATOM 2623  O O     . GLY B 2 165 ? -216.152 156.679 151.452 1.00 70.88  ? 165 GLY C O     1 
ATOM 2624  N N     . GLY B 2 166 ? -214.659 156.417 153.098 1.00 71.35  ? 166 GLY C N     1 
ATOM 2625  C CA    . GLY B 2 166 ? -215.673 156.372 154.119 1.00 71.35  ? 166 GLY C CA    1 
ATOM 2626  C C     . GLY B 2 166 ? -215.911 154.893 154.096 1.00 71.35  ? 166 GLY C C     1 
ATOM 2627  O O     . GLY B 2 166 ? -215.617 154.258 153.088 1.00 71.35  ? 166 GLY C O     1 
ATOM 2628  N N     . HIS B 2 167 ? -216.438 154.331 155.167 1.00 73.28  ? 167 HIS C N     1 
ATOM 2629  C CA    . HIS B 2 167 ? -216.661 152.905 155.172 1.00 73.28  ? 167 HIS C CA    1 
ATOM 2630  C C     . HIS B 2 167 ? -218.141 152.604 155.083 1.00 73.28  ? 167 HIS C C     1 
ATOM 2631  O O     . HIS B 2 167 ? -218.910 152.964 155.957 1.00 73.28  ? 167 HIS C O     1 
ATOM 2632  C CB    . HIS B 2 167 ? -216.026 152.313 156.421 1.00 73.28  ? 167 HIS C CB    1 
ATOM 2633  C CG    . HIS B 2 167 ? -214.682 152.897 156.740 1.00 73.28  ? 167 HIS C CG    1 
ATOM 2634  N ND1   . HIS B 2 167 ? -213.526 152.497 156.102 1.00 73.28  ? 167 HIS C ND1   1 
ATOM 2635  C CD2   . HIS B 2 167 ? -214.312 153.856 157.619 1.00 73.28  ? 167 HIS C CD2   1 
ATOM 2636  C CE1   . HIS B 2 167 ? -212.502 153.179 156.581 1.00 73.28  ? 167 HIS C CE1   1 
ATOM 2637  N NE2   . HIS B 2 167 ? -212.952 154.009 157.502 1.00 73.28  ? 167 HIS C NE2   1 
ATOM 2638  N N     . HIS B 2 168 ? -218.529 151.931 154.008 1.00 75.52  ? 168 HIS C N     1 
ATOM 2639  C CA    . HIS B 2 168 ? -219.914 151.568 153.801 1.00 75.52  ? 168 HIS C CA    1 
ATOM 2640  C C     . HIS B 2 168 ? -219.967 150.073 154.016 1.00 75.52  ? 168 HIS C C     1 
ATOM 2641  O O     . HIS B 2 168 ? -219.327 149.316 153.295 1.00 75.52  ? 168 HIS C O     1 
ATOM 2642  C CB    . HIS B 2 168 ? -220.334 151.904 152.375 1.00 75.52  ? 168 HIS C CB    1 
ATOM 2643  C CG    . HIS B 2 168 ? -220.373 153.372 152.084 1.00 75.52  ? 168 HIS C CG    1 
ATOM 2644  N ND1   . HIS B 2 168 ? -220.886 154.293 152.969 1.00 75.52  ? 168 HIS C ND1   1 
ATOM 2645  C CD2   . HIS B 2 168 ? -219.968 154.076 151.001 1.00 75.52  ? 168 HIS C CD2   1 
ATOM 2646  C CE1   . HIS B 2 168 ? -220.797 155.502 152.445 1.00 75.52  ? 168 HIS C CE1   1 
ATOM 2647  N NE2   . HIS B 2 168 ? -220.244 155.397 151.250 1.00 75.52  ? 168 HIS C NE2   1 
ATOM 2648  N N     . HIS B 2 169 ? -220.734 149.646 155.008 1.00 81.57  ? 169 HIS C N     1 
ATOM 2649  C CA    . HIS B 2 169 ? -220.832 148.233 155.340 1.00 81.57  ? 169 HIS C CA    1 
ATOM 2650  C C     . HIS B 2 169 ? -221.972 147.573 154.604 1.00 81.57  ? 169 HIS C C     1 
ATOM 2651  O O     . HIS B 2 169 ? -222.249 146.394 154.804 1.00 81.57  ? 169 HIS C O     1 
ATOM 2652  C CB    . HIS B 2 169 ? -221.011 148.032 156.847 1.00 81.57  ? 169 HIS C CB    1 
ATOM 2653  C CG    . HIS B 2 169 ? -220.491 149.161 157.678 1.00 81.57  ? 169 HIS C CG    1 
ATOM 2654  N ND1   . HIS B 2 169 ? -221.015 150.432 157.614 1.00 81.57  ? 169 HIS C ND1   1 
ATOM 2655  C CD2   . HIS B 2 169 ? -219.496 149.209 158.593 1.00 81.57  ? 169 HIS C CD2   1 
ATOM 2656  C CE1   . HIS B 2 169 ? -220.366 151.216 158.455 1.00 81.57  ? 169 HIS C CE1   1 
ATOM 2657  N NE2   . HIS B 2 169 ? -219.439 150.499 159.062 1.00 81.57  ? 169 HIS C NE2   1 
ATOM 2658  N N     . ASP B 2 170 ? -222.647 148.340 153.765 1.00 83.63  ? 170 ASP C N     1 
ATOM 2659  C CA    . ASP B 2 170 ? -223.787 147.809 153.026 1.00 83.63  ? 170 ASP C CA    1 
ATOM 2660  C C     . ASP B 2 170 ? -224.983 147.555 153.934 1.00 83.63  ? 170 ASP C C     1 
ATOM 2661  O O     . ASP B 2 170 ? -225.906 146.825 153.557 1.00 83.63  ? 170 ASP C O     1 
ATOM 2662  C CB    . ASP B 2 170 ? -223.405 146.541 152.253 1.00 83.63  ? 170 ASP C CB    1 
ATOM 2663  C CG    . ASP B 2 170 ? -224.381 146.211 151.154 1.00 83.63  ? 170 ASP C CG    1 
ATOM 2664  O OD1   . ASP B 2 170 ? -224.516 146.998 150.193 1.00 83.63  ? 170 ASP C OD1   1 
ATOM 2665  O OD2   . ASP B 2 170 ? -224.996 145.132 151.236 1.00 83.63  ? 170 ASP C OD2   1 
ATOM 2666  N N     . LEU B 2 171 ? -224.965 148.120 155.138 1.00 88.83  ? 171 LEU C N     1 
ATOM 2667  C CA    . LEU B 2 171 ? -226.088 148.083 156.062 1.00 88.83  ? 171 LEU C CA    1 
ATOM 2668  C C     . LEU B 2 171 ? -226.436 149.523 156.410 1.00 88.83  ? 171 LEU C C     1 
ATOM 2669  O O     . LEU B 2 171 ? -225.590 150.265 156.922 1.00 88.83  ? 171 LEU C O     1 
ATOM 2670  C CB    . LEU B 2 171 ? -225.733 147.310 157.329 1.00 88.83  ? 171 LEU C CB    1 
ATOM 2671  C CG    . LEU B 2 171 ? -225.962 145.806 157.352 1.00 88.83  ? 171 LEU C CG    1 
ATOM 2672  C CD1   . LEU B 2 171 ? -224.981 145.109 156.425 1.00 88.83  ? 171 LEU C CD1   1 
ATOM 2673  C CD2   . LEU B 2 171 ? -225.786 145.327 158.785 1.00 88.83  ? 171 LEU C CD2   1 
ATOM 2674  N N     . ASP B 2 172 ? -227.674 149.908 156.125 1.00 95.31  ? 172 ASP C N     1 
ATOM 2675  C CA    . ASP B 2 172 ? -228.133 151.291 156.176 1.00 95.31  ? 172 ASP C CA    1 
ATOM 2676  C C     . ASP B 2 172 ? -227.217 152.177 155.343 1.00 95.31  ? 172 ASP C C     1 
ATOM 2677  O O     . ASP B 2 172 ? -226.493 153.003 155.911 1.00 95.31  ? 172 ASP C O     1 
ATOM 2678  C CB    . ASP B 2 172 ? -228.179 151.805 157.615 1.00 95.31  ? 172 ASP C CB    1 
ATOM 2679  C CG    . ASP B 2 172 ? -228.768 153.206 157.728 1.00 95.31  ? 172 ASP C CG    1 
ATOM 2680  O OD1   . ASP B 2 172 ? -229.994 153.361 157.545 1.00 95.31  ? 172 ASP C OD1   1 
ATOM 2681  O OD2   . ASP B 2 172 ? -228.005 154.154 158.011 1.00 95.31  ? 172 ASP C OD2   1 
ATOM 2682  N N     . PRO B 2 173 ? -227.174 152.035 154.023 1.00 85.08  ? 173 PRO C N     1 
ATOM 2683  C CA    . PRO B 2 173 ? -226.293 152.911 153.250 1.00 85.08  ? 173 PRO C CA    1 
ATOM 2684  C C     . PRO B 2 173 ? -226.898 154.297 153.090 1.00 85.08  ? 173 PRO C C     1 
ATOM 2685  O O     . PRO B 2 173 ? -228.096 154.449 152.834 1.00 85.08  ? 173 PRO C O     1 
ATOM 2686  C CB    . PRO B 2 173 ? -226.185 152.186 151.905 1.00 85.08  ? 173 PRO C CB    1 
ATOM 2687  C CG    . PRO B 2 173 ? -227.489 151.476 151.779 1.00 85.08  ? 173 PRO C CG    1 
ATOM 2688  C CD    . PRO B 2 173 ? -227.893 151.076 153.169 1.00 85.08  ? 173 PRO C CD    1 
ATOM 2689  N N     . HIS B 2 174 ? -226.055 155.311 153.230 1.00 78.91  ? 174 HIS C N     1 
ATOM 2690  C CA    . HIS B 2 174 ? -226.510 156.694 153.127 1.00 78.91  ? 174 HIS C CA    1 
ATOM 2691  C C     . HIS B 2 174 ? -226.856 157.016 151.675 1.00 78.91  ? 174 HIS C C     1 
ATOM 2692  O O     . HIS B 2 174 ? -226.025 156.805 150.784 1.00 78.91  ? 174 HIS C O     1 
ATOM 2693  C CB    . HIS B 2 174 ? -225.495 157.664 153.745 1.00 78.91  ? 174 HIS C CB    1 
ATOM 2694  C CG    . HIS B 2 174 ? -224.290 157.934 152.911 1.00 78.91  ? 174 HIS C CG    1 
ATOM 2695  N ND1   . HIS B 2 174 ? -223.198 157.095 152.880 1.00 78.91  ? 174 HIS C ND1   1 
ATOM 2696  C CD2   . HIS B 2 174 ? -223.978 158.986 152.120 1.00 78.91  ? 174 HIS C CD2   1 
ATOM 2697  C CE1   . HIS B 2 174 ? -222.282 157.598 152.076 1.00 78.91  ? 174 HIS C CE1   1 
ATOM 2698  N NE2   . HIS B 2 174 ? -222.731 158.745 151.600 1.00 78.91  ? 174 HIS C NE2   1 
ATOM 2699  N N     . PRO B 2 175 ? -228.069 157.476 151.396 1.00 76.47  ? 175 PRO C N     1 
ATOM 2700  C CA    . PRO B 2 175 ? -228.507 157.704 150.013 1.00 76.47  ? 175 PRO C CA    1 
ATOM 2701  C C     . PRO B 2 175 ? -227.807 158.855 149.307 1.00 76.47  ? 175 PRO C C     1 
ATOM 2702  O O     . PRO B 2 175 ? -227.507 159.892 149.901 1.00 76.47  ? 175 PRO C O     1 
ATOM 2703  C CB    . PRO B 2 175 ? -229.997 157.994 150.170 1.00 76.47  ? 175 PRO C CB    1 
ATOM 2704  C CG    . PRO B 2 175 ? -230.139 158.488 151.558 1.00 76.47  ? 175 PRO C CG    1 
ATOM 2705  C CD    . PRO B 2 175 ? -229.138 157.746 152.367 1.00 76.47  ? 175 PRO C CD    1 
ATOM 2706  N N     . LEU B 2 176 ? -227.591 158.650 148.019 1.00 76.84  ? 176 LEU C N     1 
ATOM 2707  C CA    . LEU B 2 176 ? -226.983 159.634 147.158 1.00 76.84  ? 176 LEU C CA    1 
ATOM 2708  C C     . LEU B 2 176 ? -227.963 160.770 146.957 1.00 76.84  ? 176 LEU C C     1 
ATOM 2709  O O     . LEU B 2 176 ? -229.168 160.557 146.922 1.00 76.84  ? 176 LEU C O     1 
ATOM 2710  C CB    . LEU B 2 176 ? -226.697 159.003 145.801 1.00 76.84  ? 176 LEU C CB    1 
ATOM 2711  C CG    . LEU B 2 176 ? -225.525 158.038 145.696 1.00 76.84  ? 176 LEU C CG    1 
ATOM 2712  C CD1   . LEU B 2 176 ? -224.321 158.775 145.143 1.00 76.84  ? 176 LEU C CD1   1 
ATOM 2713  C CD2   . LEU B 2 176 ? -225.200 157.412 147.041 1.00 76.84  ? 176 LEU C CD2   1 
ATOM 2714  N N     . ASP B 2 177 ? -227.450 161.981 146.810 1.00 82.00  ? 177 ASP C N     1 
ATOM 2715  C CA    . ASP B 2 177 ? -228.309 163.115 146.562 1.00 82.00  ? 177 ASP C CA    1 
ATOM 2716  C C     . ASP B 2 177 ? -228.818 162.823 145.169 1.00 82.00  ? 177 ASP C C     1 
ATOM 2717  O O     . ASP B 2 177 ? -228.152 162.129 144.410 1.00 82.00  ? 177 ASP C O     1 
ATOM 2718  C CB    . ASP B 2 177 ? -227.508 164.409 146.581 1.00 82.00  ? 177 ASP C CB    1 
ATOM 2719  C CG    . ASP B 2 177 ? -226.354 164.363 147.562 1.00 82.00  ? 177 ASP C CG    1 
ATOM 2720  O OD1   . ASP B 2 177 ? -226.122 163.286 148.148 1.00 82.00  ? 177 ASP C OD1   1 
ATOM 2721  O OD2   . ASP B 2 177 ? -225.684 165.399 147.748 1.00 82.00  ? 177 ASP C OD2   1 
ATOM 2722  N N     . SER B 2 178 ? -229.994 163.324 144.822 1.00 78.36  ? 178 SER C N     1 
ATOM 2723  C CA    . SER B 2 178 ? -230.530 163.040 143.505 1.00 78.36  ? 178 SER C CA    1 
ATOM 2724  C C     . SER B 2 178 ? -229.586 163.577 142.451 1.00 78.36  ? 178 SER C C     1 
ATOM 2725  O O     . SER B 2 178 ? -229.325 162.919 141.449 1.00 78.36  ? 178 SER C O     1 
ATOM 2726  C CB    . SER B 2 178 ? -231.910 163.662 143.345 1.00 78.36  ? 178 SER C CB    1 
ATOM 2727  O OG    . SER B 2 178 ? -232.824 163.089 144.259 1.00 78.36  ? 178 SER C OG    1 
ATOM 2728  N N     . ALA B 2 179 ? -229.055 164.769 142.679 1.00 78.16  ? 179 ALA C N     1 
ATOM 2729  C CA    . ALA B 2 179 ? -228.136 165.348 141.718 1.00 78.16  ? 179 ALA C CA    1 
ATOM 2730  C C     . ALA B 2 179 ? -226.929 164.433 141.629 1.00 78.16  ? 179 ALA C C     1 
ATOM 2731  O O     . ALA B 2 179 ? -226.420 164.154 140.549 1.00 78.16  ? 179 ALA C O     1 
ATOM 2732  C CB    . ALA B 2 179 ? -227.723 166.738 142.160 1.00 78.16  ? 179 ALA C CB    1 
ATOM 2733  N N     . GLU B 2 180 ? -226.484 163.957 142.784 1.00 78.57  ? 180 GLU C N     1 
ATOM 2734  C CA    . GLU B 2 180 ? -225.347 163.061 142.870 1.00 78.57  ? 180 GLU C CA    1 
ATOM 2735  C C     . GLU B 2 180 ? -225.668 161.773 142.158 1.00 78.57  ? 180 GLU C C     1 
ATOM 2736  O O     . GLU B 2 180 ? -224.830 161.208 141.469 1.00 78.57  ? 180 GLU C O     1 
ATOM 2737  C CB    . GLU B 2 180 ? -225.042 162.750 144.328 1.00 78.57  ? 180 GLU C CB    1 
ATOM 2738  C CG    . GLU B 2 180 ? -223.722 163.299 144.824 1.00 78.57  ? 180 GLU C CG    1 
ATOM 2739  C CD    . GLU B 2 180 ? -223.048 162.364 145.807 1.00 78.57  ? 180 GLU C CD    1 
ATOM 2740  O OE1   . GLU B 2 180 ? -223.084 161.141 145.578 1.00 78.57  ? 180 GLU C OE1   1 
ATOM 2741  O OE2   . GLU B 2 180 ? -222.484 162.852 146.806 1.00 78.57  ? 180 GLU C OE2   1 
ATOM 2742  N N     . ALA B 2 181 ? -226.898 161.309 142.324 1.00 75.54  ? 181 ALA C N     1 
ATOM 2743  C CA    . ALA B 2 181 ? -227.317 160.064 141.711 1.00 75.54  ? 181 ALA C CA    1 
ATOM 2744  C C     . ALA B 2 181 ? -227.205 160.179 140.211 1.00 75.54  ? 181 ALA C C     1 
ATOM 2745  O O     . ALA B 2 181 ? -226.800 159.244 139.534 1.00 75.54  ? 181 ALA C O     1 
ATOM 2746  C CB    . ALA B 2 181 ? -228.737 159.731 142.109 1.00 75.54  ? 181 ALA C CB    1 
ATOM 2747  N N     . VAL B 2 182 ? -227.556 161.339 139.686 1.00 73.18  ? 182 VAL C N     1 
ATOM 2748  C CA    . VAL B 2 182 ? -227.494 161.529 138.254 1.00 73.18  ? 182 VAL C CA    1 
ATOM 2749  C C     . VAL B 2 182 ? -226.082 161.372 137.716 1.00 73.18  ? 182 VAL C C     1 
ATOM 2750  O O     . VAL B 2 182 ? -225.893 160.795 136.655 1.00 73.18  ? 182 VAL C O     1 
ATOM 2751  C CB    . VAL B 2 182 ? -228.024 162.908 137.861 1.00 73.18  ? 182 VAL C CB    1 
ATOM 2752  C CG1   . VAL B 2 182 ? -228.200 162.986 136.356 1.00 73.18  ? 182 VAL C CG1   1 
ATOM 2753  C CG2   . VAL B 2 182 ? -229.328 163.190 138.586 1.00 73.18  ? 182 VAL C CG2   1 
ATOM 2754  N N     . TRP B 2 183 ? -225.091 161.889 138.435 1.00 71.02  ? 183 TRP C N     1 
ATOM 2755  C CA    . TRP B 2 183 ? -223.716 161.788 137.971 1.00 71.02  ? 183 TRP C CA    1 
ATOM 2756  C C     . TRP B 2 183 ? -223.281 160.342 137.878 1.00 71.02  ? 183 TRP C C     1 
ATOM 2757  O O     . TRP B 2 183 ? -222.681 159.928 136.898 1.00 71.02  ? 183 TRP C O     1 
ATOM 2758  C CB    . TRP B 2 183 ? -222.775 162.470 138.959 1.00 71.02  ? 183 TRP C CB    1 
ATOM 2759  C CG    . TRP B 2 183 ? -223.012 163.917 139.189 1.00 71.02  ? 183 TRP C CG    1 
ATOM 2760  C CD1   . TRP B 2 183 ? -223.245 164.868 138.252 1.00 71.02  ? 183 TRP C CD1   1 
ATOM 2761  C CD2   . TRP B 2 183 ? -223.006 164.590 140.453 1.00 71.02  ? 183 TRP C CD2   1 
ATOM 2762  N NE1   . TRP B 2 183 ? -223.395 166.092 138.849 1.00 71.02  ? 183 TRP C NE1   1 
ATOM 2763  C CE2   . TRP B 2 183 ? -223.253 165.947 140.203 1.00 71.02  ? 183 TRP C CE2   1 
ATOM 2764  C CE3   . TRP B 2 183 ? -222.820 164.174 141.775 1.00 71.02  ? 183 TRP C CE3   1 
ATOM 2765  C CZ2   . TRP B 2 183 ? -223.320 166.891 141.219 1.00 71.02  ? 183 TRP C CZ2   1 
ATOM 2766  C CZ3   . TRP B 2 183 ? -222.886 165.111 142.781 1.00 71.02  ? 183 TRP C CZ3   1 
ATOM 2767  C CH2   . TRP B 2 183 ? -223.134 166.452 142.500 1.00 71.02  ? 183 TRP C CH2   1 
ATOM 2768  N N     . HIS B 2 184 ? -223.591 159.570 138.908 1.00 65.82  ? 184 HIS C N     1 
ATOM 2769  C CA    . HIS B 2 184 ? -223.210 158.168 138.950 1.00 65.82  ? 184 HIS C CA    1 
ATOM 2770  C C     . HIS B 2 184 ? -223.877 157.321 137.884 1.00 65.82  ? 184 HIS C C     1 
ATOM 2771  O O     . HIS B 2 184 ? -223.252 156.455 137.286 1.00 65.82  ? 184 HIS C O     1 
ATOM 2772  C CB    . HIS B 2 184 ? -223.481 157.592 140.335 1.00 65.82  ? 184 HIS C CB    1 
ATOM 2773  C CG    . HIS B 2 184 ? -222.641 158.204 141.410 1.00 65.82  ? 184 HIS C CG    1 
ATOM 2774  N ND1   . HIS B 2 184 ? -221.282 158.389 141.276 1.00 65.82  ? 184 HIS C ND1   1 
ATOM 2775  C CD2   . HIS B 2 184 ? -222.966 158.678 142.634 1.00 65.82  ? 184 HIS C CD2   1 
ATOM 2776  C CE1   . HIS B 2 184 ? -220.805 158.946 142.374 1.00 65.82  ? 184 HIS C CE1   1 
ATOM 2777  N NE2   . HIS B 2 184 ? -221.806 159.131 143.213 1.00 65.82  ? 184 HIS C NE2   1 
ATOM 2778  N N     . LEU B 2 185 ? -225.153 157.578 137.649 1.00 63.71  ? 185 LEU C N     1 
ATOM 2779  C CA    . LEU B 2 185 ? -225.913 156.813 136.678 1.00 63.71  ? 185 LEU C CA    1 
ATOM 2780  C C     . LEU B 2 185 ? -225.292 156.988 135.318 1.00 63.71  ? 185 LEU C C     1 
ATOM 2781  O O     . LEU B 2 185 ? -225.205 156.060 134.528 1.00 63.71  ? 185 LEU C O     1 
ATOM 2782  C CB    . LEU B 2 185 ? -227.369 157.295 136.662 1.00 63.71  ? 185 LEU C CB    1 
ATOM 2783  C CG    . LEU B 2 185 ? -228.104 157.402 135.328 1.00 63.71  ? 185 LEU C CG    1 
ATOM 2784  C CD1   . LEU B 2 185 ? -227.909 156.120 134.545 1.00 63.71  ? 185 LEU C CD1   1 
ATOM 2785  C CD2   . LEU B 2 185 ? -229.576 157.691 135.525 1.00 63.71  ? 185 LEU C CD2   1 
ATOM 2786  N N     . LEU B 2 186 ? -224.875 158.206 135.049 1.00 57.92  ? 186 LEU C N     1 
ATOM 2787  C CA    . LEU B 2 186 ? -224.278 158.535 133.768 1.00 57.92  ? 186 LEU C CA    1 
ATOM 2788  C C     . LEU B 2 186 ? -222.903 157.887 133.614 1.00 57.92  ? 186 LEU C C     1 
ATOM 2789  O O     . LEU B 2 186 ? -222.551 157.387 132.536 1.00 57.92  ? 186 LEU C O     1 
ATOM 2790  C CB    . LEU B 2 186 ? -224.251 160.056 133.686 1.00 57.92  ? 186 LEU C CB    1 
ATOM 2791  C CG    . LEU B 2 186 ? -224.271 160.848 132.400 1.00 57.92  ? 186 LEU C CG    1 
ATOM 2792  C CD1   . LEU B 2 186 ? -225.154 162.008 132.623 1.00 57.92  ? 186 LEU C CD1   1 
ATOM 2793  C CD2   . LEU B 2 186 ? -222.949 161.406 132.116 1.00 57.92  ? 186 LEU C CD2   1 
ATOM 2794  N N     . ALA B 2 187 ? -222.135 157.834 134.699 1.00 59.56  ? 187 ALA C N     1 
ATOM 2795  C CA    . ALA B 2 187 ? -220.817 157.217 134.657 1.00 59.56  ? 187 ALA C CA    1 
ATOM 2796  C C     . ALA B 2 187 ? -220.943 155.728 134.407 1.00 59.56  ? 187 ALA C C     1 
ATOM 2797  O O     . ALA B 2 187 ? -220.290 155.181 133.514 1.00 59.56  ? 187 ALA C O     1 
ATOM 2798  C CB    . ALA B 2 187 ? -220.060 157.492 135.952 1.00 59.56  ? 187 ALA C CB    1 
ATOM 2799  N N     . THR B 2 188 ? -221.814 155.064 135.168 1.00 60.94  ? 188 THR C N     1 
ATOM 2800  C CA    . THR B 2 188 ? -221.985 153.632 134.999 1.00 60.94  ? 188 THR C CA    1 
ATOM 2801  C C     . THR B 2 188 ? -222.512 153.317 133.617 1.00 60.94  ? 188 THR C C     1 
ATOM 2802  O O     . THR B 2 188 ? -222.220 152.252 133.071 1.00 60.94  ? 188 THR C O     1 
ATOM 2803  C CB    . THR B 2 188 ? -222.907 153.070 136.071 1.00 60.94  ? 188 THR C CB    1 
ATOM 2804  O OG1   . THR B 2 188 ? -224.062 153.897 136.190 1.00 60.94  ? 188 THR C OG1   1 
ATOM 2805  C CG2   . THR B 2 188 ? -222.192 153.052 137.388 1.00 60.94  ? 188 THR C CG2   1 
ATOM 2806  N N     . LEU B 2 189 ? -223.273 154.229 133.023 1.00 61.78  ? 189 LEU C N     1 
ATOM 2807  C CA    . LEU B 2 189 ? -223.684 154.000 131.648 1.00 61.78  ? 189 LEU C CA    1 
ATOM 2808  C C     . LEU B 2 189 ? -222.503 154.131 130.706 1.00 61.78  ? 189 LEU C C     1 
ATOM 2809  O O     . LEU B 2 189 ? -222.449 153.440 129.684 1.00 61.78  ? 189 LEU C O     1 
ATOM 2810  C CB    . LEU B 2 189 ? -224.785 154.970 131.271 1.00 61.78  ? 189 LEU C CB    1 
ATOM 2811  C CG    . LEU B 2 189 ? -226.035 154.625 132.055 1.00 61.78  ? 189 LEU C CG    1 
ATOM 2812  C CD1   . LEU B 2 189 ? -227.023 155.735 131.933 1.00 61.78  ? 189 LEU C CD1   1 
ATOM 2813  C CD2   . LEU B 2 189 ? -226.602 153.344 131.506 1.00 61.78  ? 189 LEU C CD2   1 
ATOM 2814  N N     . GLY B 2 190 ? -221.535 154.978 131.045 1.00 59.00  ? 190 GLY C N     1 
ATOM 2815  C CA    . GLY B 2 190 ? -220.302 154.988 130.282 1.00 59.00  ? 190 GLY C CA    1 
ATOM 2816  C C     . GLY B 2 190 ? -219.457 153.824 130.745 1.00 59.00  ? 190 GLY C C     1 
ATOM 2817  O O     . GLY B 2 190 ? -219.663 152.700 130.286 1.00 59.00  ? 190 GLY C O     1 
ATOM 2818  N N     . TYR B 2 191 ? -218.585 154.075 131.698 1.00 58.81  ? 191 TYR C N     1 
ATOM 2819  C CA    . TYR B 2 191 ? -217.757 153.044 132.282 1.00 58.81  ? 191 TYR C CA    1 
ATOM 2820  C C     . TYR B 2 191 ? -218.665 152.181 133.145 1.00 58.81  ? 191 TYR C C     1 
ATOM 2821  O O     . TYR B 2 191 ? -219.565 152.694 133.788 1.00 58.81  ? 191 TYR C O     1 
ATOM 2822  C CB    . TYR B 2 191 ? -216.658 153.717 133.091 1.00 58.81  ? 191 TYR C CB    1 
ATOM 2823  C CG    . TYR B 2 191 ? -216.104 154.939 132.381 1.00 58.81  ? 191 TYR C CG    1 
ATOM 2824  C CD1   . TYR B 2 191 ? -216.716 156.175 132.510 1.00 58.81  ? 191 TYR C CD1   1 
ATOM 2825  C CD2   . TYR B 2 191 ? -215.024 154.834 131.530 1.00 58.81  ? 191 TYR C CD2   1 
ATOM 2826  C CE1   . TYR B 2 191 ? -216.230 157.278 131.843 1.00 58.81  ? 191 TYR C CE1   1 
ATOM 2827  C CE2   . TYR B 2 191 ? -214.531 155.931 130.865 1.00 58.81  ? 191 TYR C CE2   1 
ATOM 2828  C CZ    . TYR B 2 191 ? -215.135 157.146 131.023 1.00 58.81  ? 191 TYR C CZ    1 
ATOM 2829  O OH    . TYR B 2 191 ? -214.628 158.228 130.350 1.00 58.81  ? 191 TYR C OH    1 
ATOM 2830  N N     . GLY B 2 192 ? -218.443 150.873 133.151 1.00 58.43  ? 192 GLY C N     1 
ATOM 2831  C CA    . GLY B 2 192 ? -219.238 149.960 133.926 1.00 58.43  ? 192 GLY C CA    1 
ATOM 2832  C C     . GLY B 2 192 ? -218.516 148.635 134.018 1.00 58.43  ? 192 GLY C C     1 
ATOM 2833  O O     . GLY B 2 192 ? -217.904 148.168 133.055 1.00 58.43  ? 192 GLY C O     1 
ATOM 2834  N N     . PRO B 2 193 ? -218.569 148.009 135.184 1.00 58.29  ? 193 PRO C N     1 
ATOM 2835  C CA    . PRO B 2 193 ? -217.888 146.728 135.375 1.00 58.29  ? 193 PRO C CA    1 
ATOM 2836  C C     . PRO B 2 193 ? -218.480 145.648 134.492 1.00 58.29  ? 193 PRO C C     1 
ATOM 2837  O O     . PRO B 2 193 ? -219.600 145.765 134.004 1.00 58.29  ? 193 PRO C O     1 
ATOM 2838  C CB    . PRO B 2 193 ? -218.123 146.420 136.853 1.00 58.29  ? 193 PRO C CB    1 
ATOM 2839  C CG    . PRO B 2 193 ? -219.328 147.201 137.202 1.00 58.29  ? 193 PRO C CG    1 
ATOM 2840  C CD    . PRO B 2 193 ? -219.297 148.436 136.381 1.00 58.29  ? 193 PRO C CD    1 
ATOM 2841  N N     . SER B 2 194 ? -217.705 144.588 134.273 1.00 63.36  ? 194 SER C N     1 
ATOM 2842  C CA    . SER B 2 194 ? -218.112 143.506 133.394 1.00 63.36  ? 194 SER C CA    1 
ATOM 2843  C C     . SER B 2 194 ? -218.063 142.190 134.154 1.00 63.36  ? 194 SER C C     1 
ATOM 2844  O O     . SER B 2 194 ? -217.124 141.924 134.908 1.00 63.36  ? 194 SER C O     1 
ATOM 2845  C CB    . SER B 2 194 ? -217.222 143.430 132.180 1.00 63.36  ? 194 SER C CB    1 
ATOM 2846  O OG    . SER B 2 194 ? -215.927 143.027 132.555 1.00 63.36  ? 194 SER C OG    1 
ATOM 2847  N N     . GLY B 2 195 ? -219.077 141.368 133.932 1.00 69.62  ? 195 GLY C N     1 
ATOM 2848  C CA    . GLY B 2 195 ? -219.193 140.076 134.566 1.00 69.62  ? 195 GLY C CA    1 
ATOM 2849  C C     . GLY B 2 195 ? -219.918 140.103 135.901 1.00 69.62  ? 195 GLY C C     1 
ATOM 2850  O O     . GLY B 2 195 ? -219.598 140.905 136.779 1.00 69.62  ? 195 GLY C O     1 
ATOM 2851  N N     . MET B 2 196 ? -220.900 139.215 136.044 1.00 80.94  ? 196 MET C N     1 
ATOM 2852  C CA    . MET B 2 196 ? -221.564 138.925 137.310 1.00 80.94  ? 196 MET C CA    1 
ATOM 2853  C C     . MET B 2 196 ? -222.231 140.121 137.975 1.00 80.94  ? 196 MET C C     1 
ATOM 2854  O O     . MET B 2 196 ? -222.033 140.378 139.161 1.00 80.94  ? 196 MET C O     1 
ATOM 2855  C CB    . MET B 2 196 ? -220.578 138.251 138.264 1.00 80.94  ? 196 MET C CB    1 
ATOM 2856  C CG    . MET B 2 196 ? -220.336 136.803 137.919 1.00 80.94  ? 196 MET C CG    1 
ATOM 2857  S SD    . MET B 2 196 ? -219.556 136.554 136.331 1.00 80.94  ? 196 MET C SD    1 
ATOM 2858  C CE    . MET B 2 196 ? -219.342 134.772 136.280 1.00 80.94  ? 196 MET C CE    1 
ATOM 2859  N N     . CYS B 2 197 ? -223.014 140.879 137.218 1.00 79.72  ? 197 CYS C N     1 
ATOM 2860  C CA    . CYS B 2 197 ? -223.925 141.756 137.933 1.00 79.72  ? 197 CYS C CA    1 
ATOM 2861  C C     . CYS B 2 197 ? -225.151 140.960 138.371 1.00 79.72  ? 197 CYS C C     1 
ATOM 2862  O O     . CYS B 2 197 ? -225.246 139.768 138.106 1.00 79.72  ? 197 CYS C O     1 
ATOM 2863  C CB    . CYS B 2 197 ? -224.336 142.906 137.053 1.00 79.72  ? 197 CYS C CB    1 
ATOM 2864  S SG    . CYS B 2 197 ? -225.981 142.669 136.558 1.00 79.72  ? 197 CYS C SG    1 
ATOM 2865  N N     . THR B 2 198 ? -226.125 141.606 139.023 1.00 76.15  ? 198 THR C N     1 
ATOM 2866  C CA    . THR B 2 198 ? -227.293 140.864 139.495 1.00 76.15  ? 198 THR C CA    1 
ATOM 2867  C C     . THR B 2 198 ? -228.211 140.508 138.326 1.00 76.15  ? 198 THR C C     1 
ATOM 2868  O O     . THR B 2 198 ? -228.697 141.391 137.626 1.00 76.15  ? 198 THR C O     1 
ATOM 2869  C CB    . THR B 2 198 ? -228.059 141.709 140.509 1.00 76.15  ? 198 THR C CB    1 
ATOM 2870  O OG1   . THR B 2 198 ? -228.909 142.600 139.790 1.00 76.15  ? 198 THR C OG1   1 
ATOM 2871  C CG2   . THR B 2 198 ? -227.088 142.544 141.347 1.00 76.15  ? 198 THR C CG2   1 
ATOM 2872  N N     . ALA B 2 199 ? -228.509 139.225 138.166 1.00 82.28  ? 199 ALA C N     1 
ATOM 2873  C CA    . ALA B 2 199 ? -229.337 138.717 137.073 1.00 82.28  ? 199 ALA C CA    1 
ATOM 2874  C C     . ALA B 2 199 ? -230.797 139.136 137.172 1.00 82.28  ? 199 ALA C C     1 
ATOM 2875  O O     . ALA B 2 199 ? -231.373 139.124 138.261 1.00 82.28  ? 199 ALA C O     1 
ATOM 2876  C CB    . ALA B 2 199 ? -229.264 137.202 137.012 1.00 82.28  ? 199 ALA C CB    1 
ATOM 2877  N N     . ARG B 2 200 ? -231.392 139.542 136.050 1.00 85.55  ? 200 ARG C N     1 
ATOM 2878  C CA    . ARG B 2 200 ? -232.842 139.702 136.002 1.00 85.55  ? 200 ARG C CA    1 
ATOM 2879  C C     . ARG B 2 200 ? -233.383 138.803 134.895 1.00 85.55  ? 200 ARG C C     1 
ATOM 2880  O O     . ARG B 2 200 ? -232.877 138.823 133.770 1.00 85.55  ? 200 ARG C O     1 
ATOM 2881  C CB    . ARG B 2 200 ? -233.337 141.136 135.826 1.00 85.55  ? 200 ARG C CB    1 
ATOM 2882  C CG    . ARG B 2 200 ? -233.418 141.831 134.482 1.00 85.55  ? 200 ARG C CG    1 
ATOM 2883  C CD    . ARG B 2 200 ? -232.147 142.314 133.903 1.00 85.55  ? 200 ARG C CD    1 
ATOM 2884  N NE    . ARG B 2 200 ? -232.438 143.177 132.768 1.00 85.55  ? 200 ARG C NE    1 
ATOM 2885  C CZ    . ARG B 2 200 ? -232.668 142.736 131.545 1.00 85.55  ? 200 ARG C CZ    1 
ATOM 2886  N NH1   . ARG B 2 200 ? -232.926 143.588 130.569 1.00 85.55  ? 200 ARG C NH1   1 
ATOM 2887  N NH2   . ARG B 2 200 ? -232.605 141.444 131.306 1.00 85.55  ? 200 ARG C NH2   1 
ATOM 2888  N N     . VAL B 2 201 ? -234.404 138.007 135.223 1.00 91.03  ? 201 VAL C N     1 
ATOM 2889  C CA    . VAL B 2 201 ? -235.051 137.142 134.243 1.00 91.03  ? 201 VAL C CA    1 
ATOM 2890  C C     . VAL B 2 201 ? -235.920 137.918 133.266 1.00 91.03  ? 201 VAL C C     1 
ATOM 2891  O O     . VAL B 2 201 ? -236.606 138.879 133.620 1.00 91.03  ? 201 VAL C O     1 
ATOM 2892  C CB    . VAL B 2 201 ? -235.876 136.085 134.985 1.00 91.03  ? 201 VAL C CB    1 
ATOM 2893  C CG1   . VAL B 2 201 ? -235.000 134.901 135.340 1.00 91.03  ? 201 VAL C CG1   1 
ATOM 2894  C CG2   . VAL B 2 201 ? -236.471 136.714 136.254 1.00 91.03  ? 201 VAL C CG2   1 
ATOM 2895  N N     . VAL B 2 202 ? -235.885 137.491 132.011 1.00 93.58  ? 202 VAL C N     1 
ATOM 2896  C CA    . VAL B 2 202 ? -236.722 138.049 130.954 1.00 93.58  ? 202 VAL C CA    1 
ATOM 2897  C C     . VAL B 2 202 ? -237.346 136.865 130.223 1.00 93.58  ? 202 VAL C C     1 
ATOM 2898  O O     . VAL B 2 202 ? -236.740 136.303 129.304 1.00 93.58  ? 202 VAL C O     1 
ATOM 2899  C CB    . VAL B 2 202 ? -235.929 138.941 129.994 1.00 93.58  ? 202 VAL C CB    1 
ATOM 2900  C CG1   . VAL B 2 202 ? -236.808 139.499 128.918 1.00 93.58  ? 202 VAL C CG1   1 
ATOM 2901  C CG2   . VAL B 2 202 ? -235.331 140.075 130.754 1.00 93.58  ? 202 VAL C CG2   1 
ATOM 2902  N N     . ARG B 2 203 ? -238.562 136.472 130.618 1.00 95.09  ? 203 ARG C N     1 
ATOM 2903  C CA    . ARG B 2 203 ? -239.188 135.310 129.991 1.00 95.09  ? 203 ARG C CA    1 
ATOM 2904  C C     . ARG B 2 203 ? -238.314 134.062 130.086 1.00 95.09  ? 203 ARG C C     1 
ATOM 2905  O O     . ARG B 2 203 ? -238.096 133.367 129.091 1.00 95.09  ? 203 ARG C O     1 
ATOM 2906  C CB    . ARG B 2 203 ? -239.590 135.600 128.541 1.00 95.09  ? 203 ARG C CB    1 
ATOM 2907  C CG    . ARG B 2 203 ? -240.675 136.654 128.408 1.00 95.09  ? 203 ARG C CG    1 
ATOM 2908  C CD    . ARG B 2 203 ? -240.177 138.070 128.487 1.00 95.09  ? 203 ARG C CD    1 
ATOM 2909  N NE    . ARG B 2 203 ? -239.261 138.387 127.403 1.00 95.09  ? 203 ARG C NE    1 
ATOM 2910  C CZ    . ARG B 2 203 ? -239.649 138.743 126.186 1.00 95.09  ? 203 ARG C CZ    1 
ATOM 2911  N NH1   . ARG B 2 203 ? -240.940 138.820 125.899 1.00 95.09  ? 203 ARG C NH1   1 
ATOM 2912  N NH2   . ARG B 2 203 ? -238.750 139.031 125.262 1.00 95.09  ? 203 ARG C NH2   1 
ATOM 2913  N N     . GLY B 2 204 ? -237.771 133.780 131.273 1.00 95.32  ? 204 GLY C N     1 
ATOM 2914  C CA    . GLY B 2 204 ? -236.974 132.580 131.422 1.00 95.32  ? 204 GLY C CA    1 
ATOM 2915  C C     . GLY B 2 204 ? -235.473 132.731 131.293 1.00 95.32  ? 204 GLY C C     1 
ATOM 2916  O O     . GLY B 2 204 ? -234.757 131.748 131.514 1.00 95.32  ? 204 GLY C O     1 
ATOM 2917  N N     . ARG B 2 205 ? -234.964 133.905 130.933 1.00 97.90  ? 205 ARG C N     1 
ATOM 2918  C CA    . ARG B 2 205 ? -233.537 134.082 130.721 1.00 97.90  ? 205 ARG C CA    1 
ATOM 2919  C C     . ARG B 2 205 ? -232.847 134.799 131.883 1.00 97.90  ? 205 ARG C C     1 
ATOM 2920  O O     . ARG B 2 205 ? -233.143 135.964 132.160 1.00 97.90  ? 205 ARG C O     1 
ATOM 2921  C CB    . ARG B 2 205 ? -233.432 134.952 129.471 1.00 97.90  ? 205 ARG C CB    1 
ATOM 2922  C CG    . ARG B 2 205 ? -232.095 135.218 128.925 1.00 97.90  ? 205 ARG C CG    1 
ATOM 2923  C CD    . ARG B 2 205 ? -231.646 134.119 128.041 1.00 97.90  ? 205 ARG C CD    1 
ATOM 2924  N NE    . ARG B 2 205 ? -231.186 132.979 128.799 1.00 97.90  ? 205 ARG C NE    1 
ATOM 2925  C CZ    . ARG B 2 205 ? -230.702 131.885 128.239 1.00 97.90  ? 205 ARG C CZ    1 
ATOM 2926  N NH1   . ARG B 2 205 ? -230.616 131.808 126.921 1.00 97.90  ? 205 ARG C NH1   1 
ATOM 2927  N NH2   . ARG B 2 205 ? -230.297 130.874 128.993 1.00 97.90  ? 205 ARG C NH2   1 
ATOM 2928  N N     . SER B 2 206 ? -231.928 134.096 132.566 1.00 96.51  ? 206 SER C N     1 
ATOM 2929  C CA    . SER B 2 206 ? -231.169 134.648 133.688 1.00 96.51  ? 206 SER C CA    1 
ATOM 2930  C C     . SER B 2 206 ? -229.670 134.464 133.479 1.00 96.51  ? 206 SER C C     1 
ATOM 2931  O O     . SER B 2 206 ? -229.184 133.329 133.506 1.00 96.51  ? 206 SER C O     1 
ATOM 2932  C CB    . SER B 2 206 ? -231.604 133.963 134.982 1.00 96.51  ? 206 SER C CB    1 
ATOM 2933  O OG    . SER B 2 206 ? -230.950 134.491 136.114 1.00 96.51  ? 206 SER C OG    1 
ATOM 2934  N N     . GLU B 2 207 ? -228.929 135.557 133.327 1.00 92.99  ? 207 GLU C N     1 
ATOM 2935  C CA    . GLU B 2 207 ? -227.463 135.519 133.161 1.00 92.99  ? 207 GLU C CA    1 
ATOM 2936  C C     . GLU B 2 207 ? -226.721 136.649 133.871 1.00 92.99  ? 207 GLU C C     1 
ATOM 2937  O O     . GLU B 2 207 ? -226.605 137.742 133.316 1.00 92.99  ? 207 GLU C O     1 
ATOM 2938  C CB    . GLU B 2 207 ? -227.004 135.341 131.720 1.00 92.99  ? 207 GLU C CB    1 
ATOM 2939  C CG    . GLU B 2 207 ? -227.356 133.968 131.167 1.00 92.99  ? 207 GLU C CG    1 
ATOM 2940  C CD    . GLU B 2 207 ? -228.766 133.764 130.695 1.00 92.99  ? 207 GLU C CD    1 
ATOM 2941  O OE1   . GLU B 2 207 ? -229.539 134.725 130.560 1.00 92.99  ? 207 GLU C OE1   1 
ATOM 2942  O OE2   . GLU B 2 207 ? -229.127 132.592 130.517 1.00 92.99  ? 207 GLU C OE2   1 
ATOM 2943  N N     . ARG B 2 208 ? -226.329 136.431 135.125 1.00 85.97  ? 208 ARG C N     1 
ATOM 2944  C CA    . ARG B 2 208 ? -225.699 137.511 135.875 1.00 85.97  ? 208 ARG C CA    1 
ATOM 2945  C C     . ARG B 2 208 ? -224.546 138.168 135.114 1.00 85.97  ? 208 ARG C C     1 
ATOM 2946  O O     . ARG B 2 208 ? -224.108 139.260 135.490 1.00 85.97  ? 208 ARG C O     1 
ATOM 2947  C CB    . ARG B 2 208 ? -225.124 136.990 137.195 1.00 85.97  ? 208 ARG C CB    1 
ATOM 2948  C CG    . ARG B 2 208 ? -226.088 136.784 138.329 1.00 85.97  ? 208 ARG C CG    1 
ATOM 2949  C CD    . ARG B 2 208 ? -226.669 135.403 138.257 1.00 85.97  ? 208 ARG C CD    1 
ATOM 2950  N NE    . ARG B 2 208 ? -225.644 134.377 138.378 1.00 85.97  ? 208 ARG C NE    1 
ATOM 2951  C CZ    . ARG B 2 208 ? -225.837 133.098 138.077 1.00 85.97  ? 208 ARG C CZ    1 
ATOM 2952  N NH1   . ARG B 2 208 ? -227.020 132.685 137.645 1.00 85.97  ? 208 ARG C NH1   1 
ATOM 2953  N NH2   . ARG B 2 208 ? -224.848 132.228 138.215 1.00 85.97  ? 208 ARG C NH2   1 
ATOM 2954  N N     . ASN B 2 209 ? -224.053 137.535 134.047 1.00 80.61  ? 209 ASN C N     1 
ATOM 2955  C CA    . ASN B 2 209 ? -222.908 138.084 133.341 1.00 80.61  ? 209 ASN C CA    1 
ATOM 2956  C C     . ASN B 2 209 ? -223.296 139.388 132.663 1.00 80.61  ? 209 ASN C C     1 
ATOM 2957  O O     . ASN B 2 209 ? -224.443 139.583 132.269 1.00 80.61  ? 209 ASN C O     1 
ATOM 2958  C CB    . ASN B 2 209 ? -222.376 137.119 132.277 1.00 80.61  ? 209 ASN C CB    1 
ATOM 2959  C CG    . ASN B 2 209 ? -221.706 135.918 132.871 1.00 80.61  ? 209 ASN C CG    1 
ATOM 2960  O OD1   . ASN B 2 209 ? -221.220 135.978 133.988 1.00 80.61  ? 209 ASN C OD1   1 
ATOM 2961  N ND2   . ASN B 2 209 ? -221.598 134.843 132.100 1.00 80.61  ? 209 ASN C ND2   1 
ATOM 2962  N N     . VAL B 2 210 ? -222.317 140.276 132.517 1.00 68.49  ? 210 VAL C N     1 
ATOM 2963  C CA    . VAL B 2 210 ? -222.511 141.596 131.923 1.00 68.49  ? 210 VAL C CA    1 
ATOM 2964  C C     . VAL B 2 210 ? -221.237 141.996 131.192 1.00 68.49  ? 210 VAL C C     1 
ATOM 2965  O O     . VAL B 2 210 ? -220.132 141.722 131.665 1.00 68.49  ? 210 VAL C O     1 
ATOM 2966  C CB    . VAL B 2 210 ? -222.869 142.636 133.002 1.00 68.49  ? 210 VAL C CB    1 
ATOM 2967  C CG1   . VAL B 2 210 ? -222.524 144.034 132.544 1.00 68.49  ? 210 VAL C CG1   1 
ATOM 2968  C CG2   . VAL B 2 210 ? -224.321 142.530 133.356 1.00 68.49  ? 210 VAL C CG2   1 
ATOM 2969  N N     . THR B 2 211 ? -221.377 142.616 130.032 1.00 64.31  ? 211 THR C N     1 
ATOM 2970  C CA    . THR B 2 211 ? -220.197 143.078 129.323 1.00 64.31  ? 211 THR C CA    1 
ATOM 2971  C C     . THR B 2 211 ? -219.841 144.496 129.784 1.00 64.31  ? 211 THR C C     1 
ATOM 2972  O O     . THR B 2 211 ? -220.656 145.204 130.374 1.00 64.31  ? 211 THR C O     1 
ATOM 2973  C CB    . THR B 2 211 ? -220.398 143.004 127.819 1.00 64.31  ? 211 THR C CB    1 
ATOM 2974  O OG1   . THR B 2 211 ? -219.220 143.479 127.159 1.00 64.31  ? 211 THR C OG1   1 
ATOM 2975  C CG2   . THR B 2 211 ? -221.582 143.818 127.417 1.00 64.31  ? 211 THR C CG2   1 
ATOM 2976  N N     . ALA B 2 212 ? -218.616 144.915 129.485 1.00 62.18  ? 212 ALA C N     1 
ATOM 2977  C CA    . ALA B 2 212 ? -218.095 146.207 129.919 1.00 62.18  ? 212 ALA C CA    1 
ATOM 2978  C C     . ALA B 2 212 ? -218.674 147.376 129.124 1.00 62.18  ? 212 ALA C C     1 
ATOM 2979  O O     . ALA B 2 212 ? -219.244 147.214 128.044 1.00 62.18  ? 212 ALA C O     1 
ATOM 2980  C CB    . ALA B 2 212 ? -216.576 146.239 129.822 1.00 62.18  ? 212 ALA C CB    1 
ATOM 2981  N N     . GLY B 2 213 ? -218.496 148.574 129.676 1.00 61.70  ? 213 GLY C N     1 
ATOM 2982  C CA    . GLY B 2 213 ? -218.900 149.809 129.043 1.00 61.70  ? 213 GLY C CA    1 
ATOM 2983  C C     . GLY B 2 213 ? -218.152 150.095 127.759 1.00 61.70  ? 213 GLY C C     1 
ATOM 2984  O O     . GLY B 2 213 ? -217.091 149.530 127.487 1.00 61.70  ? 213 GLY C O     1 
ATOM 2985  N N     . PRO B 2 214 ? -218.706 150.981 126.932 1.00 59.98  ? 214 PRO C N     1 
ATOM 2986  C CA    . PRO B 2 214 ? -218.119 151.188 125.601 1.00 59.98  ? 214 PRO C CA    1 
ATOM 2987  C C     . PRO B 2 214 ? -216.799 151.925 125.606 1.00 59.98  ? 214 PRO C C     1 
ATOM 2988  O O     . PRO B 2 214 ? -215.953 151.653 124.751 1.00 59.98  ? 214 PRO C O     1 
ATOM 2989  C CB    . PRO B 2 214 ? -219.192 152.018 124.887 1.00 59.98  ? 214 PRO C CB    1 
ATOM 2990  C CG    . PRO B 2 214 ? -219.883 152.733 125.996 1.00 59.98  ? 214 PRO C CG    1 
ATOM 2991  C CD    . PRO B 2 214 ? -219.903 151.801 127.155 1.00 59.98  ? 214 PRO C CD    1 
ATOM 2992  N N     . LEU B 2 215 ? -216.598 152.859 126.519 1.00 54.04  ? 215 LEU C N     1 
ATOM 2993  C CA    . LEU B 2 215 ? -215.380 153.651 126.569 1.00 54.04  ? 215 LEU C CA    1 
ATOM 2994  C C     . LEU B 2 215 ? -214.460 153.227 127.702 1.00 54.04  ? 215 LEU C C     1 
ATOM 2995  O O     . LEU B 2 215 ? -213.496 153.933 128.007 1.00 54.04  ? 215 LEU C O     1 
ATOM 2996  C CB    . LEU B 2 215 ? -215.728 155.133 126.613 1.00 54.04  ? 215 LEU C CB    1 
ATOM 2997  C CG    . LEU B 2 215 ? -216.850 155.593 127.521 1.00 54.04  ? 215 LEU C CG    1 
ATOM 2998  C CD1   . LEU B 2 215 ? -216.384 155.937 128.898 1.00 54.04  ? 215 LEU C CD1   1 
ATOM 2999  C CD2   . LEU B 2 215 ? -217.481 156.785 126.881 1.00 54.04  ? 215 LEU C CD2   1 
ATOM 3000  N N     . ARG B 2 216 ? -214.719 152.070 128.297 1.00 59.34  ? 216 ARG C N     1 
ATOM 3001  C CA    . ARG B 2 216 ? -214.088 151.677 129.547 1.00 59.34  ? 216 ARG C CA    1 
ATOM 3002  C C     . ARG B 2 216 ? -212.569 151.661 129.434 1.00 59.34  ? 216 ARG C C     1 
ATOM 3003  O O     . ARG B 2 216 ? -212.002 151.000 128.563 1.00 59.34  ? 216 ARG C O     1 
ATOM 3004  C CB    . ARG B 2 216 ? -214.646 150.330 129.975 1.00 59.34  ? 216 ARG C CB    1 
ATOM 3005  C CG    . ARG B 2 216 ? -214.016 149.778 131.171 1.00 59.34  ? 216 ARG C CG    1 
ATOM 3006  C CD    . ARG B 2 216 ? -214.778 148.610 131.649 1.00 59.34  ? 216 ARG C CD    1 
ATOM 3007  N NE    . ARG B 2 216 ? -214.259 148.108 132.907 1.00 59.34  ? 216 ARG C NE    1 
ATOM 3008  C CZ    . ARG B 2 216 ? -214.578 148.643 134.078 1.00 59.34  ? 216 ARG C CZ    1 
ATOM 3009  N NH1   . ARG B 2 216 ? -215.392 149.680 134.129 1.00 59.34  ? 216 ARG C NH1   1 
ATOM 3010  N NH2   . ARG B 2 216 ? -214.092 148.137 135.197 1.00 59.34  ? 216 ARG C NH2   1 
ATOM 3011  N N     . GLY B 2 217 ? -211.921 152.398 130.335 1.00 58.33  ? 217 GLY C N     1 
ATOM 3012  C CA    . GLY B 2 217 ? -210.476 152.468 130.432 1.00 58.33  ? 217 GLY C CA    1 
ATOM 3013  C C     . GLY B 2 217 ? -209.832 153.339 129.381 1.00 58.33  ? 217 GLY C C     1 
ATOM 3014  O O     . GLY B 2 217 ? -208.702 153.074 128.963 1.00 58.33  ? 217 GLY C O     1 
ATOM 3015  N N     . THR B 2 218 ? -210.522 154.394 128.955 1.00 57.47  ? 218 THR C N     1 
ATOM 3016  C CA    . THR B 2 218 ? -210.055 155.290 127.913 1.00 57.47  ? 218 THR C CA    1 
ATOM 3017  C C     . THR B 2 218 ? -210.118 156.742 128.361 1.00 57.47  ? 218 THR C C     1 
ATOM 3018  O O     . THR B 2 218 ? -210.813 157.095 129.312 1.00 57.47  ? 218 THR C O     1 
ATOM 3019  C CB    . THR B 2 218 ? -210.889 155.128 126.662 1.00 57.47  ? 218 THR C CB    1 
ATOM 3020  O OG1   . THR B 2 218 ? -212.247 155.437 126.984 1.00 57.47  ? 218 THR C OG1   1 
ATOM 3021  C CG2   . THR B 2 218 ? -210.805 153.709 126.153 1.00 57.47  ? 218 THR C CG2   1 
ATOM 3022  N N     . VAL B 2 219 ? -209.402 157.578 127.617 1.00 54.94  ? 219 VAL C N     1 
ATOM 3023  C CA    . VAL B 2 219 ? -209.316 159.022 127.812 1.00 54.94  ? 219 VAL C CA    1 
ATOM 3024  C C     . VAL B 2 219 ? -210.121 159.694 126.710 1.00 54.94  ? 219 VAL C C     1 
ATOM 3025  O O     . VAL B 2 219 ? -209.772 159.569 125.533 1.00 54.94  ? 219 VAL C O     1 
ATOM 3026  C CB    . VAL B 2 219 ? -207.867 159.520 127.781 1.00 54.94  ? 219 VAL C CB    1 
ATOM 3027  C CG1   . VAL B 2 219 ? -207.825 160.994 128.069 1.00 54.94  ? 219 VAL C CG1   1 
ATOM 3028  C CG2   . VAL B 2 219 ? -207.045 158.779 128.786 1.00 54.94  ? 219 VAL C CG2   1 
ATOM 3029  N N     . SER B 2 220 ? -211.187 160.400 127.075 1.00 56.77  ? 220 SER C N     1 
ATOM 3030  C CA    . SER B 2 220 ? -211.962 161.175 126.113 1.00 56.77  ? 220 SER C CA    1 
ATOM 3031  C C     . SER B 2 220 ? -211.421 162.597 126.017 1.00 56.77  ? 220 SER C C     1 
ATOM 3032  O O     . SER B 2 220 ? -211.163 163.243 127.035 1.00 56.77  ? 220 SER C O     1 
ATOM 3033  C CB    . SER B 2 220 ? -213.425 161.212 126.522 1.00 56.77  ? 220 SER C CB    1 
ATOM 3034  O OG    . SER B 2 220 ? -213.551 161.911 127.740 1.00 56.77  ? 220 SER C OG    1 
ATOM 3035  N N     . TYR B 2 221 ? -211.282 163.090 124.780 1.00 60.36  ? 221 TYR C N     1 
ATOM 3036  C CA    . TYR B 2 221 ? -210.692 164.396 124.502 1.00 60.36  ? 221 TYR C CA    1 
ATOM 3037  C C     . TYR B 2 221 ? -211.748 165.373 124.000 1.00 60.36  ? 221 TYR C C     1 
ATOM 3038  O O     . TYR B 2 221 ? -212.188 165.277 122.853 1.00 60.36  ? 221 TYR C O     1 
ATOM 3039  C CB    . TYR B 2 221 ? -209.611 164.211 123.452 1.00 60.36  ? 221 TYR C CB    1 
ATOM 3040  C CG    . TYR B 2 221 ? -208.400 163.527 123.987 1.00 60.36  ? 221 TYR C CG    1 
ATOM 3041  C CD1   . TYR B 2 221 ? -207.395 164.221 124.619 1.00 60.36  ? 221 TYR C CD1   1 
ATOM 3042  C CD2   . TYR B 2 221 ? -208.284 162.160 123.883 1.00 60.36  ? 221 TYR C CD2   1 
ATOM 3043  C CE1   . TYR B 2 221 ? -206.297 163.570 125.110 1.00 60.36  ? 221 TYR C CE1   1 
ATOM 3044  C CE2   . TYR B 2 221 ? -207.201 161.503 124.372 1.00 60.36  ? 221 TYR C CE2   1 
ATOM 3045  C CZ    . TYR B 2 221 ? -206.205 162.209 124.981 1.00 60.36  ? 221 TYR C CZ    1 
ATOM 3046  O OH    . TYR B 2 221 ? -205.112 161.536 125.468 1.00 60.36  ? 221 TYR C OH    1 
ATOM 3047  N N     . HIS B 2 222 ? -212.120 166.332 124.835 1.00 65.02  ? 222 HIS C N     1 
ATOM 3048  C CA    . HIS B 2 222 ? -213.104 167.362 124.506 1.00 65.02  ? 222 HIS C CA    1 
ATOM 3049  C C     . HIS B 2 222 ? -212.471 168.736 124.375 1.00 65.02  ? 222 HIS C C     1 
ATOM 3050  O O     . HIS B 2 222 ? -211.876 169.227 125.348 1.00 65.02  ? 222 HIS C O     1 
ATOM 3051  C CB    . HIS B 2 222 ? -214.224 167.404 125.534 1.00 65.02  ? 222 HIS C CB    1 
ATOM 3052  C CG    . HIS B 2 222 ? -214.937 166.108 125.675 1.00 65.02  ? 222 HIS C CG    1 
ATOM 3053  N ND1   . HIS B 2 222 ? -215.910 165.700 124.791 1.00 65.02  ? 222 HIS C ND1   1 
ATOM 3054  C CD2   . HIS B 2 222 ? -214.839 165.132 126.604 1.00 65.02  ? 222 HIS C CD2   1 
ATOM 3055  C CE1   . HIS B 2 222 ? -216.367 164.520 125.159 1.00 65.02  ? 222 HIS C CE1   1 
ATOM 3056  N NE2   . HIS B 2 222 ? -215.736 164.154 126.259 1.00 65.02  ? 222 HIS C NE2   1 
ATOM 3057  N N     . PRO B 2 223 ? -212.502 169.364 123.202 1.00 66.99  ? 223 PRO C N     1 
ATOM 3058  C CA    . PRO B 2 223 ? -211.928 170.702 123.092 1.00 66.99  ? 223 PRO C CA    1 
ATOM 3059  C C     . PRO B 2 223 ? -212.803 171.701 123.824 1.00 66.99  ? 223 PRO C C     1 
ATOM 3060  O O     . PRO B 2 223 ? -214.024 171.556 123.902 1.00 66.99  ? 223 PRO C O     1 
ATOM 3061  C CB    . PRO B 2 223 ? -211.945 170.969 121.587 1.00 66.99  ? 223 PRO C CB    1 
ATOM 3062  C CG    . PRO B 2 223 ? -213.040 170.127 121.088 1.00 66.99  ? 223 PRO C CG    1 
ATOM 3063  C CD    . PRO B 2 223 ? -213.061 168.897 121.927 1.00 66.99  ? 223 PRO C CD    1 
ATOM 3064  N N     . LEU B 2 224 ? -212.147 172.703 124.397 1.00 72.94  ? 224 LEU C N     1 
ATOM 3065  C CA    . LEU B 2 224 ? -212.765 173.777 125.150 1.00 72.94  ? 224 LEU C CA    1 
ATOM 3066  C C     . LEU B 2 224 ? -212.507 175.115 124.481 1.00 72.94  ? 224 LEU C C     1 
ATOM 3067  O O     . LEU B 2 224 ? -211.669 175.243 123.588 1.00 72.94  ? 224 LEU C O     1 
ATOM 3068  C CB    . LEU B 2 224 ? -212.173 173.849 126.561 1.00 72.94  ? 224 LEU C CB    1 
ATOM 3069  C CG    . LEU B 2 224 ? -212.661 173.055 127.751 1.00 72.94  ? 224 LEU C CG    1 
ATOM 3070  C CD1   . LEU B 2 224 ? -211.808 173.450 128.926 1.00 72.94  ? 224 LEU C CD1   1 
ATOM 3071  C CD2   . LEU B 2 224 ? -214.103 173.359 128.027 1.00 72.94  ? 224 LEU C CD2   1 
ATOM 3072  N N     . GLY B 2 225 ? -213.230 176.124 124.944 1.00 84.07  ? 225 GLY C N     1 
ATOM 3073  C CA    . GLY B 2 225 ? -213.002 177.476 124.495 1.00 84.07  ? 225 GLY C CA    1 
ATOM 3074  C C     . GLY B 2 225 ? -213.067 178.464 125.638 1.00 84.07  ? 225 GLY C C     1 
ATOM 3075  O O     . GLY B 2 225 ? -212.855 178.131 126.810 1.00 84.07  ? 225 GLY C O     1 
ATOM 3076  N N     . ARG B 2 226 ? -213.381 179.707 125.260 1.00 88.38  ? 226 ARG C N     1 
ATOM 3077  C CA    . ARG B 2 226 ? -213.582 180.795 126.203 1.00 88.38  ? 226 ARG C CA    1 
ATOM 3078  C C     . ARG B 2 226 ? -214.979 180.768 126.790 1.00 88.38  ? 226 ARG C C     1 
ATOM 3079  O O     . ARG B 2 226 ? -215.163 181.211 127.927 1.00 88.38  ? 226 ARG C O     1 
ATOM 3080  C CB    . ARG B 2 226 ? -213.149 182.141 125.615 1.00 88.38  ? 226 ARG C CB    1 
ATOM 3081  C CG    . ARG B 2 226 ? -211.882 181.961 124.816 1.00 88.38  ? 226 ARG C CG    1 
ATOM 3082  C CD    . ARG B 2 226 ? -211.257 183.265 124.295 1.00 88.38  ? 226 ARG C CD    1 
ATOM 3083  N NE    . ARG B 2 226 ? -211.888 183.807 123.103 1.00 88.38  ? 226 ARG C NE    1 
ATOM 3084  C CZ    . ARG B 2 226 ? -212.703 184.848 123.033 1.00 88.38  ? 226 ARG C CZ    1 
ATOM 3085  N NH1   . ARG B 2 226 ? -213.030 185.541 124.114 1.00 88.38  ? 226 ARG C NH1   1 
ATOM 3086  N NH2   . ARG B 2 226 ? -213.179 185.201 121.848 1.00 88.38  ? 226 ARG C NH2   1 
ATOM 3087  N N     . THR B 2 227 ? -215.985 180.310 126.046 1.00 89.60  ? 227 THR C N     1 
ATOM 3088  C CA    . THR B 2 227 ? -217.305 180.277 126.649 1.00 89.60  ? 227 THR C CA    1 
ATOM 3089  C C     . THR B 2 227 ? -217.907 178.907 126.384 1.00 89.60  ? 227 THR C C     1 
ATOM 3090  O O     . THR B 2 227 ? -217.380 178.127 125.590 1.00 89.60  ? 227 THR C O     1 
ATOM 3091  C CB    . THR B 2 227 ? -218.214 181.368 126.067 1.00 89.60  ? 227 THR C CB    1 
ATOM 3092  O OG1   . THR B 2 227 ? -218.125 181.347 124.639 1.00 89.60  ? 227 THR C OG1   1 
ATOM 3093  C CG2   . THR B 2 227 ? -217.786 182.745 126.564 1.00 89.60  ? 227 THR C CG2   1 
ATOM 3094  N N     . LEU B 2 228 ? -219.042 178.629 127.033 1.00 85.95  ? 228 LEU C N     1 
ATOM 3095  C CA    . LEU B 2 228 ? -219.689 177.326 126.882 1.00 85.95  ? 228 LEU C CA    1 
ATOM 3096  C C     . LEU B 2 228 ? -220.098 177.048 125.456 1.00 85.95  ? 228 LEU C C     1 
ATOM 3097  O O     . LEU B 2 228 ? -219.751 176.011 124.871 1.00 85.95  ? 228 LEU C O     1 
ATOM 3098  C CB    . LEU B 2 228 ? -220.938 177.268 127.760 1.00 85.95  ? 228 LEU C CB    1 
ATOM 3099  C CG    . LEU B 2 228 ? -220.968 176.713 129.159 1.00 85.95  ? 228 LEU C CG    1 
ATOM 3100  C CD1   . LEU B 2 228 ? -222.309 177.011 129.741 1.00 85.95  ? 228 LEU C CD1   1 
ATOM 3101  C CD2   . LEU B 2 228 ? -220.881 175.196 129.004 1.00 85.95  ? 228 LEU C CD2   1 
ATOM 3102  N N     . PHE B 2 229 ? -220.787 178.015 124.868 1.00 91.49  ? 229 PHE C N     1 
ATOM 3103  C CA    . PHE B 2 229 ? -221.424 177.832 123.577 1.00 91.49  ? 229 PHE C CA    1 
ATOM 3104  C C     . PHE B 2 229 ? -220.385 177.362 122.571 1.00 91.49  ? 229 PHE C C     1 
ATOM 3105  O O     . PHE B 2 229 ? -220.576 176.345 121.889 1.00 91.49  ? 229 PHE C O     1 
ATOM 3106  C CB    . PHE B 2 229 ? -222.131 179.123 123.195 1.00 91.49  ? 229 PHE C CB    1 
ATOM 3107  C CG    . PHE B 2 229 ? -222.677 179.148 121.821 1.00 91.49  ? 229 PHE C CG    1 
ATOM 3108  C CD1   . PHE B 2 229 ? -223.929 178.599 121.613 1.00 91.49  ? 229 PHE C CD1   1 
ATOM 3109  C CD2   . PHE B 2 229 ? -222.034 179.757 120.765 1.00 91.49  ? 229 PHE C CD2   1 
ATOM 3110  C CE1   . PHE B 2 229 ? -224.519 178.616 120.380 1.00 91.49  ? 229 PHE C CE1   1 
ATOM 3111  C CE2   . PHE B 2 229 ? -222.627 179.772 119.512 1.00 91.49  ? 229 PHE C CE2   1 
ATOM 3112  C CZ    . PHE B 2 229 ? -223.870 179.208 119.326 1.00 91.49  ? 229 PHE C CZ    1 
ATOM 3113  N N     . GLU B 2 230 ? -219.194 177.969 122.633 1.00 87.90  ? 230 GLU C N     1 
ATOM 3114  C CA    . GLU B 2 230 ? -218.118 177.616 121.717 1.00 87.90  ? 230 GLU C CA    1 
ATOM 3115  C C     . GLU B 2 230 ? -217.812 176.145 121.821 1.00 87.90  ? 230 GLU C C     1 
ATOM 3116  O O     . GLU B 2 230 ? -217.736 175.448 120.809 1.00 87.90  ? 230 GLU C O     1 
ATOM 3117  C CB    . GLU B 2 230 ? -216.840 178.366 122.097 1.00 87.90  ? 230 GLU C CB    1 
ATOM 3118  C CG    . GLU B 2 230 ? -215.825 178.637 121.011 1.00 87.90  ? 230 GLU C CG    1 
ATOM 3119  C CD    . GLU B 2 230 ? -214.717 179.543 121.526 1.00 87.90  ? 230 GLU C CD    1 
ATOM 3120  O OE1   . GLU B 2 230 ? -214.815 179.953 122.699 1.00 87.90  ? 230 GLU C OE1   1 
ATOM 3121  O OE2   . GLU B 2 230 ? -213.708 179.768 120.828 1.00 87.90  ? 230 GLU C OE2   1 
ATOM 3122  N N     . SER B 2 231 ? -217.656 175.649 123.039 1.00 84.01  ? 231 SER C N     1 
ATOM 3123  C CA    . SER B 2 231 ? -217.241 174.270 123.191 1.00 84.01  ? 231 SER C CA    1 
ATOM 3124  C C     . SER B 2 231 ? -218.325 173.358 122.660 1.00 84.01  ? 231 SER C C     1 
ATOM 3125  O O     . SER B 2 231 ? -218.059 172.455 121.860 1.00 84.01  ? 231 SER C O     1 
ATOM 3126  C CB    . SER B 2 231 ? -216.942 173.982 124.656 1.00 84.01  ? 231 SER C CB    1 
ATOM 3127  O OG    . SER B 2 231 ? -215.997 174.910 125.160 1.00 84.01  ? 231 SER C OG    1 
ATOM 3128  N N     . LEU B 2 232 ? -219.569 173.635 123.036 1.00 82.38  ? 232 LEU C N     1 
ATOM 3129  C CA    . LEU B 2 232 ? -220.659 172.782 122.590 1.00 82.38  ? 232 LEU C CA    1 
ATOM 3130  C C     . LEU B 2 232 ? -220.728 172.673 121.066 1.00 82.38  ? 232 LEU C C     1 
ATOM 3131  O O     . LEU B 2 232 ? -220.938 171.574 120.544 1.00 82.38  ? 232 LEU C O     1 
ATOM 3132  C CB    . LEU B 2 232 ? -221.974 173.250 123.213 1.00 82.38  ? 232 LEU C CB    1 
ATOM 3133  C CG    . LEU B 2 232 ? -222.128 172.925 124.716 1.00 82.38  ? 232 LEU C CG    1 
ATOM 3134  C CD1   . LEU B 2 232 ? -221.080 173.507 125.614 1.00 82.38  ? 232 LEU C CD1   1 
ATOM 3135  C CD2   . LEU B 2 232 ? -223.461 173.375 125.267 1.00 82.38  ? 232 LEU C CD2   1 
ATOM 3136  N N     . ILE B 2 233 ? -220.497 173.796 120.392 1.00 85.61  ? 233 ILE C N     1 
ATOM 3137  C CA    . ILE B 2 233 ? -220.485 173.848 118.939 1.00 85.61  ? 233 ILE C CA    1 
ATOM 3138  C C     . ILE B 2 233 ? -219.312 173.025 118.414 1.00 85.61  ? 233 ILE C C     1 
ATOM 3139  O O     . ILE B 2 233 ? -219.504 172.120 117.602 1.00 85.61  ? 233 ILE C O     1 
ATOM 3140  C CB    . ILE B 2 233 ? -220.363 175.293 118.425 1.00 85.61  ? 233 ILE C CB    1 
ATOM 3141  N N     . LEU B 2 234 ? -218.119 173.318 118.915 1.00 83.93  ? 234 LEU C N     1 
ATOM 3142  C CA    . LEU B 2 234 ? -216.919 172.603 118.506 1.00 83.93  ? 234 LEU C CA    1 
ATOM 3143  C C     . LEU B 2 234 ? -216.847 171.160 119.015 1.00 83.93  ? 234 LEU C C     1 
ATOM 3144  O O     . LEU B 2 234 ? -215.930 170.428 118.643 1.00 83.93  ? 234 LEU C O     1 
ATOM 3145  C CB    . LEU B 2 234 ? -215.668 173.371 118.945 1.00 83.93  ? 234 LEU C CB    1 
ATOM 3146  N N     . ASN B 2 235 ? -217.791 170.738 119.856 1.00 81.30  ? 235 ASN C N     1 
ATOM 3147  C CA    . ASN B 2 235 ? -217.734 169.362 120.353 1.00 81.30  ? 235 ASN C CA    1 
ATOM 3148  C C     . ASN B 2 235 ? -218.428 168.298 119.497 1.00 81.30  ? 235 ASN C C     1 
ATOM 3149  O O     . ASN B 2 235 ? -218.348 167.126 119.856 1.00 81.30  ? 235 ASN C O     1 
ATOM 3150  C CB    . ASN B 2 235 ? -218.363 169.313 121.749 1.00 81.30  ? 235 ASN C CB    1 
ATOM 3151  C CG    . ASN B 2 235 ? -217.401 169.699 122.851 1.00 81.30  ? 235 ASN C CG    1 
ATOM 3152  O OD1   . ASN B 2 235 ? -216.196 169.829 122.632 1.00 81.30  ? 235 ASN C OD1   1 
ATOM 3153  N ND2   . ASN B 2 235 ? -217.938 169.923 124.042 1.00 81.30  ? 235 ASN C ND2   1 
ATOM 3154  N N     . ILE B 2 236 ? -219.137 168.629 118.430 1.00 85.89  ? 236 ILE C N     1 
ATOM 3155  C CA    . ILE B 2 236 ? -219.827 167.554 117.707 1.00 85.89  ? 236 ILE C CA    1 
ATOM 3156  C C     . ILE B 2 236 ? -219.063 166.885 116.565 1.00 85.89  ? 236 ILE C C     1 
ATOM 3157  O O     . ILE B 2 236 ? -218.701 167.558 115.600 1.00 85.89  ? 236 ILE C O     1 
ATOM 3158  C CB    . ILE B 2 236 ? -221.187 168.037 117.163 1.00 85.89  ? 236 ILE C CB    1 
ATOM 3159  N N     . PRO B 2 237 ? -218.823 165.571 116.642 1.00 90.67  ? 237 PRO C N     1 
ATOM 3160  C CA    . PRO B 2 237 ? -218.128 164.965 115.508 1.00 90.67  ? 237 PRO C CA    1 
ATOM 3161  C C     . PRO B 2 237 ? -218.954 165.302 114.290 1.00 90.67  ? 237 PRO C C     1 
ATOM 3162  O O     . PRO B 2 237 ? -220.168 165.487 114.365 1.00 90.67  ? 237 PRO C O     1 
ATOM 3163  C CB    . PRO B 2 237 ? -218.176 163.464 115.801 1.00 90.67  ? 237 PRO C CB    1 
ATOM 3164  C CG    . PRO B 2 237 ? -219.393 163.311 116.565 1.00 90.67  ? 237 PRO C CG    1 
ATOM 3165  C CD    . PRO B 2 237 ? -219.593 164.563 117.381 1.00 90.67  ? 237 PRO C CD    1 
ATOM 3166  N N     . TYR B 2 238 ? -218.291 165.425 113.165 1.00 105.19 ? 238 TYR C N     1 
ATOM 3167  C CA    . TYR B 2 238 ? -219.070 165.709 111.992 1.00 105.19 ? 238 TYR C CA    1 
ATOM 3168  C C     . TYR B 2 238 ? -219.811 164.435 111.651 1.00 105.19 ? 238 TYR C C     1 
ATOM 3169  O O     . TYR B 2 238 ? -219.172 163.416 111.357 1.00 105.19 ? 238 TYR C O     1 
ATOM 3170  C CB    . TYR B 2 238 ? -218.179 166.148 110.849 1.00 105.19 ? 238 TYR C CB    1 
ATOM 3171  C CG    . TYR B 2 238 ? -218.905 166.161 109.545 1.00 105.19 ? 238 TYR C CG    1 
ATOM 3172  C CD1   . TYR B 2 238 ? -219.852 167.133 109.318 1.00 105.19 ? 238 TYR C CD1   1 
ATOM 3173  C CD2   . TYR B 2 238 ? -218.674 165.227 108.559 1.00 105.19 ? 238 TYR C CD2   1 
ATOM 3174  C CE1   . TYR B 2 238 ? -220.539 167.203 108.163 1.00 105.19 ? 238 TYR C CE1   1 
ATOM 3175  C CE2   . TYR B 2 238 ? -219.374 165.287 107.379 1.00 105.19 ? 238 TYR C CE2   1 
ATOM 3176  C CZ    . TYR B 2 238 ? -220.304 166.279 107.193 1.00 105.19 ? 238 TYR C CZ    1 
ATOM 3177  O OH    . TYR B 2 238 ? -220.999 166.348 106.023 1.00 105.19 ? 238 TYR C OH    1 
ATOM 3178  N N     . PRO B 2 239 ? -221.144 164.446 111.628 1.00 101.77 ? 239 PRO C N     1 
ATOM 3179  C CA    . PRO B 2 239 ? -221.845 163.231 111.224 1.00 101.77 ? 239 PRO C CA    1 
ATOM 3180  C C     . PRO B 2 239 ? -221.750 163.060 109.721 1.00 101.77 ? 239 PRO C C     1 
ATOM 3181  O O     . PRO B 2 239 ? -222.127 163.944 108.951 1.00 101.77 ? 239 PRO C O     1 
ATOM 3182  C CB    . PRO B 2 239 ? -223.288 163.494 111.673 1.00 101.77 ? 239 PRO C CB    1 
ATOM 3183  C CG    . PRO B 2 239 ? -223.421 164.971 111.588 1.00 101.77 ? 239 PRO C CG    1 
ATOM 3184  C CD    . PRO B 2 239 ? -222.074 165.535 111.964 1.00 101.77 ? 239 PRO C CD    1 
ATOM 3185  N N     . GLY B 2 240 ? -221.201 161.925 109.310 1.00 104.15 ? 240 GLY C N     1 
ATOM 3186  C CA    . GLY B 2 240 ? -221.254 161.567 107.918 1.00 104.15 ? 240 GLY C CA    1 
ATOM 3187  C C     . GLY B 2 240 ? -222.685 161.342 107.487 1.00 104.15 ? 240 GLY C C     1 
ATOM 3188  O O     . GLY B 2 240 ? -223.577 161.093 108.297 1.00 104.15 ? 240 GLY C O     1 
ATOM 3189  N N     . THR B 2 241 ? -222.909 161.456 106.191 1.00 110.29 ? 241 THR C N     1 
ATOM 3190  C CA    . THR B 2 241 ? -224.238 161.217 105.656 1.00 110.29 ? 241 THR C CA    1 
ATOM 3191  C C     . THR B 2 241 ? -224.606 159.749 105.849 1.00 110.29 ? 241 THR C C     1 
ATOM 3192  O O     . THR B 2 241 ? -223.831 158.848 105.508 1.00 110.29 ? 241 THR C O     1 
ATOM 3193  C CB    . THR B 2 241 ? -224.296 161.625 104.189 1.00 110.29 ? 241 THR C CB    1 
ATOM 3194  O OG1   . THR B 2 241 ? -225.560 161.242 103.631 1.00 110.29 ? 241 THR C OG1   1 
ATOM 3195  C CG2   . THR B 2 241 ? -223.161 160.990 103.410 1.00 110.29 ? 241 THR C CG2   1 
ATOM 3196  N N     . GLY B 2 242 ? -225.787 159.509 106.401 1.00 106.92 ? 242 GLY C N     1 
ATOM 3197  C CA    . GLY B 2 242 ? -226.202 158.152 106.696 1.00 106.92 ? 242 GLY C CA    1 
ATOM 3198  C C     . GLY B 2 242 ? -227.586 158.147 107.300 1.00 106.92 ? 242 GLY C C     1 
ATOM 3199  O O     . GLY B 2 242 ? -228.299 159.150 107.258 1.00 106.92 ? 242 GLY C O     1 
ATOM 3200  N N     . ALA B 2 243 ? -227.960 157.014 107.887 1.00 105.24 ? 243 ALA C N     1 
ATOM 3201  C CA    . ALA B 2 243 ? -229.312 156.898 108.414 1.00 105.24 ? 243 ALA C CA    1 
ATOM 3202  C C     . ALA B 2 243 ? -229.555 157.874 109.553 1.00 105.24 ? 243 ALA C C     1 
ATOM 3203  O O     . ALA B 2 243 ? -228.688 158.101 110.399 1.00 105.24 ? 243 ALA C O     1 
ATOM 3204  C CB    . ALA B 2 243 ? -229.574 155.476 108.903 1.00 105.24 ? 243 ALA C CB    1 
ATOM 3205  N N     . ALA B 2 244 ? -230.752 158.451 109.566 1.00 107.30 ? 244 ALA C N     1 
ATOM 3206  C CA    . ALA B 2 244 ? -231.147 159.320 110.659 1.00 107.30 ? 244 ALA C CA    1 
ATOM 3207  C C     . ALA B 2 244 ? -231.135 158.538 111.959 1.00 107.30 ? 244 ALA C C     1 
ATOM 3208  O O     . ALA B 2 244 ? -231.578 157.388 112.019 1.00 107.30 ? 244 ALA C O     1 
ATOM 3209  C CB    . ALA B 2 244 ? -232.533 159.906 110.406 1.00 107.30 ? 244 ALA C CB    1 
ATOM 3210  N N     . ASP B 2 245 ? -230.641 159.172 113.009 1.00 101.40 ? 245 ASP C N     1 
ATOM 3211  C CA    . ASP B 2 245 ? -230.379 158.483 114.256 1.00 101.40 ? 245 ASP C CA    1 
ATOM 3212  C C     . ASP B 2 245 ? -231.062 159.213 115.394 1.00 101.40 ? 245 ASP C C     1 
ATOM 3213  O O     . ASP B 2 245 ? -231.512 160.353 115.254 1.00 101.40 ? 245 ASP C O     1 
ATOM 3214  C CB    . ASP B 2 245 ? -228.882 158.352 114.513 1.00 101.40 ? 245 ASP C CB    1 
ATOM 3215  C CG    . ASP B 2 245 ? -228.575 157.298 115.526 1.00 101.40 ? 245 ASP C CG    1 
ATOM 3216  O OD1   . ASP B 2 245 ? -229.505 156.538 115.863 1.00 101.40 ? 245 ASP C OD1   1 
ATOM 3217  O OD2   . ASP B 2 245 ? -227.401 157.187 115.934 1.00 101.40 ? 245 ASP C OD2   1 
ATOM 3218  N N     . LEU B 2 246 ? -231.132 158.557 116.532 1.00 95.29  ? 246 LEU C N     1 
ATOM 3219  C CA    . LEU B 2 246 ? -231.717 159.182 117.691 1.00 95.29  ? 246 LEU C CA    1 
ATOM 3220  C C     . LEU B 2 246 ? -231.030 158.559 118.892 1.00 95.29  ? 246 LEU C C     1 
ATOM 3221  O O     . LEU B 2 246 ? -230.302 157.574 118.762 1.00 95.29  ? 246 LEU C O     1 
ATOM 3222  C CB    . LEU B 2 246 ? -233.243 159.090 117.695 1.00 95.29  ? 246 LEU C CB    1 
ATOM 3223  C CG    . LEU B 2 246 ? -233.849 157.864 117.008 1.00 95.29  ? 246 LEU C CG    1 
ATOM 3224  C CD1   . LEU B 2 246 ? -234.297 156.838 118.037 1.00 95.29  ? 246 LEU C CD1   1 
ATOM 3225  C CD2   . LEU B 2 246 ? -235.008 158.269 116.109 1.00 95.29  ? 246 LEU C CD2   1 
ATOM 3226  N N     . ALA B 2 247 ? -231.241 159.149 120.053 1.00 89.82  ? 247 ALA C N     1 
ATOM 3227  C CA    . ALA B 2 247 ? -230.568 158.726 121.262 1.00 89.82  ? 247 ALA C CA    1 
ATOM 3228  C C     . ALA B 2 247 ? -231.369 157.646 121.980 1.00 89.82  ? 247 ALA C C     1 
ATOM 3229  O O     . ALA B 2 247 ? -232.461 157.261 121.563 1.00 89.82  ? 247 ALA C O     1 
ATOM 3230  C CB    . ALA B 2 247 ? -230.330 159.928 122.163 1.00 89.82  ? 247 ALA C CB    1 
ATOM 3231  N N     . PHE B 2 248 ? -230.821 157.177 123.103 1.00 86.77  ? 248 PHE C N     1 
ATOM 3232  C CA    . PHE B 2 248 ? -231.541 156.237 123.954 1.00 86.77  ? 248 PHE C CA    1 
ATOM 3233  C C     . PHE B 2 248 ? -232.805 156.870 124.499 1.00 86.77  ? 248 PHE C C     1 
ATOM 3234  O O     . PHE B 2 248 ? -233.842 156.213 124.621 1.00 86.77  ? 248 PHE C O     1 
ATOM 3235  C CB    . PHE B 2 248 ? -230.642 155.798 125.110 1.00 86.77  ? 248 PHE C CB    1 
ATOM 3236  C CG    . PHE B 2 248 ? -231.262 154.775 126.002 1.00 86.77  ? 248 PHE C CG    1 
ATOM 3237  C CD1   . PHE B 2 248 ? -231.226 153.435 125.684 1.00 86.77  ? 248 PHE C CD1   1 
ATOM 3238  C CD2   . PHE B 2 248 ? -231.922 155.169 127.152 1.00 86.77  ? 248 PHE C CD2   1 
ATOM 3239  C CE1   . PHE B 2 248 ? -231.814 152.507 126.510 1.00 86.77  ? 248 PHE C CE1   1 
ATOM 3240  C CE2   . PHE B 2 248 ? -232.513 154.250 127.975 1.00 86.77  ? 248 PHE C CE2   1 
ATOM 3241  C CZ    . PHE B 2 248 ? -232.460 152.915 127.654 1.00 86.77  ? 248 PHE C CZ    1 
ATOM 3242  N N     . TRP B 2 249 ? -232.750 158.161 124.796 1.00 88.26  ? 249 TRP C N     1 
ATOM 3243  C CA    . TRP B 2 249 ? -233.942 158.832 125.294 1.00 88.26  ? 249 TRP C CA    1 
ATOM 3244  C C     . TRP B 2 249 ? -234.821 159.338 124.146 1.00 88.26  ? 249 TRP C C     1 
ATOM 3245  O O     . TRP B 2 249 ? -235.943 159.780 124.365 1.00 88.26  ? 249 TRP C O     1 
ATOM 3246  C CB    . TRP B 2 249 ? -233.602 159.937 126.295 1.00 88.26  ? 249 TRP C CB    1 
ATOM 3247  C CG    . TRP B 2 249 ? -233.008 161.154 125.696 1.00 88.26  ? 249 TRP C CG    1 
ATOM 3248  C CD1   . TRP B 2 249 ? -233.655 162.309 125.385 1.00 88.26  ? 249 TRP C CD1   1 
ATOM 3249  C CD2   . TRP B 2 249 ? -231.636 161.357 125.352 1.00 88.26  ? 249 TRP C CD2   1 
ATOM 3250  N NE1   . TRP B 2 249 ? -232.774 163.218 124.860 1.00 88.26  ? 249 TRP C NE1   1 
ATOM 3251  C CE2   . TRP B 2 249 ? -231.525 162.655 124.827 1.00 88.26  ? 249 TRP C CE2   1 
ATOM 3252  C CE3   . TRP B 2 249 ? -230.491 160.564 125.429 1.00 88.26  ? 249 TRP C CE3   1 
ATOM 3253  C CZ2   . TRP B 2 249 ? -230.315 163.177 124.382 1.00 88.26  ? 249 TRP C CZ2   1 
ATOM 3254  C CZ3   . TRP B 2 249 ? -229.296 161.086 124.988 1.00 88.26  ? 249 TRP C CZ3   1 
ATOM 3255  C CH2   . TRP B 2 249 ? -229.217 162.377 124.472 1.00 88.26  ? 249 TRP C CH2   1 
ATOM 3256  N N     . GLU B 2 250 ? -234.311 159.259 122.921 1.00 90.49  ? 250 GLU C N     1 
ATOM 3257  C CA    . GLU B 2 250 ? -235.069 159.675 121.753 1.00 90.49  ? 250 GLU C CA    1 
ATOM 3258  C C     . GLU B 2 250 ? -235.710 158.449 121.097 1.00 90.49  ? 250 GLU C C     1 
ATOM 3259  O O     . GLU B 2 250 ? -236.378 158.567 120.069 1.00 90.49  ? 250 GLU C O     1 
ATOM 3260  C CB    . GLU B 2 250 ? -234.165 160.398 120.754 1.00 90.49  ? 250 GLU C CB    1 
ATOM 3261  C CG    . GLU B 2 250 ? -233.395 161.568 121.346 1.00 90.49  ? 250 GLU C CG    1 
ATOM 3262  C CD    . GLU B 2 250 ? -232.837 162.496 120.285 1.00 90.49  ? 250 GLU C CD    1 
ATOM 3263  O OE1   . GLU B 2 250 ? -231.924 162.073 119.545 1.00 90.49  ? 250 GLU C OE1   1 
ATOM 3264  O OE2   . GLU B 2 250 ? -233.311 163.648 120.191 1.00 90.49  ? 250 GLU C OE2   1 
ATOM 3265  N N     . GLN B 2 251 ? -235.504 157.276 121.695 1.00 90.77  ? 251 GLN C N     1 
ATOM 3266  C CA    . GLN B 2 251 ? -236.060 156.047 121.167 1.00 90.77  ? 251 GLN C CA    1 
ATOM 3267  C C     . GLN B 2 251 ? -237.565 156.086 121.383 1.00 90.77  ? 251 GLN C C     1 
ATOM 3268  O O     . GLN B 2 251 ? -238.030 156.425 122.474 1.00 90.77  ? 251 GLN C O     1 
ATOM 3269  C CB    . GLN B 2 251 ? -235.461 154.843 121.888 1.00 90.77  ? 251 GLN C CB    1 
ATOM 3270  C CG    . GLN B 2 251 ? -234.038 154.523 121.473 1.00 90.77  ? 251 GLN C CG    1 
ATOM 3271  C CD    . GLN B 2 251 ? -233.906 154.304 119.981 1.00 90.77  ? 251 GLN C CD    1 
ATOM 3272  O OE1   . GLN B 2 251 ? -234.594 154.940 119.185 1.00 90.77  ? 251 GLN C OE1   1 
ATOM 3273  N NE2   . GLN B 2 251 ? -233.017 153.403 119.594 1.00 90.77  ? 251 GLN C NE2   1 
ATOM 3274  N N     . PRO B 2 252 ? -238.344 155.721 120.292 1.00 91.44  ? 252 PRO C N     1 
ATOM 3275  C CA    . PRO B 2 252 ? -239.795 155.772 120.542 1.00 91.44  ? 252 PRO C CA    1 
ATOM 3276  C C     . PRO B 2 252 ? -240.282 154.763 121.587 1.00 91.44  ? 252 PRO C C     1 
ATOM 3277  O O     . PRO B 2 252 ? -241.139 155.084 122.411 1.00 91.44  ? 252 PRO C O     1 
ATOM 3278  C CB    . PRO B 2 252 ? -240.407 155.463 119.173 1.00 91.44  ? 252 PRO C CB    1 
ATOM 3279  C CG    . PRO B 2 252 ? -239.430 154.560 118.536 1.00 91.44  ? 252 PRO C CG    1 
ATOM 3280  C CD    . PRO B 2 252 ? -238.139 155.234 118.855 1.00 91.44  ? 252 PRO C CD    1 
ATOM 3281  N N     . GLU B 2 253 ? -239.737 153.554 121.540 1.00 92.79  ? 253 GLU C N     1 
ATOM 3282  C CA    . GLU B 2 253 ? -240.120 152.494 122.462 1.00 92.79  ? 253 GLU C CA    1 
ATOM 3283  C C     . GLU B 2 253 ? -238.908 151.704 122.944 1.00 92.79  ? 253 GLU C C     1 
ATOM 3284  O O     . GLU B 2 253 ? -237.850 151.744 122.320 1.00 92.79  ? 253 GLU C O     1 
ATOM 3285  C CB    . GLU B 2 253 ? -241.135 151.564 121.808 1.00 92.79  ? 253 GLU C CB    1 
ATOM 3286  C CG    . GLU B 2 253 ? -240.812 151.215 120.370 1.00 92.79  ? 253 GLU C CG    1 
ATOM 3287  C CD    . GLU B 2 253 ? -241.628 150.045 119.866 1.00 92.79  ? 253 GLU C CD    1 
ATOM 3288  O OE1   . GLU B 2 253 ? -242.060 150.086 118.698 1.00 92.79  ? 253 GLU C OE1   1 
ATOM 3289  O OE2   . GLU B 2 253 ? -241.837 149.087 120.636 1.00 92.79  ? 253 GLU C OE2   1 
ATOM 3290  N N     . LEU B 2 254 ? -239.070 150.957 124.035 1.00 90.16  ? 254 LEU C N     1 
ATOM 3291  C CA    . LEU B 2 254 ? -237.978 150.159 124.608 1.00 90.16  ? 254 LEU C CA    1 
ATOM 3292  C C     . LEU B 2 254 ? -237.449 149.057 123.688 1.00 90.16  ? 254 LEU C C     1 
ATOM 3293  O O     . LEU B 2 254 ? -238.202 148.422 122.958 1.00 90.16  ? 254 LEU C O     1 
ATOM 3294  C CB    . LEU B 2 254 ? -238.402 149.563 125.947 1.00 90.16  ? 254 LEU C CB    1 
ATOM 3295  N N     . ASN B 2 255 ? -236.136 148.860 123.728 1.00 88.99  ? 255 ASN C N     1 
ATOM 3296  C CA    . ASN B 2 255 ? -235.436 147.879 122.895 1.00 88.99  ? 255 ASN C CA    1 
ATOM 3297  C C     . ASN B 2 255 ? -235.712 146.388 123.061 1.00 88.99  ? 255 ASN C C     1 
ATOM 3298  O O     . ASN B 2 255 ? -235.810 145.659 122.081 1.00 88.99  ? 255 ASN C O     1 
ATOM 3299  C CB    . ASN B 2 255 ? -233.936 148.068 123.095 1.00 88.99  ? 255 ASN C CB    1 
ATOM 3300  C CG    . ASN B 2 255 ? -233.454 147.489 124.410 1.00 88.99  ? 255 ASN C CG    1 
ATOM 3301  O OD1   . ASN B 2 255 ? -234.053 147.726 125.457 1.00 88.99  ? 255 ASN C OD1   1 
ATOM 3302  N ND2   . ASN B 2 255 ? -232.374 146.716 124.361 1.00 88.99  ? 255 ASN C ND2   1 
ATOM 3303  N N     . ASP B 2 256 ? -235.792 145.958 124.312 1.00 93.47  ? 256 ASP C N     1 
ATOM 3304  C CA    . ASP B 2 256 ? -235.994 144.563 124.706 1.00 93.47  ? 256 ASP C CA    1 
ATOM 3305  C C     . ASP B 2 256 ? -234.572 144.010 124.839 1.00 93.47  ? 256 ASP C C     1 
ATOM 3306  O O     . ASP B 2 256 ? -233.686 144.409 124.082 1.00 93.47  ? 256 ASP C O     1 
ATOM 3307  C CB    . ASP B 2 256 ? -236.897 143.805 123.705 1.00 93.47  ? 256 ASP C CB    1 
ATOM 3308  C CG    . ASP B 2 256 ? -236.390 142.408 123.353 1.00 93.47  ? 256 ASP C CG    1 
ATOM 3309  O OD1   . ASP B 2 256 ? -235.863 141.714 124.242 1.00 93.47  ? 256 ASP C OD1   1 
ATOM 3310  O OD2   . ASP B 2 256 ? -236.533 142.002 122.180 1.00 93.47  ? 256 ASP C OD2   1 
ATOM 3311  N N     . PRO B 2 257 ? -234.362 143.064 125.835 1.00 91.10  ? 257 PRO C N     1 
ATOM 3312  C CA    . PRO B 2 257 ? -232.973 142.581 125.929 1.00 91.10  ? 257 PRO C CA    1 
ATOM 3313  C C     . PRO B 2 257 ? -232.478 141.770 124.747 1.00 91.10  ? 257 PRO C C     1 
ATOM 3314  O O     . PRO B 2 257 ? -231.364 141.967 124.268 1.00 91.10  ? 257 PRO C O     1 
ATOM 3315  C CB    . PRO B 2 257 ? -233.001 141.676 127.156 1.00 91.10  ? 257 PRO C CB    1 
ATOM 3316  C CG    . PRO B 2 257 ? -234.358 141.099 127.134 1.00 91.10  ? 257 PRO C CG    1 
ATOM 3317  C CD    . PRO B 2 257 ? -235.168 142.328 126.905 1.00 91.10  ? 257 PRO C CD    1 
ATOM 3318  N N     . LEU B 2 258 ? -233.317 140.858 124.281 1.00 92.47  ? 258 LEU C N     1 
ATOM 3319  C CA    . LEU B 2 258 ? -232.955 139.982 123.175 1.00 92.47  ? 258 LEU C CA    1 
ATOM 3320  C C     . LEU B 2 258 ? -232.919 140.682 121.826 1.00 92.47  ? 258 LEU C C     1 
ATOM 3321  O O     . LEU B 2 258 ? -233.542 141.720 121.638 1.00 92.47  ? 258 LEU C O     1 
ATOM 3322  C CB    . LEU B 2 258 ? -233.861 138.750 123.156 1.00 92.47  ? 258 LEU C CB    1 
ATOM 3323  C CG    . LEU B 2 258 ? -233.604 137.757 124.297 1.00 92.47  ? 258 LEU C CG    1 
ATOM 3324  C CD1   . LEU B 2 258 ? -233.190 138.462 125.579 1.00 92.47  ? 258 LEU C CD1   1 
ATOM 3325  C CD2   . LEU B 2 258 ? -234.824 136.886 124.540 1.00 92.47  ? 258 LEU C CD2   1 
ATOM 3326  N N     . GLY B 2 259 ? -232.167 140.112 120.895 1.00 97.17  ? 259 GLY C N     1 
ATOM 3327  C CA    . GLY B 2 259 ? -232.040 140.686 119.570 1.00 97.17  ? 259 GLY C CA    1 
ATOM 3328  C C     . GLY B 2 259 ? -230.759 141.475 119.399 1.00 97.17  ? 259 GLY C C     1 
ATOM 3329  O O     . GLY B 2 259 ? -229.898 141.549 120.280 1.00 97.17  ? 259 GLY C O     1 
ATOM 3330  N N     . LEU B 2 260 ? -230.628 142.022 118.226 1.00 98.76  ? 260 LEU C N     1 
ATOM 3331  C CA    . LEU B 2 260 ? -229.432 142.742 117.817 1.00 98.76  ? 260 LEU C CA    1 
ATOM 3332  C C     . LEU B 2 260 ? -229.465 144.204 118.248 1.00 98.76  ? 260 LEU C C     1 
ATOM 3333  O O     . LEU B 2 260 ? -230.525 144.842 118.175 1.00 98.76  ? 260 LEU C O     1 
ATOM 3334  C CB    . LEU B 2 260 ? -229.273 142.669 116.303 1.00 98.76  ? 260 LEU C CB    1 
ATOM 3335  C CG    . LEU B 2 260 ? -230.241 143.555 115.498 1.00 98.76  ? 260 LEU C CG    1 
ATOM 3336  C CD1   . LEU B 2 260 ? -229.796 143.720 114.057 1.00 98.76  ? 260 LEU C CD1   1 
ATOM 3337  C CD2   . LEU B 2 260 ? -231.694 143.077 115.556 1.00 98.76  ? 260 LEU C CD2   1 
ATOM 3338  N N     . PRO B 2 261 ? -228.384 144.717 118.826 1.00 99.80  ? 261 PRO C N     1 
ATOM 3339  C CA    . PRO B 2 261 ? -228.244 146.167 118.990 1.00 99.80  ? 261 PRO C CA    1 
ATOM 3340  C C     . PRO B 2 261 ? -228.077 146.804 117.616 1.00 99.80  ? 261 PRO C C     1 
ATOM 3341  O O     . PRO B 2 261 ? -226.991 146.738 117.033 1.00 99.80  ? 261 PRO C O     1 
ATOM 3342  C CB    . PRO B 2 261 ? -226.996 146.316 119.871 1.00 99.80  ? 261 PRO C CB    1 
ATOM 3343  C CG    . PRO B 2 261 ? -226.782 144.974 120.469 1.00 99.80  ? 261 PRO C CG    1 
ATOM 3344  C CD    . PRO B 2 261 ? -227.283 143.990 119.473 1.00 99.80  ? 261 PRO C CD    1 
ATOM 3345  N N     . GLU B 2 262 ? -229.135 147.379 117.068 1.00 102.57 ? 262 GLU C N     1 
ATOM 3346  C CA    . GLU B 2 262 ? -229.095 147.868 115.697 1.00 102.57 ? 262 GLU C CA    1 
ATOM 3347  C C     . GLU B 2 262 ? -228.055 148.966 115.493 1.00 102.57 ? 262 GLU C C     1 
ATOM 3348  O O     . GLU B 2 262 ? -227.774 149.775 116.381 1.00 102.57 ? 262 GLU C O     1 
ATOM 3349  C CB    . GLU B 2 262 ? -230.460 148.377 115.272 1.00 102.57 ? 262 GLU C CB    1 
ATOM 3350  C CG    . GLU B 2 262 ? -230.974 149.433 116.202 1.00 102.57 ? 262 GLU C CG    1 
ATOM 3351  C CD    . GLU B 2 262 ? -232.297 149.991 115.770 1.00 102.57 ? 262 GLU C CD    1 
ATOM 3352  O OE1   . GLU B 2 262 ? -232.754 149.642 114.663 1.00 102.57 ? 262 GLU C OE1   1 
ATOM 3353  O OE2   . GLU B 2 262 ? -232.885 150.772 116.545 1.00 102.57 ? 262 GLU C OE2   1 
ATOM 3354  N N     . GLU B 2 263 ? -227.480 148.971 114.294 1.00 106.09 ? 263 GLU C N     1 
ATOM 3355  C CA    . GLU B 2 263 ? -226.437 149.917 113.947 1.00 106.09 ? 263 GLU C CA    1 
ATOM 3356  C C     . GLU B 2 263 ? -227.067 151.300 113.793 1.00 106.09 ? 263 GLU C C     1 
ATOM 3357  O O     . GLU B 2 263 ? -228.288 151.441 113.736 1.00 106.09 ? 263 GLU C O     1 
ATOM 3358  C CB    . GLU B 2 263 ? -225.762 149.405 112.663 1.00 106.09 ? 263 GLU C CB    1 
ATOM 3359  C CG    . GLU B 2 263 ? -224.546 150.114 112.068 1.00 106.09 ? 263 GLU C CG    1 
ATOM 3360  C CD    . GLU B 2 263 ? -224.848 151.422 111.359 1.00 106.09 ? 263 GLU C CD    1 
ATOM 3361  O OE1   . GLU B 2 263 ? -226.038 151.735 111.139 1.00 106.09 ? 263 GLU C OE1   1 
ATOM 3362  O OE2   . GLU B 2 263 ? -223.885 152.126 110.997 1.00 106.09 ? 263 GLU C OE2   1 
ATOM 3363  N N     . SER B 2 264 ? -226.236 152.341 113.733 1.00 101.87 ? 264 SER C N     1 
ATOM 3364  C CA    . SER B 2 264 ? -226.781 153.696 113.625 1.00 101.87 ? 264 SER C CA    1 
ATOM 3365  C C     . SER B 2 264 ? -225.739 154.600 112.978 1.00 101.87 ? 264 SER C C     1 
ATOM 3366  O O     . SER B 2 264 ? -224.792 155.023 113.646 1.00 101.87 ? 264 SER C O     1 
ATOM 3367  C CB    . SER B 2 264 ? -227.205 154.212 114.990 1.00 101.87 ? 264 SER C CB    1 
ATOM 3368  O OG    . SER B 2 264 ? -228.291 153.449 115.490 1.00 101.87 ? 264 SER C OG    1 
ATOM 3369  N N     . ALA B 2 265 ? -225.914 154.900 111.695 1.00 101.14 ? 265 ALA C N     1 
ATOM 3370  C CA    . ALA B 2 265 ? -224.932 155.746 111.035 1.00 101.14 ? 265 ALA C CA    1 
ATOM 3371  C C     . ALA B 2 265 ? -224.950 157.166 111.578 1.00 101.14 ? 265 ALA C C     1 
ATOM 3372  O O     . ALA B 2 265 ? -223.941 157.869 111.472 1.00 101.14 ? 265 ALA C O     1 
ATOM 3373  C CB    . ALA B 2 265 ? -225.170 155.765 109.527 1.00 101.14 ? 265 ALA C CB    1 
ATOM 3374  N N     . GLY B 2 266 ? -226.064 157.597 112.153 1.00 95.97  ? 266 GLY C N     1 
ATOM 3375  C CA    . GLY B 2 266 ? -226.137 158.920 112.733 1.00 95.97  ? 266 GLY C CA    1 
ATOM 3376  C C     . GLY B 2 266 ? -225.152 159.105 113.868 1.00 95.97  ? 266 GLY C C     1 
ATOM 3377  O O     . GLY B 2 266 ? -224.561 158.168 114.400 1.00 95.97  ? 266 GLY C O     1 
ATOM 3378  N N     . LEU B 2 267 ? -224.979 160.372 114.242 1.00 89.56  ? 267 LEU C N     1 
ATOM 3379  C CA    . LEU B 2 267 ? -224.017 160.717 115.277 1.00 89.56  ? 267 LEU C CA    1 
ATOM 3380  C C     . LEU B 2 267 ? -224.391 160.147 116.634 1.00 89.56  ? 267 LEU C C     1 
ATOM 3381  O O     . LEU B 2 267 ? -223.494 159.831 117.420 1.00 89.56  ? 267 LEU C O     1 
ATOM 3382  C CB    . LEU B 2 267 ? -223.886 162.234 115.402 1.00 89.56  ? 267 LEU C CB    1 
ATOM 3383  C CG    . LEU B 2 267 ? -225.056 163.020 115.997 1.00 89.56  ? 267 LEU C CG    1 
ATOM 3384  C CD1   . LEU B 2 267 ? -224.629 164.454 116.248 1.00 89.56  ? 267 LEU C CD1   1 
ATOM 3385  C CD2   . LEU B 2 267 ? -226.317 162.964 115.159 1.00 89.56  ? 267 LEU C CD2   1 
ATOM 3386  N N     . ALA B 2 268 ? -225.671 159.871 116.881 1.00 87.04  ? 268 ALA C N     1 
ATOM 3387  C CA    . ALA B 2 268 ? -226.026 159.224 118.137 1.00 87.04  ? 268 ALA C CA    1 
ATOM 3388  C C     . ALA B 2 268 ? -225.471 157.820 118.191 1.00 87.04  ? 268 ALA C C     1 
ATOM 3389  O O     . ALA B 2 268 ? -225.311 157.260 119.277 1.00 87.04  ? 268 ALA C O     1 
ATOM 3390  C CB    . ALA B 2 268 ? -227.536 159.204 118.328 1.00 87.04  ? 268 ALA C CB    1 
ATOM 3391  N N     . GLY B 2 269 ? -225.172 157.253 117.039 1.00 90.01  ? 269 GLY C N     1 
ATOM 3392  C CA    . GLY B 2 269 ? -224.485 155.993 116.967 1.00 90.01  ? 269 GLY C CA    1 
ATOM 3393  C C     . GLY B 2 269 ? -222.998 156.262 116.964 1.00 90.01  ? 269 GLY C C     1 
ATOM 3394  O O     . GLY B 2 269 ? -222.210 155.345 117.209 1.00 90.01  ? 269 GLY C O     1 
ATOM 3395  N N     . ILE B 2 270 ? -222.584 157.508 116.698 1.00 86.50  ? 270 ILE C N     1 
ATOM 3396  C CA    . ILE B 2 270 ? -221.174 157.842 116.835 1.00 86.50  ? 270 ILE C CA    1 
ATOM 3397  C C     . ILE B 2 270 ? -220.880 158.591 118.126 1.00 86.50  ? 270 ILE C C     1 
ATOM 3398  O O     . ILE B 2 270 ? -219.709 158.806 118.454 1.00 86.50  ? 270 ILE C O     1 
ATOM 3399  C CB    . ILE B 2 270 ? -220.710 158.659 115.608 1.00 86.50  ? 270 ILE C CB    1 
ATOM 3400  C CG1   . ILE B 2 270 ? -220.968 157.871 114.334 1.00 86.50  ? 270 ILE C CG1   1 
ATOM 3401  C CG2   . ILE B 2 270 ? -219.218 158.937 115.624 1.00 86.50  ? 270 ILE C CG2   1 
ATOM 3402  C CD1   . ILE B 2 270 ? -220.218 156.579 114.293 1.00 86.50  ? 270 ILE C CD1   1 
ATOM 3403  N N     . LEU B 2 271 ? -221.893 158.936 118.907 1.00 80.09  ? 271 LEU C N     1 
ATOM 3404  C CA    . LEU B 2 271 ? -221.648 159.326 120.284 1.00 80.09  ? 271 LEU C CA    1 
ATOM 3405  C C     . LEU B 2 271 ? -221.812 158.167 121.241 1.00 80.09  ? 271 LEU C C     1 
ATOM 3406  O O     . LEU B 2 271 ? -221.805 158.383 122.455 1.00 80.09  ? 271 LEU C O     1 
ATOM 3407  C CB    . LEU B 2 271 ? -222.538 160.490 120.700 1.00 80.09  ? 271 LEU C CB    1 
ATOM 3408  C CG    . LEU B 2 271 ? -222.167 161.878 120.190 1.00 80.09  ? 271 LEU C CG    1 
ATOM 3409  C CD1   . LEU B 2 271 ? -222.119 162.036 118.708 1.00 80.09  ? 271 LEU C CD1   1 
ATOM 3410  C CD2   . LEU B 2 271 ? -223.197 162.803 120.737 1.00 80.09  ? 271 LEU C CD2   1 
ATOM 3411  N N     . ARG B 2 272 ? -221.934 156.956 120.721 1.00 81.42  ? 272 ARG C N     1 
ATOM 3412  C CA    . ARG B 2 272 ? -222.052 155.797 121.584 1.00 81.42  ? 272 ARG C CA    1 
ATOM 3413  C C     . ARG B 2 272 ? -223.184 156.003 122.565 1.00 81.42  ? 272 ARG C C     1 
ATOM 3414  O O     . ARG B 2 272 ? -223.070 155.730 123.752 1.00 81.42  ? 272 ARG C O     1 
ATOM 3415  C CB    . ARG B 2 272 ? -220.737 155.533 122.302 1.00 81.42  ? 272 ARG C CB    1 
ATOM 3416  C CG    . ARG B 2 272 ? -219.818 154.622 121.514 1.00 81.42  ? 272 ARG C CG    1 
ATOM 3417  C CD    . ARG B 2 272 ? -218.410 155.176 121.428 1.00 81.42  ? 272 ARG C CD    1 
ATOM 3418  N NE    . ARG B 2 272 ? -217.422 154.139 121.701 1.00 81.42  ? 272 ARG C NE    1 
ATOM 3419  C CZ    . ARG B 2 272 ? -217.461 152.919 121.179 1.00 81.42  ? 272 ARG C CZ    1 
ATOM 3420  N NH1   . ARG B 2 272 ? -218.436 152.582 120.346 1.00 81.42  ? 272 ARG C NH1   1 
ATOM 3421  N NH2   . ARG B 2 272 ? -216.523 152.034 121.486 1.00 81.42  ? 272 ARG C NH2   1 
ATOM 3422  N N     . LEU B 2 273 ? -224.280 156.507 122.029 1.00 82.89  ? 273 LEU C N     1 
ATOM 3423  C CA    . LEU B 2 273 ? -225.494 156.798 122.779 1.00 82.89  ? 273 LEU C CA    1 
ATOM 3424  C C     . LEU B 2 273 ? -226.712 156.108 122.217 1.00 82.89  ? 273 LEU C C     1 
ATOM 3425  O O     . LEU B 2 273 ? -227.832 156.366 122.670 1.00 82.89  ? 273 LEU C O     1 
ATOM 3426  C CB    . LEU B 2 273 ? -225.741 158.315 122.836 1.00 82.89  ? 273 LEU C CB    1 
ATOM 3427  C CG    . LEU B 2 273 ? -224.714 159.141 123.597 1.00 82.89  ? 273 LEU C CG    1 
ATOM 3428  C CD1   . LEU B 2 273 ? -225.074 160.601 123.507 1.00 82.89  ? 273 LEU C CD1   1 
ATOM 3429  C CD2   . LEU B 2 273 ? -224.688 158.686 125.022 1.00 82.89  ? 273 LEU C CD2   1 
ATOM 3430  N N     . ASP B 2 274 ? -226.535 155.237 121.227 1.00 89.03  ? 274 ASP C N     1 
ATOM 3431  C CA    . ASP B 2 274 ? -227.752 154.521 120.735 1.00 89.03  ? 274 ASP C CA    1 
ATOM 3432  C C     . ASP B 2 274 ? -228.255 153.504 121.704 1.00 89.03  ? 274 ASP C C     1 
ATOM 3433  O O     . ASP B 2 274 ? -229.470 153.258 121.766 1.00 89.03  ? 274 ASP C O     1 
ATOM 3434  C CB    . ASP B 2 274 ? -227.425 153.787 119.439 1.00 89.03  ? 274 ASP C CB    1 
ATOM 3435  C CG    . ASP B 2 274 ? -226.124 153.015 119.525 1.00 89.03  ? 274 ASP C CG    1 
ATOM 3436  O OD1   . ASP B 2 274 ? -225.763 152.562 120.664 1.00 89.03  ? 274 ASP C OD1   1 
ATOM 3437  O OD2   . ASP B 2 274 ? -225.466 152.804 118.487 1.00 89.03  ? 274 ASP C OD2   1 
ATOM 3438  N N     . HIS B 2 275 ? -227.376 152.898 122.484 1.00 86.42  ? 275 HIS C N     1 
ATOM 3439  C CA    . HIS B 2 275 ? -227.816 151.879 123.427 1.00 86.42  ? 275 HIS C CA    1 
ATOM 3440  C C     . HIS B 2 275 ? -226.672 151.614 124.376 1.00 86.42  ? 275 HIS C C     1 
ATOM 3441  O O     . HIS B 2 275 ? -225.503 151.683 123.987 1.00 86.42  ? 275 HIS C O     1 
ATOM 3442  C CB    . HIS B 2 275 ? -228.108 150.564 122.723 1.00 86.42  ? 275 HIS C CB    1 
ATOM 3443  C CG    . HIS B 2 275 ? -226.917 150.006 122.005 1.00 86.42  ? 275 HIS C CG    1 
ATOM 3444  N ND1   . HIS B 2 275 ? -226.557 150.380 120.730 1.00 86.42  ? 275 HIS C ND1   1 
ATOM 3445  C CD2   . HIS B 2 275 ? -225.940 149.173 122.438 1.00 86.42  ? 275 HIS C CD2   1 
ATOM 3446  C CE1   . HIS B 2 275 ? -225.445 149.754 120.386 1.00 86.42  ? 275 HIS C CE1   1 
ATOM 3447  N NE2   . HIS B 2 275 ? -225.044 149.026 121.411 1.00 86.42  ? 275 HIS C NE2   1 
ATOM 3448  N N     . PHE B 2 276 ? -226.996 151.314 125.612 1.00 76.12  ? 276 PHE C N     1 
ATOM 3449  C CA    . PHE B 2 276 ? -225.922 151.022 126.530 1.00 76.12  ? 276 PHE C CA    1 
ATOM 3450  C C     . PHE B 2 276 ? -225.869 149.533 126.810 1.00 76.12  ? 276 PHE C C     1 
ATOM 3451  O O     . PHE B 2 276 ? -226.886 148.837 126.817 1.00 76.12  ? 276 PHE C O     1 
ATOM 3452  C CB    . PHE B 2 276 ? -226.026 151.830 127.806 1.00 76.12  ? 276 PHE C CB    1 
ATOM 3453  C CG    . PHE B 2 276 ? -225.958 153.289 127.559 1.00 76.12  ? 276 PHE C CG    1 
ATOM 3454  C CD1   . PHE B 2 276 ? -224.728 153.884 127.407 1.00 76.12  ? 276 PHE C CD1   1 
ATOM 3455  C CD2   . PHE B 2 276 ? -227.088 154.069 127.491 1.00 76.12  ? 276 PHE C CD2   1 
ATOM 3456  C CE1   . PHE B 2 276 ? -224.619 155.219 127.169 1.00 76.12  ? 276 PHE C CE1   1 
ATOM 3457  C CE2   . PHE B 2 276 ? -226.985 155.418 127.262 1.00 76.12  ? 276 PHE C CE2   1 
ATOM 3458  C CZ    . PHE B 2 276 ? -225.748 155.993 127.100 1.00 76.12  ? 276 PHE C CZ    1 
ATOM 3459  N N     . ARG B 2 277 ? -224.651 149.068 127.043 1.00 66.55  ? 277 ARG C N     1 
ATOM 3460  C CA    . ARG B 2 277 ? -224.411 147.709 127.489 1.00 66.55  ? 277 ARG C CA    1 
ATOM 3461  C C     . ARG B 2 277 ? -224.869 147.518 128.910 1.00 66.55  ? 277 ARG C C     1 
ATOM 3462  O O     . ARG B 2 277 ? -225.200 146.397 129.304 1.00 66.55  ? 277 ARG C O     1 
ATOM 3463  C CB    . ARG B 2 277 ? -222.963 147.321 127.276 1.00 66.55  ? 277 ARG C CB    1 
ATOM 3464  C CG    . ARG B 2 277 ? -222.633 147.588 125.857 1.00 66.55  ? 277 ARG C CG    1 
ATOM 3465  C CD    . ARG B 2 277 ? -221.610 146.648 125.351 1.00 66.55  ? 277 ARG C CD    1 
ATOM 3466  N NE    . ARG B 2 277 ? -220.248 146.928 125.750 1.00 66.55  ? 277 ARG C NE    1 
ATOM 3467  C CZ    . ARG B 2 277 ? -219.435 147.698 125.046 1.00 66.55  ? 277 ARG C CZ    1 
ATOM 3468  N NH1   . ARG B 2 277 ? -219.858 148.251 123.920 1.00 66.55  ? 277 ARG C NH1   1 
ATOM 3469  N NH2   . ARG B 2 277 ? -218.199 147.905 125.463 1.00 66.55  ? 277 ARG C NH2   1 
ATOM 3470  N N     . HIS B 2 278 ? -224.941 148.603 129.668 1.00 61.64  ? 278 HIS C N     1 
ATOM 3471  C CA    . HIS B 2 278 ? -225.383 148.551 131.057 1.00 61.64  ? 278 HIS C CA    1 
ATOM 3472  C C     . HIS B 2 278 ? -226.767 149.154 131.196 1.00 61.64  ? 278 HIS C C     1 
ATOM 3473  O O     . HIS B 2 278 ? -227.106 150.111 130.512 1.00 61.64  ? 278 HIS C O     1 
ATOM 3474  C CB    . HIS B 2 278 ? -224.402 149.281 131.964 1.00 61.64  ? 278 HIS C CB    1 
ATOM 3475  C CG    . HIS B 2 278 ? -223.486 148.370 132.711 1.00 61.64  ? 278 HIS C CG    1 
ATOM 3476  N ND1   . HIS B 2 278 ? -223.733 147.969 134.004 1.00 61.64  ? 278 HIS C ND1   1 
ATOM 3477  C CD2   . HIS B 2 278 ? -222.331 147.771 132.343 1.00 61.64  ? 278 HIS C CD2   1 
ATOM 3478  C CE1   . HIS B 2 278 ? -222.769 147.161 134.401 1.00 61.64  ? 278 HIS C CE1   1 
ATOM 3479  N NE2   . HIS B 2 278 ? -221.903 147.028 133.414 1.00 61.64  ? 278 HIS C NE2   1 
ATOM 3480  N N     . ALA B 2 279 ? -227.579 148.586 132.070 1.00 68.41  ? 279 ALA C N     1 
ATOM 3481  C CA    . ALA B 2 279 ? -228.945 149.067 132.247 1.00 68.41  ? 279 ALA C CA    1 
ATOM 3482  C C     . ALA B 2 279 ? -229.210 149.361 133.709 1.00 68.41  ? 279 ALA C C     1 
ATOM 3483  O O     . ALA B 2 279 ? -229.194 148.455 134.541 1.00 68.41  ? 279 ALA C O     1 
ATOM 3484  C CB    . ALA B 2 279 ? -229.962 148.050 131.726 1.00 68.41  ? 279 ALA C CB    1 
ATOM 3485  N N     . VAL B 2 280 ? -229.512 150.595 134.015 1.00 70.91  ? 280 VAL C N     1 
ATOM 3486  C CA    . VAL B 2 280 ? -229.633 151.002 135.398 1.00 70.91  ? 280 VAL C CA    1 
ATOM 3487  C C     . VAL B 2 280 ? -231.053 151.423 135.699 1.00 70.91  ? 280 VAL C C     1 
ATOM 3488  O O     . VAL B 2 280 ? -231.740 151.985 134.842 1.00 70.91  ? 280 VAL C O     1 
ATOM 3489  C CB    . VAL B 2 280 ? -228.668 152.160 135.686 1.00 70.91  ? 280 VAL C CB    1 
ATOM 3490  C CG1   . VAL B 2 280 ? -228.641 152.442 137.130 1.00 70.91  ? 280 VAL C CG1   1 
ATOM 3491  C CG2   . VAL B 2 280 ? -227.281 151.807 135.232 1.00 70.91  ? 280 VAL C CG2   1 
ATOM 3492  N N     . LEU B 2 281 ? -231.507 151.144 136.915 1.00 79.59  ? 281 LEU C N     1 
ATOM 3493  C CA    . LEU B 2 281 ? -232.776 151.691 137.357 1.00 79.59  ? 281 LEU C CA    1 
ATOM 3494  C C     . LEU B 2 281 ? -232.579 152.134 138.791 1.00 79.59  ? 281 LEU C C     1 
ATOM 3495  O O     . LEU B 2 281 ? -232.110 151.358 139.620 1.00 79.59  ? 281 LEU C O     1 
ATOM 3496  C CB    . LEU B 2 281 ? -233.905 150.663 137.263 1.00 79.59  ? 281 LEU C CB    1 
ATOM 3497  C CG    . LEU B 2 281 ? -235.267 151.187 137.707 1.00 79.59  ? 281 LEU C CG    1 
ATOM 3498  C CD1   . LEU B 2 281 ? -235.670 152.375 136.896 1.00 79.59  ? 281 LEU C CD1   1 
ATOM 3499  C CD2   . LEU B 2 281 ? -236.323 150.123 137.594 1.00 79.59  ? 281 LEU C CD2   1 
ATOM 3500  N N     . LEU B 2 282 ? -232.946 153.364 139.084 1.00 77.27  ? 282 LEU C N     1 
ATOM 3501  C CA    . LEU B 2 282 ? -232.704 153.961 140.389 1.00 77.27  ? 282 LEU C CA    1 
ATOM 3502  C C     . LEU B 2 282 ? -234.015 154.136 141.132 1.00 77.27  ? 282 LEU C C     1 
ATOM 3503  O O     . LEU B 2 282 ? -234.911 154.841 140.662 1.00 77.27  ? 282 LEU C O     1 
ATOM 3504  C CB    . LEU B 2 282 ? -231.899 155.249 140.278 1.00 77.27  ? 282 LEU C CB    1 
ATOM 3505  C CG    . LEU B 2 282 ? -232.240 156.444 139.429 1.00 77.27  ? 282 LEU C CG    1 
ATOM 3506  C CD1   . LEU B 2 282 ? -233.151 157.327 140.185 1.00 77.27  ? 282 LEU C CD1   1 
ATOM 3507  C CD2   . LEU B 2 282 ? -230.944 157.164 139.118 1.00 77.27  ? 282 LEU C CD2   1 
ATOM 3508  N N     . HIS B 2 283 ? -234.136 153.477 142.249 1.00 78.47  ? 283 HIS C N     1 
ATOM 3509  C CA    . HIS B 2 283 ? -235.314 153.619 143.085 1.00 78.47  ? 283 HIS C CA    1 
ATOM 3510  C C     . HIS B 2 283 ? -235.275 154.936 143.851 1.00 78.47  ? 283 HIS C C     1 
ATOM 3511  O O     . HIS B 2 283 ? -234.309 155.204 144.566 1.00 78.47  ? 283 HIS C O     1 
ATOM 3512  C CB    . HIS B 2 283 ? -235.404 152.461 144.053 1.00 78.47  ? 283 HIS C CB    1 
ATOM 3513  C CG    . HIS B 2 283 ? -236.665 152.442 144.848 1.00 78.47  ? 283 HIS C CG    1 
ATOM 3514  N ND1   . HIS B 2 283 ? -236.738 152.948 146.124 1.00 78.47  ? 283 HIS C ND1   1 
ATOM 3515  C CD2   . HIS B 2 283 ? -237.908 152.006 144.541 1.00 78.47  ? 283 HIS C CD2   1 
ATOM 3516  C CE1   . HIS B 2 283 ? -237.968 152.802 146.583 1.00 78.47  ? 283 HIS C CE1   1 
ATOM 3517  N NE2   . HIS B 2 283 ? -238.698 152.236 145.640 1.00 78.47  ? 283 HIS C NE2   1 
ATOM 3518  N N     . PRO B 2 284 ? -236.305 155.759 143.736 1.00 80.54  ? 284 PRO C N     1 
ATOM 3519  C CA    . PRO B 2 284 ? -236.283 157.092 144.336 1.00 80.54  ? 284 PRO C CA    1 
ATOM 3520  C C     . PRO B 2 284 ? -236.655 157.085 145.811 1.00 80.54  ? 284 PRO C C     1 
ATOM 3521  O O     . PRO B 2 284 ? -237.312 156.175 146.317 1.00 80.54  ? 284 PRO C O     1 
ATOM 3522  C CB    . PRO B 2 284 ? -237.331 157.849 143.521 1.00 80.54  ? 284 PRO C CB    1 
ATOM 3523  C CG    . PRO B 2 284 ? -238.316 156.797 143.153 1.00 80.54  ? 284 PRO C CG    1 
ATOM 3524  C CD    . PRO B 2 284 ? -237.527 155.529 142.946 1.00 80.54  ? 284 PRO C CD    1 
ATOM 3525  N N     . SER B 2 285 ? -236.241 158.142 146.490 1.00 84.32  ? 285 SER C N     1 
ATOM 3526  C CA    . SER B 2 285 ? -236.765 158.414 147.813 1.00 84.32  ? 285 SER C CA    1 
ATOM 3527  C C     . SER B 2 285 ? -238.105 159.123 147.684 1.00 84.32  ? 285 SER C C     1 
ATOM 3528  O O     . SER B 2 285 ? -238.383 159.744 146.657 1.00 84.32  ? 285 SER C O     1 
ATOM 3529  C CB    . SER B 2 285 ? -235.785 159.282 148.594 1.00 84.32  ? 285 SER C CB    1 
ATOM 3530  O OG    . SER B 2 285 ? -235.571 160.514 147.928 1.00 84.32  ? 285 SER C OG    1 
ATOM 3531  N N     . PRO B 2 286 ? -238.965 159.041 148.713 1.00 89.54  ? 286 PRO C N     1 
ATOM 3532  C CA    . PRO B 2 286 ? -240.330 159.591 148.568 1.00 89.54  ? 286 PRO C CA    1 
ATOM 3533  C C     . PRO B 2 286 ? -240.372 161.061 148.207 1.00 89.54  ? 286 PRO C C     1 
ATOM 3534  O O     . PRO B 2 286 ? -241.210 161.475 147.397 1.00 89.54  ? 286 PRO C O     1 
ATOM 3535  C CB    . PRO B 2 286 ? -240.955 159.364 149.952 1.00 89.54  ? 286 PRO C CB    1 
ATOM 3536  C CG    . PRO B 2 286 ? -239.793 159.166 150.868 1.00 89.54  ? 286 PRO C CG    1 
ATOM 3537  C CD    . PRO B 2 286 ? -238.752 158.480 150.056 1.00 89.54  ? 286 PRO C CD    1 
ATOM 3538  N N     . ASP B 2 287 ? -239.466 161.863 148.762 1.00 90.19  ? 287 ASP C N     1 
ATOM 3539  C CA    . ASP B 2 287 ? -239.389 163.266 148.395 1.00 90.19  ? 287 ASP C CA    1 
ATOM 3540  C C     . ASP B 2 287 ? -238.752 163.491 147.041 1.00 90.19  ? 287 ASP C C     1 
ATOM 3541  O O     . ASP B 2 287 ? -239.013 164.523 146.419 1.00 90.19  ? 287 ASP C O     1 
ATOM 3542  C CB    . ASP B 2 287 ? -238.588 164.059 149.429 1.00 90.19  ? 287 ASP C CB    1 
ATOM 3543  C CG    . ASP B 2 287 ? -238.594 165.539 149.142 1.00 90.19  ? 287 ASP C CG    1 
ATOM 3544  O OD1   . ASP B 2 287 ? -239.578 165.998 148.530 1.00 90.19  ? 287 ASP C OD1   1 
ATOM 3545  O OD2   . ASP B 2 287 ? -237.633 166.236 149.536 1.00 90.19  ? 287 ASP C OD2   1 
ATOM 3546  N N     . GLY B 2 288 ? -237.980 162.534 146.554 1.00 88.10  ? 288 GLY C N     1 
ATOM 3547  C CA    . GLY B 2 288 ? -237.160 162.764 145.390 1.00 88.10  ? 288 GLY C CA    1 
ATOM 3548  C C     . GLY B 2 288 ? -235.817 163.388 145.681 1.00 88.10  ? 288 GLY C C     1 
ATOM 3549  O O     . GLY B 2 288 ? -235.085 163.712 144.740 1.00 88.10  ? 288 GLY C O     1 
ATOM 3550  N N     . SER B 2 289 ? -235.444 163.521 146.951 1.00 83.23  ? 289 SER C N     1 
ATOM 3551  C CA    . SER B 2 289 ? -234.165 164.131 147.287 1.00 83.23  ? 289 SER C CA    1 
ATOM 3552  C C     . SER B 2 289 ? -232.990 163.194 147.085 1.00 83.23  ? 289 SER C C     1 
ATOM 3553  O O     . SER B 2 289 ? -231.868 163.665 146.889 1.00 83.23  ? 289 SER C O     1 
ATOM 3554  C CB    . SER B 2 289 ? -234.167 164.590 148.741 1.00 83.23  ? 289 SER C CB    1 
ATOM 3555  O OG    . SER B 2 289 ? -235.295 165.394 148.999 1.00 83.23  ? 289 SER C OG    1 
ATOM 3556  N N     . HIS B 2 290 ? -233.215 161.889 147.141 1.00 81.29  ? 290 HIS C N     1 
ATOM 3557  C CA    . HIS B 2 290 ? -232.119 160.943 147.098 1.00 81.29  ? 290 HIS C CA    1 
ATOM 3558  C C     . HIS B 2 290 ? -232.570 159.675 146.396 1.00 81.29  ? 290 HIS C C     1 
ATOM 3559  O O     . HIS B 2 290 ? -233.762 159.447 146.184 1.00 81.29  ? 290 HIS C O     1 
ATOM 3560  C CB    . HIS B 2 290 ? -231.575 160.631 148.494 1.00 81.29  ? 290 HIS C CB    1 
ATOM 3561  C CG    . HIS B 2 290 ? -231.090 161.830 149.247 1.00 81.29  ? 290 HIS C CG    1 
ATOM 3562  N ND1   . HIS B 2 290 ? -230.042 162.613 148.806 1.00 81.29  ? 290 HIS C ND1   1 
ATOM 3563  C CD2   . HIS B 2 290 ? -231.454 162.337 150.446 1.00 81.29  ? 290 HIS C CD2   1 
ATOM 3564  C CE1   . HIS B 2 290 ? -229.817 163.577 149.680 1.00 81.29  ? 290 HIS C CE1   1 
ATOM 3565  N NE2   . HIS B 2 290 ? -230.657 163.428 150.688 1.00 81.29  ? 290 HIS C NE2   1 
ATOM 3566  N N     . VAL B 2 291 ? -231.599 158.865 146.015 1.00 75.99  ? 291 VAL C N     1 
ATOM 3567  C CA    . VAL B 2 291 ? -231.832 157.497 145.582 1.00 75.99  ? 291 VAL C CA    1 
ATOM 3568  C C     . VAL B 2 291 ? -231.545 156.579 146.752 1.00 75.99  ? 291 VAL C C     1 
ATOM 3569  O O     . VAL B 2 291 ? -230.583 156.795 147.494 1.00 75.99  ? 291 VAL C O     1 
ATOM 3570  C CB    . VAL B 2 291 ? -230.949 157.152 144.373 1.00 75.99  ? 291 VAL C CB    1 
ATOM 3571  C CG1   . VAL B 2 291 ? -231.133 155.717 143.979 1.00 75.99  ? 291 VAL C CG1   1 
ATOM 3572  C CG2   . VAL B 2 291 ? -231.289 158.057 143.229 1.00 75.99  ? 291 VAL C CG2   1 
ATOM 3573  N N     . VAL B 2 292 ? -232.368 155.552 146.924 1.00 74.61  ? 292 VAL C N     1 
ATOM 3574  C CA    . VAL B 2 292 ? -232.243 154.615 148.031 1.00 74.61  ? 292 VAL C CA    1 
ATOM 3575  C C     . VAL B 2 292 ? -231.722 153.264 147.561 1.00 74.61  ? 292 VAL C C     1 
ATOM 3576  O O     . VAL B 2 292 ? -230.811 152.700 148.164 1.00 74.61  ? 292 VAL C O     1 
ATOM 3577  C CB    . VAL B 2 292 ? -233.583 154.457 148.778 1.00 74.61  ? 292 VAL C CB    1 
ATOM 3578  C CG1   . VAL B 2 292 ? -233.424 153.480 149.917 1.00 74.61  ? 292 VAL C CG1   1 
ATOM 3579  C CG2   . VAL B 2 292 ? -234.031 155.791 149.312 1.00 74.61  ? 292 VAL C CG2   1 
ATOM 3580  N N     . ASP B 2 293 ? -232.306 152.713 146.509 1.00 77.71  ? 293 ASP C N     1 
ATOM 3581  C CA    . ASP B 2 293 ? -231.850 151.452 145.953 1.00 77.71  ? 293 ASP C CA    1 
ATOM 3582  C C     . ASP B 2 293 ? -231.531 151.620 144.479 1.00 77.71  ? 293 ASP C C     1 
ATOM 3583  O O     . ASP B 2 293 ? -231.971 152.571 143.843 1.00 77.71  ? 293 ASP C O     1 
ATOM 3584  C CB    . ASP B 2 293 ? -232.899 150.356 146.134 1.00 77.71  ? 293 ASP C CB    1 
ATOM 3585  C CG    . ASP B 2 293 ? -232.995 149.874 147.567 1.00 77.71  ? 293 ASP C CG    1 
ATOM 3586  O OD1   . ASP B 2 293 ? -231.996 150.001 148.299 1.00 77.71  ? 293 ASP C OD1   1 
ATOM 3587  O OD2   . ASP B 2 293 ? -234.067 149.364 147.959 1.00 77.71  ? 293 ASP C OD2   1 
ATOM 3588  N N     . ALA B 2 294 ? -230.705 150.729 143.946 1.00 72.32  ? 294 ALA C N     1 
ATOM 3589  C CA    . ALA B 2 294 ? -230.326 150.815 142.545 1.00 72.32  ? 294 ALA C CA    1 
ATOM 3590  C C     . ALA B 2 294 ? -230.222 149.418 141.965 1.00 72.32  ? 294 ALA C C     1 
ATOM 3591  O O     . ALA B 2 294 ? -229.869 148.463 142.658 1.00 72.32  ? 294 ALA C O     1 
ATOM 3592  C CB    . ALA B 2 294 ? -229.006 151.551 142.352 1.00 72.32  ? 294 ALA C CB    1 
ATOM 3593  N N     . TRP B 2 295 ? -230.537 149.307 140.683 1.00 74.84  ? 295 TRP C N     1 
ATOM 3594  C CA    . TRP B 2 295 ? -230.460 148.052 139.953 1.00 74.84  ? 295 TRP C CA    1 
ATOM 3595  C C     . TRP B 2 295 ? -229.531 148.230 138.760 1.00 74.84  ? 295 TRP C C     1 
ATOM 3596  O O     . TRP B 2 295 ? -229.883 148.931 137.807 1.00 74.84  ? 295 TRP C O     1 
ATOM 3597  C CB    . TRP B 2 295 ? -231.843 147.669 139.460 1.00 74.84  ? 295 TRP C CB    1 
ATOM 3598  C CG    . TRP B 2 295 ? -232.813 147.291 140.496 1.00 74.84  ? 295 TRP C CG    1 
ATOM 3599  C CD1   . TRP B 2 295 ? -232.978 146.071 141.063 1.00 74.84  ? 295 TRP C CD1   1 
ATOM 3600  C CD2   . TRP B 2 295 ? -233.803 148.141 141.073 1.00 74.84  ? 295 TRP C CD2   1 
ATOM 3601  N NE1   . TRP B 2 295 ? -233.998 146.111 141.979 1.00 74.84  ? 295 TRP C NE1   1 
ATOM 3602  C CE2   . TRP B 2 295 ? -234.521 147.376 142.001 1.00 74.84  ? 295 TRP C CE2   1 
ATOM 3603  C CE3   . TRP B 2 295 ? -234.144 149.482 140.901 1.00 74.84  ? 295 TRP C CE3   1 
ATOM 3604  C CZ2   . TRP B 2 295 ? -235.553 147.904 142.754 1.00 74.84  ? 295 TRP C CZ2   1 
ATOM 3605  C CZ3   . TRP B 2 295 ? -235.170 150.002 141.649 1.00 74.84  ? 295 TRP C CZ3   1 
ATOM 3606  C CH2   . TRP B 2 295 ? -235.862 149.218 142.565 1.00 74.84  ? 295 TRP C CH2   1 
ATOM 3607  N N     . VAL B 2 296 ? -228.360 147.611 138.781 1.00 67.92  ? 296 VAL C N     1 
ATOM 3608  C CA    . VAL B 2 296 ? -227.453 147.656 137.639 1.00 67.92  ? 296 VAL C CA    1 
ATOM 3609  C C     . VAL B 2 296 ? -227.465 146.289 136.977 1.00 67.92  ? 296 VAL C C     1 
ATOM 3610  O O     . VAL B 2 296 ? -227.135 145.293 137.626 1.00 67.92  ? 296 VAL C O     1 
ATOM 3611  C CB    . VAL B 2 296 ? -226.028 148.035 138.060 1.00 67.92  ? 296 VAL C CB    1 
ATOM 3612  C CG1   . VAL B 2 296 ? -225.167 148.291 136.842 1.00 67.92  ? 296 VAL C CG1   1 
ATOM 3613  C CG2   . VAL B 2 296 ? -226.054 149.238 138.945 1.00 67.92  ? 296 VAL C CG2   1 
ATOM 3614  N N     . THR B 2 297 ? -227.874 146.219 135.713 1.00 73.81  ? 297 THR C N     1 
ATOM 3615  C CA    . THR B 2 297 ? -227.971 144.922 135.056 1.00 73.81  ? 297 THR C CA    1 
ATOM 3616  C C     . THR B 2 297 ? -227.896 145.107 133.554 1.00 73.81  ? 297 THR C C     1 
ATOM 3617  O O     . THR B 2 297 ? -228.267 146.149 133.030 1.00 73.81  ? 297 THR C O     1 
ATOM 3618  C CB    . THR B 2 297 ? -229.249 144.181 135.428 1.00 73.81  ? 297 THR C CB    1 
ATOM 3619  O OG1   . THR B 2 297 ? -229.419 144.238 136.843 1.00 73.81  ? 297 THR C OG1   1 
ATOM 3620  C CG2   . THR B 2 297 ? -229.144 142.744 135.017 1.00 73.81  ? 297 THR C CG2   1 
ATOM 3621  N N     . TRP B 2 298 ? -227.560 144.026 132.863 1.00 81.11  ? 298 TRP C N     1 
ATOM 3622  C CA    . TRP B 2 298 ? -227.461 144.044 131.414 1.00 81.11  ? 298 TRP C CA    1 
ATOM 3623  C C     . TRP B 2 298 ? -228.773 144.339 130.706 1.00 81.11  ? 298 TRP C C     1 
ATOM 3624  O O     . TRP B 2 298 ? -229.857 143.983 131.166 1.00 81.11  ? 298 TRP C O     1 
ATOM 3625  C CB    . TRP B 2 298 ? -226.898 142.692 131.012 1.00 81.11  ? 298 TRP C CB    1 
ATOM 3626  C CG    . TRP B 2 298 ? -227.859 141.574 131.323 1.00 81.11  ? 298 TRP C CG    1 
ATOM 3627  C CD1   . TRP B 2 298 ? -227.882 140.889 132.504 1.00 81.11  ? 298 TRP C CD1   1 
ATOM 3628  C CD2   . TRP B 2 298 ? -228.908 141.015 130.527 1.00 81.11  ? 298 TRP C CD2   1 
ATOM 3629  N NE1   . TRP B 2 298 ? -228.857 139.938 132.495 1.00 81.11  ? 298 TRP C NE1   1 
ATOM 3630  C CE2   . TRP B 2 298 ? -229.507 139.992 131.295 1.00 81.11  ? 298 TRP C CE2   1 
ATOM 3631  C CE3   . TRP B 2 298 ? -229.398 141.266 129.250 1.00 81.11  ? 298 TRP C CE3   1 
ATOM 3632  C CZ2   . TRP B 2 298 ? -230.556 139.225 130.827 1.00 81.11  ? 298 TRP C CZ2   1 
ATOM 3633  C CZ3   . TRP B 2 298 ? -230.451 140.502 128.792 1.00 81.11  ? 298 TRP C CZ3   1 
ATOM 3634  C CH2   . TRP B 2 298 ? -231.014 139.491 129.576 1.00 81.11  ? 298 TRP C CH2   1 
ATOM 3635  N N     . ALA B 2 299 ? -228.645 145.007 129.556 1.00 82.04  ? 299 ALA C N     1 
ATOM 3636  C CA    . ALA B 2 299 ? -229.725 145.218 128.613 1.00 82.04  ? 299 ALA C CA    1 
ATOM 3637  C C     . ALA B 2 299 ? -229.581 144.435 127.323 1.00 82.04  ? 299 ALA C C     1 
ATOM 3638  O O     . ALA B 2 299 ? -230.533 144.396 126.540 1.00 82.04  ? 299 ALA C O     1 
ATOM 3639  C CB    . ALA B 2 299 ? -229.839 146.709 128.282 1.00 82.04  ? 299 ALA C CB    1 
ATOM 3640  N N     . TRP B 2 300 ? -228.423 143.842 127.061 1.00 88.51  ? 300 TRP C N     1 
ATOM 3641  C CA    . TRP B 2 300 ? -228.213 143.083 125.837 1.00 88.51  ? 300 TRP C CA    1 
ATOM 3642  C C     . TRP B 2 300 ? -227.305 141.903 126.099 1.00 88.51  ? 300 TRP C C     1 
ATOM 3643  O O     . TRP B 2 300 ? -226.277 142.025 126.764 1.00 88.51  ? 300 TRP C O     1 
ATOM 3644  C CB    . TRP B 2 300 ? -227.589 143.900 124.702 1.00 88.51  ? 300 TRP C CB    1 
ATOM 3645  C CG    . TRP B 2 300 ? -228.367 145.046 124.181 1.00 88.51  ? 300 TRP C CG    1 
ATOM 3646  C CD1   . TRP B 2 300 ? -228.302 146.338 124.583 1.00 88.51  ? 300 TRP C CD1   1 
ATOM 3647  C CD2   . TRP B 2 300 ? -229.276 145.012 123.077 1.00 88.51  ? 300 TRP C CD2   1 
ATOM 3648  N NE1   . TRP B 2 300 ? -229.149 147.111 123.827 1.00 88.51  ? 300 TRP C NE1   1 
ATOM 3649  C CE2   . TRP B 2 300 ? -229.757 146.317 122.893 1.00 88.51  ? 300 TRP C CE2   1 
ATOM 3650  C CE3   . TRP B 2 300 ? -229.743 143.997 122.238 1.00 88.51  ? 300 TRP C CE3   1 
ATOM 3651  C CZ2   . TRP B 2 300 ? -230.679 146.636 121.905 1.00 88.51  ? 300 TRP C CZ2   1 
ATOM 3652  C CZ3   . TRP B 2 300 ? -230.660 144.316 121.263 1.00 88.51  ? 300 TRP C CZ3   1 
ATOM 3653  C CH2   . TRP B 2 300 ? -231.116 145.623 121.102 1.00 88.51  ? 300 TRP C CH2   1 
ATOM 3654  N N     . ARG B 2 301 ? -227.687 140.776 125.528 1.00 90.71  ? 301 ARG C N     1 
ATOM 3655  C CA    . ARG B 2 301 ? -226.911 139.556 125.545 1.00 90.71  ? 301 ARG C CA    1 
ATOM 3656  C C     . ARG B 2 301 ? -225.947 139.471 124.376 1.00 90.71  ? 301 ARG C C     1 
ATOM 3657  O O     . ARG B 2 301 ? -224.852 138.916 124.514 1.00 90.71  ? 301 ARG C O     1 
ATOM 3658  C CB    . ARG B 2 301 ? -227.852 138.360 125.582 1.00 90.71  ? 301 ARG C CB    1 
ATOM 3659  C CG    . ARG B 2 301 ? -228.675 138.391 126.833 1.00 90.71  ? 301 ARG C CG    1 
ATOM 3660  C CD    . ARG B 2 301 ? -227.766 138.334 128.050 1.00 90.71  ? 301 ARG C CD    1 
ATOM 3661  N NE    . ARG B 2 301 ? -226.896 137.173 127.949 1.00 90.71  ? 301 ARG C NE    1 
ATOM 3662  C CZ    . ARG B 2 301 ? -227.293 135.942 128.235 1.00 90.71  ? 301 ARG C CZ    1 
ATOM 3663  N NH1   . ARG B 2 301 ? -228.539 135.746 128.627 1.00 90.71  ? 301 ARG C NH1   1 
ATOM 3664  N NH2   . ARG B 2 301 ? -226.468 134.912 128.112 1.00 90.71  ? 301 ARG C NH2   1 
ATOM 3665  N N     . GLU B 2 302 ? -226.338 139.977 123.218 1.00 97.83  ? 302 GLU C N     1 
ATOM 3666  C CA    . GLU B 2 302 ? -225.507 139.903 122.035 1.00 97.83  ? 302 GLU C CA    1 
ATOM 3667  C C     . GLU B 2 302 ? -224.837 141.233 121.772 1.00 97.83  ? 302 GLU C C     1 
ATOM 3668  O O     . GLU B 2 302 ? -225.506 142.246 121.593 1.00 97.83  ? 302 GLU C O     1 
ATOM 3669  C CB    . GLU B 2 302 ? -226.343 139.584 120.812 1.00 97.83  ? 302 GLU C CB    1 
ATOM 3670  C CG    . GLU B 2 302 ? -227.320 138.502 120.926 1.00 97.83  ? 302 GLU C CG    1 
ATOM 3671  C CD    . GLU B 2 302 ? -228.203 138.519 119.708 1.00 97.83  ? 302 GLU C CD    1 
ATOM 3672  O OE1   . GLU B 2 302 ? -228.240 139.566 119.019 1.00 97.83  ? 302 GLU C OE1   1 
ATOM 3673  O OE2   . GLU B 2 302 ? -228.827 137.487 119.411 1.00 97.83  ? 302 GLU C OE2   1 
ATOM 3674  N N     . ARG B 2 303 ? -223.527 141.231 121.747 1.00 101.54 ? 303 ARG C N     1 
ATOM 3675  C CA    . ARG B 2 303 ? -222.769 142.425 121.458 1.00 101.54 ? 303 ARG C CA    1 
ATOM 3676  C C     . ARG B 2 303 ? -222.724 142.676 119.960 1.00 101.54 ? 303 ARG C C     1 
ATOM 3677  O O     . ARG B 2 303 ? -222.784 141.766 119.147 1.00 101.54 ? 303 ARG C O     1 
ATOM 3678  C CB    . ARG B 2 303 ? -221.362 142.412 122.040 1.00 101.54 ? 303 ARG C CB    1 
ATOM 3679  C CG    . ARG B 2 303 ? -220.683 143.789 121.876 1.00 101.54 ? 303 ARG C CG    1 
ATOM 3680  C CD    . ARG B 2 303 ? -221.438 144.883 122.677 1.00 101.54 ? 303 ARG C CD    1 
ATOM 3681  N NE    . ARG B 2 303 ? -222.646 145.394 122.007 1.00 101.54 ? 303 ARG C NE    1 
ATOM 3682  C CZ    . ARG B 2 303 ? -222.690 146.422 121.160 1.00 101.54 ? 303 ARG C CZ    1 
ATOM 3683  N NH1   . ARG B 2 303 ? -221.591 147.086 120.848 1.00 101.54 ? 303 ARG C NH1   1 
ATOM 3684  N NH2   . ARG B 2 303 ? -223.827 146.764 120.575 1.00 101.54 ? 303 ARG C NH2   1 
ATOM 3685  N N     . ASN B 2 304 ? -222.692 143.947 119.597 1.00 106.51 ? 304 ASN C N     1 
ATOM 3686  C CA    . ASN B 2 304 ? -222.681 144.426 118.214 1.00 106.51 ? 304 ASN C CA    1 
ATOM 3687  C C     . ASN B 2 304 ? -221.500 145.383 118.067 1.00 106.51 ? 304 ASN C C     1 
ATOM 3688  O O     . ASN B 2 304 ? -221.123 146.076 119.016 1.00 106.51 ? 304 ASN C O     1 
ATOM 3689  C CB    . ASN B 2 304 ? -223.974 145.139 117.825 1.00 106.51 ? 304 ASN C CB    1 
ATOM 3690  C CG    . ASN B 2 304 ? -224.131 145.254 116.335 1.00 106.51 ? 304 ASN C CG    1 
ATOM 3691  O OD1   . ASN B 2 304 ? -223.162 145.195 115.590 1.00 106.51 ? 304 ASN C OD1   1 
ATOM 3692  N ND2   . ASN B 2 304 ? -225.373 145.430 115.887 1.00 106.51 ? 304 ASN C ND2   1 
ATOM 3693  N N     . ILE B 2 305 ? -220.890 145.374 116.877 1.00 107.88 ? 305 ILE C N     1 
ATOM 3694  C CA    . ILE B 2 305 ? -219.771 146.251 116.592 1.00 107.88 ? 305 ILE C CA    1 
ATOM 3695  C C     . ILE B 2 305 ? -220.307 147.663 116.418 1.00 107.88 ? 305 ILE C C     1 
ATOM 3696  O O     . ILE B 2 305 ? -221.313 147.893 115.738 1.00 107.88 ? 305 ILE C O     1 
ATOM 3697  C CB    . ILE B 2 305 ? -219.044 145.749 115.330 1.00 107.88 ? 305 ILE C CB    1 
ATOM 3698  C CG1   . ILE B 2 305 ? -217.835 146.627 114.993 1.00 107.88 ? 305 ILE C CG1   1 
ATOM 3699  C CG2   . ILE B 2 305 ? -219.970 145.708 114.142 1.00 107.88 ? 305 ILE C CG2   1 
ATOM 3700  C CD1   . ILE B 2 305 ? -216.440 146.030 115.318 1.00 107.88 ? 305 ILE C CD1   1 
ATOM 3701  N N     . SER B 2 306 ? -219.710 148.583 117.087 1.00 102.63 ? 306 SER C N     1 
ATOM 3702  C CA    . SER B 2 306 ? -220.297 149.891 116.924 1.00 102.63 ? 306 SER C CA    1 
ATOM 3703  C C     . SER B 2 306 ? -219.674 150.482 115.682 1.00 102.63 ? 306 SER C C     1 
ATOM 3704  O O     . SER B 2 306 ? -218.445 150.443 115.540 1.00 102.63 ? 306 SER C O     1 
ATOM 3705  C CB    . SER B 2 306 ? -220.020 150.764 118.131 1.00 102.63 ? 306 SER C CB    1 
ATOM 3706  O OG    . SER B 2 306 ? -220.554 152.059 117.948 1.00 102.63 ? 306 SER C OG    1 
ATOM 3707  N N     . PRO B 2 307 ? -220.455 150.972 114.736 1.00 102.53 ? 307 PRO C N     1 
ATOM 3708  C CA    . PRO B 2 307 ? -219.842 151.434 113.490 1.00 102.53 ? 307 PRO C CA    1 
ATOM 3709  C C     . PRO B 2 307 ? -219.050 152.716 113.668 1.00 102.53 ? 307 PRO C C     1 
ATOM 3710  O O     . PRO B 2 307 ? -219.450 153.611 114.412 1.00 102.53 ? 307 PRO C O     1 
ATOM 3711  C CB    . PRO B 2 307 ? -221.053 151.688 112.589 1.00 102.53 ? 307 PRO C CB    1 
ATOM 3712  C CG    . PRO B 2 307 ? -222.159 152.002 113.564 1.00 102.53 ? 307 PRO C CG    1 
ATOM 3713  C CD    . PRO B 2 307 ? -221.915 151.140 114.750 1.00 102.53 ? 307 PRO C CD    1 
ATOM 3714  N N     . GLU B 2 308 ? -217.923 152.791 112.964 1.00 98.98  ? 308 GLU C N     1 
ATOM 3715  C CA    . GLU B 2 308 ? -217.045 153.955 112.923 1.00 98.98  ? 308 GLU C CA    1 
ATOM 3716  C C     . GLU B 2 308 ? -216.402 154.240 114.274 1.00 98.98  ? 308 GLU C C     1 
ATOM 3717  O O     . GLU B 2 308 ? -217.055 154.187 115.321 1.00 98.98  ? 308 GLU C O     1 
ATOM 3718  C CB    . GLU B 2 308 ? -217.732 155.185 112.322 1.00 98.98  ? 308 GLU C CB    1 
ATOM 3719  C CG    . GLU B 2 308 ? -218.092 154.994 110.844 1.00 98.98  ? 308 GLU C CG    1 
ATOM 3720  C CD    . GLU B 2 308 ? -219.485 154.470 110.601 1.00 98.98  ? 308 GLU C CD    1 
ATOM 3721  O OE1   . GLU B 2 308 ? -220.287 154.453 111.551 1.00 98.98  ? 308 GLU C OE1   1 
ATOM 3722  O OE2   . GLU B 2 308 ? -219.769 154.064 109.454 1.00 98.98  ? 308 GLU C OE2   1 
ATOM 3723  N N     . LEU B 2 309 ? -215.121 154.569 114.244 1.00 84.69  ? 309 LEU C N     1 
ATOM 3724  C CA    . LEU B 2 309 ? -214.393 154.911 115.453 1.00 84.69  ? 309 LEU C CA    1 
ATOM 3725  C C     . LEU B 2 309 ? -214.908 156.186 116.110 1.00 84.69  ? 309 LEU C C     1 
ATOM 3726  O O     . LEU B 2 309 ? -215.298 157.142 115.442 1.00 84.69  ? 309 LEU C O     1 
ATOM 3727  C CB    . LEU B 2 309 ? -212.898 155.009 115.140 1.00 84.69  ? 309 LEU C CB    1 
ATOM 3728  C CG    . LEU B 2 309 ? -212.097 153.770 114.704 1.00 84.69  ? 309 LEU C CG    1 
ATOM 3729  C CD1   . LEU B 2 309 ? -211.972 152.824 115.885 1.00 84.69  ? 309 LEU C CD1   1 
ATOM 3730  C CD2   . LEU B 2 309 ? -212.651 153.002 113.524 1.00 84.69  ? 309 LEU C CD2   1 
ATOM 3731  N N     . ASP B 2 310 ? -214.900 156.180 117.431 1.00 81.99  ? 310 ASP C N     1 
ATOM 3732  C CA    . ASP B 2 310 ? -215.273 157.311 118.273 1.00 81.99  ? 310 ASP C CA    1 
ATOM 3733  C C     . ASP B 2 310 ? -214.316 158.481 118.053 1.00 81.99  ? 310 ASP C C     1 
ATOM 3734  O O     . ASP B 2 310 ? -213.096 158.304 118.174 1.00 81.99  ? 310 ASP C O     1 
ATOM 3735  C CB    . ASP B 2 310 ? -215.292 156.900 119.736 1.00 81.99  ? 310 ASP C CB    1 
ATOM 3736  C CG    . ASP B 2 310 ? -216.053 157.862 120.603 1.00 81.99  ? 310 ASP C CG    1 
ATOM 3737  O OD1   . ASP B 2 310 ? -216.139 159.054 120.263 1.00 81.99  ? 310 ASP C OD1   1 
ATOM 3738  O OD2   . ASP B 2 310 ? -216.592 157.413 121.630 1.00 81.99  ? 310 ASP C OD2   1 
ATOM 3739  N N     . PRO B 2 311 ? -214.812 159.658 117.687 1.00 76.93  ? 311 PRO C N     1 
ATOM 3740  C CA    . PRO B 2 311 ? -213.916 160.815 117.517 1.00 76.93  ? 311 PRO C CA    1 
ATOM 3741  C C     . PRO B 2 311 ? -213.046 161.108 118.725 1.00 76.93  ? 311 PRO C C     1 
ATOM 3742  O O     . PRO B 2 311 ? -211.854 161.389 118.577 1.00 76.93  ? 311 PRO C O     1 
ATOM 3743  C CB    . PRO B 2 311 ? -214.889 161.963 117.243 1.00 76.93  ? 311 PRO C CB    1 
ATOM 3744  C CG    . PRO B 2 311 ? -216.202 161.477 117.727 1.00 76.93  ? 311 PRO C CG    1 
ATOM 3745  C CD    . PRO B 2 311 ? -216.211 160.025 117.450 1.00 76.93  ? 311 PRO C CD    1 
ATOM 3746  N N     . TYR B 2 312 ? -213.619 161.102 119.920 1.00 68.92  ? 312 TYR C N     1 
ATOM 3747  C CA    . TYR B 2 312 ? -212.910 161.608 121.085 1.00 68.92  ? 312 TYR C CA    1 
ATOM 3748  C C     . TYR B 2 312 ? -211.665 160.786 121.405 1.00 68.92  ? 312 TYR C C     1 
ATOM 3749  O O     . TYR B 2 312 ? -210.597 161.342 121.674 1.00 68.92  ? 312 TYR C O     1 
ATOM 3750  C CB    . TYR B 2 312 ? -213.865 161.600 122.262 1.00 68.92  ? 312 TYR C CB    1 
ATOM 3751  C CG    . TYR B 2 312 ? -214.973 162.574 122.050 1.00 68.92  ? 312 TYR C CG    1 
ATOM 3752  C CD1   . TYR B 2 312 ? -214.731 163.920 122.023 1.00 68.92  ? 312 TYR C CD1   1 
ATOM 3753  C CD2   . TYR B 2 312 ? -216.253 162.137 121.799 1.00 68.92  ? 312 TYR C CD2   1 
ATOM 3754  C CE1   . TYR B 2 312 ? -215.742 164.802 121.797 1.00 68.92  ? 312 TYR C CE1   1 
ATOM 3755  C CE2   . TYR B 2 312 ? -217.269 163.005 121.576 1.00 68.92  ? 312 TYR C CE2   1 
ATOM 3756  C CZ    . TYR B 2 312 ? -217.010 164.336 121.570 1.00 68.92  ? 312 TYR C CZ    1 
ATOM 3757  O OH    . TYR B 2 312 ? -218.038 165.209 121.351 1.00 68.92  ? 312 TYR C OH    1 
ATOM 3758  N N     . LEU B 2 313 ? -211.770 159.469 121.386 1.00 69.42  ? 313 LEU C N     1 
ATOM 3759  C CA    . LEU B 2 313 ? -210.664 158.685 121.912 1.00 69.42  ? 313 LEU C CA    1 
ATOM 3760  C C     . LEU B 2 313 ? -209.499 158.632 120.925 1.00 69.42  ? 313 LEU C C     1 
ATOM 3761  O O     . LEU B 2 313 ? -209.670 158.792 119.719 1.00 69.42  ? 313 LEU C O     1 
ATOM 3762  C CB    . LEU B 2 313 ? -211.131 157.277 122.230 1.00 69.42  ? 313 LEU C CB    1 
ATOM 3763  C CG    . LEU B 2 313 ? -212.413 157.217 123.057 1.00 69.42  ? 313 LEU C CG    1 
ATOM 3764  C CD1   . LEU B 2 313 ? -212.846 155.790 123.249 1.00 69.42  ? 313 LEU C CD1   1 
ATOM 3765  C CD2   . LEU B 2 313 ? -212.295 157.920 124.361 1.00 69.42  ? 313 LEU C CD2   1 
ATOM 3766  N N     . ILE B 2 314 ? -208.303 158.381 121.454 1.00 72.81  ? 314 ILE C N     1 
ATOM 3767  C CA    . ILE B 2 314 ? -207.118 158.146 120.634 1.00 72.81  ? 314 ILE C CA    1 
ATOM 3768  C C     . ILE B 2 314 ? -207.017 156.645 120.418 1.00 72.81  ? 314 ILE C C     1 
ATOM 3769  O O     . ILE B 2 314 ? -207.033 155.865 121.373 1.00 72.81  ? 314 ILE C O     1 
ATOM 3770  C CB    . ILE B 2 314 ? -205.849 158.708 121.272 1.00 72.81  ? 314 ILE C CB    1 
ATOM 3771  C CG1   . ILE B 2 314 ? -205.995 160.200 121.464 1.00 72.81  ? 314 ILE C CG1   1 
ATOM 3772  C CG2   . ILE B 2 314 ? -204.743 158.545 120.279 1.00 72.81  ? 314 ILE C CG2   1 
ATOM 3773  C CD1   . ILE B 2 314 ? -204.750 160.885 121.944 1.00 72.81  ? 314 ILE C CD1   1 
ATOM 3774  N N     . TYR B 2 315 ? -206.938 156.244 119.164 1.00 78.75  ? 315 TYR C N     1 
ATOM 3775  C CA    . TYR B 2 315 ? -206.905 154.853 118.753 1.00 78.75  ? 315 TYR C CA    1 
ATOM 3776  C C     . TYR B 2 315 ? -205.502 154.327 118.510 1.00 78.75  ? 315 TYR C C     1 
ATOM 3777  O O     . TYR B 2 315 ? -204.521 155.069 118.452 1.00 78.75  ? 315 TYR C O     1 
ATOM 3778  C CB    . TYR B 2 315 ? -207.701 154.781 117.470 1.00 78.75  ? 315 TYR C CB    1 
ATOM 3779  C CG    . TYR B 2 315 ? -209.106 154.847 117.852 1.00 78.75  ? 315 TYR C CG    1 
ATOM 3780  C CD1   . TYR B 2 315 ? -209.537 154.267 119.018 1.00 78.75  ? 315 TYR C CD1   1 
ATOM 3781  C CD2   . TYR B 2 315 ? -209.936 155.734 117.221 1.00 78.75  ? 315 TYR C CD2   1 
ATOM 3782  C CE1   . TYR B 2 315 ? -210.808 154.415 119.431 1.00 78.75  ? 315 TYR C CE1   1 
ATOM 3783  C CE2   . TYR B 2 315 ? -211.198 155.909 117.638 1.00 78.75  ? 315 TYR C CE2   1 
ATOM 3784  C CZ    . TYR B 2 315 ? -211.632 155.238 118.737 1.00 78.75  ? 315 TYR C CZ    1 
ATOM 3785  O OH    . TYR B 2 315 ? -212.903 155.374 119.171 1.00 78.75  ? 315 TYR C OH    1 
ATOM 3786  N N     . GLN B 2 316 ? -205.429 153.014 118.334 1.00 80.81  ? 316 GLN C N     1 
ATOM 3787  C CA    . GLN B 2 316 ? -204.161 152.349 118.101 1.00 80.81  ? 316 GLN C CA    1 
ATOM 3788  C C     . GLN B 2 316 ? -204.410 151.024 117.419 1.00 80.81  ? 316 GLN C C     1 
ATOM 3789  O O     . GLN B 2 316 ? -205.372 150.319 117.736 1.00 80.81  ? 316 GLN C O     1 
ATOM 3790  C CB    . GLN B 2 316 ? -203.381 152.067 119.386 1.00 80.81  ? 316 GLN C CB    1 
ATOM 3791  C CG    . GLN B 2 316 ? -202.535 153.179 119.916 1.00 80.81  ? 316 GLN C CG    1 
ATOM 3792  C CD    . GLN B 2 316 ? -201.785 152.740 121.145 1.00 80.81  ? 316 GLN C CD    1 
ATOM 3793  O OE1   . GLN B 2 316 ? -202.093 151.702 121.729 1.00 80.81  ? 316 GLN C OE1   1 
ATOM 3794  N NE2   . GLN B 2 316 ? -200.747 153.481 121.501 1.00 80.81  ? 316 GLN C NE2   1 
ATOM 3795  N N     . THR B 2 317 ? -203.541 150.707 116.472 1.00 86.53  ? 317 THR C N     1 
ATOM 3796  C CA    . THR B 2 317 ? -203.612 149.450 115.761 1.00 86.53  ? 317 THR C CA    1 
ATOM 3797  C C     . THR B 2 317 ? -202.487 148.583 116.289 1.00 86.53  ? 317 THR C C     1 
ATOM 3798  O O     . THR B 2 317 ? -201.384 149.071 116.548 1.00 86.53  ? 317 THR C O     1 
ATOM 3799  C CB    . THR B 2 317 ? -203.460 149.651 114.257 1.00 86.53  ? 317 THR C CB    1 
ATOM 3800  O OG1   . THR B 2 317 ? -202.144 150.145 113.980 1.00 86.53  ? 317 THR C OG1   1 
ATOM 3801  C CG2   . THR B 2 317 ? -204.485 150.643 113.753 1.00 86.53  ? 317 THR C CG2   1 
ATOM 3802  N N     . SER B 2 318 ? -202.754 147.298 116.482 1.00 89.23  ? 318 SER C N     1 
ATOM 3803  C CA    . SER B 2 318 ? -201.734 146.392 117.002 1.00 89.23  ? 318 SER C CA    1 
ATOM 3804  C C     . SER B 2 318 ? -201.576 145.191 116.086 1.00 89.23  ? 318 SER C C     1 
ATOM 3805  O O     . SER B 2 318 ? -202.522 144.805 115.399 1.00 89.23  ? 318 SER C O     1 
ATOM 3806  C CB    . SER B 2 318 ? -202.094 145.933 118.416 1.00 89.23  ? 318 SER C CB    1 
ATOM 3807  O OG    . SER B 2 318 ? -203.137 144.974 118.391 1.00 89.23  ? 318 SER C OG    1 
ATOM 3808  N N     . LYS B 2 319 ? -200.388 144.595 116.068 1.00 87.17  ? 319 LYS C N     1 
ATOM 3809  C CA    . LYS B 2 319 ? -200.189 143.448 115.208 1.00 87.17  ? 319 LYS C CA    1 
ATOM 3810  C C     . LYS B 2 319 ? -201.462 142.611 115.277 1.00 87.17  ? 319 LYS C C     1 
ATOM 3811  O O     . LYS B 2 319 ? -202.132 142.569 116.311 1.00 87.17  ? 319 LYS C O     1 
ATOM 3812  C CB    . LYS B 2 319 ? -198.963 142.656 115.652 1.00 87.17  ? 319 LYS C CB    1 
ATOM 3813  C CG    . LYS B 2 319 ? -197.684 143.466 115.557 1.00 87.17  ? 319 LYS C CG    1 
ATOM 3814  C CD    . LYS B 2 319 ? -196.439 142.630 115.744 1.00 87.17  ? 319 LYS C CD    1 
ATOM 3815  C CE    . LYS B 2 319 ? -196.317 142.135 117.170 1.00 87.17  ? 319 LYS C CE    1 
ATOM 3816  N NZ    . LYS B 2 319 ? -195.056 141.374 117.379 1.00 87.17  ? 319 LYS C NZ    1 
ATOM 3817  N N     . GLU B 2 320 ? -201.783 141.944 114.165 1.00 89.40  ? 320 GLU C N     1 
ATOM 3818  C CA    . GLU B 2 320 ? -203.052 141.332 113.771 1.00 89.40  ? 320 GLU C CA    1 
ATOM 3819  C C     . GLU B 2 320 ? -203.984 142.361 113.116 1.00 89.40  ? 320 GLU C C     1 
ATOM 3820  O O     . GLU B 2 320 ? -204.968 141.968 112.486 1.00 89.40  ? 320 GLU C O     1 
ATOM 3821  C CB    . GLU B 2 320 ? -203.791 140.670 114.957 1.00 89.40  ? 320 GLU C CB    1 
ATOM 3822  C CG    . GLU B 2 320 ? -205.053 139.871 114.658 1.00 89.40  ? 320 GLU C CG    1 
ATOM 3823  C CD    . GLU B 2 320 ? -205.708 139.336 115.927 1.00 89.40  ? 320 GLU C CD    1 
ATOM 3824  O OE1   . GLU B 2 320 ? -205.363 139.824 117.023 1.00 89.40  ? 320 GLU C OE1   1 
ATOM 3825  O OE2   . GLU B 2 320 ? -206.549 138.415 115.832 1.00 89.40  ? 320 GLU C OE2   1 
ATOM 3826  N N     . GLY B 2 321 ? -203.701 143.654 113.233 1.00 89.38  ? 321 GLY C N     1 
ATOM 3827  C CA    . GLY B 2 321 ? -204.421 144.733 112.584 1.00 89.38  ? 321 GLY C CA    1 
ATOM 3828  C C     . GLY B 2 321 ? -205.646 145.213 113.323 1.00 89.38  ? 321 GLY C C     1 
ATOM 3829  O O     . GLY B 2 321 ? -206.344 146.106 112.825 1.00 89.38  ? 321 GLY C O     1 
ATOM 3830  N N     . ARG B 2 322 ? -205.914 144.650 114.492 1.00 87.85  ? 322 ARG C N     1 
ATOM 3831  C CA    . ARG B 2 322 ? -207.056 145.020 115.314 1.00 87.85  ? 322 ARG C CA    1 
ATOM 3832  C C     . ARG B 2 322 ? -206.884 146.435 115.848 1.00 87.85  ? 322 ARG C C     1 
ATOM 3833  O O     . ARG B 2 322 ? -205.783 146.838 116.232 1.00 87.85  ? 322 ARG C O     1 
ATOM 3834  C CB    . ARG B 2 322 ? -207.237 143.948 116.391 1.00 87.85  ? 322 ARG C CB    1 
ATOM 3835  C CG    . ARG B 2 322 ? -206.022 143.795 117.263 1.00 87.85  ? 322 ARG C CG    1 
ATOM 3836  C CD    . ARG B 2 322 ? -206.134 142.881 118.481 1.00 87.85  ? 322 ARG C CD    1 
ATOM 3837  N NE    . ARG B 2 322 ? -205.064 143.184 119.426 1.00 87.85  ? 322 ARG C NE    1 
ATOM 3838  C CZ    . ARG B 2 322 ? -203.944 142.467 119.472 1.00 87.85  ? 322 ARG C CZ    1 
ATOM 3839  N NH1   . ARG B 2 322 ? -203.786 141.455 118.629 1.00 87.85  ? 322 ARG C NH1   1 
ATOM 3840  N NH2   . ARG B 2 322 ? -202.976 142.762 120.327 1.00 87.85  ? 322 ARG C NH2   1 
ATOM 3841  N N     . VAL B 2 323 ? -207.975 147.198 115.853 1.00 80.95  ? 323 VAL C N     1 
ATOM 3842  C CA    . VAL B 2 323 ? -207.960 148.607 116.239 1.00 80.95  ? 323 VAL C CA    1 
ATOM 3843  C C     . VAL B 2 323 ? -208.693 148.769 117.561 1.00 80.95  ? 323 VAL C C     1 
ATOM 3844  O O     . VAL B 2 323 ? -209.883 148.453 117.666 1.00 80.95  ? 323 VAL C O     1 
ATOM 3845  C CB    . VAL B 2 323 ? -208.592 149.495 115.162 1.00 80.95  ? 323 VAL C CB    1 
ATOM 3846  C CG1   . VAL B 2 323 ? -208.545 150.938 115.589 1.00 80.95  ? 323 VAL C CG1   1 
ATOM 3847  C CG2   . VAL B 2 323 ? -207.870 149.316 113.859 1.00 80.95  ? 323 VAL C CG2   1 
ATOM 3848  N N     . TYR B 2 324 ? -207.989 149.296 118.554 1.00 79.31  ? 324 TYR C N     1 
ATOM 3849  C CA    . TYR B 2 324 ? -208.481 149.504 119.905 1.00 79.31  ? 324 TYR C CA    1 
ATOM 3850  C C     . TYR B 2 324 ? -208.057 150.852 120.467 1.00 79.31  ? 324 TYR C C     1 
ATOM 3851  O O     . TYR B 2 324 ? -206.956 151.334 120.177 1.00 79.31  ? 324 TYR C O     1 
ATOM 3852  C CB    . TYR B 2 324 ? -207.979 148.344 120.775 1.00 79.31  ? 324 TYR C CB    1 
ATOM 3853  C CG    . TYR B 2 324 ? -206.486 148.376 120.958 1.00 79.31  ? 324 TYR C CG    1 
ATOM 3854  C CD1   . TYR B 2 324 ? -205.673 147.870 119.959 1.00 79.31  ? 324 TYR C CD1   1 
ATOM 3855  C CD2   . TYR B 2 324 ? -205.884 148.926 122.068 1.00 79.31  ? 324 TYR C CD2   1 
ATOM 3856  C CE1   . TYR B 2 324 ? -204.317 147.883 120.063 1.00 79.31  ? 324 TYR C CE1   1 
ATOM 3857  C CE2   . TYR B 2 324 ? -204.507 148.949 122.182 1.00 79.31  ? 324 TYR C CE2   1 
ATOM 3858  C CZ    . TYR B 2 324 ? -203.732 148.422 121.173 1.00 79.31  ? 324 TYR C CZ    1 
ATOM 3859  O OH    . TYR B 2 324 ? -202.363 148.429 121.264 1.00 79.31  ? 324 TYR C OH    1 
ATOM 3860  N N     . PRO B 2 325 ? -208.899 151.461 121.305 1.00 73.30  ? 325 PRO C N     1 
ATOM 3861  C CA    . PRO B 2 325 ? -208.540 152.741 121.930 1.00 73.30  ? 325 PRO C CA    1 
ATOM 3862  C C     . PRO B 2 325 ? -207.401 152.621 122.921 1.00 73.30  ? 325 PRO C C     1 
ATOM 3863  O O     . PRO B 2 325 ? -207.347 151.685 123.721 1.00 73.30  ? 325 PRO C O     1 
ATOM 3864  C CB    . PRO B 2 325 ? -209.831 153.155 122.638 1.00 73.30  ? 325 PRO C CB    1 
ATOM 3865  C CG    . PRO B 2 325 ? -210.542 151.894 122.873 1.00 73.30  ? 325 PRO C CG    1 
ATOM 3866  C CD    . PRO B 2 325 ? -210.243 151.022 121.695 1.00 73.30  ? 325 PRO C CD    1 
ATOM 3867  N N     . ARG B 2 326 ? -206.492 153.582 122.868 1.00 71.97  ? 326 ARG C N     1 
ATOM 3868  C CA    . ARG B 2 326 ? -205.339 153.561 123.748 1.00 71.97  ? 326 ARG C CA    1 
ATOM 3869  C C     . ARG B 2 326 ? -205.754 153.725 125.200 1.00 71.97  ? 326 ARG C C     1 
ATOM 3870  O O     . ARG B 2 326 ? -206.400 154.721 125.546 1.00 71.97  ? 326 ARG C O     1 
ATOM 3871  C CB    . ARG B 2 326 ? -204.345 154.625 123.319 1.00 71.97  ? 326 ARG C CB    1 
ATOM 3872  C CG    . ARG B 2 326 ? -203.016 154.483 123.989 1.00 71.97  ? 326 ARG C CG    1 
ATOM 3873  C CD    . ARG B 2 326 ? -202.006 155.482 123.456 1.00 71.97  ? 326 ARG C CD    1 
ATOM 3874  N NE    . ARG B 2 326 ? -202.107 156.822 124.006 1.00 71.97  ? 326 ARG C NE    1 
ATOM 3875  C CZ    . ARG B 2 326 ? -202.232 157.904 123.247 1.00 71.97  ? 326 ARG C CZ    1 
ATOM 3876  N NH1   . ARG B 2 326 ? -202.255 157.769 121.928 1.00 71.97  ? 326 ARG C NH1   1 
ATOM 3877  N NH2   . ARG B 2 326 ? -202.331 159.108 123.789 1.00 71.97  ? 326 ARG C NH2   1 
ATOM 3878  N N     . PRO B 2 327 ? -205.401 152.789 126.069 1.00 65.98  ? 327 PRO C N     1 
ATOM 3879  C CA    . PRO B 2 327 ? -205.882 152.828 127.448 1.00 65.98  ? 327 PRO C CA    1 
ATOM 3880  C C     . PRO B 2 327 ? -205.297 153.998 128.206 1.00 65.98  ? 327 PRO C C     1 
ATOM 3881  O O     . PRO B 2 327 ? -204.177 154.438 127.950 1.00 65.98  ? 327 PRO C O     1 
ATOM 3882  C CB    . PRO B 2 327 ? -205.391 151.504 128.035 1.00 65.98  ? 327 PRO C CB    1 
ATOM 3883  C CG    . PRO B 2 327 ? -204.236 151.153 127.214 1.00 65.98  ? 327 PRO C CG    1 
ATOM 3884  C CD    . PRO B 2 327 ? -204.521 151.641 125.833 1.00 65.98  ? 327 PRO C CD    1 
ATOM 3885  N N     . ALA B 2 328 ? -206.068 154.503 129.153 1.00 58.21  ? 328 ALA C N     1 
ATOM 3886  C CA    . ALA B 2 328 ? -205.554 155.536 130.026 1.00 58.21  ? 328 ALA C CA    1 
ATOM 3887  C C     . ALA B 2 328 ? -204.430 154.953 130.864 1.00 58.21  ? 328 ALA C C     1 
ATOM 3888  O O     . ALA B 2 328 ? -204.396 153.756 131.143 1.00 58.21  ? 328 ALA C O     1 
ATOM 3889  C CB    . ALA B 2 328 ? -206.650 156.074 130.931 1.00 58.21  ? 328 ALA C CB    1 
ATOM 3890  N N     . GLU B 2 329 ? -203.488 155.800 131.251 1.00 55.20  ? 329 GLU C N     1 
ATOM 3891  C CA    . GLU B 2 329 ? -202.382 155.371 132.090 1.00 55.20  ? 329 GLU C CA    1 
ATOM 3892  C C     . GLU B 2 329 ? -202.272 156.384 133.210 1.00 55.20  ? 329 GLU C C     1 
ATOM 3893  O O     . GLU B 2 329 ? -202.056 157.570 132.956 1.00 55.20  ? 329 GLU C O     1 
ATOM 3894  C CB    . GLU B 2 329 ? -201.089 155.318 131.276 1.00 55.20  ? 329 GLU C CB    1 
ATOM 3895  C CG    . GLU B 2 329 ? -201.074 154.240 130.214 1.00 55.20  ? 329 GLU C CG    1 
ATOM 3896  C CD    . GLU B 2 329 ? -199.729 154.106 129.532 1.00 55.20  ? 329 GLU C CD    1 
ATOM 3897  O OE1   . GLU B 2 329 ? -198.847 154.950 129.783 1.00 55.20  ? 329 GLU C OE1   1 
ATOM 3898  O OE2   . GLU B 2 329 ? -199.553 153.163 128.732 1.00 55.20  ? 329 GLU C OE2   1 
ATOM 3899  N N     . ALA B 2 330 ? -202.416 155.920 134.449 1.00 52.16  ? 330 ALA C N     1 
ATOM 3900  C CA    . ALA B 2 330 ? -202.260 156.829 135.571 1.00 52.16  ? 330 ALA C CA    1 
ATOM 3901  C C     . ALA B 2 330 ? -200.848 157.364 135.728 1.00 52.16  ? 330 ALA C C     1 
ATOM 3902  O O     . ALA B 2 330 ? -200.666 158.359 136.434 1.00 52.16  ? 330 ALA C O     1 
ATOM 3903  C CB    . ALA B 2 330 ? -202.672 156.127 136.859 1.00 52.16  ? 330 ALA C CB    1 
ATOM 3904  N N     . GLU B 2 331 ? -199.843 156.740 135.113 1.00 56.42  ? 331 GLU C N     1 
ATOM 3905  C CA    . GLU B 2 331 ? -198.510 157.321 135.162 1.00 56.42  ? 331 GLU C CA    1 
ATOM 3906  C C     . GLU B 2 331 ? -198.413 158.635 134.401 1.00 56.42  ? 331 GLU C C     1 
ATOM 3907  O O     . GLU B 2 331 ? -197.642 159.512 134.795 1.00 56.42  ? 331 GLU C O     1 
ATOM 3908  C CB    . GLU B 2 331 ? -197.457 156.335 134.679 1.00 56.42  ? 331 GLU C CB    1 
ATOM 3909  C CG    . GLU B 2 331 ? -197.552 155.922 133.255 1.00 56.42  ? 331 GLU C CG    1 
ATOM 3910  C CD    . GLU B 2 331 ? -198.251 154.607 133.110 1.00 56.42  ? 331 GLU C CD    1 
ATOM 3911  O OE1   . GLU B 2 331 ? -198.971 154.218 134.046 1.00 56.42  ? 331 GLU C OE1   1 
ATOM 3912  O OE2   . GLU B 2 331 ? -198.028 153.932 132.087 1.00 56.42  ? 331 GLU C OE2   1 
ATOM 3913  N N     . ARG B 2 332 ? -199.191 158.812 133.333 1.00 53.57  ? 332 ARG C N     1 
ATOM 3914  C CA    . ARG B 2 332 ? -199.139 160.085 132.632 1.00 53.57  ? 332 ARG C CA    1 
ATOM 3915  C C     . ARG B 2 332 ? -199.884 161.155 133.391 1.00 53.57  ? 332 ARG C C     1 
ATOM 3916  O O     . ARG B 2 332 ? -199.681 162.341 133.131 1.00 53.57  ? 332 ARG C O     1 
ATOM 3917  C CB    . ARG B 2 332 ? -199.727 159.961 131.228 1.00 53.57  ? 332 ARG C CB    1 
ATOM 3918  C CG    . ARG B 2 332 ? -199.064 158.946 130.342 1.00 53.57  ? 332 ARG C CG    1 
ATOM 3919  C CD    . ARG B 2 332 ? -199.858 158.817 129.073 1.00 53.57  ? 332 ARG C CD    1 
ATOM 3920  N NE    . ARG B 2 332 ? -199.969 160.078 128.347 1.00 53.57  ? 332 ARG C NE    1 
ATOM 3921  C CZ    . ARG B 2 332 ? -199.088 160.513 127.459 1.00 53.57  ? 332 ARG C CZ    1 
ATOM 3922  N NH1   . ARG B 2 332 ? -198.014 159.797 127.179 1.00 53.57  ? 332 ARG C NH1   1 
ATOM 3923  N NH2   . ARG B 2 332 ? -199.278 161.673 126.855 1.00 53.57  ? 332 ARG C NH2   1 
ATOM 3924  N N     . ALA B 2 333 ? -200.735 160.756 134.318 1.00 52.19  ? 333 ALA C N     1 
ATOM 3925  C CA    . ALA B 2 333 ? -201.420 161.682 135.197 1.00 52.19  ? 333 ALA C CA    1 
ATOM 3926  C C     . ALA B 2 333 ? -200.551 162.144 136.348 1.00 52.19  ? 333 ALA C C     1 
ATOM 3927  O O     . ALA B 2 333 ? -200.932 163.095 137.037 1.00 52.19  ? 333 ALA C O     1 
ATOM 3928  C CB    . ALA B 2 333 ? -202.676 161.034 135.761 1.00 52.19  ? 333 ALA C CB    1 
ATOM 3929  N N     . ILE B 2 334 ? -199.384 161.542 136.522 1.00 55.85  ? 334 ILE C N     1 
ATOM 3930  C CA    . ILE B 2 334 ? -198.476 161.988 137.563 1.00 55.85  ? 334 ILE C CA    1 
ATOM 3931  C C     . ILE B 2 334 ? -198.039 163.409 137.220 1.00 55.85  ? 334 ILE C C     1 
ATOM 3932  O O     . ILE B 2 334 ? -197.935 164.260 138.090 1.00 55.85  ? 334 ILE C O     1 
ATOM 3933  C CB    . ILE B 2 334 ? -197.287 161.030 137.757 1.00 55.85  ? 334 ILE C CB    1 
ATOM 3934  C CG1   . ILE B 2 334 ? -196.760 161.139 139.183 1.00 55.85  ? 334 ILE C CG1   1 
ATOM 3935  C CG2   . ILE B 2 334 ? -196.190 161.295 136.742 1.00 55.85  ? 334 ILE C CG2   1 
ATOM 3936  C CD1   . ILE B 2 334 ? -197.151 159.977 140.066 1.00 55.85  ? 334 ILE C CD1   1 
ATOM 3937  N N     . TRP B 2 335 ? -197.787 163.663 135.940 1.00 59.77  ? 335 TRP C N     1 
ATOM 3938  C CA    . TRP B 2 335 ? -197.410 164.996 135.497 1.00 59.77  ? 335 TRP C CA    1 
ATOM 3939  C C     . TRP B 2 335 ? -198.756 165.540 135.172 1.00 59.77  ? 335 TRP C C     1 
ATOM 3940  O O     . TRP B 2 335 ? -199.350 165.143 134.188 1.00 59.77  ? 335 TRP C O     1 
ATOM 3941  C CB    . TRP B 2 335 ? -196.581 164.912 134.220 1.00 59.77  ? 335 TRP C CB    1 
ATOM 3942  C CG    . TRP B 2 335 ? -196.539 166.168 133.386 1.00 59.77  ? 335 TRP C CG    1 
ATOM 3943  C CD1   . TRP B 2 335 ? -197.194 167.338 133.616 1.00 59.77  ? 335 TRP C CD1   1 
ATOM 3944  C CD2   . TRP B 2 335 ? -195.787 166.366 132.184 1.00 59.77  ? 335 TRP C CD2   1 
ATOM 3945  N NE1   . TRP B 2 335 ? -196.902 168.247 132.636 1.00 59.77  ? 335 TRP C NE1   1 
ATOM 3946  C CE2   . TRP B 2 335 ? -196.038 167.672 131.744 1.00 59.77  ? 335 TRP C CE2   1 
ATOM 3947  C CE3   . TRP B 2 335 ? -194.924 165.563 131.441 1.00 59.77  ? 335 TRP C CE3   1 
ATOM 3948  C CZ2   . TRP B 2 335 ? -195.469 168.189 130.598 1.00 59.77  ? 335 TRP C CZ2   1 
ATOM 3949  C CZ3   . TRP B 2 335 ? -194.359 166.081 130.304 1.00 59.77  ? 335 TRP C CZ3   1 
ATOM 3950  C CH2   . TRP B 2 335 ? -194.629 167.380 129.894 1.00 59.77  ? 335 TRP C CH2   1 
ATOM 3951  N N     . ARG B 2 336 ? -199.245 166.451 136.007 1.00 60.26  ? 336 ARG C N     1 
ATOM 3952  C CA    . ARG B 2 336 ? -200.562 167.052 135.822 1.00 60.26  ? 336 ARG C CA    1 
ATOM 3953  C C     . ARG B 2 336 ? -200.787 167.689 134.452 1.00 60.26  ? 336 ARG C C     1 
ATOM 3954  O O     . ARG B 2 336 ? -199.960 168.459 133.963 1.00 60.26  ? 336 ARG C O     1 
ATOM 3955  C CB    . ARG B 2 336 ? -200.833 168.083 136.923 1.00 60.26  ? 336 ARG C CB    1 
ATOM 3956  C CG    . ARG B 2 336 ? -201.928 167.678 137.896 1.00 60.26  ? 336 ARG C CG    1 
ATOM 3957  C CD    . ARG B 2 336 ? -203.307 167.930 137.309 1.00 60.26  ? 336 ARG C CD    1 
ATOM 3958  N NE    . ARG B 2 336 ? -204.174 168.650 138.239 1.00 60.26  ? 336 ARG C NE    1 
ATOM 3959  C CZ    . ARG B 2 336 ? -204.510 168.203 139.445 1.00 60.26  ? 336 ARG C CZ    1 
ATOM 3960  N NH1   . ARG B 2 336 ? -205.304 168.926 140.224 1.00 60.26  ? 336 ARG C NH1   1 
ATOM 3961  N NH2   . ARG B 2 336 ? -204.054 167.034 139.872 1.00 60.26  ? 336 ARG C NH2   1 
ATOM 3962  N N     . ASP B 2 337 ? -201.925 167.359 133.848 1.00 61.03  ? 337 ASP C N     1 
ATOM 3963  C CA    . ASP B 2 337 ? -202.319 167.892 132.555 1.00 61.03  ? 337 ASP C CA    1 
ATOM 3964  C C     . ASP B 2 337 ? -201.401 167.634 131.360 1.00 61.03  ? 337 ASP C C     1 
ATOM 3965  O O     . ASP B 2 337 ? -201.246 168.498 130.507 1.00 61.03  ? 337 ASP C O     1 
ATOM 3966  C CB    . ASP B 2 337 ? -202.680 169.378 132.659 1.00 61.03  ? 337 ASP C CB    1 
ATOM 3967  C CG    . ASP B 2 337 ? -201.496 170.244 132.993 1.00 61.03  ? 337 ASP C CG    1 
ATOM 3968  O OD1   . ASP B 2 337 ? -200.475 170.160 132.281 1.00 61.03  ? 337 ASP C OD1   1 
ATOM 3969  O OD2   . ASP B 2 337 ? -201.586 171.015 133.969 1.00 61.03  ? 337 ASP C OD2   1 
ATOM 3970  N N     . LEU B 2 338 ? -200.803 166.456 131.264 1.00 58.89  ? 338 LEU C N     1 
ATOM 3971  C CA    . LEU B 2 338 ? -199.996 166.210 130.068 1.00 58.89  ? 338 LEU C CA    1 
ATOM 3972  C C     . LEU B 2 338 ? -200.792 165.923 128.802 1.00 58.89  ? 338 LEU C C     1 
ATOM 3973  O O     . LEU B 2 338 ? -200.362 166.321 127.716 1.00 58.89  ? 338 LEU C O     1 
ATOM 3974  C CB    . LEU B 2 338 ? -199.089 165.006 130.314 1.00 58.89  ? 338 LEU C CB    1 
ATOM 3975  C CG    . LEU B 2 338 ? -198.290 164.391 129.169 1.00 58.89  ? 338 LEU C CG    1 
ATOM 3976  C CD1   . LEU B 2 338 ? -197.085 165.214 128.803 1.00 58.89  ? 338 LEU C CD1   1 
ATOM 3977  C CD2   . LEU B 2 338 ? -197.908 162.970 129.554 1.00 58.89  ? 338 LEU C CD2   1 
ATOM 3978  N N     . ASP B 2 339 ? -201.936 165.260 128.895 1.00 60.92  ? 339 ASP C N     1 
ATOM 3979  C CA    . ASP B 2 339 ? -202.691 164.935 127.684 1.00 60.92  ? 339 ASP C CA    1 
ATOM 3980  C C     . ASP B 2 339 ? -203.281 166.148 126.991 1.00 60.92  ? 339 ASP C C     1 
ATOM 3981  O O     . ASP B 2 339 ? -203.457 166.132 125.769 1.00 60.92  ? 339 ASP C O     1 
ATOM 3982  C CB    . ASP B 2 339 ? -203.704 163.843 127.956 1.00 60.92  ? 339 ASP C CB    1 
ATOM 3983  C CG    . ASP B 2 339 ? -203.028 162.595 128.463 1.00 60.92  ? 339 ASP C CG    1 
ATOM 3984  O OD1   . ASP B 2 339 ? -201.870 162.354 128.055 1.00 60.92  ? 339 ASP C OD1   1 
ATOM 3985  O OD2   . ASP B 2 339 ? -203.623 161.868 129.269 1.00 60.92  ? 339 ASP C OD2   1 
ATOM 3986  N N     . ALA B 2 340 ? -203.611 167.197 127.727 1.00 63.17  ? 340 ALA C N     1 
ATOM 3987  C CA    . ALA B 2 340 ? -204.230 168.315 127.050 1.00 63.17  ? 340 ALA C CA    1 
ATOM 3988  C C     . ALA B 2 340 ? -203.244 169.051 126.165 1.00 63.17  ? 340 ALA C C     1 
ATOM 3989  O O     . ALA B 2 340 ? -203.661 169.808 125.288 1.00 63.17  ? 340 ALA C O     1 
ATOM 3990  C CB    . ALA B 2 340 ? -204.828 169.260 128.079 1.00 63.17  ? 340 ALA C CB    1 
ATOM 3991  N N     . LEU B 2 341 ? -201.980 168.692 126.267 1.00 62.89  ? 341 LEU C N     1 
ATOM 3992  C CA    . LEU B 2 341 ? -200.950 169.275 125.427 1.00 62.89  ? 341 LEU C CA    1 
ATOM 3993  C C     . LEU B 2 341 ? -201.001 168.602 124.045 1.00 62.89  ? 341 LEU C C     1 
ATOM 3994  O O     . LEU B 2 341 ? -200.127 168.789 123.209 1.00 62.89  ? 341 LEU C O     1 
ATOM 3995  C CB    . LEU B 2 341 ? -199.578 169.105 126.068 1.00 62.89  ? 341 LEU C CB    1 
ATOM 3996  C CG    . LEU B 2 341 ? -199.414 169.869 127.375 1.00 62.89  ? 341 LEU C CG    1 
ATOM 3997  C CD1   . LEU B 2 341 ? -197.953 169.939 127.769 1.00 62.89  ? 341 LEU C CD1   1 
ATOM 3998  C CD2   . LEU B 2 341 ? -199.997 171.263 127.241 1.00 62.89  ? 341 LEU C CD2   1 
ATOM 3999  N N     . LEU B 2 342 ? -202.043 167.804 123.837 1.00 70.21  ? 342 LEU C N     1 
ATOM 4000  C CA    . LEU B 2 342 ? -202.289 167.062 122.610 1.00 70.21  ? 342 LEU C CA    1 
ATOM 4001  C C     . LEU B 2 342 ? -202.405 168.010 121.435 1.00 70.21  ? 342 LEU C C     1 
ATOM 4002  O O     . LEU B 2 342 ? -202.015 167.681 120.319 1.00 70.21  ? 342 LEU C O     1 
ATOM 4003  C CB    . LEU B 2 342 ? -203.594 166.279 122.748 1.00 70.21  ? 342 LEU C CB    1 
ATOM 4004  C CG    . LEU B 2 342 ? -203.901 165.168 121.747 1.00 70.21  ? 342 LEU C CG    1 
ATOM 4005  C CD1   . LEU B 2 342 ? -203.837 165.686 120.321 1.00 70.21  ? 342 LEU C CD1   1 
ATOM 4006  C CD2   . LEU B 2 342 ? -202.954 163.998 121.946 1.00 70.21  ? 342 LEU C CD2   1 
ATOM 4007  N N     . HIS B 2 343 ? -202.952 169.187 121.688 1.00 73.12  ? 343 HIS C N     1 
ATOM 4008  C CA    . HIS B 2 343 ? -203.143 170.191 120.650 1.00 73.12  ? 343 HIS C CA    1 
ATOM 4009  C C     . HIS B 2 343 ? -201.838 170.632 119.986 1.00 73.12  ? 343 HIS C C     1 
ATOM 4010  O O     . HIS B 2 343 ? -201.824 170.936 118.798 1.00 73.12  ? 343 HIS C O     1 
ATOM 4011  C CB    . HIS B 2 343 ? -203.882 171.415 121.204 1.00 73.12  ? 343 HIS C CB    1 
ATOM 4012  C CG    . HIS B 2 343 ? -205.108 171.785 120.426 1.00 73.12  ? 343 HIS C CG    1 
ATOM 4013  N ND1   . HIS B 2 343 ? -205.264 171.478 119.091 1.00 73.12  ? 343 HIS C ND1   1 
ATOM 4014  C CD2   . HIS B 2 343 ? -206.239 172.428 120.798 1.00 73.12  ? 343 HIS C CD2   1 
ATOM 4015  C CE1   . HIS B 2 343 ? -206.439 171.915 118.674 1.00 73.12  ? 343 HIS C CE1   1 
ATOM 4016  N NE2   . HIS B 2 343 ? -207.051 172.495 119.690 1.00 73.12  ? 343 HIS C NE2   1 
ATOM 4017  N N     . TYR B 2 344 ? -200.753 170.699 120.746 1.00 72.02  ? 344 TYR C N     1 
ATOM 4018  C CA    . TYR B 2 344 ? -199.497 171.169 120.182 1.00 72.02  ? 344 TYR C CA    1 
ATOM 4019  C C     . TYR B 2 344 ? -198.814 170.169 119.256 1.00 72.02  ? 344 TYR C C     1 
ATOM 4020  O O     . TYR B 2 344 ? -197.696 170.430 118.808 1.00 72.02  ? 344 TYR C O     1 
ATOM 4021  C CB    . TYR B 2 344 ? -198.605 171.596 121.337 1.00 72.02  ? 344 TYR C CB    1 
ATOM 4022  C CG    . TYR B 2 344 ? -199.149 172.856 121.950 1.00 72.02  ? 344 TYR C CG    1 
ATOM 4023  C CD1   . TYR B 2 344 ? -198.898 174.091 121.383 1.00 72.02  ? 344 TYR C CD1   1 
ATOM 4024  C CD2   . TYR B 2 344 ? -199.979 172.805 123.059 1.00 72.02  ? 344 TYR C CD2   1 
ATOM 4025  C CE1   . TYR B 2 344 ? -199.424 175.239 121.930 1.00 72.02  ? 344 TYR C CE1   1 
ATOM 4026  C CE2   . TYR B 2 344 ? -200.507 173.946 123.613 1.00 72.02  ? 344 TYR C CE2   1 
ATOM 4027  C CZ    . TYR B 2 344 ? -200.229 175.160 123.044 1.00 72.02  ? 344 TYR C CZ    1 
ATOM 4028  O OH    . TYR B 2 344 ? -200.756 176.302 123.592 1.00 72.02  ? 344 TYR C OH    1 
ATOM 4029  N N     . GLY B 2 345 ? -199.427 169.033 118.967 1.00 76.46  ? 345 GLY C N     1 
ATOM 4030  C CA    . GLY B 2 345 ? -198.808 168.085 118.066 1.00 76.46  ? 345 GLY C CA    1 
ATOM 4031  C C     . GLY B 2 345 ? -198.808 168.541 116.628 1.00 76.46  ? 345 GLY C C     1 
ATOM 4032  O O     . GLY B 2 345 ? -198.172 167.915 115.780 1.00 76.46  ? 345 GLY C O     1 
ATOM 4033  N N     . ASN B 2 349 ? -198.510 162.303 114.972 1.00 105.30 ? 349 ASN C N     1 
ATOM 4034  C CA    . ASN B 2 349 ? -198.939 161.139 114.215 1.00 105.30 ? 349 ASN C CA    1 
ATOM 4035  C C     . ASN B 2 349 ? -200.455 160.976 114.280 1.00 105.30 ? 349 ASN C C     1 
ATOM 4036  O O     . ASN B 2 349 ? -201.201 161.736 113.664 1.00 105.30 ? 349 ASN C O     1 
ATOM 4037  C CB    . ASN B 2 349 ? -198.251 159.894 114.782 1.00 105.30 ? 349 ASN C CB    1 
ATOM 4038  C CG    . ASN B 2 349 ? -198.279 158.715 113.835 1.00 105.30 ? 349 ASN C CG    1 
ATOM 4039  O OD1   . ASN B 2 349 ? -199.076 158.662 112.897 1.00 105.30 ? 349 ASN C OD1   1 
ATOM 4040  N ND2   . ASN B 2 349 ? -197.416 157.741 114.097 1.00 105.30 ? 349 ASN C ND2   1 
ATOM 4041  N N     . TYR B 2 350 ? -200.893 159.952 115.007 1.00 96.11  ? 350 TYR C N     1 
ATOM 4042  C CA    . TYR B 2 350 ? -202.315 159.684 115.181 1.00 96.11  ? 350 TYR C CA    1 
ATOM 4043  C C     . TYR B 2 350 ? -202.971 160.710 116.104 1.00 96.11  ? 350 TYR C C     1 
ATOM 4044  O O     . TYR B 2 350 ? -202.445 161.014 117.177 1.00 96.11  ? 350 TYR C O     1 
ATOM 4045  C CB    . TYR B 2 350 ? -202.557 158.279 115.689 1.00 96.11  ? 350 TYR C CB    1 
ATOM 4046  C CG    . TYR B 2 350 ? -204.023 158.003 115.585 1.00 96.11  ? 350 TYR C CG    1 
ATOM 4047  C CD1   . TYR B 2 350 ? -204.614 157.790 114.348 1.00 96.11  ? 350 TYR C CD1   1 
ATOM 4048  C CD2   . TYR B 2 350 ? -204.831 158.023 116.704 1.00 96.11  ? 350 TYR C CD2   1 
ATOM 4049  C CE1   . TYR B 2 350 ? -205.964 157.568 114.233 1.00 96.11  ? 350 TYR C CE1   1 
ATOM 4050  C CE2   . TYR B 2 350 ? -206.184 157.802 116.599 1.00 96.11  ? 350 TYR C CE2   1 
ATOM 4051  C CZ    . TYR B 2 350 ? -206.745 157.573 115.365 1.00 96.11  ? 350 TYR C CZ    1 
ATOM 4052  O OH    . TYR B 2 350 ? -208.096 157.355 115.269 1.00 96.11  ? 350 TYR C OH    1 
ATOM 4053  N N     . ARG B 2 351 ? -204.131 161.232 115.699 1.00 91.24  ? 351 ARG C N     1 
ATOM 4054  C CA    . ARG B 2 351 ? -204.804 162.302 116.433 1.00 91.24  ? 351 ARG C CA    1 
ATOM 4055  C C     . ARG B 2 351 ? -206.302 162.036 116.394 1.00 91.24  ? 351 ARG C C     1 
ATOM 4056  O O     . ARG B 2 351 ? -206.804 161.538 115.380 1.00 91.24  ? 351 ARG C O     1 
ATOM 4057  C CB    . ARG B 2 351 ? -204.521 163.679 115.827 1.00 91.24  ? 351 ARG C CB    1 
ATOM 4058  C CG    . ARG B 2 351 ? -203.070 164.111 115.889 1.00 91.24  ? 351 ARG C CG    1 
ATOM 4059  C CD    . ARG B 2 351 ? -202.870 165.416 115.159 1.00 91.24  ? 351 ARG C CD    1 
ATOM 4060  N NE    . ARG B 2 351 ? -201.462 165.753 114.998 1.00 91.24  ? 351 ARG C NE    1 
ATOM 4061  C CZ    . ARG B 2 351 ? -201.034 166.877 114.443 1.00 91.24  ? 351 ARG C CZ    1 
ATOM 4062  N NH1   . ARG B 2 351 ? -201.906 167.773 114.007 1.00 91.24  ? 351 ARG C NH1   1 
ATOM 4063  N NH2   . ARG B 2 351 ? -199.738 167.101 114.313 1.00 91.24  ? 351 ARG C NH2   1 
ATOM 4064  N N     . PRO B 2 352 ? -207.036 162.340 117.464 1.00 83.97  ? 352 PRO C N     1 
ATOM 4065  C CA    . PRO B 2 352 ? -208.483 162.121 117.426 1.00 83.97  ? 352 PRO C CA    1 
ATOM 4066  C C     . PRO B 2 352 ? -209.110 162.928 116.306 1.00 83.97  ? 352 PRO C C     1 
ATOM 4067  O O     . PRO B 2 352 ? -208.690 164.043 115.992 1.00 83.97  ? 352 PRO C O     1 
ATOM 4068  C CB    . PRO B 2 352 ? -208.956 162.616 118.794 1.00 83.97  ? 352 PRO C CB    1 
ATOM 4069  C CG    . PRO B 2 352 ? -207.790 162.562 119.629 1.00 83.97  ? 352 PRO C CG    1 
ATOM 4070  C CD    . PRO B 2 352 ? -206.602 162.839 118.769 1.00 83.97  ? 352 PRO C CD    1 
ATOM 4071  N N     . THR B 2 353 ? -210.133 162.330 115.700 1.00 84.53  ? 353 THR C N     1 
ATOM 4072  C CA    . THR B 2 353 ? -210.799 162.948 114.561 1.00 84.53  ? 353 THR C CA    1 
ATOM 4073  C C     . THR B 2 353 ? -211.624 164.178 114.900 1.00 84.53  ? 353 THR C C     1 
ATOM 4074  O O     . THR B 2 353 ? -211.627 165.138 114.122 1.00 84.53  ? 353 THR C O     1 
ATOM 4075  C CB    . THR B 2 353 ? -211.694 161.929 113.873 1.00 84.53  ? 353 THR C CB    1 
ATOM 4076  O OG1   . THR B 2 353 ? -212.919 161.842 114.601 1.00 84.53  ? 353 THR C OG1   1 
ATOM 4077  C CG2   . THR B 2 353 ? -211.015 160.565 113.851 1.00 84.53  ? 353 THR C CG2   1 
ATOM 4078  N N     . ILE B 2 354 ? -212.335 164.194 116.029 1.00 81.60  ? 354 ILE C N     1 
ATOM 4079  C CA    . ILE B 2 354 ? -213.051 165.427 116.339 1.00 81.60  ? 354 ILE C CA    1 
ATOM 4080  C C     . ILE B 2 354 ? -212.119 166.614 116.452 1.00 81.60  ? 354 ILE C C     1 
ATOM 4081  O O     . ILE B 2 354 ? -212.386 167.682 115.895 1.00 81.60  ? 354 ILE C O     1 
ATOM 4082  C CB    . ILE B 2 354 ? -213.871 165.275 117.622 1.00 81.60  ? 354 ILE C CB    1 
ATOM 4083  C CG1   . ILE B 2 354 ? -214.530 166.610 117.928 1.00 81.60  ? 354 ILE C CG1   1 
ATOM 4084  C CG2   . ILE B 2 354 ? -213.030 164.776 118.750 1.00 81.60  ? 354 ILE C CG2   1 
ATOM 4085  C CD1   . ILE B 2 354 ? -215.481 166.544 119.032 1.00 81.60  ? 354 ILE C CD1   1 
ATOM 4086  N N     . LEU B 2 355 ? -211.018 166.456 117.171 1.00 86.38  ? 355 LEU C N     1 
ATOM 4087  C CA    . LEU B 2 355 ? -210.048 167.535 117.238 1.00 86.38  ? 355 LEU C CA    1 
ATOM 4088  C C     . LEU B 2 355 ? -209.492 167.825 115.864 1.00 86.38  ? 355 LEU C C     1 
ATOM 4089  O O     . LEU B 2 355 ? -209.217 168.980 115.529 1.00 86.38  ? 355 LEU C O     1 
ATOM 4090  C CB    . LEU B 2 355 ? -208.965 167.278 118.269 1.00 86.38  ? 355 LEU C CB    1 
ATOM 4091  C CG    . LEU B 2 355 ? -207.956 166.180 118.273 1.00 86.38  ? 355 LEU C CG    1 
ATOM 4092  C CD1   . LEU B 2 355 ? -206.747 166.649 117.511 1.00 86.38  ? 355 LEU C CD1   1 
ATOM 4093  C CD2   . LEU B 2 355 ? -207.683 166.029 119.732 1.00 86.38  ? 355 LEU C CD2   1 
ATOM 4094  N N     . ASP B 2 356 ? -209.384 166.803 115.020 1.00 90.97  ? 356 ASP C N     1 
ATOM 4095  C CA    . ASP B 2 356 ? -208.677 167.013 113.776 1.00 90.97  ? 356 ASP C CA    1 
ATOM 4096  C C     . ASP B 2 356 ? -209.586 167.612 112.732 1.00 90.97  ? 356 ASP C C     1 
ATOM 4097  O O     . ASP B 2 356 ? -209.126 167.932 111.632 1.00 90.97  ? 356 ASP C O     1 
ATOM 4098  C CB    . ASP B 2 356 ? -208.177 165.669 113.230 1.00 90.97  ? 356 ASP C CB    1 
ATOM 4099  C CG    . ASP B 2 356 ? -206.788 165.300 113.700 1.00 90.97  ? 356 ASP C CG    1 
ATOM 4100  O OD1   . ASP B 2 356 ? -206.067 166.130 114.294 1.00 90.97  ? 356 ASP C OD1   1 
ATOM 4101  O OD2   . ASP B 2 356 ? -206.419 164.142 113.432 1.00 90.97  ? 356 ASP C OD2   1 
ATOM 4102  N N     . ASN B 2 357 ? -210.869 167.717 113.034 1.00 94.45  ? 357 ASN C N     1 
ATOM 4103  C CA    . ASN B 2 357 ? -211.807 168.364 112.143 1.00 94.45  ? 357 ASN C CA    1 
ATOM 4104  C C     . ASN B 2 357 ? -212.038 169.808 112.557 1.00 94.45  ? 357 ASN C C     1 
ATOM 4105  O O     . ASN B 2 357 ? -212.052 170.699 111.712 1.00 94.45  ? 357 ASN C O     1 
ATOM 4106  C CB    . ASN B 2 357 ? -213.112 167.588 112.049 1.00 94.45  ? 357 ASN C CB    1 
ATOM 4107  C CG    . ASN B 2 357 ? -212.959 166.365 111.173 1.00 94.45  ? 357 ASN C CG    1 
ATOM 4108  O OD1   . ASN B 2 357 ? -212.252 166.398 110.170 1.00 94.45  ? 357 ASN C OD1   1 
ATOM 4109  N ND2   . ASN B 2 357 ? -213.625 165.283 111.540 1.00 94.45  ? 357 ASN C ND2   1 
ATOM 4110  N N     . CYS B 2 358 ? -212.167 170.054 113.857 1.00 91.77  ? 358 CYS C N     1 
ATOM 4111  C CA    . CYS B 2 358 ? -212.582 171.342 114.404 1.00 91.77  ? 358 CYS C CA    1 
ATOM 4112  C C     . CYS B 2 358 ? -211.428 172.229 114.815 1.00 91.77  ? 358 CYS C C     1 
ATOM 4113  O O     . CYS B 2 358 ? -211.556 173.452 114.775 1.00 91.77  ? 358 CYS C O     1 
ATOM 4114  C CB    . CYS B 2 358 ? -213.486 171.116 115.600 1.00 91.77  ? 358 CYS C CB    1 
ATOM 4115  S SG    . CYS B 2 358 ? -214.704 169.812 115.298 1.00 91.77  ? 358 CYS C SG    1 
ATOM 4116  N N     . THR B 2 359 ? -210.326 171.660 115.232 1.00 86.65  ? 359 THR C N     1 
ATOM 4117  C CA    . THR B 2 359 ? -209.202 172.474 115.678 1.00 86.65  ? 359 THR C CA    1 
ATOM 4118  C C     . THR B 2 359 ? -208.386 173.009 114.515 1.00 86.65  ? 359 THR C C     1 
ATOM 4119  O O     . THR B 2 359 ? -207.864 174.123 114.645 1.00 86.65  ? 359 THR C O     1 
ATOM 4120  C CB    . THR B 2 359 ? -208.272 171.751 116.671 1.00 86.65  ? 359 THR C CB    1 
ATOM 4121  N N     . PRO B 2 360 ? -208.277 172.337 113.360 1.00 92.44  ? 360 PRO C N     1 
ATOM 4122  C CA    . PRO B 2 360 ? -207.296 172.830 112.398 1.00 92.44  ? 360 PRO C CA    1 
ATOM 4123  C C     . PRO B 2 360 ? -207.787 174.020 111.590 1.00 92.44  ? 360 PRO C C     1 
ATOM 4124  O O     . PRO B 2 360 ? -208.842 174.590 111.869 1.00 92.44  ? 360 PRO C O     1 
ATOM 4125  C CB    . PRO B 2 360 ? -207.072 171.618 111.504 1.00 92.44  ? 360 PRO C CB    1 
ATOM 4126  C CG    . PRO B 2 360 ? -208.410 171.095 111.390 1.00 92.44  ? 360 PRO C CG    1 
ATOM 4127  C CD    . PRO B 2 360 ? -208.991 171.183 112.780 1.00 92.44  ? 360 PRO C CD    1 
ATOM 4128  N N     . LEU B 2 361 ? -207.057 174.341 110.531 1.00 96.93  ? 361 LEU C N     1 
ATOM 4129  C CA    . LEU B 2 361 ? -207.357 175.482 109.682 1.00 96.93  ? 361 LEU C CA    1 
ATOM 4130  C C     . LEU B 2 361 ? -208.208 175.195 108.450 1.00 96.93  ? 361 LEU C C     1 
ATOM 4131  O O     . LEU B 2 361 ? -208.651 176.149 107.809 1.00 96.93  ? 361 LEU C O     1 
ATOM 4132  C CB    . LEU B 2 361 ? -206.052 176.119 109.211 1.00 96.93  ? 361 LEU C CB    1 
ATOM 4133  C CG    . LEU B 2 361 ? -205.356 177.098 110.153 1.00 96.93  ? 361 LEU C CG    1 
ATOM 4134  C CD1   . LEU B 2 361 ? -206.283 178.260 110.426 1.00 96.93  ? 361 LEU C CD1   1 
ATOM 4135  C CD2   . LEU B 2 361 ? -204.898 176.440 111.443 1.00 96.93  ? 361 LEU C CD2   1 
ATOM 4136  N N     . ALA B 2 362 ? -208.434 173.938 108.074 1.00 98.73  ? 362 ALA C N     1 
ATOM 4137  C CA    . ALA B 2 362 ? -209.356 173.677 106.972 1.00 98.73  ? 362 ALA C CA    1 
ATOM 4138  C C     . ALA B 2 362 ? -210.795 174.011 107.339 1.00 98.73  ? 362 ALA C C     1 
ATOM 4139  O O     . ALA B 2 362 ? -211.544 174.544 106.513 1.00 98.73  ? 362 ALA C O     1 
ATOM 4140  C CB    . ALA B 2 362 ? -209.236 172.219 106.545 1.00 98.73  ? 362 ALA C CB    1 
ATOM 4141  N N     . GLN B 2 363 ? -211.155 173.766 108.598 1.00 103.73 ? 363 GLN C N     1 
ATOM 4142  C CA    . GLN B 2 363 ? -212.493 174.065 109.116 1.00 103.73 ? 363 GLN C CA    1 
ATOM 4143  C C     . GLN B 2 363 ? -213.090 175.376 108.572 1.00 103.73 ? 363 GLN C C     1 
ATOM 4144  O O     . GLN B 2 363 ? -213.284 175.506 107.363 1.00 103.73 ? 363 GLN C O     1 
ATOM 4145  C CB    . GLN B 2 363 ? -212.482 174.068 110.650 1.00 103.73 ? 363 GLN C CB    1 
ATOM 4146  C CG    . GLN B 2 363 ? -213.755 173.527 111.280 1.00 103.73 ? 363 GLN C CG    1 
ATOM 4147  C CD    . GLN B 2 363 ? -214.504 174.579 112.074 1.00 103.73 ? 363 GLN C CD    1 
ATOM 4148  O OE1   . GLN B 2 363 ? -215.428 175.214 111.567 1.00 103.73 ? 363 GLN C OE1   1 
ATOM 4149  N NE2   . GLN B 2 363 ? -214.107 174.768 113.327 1.00 103.73 ? 363 GLN C NE2   1 
ATOM 4150  N N     . VAL B 2 364 ? -213.387 176.341 109.448 1.00 107.85 ? 364 VAL C N     1 
ATOM 4151  C CA    . VAL B 2 364 ? -213.977 177.605 108.990 1.00 107.85 ? 364 VAL C CA    1 
ATOM 4152  C C     . VAL B 2 364 ? -213.886 178.830 109.920 1.00 107.85 ? 364 VAL C C     1 
ATOM 4153  O O     . VAL B 2 364 ? -213.797 179.958 109.427 1.00 107.85 ? 364 VAL C O     1 
ATOM 4154  C CB    . VAL B 2 364 ? -215.455 177.412 108.592 1.00 107.85 ? 364 VAL C CB    1 
ATOM 4155  N N     . PRO B 2 365 ? -213.925 178.602 111.294 1.00 106.68 ? 365 PRO C N     1 
ATOM 4156  C CA    . PRO B 2 365 ? -213.847 179.830 112.121 1.00 106.68 ? 365 PRO C CA    1 
ATOM 4157  C C     . PRO B 2 365 ? -212.643 180.697 111.754 1.00 106.68 ? 365 PRO C C     1 
ATOM 4158  O O     . PRO B 2 365 ? -211.789 180.208 111.014 1.00 106.68 ? 365 PRO C O     1 
ATOM 4159  C CB    . PRO B 2 365 ? -213.706 179.304 113.560 1.00 106.68 ? 365 PRO C CB    1 
ATOM 4160  C CG    . PRO B 2 365 ? -213.242 177.898 113.434 1.00 106.68 ? 365 PRO C CG    1 
ATOM 4161  C CD    . PRO B 2 365 ? -214.010 177.414 112.253 1.00 106.68 ? 365 PRO C CD    1 
ATOM 4162  N N     . GLN B 2 366 ? -212.555 181.940 112.232 1.00 111.08 ? 366 GLN C N     1 
ATOM 4163  C CA    . GLN B 2 366 ? -211.392 182.734 111.840 1.00 111.08 ? 366 GLN C CA    1 
ATOM 4164  C C     . GLN B 2 366 ? -210.333 182.766 112.948 1.00 111.08 ? 366 GLN C C     1 
ATOM 4165  O O     . GLN B 2 366 ? -209.220 182.262 112.767 1.00 111.08 ? 366 GLN C O     1 
ATOM 4166  C CB    . GLN B 2 366 ? -211.835 184.144 111.416 1.00 111.08 ? 366 GLN C CB    1 
ATOM 4167  C CG    . GLN B 2 366 ? -212.341 185.028 112.524 1.00 111.08 ? 366 GLN C CG    1 
ATOM 4168  C CD    . GLN B 2 366 ? -213.666 184.535 113.018 1.00 111.08 ? 366 GLN C CD    1 
ATOM 4169  O OE1   . GLN B 2 366 ? -214.287 183.687 112.379 1.00 111.08 ? 366 GLN C OE1   1 
ATOM 4170  N NE2   . GLN B 2 366 ? -214.050 184.960 114.210 1.00 111.08 ? 366 GLN C NE2   1 
ATOM 4171  N N     . GLU B 2 367 ? -210.665 183.339 114.104 1.00 101.36 ? 367 GLU C N     1 
ATOM 4172  C CA    . GLU B 2 367 ? -209.743 183.542 115.213 1.00 101.36 ? 367 GLU C CA    1 
ATOM 4173  C C     . GLU B 2 367 ? -209.971 182.560 116.337 1.00 101.36 ? 367 GLU C C     1 
ATOM 4174  O O     . GLU B 2 367 ? -209.036 182.282 117.092 1.00 101.36 ? 367 GLU C O     1 
ATOM 4175  C CB    . GLU B 2 367 ? -209.848 184.966 115.772 1.00 101.36 ? 367 GLU C CB    1 
ATOM 4176  C CG    . GLU B 2 367 ? -208.824 185.284 116.873 1.00 101.36 ? 367 GLU C CG    1 
ATOM 4177  C CD    . GLU B 2 367 ? -209.377 185.011 118.279 1.00 101.36 ? 367 GLU C CD    1 
ATOM 4178  O OE1   . GLU B 2 367 ? -210.611 184.897 118.413 1.00 101.36 ? 367 GLU C OE1   1 
ATOM 4179  O OE2   . GLU B 2 367 ? -208.591 184.876 119.244 1.00 101.36 ? 367 GLU C OE2   1 
ATOM 4180  N N     . VAL B 2 368 ? -211.179 182.010 116.428 1.00 97.60  ? 368 VAL C N     1 
ATOM 4181  C CA    . VAL B 2 368 ? -211.607 181.103 117.485 1.00 97.60  ? 368 VAL C CA    1 
ATOM 4182  C C     . VAL B 2 368 ? -210.507 180.117 117.830 1.00 97.60  ? 368 VAL C C     1 
ATOM 4183  O O     . VAL B 2 368 ? -210.257 179.837 119.007 1.00 97.60  ? 368 VAL C O     1 
ATOM 4184  C CB    . VAL B 2 368 ? -212.879 180.362 117.047 1.00 97.60  ? 368 VAL C CB    1 
ATOM 4185  C CG1   . VAL B 2 368 ? -213.131 179.154 117.931 1.00 97.60  ? 368 VAL C CG1   1 
ATOM 4186  C CG2   . VAL B 2 368 ? -214.065 181.326 117.056 1.00 97.60  ? 368 VAL C CG2   1 
ATOM 4187  N N     . LEU B 2 369 ? -209.848 179.579 116.811 1.00 93.65  ? 369 LEU C N     1 
ATOM 4188  C CA    . LEU B 2 369 ? -208.876 178.528 117.048 1.00 93.65  ? 369 LEU C CA    1 
ATOM 4189  C C     . LEU B 2 369 ? -207.731 179.023 117.912 1.00 93.65  ? 369 LEU C C     1 
ATOM 4190  O O     . LEU B 2 369 ? -207.050 178.213 118.549 1.00 93.65  ? 369 LEU C O     1 
ATOM 4191  C CB    . LEU B 2 369 ? -208.300 178.041 115.733 1.00 93.65  ? 369 LEU C CB    1 
ATOM 4192  C CG    . LEU B 2 369 ? -209.264 177.577 114.659 1.00 93.65  ? 369 LEU C CG    1 
ATOM 4193  C CD1   . LEU B 2 369 ? -208.453 177.120 113.472 1.00 93.65  ? 369 LEU C CD1   1 
ATOM 4194  C CD2   . LEU B 2 369 ? -210.173 176.496 115.160 1.00 93.65  ? 369 LEU C CD2   1 
ATOM 4195  N N     . ASP B 2 370 ? -207.512 180.337 117.956 1.00 95.22  ? 370 ASP C N     1 
ATOM 4196  C CA    . ASP B 2 370 ? -206.388 180.850 118.720 1.00 95.22  ? 370 ASP C CA    1 
ATOM 4197  C C     . ASP B 2 370 ? -206.601 180.665 120.206 1.00 95.22  ? 370 ASP C C     1 
ATOM 4198  O O     . ASP B 2 370 ? -205.635 180.452 120.943 1.00 95.22  ? 370 ASP C O     1 
ATOM 4199  C CB    . ASP B 2 370 ? -206.167 182.331 118.417 1.00 95.22  ? 370 ASP C CB    1 
ATOM 4200  C CG    . ASP B 2 370 ? -205.869 182.591 116.955 1.00 95.22  ? 370 ASP C CG    1 
ATOM 4201  O OD1   . ASP B 2 370 ? -205.279 181.702 116.313 1.00 95.22  ? 370 ASP C OD1   1 
ATOM 4202  O OD2   . ASP B 2 370 ? -206.209 183.682 116.452 1.00 95.22  ? 370 ASP C OD2   1 
ATOM 4203  N N     . SER B 2 371 ? -207.836 180.759 120.680 1.00 89.90  ? 371 SER C N     1 
ATOM 4204  C CA    . SER B 2 371 ? -208.041 180.680 122.112 1.00 89.90  ? 371 SER C CA    1 
ATOM 4205  C C     . SER B 2 371 ? -208.742 179.407 122.565 1.00 89.90  ? 371 SER C C     1 
ATOM 4206  O O     . SER B 2 371 ? -209.102 179.309 123.741 1.00 89.90  ? 371 SER C O     1 
ATOM 4207  C CB    . SER B 2 371 ? -208.776 181.899 122.623 1.00 89.90  ? 371 SER C CB    1 
ATOM 4208  O OG    . SER B 2 371 ? -208.745 181.870 124.037 1.00 89.90  ? 371 SER C OG    1 
ATOM 4209  N N     . LEU B 2 372 ? -208.964 178.442 121.678 1.00 83.56  ? 372 LEU C N     1 
ATOM 4210  C CA    . LEU B 2 372 ? -209.488 177.167 122.142 1.00 83.56  ? 372 LEU C CA    1 
ATOM 4211  C C     . LEU B 2 372 ? -208.407 176.449 122.937 1.00 83.56  ? 372 LEU C C     1 
ATOM 4212  O O     . LEU B 2 372 ? -207.210 176.613 122.690 1.00 83.56  ? 372 LEU C O     1 
ATOM 4213  C CB    . LEU B 2 372 ? -209.956 176.291 120.971 1.00 83.56  ? 372 LEU C CB    1 
ATOM 4214  C CG    . LEU B 2 372 ? -208.950 175.561 120.061 1.00 83.56  ? 372 LEU C CG    1 
ATOM 4215  C CD1   . LEU B 2 372 ? -208.496 174.252 120.639 1.00 83.56  ? 372 LEU C CD1   1 
ATOM 4216  C CD2   . LEU B 2 372 ? -209.534 175.285 118.696 1.00 83.56  ? 372 LEU C CD2   1 
ATOM 4217  N N     . ARG B 2 373 ? -208.837 175.665 123.912 1.00 73.36  ? 373 ARG C N     1 
ATOM 4218  C CA    . ARG B 2 373 ? -207.926 174.899 124.738 1.00 73.36  ? 373 ARG C CA    1 
ATOM 4219  C C     . ARG B 2 373 ? -208.590 173.582 125.086 1.00 73.36  ? 373 ARG C C     1 
ATOM 4220  O O     . ARG B 2 373 ? -209.751 173.550 125.477 1.00 73.36  ? 373 ARG C O     1 
ATOM 4221  C CB    . ARG B 2 373 ? -207.519 175.702 125.967 1.00 73.36  ? 373 ARG C CB    1 
ATOM 4222  C CG    . ARG B 2 373 ? -208.635 176.084 126.873 1.00 73.36  ? 373 ARG C CG    1 
ATOM 4223  C CD    . ARG B 2 373 ? -208.090 176.757 128.089 1.00 73.36  ? 373 ARG C CD    1 
ATOM 4224  N NE    . ARG B 2 373 ? -209.150 177.029 129.041 1.00 73.36  ? 373 ARG C NE    1 
ATOM 4225  C CZ    . ARG B 2 373 ? -208.945 177.511 130.255 1.00 73.36  ? 373 ARG C CZ    1 
ATOM 4226  N NH1   . ARG B 2 373 ? -207.712 177.769 130.656 1.00 73.36  ? 373 ARG C NH1   1 
ATOM 4227  N NH2   . ARG B 2 373 ? -209.970 177.745 131.061 1.00 73.36  ? 373 ARG C NH2   1 
ATOM 4228  N N     . LEU B 2 374 ? -207.803 172.526 125.047 1.00 64.03  ? 374 LEU C N     1 
ATOM 4229  C CA    . LEU B 2 374 ? -208.260 171.152 125.134 1.00 64.03  ? 374 LEU C CA    1 
ATOM 4230  C C     . LEU B 2 374 ? -208.376 170.650 126.566 1.00 64.03  ? 374 LEU C C     1 
ATOM 4231  O O     . LEU B 2 374 ? -207.613 171.052 127.446 1.00 64.03  ? 374 LEU C O     1 
ATOM 4232  C CB    . LEU B 2 374 ? -207.282 170.275 124.364 1.00 64.03  ? 374 LEU C CB    1 
ATOM 4233  C CG    . LEU B 2 374 ? -207.568 168.795 124.240 1.00 64.03  ? 374 LEU C CG    1 
ATOM 4234  C CD1   . LEU B 2 374 ? -208.915 168.626 123.606 1.00 64.03  ? 374 LEU C CD1   1 
ATOM 4235  C CD2   . LEU B 2 374 ? -206.489 168.136 123.413 1.00 64.03  ? 374 LEU C CD2   1 
ATOM 4236  N N     . ARG B 2 375 ? -209.362 169.781 126.800 1.00 58.23  ? 375 ARG C N     1 
ATOM 4237  C CA    . ARG B 2 375 ? -209.504 169.124 128.091 1.00 58.23  ? 375 ARG C CA    1 
ATOM 4238  C C     . ARG B 2 375 ? -209.793 167.649 127.882 1.00 58.23  ? 375 ARG C C     1 
ATOM 4239  O O     . ARG B 2 375 ? -210.550 167.289 126.986 1.00 58.23  ? 375 ARG C O     1 
ATOM 4240  C CB    . ARG B 2 375 ? -210.621 169.695 128.940 1.00 58.23  ? 375 ARG C CB    1 
ATOM 4241  C CG    . ARG B 2 375 ? -210.686 168.935 130.225 1.00 58.23  ? 375 ARG C CG    1 
ATOM 4242  C CD    . ARG B 2 375 ? -211.700 169.423 131.166 1.00 58.23  ? 375 ARG C CD    1 
ATOM 4243  N NE    . ARG B 2 375 ? -213.006 169.478 130.549 1.00 58.23  ? 375 ARG C NE    1 
ATOM 4244  C CZ    . ARG B 2 375 ? -214.020 170.137 131.081 1.00 58.23  ? 375 ARG C CZ    1 
ATOM 4245  N NH1   . ARG B 2 375 ? -213.855 170.784 132.223 1.00 58.23  ? 375 ARG C NH1   1 
ATOM 4246  N NH2   . ARG B 2 375 ? -215.191 170.152 130.473 1.00 58.23  ? 375 ARG C NH2   1 
ATOM 4247  N N     . ALA B 2 376 ? -209.238 166.805 128.753 1.00 53.15  ? 376 ALA C N     1 
ATOM 4248  C CA    . ALA B 2 376 ? -209.377 165.360 128.652 1.00 53.15  ? 376 ALA C CA    1 
ATOM 4249  C C     . ALA B 2 376 ? -209.819 164.748 129.973 1.00 53.15  ? 376 ALA C C     1 
ATOM 4250  O O     . ALA B 2 376 ? -209.376 165.175 131.044 1.00 53.15  ? 376 ALA C O     1 
ATOM 4251  C CB    . ALA B 2 376 ? -208.062 164.722 128.224 1.00 53.15  ? 376 ALA C CB    1 
ATOM 4252  N N     . PHE B 2 377 ? -210.710 163.762 129.885 1.00 50.59  ? 377 PHE C N     1 
ATOM 4253  C CA    . PHE B 2 377 ? -211.182 162.976 131.023 1.00 50.59  ? 377 PHE C CA    1 
ATOM 4254  C C     . PHE B 2 377 ? -210.699 161.548 130.839 1.00 50.59  ? 377 PHE C C     1 
ATOM 4255  O O     . PHE B 2 377 ? -211.132 160.862 129.912 1.00 50.59  ? 377 PHE C O     1 
ATOM 4256  C CB    . PHE B 2 377 ? -212.696 163.010 131.169 1.00 50.59  ? 377 PHE C CB    1 
ATOM 4257  C CG    . PHE B 2 377 ? -213.237 164.368 131.399 1.00 50.59  ? 377 PHE C CG    1 
ATOM 4258  C CD1   . PHE B 2 377 ? -212.961 165.029 132.567 1.00 50.59  ? 377 PHE C CD1   1 
ATOM 4259  C CD2   . PHE B 2 377 ? -214.054 164.968 130.477 1.00 50.59  ? 377 PHE C CD2   1 
ATOM 4260  C CE1   . PHE B 2 377 ? -213.449 166.277 132.796 1.00 50.59  ? 377 PHE C CE1   1 
ATOM 4261  C CE2   . PHE B 2 377 ? -214.552 166.216 130.704 1.00 50.59  ? 377 PHE C CE2   1 
ATOM 4262  C CZ    . PHE B 2 377 ? -214.246 166.872 131.867 1.00 50.59  ? 377 PHE C CZ    1 
ATOM 4263  N N     . GLY B 2 378 ? -209.821 161.094 131.718 1.00 49.20  ? 378 GLY C N     1 
ATOM 4264  C CA    . GLY B 2 378 ? -209.326 159.742 131.584 1.00 49.20  ? 378 GLY C CA    1 
ATOM 4265  C C     . GLY B 2 378 ? -209.600 158.899 132.805 1.00 49.20  ? 378 GLY C C     1 
ATOM 4266  O O     . GLY B 2 378 ? -209.411 159.349 133.933 1.00 49.20  ? 378 GLY C O     1 
ATOM 4267  N N     . PHE B 2 379 ? -210.112 157.694 132.599 1.00 53.13  ? 379 PHE C N     1 
ATOM 4268  C CA    . PHE B 2 379 ? -210.329 156.754 133.687 1.00 53.13  ? 379 PHE C CA    1 
ATOM 4269  C C     . PHE B 2 379 ? -209.538 155.467 133.496 1.00 53.13  ? 379 PHE C C     1 
ATOM 4270  O O     . PHE B 2 379 ? -210.027 154.510 132.900 1.00 53.13  ? 379 PHE C O     1 
ATOM 4271  C CB    . PHE B 2 379 ? -211.787 156.486 133.775 1.00 53.13  ? 379 PHE C CB    1 
ATOM 4272  C CG    . PHE B 2 379 ? -212.177 155.616 134.908 1.00 53.13  ? 379 PHE C CG    1 
ATOM 4273  C CD1   . PHE B 2 379 ? -212.044 156.037 136.192 1.00 53.13  ? 379 PHE C CD1   1 
ATOM 4274  C CD2   . PHE B 2 379 ? -212.749 154.399 134.687 1.00 53.13  ? 379 PHE C CD2   1 
ATOM 4275  C CE1   . PHE B 2 379 ? -212.420 155.236 137.218 1.00 53.13  ? 379 PHE C CE1   1 
ATOM 4276  C CE2   . PHE B 2 379 ? -213.139 153.628 135.730 1.00 53.13  ? 379 PHE C CE2   1 
ATOM 4277  C CZ    . PHE B 2 379 ? -212.967 154.037 136.985 1.00 53.13  ? 379 PHE C CZ    1 
ATOM 4278  N N     . ASP B 2 380 ? -208.303 155.455 133.981 1.00 58.40  ? 380 ASP C N     1 
ATOM 4279  C CA    . ASP B 2 380 ? -207.459 154.276 133.890 1.00 58.40  ? 380 ASP C CA    1 
ATOM 4280  C C     . ASP B 2 380 ? -207.985 153.201 134.827 1.00 58.40  ? 380 ASP C C     1 
ATOM 4281  O O     . ASP B 2 380 ? -208.120 153.421 136.036 1.00 58.40  ? 380 ASP C O     1 
ATOM 4282  C CB    . ASP B 2 380 ? -206.018 154.618 134.225 1.00 58.40  ? 380 ASP C CB    1 
ATOM 4283  C CG    . ASP B 2 380 ? -205.105 153.423 134.128 1.00 58.40  ? 380 ASP C CG    1 
ATOM 4284  O OD1   . ASP B 2 380 ? -205.530 152.381 133.593 1.00 58.40  ? 380 ASP C OD1   1 
ATOM 4285  O OD2   . ASP B 2 380 ? -203.931 153.548 134.518 1.00 58.40  ? 380 ASP C OD2   1 
ATOM 4286  N N     . GLN B 2 381 ? -208.232 152.026 134.267 1.00 58.09  ? 381 GLN C N     1 
ATOM 4287  C CA    . GLN B 2 381 ? -208.826 150.917 134.991 1.00 58.09  ? 381 GLN C CA    1 
ATOM 4288  C C     . GLN B 2 381 ? -208.623 149.646 134.195 1.00 58.09  ? 381 GLN C C     1 
ATOM 4289  O O     . GLN B 2 381 ? -208.171 149.666 133.049 1.00 58.09  ? 381 GLN C O     1 
ATOM 4290  C CB    . GLN B 2 381 ? -210.315 151.068 135.165 1.00 58.09  ? 381 GLN C CB    1 
ATOM 4291  C CG    . GLN B 2 381 ? -210.918 151.202 133.818 1.00 58.09  ? 381 GLN C CG    1 
ATOM 4292  C CD    . GLN B 2 381 ? -212.388 151.378 133.849 1.00 58.09  ? 381 GLN C CD    1 
ATOM 4293  O OE1   . GLN B 2 381 ? -213.039 151.043 134.829 1.00 58.09  ? 381 GLN C OE1   1 
ATOM 4294  N NE2   . GLN B 2 381 ? -212.930 151.940 132.798 1.00 58.09  ? 381 GLN C NE2   1 
ATOM 4295  N N     . ASP B 2 382 ? -208.953 148.533 134.832 1.00 65.39  ? 382 ASP C N     1 
ATOM 4296  C CA    . ASP B 2 382 ? -208.924 147.264 134.139 1.00 65.39  ? 382 ASP C CA    1 
ATOM 4297  C C     . ASP B 2 382 ? -210.104 147.224 133.183 1.00 65.39  ? 382 ASP C C     1 
ATOM 4298  O O     . ASP B 2 382 ? -211.130 147.865 133.406 1.00 65.39  ? 382 ASP C O     1 
ATOM 4299  C CB    . ASP B 2 382 ? -209.049 146.136 135.164 1.00 65.39  ? 382 ASP C CB    1 
ATOM 4300  C CG    . ASP B 2 382 ? -208.651 144.791 134.624 1.00 65.39  ? 382 ASP C CG    1 
ATOM 4301  O OD1   . ASP B 2 382 ? -208.476 144.665 133.399 1.00 65.39  ? 382 ASP C OD1   1 
ATOM 4302  O OD2   . ASP B 2 382 ? -208.526 143.844 135.432 1.00 65.39  ? 382 ASP C OD2   1 
ATOM 4303  N N     . GLY B 2 383 ? -209.961 146.483 132.092 1.00 64.74  ? 383 GLY C N     1 
ATOM 4304  C CA    . GLY B 2 383 ? -211.160 146.296 131.304 1.00 64.74  ? 383 GLY C CA    1 
ATOM 4305  C C     . GLY B 2 383 ? -212.201 145.430 131.967 1.00 64.74  ? 383 GLY C C     1 
ATOM 4306  O O     . GLY B 2 383 ? -213.321 145.333 131.461 1.00 64.74  ? 383 GLY C O     1 
ATOM 4307  N N     . GLN B 2 384 ? -211.840 144.776 133.065 1.00 63.67  ? 384 GLN C N     1 
ATOM 4308  C CA    . GLN B 2 384 ? -212.728 143.960 133.878 1.00 63.67  ? 384 GLN C CA    1 
ATOM 4309  C C     . GLN B 2 384 ? -213.401 144.798 134.946 1.00 63.67  ? 384 GLN C C     1 
ATOM 4310  O O     . GLN B 2 384 ? -213.972 145.838 134.629 1.00 63.67  ? 384 GLN C O     1 
ATOM 4311  C CB    . GLN B 2 384 ? -211.976 142.771 134.437 1.00 63.67  ? 384 GLN C CB    1 
ATOM 4312  C CG    . GLN B 2 384 ? -211.354 142.031 133.280 1.00 63.67  ? 384 GLN C CG    1 
ATOM 4313  C CD    . GLN B 2 384 ? -212.329 141.088 132.630 1.00 63.67  ? 384 GLN C CD    1 
ATOM 4314  O OE1   . GLN B 2 384 ? -212.716 141.265 131.470 1.00 63.67  ? 384 GLN C OE1   1 
ATOM 4315  N NE2   . GLN B 2 384 ? -212.778 140.115 133.385 1.00 63.67  ? 384 GLN C NE2   1 
ATOM 4316  N N     . ALA B 2 385 ? -213.351 144.374 136.204 1.00 59.20  ? 385 ALA C N     1 
ATOM 4317  C CA    . ALA B 2 385 ? -213.924 145.188 137.265 1.00 59.20  ? 385 ALA C CA    1 
ATOM 4318  C C     . ALA B 2 385 ? -212.919 145.952 138.117 1.00 59.20  ? 385 ALA C C     1 
ATOM 4319  O O     . ALA B 2 385 ? -213.347 146.699 138.995 1.00 59.20  ? 385 ALA C O     1 
ATOM 4320  C CB    . ALA B 2 385 ? -214.786 144.325 138.181 1.00 59.20  ? 385 ALA C CB    1 
ATOM 4321  N N     . ARG B 2 386 ? -211.614 145.784 137.932 1.00 63.17  ? 386 ARG C N     1 
ATOM 4322  C CA    . ARG B 2 386 ? -210.685 146.549 138.760 1.00 63.17  ? 386 ARG C CA    1 
ATOM 4323  C C     . ARG B 2 386 ? -210.546 147.956 138.204 1.00 63.17  ? 386 ARG C C     1 
ATOM 4324  O O     . ARG B 2 386 ? -210.608 148.169 136.994 1.00 63.17  ? 386 ARG C O     1 
ATOM 4325  C CB    . ARG B 2 386 ? -209.314 145.891 138.881 1.00 63.17  ? 386 ARG C CB    1 
ATOM 4326  C CG    . ARG B 2 386 ? -209.299 144.554 139.571 1.00 63.17  ? 386 ARG C CG    1 
ATOM 4327  C CD    . ARG B 2 386 ? -207.863 144.097 139.706 1.00 63.17  ? 386 ARG C CD    1 
ATOM 4328  N NE    . ARG B 2 386 ? -207.736 142.788 140.327 1.00 63.17  ? 386 ARG C NE    1 
ATOM 4329  C CZ    . ARG B 2 386 ? -207.741 141.640 139.667 1.00 63.17  ? 386 ARG C CZ    1 
ATOM 4330  N NH1   . ARG B 2 386 ? -207.870 141.631 138.353 1.00 63.17  ? 386 ARG C NH1   1 
ATOM 4331  N NH2   . ARG B 2 386 ? -207.616 140.501 140.325 1.00 63.17  ? 386 ARG C NH2   1 
ATOM 4332  N N     . ASP B 2 387 ? -210.295 148.914 139.094 1.00 61.27  ? 387 ASP C N     1 
ATOM 4333  C CA    . ASP B 2 387 ? -210.124 150.301 138.701 1.00 61.27  ? 387 ASP C CA    1 
ATOM 4334  C C     . ASP B 2 387 ? -209.003 150.938 139.496 1.00 61.27  ? 387 ASP C C     1 
ATOM 4335  O O     . ASP B 2 387 ? -208.786 150.613 140.663 1.00 61.27  ? 387 ASP C O     1 
ATOM 4336  C CB    . ASP B 2 387 ? -211.387 151.101 138.978 1.00 61.27  ? 387 ASP C CB    1 
ATOM 4337  C CG    . ASP B 2 387 ? -212.595 150.530 138.303 1.00 61.27  ? 387 ASP C CG    1 
ATOM 4338  O OD1   . ASP B 2 387 ? -212.482 149.940 137.221 1.00 61.27  ? 387 ASP C OD1   1 
ATOM 4339  O OD2   . ASP B 2 387 ? -213.679 150.644 138.882 1.00 61.27  ? 387 ASP C OD2   1 
ATOM 4340  N N     . LYS B 2 388 ? -208.303 151.870 138.864 1.00 53.33  ? 388 LYS C N     1 
ATOM 4341  C CA    . LYS B 2 388 ? -207.108 152.406 139.489 1.00 53.33  ? 388 LYS C CA    1 
ATOM 4342  C C     . LYS B 2 388 ? -207.129 153.909 139.683 1.00 53.33  ? 388 LYS C C     1 
ATOM 4343  O O     . LYS B 2 388 ? -206.872 154.382 140.789 1.00 53.33  ? 388 LYS C O     1 
ATOM 4344  C CB    . LYS B 2 388 ? -205.890 152.026 138.648 1.00 53.33  ? 388 LYS C CB    1 
ATOM 4345  C CG    . LYS B 2 388 ? -204.598 152.505 139.234 1.00 53.33  ? 388 LYS C CG    1 
ATOM 4346  C CD    . LYS B 2 388 ? -203.426 151.832 138.565 1.00 53.33  ? 388 LYS C CD    1 
ATOM 4347  C CE    . LYS B 2 388 ? -203.359 152.209 137.111 1.00 53.33  ? 388 LYS C CE    1 
ATOM 4348  N NZ    . LYS B 2 388 ? -202.179 151.621 136.428 1.00 53.33  ? 388 LYS C NZ    1 
ATOM 4349  N N     . GLN B 2 389 ? -207.440 154.683 138.654 1.00 50.47  ? 389 GLN C N     1 
ATOM 4350  C CA    . GLN B 2 389 ? -207.220 156.122 138.759 1.00 50.47  ? 389 GLN C CA    1 
ATOM 4351  C C     . GLN B 2 389 ? -207.991 156.867 137.699 1.00 50.47  ? 389 GLN C C     1 
ATOM 4352  O O     . GLN B 2 389 ? -208.150 156.340 136.607 1.00 50.47  ? 389 GLN C O     1 
ATOM 4353  C CB    . GLN B 2 389 ? -205.722 156.409 138.694 1.00 50.47  ? 389 GLN C CB    1 
ATOM 4354  C CG    . GLN B 2 389 ? -205.332 157.811 139.030 1.00 50.47  ? 389 GLN C CG    1 
ATOM 4355  C CD    . GLN B 2 389 ? -205.634 158.189 140.446 1.00 50.47  ? 389 GLN C CD    1 
ATOM 4356  O OE1   . GLN B 2 389 ? -206.807 158.420 140.768 1.00 50.47  ? 389 GLN C OE1   1 
ATOM 4357  N NE2   . GLN B 2 389 ? -204.639 158.228 141.298 1.00 50.47  ? 389 GLN C NE2   1 
ATOM 4358  N N     . TRP B 2 390 ? -208.527 158.053 138.034 1.00 46.00  ? 390 TRP C N     1 
ATOM 4359  C CA    . TRP B 2 390 ? -209.114 158.897 137.019 1.00 46.00  ? 390 TRP C CA    1 
ATOM 4360  C C     . TRP B 2 390 ? -208.534 160.318 137.114 1.00 46.00  ? 390 TRP C C     1 
ATOM 4361  O O     . TRP B 2 390 ? -208.021 160.718 138.164 1.00 46.00  ? 390 TRP C O     1 
ATOM 4362  C CB    . TRP B 2 390 ? -210.633 158.942 137.125 1.00 46.00  ? 390 TRP C CB    1 
ATOM 4363  C CG    . TRP B 2 390 ? -211.316 159.501 138.317 1.00 46.00  ? 390 TRP C CG    1 
ATOM 4364  C CD1   . TRP B 2 390 ? -210.979 160.643 138.981 1.00 46.00  ? 390 TRP C CD1   1 
ATOM 4365  C CD2   . TRP B 2 390 ? -212.204 158.814 139.183 1.00 46.00  ? 390 TRP C CD2   1 
ATOM 4366  N NE1   . TRP B 2 390 ? -211.799 160.822 140.057 1.00 46.00  ? 390 TRP C NE1   1 
ATOM 4367  C CE2   . TRP B 2 390 ? -212.524 159.678 140.233 1.00 46.00  ? 390 TRP C CE2   1 
ATOM 4368  C CE3   . TRP B 2 390 ? -212.818 157.568 139.137 1.00 46.00  ? 390 TRP C CE3   1 
ATOM 4369  C CZ2   . TRP B 2 390 ? -213.431 159.333 141.222 1.00 46.00  ? 390 TRP C CZ2   1 
ATOM 4370  C CZ3   . TRP B 2 390 ? -213.712 157.226 140.116 1.00 46.00  ? 390 TRP C CZ3   1 
ATOM 4371  C CH2   . TRP B 2 390 ? -214.010 158.101 141.145 1.00 46.00  ? 390 TRP C CH2   1 
ATOM 4372  N N     . PHE B 2 391 ? -208.649 161.110 136.049 1.00 45.80  ? 391 PHE C N     1 
ATOM 4373  C CA    . PHE B 2 391 ? -208.019 162.417 136.135 1.00 45.80  ? 391 PHE C CA    1 
ATOM 4374  C C     . PHE B 2 391 ? -208.598 163.284 135.034 1.00 45.80  ? 391 PHE C C     1 
ATOM 4375  O O     . PHE B 2 391 ? -208.897 162.786 133.947 1.00 45.80  ? 391 PHE C O     1 
ATOM 4376  C CB    . PHE B 2 391 ? -206.517 162.380 135.872 1.00 45.80  ? 391 PHE C CB    1 
ATOM 4377  C CG    . PHE B 2 391 ? -206.144 161.690 134.602 1.00 45.80  ? 391 PHE C CG    1 
ATOM 4378  C CD1   . PHE B 2 391 ? -205.991 160.332 134.502 1.00 45.80  ? 391 PHE C CD1   1 
ATOM 4379  C CD2   . PHE B 2 391 ? -205.922 162.471 133.481 1.00 45.80  ? 391 PHE C CD2   1 
ATOM 4380  C CE1   . PHE B 2 391 ? -205.642 159.776 133.291 1.00 45.80  ? 391 PHE C CE1   1 
ATOM 4381  C CE2   . PHE B 2 391 ? -205.577 161.931 132.295 1.00 45.80  ? 391 PHE C CE2   1 
ATOM 4382  C CZ    . PHE B 2 391 ? -205.433 160.584 132.192 1.00 45.80  ? 391 PHE C CZ    1 
ATOM 4383  N N     . THR B 2 392 ? -208.774 164.565 135.326 1.00 50.05  ? 392 THR C N     1 
ATOM 4384  C CA    . THR B 2 392 ? -209.116 165.538 134.303 1.00 50.05  ? 392 THR C CA    1 
ATOM 4385  C C     . THR B 2 392 ? -207.864 166.325 133.944 1.00 50.05  ? 392 THR C C     1 
ATOM 4386  O O     . THR B 2 392 ? -206.876 166.310 134.675 1.00 50.05  ? 392 THR C O     1 
ATOM 4387  C CB    . THR B 2 392 ? -210.178 166.483 134.829 1.00 50.05  ? 392 THR C CB    1 
ATOM 4388  O OG1   . THR B 2 392 ? -209.585 167.295 135.844 1.00 50.05  ? 392 THR C OG1   1 
ATOM 4389  C CG2   . THR B 2 392 ? -211.288 165.696 135.466 1.00 50.05  ? 392 THR C CG2   1 
ATOM 4390  N N     . ALA B 2 393 ? -207.907 167.033 132.814 1.00 55.15  ? 393 ALA C N     1 
ATOM 4391  C CA    . ALA B 2 393 ? -206.689 167.685 132.329 1.00 55.15  ? 393 ALA C CA    1 
ATOM 4392  C C     . ALA B 2 393 ? -207.045 168.757 131.300 1.00 55.15  ? 393 ALA C C     1 
ATOM 4393  O O     . ALA B 2 393 ? -207.233 168.435 130.125 1.00 55.15  ? 393 ALA C O     1 
ATOM 4394  C CB    . ALA B 2 393 ? -205.736 166.660 131.750 1.00 55.15  ? 393 ALA C CB    1 
ATOM 4395  N N     . THR B 2 394 ? -207.159 170.006 131.742 1.00 58.43  ? 394 THR C N     1 
ATOM 4396  C CA    . THR B 2 394 ? -207.213 171.136 130.824 1.00 58.43  ? 394 THR C CA    1 
ATOM 4397  C C     . THR B 2 394 ? -205.813 171.666 130.558 1.00 58.43  ? 394 THR C C     1 
ATOM 4398  O O     . THR B 2 394 ? -204.982 171.698 131.463 1.00 58.43  ? 394 THR C O     1 
ATOM 4399  C CB    . THR B 2 394 ? -208.035 172.261 131.426 1.00 58.43  ? 394 THR C CB    1 
ATOM 4400  O OG1   . THR B 2 394 ? -207.231 172.917 132.405 1.00 58.43  ? 394 THR C OG1   1 
ATOM 4401  C CG2   . THR B 2 394 ? -209.237 171.705 132.133 1.00 58.43  ? 394 THR C CG2   1 
ATOM 4402  N N     . THR B 2 395 ? -205.561 172.103 129.328 1.00 59.44  ? 395 THR C N     1 
ATOM 4403  C CA    . THR B 2 395 ? -204.241 172.611 128.993 1.00 59.44  ? 395 THR C CA    1 
ATOM 4404  C C     . THR B 2 395 ? -203.945 173.880 129.790 1.00 59.44  ? 395 THR C C     1 
ATOM 4405  O O     . THR B 2 395 ? -204.860 174.625 130.147 1.00 59.44  ? 395 THR C O     1 
ATOM 4406  C CB    . THR B 2 395 ? -204.129 172.885 127.502 1.00 59.44  ? 395 THR C CB    1 
ATOM 4407  O OG1   . THR B 2 395 ? -202.752 173.018 127.147 1.00 59.44  ? 395 THR C OG1   1 
ATOM 4408  C CG2   . THR B 2 395 ? -204.821 174.144 127.158 1.00 59.44  ? 395 THR C CG2   1 
ATOM 4409  N N     . PRO B 2 396 ? -202.690 174.110 130.162 1.00 61.12  ? 396 PRO C N     1 
ATOM 4410  C CA    . PRO B 2 396 ? -202.378 175.309 130.942 1.00 61.12  ? 396 PRO C CA    1 
ATOM 4411  C C     . PRO B 2 396 ? -202.566 176.559 130.099 1.00 61.12  ? 396 PRO C C     1 
ATOM 4412  O O     . PRO B 2 396 ? -202.164 176.601 128.935 1.00 61.12  ? 396 PRO C O     1 
ATOM 4413  C CB    . PRO B 2 396 ? -200.904 175.118 131.306 1.00 61.12  ? 396 PRO C CB    1 
ATOM 4414  C CG    . PRO B 2 396 ? -200.632 173.673 131.105 1.00 61.12  ? 396 PRO C CG    1 
ATOM 4415  C CD    . PRO B 2 396 ? -201.522 173.233 130.009 1.00 61.12  ? 396 PRO C CD    1 
ATOM 4416  N N     . ALA B 2 397 ? -203.153 177.598 130.686 1.00 67.79  ? 397 ALA C N     1 
ATOM 4417  C CA    . ALA B 2 397 ? -203.315 178.788 129.866 1.00 67.79  ? 397 ALA C CA    1 
ATOM 4418  C C     . ALA B 2 397 ? -202.031 179.589 129.775 1.00 67.79  ? 397 ALA C C     1 
ATOM 4419  O O     . ALA B 2 397 ? -201.874 180.424 128.865 1.00 67.79  ? 397 ALA C O     1 
ATOM 4420  C CB    . ALA B 2 397 ? -204.419 179.665 130.440 1.00 67.79  ? 397 ALA C CB    1 
ATOM 4421  N N     . VAL B 2 398 ? -201.066 179.263 130.627 1.00 72.51  ? 398 VAL C N     1 
ATOM 4422  C CA    . VAL B 2 398 ? -199.786 179.930 130.557 1.00 72.51  ? 398 VAL C CA    1 
ATOM 4423  C C     . VAL B 2 398 ? -199.044 179.620 129.270 1.00 72.51  ? 398 VAL C C     1 
ATOM 4424  O O     . VAL B 2 398 ? -198.254 180.451 128.820 1.00 72.51  ? 398 VAL C O     1 
ATOM 4425  C CB    . VAL B 2 398 ? -198.941 179.599 131.796 1.00 72.51  ? 398 VAL C CB    1 
ATOM 4426  C CG1   . VAL B 2 398 ? -199.658 180.061 133.037 1.00 72.51  ? 398 VAL C CG1   1 
ATOM 4427  C CG2   . VAL B 2 398 ? -198.662 178.124 131.866 1.00 72.51  ? 398 VAL C CG2   1 
ATOM 4428  N N     . LEU B 2 399 ? -199.239 178.449 128.649 1.00 76.46  ? 399 LEU C N     1 
ATOM 4429  C CA    . LEU B 2 399 ? -198.348 178.181 127.524 1.00 76.46  ? 399 LEU C CA    1 
ATOM 4430  C C     . LEU B 2 399 ? -198.667 179.061 126.331 1.00 76.46  ? 399 LEU C C     1 
ATOM 4431  O O     . LEU B 2 399 ? -197.751 179.578 125.680 1.00 76.46  ? 399 LEU C O     1 
ATOM 4432  C CB    . LEU B 2 399 ? -198.455 176.729 127.081 1.00 76.46  ? 399 LEU C CB    1 
ATOM 4433  C CG    . LEU B 2 399 ? -197.926 175.607 127.943 1.00 76.46  ? 399 LEU C CG    1 
ATOM 4434  C CD1   . LEU B 2 399 ? -197.730 174.389 127.084 1.00 76.46  ? 399 LEU C CD1   1 
ATOM 4435  C CD2   . LEU B 2 399 ? -196.672 176.004 128.616 1.00 76.46  ? 399 LEU C CD2   1 
ATOM 4436  N N     . ARG B 2 400 ? -199.951 179.259 126.029 1.00 87.34  ? 400 ARG C N     1 
ATOM 4437  C CA    . ARG B 2 400 ? -200.320 180.162 124.945 1.00 87.34  ? 400 ARG C CA    1 
ATOM 4438  C C     . ARG B 2 400 ? -200.242 181.619 125.365 1.00 87.34  ? 400 ARG C C     1 
ATOM 4439  O O     . ARG B 2 400 ? -200.037 182.487 124.515 1.00 87.34  ? 400 ARG C O     1 
ATOM 4440  C CB    . ARG B 2 400 ? -201.643 179.752 124.313 1.00 87.34  ? 400 ARG C CB    1 
ATOM 4441  C CG    . ARG B 2 400 ? -202.938 179.892 125.005 1.00 87.34  ? 400 ARG C CG    1 
ATOM 4442  C CD    . ARG B 2 400 ? -203.351 181.301 125.232 1.00 87.34  ? 400 ARG C CD    1 
ATOM 4443  N NE    . ARG B 2 400 ? -204.579 181.200 125.971 1.00 87.34  ? 400 ARG C NE    1 
ATOM 4444  C CZ    . ARG B 2 400 ? -205.715 180.945 125.343 1.00 87.34  ? 400 ARG C CZ    1 
ATOM 4445  N NH1   . ARG B 2 400 ? -205.686 180.786 124.026 1.00 87.34  ? 400 ARG C NH1   1 
ATOM 4446  N NH2   . ARG B 2 400 ? -206.858 180.825 126.006 1.00 87.34  ? 400 ARG C NH2   1 
ATOM 4447  N N     . TRP B 2 401 ? -200.393 181.912 126.657 1.00 88.17  ? 401 TRP C N     1 
ATOM 4448  C CA    . TRP B 2 401 ? -200.402 183.310 127.068 1.00 88.17  ? 401 TRP C CA    1 
ATOM 4449  C C     . TRP B 2 401 ? -198.966 183.827 127.102 1.00 88.17  ? 401 TRP C C     1 
ATOM 4450  O O     . TRP B 2 401 ? -198.720 185.011 126.853 1.00 88.17  ? 401 TRP C O     1 
ATOM 4451  C CB    . TRP B 2 401 ? -201.151 183.491 128.378 1.00 88.17  ? 401 TRP C CB    1 
ATOM 4452  C CG    . TRP B 2 401 ? -201.109 184.884 128.901 1.00 88.17  ? 401 TRP C CG    1 
ATOM 4453  C CD1   . TRP B 2 401 ? -201.937 185.906 128.519 1.00 88.17  ? 401 TRP C CD1   1 
ATOM 4454  C CD2   . TRP B 2 401 ? -200.284 185.410 129.933 1.00 88.17  ? 401 TRP C CD2   1 
ATOM 4455  N NE1   . TRP B 2 401 ? -201.646 187.042 129.220 1.00 88.17  ? 401 TRP C NE1   1 
ATOM 4456  C CE2   . TRP B 2 401 ? -200.637 186.764 130.101 1.00 88.17  ? 401 TRP C CE2   1 
ATOM 4457  C CE3   . TRP B 2 401 ? -199.270 184.882 130.718 1.00 88.17  ? 401 TRP C CE3   1 
ATOM 4458  C CZ2   . TRP B 2 401 ? -200.011 187.582 131.020 1.00 88.17  ? 401 TRP C CZ2   1 
ATOM 4459  C CZ3   . TRP B 2 401 ? -198.658 185.692 131.621 1.00 88.17  ? 401 TRP C CZ3   1 
ATOM 4460  C CH2   . TRP B 2 401 ? -199.024 187.027 131.772 1.00 88.17  ? 401 TRP C CH2   1 
ATOM 4461  N N     . LEU B 2 402 ? -198.013 182.950 127.425 1.00 82.82  ? 402 LEU C N     1 
ATOM 4462  C CA    . LEU B 2 402 ? -196.605 183.314 127.348 1.00 82.82  ? 402 LEU C CA    1 
ATOM 4463  C C     . LEU B 2 402 ? -196.223 183.654 125.917 1.00 82.82  ? 402 LEU C C     1 
ATOM 4464  O O     . LEU B 2 402 ? -195.234 184.356 125.693 1.00 82.82  ? 402 LEU C O     1 
ATOM 4465  C CB    . LEU B 2 402 ? -195.711 182.149 127.772 1.00 82.82  ? 402 LEU C CB    1 
ATOM 4466  C CG    . LEU B 2 402 ? -195.446 181.530 129.132 1.00 82.82  ? 402 LEU C CG    1 
ATOM 4467  C CD1   . LEU B 2 402 ? -194.606 180.290 128.929 1.00 82.82  ? 402 LEU C CD1   1 
ATOM 4468  C CD2   . LEU B 2 402 ? -194.681 182.518 129.952 1.00 82.82  ? 402 LEU C CD2   1 
ATOM 4469  N N     . ALA B 2 403 ? -196.962 183.126 124.941 1.00 91.25  ? 403 ALA C N     1 
ATOM 4470  C CA    . ALA B 2 403 ? -196.736 183.476 123.540 1.00 91.25  ? 403 ALA C CA    1 
ATOM 4471  C C     . ALA B 2 403 ? -197.214 184.887 123.196 1.00 91.25  ? 403 ALA C C     1 
ATOM 4472  O O     . ALA B 2 403 ? -196.637 185.537 122.319 1.00 91.25  ? 403 ALA C O     1 
ATOM 4473  C CB    . ALA B 2 403 ? -197.409 182.454 122.631 1.00 91.25  ? 403 ALA C CB    1 
ATOM 4474  N N     . ASP B 2 404 ? -198.233 185.395 123.877 1.00 99.50  ? 404 ASP C N     1 
ATOM 4475  C CA    . ASP B 2 404 ? -198.789 186.708 123.572 1.00 99.50  ? 404 ASP C CA    1 
ATOM 4476  C C     . ASP B 2 404 ? -198.242 187.831 124.438 1.00 99.50  ? 404 ASP C C     1 
ATOM 4477  O O     . ASP B 2 404 ? -198.567 188.991 124.184 1.00 99.50  ? 404 ASP C O     1 
ATOM 4478  C CB    . ASP B 2 404 ? -200.313 186.665 123.661 1.00 99.50  ? 404 ASP C CB    1 
ATOM 4479  C CG    . ASP B 2 404 ? -200.886 185.544 122.842 1.00 99.50  ? 404 ASP C CG    1 
ATOM 4480  O OD1   . ASP B 2 404 ? -200.275 185.263 121.790 1.00 99.50  ? 404 ASP C OD1   1 
ATOM 4481  O OD2   . ASP B 2 404 ? -201.900 184.935 123.238 1.00 99.50  ? 404 ASP C OD2   1 
ATOM 4482  N N     . ARG B 2 405 ? -197.434 187.513 125.437 1.00 102.27 ? 405 ARG C N     1 
ATOM 4483  C CA    . ARG B 2 405 ? -196.888 188.570 126.255 1.00 102.27 ? 405 ARG C CA    1 
ATOM 4484  C C     . ARG B 2 405 ? -196.038 189.435 125.333 1.00 102.27 ? 405 ARG C C     1 
ATOM 4485  O O     . ARG B 2 405 ? -196.125 190.661 125.356 1.00 102.27 ? 405 ARG C O     1 
ATOM 4486  C CB    . ARG B 2 405 ? -195.997 187.963 127.332 1.00 102.27 ? 405 ARG C CB    1 
ATOM 4487  C CG    . ARG B 2 405 ? -196.042 188.667 128.677 1.00 102.27 ? 405 ARG C CG    1 
ATOM 4488  C CD    . ARG B 2 405 ? -196.624 187.762 129.754 1.00 102.27 ? 405 ARG C CD    1 
ATOM 4489  N NE    . ARG B 2 405 ? -195.604 187.178 130.621 1.00 102.27 ? 405 ARG C NE    1 
ATOM 4490  C CZ    . ARG B 2 405 ? -194.446 186.687 130.191 1.00 102.27 ? 405 ARG C CZ    1 
ATOM 4491  N NH1   . ARG B 2 405 ? -194.149 186.713 128.900 1.00 102.27 ? 405 ARG C NH1   1 
ATOM 4492  N NH2   . ARG B 2 405 ? -193.582 186.172 131.055 1.00 102.27 ? 405 ARG C NH2   1 
ATOM 4493  N N     . GLU B 2 406 ? -195.217 188.777 124.518 1.00 108.20 ? 406 GLU C N     1 
ATOM 4494  C CA    . GLU B 2 406 ? -194.334 189.452 123.561 1.00 108.20 ? 406 GLU C CA    1 
ATOM 4495  C C     . GLU B 2 406 ? -194.977 190.156 122.356 1.00 108.20 ? 406 GLU C C     1 
ATOM 4496  O O     . GLU B 2 406 ? -194.608 191.276 122.005 1.00 108.20 ? 406 GLU C O     1 
ATOM 4497  C CB    . GLU B 2 406 ? -193.277 188.466 123.064 1.00 108.20 ? 406 GLU C CB    1 
ATOM 4498  C CG    . GLU B 2 406 ? -193.785 187.043 122.950 1.00 108.20 ? 406 GLU C CG    1 
ATOM 4499  C CD    . GLU B 2 406 ? -193.178 186.303 121.782 1.00 108.20 ? 406 GLU C CD    1 
ATOM 4500  O OE1   . GLU B 2 406 ? -191.955 186.429 121.573 1.00 108.20 ? 406 GLU C OE1   1 
ATOM 4501  O OE2   . GLU B 2 406 ? -193.921 185.596 121.073 1.00 108.20 ? 406 GLU C OE2   1 
ATOM 4502  N N     . THR B 2 407 ? -195.940 189.489 121.731 1.00 110.84 ? 407 THR C N     1 
ATOM 4503  C CA    . THR B 2 407 ? -196.623 190.000 120.542 1.00 110.84 ? 407 THR C CA    1 
ATOM 4504  C C     . THR B 2 407 ? -195.722 190.175 119.324 1.00 110.84 ? 407 THR C C     1 
ATOM 4505  O O     . THR B 2 407 ? -195.801 191.187 118.629 1.00 110.84 ? 407 THR C O     1 
ATOM 4506  C CB    . THR B 2 407 ? -197.281 191.351 120.835 1.00 110.84 ? 407 THR C CB    1 
ATOM 4507  O OG1   . THR B 2 407 ? -196.263 192.299 121.183 1.00 110.84 ? 407 THR C OG1   1 
ATOM 4508  C CG2   . THR B 2 407 ? -198.294 191.258 121.958 1.00 110.84 ? 407 THR C CG2   1 
ATOM 4509  N N     . ASP B 2 408 ? -194.851 189.208 119.048 1.00 113.65 ? 408 ASP C N     1 
ATOM 4510  C CA    . ASP B 2 408 ? -194.042 189.331 117.846 1.00 113.65 ? 408 ASP C CA    1 
ATOM 4511  C C     . ASP B 2 408 ? -194.236 188.068 117.025 1.00 113.65 ? 408 ASP C C     1 
ATOM 4512  O O     . ASP B 2 408 ? -194.640 187.030 117.541 1.00 113.65 ? 408 ASP C O     1 
ATOM 4513  C CB    . ASP B 2 408 ? -192.551 189.525 118.148 1.00 113.65 ? 408 ASP C CB    1 
ATOM 4514  C CG    . ASP B 2 408 ? -192.281 190.790 118.915 1.00 113.65 ? 408 ASP C CG    1 
ATOM 4515  O OD1   . ASP B 2 408 ? -193.093 191.725 118.803 1.00 113.65 ? 408 ASP C OD1   1 
ATOM 4516  O OD2   . ASP B 2 408 ? -191.280 190.846 119.656 1.00 113.65 ? 408 ASP C OD2   1 
ATOM 4517  N N     . ASP B 2 409 ? -193.951 188.165 115.731 1.00 114.90 ? 409 ASP C N     1 
ATOM 4518  C CA    . ASP B 2 409 ? -194.156 187.026 114.842 1.00 114.90 ? 409 ASP C CA    1 
ATOM 4519  C C     . ASP B 2 409 ? -193.094 185.955 115.063 1.00 114.90 ? 409 ASP C C     1 
ATOM 4520  O O     . ASP B 2 409 ? -193.370 184.761 114.898 1.00 114.90 ? 409 ASP C O     1 
ATOM 4521  C CB    . ASP B 2 409 ? -194.270 187.395 113.371 1.00 114.90 ? 409 ASP C CB    1 
ATOM 4522  C CG    . ASP B 2 409 ? -195.064 186.321 112.596 1.00 114.90 ? 409 ASP C CG    1 
ATOM 4523  O OD1   . ASP B 2 409 ? -195.149 185.186 113.097 1.00 114.90 ? 409 ASP C OD1   1 
ATOM 4524  O OD2   . ASP B 2 409 ? -195.672 186.605 111.539 1.00 114.90 ? 409 ASP C OD2   1 
ATOM 4525  N N     . ASN B 2 410 ? -191.878 186.347 115.448 1.00 110.92 ? 410 ASN C N     1 
ATOM 4526  C CA    . ASN B 2 410 ? -190.796 185.381 115.472 1.00 110.92 ? 410 ASN C CA    1 
ATOM 4527  C C     . ASN B 2 410 ? -190.474 184.821 116.843 1.00 110.92 ? 410 ASN C C     1 
ATOM 4528  O O     . ASN B 2 410 ? -190.397 183.602 116.960 1.00 110.92 ? 410 ASN C O     1 
ATOM 4529  C CB    . ASN B 2 410 ? -189.514 186.073 114.987 1.00 110.92 ? 410 ASN C CB    1 
ATOM 4530  C CG    . ASN B 2 410 ? -189.230 187.375 115.768 1.00 110.92 ? 410 ASN C CG    1 
ATOM 4531  O OD1   . ASN B 2 410 ? -190.171 188.001 116.284 1.00 110.92 ? 410 ASN C OD1   1 
ATOM 4532  N ND2   . ASN B 2 410 ? -187.967 187.697 115.978 1.00 110.92 ? 410 ASN C ND2   1 
ATOM 4533  N N     . GLU B 2 411 ? -190.242 185.622 117.877 1.00 109.53 ? 411 GLU C N     1 
ATOM 4534  C CA    . GLU B 2 411 ? -189.914 184.983 119.139 1.00 109.53 ? 411 GLU C CA    1 
ATOM 4535  C C     . GLU B 2 411 ? -191.084 184.115 119.580 1.00 109.53 ? 411 GLU C C     1 
ATOM 4536  O O     . GLU B 2 411 ? -190.885 183.067 120.191 1.00 109.53 ? 411 GLU C O     1 
ATOM 4537  C CB    . GLU B 2 411 ? -189.491 186.004 120.181 1.00 109.53 ? 411 GLU C CB    1 
ATOM 4538  C CG    . GLU B 2 411 ? -189.120 185.384 121.495 1.00 109.53 ? 411 GLU C CG    1 
ATOM 4539  C CD    . GLU B 2 411 ? -188.588 186.390 122.464 1.00 109.53 ? 411 GLU C CD    1 
ATOM 4540  O OE1   . GLU B 2 411 ? -188.284 187.517 122.022 1.00 109.53 ? 411 GLU C OE1   1 
ATOM 4541  O OE2   . GLU B 2 411 ? -188.495 186.061 123.664 1.00 109.53 ? 411 GLU C OE2   1 
ATOM 4542  N N     . ASN B 2 412 ? -192.305 184.517 119.207 1.00 101.47 ? 412 ASN C N     1 
ATOM 4543  C CA    . ASN B 2 412 ? -193.519 183.728 119.427 1.00 101.47 ? 412 ASN C CA    1 
ATOM 4544  C C     . ASN B 2 412 ? -193.554 182.412 118.650 1.00 101.47 ? 412 ASN C C     1 
ATOM 4545  O O     . ASN B 2 412 ? -193.787 181.353 119.240 1.00 101.47 ? 412 ASN C O     1 
ATOM 4546  C CB    . ASN B 2 412 ? -194.727 184.564 119.054 1.00 101.47 ? 412 ASN C CB    1 
ATOM 4547  C CG    . ASN B 2 412 ? -196.012 183.809 119.160 1.00 101.47 ? 412 ASN C CG    1 
ATOM 4548  O OD1   . ASN B 2 412 ? -196.112 182.791 119.838 1.00 101.47 ? 412 ASN C OD1   1 
ATOM 4549  N ND2   . ASN B 2 412 ? -197.020 184.298 118.469 1.00 101.47 ? 412 ASN C ND2   1 
ATOM 4550  N N     . ALA B 2 413 ? -193.325 182.434 117.340 1.00 97.45  ? 413 ALA C N     1 
ATOM 4551  C CA    . ALA B 2 413 ? -193.386 181.169 116.610 1.00 97.45  ? 413 ALA C CA    1 
ATOM 4552  C C     . ALA B 2 413 ? -192.298 180.235 117.088 1.00 97.45  ? 413 ALA C C     1 
ATOM 4553  O O     . ALA B 2 413 ? -192.414 179.011 116.948 1.00 97.45  ? 413 ALA C O     1 
ATOM 4554  C CB    . ALA B 2 413 ? -193.273 181.411 115.107 1.00 97.45  ? 413 ALA C CB    1 
ATOM 4555  N N     . ARG B 2 414 ? -191.252 180.814 117.648 1.00 96.97  ? 414 ARG C N     1 
ATOM 4556  C CA    . ARG B 2 414 ? -190.129 180.101 118.216 1.00 96.97  ? 414 ARG C CA    1 
ATOM 4557  C C     . ARG B 2 414 ? -190.502 179.521 119.576 1.00 96.97  ? 414 ARG C C     1 
ATOM 4558  O O     . ARG B 2 414 ? -190.097 178.404 119.907 1.00 96.97  ? 414 ARG C O     1 
ATOM 4559  C CB    . ARG B 2 414 ? -188.973 181.090 118.327 1.00 96.97  ? 414 ARG C CB    1 
ATOM 4560  C CG    . ARG B 2 414 ? -188.341 181.457 116.985 1.00 96.97  ? 414 ARG C CG    1 
ATOM 4561  C CD    . ARG B 2 414 ? -187.144 182.368 117.189 1.00 96.97  ? 414 ARG C CD    1 
ATOM 4562  N NE    . ARG B 2 414 ? -186.030 181.824 117.945 1.00 96.97  ? 414 ARG C NE    1 
ATOM 4563  C CZ    . ARG B 2 414 ? -184.927 182.519 118.185 1.00 96.97  ? 414 ARG C CZ    1 
ATOM 4564  N NH1   . ARG B 2 414 ? -184.822 183.761 117.729 1.00 96.97  ? 414 ARG C NH1   1 
ATOM 4565  N NH2   . ARG B 2 414 ? -183.937 181.984 118.879 1.00 96.97  ? 414 ARG C NH2   1 
ATOM 4566  N N     . ILE B 2 415 ? -191.271 180.268 120.377 1.00 89.70  ? 415 ILE C N     1 
ATOM 4567  C CA    . ILE B 2 415 ? -191.823 179.731 121.621 1.00 89.70  ? 415 ILE C CA    1 
ATOM 4568  C C     . ILE B 2 415 ? -192.741 178.554 121.344 1.00 89.70  ? 415 ILE C C     1 
ATOM 4569  O O     . ILE B 2 415 ? -192.632 177.490 121.969 1.00 89.70  ? 415 ILE C O     1 
ATOM 4570  C CB    . ILE B 2 415 ? -192.563 180.836 122.391 1.00 89.70  ? 415 ILE C CB    1 
ATOM 4571  C CG1   . ILE B 2 415 ? -191.557 181.802 123.003 1.00 89.70  ? 415 ILE C CG1   1 
ATOM 4572  C CG2   . ILE B 2 415 ? -193.513 180.238 123.407 1.00 89.70  ? 415 ILE C CG2   1 
ATOM 4573  C CD1   . ILE B 2 415 ? -192.180 182.874 123.848 1.00 89.70  ? 415 ILE C CD1   1 
ATOM 4574  N N     . VAL B 2 416 ? -193.664 178.743 120.413 1.00 83.59  ? 416 VAL C N     1 
ATOM 4575  C CA    . VAL B 2 416 ? -194.596 177.688 120.072 1.00 83.59  ? 416 VAL C CA    1 
ATOM 4576  C C     . VAL B 2 416 ? -193.817 176.513 119.513 1.00 83.59  ? 416 VAL C C     1 
ATOM 4577  O O     . VAL B 2 416 ? -194.100 175.370 119.831 1.00 83.59  ? 416 VAL C O     1 
ATOM 4578  C CB    . VAL B 2 416 ? -195.654 178.183 119.070 1.00 83.59  ? 416 VAL C CB    1 
ATOM 4579  C CG1   . VAL B 2 416 ? -196.383 177.029 118.400 1.00 83.59  ? 416 VAL C CG1   1 
ATOM 4580  C CG2   . VAL B 2 416 ? -196.645 179.087 119.778 1.00 83.59  ? 416 VAL C CG2   1 
ATOM 4581  N N     . ARG B 2 417 ? -192.828 176.794 118.683 1.00 83.38  ? 417 ARG C N     1 
ATOM 4582  C CA    . ARG B 2 417 ? -192.046 175.720 118.110 1.00 83.38  ? 417 ARG C CA    1 
ATOM 4583  C C     . ARG B 2 417 ? -191.323 174.968 119.208 1.00 83.38  ? 417 ARG C C     1 
ATOM 4584  O O     . ARG B 2 417 ? -191.254 173.745 119.189 1.00 83.38  ? 417 ARG C O     1 
ATOM 4585  C CB    . ARG B 2 417 ? -191.045 176.254 117.090 1.00 83.38  ? 417 ARG C CB    1 
ATOM 4586  C CG    . ARG B 2 417 ? -190.702 175.269 115.980 1.00 83.38  ? 417 ARG C CG    1 
ATOM 4587  C CD    . ARG B 2 417 ? -191.906 174.435 115.567 1.00 83.38  ? 417 ARG C CD    1 
ATOM 4588  N NE    . ARG B 2 417 ? -191.506 173.194 114.916 1.00 83.38  ? 417 ARG C NE    1 
ATOM 4589  C CZ    . ARG B 2 417 ? -190.992 173.126 113.690 1.00 83.38  ? 417 ARG C CZ    1 
ATOM 4590  N NH1   . ARG B 2 417 ? -190.820 174.237 112.983 1.00 83.38  ? 417 ARG C NH1   1 
ATOM 4591  N NH2   . ARG B 2 417 ? -190.653 171.952 113.167 1.00 83.38  ? 417 ARG C NH2   1 
ATOM 4592  N N     . ARG B 2 418 ? -190.785 175.702 120.172 1.00 79.18  ? 418 ARG C N     1 
ATOM 4593  C CA    . ARG B 2 418 ? -190.069 175.079 121.276 1.00 79.18  ? 418 ARG C CA    1 
ATOM 4594  C C     . ARG B 2 418 ? -190.979 174.171 122.072 1.00 79.18  ? 418 ARG C C     1 
ATOM 4595  O O     . ARG B 2 418 ? -190.654 173.022 122.339 1.00 79.18  ? 418 ARG C O     1 
ATOM 4596  C CB    . ARG B 2 418 ? -189.491 176.138 122.214 1.00 79.18  ? 418 ARG C CB    1 
ATOM 4597  C CG    . ARG B 2 418 ? -188.641 177.188 121.523 1.00 79.18  ? 418 ARG C CG    1 
ATOM 4598  C CD    . ARG B 2 418 ? -187.223 177.197 122.068 1.00 79.18  ? 418 ARG C CD    1 
ATOM 4599  N NE    . ARG B 2 418 ? -187.209 177.319 123.520 1.00 79.18  ? 418 ARG C NE    1 
ATOM 4600  C CZ    . ARG B 2 418 ? -187.358 178.464 124.173 1.00 79.18  ? 418 ARG C CZ    1 
ATOM 4601  N NH1   . ARG B 2 418 ? -187.531 179.592 123.504 1.00 79.18  ? 418 ARG C NH1   1 
ATOM 4602  N NH2   . ARG B 2 418 ? -187.334 178.479 125.496 1.00 79.18  ? 418 ARG C NH2   1 
ATOM 4603  N N     . ILE B 2 419 ? -192.130 174.702 122.449 1.00 75.43  ? 419 ILE C N     1 
ATOM 4604  C CA    . ILE B 2 419 ? -193.092 173.969 123.258 1.00 75.43  ? 419 ILE C CA    1 
ATOM 4605  C C     . ILE B 2 419 ? -193.572 172.724 122.531 1.00 75.43  ? 419 ILE C C     1 
ATOM 4606  O O     . ILE B 2 419 ? -193.676 171.667 123.134 1.00 75.43  ? 419 ILE C O     1 
ATOM 4607  C CB    . ILE B 2 419 ? -194.302 174.835 123.655 1.00 75.43  ? 419 ILE C CB    1 
ATOM 4608  C CG1   . ILE B 2 419 ? -193.870 175.958 124.592 1.00 75.43  ? 419 ILE C CG1   1 
ATOM 4609  C CG2   . ILE B 2 419 ? -195.356 173.995 124.351 1.00 75.43  ? 419 ILE C CG2   1 
ATOM 4610  C CD1   . ILE B 2 419 ? -195.024 176.684 125.247 1.00 75.43  ? 419 ILE C CD1   1 
ATOM 4611  N N     . THR B 2 420 ? -193.868 172.835 121.244 1.00 73.21  ? 420 THR C N     1 
ATOM 4612  C CA    . THR B 2 420 ? -194.312 171.666 120.506 1.00 73.21  ? 420 THR C CA    1 
ATOM 4613  C C     . THR B 2 420 ? -193.173 170.685 120.475 1.00 73.21  ? 420 THR C C     1 
ATOM 4614  O O     . THR B 2 420 ? -193.362 169.486 120.601 1.00 73.21  ? 420 THR C O     1 
ATOM 4615  C CB    . THR B 2 420 ? -194.707 171.982 119.068 1.00 73.21  ? 420 THR C CB    1 
ATOM 4616  N N     . LEU B 2 421 ? -191.974 171.208 120.288 1.00 70.97  ? 421 LEU C N     1 
ATOM 4617  C CA    . LEU B 2 421 ? -190.798 170.369 120.243 1.00 70.97  ? 421 LEU C CA    1 
ATOM 4618  C C     . LEU B 2 421 ? -190.553 169.679 121.572 1.00 70.97  ? 421 LEU C C     1 
ATOM 4619  O O     . LEU B 2 421 ? -190.188 168.509 121.606 1.00 70.97  ? 421 LEU C O     1 
ATOM 4620  C CB    . LEU B 2 421 ? -189.575 171.187 119.834 1.00 70.97  ? 421 LEU C CB    1 
ATOM 4621  C CG    . LEU B 2 421 ? -189.410 171.554 118.359 1.00 70.97  ? 421 LEU C CG    1 
ATOM 4622  C CD1   . LEU B 2 421 ? -188.118 170.975 117.816 1.00 70.97  ? 421 LEU C CD1   1 
ATOM 4623  C CD2   . LEU B 2 421 ? -190.586 171.116 117.502 1.00 70.97  ? 421 LEU C CD2   1 
ATOM 4624  N N     . ALA B 2 422 ? -190.745 170.400 122.669 1.00 67.54  ? 422 ALA C N     1 
ATOM 4625  C CA    . ALA B 2 422 ? -190.506 169.817 123.977 1.00 67.54  ? 422 ALA C CA    1 
ATOM 4626  C C     . ALA B 2 422 ? -191.435 168.656 124.234 1.00 67.54  ? 422 ALA C C     1 
ATOM 4627  O O     . ALA B 2 422 ? -191.015 167.611 124.707 1.00 67.54  ? 422 ALA C O     1 
ATOM 4628  C CB    . ALA B 2 422 ? -190.673 170.864 125.059 1.00 67.54  ? 422 ALA C CB    1 
ATOM 4629  N N     . ARG B 2 423 ? -192.706 168.851 123.898 1.00 66.65  ? 423 ARG C N     1 
ATOM 4630  C CA    . ARG B 2 423 ? -193.721 167.824 124.079 1.00 66.65  ? 423 ARG C CA    1 
ATOM 4631  C C     . ARG B 2 423 ? -193.415 166.575 123.257 1.00 66.65  ? 423 ARG C C     1 
ATOM 4632  O O     . ARG B 2 423 ? -193.610 165.455 123.728 1.00 66.65  ? 423 ARG C O     1 
ATOM 4633  C CB    . ARG B 2 423 ? -195.103 168.368 123.712 1.00 66.65  ? 423 ARG C CB    1 
ATOM 4634  C CG    . ARG B 2 423 ? -196.165 167.294 123.533 1.00 66.65  ? 423 ARG C CG    1 
ATOM 4635  C CD    . ARG B 2 423 ? -197.347 167.815 122.730 1.00 66.65  ? 423 ARG C CD    1 
ATOM 4636  N NE    . ARG B 2 423 ? -198.569 167.067 123.008 1.00 66.65  ? 423 ARG C NE    1 
ATOM 4637  C CZ    . ARG B 2 423 ? -198.949 165.981 122.342 1.00 66.65  ? 423 ARG C CZ    1 
ATOM 4638  N NH1   . ARG B 2 423 ? -198.201 165.512 121.352 1.00 66.65  ? 423 ARG C NH1   1 
ATOM 4639  N NH2   . ARG B 2 423 ? -200.078 165.365 122.663 1.00 66.65  ? 423 ARG C NH2   1 
ATOM 4640  N N     . LYS B 2 424 ? -192.938 166.763 122.029 1.00 65.52  ? 424 LYS C N     1 
ATOM 4641  C CA    . LYS B 2 424 ? -192.625 165.627 121.181 1.00 65.52  ? 424 LYS C CA    1 
ATOM 4642  C C     . LYS B 2 424 ? -191.485 164.784 121.748 1.00 65.52  ? 424 LYS C C     1 
ATOM 4643  O O     . LYS B 2 424 ? -191.549 163.562 121.718 1.00 65.52  ? 424 LYS C O     1 
ATOM 4644  C CB    . LYS B 2 424 ? -192.316 166.091 119.770 1.00 65.52  ? 424 LYS C CB    1 
ATOM 4645  C CG    . LYS B 2 424 ? -193.540 166.599 119.036 1.00 65.52  ? 424 LYS C CG    1 
ATOM 4646  C CD    . LYS B 2 424 ? -193.593 166.057 117.623 1.00 65.52  ? 424 LYS C CD    1 
ATOM 4647  C CE    . LYS B 2 424 ? -194.869 165.275 117.383 1.00 65.52  ? 424 LYS C CE    1 
ATOM 4648  N NZ    . LYS B 2 424 ? -195.835 166.046 116.554 1.00 65.52  ? 424 LYS C NZ    1 
ATOM 4649  N N     . ALA B 2 425 ? -190.449 165.434 122.269 1.00 62.86  ? 425 ALA C N     1 
ATOM 4650  C CA    . ALA B 2 425 ? -189.321 164.741 122.869 1.00 62.86  ? 425 ALA C CA    1 
ATOM 4651  C C     . ALA B 2 425 ? -189.755 163.981 124.113 1.00 62.86  ? 425 ALA C C     1 
ATOM 4652  O O     . ALA B 2 425 ? -189.468 162.785 124.256 1.00 62.86  ? 425 ALA C O     1 
ATOM 4653  C CB    . ALA B 2 425 ? -188.212 165.727 123.207 1.00 62.86  ? 425 ALA C CB    1 
ATOM 4654  N N     . ALA B 2 426 ? -190.547 164.622 124.972 1.00 58.57  ? 426 ALA C N     1 
ATOM 4655  C CA    . ALA B 2 426 ? -190.963 163.949 126.194 1.00 58.57  ? 426 ALA C CA    1 
ATOM 4656  C C     . ALA B 2 426 ? -191.768 162.693 125.909 1.00 58.57  ? 426 ALA C C     1 
ATOM 4657  O O     . ALA B 2 426 ? -191.585 161.669 126.573 1.00 58.57  ? 426 ALA C O     1 
ATOM 4658  C CB    . ALA B 2 426 ? -191.766 164.906 127.065 1.00 58.57  ? 426 ALA C CB    1 
ATOM 4659  N N     . GLU B 2 427 ? -192.640 162.734 124.907 1.00 61.36  ? 427 GLU C N     1 
ATOM 4660  C CA    . GLU B 2 427 ? -193.470 161.567 124.643 1.00 61.36  ? 427 GLU C CA    1 
ATOM 4661  C C     . GLU B 2 427 ? -192.683 160.476 123.923 1.00 61.36  ? 427 GLU C C     1 
ATOM 4662  O O     . GLU B 2 427 ? -192.809 159.296 124.256 1.00 61.36  ? 427 GLU C O     1 
ATOM 4663  C CB    . GLU B 2 427 ? -194.693 161.939 123.857 1.00 61.36  ? 427 GLU C CB    1 
ATOM 4664  C CG    . GLU B 2 427 ? -195.569 162.981 124.517 1.00 61.36  ? 427 GLU C CG    1 
ATOM 4665  C CD    . GLU B 2 427 ? -197.009 162.695 124.228 1.00 61.36  ? 427 GLU C CD    1 
ATOM 4666  O OE1   . GLU B 2 427 ? -197.279 162.389 123.043 1.00 61.36  ? 427 GLU C OE1   1 
ATOM 4667  O OE2   . GLU B 2 427 ? -197.876 163.178 124.994 1.00 61.36  ? 427 GLU C OE2   1 
ATOM 4668  N N     . ALA B 2 428 ? -191.885 160.843 122.918 1.00 60.49  ? 428 ALA C N     1 
ATOM 4669  C CA    . ALA B 2 428 ? -191.136 159.828 122.194 1.00 60.49  ? 428 ALA C CA    1 
ATOM 4670  C C     . ALA B 2 428 ? -190.249 159.058 123.150 1.00 60.49  ? 428 ALA C C     1 
ATOM 4671  O O     . ALA B 2 428 ? -190.201 157.819 123.112 1.00 60.49  ? 428 ALA C O     1 
ATOM 4672  C CB    . ALA B 2 428 ? -190.310 160.472 121.090 1.00 60.49  ? 428 ALA C CB    1 
ATOM 4673  N N     . LEU B 2 429 ? -189.588 159.759 124.057 1.00 55.23  ? 429 LEU C N     1 
ATOM 4674  C CA    . LEU B 2 429 ? -188.789 159.016 125.009 1.00 55.23  ? 429 LEU C CA    1 
ATOM 4675  C C     . LEU B 2 429 ? -189.617 158.411 126.117 1.00 55.23  ? 429 LEU C C     1 
ATOM 4676  O O     . LEU B 2 429 ? -189.130 157.515 126.808 1.00 55.23  ? 429 LEU C O     1 
ATOM 4677  C CB    . LEU B 2 429 ? -187.665 159.845 125.591 1.00 55.23  ? 429 LEU C CB    1 
ATOM 4678  C CG    . LEU B 2 429 ? -186.625 160.265 124.570 1.00 55.23  ? 429 LEU C CG    1 
ATOM 4679  C CD1   . LEU B 2 429 ? -186.996 161.372 123.616 1.00 55.23  ? 429 LEU C CD1   1 
ATOM 4680  C CD2   . LEU B 2 429 ? -185.448 160.631 125.384 1.00 55.23  ? 429 LEU C CD2   1 
ATOM 4681  N N     . GLY B 2 430 ? -190.853 158.854 126.305 1.00 55.93  ? 430 GLY C N     1 
ATOM 4682  C CA    . GLY B 2 430 ? -191.729 158.107 127.181 1.00 55.93  ? 430 GLY C CA    1 
ATOM 4683  C C     . GLY B 2 430 ? -192.083 156.739 126.635 1.00 55.93  ? 430 GLY C C     1 
ATOM 4684  O O     . GLY B 2 430 ? -192.084 155.753 127.375 1.00 55.93  ? 430 GLY C O     1 
ATOM 4685  N N     . ARG B 2 431 ? -192.329 156.636 125.331 1.00 60.12  ? 431 ARG C N     1 
ATOM 4686  C CA    . ARG B 2 431 ? -192.612 155.302 124.819 1.00 60.12  ? 431 ARG C CA    1 
ATOM 4687  C C     . ARG B 2 431 ? -191.353 154.461 124.676 1.00 60.12  ? 431 ARG C C     1 
ATOM 4688  O O     . ARG B 2 431 ? -191.374 153.259 124.955 1.00 60.12  ? 431 ARG C O     1 
ATOM 4689  C CB    . ARG B 2 431 ? -193.343 155.359 123.483 1.00 60.12  ? 431 ARG C CB    1 
ATOM 4690  C CG    . ARG B 2 431 ? -194.720 155.957 123.573 1.00 60.12  ? 431 ARG C CG    1 
ATOM 4691  C CD    . ARG B 2 431 ? -195.447 155.880 122.250 1.00 60.12  ? 431 ARG C CD    1 
ATOM 4692  N NE    . ARG B 2 431 ? -194.768 156.588 121.180 1.00 60.12  ? 431 ARG C NE    1 
ATOM 4693  C CZ    . ARG B 2 431 ? -194.978 157.864 120.901 1.00 60.12  ? 431 ARG C CZ    1 
ATOM 4694  N NH1   . ARG B 2 431 ? -195.850 158.562 121.617 1.00 60.12  ? 431 ARG C NH1   1 
ATOM 4695  N NH2   . ARG B 2 431 ? -194.326 158.438 119.906 1.00 60.12  ? 431 ARG C NH2   1 
ATOM 4696  N N     . ARG B 2 432 ? -190.254 155.125 124.333 1.00 55.24  ? 432 ARG C N     1 
ATOM 4697  C CA    . ARG B 2 432 ? -188.965 154.467 124.229 1.00 55.24  ? 432 ARG C CA    1 
ATOM 4698  C C     . ARG B 2 432 ? -188.606 153.891 125.599 1.00 55.24  ? 432 ARG C C     1 
ATOM 4699  O O     . ARG B 2 432 ? -188.113 152.767 125.687 1.00 55.24  ? 432 ARG C O     1 
ATOM 4700  C CB    . ARG B 2 432 ? -187.891 155.453 123.769 1.00 55.24  ? 432 ARG C CB    1 
ATOM 4701  C CG    . ARG B 2 432 ? -187.973 156.816 124.437 1.00 55.24  ? 432 ARG C CG    1 
ATOM 4702  C CD    . ARG B 2 432 ? -186.931 157.770 123.874 1.00 55.24  ? 432 ARG C CD    1 
ATOM 4703  N NE    . ARG B 2 432 ? -185.713 157.072 123.471 1.00 55.24  ? 432 ARG C NE    1 
ATOM 4704  C CZ    . ARG B 2 432 ? -185.119 157.228 122.293 1.00 55.24  ? 432 ARG C CZ    1 
ATOM 4705  N NH1   . ARG B 2 432 ? -185.631 158.059 121.395 1.00 55.24  ? 432 ARG C NH1   1 
ATOM 4706  N NH2   . ARG B 2 432 ? -184.013 156.554 122.012 1.00 55.24  ? 432 ARG C NH2   1 
ATOM 4707  N N     . LEU B 2 433 ? -188.856 154.651 126.669 1.00 49.86  ? 433 LEU C N     1 
ATOM 4708  C CA    . LEU B 2 433 ? -188.550 154.146 128.003 1.00 49.86  ? 433 LEU C CA    1 
ATOM 4709  C C     . LEU B 2 433 ? -189.524 153.091 128.492 1.00 49.86  ? 433 LEU C C     1 
ATOM 4710  O O     . LEU B 2 433 ? -189.108 152.161 129.197 1.00 49.86  ? 433 LEU C O     1 
ATOM 4711  C CB    . LEU B 2 433 ? -188.576 155.294 129.009 1.00 49.86  ? 433 LEU C CB    1 
ATOM 4712  C CG    . LEU B 2 433 ? -188.118 154.942 130.411 1.00 49.86  ? 433 LEU C CG    1 
ATOM 4713  C CD1   . LEU B 2 433 ? -186.787 154.315 130.364 1.00 49.86  ? 433 LEU C CD1   1 
ATOM 4714  C CD2   . LEU B 2 433 ? -188.122 156.143 131.300 1.00 49.86  ? 433 LEU C CD2   1 
ATOM 4715  N N     . GLU B 2 434 ? -190.803 153.180 128.124 1.00 55.94  ? 434 GLU C N     1 
ATOM 4716  C CA    . GLU B 2 434 ? -191.741 152.101 128.452 1.00 55.94  ? 434 GLU C CA    1 
ATOM 4717  C C     . GLU B 2 434 ? -191.277 150.796 127.819 1.00 55.94  ? 434 GLU C C     1 
ATOM 4718  O O     . GLU B 2 434 ? -191.044 149.789 128.498 1.00 55.94  ? 434 GLU C O     1 
ATOM 4719  C CB    . GLU B 2 434 ? -193.194 152.473 128.152 1.00 55.94  ? 434 GLU C CB    1 
ATOM 4720  C CG    . GLU B 2 434 ? -193.701 152.623 126.756 1.00 55.94  ? 434 GLU C CG    1 
ATOM 4721  C CD    . GLU B 2 434 ? -194.468 151.402 126.317 1.00 55.94  ? 434 GLU C CD    1 
ATOM 4722  O OE1   . GLU B 2 434 ? -194.742 150.547 127.181 1.00 55.94  ? 434 GLU C OE1   1 
ATOM 4723  O OE2   . GLU B 2 434 ? -194.864 151.324 125.137 1.00 55.94  ? 434 GLU C OE2   1 
ATOM 4724  N N     . LYS B 2 435 ? -191.110 150.816 126.499 1.00 53.65  ? 435 LYS C N     1 
ATOM 4725  C CA    . LYS B 2 435 ? -190.658 149.640 125.766 1.00 53.65  ? 435 LYS C CA    1 
ATOM 4726  C C     . LYS B 2 435 ? -189.284 149.179 126.217 1.00 53.65  ? 435 LYS C C     1 
ATOM 4727  O O     . LYS B 2 435 ? -188.996 147.978 126.180 1.00 53.65  ? 435 LYS C O     1 
ATOM 4728  C CB    . LYS B 2 435 ? -190.644 150.026 124.288 1.00 53.65  ? 435 LYS C CB    1 
ATOM 4729  C CG    . LYS B 2 435 ? -190.701 148.965 123.254 1.00 53.65  ? 435 LYS C CG    1 
ATOM 4730  C CD    . LYS B 2 435 ? -190.390 149.652 121.938 1.00 53.65  ? 435 LYS C CD    1 
ATOM 4731  C CE    . LYS B 2 435 ? -188.940 150.033 121.735 1.00 53.65  ? 435 LYS C CE    1 
ATOM 4732  N NZ    . LYS B 2 435 ? -188.086 148.922 121.351 1.00 53.65  ? 435 LYS C NZ    1 
ATOM 4733  N N     . ALA B 2 436 ? -188.447 150.099 126.690 1.00 50.98  ? 436 ALA C N     1 
ATOM 4734  C CA    . ALA B 2 436 ? -187.133 149.743 127.205 1.00 50.98  ? 436 ALA C CA    1 
ATOM 4735  C C     . ALA B 2 436 ? -187.263 148.886 128.450 1.00 50.98  ? 436 ALA C C     1 
ATOM 4736  O O     . ALA B 2 436 ? -186.731 147.774 128.524 1.00 50.98  ? 436 ALA C O     1 
ATOM 4737  C CB    . ALA B 2 436 ? -186.327 150.991 127.528 1.00 50.98  ? 436 ALA C CB    1 
ATOM 4738  N N     . CYS B 2 437 ? -187.983 149.406 129.432 1.00 49.75  ? 437 CYS C N     1 
ATOM 4739  C CA    . CYS B 2 437 ? -188.194 148.695 130.676 1.00 49.75  ? 437 CYS C CA    1 
ATOM 4740  C C     . CYS B 2 437 ? -188.948 147.414 130.440 1.00 49.75  ? 437 CYS C C     1 
ATOM 4741  O O     . CYS B 2 437 ? -188.628 146.387 131.016 1.00 49.75  ? 437 CYS C O     1 
ATOM 4742  C CB    . CYS B 2 437 ? -189.009 149.544 131.636 1.00 49.75  ? 437 CYS C CB    1 
ATOM 4743  S SG    . CYS B 2 437 ? -188.132 150.950 132.334 1.00 49.75  ? 437 CYS C SG    1 
ATOM 4744  N N     . LYS B 2 438 ? -189.968 147.472 129.597 1.00 50.92  ? 438 LYS C N     1 
ATOM 4745  C CA    . LYS B 2 438 ? -190.764 146.290 129.327 1.00 50.92  ? 438 LYS C CA    1 
ATOM 4746  C C     . LYS B 2 438 ? -189.948 145.191 128.665 1.00 50.92  ? 438 LYS C C     1 
ATOM 4747  O O     . LYS B 2 438 ? -190.032 144.036 129.059 1.00 50.92  ? 438 LYS C O     1 
ATOM 4748  C CB    . LYS B 2 438 ? -191.964 146.669 128.466 1.00 50.92  ? 438 LYS C CB    1 
ATOM 4749  C CG    . LYS B 2 438 ? -192.624 145.520 127.732 1.00 50.92  ? 438 LYS C CG    1 
ATOM 4750  C CD    . LYS B 2 438 ? -193.771 146.026 126.874 1.00 50.92  ? 438 LYS C CD    1 
ATOM 4751  C CE    . LYS B 2 438 ? -194.053 145.084 125.718 1.00 50.92  ? 438 LYS C CE    1 
ATOM 4752  N NZ    . LYS B 2 438 ? -194.748 143.851 126.176 1.00 50.92  ? 438 LYS C NZ    1 
ATOM 4753  N N     . GLU B 2 439 ? -189.153 145.550 127.664 1.00 55.00  ? 439 GLU C N     1 
ATOM 4754  C CA    . GLU B 2 439 ? -188.321 144.574 126.977 1.00 55.00  ? 439 GLU C CA    1 
ATOM 4755  C C     . GLU B 2 439 ? -187.224 144.016 127.865 1.00 55.00  ? 439 GLU C C     1 
ATOM 4756  O O     . GLU B 2 439 ? -186.952 142.827 127.843 1.00 55.00  ? 439 GLU C O     1 
ATOM 4757  C CB    . GLU B 2 439 ? -187.735 145.158 125.699 1.00 55.00  ? 439 GLU C CB    1 
ATOM 4758  C CG    . GLU B 2 439 ? -188.735 145.240 124.562 1.00 55.00  ? 439 GLU C CG    1 
ATOM 4759  C CD    . GLU B 2 439 ? -188.199 144.678 123.260 1.00 55.00  ? 439 GLU C CD    1 
ATOM 4760  O OE1   . GLU B 2 439 ? -187.467 145.401 122.553 1.00 55.00  ? 439 GLU C OE1   1 
ATOM 4761  O OE2   . GLU B 2 439 ? -188.514 143.516 122.937 1.00 55.00  ? 439 GLU C OE2   1 
ATOM 4762  N N     . ALA B 2 440 ? -186.583 144.881 128.639 1.00 51.18  ? 440 ALA C N     1 
ATOM 4763  C CA    . ALA B 2 440 ? -185.520 144.449 129.539 1.00 51.18  ? 440 ALA C CA    1 
ATOM 4764  C C     . ALA B 2 440 ? -186.023 143.536 130.648 1.00 51.18  ? 440 ALA C C     1 
ATOM 4765  O O     . ALA B 2 440 ? -185.377 142.552 130.986 1.00 51.18  ? 440 ALA C O     1 
ATOM 4766  C CB    . ALA B 2 440 ? -184.797 145.643 130.130 1.00 51.18  ? 440 ALA C CB    1 
ATOM 4767  N N     . TRP B 2 441 ? -187.172 143.857 131.226 1.00 55.97  ? 441 TRP C N     1 
ATOM 4768  C CA    . TRP B 2 441 ? -187.696 143.018 132.289 1.00 55.97  ? 441 TRP C CA    1 
ATOM 4769  C C     . TRP B 2 441 ? -188.037 141.632 131.791 1.00 55.97  ? 441 TRP C C     1 
ATOM 4770  O O     . TRP B 2 441 ? -187.782 140.654 132.473 1.00 55.97  ? 441 TRP C O     1 
ATOM 4771  C CB    . TRP B 2 441 ? -188.907 143.635 132.962 1.00 55.97  ? 441 TRP C CB    1 
ATOM 4772  C CG    . TRP B 2 441 ? -189.345 142.847 134.145 1.00 55.97  ? 441 TRP C CG    1 
ATOM 4773  C CD1   . TRP B 2 441 ? -189.002 143.062 135.440 1.00 55.97  ? 441 TRP C CD1   1 
ATOM 4774  C CD2   . TRP B 2 441 ? -190.194 141.703 134.140 1.00 55.97  ? 441 TRP C CD2   1 
ATOM 4775  N NE1   . TRP B 2 441 ? -189.594 142.134 136.248 1.00 55.97  ? 441 TRP C NE1   1 
ATOM 4776  C CE2   . TRP B 2 441 ? -190.335 141.286 135.471 1.00 55.97  ? 441 TRP C CE2   1 
ATOM 4777  C CE3   . TRP B 2 441 ? -190.860 140.999 133.139 1.00 55.97  ? 441 TRP C CE3   1 
ATOM 4778  C CZ2   . TRP B 2 441 ? -191.109 140.190 135.830 1.00 55.97  ? 441 TRP C CZ2   1 
ATOM 4779  C CZ3   . TRP B 2 441 ? -191.628 139.916 133.493 1.00 55.97  ? 441 TRP C CZ3   1 
ATOM 4780  C CH2   . TRP B 2 441 ? -191.749 139.520 134.828 1.00 55.97  ? 441 TRP C CH2   1 
ATOM 4781  N N     . LYS B 2 442 ? -188.635 141.541 130.614 1.00 57.22  ? 442 LYS C N     1 
ATOM 4782  C CA    . LYS B 2 442 ? -188.971 140.232 130.080 1.00 57.22  ? 442 LYS C CA    1 
ATOM 4783  C C     . LYS B 2 442 ? -187.704 139.433 129.784 1.00 57.22  ? 442 LYS C C     1 
ATOM 4784  O O     . LYS B 2 442 ? -187.613 138.252 130.087 1.00 57.22  ? 442 LYS C O     1 
ATOM 4785  C CB    . LYS B 2 442 ? -189.880 140.356 128.848 1.00 57.22  ? 442 LYS C CB    1 
ATOM 4786  C CG    . LYS B 2 442 ? -189.191 140.250 127.496 1.00 57.22  ? 442 LYS C CG    1 
ATOM 4787  C CD    . LYS B 2 442 ? -190.192 140.319 126.356 1.00 57.22  ? 442 LYS C CD    1 
ATOM 4788  C CE    . LYS B 2 442 ? -191.175 141.462 126.554 1.00 57.22  ? 442 LYS C CE    1 
ATOM 4789  N NZ    . LYS B 2 442 ? -191.874 141.836 125.294 1.00 57.22  ? 442 LYS C NZ    1 
ATOM 4790  N N     . GLU B 2 443 ? -186.730 140.097 129.185 1.00 56.78  ? 443 GLU C N     1 
ATOM 4791  C CA    . GLU B 2 443 ? -185.465 139.473 128.843 1.00 56.78  ? 443 GLU C CA    1 
ATOM 4792  C C     . GLU B 2 443 ? -184.592 139.050 130.019 1.00 56.78  ? 443 GLU C C     1 
ATOM 4793  O O     . GLU B 2 443 ? -183.937 138.013 129.976 1.00 56.78  ? 443 GLU C O     1 
ATOM 4794  C CB    . GLU B 2 443 ? -184.665 140.396 127.932 1.00 56.78  ? 443 GLU C CB    1 
ATOM 4795  C CG    . GLU B 2 443 ? -184.513 139.893 126.509 1.00 56.78  ? 443 GLU C CG    1 
ATOM 4796  C CD    . GLU B 2 443 ? -183.349 140.542 125.794 1.00 56.78  ? 443 GLU C CD    1 
ATOM 4797  O OE1   . GLU B 2 443 ? -182.231 139.997 125.873 1.00 56.78  ? 443 GLU C OE1   1 
ATOM 4798  O OE2   . GLU B 2 443 ? -183.550 141.599 125.162 1.00 56.78  ? 443 GLU C OE2   1 
ATOM 4799  N N     . SER B 2 444 ? -184.565 139.876 131.057 1.00 57.61  ? 444 SER C N     1 
ATOM 4800  C CA    . SER B 2 444 ? -183.709 139.640 132.212 1.00 57.61  ? 444 SER C CA    1 
ATOM 4801  C C     . SER B 2 444 ? -184.143 138.384 132.941 1.00 57.61  ? 444 SER C C     1 
ATOM 4802  O O     . SER B 2 444 ? -183.309 137.651 133.481 1.00 57.61  ? 444 SER C O     1 
ATOM 4803  C CB    . SER B 2 444 ? -183.755 140.825 133.169 1.00 57.61  ? 444 SER C CB    1 
ATOM 4804  O OG    . SER B 2 444 ? -183.106 141.955 132.642 1.00 57.61  ? 444 SER C OG    1 
ATOM 4805  N N     . ASN B 2 445 ? -185.442 138.125 132.980 1.00 61.29  ? 445 ASN C N     1 
ATOM 4806  C CA    . ASN B 2 445 ? -185.927 136.903 133.586 1.00 61.29  ? 445 ASN C CA    1 
ATOM 4807  C C     . ASN B 2 445 ? -186.077 135.757 132.599 1.00 61.29  ? 445 ASN C C     1 
ATOM 4808  O O     . ASN B 2 445 ? -186.281 134.619 133.029 1.00 61.29  ? 445 ASN C O     1 
ATOM 4809  C CB    . ASN B 2 445 ? -187.269 137.164 134.268 1.00 61.29  ? 445 ASN C CB    1 
ATOM 4810  C CG    . ASN B 2 445 ? -187.131 138.062 135.469 1.00 61.29  ? 445 ASN C CG    1 
ATOM 4811  O OD1   . ASN B 2 445 ? -186.042 138.209 136.012 1.00 61.29  ? 445 ASN C OD1   1 
ATOM 4812  N ND2   . ASN B 2 445 ? -188.232 138.655 135.902 1.00 61.29  ? 445 ASN C ND2   1 
ATOM 4813  N N     . SER B 2 446 ? -185.952 136.018 131.302 1.00 63.63  ? 446 SER C N     1 
ATOM 4814  C CA    . SER B 2 446 ? -186.054 134.978 130.279 1.00 63.63  ? 446 SER C CA    1 
ATOM 4815  C C     . SER B 2 446 ? -187.342 134.174 130.421 1.00 63.63  ? 446 SER C C     1 
ATOM 4816  O O     . SER B 2 446 ? -187.340 133.083 130.992 1.00 63.63  ? 446 SER C O     1 
ATOM 4817  C CB    . SER B 2 446 ? -184.849 134.031 130.325 1.00 63.63  ? 446 SER C CB    1 
ATOM 4818  O OG    . SER B 2 446 ? -184.781 133.309 131.543 1.00 63.63  ? 446 SER C OG    1 
ATOM 4819  N N     . GLY B 2 463 ? -194.674 144.400 133.170 1.00 56.57  ? 463 GLY C N     1 
ATOM 4820  C CA    . GLY B 2 463 ? -193.608 144.275 134.146 1.00 56.57  ? 463 GLY C CA    1 
ATOM 4821  C C     . GLY B 2 463 ? -193.565 145.361 135.203 1.00 56.57  ? 463 GLY C C     1 
ATOM 4822  O O     . GLY B 2 463 ? -193.985 146.488 134.959 1.00 56.57  ? 463 GLY C O     1 
ATOM 4823  N N     . PRO B 2 464 ? -193.078 145.020 136.397 1.00 55.42  ? 464 PRO C N     1 
ATOM 4824  C CA    . PRO B 2 464 ? -193.000 146.024 137.464 1.00 55.42  ? 464 PRO C CA    1 
ATOM 4825  C C     . PRO B 2 464 ? -191.949 147.086 137.225 1.00 55.42  ? 464 PRO C C     1 
ATOM 4826  O O     . PRO B 2 464 ? -191.981 148.119 137.900 1.00 55.42  ? 464 PRO C O     1 
ATOM 4827  C CB    . PRO B 2 464 ? -192.676 145.191 138.708 1.00 55.42  ? 464 PRO C CB    1 
ATOM 4828  C CG    . PRO B 2 464 ? -192.008 143.997 138.177 1.00 55.42  ? 464 PRO C CG    1 
ATOM 4829  C CD    . PRO B 2 464 ? -192.670 143.691 136.871 1.00 55.42  ? 464 PRO C CD    1 
ATOM 4830  N N     . TRP B 2 465 ? -190.994 146.859 136.327 1.00 52.37  ? 465 TRP C N     1 
ATOM 4831  C CA    . TRP B 2 465 ? -190.008 147.894 136.049 1.00 52.37  ? 465 TRP C CA    1 
ATOM 4832  C C     . TRP B 2 465 ? -190.636 149.060 135.304 1.00 52.37  ? 465 TRP C C     1 
ATOM 4833  O O     . TRP B 2 465 ? -190.173 150.198 135.416 1.00 52.37  ? 465 TRP C O     1 
ATOM 4834  C CB    . TRP B 2 465 ? -188.865 147.320 135.225 1.00 52.37  ? 465 TRP C CB    1 
ATOM 4835  C CG    . TRP B 2 465 ? -187.966 146.437 136.004 1.00 52.37  ? 465 TRP C CG    1 
ATOM 4836  C CD1   . TRP B 2 465 ? -188.085 146.100 137.319 1.00 52.37  ? 465 TRP C CD1   1 
ATOM 4837  C CD2   . TRP B 2 465 ? -186.803 145.770 135.523 1.00 52.37  ? 465 TRP C CD2   1 
ATOM 4838  N NE1   . TRP B 2 465 ? -187.073 145.256 137.684 1.00 52.37  ? 465 TRP C NE1   1 
ATOM 4839  C CE2   . TRP B 2 465 ? -186.268 145.039 136.596 1.00 52.37  ? 465 TRP C CE2   1 
ATOM 4840  C CE3   . TRP B 2 465 ? -186.163 145.716 134.289 1.00 52.37  ? 465 TRP C CE3   1 
ATOM 4841  C CZ2   . TRP B 2 465 ? -185.125 144.269 136.472 1.00 52.37  ? 465 TRP C CZ2   1 
ATOM 4842  C CZ3   . TRP B 2 465 ? -185.032 144.951 134.169 1.00 52.37  ? 465 TRP C CZ3   1 
ATOM 4843  C CH2   . TRP B 2 465 ? -184.521 144.239 135.253 1.00 52.37  ? 465 TRP C CH2   1 
ATOM 4844  N N     . VAL B 2 466 ? -191.698 148.785 134.550 1.00 52.00  ? 466 VAL C N     1 
ATOM 4845  C CA    . VAL B 2 466 ? -192.363 149.809 133.757 1.00 52.00  ? 466 VAL C CA    1 
ATOM 4846  C C     . VAL B 2 466 ? -193.088 150.808 134.638 1.00 52.00  ? 466 VAL C C     1 
ATOM 4847  O O     . VAL B 2 466 ? -193.122 152.006 134.338 1.00 52.00  ? 466 VAL C O     1 
ATOM 4848  C CB    . VAL B 2 466 ? -193.323 149.144 132.762 1.00 52.00  ? 466 VAL C CB    1 
ATOM 4849  C CG1   . VAL B 2 466 ? -194.010 150.184 131.938 1.00 52.00  ? 466 VAL C CG1   1 
ATOM 4850  C CG2   . VAL B 2 466 ? -192.547 148.211 131.869 1.00 52.00  ? 466 VAL C CG2   1 
ATOM 4851  N N     . GLN B 2 467 ? -193.687 150.341 135.727 1.00 54.24  ? 467 GLN C N     1 
ATOM 4852  C CA    . GLN B 2 467 ? -194.463 151.237 136.572 1.00 54.24  ? 467 GLN C CA    1 
ATOM 4853  C C     . GLN B 2 467 ? -193.577 152.287 137.218 1.00 54.24  ? 467 GLN C C     1 
ATOM 4854  O O     . GLN B 2 467 ? -193.819 153.491 137.092 1.00 54.24  ? 467 GLN C O     1 
ATOM 4855  C CB    . GLN B 2 467 ? -195.204 150.427 137.626 1.00 54.24  ? 467 GLN C CB    1 
ATOM 4856  C CG    . GLN B 2 467 ? -196.068 151.239 138.537 1.00 54.24  ? 467 GLN C CG    1 
ATOM 4857  C CD    . GLN B 2 467 ? -196.820 150.362 139.506 1.00 54.24  ? 467 GLN C CD    1 
ATOM 4858  O OE1   . GLN B 2 467 ? -196.679 149.140 139.477 1.00 54.24  ? 467 GLN C OE1   1 
ATOM 4859  N NE2   . GLN B 2 467 ? -197.606 150.973 140.385 1.00 54.24  ? 467 GLN C NE2   1 
ATOM 4860  N N     . HIS B 2 468 ? -192.533 151.851 137.906 1.00 51.74  ? 468 HIS C N     1 
ATOM 4861  C CA    . HIS B 2 468 ? -191.634 152.813 138.520 1.00 51.74  ? 468 HIS C CA    1 
ATOM 4862  C C     . HIS B 2 468 ? -190.850 153.570 137.474 1.00 51.74  ? 468 HIS C C     1 
ATOM 4863  O O     . HIS B 2 468 ? -190.480 154.725 137.693 1.00 51.74  ? 468 HIS C O     1 
ATOM 4864  C CB    . HIS B 2 468 ? -190.709 152.106 139.495 1.00 51.74  ? 468 HIS C CB    1 
ATOM 4865  C CG    . HIS B 2 468 ? -191.448 151.375 140.563 1.00 51.74  ? 468 HIS C CG    1 
ATOM 4866  N ND1   . HIS B 2 468 ? -192.088 152.023 141.592 1.00 51.74  ? 468 HIS C ND1   1 
ATOM 4867  C CD2   . HIS B 2 468 ? -191.687 150.056 140.739 1.00 51.74  ? 468 HIS C CD2   1 
ATOM 4868  C CE1   . HIS B 2 468 ? -192.688 151.136 142.363 1.00 51.74  ? 468 HIS C CE1   1 
ATOM 4869  N NE2   . HIS B 2 468 ? -192.455 149.933 141.871 1.00 51.74  ? 468 HIS C NE2   1 
ATOM 4870  N N     . GLY B 2 469 ? -190.579 152.940 136.338 1.00 48.07  ? 469 GLY C N     1 
ATOM 4871  C CA    . GLY B 2 469 ? -189.899 153.658 135.276 1.00 48.07  ? 469 GLY C CA    1 
ATOM 4872  C C     . GLY B 2 469 ? -190.696 154.857 134.806 1.00 48.07  ? 469 GLY C C     1 
ATOM 4873  O O     . GLY B 2 469 ? -190.158 155.955 134.682 1.00 48.07  ? 469 GLY C O     1 
ATOM 4874  N N     . MET B 2 470 ? -191.978 154.657 134.517 1.00 50.99  ? 470 MET C N     1 
ATOM 4875  C CA    . MET B 2 470 ? -192.810 155.763 134.082 1.00 50.99  ? 470 MET C CA    1 
ATOM 4876  C C     . MET B 2 470 ? -193.073 156.759 135.200 1.00 50.99  ? 470 MET C C     1 
ATOM 4877  O O     . MET B 2 470 ? -193.042 157.969 134.967 1.00 50.99  ? 470 MET C O     1 
ATOM 4878  C CB    . MET B 2 470 ? -194.107 155.211 133.537 1.00 50.99  ? 470 MET C CB    1 
ATOM 4879  C CG    . MET B 2 470 ? -193.910 154.504 132.235 1.00 50.99  ? 470 MET C CG    1 
ATOM 4880  S SD    . MET B 2 470 ? -193.116 155.671 131.175 1.00 50.99  ? 470 MET C SD    1 
ATOM 4881  C CE    . MET B 2 470 ? -191.753 154.676 130.679 1.00 50.99  ? 470 MET C CE    1 
ATOM 4882  N N     . SER B 2 471 ? -193.284 156.286 136.425 1.00 47.62  ? 471 SER C N     1 
ATOM 4883  C CA    . SER B 2 471 ? -193.493 157.207 137.538 1.00 47.62  ? 471 SER C CA    1 
ATOM 4884  C C     . SER B 2 471 ? -192.292 158.132 137.711 1.00 47.62  ? 471 SER C C     1 
ATOM 4885  O O     . SER B 2 471 ? -192.421 159.366 137.673 1.00 47.62  ? 471 SER C O     1 
ATOM 4886  C CB    . SER B 2 471 ? -193.771 156.432 138.815 1.00 47.62  ? 471 SER C CB    1 
ATOM 4887  O OG    . SER B 2 471 ? -194.030 157.327 139.872 1.00 47.62  ? 471 SER C OG    1 
ATOM 4888  N N     . ARG B 2 472 ? -191.120 157.559 137.809 1.00 51.22  ? 472 ARG C N     1 
ATOM 4889  C CA    . ARG B 2 472 ? -189.951 158.383 137.924 1.00 51.22  ? 472 ARG C CA    1 
ATOM 4890  C C     . ARG B 2 472 ? -189.806 159.235 136.671 1.00 51.22  ? 472 ARG C C     1 
ATOM 4891  O O     . ARG B 2 472 ? -189.359 160.365 136.745 1.00 51.22  ? 472 ARG C O     1 
ATOM 4892  C CB    . ARG B 2 472 ? -188.699 157.530 138.122 1.00 51.22  ? 472 ARG C CB    1 
ATOM 4893  C CG    . ARG B 2 472 ? -188.965 156.144 138.682 1.00 51.22  ? 472 ARG C CG    1 
ATOM 4894  C CD    . ARG B 2 472 ? -187.958 155.769 139.746 1.00 51.22  ? 472 ARG C CD    1 
ATOM 4895  N NE    . ARG B 2 472 ? -188.042 156.625 140.917 1.00 51.22  ? 472 ARG C NE    1 
ATOM 4896  C CZ    . ARG B 2 472 ? -187.178 156.579 141.923 1.00 51.22  ? 472 ARG C CZ    1 
ATOM 4897  N NH1   . ARG B 2 472 ? -186.178 155.712 141.889 1.00 51.22  ? 472 ARG C NH1   1 
ATOM 4898  N NH2   . ARG B 2 472 ? -187.313 157.394 142.957 1.00 51.22  ? 472 ARG C NH2   1 
ATOM 4899  N N     . TYR B 2 473 ? -190.157 158.699 135.510 1.00 46.46  ? 473 TYR C N     1 
ATOM 4900  C CA    . TYR B 2 473 ? -189.923 159.433 134.281 1.00 46.46  ? 473 TYR C CA    1 
ATOM 4901  C C     . TYR B 2 473 ? -190.714 160.722 134.302 1.00 46.46  ? 473 TYR C C     1 
ATOM 4902  O O     . TYR B 2 473 ? -190.138 161.799 134.225 1.00 46.46  ? 473 TYR C O     1 
ATOM 4903  C CB    . TYR B 2 473 ? -190.269 158.608 133.060 1.00 46.46  ? 473 TYR C CB    1 
ATOM 4904  C CG    . TYR B 2 473 ? -190.087 159.417 131.807 1.00 46.46  ? 473 TYR C CG    1 
ATOM 4905  C CD1   . TYR B 2 473 ? -188.834 159.869 131.453 1.00 46.46  ? 473 TYR C CD1   1 
ATOM 4906  C CD2   . TYR B 2 473 ? -191.138 159.709 130.973 1.00 46.46  ? 473 TYR C CD2   1 
ATOM 4907  C CE1   . TYR B 2 473 ? -188.639 160.601 130.319 1.00 46.46  ? 473 TYR C CE1   1 
ATOM 4908  C CE2   . TYR B 2 473 ? -190.945 160.440 129.832 1.00 46.46  ? 473 TYR C CE2   1 
ATOM 4909  C CZ    . TYR B 2 473 ? -189.697 160.880 129.515 1.00 46.46  ? 473 TYR C CZ    1 
ATOM 4910  O OH    . TYR B 2 473 ? -189.505 161.609 128.375 1.00 46.46  ? 473 TYR C OH    1 
ATOM 4911  N N     . TRP B 2 474 ? -192.040 160.646 134.377 1.00 48.55  ? 474 TRP C N     1 
ATOM 4912  C CA    . TRP B 2 474 ? -192.797 161.894 134.333 1.00 48.55  ? 474 TRP C CA    1 
ATOM 4913  C C     . TRP B 2 474 ? -192.510 162.794 135.525 1.00 48.55  ? 474 TRP C C     1 
ATOM 4914  O O     . TRP B 2 474 ? -192.470 164.021 135.370 1.00 48.55  ? 474 TRP C O     1 
ATOM 4915  C CB    . TRP B 2 474 ? -194.291 161.618 134.186 1.00 48.55  ? 474 TRP C CB    1 
ATOM 4916  C CG    . TRP B 2 474 ? -194.610 160.898 132.926 1.00 48.55  ? 474 TRP C CG    1 
ATOM 4917  C CD1   . TRP B 2 474 ? -195.122 159.651 132.768 1.00 48.55  ? 474 TRP C CD1   1 
ATOM 4918  C CD2   . TRP B 2 474 ? -194.539 161.468 131.622 1.00 48.55  ? 474 TRP C CD2   1 
ATOM 4919  N NE1   . TRP B 2 474 ? -195.307 159.384 131.432 1.00 48.55  ? 474 TRP C NE1   1 
ATOM 4920  C CE2   . TRP B 2 474 ? -194.966 160.498 130.713 1.00 48.55  ? 474 TRP C CE2   1 
ATOM 4921  C CE3   . TRP B 2 474 ? -194.136 162.713 131.138 1.00 48.55  ? 474 TRP C CE3   1 
ATOM 4922  C CZ2   . TRP B 2 474 ? -194.993 160.728 129.346 1.00 48.55  ? 474 TRP C CZ2   1 
ATOM 4923  C CZ3   . TRP B 2 474 ? -194.164 162.937 129.790 1.00 48.55  ? 474 TRP C CZ3   1 
ATOM 4924  C CH2   . TRP B 2 474 ? -194.591 161.955 128.906 1.00 48.55  ? 474 TRP C CH2   1 
ATOM 4925  N N     . ALA B 2 475 ? -192.240 162.232 136.701 1.00 49.31  ? 475 ALA C N     1 
ATOM 4926  C CA    . ALA B 2 475 ? -191.917 163.112 137.820 1.00 49.31  ? 475 ALA C CA    1 
ATOM 4927  C C     . ALA B 2 475 ? -190.645 163.920 137.571 1.00 49.31  ? 475 ALA C C     1 
ATOM 4928  O O     . ALA B 2 475 ? -190.593 165.109 137.895 1.00 49.31  ? 475 ALA C O     1 
ATOM 4929  C CB    . ALA B 2 475 ? -191.791 162.303 139.106 1.00 49.31  ? 475 ALA C CB    1 
ATOM 4930  N N     . LYS B 2 476 ? -189.622 163.317 136.960 1.00 50.87  ? 476 LYS C N     1 
ATOM 4931  C CA    . LYS B 2 476 ? -188.427 164.093 136.634 1.00 50.87  ? 476 LYS C CA    1 
ATOM 4932  C C     . LYS B 2 476 ? -188.544 164.870 135.339 1.00 50.87  ? 476 LYS C C     1 
ATOM 4933  O O     . LYS B 2 476 ? -187.831 165.859 135.155 1.00 50.87  ? 476 LYS C O     1 
ATOM 4934  C CB    . LYS B 2 476 ? -187.196 163.189 136.525 1.00 50.87  ? 476 LYS C CB    1 
ATOM 4935  C CG    . LYS B 2 476 ? -186.768 162.533 137.802 1.00 50.87  ? 476 LYS C CG    1 
ATOM 4936  C CD    . LYS B 2 476 ? -185.622 161.593 137.548 1.00 50.87  ? 476 LYS C CD    1 
ATOM 4937  C CE    . LYS B 2 476 ? -185.191 160.922 138.828 1.00 50.87  ? 476 LYS C CE    1 
ATOM 4938  N NZ    . LYS B 2 476 ? -184.694 161.929 139.800 1.00 50.87  ? 476 LYS C NZ    1 
ATOM 4939  N N     . ALA B 2 477 ? -189.421 164.453 134.452 1.00 50.62  ? 477 ALA C N     1 
ATOM 4940  C CA    . ALA B 2 477 ? -189.534 165.045 133.137 1.00 50.62  ? 477 ALA C CA    1 
ATOM 4941  C C     . ALA B 2 477 ? -190.422 166.260 133.121 1.00 50.62  ? 477 ALA C C     1 
ATOM 4942  O O     . ALA B 2 477 ? -190.428 166.990 132.130 1.00 50.62  ? 477 ALA C O     1 
ATOM 4943  C CB    . ALA B 2 477 ? -190.052 164.019 132.134 1.00 50.62  ? 477 ALA C CB    1 
ATOM 4944  N N     . GLU B 2 478 ? -191.195 166.441 134.194 1.00 57.70  ? 478 GLU C N     1 
ATOM 4945  C CA    . GLU B 2 478 ? -192.106 167.585 134.382 1.00 57.70  ? 478 GLU C CA    1 
ATOM 4946  C C     . GLU B 2 478 ? -191.447 168.961 134.601 1.00 57.70  ? 478 GLU C C     1 
ATOM 4947  O O     . GLU B 2 478 ? -191.825 169.925 133.954 1.00 57.70  ? 478 GLU C O     1 
ATOM 4948  C CB    . GLU B 2 478 ? -193.094 167.267 135.513 1.00 57.70  ? 478 GLU C CB    1 
ATOM 4949  C CG    . GLU B 2 478 ? -193.750 168.454 136.187 1.00 57.70  ? 478 GLU C CG    1 
ATOM 4950  C CD    . GLU B 2 478 ? -194.972 168.919 135.444 1.00 57.70  ? 478 GLU C CD    1 
ATOM 4951  O OE1   . GLU B 2 478 ? -195.044 168.655 134.227 1.00 57.70  ? 478 GLU C OE1   1 
ATOM 4952  O OE2   . GLU B 2 478 ? -195.852 169.543 136.079 1.00 57.70  ? 478 GLU C OE2   1 
ATOM 4953  N N     . PRO B 2 479 ? -190.460 169.052 135.489 1.00 53.52  ? 479 PRO C N     1 
ATOM 4954  C CA    . PRO B 2 479 ? -189.749 170.315 135.678 1.00 53.52  ? 479 PRO C CA    1 
ATOM 4955  C C     . PRO B 2 479 ? -188.806 170.629 134.552 1.00 53.52  ? 479 PRO C C     1 
ATOM 4956  O O     . PRO B 2 479 ? -188.618 171.808 134.255 1.00 53.52  ? 479 PRO C O     1 
ATOM 4957  C CB    . PRO B 2 479 ? -189.013 170.118 137.006 1.00 53.52  ? 479 PRO C CB    1 
ATOM 4958  C CG    . PRO B 2 479 ? -189.720 169.031 137.678 1.00 53.52  ? 479 PRO C CG    1 
ATOM 4959  C CD    . PRO B 2 479 ? -190.180 168.120 136.587 1.00 53.52  ? 479 PRO C CD    1 
ATOM 4960  N N     . VAL B 2 480 ? -188.191 169.634 133.920 1.00 55.14  ? 480 VAL C N     1 
ATOM 4961  C CA    . VAL B 2 480 ? -187.308 169.942 132.802 1.00 55.14  ? 480 VAL C CA    1 
ATOM 4962  C C     . VAL B 2 480 ? -188.107 170.503 131.636 1.00 55.14  ? 480 VAL C C     1 
ATOM 4963  O O     . VAL B 2 480 ? -187.627 171.377 130.908 1.00 55.14  ? 480 VAL C O     1 
ATOM 4964  C CB    . VAL B 2 480 ? -186.479 168.716 132.386 1.00 55.14  ? 480 VAL C CB    1 
ATOM 4965  C CG1   . VAL B 2 480 ? -187.345 167.695 131.767 1.00 55.14  ? 480 VAL C CG1   1 
ATOM 4966  C CG2   . VAL B 2 480 ? -185.401 169.119 131.415 1.00 55.14  ? 480 VAL C CG2   1 
ATOM 4967  N N     . PHE B 2 481 ? -189.324 170.006 131.419 1.00 57.34  ? 481 PHE C N     1 
ATOM 4968  C CA    . PHE B 2 481 ? -190.177 170.615 130.403 1.00 57.34  ? 481 PHE C CA    1 
ATOM 4969  C C     . PHE B 2 481 ? -190.432 172.072 130.757 1.00 57.34  ? 481 PHE C C     1 
ATOM 4970  O O     . PHE B 2 481 ? -190.189 172.970 129.945 1.00 57.34  ? 481 PHE C O     1 
ATOM 4971  C CB    . PHE B 2 481 ? -191.477 169.839 130.246 1.00 57.34  ? 481 PHE C CB    1 
ATOM 4972  C CG    . PHE B 2 481 ? -192.450 170.480 129.307 1.00 57.34  ? 481 PHE C CG    1 
ATOM 4973  C CD1   . PHE B 2 481 ? -192.353 170.247 127.950 1.00 57.34  ? 481 PHE C CD1   1 
ATOM 4974  C CD2   . PHE B 2 481 ? -193.458 171.296 129.766 1.00 57.34  ? 481 PHE C CD2   1 
ATOM 4975  C CE1   . PHE B 2 481 ? -193.233 170.816 127.079 1.00 57.34  ? 481 PHE C CE1   1 
ATOM 4976  C CE2   . PHE B 2 481 ? -194.343 171.868 128.892 1.00 57.34  ? 481 PHE C CE2   1 
ATOM 4977  C CZ    . PHE B 2 481 ? -194.228 171.628 127.549 1.00 57.34  ? 481 PHE C CZ    1 
ATOM 4978  N N     . TRP B 2 482 ? -190.905 172.336 131.976 1.00 57.64  ? 482 TRP C N     1 
ATOM 4979  C CA    . TRP B 2 482 ? -191.166 173.729 132.326 1.00 57.64  ? 482 TRP C CA    1 
ATOM 4980  C C     . TRP B 2 482 ? -189.912 174.579 132.343 1.00 57.64  ? 482 TRP C C     1 
ATOM 4981  O O     . TRP B 2 482 ? -190.019 175.803 132.320 1.00 57.64  ? 482 TRP C O     1 
ATOM 4982  C CB    . TRP B 2 482 ? -191.828 173.902 133.683 1.00 57.64  ? 482 TRP C CB    1 
ATOM 4983  C CG    . TRP B 2 482 ? -193.201 173.493 133.792 1.00 57.64  ? 482 TRP C CG    1 
ATOM 4984  C CD1   . TRP B 2 482 ? -193.701 172.497 134.537 1.00 57.64  ? 482 TRP C CD1   1 
ATOM 4985  C CD2   . TRP B 2 482 ? -194.312 174.190 133.245 1.00 57.64  ? 482 TRP C CD2   1 
ATOM 4986  N NE1   . TRP B 2 482 ? -195.067 172.470 134.431 1.00 57.64  ? 482 TRP C NE1   1 
ATOM 4987  C CE2   . TRP B 2 482 ? -195.463 173.511 133.641 1.00 57.64  ? 482 TRP C CE2   1 
ATOM 4988  C CE3   . TRP B 2 482 ? -194.440 175.306 132.421 1.00 57.64  ? 482 TRP C CE3   1 
ATOM 4989  C CZ2   . TRP B 2 482 ? -196.728 173.905 133.245 1.00 57.64  ? 482 TRP C CZ2   1 
ATOM 4990  C CZ3   . TRP B 2 482 ? -195.696 175.698 132.035 1.00 57.64  ? 482 TRP C CZ3   1 
ATOM 4991  C CH2   . TRP B 2 482 ? -196.822 175.002 132.445 1.00 57.64  ? 482 TRP C CH2   1 
ATOM 4992  N N     . ASN B 2 483 ? -188.738 173.975 132.412 1.00 61.57  ? 483 ASN C N     1 
ATOM 4993  C CA    . ASN B 2 483 ? -187.524 174.758 132.280 1.00 61.57  ? 483 ASN C CA    1 
ATOM 4994  C C     . ASN B 2 483 ? -187.187 175.008 130.822 1.00 61.57  ? 483 ASN C C     1 
ATOM 4995  O O     . ASN B 2 483 ? -186.592 176.039 130.497 1.00 61.57  ? 483 ASN C O     1 
ATOM 4996  C CB    . ASN B 2 483 ? -186.343 174.052 132.938 1.00 61.57  ? 483 ASN C CB    1 
ATOM 4997  C CG    . ASN B 2 483 ? -186.405 174.060 134.443 1.00 61.57  ? 483 ASN C CG    1 
ATOM 4998  O OD1   . ASN B 2 483 ? -187.070 174.896 135.042 1.00 61.57  ? 483 ASN C OD1   1 
ATOM 4999  N ND2   . ASN B 2 483 ? -185.676 173.146 135.068 1.00 61.57  ? 483 ASN C ND2   1 
ATOM 5000  N N     . ILE B 2 484 ? -187.578 174.095 129.934 1.00 63.72  ? 484 ILE C N     1 
ATOM 5001  C CA    . ILE B 2 484 ? -187.348 174.303 128.514 1.00 63.72  ? 484 ILE C CA    1 
ATOM 5002  C C     . ILE B 2 484 ? -188.297 175.346 127.968 1.00 63.72  ? 484 ILE C C     1 
ATOM 5003  O O     . ILE B 2 484 ? -187.932 176.123 127.080 1.00 63.72  ? 484 ILE C O     1 
ATOM 5004  C CB    . ILE B 2 484 ? -187.468 172.978 127.732 1.00 63.72  ? 484 ILE C CB    1 
ATOM 5005  C CG1   . ILE B 2 484 ? -186.291 172.052 128.031 1.00 63.72  ? 484 ILE C CG1   1 
ATOM 5006  C CG2   . ILE B 2 484 ? -187.614 173.233 126.255 1.00 63.72  ? 484 ILE C CG2   1 
ATOM 5007  C CD1   . ILE B 2 484 ? -186.336 170.738 127.265 1.00 63.72  ? 484 ILE C CD1   1 
ATOM 5008  N N     . VAL B 2 485 ? -189.514 175.419 128.493 1.00 64.95  ? 485 VAL C N     1 
ATOM 5009  C CA    . VAL B 2 485 ? -190.435 176.413 127.964 1.00 64.95  ? 485 VAL C CA    1 
ATOM 5010  C C     . VAL B 2 485 ? -189.998 177.814 128.377 1.00 64.95  ? 485 VAL C C     1 
ATOM 5011  O O     . VAL B 2 485 ? -190.098 178.760 127.591 1.00 64.95  ? 485 VAL C O     1 
ATOM 5012  C CB    . VAL B 2 485 ? -191.880 176.096 128.385 1.00 64.95  ? 485 VAL C CB    1 
ATOM 5013  C CG1   . VAL B 2 485 ? -192.047 176.145 129.873 1.00 64.95  ? 485 VAL C CG1   1 
ATOM 5014  C CG2   . VAL B 2 485 ? -192.815 177.060 127.739 1.00 64.95  ? 485 VAL C CG2   1 
ATOM 5015  N N     . TYR B 2 486 ? -189.652 177.998 129.639 1.00 63.99  ? 486 TYR C N     1 
ATOM 5016  C CA    . TYR B 2 486 ? -189.285 179.325 130.113 1.00 63.99  ? 486 TYR C CA    1 
ATOM 5017  C C     . TYR B 2 486 ? -187.896 179.686 129.651 1.00 63.99  ? 486 TYR C C     1 
ATOM 5018  O O     . TYR B 2 486 ? -187.472 180.829 129.750 1.00 63.99  ? 486 TYR C O     1 
ATOM 5019  C CB    . TYR B 2 486 ? -189.380 179.422 131.630 1.00 63.99  ? 486 TYR C CB    1 
ATOM 5020  C CG    . TYR B 2 486 ? -190.772 179.679 132.144 1.00 63.99  ? 486 TYR C CG    1 
ATOM 5021  C CD1   . TYR B 2 486 ? -191.791 178.776 131.917 1.00 63.99  ? 486 TYR C CD1   1 
ATOM 5022  C CD2   . TYR B 2 486 ? -191.061 180.821 132.864 1.00 63.99  ? 486 TYR C CD2   1 
ATOM 5023  C CE1   . TYR B 2 486 ? -193.063 179.006 132.392 1.00 63.99  ? 486 TYR C CE1   1 
ATOM 5024  C CE2   . TYR B 2 486 ? -192.332 181.060 133.342 1.00 63.99  ? 486 TYR C CE2   1 
ATOM 5025  C CZ    . TYR B 2 486 ? -193.326 180.150 133.102 1.00 63.99  ? 486 TYR C CZ    1 
ATOM 5026  O OH    . TYR B 2 486 ? -194.588 180.389 133.579 1.00 63.99  ? 486 TYR C OH    1 
ATOM 5027  N N     . ASP B 2 487 ? -187.187 178.674 129.172 1.00 68.62  ? 487 ASP C N     1 
ATOM 5028  C CA    . ASP B 2 487 ? -185.821 178.824 128.709 1.00 68.62  ? 487 ASP C CA    1 
ATOM 5029  C C     . ASP B 2 487 ? -184.888 178.930 129.903 1.00 68.62  ? 487 ASP C C     1 
ATOM 5030  O O     . ASP B 2 487 ? -183.724 179.283 129.773 1.00 68.62  ? 487 ASP C O     1 
ATOM 5031  C CB    . ASP B 2 487 ? -185.685 180.022 127.782 1.00 68.62  ? 487 ASP C CB    1 
ATOM 5032  N N     . ARG B 2 488 ? -185.424 178.609 131.071 1.00 64.61  ? 488 ARG C N     1 
ATOM 5033  C CA    . ARG B 2 488 ? -184.680 178.635 132.310 1.00 64.61  ? 488 ARG C CA    1 
ATOM 5034  C C     . ARG B 2 488 ? -183.660 177.563 132.051 1.00 64.61  ? 488 ARG C C     1 
ATOM 5035  O O     . ARG B 2 488 ? -183.839 176.793 131.109 1.00 64.61  ? 488 ARG C O     1 
ATOM 5036  C CB    . ARG B 2 488 ? -185.561 178.247 133.490 1.00 64.61  ? 488 ARG C CB    1 
ATOM 5037  C CG    . ARG B 2 488 ? -186.551 179.315 133.905 1.00 64.61  ? 488 ARG C CG    1 
ATOM 5038  C CD    . ARG B 2 488 ? -187.018 179.083 135.326 1.00 64.61  ? 488 ARG C CD    1 
ATOM 5039  N NE    . ARG B 2 488 ? -188.310 178.414 135.366 1.00 64.61  ? 488 ARG C NE    1 
ATOM 5040  C CZ    . ARG B 2 488 ? -188.990 178.168 136.480 1.00 64.61  ? 488 ARG C CZ    1 
ATOM 5041  N NH1   . ARG B 2 488 ? -188.498 178.535 137.653 1.00 64.61  ? 488 ARG C NH1   1 
ATOM 5042  N NH2   . ARG B 2 488 ? -190.160 177.551 136.421 1.00 64.61  ? 488 ARG C NH2   1 
ATOM 5043  N N     . PRO B 2 489 ? -182.552 177.527 132.884 1.00 67.53  ? 489 PRO C N     1 
ATOM 5044  C CA    . PRO B 2 489 ? -181.585 176.486 132.529 1.00 67.53  ? 489 PRO C CA    1 
ATOM 5045  C C     . PRO B 2 489 ? -181.791 175.153 133.231 1.00 67.53  ? 489 PRO C C     1 
ATOM 5046  O O     . PRO B 2 489 ? -181.639 175.017 134.444 1.00 67.53  ? 489 PRO C O     1 
ATOM 5047  C CB    . PRO B 2 489 ? -180.259 177.101 132.947 1.00 67.53  ? 489 PRO C CB    1 
ATOM 5048  C CG    . PRO B 2 489 ? -180.588 177.784 134.224 1.00 67.53  ? 489 PRO C CG    1 
ATOM 5049  C CD    . PRO B 2 489 ? -182.034 178.199 134.157 1.00 67.53  ? 489 PRO C CD    1 
ATOM 5050  N N     . ALA B 2 490 ? -182.132 174.174 132.404 1.00 71.70  ? 490 ALA C N     1 
ATOM 5051  C CA    . ALA B 2 490 ? -182.330 172.770 132.748 1.00 71.70  ? 490 ALA C CA    1 
ATOM 5052  C C     . ALA B 2 490 ? -181.187 171.903 132.255 1.00 71.70  ? 490 ALA C C     1 
ATOM 5053  O O     . ALA B 2 490 ? -180.732 172.040 131.118 1.00 71.70  ? 490 ALA C O     1 
ATOM 5054  C CB    . ALA B 2 490 ? -183.628 172.247 132.151 1.00 71.70  ? 490 ALA C CB    1 
ATOM 5055  N N     . GLN B 2 491 ? -180.746 170.959 133.066 1.00 76.12  ? 491 GLN C N     1 
ATOM 5056  C CA    . GLN B 2 491 ? -179.647 170.116 132.634 1.00 76.12  ? 491 GLN C CA    1 
ATOM 5057  C C     . GLN B 2 491 ? -180.050 169.433 131.350 1.00 76.12  ? 491 GLN C C     1 
ATOM 5058  O O     . GLN B 2 491 ? -181.192 169.044 131.179 1.00 76.12  ? 491 GLN C O     1 
ATOM 5059  C CB    . GLN B 2 491 ? -179.328 169.067 133.688 1.00 76.12  ? 491 GLN C CB    1 
ATOM 5060  C CG    . GLN B 2 491 ? -177.903 168.558 133.620 1.00 76.12  ? 491 GLN C CG    1 
ATOM 5061  C CD    . GLN B 2 491 ? -177.461 167.934 134.922 1.00 76.12  ? 491 GLN C CD    1 
ATOM 5062  O OE1   . GLN B 2 491 ? -178.153 167.081 135.474 1.00 76.12  ? 491 GLN C OE1   1 
ATOM 5063  N NE2   . GLN B 2 491 ? -176.306 168.357 135.422 1.00 76.12  ? 491 GLN C NE2   1 
ATOM 5064  N N     . GLY B 2 492 ? -179.105 169.309 130.436 1.00 70.67  ? 492 GLY C N     1 
ATOM 5065  C CA    . GLY B 2 492 ? -179.359 168.692 129.154 1.00 70.67  ? 492 GLY C CA    1 
ATOM 5066  C C     . GLY B 2 492 ? -179.931 169.702 128.186 1.00 70.67  ? 492 GLY C C     1 
ATOM 5067  O O     . GLY B 2 492 ? -180.234 169.377 127.045 1.00 70.67  ? 492 GLY C O     1 
ATOM 5068  N N     . TYR B 2 493 ? -180.075 170.940 128.636 1.00 73.96  ? 493 TYR C N     1 
ATOM 5069  C CA    . TYR B 2 493 ? -180.613 171.987 127.781 1.00 73.96  ? 493 TYR C CA    1 
ATOM 5070  C C     . TYR B 2 493 ? -179.839 173.287 127.916 1.00 73.96  ? 493 TYR C C     1 
ATOM 5071  O O     . TYR B 2 493 ? -179.369 173.627 128.999 1.00 73.96  ? 493 TYR C O     1 
ATOM 5072  C CB    . TYR B 2 493 ? -182.069 172.233 128.141 1.00 73.96  ? 493 TYR C CB    1 
ATOM 5073  C CG    . TYR B 2 493 ? -182.733 173.336 127.365 1.00 73.96  ? 493 TYR C CG    1 
ATOM 5074  C CD1   . TYR B 2 493 ? -182.859 173.266 125.991 1.00 73.96  ? 493 TYR C CD1   1 
ATOM 5075  C CD2   . TYR B 2 493 ? -183.256 174.439 128.010 1.00 73.96  ? 493 TYR C CD2   1 
ATOM 5076  C CE1   . TYR B 2 493 ? -183.480 174.270 125.281 1.00 73.96  ? 493 TYR C CE1   1 
ATOM 5077  C CE2   . TYR B 2 493 ? -183.873 175.447 127.306 1.00 73.96  ? 493 TYR C CE2   1 
ATOM 5078  C CZ    . TYR B 2 493 ? -183.982 175.354 125.944 1.00 73.96  ? 493 TYR C CZ    1 
ATOM 5079  O OH    . TYR B 2 493 ? -184.601 176.356 125.250 1.00 73.96  ? 493 TYR C OH    1 
ATOM 5080  N N     . THR B 2 494 ? -179.716 174.015 126.813 1.00 74.21  ? 494 THR C N     1 
ATOM 5081  C CA    . THR B 2 494 ? -179.037 175.301 126.821 1.00 74.21  ? 494 THR C CA    1 
ATOM 5082  C C     . THR B 2 494 ? -180.089 176.293 126.404 1.00 74.21  ? 494 THR C C     1 
ATOM 5083  O O     . THR B 2 494 ? -180.707 176.119 125.350 1.00 74.21  ? 494 THR C O     1 
ATOM 5084  C CB    . THR B 2 494 ? -177.919 175.363 125.786 1.00 74.21  ? 494 THR C CB    1 
ATOM 5085  O OG1   . THR B 2 494 ? -177.556 176.731 125.569 1.00 74.21  ? 494 THR C OG1   1 
ATOM 5086  C CG2   . THR B 2 494 ? -178.394 174.766 124.478 1.00 74.21  ? 494 THR C CG2   1 
ATOM 5087  N N     . PRO B 2 495 ? -180.282 177.378 127.246 1.00 72.11  ? 495 PRO C N     1 
ATOM 5088  C CA    . PRO B 2 495 ? -181.346 178.292 126.800 1.00 72.11  ? 495 PRO C CA    1 
ATOM 5089  C C     . PRO B 2 495 ? -181.095 178.857 125.407 1.00 72.11  ? 495 PRO C C     1 
ATOM 5090  O O     . PRO B 2 495 ? -179.966 179.161 125.044 1.00 72.11  ? 495 PRO C O     1 
ATOM 5091  C CB    . PRO B 2 495 ? -181.317 179.408 127.841 1.00 72.11  ? 495 PRO C CB    1 
ATOM 5092  C CG    . PRO B 2 495 ? -180.900 178.728 129.082 1.00 72.11  ? 495 PRO C CG    1 
ATOM 5093  C CD    . PRO B 2 495 ? -179.767 177.893 128.593 1.00 72.11  ? 495 PRO C CD    1 
ATOM 5094  N N     . GLY B 2 496 ? -182.169 178.973 124.632 1.00 73.59  ? 496 GLY C N     1 
ATOM 5095  C CA    . GLY B 2 496 ? -182.111 179.489 123.280 1.00 73.59  ? 496 GLY C CA    1 
ATOM 5096  C C     . GLY B 2 496 ? -181.801 178.487 122.182 1.00 73.59  ? 496 GLY C C     1 
ATOM 5097  O O     . GLY B 2 496 ? -181.711 178.865 121.020 1.00 73.59  ? 496 GLY C O     1 
ATOM 5098  N N     . MET B 2 497 ? -181.652 177.215 122.537 1.00 76.72  ? 497 MET C N     1 
ATOM 5099  C CA    . MET B 2 497 ? -181.364 176.165 121.560 1.00 76.72  ? 497 MET C CA    1 
ATOM 5100  C C     . MET B 2 497 ? -182.589 176.019 120.666 1.00 76.72  ? 497 MET C C     1 
ATOM 5101  O O     . MET B 2 497 ? -183.698 176.306 121.107 1.00 76.72  ? 497 MET C O     1 
ATOM 5102  C CB    . MET B 2 497 ? -181.036 174.852 122.274 1.00 76.72  ? 497 MET C CB    1 
ATOM 5103  C CG    . MET B 2 497 ? -180.715 173.686 121.356 1.00 76.72  ? 497 MET C CG    1 
ATOM 5104  S SD    . MET B 2 497 ? -179.239 172.766 121.844 1.00 76.72  ? 497 MET C SD    1 
ATOM 5105  C CE    . MET B 2 497 ? -179.441 171.242 120.929 1.00 76.72  ? 497 MET C CE    1 
ATOM 5106  N N     . ALA B 2 498 ? -182.409 175.601 119.414 1.00 79.78  ? 498 ALA C N     1 
ATOM 5107  C CA    . ALA B 2 498 ? -183.556 175.483 118.518 1.00 79.78  ? 498 ALA C CA    1 
ATOM 5108  C C     . ALA B 2 498 ? -184.581 174.452 118.987 1.00 79.78  ? 498 ALA C C     1 
ATOM 5109  O O     . ALA B 2 498 ? -185.775 174.610 118.711 1.00 79.78  ? 498 ALA C O     1 
ATOM 5110  C CB    . ALA B 2 498 ? -183.087 175.134 117.110 1.00 79.78  ? 498 ALA C CB    1 
ATOM 5111  N N     . GLY B 2 499 ? -184.159 173.406 119.691 1.00 76.79  ? 499 GLY C N     1 
ATOM 5112  C CA    . GLY B 2 499 ? -185.083 172.375 120.104 1.00 76.79  ? 499 GLY C CA    1 
ATOM 5113  C C     . GLY B 2 499 ? -184.928 171.921 121.541 1.00 76.79  ? 499 GLY C C     1 
ATOM 5114  O O     . GLY B 2 499 ? -184.336 172.610 122.372 1.00 76.79  ? 499 GLY C O     1 
ATOM 5115  N N     . PRO B 2 500 ? -185.470 170.744 121.862 1.00 67.83  ? 500 PRO C N     1 
ATOM 5116  C CA    . PRO B 2 500 ? -185.353 170.251 123.240 1.00 67.83  ? 500 PRO C CA    1 
ATOM 5117  C C     . PRO B 2 500 ? -183.921 170.014 123.668 1.00 67.83  ? 500 PRO C C     1 
ATOM 5118  O O     . PRO B 2 500 ? -183.617 170.145 124.857 1.00 67.83  ? 500 PRO C O     1 
ATOM 5119  C CB    . PRO B 2 500 ? -186.161 168.948 123.210 1.00 67.83  ? 500 PRO C CB    1 
ATOM 5120  C CG    . PRO B 2 500 ? -187.067 169.086 122.021 1.00 67.83  ? 500 PRO C CG    1 
ATOM 5121  C CD    . PRO B 2 500 ? -186.289 169.860 121.023 1.00 67.83  ? 500 PRO C CD    1 
ATOM 5122  N N     . GLY B 2 501 ? -183.030 169.653 122.753 1.00 68.70  ? 501 GLY C N     1 
ATOM 5123  C CA    . GLY B 2 501 ? -181.625 169.569 123.096 1.00 68.70  ? 501 GLY C CA    1 
ATOM 5124  C C     . GLY B 2 501 ? -181.187 168.377 123.907 1.00 68.70  ? 501 GLY C C     1 
ATOM 5125  O O     . GLY B 2 501 ? -180.235 168.490 124.683 1.00 68.70  ? 501 GLY C O     1 
ATOM 5126  N N     . ASN B 2 502 ? -181.865 167.247 123.803 1.00 60.68  ? 502 ASN C N     1 
ATOM 5127  C CA    . ASN B 2 502 ? -181.421 166.103 124.577 1.00 60.68  ? 502 ASN C CA    1 
ATOM 5128  C C     . ASN B 2 502 ? -181.754 166.248 126.046 1.00 60.68  ? 502 ASN C C     1 
ATOM 5129  O O     . ASN B 2 502 ? -181.290 165.464 126.856 1.00 60.68  ? 502 ASN C O     1 
ATOM 5130  C CB    . ASN B 2 502 ? -179.905 165.973 124.461 1.00 60.68  ? 502 ASN C CB    1 
ATOM 5131  C CG    . ASN B 2 502 ? -179.481 164.981 123.402 1.00 60.68  ? 502 ASN C CG    1 
ATOM 5132  O OD1   . ASN B 2 502 ? -179.800 165.140 122.226 1.00 60.68  ? 502 ASN C OD1   1 
ATOM 5133  N ND2   . ASN B 2 502 ? -178.746 163.954 123.814 1.00 60.68  ? 502 ASN C ND2   1 
ATOM 5134  N N     . ALA B 2 503 ? -182.539 167.258 126.396 1.00 57.82  ? 503 ALA C N     1 
ATOM 5135  C CA    . ALA B 2 503 ? -182.890 167.472 127.792 1.00 57.82  ? 503 ALA C CA    1 
ATOM 5136  C C     . ALA B 2 503 ? -183.690 166.306 128.302 1.00 57.82  ? 503 ALA C C     1 
ATOM 5137  O O     . ALA B 2 503 ? -183.479 165.828 129.406 1.00 57.82  ? 503 ALA C O     1 
ATOM 5138  C CB    . ALA B 2 503 ? -183.686 168.751 127.946 1.00 57.82  ? 503 ALA C CB    1 
ATOM 5139  N N     . PHE B 2 504 ? -184.632 165.874 127.480 1.00 53.54  ? 504 PHE C N     1 
ATOM 5140  C CA    . PHE B 2 504 ? -185.499 164.745 127.783 1.00 53.54  ? 504 PHE C CA    1 
ATOM 5141  C C     . PHE B 2 504 ? -184.834 163.378 127.811 1.00 53.54  ? 504 PHE C C     1 
ATOM 5142  O O     . PHE B 2 504 ? -185.159 162.548 128.647 1.00 53.54  ? 504 PHE C O     1 
ATOM 5143  C CB    . PHE B 2 504 ? -186.741 164.788 126.914 1.00 53.54  ? 504 PHE C CB    1 
ATOM 5144  C CG    . PHE B 2 504 ? -187.628 165.941 127.246 1.00 53.54  ? 504 PHE C CG    1 
ATOM 5145  C CD1   . PHE B 2 504 ? -188.331 165.957 128.427 1.00 53.54  ? 504 PHE C CD1   1 
ATOM 5146  C CD2   . PHE B 2 504 ? -187.707 167.028 126.411 1.00 53.54  ? 504 PHE C CD2   1 
ATOM 5147  C CE1   . PHE B 2 504 ? -189.127 167.023 128.755 1.00 53.54  ? 504 PHE C CE1   1 
ATOM 5148  C CE2   . PHE B 2 504 ? -188.504 168.100 126.731 1.00 53.54  ? 504 PHE C CE2   1 
ATOM 5149  C CZ    . PHE B 2 504 ? -189.214 168.096 127.905 1.00 53.54  ? 504 PHE C CZ    1 
ATOM 5150  N N     . ASN B 2 505 ? -183.893 163.168 126.892 1.00 52.34  ? 505 ASN C N     1 
ATOM 5151  C CA    . ASN B 2 505 ? -183.147 161.914 126.791 1.00 52.34  ? 505 ASN C CA    1 
ATOM 5152  C C     . ASN B 2 505 ? -182.323 161.643 128.047 1.00 52.34  ? 505 ASN C C     1 
ATOM 5153  O O     . ASN B 2 505 ? -182.049 160.501 128.400 1.00 52.34  ? 505 ASN C O     1 
ATOM 5154  C CB    . ASN B 2 505 ? -182.253 161.935 125.566 1.00 52.34  ? 505 ASN C CB    1 
ATOM 5155  C CG    . ASN B 2 505 ? -181.674 160.586 125.256 1.00 52.34  ? 505 ASN C CG    1 
ATOM 5156  O OD1   . ASN B 2 505 ? -181.078 159.947 126.112 1.00 52.34  ? 505 ASN C OD1   1 
ATOM 5157  N ND2   . ASN B 2 505 ? -181.835 160.145 124.017 1.00 52.34  ? 505 ASN C ND2   1 
ATOM 5158  N N     . LEU B 2 506 ? -181.929 162.713 128.723 1.00 50.58  ? 506 LEU C N     1 
ATOM 5159  C CA    . LEU B 2 506 ? -181.204 162.590 129.976 1.00 50.58  ? 506 LEU C CA    1 
ATOM 5160  C C     . LEU B 2 506 ? -182.088 162.151 131.122 1.00 50.58  ? 506 LEU C C     1 
ATOM 5161  O O     . LEU B 2 506 ? -181.687 161.313 131.915 1.00 50.58  ? 506 LEU C O     1 
ATOM 5162  C CB    . LEU B 2 506 ? -180.530 163.908 130.331 1.00 50.58  ? 506 LEU C CB    1 
ATOM 5163  C CG    . LEU B 2 506 ? -179.019 163.906 130.151 1.00 50.58  ? 506 LEU C CG    1 
ATOM 5164  C CD1   . LEU B 2 506 ? -178.660 163.638 128.702 1.00 50.58  ? 506 LEU C CD1   1 
ATOM 5165  C CD2   . LEU B 2 506 ? -178.426 165.223 130.612 1.00 50.58  ? 506 LEU C CD2   1 
ATOM 5166  N N     . VAL B 2 507 ? -183.288 162.713 131.219 1.00 48.60  ? 507 VAL C N     1 
ATOM 5167  C CA    . VAL B 2 507 ? -184.207 162.341 132.294 1.00 48.60  ? 507 VAL C CA    1 
ATOM 5168  C C     . VAL B 2 507 ? -184.628 160.893 132.171 1.00 48.60  ? 507 VAL C C     1 
ATOM 5169  O O     . VAL B 2 507 ? -184.733 160.188 133.158 1.00 48.60  ? 507 VAL C O     1 
ATOM 5170  C CB    . VAL B 2 507 ? -185.460 163.221 132.341 1.00 48.60  ? 507 VAL C CB    1 
ATOM 5171  C CG1   . VAL B 2 507 ? -186.374 162.751 133.454 1.00 48.60  ? 507 VAL C CG1   1 
ATOM 5172  C CG2   . VAL B 2 507 ? -185.072 164.669 132.564 1.00 48.60  ? 507 VAL C CG2   1 
ATOM 5173  N N     . ALA B 2 508 ? -184.880 160.448 130.951 1.00 48.71  ? 508 ALA C N     1 
ATOM 5174  C CA    . ALA B 2 508 ? -185.283 159.073 130.756 1.00 48.71  ? 508 ALA C CA    1 
ATOM 5175  C C     . ALA B 2 508 ? -184.164 158.153 131.199 1.00 48.71  ? 508 ALA C C     1 
ATOM 5176  O O     . ALA B 2 508 ? -184.409 157.146 131.840 1.00 48.71  ? 508 ALA C O     1 
ATOM 5177  C CB    . ALA B 2 508 ? -185.644 158.815 129.307 1.00 48.71  ? 508 ALA C CB    1 
ATOM 5178  N N     . LEU B 2 509 ? -182.926 158.498 130.874 1.00 45.49  ? 509 LEU C N     1 
ATOM 5179  C CA    . LEU B 2 509 ? -181.807 157.649 131.256 1.00 45.49  ? 509 LEU C CA    1 
ATOM 5180  C C     . LEU B 2 509 ? -181.639 157.616 132.763 1.00 45.49  ? 509 LEU C C     1 
ATOM 5181  O O     . LEU B 2 509 ? -181.258 156.585 133.324 1.00 45.49  ? 509 LEU C O     1 
ATOM 5182  C CB    . LEU B 2 509 ? -180.513 158.126 130.612 1.00 45.49  ? 509 LEU C CB    1 
ATOM 5183  C CG    . LEU B 2 509 ? -180.348 157.873 129.123 1.00 45.49  ? 509 LEU C CG    1 
ATOM 5184  C CD1   . LEU B 2 509 ? -179.073 158.504 128.613 1.00 45.49  ? 509 LEU C CD1   1 
ATOM 5185  C CD2   . LEU B 2 509 ? -180.341 156.397 128.868 1.00 45.49  ? 509 LEU C CD2   1 
ATOM 5186  N N     . ALA B 2 510 ? -181.894 158.734 133.438 1.00 48.33  ? 510 ALA C N     1 
ATOM 5187  C CA    . ALA B 2 510 ? -181.764 158.743 134.890 1.00 48.33  ? 510 ALA C CA    1 
ATOM 5188  C C     . ALA B 2 510 ? -182.881 157.972 135.572 1.00 48.33  ? 510 ALA C C     1 
ATOM 5189  O O     . ALA B 2 510 ? -182.646 157.303 136.584 1.00 48.33  ? 510 ALA C O     1 
ATOM 5190  C CB    . ALA B 2 510 ? -181.733 160.177 135.405 1.00 48.33  ? 510 ALA C CB    1 
ATOM 5191  N N     . ALA B 2 511 ? -184.104 158.053 135.056 1.00 47.56  ? 511 ALA C N     1 
ATOM 5192  C CA    . ALA B 2 511 ? -185.170 157.232 135.619 1.00 47.56  ? 511 ALA C CA    1 
ATOM 5193  C C     . ALA B 2 511 ? -184.953 155.749 135.363 1.00 47.56  ? 511 ALA C C     1 
ATOM 5194  O O     . ALA B 2 511 ? -185.099 154.924 136.275 1.00 47.56  ? 511 ALA C O     1 
ATOM 5195  C CB    . ALA B 2 511 ? -186.515 157.669 135.053 1.00 47.56  ? 511 ALA C CB    1 
ATOM 5196  N N     . TYR B 2 512 ? -184.573 155.398 134.139 1.00 46.77  ? 512 TYR C N     1 
ATOM 5197  C CA    . TYR B 2 512 ? -184.289 154.008 133.813 1.00 46.77  ? 512 TYR C CA    1 
ATOM 5198  C C     . TYR B 2 512 ? -183.162 153.461 134.674 1.00 46.77  ? 512 TYR C C     1 
ATOM 5199  O O     . TYR B 2 512 ? -183.261 152.360 135.217 1.00 46.77  ? 512 TYR C O     1 
ATOM 5200  C CB    . TYR B 2 512 ? -183.928 153.890 132.340 1.00 46.77  ? 512 TYR C CB    1 
ATOM 5201  C CG    . TYR B 2 512 ? -183.601 152.495 131.888 1.00 46.77  ? 512 TYR C CG    1 
ATOM 5202  C CD1   . TYR B 2 512 ? -184.601 151.643 131.484 1.00 46.77  ? 512 TYR C CD1   1 
ATOM 5203  C CD2   . TYR B 2 512 ? -182.316 152.017 131.902 1.00 46.77  ? 512 TYR C CD2   1 
ATOM 5204  C CE1   . TYR B 2 512 ? -184.331 150.376 131.074 1.00 46.77  ? 512 TYR C CE1   1 
ATOM 5205  C CE2   . TYR B 2 512 ? -182.044 150.743 131.502 1.00 46.77  ? 512 TYR C CE2   1 
ATOM 5206  C CZ    . TYR B 2 512 ? -183.055 149.930 131.087 1.00 46.77  ? 512 TYR C CZ    1 
ATOM 5207  O OH    . TYR B 2 512 ? -182.794 148.653 130.677 1.00 46.77  ? 512 TYR C OH    1 
ATOM 5208  N N     . ASP B 2 513 ? -182.073 154.220 134.807 1.00 49.21  ? 513 ASP C N     1 
ATOM 5209  C CA    . ASP B 2 513 ? -180.958 153.772 135.630 1.00 49.21  ? 513 ASP C CA    1 
ATOM 5210  C C     . ASP B 2 513 ? -181.277 153.788 137.114 1.00 49.21  ? 513 ASP C C     1 
ATOM 5211  O O     . ASP B 2 513 ? -180.622 153.078 137.878 1.00 49.21  ? 513 ASP C O     1 
ATOM 5212  C CB    . ASP B 2 513 ? -179.727 154.642 135.372 1.00 49.21  ? 513 ASP C CB    1 
ATOM 5213  C CG    . ASP B 2 513 ? -179.074 154.368 134.022 1.00 49.21  ? 513 ASP C CG    1 
ATOM 5214  O OD1   . ASP B 2 513 ? -179.334 153.301 133.433 1.00 49.21  ? 513 ASP C OD1   1 
ATOM 5215  O OD2   . ASP B 2 513 ? -178.288 155.217 133.555 1.00 49.21  ? 513 ASP C OD2   1 
ATOM 5216  N N     . GLU B 2 514 ? -182.273 154.567 137.498 1.00 51.53  ? 514 GLU C N     1 
ATOM 5217  C CA    . GLU B 2 514 ? -182.768 154.595 138.859 1.00 51.53  ? 514 GLU C CA    1 
ATOM 5218  C C     . GLU B 2 514 ? -183.509 153.302 139.179 1.00 51.53  ? 514 GLU C C     1 
ATOM 5219  O O     . GLU B 2 514 ? -183.451 152.799 140.293 1.00 51.53  ? 514 GLU C O     1 
ATOM 5220  C CB    . GLU B 2 514 ? -183.707 155.777 139.072 1.00 51.53  ? 514 GLU C CB    1 
ATOM 5221  C CG    . GLU B 2 514 ? -183.075 157.130 138.805 1.00 51.53  ? 514 GLU C CG    1 
ATOM 5222  C CD    . GLU B 2 514 ? -182.536 157.774 140.062 1.00 51.53  ? 514 GLU C CD    1 
ATOM 5223  O OE1   . GLU B 2 514 ? -182.204 157.035 141.005 1.00 51.53  ? 514 GLU C OE1   1 
ATOM 5224  O OE2   . GLU B 2 514 ? -182.441 159.018 140.106 1.00 51.53  ? 514 GLU C OE2   1 
ATOM 5225  N N     . VAL B 2 515 ? -184.235 152.790 138.187 1.00 49.29  ? 515 VAL C N     1 
ATOM 5226  C CA    . VAL B 2 515 ? -185.084 151.612 138.352 1.00 49.29  ? 515 VAL C CA    1 
ATOM 5227  C C     . VAL B 2 515 ? -184.278 150.332 138.236 1.00 49.29  ? 515 VAL C C     1 
ATOM 5228  O O     . VAL B 2 515 ? -184.294 149.485 139.132 1.00 49.29  ? 515 VAL C O     1 
ATOM 5229  C CB    . VAL B 2 515 ? -186.228 151.627 137.333 1.00 49.29  ? 515 VAL C CB    1 
ATOM 5230  C CG1   . VAL B 2 515 ? -186.962 150.325 137.396 1.00 49.29  ? 515 VAL C CG1   1 
ATOM 5231  C CG2   . VAL B 2 515 ? -187.164 152.762 137.637 1.00 49.29  ? 515 VAL C CG2   1 
ATOM 5232  N N     . THR B 2 516 ? -183.546 150.174 137.151 1.00 50.36  ? 516 THR C N     1 
ATOM 5233  C CA    . THR B 2 516 ? -182.787 148.958 136.920 1.00 50.36  ? 516 THR C CA    1 
ATOM 5234  C C     . THR B 2 516 ? -181.502 148.932 137.719 1.00 50.36  ? 516 THR C C     1 
ATOM 5235  O O     . THR B 2 516 ? -180.729 147.977 137.606 1.00 50.36  ? 516 THR C O     1 
ATOM 5236  C CB    . THR B 2 516 ? -182.462 148.806 135.449 1.00 50.36  ? 516 THR C CB    1 
ATOM 5237  O OG1   . THR B 2 516 ? -182.028 147.466 135.209 1.00 50.36  ? 516 THR C OG1   1 
ATOM 5238  C CG2   . THR B 2 516 ? -181.377 149.768 135.065 1.00 50.36  ? 516 THR C CG2   1 
ATOM 5239  N N     . GLY B 2 517 ? -181.265 149.958 138.515 1.00 54.50  ? 517 GLY C N     1 
ATOM 5240  C CA    . GLY B 2 517 ? -180.046 150.130 139.253 1.00 54.50  ? 517 GLY C CA    1 
ATOM 5241  C C     . GLY B 2 517 ? -179.608 148.941 140.084 1.00 54.50  ? 517 GLY C C     1 
ATOM 5242  O O     . GLY B 2 517 ? -178.532 148.393 139.851 1.00 54.50  ? 517 GLY C O     1 
ATOM 5243  N N     . PRO B 2 518 ? -180.411 148.510 141.063 1.00 54.71  ? 518 PRO C N     1 
ATOM 5244  C CA    . PRO B 2 518 ? -179.968 147.388 141.915 1.00 54.71  ? 518 PRO C CA    1 
ATOM 5245  C C     . PRO B 2 518 ? -179.755 146.052 141.203 1.00 54.71  ? 518 PRO C C     1 
ATOM 5246  O O     . PRO B 2 518 ? -179.055 145.194 141.756 1.00 54.71  ? 518 PRO C O     1 
ATOM 5247  C CB    . PRO B 2 518 ? -181.093 147.283 142.950 1.00 54.71  ? 518 PRO C CB    1 
ATOM 5248  C CG    . PRO B 2 518 ? -181.761 148.615 142.923 1.00 54.71  ? 518 PRO C CG    1 
ATOM 5249  C CD    . PRO B 2 518 ? -181.660 149.114 141.537 1.00 54.71  ? 518 PRO C CD    1 
ATOM 5250  N N     . TYR B 2 519 ? -180.320 145.840 140.020 1.00 55.65  ? 519 TYR C N     1 
ATOM 5251  C CA    . TYR B 2 519 ? -180.237 144.591 139.260 1.00 55.65  ? 519 TYR C CA    1 
ATOM 5252  C C     . TYR B 2 519 ? -179.240 144.614 138.121 1.00 55.65  ? 519 TYR C C     1 
ATOM 5253  O O     . TYR B 2 519 ? -179.087 143.604 137.436 1.00 55.65  ? 519 TYR C O     1 
ATOM 5254  C CB    . TYR B 2 519 ? -181.612 144.113 138.804 1.00 55.65  ? 519 TYR C CB    1 
ATOM 5255  C CG    . TYR B 2 519 ? -182.562 144.007 139.945 1.00 55.65  ? 519 TYR C CG    1 
ATOM 5256  C CD1   . TYR B 2 519 ? -182.187 143.237 141.030 1.00 55.65  ? 519 TYR C CD1   1 
ATOM 5257  C CD2   . TYR B 2 519 ? -183.769 144.673 139.999 1.00 55.65  ? 519 TYR C CD2   1 
ATOM 5258  C CE1   . TYR B 2 519 ? -183.010 143.065 142.092 1.00 55.65  ? 519 TYR C CE1   1 
ATOM 5259  C CE2   . TYR B 2 519 ? -184.606 144.532 141.100 1.00 55.65  ? 519 TYR C CE2   1 
ATOM 5260  C CZ    . TYR B 2 519 ? -184.213 143.733 142.139 1.00 55.65  ? 519 TYR C CZ    1 
ATOM 5261  O OH    . TYR B 2 519 ? -185.062 143.589 143.204 1.00 55.65  ? 519 TYR C OH    1 
ATOM 5262  N N     . CYS B 2 520 ? -178.528 145.697 137.915 1.00 59.54  ? 520 CYS C N     1 
ATOM 5263  C CA    . CYS B 2 520 ? -177.466 145.590 136.938 1.00 59.54  ? 520 CYS C CA    1 
ATOM 5264  C C     . CYS B 2 520 ? -176.198 144.964 137.518 1.00 59.54  ? 520 CYS C C     1 
ATOM 5265  O O     . CYS B 2 520 ? -175.110 145.209 136.994 1.00 59.54  ? 520 CYS C O     1 
ATOM 5266  C CB    . CYS B 2 520 ? -177.170 146.973 136.352 1.00 59.54  ? 520 CYS C CB    1 
ATOM 5267  S SG    . CYS B 2 520 ? -176.410 146.957 134.724 1.00 59.54  ? 520 CYS C SG    1 
ATOM 5268  N N     . GLU B 2 521 ? -176.305 144.211 138.620 1.00 60.82  ? 521 GLU C N     1 
ATOM 5269  C CA    . GLU B 2 521 ? -175.130 143.651 139.289 1.00 60.82  ? 521 GLU C CA    1 
ATOM 5270  C C     . GLU B 2 521 ? -174.581 142.436 138.551 1.00 60.82  ? 521 GLU C C     1 
ATOM 5271  O O     . GLU B 2 521 ? -173.397 142.403 138.203 1.00 60.82  ? 521 GLU C O     1 
ATOM 5272  C CB    . GLU B 2 521 ? -175.392 143.352 140.762 1.00 60.82  ? 521 GLU C CB    1 
ATOM 5273  C CG    . GLU B 2 521 ? -175.411 144.627 141.581 1.00 60.82  ? 521 GLU C CG    1 
ATOM 5274  C CD    . GLU B 2 521 ? -174.166 145.512 141.350 1.00 60.82  ? 521 GLU C CD    1 
ATOM 5275  O OE1   . GLU B 2 521 ? -173.047 144.980 141.179 1.00 60.82  ? 521 GLU C OE1   1 
ATOM 5276  O OE2   . GLU B 2 521 ? -174.312 146.757 141.287 1.00 60.82  ? 521 GLU C OE2   1 
ATOM 5277  N N     . ARG B 2 522 ? -175.401 141.410 138.354 1.00 52.80  ? 522 ARG C N     1 
ATOM 5278  C CA    . ARG B 2 522 ? -174.922 140.205 137.683 1.00 52.80  ? 522 ARG C CA    1 
ATOM 5279  C C     . ARG B 2 522 ? -174.556 140.524 136.249 1.00 52.80  ? 522 ARG C C     1 
ATOM 5280  O O     . ARG B 2 522 ? -175.205 141.348 135.630 1.00 52.80  ? 522 ARG C O     1 
ATOM 5281  C CB    . ARG B 2 522 ? -175.947 139.083 137.775 1.00 52.80  ? 522 ARG C CB    1 
ATOM 5282  C CG    . ARG B 2 522 ? -175.497 137.969 138.703 1.00 52.80  ? 522 ARG C CG    1 
ATOM 5283  C CD    . ARG B 2 522 ? -176.603 136.972 138.966 1.00 52.80  ? 522 ARG C CD    1 
ATOM 5284  N NE    . ARG B 2 522 ? -177.904 137.621 139.027 1.00 52.80  ? 522 ARG C NE    1 
ATOM 5285  C CZ    . ARG B 2 522 ? -179.055 136.967 139.027 1.00 52.80  ? 522 ARG C CZ    1 
ATOM 5286  N NH1   . ARG B 2 522 ? -179.063 135.646 138.974 1.00 52.80  ? 522 ARG C NH1   1 
ATOM 5287  N NH2   . ARG B 2 522 ? -180.197 137.636 139.078 1.00 52.80  ? 522 ARG C NH2   1 
ATOM 5288  N N     . PRO B 2 523 ? -173.513 139.904 135.710 1.00 51.47  ? 523 PRO C N     1 
ATOM 5289  C CA    . PRO B 2 523 ? -173.129 140.251 134.338 1.00 51.47  ? 523 PRO C CA    1 
ATOM 5290  C C     . PRO B 2 523 ? -174.097 139.876 133.228 1.00 51.47  ? 523 PRO C C     1 
ATOM 5291  O O     . PRO B 2 523 ? -174.167 140.619 132.242 1.00 51.47  ? 523 PRO C O     1 
ATOM 5292  C CB    . PRO B 2 523 ? -171.799 139.511 134.171 1.00 51.47  ? 523 PRO C CB    1 
ATOM 5293  C CG    . PRO B 2 523 ? -171.858 138.424 135.150 1.00 51.47  ? 523 PRO C CG    1 
ATOM 5294  C CD    . PRO B 2 523 ? -172.580 138.954 136.319 1.00 51.47  ? 523 PRO C CD    1 
ATOM 5295  N N     . ARG B 2 524 ? -174.832 138.770 133.388 1.00 55.64  ? 524 ARG C N     1 
ATOM 5296  C CA    . ARG B 2 524 ? -175.842 138.298 132.420 1.00 55.64  ? 524 ARG C CA    1 
ATOM 5297  C C     . ARG B 2 524 ? -177.045 139.243 132.267 1.00 55.64  ? 524 ARG C C     1 
ATOM 5298  O O     . ARG B 2 524 ? -177.477 139.541 131.162 1.00 55.64  ? 524 ARG C O     1 
ATOM 5299  C CB    . ARG B 2 524 ? -176.316 136.899 132.830 1.00 55.64  ? 524 ARG C CB    1 
ATOM 5300  C CG    . ARG B 2 524 ? -177.642 136.453 132.236 1.00 55.64  ? 524 ARG C CG    1 
ATOM 5301  C CD    . ARG B 2 524 ? -178.323 135.431 133.133 1.00 55.64  ? 524 ARG C CD    1 
ATOM 5302  N NE    . ARG B 2 524 ? -178.930 136.057 134.305 1.00 55.64  ? 524 ARG C NE    1 
ATOM 5303  C CZ    . ARG B 2 524 ? -180.203 135.915 134.658 1.00 55.64  ? 524 ARG C CZ    1 
ATOM 5304  N NH1   . ARG B 2 524 ? -181.016 135.167 133.933 1.00 55.64  ? 524 ARG C NH1   1 
ATOM 5305  N NH2   . ARG B 2 524 ? -180.663 136.526 135.734 1.00 55.64  ? 524 ARG C NH2   1 
ATOM 5306  N N     . VAL B 2 525 ? -177.558 139.706 133.397 1.00 51.41  ? 525 VAL C N     1 
ATOM 5307  C CA    . VAL B 2 525 ? -178.639 140.675 133.528 1.00 51.41  ? 525 VAL C CA    1 
ATOM 5308  C C     . VAL B 2 525 ? -178.132 142.062 133.213 1.00 51.41  ? 525 VAL C C     1 
ATOM 5309  O O     . VAL B 2 525 ? -178.843 142.880 132.620 1.00 51.41  ? 525 VAL C O     1 
ATOM 5310  C CB    . VAL B 2 525 ? -179.206 140.630 134.952 1.00 51.41  ? 525 VAL C CB    1 
ATOM 5311  C CG1   . VAL B 2 525 ? -180.425 141.488 135.059 1.00 51.41  ? 525 VAL C CG1   1 
ATOM 5312  C CG2   . VAL B 2 525 ? -179.518 139.226 135.335 1.00 51.41  ? 525 VAL C CG2   1 
ATOM 5313  N N     . ALA B 2 526 ? -176.890 142.348 133.582 1.00 49.14  ? 526 ALA C N     1 
ATOM 5314  C CA    . ALA B 2 526 ? -176.326 143.642 133.249 1.00 49.14  ? 526 ALA C CA    1 
ATOM 5315  C C     . ALA B 2 526 ? -176.204 143.783 131.744 1.00 49.14  ? 526 ALA C C     1 
ATOM 5316  O O     . ALA B 2 526 ? -176.452 144.856 131.193 1.00 49.14  ? 526 ALA C O     1 
ATOM 5317  C CB    . ALA B 2 526 ? -174.977 143.828 133.932 1.00 49.14  ? 526 ALA C CB    1 
ATOM 5318  N N     . LYS B 2 527 ? -175.843 142.701 131.054 1.00 48.13  ? 527 LYS C N     1 
ATOM 5319  C CA    . LYS B 2 527 ? -175.752 142.761 129.600 1.00 48.13  ? 527 LYS C CA    1 
ATOM 5320  C C     . LYS B 2 527 ? -177.103 143.055 128.961 1.00 48.13  ? 527 LYS C C     1 
ATOM 5321  O O     . LYS B 2 527 ? -177.200 143.873 128.037 1.00 48.13  ? 527 LYS C O     1 
ATOM 5322  C CB    . LYS B 2 527 ? -175.197 141.444 129.065 1.00 48.13  ? 527 LYS C CB    1 
ATOM 5323  C CG    . LYS B 2 527 ? -175.156 141.358 127.566 1.00 48.13  ? 527 LYS C CG    1 
ATOM 5324  C CD    . LYS B 2 527 ? -174.570 140.034 127.131 1.00 48.13  ? 527 LYS C CD    1 
ATOM 5325  C CE    . LYS B 2 527 ? -173.068 139.996 127.353 1.00 48.13  ? 527 LYS C CE    1 
ATOM 5326  N NZ    . LYS B 2 527 ? -172.432 138.746 126.843 1.00 48.13  ? 527 LYS C NZ    1 
ATOM 5327  N N     . VAL B 2 528 ? -178.166 142.428 129.458 1.00 47.82  ? 528 VAL C N     1 
ATOM 5328  C CA    . VAL B 2 528 ? -179.499 142.711 128.926 1.00 47.82  ? 528 VAL C CA    1 
ATOM 5329  C C     . VAL B 2 528 ? -179.888 144.159 129.188 1.00 47.82  ? 528 VAL C C     1 
ATOM 5330  O O     . VAL B 2 528 ? -180.266 144.905 128.269 1.00 47.82  ? 528 VAL C O     1 
ATOM 5331  C CB    . VAL B 2 528 ? -180.523 141.738 129.522 1.00 47.82  ? 528 VAL C CB    1 
ATOM 5332  C CG1   . VAL B 2 528 ? -181.895 142.157 129.122 1.00 47.82  ? 528 VAL C CG1   1 
ATOM 5333  C CG2   . VAL B 2 528 ? -180.230 140.339 129.056 1.00 47.82  ? 528 VAL C CG2   1 
ATOM 5334  N N     . VAL B 2 529 ? -179.712 144.601 130.432 1.00 45.88  ? 529 VAL C N     1 
ATOM 5335  C CA    . VAL B 2 529 ? -180.118 145.943 130.829 1.00 45.88  ? 529 VAL C CA    1 
ATOM 5336  C C     . VAL B 2 529 ? -179.357 146.977 130.021 1.00 45.88  ? 529 VAL C C     1 
ATOM 5337  O O     . VAL B 2 529 ? -179.894 148.027 129.663 1.00 45.88  ? 529 VAL C O     1 
ATOM 5338  C CB    . VAL B 2 529 ? -179.925 146.135 132.338 1.00 45.88  ? 529 VAL C CB    1 
ATOM 5339  C CG1   . VAL B 2 529 ? -179.990 147.592 132.682 1.00 45.88  ? 529 VAL C CG1   1 
ATOM 5340  C CG2   . VAL B 2 529 ? -180.986 145.372 133.079 1.00 45.88  ? 529 VAL C CG2   1 
ATOM 5341  N N     . GLU B 2 530 ? -178.109 146.687 129.695 1.00 49.46  ? 530 GLU C N     1 
ATOM 5342  C CA    . GLU B 2 530 ? -177.327 147.637 128.923 1.00 49.46  ? 530 GLU C CA    1 
ATOM 5343  C C     . GLU B 2 530 ? -177.797 147.648 127.479 1.00 49.46  ? 530 GLU C C     1 
ATOM 5344  O O     . GLU B 2 530 ? -177.884 148.718 126.859 1.00 49.46  ? 530 GLU C O     1 
ATOM 5345  C CB    . GLU B 2 530 ? -175.849 147.288 129.010 1.00 49.46  ? 530 GLU C CB    1 
ATOM 5346  C CG    . GLU B 2 530 ? -175.270 147.529 130.383 1.00 49.46  ? 530 GLU C CG    1 
ATOM 5347  C CD    . GLU B 2 530 ? -175.381 148.951 130.816 1.00 49.46  ? 530 GLU C CD    1 
ATOM 5348  O OE1   . GLU B 2 530 ? -175.433 149.825 129.933 1.00 49.46  ? 530 GLU C OE1   1 
ATOM 5349  O OE2   . GLU B 2 530 ? -175.462 149.195 132.034 1.00 49.46  ? 530 GLU C OE2   1 
ATOM 5350  N N     . ARG B 2 531 ? -178.150 146.492 126.951 1.00 49.24  ? 531 ARG C N     1 
ATOM 5351  C CA    . ARG B 2 531 ? -178.606 146.467 125.585 1.00 49.24  ? 531 ARG C CA    1 
ATOM 5352  C C     . ARG B 2 531 ? -179.826 147.348 125.477 1.00 49.24  ? 531 ARG C C     1 
ATOM 5353  O O     . ARG B 2 531 ? -180.013 147.996 124.456 1.00 49.24  ? 531 ARG C O     1 
ATOM 5354  C CB    . ARG B 2 531 ? -178.964 145.060 125.135 1.00 49.24  ? 531 ARG C CB    1 
ATOM 5355  C CG    . ARG B 2 531 ? -179.705 145.032 123.810 1.00 49.24  ? 531 ARG C CG    1 
ATOM 5356  C CD    . ARG B 2 531 ? -179.657 143.653 123.182 1.00 49.24  ? 531 ARG C CD    1 
ATOM 5357  N NE    . ARG B 2 531 ? -179.680 142.603 124.193 1.00 49.24  ? 531 ARG C NE    1 
ATOM 5358  C CZ    . ARG B 2 531 ? -178.766 141.644 124.292 1.00 49.24  ? 531 ARG C CZ    1 
ATOM 5359  N NH1   . ARG B 2 531 ? -177.761 141.600 123.433 1.00 49.24  ? 531 ARG C NH1   1 
ATOM 5360  N NH2   . ARG B 2 531 ? -178.860 140.730 125.244 1.00 49.24  ? 531 ARG C NH2   1 
ATOM 5361  N N     . HIS B 2 532 ? -180.678 147.369 126.502 1.00 50.39  ? 532 HIS C N     1 
ATOM 5362  C CA    . HIS B 2 532 ? -181.870 148.183 126.355 1.00 50.39  ? 532 HIS C CA    1 
ATOM 5363  C C     . HIS B 2 532 ? -181.750 149.600 126.863 1.00 50.39  ? 532 HIS C C     1 
ATOM 5364  O O     . HIS B 2 532 ? -182.568 150.429 126.474 1.00 50.39  ? 532 HIS C O     1 
ATOM 5365  C CB    . HIS B 2 532 ? -183.054 147.485 127.010 1.00 50.39  ? 532 HIS C CB    1 
ATOM 5366  C CG    . HIS B 2 532 ? -183.427 146.228 126.304 1.00 50.39  ? 532 HIS C CG    1 
ATOM 5367  N ND1   . HIS B 2 532 ? -183.954 146.223 125.031 1.00 50.39  ? 532 HIS C ND1   1 
ATOM 5368  C CD2   . HIS B 2 532 ? -183.281 144.931 126.657 1.00 50.39  ? 532 HIS C CD2   1 
ATOM 5369  C CE1   . HIS B 2 532 ? -184.145 144.977 124.644 1.00 50.39  ? 532 HIS C CE1   1 
ATOM 5370  N NE2   . HIS B 2 532 ? -183.745 144.173 125.613 1.00 50.39  ? 532 HIS C NE2   1 
ATOM 5371  N N     . ARG B 2 533 ? -180.775 149.933 127.698 1.00 51.51  ? 533 ARG C N     1 
ATOM 5372  C CA    . ARG B 2 533 ? -180.641 151.351 127.973 1.00 51.51  ? 533 ARG C CA    1 
ATOM 5373  C C     . ARG B 2 533 ? -180.008 152.047 126.795 1.00 51.51  ? 533 ARG C C     1 
ATOM 5374  O O     . ARG B 2 533 ? -180.280 153.225 126.557 1.00 51.51  ? 533 ARG C O     1 
ATOM 5375  C CB    . ARG B 2 533 ? -179.839 151.655 129.224 1.00 51.51  ? 533 ARG C CB    1 
ATOM 5376  C CG    . ARG B 2 533 ? -178.408 151.335 129.147 1.00 51.51  ? 533 ARG C CG    1 
ATOM 5377  C CD    . ARG B 2 533 ? -177.780 151.671 130.461 1.00 51.51  ? 533 ARG C CD    1 
ATOM 5378  N NE    . ARG B 2 533 ? -177.820 153.110 130.657 1.00 51.51  ? 533 ARG C NE    1 
ATOM 5379  C CZ    . ARG B 2 533 ? -176.890 153.931 130.191 1.00 51.51  ? 533 ARG C CZ    1 
ATOM 5380  N NH1   . ARG B 2 533 ? -175.863 153.446 129.512 1.00 51.51  ? 533 ARG C NH1   1 
ATOM 5381  N NH2   . ARG B 2 533 ? -176.980 155.231 130.401 1.00 51.51  ? 533 ARG C NH2   1 
ATOM 5382  N N     . SER B 2 534 ? -179.172 151.329 126.043 1.00 52.98  ? 534 SER C N     1 
ATOM 5383  C CA    . SER B 2 534 ? -178.528 151.934 124.888 1.00 52.98  ? 534 SER C CA    1 
ATOM 5384  C C     . SER B 2 534 ? -179.529 152.473 123.879 1.00 52.98  ? 534 SER C C     1 
ATOM 5385  O O     . SER B 2 534 ? -179.179 153.358 123.096 1.00 52.98  ? 534 SER C O     1 
ATOM 5386  C CB    . SER B 2 534 ? -177.602 150.911 124.227 1.00 52.98  ? 534 SER C CB    1 
ATOM 5387  O OG    . SER B 2 534 ? -178.351 149.860 123.644 1.00 52.98  ? 534 SER C OG    1 
ATOM 5388  N N     . THR B 2 535 ? -180.759 151.966 123.871 1.00 50.26  ? 535 THR C N     1 
ATOM 5389  C CA    . THR B 2 535 ? -181.708 152.426 122.867 1.00 50.26  ? 535 THR C CA    1 
ATOM 5390  C C     . THR B 2 535 ? -182.190 153.833 123.183 1.00 50.26  ? 535 THR C C     1 
ATOM 5391  O O     . THR B 2 535 ? -182.570 154.567 122.270 1.00 50.26  ? 535 THR C O     1 
ATOM 5392  C CB    . THR B 2 535 ? -182.866 151.446 122.718 1.00 50.26  ? 535 THR C CB    1 
ATOM 5393  O OG1   . THR B 2 535 ? -183.584 151.755 121.523 1.00 50.26  ? 535 THR C OG1   1 
ATOM 5394  C CG2   . THR B 2 535 ? -183.813 151.549 123.857 1.00 50.26  ? 535 THR C CG2   1 
ATOM 5395  N N     . LEU B 2 536 ? -182.199 154.217 124.459 1.00 50.04  ? 536 LEU C N     1 
ATOM 5396  C CA    . LEU B 2 536 ? -182.606 155.546 124.911 1.00 50.04  ? 536 LEU C CA    1 
ATOM 5397  C C     . LEU B 2 536 ? -181.566 156.610 124.629 1.00 50.04  ? 536 LEU C C     1 
ATOM 5398  O O     . LEU B 2 536 ? -181.821 157.783 124.914 1.00 50.04  ? 536 LEU C O     1 
ATOM 5399  C CB    . LEU B 2 536 ? -182.892 155.589 126.405 1.00 50.04  ? 536 LEU C CB    1 
ATOM 5400  C CG    . LEU B 2 536 ? -184.209 155.154 127.000 1.00 50.04  ? 536 LEU C CG    1 
ATOM 5401  C CD1   . LEU B 2 536 ? -184.417 153.712 126.785 1.00 50.04  ? 536 LEU C CD1   1 
ATOM 5402  C CD2   . LEU B 2 536 ? -184.114 155.464 128.463 1.00 50.04  ? 536 LEU C CD2   1 
ATOM 5403  N N     . PHE B 2 537 ? -180.412 156.236 124.078 1.00 56.40  ? 537 PHE C N     1 
ATOM 5404  C CA    . PHE B 2 537 ? -179.368 157.203 123.775 1.00 56.40  ? 537 PHE C CA    1 
ATOM 5405  C C     . PHE B 2 537 ? -179.727 158.112 122.621 1.00 56.40  ? 537 PHE C C     1 
ATOM 5406  O O     . PHE B 2 537 ? -179.202 159.224 122.556 1.00 56.40  ? 537 PHE C O     1 
ATOM 5407  C CB    . PHE B 2 537 ? -178.092 156.454 123.386 1.00 56.40  ? 537 PHE C CB    1 
ATOM 5408  C CG    . PHE B 2 537 ? -177.273 155.943 124.537 1.00 56.40  ? 537 PHE C CG    1 
ATOM 5409  C CD1   . PHE B 2 537 ? -177.313 156.544 125.774 1.00 56.40  ? 537 PHE C CD1   1 
ATOM 5410  C CD2   . PHE B 2 537 ? -176.520 154.790 124.382 1.00 56.40  ? 537 PHE C CD2   1 
ATOM 5411  C CE1   . PHE B 2 537 ? -176.549 156.049 126.810 1.00 56.40  ? 537 PHE C CE1   1 
ATOM 5412  C CE2   . PHE B 2 537 ? -175.781 154.279 125.418 1.00 56.40  ? 537 PHE C CE2   1 
ATOM 5413  C CZ    . PHE B 2 537 ? -175.790 154.910 126.631 1.00 56.40  ? 537 PHE C CZ    1 
ATOM 5414  N N     . SER B 2 538 ? -180.613 157.686 121.732 1.00 59.27  ? 538 SER C N     1 
ATOM 5415  C CA    . SER B 2 538 ? -180.981 158.501 120.582 1.00 59.27  ? 538 SER C CA    1 
ATOM 5416  C C     . SER B 2 538 ? -179.756 158.925 119.776 1.00 59.27  ? 538 SER C C     1 
ATOM 5417  O O     . SER B 2 538 ? -179.094 158.102 119.143 1.00 59.27  ? 538 SER C O     1 
ATOM 5418  C CB    . SER B 2 538 ? -181.768 159.732 121.021 1.00 59.27  ? 538 SER C CB    1 
ATOM 5419  O OG    . SER B 2 538 ? -182.102 160.525 119.898 1.00 59.27  ? 538 SER C OG    1 
ATOM 5420  N N     . THR C 3 2   ? -201.238 167.558 176.431 1.00 72.59  ? 2   THR D N     1 
ATOM 5421  C CA    . THR C 3 2   ? -200.113 166.766 176.905 1.00 72.59  ? 2   THR D CA    1 
ATOM 5422  C C     . THR C 3 2   ? -199.771 165.704 175.881 1.00 72.59  ? 2   THR D C     1 
ATOM 5423  O O     . THR C 3 2   ? -200.584 164.837 175.590 1.00 72.59  ? 2   THR D O     1 
ATOM 5424  C CB    . THR C 3 2   ? -200.426 166.103 178.238 1.00 72.59  ? 2   THR D CB    1 
ATOM 5425  O OG1   . THR C 3 2   ? -200.924 167.095 179.139 1.00 72.59  ? 2   THR D OG1   1 
ATOM 5426  C CG2   . THR C 3 2   ? -199.181 165.497 178.831 1.00 72.59  ? 2   THR D CG2   1 
ATOM 5427  N N     . PHE C 3 3   ? -198.558 165.768 175.350 1.00 66.08  ? 3   PHE D N     1 
ATOM 5428  C CA    . PHE C 3 3   ? -198.082 164.895 174.287 1.00 66.08  ? 3   PHE D CA    1 
ATOM 5429  C C     . PHE C 3 3   ? -196.813 164.225 174.758 1.00 66.08  ? 3   PHE D C     1 
ATOM 5430  O O     . PHE C 3 3   ? -195.818 164.901 175.020 1.00 66.08  ? 3   PHE D O     1 
ATOM 5431  C CB    . PHE C 3 3   ? -197.828 165.679 173.010 1.00 66.08  ? 3   PHE D CB    1 
ATOM 5432  C CG    . PHE C 3 3   ? -199.053 166.235 172.429 1.00 66.08  ? 3   PHE D CG    1 
ATOM 5433  C CD1   . PHE C 3 3   ? -200.248 165.616 172.630 1.00 66.08  ? 3   PHE D CD1   1 
ATOM 5434  C CD2   . PHE C 3 3   ? -199.033 167.404 171.746 1.00 66.08  ? 3   PHE D CD2   1 
ATOM 5435  C CE1   . PHE C 3 3   ? -201.372 166.134 172.107 1.00 66.08  ? 3   PHE D CE1   1 
ATOM 5436  C CE2   . PHE C 3 3   ? -200.166 167.915 171.219 1.00 66.08  ? 3   PHE D CE2   1 
ATOM 5437  C CZ    . PHE C 3 3   ? -201.339 167.281 171.408 1.00 66.08  ? 3   PHE D CZ    1 
ATOM 5438  N N     . VAL C 3 4   ? -196.847 162.910 174.868 1.00 61.36  ? 4   VAL D N     1 
ATOM 5439  C CA    . VAL C 3 4   ? -195.667 162.131 175.223 1.00 61.36  ? 4   VAL D CA    1 
ATOM 5440  C C     . VAL C 3 4   ? -195.036 161.625 173.938 1.00 61.36  ? 4   VAL D C     1 
ATOM 5441  O O     . VAL C 3 4   ? -195.620 160.772 173.269 1.00 61.36  ? 4   VAL D O     1 
ATOM 5442  C CB    . VAL C 3 4   ? -196.027 160.953 176.127 1.00 61.36  ? 4   VAL D CB    1 
ATOM 5443  C CG1   . VAL C 3 4   ? -194.821 160.462 176.853 1.00 61.36  ? 4   VAL D CG1   1 
ATOM 5444  C CG2   . VAL C 3 4   ? -197.087 161.326 177.088 1.00 61.36  ? 4   VAL D CG2   1 
ATOM 5445  N N     . ASP C 3 5   ? -193.838 162.080 173.586 1.00 57.53  ? 5   ASP D N     1 
ATOM 5446  C CA    . ASP C 3 5   ? -193.226 161.544 172.382 1.00 57.53  ? 5   ASP D CA    1 
ATOM 5447  C C     . ASP C 3 5   ? -191.918 160.862 172.719 1.00 57.53  ? 5   ASP D C     1 
ATOM 5448  O O     . ASP C 3 5   ? -191.262 161.193 173.721 1.00 57.53  ? 5   ASP D O     1 
ATOM 5449  C CB    . ASP C 3 5   ? -192.980 162.625 171.351 1.00 57.53  ? 5   ASP D CB    1 
ATOM 5450  C CG    . ASP C 3 5   ? -192.183 163.758 171.893 1.00 57.53  ? 5   ASP D CG    1 
ATOM 5451  O OD1   . ASP C 3 5   ? -191.924 163.747 173.104 1.00 57.53  ? 5   ASP D OD1   1 
ATOM 5452  O OD2   . ASP C 3 5   ? -191.801 164.655 171.116 1.00 57.53  ? 5   ASP D OD2   1 
ATOM 5453  N N     . ILE C 3 6   ? -191.539 159.893 171.866 1.00 52.45  ? 6   ILE D N     1 
ATOM 5454  C CA    . ILE C 3 6   ? -190.380 159.097 172.227 1.00 52.45  ? 6   ILE D CA    1 
ATOM 5455  C C     . ILE C 3 6   ? -189.503 158.886 170.991 1.00 52.45  ? 6   ILE D C     1 
ATOM 5456  O O     . ILE C 3 6   ? -190.006 158.564 169.907 1.00 52.45  ? 6   ILE D O     1 
ATOM 5457  C CB    . ILE C 3 6   ? -190.804 157.764 172.860 1.00 52.45  ? 6   ILE D CB    1 
ATOM 5458  C CG1   . ILE C 3 6   ? -189.669 156.764 172.836 1.00 52.45  ? 6   ILE D CG1   1 
ATOM 5459  C CG2   . ILE C 3 6   ? -191.826 157.108 171.940 1.00 52.45  ? 6   ILE D CG2   1 
ATOM 5460  C CD1   . ILE C 3 6   ? -189.996 155.537 173.666 1.00 52.45  ? 6   ILE D CD1   1 
ATOM 5461  N N     . HIS C 3 7   ? -188.215 159.161 171.133 1.00 52.89  ? 7   HIS D N     1 
ATOM 5462  C CA    . HIS C 3 7   ? -187.237 158.990 170.070 1.00 52.89  ? 7   HIS D CA    1 
ATOM 5463  C C     . HIS C 3 7   ? -186.294 157.855 170.448 1.00 52.89  ? 7   HIS D C     1 
ATOM 5464  O O     . HIS C 3 7   ? -185.855 157.764 171.593 1.00 52.89  ? 7   HIS D O     1 
ATOM 5465  C CB    . HIS C 3 7   ? -186.395 160.241 169.794 1.00 52.89  ? 7   HIS D CB    1 
ATOM 5466  C CG    . HIS C 3 7   ? -187.170 161.518 169.697 1.00 52.89  ? 7   HIS D CG    1 
ATOM 5467  N ND1   . HIS C 3 7   ? -187.984 161.985 170.703 1.00 52.89  ? 7   HIS D ND1   1 
ATOM 5468  C CD2   . HIS C 3 7   ? -187.325 162.379 168.667 1.00 52.89  ? 7   HIS D CD2   1 
ATOM 5469  C CE1   . HIS C 3 7   ? -188.532 163.125 170.327 1.00 52.89  ? 7   HIS D CE1   1 
ATOM 5470  N NE2   . HIS C 3 7   ? -188.153 163.382 169.091 1.00 52.89  ? 7   HIS D NE2   1 
ATOM 5471  N N     . ALA C 3 8   ? -185.983 156.990 169.495 1.00 46.93  ? 8   ALA D N     1 
ATOM 5472  C CA    . ALA C 3 8   ? -185.052 155.900 169.730 1.00 46.93  ? 8   ALA D CA    1 
ATOM 5473  C C     . ALA C 3 8   ? -184.049 155.902 168.598 1.00 46.93  ? 8   ALA D C     1 
ATOM 5474  O O     . ALA C 3 8   ? -184.401 156.161 167.463 1.00 46.93  ? 8   ALA D O     1 
ATOM 5475  C CB    . ALA C 3 8   ? -185.754 154.555 169.810 1.00 46.93  ? 8   ALA D CB    1 
ATOM 5476  N N     . ILE C 3 9   ? -182.792 155.665 168.908 1.00 47.06  ? 9   ILE D N     1 
ATOM 5477  C CA    . ILE C 3 9   ? -181.792 155.454 167.869 1.00 47.06  ? 9   ILE D CA    1 
ATOM 5478  C C     . ILE C 3 9   ? -181.423 153.987 167.882 1.00 47.06  ? 9   ILE D C     1 
ATOM 5479  O O     . ILE C 3 9   ? -180.430 153.592 168.489 1.00 47.06  ? 9   ILE D O     1 
ATOM 5480  C CB    . ILE C 3 9   ? -180.558 156.343 168.078 1.00 47.06  ? 9   ILE D CB    1 
ATOM 5481  C CG1   . ILE C 3 9   ? -180.975 157.796 168.050 1.00 47.06  ? 9   ILE D CG1   1 
ATOM 5482  C CG2   . ILE C 3 9   ? -179.572 156.118 166.995 1.00 47.06  ? 9   ILE D CG2   1 
ATOM 5483  C CD1   . ILE C 3 9   ? -179.828 158.740 167.860 1.00 47.06  ? 9   ILE D CD1   1 
ATOM 5484  N N     . GLN C 3 10  ? -182.232 153.165 167.238 1.00 48.08  ? 10  GLN D N     1 
ATOM 5485  C CA    . GLN C 3 10  ? -182.006 151.727 167.225 1.00 48.08  ? 10  GLN D CA    1 
ATOM 5486  C C     . GLN C 3 10  ? -181.311 151.283 165.956 1.00 48.08  ? 10  GLN D C     1 
ATOM 5487  O O     . GLN C 3 10  ? -181.775 151.595 164.862 1.00 48.08  ? 10  GLN D O     1 
ATOM 5488  C CB    . GLN C 3 10  ? -183.325 150.990 167.399 1.00 48.08  ? 10  GLN D CB    1 
ATOM 5489  C CG    . GLN C 3 10  ? -183.237 149.516 167.339 1.00 48.08  ? 10  GLN D CG    1 
ATOM 5490  C CD    . GLN C 3 10  ? -184.579 148.884 167.548 1.00 48.08  ? 10  GLN D CD    1 
ATOM 5491  O OE1   . GLN C 3 10  ? -185.554 149.565 167.823 1.00 48.08  ? 10  GLN D OE1   1 
ATOM 5492  N NE2   . GLN C 3 10  ? -184.644 147.578 167.403 1.00 48.08  ? 10  GLN D NE2   1 
ATOM 5493  N N     . THR C 3 11  ? -180.211 150.562 166.094 1.00 49.84  ? 11  THR D N     1 
ATOM 5494  C CA    . THR C 3 11  ? -179.495 150.086 164.928 1.00 49.84  ? 11  THR D CA    1 
ATOM 5495  C C     . THR C 3 11  ? -179.867 148.653 164.609 1.00 49.84  ? 11  THR D C     1 
ATOM 5496  O O     . THR C 3 11  ? -180.264 147.879 165.479 1.00 49.84  ? 11  THR D O     1 
ATOM 5497  C CB    . THR C 3 11  ? -178.000 150.181 165.172 1.00 49.84  ? 11  THR D CB    1 
ATOM 5498  O OG1   . THR C 3 11  ? -177.293 149.519 164.123 1.00 49.84  ? 11  THR D OG1   1 
ATOM 5499  C CG2   . THR C 3 11  ? -177.669 149.542 166.475 1.00 49.84  ? 11  THR D CG2   1 
ATOM 5500  N N     . LEU C 3 12  ? -179.706 148.302 163.342 1.00 50.13  ? 12  LEU D N     1 
ATOM 5501  C CA    . LEU C 3 12  ? -180.062 146.992 162.867 1.00 50.13  ? 12  LEU D CA    1 
ATOM 5502  C C     . LEU C 3 12  ? -178.949 146.439 161.992 1.00 50.13  ? 12  LEU D C     1 
ATOM 5503  O O     . LEU C 3 12  ? -178.539 147.087 161.009 1.00 50.13  ? 12  LEU D O     1 
ATOM 5504  C CB    . LEU C 3 12  ? -181.367 147.015 162.082 1.00 50.13  ? 12  LEU D CB    1 
ATOM 5505  C CG    . LEU C 3 12  ? -182.510 147.377 163.008 1.00 50.13  ? 12  LEU D CG    1 
ATOM 5506  C CD1   . LEU C 3 12  ? -183.759 147.622 162.261 1.00 50.13  ? 12  LEU D CD1   1 
ATOM 5507  C CD2   . LEU C 3 12  ? -182.696 146.252 163.949 1.00 50.13  ? 12  LEU D CD2   1 
ATOM 5508  N N     . PRO C 3 13  ? -178.477 145.270 162.298 1.00 49.09  ? 13  PRO D N     1 
ATOM 5509  C CA    . PRO C 3 13  ? -177.511 144.587 161.456 1.00 49.09  ? 13  PRO D CA    1 
ATOM 5510  C C     . PRO C 3 13  ? -178.129 144.233 160.131 1.00 49.09  ? 13  PRO D C     1 
ATOM 5511  O O     . PRO C 3 13  ? -179.279 144.568 159.837 1.00 49.09  ? 13  PRO D O     1 
ATOM 5512  C CB    . PRO C 3 13  ? -177.156 143.341 162.260 1.00 49.09  ? 13  PRO D CB    1 
ATOM 5513  C CG    . PRO C 3 13  ? -178.264 143.166 163.172 1.00 49.09  ? 13  PRO D CG    1 
ATOM 5514  C CD    . PRO C 3 13  ? -178.761 144.506 163.514 1.00 49.09  ? 13  PRO D CD    1 
ATOM 5515  N N     . TYR C 3 14  ? -177.347 143.540 159.330 1.00 51.76  ? 14  TYR D N     1 
ATOM 5516  C CA    . TYR C 3 14  ? -177.765 143.069 158.028 1.00 51.76  ? 14  TYR D CA    1 
ATOM 5517  C C     . TYR C 3 14  ? -179.133 142.426 158.016 1.00 51.76  ? 14  TYR D C     1 
ATOM 5518  O O     . TYR C 3 14  ? -179.311 141.323 158.526 1.00 51.76  ? 14  TYR D O     1 
ATOM 5519  C CB    . TYR C 3 14  ? -176.746 142.050 157.595 1.00 51.76  ? 14  TYR D CB    1 
ATOM 5520  C CG    . TYR C 3 14  ? -176.773 141.665 156.184 1.00 51.76  ? 14  TYR D CG    1 
ATOM 5521  C CD1   . TYR C 3 14  ? -176.233 142.441 155.201 1.00 51.76  ? 14  TYR D CD1   1 
ATOM 5522  C CD2   . TYR C 3 14  ? -177.277 140.450 155.851 1.00 51.76  ? 14  TYR D CD2   1 
ATOM 5523  C CE1   . TYR C 3 14  ? -176.244 142.024 153.920 1.00 51.76  ? 14  TYR D CE1   1 
ATOM 5524  C CE2   . TYR C 3 14  ? -177.265 140.021 154.605 1.00 51.76  ? 14  TYR D CE2   1 
ATOM 5525  C CZ    . TYR C 3 14  ? -176.772 140.812 153.627 1.00 51.76  ? 14  TYR D CZ    1 
ATOM 5526  O OH    . TYR C 3 14  ? -176.796 140.366 152.341 1.00 51.76  ? 14  TYR D OH    1 
ATOM 5527  N N     . SER C 3 15  ? -180.100 143.115 157.428 1.00 49.50  ? 15  SER D N     1 
ATOM 5528  C CA    . SER C 3 15  ? -181.478 142.673 157.483 1.00 49.50  ? 15  SER D CA    1 
ATOM 5529  C C     . SER C 3 15  ? -182.257 143.305 156.346 1.00 49.50  ? 15  SER D C     1 
ATOM 5530  O O     . SER C 3 15  ? -181.752 144.160 155.620 1.00 49.50  ? 15  SER D O     1 
ATOM 5531  C CB    . SER C 3 15  ? -182.099 143.060 158.804 1.00 49.50  ? 15  SER D CB    1 
ATOM 5532  O OG    . SER C 3 15  ? -181.929 144.447 158.970 1.00 49.50  ? 15  SER D OG    1 
ATOM 5533  N N     . ASN C 3 16  ? -183.505 142.855 156.187 1.00 47.85  ? 16  ASN D N     1 
ATOM 5534  C CA    . ASN C 3 16  ? -184.408 143.368 155.176 1.00 47.85  ? 16  ASN D CA    1 
ATOM 5535  C C     . ASN C 3 16  ? -185.785 143.353 155.819 1.00 47.85  ? 16  ASN D C     1 
ATOM 5536  O O     . ASN C 3 16  ? -186.619 142.511 155.510 1.00 47.85  ? 16  ASN D O     1 
ATOM 5537  C CB    . ASN C 3 16  ? -184.394 142.536 153.902 1.00 47.85  ? 16  ASN D CB    1 
ATOM 5538  C CG    . ASN C 3 16  ? -185.118 143.197 152.773 1.00 47.85  ? 16  ASN D CG    1 
ATOM 5539  O OD1   . ASN C 3 16  ? -185.573 144.325 152.895 1.00 47.85  ? 16  ASN D OD1   1 
ATOM 5540  N ND2   . ASN C 3 16  ? -185.244 142.493 151.668 1.00 47.85  ? 16  ASN D ND2   1 
ATOM 5541  N N     . ILE C 3 17  ? -186.019 144.294 156.720 1.00 47.67  ? 17  ILE D N     1 
ATOM 5542  C CA    . ILE C 3 17  ? -187.234 144.251 157.512 1.00 47.67  ? 17  ILE D CA    1 
ATOM 5543  C C     . ILE C 3 17  ? -188.479 144.516 156.671 1.00 47.67  ? 17  ILE D C     1 
ATOM 5544  O O     . ILE C 3 17  ? -189.514 143.850 156.830 1.00 47.67  ? 17  ILE D O     1 
ATOM 5545  C CB    . ILE C 3 17  ? -187.106 145.256 158.656 1.00 47.67  ? 17  ILE D CB    1 
ATOM 5546  C CG1   . ILE C 3 17  ? -186.120 144.737 159.675 1.00 47.67  ? 17  ILE D CG1   1 
ATOM 5547  C CG2   . ILE C 3 17  ? -188.428 145.627 159.168 1.00 47.67  ? 17  ILE D CG2   1 
ATOM 5548  C CD1   . ILE C 3 17  ? -186.220 145.403 160.968 1.00 47.67  ? 17  ILE D CD1   1 
ATOM 5549  N N     . ASN C 3 18  ? -188.415 145.494 155.790 1.00 48.16  ? 18  ASN D N     1 
ATOM 5550  C CA    . ASN C 3 18  ? -189.507 145.822 154.886 1.00 48.16  ? 18  ASN D CA    1 
ATOM 5551  C C     . ASN C 3 18  ? -189.030 145.746 153.451 1.00 48.16  ? 18  ASN D C     1 
ATOM 5552  O O     . ASN C 3 18  ? -187.856 145.986 153.173 1.00 48.16  ? 18  ASN D O     1 
ATOM 5553  C CB    . ASN C 3 18  ? -190.052 147.188 155.109 1.00 48.16  ? 18  ASN D CB    1 
ATOM 5554  C CG    . ASN C 3 18  ? -190.912 147.260 156.309 1.00 48.16  ? 18  ASN D CG    1 
ATOM 5555  O OD1   . ASN C 3 18  ? -190.648 148.043 157.198 1.00 48.16  ? 18  ASN D OD1   1 
ATOM 5556  N ND2   . ASN C 3 18  ? -191.915 146.423 156.379 1.00 48.16  ? 18  ASN D ND2   1 
ATOM 5557  N N     . ARG C 3 19  ? -189.931 145.445 152.524 1.00 46.75  ? 19  ARG D N     1 
ATOM 5558  C CA    . ARG C 3 19  ? -189.449 145.466 151.164 1.00 46.75  ? 19  ARG D CA    1 
ATOM 5559  C C     . ARG C 3 19  ? -190.557 145.950 150.256 1.00 46.75  ? 19  ARG D C     1 
ATOM 5560  O O     . ARG C 3 19  ? -191.730 145.991 150.620 1.00 46.75  ? 19  ARG D O     1 
ATOM 5561  C CB    . ARG C 3 19  ? -189.018 144.117 150.578 1.00 46.75  ? 19  ARG D CB    1 
ATOM 5562  C CG    . ARG C 3 19  ? -190.020 142.993 150.622 1.00 46.75  ? 19  ARG D CG    1 
ATOM 5563  C CD    . ARG C 3 19  ? -189.479 141.849 149.752 1.00 46.75  ? 19  ARG D CD    1 
ATOM 5564  N NE    . ARG C 3 19  ? -190.144 140.555 149.875 1.00 46.75  ? 19  ARG D NE    1 
ATOM 5565  C CZ    . ARG C 3 19  ? -190.039 139.739 150.907 1.00 46.75  ? 19  ARG D CZ    1 
ATOM 5566  N NH1   . ARG C 3 19  ? -189.304 140.086 151.943 1.00 46.75  ? 19  ARG D NH1   1 
ATOM 5567  N NH2   . ARG C 3 19  ? -190.670 138.582 150.900 1.00 46.75  ? 19  ARG D NH2   1 
ATOM 5568  N N     . ASP C 3 20  ? -190.146 146.297 149.052 1.00 48.57  ? 20  ASP D N     1 
ATOM 5569  C CA    . ASP C 3 20  ? -190.974 146.988 148.086 1.00 48.57  ? 20  ASP D CA    1 
ATOM 5570  C C     . ASP C 3 20  ? -191.904 145.969 147.471 1.00 48.57  ? 20  ASP D C     1 
ATOM 5571  O O     . ASP C 3 20  ? -192.018 144.836 147.934 1.00 48.57  ? 20  ASP D O     1 
ATOM 5572  C CB    . ASP C 3 20  ? -190.124 147.612 146.985 1.00 48.57  ? 20  ASP D CB    1 
ATOM 5573  C CG    . ASP C 3 20  ? -189.306 148.774 147.453 1.00 48.57  ? 20  ASP D CG    1 
ATOM 5574  O OD1   . ASP C 3 20  ? -189.742 149.456 148.395 1.00 48.57  ? 20  ASP D OD1   1 
ATOM 5575  O OD2   . ASP C 3 20  ? -188.231 149.019 146.860 1.00 48.57  ? 20  ASP D OD2   1 
ATOM 5576  N N     . ASP C 3 21  ? -192.593 146.352 146.411 1.00 50.38  ? 21  ASP D N     1 
ATOM 5577  C CA    . ASP C 3 21  ? -193.243 145.337 145.606 1.00 50.38  ? 21  ASP D CA    1 
ATOM 5578  C C     . ASP C 3 21  ? -192.218 144.412 144.977 1.00 50.38  ? 21  ASP D C     1 
ATOM 5579  O O     . ASP C 3 21  ? -192.534 143.265 144.651 1.00 50.38  ? 21  ASP D O     1 
ATOM 5580  C CB    . ASP C 3 21  ? -194.114 146.012 144.560 1.00 50.38  ? 21  ASP D CB    1 
ATOM 5581  C CG    . ASP C 3 21  ? -193.319 146.830 143.594 1.00 50.38  ? 21  ASP D CG    1 
ATOM 5582  O OD1   . ASP C 3 21  ? -192.211 147.259 143.959 1.00 50.38  ? 21  ASP D OD1   1 
ATOM 5583  O OD2   . ASP C 3 21  ? -193.832 147.089 142.493 1.00 50.38  ? 21  ASP D OD2   1 
ATOM 5584  N N     . LEU C 3 22  ? -191.003 144.888 144.781 1.00 48.72  ? 22  LEU D N     1 
ATOM 5585  C CA    . LEU C 3 22  ? -189.888 144.013 144.464 1.00 48.72  ? 22  LEU D CA    1 
ATOM 5586  C C     . LEU C 3 22  ? -189.241 143.578 145.775 1.00 48.72  ? 22  LEU D C     1 
ATOM 5587  O O     . LEU C 3 22  ? -189.847 143.687 146.840 1.00 48.72  ? 22  LEU D O     1 
ATOM 5588  C CB    . LEU C 3 22  ? -188.946 144.701 143.487 1.00 48.72  ? 22  LEU D CB    1 
ATOM 5589  C CG    . LEU C 3 22  ? -189.776 145.268 142.349 1.00 48.72  ? 22  LEU D CG    1 
ATOM 5590  C CD1   . LEU C 3 22  ? -188.957 146.207 141.506 1.00 48.72  ? 22  LEU D CD1   1 
ATOM 5591  C CD2   . LEU C 3 22  ? -190.345 144.150 141.531 1.00 48.72  ? 22  LEU D CD2   1 
ATOM 5592  N N     . GLY C 3 23  ? -188.023 143.077 145.722 1.00 47.85  ? 23  GLY D N     1 
ATOM 5593  C CA    . GLY C 3 23  ? -187.396 142.599 146.930 1.00 47.85  ? 23  GLY D CA    1 
ATOM 5594  C C     . GLY C 3 23  ? -186.664 143.640 147.742 1.00 47.85  ? 23  GLY D C     1 
ATOM 5595  O O     . GLY C 3 23  ? -186.442 143.438 148.933 1.00 47.85  ? 23  GLY D O     1 
ATOM 5596  N N     . SER C 3 24  ? -186.346 144.774 147.142 1.00 46.17  ? 24  SER D N     1 
ATOM 5597  C CA    . SER C 3 24  ? -185.468 145.724 147.791 1.00 46.17  ? 24  SER D CA    1 
ATOM 5598  C C     . SER C 3 24  ? -186.185 146.412 148.940 1.00 46.17  ? 24  SER D C     1 
ATOM 5599  O O     . SER C 3 24  ? -187.406 146.549 148.920 1.00 46.17  ? 24  SER D O     1 
ATOM 5600  C CB    . SER C 3 24  ? -184.983 146.764 146.795 1.00 46.17  ? 24  SER D CB    1 
ATOM 5601  O OG    . SER C 3 24  ? -186.082 147.350 146.133 1.00 46.17  ? 24  SER D OG    1 
ATOM 5602  N N     . PRO C 3 25  ? -185.450 146.845 149.954 1.00 45.64  ? 25  PRO D N     1 
ATOM 5603  C CA    . PRO C 3 25  ? -186.076 147.506 151.094 1.00 45.64  ? 25  PRO D CA    1 
ATOM 5604  C C     . PRO C 3 25  ? -186.499 148.929 150.778 1.00 45.64  ? 25  PRO D C     1 
ATOM 5605  O O     . PRO C 3 25  ? -186.081 149.533 149.794 1.00 45.64  ? 25  PRO D O     1 
ATOM 5606  C CB    . PRO C 3 25  ? -184.971 147.484 152.147 1.00 45.64  ? 25  PRO D CB    1 
ATOM 5607  C CG    . PRO C 3 25  ? -183.759 147.488 151.375 1.00 45.64  ? 25  PRO D CG    1 
ATOM 5608  C CD    . PRO C 3 25  ? -184.012 146.672 150.163 1.00 45.64  ? 25  PRO D CD    1 
ATOM 5609  N N     . LYS C 3 26  ? -187.344 149.464 151.647 1.00 46.71  ? 26  LYS D N     1 
ATOM 5610  C CA    . LYS C 3 26  ? -187.910 150.778 151.428 1.00 46.71  ? 26  LYS D CA    1 
ATOM 5611  C C     . LYS C 3 26  ? -186.904 151.871 151.736 1.00 46.71  ? 26  LYS D C     1 
ATOM 5612  O O     . LYS C 3 26  ? -186.173 151.795 152.722 1.00 46.71  ? 26  LYS D O     1 
ATOM 5613  C CB    . LYS C 3 26  ? -189.107 150.938 152.341 1.00 46.71  ? 26  LYS D CB    1 
ATOM 5614  C CG    . LYS C 3 26  ? -190.224 150.014 152.040 1.00 46.71  ? 26  LYS D CG    1 
ATOM 5615  C CD    . LYS C 3 26  ? -191.422 150.365 152.879 1.00 46.71  ? 26  LYS D CD    1 
ATOM 5616  C CE    . LYS C 3 26  ? -192.709 149.954 152.223 1.00 46.71  ? 26  LYS D CE    1 
ATOM 5617  N NZ    . LYS C 3 26  ? -192.903 148.499 152.331 1.00 46.71  ? 26  LYS D NZ    1 
ATOM 5618  N N     . THR C 3 27  ? -186.918 152.932 150.931 1.00 50.39  ? 27  THR D N     1 
ATOM 5619  C CA    . THR C 3 27  ? -185.967 154.012 151.121 1.00 50.39  ? 27  THR D CA    1 
ATOM 5620  C C     . THR C 3 27  ? -186.617 155.371 150.943 1.00 50.39  ? 27  THR D C     1 
ATOM 5621  O O     . THR C 3 27  ? -187.336 155.589 149.969 1.00 50.39  ? 27  THR D O     1 
ATOM 5622  C CB    . THR C 3 27  ? -184.860 153.938 150.088 1.00 50.39  ? 27  THR D CB    1 
ATOM 5623  O OG1   . THR C 3 27  ? -185.427 154.221 148.811 1.00 50.39  ? 27  THR D OG1   1 
ATOM 5624  C CG2   . THR C 3 27  ? -184.259 152.559 150.047 1.00 50.39  ? 27  THR D CG2   1 
ATOM 5625  N N     . VAL C 3 28  ? -186.314 156.289 151.852 1.00 50.11  ? 28  VAL D N     1 
ATOM 5626  C CA    . VAL C 3 28  ? -186.531 157.721 151.688 1.00 50.11  ? 28  VAL D CA    1 
ATOM 5627  C C     . VAL C 3 28  ? -185.311 158.319 151.034 1.00 50.11  ? 28  VAL D C     1 
ATOM 5628  O O     . VAL C 3 28  ? -184.195 157.934 151.351 1.00 50.11  ? 28  VAL D O     1 
ATOM 5629  C CB    . VAL C 3 28  ? -186.785 158.407 153.028 1.00 50.11  ? 28  VAL D CB    1 
ATOM 5630  C CG1   . VAL C 3 28  ? -187.228 159.805 152.778 1.00 50.11  ? 28  VAL D CG1   1 
ATOM 5631  C CG2   . VAL C 3 28  ? -187.788 157.681 153.753 1.00 50.11  ? 28  VAL D CG2   1 
ATOM 5632  N N     . VAL C 3 29  ? -185.497 159.285 150.158 1.00 52.85  ? 29  VAL D N     1 
ATOM 5633  C CA    . VAL C 3 29  ? -184.412 160.123 149.672 1.00 52.85  ? 29  VAL D CA    1 
ATOM 5634  C C     . VAL C 3 29  ? -184.475 161.433 150.450 1.00 52.85  ? 29  VAL D C     1 
ATOM 5635  O O     . VAL C 3 29  ? -185.313 162.284 150.190 1.00 52.85  ? 29  VAL D O     1 
ATOM 5636  C CB    . VAL C 3 29  ? -184.449 160.301 148.154 1.00 52.85  ? 29  VAL D CB    1 
ATOM 5637  C CG1   . VAL C 3 29  ? -185.720 160.963 147.685 1.00 52.85  ? 29  VAL D CG1   1 
ATOM 5638  C CG2   . VAL C 3 29  ? -183.245 161.072 147.712 1.00 52.85  ? 29  VAL D CG2   1 
ATOM 5639  N N     . TYR C 3 30  ? -183.635 161.586 151.467 1.00 53.81  ? 30  TYR D N     1 
ATOM 5640  C CA    . TYR C 3 30  ? -183.762 162.695 152.405 1.00 53.81  ? 30  TYR D CA    1 
ATOM 5641  C C     . TYR C 3 30  ? -182.414 163.296 152.730 1.00 53.81  ? 30  TYR D C     1 
ATOM 5642  O O     . TYR C 3 30  ? -181.474 162.586 153.089 1.00 53.81  ? 30  TYR D O     1 
ATOM 5643  C CB    . TYR C 3 30  ? -184.399 162.256 153.700 1.00 53.81  ? 30  TYR D CB    1 
ATOM 5644  C CG    . TYR C 3 30  ? -184.543 163.368 154.686 1.00 53.81  ? 30  TYR D CG    1 
ATOM 5645  C CD1   . TYR C 3 30  ? -185.334 164.456 154.427 1.00 53.81  ? 30  TYR D CD1   1 
ATOM 5646  C CD2   . TYR C 3 30  ? -183.888 163.319 155.888 1.00 53.81  ? 30  TYR D CD2   1 
ATOM 5647  C CE1   . TYR C 3 30  ? -185.471 165.459 155.347 1.00 53.81  ? 30  TYR D CE1   1 
ATOM 5648  C CE2   . TYR C 3 30  ? -184.020 164.308 156.804 1.00 53.81  ? 30  TYR D CE2   1 
ATOM 5649  C CZ    . TYR C 3 30  ? -184.810 165.377 156.534 1.00 53.81  ? 30  TYR D CZ    1 
ATOM 5650  O OH    . TYR C 3 30  ? -184.941 166.378 157.456 1.00 53.81  ? 30  TYR D OH    1 
ATOM 5651  N N     . GLY C 3 31  ? -182.353 164.617 152.642 1.00 54.32  ? 31  GLY D N     1 
ATOM 5652  C CA    . GLY C 3 31  ? -181.101 165.307 152.773 1.00 54.32  ? 31  GLY D CA    1 
ATOM 5653  C C     . GLY C 3 31  ? -180.228 165.103 151.574 1.00 54.32  ? 31  GLY D C     1 
ATOM 5654  O O     . GLY C 3 31  ? -179.013 165.236 151.666 1.00 54.32  ? 31  GLY D O     1 
ATOM 5655  N N     . GLY C 3 32  ? -180.827 164.765 150.440 1.00 57.34  ? 32  GLY D N     1 
ATOM 5656  C CA    . GLY C 3 32  ? -180.090 164.481 149.240 1.00 57.34  ? 32  GLY D CA    1 
ATOM 5657  C C     . GLY C 3 32  ? -179.472 163.110 149.175 1.00 57.34  ? 32  GLY D C     1 
ATOM 5658  O O     . GLY C 3 32  ? -179.034 162.701 148.095 1.00 57.34  ? 32  GLY D O     1 
ATOM 5659  N N     . LYS C 3 33  ? -179.437 162.375 150.276 1.00 58.58  ? 33  LYS D N     1 
ATOM 5660  C CA    . LYS C 3 33  ? -178.838 161.051 150.312 1.00 58.58  ? 33  LYS D CA    1 
ATOM 5661  C C     . LYS C 3 33  ? -179.922 160.018 150.583 1.00 58.58  ? 33  LYS D C     1 
ATOM 5662  O O     . LYS C 3 33  ? -180.574 160.056 151.628 1.00 58.58  ? 33  LYS D O     1 
ATOM 5663  C CB    . LYS C 3 33  ? -177.720 161.008 151.347 1.00 58.58  ? 33  LYS D CB    1 
ATOM 5664  C CG    . LYS C 3 33  ? -176.498 161.729 150.824 1.00 58.58  ? 33  LYS D CG    1 
ATOM 5665  C CD    . LYS C 3 33  ? -175.413 161.916 151.848 1.00 58.58  ? 33  LYS D CD    1 
ATOM 5666  C CE    . LYS C 3 33  ? -174.636 160.649 152.085 1.00 58.58  ? 33  LYS D CE    1 
ATOM 5667  N NZ    . LYS C 3 33  ? -173.497 160.928 153.000 1.00 58.58  ? 33  LYS D NZ    1 
ATOM 5668  N N     . GLU C 3 34  ? -180.098 159.094 149.644 1.00 58.38  ? 34  GLU D N     1 
ATOM 5669  C CA    . GLU C 3 34  ? -181.000 157.972 149.850 1.00 58.38  ? 34  GLU D CA    1 
ATOM 5670  C C     . GLU C 3 34  ? -180.661 157.222 151.120 1.00 58.38  ? 34  GLU D C     1 
ATOM 5671  O O     . GLU C 3 34  ? -179.498 157.069 151.480 1.00 58.38  ? 34  GLU D O     1 
ATOM 5672  C CB    . GLU C 3 34  ? -180.944 157.028 148.664 1.00 58.38  ? 34  GLU D CB    1 
ATOM 5673  C CG    . GLU C 3 34  ? -181.689 157.561 147.475 1.00 58.38  ? 34  GLU D CG    1 
ATOM 5674  C CD    . GLU C 3 34  ? -181.780 156.559 146.350 1.00 58.38  ? 34  GLU D CD    1 
ATOM 5675  O OE1   . GLU C 3 34  ? -181.137 155.497 146.454 1.00 58.38  ? 34  GLU D OE1   1 
ATOM 5676  O OE2   . GLU C 3 34  ? -182.507 156.824 145.366 1.00 58.38  ? 34  GLU D OE2   1 
ATOM 5677  N N     . ARG C 3 35  ? -181.694 156.760 151.804 1.00 51.16  ? 35  ARG D N     1 
ATOM 5678  C CA    . ARG C 3 35  ? -181.534 156.040 153.050 1.00 51.16  ? 35  ARG D CA    1 
ATOM 5679  C C     . ARG C 3 35  ? -182.668 155.058 153.266 1.00 51.16  ? 35  ARG D C     1 
ATOM 5680  O O     . ARG C 3 35  ? -183.833 155.402 153.073 1.00 51.16  ? 35  ARG D O     1 
ATOM 5681  C CB    . ARG C 3 35  ? -181.495 157.001 154.221 1.00 51.16  ? 35  ARG D CB    1 
ATOM 5682  C CG    . ARG C 3 35  ? -182.632 157.946 154.241 1.00 51.16  ? 35  ARG D CG    1 
ATOM 5683  C CD    . ARG C 3 35  ? -182.379 158.989 155.269 1.00 51.16  ? 35  ARG D CD    1 
ATOM 5684  N NE    . ARG C 3 35  ? -181.322 159.934 154.961 1.00 51.16  ? 35  ARG D NE    1 
ATOM 5685  C CZ    . ARG C 3 35  ? -180.846 160.764 155.874 1.00 51.16  ? 35  ARG D CZ    1 
ATOM 5686  N NH1   . ARG C 3 35  ? -181.339 160.726 157.096 1.00 51.16  ? 35  ARG D NH1   1 
ATOM 5687  N NH2   . ARG C 3 35  ? -179.887 161.617 155.583 1.00 51.16  ? 35  ARG D NH2   1 
ATOM 5688  N N     . THR C 3 36  ? -182.323 153.840 153.656 1.00 47.38  ? 36  THR D N     1 
ATOM 5689  C CA    . THR C 3 36  ? -183.336 152.819 153.868 1.00 47.38  ? 36  THR D CA    1 
ATOM 5690  C C     . THR C 3 36  ? -184.256 153.230 155.003 1.00 47.38  ? 36  THR D C     1 
ATOM 5691  O O     . THR C 3 36  ? -183.886 154.023 155.864 1.00 47.38  ? 36  THR D O     1 
ATOM 5692  C CB    . THR C 3 36  ? -182.688 151.475 154.175 1.00 47.38  ? 36  THR D CB    1 
ATOM 5693  O OG1   . THR C 3 36  ? -183.703 150.501 154.419 1.00 47.38  ? 36  THR D OG1   1 
ATOM 5694  C CG2   . THR C 3 36  ? -181.827 151.572 155.383 1.00 47.38  ? 36  THR D CG2   1 
ATOM 5695  N N     . ARG C 3 37  ? -185.477 152.708 154.982 1.00 46.20  ? 37  ARG D N     1 
ATOM 5696  C CA    . ARG C 3 37  ? -186.476 153.050 155.980 1.00 46.20  ? 37  ARG D CA    1 
ATOM 5697  C C     . ARG C 3 37  ? -187.301 151.825 156.313 1.00 46.20  ? 37  ARG D C     1 
ATOM 5698  O O     . ARG C 3 37  ? -187.382 150.873 155.544 1.00 46.20  ? 37  ARG D O     1 
ATOM 5699  C CB    . ARG C 3 37  ? -187.395 154.187 155.573 1.00 46.20  ? 37  ARG D CB    1 
ATOM 5700  C CG    . ARG C 3 37  ? -188.346 153.858 154.507 1.00 46.20  ? 37  ARG D CG    1 
ATOM 5701  C CD    . ARG C 3 37  ? -189.446 154.874 154.449 1.00 46.20  ? 37  ARG D CD    1 
ATOM 5702  N NE    . ARG C 3 37  ? -190.047 154.825 153.134 1.00 46.20  ? 37  ARG D NE    1 
ATOM 5703  C CZ    . ARG C 3 37  ? -191.265 154.383 152.901 1.00 46.20  ? 37  ARG D CZ    1 
ATOM 5704  N NH1   . ARG C 3 37  ? -192.015 153.956 153.899 1.00 46.20  ? 37  ARG D NH1   1 
ATOM 5705  N NH2   . ARG C 3 37  ? -191.728 154.366 151.672 1.00 46.20  ? 37  ARG D NH2   1 
ATOM 5706  N N     . VAL C 3 38  ? -187.924 151.869 157.477 1.00 46.04  ? 38  VAL D N     1 
ATOM 5707  C CA    . VAL C 3 38  ? -188.881 150.870 157.910 1.00 46.04  ? 38  VAL D CA    1 
ATOM 5708  C C     . VAL C 3 38  ? -190.206 151.563 158.049 1.00 46.04  ? 38  VAL D C     1 
ATOM 5709  O O     . VAL C 3 38  ? -190.385 152.402 158.934 1.00 46.04  ? 38  VAL D O     1 
ATOM 5710  C CB    . VAL C 3 38  ? -188.462 150.249 159.242 1.00 46.04  ? 38  VAL D CB    1 
ATOM 5711  C CG1   . VAL C 3 38  ? -189.327 149.112 159.592 1.00 46.04  ? 38  VAL D CG1   1 
ATOM 5712  C CG2   . VAL C 3 38  ? -187.092 149.712 159.109 1.00 46.04  ? 38  VAL D CG2   1 
ATOM 5713  N N     . SER C 3 39  ? -191.141 151.195 157.191 1.00 49.57  ? 39  SER D N     1 
ATOM 5714  C CA    . SER C 3 39  ? -192.336 151.986 157.052 1.00 49.57  ? 39  SER D CA    1 
ATOM 5715  C C     . SER C 3 39  ? -193.100 152.043 158.361 1.00 49.57  ? 39  SER D C     1 
ATOM 5716  O O     . SER C 3 39  ? -192.957 151.196 159.231 1.00 49.57  ? 39  SER D O     1 
ATOM 5717  C CB    . SER C 3 39  ? -193.222 151.409 155.973 1.00 49.57  ? 39  SER D CB    1 
ATOM 5718  O OG    . SER C 3 39  ? -194.344 152.239 155.833 1.00 49.57  ? 39  SER D OG    1 
ATOM 5719  N N     . SER C 3 40  ? -193.909 153.082 158.497 1.00 50.83  ? 40  SER D N     1 
ATOM 5720  C CA    . SER C 3 40  ? -194.614 153.309 159.747 1.00 50.83  ? 40  SER D CA    1 
ATOM 5721  C C     . SER C 3 40  ? -195.632 152.225 160.048 1.00 50.83  ? 40  SER D C     1 
ATOM 5722  O O     . SER C 3 40  ? -195.744 151.779 161.182 1.00 50.83  ? 40  SER D O     1 
ATOM 5723  C CB    . SER C 3 40  ? -195.314 154.644 159.725 1.00 50.83  ? 40  SER D CB    1 
ATOM 5724  O OG    . SER C 3 40  ? -196.384 154.583 160.624 1.00 50.83  ? 40  SER D OG    1 
ATOM 5725  N N     . GLN C 3 41  ? -196.439 151.835 159.064 1.00 51.69  ? 41  GLN D N     1 
ATOM 5726  C CA    . GLN C 3 41  ? -197.483 150.847 159.334 1.00 51.69  ? 41  GLN D CA    1 
ATOM 5727  C C     . GLN C 3 41  ? -196.910 149.495 159.708 1.00 51.69  ? 41  GLN D C     1 
ATOM 5728  O O     . GLN C 3 41  ? -197.529 148.753 160.470 1.00 51.69  ? 41  GLN D O     1 
ATOM 5729  C CB    . GLN C 3 41  ? -198.389 150.711 158.132 1.00 51.69  ? 41  GLN D CB    1 
ATOM 5730  C CG    . GLN C 3 41  ? -197.726 150.109 156.947 1.00 51.69  ? 41  GLN D CG    1 
ATOM 5731  C CD    . GLN C 3 41  ? -196.840 151.064 156.233 1.00 51.69  ? 41  GLN D CD    1 
ATOM 5732  O OE1   . GLN C 3 41  ? -196.613 152.166 156.711 1.00 51.69  ? 41  GLN D OE1   1 
ATOM 5733  N NE2   . GLN C 3 41  ? -196.286 150.644 155.103 1.00 51.69  ? 41  GLN D NE2   1 
ATOM 5734  N N     . SER C 3 42  ? -195.758 149.137 159.160 1.00 54.33  ? 42  SER D N     1 
ATOM 5735  C CA    . SER C 3 42  ? -195.222 147.818 159.441 1.00 54.33  ? 42  SER D CA    1 
ATOM 5736  C C     . SER C 3 42  ? -194.782 147.770 160.876 1.00 54.33  ? 42  SER D C     1 
ATOM 5737  O O     . SER C 3 42  ? -195.202 146.904 161.665 1.00 54.33  ? 42  SER D O     1 
ATOM 5738  C CB    . SER C 3 42  ? -194.047 147.528 158.522 1.00 54.33  ? 42  SER D CB    1 
ATOM 5739  O OG    . SER C 3 42  ? -193.440 146.332 158.922 1.00 54.33  ? 42  SER D OG    1 
ATOM 5740  N N     . TRP C 3 43  ? -194.038 148.792 161.260 1.00 56.18  ? 43  TRP D N     1 
ATOM 5741  C CA    . TRP C 3 43  ? -193.587 148.959 162.622 1.00 56.18  ? 43  TRP D CA    1 
ATOM 5742  C C     . TRP C 3 43  ? -194.789 149.114 163.554 1.00 56.18  ? 43  TRP D C     1 
ATOM 5743  O O     . TRP C 3 43  ? -194.767 148.616 164.664 1.00 56.18  ? 43  TRP D O     1 
ATOM 5744  C CB    . TRP C 3 43  ? -192.766 150.239 162.737 1.00 56.18  ? 43  TRP D CB    1 
ATOM 5745  C CG    . TRP C 3 43  ? -191.289 150.071 162.838 1.00 56.18  ? 43  TRP D CG    1 
ATOM 5746  C CD1   . TRP C 3 43  ? -190.359 150.460 161.921 1.00 56.18  ? 43  TRP D CD1   1 
ATOM 5747  C CD2   . TRP C 3 43  ? -190.559 149.507 163.927 1.00 56.18  ? 43  TRP D CD2   1 
ATOM 5748  N NE1   . TRP C 3 43  ? -189.093 150.157 162.362 1.00 56.18  ? 43  TRP D NE1   1 
ATOM 5749  C CE2   . TRP C 3 43  ? -189.191 149.571 163.592 1.00 56.18  ? 43  TRP D CE2   1 
ATOM 5750  C CE3   . TRP C 3 43  ? -190.927 148.943 165.142 1.00 56.18  ? 43  TRP D CE3   1 
ATOM 5751  C CZ2   . TRP C 3 43  ? -188.206 149.094 164.422 1.00 56.18  ? 43  TRP D CZ2   1 
ATOM 5752  C CZ3   . TRP C 3 43  ? -189.949 148.483 165.961 1.00 56.18  ? 43  TRP D CZ3   1 
ATOM 5753  C CH2   . TRP C 3 43  ? -188.603 148.559 165.603 1.00 56.18  ? 43  TRP D CH2   1 
ATOM 5754  N N     . LYS C 3 44  ? -195.803 149.864 163.147 1.00 55.52  ? 44  LYS D N     1 
ATOM 5755  C CA    . LYS C 3 44  ? -196.949 150.034 164.023 1.00 55.52  ? 44  LYS D CA    1 
ATOM 5756  C C     . LYS C 3 44  ? -197.658 148.718 164.237 1.00 55.52  ? 44  LYS D C     1 
ATOM 5757  O O     . LYS C 3 44  ? -197.996 148.383 165.351 1.00 55.52  ? 44  LYS D O     1 
ATOM 5758  C CB    . LYS C 3 44  ? -197.911 151.080 163.499 1.00 55.52  ? 44  LYS D CB    1 
ATOM 5759  C CG    . LYS C 3 44  ? -198.893 151.549 164.554 1.00 55.52  ? 44  LYS D CG    1 
ATOM 5760  C CD    . LYS C 3 44  ? -199.827 152.601 163.996 1.00 55.52  ? 44  LYS D CD    1 
ATOM 5761  C CE    . LYS C 3 44  ? -200.950 152.887 164.964 1.00 55.52  ? 44  LYS D CE    1 
ATOM 5762  N NZ    . LYS C 3 44  ? -201.526 154.219 164.671 1.00 55.52  ? 44  LYS D NZ    1 
ATOM 5763  N N     . ARG C 3 45  ? -197.872 147.952 163.174 1.00 55.49  ? 45  ARG D N     1 
ATOM 5764  C CA    . ARG C 3 45  ? -198.492 146.648 163.340 1.00 55.49  ? 45  ARG D CA    1 
ATOM 5765  C C     . ARG C 3 45  ? -197.788 145.793 164.362 1.00 55.49  ? 45  ARG D C     1 
ATOM 5766  O O     . ARG C 3 45  ? -198.434 145.162 165.201 1.00 55.49  ? 45  ARG D O     1 
ATOM 5767  C CB    . ARG C 3 45  ? -198.509 145.898 162.023 1.00 55.49  ? 45  ARG D CB    1 
ATOM 5768  C CG    . ARG C 3 45  ? -198.777 144.423 162.204 1.00 55.49  ? 45  ARG D CG    1 
ATOM 5769  C CD    . ARG C 3 45  ? -198.718 143.721 160.891 1.00 55.49  ? 45  ARG D CD    1 
ATOM 5770  N NE    . ARG C 3 45  ? -199.384 142.436 160.923 1.00 55.49  ? 45  ARG D NE    1 
ATOM 5771  C CZ    . ARG C 3 45  ? -199.720 141.778 159.828 1.00 55.49  ? 45  ARG D CZ    1 
ATOM 5772  N NH1   . ARG C 3 45  ? -199.453 142.289 158.650 1.00 55.49  ? 45  ARG D NH1   1 
ATOM 5773  N NH2   . ARG C 3 45  ? -200.341 140.618 159.909 1.00 55.49  ? 45  ARG D NH2   1 
ATOM 5774  N N     . ALA C 3 46  ? -196.471 145.703 164.289 1.00 54.49  ? 46  ALA D N     1 
ATOM 5775  C CA    . ALA C 3 46  ? -195.805 144.908 165.318 1.00 54.49  ? 46  ALA D CA    1 
ATOM 5776  C C     . ALA C 3 46  ? -195.992 145.464 166.720 1.00 54.49  ? 46  ALA D C     1 
ATOM 5777  O O     . ALA C 3 46  ? -196.213 144.701 167.671 1.00 54.49  ? 46  ALA D O     1 
ATOM 5778  C CB    . ALA C 3 46  ? -194.335 144.739 165.012 1.00 54.49  ? 46  ALA D CB    1 
ATOM 5779  N N     . VAL C 3 47  ? -195.960 146.785 166.873 1.00 56.81  ? 47  VAL D N     1 
ATOM 5780  C CA    . VAL C 3 47  ? -196.169 147.332 168.209 1.00 56.81  ? 47  VAL D CA    1 
ATOM 5781  C C     . VAL C 3 47  ? -197.579 147.079 168.706 1.00 56.81  ? 47  VAL D C     1 
ATOM 5782  O O     . VAL C 3 47  ? -197.788 146.739 169.873 1.00 56.81  ? 47  VAL D O     1 
ATOM 5783  C CB    . VAL C 3 47  ? -195.856 148.831 168.219 1.00 56.81  ? 47  VAL D CB    1 
ATOM 5784  C CG1   . VAL C 3 47  ? -196.119 149.378 169.569 1.00 56.81  ? 47  VAL D CG1   1 
ATOM 5785  C CG2   . VAL C 3 47  ? -194.431 149.067 167.832 1.00 56.81  ? 47  VAL D CG2   1 
ATOM 5786  N N     . ARG C 3 48  ? -198.568 147.263 167.847 1.00 62.07  ? 48  ARG D N     1 
ATOM 5787  C CA    . ARG C 3 48  ? -199.944 147.059 168.264 1.00 62.07  ? 48  ARG D CA    1 
ATOM 5788  C C     . ARG C 3 48  ? -200.194 145.604 168.608 1.00 62.07  ? 48  ARG D C     1 
ATOM 5789  O O     . ARG C 3 48  ? -200.842 145.303 169.613 1.00 62.07  ? 48  ARG D O     1 
ATOM 5790  C CB    . ARG C 3 48  ? -200.870 147.606 167.192 1.00 62.07  ? 48  ARG D CB    1 
ATOM 5791  C CG    . ARG C 3 48  ? -200.960 146.902 165.898 1.00 62.07  ? 48  ARG D CG    1 
ATOM 5792  C CD    . ARG C 3 48  ? -202.169 147.450 165.210 1.00 62.07  ? 48  ARG D CD    1 
ATOM 5793  N NE    . ARG C 3 48  ? -203.390 147.261 165.962 1.00 62.07  ? 48  ARG D NE    1 
ATOM 5794  C CZ    . ARG C 3 48  ? -204.429 148.080 165.894 1.00 62.07  ? 48  ARG D CZ    1 
ATOM 5795  N NH1   . ARG C 3 48  ? -204.409 149.149 165.129 1.00 62.07  ? 48  ARG D NH1   1 
ATOM 5796  N NH2   . ARG C 3 48  ? -205.489 147.821 166.595 1.00 62.07  ? 48  ARG D NH2   1 
ATOM 5797  N N     . HIS C 3 49  ? -199.707 144.684 167.782 1.00 62.26  ? 49  HIS D N     1 
ATOM 5798  C CA    . HIS C 3 49  ? -199.856 143.273 168.101 1.00 62.26  ? 49  HIS D CA    1 
ATOM 5799  C C     . HIS C 3 49  ? -199.196 142.936 169.422 1.00 62.26  ? 49  HIS D C     1 
ATOM 5800  O O     . HIS C 3 49  ? -199.722 142.141 170.208 1.00 62.26  ? 49  HIS D O     1 
ATOM 5801  C CB    . HIS C 3 49  ? -199.228 142.430 167.002 1.00 62.26  ? 49  HIS D CB    1 
ATOM 5802  C CG    . HIS C 3 49  ? -199.405 140.962 167.199 1.00 62.26  ? 49  HIS D CG    1 
ATOM 5803  N ND1   . HIS C 3 49  ? -198.583 140.231 168.030 1.00 62.26  ? 49  HIS D ND1   1 
ATOM 5804  C CD2   . HIS C 3 49  ? -200.291 140.082 166.681 1.00 62.26  ? 49  HIS D CD2   1 
ATOM 5805  C CE1   . HIS C 3 49  ? -198.953 138.965 168.013 1.00 62.26  ? 49  HIS D CE1   1 
ATOM 5806  N NE2   . HIS C 3 49  ? -199.990 138.847 167.204 1.00 62.26  ? 49  HIS D NE2   1 
ATOM 5807  N N     . GLU C 3 50  ? -198.059 143.562 169.703 1.00 64.66  ? 50  GLU D N     1 
ATOM 5808  C CA    . GLU C 3 50  ? -197.365 143.264 170.945 1.00 64.66  ? 50  GLU D CA    1 
ATOM 5809  C C     . GLU C 3 50  ? -198.109 143.824 172.142 1.00 64.66  ? 50  GLU D C     1 
ATOM 5810  O O     . GLU C 3 50  ? -198.219 143.163 173.177 1.00 64.66  ? 50  GLU D O     1 
ATOM 5811  C CB    . GLU C 3 50  ? -195.958 143.835 170.895 1.00 64.66  ? 50  GLU D CB    1 
ATOM 5812  C CG    . GLU C 3 50  ? -195.257 143.785 172.222 1.00 64.66  ? 50  GLU D CG    1 
ATOM 5813  C CD    . GLU C 3 50  ? -194.972 142.371 172.678 1.00 64.66  ? 50  GLU D CD    1 
ATOM 5814  O OE1   . GLU C 3 50  ? -194.917 141.459 171.825 1.00 64.66  ? 50  GLU D OE1   1 
ATOM 5815  O OE2   . GLU C 3 50  ? -194.822 142.167 173.896 1.00 64.66  ? 50  GLU D OE2   1 
ATOM 5816  N N     . VAL C 3 51  ? -198.660 145.028 172.007 1.00 63.78  ? 51  VAL D N     1 
ATOM 5817  C CA    . VAL C 3 51  ? -199.418 145.627 173.099 1.00 63.78  ? 51  VAL D CA    1 
ATOM 5818  C C     . VAL C 3 51  ? -200.658 144.810 173.384 1.00 63.78  ? 51  VAL D C     1 
ATOM 5819  O O     . VAL C 3 51  ? -200.955 144.475 174.534 1.00 63.78  ? 51  VAL D O     1 
ATOM 5820  C CB    . VAL C 3 51  ? -199.797 147.079 172.775 1.00 63.78  ? 51  VAL D CB    1 
ATOM 5821  C CG1   . VAL C 3 51  ? -200.731 147.599 173.822 1.00 63.78  ? 51  VAL D CG1   1 
ATOM 5822  C CG2   . VAL C 3 51  ? -198.593 147.932 172.721 1.00 63.78  ? 51  VAL D CG2   1 
ATOM 5823  N N     . GLU C 3 52  ? -201.376 144.431 172.335 1.00 68.62  ? 52  GLU D N     1 
ATOM 5824  C CA    . GLU C 3 52  ? -202.581 143.659 172.559 1.00 68.62  ? 52  GLU D CA    1 
ATOM 5825  C C     . GLU C 3 52  ? -202.246 142.288 173.119 1.00 68.62  ? 52  GLU D C     1 
ATOM 5826  O O     . GLU C 3 52  ? -203.034 141.729 173.884 1.00 68.62  ? 52  GLU D O     1 
ATOM 5827  C CB    . GLU C 3 52  ? -203.346 143.510 171.245 1.00 68.62  ? 52  GLU D CB    1 
ATOM 5828  C CG    . GLU C 3 52  ? -203.878 144.800 170.653 1.00 68.62  ? 52  GLU D CG    1 
ATOM 5829  C CD    . GLU C 3 52  ? -204.625 144.558 169.352 1.00 68.62  ? 52  GLU D CD    1 
ATOM 5830  O OE1   . GLU C 3 52  ? -204.456 143.472 168.766 1.00 68.62  ? 52  GLU D OE1   1 
ATOM 5831  O OE2   . GLU C 3 52  ? -205.360 145.453 168.894 1.00 68.62  ? 52  GLU D OE2   1 
ATOM 5832  N N     . ALA C 3 53  ? -201.081 141.737 172.786 1.00 69.16  ? 53  ALA D N     1 
ATOM 5833  C CA    . ALA C 3 53  ? -200.750 140.445 173.364 1.00 69.16  ? 53  ALA D CA    1 
ATOM 5834  C C     . ALA C 3 53  ? -200.388 140.563 174.834 1.00 69.16  ? 53  ALA D C     1 
ATOM 5835  O O     . ALA C 3 53  ? -200.842 139.756 175.648 1.00 69.16  ? 53  ALA D O     1 
ATOM 5836  C CB    . ALA C 3 53  ? -199.604 139.797 172.592 1.00 69.16  ? 53  ALA D CB    1 
ATOM 5837  N N     . ARG C 3 54  ? -199.587 141.564 175.209 1.00 73.82  ? 54  ARG D N     1 
ATOM 5838  C CA    . ARG C 3 54  ? -199.246 141.697 176.624 1.00 73.82  ? 54  ARG D CA    1 
ATOM 5839  C C     . ARG C 3 54  ? -200.428 142.192 177.444 1.00 73.82  ? 54  ARG D C     1 
ATOM 5840  O O     . ARG C 3 54  ? -200.637 141.745 178.574 1.00 73.82  ? 54  ARG D O     1 
ATOM 5841  C CB    . ARG C 3 54  ? -198.040 142.599 176.870 1.00 73.82  ? 54  ARG D CB    1 
ATOM 5842  C CG    . ARG C 3 54  ? -197.795 142.648 178.385 1.00 73.82  ? 54  ARG D CG    1 
ATOM 5843  C CD    . ARG C 3 54  ? -196.725 143.562 178.929 1.00 73.82  ? 54  ARG D CD    1 
ATOM 5844  N NE    . ARG C 3 54  ? -195.371 143.221 178.548 1.00 73.82  ? 54  ARG D NE    1 
ATOM 5845  C CZ    . ARG C 3 54  ? -194.733 143.752 177.514 1.00 73.82  ? 54  ARG D CZ    1 
ATOM 5846  N NH1   . ARG C 3 54  ? -195.333 144.651 176.749 1.00 73.82  ? 54  ARG D NH1   1 
ATOM 5847  N NH2   . ARG C 3 54  ? -193.489 143.385 177.244 1.00 73.82  ? 54  ARG D NH2   1 
ATOM 5848  N N     . LEU C 3 55  ? -201.237 143.082 176.884 1.00 72.63  ? 55  LEU D N     1 
ATOM 5849  C CA    . LEU C 3 55  ? -202.399 143.591 177.606 1.00 72.63  ? 55  LEU D CA    1 
ATOM 5850  C C     . LEU C 3 55  ? -203.547 142.600 177.682 1.00 72.63  ? 55  LEU D C     1 
ATOM 5851  O O     . LEU C 3 55  ? -204.597 142.944 178.237 1.00 72.63  ? 55  LEU D O     1 
ATOM 5852  C CB    . LEU C 3 55  ? -202.942 144.856 176.958 1.00 72.63  ? 55  LEU D CB    1 
ATOM 5853  C CG    . LEU C 3 55  ? -202.447 146.175 177.524 1.00 72.63  ? 55  LEU D CG    1 
ATOM 5854  C CD1   . LEU C 3 55  ? -203.138 147.369 176.889 1.00 72.63  ? 55  LEU D CD1   1 
ATOM 5855  C CD2   . LEU C 3 55  ? -202.688 146.163 178.986 1.00 72.63  ? 55  LEU D CD2   1 
ATOM 5856  N N     . GLY C 3 56  ? -203.422 141.423 177.079 1.00 74.12  ? 56  GLY D N     1 
ATOM 5857  C CA    . GLY C 3 56  ? -204.499 140.454 177.156 1.00 74.12  ? 56  GLY D CA    1 
ATOM 5858  C C     . GLY C 3 56  ? -205.739 140.759 176.350 1.00 74.12  ? 56  GLY D C     1 
ATOM 5859  O O     . GLY C 3 56  ? -205.944 141.904 175.910 1.00 74.12  ? 56  GLY D O     1 
ATOM 5860  N N     . ASN C 3 164 ? -212.022 149.623 175.045 1.00 78.86  ? 164 ASN D N     1 
ATOM 5861  C CA    . ASN C 3 164 ? -211.170 149.122 173.988 1.00 78.86  ? 164 ASN D CA    1 
ATOM 5862  C C     . ASN C 3 164 ? -209.985 150.013 173.781 1.00 78.86  ? 164 ASN D C     1 
ATOM 5863  O O     . ASN C 3 164 ? -209.989 150.912 172.953 1.00 78.86  ? 164 ASN D O     1 
ATOM 5864  C CB    . ASN C 3 164 ? -211.916 148.986 172.693 1.00 78.86  ? 164 ASN D CB    1 
ATOM 5865  C CG    . ASN C 3 164 ? -211.384 147.880 171.853 1.00 78.86  ? 164 ASN D CG    1 
ATOM 5866  O OD1   . ASN C 3 164 ? -210.207 147.548 171.920 1.00 78.86  ? 164 ASN D OD1   1 
ATOM 5867  N ND2   . ASN C 3 164 ? -212.254 147.272 171.070 1.00 78.86  ? 164 ASN D ND2   1 
ATOM 5868  N N     . VAL C 3 165 ? -208.960 149.753 174.578 1.00 76.41  ? 165 VAL D N     1 
ATOM 5869  C CA    . VAL C 3 165 ? -207.802 150.612 174.563 1.00 76.41  ? 165 VAL D CA    1 
ATOM 5870  C C     . VAL C 3 165 ? -206.994 150.436 173.285 1.00 76.41  ? 165 VAL D C     1 
ATOM 5871  O O     . VAL C 3 165 ? -206.213 151.307 172.934 1.00 76.41  ? 165 VAL D O     1 
ATOM 5872  C CB    . VAL C 3 165 ? -206.951 150.375 175.813 1.00 76.41  ? 165 VAL D CB    1 
ATOM 5873  C CG1   . VAL C 3 165 ? -206.167 151.601 176.090 1.00 76.41  ? 165 VAL D CG1   1 
ATOM 5874  C CG2   . VAL C 3 165 ? -207.794 149.896 176.975 1.00 76.41  ? 165 VAL D CG2   1 
ATOM 5875  N N     . SER C 3 166 ? -207.135 149.330 172.578 1.00 75.27  ? 166 SER D N     1 
ATOM 5876  C CA    . SER C 3 166 ? -206.381 149.192 171.356 1.00 75.27  ? 166 SER D CA    1 
ATOM 5877  C C     . SER C 3 166 ? -207.032 149.994 170.258 1.00 75.27  ? 166 SER D C     1 
ATOM 5878  O O     . SER C 3 166 ? -206.314 150.486 169.391 1.00 75.27  ? 166 SER D O     1 
ATOM 5879  C CB    . SER C 3 166 ? -206.285 147.733 170.983 1.00 75.27  ? 166 SER D CB    1 
ATOM 5880  O OG    . SER C 3 166 ? -207.402 146.978 171.461 1.00 75.27  ? 166 SER D OG    1 
ATOM 5881  N N     . VAL C 3 167 ? -208.361 150.168 170.315 1.00 76.63  ? 167 VAL D N     1 
ATOM 5882  C CA    . VAL C 3 167 ? -209.034 151.084 169.408 1.00 76.63  ? 167 VAL D CA    1 
ATOM 5883  C C     . VAL C 3 167 ? -208.886 152.513 169.869 1.00 76.63  ? 167 VAL D C     1 
ATOM 5884  O O     . VAL C 3 167 ? -209.224 153.432 169.121 1.00 76.63  ? 167 VAL D O     1 
ATOM 5885  C CB    . VAL C 3 167 ? -210.521 150.708 169.264 1.00 76.63  ? 167 VAL D CB    1 
ATOM 5886  C CG1   . VAL C 3 167 ? -211.186 151.489 168.146 1.00 76.63  ? 167 VAL D CG1   1 
ATOM 5887  C CG2   . VAL C 3 167 ? -210.641 149.264 168.929 1.00 76.63  ? 167 VAL D CG2   1 
ATOM 5888  N N     . ASN C 3 168 ? -208.406 152.725 171.084 1.00 74.31  ? 168 ASN D N     1 
ATOM 5889  C CA    . ASN C 3 168 ? -208.212 154.101 171.468 1.00 74.31  ? 168 ASN D CA    1 
ATOM 5890  C C     . ASN C 3 168 ? -206.776 154.562 171.257 1.00 74.31  ? 168 ASN D C     1 
ATOM 5891  O O     . ASN C 3 168 ? -206.578 155.544 170.542 1.00 74.31  ? 168 ASN D O     1 
ATOM 5892  C CB    . ASN C 3 168 ? -208.680 154.280 172.911 1.00 74.31  ? 168 ASN D CB    1 
ATOM 5893  C CG    . ASN C 3 168 ? -209.274 155.645 173.144 1.00 74.31  ? 168 ASN D CG    1 
ATOM 5894  O OD1   . ASN C 3 168 ? -208.754 156.652 172.664 1.00 74.31  ? 168 ASN D OD1   1 
ATOM 5895  N ND2   . ASN C 3 168 ? -210.439 155.670 173.760 1.00 74.31  ? 168 ASN D ND2   1 
ATOM 5896  N N     . LEU C 3 169 ? -205.793 153.878 171.832 1.00 70.94  ? 169 LEU D N     1 
ATOM 5897  C CA    . LEU C 3 169 ? -204.401 154.274 171.632 1.00 70.94  ? 169 LEU D CA    1 
ATOM 5898  C C     . LEU C 3 169 ? -204.074 154.201 170.140 1.00 70.94  ? 169 LEU D C     1 
ATOM 5899  O O     . LEU C 3 169 ? -203.467 155.108 169.571 1.00 70.94  ? 169 LEU D O     1 
ATOM 5900  C CB    . LEU C 3 169 ? -203.462 153.367 172.428 1.00 70.94  ? 169 LEU D CB    1 
ATOM 5901  C CG    . LEU C 3 169 ? -203.648 151.861 172.233 1.00 70.94  ? 169 LEU D CG    1 
ATOM 5902  C CD1   . LEU C 3 169 ? -202.391 151.234 171.650 1.00 70.94  ? 169 LEU D CD1   1 
ATOM 5903  C CD2   . LEU C 3 169 ? -204.027 151.192 173.546 1.00 70.94  ? 169 LEU D CD2   1 
ATOM 5904  N N     . PHE C 3 170 ? -204.494 153.101 169.525 1.00 70.19  ? 170 PHE D N     1 
ATOM 5905  C CA    . PHE C 3 170 ? -204.307 152.832 168.107 1.00 70.19  ? 170 PHE D CA    1 
ATOM 5906  C C     . PHE C 3 170 ? -205.707 153.117 167.623 1.00 70.19  ? 170 PHE D C     1 
ATOM 5907  O O     . PHE C 3 170 ? -206.663 152.778 168.315 1.00 70.19  ? 170 PHE D O     1 
ATOM 5908  C CB    . PHE C 3 170 ? -203.874 151.394 167.872 1.00 70.19  ? 170 PHE D CB    1 
ATOM 5909  C CG    . PHE C 3 170 ? -202.649 151.012 168.648 1.00 70.19  ? 170 PHE D CG    1 
ATOM 5910  C CD1   . PHE C 3 170 ? -201.426 151.562 168.341 1.00 70.19  ? 170 PHE D CD1   1 
ATOM 5911  C CD2   . PHE C 3 170 ? -202.728 150.115 169.694 1.00 70.19  ? 170 PHE D CD2   1 
ATOM 5912  C CE1   . PHE C 3 170 ? -200.305 151.223 169.060 1.00 70.19  ? 170 PHE D CE1   1 
ATOM 5913  C CE2   . PHE C 3 170 ? -201.610 149.768 170.413 1.00 70.19  ? 170 PHE D CE2   1 
ATOM 5914  C CZ    . PHE C 3 170 ? -200.398 150.324 170.097 1.00 70.19  ? 170 PHE D CZ    1 
ATOM 5915  N N     . GLY C 3 171 ? -205.857 153.752 166.468 1.00 79.23  ? 171 GLY D N     1 
ATOM 5916  C CA    . GLY C 3 171 ? -207.183 154.154 166.057 1.00 79.23  ? 171 GLY D CA    1 
ATOM 5917  C C     . GLY C 3 171 ? -208.317 153.172 165.872 1.00 79.23  ? 171 GLY D C     1 
ATOM 5918  O O     . GLY C 3 171 ? -209.396 153.431 166.396 1.00 79.23  ? 171 GLY D O     1 
ATOM 5919  N N     . ARG C 3 172 ? -208.116 152.059 165.186 1.00 81.23  ? 172 ARG D N     1 
ATOM 5920  C CA    . ARG C 3 172 ? -209.220 151.124 165.020 1.00 81.23  ? 172 ARG D CA    1 
ATOM 5921  C C     . ARG C 3 172 ? -208.743 149.741 164.710 1.00 81.23  ? 172 ARG D C     1 
ATOM 5922  O O     . ARG C 3 172 ? -207.629 149.548 164.256 1.00 81.23  ? 172 ARG D O     1 
ATOM 5923  C CB    . ARG C 3 172 ? -210.221 151.617 163.966 1.00 81.23  ? 172 ARG D CB    1 
ATOM 5924  C CG    . ARG C 3 172 ? -210.039 151.078 162.558 1.00 81.23  ? 172 ARG D CG    1 
ATOM 5925  C CD    . ARG C 3 172 ? -211.265 150.321 162.080 1.00 81.23  ? 172 ARG D CD    1 
ATOM 5926  N NE    . ARG C 3 172 ? -211.595 150.645 160.698 1.00 81.23  ? 172 ARG D NE    1 
ATOM 5927  C CZ    . ARG C 3 172 ? -211.965 149.756 159.787 1.00 81.23  ? 172 ARG D CZ    1 
ATOM 5928  N NH1   . ARG C 3 172 ? -212.240 150.140 158.558 1.00 81.23  ? 172 ARG D NH1   1 
ATOM 5929  N NH2   . ARG C 3 172 ? -212.057 148.482 160.104 1.00 81.23  ? 172 ARG D NH2   1 
ATOM 5930  N N     . MET C 3 173 ? -209.599 148.769 164.947 1.00 83.90  ? 173 MET D N     1 
ATOM 5931  C CA    . MET C 3 173 ? -209.214 147.405 164.643 1.00 83.90  ? 173 MET D CA    1 
ATOM 5932  C C     . MET C 3 173 ? -209.325 147.215 163.145 1.00 83.90  ? 173 MET D C     1 
ATOM 5933  O O     . MET C 3 173 ? -210.257 147.717 162.521 1.00 83.90  ? 173 MET D O     1 
ATOM 5934  C CB    . MET C 3 173 ? -210.193 146.409 165.279 1.00 83.90  ? 173 MET D CB    1 
ATOM 5935  C CG    . MET C 3 173 ? -210.245 146.076 166.777 1.00 83.90  ? 173 MET D CG    1 
ATOM 5936  S SD    . MET C 3 173 ? -208.857 145.579 167.778 1.00 83.90  ? 173 MET D SD    1 
ATOM 5937  C CE    . MET C 3 173 ? -207.941 147.093 167.832 1.00 83.90  ? 173 MET D CE    1 
ATOM 5938  N N     . LEU C 3 174 ? -208.338 146.540 162.558 1.00 84.45  ? 174 LEU D N     1 
ATOM 5939  C CA    . LEU C 3 174 ? -208.326 146.406 161.103 1.00 84.45  ? 174 LEU D CA    1 
ATOM 5940  C C     . LEU C 3 174 ? -209.484 145.533 160.643 1.00 84.45  ? 174 LEU D C     1 
ATOM 5941  O O     . LEU C 3 174 ? -210.065 145.771 159.581 1.00 84.45  ? 174 LEU D O     1 
ATOM 5942  C CB    . LEU C 3 174 ? -206.977 145.932 160.574 1.00 84.45  ? 174 LEU D CB    1 
ATOM 5943  C CG    . LEU C 3 174 ? -206.382 144.553 160.729 1.00 84.45  ? 174 LEU D CG    1 
ATOM 5944  C CD1   . LEU C 3 174 ? -206.877 143.662 159.617 1.00 84.45  ? 174 LEU D CD1   1 
ATOM 5945  C CD2   . LEU C 3 174 ? -204.877 144.661 160.742 1.00 84.45  ? 174 LEU D CD2   1 
ATOM 5946  N N     . ALA C 3 175 ? -209.801 144.485 161.407 1.00 87.75  ? 175 ALA D N     1 
ATOM 5947  C CA    . ALA C 3 175 ? -210.776 143.480 160.998 1.00 87.75  ? 175 ALA D CA    1 
ATOM 5948  C C     . ALA C 3 175 ? -212.163 143.748 161.556 1.00 87.75  ? 175 ALA D C     1 
ATOM 5949  O O     . ALA C 3 175 ? -213.077 142.961 161.314 1.00 87.75  ? 175 ALA D O     1 
ATOM 5950  C CB    . ALA C 3 175 ? -210.307 142.088 161.419 1.00 87.75  ? 175 ALA D CB    1 
ATOM 5951  N N     . GLU C 3 176 ? -212.330 144.825 162.311 1.00 90.68  ? 176 GLU D N     1 
ATOM 5952  C CA    . GLU C 3 176 ? -213.606 145.232 162.872 1.00 90.68  ? 176 GLU D CA    1 
ATOM 5953  C C     . GLU C 3 176 ? -214.127 146.423 162.096 1.00 90.68  ? 176 GLU D C     1 
ATOM 5954  O O     . GLU C 3 176 ? -213.378 147.168 161.461 1.00 90.68  ? 176 GLU D O     1 
ATOM 5955  C CB    . GLU C 3 176 ? -213.586 145.530 164.369 1.00 90.68  ? 176 GLU D CB    1 
ATOM 5956  C CG    . GLU C 3 176 ? -213.007 144.438 165.216 1.00 90.68  ? 176 GLU D CG    1 
ATOM 5957  C CD    . GLU C 3 176 ? -213.826 143.162 165.072 1.00 90.68  ? 176 GLU D CD    1 
ATOM 5958  O OE1   . GLU C 3 176 ? -215.047 143.262 164.816 1.00 90.68  ? 176 GLU D OE1   1 
ATOM 5959  O OE2   . GLU C 3 176 ? -213.267 142.059 165.234 1.00 90.68  ? 176 GLU D OE2   1 
ATOM 5960  N N     . LEU C 3 177 ? -215.381 146.553 162.132 1.00 91.24  ? 177 LEU D N     1 
ATOM 5961  C CA    . LEU C 3 177 ? -216.036 147.621 161.437 1.00 91.24  ? 177 LEU D CA    1 
ATOM 5962  C C     . LEU C 3 177 ? -215.844 148.912 162.227 1.00 91.24  ? 177 LEU D C     1 
ATOM 5963  O O     . LEU C 3 177 ? -215.652 148.878 163.444 1.00 91.24  ? 177 LEU D O     1 
ATOM 5964  C CB    . LEU C 3 177 ? -217.503 147.267 161.333 1.00 91.24  ? 177 LEU D CB    1 
ATOM 5965  C CG    . LEU C 3 177 ? -217.549 145.991 160.489 1.00 91.24  ? 177 LEU D CG    1 
ATOM 5966  C CD1   . LEU C 3 177 ? -218.961 145.453 160.290 1.00 91.24  ? 177 LEU D CD1   1 
ATOM 5967  C CD2   . LEU C 3 177 ? -216.826 146.170 159.168 1.00 91.24  ? 177 LEU D CD2   1 
ATOM 5968  N N     . PRO C 3 178 ? -215.855 150.058 161.559 1.00 90.64  ? 178 PRO D N     1 
ATOM 5969  C CA    . PRO C 3 178 ? -215.539 151.311 162.251 1.00 90.64  ? 178 PRO D CA    1 
ATOM 5970  C C     . PRO C 3 178 ? -216.511 151.610 163.380 1.00 90.64  ? 178 PRO D C     1 
ATOM 5971  O O     . PRO C 3 178 ? -217.729 151.565 163.204 1.00 90.64  ? 178 PRO D O     1 
ATOM 5972  C CB    . PRO C 3 178 ? -215.621 152.352 161.135 1.00 90.64  ? 178 PRO D CB    1 
ATOM 5973  C CG    . PRO C 3 178 ? -215.313 151.588 159.926 1.00 90.64  ? 178 PRO D CG    1 
ATOM 5974  C CD    . PRO C 3 178 ? -215.918 150.245 160.107 1.00 90.64  ? 178 PRO D CD    1 
ATOM 5975  N N     . SER C 3 179 ? -215.961 151.946 164.543 1.00 94.61  ? 179 SER D N     1 
ATOM 5976  C CA    . SER C 3 179 ? -216.802 152.255 165.690 1.00 94.61  ? 179 SER D CA    1 
ATOM 5977  C C     . SER C 3 179 ? -216.746 153.738 166.011 1.00 94.61  ? 179 SER D C     1 
ATOM 5978  O O     . SER C 3 179 ? -216.562 154.123 167.170 1.00 94.61  ? 179 SER D O     1 
ATOM 5979  C CB    . SER C 3 179 ? -216.382 151.444 166.915 1.00 94.61  ? 179 SER D CB    1 
ATOM 5980  O OG    . SER C 3 179 ? -215.171 151.931 167.462 1.00 94.61  ? 179 SER D OG    1 
ATOM 5981  N N     . THR C 3 180 ? -216.896 154.572 164.986 1.00 95.96  ? 180 THR D N     1 
ATOM 5982  C CA    . THR C 3 180 ? -216.930 156.027 165.099 1.00 95.96  ? 180 THR D CA    1 
ATOM 5983  C C     . THR C 3 180 ? -215.657 156.663 165.653 1.00 95.96  ? 180 THR D C     1 
ATOM 5984  O O     . THR C 3 180 ? -215.599 157.887 165.801 1.00 95.96  ? 180 THR D O     1 
ATOM 5985  C CB    . THR C 3 180 ? -218.115 156.457 165.971 1.00 95.96  ? 180 THR D CB    1 
ATOM 5986  O OG1   . THR C 3 180 ? -217.882 156.060 167.329 1.00 95.96  ? 180 THR D OG1   1 
ATOM 5987  C CG2   . THR C 3 180 ? -219.406 155.818 165.484 1.00 95.96  ? 180 THR D CG2   1 
ATOM 5988  N N     . GLU C 3 181 ? -214.640 155.865 165.989 1.00 90.48  ? 181 GLU D N     1 
ATOM 5989  C CA    . GLU C 3 181 ? -213.327 156.388 166.385 1.00 90.48  ? 181 GLU D CA    1 
ATOM 5990  C C     . GLU C 3 181 ? -212.286 155.661 165.544 1.00 90.48  ? 181 GLU D C     1 
ATOM 5991  O O     . GLU C 3 181 ? -211.736 154.644 165.961 1.00 90.48  ? 181 GLU D O     1 
ATOM 5992  C CB    . GLU C 3 181 ? -213.055 156.270 167.862 1.00 90.48  ? 181 GLU D CB    1 
ATOM 5993  C CG    . GLU C 3 181 ? -211.656 156.734 168.205 1.00 90.48  ? 181 GLU D CG    1 
ATOM 5994  C CD    . GLU C 3 181 ? -211.509 158.239 168.059 1.00 90.48  ? 181 GLU D CD    1 
ATOM 5995  O OE1   . GLU C 3 181 ? -212.526 158.951 168.179 1.00 90.48  ? 181 GLU D OE1   1 
ATOM 5996  O OE2   . GLU C 3 181 ? -210.381 158.711 167.803 1.00 90.48  ? 181 GLU D OE2   1 
ATOM 5997  N N     . VAL C 3 182 ? -212.034 156.175 164.347 1.00 85.65  ? 182 VAL D N     1 
ATOM 5998  C CA    . VAL C 3 182 ? -211.016 155.604 163.480 1.00 85.65  ? 182 VAL D CA    1 
ATOM 5999  C C     . VAL C 3 182 ? -209.639 156.189 163.768 1.00 85.65  ? 182 VAL D C     1 
ATOM 6000  O O     . VAL C 3 182 ? -208.631 155.568 163.428 1.00 85.65  ? 182 VAL D O     1 
ATOM 6001  C CB    . VAL C 3 182 ? -211.409 155.793 162.012 1.00 85.65  ? 182 VAL D CB    1 
ATOM 6002  C CG1   . VAL C 3 182 ? -212.602 154.945 161.712 1.00 85.65  ? 182 VAL D CG1   1 
ATOM 6003  C CG2   . VAL C 3 182 ? -211.750 157.235 161.776 1.00 85.65  ? 182 VAL D CG2   1 
ATOM 6004  N N     . ASP C 3 183 ? -209.622 157.371 164.374 1.00 84.17  ? 183 ASP D N     1 
ATOM 6005  C CA    . ASP C 3 183 ? -208.383 158.045 164.724 1.00 84.17  ? 183 ASP D CA    1 
ATOM 6006  C C     . ASP C 3 183 ? -207.793 157.332 165.925 1.00 84.17  ? 183 ASP D C     1 
ATOM 6007  O O     . ASP C 3 183 ? -208.514 156.942 166.843 1.00 84.17  ? 183 ASP D O     1 
ATOM 6008  C CB    . ASP C 3 183 ? -208.642 159.515 165.053 1.00 84.17  ? 183 ASP D CB    1 
ATOM 6009  C CG    . ASP C 3 183 ? -208.200 160.448 163.943 1.00 84.17  ? 183 ASP D CG    1 
ATOM 6010  O OD1   . ASP C 3 183 ? -207.252 160.095 163.210 1.00 84.17  ? 183 ASP D OD1   1 
ATOM 6011  O OD2   . ASP C 3 183 ? -208.800 161.534 163.802 1.00 84.17  ? 183 ASP D OD2   1 
ATOM 6012  N N     . GLY C 3 184 ? -206.479 157.155 165.917 1.00 72.14  ? 184 GLY D N     1 
ATOM 6013  C CA    . GLY C 3 184 ? -205.811 156.466 167.007 1.00 72.14  ? 184 GLY D CA    1 
ATOM 6014  C C     . GLY C 3 184 ? -205.068 157.417 167.923 1.00 72.14  ? 184 GLY D C     1 
ATOM 6015  O O     . GLY C 3 184 ? -204.575 157.019 168.979 1.00 72.14  ? 184 GLY D O     1 
ATOM 6016  N N     . ALA C 3 185 ? -204.985 158.680 167.516 1.00 67.16  ? 185 ALA D N     1 
ATOM 6017  C CA    . ALA C 3 185 ? -204.297 159.695 168.304 1.00 67.16  ? 185 ALA D CA    1 
ATOM 6018  C C     . ALA C 3 185 ? -202.786 159.485 168.277 1.00 67.16  ? 185 ALA D C     1 
ATOM 6019  O O     . ALA C 3 185 ? -202.018 160.443 168.194 1.00 67.16  ? 185 ALA D O     1 
ATOM 6020  C CB    . ALA C 3 185 ? -204.809 159.692 169.737 1.00 67.16  ? 185 ALA D CB    1 
ATOM 6021  N N     . VAL C 3 186 ? -202.368 158.226 168.350 1.00 59.07  ? 186 VAL D N     1 
ATOM 6022  C CA    . VAL C 3 186 ? -200.958 157.890 168.334 1.00 59.07  ? 186 VAL D CA    1 
ATOM 6023  C C     . VAL C 3 186 ? -200.468 158.192 166.942 1.00 59.07  ? 186 VAL D C     1 
ATOM 6024  O O     . VAL C 3 186 ? -201.150 157.894 165.982 1.00 59.07  ? 186 VAL D O     1 
ATOM 6025  C CB    . VAL C 3 186 ? -200.740 156.398 168.626 1.00 59.07  ? 186 VAL D CB    1 
ATOM 6026  C CG1   . VAL C 3 186 ? -199.311 156.000 168.350 1.00 59.07  ? 186 VAL D CG1   1 
ATOM 6027  C CG2   . VAL C 3 186 ? -201.064 156.092 170.067 1.00 59.07  ? 186 VAL D CG2   1 
ATOM 6028  N N     . GLN C 3 187 ? -199.287 158.770 166.822 1.00 51.66  ? 187 GLN D N     1 
ATOM 6029  C CA    . GLN C 3 187 ? -198.745 159.079 165.516 1.00 51.66  ? 187 GLN D CA    1 
ATOM 6030  C C     . GLN C 3 187 ? -197.431 158.358 165.376 1.00 51.66  ? 187 GLN D C     1 
ATOM 6031  O O     . GLN C 3 187 ? -196.578 158.481 166.233 1.00 51.66  ? 187 GLN D O     1 
ATOM 6032  C CB    . GLN C 3 187 ? -198.525 160.578 165.396 1.00 51.66  ? 187 GLN D CB    1 
ATOM 6033  C CG    . GLN C 3 187 ? -197.916 161.019 164.082 1.00 51.66  ? 187 GLN D CG    1 
ATOM 6034  C CD    . GLN C 3 187 ? -198.236 162.458 163.747 1.00 51.66  ? 187 GLN D CD    1 
ATOM 6035  O OE1   . GLN C 3 187 ? -198.492 163.269 164.624 1.00 51.66  ? 187 GLN D OE1   1 
ATOM 6036  N NE2   . GLN C 3 187 ? -198.219 162.778 162.471 1.00 51.66  ? 187 GLN D NE2   1 
ATOM 6037  N N     . PHE C 3 188 ? -197.253 157.603 164.304 1.00 50.67  ? 188 PHE D N     1 
ATOM 6038  C CA    . PHE C 3 188 ? -196.005 156.888 164.117 1.00 50.67  ? 188 PHE D CA    1 
ATOM 6039  C C     . PHE C 3 188 ? -195.281 157.430 162.912 1.00 50.67  ? 188 PHE D C     1 
ATOM 6040  O O     . PHE C 3 188 ? -195.788 157.369 161.814 1.00 50.67  ? 188 PHE D O     1 
ATOM 6041  C CB    . PHE C 3 188 ? -196.298 155.420 163.865 1.00 50.67  ? 188 PHE D CB    1 
ATOM 6042  C CG    . PHE C 3 188 ? -195.749 154.499 164.906 1.00 50.67  ? 188 PHE D CG    1 
ATOM 6043  C CD1   . PHE C 3 188 ? -196.427 154.286 166.081 1.00 50.67  ? 188 PHE D CD1   1 
ATOM 6044  C CD2   . PHE C 3 188 ? -194.564 153.833 164.692 1.00 50.67  ? 188 PHE D CD2   1 
ATOM 6045  C CE1   . PHE C 3 188 ? -195.923 153.438 167.034 1.00 50.67  ? 188 PHE D CE1   1 
ATOM 6046  C CE2   . PHE C 3 188 ? -194.056 152.979 165.636 1.00 50.67  ? 188 PHE D CE2   1 
ATOM 6047  C CZ    . PHE C 3 188 ? -194.737 152.780 166.808 1.00 50.67  ? 188 PHE D CZ    1 
ATOM 6048  N N     . ALA C 3 189 ? -194.088 157.949 163.115 1.00 49.62  ? 189 ALA D N     1 
ATOM 6049  C CA    . ALA C 3 189 ? -193.308 158.470 162.019 1.00 49.62  ? 189 ALA D CA    1 
ATOM 6050  C C     . ALA C 3 189 ? -192.672 157.282 161.356 1.00 49.62  ? 189 ALA D C     1 
ATOM 6051  O O     . ALA C 3 189 ? -192.586 156.225 161.958 1.00 49.62  ? 189 ALA D O     1 
ATOM 6052  C CB    . ALA C 3 189 ? -192.246 159.419 162.525 1.00 49.62  ? 189 ALA D CB    1 
ATOM 6053  N N     . HIS C 3 190 ? -192.229 157.435 160.120 1.00 49.21  ? 190 HIS D N     1 
ATOM 6054  C CA    . HIS C 3 190 ? -191.592 156.329 159.445 1.00 49.21  ? 190 HIS D CA    1 
ATOM 6055  C C     . HIS C 3 190 ? -190.127 156.322 159.835 1.00 49.21  ? 190 HIS D C     1 
ATOM 6056  O O     . HIS C 3 190 ? -189.451 157.318 159.673 1.00 49.21  ? 190 HIS D O     1 
ATOM 6057  C CB    . HIS C 3 190 ? -191.674 156.524 157.939 1.00 49.21  ? 190 HIS D CB    1 
ATOM 6058  C CG    . HIS C 3 190 ? -193.026 156.263 157.357 1.00 49.21  ? 190 HIS D CG    1 
ATOM 6059  N ND1   . HIS C 3 190 ? -193.204 155.835 156.061 1.00 49.21  ? 190 HIS D ND1   1 
ATOM 6060  C CD2   . HIS C 3 190 ? -194.262 156.375 157.886 1.00 49.21  ? 190 HIS D CD2   1 
ATOM 6061  C CE1   . HIS C 3 190 ? -194.490 155.695 155.817 1.00 49.21  ? 190 HIS D CE1   1 
ATOM 6062  N NE2   . HIS C 3 190 ? -195.155 156.017 156.907 1.00 49.21  ? 190 HIS D NE2   1 
ATOM 6063  N N     . ALA C 3 191 ? -189.625 155.207 160.339 1.00 47.73  ? 191 ALA D N     1 
ATOM 6064  C CA    . ALA C 3 191 ? -188.218 155.098 160.694 1.00 47.73  ? 191 ALA D CA    1 
ATOM 6065  C C     . ALA C 3 191 ? -187.304 155.170 159.483 1.00 47.73  ? 191 ALA D C     1 
ATOM 6066  O O     . ALA C 3 191 ? -187.550 154.521 158.470 1.00 47.73  ? 191 ALA D O     1 
ATOM 6067  C CB    . ALA C 3 191 ? -187.986 153.777 161.388 1.00 47.73  ? 191 ALA D CB    1 
ATOM 6068  N N     . PHE C 3 192 ? -186.228 155.945 159.597 1.00 47.10  ? 192 PHE D N     1 
ATOM 6069  C CA    . PHE C 3 192 ? -185.271 156.119 158.516 1.00 47.10  ? 192 PHE D CA    1 
ATOM 6070  C C     . PHE C 3 192 ? -183.865 156.173 159.083 1.00 47.10  ? 192 PHE D C     1 
ATOM 6071  O O     . PHE C 3 192 ? -183.664 156.580 160.226 1.00 47.10  ? 192 PHE D O     1 
ATOM 6072  C CB    . PHE C 3 192 ? -185.564 157.361 157.697 1.00 47.10  ? 192 PHE D CB    1 
ATOM 6073  C CG    . PHE C 3 192 ? -185.420 158.613 158.452 1.00 47.10  ? 192 PHE D CG    1 
ATOM 6074  C CD1   . PHE C 3 192 ? -186.373 158.983 159.358 1.00 47.10  ? 192 PHE D CD1   1 
ATOM 6075  C CD2   . PHE C 3 192 ? -184.358 159.444 158.233 1.00 47.10  ? 192 PHE D CD2   1 
ATOM 6076  C CE1   . PHE C 3 192 ? -186.248 160.127 160.054 1.00 47.10  ? 192 PHE D CE1   1 
ATOM 6077  C CE2   . PHE C 3 192 ? -184.237 160.592 158.922 1.00 47.10  ? 192 PHE D CE2   1 
ATOM 6078  C CZ    . PHE C 3 192 ? -185.181 160.936 159.835 1.00 47.10  ? 192 PHE D CZ    1 
ATOM 6079  N N     . THR C 3 193 ? -182.897 155.758 158.274 1.00 49.59  ? 193 THR D N     1 
ATOM 6080  C CA    . THR C 3 193 ? -181.516 155.653 158.722 1.00 49.59  ? 193 THR D CA    1 
ATOM 6081  C C     . THR C 3 193 ? -180.867 156.999 158.956 1.00 49.59  ? 193 THR D C     1 
ATOM 6082  O O     . THR C 3 193 ? -181.152 157.966 158.258 1.00 49.59  ? 193 THR D O     1 
ATOM 6083  C CB    . THR C 3 193 ? -180.674 154.903 157.694 1.00 49.59  ? 193 THR D CB    1 
ATOM 6084  O OG1   . THR C 3 193 ? -181.228 155.017 156.382 1.00 49.59  ? 193 THR D OG1   1 
ATOM 6085  C CG2   . THR C 3 193 ? -180.325 153.553 158.049 1.00 49.59  ? 193 THR D CG2   1 
ATOM 6086  N N     . VAL C 3 194 ? -180.005 157.063 159.974 1.00 52.25  ? 194 VAL D N     1 
ATOM 6087  C CA    . VAL C 3 194 ? -179.274 158.287 160.275 1.00 52.25  ? 194 VAL D CA    1 
ATOM 6088  C C     . VAL C 3 194 ? -178.397 158.688 159.099 1.00 52.25  ? 194 VAL D C     1 
ATOM 6089  O O     . VAL C 3 194 ? -178.224 159.874 158.821 1.00 52.25  ? 194 VAL D O     1 
ATOM 6090  C CB    . VAL C 3 194 ? -178.449 158.076 161.553 1.00 52.25  ? 194 VAL D CB    1 
ATOM 6091  C CG1   . VAL C 3 194 ? -177.397 159.132 161.692 1.00 52.25  ? 194 VAL D CG1   1 
ATOM 6092  C CG2   . VAL C 3 194 ? -179.348 158.121 162.730 1.00 52.25  ? 194 VAL D CG2   1 
ATOM 6093  N N     . HIS C 3 195 ? -177.847 157.717 158.386 1.00 53.27  ? 195 HIS D N     1 
ATOM 6094  C CA    . HIS C 3 195 ? -176.893 157.914 157.308 1.00 53.27  ? 195 HIS D CA    1 
ATOM 6095  C C     . HIS C 3 195 ? -177.471 157.414 155.995 1.00 53.27  ? 195 HIS D C     1 
ATOM 6096  O O     . HIS C 3 195 ? -178.501 156.748 155.960 1.00 53.27  ? 195 HIS D O     1 
ATOM 6097  C CB    . HIS C 3 195 ? -175.611 157.164 157.599 1.00 53.27  ? 195 HIS D CB    1 
ATOM 6098  C CG    . HIS C 3 195 ? -175.830 155.704 157.767 1.00 53.27  ? 195 HIS D CG    1 
ATOM 6099  N ND1   . HIS C 3 195 ? -176.320 155.166 158.933 1.00 53.27  ? 195 HIS D ND1   1 
ATOM 6100  C CD2   . HIS C 3 195 ? -175.670 154.671 156.912 1.00 53.27  ? 195 HIS D CD2   1 
ATOM 6101  C CE1   . HIS C 3 195 ? -176.439 153.860 158.796 1.00 53.27  ? 195 HIS D CE1   1 
ATOM 6102  N NE2   . HIS C 3 195 ? -176.048 153.535 157.580 1.00 53.27  ? 195 HIS D NE2   1 
ATOM 6103  N N     . GLY C 3 196 ? -176.806 157.763 154.899 1.00 54.23  ? 196 GLY D N     1 
ATOM 6104  C CA    . GLY C 3 196 ? -177.191 157.232 153.601 1.00 54.23  ? 196 GLY D CA    1 
ATOM 6105  C C     . GLY C 3 196 ? -176.715 155.799 153.442 1.00 54.23  ? 196 GLY D C     1 
ATOM 6106  O O     . GLY C 3 196 ? -175.611 155.448 153.849 1.00 54.23  ? 196 GLY D O     1 
ATOM 6107  N N     . THR C 3 197 ? -177.557 154.961 152.836 1.00 55.27  ? 197 THR D N     1 
ATOM 6108  C CA    . THR C 3 197 ? -177.288 153.528 152.749 1.00 55.27  ? 197 THR D CA    1 
ATOM 6109  C C     . THR C 3 197 ? -177.460 153.008 151.332 1.00 55.27  ? 197 THR D C     1 
ATOM 6110  O O     . THR C 3 197 ? -178.528 153.171 150.742 1.00 55.27  ? 197 THR D O     1 
ATOM 6111  C CB    . THR C 3 197 ? -178.230 152.728 153.635 1.00 55.27  ? 197 THR D CB    1 
ATOM 6112  O OG1   . THR C 3 197 ? -179.564 152.898 153.153 1.00 55.27  ? 197 THR D OG1   1 
ATOM 6113  C CG2   . THR C 3 197 ? -178.161 153.199 155.055 1.00 55.27  ? 197 THR D CG2   1 
ATOM 6114  N N     . THR C 3 198 ? -176.430 152.362 150.799 1.00 61.33  ? 198 THR D N     1 
ATOM 6115  C CA    . THR C 3 198 ? -176.563 151.662 149.530 1.00 61.33  ? 198 THR D CA    1 
ATOM 6116  C C     . THR C 3 198 ? -177.112 150.253 149.753 1.00 61.33  ? 198 THR D C     1 
ATOM 6117  O O     . THR C 3 198 ? -176.738 149.563 150.702 1.00 61.33  ? 198 THR D O     1 
ATOM 6118  C CB    . THR C 3 198 ? -175.228 151.624 148.783 1.00 61.33  ? 198 THR D CB    1 
ATOM 6119  O OG1   . THR C 3 198 ? -175.437 151.112 147.462 1.00 61.33  ? 198 THR D OG1   1 
ATOM 6120  C CG2   . THR C 3 198 ? -174.210 150.761 149.505 1.00 61.33  ? 198 THR D CG2   1 
ATOM 6121  N N     . VAL C 3 199 ? -178.026 149.846 148.878 1.00 57.05  ? 199 VAL D N     1 
ATOM 6122  C CA    . VAL C 3 199 ? -178.682 148.541 148.916 1.00 57.05  ? 199 VAL D CA    1 
ATOM 6123  C C     . VAL C 3 199 ? -177.687 147.430 148.622 1.00 57.05  ? 199 VAL D C     1 
ATOM 6124  O O     . VAL C 3 199 ? -177.009 147.447 147.590 1.00 57.05  ? 199 VAL D O     1 
ATOM 6125  C CB    . VAL C 3 199 ? -179.845 148.495 147.927 1.00 57.05  ? 199 VAL D CB    1 
ATOM 6126  C CG1   . VAL C 3 199 ? -180.483 147.172 147.978 1.00 57.05  ? 199 VAL D CG1   1 
ATOM 6127  C CG2   . VAL C 3 199 ? -180.851 149.540 148.289 1.00 57.05  ? 199 VAL D CG2   1 
ATOM 6128  N N     . GLU C 3 200 ? -177.592 146.458 149.527 1.00 58.82  ? 200 GLU D N     1 
ATOM 6129  C CA    . GLU C 3 200 ? -176.572 145.417 149.453 1.00 58.82  ? 200 GLU D CA    1 
ATOM 6130  C C     . GLU C 3 200 ? -177.166 144.125 148.916 1.00 58.82  ? 200 GLU D C     1 
ATOM 6131  O O     . GLU C 3 200 ? -178.016 143.514 149.569 1.00 58.82  ? 200 GLU D O     1 
ATOM 6132  C CB    . GLU C 3 200 ? -175.974 145.139 150.822 1.00 58.82  ? 200 GLU D CB    1 
ATOM 6133  C CG    . GLU C 3 200 ? -175.247 146.262 151.433 1.00 58.82  ? 200 GLU D CG    1 
ATOM 6134  C CD    . GLU C 3 200 ? -174.999 145.982 152.872 1.00 58.82  ? 200 GLU D CD    1 
ATOM 6135  O OE1   . GLU C 3 200 ? -175.471 144.925 153.333 1.00 58.82  ? 200 GLU D OE1   1 
ATOM 6136  O OE2   . GLU C 3 200 ? -174.363 146.812 153.543 1.00 58.82  ? 200 GLU D OE2   1 
ATOM 6137  N N     . VAL C 3 201 ? -176.776 143.746 147.714 1.00 58.32  ? 201 VAL D N     1 
ATOM 6138  C CA    . VAL C 3 201 ? -177.309 142.538 147.102 1.00 58.32  ? 201 VAL D CA    1 
ATOM 6139  C C     . VAL C 3 201 ? -176.621 141.317 147.690 1.00 58.32  ? 201 VAL D C     1 
ATOM 6140  O O     . VAL C 3 201 ? -175.401 141.304 147.862 1.00 58.32  ? 201 VAL D O     1 
ATOM 6141  C CB    . VAL C 3 201 ? -177.120 142.584 145.584 1.00 58.32  ? 201 VAL D CB    1 
ATOM 6142  C CG1   . VAL C 3 201 ? -177.610 141.307 144.979 1.00 58.32  ? 201 VAL D CG1   1 
ATOM 6143  C CG2   . VAL C 3 201 ? -177.866 143.751 145.003 1.00 58.32  ? 201 VAL D CG2   1 
ATOM 6144  N N     . ASP C 3 202 ? -177.392 140.274 147.973 1.00 55.36  ? 202 ASP D N     1 
ATOM 6145  C CA    . ASP C 3 202 ? -176.897 139.007 148.509 1.00 55.36  ? 202 ASP D CA    1 
ATOM 6146  C C     . ASP C 3 202 ? -177.308 137.924 147.535 1.00 55.36  ? 202 ASP D C     1 
ATOM 6147  O O     . ASP C 3 202 ? -178.480 137.546 147.489 1.00 55.36  ? 202 ASP D O     1 
ATOM 6148  C CB    . ASP C 3 202 ? -177.440 138.703 149.891 1.00 55.36  ? 202 ASP D CB    1 
ATOM 6149  C CG    . ASP C 3 202 ? -177.172 137.269 150.322 1.00 55.36  ? 202 ASP D CG    1 
ATOM 6150  O OD1   . ASP C 3 202 ? -176.023 136.960 150.694 1.00 55.36  ? 202 ASP D OD1   1 
ATOM 6151  O OD2   . ASP C 3 202 ? -178.121 136.465 150.340 1.00 55.36  ? 202 ASP D OD2   1 
ATOM 6152  N N     . PHE C 3 203 ? -176.366 137.431 146.753 1.00 52.00  ? 203 PHE D N     1 
ATOM 6153  C CA    . PHE C 3 203 ? -176.672 136.395 145.788 1.00 52.00  ? 203 PHE D CA    1 
ATOM 6154  C C     . PHE C 3 203 ? -176.725 135.058 146.509 1.00 52.00  ? 203 PHE D C     1 
ATOM 6155  O O     . PHE C 3 203 ? -175.806 134.730 147.253 1.00 52.00  ? 203 PHE D O     1 
ATOM 6156  C CB    . PHE C 3 203 ? -175.597 136.400 144.718 1.00 52.00  ? 203 PHE D CB    1 
ATOM 6157  C CG    . PHE C 3 203 ? -175.705 135.296 143.759 1.00 52.00  ? 203 PHE D CG    1 
ATOM 6158  C CD1   . PHE C 3 203 ? -176.572 135.398 142.702 1.00 52.00  ? 203 PHE D CD1   1 
ATOM 6159  C CD2   . PHE C 3 203 ? -174.949 134.167 143.892 1.00 52.00  ? 203 PHE D CD2   1 
ATOM 6160  C CE1   . PHE C 3 203 ? -176.679 134.403 141.808 1.00 52.00  ? 203 PHE D CE1   1 
ATOM 6161  C CE2   . PHE C 3 203 ? -175.064 133.171 142.999 1.00 52.00  ? 203 PHE D CE2   1 
ATOM 6162  C CZ    . PHE C 3 203 ? -175.927 133.287 141.958 1.00 52.00  ? 203 PHE D CZ    1 
ATOM 6163  N N     . PHE C 3 204 ? -177.773 134.272 146.273 1.00 52.03  ? 204 PHE D N     1 
ATOM 6164  C CA    . PHE C 3 204 ? -177.947 132.995 146.956 1.00 52.03  ? 204 PHE D CA    1 
ATOM 6165  C C     . PHE C 3 204 ? -178.461 131.934 145.997 1.00 52.03  ? 204 PHE D C     1 
ATOM 6166  O O     . PHE C 3 204 ? -179.084 132.241 144.985 1.00 52.03  ? 204 PHE D O     1 
ATOM 6167  C CB    . PHE C 3 204 ? -178.889 133.095 148.140 1.00 52.03  ? 204 PHE D CB    1 
ATOM 6168  C CG    . PHE C 3 204 ? -180.284 133.408 147.767 1.00 52.03  ? 204 PHE D CG    1 
ATOM 6169  C CD1   . PHE C 3 204 ? -180.691 134.706 147.649 1.00 52.03  ? 204 PHE D CD1   1 
ATOM 6170  C CD2   . PHE C 3 204 ? -181.180 132.414 147.484 1.00 52.03  ? 204 PHE D CD2   1 
ATOM 6171  C CE1   . PHE C 3 204 ? -181.967 135.006 147.303 1.00 52.03  ? 204 PHE D CE1   1 
ATOM 6172  C CE2   . PHE C 3 204 ? -182.457 132.714 147.123 1.00 52.03  ? 204 PHE D CE2   1 
ATOM 6173  C CZ    . PHE C 3 204 ? -182.848 134.009 147.035 1.00 52.03  ? 204 PHE D CZ    1 
ATOM 6174  N N     . THR C 3 205 ? -178.195 130.670 146.333 1.00 54.84  ? 205 THR D N     1 
ATOM 6175  C CA    . THR C 3 205 ? -178.651 129.533 145.538 1.00 54.84  ? 205 THR D CA    1 
ATOM 6176  C C     . THR C 3 205 ? -179.135 128.400 146.420 1.00 54.84  ? 205 THR D C     1 
ATOM 6177  O O     . THR C 3 205 ? -178.368 127.901 147.239 1.00 54.84  ? 205 THR D O     1 
ATOM 6178  C CB    . THR C 3 205 ? -177.524 129.003 144.679 1.00 54.84  ? 205 THR D CB    1 
ATOM 6179  O OG1   . THR C 3 205 ? -176.454 128.623 145.537 1.00 54.84  ? 205 THR D OG1   1 
ATOM 6180  C CG2   . THR C 3 205 ? -177.023 130.081 143.768 1.00 54.84  ? 205 THR D CG2   1 
ATOM 6181  N N     . ALA C 3 206 ? -180.381 127.977 146.240 1.00 59.09  ? 206 ALA D N     1 
ATOM 6182  C CA    . ALA C 3 206 ? -180.890 126.784 146.899 1.00 59.09  ? 206 ALA D CA    1 
ATOM 6183  C C     . ALA C 3 206 ? -180.363 125.527 146.228 1.00 59.09  ? 206 ALA D C     1 
ATOM 6184  O O     . ALA C 3 206 ? -180.393 125.408 144.998 1.00 59.09  ? 206 ALA D O     1 
ATOM 6185  C CB    . ALA C 3 206 ? -182.411 126.777 146.873 1.00 59.09  ? 206 ALA D CB    1 
ATOM 6186  N N     . VAL C 3 207 ? -179.910 124.583 147.055 1.00 61.55  ? 207 VAL D N     1 
ATOM 6187  C CA    . VAL C 3 207 ? -179.203 123.382 146.628 1.00 61.55  ? 207 VAL D CA    1 
ATOM 6188  C C     . VAL C 3 207 ? -180.175 122.237 146.411 1.00 61.55  ? 207 VAL D C     1 
ATOM 6189  O O     . VAL C 3 207 ? -181.062 121.994 147.231 1.00 61.55  ? 207 VAL D O     1 
ATOM 6190  C CB    . VAL C 3 207 ? -178.139 122.976 147.651 1.00 61.55  ? 207 VAL D CB    1 
ATOM 6191  C CG1   . VAL C 3 207 ? -177.421 121.766 147.171 1.00 61.55  ? 207 VAL D CG1   1 
ATOM 6192  C CG2   . VAL C 3 207 ? -177.174 124.080 147.820 1.00 61.55  ? 207 VAL D CG2   1 
ATOM 6193  N N     . ASP C 3 208 ? -179.993 121.535 145.303 1.00 67.72  ? 208 ASP D N     1 
ATOM 6194  C CA    . ASP C 3 208 ? -180.738 120.332 144.967 1.00 67.72  ? 208 ASP D CA    1 
ATOM 6195  C C     . ASP C 3 208 ? -180.091 119.130 145.628 1.00 67.72  ? 208 ASP D C     1 
ATOM 6196  O O     . ASP C 3 208 ? -178.905 118.864 145.417 1.00 67.72  ? 208 ASP D O     1 
ATOM 6197  C CB    . ASP C 3 208 ? -180.792 120.124 143.464 1.00 67.72  ? 208 ASP D CB    1 
ATOM 6198  C CG    . ASP C 3 208 ? -181.912 119.203 143.056 1.00 67.72  ? 208 ASP D CG    1 
ATOM 6199  O OD1   . ASP C 3 208 ? -182.551 118.604 143.942 1.00 67.72  ? 208 ASP D OD1   1 
ATOM 6200  O OD2   . ASP C 3 208 ? -182.150 119.075 141.843 1.00 67.72  ? 208 ASP D OD2   1 
ATOM 6201  N N     . ASP C 3 209 ? -180.860 118.409 146.431 1.00 72.18  ? 209 ASP D N     1 
ATOM 6202  C CA    . ASP C 3 209 ? -180.303 117.353 147.260 1.00 72.18  ? 209 ASP D CA    1 
ATOM 6203  C C     . ASP C 3 209 ? -180.042 116.098 146.444 1.00 72.18  ? 209 ASP D C     1 
ATOM 6204  O O     . ASP C 3 209 ? -179.053 115.400 146.673 1.00 72.18  ? 209 ASP D O     1 
ATOM 6205  C CB    . ASP C 3 209 ? -181.257 117.038 148.393 1.00 72.18  ? 209 ASP D CB    1 
ATOM 6206  C CG    . ASP C 3 209 ? -181.007 117.877 149.605 1.00 72.18  ? 209 ASP D CG    1 
ATOM 6207  O OD1   . ASP C 3 209 ? -179.867 118.346 149.780 1.00 72.18  ? 209 ASP D OD1   1 
ATOM 6208  O OD2   . ASP C 3 209 ? -181.957 118.046 150.393 1.00 72.18  ? 209 ASP D OD2   1 
ATOM 6209  N N     . ILE C 3 210 ? -180.955 115.752 145.550 1.00 76.08  ? 210 ILE D N     1 
ATOM 6210  C CA    . ILE C 3 210 ? -180.815 114.613 144.646 1.00 76.08  ? 210 ILE D CA    1 
ATOM 6211  C C     . ILE C 3 210 ? -179.781 114.914 143.561 1.00 76.08  ? 210 ILE D C     1 
ATOM 6212  O O     . ILE C 3 210 ? -179.963 115.850 142.770 1.00 76.08  ? 210 ILE D O     1 
ATOM 6213  C CB    . ILE C 3 210 ? -182.167 114.213 144.056 1.00 76.08  ? 210 ILE D CB    1 
ATOM 6214  C CG1   . ILE C 3 210 ? -183.186 114.025 145.166 1.00 76.08  ? 210 ILE D CG1   1 
ATOM 6215  C CG2   . ILE C 3 210 ? -182.030 112.908 143.377 1.00 76.08  ? 210 ILE D CG2   1 
ATOM 6216  C CD1   . ILE C 3 210 ? -182.651 113.263 146.341 1.00 76.08  ? 210 ILE D CD1   1 
ATOM 6217  N N     . PRO C 3 211 ? -178.699 114.158 143.477 1.00 83.09  ? 211 PRO D N     1 
ATOM 6218  C CA    . PRO C 3 211 ? -177.640 114.465 142.508 1.00 83.09  ? 211 PRO D CA    1 
ATOM 6219  C C     . PRO C 3 211 ? -177.710 113.655 141.223 1.00 83.09  ? 211 PRO D C     1 
ATOM 6220  O O     . PRO C 3 211 ? -177.765 112.425 141.242 1.00 83.09  ? 211 PRO D O     1 
ATOM 6221  C CB    . PRO C 3 211 ? -176.371 114.130 143.285 1.00 83.09  ? 211 PRO D CB    1 
ATOM 6222  C CG    . PRO C 3 211 ? -176.798 113.008 144.176 1.00 83.09  ? 211 PRO D CG    1 
ATOM 6223  C CD    . PRO C 3 211 ? -178.285 113.096 144.404 1.00 83.09  ? 211 PRO D CD    1 
ATOM 6224  N N     . LYS C 3 212 ? -177.729 114.351 140.092 1.00 93.52  ? 212 LYS D N     1 
ATOM 6225  C CA    . LYS C 3 212 ? -177.653 113.710 138.790 1.00 93.52  ? 212 LYS D CA    1 
ATOM 6226  C C     . LYS C 3 212 ? -176.221 113.345 138.422 1.00 93.52  ? 212 LYS D C     1 
ATOM 6227  O O     . LYS C 3 212 ? -175.271 113.603 139.166 1.00 93.52  ? 212 LYS D O     1 
ATOM 6228  C CB    . LYS C 3 212 ? -178.097 114.703 137.727 1.00 93.52  ? 212 LYS D CB    1 
ATOM 6229  C CG    . LYS C 3 212 ? -179.408 115.360 137.948 1.00 93.52  ? 212 LYS D CG    1 
ATOM 6230  C CD    . LYS C 3 212 ? -180.512 114.523 137.424 1.00 93.52  ? 212 LYS D CD    1 
ATOM 6231  C CE    . LYS C 3 212 ? -180.255 114.273 135.958 1.00 93.52  ? 212 LYS D CE    1 
ATOM 6232  N NZ    . LYS C 3 212 ? -181.365 113.538 135.321 1.00 93.52  ? 212 LYS D NZ    1 
ATOM 6233  N N     . GLU C 3 213 ? -176.045 112.771 137.222 1.00 102.18 ? 213 GLU D N     1 
ATOM 6234  C CA    . GLU C 3 213 ? -174.695 112.523 136.726 1.00 102.18 ? 213 GLU D CA    1 
ATOM 6235  C C     . GLU C 3 213 ? -174.222 113.905 136.317 1.00 102.18 ? 213 GLU D C     1 
ATOM 6236  O O     . GLU C 3 213 ? -173.869 114.144 135.160 1.00 102.18 ? 213 GLU D O     1 
ATOM 6237  C CB    . GLU C 3 213 ? -174.690 111.593 135.516 1.00 102.18 ? 213 GLU D CB    1 
ATOM 6238  C CG    . GLU C 3 213 ? -175.181 110.172 135.732 1.00 102.18 ? 213 GLU D CG    1 
ATOM 6239  C CD    . GLU C 3 213 ? -174.194 109.311 136.487 1.00 102.18 ? 213 GLU D CD    1 
ATOM 6240  O OE1   . GLU C 3 213 ? -172.978 109.564 136.378 1.00 102.18 ? 213 GLU D OE1   1 
ATOM 6241  O OE2   . GLU C 3 213 ? -174.630 108.362 137.165 1.00 102.18 ? 213 GLU D OE2   1 
ATOM 6242  N N     . ASN C 3 214 ? -174.277 114.827 137.257 1.00 102.25 ? 214 ASN D N     1 
ATOM 6243  C CA    . ASN C 3 214 ? -173.954 116.220 137.061 1.00 102.25 ? 214 ASN D CA    1 
ATOM 6244  C C     . ASN C 3 214 ? -173.750 116.811 138.437 1.00 102.25 ? 214 ASN D C     1 
ATOM 6245  O O     . ASN C 3 214 ? -174.340 116.338 139.411 1.00 102.25 ? 214 ASN D O     1 
ATOM 6246  C CB    . ASN C 3 214 ? -175.070 116.943 136.311 1.00 102.25 ? 214 ASN D CB    1 
ATOM 6247  C CG    . ASN C 3 214 ? -174.742 118.376 136.013 1.00 102.25 ? 214 ASN D CG    1 
ATOM 6248  O OD1   . ASN C 3 214 ? -173.668 118.877 136.349 1.00 102.25 ? 214 ASN D OD1   1 
ATOM 6249  N ND2   . ASN C 3 214 ? -175.673 119.053 135.366 1.00 102.25 ? 214 ASN D ND2   1 
ATOM 6250  N N     . ASP C 3 215 ? -172.900 117.807 138.541 1.00 102.91 ? 215 ASP D N     1 
ATOM 6251  C CA    . ASP C 3 215 ? -172.630 118.343 139.854 1.00 102.91 ? 215 ASP D CA    1 
ATOM 6252  C C     . ASP C 3 215 ? -173.005 119.815 139.823 1.00 102.91 ? 215 ASP D C     1 
ATOM 6253  O O     . ASP C 3 215 ? -172.691 120.528 138.866 1.00 102.91 ? 215 ASP D O     1 
ATOM 6254  C CB    . ASP C 3 215 ? -171.158 118.142 140.222 1.00 102.91 ? 215 ASP D CB    1 
ATOM 6255  C CG    . ASP C 3 215 ? -170.874 116.764 140.789 1.00 102.91 ? 215 ASP D CG    1 
ATOM 6256  O OD1   . ASP C 3 215 ? -171.759 116.175 141.440 1.00 102.91 ? 215 ASP D OD1   1 
ATOM 6257  O OD2   . ASP C 3 215 ? -169.749 116.269 140.583 1.00 102.91 ? 215 ASP D OD2   1 
ATOM 6258  N N     . HIS C 3 216 ? -173.713 120.257 140.859 1.00 98.46  ? 216 HIS D N     1 
ATOM 6259  C CA    . HIS C 3 216 ? -173.957 121.664 141.132 1.00 98.46  ? 216 HIS D CA    1 
ATOM 6260  C C     . HIS C 3 216 ? -174.977 122.341 140.231 1.00 98.46  ? 216 HIS D C     1 
ATOM 6261  O O     . HIS C 3 216 ? -175.065 123.573 140.251 1.00 98.46  ? 216 HIS D O     1 
ATOM 6262  C CB    . HIS C 3 216 ? -172.656 122.461 141.196 1.00 98.46  ? 216 HIS D CB    1 
ATOM 6263  C CG    . HIS C 3 216 ? -171.579 121.758 141.956 1.00 98.46  ? 216 HIS D CG    1 
ATOM 6264  N ND1   . HIS C 3 216 ? -170.656 120.921 141.379 1.00 98.46  ? 216 HIS D ND1   1 
ATOM 6265  C CD2   . HIS C 3 216 ? -171.328 121.737 143.284 1.00 98.46  ? 216 HIS D CD2   1 
ATOM 6266  C CE1   . HIS C 3 216 ? -169.861 120.436 142.316 1.00 98.46  ? 216 HIS D CE1   1 
ATOM 6267  N NE2   . HIS C 3 216 ? -170.242 120.922 143.481 1.00 98.46  ? 216 HIS D NE2   1 
ATOM 6268  N N     . GLY C 3 217 ? -175.701 121.611 139.399 1.00 88.73  ? 217 GLY D N     1 
ATOM 6269  C CA    . GLY C 3 217 ? -176.804 122.251 138.721 1.00 88.73  ? 217 GLY D CA    1 
ATOM 6270  C C     . GLY C 3 217 ? -177.763 122.701 139.803 1.00 88.73  ? 217 GLY D C     1 
ATOM 6271  O O     . GLY C 3 217 ? -178.789 122.063 140.046 1.00 88.73  ? 217 GLY D O     1 
ATOM 6272  N N     . SER C 3 218 ? -177.412 123.802 140.468 1.00 75.21  ? 218 SER D N     1 
ATOM 6273  C CA    . SER C 3 218 ? -178.053 124.210 141.711 1.00 75.21  ? 218 SER D CA    1 
ATOM 6274  C C     . SER C 3 218 ? -179.554 124.366 141.551 1.00 75.21  ? 218 SER D C     1 
ATOM 6275  O O     . SER C 3 218 ? -180.059 124.662 140.468 1.00 75.21  ? 218 SER D O     1 
ATOM 6276  C CB    . SER C 3 218 ? -177.466 125.520 142.198 1.00 75.21  ? 218 SER D CB    1 
ATOM 6277  O OG    . SER C 3 218 ? -178.164 125.940 143.341 1.00 75.21  ? 218 SER D OG    1 
ATOM 6278  N N     . GLY C 3 219 ? -180.269 124.161 142.654 1.00 66.51  ? 219 GLY D N     1 
ATOM 6279  C CA    . GLY C 3 219 ? -181.719 124.158 142.594 1.00 66.51  ? 219 GLY D CA    1 
ATOM 6280  C C     . GLY C 3 219 ? -182.315 125.478 142.158 1.00 66.51  ? 219 GLY D C     1 
ATOM 6281  O O     . GLY C 3 219 ? -183.255 125.507 141.368 1.00 66.51  ? 219 GLY D O     1 
ATOM 6282  N N     . HIS C 3 220 ? -181.777 126.586 142.649 1.00 62.11  ? 220 HIS D N     1 
ATOM 6283  C CA    . HIS C 3 220 ? -182.391 127.875 142.351 1.00 62.11  ? 220 HIS D CA    1 
ATOM 6284  C C     . HIS C 3 220 ? -181.388 128.980 142.624 1.00 62.11  ? 220 HIS D C     1 
ATOM 6285  O O     . HIS C 3 220 ? -181.040 129.219 143.775 1.00 62.11  ? 220 HIS D O     1 
ATOM 6286  C CB    . HIS C 3 220 ? -183.634 128.040 143.204 1.00 62.11  ? 220 HIS D CB    1 
ATOM 6287  C CG    . HIS C 3 220 ? -184.356 129.323 142.985 1.00 62.11  ? 220 HIS D CG    1 
ATOM 6288  N ND1   . HIS C 3 220 ? -185.017 129.611 141.815 1.00 62.11  ? 220 HIS D ND1   1 
ATOM 6289  C CD2   . HIS C 3 220 ? -184.564 130.378 143.804 1.00 62.11  ? 220 HIS D CD2   1 
ATOM 6290  C CE1   . HIS C 3 220 ? -185.573 130.803 141.910 1.00 62.11  ? 220 HIS D CE1   1 
ATOM 6291  N NE2   . HIS C 3 220 ? -185.316 131.289 143.109 1.00 62.11  ? 220 HIS D NE2   1 
ATOM 6292  N N     . MET C 3 221 ? -180.994 129.705 141.587 1.00 59.81  ? 221 MET D N     1 
ATOM 6293  C CA    . MET C 3 221 ? -180.171 130.897 141.717 1.00 59.81  ? 221 MET D CA    1 
ATOM 6294  C C     . MET C 3 221 ? -181.034 132.136 141.829 1.00 59.81  ? 221 MET D C     1 
ATOM 6295  O O     . MET C 3 221 ? -182.016 132.267 141.105 1.00 59.81  ? 221 MET D O     1 
ATOM 6296  C CB    . MET C 3 221 ? -179.285 131.015 140.486 1.00 59.81  ? 221 MET D CB    1 
ATOM 6297  C CG    . MET C 3 221 ? -178.287 129.927 140.413 1.00 59.81  ? 221 MET D CG    1 
ATOM 6298  S SD    . MET C 3 221 ? -177.234 129.999 138.977 1.00 59.81  ? 221 MET D SD    1 
ATOM 6299  C CE    . MET C 3 221 ? -176.779 131.710 139.049 1.00 59.81  ? 221 MET D CE    1 
ATOM 6300  N N     . ASN C 3 222 ? -180.644 133.064 142.693 1.00 54.77  ? 222 ASN D N     1 
ATOM 6301  C CA    . ASN C 3 222 ? -181.381 134.318 142.827 1.00 54.77  ? 222 ASN D CA    1 
ATOM 6302  C C     . ASN C 3 222 ? -180.527 135.303 143.614 1.00 54.77  ? 222 ASN D C     1 
ATOM 6303  O O     . ASN C 3 222 ? -179.406 134.990 144.011 1.00 54.77  ? 222 ASN D O     1 
ATOM 6304  C CB    . ASN C 3 222 ? -182.718 134.098 143.513 1.00 54.77  ? 222 ASN D CB    1 
ATOM 6305  C CG    . ASN C 3 222 ? -183.714 135.138 143.143 1.00 54.77  ? 222 ASN D CG    1 
ATOM 6306  O OD1   . ASN C 3 222 ? -183.512 135.881 142.188 1.00 54.77  ? 222 ASN D OD1   1 
ATOM 6307  N ND2   . ASN C 3 222 ? -184.776 135.244 143.922 1.00 54.77  ? 222 ASN D ND2   1 
ATOM 6308  N N     . ALA C 3 223 ? -181.043 136.510 143.820 1.00 52.87  ? 223 ALA D N     1 
ATOM 6309  C CA    . ALA C 3 223 ? -180.309 137.496 144.600 1.00 52.87  ? 223 ALA D CA    1 
ATOM 6310  C C     . ALA C 3 223 ? -181.301 138.361 145.354 1.00 52.87  ? 223 ALA D C     1 
ATOM 6311  O O     . ALA C 3 223 ? -182.197 138.927 144.730 1.00 52.87  ? 223 ALA D O     1 
ATOM 6312  C CB    . ALA C 3 223 ? -179.428 138.354 143.700 1.00 52.87  ? 223 ALA D CB    1 
ATOM 6313  N N     . GLY C 3 224 ? -181.166 138.468 146.673 1.00 53.94  ? 224 GLY D N     1 
ATOM 6314  C CA    . GLY C 3 224 ? -182.070 139.284 147.466 1.00 53.94  ? 224 GLY D CA    1 
ATOM 6315  C C     . GLY C 3 224 ? -181.376 140.440 148.158 1.00 53.94  ? 224 GLY D C     1 
ATOM 6316  O O     . GLY C 3 224 ? -180.224 140.332 148.566 1.00 53.94  ? 224 GLY D O     1 
ATOM 6317  N N     . GLN C 3 225 ? -182.088 141.555 148.289 1.00 52.95  ? 225 GLN D N     1 
ATOM 6318  C CA    . GLN C 3 225 ? -181.436 142.738 148.819 1.00 52.95  ? 225 GLN D CA    1 
ATOM 6319  C C     . GLN C 3 225 ? -181.633 142.849 150.309 1.00 52.95  ? 225 GLN D C     1 
ATOM 6320  O O     . GLN C 3 225 ? -182.752 142.725 150.803 1.00 52.95  ? 225 GLN D O     1 
ATOM 6321  C CB    . GLN C 3 225 ? -181.979 144.016 148.202 1.00 52.95  ? 225 GLN D CB    1 
ATOM 6322  C CG    . GLN C 3 225 ? -181.762 144.096 146.758 1.00 52.95  ? 225 GLN D CG    1 
ATOM 6323  C CD    . GLN C 3 225 ? -182.688 143.178 146.062 1.00 52.95  ? 225 GLN D CD    1 
ATOM 6324  O OE1   . GLN C 3 225 ? -183.650 142.702 146.653 1.00 52.95  ? 225 GLN D OE1   1 
ATOM 6325  N NE2   . GLN C 3 225 ? -182.351 142.817 144.851 1.00 52.95  ? 225 GLN D NE2   1 
ATOM 6326  N N     . PHE C 3 226 ? -180.612 143.377 150.964 1.00 51.80  ? 226 PHE D N     1 
ATOM 6327  C CA    . PHE C 3 226 ? -180.613 143.589 152.397 1.00 51.80  ? 226 PHE D CA    1 
ATOM 6328  C C     . PHE C 3 226 ? -179.851 144.875 152.628 1.00 51.80  ? 226 PHE D C     1 
ATOM 6329  O O     . PHE C 3 226 ? -179.260 145.443 151.707 1.00 51.80  ? 226 PHE D O     1 
ATOM 6330  C CB    . PHE C 3 226 ? -179.961 142.448 153.194 1.00 51.80  ? 226 PHE D CB    1 
ATOM 6331  C CG    . PHE C 3 226 ? -180.636 141.099 153.074 1.00 51.80  ? 226 PHE D CG    1 
ATOM 6332  C CD1   . PHE C 3 226 ? -181.891 140.957 152.610 1.00 51.80  ? 226 PHE D CD1   1 
ATOM 6333  C CD2   . PHE C 3 226 ? -180.008 139.978 153.499 1.00 51.80  ? 226 PHE D CD2   1 
ATOM 6334  C CE1   . PHE C 3 226 ? -182.485 139.741 152.519 1.00 51.80  ? 226 PHE D CE1   1 
ATOM 6335  C CE2   . PHE C 3 226 ? -180.599 138.762 153.423 1.00 51.80  ? 226 PHE D CE2   1 
ATOM 6336  C CZ    . PHE C 3 226 ? -181.838 138.645 152.933 1.00 51.80  ? 226 PHE D CZ    1 
ATOM 6337  N N     . SER C 3 227 ? -179.858 145.328 153.872 1.00 51.57  ? 227 SER D N     1 
ATOM 6338  C CA    . SER C 3 227 ? -179.140 146.537 154.233 1.00 51.57  ? 227 SER D CA    1 
ATOM 6339  C C     . SER C 3 227 ? -179.078 146.604 155.739 1.00 51.57  ? 227 SER D C     1 
ATOM 6340  O O     . SER C 3 227 ? -179.850 145.946 156.431 1.00 51.57  ? 227 SER D O     1 
ATOM 6341  C CB    . SER C 3 227 ? -179.816 147.787 153.692 1.00 51.57  ? 227 SER D CB    1 
ATOM 6342  O OG    . SER C 3 227 ? -181.182 147.771 154.030 1.00 51.57  ? 227 SER D OG    1 
ATOM 6343  N N     . ALA C 3 228 ? -178.176 147.428 156.239 1.00 50.11  ? 228 ALA D N     1 
ATOM 6344  C CA    . ALA C 3 228 ? -178.024 147.571 157.671 1.00 50.11  ? 228 ALA D CA    1 
ATOM 6345  C C     . ALA C 3 228 ? -177.778 149.030 157.970 1.00 50.11  ? 228 ALA D C     1 
ATOM 6346  O O     . ALA C 3 228 ? -177.234 149.759 157.146 1.00 50.11  ? 228 ALA D O     1 
ATOM 6347  C CB    . ALA C 3 228 ? -176.863 146.736 158.190 1.00 50.11  ? 228 ALA D CB    1 
ATOM 6348  N N     . GLY C 3 229 ? -178.150 149.448 159.164 1.00 50.29  ? 229 GLY D N     1 
ATOM 6349  C CA    . GLY C 3 229 ? -177.923 150.834 159.501 1.00 50.29  ? 229 GLY D CA    1 
ATOM 6350  C C     . GLY C 3 229 ? -178.521 151.153 160.843 1.00 50.29  ? 229 GLY D C     1 
ATOM 6351  O O     . GLY C 3 229 ? -179.136 150.315 161.484 1.00 50.29  ? 229 GLY D O     1 
ATOM 6352  N N     . THR C 3 230 ? -178.374 152.401 161.231 1.00 52.09  ? 230 THR D N     1 
ATOM 6353  C CA    . THR C 3 230 ? -178.930 152.894 162.481 1.00 52.09  ? 230 THR D CA    1 
ATOM 6354  C C     . THR C 3 230 ? -180.174 153.729 162.233 1.00 52.09  ? 230 THR D C     1 
ATOM 6355  O O     . THR C 3 230 ? -180.078 154.900 161.871 1.00 52.09  ? 230 THR D O     1 
ATOM 6356  C CB    . THR C 3 230 ? -177.877 153.712 163.205 1.00 52.09  ? 230 THR D CB    1 
ATOM 6357  O OG1   . THR C 3 230 ? -176.735 152.894 163.460 1.00 52.09  ? 230 THR D OG1   1 
ATOM 6358  C CG2   . THR C 3 230 ? -178.414 154.188 164.482 1.00 52.09  ? 230 THR D CG2   1 
ATOM 6359  N N     . PHE C 3 231 ? -181.348 153.144 162.438 1.00 49.10  ? 231 PHE D N     1 
ATOM 6360  C CA    . PHE C 3 231 ? -182.558 153.884 162.143 1.00 49.10  ? 231 PHE D CA    1 
ATOM 6361  C C     . PHE C 3 231 ? -182.835 154.804 163.303 1.00 49.10  ? 231 PHE D C     1 
ATOM 6362  O O     . PHE C 3 231 ? -182.635 154.430 164.467 1.00 49.10  ? 231 PHE D O     1 
ATOM 6363  C CB    . PHE C 3 231 ? -183.725 152.933 161.950 1.00 49.10  ? 231 PHE D CB    1 
ATOM 6364  C CG    . PHE C 3 231 ? -183.547 152.016 160.811 1.00 49.10  ? 231 PHE D CG    1 
ATOM 6365  C CD1   . PHE C 3 231 ? -182.722 152.332 159.799 1.00 49.10  ? 231 PHE D CD1   1 
ATOM 6366  C CD2   . PHE C 3 231 ? -184.157 150.810 160.786 1.00 49.10  ? 231 PHE D CD2   1 
ATOM 6367  C CE1   . PHE C 3 231 ? -182.540 151.483 158.768 1.00 49.10  ? 231 PHE D CE1   1 
ATOM 6368  C CE2   . PHE C 3 231 ? -183.951 149.969 159.753 1.00 49.10  ? 231 PHE D CE2   1 
ATOM 6369  C CZ    . PHE C 3 231 ? -183.147 150.315 158.743 1.00 49.10  ? 231 PHE D CZ    1 
ATOM 6370  N N     . TYR C 3 232 ? -183.356 155.983 162.978 1.00 51.41  ? 232 TYR D N     1 
ATOM 6371  C CA    . TYR C 3 232 ? -183.777 156.955 163.961 1.00 51.41  ? 232 TYR D CA    1 
ATOM 6372  C C     . TYR C 3 232 ? -185.296 156.837 164.032 1.00 51.41  ? 232 TYR D C     1 
ATOM 6373  O O     . TYR C 3 232 ? -185.983 157.368 163.186 1.00 51.41  ? 232 TYR D O     1 
ATOM 6374  C CB    . TYR C 3 232 ? -183.397 158.394 163.571 1.00 51.41  ? 232 TYR D CB    1 
ATOM 6375  C CG    . TYR C 3 232 ? -184.238 159.438 164.294 1.00 51.41  ? 232 TYR D CG    1 
ATOM 6376  C CD1   . TYR C 3 232 ? -184.089 159.646 165.646 1.00 51.41  ? 232 TYR D CD1   1 
ATOM 6377  C CD2   . TYR C 3 232 ? -185.248 160.108 163.646 1.00 51.41  ? 232 TYR D CD2   1 
ATOM 6378  C CE1   . TYR C 3 232 ? -184.875 160.543 166.320 1.00 51.41  ? 232 TYR D CE1   1 
ATOM 6379  C CE2   . TYR C 3 232 ? -186.038 161.012 164.314 1.00 51.41  ? 232 TYR D CE2   1 
ATOM 6380  C CZ    . TYR C 3 232 ? -185.844 161.217 165.651 1.00 51.41  ? 232 TYR D CZ    1 
ATOM 6381  O OH    . TYR C 3 232 ? -186.624 162.109 166.329 1.00 51.41  ? 232 TYR D OH    1 
ATOM 6382  N N     . ARG C 3 233 ? -185.817 156.164 165.054 1.00 50.90  ? 233 ARG D N     1 
ATOM 6383  C CA    . ARG C 3 233 ? -187.267 156.008 165.203 1.00 50.90  ? 233 ARG D CA    1 
ATOM 6384  C C     . ARG C 3 233 ? -187.911 157.152 165.996 1.00 50.90  ? 233 ARG D C     1 
ATOM 6385  O O     . ARG C 3 233 ? -187.219 157.907 166.679 1.00 50.90  ? 233 ARG D O     1 
ATOM 6386  C CB    . ARG C 3 233 ? -187.595 154.666 165.862 1.00 50.90  ? 233 ARG D CB    1 
ATOM 6387  C CG    . ARG C 3 233 ? -186.666 153.533 165.458 1.00 50.90  ? 233 ARG D CG    1 
ATOM 6388  C CD    . ARG C 3 233 ? -187.113 152.211 166.059 1.00 50.90  ? 233 ARG D CD    1 
ATOM 6389  N NE    . ARG C 3 233 ? -188.567 152.122 166.164 1.00 50.90  ? 233 ARG D NE    1 
ATOM 6390  C CZ    . ARG C 3 233 ? -189.207 151.468 167.128 1.00 50.90  ? 233 ARG D CZ    1 
ATOM 6391  N NH1   . ARG C 3 233 ? -188.523 150.841 168.074 1.00 50.90  ? 233 ARG D NH1   1 
ATOM 6392  N NH2   . ARG C 3 233 ? -190.533 151.440 167.145 1.00 50.90  ? 233 ARG D NH2   1 
ATOM 6393  N N     . TYR C 3 234 ? -189.235 157.275 165.901 1.00 52.37  ? 234 TYR D N     1 
ATOM 6394  C CA    . TYR C 3 234 ? -189.963 158.324 166.613 1.00 52.37  ? 234 TYR D CA    1 
ATOM 6395  C C     . TYR C 3 234 ? -191.470 158.109 166.620 1.00 52.37  ? 234 TYR D C     1 
ATOM 6396  O O     . TYR C 3 234 ? -192.034 157.676 165.621 1.00 52.37  ? 234 TYR D O     1 
ATOM 6397  C CB    . TYR C 3 234 ? -189.703 159.683 165.986 1.00 52.37  ? 234 TYR D CB    1 
ATOM 6398  C CG    . TYR C 3 234 ? -190.555 160.780 166.559 1.00 52.37  ? 234 TYR D CG    1 
ATOM 6399  C CD1   . TYR C 3 234 ? -190.274 161.347 167.775 1.00 52.37  ? 234 TYR D CD1   1 
ATOM 6400  C CD2   . TYR C 3 234 ? -191.670 161.213 165.897 1.00 52.37  ? 234 TYR D CD2   1 
ATOM 6401  C CE1   . TYR C 3 234 ? -191.063 162.342 168.286 1.00 52.37  ? 234 TYR D CE1   1 
ATOM 6402  C CE2   . TYR C 3 234 ? -192.458 162.192 166.404 1.00 52.37  ? 234 TYR D CE2   1 
ATOM 6403  C CZ    . TYR C 3 234 ? -192.146 162.754 167.592 1.00 52.37  ? 234 TYR D CZ    1 
ATOM 6404  O OH    . TYR C 3 234 ? -192.931 163.747 168.098 1.00 52.37  ? 234 TYR D OH    1 
ATOM 6405  N N     . ALA C 3 235 ? -192.117 158.462 167.736 1.00 52.55  ? 235 ALA D N     1 
ATOM 6406  C CA    . ALA C 3 235 ? -193.562 158.294 167.890 1.00 52.55  ? 235 ALA D CA    1 
ATOM 6407  C C     . ALA C 3 235 ? -194.119 159.383 168.799 1.00 52.55  ? 235 ALA D C     1 
ATOM 6408  O O     . ALA C 3 235 ? -193.390 159.986 169.587 1.00 52.55  ? 235 ALA D O     1 
ATOM 6409  C CB    . ALA C 3 235 ? -193.922 156.921 168.434 1.00 52.55  ? 235 ALA D CB    1 
ATOM 6410  N N     . ASN C 3 236 ? -195.429 159.510 168.764 1.00 55.22  ? 236 ASN D N     1 
ATOM 6411  C CA    . ASN C 3 236 ? -196.132 160.482 169.550 1.00 55.22  ? 236 ASN D CA    1 
ATOM 6412  C C     . ASN C 3 236 ? -197.381 159.887 170.188 1.00 55.22  ? 236 ASN D C     1 
ATOM 6413  O O     . ASN C 3 236 ? -197.995 159.001 169.632 1.00 55.22  ? 236 ASN D O     1 
ATOM 6414  C CB    . ASN C 3 236 ? -196.521 161.574 168.563 1.00 55.22  ? 236 ASN D CB    1 
ATOM 6415  C CG    . ASN C 3 236 ? -197.111 162.776 169.215 1.00 55.22  ? 236 ASN D CG    1 
ATOM 6416  O OD1   . ASN C 3 236 ? -196.947 163.888 168.729 1.00 55.22  ? 236 ASN D OD1   1 
ATOM 6417  N ND2   . ASN C 3 236 ? -197.817 162.569 170.308 1.00 55.22  ? 236 ASN D ND2   1 
ATOM 6418  N N     . VAL C 3 237 ? -197.764 160.379 171.354 1.00 60.94  ? 237 VAL D N     1 
ATOM 6419  C CA    . VAL C 3 237 ? -198.979 159.954 172.023 1.00 60.94  ? 237 VAL D CA    1 
ATOM 6420  C C     . VAL C 3 237 ? -199.772 161.160 172.507 1.00 60.94  ? 237 VAL D C     1 
ATOM 6421  O O     . VAL C 3 237 ? -199.285 161.931 173.346 1.00 60.94  ? 237 VAL D O     1 
ATOM 6422  C CB    . VAL C 3 237 ? -198.695 159.010 173.187 1.00 60.94  ? 237 VAL D CB    1 
ATOM 6423  C CG1   . VAL C 3 237 ? -199.989 158.623 173.826 1.00 60.94  ? 237 VAL D CG1   1 
ATOM 6424  C CG2   . VAL C 3 237 ? -197.982 157.793 172.698 1.00 60.94  ? 237 VAL D CG2   1 
ATOM 6425  N N     . ASN C 3 238 ? -200.981 161.332 171.966 1.00 69.31  ? 238 ASN D N     1 
ATOM 6426  C CA    . ASN C 3 238 ? -201.874 162.421 172.355 1.00 69.31  ? 238 ASN D CA    1 
ATOM 6427  C C     . ASN C 3 238 ? -202.579 162.020 173.622 1.00 69.31  ? 238 ASN D C     1 
ATOM 6428  O O     . ASN C 3 238 ? -203.613 161.358 173.596 1.00 69.31  ? 238 ASN D O     1 
ATOM 6429  C CB    . ASN C 3 238 ? -202.908 162.680 171.271 1.00 69.31  ? 238 ASN D CB    1 
ATOM 6430  C CG    . ASN C 3 238 ? -203.615 163.990 171.441 1.00 69.31  ? 238 ASN D CG    1 
ATOM 6431  O OD1   . ASN C 3 238 ? -203.581 164.573 172.512 1.00 69.31  ? 238 ASN D OD1   1 
ATOM 6432  N ND2   . ASN C 3 238 ? -204.268 164.459 170.393 1.00 69.31  ? 238 ASN D ND2   1 
ATOM 6433  N N     . LEU C 3 239 ? -202.013 162.444 174.738 1.00 73.82  ? 239 LEU D N     1 
ATOM 6434  C CA    . LEU C 3 239 ? -202.463 161.925 176.013 1.00 73.82  ? 239 LEU D CA    1 
ATOM 6435  C C     . LEU C 3 239 ? -203.854 162.420 176.375 1.00 73.82  ? 239 LEU D C     1 
ATOM 6436  O O     . LEU C 3 239 ? -204.697 161.640 176.824 1.00 73.82  ? 239 LEU D O     1 
ATOM 6437  C CB    . LEU C 3 239 ? -201.447 162.281 177.078 1.00 73.82  ? 239 LEU D CB    1 
ATOM 6438  C CG    . LEU C 3 239 ? -201.811 161.795 178.458 1.00 73.82  ? 239 LEU D CG    1 
ATOM 6439  C CD1   . LEU C 3 239 ? -200.557 161.386 179.128 1.00 73.82  ? 239 LEU D CD1   1 
ATOM 6440  C CD2   . LEU C 3 239 ? -202.437 162.951 179.203 1.00 73.82  ? 239 LEU D CD2   1 
ATOM 6441  N N     . ASP C 3 240 ? -204.118 163.708 176.173 1.00 78.59  ? 240 ASP D N     1 
ATOM 6442  C CA    . ASP C 3 240 ? -205.374 164.295 176.632 1.00 78.59  ? 240 ASP D CA    1 
ATOM 6443  C C     . ASP C 3 240 ? -206.580 163.675 175.951 1.00 78.59  ? 240 ASP D C     1 
ATOM 6444  O O     . ASP C 3 240 ? -207.530 163.251 176.612 1.00 78.59  ? 240 ASP D O     1 
ATOM 6445  C CB    . ASP C 3 240 ? -205.358 165.795 176.398 1.00 78.59  ? 240 ASP D CB    1 
ATOM 6446  C CG    . ASP C 3 240 ? -204.312 166.496 177.220 1.00 78.59  ? 240 ASP D CG    1 
ATOM 6447  O OD1   . ASP C 3 240 ? -203.959 165.971 178.293 1.00 78.59  ? 240 ASP D OD1   1 
ATOM 6448  O OD2   . ASP C 3 240 ? -203.832 167.569 176.797 1.00 78.59  ? 240 ASP D OD2   1 
ATOM 6449  N N     . ARG C 3 241 ? -206.546 163.583 174.633 1.00 76.47  ? 241 ARG D N     1 
ATOM 6450  C CA    . ARG C 3 241 ? -207.641 162.948 173.919 1.00 76.47  ? 241 ARG D CA    1 
ATOM 6451  C C     . ARG C 3 241 ? -207.724 161.478 174.281 1.00 76.47  ? 241 ARG D C     1 
ATOM 6452  O O     . ARG C 3 241 ? -208.809 160.893 174.245 1.00 76.47  ? 241 ARG D O     1 
ATOM 6453  C CB    . ARG C 3 241 ? -207.528 163.241 172.429 1.00 76.47  ? 241 ARG D CB    1 
ATOM 6454  C CG    . ARG C 3 241 ? -208.279 164.566 172.100 1.00 76.47  ? 241 ARG D CG    1 
ATOM 6455  C CD    . ARG C 3 241 ? -207.724 165.683 172.987 1.00 76.47  ? 241 ARG D CD    1 
ATOM 6456  N NE    . ARG C 3 241 ? -207.843 167.086 172.599 1.00 76.47  ? 241 ARG D NE    1 
ATOM 6457  C CZ    . ARG C 3 241 ? -207.394 168.057 173.395 1.00 76.47  ? 241 ARG D CZ    1 
ATOM 6458  N NH1   . ARG C 3 241 ? -206.843 167.728 174.547 1.00 76.47  ? 241 ARG D NH1   1 
ATOM 6459  N NH2   . ARG C 3 241 ? -207.479 169.339 173.081 1.00 76.47  ? 241 ARG D NH2   1 
ATOM 6460  N N     . LEU C 3 242 ? -206.600 160.862 174.623 1.00 74.71  ? 242 LEU D N     1 
ATOM 6461  C CA    . LEU C 3 242 ? -206.647 159.460 175.005 1.00 74.71  ? 242 LEU D CA    1 
ATOM 6462  C C     . LEU C 3 242 ? -207.393 159.312 176.315 1.00 74.71  ? 242 LEU D C     1 
ATOM 6463  O O     . LEU C 3 242 ? -208.128 158.342 176.511 1.00 74.71  ? 242 LEU D O     1 
ATOM 6464  C CB    . LEU C 3 242 ? -205.245 158.893 175.156 1.00 74.71  ? 242 LEU D CB    1 
ATOM 6465  C CG    . LEU C 3 242 ? -205.190 157.377 175.084 1.00 74.71  ? 242 LEU D CG    1 
ATOM 6466  C CD1   . LEU C 3 242 ? -205.635 156.867 173.774 1.00 74.71  ? 242 LEU D CD1   1 
ATOM 6467  C CD2   . LEU C 3 242 ? -203.810 156.913 175.372 1.00 74.71  ? 242 LEU D CD2   1 
ATOM 6468  N N     . VAL C 3 243 ? -207.184 160.247 177.238 1.00 77.44  ? 243 VAL D N     1 
ATOM 6469  C CA    . VAL C 3 243 ? -207.929 160.235 178.488 1.00 77.44  ? 243 VAL D CA    1 
ATOM 6470  C C     . VAL C 3 243 ? -209.397 160.567 178.260 1.00 77.44  ? 243 VAL D C     1 
ATOM 6471  O O     . VAL C 3 243 ? -210.285 159.946 178.853 1.00 77.44  ? 243 VAL D O     1 
ATOM 6472  C CB    . VAL C 3 243 ? -207.287 161.227 179.463 1.00 77.44  ? 243 VAL D CB    1 
ATOM 6473  C CG1   . VAL C 3 243 ? -208.108 161.336 180.714 1.00 77.44  ? 243 VAL D CG1   1 
ATOM 6474  C CG2   . VAL C 3 243 ? -205.890 160.797 179.783 1.00 77.44  ? 243 VAL D CG2   1 
ATOM 6475  N N     . GLU C 3 244 ? -209.682 161.532 177.388 1.00 79.92  ? 244 GLU D N     1 
ATOM 6476  C CA    . GLU C 3 244 ? -211.068 161.915 177.148 1.00 79.92  ? 244 GLU D CA    1 
ATOM 6477  C C     . GLU C 3 244 ? -211.853 160.826 176.441 1.00 79.92  ? 244 GLU D C     1 
ATOM 6478  O O     . GLU C 3 244 ? -213.067 160.713 176.635 1.00 79.92  ? 244 GLU D O     1 
ATOM 6479  C CB    . GLU C 3 244 ? -211.133 163.172 176.290 1.00 79.92  ? 244 GLU D CB    1 
ATOM 6480  C CG    . GLU C 3 244 ? -210.645 164.426 176.947 1.00 79.92  ? 244 GLU D CG    1 
ATOM 6481  C CD    . GLU C 3 244 ? -210.700 165.608 176.003 1.00 79.92  ? 244 GLU D CD    1 
ATOM 6482  O OE1   . GLU C 3 244 ? -210.988 165.413 174.802 1.00 79.92  ? 244 GLU D OE1   1 
ATOM 6483  O OE2   . GLU C 3 244 ? -210.445 166.734 176.463 1.00 79.92  ? 244 GLU D OE2   1 
ATOM 6484  N N     . ASN C 3 245 ? -211.180 160.004 175.648 1.00 79.47  ? 245 ASN D N     1 
ATOM 6485  C CA    . ASN C 3 245 ? -211.858 158.949 174.913 1.00 79.47  ? 245 ASN D CA    1 
ATOM 6486  C C     . ASN C 3 245 ? -211.904 157.656 175.693 1.00 79.47  ? 245 ASN D C     1 
ATOM 6487  O O     . ASN C 3 245 ? -212.938 156.984 175.723 1.00 79.47  ? 245 ASN D O     1 
ATOM 6488  C CB    . ASN C 3 245 ? -211.170 158.712 173.576 1.00 79.47  ? 245 ASN D CB    1 
ATOM 6489  C CG    . ASN C 3 245 ? -211.245 159.904 172.682 1.00 79.47  ? 245 ASN D CG    1 
ATOM 6490  O OD1   . ASN C 3 245 ? -212.195 160.677 172.754 1.00 79.47  ? 245 ASN D OD1   1 
ATOM 6491  N ND2   . ASN C 3 245 ? -210.244 160.075 171.831 1.00 79.47  ? 245 ASN D ND2   1 
ATOM 6492  N N     . THR C 3 246 ? -210.808 157.316 176.351 1.00 81.14  ? 246 THR D N     1 
ATOM 6493  C CA    . THR C 3 246 ? -210.793 156.092 177.122 1.00 81.14  ? 246 THR D CA    1 
ATOM 6494  C C     . THR C 3 246 ? -211.647 156.220 178.360 1.00 81.14  ? 246 THR D C     1 
ATOM 6495  O O     . THR C 3 246 ? -212.251 155.238 178.798 1.00 81.14  ? 246 THR D O     1 
ATOM 6496  C CB    . THR C 3 246 ? -209.364 155.760 177.513 1.00 81.14  ? 246 THR D CB    1 
ATOM 6497  O OG1   . THR C 3 246 ? -208.549 155.730 176.337 1.00 81.14  ? 246 THR D OG1   1 
ATOM 6498  C CG2   . THR C 3 246 ? -209.313 154.417 178.160 1.00 81.14  ? 246 THR D CG2   1 
ATOM 6499  N N     . GLY C 3 247 ? -211.713 157.408 178.938 1.00 82.34  ? 247 GLY D N     1 
ATOM 6500  C CA    . GLY C 3 247 ? -212.477 157.557 180.150 1.00 82.34  ? 247 GLY D CA    1 
ATOM 6501  C C     . GLY C 3 247 ? -211.584 157.541 181.363 1.00 82.34  ? 247 GLY D C     1 
ATOM 6502  O O     . GLY C 3 247 ? -211.099 158.578 181.819 1.00 82.34  ? 247 GLY D O     1 
ATOM 6503  N N     . ASP C 3 248 ? -211.328 156.337 181.864 1.00 87.25  ? 248 ASP D N     1 
ATOM 6504  C CA    . ASP C 3 248 ? -210.497 156.173 183.043 1.00 87.25  ? 248 ASP D CA    1 
ATOM 6505  C C     . ASP C 3 248 ? -209.061 156.562 182.758 1.00 87.25  ? 248 ASP D C     1 
ATOM 6506  O O     . ASP C 3 248 ? -208.453 156.088 181.799 1.00 87.25  ? 248 ASP D O     1 
ATOM 6507  C CB    . ASP C 3 248 ? -210.521 154.721 183.510 1.00 87.25  ? 248 ASP D CB    1 
ATOM 6508  C CG    . ASP C 3 248 ? -211.844 154.324 184.104 1.00 87.25  ? 248 ASP D CG    1 
ATOM 6509  O OD1   . ASP C 3 248 ? -212.555 155.206 184.622 1.00 87.25  ? 248 ASP D OD1   1 
ATOM 6510  O OD2   . ASP C 3 248 ? -212.169 153.120 184.064 1.00 87.25  ? 248 ASP D OD2   1 
ATOM 6511  N N     . ALA C 3 249 ? -208.520 157.427 183.605 1.00 85.71  ? 249 ALA D N     1 
ATOM 6512  C CA    . ALA C 3 249 ? -207.130 157.815 183.474 1.00 85.71  ? 249 ALA D CA    1 
ATOM 6513  C C     . ALA C 3 249 ? -206.204 156.660 183.808 1.00 85.71  ? 249 ALA D C     1 
ATOM 6514  O O     . ALA C 3 249 ? -205.046 156.666 183.383 1.00 85.71  ? 249 ALA D O     1 
ATOM 6515  C CB    . ALA C 3 249 ? -206.819 159.008 184.375 1.00 85.71  ? 249 ALA D CB    1 
ATOM 6516  N N     . GLN C 3 250 ? -206.704 155.643 184.515 1.00 85.31  ? 250 GLN D N     1 
ATOM 6517  C CA    . GLN C 3 250 ? -205.840 154.545 184.916 1.00 85.31  ? 250 GLN D CA    1 
ATOM 6518  C C     . GLN C 3 250 ? -205.602 153.545 183.793 1.00 85.31  ? 250 GLN D C     1 
ATOM 6519  O O     . GLN C 3 250 ? -204.475 153.069 183.597 1.00 85.31  ? 250 GLN D O     1 
ATOM 6520  C CB    . GLN C 3 250 ? -206.529 153.807 186.062 1.00 85.31  ? 250 GLN D CB    1 
ATOM 6521  C CG    . GLN C 3 250 ? -206.598 154.544 187.381 1.00 85.31  ? 250 GLN D CG    1 
ATOM 6522  C CD    . GLN C 3 250 ? -205.266 154.978 187.889 1.00 85.31  ? 250 GLN D CD    1 
ATOM 6523  O OE1   . GLN C 3 250 ? -204.291 154.236 187.802 1.00 85.31  ? 250 GLN D OE1   1 
ATOM 6524  N NE2   . GLN C 3 250 ? -205.198 156.200 188.399 1.00 85.31  ? 250 GLN D NE2   1 
ATOM 6525  N N     . THR C 3 251 ? -206.654 153.198 183.067 1.00 83.13  ? 251 THR D N     1 
ATOM 6526  C CA    . THR C 3 251 ? -206.490 152.262 181.974 1.00 83.13  ? 251 THR D CA    1 
ATOM 6527  C C     . THR C 3 251 ? -205.576 152.948 180.989 1.00 83.13  ? 251 THR D C     1 
ATOM 6528  O O     . THR C 3 251 ? -204.678 152.340 180.422 1.00 83.13  ? 251 THR D O     1 
ATOM 6529  C CB    . THR C 3 251 ? -207.815 151.961 181.277 1.00 83.13  ? 251 THR D CB    1 
ATOM 6530  O OG1   . THR C 3 251 ? -208.244 153.128 180.570 1.00 83.13  ? 251 THR D OG1   1 
ATOM 6531  C CG2   . THR C 3 251 ? -208.870 151.577 182.293 1.00 83.13  ? 251 THR D CG2   1 
ATOM 6532  N N     . ALA C 3 252 ? -205.807 154.238 180.799 1.00 78.75  ? 252 ALA D N     1 
ATOM 6533  C CA    . ALA C 3 252 ? -204.998 155.013 179.885 1.00 78.75  ? 252 ALA D CA    1 
ATOM 6534  C C     . ALA C 3 252 ? -203.582 155.006 180.391 1.00 78.75  ? 252 ALA D C     1 
ATOM 6535  O O     . ALA C 3 252 ? -202.645 154.895 179.616 1.00 78.75  ? 252 ALA D O     1 
ATOM 6536  C CB    . ALA C 3 252 ? -205.511 156.437 179.797 1.00 78.75  ? 252 ALA D CB    1 
ATOM 6537  N N     . ARG C 3 253 ? -203.423 155.132 181.699 1.00 79.63  ? 253 ARG D N     1 
ATOM 6538  C CA    . ARG C 3 253 ? -202.092 155.148 182.274 1.00 79.63  ? 253 ARG D CA    1 
ATOM 6539  C C     . ARG C 3 253 ? -201.360 153.842 182.053 1.00 79.63  ? 253 ARG D C     1 
ATOM 6540  O O     . ARG C 3 253 ? -200.192 153.847 181.704 1.00 79.63  ? 253 ARG D O     1 
ATOM 6541  C CB    . ARG C 3 253 ? -202.155 155.453 183.763 1.00 79.63  ? 253 ARG D CB    1 
ATOM 6542  C CG    . ARG C 3 253 ? -200.806 155.395 184.445 1.00 79.63  ? 253 ARG D CG    1 
ATOM 6543  C CD    . ARG C 3 253 ? -200.841 156.128 185.771 1.00 79.63  ? 253 ARG D CD    1 
ATOM 6544  N NE    . ARG C 3 253 ? -199.673 155.804 186.573 1.00 79.63  ? 253 ARG D NE    1 
ATOM 6545  C CZ    . ARG C 3 253 ? -198.892 156.704 187.153 1.00 79.63  ? 253 ARG D CZ    1 
ATOM 6546  N NH1   . ARG C 3 253 ? -199.154 157.994 187.027 1.00 79.63  ? 253 ARG D NH1   1 
ATOM 6547  N NH2   . ARG C 3 253 ? -197.846 156.311 187.859 1.00 79.63  ? 253 ARG D NH2   1 
ATOM 6548  N N     . THR C 3 254 ? -202.031 152.719 182.262 1.00 76.19  ? 254 THR D N     1 
ATOM 6549  C CA    . THR C 3 254 ? -201.375 151.441 182.034 1.00 76.19  ? 254 THR D CA    1 
ATOM 6550  C C     . THR C 3 254 ? -201.101 151.272 180.556 1.00 76.19  ? 254 THR D C     1 
ATOM 6551  O O     . THR C 3 254 ? -200.037 150.828 180.160 1.00 76.19  ? 254 THR D O     1 
ATOM 6552  C CB    . THR C 3 254 ? -202.200 150.244 182.533 1.00 76.19  ? 254 THR D CB    1 
ATOM 6553  O OG1   . THR C 3 254 ? -203.211 149.927 181.572 1.00 76.19  ? 254 THR D OG1   1 
ATOM 6554  C CG2   . THR C 3 254 ? -202.854 150.559 183.867 1.00 76.19  ? 254 THR D CG2   1 
ATOM 6555  N N     . ALA C 3 255 ? -202.076 151.644 179.739 1.00 74.34  ? 255 ALA D N     1 
ATOM 6556  C CA    . ALA C 3 255 ? -201.945 151.502 178.299 1.00 74.34  ? 255 ALA D CA    1 
ATOM 6557  C C     . ALA C 3 255 ? -200.809 152.328 177.754 1.00 74.34  ? 255 ALA D C     1 
ATOM 6558  O O     . ALA C 3 255 ? -200.067 151.860 176.915 1.00 74.34  ? 255 ALA D O     1 
ATOM 6559  C CB    . ALA C 3 255 ? -203.241 151.878 177.606 1.00 74.34  ? 255 ALA D CB    1 
ATOM 6560  N N     . VAL C 3 256 ? -200.664 153.557 178.225 1.00 68.25  ? 256 VAL D N     1 
ATOM 6561  C CA    . VAL C 3 256 ? -199.578 154.388 177.741 1.00 68.25  ? 256 VAL D CA    1 
ATOM 6562  C C     . VAL C 3 256 ? -198.232 153.800 178.118 1.00 68.25  ? 256 VAL D C     1 
ATOM 6563  O O     . VAL C 3 256 ? -197.309 153.802 177.314 1.00 68.25  ? 256 VAL D O     1 
ATOM 6564  C CB    . VAL C 3 256 ? -199.656 155.816 178.275 1.00 68.25  ? 256 VAL D CB    1 
ATOM 6565  C CG1   . VAL C 3 256 ? -198.477 156.620 177.763 1.00 68.25  ? 256 VAL D CG1   1 
ATOM 6566  C CG2   . VAL C 3 256 ? -200.959 156.458 177.844 1.00 68.25  ? 256 VAL D CG2   1 
ATOM 6567  N N     . ALA C 3 257 ? -198.112 153.301 179.340 1.00 68.69  ? 257 ALA D N     1 
ATOM 6568  C CA    . ALA C 3 257 ? -196.850 152.729 179.779 1.00 68.69  ? 257 ALA D CA    1 
ATOM 6569  C C     . ALA C 3 257 ? -196.464 151.504 178.969 1.00 68.69  ? 257 ALA D C     1 
ATOM 6570  O O     . ALA C 3 257 ? -195.331 151.366 178.549 1.00 68.69  ? 257 ALA D O     1 
ATOM 6571  C CB    . ALA C 3 257 ? -196.920 152.383 181.252 1.00 68.69  ? 257 ALA D CB    1 
ATOM 6572  N N     . GLU C 3 258 ? -197.426 150.627 178.737 1.00 68.31  ? 258 GLU D N     1 
ATOM 6573  C CA    . GLU C 3 258 ? -197.211 149.408 177.970 1.00 68.31  ? 258 GLU D CA    1 
ATOM 6574  C C     . GLU C 3 258 ? -196.973 149.699 176.510 1.00 68.31  ? 258 GLU D C     1 
ATOM 6575  O O     . GLU C 3 258 ? -196.234 148.968 175.840 1.00 68.31  ? 258 GLU D O     1 
ATOM 6576  C CB    . GLU C 3 258 ? -198.396 148.471 178.104 1.00 68.31  ? 258 GLU D CB    1 
ATOM 6577  C CG    . GLU C 3 258 ? -198.536 147.887 179.473 1.00 68.31  ? 258 GLU D CG    1 
ATOM 6578  C CD    . GLU C 3 258 ? -197.343 147.047 179.844 1.00 68.31  ? 258 GLU D CD    1 
ATOM 6579  O OE1   . GLU C 3 258 ? -196.730 146.484 178.921 1.00 68.31  ? 258 GLU D OE1   1 
ATOM 6580  O OE2   . GLU C 3 258 ? -197.017 146.953 181.046 1.00 68.31  ? 258 GLU D OE2   1 
ATOM 6581  N N     . PHE C 3 259 ? -197.561 150.764 176.000 1.00 60.68  ? 259 PHE D N     1 
ATOM 6582  C CA    . PHE C 3 259 ? -197.289 151.118 174.622 1.00 60.68  ? 259 PHE D CA    1 
ATOM 6583  C C     . PHE C 3 259 ? -195.847 151.559 174.437 1.00 60.68  ? 259 PHE D C     1 
ATOM 6584  O O     . PHE C 3 259 ? -195.212 151.199 173.450 1.00 60.68  ? 259 PHE D O     1 
ATOM 6585  C CB    . PHE C 3 259 ? -198.242 152.189 174.160 1.00 60.68  ? 259 PHE D CB    1 
ATOM 6586  C CG    . PHE C 3 259 ? -197.849 152.776 172.883 1.00 60.68  ? 259 PHE D CG    1 
ATOM 6587  C CD1   . PHE C 3 259 ? -198.155 152.141 171.720 1.00 60.68  ? 259 PHE D CD1   1 
ATOM 6588  C CD2   . PHE C 3 259 ? -197.130 153.943 172.839 1.00 60.68  ? 259 PHE D CD2   1 
ATOM 6589  C CE1   . PHE C 3 259 ? -197.776 152.654 170.545 1.00 60.68  ? 259 PHE D CE1   1 
ATOM 6590  C CE2   . PHE C 3 259 ? -196.752 154.459 171.659 1.00 60.68  ? 259 PHE D CE2   1 
ATOM 6591  C CZ    . PHE C 3 259 ? -197.073 153.819 170.516 1.00 60.68  ? 259 PHE D CZ    1 
ATOM 6592  N N     . LEU C 3 260 ? -195.306 152.317 175.378 1.00 59.43  ? 260 LEU D N     1 
ATOM 6593  C CA    . LEU C 3 260 ? -193.913 152.738 175.263 1.00 59.43  ? 260 LEU D CA    1 
ATOM 6594  C C     . LEU C 3 260 ? -192.979 151.537 175.365 1.00 59.43  ? 260 LEU D C     1 
ATOM 6595  O O     . LEU C 3 260 ? -192.048 151.389 174.559 1.00 59.43  ? 260 LEU D O     1 
ATOM 6596  C CB    . LEU C 3 260 ? -193.582 153.783 176.316 1.00 59.43  ? 260 LEU D CB    1 
ATOM 6597  C CG    . LEU C 3 260 ? -193.802 155.280 176.078 1.00 59.43  ? 260 LEU D CG    1 
ATOM 6598  C CD1   . LEU C 3 260 ? -195.066 155.542 175.408 1.00 59.43  ? 260 LEU D CD1   1 
ATOM 6599  C CD2   . LEU C 3 260 ? -193.967 155.886 177.407 1.00 59.43  ? 260 LEU D CD2   1 
ATOM 6600  N N     . ARG C 3 261 ? -193.265 150.622 176.293 1.00 60.08  ? 261 ARG D N     1 
ATOM 6601  C CA    . ARG C 3 261 ? -192.423 149.438 176.383 1.00 60.08  ? 261 ARG D CA    1 
ATOM 6602  C C     . ARG C 3 261 ? -192.505 148.610 175.111 1.00 60.08  ? 261 ARG D C     1 
ATOM 6603  O O     . ARG C 3 261 ? -191.488 148.084 174.644 1.00 60.08  ? 261 ARG D O     1 
ATOM 6604  C CB    . ARG C 3 261 ? -192.825 148.579 177.574 1.00 60.08  ? 261 ARG D CB    1 
ATOM 6605  C CG    . ARG C 3 261 ? -192.003 147.327 177.703 1.00 60.08  ? 261 ARG D CG    1 
ATOM 6606  C CD    . ARG C 3 261 ? -192.499 146.455 178.830 1.00 60.08  ? 261 ARG D CD    1 
ATOM 6607  N NE    . ARG C 3 261 ? -191.568 145.366 179.072 1.00 60.08  ? 261 ARG D NE    1 
ATOM 6608  C CZ    . ARG C 3 261 ? -190.518 145.479 179.871 1.00 60.08  ? 261 ARG D CZ    1 
ATOM 6609  N NH1   . ARG C 3 261 ? -190.287 146.629 180.491 1.00 60.08  ? 261 ARG D NH1   1 
ATOM 6610  N NH2   . ARG C 3 261 ? -189.696 144.456 180.043 1.00 60.08  ? 261 ARG D NH2   1 
ATOM 6611  N N     . ALA C 3 262 ? -193.672 148.554 174.484 1.00 56.92  ? 262 ALA D N     1 
ATOM 6612  C CA    . ALA C 3 262 ? -193.763 147.816 173.233 1.00 56.92  ? 262 ALA D CA    1 
ATOM 6613  C C     . ALA C 3 262 ? -192.975 148.517 172.144 1.00 56.92  ? 262 ALA D C     1 
ATOM 6614  O O     . ALA C 3 262 ? -192.313 147.864 171.333 1.00 56.92  ? 262 ALA D O     1 
ATOM 6615  C CB    . ALA C 3 262 ? -195.211 147.654 172.804 1.00 56.92  ? 262 ALA D CB    1 
ATOM 6616  N N     . PHE C 3 263 ? -193.022 149.843 172.116 1.00 53.72  ? 263 PHE D N     1 
ATOM 6617  C CA    . PHE C 3 263 ? -192.270 150.579 171.113 1.00 53.72  ? 263 PHE D CA    1 
ATOM 6618  C C     . PHE C 3 263 ? -190.792 150.248 171.212 1.00 53.72  ? 263 PHE D C     1 
ATOM 6619  O O     . PHE C 3 263 ? -190.097 150.159 170.195 1.00 53.72  ? 263 PHE D O     1 
ATOM 6620  C CB    . PHE C 3 263 ? -192.501 152.066 171.328 1.00 53.72  ? 263 PHE D CB    1 
ATOM 6621  C CG    . PHE C 3 263 ? -191.803 152.948 170.352 1.00 53.72  ? 263 PHE D CG    1 
ATOM 6622  C CD1   . PHE C 3 263 ? -192.402 153.307 169.173 1.00 53.72  ? 263 PHE D CD1   1 
ATOM 6623  C CD2   . PHE C 3 263 ? -190.556 153.447 170.627 1.00 53.72  ? 263 PHE D CD2   1 
ATOM 6624  C CE1   . PHE C 3 263 ? -191.767 154.129 168.293 1.00 53.72  ? 263 PHE D CE1   1 
ATOM 6625  C CE2   . PHE C 3 263 ? -189.924 154.265 169.742 1.00 53.72  ? 263 PHE D CE2   1 
ATOM 6626  C CZ    . PHE C 3 263 ? -190.531 154.602 168.574 1.00 53.72  ? 263 PHE D CZ    1 
ATOM 6627  N N     . LEU C 3 264 ? -190.292 150.096 172.438 1.00 54.63  ? 264 LEU D N     1 
ATOM 6628  C CA    . LEU C 3 264 ? -188.882 149.788 172.660 1.00 54.63  ? 264 LEU D CA    1 
ATOM 6629  C C     . LEU C 3 264 ? -188.522 148.345 172.337 1.00 54.63  ? 264 LEU D C     1 
ATOM 6630  O O     . LEU C 3 264 ? -187.597 148.081 171.567 1.00 54.63  ? 264 LEU D O     1 
ATOM 6631  C CB    . LEU C 3 264 ? -188.505 150.061 174.103 1.00 54.63  ? 264 LEU D CB    1 
ATOM 6632  C CG    . LEU C 3 264 ? -188.536 151.529 174.428 1.00 54.63  ? 264 LEU D CG    1 
ATOM 6633  C CD1   . LEU C 3 264 ? -187.900 151.752 175.766 1.00 54.63  ? 264 LEU D CD1   1 
ATOM 6634  C CD2   . LEU C 3 264 ? -187.846 152.271 173.338 1.00 54.63  ? 264 LEU D CD2   1 
ATOM 6635  N N     . SER C 3 265 ? -189.265 147.394 172.896 1.00 56.96  ? 265 SER D N     1 
ATOM 6636  C CA    . SER C 3 265 ? -188.826 146.005 172.880 1.00 56.96  ? 265 SER D CA    1 
ATOM 6637  C C     . SER C 3 265 ? -188.903 145.328 171.524 1.00 56.96  ? 265 SER D C     1 
ATOM 6638  O O     . SER C 3 265 ? -188.112 144.432 171.243 1.00 56.96  ? 265 SER D O     1 
ATOM 6639  C CB    . SER C 3 265 ? -189.678 145.219 173.857 1.00 56.96  ? 265 SER D CB    1 
ATOM 6640  O OG    . SER C 3 265 ? -191.028 145.296 173.450 1.00 56.96  ? 265 SER D OG    1 
ATOM 6641  N N     . THR C 3 266 ? -189.857 145.686 170.704 1.00 53.62  ? 266 THR D N     1 
ATOM 6642  C CA    . THR C 3 266 ? -190.153 144.951 169.485 1.00 53.62  ? 266 THR D CA    1 
ATOM 6643  C C     . THR C 3 266 ? -189.337 145.333 168.248 1.00 53.62  ? 266 THR D C     1 
ATOM 6644  O O     . THR C 3 266 ? -188.830 146.448 168.105 1.00 53.62  ? 266 THR D O     1 
ATOM 6645  C CB    . THR C 3 266 ? -191.621 145.047 169.199 1.00 53.62  ? 266 THR D CB    1 
ATOM 6646  O OG1   . THR C 3 266 ? -192.002 146.405 169.349 1.00 53.62  ? 266 THR D OG1   1 
ATOM 6647  C CG2   . THR C 3 266 ? -192.359 144.231 170.168 1.00 53.62  ? 266 THR D CG2   1 
ATOM 6648  N N     . VAL C 3 267 ? -189.304 144.389 167.309 1.00 50.44  ? 267 VAL D N     1 
ATOM 6649  C CA    . VAL C 3 267 ? -188.632 144.469 166.013 1.00 50.44  ? 267 VAL D CA    1 
ATOM 6650  C C     . VAL C 3 267 ? -189.552 143.725 165.063 1.00 50.44  ? 267 VAL D C     1 
ATOM 6651  O O     . VAL C 3 267 ? -190.103 142.674 165.424 1.00 50.44  ? 267 VAL D O     1 
ATOM 6652  C CB    . VAL C 3 267 ? -187.223 143.860 166.036 1.00 50.44  ? 267 VAL D CB    1 
ATOM 6653  C CG1   . VAL C 3 267 ? -186.722 143.555 164.666 1.00 50.44  ? 267 VAL D CG1   1 
ATOM 6654  C CG2   . VAL C 3 267 ? -186.245 144.789 166.647 1.00 50.44  ? 267 VAL D CG2   1 
ATOM 6655  N N     . PRO C 3 268 ? -189.752 144.239 163.853 1.00 49.73  ? 268 PRO D N     1 
ATOM 6656  C CA    . PRO C 3 268 ? -190.664 143.608 162.899 1.00 49.73  ? 268 PRO D CA    1 
ATOM 6657  C C     . PRO C 3 268 ? -190.233 142.215 162.511 1.00 49.73  ? 268 PRO D C     1 
ATOM 6658  O O     . PRO C 3 268 ? -189.072 141.835 162.645 1.00 49.73  ? 268 PRO D O     1 
ATOM 6659  C CB    . PRO C 3 268 ? -190.544 144.496 161.670 1.00 49.73  ? 268 PRO D CB    1 
ATOM 6660  C CG    . PRO C 3 268 ? -190.024 145.650 162.113 1.00 49.73  ? 268 PRO D CG    1 
ATOM 6661  C CD    . PRO C 3 268 ? -189.126 145.418 163.254 1.00 49.73  ? 268 PRO D CD    1 
ATOM 6662  N N     . SER C 3 269 ? -191.192 141.438 162.036 1.00 49.36  ? 269 SER D N     1 
ATOM 6663  C CA    . SER C 3 269 ? -190.904 140.081 161.616 1.00 49.36  ? 269 SER D CA    1 
ATOM 6664  C C     . SER C 3 269 ? -190.957 140.115 160.103 1.00 49.36  ? 269 SER D C     1 
ATOM 6665  O O     . SER C 3 269 ? -192.039 140.019 159.523 1.00 49.36  ? 269 SER D O     1 
ATOM 6666  C CB    . SER C 3 269 ? -191.917 139.093 162.152 1.00 49.36  ? 269 SER D CB    1 
ATOM 6667  O OG    . SER C 3 269 ? -193.184 139.418 161.622 1.00 49.36  ? 269 SER D OG    1 
ATOM 6668  N N     . GLY C 3 270 ? -189.810 140.255 159.464 1.00 48.46  ? 270 GLY D N     1 
ATOM 6669  C CA    . GLY C 3 270 ? -189.768 140.183 158.026 1.00 48.46  ? 270 GLY D CA    1 
ATOM 6670  C C     . GLY C 3 270 ? -188.417 139.676 157.613 1.00 48.46  ? 270 GLY D C     1 
ATOM 6671  O O     . GLY C 3 270 ? -187.426 140.304 157.962 1.00 48.46  ? 270 GLY D O     1 
ATOM 6672  N N     . LYS C 3 271 ? -188.332 138.533 156.946 1.00 48.74  ? 271 LYS D N     1 
ATOM 6673  C CA    . LYS C 3 271 ? -187.038 137.920 156.651 1.00 48.74  ? 271 LYS D CA    1 
ATOM 6674  C C     . LYS C 3 271 ? -186.214 137.773 157.926 1.00 48.74  ? 271 LYS D C     1 
ATOM 6675  O O     . LYS C 3 271 ? -184.987 137.785 157.892 1.00 48.74  ? 271 LYS D O     1 
ATOM 6676  C CB    . LYS C 3 271 ? -186.274 138.704 155.583 1.00 48.74  ? 271 LYS D CB    1 
ATOM 6677  C CG    . LYS C 3 271 ? -186.902 138.549 154.232 1.00 48.74  ? 271 LYS D CG    1 
ATOM 6678  C CD    . LYS C 3 271 ? -186.669 137.179 153.656 1.00 48.74  ? 271 LYS D CD    1 
ATOM 6679  C CE    . LYS C 3 271 ? -185.273 137.055 153.137 1.00 48.74  ? 271 LYS D CE    1 
ATOM 6680  N NZ    . LYS C 3 271 ? -185.127 137.961 151.979 1.00 48.74  ? 271 LYS D NZ    1 
ATOM 6681  N N     . GLN C 3 272 ? -186.885 137.659 159.070 1.00 47.85  ? 272 GLN D N     1 
ATOM 6682  C CA    . GLN C 3 272 ? -186.190 137.570 160.350 1.00 47.85  ? 272 GLN D CA    1 
ATOM 6683  C C     . GLN C 3 272 ? -185.531 136.229 160.560 1.00 47.85  ? 272 GLN D C     1 
ATOM 6684  O O     . GLN C 3 272 ? -184.522 136.143 161.259 1.00 47.85  ? 272 GLN D O     1 
ATOM 6685  C CB    . GLN C 3 272 ? -187.154 137.798 161.508 1.00 47.85  ? 272 GLN D CB    1 
ATOM 6686  C CG    . GLN C 3 272 ? -187.542 139.208 161.790 1.00 47.85  ? 272 GLN D CG    1 
ATOM 6687  C CD    . GLN C 3 272 ? -186.386 140.070 162.183 1.00 47.85  ? 272 GLN D CD    1 
ATOM 6688  O OE1   . GLN C 3 272 ? -186.133 141.104 161.582 1.00 47.85  ? 272 GLN D OE1   1 
ATOM 6689  N NE2   . GLN C 3 272 ? -185.701 139.676 163.230 1.00 47.85  ? 272 GLN D NE2   1 
ATOM 6690  N N     . ASN C 3 273 ? -186.068 135.177 159.969 1.00 46.52  ? 273 ASN D N     1 
ATOM 6691  C CA    . ASN C 3 273 ? -185.421 133.884 160.097 1.00 46.52  ? 273 ASN D CA    1 
ATOM 6692  C C     . ASN C 3 273 ? -184.140 133.800 159.303 1.00 46.52  ? 273 ASN D C     1 
ATOM 6693  O O     . ASN C 3 273 ? -183.225 133.076 159.693 1.00 46.52  ? 273 ASN D O     1 
ATOM 6694  C CB    . ASN C 3 273 ? -186.370 132.774 159.697 1.00 46.52  ? 273 ASN D CB    1 
ATOM 6695  C CG    . ASN C 3 273 ? -187.592 132.764 160.543 1.00 46.52  ? 273 ASN D CG    1 
ATOM 6696  O OD1   . ASN C 3 273 ? -188.701 132.847 160.043 1.00 46.52  ? 273 ASN D OD1   1 
ATOM 6697  N ND2   . ASN C 3 273 ? -187.398 132.755 161.842 1.00 46.52  ? 273 ASN D ND2   1 
ATOM 6698  N N     . ALA C 3 274 ? -184.047 134.507 158.199 1.00 45.93  ? 274 ALA D N     1 
ATOM 6699  C CA    . ALA C 3 274 ? -182.787 134.522 157.486 1.00 45.93  ? 274 ALA D CA    1 
ATOM 6700  C C     . ALA C 3 274 ? -181.807 135.532 158.045 1.00 45.93  ? 274 ALA D C     1 
ATOM 6701  O O     . ALA C 3 274 ? -180.608 135.380 157.820 1.00 45.93  ? 274 ALA D O     1 
ATOM 6702  C CB    . ALA C 3 274 ? -183.015 134.812 156.009 1.00 45.93  ? 274 ALA D CB    1 
ATOM 6703  N N     . THR C 3 275 ? -182.274 136.551 158.758 1.00 47.58  ? 275 THR D N     1 
ATOM 6704  C CA    . THR C 3 275 ? -181.399 137.525 159.406 1.00 47.58  ? 275 THR D CA    1 
ATOM 6705  C C     . THR C 3 275 ? -181.956 137.822 160.785 1.00 47.58  ? 275 THR D C     1 
ATOM 6706  O O     . THR C 3 275 ? -182.981 138.490 160.898 1.00 47.58  ? 275 THR D O     1 
ATOM 6707  C CB    . THR C 3 275 ? -181.340 138.823 158.614 1.00 47.58  ? 275 THR D CB    1 
ATOM 6708  O OG1   . THR C 3 275 ? -182.543 139.550 158.871 1.00 47.58  ? 275 THR D OG1   1 
ATOM 6709  C CG2   . THR C 3 275 ? -181.267 138.562 157.132 1.00 47.58  ? 275 THR D CG2   1 
ATOM 6710  N N     . ALA C 3 276 ? -181.268 137.382 161.825 1.00 48.70  ? 276 ALA D N     1 
ATOM 6711  C CA    . ALA C 3 276 ? -181.702 137.635 163.189 1.00 48.70  ? 276 ALA D CA    1 
ATOM 6712  C C     . ALA C 3 276 ? -181.391 139.083 163.531 1.00 48.70  ? 276 ALA D C     1 
ATOM 6713  O O     . ALA C 3 276 ? -180.379 139.412 164.150 1.00 48.70  ? 276 ALA D O     1 
ATOM 6714  C CB    . ALA C 3 276 ? -181.045 136.676 164.161 1.00 48.70  ? 276 ALA D CB    1 
ATOM 6715  N N     . ALA C 3 277 ? -182.314 139.951 163.156 1.00 50.10  ? 277 ALA D N     1 
ATOM 6716  C CA    . ALA C 3 277 ? -182.199 141.381 163.365 1.00 50.10  ? 277 ALA D CA    1 
ATOM 6717  C C     . ALA C 3 277 ? -182.738 141.843 164.716 1.00 50.10  ? 277 ALA D C     1 
ATOM 6718  O O     . ALA C 3 277 ? -182.828 143.058 164.909 1.00 50.10  ? 277 ALA D O     1 
ATOM 6719  C CB    . ALA C 3 277 ? -182.864 142.163 162.235 1.00 50.10  ? 277 ALA D CB    1 
ATOM 6720  N N     . MET C 3 278 ? -183.073 140.918 165.636 1.00 54.75  ? 278 MET D N     1 
ATOM 6721  C CA    . MET C 3 278 ? -183.568 141.272 166.962 1.00 54.75  ? 278 MET D CA    1 
ATOM 6722  C C     . MET C 3 278 ? -182.556 142.141 167.674 1.00 54.75  ? 278 MET D C     1 
ATOM 6723  O O     . MET C 3 278 ? -181.398 141.752 167.792 1.00 54.75  ? 278 MET D O     1 
ATOM 6724  C CB    . MET C 3 278 ? -183.810 140.008 167.753 1.00 54.75  ? 278 MET D CB    1 
ATOM 6725  C CG    . MET C 3 278 ? -185.018 139.162 167.368 1.00 54.75  ? 278 MET D CG    1 
ATOM 6726  S SD    . MET C 3 278 ? -186.673 139.907 167.640 1.00 54.75  ? 278 MET D SD    1 
ATOM 6727  C CE    . MET C 3 278 ? -187.474 139.288 166.216 1.00 54.75  ? 278 MET D CE    1 
ATOM 6728  N N     . THR C 3 279 ? -182.959 143.336 168.101 1.00 49.41  ? 279 THR D N     1 
ATOM 6729  C CA    . THR C 3 279 ? -182.003 144.275 168.681 1.00 49.41  ? 279 THR D CA    1 
ATOM 6730  C C     . THR C 3 279 ? -182.735 145.237 169.596 1.00 49.41  ? 279 THR D C     1 
ATOM 6731  O O     . THR C 3 279 ? -183.943 145.422 169.467 1.00 49.41  ? 279 THR D O     1 
ATOM 6732  C CB    . THR C 3 279 ? -181.257 145.056 167.588 1.00 49.41  ? 279 THR D CB    1 
ATOM 6733  O OG1   . THR C 3 279 ? -180.836 144.151 166.575 1.00 49.41  ? 279 THR D OG1   1 
ATOM 6734  C CG2   . THR C 3 279 ? -180.086 145.693 168.162 1.00 49.41  ? 279 THR D CG2   1 
ATOM 6735  N N     . LEU C 3 280 ? -181.994 145.822 170.565 1.00 47.40  ? 280 LEU D N     1 
ATOM 6736  C CA    . LEU C 3 280 ? -182.484 146.886 171.445 1.00 47.40  ? 280 LEU D CA    1 
ATOM 6737  C C     . LEU C 3 280 ? -181.945 148.245 171.062 1.00 47.40  ? 280 LEU D C     1 
ATOM 6738  O O     . LEU C 3 280 ? -180.802 148.354 170.631 1.00 47.40  ? 280 LEU D O     1 
ATOM 6739  C CB    . LEU C 3 280 ? -182.156 146.657 172.920 1.00 47.40  ? 280 LEU D CB    1 
ATOM 6740  C CG    . LEU C 3 280 ? -182.991 145.747 173.792 1.00 47.40  ? 280 LEU D CG    1 
ATOM 6741  C CD1   . LEU C 3 280 ? -182.340 145.685 175.140 1.00 47.40  ? 280 LEU D CD1   1 
ATOM 6742  C CD2   . LEU C 3 280 ? -184.358 146.359 173.911 1.00 47.40  ? 280 LEU D CD2   1 
ATOM 6743  N N     . PRO C 3 281 ? -182.760 149.278 171.205 1.00 49.20  ? 281 PRO D N     1 
ATOM 6744  C CA    . PRO C 3 281 ? -182.313 150.626 170.871 1.00 49.20  ? 281 PRO D CA    1 
ATOM 6745  C C     . PRO C 3 281 ? -181.148 151.094 171.719 1.00 49.20  ? 281 PRO D C     1 
ATOM 6746  O O     . PRO C 3 281 ? -181.037 150.768 172.899 1.00 49.20  ? 281 PRO D O     1 
ATOM 6747  C CB    . PRO C 3 281 ? -183.543 151.476 171.157 1.00 49.20  ? 281 PRO D CB    1 
ATOM 6748  C CG    . PRO C 3 281 ? -184.649 150.583 171.017 1.00 49.20  ? 281 PRO D CG    1 
ATOM 6749  C CD    . PRO C 3 281 ? -184.195 149.249 171.486 1.00 49.20  ? 281 PRO D CD    1 
ATOM 6750  N N     . ASP C 3 282 ? -180.292 151.905 171.112 1.00 54.73  ? 282 ASP D N     1 
ATOM 6751  C CA    . ASP C 3 282 ? -179.129 152.411 171.822 1.00 54.73  ? 282 ASP D CA    1 
ATOM 6752  C C     . ASP C 3 282 ? -179.501 153.606 172.677 1.00 54.73  ? 282 ASP D C     1 
ATOM 6753  O O     . ASP C 3 282 ? -178.928 153.797 173.744 1.00 54.73  ? 282 ASP D O     1 
ATOM 6754  C CB    . ASP C 3 282 ? -178.009 152.778 170.855 1.00 54.73  ? 282 ASP D CB    1 
ATOM 6755  C CG    . ASP C 3 282 ? -177.633 151.632 169.968 1.00 54.73  ? 282 ASP D CG    1 
ATOM 6756  O OD1   . ASP C 3 282 ? -177.833 150.484 170.408 1.00 54.73  ? 282 ASP D OD1   1 
ATOM 6757  O OD2   . ASP C 3 282 ? -177.118 151.864 168.860 1.00 54.73  ? 282 ASP D OD2   1 
ATOM 6758  N N     . LEU C 3 283 ? -180.436 154.422 172.220 1.00 51.26  ? 283 LEU D N     1 
ATOM 6759  C CA    . LEU C 3 283 ? -180.887 155.604 172.929 1.00 51.26  ? 283 LEU D CA    1 
ATOM 6760  C C     . LEU C 3 283 ? -182.394 155.736 172.901 1.00 51.26  ? 283 LEU D C     1 
ATOM 6761  O O     . LEU C 3 283 ? -183.011 155.581 171.848 1.00 51.26  ? 283 LEU D O     1 
ATOM 6762  C CB    . LEU C 3 283 ? -180.327 156.854 172.277 1.00 51.26  ? 283 LEU D CB    1 
ATOM 6763  C CG    . LEU C 3 283 ? -180.108 158.097 173.110 1.00 51.26  ? 283 LEU D CG    1 
ATOM 6764  C CD1   . LEU C 3 283 ? -179.081 158.924 172.473 1.00 51.26  ? 283 LEU D CD1   1 
ATOM 6765  C CD2   . LEU C 3 283 ? -181.373 158.880 173.109 1.00 51.26  ? 283 LEU D CD2   1 
ATOM 6766  N N     . VAL C 3 284 ? -182.998 156.047 174.038 1.00 52.52  ? 284 VAL D N     1 
ATOM 6767  C CA    . VAL C 3 284 ? -184.404 156.416 174.038 1.00 52.52  ? 284 VAL D CA    1 
ATOM 6768  C C     . VAL C 3 284 ? -184.508 157.725 174.788 1.00 52.52  ? 284 VAL D C     1 
ATOM 6769  O O     . VAL C 3 284 ? -183.782 157.947 175.764 1.00 52.52  ? 284 VAL D O     1 
ATOM 6770  C CB    . VAL C 3 284 ? -185.332 155.348 174.644 1.00 52.52  ? 284 VAL D CB    1 
ATOM 6771  C CG1   . VAL C 3 284 ? -185.022 154.017 174.052 1.00 52.52  ? 284 VAL D CG1   1 
ATOM 6772  C CG2   . VAL C 3 284 ? -185.250 155.303 176.129 1.00 52.52  ? 284 VAL D CG2   1 
ATOM 6773  N N     . HIS C 3 285 ? -185.395 158.595 174.332 1.00 56.29  ? 285 HIS D N     1 
ATOM 6774  C CA    . HIS C 3 285 ? -185.552 159.912 174.931 1.00 56.29  ? 285 HIS D CA    1 
ATOM 6775  C C     . HIS C 3 285 ? -187.040 160.205 174.888 1.00 56.29  ? 285 HIS D C     1 
ATOM 6776  O O     . HIS C 3 285 ? -187.614 160.302 173.800 1.00 56.29  ? 285 HIS D O     1 
ATOM 6777  C CB    . HIS C 3 285 ? -184.780 161.006 174.216 1.00 56.29  ? 285 HIS D CB    1 
ATOM 6778  C CG    . HIS C 3 285 ? -185.124 162.367 174.724 1.00 56.29  ? 285 HIS D CG    1 
ATOM 6779  N ND1   . HIS C 3 285 ? -185.252 163.468 173.910 1.00 56.29  ? 285 HIS D ND1   1 
ATOM 6780  C CD2   . HIS C 3 285 ? -185.309 162.810 175.987 1.00 56.29  ? 285 HIS D CD2   1 
ATOM 6781  C CE1   . HIS C 3 285 ? -185.556 164.521 174.645 1.00 56.29  ? 285 HIS D CE1   1 
ATOM 6782  N NE2   . HIS C 3 285 ? -185.582 164.151 175.911 1.00 56.29  ? 285 HIS D NE2   1 
ATOM 6783  N N     . ILE C 3 286 ? -187.674 160.224 176.051 1.00 56.55  ? 286 ILE D N     1 
ATOM 6784  C CA    . ILE C 3 286 ? -189.099 160.487 176.199 1.00 56.55  ? 286 ILE D CA    1 
ATOM 6785  C C     . ILE C 3 286 ? -189.282 161.880 176.764 1.00 56.55  ? 286 ILE D C     1 
ATOM 6786  O O     . ILE C 3 286 ? -188.835 162.170 177.878 1.00 56.55  ? 286 ILE D O     1 
ATOM 6787  C CB    . ILE C 3 286 ? -189.775 159.453 177.103 1.00 56.55  ? 286 ILE D CB    1 
ATOM 6788  C CG1   . ILE C 3 286 ? -189.541 158.059 176.556 1.00 56.55  ? 286 ILE D CG1   1 
ATOM 6789  C CG2   . ILE C 3 286 ? -191.225 159.740 177.176 1.00 56.55  ? 286 ILE D CG2   1 
ATOM 6790  C CD1   . ILE C 3 286 ? -190.303 157.015 177.290 1.00 56.55  ? 286 ILE D CD1   1 
ATOM 6791  N N     . ALA C 3 287 ? -189.965 162.736 176.015 1.00 60.66  ? 287 ALA D N     1 
ATOM 6792  C CA    . ALA C 3 287 ? -190.145 164.131 176.409 1.00 60.66  ? 287 ALA D CA    1 
ATOM 6793  C C     . ALA C 3 287 ? -191.624 164.472 176.538 1.00 60.66  ? 287 ALA D C     1 
ATOM 6794  O O     . ALA C 3 287 ? -192.296 164.712 175.536 1.00 60.66  ? 287 ALA D O     1 
ATOM 6795  C CB    . ALA C 3 287 ? -189.475 165.048 175.402 1.00 60.66  ? 287 ALA D CB    1 
ATOM 6796  N N     . VAL C 3 288 ? -192.122 164.555 177.765 1.00 64.61  ? 288 VAL D N     1 
ATOM 6797  C CA    . VAL C 3 288 ? -193.502 164.964 177.996 1.00 64.61  ? 288 VAL D CA    1 
ATOM 6798  C C     . VAL C 3 288 ? -193.643 166.455 177.701 1.00 64.61  ? 288 VAL D C     1 
ATOM 6799  O O     . VAL C 3 288 ? -193.280 167.297 178.523 1.00 64.61  ? 288 VAL D O     1 
ATOM 6800  C CB    . VAL C 3 288 ? -193.940 164.634 179.429 1.00 64.61  ? 288 VAL D CB    1 
ATOM 6801  C CG1   . VAL C 3 288 ? -195.320 165.122 179.665 1.00 64.61  ? 288 VAL D CG1   1 
ATOM 6802  C CG2   . VAL C 3 288 ? -193.900 163.157 179.648 1.00 64.61  ? 288 VAL D CG2   1 
ATOM 6803  N N     . ARG C 3 289 ? -194.169 166.781 176.524 1.00 67.44  ? 289 ARG D N     1 
ATOM 6804  C CA    . ARG C 3 289 ? -194.329 168.143 176.028 1.00 67.44  ? 289 ARG D CA    1 
ATOM 6805  C C     . ARG C 3 289 ? -195.774 168.616 176.094 1.00 67.44  ? 289 ARG D C     1 
ATOM 6806  O O     . ARG C 3 289 ? -196.690 167.858 175.779 1.00 67.44  ? 289 ARG D O     1 
ATOM 6807  C CB    . ARG C 3 289 ? -193.884 168.207 174.566 1.00 67.44  ? 289 ARG D CB    1 
ATOM 6808  C CG    . ARG C 3 289 ? -192.513 167.678 174.265 1.00 67.44  ? 289 ARG D CG    1 
ATOM 6809  C CD    . ARG C 3 289 ? -192.028 168.273 172.968 1.00 67.44  ? 289 ARG D CD    1 
ATOM 6810  N NE    . ARG C 3 289 ? -192.198 169.708 172.825 1.00 67.44  ? 289 ARG D NE    1 
ATOM 6811  C CZ    . ARG C 3 289 ? -191.224 170.590 172.978 1.00 67.44  ? 289 ARG D CZ    1 
ATOM 6812  N NH1   . ARG C 3 289 ? -191.444 171.884 172.826 1.00 67.44  ? 289 ARG D NH1   1 
ATOM 6813  N NH2   . ARG C 3 289 ? -190.005 170.169 173.253 1.00 67.44  ? 289 ARG D NH2   1 
ATOM 6814  N N     . PHE C 3 290 ? -195.989 169.842 176.562 1.00 70.20  ? 290 PHE D N     1 
ATOM 6815  C CA    . PHE C 3 290 ? -197.339 170.395 176.557 1.00 70.20  ? 290 PHE D CA    1 
ATOM 6816  C C     . PHE C 3 290 ? -197.605 171.306 175.367 1.00 70.20  ? 290 PHE D C     1 
ATOM 6817  O O     . PHE C 3 290 ? -198.762 171.453 174.961 1.00 70.20  ? 290 PHE D O     1 
ATOM 6818  C CB    . PHE C 3 290 ? -197.657 171.138 177.854 1.00 70.20  ? 290 PHE D CB    1 
ATOM 6819  C CG    . PHE C 3 290 ? -197.543 170.290 179.080 1.00 70.20  ? 290 PHE D CG    1 
ATOM 6820  C CD1   . PHE C 3 290 ? -198.605 169.492 179.466 1.00 70.20  ? 290 PHE D CD1   1 
ATOM 6821  C CD2   . PHE C 3 290 ? -196.404 170.282 179.846 1.00 70.20  ? 290 PHE D CD2   1 
ATOM 6822  C CE1   . PHE C 3 290 ? -198.526 168.708 180.584 1.00 70.20  ? 290 PHE D CE1   1 
ATOM 6823  C CE2   . PHE C 3 290 ? -196.325 169.496 180.963 1.00 70.20  ? 290 PHE D CE2   1 
ATOM 6824  C CZ    . PHE C 3 290 ? -197.383 168.709 181.332 1.00 70.20  ? 290 PHE D CZ    1 
ATOM 6825  N N     . ASP C 3 291 ? -196.576 171.946 174.814 1.00 72.81  ? 291 ASP D N     1 
ATOM 6826  C CA    . ASP C 3 291 ? -196.807 172.787 173.650 1.00 72.81  ? 291 ASP D CA    1 
ATOM 6827  C C     . ASP C 3 291 ? -197.219 171.946 172.445 1.00 72.81  ? 291 ASP D C     1 
ATOM 6828  O O     . ASP C 3 291 ? -198.385 171.990 172.045 1.00 72.81  ? 291 ASP D O     1 
ATOM 6829  C CB    . ASP C 3 291 ? -195.593 173.666 173.339 1.00 72.81  ? 291 ASP D CB    1 
ATOM 6830  C CG    . ASP C 3 291 ? -194.348 172.878 173.062 1.00 72.81  ? 291 ASP D CG    1 
ATOM 6831  O OD1   . ASP C 3 291 ? -194.296 171.711 173.489 1.00 72.81  ? 291 ASP D OD1   1 
ATOM 6832  O OD2   . ASP C 3 291 ? -193.435 173.409 172.395 1.00 72.81  ? 291 ASP D OD2   1 
ATOM 6833  N N     . ARG C 3 292 ? -196.315 171.150 171.882 1.00 66.79  ? 292 ARG D N     1 
ATOM 6834  C CA    . ARG C 3 292 ? -196.641 170.396 170.683 1.00 66.79  ? 292 ARG D CA    1 
ATOM 6835  C C     . ARG C 3 292 ? -195.604 169.302 170.532 1.00 66.79  ? 292 ARG D C     1 
ATOM 6836  O O     . ARG C 3 292 ? -194.494 169.422 171.057 1.00 66.79  ? 292 ARG D O     1 
ATOM 6837  C CB    . ARG C 3 292 ? -196.604 171.292 169.443 1.00 66.79  ? 292 ARG D CB    1 
ATOM 6838  C CG    . ARG C 3 292 ? -195.273 171.975 169.241 1.00 66.79  ? 292 ARG D CG    1 
ATOM 6839  C CD    . ARG C 3 292 ? -195.343 172.919 168.080 1.00 66.79  ? 292 ARG D CD    1 
ATOM 6840  N NE    . ARG C 3 292 ? -194.058 173.524 167.774 1.00 66.79  ? 292 ARG D NE    1 
ATOM 6841  C CZ    . ARG C 3 292 ? -193.223 172.978 166.902 1.00 66.79  ? 292 ARG D CZ    1 
ATOM 6842  N NH1   . ARG C 3 292 ? -192.059 173.533 166.634 1.00 66.79  ? 292 ARG D NH1   1 
ATOM 6843  N NH2   . ARG C 3 292 ? -193.585 171.873 166.268 1.00 66.79  ? 292 ARG D NH2   1 
ATOM 6844  N N     . PRO C 3 293 ? -195.924 168.227 169.825 1.00 64.01  ? 293 PRO D N     1 
ATOM 6845  C CA    . PRO C 3 293 ? -194.924 167.195 169.560 1.00 64.01  ? 293 PRO D CA    1 
ATOM 6846  C C     . PRO C 3 293 ? -193.955 167.627 168.473 1.00 64.01  ? 293 PRO D C     1 
ATOM 6847  O O     . PRO C 3 293 ? -194.341 168.292 167.510 1.00 64.01  ? 293 PRO D O     1 
ATOM 6848  C CB    . PRO C 3 293 ? -195.772 166.015 169.085 1.00 64.01  ? 293 PRO D CB    1 
ATOM 6849  C CG    . PRO C 3 293 ? -196.953 166.663 168.504 1.00 64.01  ? 293 PRO D CG    1 
ATOM 6850  C CD    . PRO C 3 293 ? -197.238 167.858 169.291 1.00 64.01  ? 293 PRO D CD    1 
ATOM 6851  N N     . ILE C 3 294 ? -192.692 167.246 168.621 1.00 61.16  ? 294 ILE D N     1 
ATOM 6852  C CA    . ILE C 3 294 ? -191.646 167.647 167.690 1.00 61.16  ? 294 ILE D CA    1 
ATOM 6853  C C     . ILE C 3 294 ? -190.755 166.437 167.481 1.00 61.16  ? 294 ILE D C     1 
ATOM 6854  O O     . ILE C 3 294 ? -190.416 165.735 168.437 1.00 61.16  ? 294 ILE D O     1 
ATOM 6855  C CB    . ILE C 3 294 ? -190.834 168.876 168.135 1.00 61.16  ? 294 ILE D CB    1 
ATOM 6856  C CG1   . ILE C 3 294 ? -190.047 168.614 169.390 1.00 61.16  ? 294 ILE D CG1   1 
ATOM 6857  C CG2   . ILE C 3 294 ? -191.740 170.032 168.400 1.00 61.16  ? 294 ILE D CG2   1 
ATOM 6858  C CD1   . ILE C 3 294 ? -189.461 169.875 169.949 1.00 61.16  ? 294 ILE D CD1   1 
ATOM 6859  N N     . SER C 3 295 ? -190.381 166.185 166.237 1.00 58.56  ? 295 SER D N     1 
ATOM 6860  C CA    . SER C 3 295 ? -189.469 165.101 165.925 1.00 58.56  ? 295 SER D CA    1 
ATOM 6861  C C     . SER C 3 295 ? -188.099 165.682 165.653 1.00 58.56  ? 295 SER D C     1 
ATOM 6862  O O     . SER C 3 295 ? -187.969 166.683 164.954 1.00 58.56  ? 295 SER D O     1 
ATOM 6863  C CB    . SER C 3 295 ? -189.945 164.314 164.714 1.00 58.56  ? 295 SER D CB    1 
ATOM 6864  O OG    . SER C 3 295 ? -189.894 165.133 163.569 1.00 58.56  ? 295 SER D OG    1 
ATOM 6865  N N     . PHE C 3 296 ? -187.073 165.001 166.144 1.00 56.60  ? 296 PHE D N     1 
ATOM 6866  C CA    . PHE C 3 296 ? -185.701 165.402 165.881 1.00 56.60  ? 296 PHE D CA    1 
ATOM 6867  C C     . PHE C 3 296 ? -185.175 164.870 164.573 1.00 56.60  ? 296 PHE D C     1 
ATOM 6868  O O     . PHE C 3 296 ? -183.963 164.699 164.423 1.00 56.60  ? 296 PHE D O     1 
ATOM 6869  C CB    . PHE C 3 296 ? -184.799 164.958 167.025 1.00 56.60  ? 296 PHE D CB    1 
ATOM 6870  C CG    . PHE C 3 296 ? -185.105 165.625 168.313 1.00 56.60  ? 296 PHE D CG    1 
ATOM 6871  C CD1   . PHE C 3 296 ? -185.753 166.831 168.339 1.00 56.60  ? 296 PHE D CD1   1 
ATOM 6872  C CD2   . PHE C 3 296 ? -184.728 165.053 169.498 1.00 56.60  ? 296 PHE D CD2   1 
ATOM 6873  C CE1   . PHE C 3 296 ? -186.035 167.431 169.521 1.00 56.60  ? 296 PHE D CE1   1 
ATOM 6874  C CE2   . PHE C 3 296 ? -185.002 165.652 170.678 1.00 56.60  ? 296 PHE D CE2   1 
ATOM 6875  C CZ    . PHE C 3 296 ? -185.653 166.841 170.694 1.00 56.60  ? 296 PHE D CZ    1 
ATOM 6876  N N     . ALA C 3 297 ? -186.050 164.655 163.607 1.00 57.17  ? 297 ALA D N     1 
ATOM 6877  C CA    . ALA C 3 297 ? -185.610 164.122 162.326 1.00 57.17  ? 297 ALA D CA    1 
ATOM 6878  C C     . ALA C 3 297 ? -184.650 165.066 161.622 1.00 57.17  ? 297 ALA D C     1 
ATOM 6879  O O     . ALA C 3 297 ? -183.642 164.581 161.080 1.00 57.17  ? 297 ALA D O     1 
ATOM 6880  C CB    . ALA C 3 297 ? -186.818 163.816 161.439 1.00 57.17  ? 297 ALA D CB    1 
ATOM 6881  N N     . PRO C 3 298 ? -184.850 166.382 161.625 1.00 57.03  ? 298 PRO D N     1 
ATOM 6882  C CA    . PRO C 3 298 ? -183.887 167.265 160.962 1.00 57.03  ? 298 PRO D CA    1 
ATOM 6883  C C     . PRO C 3 298 ? -182.483 167.211 161.523 1.00 57.03  ? 298 PRO D C     1 
ATOM 6884  O O     . PRO C 3 298 ? -181.570 167.719 160.867 1.00 57.03  ? 298 PRO D O     1 
ATOM 6885  C CB    . PRO C 3 298 ? -184.502 168.647 161.156 1.00 57.03  ? 298 PRO D CB    1 
ATOM 6886  C CG    . PRO C 3 298 ? -185.905 168.387 161.362 1.00 57.03  ? 298 PRO D CG    1 
ATOM 6887  C CD    . PRO C 3 298 ? -186.005 167.143 162.110 1.00 57.03  ? 298 PRO D CD    1 
ATOM 6888  N N     . ALA C 3 299 ? -182.261 166.594 162.679 1.00 56.79  ? 299 ALA D N     1 
ATOM 6889  C CA    . ALA C 3 299 ? -180.895 166.414 163.140 1.00 56.79  ? 299 ALA D CA    1 
ATOM 6890  C C     . ALA C 3 299 ? -180.080 165.652 162.123 1.00 56.79  ? 299 ALA D C     1 
ATOM 6891  O O     . ALA C 3 299 ? -178.873 165.866 161.997 1.00 56.79  ? 299 ALA D O     1 
ATOM 6892  C CB    . ALA C 3 299 ? -180.881 165.671 164.458 1.00 56.79  ? 299 ALA D CB    1 
ATOM 6893  N N     . PHE C 3 300 ? -180.737 164.776 161.377 1.00 55.07  ? 300 PHE D N     1 
ATOM 6894  C CA    . PHE C 3 300 ? -180.116 163.941 160.369 1.00 55.07  ? 300 PHE D CA    1 
ATOM 6895  C C     . PHE C 3 300 ? -180.474 164.370 158.959 1.00 55.07  ? 300 PHE D C     1 
ATOM 6896  O O     . PHE C 3 300 ? -180.423 163.556 158.038 1.00 55.07  ? 300 PHE D O     1 
ATOM 6897  C CB    . PHE C 3 300 ? -180.480 162.496 160.646 1.00 55.07  ? 300 PHE D CB    1 
ATOM 6898  C CG    . PHE C 3 300 ? -180.310 162.129 162.076 1.00 55.07  ? 300 PHE D CG    1 
ATOM 6899  C CD1   . PHE C 3 300 ? -179.234 162.593 162.789 1.00 55.07  ? 300 PHE D CD1   1 
ATOM 6900  C CD2   . PHE C 3 300 ? -181.267 161.409 162.733 1.00 55.07  ? 300 PHE D CD2   1 
ATOM 6901  C CE1   . PHE C 3 300 ? -179.086 162.281 164.103 1.00 55.07  ? 300 PHE D CE1   1 
ATOM 6902  C CE2   . PHE C 3 300 ? -181.122 161.111 164.051 1.00 55.07  ? 300 PHE D CE2   1 
ATOM 6903  C CZ    . PHE C 3 300 ? -180.034 161.545 164.738 1.00 55.07  ? 300 PHE D CZ    1 
ATOM 6904  N N     . GLU C 3 301 ? -180.808 165.641 158.760 1.00 60.92  ? 301 GLU D N     1 
ATOM 6905  C CA    . GLU C 3 301 ? -181.002 166.082 157.393 1.00 60.92  ? 301 GLU D CA    1 
ATOM 6906  C C     . GLU C 3 301 ? -179.693 166.066 156.645 1.00 60.92  ? 301 GLU D C     1 
ATOM 6907  O O     . GLU C 3 301 ? -179.692 166.002 155.415 1.00 60.92  ? 301 GLU D O     1 
ATOM 6908  C CB    . GLU C 3 301 ? -181.611 167.482 157.350 1.00 60.92  ? 301 GLU D CB    1 
ATOM 6909  C CG    . GLU C 3 301 ? -182.126 167.906 155.980 1.00 60.92  ? 301 GLU D CG    1 
ATOM 6910  C CD    . GLU C 3 301 ? -181.063 168.541 155.102 1.00 60.92  ? 301 GLU D CD    1 
ATOM 6911  O OE1   . GLU C 3 301 ? -180.132 169.167 155.644 1.00 60.92  ? 301 GLU D OE1   1 
ATOM 6912  O OE2   . GLU C 3 301 ? -181.145 168.395 153.866 1.00 60.92  ? 301 GLU D OE2   1 
ATOM 6913  N N     . THR C 3 302 ? -178.583 166.110 157.346 1.00 61.28  ? 302 THR D N     1 
ATOM 6914  C CA    . THR C 3 302 ? -177.292 165.877 156.729 1.00 61.28  ? 302 THR D CA    1 
ATOM 6915  C C     . THR C 3 302 ? -176.825 164.506 157.201 1.00 61.28  ? 302 THR D C     1 
ATOM 6916  O O     . THR C 3 302 ? -176.479 164.337 158.374 1.00 61.28  ? 302 THR D O     1 
ATOM 6917  C CB    . THR C 3 302 ? -176.315 166.967 157.124 1.00 61.28  ? 302 THR D CB    1 
ATOM 6918  O OG1   . THR C 3 302 ? -176.115 166.903 158.537 1.00 61.28  ? 302 THR D OG1   1 
ATOM 6919  C CG2   . THR C 3 302 ? -176.887 168.310 156.777 1.00 61.28  ? 302 THR D CG2   1 
ATOM 6920  N N     . ALA C 3 303 ? -176.835 163.531 156.298 1.00 61.27  ? 303 ALA D N     1 
ATOM 6921  C CA    . ALA C 3 303 ? -176.459 162.172 156.649 1.00 61.27  ? 303 ALA D CA    1 
ATOM 6922  C C     . ALA C 3 303 ? -175.028 162.132 157.158 1.00 61.27  ? 303 ALA D C     1 
ATOM 6923  O O     . ALA C 3 303 ? -174.148 162.789 156.603 1.00 61.27  ? 303 ALA D O     1 
ATOM 6924  C CB    . ALA C 3 303 ? -176.618 161.266 155.437 1.00 61.27  ? 303 ALA D CB    1 
ATOM 6925  N N     . LEU C 3 304 ? -174.788 161.399 158.237 1.00 62.30  ? 304 LEU D N     1 
ATOM 6926  C CA    . LEU C 3 304 ? -173.431 161.353 158.750 1.00 62.30  ? 304 LEU D CA    1 
ATOM 6927  C C     . LEU C 3 304 ? -172.529 160.516 157.842 1.00 62.30  ? 304 LEU D C     1 
ATOM 6928  O O     . LEU C 3 304 ? -172.951 159.499 157.301 1.00 62.30  ? 304 LEU D O     1 
ATOM 6929  C CB    . LEU C 3 304 ? -173.470 160.719 160.129 1.00 62.30  ? 304 LEU D CB    1 
ATOM 6930  C CG    . LEU C 3 304 ? -174.365 161.421 161.138 1.00 62.30  ? 304 LEU D CG    1 
ATOM 6931  C CD1   . LEU C 3 304 ? -174.141 160.846 162.497 1.00 62.30  ? 304 LEU D CD1   1 
ATOM 6932  C CD2   . LEU C 3 304 ? -174.154 162.890 161.133 1.00 62.30  ? 304 LEU D CD2   1 
ATOM 6933  N N     . TYR C 3 305 ? -171.261 160.917 157.773 1.00 70.29  ? 305 TYR D N     1 
ATOM 6934  C CA    . TYR C 3 305 ? -170.228 160.215 157.031 1.00 70.29  ? 305 TYR D CA    1 
ATOM 6935  C C     . TYR C 3 305 ? -169.917 158.951 157.809 1.00 70.29  ? 305 TYR D C     1 
ATOM 6936  O O     . TYR C 3 305 ? -170.310 158.828 158.954 1.00 70.29  ? 305 TYR D O     1 
ATOM 6937  C CB    . TYR C 3 305 ? -168.974 161.062 156.940 1.00 70.29  ? 305 TYR D CB    1 
ATOM 6938  C CG    . TYR C 3 305 ? -169.175 162.408 156.299 1.00 70.29  ? 305 TYR D CG    1 
ATOM 6939  C CD1   . TYR C 3 305 ? -170.066 162.570 155.256 1.00 70.29  ? 305 TYR D CD1   1 
ATOM 6940  C CD2   . TYR C 3 305 ? -168.463 163.516 156.732 1.00 70.29  ? 305 TYR D CD2   1 
ATOM 6941  C CE1   . TYR C 3 305 ? -170.251 163.800 154.663 1.00 70.29  ? 305 TYR D CE1   1 
ATOM 6942  C CE2   . TYR C 3 305 ? -168.640 164.750 156.147 1.00 70.29  ? 305 TYR D CE2   1 
ATOM 6943  C CZ    . TYR C 3 305 ? -169.537 164.885 155.111 1.00 70.29  ? 305 TYR D CZ    1 
ATOM 6944  O OH    . TYR C 3 305 ? -169.722 166.111 154.518 1.00 70.29  ? 305 TYR D OH    1 
ATOM 6945  N N     . GLY C 3 306 ? -169.200 158.016 157.197 1.00 68.06  ? 306 GLY D N     1 
ATOM 6946  C CA    . GLY C 3 306 ? -168.921 156.732 157.805 1.00 68.06  ? 306 GLY D CA    1 
ATOM 6947  C C     . GLY C 3 306 ? -167.517 156.463 158.298 1.00 68.06  ? 306 GLY D C     1 
ATOM 6948  O O     . GLY C 3 306 ? -166.721 157.370 158.559 1.00 68.06  ? 306 GLY D O     1 
ATOM 6949  N N     . SER C 3 307 ? -167.246 155.171 158.466 1.00 68.87  ? 307 SER D N     1 
ATOM 6950  C CA    . SER C 3 307 ? -166.027 154.453 158.814 1.00 68.87  ? 307 SER D CA    1 
ATOM 6951  C C     . SER C 3 307 ? -165.686 154.472 160.290 1.00 68.87  ? 307 SER D C     1 
ATOM 6952  O O     . SER C 3 307 ? -164.715 153.831 160.673 1.00 68.87  ? 307 SER D O     1 
ATOM 6953  C CB    . SER C 3 307 ? -164.807 154.957 158.029 1.00 68.87  ? 307 SER D CB    1 
ATOM 6954  O OG    . SER C 3 307 ? -163.657 154.211 158.366 1.00 68.87  ? 307 SER D OG    1 
ATOM 6955  N N     . ASP C 3 308 ? -166.435 155.164 161.131 1.00 69.18  ? 308 ASP D N     1 
ATOM 6956  C CA    . ASP C 3 308 ? -166.132 155.154 162.553 1.00 69.18  ? 308 ASP D CA    1 
ATOM 6957  C C     . ASP C 3 308 ? -167.369 154.752 163.342 1.00 69.18  ? 308 ASP D C     1 
ATOM 6958  O O     . ASP C 3 308 ? -167.375 154.840 164.572 1.00 69.18  ? 308 ASP D O     1 
ATOM 6959  C CB    . ASP C 3 308 ? -165.591 156.495 163.048 1.00 69.18  ? 308 ASP D CB    1 
ATOM 6960  C CG    . ASP C 3 308 ? -165.084 156.418 164.476 1.00 69.18  ? 308 ASP D CG    1 
ATOM 6961  O OD1   . ASP C 3 308 ? -164.026 155.797 164.706 1.00 69.18  ? 308 ASP D OD1   1 
ATOM 6962  O OD2   . ASP C 3 308 ? -165.752 156.963 165.378 1.00 69.18  ? 308 ASP D OD2   1 
ATOM 6963  N N     . GLY C 3 309 ? -168.402 154.283 162.668 1.00 66.86  ? 309 GLY D N     1 
ATOM 6964  C CA    . GLY C 3 309 ? -169.677 154.078 163.303 1.00 66.86  ? 309 GLY D CA    1 
ATOM 6965  C C     . GLY C 3 309 ? -170.504 155.341 163.353 1.00 66.86  ? 309 GLY D C     1 
ATOM 6966  O O     . GLY C 3 309 ? -170.056 156.444 163.053 1.00 66.86  ? 309 GLY D O     1 
ATOM 6967  N N     . TYR C 3 310 ? -171.755 155.152 163.737 1.00 63.77  ? 310 TYR D N     1 
ATOM 6968  C CA    . TYR C 3 310 ? -172.735 156.217 163.832 1.00 63.77  ? 310 TYR D CA    1 
ATOM 6969  C C     . TYR C 3 310 ? -173.500 156.299 165.133 1.00 63.77  ? 310 TYR D C     1 
ATOM 6970  O O     . TYR C 3 310 ? -174.158 157.314 165.357 1.00 63.77  ? 310 TYR D O     1 
ATOM 6971  C CB    . TYR C 3 310 ? -173.756 156.106 162.707 1.00 63.77  ? 310 TYR D CB    1 
ATOM 6972  C CG    . TYR C 3 310 ? -173.213 156.139 161.320 1.00 63.77  ? 310 TYR D CG    1 
ATOM 6973  C CD1   . TYR C 3 310 ? -172.805 157.327 160.772 1.00 63.77  ? 310 TYR D CD1   1 
ATOM 6974  C CD2   . TYR C 3 310 ? -173.069 154.998 160.575 1.00 63.77  ? 310 TYR D CD2   1 
ATOM 6975  C CE1   . TYR C 3 310 ? -172.330 157.384 159.510 1.00 63.77  ? 310 TYR D CE1   1 
ATOM 6976  C CE2   . TYR C 3 310 ? -172.576 155.049 159.319 1.00 63.77  ? 310 TYR D CE2   1 
ATOM 6977  C CZ    . TYR C 3 310 ? -172.207 156.238 158.793 1.00 63.77  ? 310 TYR D CZ    1 
ATOM 6978  O OH    . TYR C 3 310 ? -171.727 156.280 157.520 1.00 63.77  ? 310 TYR D OH    1 
ATOM 6979  N N     . THR C 3 311 ? -173.450 155.294 165.995 1.00 65.15  ? 311 THR D N     1 
ATOM 6980  C CA    . THR C 3 311 ? -174.249 155.366 167.210 1.00 65.15  ? 311 THR D CA    1 
ATOM 6981  C C     . THR C 3 311 ? -173.869 156.580 168.042 1.00 65.15  ? 311 THR D C     1 
ATOM 6982  O O     . THR C 3 311 ? -174.711 157.431 168.337 1.00 65.15  ? 311 THR D O     1 
ATOM 6983  C CB    . THR C 3 311 ? -174.086 154.085 168.013 1.00 65.15  ? 311 THR D CB    1 
ATOM 6984  O OG1   . THR C 3 311 ? -172.723 153.963 168.431 1.00 65.15  ? 311 THR D OG1   1 
ATOM 6985  C CG2   . THR C 3 311 ? -174.458 152.897 167.171 1.00 65.15  ? 311 THR D CG2   1 
ATOM 6986  N N     . LEU C 3 312 ? -172.600 156.694 168.408 1.00 68.67  ? 312 LEU D N     1 
ATOM 6987  C CA    . LEU C 3 312 ? -172.175 157.789 169.268 1.00 68.67  ? 312 LEU D CA    1 
ATOM 6988  C C     . LEU C 3 312 ? -172.379 159.141 168.600 1.00 68.67  ? 312 LEU D C     1 
ATOM 6989  O O     . LEU C 3 312 ? -172.919 160.075 169.206 1.00 68.67  ? 312 LEU D O     1 
ATOM 6990  C CB    . LEU C 3 312 ? -170.717 157.606 169.648 1.00 68.67  ? 312 LEU D CB    1 
ATOM 6991  C CG    . LEU C 3 312 ? -170.228 158.755 170.506 1.00 68.67  ? 312 LEU D CG    1 
ATOM 6992  C CD1   . LEU C 3 312 ? -170.956 158.723 171.825 1.00 68.67  ? 312 LEU D CD1   1 
ATOM 6993  C CD2   . LEU C 3 312 ? -168.733 158.665 170.708 1.00 68.67  ? 312 LEU D CD2   1 
ATOM 6994  N N     . ARG C 3 313 ? -172.003 159.250 167.330 1.00 69.01  ? 313 ARG D N     1 
ATOM 6995  C CA    . ARG C 3 313 ? -172.088 160.538 166.659 1.00 69.01  ? 313 ARG D CA    1 
ATOM 6996  C C     . ARG C 3 313 ? -173.532 160.960 166.505 1.00 69.01  ? 313 ARG D C     1 
ATOM 6997  O O     . ARG C 3 313 ? -173.859 162.137 166.676 1.00 69.01  ? 313 ARG D O     1 
ATOM 6998  C CB    . ARG C 3 313 ? -171.423 160.445 165.293 1.00 69.01  ? 313 ARG D CB    1 
ATOM 6999  C CG    . ARG C 3 313 ? -170.015 159.935 165.371 1.00 69.01  ? 313 ARG D CG    1 
ATOM 7000  C CD    . ARG C 3 313 ? -169.297 159.978 164.038 1.00 69.01  ? 313 ARG D CD    1 
ATOM 7001  N NE    . ARG C 3 313 ? -169.384 161.273 163.373 1.00 69.01  ? 313 ARG D NE    1 
ATOM 7002  C CZ    . ARG C 3 313 ? -169.233 161.432 162.064 1.00 69.01  ? 313 ARG D CZ    1 
ATOM 7003  N NH1   . ARG C 3 313 ? -168.993 160.382 161.291 1.00 69.01  ? 313 ARG D NH1   1 
ATOM 7004  N NH2   . ARG C 3 313 ? -169.324 162.639 161.531 1.00 69.01  ? 313 ARG D NH2   1 
ATOM 7005  N N     . ALA C 3 314 ? -174.413 160.015 166.204 1.00 64.15  ? 314 ALA D N     1 
ATOM 7006  C CA    . ALA C 3 314 ? -175.825 160.341 166.118 1.00 64.15  ? 314 ALA D CA    1 
ATOM 7007  C C     . ALA C 3 314 ? -176.378 160.724 167.479 1.00 64.15  ? 314 ALA D C     1 
ATOM 7008  O O     . ALA C 3 314 ? -177.263 161.582 167.583 1.00 64.15  ? 314 ALA D O     1 
ATOM 7009  C CB    . ALA C 3 314 ? -176.602 159.158 165.551 1.00 64.15  ? 314 ALA D CB    1 
ATOM 7010  N N     . CYS C 3 315 ? -175.891 160.089 168.536 1.00 65.39  ? 315 CYS D N     1 
ATOM 7011  C CA    . CYS C 3 315 ? -176.296 160.513 169.871 1.00 65.39  ? 315 CYS D CA    1 
ATOM 7012  C C     . CYS C 3 315 ? -175.939 161.974 170.162 1.00 65.39  ? 315 CYS D C     1 
ATOM 7013  O O     . CYS C 3 315 ? -176.817 162.767 170.497 1.00 65.39  ? 315 CYS D O     1 
ATOM 7014  C CB    . CYS C 3 315 ? -175.688 159.585 170.903 1.00 65.39  ? 315 CYS D CB    1 
ATOM 7015  S SG    . CYS C 3 315 ? -176.324 157.866 170.888 1.00 65.39  ? 315 CYS D SG    1 
ATOM 7016  N N     . GLN C 3 316 ? -174.682 162.392 169.974 1.00 65.81  ? 316 GLN D N     1 
ATOM 7017  C CA    . GLN C 3 316 ? -174.448 163.808 170.272 1.00 65.81  ? 316 GLN D CA    1 
ATOM 7018  C C     . GLN C 3 316 ? -175.061 164.743 169.259 1.00 65.81  ? 316 GLN D C     1 
ATOM 7019  O O     . GLN C 3 316 ? -175.429 165.851 169.634 1.00 65.81  ? 316 GLN D O     1 
ATOM 7020  C CB    . GLN C 3 316 ? -172.982 164.209 170.487 1.00 65.81  ? 316 GLN D CB    1 
ATOM 7021  C CG    . GLN C 3 316 ? -171.943 163.996 169.459 1.00 65.81  ? 316 GLN D CG    1 
ATOM 7022  C CD    . GLN C 3 316 ? -170.629 163.781 170.145 1.00 65.81  ? 316 GLN D CD    1 
ATOM 7023  O OE1   . GLN C 3 316 ? -170.626 163.397 171.312 1.00 65.81  ? 316 GLN D OE1   1 
ATOM 7024  N NE2   . GLN C 3 316 ? -169.517 163.968 169.434 1.00 65.81  ? 316 GLN D NE2   1 
ATOM 7025  N N     . GLU C 3 317 ? -175.181 164.358 167.992 1.00 64.26  ? 317 GLU D N     1 
ATOM 7026  C CA    . GLU C 3 317 ? -175.849 165.268 167.065 1.00 64.26  ? 317 GLU D CA    1 
ATOM 7027  C C     . GLU C 3 317 ? -177.281 165.510 167.506 1.00 64.26  ? 317 GLU D C     1 
ATOM 7028  O O     . GLU C 3 317 ? -177.749 166.660 167.540 1.00 64.26  ? 317 GLU D O     1 
ATOM 7029  C CB    . GLU C 3 317 ? -175.781 164.789 165.632 1.00 64.26  ? 317 GLU D CB    1 
ATOM 7030  C CG    . GLU C 3 317 ? -176.523 165.803 164.817 1.00 64.26  ? 317 GLU D CG    1 
ATOM 7031  C CD    . GLU C 3 317 ? -175.709 167.089 164.613 1.00 64.26  ? 317 GLU D CD    1 
ATOM 7032  O OE1   . GLU C 3 317 ? -174.498 167.096 164.921 1.00 64.26  ? 317 GLU D OE1   1 
ATOM 7033  O OE2   . GLU C 3 317 ? -176.275 168.108 164.165 1.00 64.26  ? 317 GLU D OE2   1 
ATOM 7034  N N     . LEU C 3 318 ? -177.988 164.457 167.881 1.00 61.03  ? 318 LEU D N     1 
ATOM 7035  C CA    . LEU C 3 318 ? -179.332 164.671 168.389 1.00 61.03  ? 318 LEU D CA    1 
ATOM 7036  C C     . LEU C 3 318 ? -179.287 165.495 169.664 1.00 61.03  ? 318 LEU D C     1 
ATOM 7037  O O     . LEU C 3 318 ? -180.234 166.243 169.952 1.00 61.03  ? 318 LEU D O     1 
ATOM 7038  C CB    . LEU C 3 318 ? -179.976 163.330 168.684 1.00 61.03  ? 318 LEU D CB    1 
ATOM 7039  C CG    . LEU C 3 318 ? -181.421 163.315 169.107 1.00 61.03  ? 318 LEU D CG    1 
ATOM 7040  C CD1   . LEU C 3 318 ? -182.067 162.210 168.407 1.00 61.03  ? 318 LEU D CD1   1 
ATOM 7041  C CD2   . LEU C 3 318 ? -181.411 163.043 170.566 1.00 61.03  ? 318 LEU D CD2   1 
ATOM 7042  N N     . ASN C 3 319 ? -178.174 165.448 170.400 1.00 63.85  ? 319 ASN D N     1 
ATOM 7043  C CA    . ASN C 3 319 ? -178.052 166.313 171.563 1.00 63.85  ? 319 ASN D CA    1 
ATOM 7044  C C     . ASN C 3 319 ? -177.903 167.772 171.147 1.00 63.85  ? 319 ASN D C     1 
ATOM 7045  O O     . ASN C 3 319 ? -178.466 168.651 171.794 1.00 63.85  ? 319 ASN D O     1 
ATOM 7046  C CB    . ASN C 3 319 ? -176.854 165.946 172.417 1.00 63.85  ? 319 ASN D CB    1 
ATOM 7047  C CG    . ASN C 3 319 ? -176.822 166.741 173.682 1.00 63.85  ? 319 ASN D CG    1 
ATOM 7048  O OD1   . ASN C 3 319 ? -177.861 167.035 174.252 1.00 63.85  ? 319 ASN D OD1   1 
ATOM 7049  N ND2   . ASN C 3 319 ? -175.644 167.212 174.050 1.00 63.85  ? 319 ASN D ND2   1 
ATOM 7050  N N     . ASN C 3 320 ? -177.186 168.028 170.047 1.00 62.14  ? 320 ASN D N     1 
ATOM 7051  C CA    . ASN C 3 320 ? -177.050 169.394 169.542 1.00 62.14  ? 320 ASN D CA    1 
ATOM 7052  C C     . ASN C 3 320 ? -178.386 169.924 169.060 1.00 62.14  ? 320 ASN D C     1 
ATOM 7053  O O     . ASN C 3 320 ? -178.726 171.088 169.293 1.00 62.14  ? 320 ASN D O     1 
ATOM 7054  C CB    . ASN C 3 320 ? -176.058 169.450 168.377 1.00 62.14  ? 320 ASN D CB    1 
ATOM 7055  C CG    . ASN C 3 320 ? -174.633 169.148 168.779 1.00 62.14  ? 320 ASN D CG    1 
ATOM 7056  O OD1   . ASN C 3 320 ? -174.266 169.264 169.942 1.00 62.14  ? 320 ASN D OD1   1 
ATOM 7057  N ND2   . ASN C 3 320 ? -173.810 168.775 167.804 1.00 62.14  ? 320 ASN D ND2   1 
ATOM 7058  N N     . TYR C 3 321 ? -179.152 169.094 168.372 1.00 60.03  ? 321 TYR D N     1 
ATOM 7059  C CA    . TYR C 3 321 ? -180.462 169.554 167.950 1.00 60.03  ? 321 TYR D CA    1 
ATOM 7060  C C     . TYR C 3 321 ? -181.404 169.789 169.106 1.00 60.03  ? 321 TYR D C     1 
ATOM 7061  O O     . TYR C 3 321 ? -182.207 170.731 169.061 1.00 60.03  ? 321 TYR D O     1 
ATOM 7062  C CB    . TYR C 3 321 ? -181.066 168.521 167.024 1.00 60.03  ? 321 TYR D CB    1 
ATOM 7063  C CG    . TYR C 3 321 ? -182.220 169.006 166.225 1.00 60.03  ? 321 TYR D CG    1 
ATOM 7064  C CD1   . TYR C 3 321 ? -182.074 169.847 165.161 1.00 60.03  ? 321 TYR D CD1   1 
ATOM 7065  C CD2   . TYR C 3 321 ? -183.480 168.560 166.527 1.00 60.03  ? 321 TYR D CD2   1 
ATOM 7066  C CE1   . TYR C 3 321 ? -183.160 170.254 164.452 1.00 60.03  ? 321 TYR D CE1   1 
ATOM 7067  C CE2   . TYR C 3 321 ? -184.549 168.946 165.821 1.00 60.03  ? 321 TYR D CE2   1 
ATOM 7068  C CZ    . TYR C 3 321 ? -184.391 169.797 164.791 1.00 60.03  ? 321 TYR D CZ    1 
ATOM 7069  O OH    . TYR C 3 321 ? -185.488 170.194 164.086 1.00 60.03  ? 321 TYR D OH    1 
ATOM 7070  N N     . ALA C 3 322 ? -181.275 169.016 170.176 1.00 62.44  ? 322 ALA D N     1 
ATOM 7071  C CA    . ALA C 3 322 ? -182.133 169.294 171.313 1.00 62.44  ? 322 ALA D CA    1 
ATOM 7072  C C     . ALA C 3 322 ? -181.738 170.566 172.040 1.00 62.44  ? 322 ALA D C     1 
ATOM 7073  O O     . ALA C 3 322 ? -182.612 171.319 172.483 1.00 62.44  ? 322 ALA D O     1 
ATOM 7074  C CB    . ALA C 3 322 ? -182.104 168.109 172.270 1.00 62.44  ? 322 ALA D CB    1 
ATOM 7075  N N     . GLU C 3 323 ? -180.437 170.826 172.199 1.00 66.21  ? 323 GLU D N     1 
ATOM 7076  C CA    . GLU C 3 323 ? -180.039 172.129 172.719 1.00 66.21  ? 323 GLU D CA    1 
ATOM 7077  C C     . GLU C 3 323 ? -180.575 173.272 171.869 1.00 66.21  ? 323 GLU D C     1 
ATOM 7078  O O     . GLU C 3 323 ? -181.085 174.251 172.416 1.00 66.21  ? 323 GLU D O     1 
ATOM 7079  C CB    . GLU C 3 323 ? -178.536 172.214 172.977 1.00 66.21  ? 323 GLU D CB    1 
ATOM 7080  C CG    . GLU C 3 323 ? -177.604 172.163 171.851 1.00 66.21  ? 323 GLU D CG    1 
ATOM 7081  C CD    . GLU C 3 323 ? -176.194 172.192 172.369 1.00 66.21  ? 323 GLU D CD    1 
ATOM 7082  O OE1   . GLU C 3 323 ? -176.041 172.199 173.605 1.00 66.21  ? 323 GLU D OE1   1 
ATOM 7083  O OE2   . GLU C 3 323 ? -175.240 172.198 171.568 1.00 66.21  ? 323 GLU D OE2   1 
ATOM 7084  N N     . ARG C 3 324 ? -180.490 173.188 170.536 1.00 67.04  ? 324 ARG D N     1 
ATOM 7085  C CA    . ARG C 3 324 ? -180.870 174.382 169.780 1.00 67.04  ? 324 ARG D CA    1 
ATOM 7086  C C     . ARG C 3 324 ? -182.366 174.607 169.857 1.00 67.04  ? 324 ARG D C     1 
ATOM 7087  O O     . ARG C 3 324 ? -182.818 175.720 170.146 1.00 67.04  ? 324 ARG D O     1 
ATOM 7088  C CB    . ARG C 3 324 ? -180.503 174.344 168.300 1.00 67.04  ? 324 ARG D CB    1 
ATOM 7089  C CG    . ARG C 3 324 ? -179.090 174.568 167.855 1.00 67.04  ? 324 ARG D CG    1 
ATOM 7090  C CD    . ARG C 3 324 ? -179.050 174.089 166.424 1.00 67.04  ? 324 ARG D CD    1 
ATOM 7091  N NE    . ARG C 3 324 ? -177.823 174.393 165.710 1.00 67.04  ? 324 ARG D NE    1 
ATOM 7092  C CZ    . ARG C 3 324 ? -177.497 173.812 164.564 1.00 67.04  ? 324 ARG D CZ    1 
ATOM 7093  N NH1   . ARG C 3 324 ? -178.317 172.917 164.038 1.00 67.04  ? 324 ARG D NH1   1 
ATOM 7094  N NH2   . ARG C 3 324 ? -176.360 174.108 163.947 1.00 67.04  ? 324 ARG D NH2   1 
ATOM 7095  N N     . LEU C 3 325 ? -183.156 173.561 169.629 1.00 66.50  ? 325 LEU D N     1 
ATOM 7096  C CA    . LEU C 3 325 ? -184.598 173.759 169.705 1.00 66.50  ? 325 LEU D CA    1 
ATOM 7097  C C     . LEU C 3 325 ? -185.021 174.162 171.104 1.00 66.50  ? 325 LEU D C     1 
ATOM 7098  O O     . LEU C 3 325 ? -185.890 175.020 171.271 1.00 66.50  ? 325 LEU D O     1 
ATOM 7099  C CB    . LEU C 3 325 ? -185.355 172.508 169.292 1.00 66.50  ? 325 LEU D CB    1 
ATOM 7100  C CG    . LEU C 3 325 ? -185.554 172.114 167.845 1.00 66.50  ? 325 LEU D CG    1 
ATOM 7101  C CD1   . LEU C 3 325 ? -186.309 170.818 167.840 1.00 66.50  ? 325 LEU D CD1   1 
ATOM 7102  C CD2   . LEU C 3 325 ? -186.366 173.171 167.153 1.00 66.50  ? 325 LEU D CD2   1 
ATOM 7103  N N     . ARG C 3 326 ? -184.398 173.589 172.125 1.00 69.12  ? 326 ARG D N     1 
ATOM 7104  C CA    . ARG C 3 326 ? -184.724 174.014 173.477 1.00 69.12  ? 326 ARG D CA    1 
ATOM 7105  C C     . ARG C 3 326 ? -184.345 175.462 173.714 1.00 69.12  ? 326 ARG D C     1 
ATOM 7106  O O     . ARG C 3 326 ? -184.994 176.150 174.505 1.00 69.12  ? 326 ARG D O     1 
ATOM 7107  C CB    . ARG C 3 326 ? -184.001 173.141 174.489 1.00 69.12  ? 326 ARG D CB    1 
ATOM 7108  C CG    . ARG C 3 326 ? -184.335 173.525 175.889 1.00 69.12  ? 326 ARG D CG    1 
ATOM 7109  C CD    . ARG C 3 326 ? -183.547 172.758 176.901 1.00 69.12  ? 326 ARG D CD    1 
ATOM 7110  N NE    . ARG C 3 326 ? -183.985 173.114 178.243 1.00 69.12  ? 326 ARG D NE    1 
ATOM 7111  C CZ    . ARG C 3 326 ? -183.611 172.482 179.346 1.00 69.12  ? 326 ARG D CZ    1 
ATOM 7112  N NH1   . ARG C 3 326 ? -182.783 171.451 179.271 1.00 69.12  ? 326 ARG D NH1   1 
ATOM 7113  N NH2   . ARG C 3 326 ? -184.065 172.880 180.522 1.00 69.12  ? 326 ARG D NH2   1 
ATOM 7114  N N     . GLU C 3 327 ? -183.351 175.955 172.988 1.00 70.12  ? 327 GLU D N     1 
ATOM 7115  C CA    . GLU C 3 327 ? -182.905 177.330 173.135 1.00 70.12  ? 327 GLU D CA    1 
ATOM 7116  C C     . GLU C 3 327 ? -183.871 178.309 172.491 1.00 70.12  ? 327 GLU D C     1 
ATOM 7117  O O     . GLU C 3 327 ? -184.255 179.306 173.112 1.00 70.12  ? 327 GLU D O     1 
ATOM 7118  C CB    . GLU C 3 327 ? -181.509 177.458 172.535 1.00 70.12  ? 327 GLU D CB    1 
ATOM 7119  C CG    . GLU C 3 327 ? -180.839 178.775 172.761 1.00 70.12  ? 327 GLU D CG    1 
ATOM 7120  C CD    . GLU C 3 327 ? -181.192 179.780 171.699 1.00 70.12  ? 327 GLU D CD    1 
ATOM 7121  O OE1   . GLU C 3 327 ? -181.766 179.371 170.670 1.00 70.12  ? 327 GLU D OE1   1 
ATOM 7122  O OE2   . GLU C 3 327 ? -180.916 180.979 171.898 1.00 70.12  ? 327 GLU D OE2   1 
ATOM 7123  N N     . VAL C 3 328 ? -184.311 178.023 171.269 1.00 71.03  ? 328 VAL D N     1 
ATOM 7124  C CA    . VAL C 3 328 ? -185.227 178.932 170.590 1.00 71.03  ? 328 VAL D CA    1 
ATOM 7125  C C     . VAL C 3 328 ? -186.561 178.982 171.308 1.00 71.03  ? 328 VAL D C     1 
ATOM 7126  O O     . VAL C 3 328 ? -187.141 180.055 171.491 1.00 71.03  ? 328 VAL D O     1 
ATOM 7127  C CB    . VAL C 3 328 ? -185.406 178.505 169.129 1.00 71.03  ? 328 VAL D CB    1 
ATOM 7128  C CG1   . VAL C 3 328 ? -186.463 179.342 168.486 1.00 71.03  ? 328 VAL D CG1   1 
ATOM 7129  C CG2   . VAL C 3 328 ? -184.106 178.657 168.384 1.00 71.03  ? 328 VAL D CG2   1 
ATOM 7130  N N     . TRP C 3 329 ? -187.068 177.831 171.729 1.00 75.30  ? 329 TRP D N     1 
ATOM 7131  C CA    . TRP C 3 329 ? -188.337 177.729 172.439 1.00 75.30  ? 329 TRP D CA    1 
ATOM 7132  C C     . TRP C 3 329 ? -188.087 177.071 173.784 1.00 75.30  ? 329 TRP D C     1 
ATOM 7133  O O     . TRP C 3 329 ? -188.153 175.841 173.910 1.00 75.30  ? 329 TRP D O     1 
ATOM 7134  C CB    . TRP C 3 329 ? -189.375 176.951 171.647 1.00 75.30  ? 329 TRP D CB    1 
ATOM 7135  C CG    . TRP C 3 329 ? -189.847 177.698 170.489 1.00 75.30  ? 329 TRP D CG    1 
ATOM 7136  C CD1   . TRP C 3 329 ? -190.704 178.743 170.497 1.00 75.30  ? 329 TRP D CD1   1 
ATOM 7137  C CD2   . TRP C 3 329 ? -189.539 177.437 169.124 1.00 75.30  ? 329 TRP D CD2   1 
ATOM 7138  N NE1   . TRP C 3 329 ? -190.930 179.180 169.220 1.00 75.30  ? 329 TRP D NE1   1 
ATOM 7139  C CE2   . TRP C 3 329 ? -190.228 178.386 168.356 1.00 75.30  ? 329 TRP D CE2   1 
ATOM 7140  C CE3   . TRP C 3 329 ? -188.740 176.497 168.476 1.00 75.30  ? 329 TRP D CE3   1 
ATOM 7141  C CZ2   . TRP C 3 329 ? -190.146 178.423 166.978 1.00 75.30  ? 329 TRP D CZ2   1 
ATOM 7142  C CZ3   . TRP C 3 329 ? -188.658 176.535 167.112 1.00 75.30  ? 329 TRP D CZ3   1 
ATOM 7143  C CH2   . TRP C 3 329 ? -189.357 177.490 166.374 1.00 75.30  ? 329 TRP D CH2   1 
ATOM 7144  N N     . PRO C 3 330 ? -187.813 177.854 174.817 1.00 75.37  ? 330 PRO D N     1 
ATOM 7145  C CA    . PRO C 3 330 ? -187.753 177.293 176.167 1.00 75.37  ? 330 PRO D CA    1 
ATOM 7146  C C     . PRO C 3 330 ? -189.146 176.899 176.617 1.00 75.37  ? 330 PRO D C     1 
ATOM 7147  O O     . PRO C 3 330 ? -190.100 177.666 176.473 1.00 75.37  ? 330 PRO D O     1 
ATOM 7148  C CB    . PRO C 3 330 ? -187.189 178.443 177.003 1.00 75.37  ? 330 PRO D CB    1 
ATOM 7149  C CG    . PRO C 3 330 ? -187.579 179.657 176.257 1.00 75.37  ? 330 PRO D CG    1 
ATOM 7150  C CD    . PRO C 3 330 ? -187.554 179.298 174.805 1.00 75.37  ? 330 PRO D CD    1 
ATOM 7151  N N     . ASP C 3 331 ? -189.268 175.676 177.119 1.00 79.11  ? 331 ASP D N     1 
ATOM 7152  C CA    . ASP C 3 331 ? -190.557 175.112 177.462 1.00 79.11  ? 331 ASP D CA    1 
ATOM 7153  C C     . ASP C 3 331 ? -190.483 174.453 178.830 1.00 79.11  ? 331 ASP D C     1 
ATOM 7154  O O     . ASP C 3 331 ? -189.408 174.215 179.380 1.00 79.11  ? 331 ASP D O     1 
ATOM 7155  C CB    . ASP C 3 331 ? -191.019 174.100 176.411 1.00 79.11  ? 331 ASP D CB    1 
ATOM 7156  C CG    . ASP C 3 331 ? -192.442 173.634 176.638 1.00 79.11  ? 331 ASP D CG    1 
ATOM 7157  O OD1   . ASP C 3 331 ? -193.375 174.413 176.360 1.00 79.11  ? 331 ASP D OD1   1 
ATOM 7158  O OD2   . ASP C 3 331 ? -192.634 172.495 177.111 1.00 79.11  ? 331 ASP D OD2   1 
ATOM 7159  N N     . ASP C 3 332 ? -191.664 174.152 179.361 1.00 82.02  ? 332 ASP D N     1 
ATOM 7160  C CA    . ASP C 3 332 ? -191.867 173.371 180.572 1.00 82.02  ? 332 ASP D CA    1 
ATOM 7161  C C     . ASP C 3 332 ? -191.832 171.870 180.315 1.00 82.02  ? 332 ASP D C     1 
ATOM 7162  O O     . ASP C 3 332 ? -192.419 171.087 181.066 1.00 82.02  ? 332 ASP D O     1 
ATOM 7163  C CB    . ASP C 3 332 ? -193.211 173.795 181.168 1.00 82.02  ? 332 ASP D CB    1 
ATOM 7164  C CG    . ASP C 3 332 ? -193.512 173.143 182.489 1.00 82.02  ? 332 ASP D CG    1 
ATOM 7165  O OD1   . ASP C 3 332 ? -192.864 173.500 183.490 1.00 82.02  ? 332 ASP D OD1   1 
ATOM 7166  O OD2   . ASP C 3 332 ? -194.416 172.282 182.529 1.00 82.02  ? 332 ASP D OD2   1 
ATOM 7167  N N     . ALA C 3 333 ? -191.138 171.443 179.269 1.00 74.53  ? 333 ALA D N     1 
ATOM 7168  C CA    . ALA C 3 333 ? -191.164 170.037 178.907 1.00 74.53  ? 333 ALA D CA    1 
ATOM 7169  C C     . ALA C 3 333 ? -190.348 169.210 179.885 1.00 74.53  ? 333 ALA D C     1 
ATOM 7170  O O     . ALA C 3 333 ? -189.205 169.548 180.194 1.00 74.53  ? 333 ALA D O     1 
ATOM 7171  C CB    . ALA C 3 333 ? -190.626 169.851 177.496 1.00 74.53  ? 333 ALA D CB    1 
ATOM 7172  N N     . ILE C 3 334 ? -190.932 168.128 180.365 1.00 69.19  ? 334 ILE D N     1 
ATOM 7173  C CA    . ILE C 3 334 ? -190.241 167.195 181.243 1.00 69.19  ? 334 ILE D CA    1 
ATOM 7174  C C     . ILE C 3 334 ? -189.535 166.177 180.366 1.00 69.19  ? 334 ILE D C     1 
ATOM 7175  O O     . ILE C 3 334 ? -190.150 165.596 179.470 1.00 69.19  ? 334 ILE D O     1 
ATOM 7176  C CB    . ILE C 3 334 ? -191.216 166.503 182.198 1.00 69.19  ? 334 ILE D CB    1 
ATOM 7177  C CG1   . ILE C 3 334 ? -192.042 167.540 182.931 1.00 69.19  ? 334 ILE D CG1   1 
ATOM 7178  C CG2   . ILE C 3 334 ? -190.466 165.677 183.196 1.00 69.19  ? 334 ILE D CG2   1 
ATOM 7179  C CD1   . ILE C 3 334 ? -193.129 166.925 183.743 1.00 69.19  ? 334 ILE D CD1   1 
ATOM 7180  N N     . ARG C 3 335 ? -188.257 165.948 180.615 1.00 67.32  ? 335 ARG D N     1 
ATOM 7181  C CA    . ARG C 3 335 ? -187.467 165.131 179.717 1.00 67.32  ? 335 ARG D CA    1 
ATOM 7182  C C     . ARG C 3 335 ? -186.615 164.155 180.496 1.00 67.32  ? 335 ARG D C     1 
ATOM 7183  O O     . ARG C 3 335 ? -186.439 164.271 181.707 1.00 67.32  ? 335 ARG D O     1 
ATOM 7184  C CB    . ARG C 3 335 ? -186.583 165.997 178.844 1.00 67.32  ? 335 ARG D CB    1 
ATOM 7185  C CG    . ARG C 3 335 ? -187.321 166.743 177.807 1.00 67.32  ? 335 ARG D CG    1 
ATOM 7186  C CD    . ARG C 3 335 ? -186.313 167.456 176.993 1.00 67.32  ? 335 ARG D CD    1 
ATOM 7187  N NE    . ARG C 3 335 ? -185.756 168.497 177.830 1.00 67.32  ? 335 ARG D NE    1 
ATOM 7188  C CZ    . ARG C 3 335 ? -186.176 169.750 177.788 1.00 67.32  ? 335 ARG D CZ    1 
ATOM 7189  N NH1   . ARG C 3 335 ? -187.132 170.097 176.940 1.00 67.32  ? 335 ARG D NH1   1 
ATOM 7190  N NH2   . ARG C 3 335 ? -185.652 170.652 178.591 1.00 67.32  ? 335 ARG D NH2   1 
ATOM 7191  N N     . GLY C 3 336 ? -186.066 163.197 179.766 1.00 63.99  ? 336 GLY D N     1 
ATOM 7192  C CA    . GLY C 3 336 ? -185.185 162.198 180.320 1.00 63.99  ? 336 GLY D CA    1 
ATOM 7193  C C     . GLY C 3 336 ? -184.854 161.163 179.275 1.00 63.99  ? 336 GLY D C     1 
ATOM 7194  O O     . GLY C 3 336 ? -185.630 160.933 178.351 1.00 63.99  ? 336 GLY D O     1 
ATOM 7195  N N     . TYR C 3 337 ? -183.698 160.534 179.411 1.00 64.25  ? 337 TYR D N     1 
ATOM 7196  C CA    . TYR C 3 337 ? -183.222 159.626 178.388 1.00 64.25  ? 337 TYR D CA    1 
ATOM 7197  C C     . TYR C 3 337 ? -182.391 158.527 179.008 1.00 64.25  ? 337 TYR D C     1 
ATOM 7198  O O     . TYR C 3 337 ? -181.792 158.710 180.067 1.00 64.25  ? 337 TYR D O     1 
ATOM 7199  C CB    . TYR C 3 337 ? -182.445 160.401 177.338 1.00 64.25  ? 337 TYR D CB    1 
ATOM 7200  C CG    . TYR C 3 337 ? -181.146 160.977 177.810 1.00 64.25  ? 337 TYR D CG    1 
ATOM 7201  C CD1   . TYR C 3 337 ? -181.139 162.029 178.698 1.00 64.25  ? 337 TYR D CD1   1 
ATOM 7202  C CD2   . TYR C 3 337 ? -179.941 160.573 177.275 1.00 64.25  ? 337 TYR D CD2   1 
ATOM 7203  C CE1   . TYR C 3 337 ? -179.975 162.602 179.115 1.00 64.25  ? 337 TYR D CE1   1 
ATOM 7204  C CE2   . TYR C 3 337 ? -178.761 161.150 177.684 1.00 64.25  ? 337 TYR D CE2   1 
ATOM 7205  C CZ    . TYR C 3 337 ? -178.790 162.169 178.594 1.00 64.25  ? 337 TYR D CZ    1 
ATOM 7206  O OH    . TYR C 3 337 ? -177.619 162.747 179.009 1.00 64.25  ? 337 TYR D OH    1 
ATOM 7207  N N     . ALA C 3 338 ? -182.373 157.379 178.352 1.00 57.73  ? 338 ALA D N     1 
ATOM 7208  C CA    . ALA C 3 338 ? -181.552 156.276 178.809 1.00 57.73  ? 338 ALA D CA    1 
ATOM 7209  C C     . ALA C 3 338 ? -180.779 155.774 177.613 1.00 57.73  ? 338 ALA D C     1 
ATOM 7210  O O     . ALA C 3 338 ? -181.308 155.725 176.497 1.00 57.73  ? 338 ALA D O     1 
ATOM 7211  C CB    . ALA C 3 338 ? -182.364 155.153 179.407 1.00 57.73  ? 338 ALA D CB    1 
ATOM 7212  N N     . THR C 3 339 ? -179.518 155.435 177.844 1.00 58.63  ? 339 THR D N     1 
ATOM 7213  C CA    . THR C 3 339 ? -178.625 155.057 176.766 1.00 58.63  ? 339 THR D CA    1 
ATOM 7214  C C     . THR C 3 339 ? -177.899 153.763 177.126 1.00 58.63  ? 339 THR D C     1 
ATOM 7215  O O     . THR C 3 339 ? -177.850 153.380 178.290 1.00 58.63  ? 339 THR D O     1 
ATOM 7216  C CB    . THR C 3 339 ? -177.691 156.197 176.486 1.00 58.63  ? 339 THR D CB    1 
ATOM 7217  O OG1   . THR C 3 339 ? -178.449 157.411 176.532 1.00 58.63  ? 339 THR D OG1   1 
ATOM 7218  C CG2   . THR C 3 339 ? -177.183 156.042 175.096 1.00 58.63  ? 339 THR D CG2   1 
ATOM 7219  N N     . VAL C 3 340 ? -177.325 153.085 176.129 1.00 59.45  ? 340 VAL D N     1 
ATOM 7220  C CA    . VAL C 3 340 ? -176.429 151.968 176.416 1.00 59.45  ? 340 VAL D CA    1 
ATOM 7221  C C     . VAL C 3 340 ? -174.988 152.453 176.486 1.00 59.45  ? 340 VAL D C     1 
ATOM 7222  O O     . VAL C 3 340 ? -174.047 151.665 176.599 1.00 59.45  ? 340 VAL D O     1 
ATOM 7223  C CB    . VAL C 3 340 ? -176.639 150.899 175.337 1.00 59.45  ? 340 VAL D CB    1 
ATOM 7224  C CG1   . VAL C 3 340 ? -175.746 149.725 175.506 1.00 59.45  ? 340 VAL D CG1   1 
ATOM 7225  C CG2   . VAL C 3 340 ? -178.054 150.463 175.393 1.00 59.45  ? 340 VAL D CG2   1 
ATOM 7226  N N     . GLU C 3 341 ? -174.831 153.777 176.502 1.00 71.05  ? 341 GLU D N     1 
ATOM 7227  C CA    . GLU C 3 341 ? -173.517 154.413 176.610 1.00 71.05  ? 341 GLU D CA    1 
ATOM 7228  C C     . GLU C 3 341 ? -173.428 155.435 177.760 1.00 71.05  ? 341 GLU D C     1 
ATOM 7229  O O     . GLU C 3 341 ? -174.274 156.320 177.886 1.00 71.05  ? 341 GLU D O     1 
ATOM 7230  C CB    . GLU C 3 341 ? -173.138 155.081 175.286 1.00 71.05  ? 341 GLU D CB    1 
ATOM 7231  C CG    . GLU C 3 341 ? -173.847 156.401 175.031 1.00 71.05  ? 341 GLU D CG    1 
ATOM 7232  C CD    . GLU C 3 341 ? -174.613 156.407 173.723 1.00 71.05  ? 341 GLU D CD    1 
ATOM 7233  O OE1   . GLU C 3 341 ? -174.704 155.340 173.080 1.00 71.05  ? 341 GLU D OE1   1 
ATOM 7234  O OE2   . GLU C 3 341 ? -175.123 157.479 173.336 1.00 71.05  ? 341 GLU D OE2   1 
ATOM 7235  N N     . ASN C 3 342 ? -172.392 155.296 178.588 1.00 79.12  ? 342 ASN D N     1 
ATOM 7236  C CA    . ASN C 3 342 ? -172.125 156.164 179.718 1.00 79.12  ? 342 ASN D CA    1 
ATOM 7237  C C     . ASN C 3 342 ? -170.949 157.079 179.477 1.00 79.12  ? 342 ASN D C     1 
ATOM 7238  O O     . ASN C 3 342 ? -170.536 157.830 180.374 1.00 79.12  ? 342 ASN D O     1 
ATOM 7239  C CB    . ASN C 3 342 ? -171.877 155.328 180.969 1.00 79.12  ? 342 ASN D CB    1 
ATOM 7240  C CG    . ASN C 3 342 ? -172.956 154.303 181.186 1.00 79.12  ? 342 ASN D CG    1 
ATOM 7241  O OD1   . ASN C 3 342 ? -174.125 154.590 180.928 1.00 79.12  ? 342 ASN D OD1   1 
ATOM 7242  N ND2   . ASN C 3 342 ? -172.598 153.120 181.660 1.00 79.12  ? 342 ASN D ND2   1 
ATOM 7243  N N     . LYS C 3 343 ? -170.403 157.039 178.273 1.00 83.04  ? 343 LYS D N     1 
ATOM 7244  C CA    . LYS C 3 343 ? -169.160 157.705 177.935 1.00 83.04  ? 343 LYS D CA    1 
ATOM 7245  C C     . LYS C 3 343 ? -169.394 159.174 177.643 1.00 83.04  ? 343 LYS D C     1 
ATOM 7246  O O     . LYS C 3 343 ? -168.504 159.997 177.874 1.00 83.04  ? 343 LYS D O     1 
ATOM 7247  C CB    . LYS C 3 343 ? -168.541 156.983 176.741 1.00 83.04  ? 343 LYS D CB    1 
ATOM 7248  C CG    . LYS C 3 343 ? -167.266 157.577 176.178 1.00 83.04  ? 343 LYS D CG    1 
ATOM 7249  C CD    . LYS C 3 343 ? -167.563 158.375 174.920 1.00 83.04  ? 343 LYS D CD    1 
ATOM 7250  C CE    . LYS C 3 343 ? -166.310 158.954 174.283 1.00 83.04  ? 343 LYS D CE    1 
ATOM 7251  N NZ    . LYS C 3 343 ? -165.435 157.927 173.662 1.00 83.04  ? 343 LYS D NZ    1 
ATOM 7252  N N     . THR C 3 344 ? -170.579 159.516 177.150 1.00 81.55  ? 344 THR D N     1 
ATOM 7253  C CA    . THR C 3 344 ? -170.882 160.864 176.701 1.00 81.55  ? 344 THR D CA    1 
ATOM 7254  C C     . THR C 3 344 ? -172.117 161.366 177.419 1.00 81.55  ? 344 THR D C     1 
ATOM 7255  O O     . THR C 3 344 ? -173.090 160.624 177.580 1.00 81.55  ? 344 THR D O     1 
ATOM 7256  C CB    . THR C 3 344 ? -171.136 160.922 175.194 1.00 81.55  ? 344 THR D CB    1 
ATOM 7257  O OG1   . THR C 3 344 ? -171.894 159.775 174.784 1.00 81.55  ? 344 THR D OG1   1 
ATOM 7258  C CG2   . THR C 3 344 ? -169.824 160.985 174.440 1.00 81.55  ? 344 THR D CG2   1 
ATOM 7259  N N     . ASP C 3 345 ? -172.056 162.612 177.885 1.00 77.31  ? 345 ASP D N     1 
ATOM 7260  C CA    . ASP C 3 345 ? -173.209 163.262 178.486 1.00 77.31  ? 345 ASP D CA    1 
ATOM 7261  C C     . ASP C 3 345 ? -173.979 164.052 177.444 1.00 77.31  ? 345 ASP D C     1 
ATOM 7262  O O     . ASP C 3 345 ? -173.388 164.689 176.569 1.00 77.31  ? 345 ASP D O     1 
ATOM 7263  C CB    . ASP C 3 345 ? -172.783 164.194 179.612 1.00 77.31  ? 345 ASP D CB    1 
ATOM 7264  C CG    . ASP C 3 345 ? -173.897 164.452 180.593 1.00 77.31  ? 345 ASP D CG    1 
ATOM 7265  O OD1   . ASP C 3 345 ? -175.041 164.053 180.293 1.00 77.31  ? 345 ASP D OD1   1 
ATOM 7266  O OD2   . ASP C 3 345 ? -173.629 165.022 181.670 1.00 77.31  ? 345 ASP D OD2   1 
ATOM 7267  N N     . LEU C 3 346 ? -175.306 164.032 177.569 1.00 68.21  ? 346 LEU D N     1 
ATOM 7268  C CA    . LEU C 3 346 ? -176.207 164.724 176.655 1.00 68.21  ? 346 LEU D CA    1 
ATOM 7269  C C     . LEU C 3 346 ? -177.143 165.538 177.544 1.00 68.21  ? 346 LEU D C     1 
ATOM 7270  O O     . LEU C 3 346 ? -178.294 165.160 177.742 1.00 68.21  ? 346 LEU D O     1 
ATOM 7271  C CB    . LEU C 3 346 ? -176.940 163.722 175.801 1.00 68.21  ? 346 LEU D CB    1 
ATOM 7272  C CG    . LEU C 3 346 ? -176.046 162.663 175.142 1.00 68.21  ? 346 LEU D CG    1 
ATOM 7273  C CD1   . LEU C 3 346 ? -176.867 161.663 174.388 1.00 68.21  ? 346 LEU D CD1   1 
ATOM 7274  C CD2   . LEU C 3 346 ? -174.985 163.239 174.232 1.00 68.21  ? 346 LEU D CD2   1 
ATOM 7275  N N     . ALA C 3 347 ? -176.659 166.661 178.070 1.00 65.55  ? 347 ALA D N     1 
ATOM 7276  C CA    . ALA C 3 347 ? -177.440 167.393 179.061 1.00 65.55  ? 347 ALA D CA    1 
ATOM 7277  C C     . ALA C 3 347 ? -178.743 167.947 178.498 1.00 65.55  ? 347 ALA D C     1 
ATOM 7278  O O     . ALA C 3 347 ? -179.714 168.116 179.242 1.00 65.55  ? 347 ALA D O     1 
ATOM 7279  C CB    . ALA C 3 347 ? -176.602 168.525 179.646 1.00 65.55  ? 347 ALA D CB    1 
ATOM 7280  N N     . ALA C 3 348 ? -178.800 168.193 177.196 1.00 63.93  ? 348 ALA D N     1 
ATOM 7281  C CA    . ALA C 3 348 ? -179.975 168.801 176.585 1.00 63.93  ? 348 ALA D CA    1 
ATOM 7282  C C     . ALA C 3 348 ? -181.170 167.866 176.545 1.00 63.93  ? 348 ALA D C     1 
ATOM 7283  O O     . ALA C 3 348 ? -182.304 168.333 176.436 1.00 63.93  ? 348 ALA D O     1 
ATOM 7284  C CB    . ALA C 3 348 ? -179.654 169.293 175.180 1.00 63.93  ? 348 ALA D CB    1 
ATOM 7285  N N     . LEU C 3 349 ? -180.953 166.567 176.628 1.00 63.41  ? 349 LEU D N     1 
ATOM 7286  C CA    . LEU C 3 349 ? -182.050 165.619 176.566 1.00 63.41  ? 349 LEU D CA    1 
ATOM 7287  C C     . LEU C 3 349 ? -182.729 165.402 177.903 1.00 63.41  ? 349 LEU D C     1 
ATOM 7288  O O     . LEU C 3 349 ? -183.723 164.676 177.961 1.00 63.41  ? 349 LEU D O     1 
ATOM 7289  C CB    . LEU C 3 349 ? -181.536 164.292 176.031 1.00 63.41  ? 349 LEU D CB    1 
ATOM 7290  C CG    . LEU C 3 349 ? -180.967 164.412 174.627 1.00 63.41  ? 349 LEU D CG    1 
ATOM 7291  C CD1   . LEU C 3 349 ? -180.272 163.149 174.216 1.00 63.41  ? 349 LEU D CD1   1 
ATOM 7292  C CD2   . LEU C 3 349 ? -182.098 164.700 173.692 1.00 63.41  ? 349 LEU D CD2   1 
ATOM 7293  N N     . GLY C 3 350 ? -182.218 166.015 178.962 1.00 67.51  ? 350 GLY D N     1 
ATOM 7294  C CA    . GLY C 3 350 ? -182.807 165.855 180.280 1.00 67.51  ? 350 GLY D CA    1 
ATOM 7295  C C     . GLY C 3 350 ? -182.026 164.931 181.187 1.00 67.51  ? 350 GLY D C     1 
ATOM 7296  O O     . GLY C 3 350 ? -180.944 164.479 180.835 1.00 67.51  ? 350 GLY D O     1 
ATOM 7297  N N     . GLU C 3 351 ? -182.586 164.647 182.356 1.00 70.76  ? 351 GLU D N     1 
ATOM 7298  C CA    . GLU C 3 351 ? -181.930 163.789 183.324 1.00 70.76  ? 351 GLU D CA    1 
ATOM 7299  C C     . GLU C 3 351 ? -181.787 162.372 182.833 1.00 70.76  ? 351 GLU D C     1 
ATOM 7300  O O     . GLU C 3 351 ? -182.735 161.794 182.332 1.00 70.76  ? 351 GLU D O     1 
ATOM 7301  C CB    . GLU C 3 351 ? -182.722 163.780 184.627 1.00 70.76  ? 351 GLU D CB    1 
ATOM 7302  C CG    . GLU C 3 351 ? -182.606 165.063 185.435 1.00 70.76  ? 351 GLU D CG    1 
ATOM 7303  C CD    . GLU C 3 351 ? -183.506 166.169 184.916 1.00 70.76  ? 351 GLU D CD    1 
ATOM 7304  O OE1   . GLU C 3 351 ? -183.002 167.292 184.695 1.00 70.76  ? 351 GLU D OE1   1 
ATOM 7305  O OE2   . GLU C 3 351 ? -184.716 165.920 184.735 1.00 70.76  ? 351 GLU D OE2   1 
ATOM 7306  N N     . ARG C 3 352 ? -180.589 161.816 182.990 1.00 72.53  ? 352 ARG D N     1 
ATOM 7307  C CA    . ARG C 3 352 ? -180.317 160.450 182.570 1.00 72.53  ? 352 ARG D CA    1 
ATOM 7308  C C     . ARG C 3 352 ? -180.936 159.463 183.553 1.00 72.53  ? 352 ARG D C     1 
ATOM 7309  O O     . ARG C 3 352 ? -181.100 159.767 184.735 1.00 72.53  ? 352 ARG D O     1 
ATOM 7310  C CB    . ARG C 3 352 ? -178.809 160.211 182.463 1.00 72.53  ? 352 ARG D CB    1 
ATOM 7311  C CG    . ARG C 3 352 ? -178.428 158.766 182.184 1.00 72.53  ? 352 ARG D CG    1 
ATOM 7312  C CD    . ARG C 3 352 ? -178.523 158.447 180.701 1.00 72.53  ? 352 ARG D CD    1 
ATOM 7313  N NE    . ARG C 3 352 ? -177.561 157.425 180.300 1.00 72.53  ? 352 ARG D NE    1 
ATOM 7314  C CZ    . ARG C 3 352 ? -176.265 157.653 180.111 1.00 72.53  ? 352 ARG D CZ    1 
ATOM 7315  N NH1   . ARG C 3 352 ? -175.771 158.870 180.287 1.00 72.53  ? 352 ARG D NH1   1 
ATOM 7316  N NH2   . ARG C 3 352 ? -175.462 156.663 179.745 1.00 72.53  ? 352 ARG D NH2   1 
ATOM 7317  N N     . TYR C 3 353 ? -181.279 158.281 183.056 1.00 67.83  ? 353 TYR D N     1 
ATOM 7318  C CA    . TYR C 3 353 ? -181.882 157.251 183.873 1.00 67.83  ? 353 TYR D CA    1 
ATOM 7319  C C     . TYR C 3 353 ? -181.088 155.978 183.723 1.00 67.83  ? 353 TYR D C     1 
ATOM 7320  O O     . TYR C 3 353 ? -180.407 155.774 182.725 1.00 67.83  ? 353 TYR D O     1 
ATOM 7321  C CB    . TYR C 3 353 ? -183.325 157.021 183.484 1.00 67.83  ? 353 TYR D CB    1 
ATOM 7322  C CG    . TYR C 3 353 ? -184.214 158.148 183.889 1.00 67.83  ? 353 TYR D CG    1 
ATOM 7323  C CD1   . TYR C 3 353 ? -184.021 159.408 183.384 1.00 67.83  ? 353 TYR D CD1   1 
ATOM 7324  C CD2   . TYR C 3 353 ? -185.235 157.955 184.793 1.00 67.83  ? 353 TYR D CD2   1 
ATOM 7325  C CE1   . TYR C 3 353 ? -184.834 160.450 183.753 1.00 67.83  ? 353 TYR D CE1   1 
ATOM 7326  C CE2   . TYR C 3 353 ? -186.057 158.991 185.168 1.00 67.83  ? 353 TYR D CE2   1 
ATOM 7327  C CZ    . TYR C 3 353 ? -185.850 160.233 184.645 1.00 67.83  ? 353 TYR D CZ    1 
ATOM 7328  O OH    . TYR C 3 353 ? -186.659 161.277 185.013 1.00 67.83  ? 353 TYR D OH    1 
ATOM 7329  N N     . ASP C 3 354 ? -181.160 155.124 184.729 1.00 68.29  ? 354 ASP D N     1 
ATOM 7330  C CA    . ASP C 3 354 ? -180.407 153.888 184.696 1.00 68.29  ? 354 ASP D CA    1 
ATOM 7331  C C     . ASP C 3 354 ? -180.931 152.910 183.662 1.00 68.29  ? 354 ASP D C     1 
ATOM 7332  O O     . ASP C 3 354 ? -180.175 152.049 183.213 1.00 68.29  ? 354 ASP D O     1 
ATOM 7333  C CB    . ASP C 3 354 ? -180.429 153.231 186.066 1.00 68.29  ? 354 ASP D CB    1 
ATOM 7334  C CG    . ASP C 3 354 ? -179.591 153.970 187.071 1.00 68.29  ? 354 ASP D CG    1 
ATOM 7335  O OD1   . ASP C 3 354 ? -178.644 154.663 186.649 1.00 68.29  ? 354 ASP D OD1   1 
ATOM 7336  O OD2   . ASP C 3 354 ? -179.876 153.865 188.282 1.00 68.29  ? 354 ASP D OD2   1 
ATOM 7337  N N     . SER C 3 355 ? -182.198 152.968 183.306 1.00 63.15  ? 355 SER D N     1 
ATOM 7338  C CA    . SER C 3 355 ? -182.679 151.980 182.370 1.00 63.15  ? 355 SER D CA    1 
ATOM 7339  C C     . SER C 3 355 ? -183.893 152.443 181.608 1.00 63.15  ? 355 SER D C     1 
ATOM 7340  O O     . SER C 3 355 ? -184.415 153.521 181.848 1.00 63.15  ? 355 SER D O     1 
ATOM 7341  C CB    . SER C 3 355 ? -182.992 150.702 183.145 1.00 63.15  ? 355 SER D CB    1 
ATOM 7342  O OG    . SER C 3 355 ? -183.989 149.914 182.523 1.00 63.15  ? 355 SER D OG    1 
ATOM 7343  N N     . TYR C 3 356 ? -184.348 151.608 180.686 1.00 57.45  ? 356 TYR D N     1 
ATOM 7344  C CA    . TYR C 3 356 ? -185.524 151.963 179.894 1.00 57.45  ? 356 TYR D CA    1 
ATOM 7345  C C     . TYR C 3 356 ? -186.812 151.862 180.688 1.00 57.45  ? 356 TYR D C     1 
ATOM 7346  O O     . TYR C 3 356 ? -187.570 152.842 180.700 1.00 57.45  ? 356 TYR D O     1 
ATOM 7347  C CB    . TYR C 3 356 ? -185.590 151.125 178.619 1.00 57.45  ? 356 TYR D CB    1 
ATOM 7348  C CG    . TYR C 3 356 ? -184.475 151.352 177.645 1.00 57.45  ? 356 TYR D CG    1 
ATOM 7349  C CD1   . TYR C 3 356 ? -183.766 152.524 177.640 1.00 57.45  ? 356 TYR D CD1   1 
ATOM 7350  C CD2   . TYR C 3 356 ? -184.167 150.406 176.700 1.00 57.45  ? 356 TYR D CD2   1 
ATOM 7351  C CE1   . TYR C 3 356 ? -182.771 152.738 176.739 1.00 57.45  ? 356 TYR D CE1   1 
ATOM 7352  C CE2   . TYR C 3 356 ? -183.172 150.612 175.806 1.00 57.45  ? 356 TYR D CE2   1 
ATOM 7353  C CZ    . TYR C 3 356 ? -182.481 151.777 175.827 1.00 57.45  ? 356 TYR D CZ    1 
ATOM 7354  O OH    . TYR C 3 356 ? -181.482 151.967 174.915 1.00 57.45  ? 356 TYR D OH    1 
ATOM 7355  N N     . PRO C 3 357 ? -187.125 150.760 181.373 1.00 61.25  ? 357 PRO D N     1 
ATOM 7356  C CA    . PRO C 3 357 ? -188.400 150.724 182.101 1.00 61.25  ? 357 PRO D CA    1 
ATOM 7357  C C     . PRO C 3 357 ? -188.455 151.706 183.249 1.00 61.25  ? 357 PRO D C     1 
ATOM 7358  O O     . PRO C 3 357 ? -189.537 152.208 183.570 1.00 61.25  ? 357 PRO D O     1 
ATOM 7359  C CB    . PRO C 3 357 ? -188.478 149.274 182.583 1.00 61.25  ? 357 PRO D CB    1 
ATOM 7360  C CG    . PRO C 3 357 ? -187.079 148.857 182.665 1.00 61.25  ? 357 PRO D CG    1 
ATOM 7361  C CD    . PRO C 3 357 ? -186.416 149.484 181.496 1.00 61.25  ? 357 PRO D CD    1 
ATOM 7362  N N     . ALA C 3 358 ? -187.326 151.992 183.886 1.00 62.71  ? 358 ALA D N     1 
ATOM 7363  C CA    . ALA C 3 358 ? -187.307 153.040 184.893 1.00 62.71  ? 358 ALA D CA    1 
ATOM 7364  C C     . ALA C 3 358 ? -187.630 154.383 184.260 1.00 62.71  ? 358 ALA D C     1 
ATOM 7365  O O     . ALA C 3 358 ? -188.352 155.200 184.841 1.00 62.71  ? 358 ALA D O     1 
ATOM 7366  C CB    . ALA C 3 358 ? -185.956 153.079 185.591 1.00 62.71  ? 358 ALA D CB    1 
ATOM 7367  N N     . LEU C 3 359 ? -187.118 154.614 183.054 1.00 61.66  ? 359 LEU D N     1 
ATOM 7368  C CA    . LEU C 3 359 ? -187.406 155.853 182.345 1.00 61.66  ? 359 LEU D CA    1 
ATOM 7369  C C     . LEU C 3 359 ? -188.875 155.954 181.992 1.00 61.66  ? 359 LEU D C     1 
ATOM 7370  O O     . LEU C 3 359 ? -189.524 156.968 182.264 1.00 61.66  ? 359 LEU D O     1 
ATOM 7371  C CB    . LEU C 3 359 ? -186.587 155.905 181.066 1.00 61.66  ? 359 LEU D CB    1 
ATOM 7372  C CG    . LEU C 3 359 ? -186.454 157.218 180.314 1.00 61.66  ? 359 LEU D CG    1 
ATOM 7373  C CD1   . LEU C 3 359 ? -185.299 157.053 179.427 1.00 61.66  ? 359 LEU D CD1   1 
ATOM 7374  C CD2   . LEU C 3 359 ? -187.632 157.575 179.500 1.00 61.66  ? 359 LEU D CD2   1 
ATOM 7375  N N     . ILE C 3 360 ? -189.413 154.905 181.384 1.00 63.31  ? 360 ILE D N     1 
ATOM 7376  C CA    . ILE C 3 360 ? -190.823 154.883 181.041 1.00 63.31  ? 360 ILE D CA    1 
ATOM 7377  C C     . ILE C 3 360 ? -191.672 155.107 182.277 1.00 63.31  ? 360 ILE D C     1 
ATOM 7378  O O     . ILE C 3 360 ? -192.684 155.811 182.235 1.00 63.31  ? 360 ILE D O     1 
ATOM 7379  C CB    . ILE C 3 360 ? -191.172 153.566 180.338 1.00 63.31  ? 360 ILE D CB    1 
ATOM 7380  C CG1   . ILE C 3 360 ? -190.438 153.486 179.006 1.00 63.31  ? 360 ILE D CG1   1 
ATOM 7381  C CG2   . ILE C 3 360 ? -192.652 153.445 180.154 1.00 63.31  ? 360 ILE D CG2   1 
ATOM 7382  C CD1   . ILE C 3 360 ? -190.644 152.202 178.270 1.00 63.31  ? 360 ILE D CD1   1 
ATOM 7383  N N     . ASP C 3 361 ? -191.260 154.539 183.403 1.00 66.06  ? 361 ASP D N     1 
ATOM 7384  C CA    . ASP C 3 361 ? -192.000 154.763 184.636 1.00 66.06  ? 361 ASP D CA    1 
ATOM 7385  C C     . ASP C 3 361 ? -191.955 156.217 185.066 1.00 66.06  ? 361 ASP D C     1 
ATOM 7386  O O     . ASP C 3 361 ? -192.972 156.777 185.487 1.00 66.06  ? 361 ASP D O     1 
ATOM 7387  C CB    . ASP C 3 361 ? -191.462 153.869 185.740 1.00 66.06  ? 361 ASP D CB    1 
ATOM 7388  C CG    . ASP C 3 361 ? -191.871 152.436 185.558 1.00 66.06  ? 361 ASP D CG    1 
ATOM 7389  O OD1   . ASP C 3 361 ? -192.936 152.206 184.950 1.00 66.06  ? 361 ASP D OD1   1 
ATOM 7390  O OD2   . ASP C 3 361 ? -191.141 151.542 186.026 1.00 66.06  ? 361 ASP D OD2   1 
ATOM 7391  N N     . ALA C 3 362 ? -190.793 156.853 184.962 1.00 66.86  ? 362 ALA D N     1 
ATOM 7392  C CA    . ALA C 3 362 ? -190.733 158.241 185.396 1.00 66.86  ? 362 ALA D CA    1 
ATOM 7393  C C     . ALA C 3 362 ? -191.515 159.162 184.476 1.00 66.86  ? 362 ALA D C     1 
ATOM 7394  O O     . ALA C 3 362 ? -192.081 160.155 184.941 1.00 66.86  ? 362 ALA D O     1 
ATOM 7395  C CB    . ALA C 3 362 ? -189.288 158.711 185.484 1.00 66.86  ? 362 ALA D CB    1 
ATOM 7396  N N     . MET C 3 363 ? -191.593 158.849 183.187 1.00 66.35  ? 363 MET D N     1 
ATOM 7397  C CA    . MET C 3 363 ? -192.342 159.733 182.311 1.00 66.35  ? 363 MET D CA    1 
ATOM 7398  C C     . MET C 3 363 ? -193.838 159.484 182.366 1.00 66.35  ? 363 MET D C     1 
ATOM 7399  O O     . MET C 3 363 ? -194.618 160.434 182.272 1.00 66.35  ? 363 MET D O     1 
ATOM 7400  C CB    . MET C 3 363 ? -191.836 159.599 180.884 1.00 66.35  ? 363 MET D CB    1 
ATOM 7401  C CG    . MET C 3 363 ? -190.415 160.030 180.774 1.00 66.35  ? 363 MET D CG    1 
ATOM 7402  S SD    . MET C 3 363 ? -190.219 161.637 181.524 1.00 66.35  ? 363 MET D SD    1 
ATOM 7403  C CE    . MET C 3 363 ? -188.466 161.626 181.810 1.00 66.35  ? 363 MET D CE    1 
ATOM 7404  N N     . VAL C 3 364 ? -194.261 158.239 182.560 1.00 68.54  ? 364 VAL D N     1 
ATOM 7405  C CA    . VAL C 3 364 ? -195.670 157.988 182.833 1.00 68.54  ? 364 VAL D CA    1 
ATOM 7406  C C     . VAL C 3 364 ? -196.082 158.652 184.134 1.00 68.54  ? 364 VAL D C     1 
ATOM 7407  O O     . VAL C 3 364 ? -197.186 159.194 184.256 1.00 68.54  ? 364 VAL D O     1 
ATOM 7408  C CB    . VAL C 3 364 ? -195.948 156.478 182.840 1.00 68.54  ? 364 VAL D CB    1 
ATOM 7409  C CG1   . VAL C 3 364 ? -197.328 156.197 183.371 1.00 68.54  ? 364 VAL D CG1   1 
ATOM 7410  C CG2   . VAL C 3 364 ? -195.800 155.947 181.446 1.00 68.54  ? 364 VAL D CG2   1 
ATOM 7411  N N     . ALA C 3 365 ? -195.187 158.660 185.111 1.00 69.35  ? 365 ALA D N     1 
ATOM 7412  C CA    . ALA C 3 365 ? -195.447 159.393 186.340 1.00 69.35  ? 365 ALA D CA    1 
ATOM 7413  C C     . ALA C 3 365 ? -195.533 160.885 186.071 1.00 69.35  ? 365 ALA D C     1 
ATOM 7414  O O     . ALA C 3 365 ? -196.383 161.579 186.636 1.00 69.35  ? 365 ALA D O     1 
ATOM 7415  C CB    . ALA C 3 365 ? -194.361 159.093 187.367 1.00 69.35  ? 365 ALA D CB    1 
ATOM 7416  N N     . ALA C 3 366 ? -194.694 161.385 185.174 1.00 71.04  ? 366 ALA D N     1 
ATOM 7417  C CA    . ALA C 3 366 ? -194.705 162.802 184.846 1.00 71.04  ? 366 ALA D CA    1 
ATOM 7418  C C     . ALA C 3 366 ? -195.946 163.225 184.077 1.00 71.04  ? 366 ALA D C     1 
ATOM 7419  O O     . ALA C 3 366 ? -196.324 164.398 184.142 1.00 71.04  ? 366 ALA D O     1 
ATOM 7420  C CB    . ALA C 3 366 ? -193.460 163.163 184.045 1.00 71.04  ? 366 ALA D CB    1 
ATOM 7421  N N     . ALA C 3 367 ? -196.598 162.330 183.340 1.00 73.43  ? 367 ALA D N     1 
ATOM 7422  C CA    . ALA C 3 367 ? -197.750 162.842 182.613 1.00 73.43  ? 367 ALA D CA    1 
ATOM 7423  C C     . ALA C 3 367 ? -198.919 163.098 183.546 1.00 73.43  ? 367 ALA D C     1 
ATOM 7424  O O     . ALA C 3 367 ? -199.719 164.000 183.290 1.00 73.43  ? 367 ALA D O     1 
ATOM 7425  C CB    . ALA C 3 367 ? -198.153 161.866 181.519 1.00 73.43  ? 367 ALA D CB    1 
ATOM 7426  N N     . PHE C 3 368 ? -199.049 162.310 184.603 1.00 76.11  ? 368 PHE D N     1 
ATOM 7427  C CA    . PHE C 3 368 ? -200.155 162.496 185.533 1.00 76.11  ? 368 PHE D CA    1 
ATOM 7428  C C     . PHE C 3 368 ? -199.663 162.851 186.933 1.00 76.11  ? 368 PHE D C     1 
ATOM 7429  O O     . PHE C 3 368 ? -199.450 164.020 187.248 1.00 76.11  ? 368 PHE D O     1 
ATOM 7430  C CB    . PHE C 3 368 ? -201.039 161.248 185.584 1.00 76.11  ? 368 PHE D CB    1 
ATOM 7431  C CG    . PHE C 3 368 ? -201.025 160.433 184.321 1.00 76.11  ? 368 PHE D CG    1 
ATOM 7432  C CD1   . PHE C 3 368 ? -199.876 159.805 183.900 1.00 76.11  ? 368 PHE D CD1   1 
ATOM 7433  C CD2   . PHE C 3 368 ? -202.172 160.282 183.569 1.00 76.11  ? 368 PHE D CD2   1 
ATOM 7434  C CE1   . PHE C 3 368 ? -199.867 159.049 182.746 1.00 76.11  ? 368 PHE D CE1   1 
ATOM 7435  C CE2   . PHE C 3 368 ? -202.169 159.529 182.412 1.00 76.11  ? 368 PHE D CE2   1 
ATOM 7436  C CZ    . PHE C 3 368 ? -201.014 158.910 182.000 1.00 76.11  ? 368 PHE D CZ    1 
ATOM 7437  N N     . THR D 3 2   ? -96.870  135.407 147.853 1.00 56.58  ? 2   THR E N     1 
ATOM 7438  C CA    . THR D 3 2   ? -97.234  136.587 147.098 1.00 56.58  ? 2   THR E CA    1 
ATOM 7439  C C     . THR D 3 2   ? -98.060  137.538 147.941 1.00 56.58  ? 2   THR E C     1 
ATOM 7440  O O     . THR D 3 2   ? -98.421  138.620 147.497 1.00 56.58  ? 2   THR E O     1 
ATOM 7441  C CB    . THR D 3 2   ? -98.011  136.217 145.853 1.00 56.58  ? 2   THR E CB    1 
ATOM 7442  O OG1   . THR D 3 2   ? -99.239  135.593 146.232 1.00 56.58  ? 2   THR E OG1   1 
ATOM 7443  C CG2   . THR D 3 2   ? -97.209  135.245 145.021 1.00 56.58  ? 2   THR E CG2   1 
ATOM 7444  N N     . PHE D 3 3   ? -98.380  137.115 149.154 1.00 50.05  ? 3   PHE E N     1 
ATOM 7445  C CA    . PHE D 3 3   ? -99.141  137.899 150.117 1.00 50.05  ? 3   PHE E CA    1 
ATOM 7446  C C     . PHE D 3 3   ? -98.277  138.055 151.349 1.00 50.05  ? 3   PHE E C     1 
ATOM 7447  O O     . PHE D 3 3   ? -97.930  137.064 151.983 1.00 50.05  ? 3   PHE E O     1 
ATOM 7448  C CB    . PHE D 3 3   ? -100.459 137.242 150.492 1.00 50.05  ? 3   PHE E CB    1 
ATOM 7449  C CG    . PHE D 3 3   ? -101.503 137.332 149.439 1.00 50.05  ? 3   PHE E CG    1 
ATOM 7450  C CD1   . PHE D 3 3   ? -102.194 138.502 149.250 1.00 50.05  ? 3   PHE E CD1   1 
ATOM 7451  C CD2   . PHE D 3 3   ? -101.794 136.255 148.639 1.00 50.05  ? 3   PHE E CD2   1 
ATOM 7452  C CE1   . PHE D 3 3   ? -103.155 138.595 148.294 1.00 50.05  ? 3   PHE E CE1   1 
ATOM 7453  C CE2   . PHE D 3 3   ? -102.754 136.348 147.676 1.00 50.05  ? 3   PHE E CE2   1 
ATOM 7454  C CZ    . PHE D 3 3   ? -103.434 137.520 147.504 1.00 50.05  ? 3   PHE E CZ    1 
ATOM 7455  N N     . VAL D 3 4   ? -97.928  139.275 151.704 1.00 47.54  ? 4   VAL E N     1 
ATOM 7456  C CA    . VAL D 3 4   ? -97.211  139.507 152.949 1.00 47.54  ? 4   VAL E CA    1 
ATOM 7457  C C     . VAL D 3 4   ? -98.200  140.130 153.908 1.00 47.54  ? 4   VAL E C     1 
ATOM 7458  O O     . VAL D 3 4   ? -98.679  141.239 153.671 1.00 47.54  ? 4   VAL E O     1 
ATOM 7459  C CB    . VAL D 3 4   ? -96.000  140.422 152.750 1.00 47.54  ? 4   VAL E CB    1 
ATOM 7460  C CG1   . VAL D 3 4   ? -95.310  140.636 154.060 1.00 47.54  ? 4   VAL E CG1   1 
ATOM 7461  C CG2   . VAL D 3 4   ? -95.052  139.827 151.752 1.00 47.54  ? 4   VAL E CG2   1 
ATOM 7462  N N     . ASP D 3 5   ? -98.495  139.452 155.004 1.00 44.74  ? 5   ASP E N     1 
ATOM 7463  C CA    . ASP D 3 5   ? -99.384  140.040 155.992 1.00 44.74  ? 5   ASP E CA    1 
ATOM 7464  C C     . ASP D 3 5   ? -98.660  140.191 157.308 1.00 44.74  ? 5   ASP E C     1 
ATOM 7465  O O     . ASP D 3 5   ? -97.883  139.322 157.708 1.00 44.74  ? 5   ASP E O     1 
ATOM 7466  C CB    . ASP D 3 5   ? -100.662 139.224 156.158 1.00 44.74  ? 5   ASP E CB    1 
ATOM 7467  C CG    . ASP D 3 5   ? -100.398 137.782 156.411 1.00 44.74  ? 5   ASP E CG    1 
ATOM 7468  O OD1   . ASP D 3 5   ? -99.363  137.297 155.943 1.00 44.74  ? 5   ASP E OD1   1 
ATOM 7469  O OD2   . ASP D 3 5   ? -101.234 137.117 157.055 1.00 44.74  ? 5   ASP E OD2   1 
ATOM 7470  N N     . ILE D 3 6   ? -98.927  141.306 157.972 1.00 40.84  ? 6   ILE E N     1 
ATOM 7471  C CA    . ILE D 3 6   ? -98.235  141.675 159.188 1.00 40.84  ? 6   ILE E CA    1 
ATOM 7472  C C     . ILE D 3 6   ? -99.250  141.924 160.280 1.00 40.84  ? 6   ILE E C     1 
ATOM 7473  O O     . ILE D 3 6   ? -100.205 142.687 160.090 1.00 40.84  ? 6   ILE E O     1 
ATOM 7474  C CB    . ILE D 3 6   ? -97.345  142.903 158.963 1.00 40.84  ? 6   ILE E CB    1 
ATOM 7475  C CG1   . ILE D 3 6   ? -96.771  143.396 160.275 1.00 40.84  ? 6   ILE E CG1   1 
ATOM 7476  C CG2   . ILE D 3 6   ? -98.100  143.983 158.277 1.00 40.84  ? 6   ILE E CG2   1 
ATOM 7477  C CD1   . ILE D 3 6   ? -95.667  144.364 160.076 1.00 40.84  ? 6   ILE E CD1   1 
ATOM 7478  N N     . HIS D 3 7   ? -99.062  141.243 161.402 1.00 41.33  ? 7   HIS E N     1 
ATOM 7479  C CA    . HIS D 3 7   ? -99.894  141.388 162.580 1.00 41.33  ? 7   HIS E CA    1 
ATOM 7480  C C     . HIS D 3 7   ? -99.086  142.114 163.638 1.00 41.33  ? 7   HIS E C     1 
ATOM 7481  O O     . HIS D 3 7   ? -97.858  142.037 163.649 1.00 41.33  ? 7   HIS E O     1 
ATOM 7482  C CB    . HIS D 3 7   ? -100.319 140.029 163.109 1.00 41.33  ? 7   HIS E CB    1 
ATOM 7483  C CG    . HIS D 3 7   ? -100.782 139.084 162.054 1.00 41.33  ? 7   HIS E CG    1 
ATOM 7484  N ND1   . HIS D 3 7   ? -102.109 138.799 161.844 1.00 41.33  ? 7   HIS E ND1   1 
ATOM 7485  C CD2   . HIS D 3 7   ? -100.095 138.359 161.146 1.00 41.33  ? 7   HIS E CD2   1 
ATOM 7486  C CE1   . HIS D 3 7   ? -102.219 137.926 160.862 1.00 41.33  ? 7   HIS E CE1   1 
ATOM 7487  N NE2   . HIS D 3 7   ? -101.011 137.645 160.418 1.00 41.33  ? 7   HIS E NE2   1 
ATOM 7488  N N     . ALA D 3 8   ? -99.771  142.776 164.559 1.00 40.38  ? 8   ALA E N     1 
ATOM 7489  C CA    . ALA D 3 8   ? -99.065  143.572 165.549 1.00 40.38  ? 8   ALA E CA    1 
ATOM 7490  C C     . ALA D 3 8   ? -99.954  143.834 166.747 1.00 40.38  ? 8   ALA E C     1 
ATOM 7491  O O     . ALA D 3 8   ? -101.110 144.205 166.584 1.00 40.38  ? 8   ALA E O     1 
ATOM 7492  C CB    . ALA D 3 8   ? -98.610  144.893 164.951 1.00 40.38  ? 8   ALA E CB    1 
ATOM 7493  N N     . ILE D 3 9   ? -99.429  143.633 167.942 1.00 43.08  ? 9   ILE E N     1 
ATOM 7494  C CA    . ILE D 3 9   ? -100.107 144.040 169.164 1.00 43.08  ? 9   ILE E CA    1 
ATOM 7495  C C     . ILE D 3 9   ? -99.380  145.268 169.679 1.00 43.08  ? 9   ILE E C     1 
ATOM 7496  O O     . ILE D 3 9   ? -98.156  145.234 169.865 1.00 43.08  ? 9   ILE E O     1 
ATOM 7497  C CB    . ILE D 3 9   ? -100.107 142.932 170.217 1.00 43.08  ? 9   ILE E CB    1 
ATOM 7498  C CG1   . ILE D 3 9   ? -100.652 141.644 169.640 1.00 43.08  ? 9   ILE E CG1   1 
ATOM 7499  C CG2   . ILE D 3 9   ? -100.949 143.347 171.369 1.00 43.08  ? 9   ILE E CG2   1 
ATOM 7500  C CD1   . ILE D 3 9   ? -102.089 141.693 169.380 1.00 43.08  ? 9   ILE E CD1   1 
ATOM 7501  N N     . GLN D 3 10  ? -100.126 146.344 169.927 1.00 44.89  ? 10  GLN E N     1 
ATOM 7502  C CA    . GLN D 3 10  ? -99.531  147.608 170.342 1.00 44.89  ? 10  GLN E CA    1 
ATOM 7503  C C     . GLN D 3 10  ? -100.420 148.338 171.327 1.00 44.89  ? 10  GLN E C     1 
ATOM 7504  O O     . GLN D 3 10  ? -101.526 148.746 170.977 1.00 44.89  ? 10  GLN E O     1 
ATOM 7505  C CB    . GLN D 3 10  ? -99.287  148.498 169.145 1.00 44.89  ? 10  GLN E CB    1 
ATOM 7506  C CG    . GLN D 3 10  ? -98.813  149.853 169.523 1.00 44.89  ? 10  GLN E CG    1 
ATOM 7507  C CD    . GLN D 3 10  ? -98.303  150.606 168.344 1.00 44.89  ? 10  GLN E CD    1 
ATOM 7508  O OE1   . GLN D 3 10  ? -98.272  150.085 167.239 1.00 44.89  ? 10  GLN E OE1   1 
ATOM 7509  N NE2   . GLN D 3 10  ? -97.924  151.851 168.554 1.00 44.89  ? 10  GLN E NE2   1 
ATOM 7510  N N     . THR D 3 11  ? -99.931  148.521 172.545 1.00 47.65  ? 11  THR E N     1 
ATOM 7511  C CA    . THR D 3 11  ? -100.643 149.254 173.578 1.00 47.65  ? 11  THR E CA    1 
ATOM 7512  C C     . THR D 3 11  ? -100.458 150.755 173.417 1.00 47.65  ? 11  THR E C     1 
ATOM 7513  O O     . THR D 3 11  ? -99.378  151.225 173.066 1.00 47.65  ? 11  THR E O     1 
ATOM 7514  C CB    . THR D 3 11  ? -100.147 148.867 174.955 1.00 47.65  ? 11  THR E CB    1 
ATOM 7515  O OG1   . THR D 3 11  ? -98.980  149.628 175.231 1.00 47.65  ? 11  THR E OG1   1 
ATOM 7516  C CG2   . THR D 3 11  ? -99.739  147.438 174.963 1.00 47.65  ? 11  THR E CG2   1 
ATOM 7517  N N     . LEU D 3 12  ? -101.509 151.507 173.700 1.00 48.67  ? 12  LEU E N     1 
ATOM 7518  C CA    . LEU D 3 12  ? -101.483 152.958 173.636 1.00 48.67  ? 12  LEU E CA    1 
ATOM 7519  C C     . LEU D 3 12  ? -102.037 153.480 174.952 1.00 48.67  ? 12  LEU E C     1 
ATOM 7520  O O     . LEU D 3 12  ? -103.124 153.058 175.378 1.00 48.67  ? 12  LEU E O     1 
ATOM 7521  C CB    . LEU D 3 12  ? -102.281 153.504 172.465 1.00 48.67  ? 12  LEU E CB    1 
ATOM 7522  C CG    . LEU D 3 12  ? -101.593 153.113 171.178 1.00 48.67  ? 12  LEU E CG    1 
ATOM 7523  C CD1   . LEU D 3 12  ? -102.493 153.321 170.022 1.00 48.67  ? 12  LEU E CD1   1 
ATOM 7524  C CD2   . LEU D 3 12  ? -100.373 153.963 171.043 1.00 48.67  ? 12  LEU E CD2   1 
ATOM 7525  N N     . PRO D 3 13  ? -101.317 154.361 175.623 1.00 49.08  ? 13  PRO E N     1 
ATOM 7526  C CA    . PRO D 3 13  ? -101.757 154.825 176.935 1.00 49.08  ? 13  PRO E CA    1 
ATOM 7527  C C     . PRO D 3 13  ? -102.520 156.128 176.954 1.00 49.08  ? 13  PRO E C     1 
ATOM 7528  O O     . PRO D 3 13  ? -101.939 157.203 176.807 1.00 49.08  ? 13  PRO E O     1 
ATOM 7529  C CB    . PRO D 3 13  ? -100.436 155.006 177.672 1.00 49.08  ? 13  PRO E CB    1 
ATOM 7530  C CG    . PRO D 3 13  ? -99.494  155.384 176.604 1.00 49.08  ? 13  PRO E CG    1 
ATOM 7531  C CD    . PRO D 3 13  ? -99.937  154.759 175.332 1.00 49.08  ? 13  PRO E CD    1 
ATOM 7532  N N     . TYR D 3 14  ? -103.822 156.034 177.194 1.00 52.98  ? 14  TYR E N     1 
ATOM 7533  C CA    . TYR D 3 14  ? -104.690 157.205 177.253 1.00 52.98  ? 14  TYR E CA    1 
ATOM 7534  C C     . TYR D 3 14  ? -104.339 158.095 176.098 1.00 52.98  ? 14  TYR E C     1 
ATOM 7535  O O     . TYR D 3 14  ? -103.891 159.218 176.269 1.00 52.98  ? 14  TYR E O     1 
ATOM 7536  C CB    . TYR D 3 14  ? -104.516 157.955 178.564 1.00 52.98  ? 14  TYR E CB    1 
ATOM 7537  C CG    . TYR D 3 14  ? -105.790 158.576 179.039 1.00 52.98  ? 14  TYR E CG    1 
ATOM 7538  C CD1   . TYR D 3 14  ? -106.629 157.885 179.875 1.00 52.98  ? 14  TYR E CD1   1 
ATOM 7539  C CD2   . TYR D 3 14  ? -106.163 159.839 178.640 1.00 52.98  ? 14  TYR E CD2   1 
ATOM 7540  C CE1   . TYR D 3 14  ? -107.803 158.435 180.316 1.00 52.98  ? 14  TYR E CE1   1 
ATOM 7541  C CE2   . TYR D 3 14  ? -107.340 160.399 179.081 1.00 52.98  ? 14  TYR E CE2   1 
ATOM 7542  C CZ    . TYR D 3 14  ? -108.151 159.684 179.918 1.00 52.98  ? 14  TYR E CZ    1 
ATOM 7543  O OH    . TYR D 3 14  ? -109.325 160.198 180.381 1.00 52.98  ? 14  TYR E OH    1 
ATOM 7544  N N     . SER D 3 15  ? -104.541 157.576 174.904 1.00 53.38  ? 15  SER E N     1 
ATOM 7545  C CA    . SER D 3 15  ? -104.172 158.309 173.705 1.00 53.38  ? 15  SER E CA    1 
ATOM 7546  C C     . SER D 3 15  ? -105.271 159.160 173.079 1.00 53.38  ? 15  SER E C     1 
ATOM 7547  O O     . SER D 3 15  ? -105.137 160.378 172.959 1.00 53.38  ? 15  SER E O     1 
ATOM 7548  C CB    . SER D 3 15  ? -103.665 157.315 172.668 1.00 53.38  ? 15  SER E CB    1 
ATOM 7549  O OG    . SER D 3 15  ? -104.561 156.227 172.552 1.00 53.38  ? 15  SER E OG    1 
ATOM 7550  N N     . ASN D 3 16  ? -106.372 158.517 172.706 1.00 51.29  ? 16  ASN E N     1 
ATOM 7551  C CA    . ASN D 3 16  ? -107.450 159.093 171.896 1.00 51.29  ? 16  ASN E CA    1 
ATOM 7552  C C     . ASN D 3 16  ? -106.880 159.680 170.610 1.00 51.29  ? 16  ASN E C     1 
ATOM 7553  O O     . ASN D 3 16  ? -107.031 160.863 170.311 1.00 51.29  ? 16  ASN E O     1 
ATOM 7554  C CB    . ASN D 3 16  ? -108.229 160.173 172.633 1.00 51.29  ? 16  ASN E CB    1 
ATOM 7555  C CG    . ASN D 3 16  ? -109.505 160.543 171.919 1.00 51.29  ? 16  ASN E CG    1 
ATOM 7556  O OD1   . ASN D 3 16  ? -109.846 159.952 170.909 1.00 51.29  ? 16  ASN E OD1   1 
ATOM 7557  N ND2   . ASN D 3 16  ? -110.205 161.542 172.426 1.00 51.29  ? 16  ASN E ND2   1 
ATOM 7558  N N     . ILE D 3 17  ? -106.242 158.810 169.830 1.00 47.18  ? 17  ILE E N     1 
ATOM 7559  C CA    . ILE D 3 17  ? -105.513 159.222 168.639 1.00 47.18  ? 17  ILE E CA    1 
ATOM 7560  C C     . ILE D 3 17  ? -106.469 159.574 167.514 1.00 47.18  ? 17  ILE E C     1 
ATOM 7561  O O     . ILE D 3 17  ? -106.157 160.413 166.669 1.00 47.18  ? 17  ILE E O     1 
ATOM 7562  C CB    . ILE D 3 17  ? -104.480 158.174 168.207 1.00 47.18  ? 17  ILE E CB    1 
ATOM 7563  C CG1   . ILE D 3 17  ? -105.056 156.784 168.230 1.00 47.18  ? 17  ILE E CG1   1 
ATOM 7564  C CG2   . ILE D 3 17  ? -103.296 158.229 169.112 1.00 47.18  ? 17  ILE E CG2   1 
ATOM 7565  C CD1   . ILE D 3 17  ? -103.998 155.768 168.002 1.00 47.18  ? 17  ILE E CD1   1 
ATOM 7566  N N     . ASN D 3 18  ? -107.615 158.906 167.450 1.00 45.17  ? 18  ASN E N     1 
ATOM 7567  C CA    . ASN D 3 18  ? -108.536 159.082 166.336 1.00 45.17  ? 18  ASN E CA    1 
ATOM 7568  C C     . ASN D 3 18  ? -109.951 159.293 166.847 1.00 45.17  ? 18  ASN E C     1 
ATOM 7569  O O     . ASN D 3 18  ? -110.527 158.415 167.486 1.00 45.17  ? 18  ASN E O     1 
ATOM 7570  C CB    . ASN D 3 18  ? -108.459 157.877 165.421 1.00 45.17  ? 18  ASN E CB    1 
ATOM 7571  C CG    . ASN D 3 18  ? -108.939 158.181 164.059 1.00 45.17  ? 18  ASN E CG    1 
ATOM 7572  O OD1   . ASN D 3 18  ? -109.043 159.334 163.688 1.00 45.17  ? 18  ASN E OD1   1 
ATOM 7573  N ND2   . ASN D 3 18  ? -109.186 157.153 163.272 1.00 45.17  ? 18  ASN E ND2   1 
ATOM 7574  N N     . ARG D 3 19  ? -110.498 160.468 166.563 1.00 48.52  ? 19  ARG E N     1 
ATOM 7575  C CA    . ARG D 3 19  ? -111.785 160.909 167.066 1.00 48.52  ? 19  ARG E CA    1 
ATOM 7576  C C     . ARG D 3 19  ? -112.870 160.846 166.007 1.00 48.52  ? 19  ARG E C     1 
ATOM 7577  O O     . ARG D 3 19  ? -112.616 161.034 164.820 1.00 48.52  ? 19  ARG E O     1 
ATOM 7578  C CB    . ARG D 3 19  ? -111.670 162.341 167.546 1.00 48.52  ? 19  ARG E CB    1 
ATOM 7579  C CG    . ARG D 3 19  ? -110.730 162.506 168.672 1.00 48.52  ? 19  ARG E CG    1 
ATOM 7580  C CD    . ARG D 3 19  ? -110.649 163.940 169.064 1.00 48.52  ? 19  ARG E CD    1 
ATOM 7581  N NE    . ARG D 3 19  ? -109.918 164.716 168.077 1.00 48.52  ? 19  ARG E NE    1 
ATOM 7582  C CZ    . ARG D 3 19  ? -109.790 166.030 168.139 1.00 48.52  ? 19  ARG E CZ    1 
ATOM 7583  N NH1   . ARG D 3 19  ? -110.351 166.685 169.125 1.00 48.52  ? 19  ARG E NH1   1 
ATOM 7584  N NH2   . ARG D 3 19  ? -109.103 166.687 167.229 1.00 48.52  ? 19  ARG E NH2   1 
ATOM 7585  N N     . ASP D 3 20  ? -114.093 160.610 166.455 1.00 56.74  ? 20  ASP E N     1 
ATOM 7586  C CA    . ASP D 3 20  ? -115.266 160.697 165.601 1.00 56.74  ? 20  ASP E CA    1 
ATOM 7587  C C     . ASP D 3 20  ? -115.624 162.153 165.353 1.00 56.74  ? 20  ASP E C     1 
ATOM 7588  O O     . ASP D 3 20  ? -114.833 163.063 165.590 1.00 56.74  ? 20  ASP E O     1 
ATOM 7589  C CB    . ASP D 3 20  ? -116.448 159.948 166.205 1.00 56.74  ? 20  ASP E CB    1 
ATOM 7590  C CG    . ASP D 3 20  ? -116.998 160.617 167.431 1.00 56.74  ? 20  ASP E CG    1 
ATOM 7591  O OD1   . ASP D 3 20  ? -116.293 161.450 168.037 1.00 56.74  ? 20  ASP E OD1   1 
ATOM 7592  O OD2   . ASP D 3 20  ? -118.147 160.308 167.798 1.00 56.74  ? 20  ASP E OD2   1 
ATOM 7593  N N     . ASP D 3 21  ? -116.833 162.368 164.858 1.00 61.86  ? 21  ASP E N     1 
ATOM 7594  C CA    . ASP D 3 21  ? -117.318 163.709 164.592 1.00 61.86  ? 21  ASP E CA    1 
ATOM 7595  C C     . ASP D 3 21  ? -117.639 164.501 165.845 1.00 61.86  ? 21  ASP E C     1 
ATOM 7596  O O     . ASP D 3 21  ? -117.675 165.733 165.786 1.00 61.86  ? 21  ASP E O     1 
ATOM 7597  C CB    . ASP D 3 21  ? -118.574 163.613 163.737 1.00 61.86  ? 21  ASP E CB    1 
ATOM 7598  C CG    . ASP D 3 21  ? -119.056 164.951 163.281 1.00 61.86  ? 21  ASP E CG    1 
ATOM 7599  O OD1   . ASP D 3 21  ? -118.390 165.563 162.428 1.00 61.86  ? 21  ASP E OD1   1 
ATOM 7600  O OD2   . ASP D 3 21  ? -120.114 165.388 163.765 1.00 61.86  ? 21  ASP E OD2   1 
ATOM 7601  N N     . LEU D 3 22  ? -117.862 163.843 166.976 1.00 58.76  ? 22  LEU E N     1 
ATOM 7602  C CA    . LEU D 3 22  ? -118.186 164.545 168.209 1.00 58.76  ? 22  LEU E CA    1 
ATOM 7603  C C     . LEU D 3 22  ? -117.048 164.546 169.210 1.00 58.76  ? 22  LEU E C     1 
ATOM 7604  O O     . LEU D 3 22  ? -117.221 165.044 170.323 1.00 58.76  ? 22  LEU E O     1 
ATOM 7605  C CB    . LEU D 3 22  ? -119.424 163.937 168.846 1.00 58.76  ? 22  LEU E CB    1 
ATOM 7606  C CG    . LEU D 3 22  ? -120.627 164.082 167.935 1.00 58.76  ? 22  LEU E CG    1 
ATOM 7607  C CD1   . LEU D 3 22  ? -121.790 163.334 168.506 1.00 58.76  ? 22  LEU E CD1   1 
ATOM 7608  C CD2   . LEU D 3 22  ? -120.952 165.540 167.788 1.00 58.76  ? 22  LEU E CD2   1 
ATOM 7609  N N     . GLY D 3 23  ? -115.897 164.009 168.852 1.00 55.22  ? 23  GLY E N     1 
ATOM 7610  C CA    . GLY D 3 23  ? -114.762 164.004 169.737 1.00 55.22  ? 23  GLY E CA    1 
ATOM 7611  C C     . GLY D 3 23  ? -114.529 162.713 170.480 1.00 55.22  ? 23  GLY E C     1 
ATOM 7612  O O     . GLY D 3 23  ? -113.472 162.560 171.091 1.00 55.22  ? 23  GLY E O     1 
ATOM 7613  N N     . SER D 3 24  ? -115.458 161.783 170.436 1.00 53.25  ? 24  SER E N     1 
ATOM 7614  C CA    . SER D 3 24  ? -115.235 160.532 171.131 1.00 53.25  ? 24  SER E CA    1 
ATOM 7615  C C     . SER D 3 24  ? -114.386 159.620 170.259 1.00 53.25  ? 24  SER E C     1 
ATOM 7616  O O     . SER D 3 24  ? -114.496 159.656 169.036 1.00 53.25  ? 24  SER E O     1 
ATOM 7617  C CB    . SER D 3 24  ? -116.549 159.855 171.462 1.00 53.25  ? 24  SER E CB    1 
ATOM 7618  O OG    . SER D 3 24  ? -117.335 159.717 170.300 1.00 53.25  ? 24  SER E OG    1 
ATOM 7619  N N     . PRO D 3 25  ? -113.524 158.809 170.852 1.00 49.13  ? 25  PRO E N     1 
ATOM 7620  C CA    . PRO D 3 25  ? -112.776 157.838 170.057 1.00 49.13  ? 25  PRO E CA    1 
ATOM 7621  C C     . PRO D 3 25  ? -113.698 156.823 169.411 1.00 49.13  ? 25  PRO E C     1 
ATOM 7622  O O     . PRO D 3 25  ? -114.703 156.413 169.983 1.00 49.13  ? 25  PRO E O     1 
ATOM 7623  C CB    . PRO D 3 25  ? -111.851 157.187 171.083 1.00 49.13  ? 25  PRO E CB    1 
ATOM 7624  C CG    . PRO D 3 25  ? -112.503 157.414 172.360 1.00 49.13  ? 25  PRO E CG    1 
ATOM 7625  C CD    . PRO D 3 25  ? -113.197 158.715 172.274 1.00 49.13  ? 25  PRO E CD    1 
ATOM 7626  N N     . LYS D 3 26  ? -113.339 156.429 168.198 1.00 42.82  ? 26  LYS E N     1 
ATOM 7627  C CA    . LYS D 3 26  ? -114.156 155.514 167.425 1.00 42.82  ? 26  LYS E CA    1 
ATOM 7628  C C     . LYS D 3 26  ? -114.179 154.124 168.034 1.00 42.82  ? 26  LYS E C     1 
ATOM 7629  O O     . LYS D 3 26  ? -113.155 153.603 168.472 1.00 42.82  ? 26  LYS E O     1 
ATOM 7630  C CB    . LYS D 3 26  ? -113.626 155.463 166.001 1.00 42.82  ? 26  LYS E CB    1 
ATOM 7631  C CG    . LYS D 3 26  ? -113.757 156.777 165.275 1.00 42.82  ? 26  LYS E CG    1 
ATOM 7632  C CD    . LYS D 3 26  ? -113.104 156.738 163.928 1.00 42.82  ? 26  LYS E CD    1 
ATOM 7633  C CE    . LYS D 3 26  ? -113.275 158.042 163.206 1.00 42.82  ? 26  LYS E CE    1 
ATOM 7634  N NZ    . LYS D 3 26  ? -112.619 158.012 161.883 1.00 42.82  ? 26  LYS E NZ    1 
ATOM 7635  N N     . THR D 3 27  ? -115.360 153.516 168.045 1.00 45.58  ? 27  THR E N     1 
ATOM 7636  C CA    . THR D 3 27  ? -115.575 152.246 168.715 1.00 45.58  ? 27  THR E CA    1 
ATOM 7637  C C     . THR D 3 27  ? -116.262 151.233 167.812 1.00 45.58  ? 27  THR E C     1 
ATOM 7638  O O     . THR D 3 27  ? -117.094 151.594 166.983 1.00 45.58  ? 27  THR E O     1 
ATOM 7639  C CB    . THR D 3 27  ? -116.423 152.444 169.961 1.00 45.58  ? 27  THR E CB    1 
ATOM 7640  O OG1   . THR D 3 27  ? -117.695 152.985 169.593 1.00 45.58  ? 27  THR E OG1   1 
ATOM 7641  C CG2   . THR D 3 27  ? -115.743 153.405 170.890 1.00 45.58  ? 27  THR E CG2   1 
ATOM 7642  N N     . VAL D 3 28  ? -115.913 149.958 167.999 1.00 43.41  ? 28  VAL E N     1 
ATOM 7643  C CA    . VAL D 3 28  ? -116.559 148.808 167.366 1.00 43.41  ? 28  VAL E CA    1 
ATOM 7644  C C     . VAL D 3 28  ? -117.263 148.027 168.451 1.00 43.41  ? 28  VAL E C     1 
ATOM 7645  O O     . VAL D 3 28  ? -116.653 147.735 169.471 1.00 43.41  ? 28  VAL E O     1 
ATOM 7646  C CB    . VAL D 3 28  ? -115.566 147.880 166.662 1.00 43.41  ? 28  VAL E CB    1 
ATOM 7647  C CG1   . VAL D 3 28  ? -116.314 146.827 165.879 1.00 43.41  ? 28  VAL E CG1   1 
ATOM 7648  C CG2   . VAL D 3 28  ? -114.675 148.631 165.819 1.00 43.41  ? 28  VAL E CG2   1 
ATOM 7649  N N     . VAL D 3 29  ? -118.511 147.637 168.239 1.00 43.61  ? 29  VAL E N     1 
ATOM 7650  C CA    . VAL D 3 29  ? -119.174 146.725 169.168 1.00 43.61  ? 29  VAL E CA    1 
ATOM 7651  C C     . VAL D 3 29  ? -118.869 145.347 168.608 1.00 43.61  ? 29  VAL E C     1 
ATOM 7652  O O     . VAL D 3 29  ? -119.702 144.746 167.936 1.00 43.61  ? 29  VAL E O     1 
ATOM 7653  C CB    . VAL D 3 29  ? -120.685 147.000 169.233 1.00 43.61  ? 29  VAL E CB    1 
ATOM 7654  C CG1   . VAL D 3 29  ? -121.368 146.181 170.259 1.00 43.61  ? 29  VAL E CG1   1 
ATOM 7655  C CG2   . VAL D 3 29  ? -120.963 148.443 169.450 1.00 43.61  ? 29  VAL E CG2   1 
ATOM 7656  N N     . TYR D 3 30  ? -117.722 144.779 168.979 1.00 41.80  ? 30  TYR E N     1 
ATOM 7657  C CA    . TYR D 3 30  ? -117.240 143.530 168.387 1.00 41.80  ? 30  TYR E CA    1 
ATOM 7658  C C     . TYR D 3 30  ? -117.168 142.429 169.416 1.00 41.80  ? 30  TYR E C     1 
ATOM 7659  O O     . TYR D 3 30  ? -116.656 142.635 170.518 1.00 41.80  ? 30  TYR E O     1 
ATOM 7660  C CB    . TYR D 3 30  ? -115.862 143.730 167.756 1.00 41.80  ? 30  TYR E CB    1 
ATOM 7661  C CG    . TYR D 3 30  ? -115.142 142.514 167.199 1.00 41.80  ? 30  TYR E CG    1 
ATOM 7662  C CD1   . TYR D 3 30  ? -115.669 141.757 166.175 1.00 41.80  ? 30  TYR E CD1   1 
ATOM 7663  C CD2   . TYR D 3 30  ? -113.899 142.161 167.668 1.00 41.80  ? 30  TYR E CD2   1 
ATOM 7664  C CE1   . TYR D 3 30  ? -114.981 140.663 165.660 1.00 41.80  ? 30  TYR E CE1   1 
ATOM 7665  C CE2   . TYR D 3 30  ? -113.220 141.078 167.159 1.00 41.80  ? 30  TYR E CE2   1 
ATOM 7666  C CZ    . TYR D 3 30  ? -113.765 140.338 166.162 1.00 41.80  ? 30  TYR E CZ    1 
ATOM 7667  O OH    . TYR D 3 30  ? -113.055 139.272 165.688 1.00 41.80  ? 30  TYR E OH    1 
ATOM 7668  N N     . GLY D 3 31  ? -117.766 141.296 169.082 1.00 43.71  ? 31  GLY E N     1 
ATOM 7669  C CA    . GLY D 3 31  ? -117.869 140.238 170.038 1.00 43.71  ? 31  GLY E CA    1 
ATOM 7670  C C     . GLY D 3 31  ? -118.882 140.545 171.083 1.00 43.71  ? 31  GLY E C     1 
ATOM 7671  O O     . GLY D 3 31  ? -118.858 139.939 172.148 1.00 43.71  ? 31  GLY E O     1 
ATOM 7672  N N     . GLY D 3 32  ? -119.752 141.503 170.816 1.00 48.68  ? 32  GLY E N     1 
ATOM 7673  C CA    . GLY D 3 32  ? -120.766 141.892 171.748 1.00 48.68  ? 32  GLY E CA    1 
ATOM 7674  C C     . GLY D 3 32  ? -120.308 142.945 172.710 1.00 48.68  ? 32  GLY E C     1 
ATOM 7675  O O     . GLY D 3 32  ? -121.131 143.477 173.455 1.00 48.68  ? 32  GLY E O     1 
ATOM 7676  N N     . LYS D 3 33  ? -119.022 143.276 172.712 1.00 50.35  ? 33  LYS E N     1 
ATOM 7677  C CA    . LYS D 3 33  ? -118.482 144.236 173.657 1.00 50.35  ? 33  LYS E CA    1 
ATOM 7678  C C     . LYS D 3 33  ? -117.818 145.381 172.915 1.00 50.35  ? 33  LYS E C     1 
ATOM 7679  O O     . LYS D 3 33  ? -117.098 145.161 171.940 1.00 50.35  ? 33  LYS E O     1 
ATOM 7680  C CB    . LYS D 3 33  ? -117.522 143.570 174.627 1.00 50.35  ? 33  LYS E CB    1 
ATOM 7681  C CG    . LYS D 3 33  ? -117.066 144.500 175.699 1.00 50.35  ? 33  LYS E CG    1 
ATOM 7682  C CD    . LYS D 3 33  ? -116.171 143.799 176.666 1.00 50.35  ? 33  LYS E CD    1 
ATOM 7683  C CE    . LYS D 3 33  ? -116.954 142.749 177.414 1.00 50.35  ? 33  LYS E CE    1 
ATOM 7684  N NZ    . LYS D 3 33  ? -116.122 142.061 178.434 1.00 50.35  ? 33  LYS E NZ    1 
ATOM 7685  N N     . GLU D 3 34  ? -118.103 146.601 173.357 1.00 52.86  ? 34  GLU E N     1 
ATOM 7686  C CA    . GLU D 3 34  ? -117.546 147.794 172.741 1.00 52.86  ? 34  GLU E CA    1 
ATOM 7687  C C     . GLU D 3 34  ? -116.044 147.861 172.933 1.00 52.86  ? 34  GLU E C     1 
ATOM 7688  O O     . GLU D 3 34  ? -115.538 147.667 174.037 1.00 52.86  ? 34  GLU E O     1 
ATOM 7689  C CB    . GLU D 3 34  ? -118.194 149.028 173.342 1.00 52.86  ? 34  GLU E CB    1 
ATOM 7690  C CG    . GLU D 3 34  ? -117.707 150.304 172.745 1.00 52.86  ? 34  GLU E CG    1 
ATOM 7691  C CD    . GLU D 3 34  ? -118.281 151.510 173.442 1.00 52.86  ? 34  GLU E CD    1 
ATOM 7692  O OE1   . GLU D 3 34  ? -119.120 151.334 174.348 1.00 52.86  ? 34  GLU E OE1   1 
ATOM 7693  O OE2   . GLU D 3 34  ? -117.889 152.638 173.094 1.00 52.86  ? 34  GLU E OE2   1 
ATOM 7694  N N     . ARG D 3 35  ? -115.335 148.144 171.847 1.00 46.90  ? 35  ARG E N     1 
ATOM 7695  C CA    . ARG D 3 35  ? -113.885 148.195 171.813 1.00 46.90  ? 35  ARG E CA    1 
ATOM 7696  C C     . ARG D 3 35  ? -113.447 149.391 170.995 1.00 46.90  ? 35  ARG E C     1 
ATOM 7697  O O     . ARG D 3 35  ? -113.780 149.472 169.817 1.00 46.90  ? 35  ARG E O     1 
ATOM 7698  C CB    . ARG D 3 35  ? -113.339 146.921 171.188 1.00 46.90  ? 35  ARG E CB    1 
ATOM 7699  C CG    . ARG D 3 35  ? -113.819 145.697 171.866 1.00 46.90  ? 35  ARG E CG    1 
ATOM 7700  C CD    . ARG D 3 35  ? -113.305 144.483 171.198 1.00 46.90  ? 35  ARG E CD    1 
ATOM 7701  N NE    . ARG D 3 35  ? -113.935 143.302 171.738 1.00 46.90  ? 35  ARG E NE    1 
ATOM 7702  C CZ    . ARG D 3 35  ? -113.536 142.079 171.459 1.00 46.90  ? 35  ARG E CZ    1 
ATOM 7703  N NH1   . ARG D 3 35  ? -112.508 141.901 170.658 1.00 46.90  ? 35  ARG E NH1   1 
ATOM 7704  N NH2   . ARG D 3 35  ? -114.164 141.041 171.969 1.00 46.90  ? 35  ARG E NH2   1 
ATOM 7705  N N     . THR D 3 36  ? -112.695 150.304 171.588 1.00 43.41  ? 36  THR E N     1 
ATOM 7706  C CA    . THR D 3 36  ? -112.244 151.462 170.833 1.00 43.41  ? 36  THR E CA    1 
ATOM 7707  C C     . THR D 3 36  ? -111.351 151.039 169.680 1.00 43.41  ? 36  THR E C     1 
ATOM 7708  O O     . THR D 3 36  ? -110.648 150.035 169.755 1.00 43.41  ? 36  THR E O     1 
ATOM 7709  C CB    . THR D 3 36  ? -111.516 152.454 171.735 1.00 43.41  ? 36  THR E CB    1 
ATOM 7710  O OG1   . THR D 3 36  ? -111.030 153.535 170.947 1.00 43.41  ? 36  THR E OG1   1 
ATOM 7711  C CG2   . THR D 3 36  ? -110.374 151.828 172.408 1.00 43.41  ? 36  THR E CG2   1 
ATOM 7712  N N     . ARG D 3 37  ? -111.422 151.784 168.582 1.00 40.94  ? 37  ARG E N     1 
ATOM 7713  C CA    . ARG D 3 37  ? -110.710 151.438 167.362 1.00 40.94  ? 37  ARG E CA    1 
ATOM 7714  C C     . ARG D 3 37  ? -110.071 152.681 166.782 1.00 40.94  ? 37  ARG E C     1 
ATOM 7715  O O     . ARG D 3 37  ? -110.554 153.793 166.971 1.00 40.94  ? 37  ARG E O     1 
ATOM 7716  C CB    . ARG D 3 37  ? -111.594 150.821 166.295 1.00 40.94  ? 37  ARG E CB    1 
ATOM 7717  C CG    . ARG D 3 37  ? -112.630 151.746 165.767 1.00 40.94  ? 37  ARG E CG    1 
ATOM 7718  C CD    . ARG D 3 37  ? -113.193 151.228 164.484 1.00 40.94  ? 37  ARG E CD    1 
ATOM 7719  N NE    . ARG D 3 37  ? -114.414 151.931 164.147 1.00 40.94  ? 37  ARG E NE    1 
ATOM 7720  C CZ    . ARG D 3 37  ? -114.464 153.004 163.383 1.00 40.94  ? 37  ARG E CZ    1 
ATOM 7721  N NH1   . ARG D 3 37  ? -113.360 153.492 162.867 1.00 40.94  ? 37  ARG E NH1   1 
ATOM 7722  N NH2   . ARG D 3 37  ? -115.618 153.585 163.140 1.00 40.94  ? 37  ARG E NH2   1 
ATOM 7723  N N     . VAL D 3 38  ? -108.977 152.474 166.068 1.00 40.46  ? 38  VAL E N     1 
ATOM 7724  C CA    . VAL D 3 38  ? -108.362 153.501 165.248 1.00 40.46  ? 38  VAL E CA    1 
ATOM 7725  C C     . VAL D 3 38  ? -108.648 153.185 163.797 1.00 40.46  ? 38  VAL E C     1 
ATOM 7726  O O     . VAL D 3 38  ? -108.256 152.129 163.300 1.00 40.46  ? 38  VAL E O     1 
ATOM 7727  C CB    . VAL D 3 38  ? -106.855 153.561 165.495 1.00 40.46  ? 38  VAL E CB    1 
ATOM 7728  C CG1   . VAL D 3 38  ? -106.230 154.604 164.637 1.00 40.46  ? 38  VAL E CG1   1 
ATOM 7729  C CG2   . VAL D 3 38  ? -106.618 153.838 166.918 1.00 40.46  ? 38  VAL E CG2   1 
ATOM 7730  N N     . SER D 3 39  ? -109.293 154.111 163.108 1.00 41.54  ? 39  SER E N     1 
ATOM 7731  C CA    . SER D 3 39  ? -109.709 153.853 161.746 1.00 41.54  ? 39  SER E CA    1 
ATOM 7732  C C     . SER D 3 39  ? -108.513 153.583 160.858 1.00 41.54  ? 39  SER E C     1 
ATOM 7733  O O     . SER D 3 39  ? -107.415 154.081 161.089 1.00 41.54  ? 39  SER E O     1 
ATOM 7734  C CB    . SER D 3 39  ? -110.482 155.034 161.204 1.00 41.54  ? 39  SER E CB    1 
ATOM 7735  O OG    . SER D 3 39  ? -109.677 156.190 161.248 1.00 41.54  ? 39  SER E OG    1 
ATOM 7736  N N     . SER D 3 40  ? -108.740 152.782 159.827 1.00 40.88  ? 40  SER E N     1 
ATOM 7737  C CA    . SER D 3 40  ? -107.645 152.373 158.964 1.00 40.88  ? 40  SER E CA    1 
ATOM 7738  C C     . SER D 3 40  ? -107.150 153.531 158.132 1.00 40.88  ? 40  SER E C     1 
ATOM 7739  O O     . SER D 3 40  ? -105.962 153.605 157.823 1.00 40.88  ? 40  SER E O     1 
ATOM 7740  C CB    . SER D 3 40  ? -108.071 151.249 158.044 1.00 40.88  ? 40  SER E CB    1 
ATOM 7741  O OG    . SER D 3 40  ? -108.880 151.758 157.014 1.00 40.88  ? 40  SER E OG    1 
ATOM 7742  N N     . GLN D 3 41  ? -108.046 154.410 157.696 1.00 40.94  ? 41  GLN E N     1 
ATOM 7743  C CA    . GLN D 3 41  ? -107.585 155.509 156.864 1.00 40.94  ? 41  GLN E CA    1 
ATOM 7744  C C     . GLN D 3 41  ? -106.629 156.414 157.619 1.00 40.94  ? 41  GLN E C     1 
ATOM 7745  O O     . GLN D 3 41  ? -105.725 156.993 157.016 1.00 40.94  ? 41  GLN E O     1 
ATOM 7746  C CB    . GLN D 3 41  ? -108.739 156.336 156.314 1.00 40.94  ? 41  GLN E CB    1 
ATOM 7747  C CG    . GLN D 3 41  ? -109.629 156.983 157.331 1.00 40.94  ? 41  GLN E CG    1 
ATOM 7748  C CD    . GLN D 3 41  ? -110.775 156.115 157.717 1.00 40.94  ? 41  GLN E CD    1 
ATOM 7749  O OE1   . GLN D 3 41  ? -110.940 155.028 157.190 1.00 40.94  ? 41  GLN E OE1   1 
ATOM 7750  N NE2   . GLN D 3 41  ? -111.580 156.587 158.648 1.00 40.94  ? 41  GLN E NE2   1 
ATOM 7751  N N     . SER D 3 42  ? -106.792 156.546 158.930 1.00 41.28  ? 42  SER E N     1 
ATOM 7752  C CA    . SER D 3 42  ? -105.879 157.400 159.676 1.00 41.28  ? 42  SER E CA    1 
ATOM 7753  C C     . SER D 3 42  ? -104.484 156.815 159.749 1.00 41.28  ? 42  SER E C     1 
ATOM 7754  O O     . SER D 3 42  ? -103.505 157.469 159.372 1.00 41.28  ? 42  SER E O     1 
ATOM 7755  C CB    . SER D 3 42  ? -106.390 157.612 161.084 1.00 41.28  ? 42  SER E CB    1 
ATOM 7756  O OG    . SER D 3 42  ? -106.156 156.434 161.813 1.00 41.28  ? 42  SER E OG    1 
ATOM 7757  N N     . TRP D 3 43  ? -104.368 155.578 160.229 1.00 42.45  ? 43  TRP E N     1 
ATOM 7758  C CA    . TRP D 3 43  ? -103.047 154.979 160.309 1.00 42.45  ? 43  TRP E CA    1 
ATOM 7759  C C     . TRP D 3 43  ? -102.448 154.820 158.921 1.00 42.45  ? 43  TRP E C     1 
ATOM 7760  O O     . TRP D 3 43  ? -101.229 154.893 158.764 1.00 42.45  ? 43  TRP E O     1 
ATOM 7761  C CB    . TRP D 3 43  ? -103.113 153.625 160.998 1.00 42.45  ? 43  TRP E CB    1 
ATOM 7762  C CG    . TRP D 3 43  ? -101.943 153.369 161.861 1.00 42.45  ? 43  TRP E CG    1 
ATOM 7763  C CD1   . TRP D 3 43  ? -100.642 153.327 161.523 1.00 42.45  ? 43  TRP E CD1   1 
ATOM 7764  C CD2   . TRP D 3 43  ? -102.007 153.021 163.237 1.00 42.45  ? 43  TRP E CD2   1 
ATOM 7765  N NE1   . TRP D 3 43  ? -99.875  153.038 162.621 1.00 42.45  ? 43  TRP E NE1   1 
ATOM 7766  C CE2   . TRP D 3 43  ? -100.706 152.830 163.684 1.00 42.45  ? 43  TRP E CE2   1 
ATOM 7767  C CE3   . TRP D 3 43  ? -103.053 152.862 164.139 1.00 42.45  ? 43  TRP E CE3   1 
ATOM 7768  C CZ2   . TRP D 3 43  ? -100.422 152.501 164.991 1.00 42.45  ? 43  TRP E CZ2   1 
ATOM 7769  C CZ3   . TRP D 3 43  ? -102.768 152.534 165.420 1.00 42.45  ? 43  TRP E CZ3   1 
ATOM 7770  C CH2   . TRP D 3 43  ? -101.470 152.357 165.841 1.00 42.45  ? 43  TRP E CH2   1 
ATOM 7771  N N     . LYS D 3 44  ? -103.289 154.627 157.906 1.00 43.00  ? 44  LYS E N     1 
ATOM 7772  C CA    . LYS D 3 44  ? -102.809 154.571 156.531 1.00 43.00  ? 44  LYS E CA    1 
ATOM 7773  C C     . LYS D 3 44  ? -102.251 155.911 156.089 1.00 43.00  ? 44  LYS E C     1 
ATOM 7774  O O     . LYS D 3 44  ? -101.265 155.961 155.350 1.00 43.00  ? 44  LYS E O     1 
ATOM 7775  C CB    . LYS D 3 44  ? -103.937 154.136 155.603 1.00 43.00  ? 44  LYS E CB    1 
ATOM 7776  C CG    . LYS D 3 44  ? -103.577 154.125 154.150 1.00 43.00  ? 44  LYS E CG    1 
ATOM 7777  C CD    . LYS D 3 44  ? -104.746 153.724 153.258 1.00 43.00  ? 44  LYS E CD    1 
ATOM 7778  C CE    . LYS D 3 44  ? -105.294 152.359 153.601 1.00 43.00  ? 44  LYS E CE    1 
ATOM 7779  N NZ    . LYS D 3 44  ? -106.360 151.901 152.670 1.00 43.00  ? 44  LYS E NZ    1 
ATOM 7780  N N     . ARG D 3 45  ? -102.884 157.005 156.496 1.00 45.39  ? 45  ARG E N     1 
ATOM 7781  C CA    . ARG D 3 45  ? -102.333 158.313 156.179 1.00 45.39  ? 45  ARG E CA    1 
ATOM 7782  C C     . ARG D 3 45  ? -101.003 158.528 156.870 1.00 45.39  ? 45  ARG E C     1 
ATOM 7783  O O     . ARG D 3 45  ? -100.054 159.031 156.261 1.00 45.39  ? 45  ARG E O     1 
ATOM 7784  C CB    . ARG D 3 45  ? -103.298 159.410 156.571 1.00 45.39  ? 45  ARG E CB    1 
ATOM 7785  C CG    . ARG D 3 45  ? -102.712 160.769 156.346 1.00 45.39  ? 45  ARG E CG    1 
ATOM 7786  C CD    . ARG D 3 45  ? -103.622 161.847 156.820 1.00 45.39  ? 45  ARG E CD    1 
ATOM 7787  N NE    . ARG D 3 45  ? -103.070 163.164 156.571 1.00 45.39  ? 45  ARG E NE    1 
ATOM 7788  C CZ    . ARG D 3 45  ? -102.331 163.808 157.459 1.00 45.39  ? 45  ARG E CZ    1 
ATOM 7789  N NH1   . ARG D 3 45  ? -101.846 165.009 157.190 1.00 45.39  ? 45  ARG E NH1   1 
ATOM 7790  N NH2   . ARG D 3 45  ? -102.093 163.249 158.631 1.00 45.39  ? 45  ARG E NH2   1 
ATOM 7791  N N     . ALA D 3 46  ? -100.907 158.139 158.135 1.00 45.35  ? 46  ALA E N     1 
ATOM 7792  C CA    . ALA D 3 46  ? -99.630  158.259 158.821 1.00 45.35  ? 46  ALA E CA    1 
ATOM 7793  C C     . ALA D 3 46  ? -98.563  157.407 158.167 1.00 45.35  ? 46  ALA E C     1 
ATOM 7794  O O     . ALA D 3 46  ? -97.408  157.835 158.038 1.00 45.35  ? 46  ALA E O     1 
ATOM 7795  C CB    . ALA D 3 46  ? -99.787  157.864 160.281 1.00 45.35  ? 46  ALA E CB    1 
ATOM 7796  N N     . VAL D 3 47  ? -98.956  156.263 157.626 1.00 47.66  ? 47  VAL E N     1 
ATOM 7797  C CA    . VAL D 3 47  ? -97.985  155.406 156.974 1.00 47.66  ? 47  VAL E CA    1 
ATOM 7798  C C     . VAL D 3 47  ? -97.552  156.014 155.658 1.00 47.66  ? 47  VAL E C     1 
ATOM 7799  O O     . VAL D 3 47  ? -96.369  155.995 155.318 1.00 47.66  ? 47  VAL E O     1 
ATOM 7800  C CB    . VAL D 3 47  ? -98.570  154.006 156.763 1.00 47.66  ? 47  VAL E CB    1 
ATOM 7801  C CG1   . VAL D 3 47  ? -97.757  153.252 155.765 1.00 47.66  ? 47  VAL E CG1   1 
ATOM 7802  C CG2   . VAL D 3 47  ? -98.624  153.253 158.054 1.00 47.66  ? 47  VAL E CG2   1 
ATOM 7803  N N     . ARG D 3 48  ? -98.484  156.573 154.897 1.00 54.20  ? 48  ARG E N     1 
ATOM 7804  C CA    . ARG D 3 48  ? -98.066  157.116 153.617 1.00 54.20  ? 48  ARG E CA    1 
ATOM 7805  C C     . ARG D 3 48  ? -97.226  158.364 153.794 1.00 54.20  ? 48  ARG E C     1 
ATOM 7806  O O     . ARG D 3 48  ? -96.319  158.604 152.998 1.00 54.20  ? 48  ARG E O     1 
ATOM 7807  C CB    . ARG D 3 48  ? -99.257  157.404 152.713 1.00 54.20  ? 48  ARG E CB    1 
ATOM 7808  C CG    . ARG D 3 48  ? -100.099 158.577 153.103 1.00 54.20  ? 48  ARG E CG    1 
ATOM 7809  C CD    . ARG D 3 48  ? -101.120 158.874 152.032 1.00 54.20  ? 48  ARG E CD    1 
ATOM 7810  N NE    . ARG D 3 48  ? -100.485 159.568 150.920 1.00 54.20  ? 48  ARG E NE    1 
ATOM 7811  C CZ    . ARG D 3 48  ? -100.499 160.884 150.771 1.00 54.20  ? 48  ARG E CZ    1 
ATOM 7812  N NH1   . ARG D 3 48  ? -101.116 161.647 151.654 1.00 54.20  ? 48  ARG E NH1   1 
ATOM 7813  N NH2   . ARG D 3 48  ? -99.891  161.435 149.739 1.00 54.20  ? 48  ARG E NH2   1 
ATOM 7814  N N     . HIS D 3 49  ? -97.471  159.159 154.829 1.00 55.40  ? 49  HIS E N     1 
ATOM 7815  C CA    . HIS D 3 49  ? -96.598  160.310 154.997 1.00 55.40  ? 49  HIS E CA    1 
ATOM 7816  C C     . HIS D 3 49  ? -95.223  159.925 155.493 1.00 55.40  ? 49  HIS E C     1 
ATOM 7817  O O     . HIS D 3 49  ? -94.228  160.520 155.067 1.00 55.40  ? 49  HIS E O     1 
ATOM 7818  C CB    . HIS D 3 49  ? -97.228  161.324 155.927 1.00 55.40  ? 49  HIS E CB    1 
ATOM 7819  C CG    . HIS D 3 49  ? -98.163  162.229 155.220 1.00 55.40  ? 49  HIS E CG    1 
ATOM 7820  N ND1   . HIS D 3 49  ? -97.737  163.108 154.253 1.00 55.40  ? 49  HIS E ND1   1 
ATOM 7821  C CD2   . HIS D 3 49  ? -99.504  162.351 155.278 1.00 55.40  ? 49  HIS E CD2   1 
ATOM 7822  C CE1   . HIS D 3 49  ? -98.773  163.760 153.766 1.00 55.40  ? 49  HIS E CE1   1 
ATOM 7823  N NE2   . HIS D 3 49  ? -99.859  163.318 154.372 1.00 55.40  ? 49  HIS E NE2   1 
ATOM 7824  N N     . GLU D 3 50  ? -95.122  158.930 156.360 1.00 57.48  ? 50  GLU E N     1 
ATOM 7825  C CA    . GLU D 3 50  ? -93.776  158.521 156.727 1.00 57.48  ? 50  GLU E CA    1 
ATOM 7826  C C     . GLU D 3 50  ? -93.055  157.843 155.564 1.00 57.48  ? 50  GLU E C     1 
ATOM 7827  O O     . GLU D 3 50  ? -91.848  158.018 155.401 1.00 57.48  ? 50  GLU E O     1 
ATOM 7828  C CB    . GLU D 3 50  ? -93.779  157.621 157.932 1.00 57.48  ? 50  GLU E CB    1 
ATOM 7829  C CG    . GLU D 3 50  ? -93.115  156.360 157.603 1.00 57.48  ? 50  GLU E CG    1 
ATOM 7830  C CD    . GLU D 3 50  ? -91.777  156.250 158.200 1.00 57.48  ? 50  GLU E CD    1 
ATOM 7831  O OE1   . GLU D 3 50  ? -91.249  157.271 158.659 1.00 57.48  ? 50  GLU E OE1   1 
ATOM 7832  O OE2   . GLU D 3 50  ? -91.210  155.137 158.178 1.00 57.48  ? 50  GLU E OE2   1 
ATOM 7833  N N     . VAL D 3 51  ? -93.766  157.085 154.727 1.00 55.39  ? 51  VAL E N     1 
ATOM 7834  C CA    . VAL D 3 51  ? -93.119  156.446 153.581 1.00 55.39  ? 51  VAL E CA    1 
ATOM 7835  C C     . VAL D 3 51  ? -92.670  157.482 152.571 1.00 55.39  ? 51  VAL E C     1 
ATOM 7836  O O     . VAL D 3 51  ? -91.570  157.396 152.026 1.00 55.39  ? 51  VAL E O     1 
ATOM 7837  C CB    . VAL D 3 51  ? -94.053  155.423 152.918 1.00 55.39  ? 51  VAL E CB    1 
ATOM 7838  C CG1   . VAL D 3 51  ? -93.584  155.129 151.528 1.00 55.39  ? 51  VAL E CG1   1 
ATOM 7839  C CG2   . VAL D 3 51  ? -94.058  154.162 153.692 1.00 55.39  ? 51  VAL E CG2   1 
ATOM 7840  N N     . GLU D 3 52  ? -93.522  158.445 152.260 1.00 60.87  ? 52  GLU E N     1 
ATOM 7841  C CA    . GLU D 3 52  ? -93.101  159.490 151.344 1.00 60.87  ? 52  GLU E CA    1 
ATOM 7842  C C     . GLU D 3 52  ? -91.940  160.286 151.913 1.00 60.87  ? 52  GLU E C     1 
ATOM 7843  O O     . GLU D 3 52  ? -91.025  160.668 151.180 1.00 60.87  ? 52  GLU E O     1 
ATOM 7844  C CB    . GLU D 3 52  ? -94.271  160.405 151.017 1.00 60.87  ? 52  GLU E CB    1 
ATOM 7845  C CG    . GLU D 3 52  ? -95.320  159.754 150.165 1.00 60.87  ? 52  GLU E CG    1 
ATOM 7846  C CD    . GLU D 3 52  ? -96.607  160.534 150.130 1.00 60.87  ? 52  GLU E CD    1 
ATOM 7847  O OE1   . GLU D 3 52  ? -96.704  161.566 150.822 1.00 60.87  ? 52  GLU E OE1   1 
ATOM 7848  O OE2   . GLU D 3 52  ? -97.529  160.113 149.410 1.00 60.87  ? 52  GLU E OE2   1 
ATOM 7849  N N     . ALA D 3 53  ? -91.951  160.545 153.218 1.00 59.71  ? 53  ALA E N     1 
ATOM 7850  C CA    . ALA D 3 53  ? -90.864  161.320 153.799 1.00 59.71  ? 53  ALA E CA    1 
ATOM 7851  C C     . ALA D 3 53  ? -89.558  160.545 153.846 1.00 59.71  ? 53  ALA E C     1 
ATOM 7852  O O     . ALA D 3 53  ? -88.483  161.139 153.759 1.00 59.71  ? 53  ALA E O     1 
ATOM 7853  C CB    . ALA D 3 53  ? -91.243  161.776 155.204 1.00 59.71  ? 53  ALA E CB    1 
ATOM 7854  N N     . ARG D 3 54  ? -89.623  159.232 153.979 1.00 59.28  ? 54  ARG E N     1 
ATOM 7855  C CA    . ARG D 3 54  ? -88.413  158.432 154.075 1.00 59.28  ? 54  ARG E CA    1 
ATOM 7856  C C     . ARG D 3 54  ? -87.886  157.987 152.723 1.00 59.28  ? 54  ARG E C     1 
ATOM 7857  O O     . ARG D 3 54  ? -86.670  157.904 152.535 1.00 59.28  ? 54  ARG E O     1 
ATOM 7858  C CB    . ARG D 3 54  ? -88.659  157.224 154.971 1.00 59.28  ? 54  ARG E CB    1 
ATOM 7859  C CG    . ARG D 3 54  ? -87.413  156.460 155.289 1.00 59.28  ? 54  ARG E CG    1 
ATOM 7860  C CD    . ARG D 3 54  ? -87.692  155.371 156.279 1.00 59.28  ? 54  ARG E CD    1 
ATOM 7861  N NE    . ARG D 3 54  ? -86.558  154.474 156.408 1.00 59.28  ? 54  ARG E NE    1 
ATOM 7862  C CZ    . ARG D 3 54  ? -85.538  154.694 157.220 1.00 59.28  ? 54  ARG E CZ    1 
ATOM 7863  N NH1   . ARG D 3 54  ? -85.520  155.784 157.970 1.00 59.28  ? 54  ARG E NH1   1 
ATOM 7864  N NH2   . ARG D 3 54  ? -84.538  153.829 157.279 1.00 59.28  ? 54  ARG E NH2   1 
ATOM 7865  N N     . LEU D 3 55  ? -88.771  157.714 151.777 1.00 60.71  ? 55  LEU E N     1 
ATOM 7866  C CA    . LEU D 3 55  ? -88.399  157.302 150.436 1.00 60.71  ? 55  LEU E CA    1 
ATOM 7867  C C     . LEU D 3 55  ? -88.225  158.498 149.502 1.00 60.71  ? 55  LEU E C     1 
ATOM 7868  O O     . LEU D 3 55  ? -87.885  158.313 148.330 1.00 60.71  ? 55  LEU E O     1 
ATOM 7869  C CB    . LEU D 3 55  ? -89.432  156.301 149.895 1.00 60.71  ? 55  LEU E CB    1 
ATOM 7870  C CG    . LEU D 3 55  ? -88.918  155.376 148.805 1.00 60.71  ? 55  LEU E CG    1 
ATOM 7871  C CD1   . LEU D 3 55  ? -87.700  154.647 149.320 1.00 60.71  ? 55  LEU E CD1   1 
ATOM 7872  C CD2   . LEU D 3 55  ? -89.982  154.390 148.443 1.00 60.71  ? 55  LEU E CD2   1 
ATOM 7873  N N     . GLY D 3 56  ? -88.513  159.709 149.987 1.00 64.86  ? 56  GLY E N     1 
ATOM 7874  C CA    . GLY D 3 56  ? -88.267  160.961 149.297 1.00 64.86  ? 56  GLY E CA    1 
ATOM 7875  C C     . GLY D 3 56  ? -89.301  161.443 148.300 1.00 64.86  ? 56  GLY E C     1 
ATOM 7876  O O     . GLY D 3 56  ? -89.351  162.639 148.018 1.00 64.86  ? 56  GLY E O     1 
ATOM 7877  N N     . ASP D 3 57  ? -90.104  160.577 147.713 1.00 67.10  ? 57  ASP E N     1 
ATOM 7878  C CA    . ASP D 3 57  ? -91.062  161.058 146.722 1.00 67.10  ? 57  ASP E CA    1 
ATOM 7879  C C     . ASP D 3 57  ? -92.429  161.212 147.341 1.00 67.10  ? 57  ASP E C     1 
ATOM 7880  O O     . ASP D 3 57  ? -92.939  160.284 147.983 1.00 67.10  ? 57  ASP E O     1 
ATOM 7881  C CB    . ASP D 3 57  ? -91.158  160.144 145.519 1.00 67.10  ? 57  ASP E CB    1 
ATOM 7882  C CG    . ASP D 3 57  ? -91.401  158.715 145.909 1.00 67.10  ? 57  ASP E CG    1 
ATOM 7883  O OD1   . ASP D 3 57  ? -91.153  158.396 147.097 1.00 67.10  ? 57  ASP E OD1   1 
ATOM 7884  O OD2   . ASP D 3 57  ? -91.824  157.903 145.054 1.00 67.10  ? 57  ASP E OD2   1 
ATOM 7885  N N     . LYS D 3 58  ? -93.012  162.396 147.149 1.00 66.72  ? 58  LYS E N     1 
ATOM 7886  C CA    . LYS D 3 58  ? -94.301  162.719 147.755 1.00 66.72  ? 58  LYS E CA    1 
ATOM 7887  C C     . LYS D 3 58  ? -95.388  162.918 146.717 1.00 66.72  ? 58  LYS E C     1 
ATOM 7888  O O     . LYS D 3 58  ? -95.202  163.610 145.723 1.00 66.72  ? 58  LYS E O     1 
ATOM 7889  C CB    . LYS D 3 58  ? -94.239  163.966 148.639 1.00 66.72  ? 58  LYS E CB    1 
ATOM 7890  C CG    . LYS D 3 58  ? -93.392  163.711 149.803 1.00 66.72  ? 58  LYS E CG    1 
ATOM 7891  C CD    . LYS D 3 58  ? -93.434  164.930 150.711 1.00 66.72  ? 58  LYS E CD    1 
ATOM 7892  C CE    . LYS D 3 58  ? -92.586  164.761 151.969 1.00 66.72  ? 58  LYS E CE    1 
ATOM 7893  N NZ    . LYS D 3 58  ? -93.414  165.251 153.141 1.00 66.72  ? 58  LYS E NZ    1 
ATOM 7894  N N     . ALA D 3 59  ? -96.546  162.363 147.000 1.00 64.42  ? 59  ALA E N     1 
ATOM 7895  C CA    . ALA D 3 59  ? -97.758  162.510 146.226 1.00 64.42  ? 59  ALA E CA    1 
ATOM 7896  C C     . ALA D 3 59  ? -98.708  163.417 146.973 1.00 64.42  ? 59  ALA E C     1 
ATOM 7897  O O     . ALA D 3 59  ? -98.603  163.588 148.186 1.00 64.42  ? 59  ALA E O     1 
ATOM 7898  C CB    . ALA D 3 59  ? -98.363  161.148 145.956 1.00 64.42  ? 59  ALA E CB    1 
ATOM 7899  N N     . VAL D 3 60  ? -99.586  164.050 146.221 1.00 64.73  ? 60  VAL E N     1 
ATOM 7900  C CA    . VAL D 3 60  ? -100.413 165.108 146.739 1.00 64.73  ? 60  VAL E CA    1 
ATOM 7901  C C     . VAL D 3 60  ? -101.860 164.839 146.385 1.00 64.73  ? 60  VAL E C     1 
ATOM 7902  O O     . VAL D 3 60  ? -102.215 164.712 145.204 1.00 64.73  ? 60  VAL E O     1 
ATOM 7903  C CB    . VAL D 3 60  ? -99.974  166.474 146.207 1.00 64.73  ? 60  VAL E CB    1 
ATOM 7904  C CG1   . VAL D 3 60  ? -101.030 167.504 146.500 1.00 64.73  ? 60  VAL E CG1   1 
ATOM 7905  C CG2   . VAL D 3 60  ? -98.715  166.886 146.888 1.00 64.73  ? 60  VAL E CG2   1 
ATOM 7906  N N     . ARG D 3 61  ? -102.671 164.669 147.422 1.00 61.88  ? 61  ARG E N     1 
ATOM 7907  C CA    . ARG D 3 61  ? -104.109 164.492 147.322 1.00 61.88  ? 61  ARG E CA    1 
ATOM 7908  C C     . ARG D 3 61  ? -104.709 165.857 147.593 1.00 61.88  ? 61  ARG E C     1 
ATOM 7909  O O     . ARG D 3 61  ? -104.758 166.302 148.739 1.00 61.88  ? 61  ARG E O     1 
ATOM 7910  C CB    . ARG D 3 61  ? -104.615 163.518 148.374 1.00 61.88  ? 61  ARG E CB    1 
ATOM 7911  C CG    . ARG D 3 61  ? -106.103 163.291 148.383 1.00 61.88  ? 61  ARG E CG    1 
ATOM 7912  C CD    . ARG D 3 61  ? -106.449 162.412 149.553 1.00 61.88  ? 61  ARG E CD    1 
ATOM 7913  N NE    . ARG D 3 61  ? -105.683 161.182 149.594 1.00 61.88  ? 61  ARG E NE    1 
ATOM 7914  C CZ    . ARG D 3 61  ? -105.997 160.098 148.915 1.00 61.88  ? 61  ARG E CZ    1 
ATOM 7915  N NH1   . ARG D 3 61  ? -107.065 160.105 148.143 1.00 61.88  ? 61  ARG E NH1   1 
ATOM 7916  N NH2   . ARG D 3 61  ? -105.251 159.012 149.013 1.00 61.88  ? 61  ARG E NH2   1 
ATOM 7917  N N     . THR D 3 62  ? -105.185 166.515 146.554 1.00 65.45  ? 62  THR E N     1 
ATOM 7918  C CA    . THR D 3 62  ? -105.610 167.889 146.700 1.00 65.45  ? 62  THR E CA    1 
ATOM 7919  C C     . THR D 3 62  ? -106.865 168.116 145.894 1.00 65.45  ? 62  THR E C     1 
ATOM 7920  O O     . THR D 3 62  ? -107.059 167.537 144.824 1.00 65.45  ? 62  THR E O     1 
ATOM 7921  C CB    . THR D 3 62  ? -104.539 168.868 146.266 1.00 65.45  ? 62  THR E CB    1 
ATOM 7922  O OG1   . THR D 3 62  ? -105.003 170.196 146.518 1.00 65.45  ? 62  THR E OG1   1 
ATOM 7923  C CG2   . THR D 3 62  ? -104.231 168.704 144.801 1.00 65.45  ? 62  THR E CG2   1 
ATOM 7924  N N     . ARG D 3 63  ? -107.700 169.003 146.421 1.00 68.12  ? 63  ARG E N     1 
ATOM 7925  C CA    . ARG D 3 63  ? -108.938 169.399 145.772 1.00 68.12  ? 63  ARG E CA    1 
ATOM 7926  C C     . ARG D 3 63  ? -108.733 170.712 145.062 1.00 68.12  ? 63  ARG E C     1 
ATOM 7927  O O     . ARG D 3 63  ? -109.656 171.240 144.475 1.00 68.12  ? 63  ARG E O     1 
ATOM 7928  C CB    . ARG D 3 63  ? -110.076 169.550 146.774 1.00 68.12  ? 63  ARG E CB    1 
ATOM 7929  C CG    . ARG D 3 63  ? -111.448 169.435 146.142 1.00 68.12  ? 63  ARG E CG    1 
ATOM 7930  C CD    . ARG D 3 63  ? -112.561 169.639 147.146 1.00 68.12  ? 63  ARG E CD    1 
ATOM 7931  N NE    . ARG D 3 63  ? -112.178 170.589 148.174 1.00 68.12  ? 63  ARG E NE    1 
ATOM 7932  C CZ    . ARG D 3 63  ? -113.039 171.268 148.916 1.00 68.12  ? 63  ARG E CZ    1 
ATOM 7933  N NH1   . ARG D 3 63  ? -114.340 171.096 148.744 1.00 68.12  ? 63  ARG E NH1   1 
ATOM 7934  N NH2   . ARG D 3 63  ? -112.596 172.118 149.829 1.00 68.12  ? 63  ARG E NH2   1 
ATOM 7935  N N     . ARG D 3 64  ? -107.526 171.255 145.126 1.00 71.94  ? 64  ARG E N     1 
ATOM 7936  C CA    . ARG D 3 64  ? -107.256 172.522 144.464 1.00 71.94  ? 64  ARG E CA    1 
ATOM 7937  C C     . ARG D 3 64  ? -105.996 172.478 143.626 1.00 71.94  ? 64  ARG E C     1 
ATOM 7938  O O     . ARG D 3 64  ? -105.007 173.124 143.929 1.00 71.94  ? 64  ARG E O     1 
ATOM 7939  C CB    . ARG D 3 64  ? -107.152 173.648 145.479 1.00 71.94  ? 64  ARG E CB    1 
ATOM 7940  C CG    . ARG D 3 64  ? -106.713 173.205 146.855 1.00 71.94  ? 64  ARG E CG    1 
ATOM 7941  C CD    . ARG D 3 64  ? -106.755 174.374 147.812 1.00 71.94  ? 64  ARG E CD    1 
ATOM 7942  N NE    . ARG D 3 64  ? -107.741 174.187 148.860 1.00 71.94  ? 64  ARG E NE    1 
ATOM 7943  C CZ    . ARG D 3 64  ? -107.429 173.807 150.088 1.00 71.94  ? 64  ARG E CZ    1 
ATOM 7944  N NH1   . ARG D 3 64  ? -106.164 173.578 150.393 1.00 71.94  ? 64  ARG E NH1   1 
ATOM 7945  N NH2   . ARG D 3 64  ? -108.371 173.658 151.004 1.00 71.94  ? 64  ARG E NH2   1 
ATOM 7946  N N     . ILE D 3 65  ? -106.046 171.691 142.569 1.00 77.41  ? 65  ILE E N     1 
ATOM 7947  C CA    . ILE D 3 65  ? -104.946 171.570 141.643 1.00 77.41  ? 65  ILE E CA    1 
ATOM 7948  C C     . ILE D 3 65  ? -104.730 172.833 140.815 1.00 77.41  ? 65  ILE E C     1 
ATOM 7949  O O     . ILE D 3 65  ? -103.604 173.192 140.500 1.00 77.41  ? 65  ILE E O     1 
ATOM 7950  C CB    . ILE D 3 65  ? -105.112 170.349 140.724 1.00 77.41  ? 65  ILE E CB    1 
ATOM 7951  C CG1   . ILE D 3 65  ? -103.807 170.046 140.005 1.00 77.41  ? 65  ILE E CG1   1 
ATOM 7952  C CG2   . ILE D 3 65  ? -106.218 170.583 139.719 1.00 77.41  ? 65  ILE E CG2   1 
ATOM 7953  C CD1   . ILE D 3 65  ? -103.372 168.607 140.124 1.00 77.41  ? 65  ILE E CD1   1 
ATOM 7954  N N     . ILE D 3 66  ? -105.816 173.497 140.437 1.00 82.66  ? 66  ILE E N     1 
ATOM 7955  C CA    . ILE D 3 66  ? -105.721 174.660 139.567 1.00 82.66  ? 66  ILE E CA    1 
ATOM 7956  C C     . ILE D 3 66  ? -104.861 175.740 140.194 1.00 82.66  ? 66  ILE E C     1 
ATOM 7957  O O     . ILE D 3 66  ? -104.006 176.333 139.533 1.00 82.66  ? 66  ILE E O     1 
ATOM 7958  C CB    . ILE D 3 66  ? -107.125 175.190 139.251 1.00 82.66  ? 66  ILE E CB    1 
ATOM 7959  C CG1   . ILE D 3 66  ? -107.927 174.150 138.488 1.00 82.66  ? 66  ILE E CG1   1 
ATOM 7960  C CG2   . ILE D 3 66  ? -107.035 176.469 138.493 1.00 82.66  ? 66  ILE E CG2   1 
ATOM 7961  C CD1   . ILE D 3 66  ? -109.350 174.549 138.296 1.00 82.66  ? 66  ILE E CD1   1 
ATOM 7962  N N     . SER D 3 67  ? -105.054 176.001 141.480 1.00 83.69  ? 67  SER E N     1 
ATOM 7963  C CA    . SER D 3 67  ? -104.262 177.025 142.145 1.00 83.69  ? 67  SER E CA    1 
ATOM 7964  C C     . SER D 3 67  ? -102.779 176.682 142.159 1.00 83.69  ? 67  SER E C     1 
ATOM 7965  O O     . SER D 3 67  ? -101.927 177.562 141.966 1.00 83.69  ? 67  SER E O     1 
ATOM 7966  C CB    . SER D 3 67  ? -104.779 177.216 143.563 1.00 83.69  ? 67  SER E CB    1 
ATOM 7967  O OG    . SER D 3 67  ? -103.961 178.120 144.268 1.00 83.69  ? 67  SER E OG    1 
ATOM 7968  N N     . GLU D 3 68  ? -102.448 175.408 142.322 1.00 86.39  ? 68  GLU E N     1 
ATOM 7969  C CA    . GLU D 3 68  ? -101.046 175.021 142.382 1.00 86.39  ? 68  GLU E CA    1 
ATOM 7970  C C     . GLU D 3 68  ? -100.394 175.127 141.007 1.00 86.39  ? 68  GLU E C     1 
ATOM 7971  O O     . GLU D 3 68  ? -99.271  175.648 140.866 1.00 86.39  ? 68  GLU E O     1 
ATOM 7972  C CB    . GLU D 3 68  ? -100.964 173.607 142.948 1.00 86.39  ? 68  GLU E CB    1 
ATOM 7973  C CG    . GLU D 3 68  ? -99.609  173.173 143.438 1.00 86.39  ? 68  GLU E CG    1 
ATOM 7974  C CD    . GLU D 3 68  ? -99.014  174.101 144.489 1.00 86.39  ? 68  GLU E CD    1 
ATOM 7975  O OE1   . GLU D 3 68  ? -99.731  174.967 145.030 1.00 86.39  ? 68  GLU E OE1   1 
ATOM 7976  O OE2   . GLU D 3 68  ? -97.810  173.953 144.783 1.00 86.39  ? 68  GLU E OE2   1 
ATOM 7977  N N     . ILE D 3 69  ? -101.110 174.700 139.970 1.00 84.82  ? 69  ILE E N     1 
ATOM 7978  C CA    . ILE D 3 69  ? -100.594 174.898 138.624 1.00 84.82  ? 69  ILE E CA    1 
ATOM 7979  C C     . ILE D 3 69  ? -100.443 176.382 138.362 1.00 84.82  ? 69  ILE E C     1 
ATOM 7980  O O     . ILE D 3 69  ? -99.522  176.813 137.665 1.00 84.82  ? 69  ILE E O     1 
ATOM 7981  C CB    . ILE D 3 69  ? -101.493 174.235 137.569 1.00 84.82  ? 69  ILE E CB    1 
ATOM 7982  C CG1   . ILE D 3 69  ? -101.525 172.735 137.759 1.00 84.82  ? 69  ILE E CG1   1 
ATOM 7983  C CG2   . ILE D 3 69  ? -101.008 174.553 136.189 1.00 84.82  ? 69  ILE E CG2   1 
ATOM 7984  C CD1   . ILE D 3 69  ? -102.395 172.036 136.759 1.00 84.82  ? 69  ILE E CD1   1 
ATOM 7985  N N     . ALA D 3 70  ? -101.335 177.192 138.923 1.00 85.51  ? 70  ALA E N     1 
ATOM 7986  C CA    . ALA D 3 70  ? -101.190 178.632 138.782 1.00 85.51  ? 70  ALA E CA    1 
ATOM 7987  C C     . ALA D 3 70  ? -99.913  179.175 139.421 1.00 85.51  ? 70  ALA E C     1 
ATOM 7988  O O     . ALA D 3 70  ? -99.286  180.067 138.848 1.00 85.51  ? 70  ALA E O     1 
ATOM 7989  C CB    . ALA D 3 70  ? -102.406 179.330 139.368 1.00 85.51  ? 70  ALA E CB    1 
ATOM 7990  N N     . LYS D 3 71  ? -99.483  178.667 140.585 1.00 87.21  ? 71  LYS E N     1 
ATOM 7991  C CA    . LYS D 3 71  ? -98.196  179.178 141.066 1.00 87.21  ? 71  LYS E CA    1 
ATOM 7992  C C     . LYS D 3 71  ? -97.053  178.758 140.155 1.00 87.21  ? 71  LYS E C     1 
ATOM 7993  O O     . LYS D 3 71  ? -96.123  179.542 139.929 1.00 87.21  ? 71  LYS E O     1 
ATOM 7994  C CB    . LYS D 3 71  ? -97.862  178.790 142.504 1.00 87.21  ? 71  LYS E CB    1 
ATOM 7995  C CG    . LYS D 3 71  ? -98.511  177.585 143.135 1.00 87.21  ? 71  LYS E CG    1 
ATOM 7996  C CD    . LYS D 3 71  ? -97.840  177.416 144.518 1.00 87.21  ? 71  LYS E CD    1 
ATOM 7997  C CE    . LYS D 3 71  ? -98.162  178.602 145.444 1.00 87.21  ? 71  LYS E CE    1 
ATOM 7998  N NZ    . LYS D 3 71  ? -97.618  178.576 146.849 1.00 87.21  ? 71  LYS E NZ    1 
ATOM 7999  N N     . ARG D 3 72  ? -97.086  177.534 139.617 1.00 88.00  ? 72  ARG E N     1 
ATOM 8000  C CA    . ARG D 3 72  ? -95.985  177.185 138.718 1.00 88.00  ? 72  ARG E CA    1 
ATOM 8001  C C     . ARG D 3 72  ? -96.005  178.014 137.444 1.00 88.00  ? 72  ARG E C     1 
ATOM 8002  O O     . ARG D 3 72  ? -94.951  178.460 136.981 1.00 88.00  ? 72  ARG E O     1 
ATOM 8003  C CB    . ARG D 3 72  ? -95.919  175.683 138.459 1.00 88.00  ? 72  ARG E CB    1 
ATOM 8004  C CG    . ARG D 3 72  ? -95.794  174.996 139.767 1.00 88.00  ? 72  ARG E CG    1 
ATOM 8005  C CD    . ARG D 3 72  ? -95.549  173.539 139.698 1.00 88.00  ? 72  ARG E CD    1 
ATOM 8006  N NE    . ARG D 3 72  ? -95.524  173.084 141.071 1.00 88.00  ? 72  ARG E NE    1 
ATOM 8007  C CZ    . ARG D 3 72  ? -96.602  172.674 141.704 1.00 88.00  ? 72  ARG E CZ    1 
ATOM 8008  N NH1   . ARG D 3 72  ? -97.758  172.679 141.061 1.00 88.00  ? 72  ARG E NH1   1 
ATOM 8009  N NH2   . ARG D 3 72  ? -96.527  172.274 142.961 1.00 88.00  ? 72  ARG E NH2   1 
ATOM 8010  N N     . LEU D 3 73  ? -97.169  178.234 136.848 1.00 91.06  ? 73  LEU E N     1 
ATOM 8011  C CA    . LEU D 3 73  ? -97.145  179.076 135.662 1.00 91.06  ? 73  LEU E CA    1 
ATOM 8012  C C     . LEU D 3 73  ? -96.770  180.511 135.995 1.00 91.06  ? 73  LEU E C     1 
ATOM 8013  O O     . LEU D 3 73  ? -96.127  181.182 135.183 1.00 91.06  ? 73  LEU E O     1 
ATOM 8014  C CB    . LEU D 3 73  ? -98.488  179.065 134.940 1.00 91.06  ? 73  LEU E CB    1 
ATOM 8015  C CG    . LEU D 3 73  ? -98.829  177.724 134.330 1.00 91.06  ? 73  LEU E CG    1 
ATOM 8016  C CD1   . LEU D 3 73  ? -100.136 177.827 133.596 1.00 91.06  ? 73  LEU E CD1   1 
ATOM 8017  C CD2   . LEU D 3 73  ? -97.721  177.266 133.424 1.00 91.06  ? 73  LEU E CD2   1 
ATOM 8018  N N     . ARG D 3 74  ? -97.123  180.996 137.185 1.00 90.94  ? 74  ARG E N     1 
ATOM 8019  C CA    . ARG D 3 74  ? -96.717  182.341 137.570 1.00 90.94  ? 74  ARG E CA    1 
ATOM 8020  C C     . ARG D 3 74  ? -95.216  182.458 137.796 1.00 90.94  ? 74  ARG E C     1 
ATOM 8021  O O     . ARG D 3 74  ? -94.623  183.495 137.489 1.00 90.94  ? 74  ARG E O     1 
ATOM 8022  C CB    . ARG D 3 74  ? -97.450  182.756 138.838 1.00 90.94  ? 74  ARG E CB    1 
ATOM 8023  C CG    . ARG D 3 74  ? -97.278  184.205 139.186 1.00 90.94  ? 74  ARG E CG    1 
ATOM 8024  C CD    . ARG D 3 74  ? -98.170  184.603 140.335 1.00 90.94  ? 74  ARG E CD    1 
ATOM 8025  N NE    . ARG D 3 74  ? -99.579  184.431 140.012 1.00 90.94  ? 74  ARG E NE    1 
ATOM 8026  C CZ    . ARG D 3 74  ? -100.317 183.422 140.457 1.00 90.94  ? 74  ARG E CZ    1 
ATOM 8027  N NH1   . ARG D 3 74  ? -99.772  182.507 141.242 1.00 90.94  ? 74  ARG E NH1   1 
ATOM 8028  N NH2   . ARG D 3 74  ? -101.594 183.326 140.119 1.00 90.94  ? 74  ARG E NH2   1 
ATOM 8029  N N     . GLU D 3 75  ? -94.580  181.414 138.320 1.00 92.96  ? 75  GLU E N     1 
ATOM 8030  C CA    . GLU D 3 75  ? -93.125  181.423 138.408 1.00 92.96  ? 75  GLU E CA    1 
ATOM 8031  C C     . GLU D 3 75  ? -92.437  181.190 137.067 1.00 92.96  ? 75  GLU E C     1 
ATOM 8032  O O     . GLU D 3 75  ? -91.236  181.448 136.957 1.00 92.96  ? 75  GLU E O     1 
ATOM 8033  C CB    . GLU D 3 75  ? -92.651  180.426 139.466 1.00 92.96  ? 75  GLU E CB    1 
ATOM 8034  C CG    . GLU D 3 75  ? -92.981  178.989 139.213 1.00 92.96  ? 75  GLU E CG    1 
ATOM 8035  C CD    . GLU D 3 75  ? -91.882  178.266 138.486 1.00 92.96  ? 75  GLU E CD    1 
ATOM 8036  O OE1   . GLU D 3 75  ? -90.900  178.924 138.094 1.00 92.96  ? 75  GLU E OE1   1 
ATOM 8037  O OE2   . GLU D 3 75  ? -91.992  177.036 138.313 1.00 92.96  ? 75  GLU E OE2   1 
ATOM 8038  N N     . ARG D 3 76  ? -93.151  180.704 136.054 1.00 95.13  ? 76  ARG E N     1 
ATOM 8039  C CA    . ARG D 3 76  ? -92.587  180.587 134.713 1.00 95.13  ? 76  ARG E CA    1 
ATOM 8040  C C     . ARG D 3 76  ? -92.642  181.879 133.913 1.00 95.13  ? 76  ARG E C     1 
ATOM 8041  O O     . ARG D 3 76  ? -92.205  181.889 132.758 1.00 95.13  ? 76  ARG E O     1 
ATOM 8042  C CB    . ARG D 3 76  ? -93.278  179.482 133.922 1.00 95.13  ? 76  ARG E CB    1 
ATOM 8043  C CG    . ARG D 3 76  ? -93.011  178.086 134.423 1.00 95.13  ? 76  ARG E CG    1 
ATOM 8044  C CD    . ARG D 3 76  ? -93.737  177.083 133.557 1.00 95.13  ? 76  ARG E CD    1 
ATOM 8045  N NE    . ARG D 3 76  ? -93.469  175.710 133.959 1.00 95.13  ? 76  ARG E NE    1 
ATOM 8046  C CZ    . ARG D 3 76  ? -92.505  174.963 133.437 1.00 95.13  ? 76  ARG E CZ    1 
ATOM 8047  N NH1   . ARG D 3 76  ? -91.722  175.459 132.492 1.00 95.13  ? 76  ARG E NH1   1 
ATOM 8048  N NH2   . ARG D 3 76  ? -92.324  173.721 133.857 1.00 95.13  ? 76  ARG E NH2   1 
ATOM 8049  N N     . GLY D 3 77  ? -93.187  182.947 134.470 1.00 95.57  ? 77  GLY E N     1 
ATOM 8050  C CA    . GLY D 3 77  ? -93.231  184.221 133.789 1.00 95.57  ? 77  GLY E CA    1 
ATOM 8051  C C     . GLY D 3 77  ? -94.584  184.620 133.258 1.00 95.57  ? 77  GLY E C     1 
ATOM 8052  O O     . GLY D 3 77  ? -94.680  185.636 132.565 1.00 95.57  ? 77  GLY E O     1 
ATOM 8053  N N     . TRP D 3 78  ? -95.621  183.852 133.538 1.00 94.56  ? 78  TRP E N     1 
ATOM 8054  C CA    . TRP D 3 78  ? -96.964  184.162 133.092 1.00 94.56  ? 78  TRP E CA    1 
ATOM 8055  C C     . TRP D 3 78  ? -97.559  185.264 133.953 1.00 94.56  ? 78  TRP E C     1 
ATOM 8056  O O     . TRP D 3 78  ? -97.183  185.447 135.111 1.00 94.56  ? 78  TRP E O     1 
ATOM 8057  C CB    . TRP D 3 78  ? -97.831  182.912 133.168 1.00 94.56  ? 78  TRP E CB    1 
ATOM 8058  C CG    . TRP D 3 78  ? -97.536  181.909 132.138 1.00 94.56  ? 78  TRP E CG    1 
ATOM 8059  C CD1   . TRP D 3 78  ? -96.357  181.279 131.919 1.00 94.56  ? 78  TRP E CD1   1 
ATOM 8060  C CD2   . TRP D 3 78  ? -98.497  181.238 131.326 1.00 94.56  ? 78  TRP E CD2   1 
ATOM 8061  N NE1   . TRP D 3 78  ? -96.490  180.351 130.925 1.00 94.56  ? 78  TRP E NE1   1 
ATOM 8062  C CE2   . TRP D 3 78  ? -97.804  180.292 130.557 1.00 94.56  ? 78  TRP E CE2   1 
ATOM 8063  C CE3   . TRP D 3 78  ? -99.869  181.377 131.143 1.00 94.56  ? 78  TRP E CE3   1 
ATOM 8064  C CZ2   . TRP D 3 78  ? -98.433  179.494 129.622 1.00 94.56  ? 78  TRP E CZ2   1 
ATOM 8065  C CZ3   . TRP D 3 78  ? -100.491 180.589 130.216 1.00 94.56  ? 78  TRP E CZ3   1 
ATOM 8066  C CH2   . TRP D 3 78  ? -99.780  179.660 129.468 1.00 94.56  ? 78  TRP E CH2   1 
ATOM 8067  N N     . ASP D 3 79  ? -98.462  186.032 133.364 1.00 98.85  ? 79  ASP E N     1 
ATOM 8068  C CA    . ASP D 3 79  ? -99.231  186.965 134.163 1.00 98.85  ? 79  ASP E CA    1 
ATOM 8069  C C     . ASP D 3 79  ? -100.221 186.180 135.009 1.00 98.85  ? 79  ASP E C     1 
ATOM 8070  O O     . ASP D 3 79  ? -100.572 185.043 134.687 1.00 98.85  ? 79  ASP E O     1 
ATOM 8071  C CB    . ASP D 3 79  ? -99.953  187.966 133.272 1.00 98.85  ? 79  ASP E CB    1 
ATOM 8072  C CG    . ASP D 3 79  ? -100.749 188.978 134.067 1.00 98.85  ? 79  ASP E CG    1 
ATOM 8073  O OD1   . ASP D 3 79  ? -100.140 189.839 134.730 1.00 98.85  ? 79  ASP E OD1   1 
ATOM 8074  O OD2   . ASP D 3 79  ? -101.993 188.907 134.021 1.00 98.85  ? 79  ASP E OD2   1 
ATOM 8075  N N     . ALA D 3 80  ? -100.659 186.782 136.112 1.00 96.31  ? 80  ALA E N     1 
ATOM 8076  C CA    . ALA D 3 80  ? -101.525 186.049 137.025 1.00 96.31  ? 80  ALA E CA    1 
ATOM 8077  C C     . ALA D 3 80  ? -102.804 185.619 136.331 1.00 96.31  ? 80  ALA E C     1 
ATOM 8078  O O     . ALA D 3 80  ? -103.269 184.485 136.501 1.00 96.31  ? 80  ALA E O     1 
ATOM 8079  C CB    . ALA D 3 80  ? -101.842 186.907 138.245 1.00 96.31  ? 80  ALA E CB    1 
ATOM 8080  N N     . ASP D 3 81  ? -103.367 186.497 135.504 1.00 96.96  ? 81  ASP E N     1 
ATOM 8081  C CA    . ASP D 3 81  ? -104.601 186.152 134.814 1.00 96.96  ? 81  ASP E CA    1 
ATOM 8082  C C     . ASP D 3 81  ? -104.371 185.076 133.768 1.00 96.96  ? 81  ASP E C     1 
ATOM 8083  O O     . ASP D 3 81  ? -105.211 184.187 133.595 1.00 96.96  ? 81  ASP E O     1 
ATOM 8084  C CB    . ASP D 3 81  ? -105.204 187.400 134.189 1.00 96.96  ? 81  ASP E CB    1 
ATOM 8085  C CG    . ASP D 3 81  ? -105.660 188.385 135.230 1.00 96.96  ? 81  ASP E CG    1 
ATOM 8086  O OD1   . ASP D 3 81  ? -105.910 187.952 136.374 1.00 96.96  ? 81  ASP E OD1   1 
ATOM 8087  O OD2   . ASP D 3 81  ? -105.771 189.586 134.914 1.00 96.96  ? 81  ASP E OD2   1 
ATOM 8088  N N     . LEU D 3 82  ? -103.234 185.117 133.080 1.00 97.63  ? 82  LEU E N     1 
ATOM 8089  C CA    . LEU D 3 82  ? -102.950 184.045 132.140 1.00 97.63  ? 82  LEU E CA    1 
ATOM 8090  C C     . LEU D 3 82  ? -102.616 182.753 132.856 1.00 97.63  ? 82  LEU E C     1 
ATOM 8091  O O     . LEU D 3 82  ? -102.851 181.672 132.315 1.00 97.63  ? 82  LEU E O     1 
ATOM 8092  C CB    . LEU D 3 82  ? -101.799 184.424 131.217 1.00 97.63  ? 82  LEU E CB    1 
ATOM 8093  C CG    . LEU D 3 82  ? -102.122 185.393 130.090 1.00 97.63  ? 82  LEU E CG    1 
ATOM 8094  C CD1   . LEU D 3 82  ? -100.881 185.625 129.253 1.00 97.63  ? 82  LEU E CD1   1 
ATOM 8095  C CD2   . LEU D 3 82  ? -103.252 184.842 129.247 1.00 97.63  ? 82  LEU E CD2   1 
ATOM 8096  N N     . ALA D 3 83  ? -102.036 182.839 134.048 1.00 95.50  ? 83  ALA E N     1 
ATOM 8097  C CA    . ALA D 3 83  ? -101.757 181.617 134.781 1.00 95.50  ? 83  ALA E CA    1 
ATOM 8098  C C     . ALA D 3 83  ? -103.048 180.952 135.219 1.00 95.50  ? 83  ALA E C     1 
ATOM 8099  O O     . ALA D 3 83  ? -103.205 179.732 135.093 1.00 95.50  ? 83  ALA E O     1 
ATOM 8100  C CB    . ALA D 3 83  ? -100.870 181.915 135.983 1.00 95.50  ? 83  ALA E CB    1 
ATOM 8101  N N     . ASP D 3 84  ? -104.016 181.753 135.653 1.00 97.37  ? 84  ASP E N     1 
ATOM 8102  C CA    . ASP D 3 84  ? -105.306 181.208 136.047 1.00 97.37  ? 84  ASP E CA    1 
ATOM 8103  C C     . ASP D 3 84  ? -106.060 180.647 134.850 1.00 97.37  ? 84  ASP E C     1 
ATOM 8104  O O     . ASP D 3 84  ? -106.622 179.548 134.918 1.00 97.37  ? 84  ASP E O     1 
ATOM 8105  C CB    . ASP D 3 84  ? -106.120 182.289 136.752 1.00 97.37  ? 84  ASP E CB    1 
ATOM 8106  C CG    . ASP D 3 84  ? -107.403 181.763 137.360 1.00 97.37  ? 84  ASP E CG    1 
ATOM 8107  O OD1   . ASP D 3 84  ? -107.738 180.580 137.157 1.00 97.37  ? 84  ASP E OD1   1 
ATOM 8108  O OD2   . ASP D 3 84  ? -108.083 182.539 138.061 1.00 97.37  ? 84  ASP E OD2   1 
ATOM 8109  N N     . ALA D 3 85  ? -106.040 181.355 133.726 1.00 95.25  ? 85  ALA E N     1 
ATOM 8110  C CA    . ALA D 3 85  ? -106.722 180.830 132.554 1.00 95.25  ? 85  ALA E CA    1 
ATOM 8111  C C     . ALA D 3 85  ? -106.036 179.594 132.005 1.00 95.25  ? 85  ALA E C     1 
ATOM 8112  O O     . ALA D 3 85  ? -106.708 178.674 131.529 1.00 95.25  ? 85  ALA E O     1 
ATOM 8113  C CB    . ALA D 3 85  ? -106.807 181.901 131.475 1.00 95.25  ? 85  ALA E CB    1 
ATOM 8114  N N     . GLY D 3 86  ? -104.715 179.522 132.106 1.00 94.06  ? 86  GLY E N     1 
ATOM 8115  C CA    . GLY D 3 86  ? -104.023 178.339 131.639 1.00 94.06  ? 86  GLY E CA    1 
ATOM 8116  C C     . GLY D 3 86  ? -104.264 177.126 132.510 1.00 94.06  ? 86  GLY E C     1 
ATOM 8117  O O     . GLY D 3 86  ? -104.451 176.017 132.002 1.00 94.06  ? 86  GLY E O     1 
ATOM 8118  N N     . ALA D 3 87  ? -104.310 177.317 133.827 1.00 90.36  ? 87  ALA E N     1 
ATOM 8119  C CA    . ALA D 3 87  ? -104.642 176.183 134.673 1.00 90.36  ? 87  ALA E CA    1 
ATOM 8120  C C     . ALA D 3 87  ? -106.090 175.757 134.499 1.00 90.36  ? 87  ALA E C     1 
ATOM 8121  O O     . ALA D 3 87  ? -106.390 174.553 134.512 1.00 90.36  ? 87  ALA E O     1 
ATOM 8122  C CB    . ALA D 3 87  ? -104.357 176.524 136.129 1.00 90.36  ? 87  ALA E CB    1 
ATOM 8123  N N     . ARG D 3 88  ? -106.984 176.700 134.206 1.00 91.39  ? 88  ARG E N     1 
ATOM 8124  C CA    . ARG D 3 88  ? -108.338 176.270 133.904 1.00 91.39  ? 88  ARG E CA    1 
ATOM 8125  C C     . ARG D 3 88  ? -108.356 175.483 132.616 1.00 91.39  ? 88  ARG E C     1 
ATOM 8126  O O     . ARG D 3 88  ? -109.148 174.551 132.469 1.00 91.39  ? 88  ARG E O     1 
ATOM 8127  C CB    . ARG D 3 88  ? -109.281 177.456 133.794 1.00 91.39  ? 88  ARG E CB    1 
ATOM 8128  C CG    . ARG D 3 88  ? -109.573 178.158 135.082 1.00 91.39  ? 88  ARG E CG    1 
ATOM 8129  C CD    . ARG D 3 88  ? -110.481 179.320 134.798 1.00 91.39  ? 88  ARG E CD    1 
ATOM 8130  N NE    . ARG D 3 88  ? -110.882 180.028 136.002 1.00 91.39  ? 88  ARG E NE    1 
ATOM 8131  C CZ    . ARG D 3 88  ? -111.980 179.749 136.687 1.00 91.39  ? 88  ARG E CZ    1 
ATOM 8132  N NH1   . ARG D 3 88  ? -112.781 178.776 136.282 1.00 91.39  ? 88  ARG E NH1   1 
ATOM 8133  N NH2   . ARG D 3 88  ? -112.283 180.445 137.769 1.00 91.39  ? 88  ARG E NH2   1 
ATOM 8134  N N     . GLN D 3 89  ? -107.484 175.833 131.679 1.00 94.79  ? 89  GLN E N     1 
ATOM 8135  C CA    . GLN D 3 89  ? -107.418 175.059 130.452 1.00 94.79  ? 89  GLN E CA    1 
ATOM 8136  C C     . GLN D 3 89  ? -106.905 173.659 130.723 1.00 94.79  ? 89  GLN E C     1 
ATOM 8137  O O     . GLN D 3 89  ? -107.299 172.711 130.038 1.00 94.79  ? 89  GLN E O     1 
ATOM 8138  C CB    . GLN D 3 89  ? -106.541 175.764 129.432 1.00 94.79  ? 89  GLN E CB    1 
ATOM 8139  C CG    . GLN D 3 89  ? -107.094 177.066 128.972 1.00 94.79  ? 89  GLN E CG    1 
ATOM 8140  C CD    . GLN D 3 89  ? -108.409 176.881 128.286 1.00 94.79  ? 89  GLN E CD    1 
ATOM 8141  O OE1   . GLN D 3 89  ? -108.636 175.881 127.616 1.00 94.79  ? 89  GLN E OE1   1 
ATOM 8142  N NE2   . GLN D 3 89  ? -109.302 177.837 128.467 1.00 94.79  ? 89  GLN E NE2   1 
ATOM 8143  N N     . VAL D 3 90  ? -106.042 173.507 131.728 1.00 89.79  ? 90  VAL E N     1 
ATOM 8144  C CA    . VAL D 3 90  ? -105.514 172.182 132.030 1.00 89.79  ? 90  VAL E CA    1 
ATOM 8145  C C     . VAL D 3 90  ? -106.633 171.253 132.457 1.00 89.79  ? 90  VAL E C     1 
ATOM 8146  O O     . VAL D 3 90  ? -106.724 170.116 131.991 1.00 89.79  ? 90  VAL E O     1 
ATOM 8147  C CB    . VAL D 3 90  ? -104.420 172.256 133.102 1.00 89.79  ? 90  VAL E CB    1 
ATOM 8148  C CG1   . VAL D 3 90  ? -103.922 170.869 133.404 1.00 89.79  ? 90  VAL E CG1   1 
ATOM 8149  C CG2   . VAL D 3 90  ? -103.292 173.117 132.633 1.00 89.79  ? 90  VAL E CG2   1 
ATOM 8150  N N     . VAL D 3 91  ? -107.518 171.725 133.333 1.00 89.72  ? 91  VAL E N     1 
ATOM 8151  C CA    . VAL D 3 91  ? -108.591 170.843 133.783 1.00 89.72  ? 91  VAL E CA    1 
ATOM 8152  C C     . VAL D 3 91  ? -109.773 170.840 132.831 1.00 89.72  ? 91  VAL E C     1 
ATOM 8153  O O     . VAL D 3 91  ? -110.611 169.936 132.899 1.00 89.72  ? 91  VAL E O     1 
ATOM 8154  C CB    . VAL D 3 91  ? -109.109 171.221 135.177 1.00 89.72  ? 91  VAL E CB    1 
ATOM 8155  C CG1   . VAL D 3 91  ? -107.995 171.151 136.187 1.00 89.72  ? 91  VAL E CG1   1 
ATOM 8156  C CG2   . VAL D 3 91  ? -109.743 172.588 135.142 1.00 89.72  ? 91  VAL E CG2   1 
ATOM 8157  N N     . LEU D 3 92  ? -109.869 171.828 131.955 1.00 91.41  ? 92  LEU E N     1 
ATOM 8158  C CA    . LEU D 3 92  ? -110.942 171.918 130.980 1.00 91.41  ? 92  LEU E CA    1 
ATOM 8159  C C     . LEU D 3 92  ? -110.721 171.033 129.769 1.00 91.41  ? 92  LEU E C     1 
ATOM 8160  O O     . LEU D 3 92  ? -111.684 170.662 129.096 1.00 91.41  ? 92  LEU E O     1 
ATOM 8161  C CB    . LEU D 3 92  ? -111.103 173.364 130.539 1.00 91.41  ? 92  LEU E CB    1 
ATOM 8162  C CG    . LEU D 3 92  ? -112.493 173.738 130.076 1.00 91.41  ? 92  LEU E CG    1 
ATOM 8163  C CD1   . LEU D 3 92  ? -113.476 173.354 131.138 1.00 91.41  ? 92  LEU E CD1   1 
ATOM 8164  C CD2   . LEU D 3 92  ? -112.507 175.222 129.896 1.00 91.41  ? 92  LEU E CD2   1 
ATOM 8165  N N     . SER D 3 93  ? -109.479 170.695 129.475 1.00 91.92  ? 93  SER E N     1 
ATOM 8166  C CA    . SER D 3 93  ? -109.127 169.958 128.275 1.00 91.92  ? 93  SER E CA    1 
ATOM 8167  C C     . SER D 3 93  ? -109.235 168.447 128.425 1.00 91.92  ? 93  SER E C     1 
ATOM 8168  O O     . SER D 3 93  ? -108.957 167.728 127.462 1.00 91.92  ? 93  SER E O     1 
ATOM 8169  C CB    . SER D 3 93  ? -107.721 170.349 127.841 1.00 91.92  ? 93  SER E CB    1 
ATOM 8170  O OG    . SER D 3 93  ? -106.800 170.065 128.868 1.00 91.92  ? 93  SER E OG    1 
ATOM 8171  N N     . VAL D 3 94  ? -109.630 167.938 129.591 1.00 91.91  ? 94  VAL E N     1 
ATOM 8172  C CA    . VAL D 3 94  ? -109.592 166.496 129.823 1.00 91.91  ? 94  VAL E CA    1 
ATOM 8173  C C     . VAL D 3 94  ? -110.916 165.990 130.375 1.00 91.91  ? 94  VAL E C     1 
ATOM 8174  O O     . VAL D 3 94  ? -111.678 166.743 130.987 1.00 91.91  ? 94  VAL E O     1 
ATOM 8175  C CB    . VAL D 3 94  ? -108.430 166.129 130.766 1.00 91.91  ? 94  VAL E CB    1 
ATOM 8176  C CG1   . VAL D 3 94  ? -107.540 167.312 130.992 1.00 91.91  ? 94  VAL E CG1   1 
ATOM 8177  C CG2   . VAL D 3 94  ? -108.947 165.639 132.094 1.00 91.91  ? 94  VAL E CG2   1 
ATOM 8178  N N     . GLY D 3 95  ? -111.191 164.705 130.178 1.00 98.92  ? 95  GLY E N     1 
ATOM 8179  C CA    . GLY D 3 95  ? -112.454 164.130 130.591 1.00 98.92  ? 95  GLY E CA    1 
ATOM 8180  C C     . GLY D 3 95  ? -113.459 163.997 129.466 1.00 98.92  ? 95  GLY E C     1 
ATOM 8181  O O     . GLY D 3 95  ? -113.355 164.645 128.424 1.00 98.92  ? 95  GLY E O     1 
ATOM 8182  N N     . LYS D 3 96  ? -114.454 163.144 129.701 1.00 106.15 ? 96  LYS E N     1 
ATOM 8183  C CA    . LYS D 3 96  ? -115.531 162.884 128.749 1.00 106.15 ? 96  LYS E CA    1 
ATOM 8184  C C     . LYS D 3 96  ? -116.334 164.136 128.439 1.00 106.15 ? 96  LYS E C     1 
ATOM 8185  O O     . LYS D 3 96  ? -116.396 164.579 127.288 1.00 106.15 ? 96  LYS E O     1 
ATOM 8186  C CB    . LYS D 3 96  ? -116.464 161.802 129.294 1.00 106.15 ? 96  LYS E CB    1 
ATOM 8187  C CG    . LYS D 3 96  ? -116.747 161.921 130.790 1.00 106.15 ? 96  LYS E CG    1 
ATOM 8188  C CD    . LYS D 3 96  ? -117.604 160.781 131.294 1.00 106.15 ? 96  LYS E CD    1 
ATOM 8189  C CE    . LYS D 3 96  ? -116.785 159.507 131.295 1.00 106.15 ? 96  LYS E CE    1 
ATOM 8190  N NZ    . LYS D 3 96  ? -117.542 158.318 131.752 1.00 106.15 ? 96  LYS E NZ    1 
ATOM 8191  N N     . LYS D 3 97  ? -116.949 164.712 129.460 1.00 103.84 ? 97  LYS E N     1 
ATOM 8192  C CA    . LYS D 3 97  ? -117.770 165.906 129.340 1.00 103.84 ? 97  LYS E CA    1 
ATOM 8193  C C     . LYS D 3 97  ? -116.891 167.094 128.983 1.00 103.84 ? 97  LYS E C     1 
ATOM 8194  O O     . LYS D 3 97  ? -115.727 166.923 128.612 1.00 103.84 ? 97  LYS E O     1 
ATOM 8195  C CB    . LYS D 3 97  ? -118.535 166.129 130.641 1.00 103.84 ? 97  LYS E CB    1 
ATOM 8196  C CG    . LYS D 3 97  ? -119.624 165.090 130.844 1.00 103.84 ? 97  LYS E CG    1 
ATOM 8197  C CD    . LYS D 3 97  ? -120.244 165.144 132.225 1.00 103.84 ? 97  LYS E CD    1 
ATOM 8198  C CE    . LYS D 3 97  ? -121.516 164.316 132.269 1.00 103.84 ? 97  LYS E CE    1 
ATOM 8199  N NZ    . LYS D 3 97  ? -122.233 164.463 133.561 1.00 103.84 ? 97  LYS E NZ    1 
ATOM 8200  N N     . SER D 3 98  ? -117.441 168.303 129.078 1.00 100.54 ? 98  SER E N     1 
ATOM 8201  C CA    . SER D 3 98  ? -116.680 169.491 128.715 1.00 100.54 ? 98  SER E CA    1 
ATOM 8202  C C     . SER D 3 98  ? -115.371 169.571 129.482 1.00 100.54 ? 98  SER E C     1 
ATOM 8203  O O     . SER D 3 98  ? -114.327 169.865 128.896 1.00 100.54 ? 98  SER E O     1 
ATOM 8204  C CB    . SER D 3 98  ? -117.505 170.749 128.971 1.00 100.54 ? 98  SER E CB    1 
ATOM 8205  O OG    . SER D 3 98  ? -117.565 171.018 130.358 1.00 100.54 ? 98  SER E OG    1 
ATOM 8206  N N     . GLY D 3 99  ? -115.402 169.327 130.779 1.00 95.72  ? 99  GLY E N     1 
ATOM 8207  C CA    . GLY D 3 99  ? -114.191 169.393 131.564 1.00 95.72  ? 99  GLY E CA    1 
ATOM 8208  C C     . GLY D 3 99  ? -114.410 168.801 132.938 1.00 95.72  ? 99  GLY E C     1 
ATOM 8209  O O     . GLY D 3 99  ? -115.510 168.377 133.294 1.00 95.72  ? 99  GLY E O     1 
ATOM 8210  N N     . ILE D 3 100 ? -113.332 168.755 133.715 1.00 86.33  ? 100 ILE E N     1 
ATOM 8211  C CA    . ILE D 3 100 ? -113.469 168.289 135.081 1.00 86.33  ? 100 ILE E CA    1 
ATOM 8212  C C     . ILE D 3 100 ? -114.360 169.287 135.793 1.00 86.33  ? 100 ILE E C     1 
ATOM 8213  O O     . ILE D 3 100 ? -114.110 170.496 135.755 1.00 86.33  ? 100 ILE E O     1 
ATOM 8214  C CB    . ILE D 3 100 ? -112.101 168.172 135.764 1.00 86.33  ? 100 ILE E CB    1 
ATOM 8215  C CG1   . ILE D 3 100 ? -111.253 167.119 135.068 1.00 86.33  ? 100 ILE E CG1   1 
ATOM 8216  C CG2   . ILE D 3 100 ? -112.285 167.805 137.208 1.00 86.33  ? 100 ILE E CG2   1 
ATOM 8217  C CD1   . ILE D 3 100 ? -111.787 165.741 135.203 1.00 86.33  ? 100 ILE E CD1   1 
ATOM 8218  N N     . LYS D 3 101 ? -115.396 168.803 136.454 1.00 86.48  ? 101 LYS E N     1 
ATOM 8219  C CA    . LYS D 3 101 ? -116.336 169.729 137.060 1.00 86.48  ? 101 LYS E CA    1 
ATOM 8220  C C     . LYS D 3 101 ? -115.695 170.459 138.221 1.00 86.48  ? 101 LYS E C     1 
ATOM 8221  O O     . LYS D 3 101 ? -114.906 169.891 138.975 1.00 86.48  ? 101 LYS E O     1 
ATOM 8222  C CB    . LYS D 3 101 ? -117.613 169.008 137.448 1.00 86.48  ? 101 LYS E CB    1 
ATOM 8223  C CG    . LYS D 3 101 ? -118.289 168.569 136.177 1.00 86.48  ? 101 LYS E CG    1 
ATOM 8224  C CD    . LYS D 3 101 ? -119.601 167.894 136.357 1.00 86.48  ? 101 LYS E CD    1 
ATOM 8225  C CE    . LYS D 3 101 ? -119.401 166.505 136.841 1.00 86.48  ? 101 LYS E CE    1 
ATOM 8226  N NZ    . LYS D 3 101 ? -120.726 165.882 136.990 1.00 86.48  ? 101 LYS E NZ    1 
ATOM 8227  N N     . LEU D 3 102 ? -116.038 171.730 138.350 1.00 84.38  ? 102 LEU E N     1 
ATOM 8228  C CA    . LEU D 3 102 ? -115.466 172.591 139.362 1.00 84.38  ? 102 LEU E CA    1 
ATOM 8229  C C     . LEU D 3 102 ? -116.519 173.017 140.363 1.00 84.38  ? 102 LEU E C     1 
ATOM 8230  O O     . LEU D 3 102 ? -117.685 173.215 140.029 1.00 84.38  ? 102 LEU E O     1 
ATOM 8231  C CB    . LEU D 3 102 ? -114.861 173.832 138.725 1.00 84.38  ? 102 LEU E CB    1 
ATOM 8232  C CG    . LEU D 3 102 ? -113.815 173.531 137.667 1.00 84.38  ? 102 LEU E CG    1 
ATOM 8233  C CD1   . LEU D 3 102 ? -113.354 174.814 137.050 1.00 84.38  ? 102 LEU E CD1   1 
ATOM 8234  C CD2   . LEU D 3 102 ? -112.663 172.798 138.276 1.00 84.38  ? 102 LEU E CD2   1 
ATOM 8235  N N     . GLU D 3 103 ? -116.074 173.167 141.593 1.00 92.55  ? 103 GLU E N     1 
ATOM 8236  C CA    . GLU D 3 103 ? -116.879 173.693 142.674 1.00 92.55  ? 103 GLU E CA    1 
ATOM 8237  C C     . GLU D 3 103 ? -117.221 175.152 142.409 1.00 92.55  ? 103 GLU E C     1 
ATOM 8238  O O     . GLU D 3 103 ? -116.597 175.825 141.586 1.00 92.55  ? 103 GLU E O     1 
ATOM 8239  C CB    . GLU D 3 103 ? -116.131 173.543 143.998 1.00 92.55  ? 103 GLU E CB    1 
ATOM 8240  C CG    . GLU D 3 103 ? -117.004 173.496 145.227 1.00 92.55  ? 103 GLU E CG    1 
ATOM 8241  C CD    . GLU D 3 103 ? -117.785 172.203 145.336 1.00 92.55  ? 103 GLU E CD    1 
ATOM 8242  O OE1   . GLU D 3 103 ? -117.569 171.297 144.506 1.00 92.55  ? 103 GLU E OE1   1 
ATOM 8243  O OE2   . GLU D 3 103 ? -118.608 172.082 146.263 1.00 92.55  ? 103 GLU E OE2   1 
ATOM 8244  N N     . LYS D 3 104 ? -118.249 175.626 143.103 1.00 101.61 ? 104 LYS E N     1 
ATOM 8245  C CA    . LYS D 3 104 ? -118.749 176.978 142.910 1.00 101.61 ? 104 LYS E CA    1 
ATOM 8246  C C     . LYS D 3 104 ? -117.618 177.959 143.158 1.00 101.61 ? 104 LYS E C     1 
ATOM 8247  O O     . LYS D 3 104 ? -116.805 177.770 144.066 1.00 101.61 ? 104 LYS E O     1 
ATOM 8248  C CB    . LYS D 3 104 ? -119.909 177.263 143.852 1.00 101.61 ? 104 LYS E CB    1 
ATOM 8249  C CG    . LYS D 3 104 ? -121.204 176.592 143.450 1.00 101.61 ? 104 LYS E CG    1 
ATOM 8250  C CD    . LYS D 3 104 ? -121.689 177.084 142.100 1.00 101.61 ? 104 LYS E CD    1 
ATOM 8251  C CE    . LYS D 3 104 ? -123.078 176.548 141.798 1.00 101.61 ? 104 LYS E CE    1 
ATOM 8252  N NZ    . LYS D 3 104 ? -124.078 177.037 142.788 1.00 101.61 ? 104 LYS E NZ    1 
ATOM 8253  N N     . GLU D 3 105 ? -117.543 178.996 142.331 1.00 111.46 ? 105 GLU E N     1 
ATOM 8254  C CA    . GLU D 3 105 ? -116.411 179.902 142.419 1.00 111.46 ? 105 GLU E CA    1 
ATOM 8255  C C     . GLU D 3 105 ? -116.395 180.727 143.693 1.00 111.46 ? 105 GLU E C     1 
ATOM 8256  O O     . GLU D 3 105 ? -117.396 181.313 144.112 1.00 111.46 ? 105 GLU E O     1 
ATOM 8257  C CB    . GLU D 3 105 ? -116.436 180.860 141.226 1.00 111.46 ? 105 GLU E CB    1 
ATOM 8258  C CG    . GLU D 3 105 ? -115.311 181.890 141.189 1.00 111.46 ? 105 GLU E CG    1 
ATOM 8259  C CD    . GLU D 3 105 ? -113.943 181.303 140.989 1.00 111.46 ? 105 GLU E CD    1 
ATOM 8260  O OE1   . GLU D 3 105 ? -113.852 180.097 140.700 1.00 111.46 ? 105 GLU E OE1   1 
ATOM 8261  O OE2   . GLU D 3 105 ? -112.953 182.053 141.108 1.00 111.46 ? 105 GLU E OE2   1 
ATOM 8262  N N     . LYS D 3 106 ? -115.215 180.742 144.295 1.00 116.10 ? 106 LYS E N     1 
ATOM 8263  C CA    . LYS D 3 106 ? -114.867 181.486 145.491 1.00 116.10 ? 106 LYS E CA    1 
ATOM 8264  C C     . LYS D 3 106 ? -114.190 182.782 145.083 1.00 116.10 ? 106 LYS E C     1 
ATOM 8265  O O     . LYS D 3 106 ? -113.430 182.813 144.113 1.00 116.10 ? 106 LYS E O     1 
ATOM 8266  C CB    . LYS D 3 106 ? -113.967 180.674 146.419 1.00 116.10 ? 106 LYS E CB    1 
ATOM 8267  C CG    . LYS D 3 106 ? -114.548 179.357 146.860 1.00 116.10 ? 106 LYS E CG    1 
ATOM 8268  C CD    . LYS D 3 106 ? -115.670 179.581 147.854 1.00 116.10 ? 106 LYS E CD    1 
ATOM 8269  C CE    . LYS D 3 106 ? -116.271 178.263 148.281 1.00 116.10 ? 106 LYS E CE    1 
ATOM 8270  N NZ    . LYS D 3 106 ? -117.376 178.451 149.251 1.00 116.10 ? 106 LYS E NZ    1 
ATOM 8271  N N     . ASP D 3 107 ? -114.468 183.848 145.817 1.00 120.72 ? 107 ASP E N     1 
ATOM 8272  C CA    . ASP D 3 107 ? -113.883 185.144 145.532 1.00 120.72 ? 107 ASP E CA    1 
ATOM 8273  C C     . ASP D 3 107 ? -112.360 185.130 145.658 1.00 120.72 ? 107 ASP E C     1 
ATOM 8274  O O     . ASP D 3 107 ? -111.807 184.494 146.559 1.00 120.72 ? 107 ASP E O     1 
ATOM 8275  C CB    . ASP D 3 107 ? -114.505 186.173 146.471 1.00 120.72 ? 107 ASP E CB    1 
ATOM 8276  C CG    . ASP D 3 107 ? -114.509 185.716 147.926 1.00 120.72 ? 107 ASP E CG    1 
ATOM 8277  O OD1   . ASP D 3 107 ? -113.801 184.746 148.268 1.00 120.72 ? 107 ASP E OD1   1 
ATOM 8278  O OD2   . ASP D 3 107 ? -115.255 186.310 148.734 1.00 120.72 ? 107 ASP E OD2   1 
ATOM 8279  N N     . SER D 3 108 ? -111.676 185.765 144.700 1.00 119.67 ? 108 SER E N     1 
ATOM 8280  C CA    . SER D 3 108 ? -110.228 185.959 144.731 1.00 119.67 ? 108 SER E CA    1 
ATOM 8281  C C     . SER D 3 108 ? -109.408 184.684 144.605 1.00 119.67 ? 108 SER E C     1 
ATOM 8282  O O     . SER D 3 108 ? -108.177 184.771 144.576 1.00 119.67 ? 108 SER E O     1 
ATOM 8283  C CB    . SER D 3 108 ? -109.807 186.688 146.011 1.00 119.67 ? 108 SER E CB    1 
ATOM 8284  O OG    . SER D 3 108 ? -108.426 187.007 145.967 1.00 119.67 ? 108 SER E OG    1 
ATOM 8285  N N     . GLU D 3 109 ? -110.025 183.511 144.559 1.00 114.24 ? 109 GLU E N     1 
ATOM 8286  C CA    . GLU D 3 109 ? -109.243 182.287 144.473 1.00 114.24 ? 109 GLU E CA    1 
ATOM 8287  C C     . GLU D 3 109 ? -109.773 181.368 143.381 1.00 114.24 ? 109 GLU E C     1 
ATOM 8288  O O     . GLU D 3 109 ? -110.966 181.351 143.070 1.00 114.24 ? 109 GLU E O     1 
ATOM 8289  C CB    . GLU D 3 109 ? -109.223 181.595 145.831 1.00 114.24 ? 109 GLU E CB    1 
ATOM 8290  C CG    . GLU D 3 109 ? -110.584 181.387 146.431 1.00 114.24 ? 109 GLU E CG    1 
ATOM 8291  C CD    . GLU D 3 109 ? -110.515 180.910 147.863 1.00 114.24 ? 109 GLU E CD    1 
ATOM 8292  O OE1   . GLU D 3 109 ? -109.411 180.934 148.444 1.00 114.24 ? 109 GLU E OE1   1 
ATOM 8293  O OE2   . GLU D 3 109 ? -111.562 180.504 148.410 1.00 114.24 ? 109 GLU E OE2   1 
ATOM 8294  N N     . ALA D 3 110 ? -108.857 180.610 142.794 1.00 101.15 ? 110 ALA E N     1 
ATOM 8295  C CA    . ALA D 3 110 ? -109.201 179.661 141.751 1.00 101.15 ? 110 ALA E CA    1 
ATOM 8296  C C     . ALA D 3 110 ? -110.108 178.569 142.302 1.00 101.15 ? 110 ALA E C     1 
ATOM 8297  O O     . ALA D 3 110 ? -109.925 178.117 143.434 1.00 101.15 ? 110 ALA E O     1 
ATOM 8298  C CB    . ALA D 3 110 ? -107.942 179.034 141.161 1.00 101.15 ? 110 ALA E CB    1 
ATOM 8299  N N     . PRO D 3 111 ? -111.086 178.125 141.527 1.00 93.92  ? 111 PRO E N     1 
ATOM 8300  C CA    . PRO D 3 111 ? -112.051 177.155 142.036 1.00 93.92  ? 111 PRO E CA    1 
ATOM 8301  C C     . PRO D 3 111 ? -111.433 175.788 142.220 1.00 93.92  ? 111 PRO E C     1 
ATOM 8302  O O     . PRO D 3 111 ? -110.568 175.355 141.459 1.00 93.92  ? 111 PRO E O     1 
ATOM 8303  C CB    . PRO D 3 111 ? -113.117 177.113 140.939 1.00 93.92  ? 111 PRO E CB    1 
ATOM 8304  C CG    . PRO D 3 111 ? -112.365 177.445 139.716 1.00 93.92  ? 111 PRO E CG    1 
ATOM 8305  C CD    . PRO D 3 111 ? -111.307 178.425 140.108 1.00 93.92  ? 111 PRO E CD    1 
ATOM 8306  N N     . ALA D 3 112 ? -111.888 175.114 143.261 1.00 81.91  ? 112 ALA E N     1 
ATOM 8307  C CA    . ALA D 3 112 ? -111.462 173.760 143.538 1.00 81.91  ? 112 ALA E CA    1 
ATOM 8308  C C     . ALA D 3 112 ? -112.233 172.775 142.677 1.00 81.91  ? 112 ALA E C     1 
ATOM 8309  O O     . ALA D 3 112 ? -113.421 172.951 142.410 1.00 81.91  ? 112 ALA E O     1 
ATOM 8310  C CB    . ALA D 3 112 ? -111.668 173.435 145.012 1.00 81.91  ? 112 ALA E CB    1 
ATOM 8311  N N     . THR D 3 113 ? -111.548 171.726 142.256 1.00 75.29  ? 113 THR E N     1 
ATOM 8312  C CA    . THR D 3 113 ? -112.199 170.665 141.514 1.00 75.29  ? 113 THR E CA    1 
ATOM 8313  C C     . THR D 3 113 ? -113.154 169.941 142.445 1.00 75.29  ? 113 THR E C     1 
ATOM 8314  O O     . THR D 3 113 ? -113.014 169.985 143.662 1.00 75.29  ? 113 THR E O     1 
ATOM 8315  C CB    . THR D 3 113 ? -111.177 169.702 140.935 1.00 75.29  ? 113 THR E CB    1 
ATOM 8316  O OG1   . THR D 3 113 ? -110.483 169.056 142.002 1.00 75.29  ? 113 THR E OG1   1 
ATOM 8317  C CG2   . THR D 3 113 ? -110.186 170.450 140.102 1.00 75.29  ? 113 THR E CG2   1 
ATOM 8318  N N     . SER D 3 114 ? -114.179 169.330 141.875 1.00 75.39  ? 114 SER E N     1 
ATOM 8319  C CA    . SER D 3 114 ? -115.139 168.608 142.694 1.00 75.39  ? 114 SER E CA    1 
ATOM 8320  C C     . SER D 3 114 ? -114.532 167.375 143.340 1.00 75.39  ? 114 SER E C     1 
ATOM 8321  O O     . SER D 3 114 ? -114.892 167.033 144.469 1.00 75.39  ? 114 SER E O     1 
ATOM 8322  C CB    . SER D 3 114 ? -116.348 168.216 141.859 1.00 75.39  ? 114 SER E CB    1 
ATOM 8323  O OG    . SER D 3 114 ? -117.081 169.361 141.482 1.00 75.39  ? 114 SER E OG    1 
ATOM 8324  N N     . VAL D 3 115 ? -113.617 166.699 142.661 1.00 68.61  ? 115 VAL E N     1 
ATOM 8325  C CA    . VAL D 3 115 ? -113.031 165.475 143.184 1.00 68.61  ? 115 VAL E CA    1 
ATOM 8326  C C     . VAL D 3 115 ? -111.565 165.706 143.539 1.00 68.61  ? 115 VAL E C     1 
ATOM 8327  O O     . VAL D 3 115 ? -110.897 166.564 142.963 1.00 68.61  ? 115 VAL E O     1 
ATOM 8328  C CB    . VAL D 3 115 ? -113.204 164.350 142.153 1.00 68.61  ? 115 VAL E CB    1 
ATOM 8329  C CG1   . VAL D 3 115 ? -112.314 164.604 140.973 1.00 68.61  ? 115 VAL E CG1   1 
ATOM 8330  C CG2   . VAL D 3 115 ? -112.928 163.000 142.766 1.00 68.61  ? 115 VAL E CG2   1 
ATOM 8331  N N     . LEU D 3 116 ? -111.076 164.947 144.520 1.00 64.33  ? 116 LEU E N     1 
ATOM 8332  C CA    . LEU D 3 116 ? -109.692 165.027 144.976 1.00 64.33  ? 116 LEU E CA    1 
ATOM 8333  C C     . LEU D 3 116 ? -108.690 164.337 144.061 1.00 64.33  ? 116 LEU E C     1 
ATOM 8334  O O     . LEU D 3 116 ? -108.685 163.113 143.944 1.00 64.33  ? 116 LEU E O     1 
ATOM 8335  C CB    . LEU D 3 116 ? -109.545 164.403 146.362 1.00 64.33  ? 116 LEU E CB    1 
ATOM 8336  C CG    . LEU D 3 116 ? -110.132 164.953 147.655 1.00 64.33  ? 116 LEU E CG    1 
ATOM 8337  C CD1   . LEU D 3 116 ? -109.588 166.319 147.923 1.00 64.33  ? 116 LEU E CD1   1 
ATOM 8338  C CD2   . LEU D 3 116 ? -111.634 164.964 147.624 1.00 64.33  ? 116 LEU E CD2   1 
ATOM 8339  N N     . PHE D 3 117 ? -107.837 165.119 143.414 1.00 65.81  ? 117 PHE E N     1 
ATOM 8340  C CA    . PHE D 3 117 ? -106.774 164.561 142.592 1.00 65.81  ? 117 PHE E CA    1 
ATOM 8341  C C     . PHE D 3 117 ? -105.708 163.976 143.504 1.00 65.81  ? 117 PHE E C     1 
ATOM 8342  O O     . PHE D 3 117 ? -105.541 164.420 144.638 1.00 65.81  ? 117 PHE E O     1 
ATOM 8343  C CB    . PHE D 3 117 ? -106.181 165.604 141.661 1.00 65.81  ? 117 PHE E CB    1 
ATOM 8344  C CG    . PHE D 3 117 ? -107.034 165.890 140.484 1.00 65.81  ? 117 PHE E CG    1 
ATOM 8345  C CD1   . PHE D 3 117 ? -106.927 165.117 139.357 1.00 65.81  ? 117 PHE E CD1   1 
ATOM 8346  C CD2   . PHE D 3 117 ? -107.961 166.898 140.510 1.00 65.81  ? 117 PHE E CD2   1 
ATOM 8347  C CE1   . PHE D 3 117 ? -107.707 165.354 138.274 1.00 65.81  ? 117 PHE E CE1   1 
ATOM 8348  C CE2   . PHE D 3 117 ? -108.749 167.136 139.425 1.00 65.81  ? 117 PHE E CE2   1 
ATOM 8349  C CZ    . PHE D 3 117 ? -108.619 166.362 138.305 1.00 65.81  ? 117 PHE E CZ    1 
ATOM 8350  N N     . TYR D 3 118 ? -104.999 162.968 143.018 1.00 65.09  ? 118 TYR E N     1 
ATOM 8351  C CA    . TYR D 3 118 ? -103.971 162.289 143.800 1.00 65.09  ? 118 TYR E CA    1 
ATOM 8352  C C     . TYR D 3 118 ? -102.791 161.995 142.888 1.00 65.09  ? 118 TYR E C     1 
ATOM 8353  O O     . TYR D 3 118 ? -102.736 160.937 142.261 1.00 65.09  ? 118 TYR E O     1 
ATOM 8354  C CB    . TYR D 3 118 ? -104.518 161.023 144.424 1.00 65.09  ? 118 TYR E CB    1 
ATOM 8355  C CG    . TYR D 3 118 ? -103.590 160.392 145.414 1.00 65.09  ? 118 TYR E CG    1 
ATOM 8356  C CD1   . TYR D 3 118 ? -103.022 161.128 146.422 1.00 65.09  ? 118 TYR E CD1   1 
ATOM 8357  C CD2   . TYR D 3 118 ? -103.316 159.046 145.365 1.00 65.09  ? 118 TYR E CD2   1 
ATOM 8358  C CE1   . TYR D 3 118 ? -102.186 160.548 147.330 1.00 65.09  ? 118 TYR E CE1   1 
ATOM 8359  C CE2   . TYR D 3 118 ? -102.490 158.463 146.270 1.00 65.09  ? 118 TYR E CE2   1 
ATOM 8360  C CZ    . TYR D 3 118 ? -101.928 159.215 147.250 1.00 65.09  ? 118 TYR E CZ    1 
ATOM 8361  O OH    . TYR D 3 118 ? -101.093 158.623 148.157 1.00 65.09  ? 118 TYR E OH    1 
ATOM 8362  N N     . LEU D 3 119 ? -101.850 162.924 142.814 1.00 69.07  ? 119 LEU E N     1 
ATOM 8363  C CA    . LEU D 3 119 ? -100.763 162.751 141.863 1.00 69.07  ? 119 LEU E CA    1 
ATOM 8364  C C     . LEU D 3 119 ? -99.460  163.239 142.464 1.00 69.07  ? 119 LEU E C     1 
ATOM 8365  O O     . LEU D 3 119 ? -99.467  164.113 143.334 1.00 69.07  ? 119 LEU E O     1 
ATOM 8366  C CB    . LEU D 3 119 ? -101.062 163.490 140.557 1.00 69.07  ? 119 LEU E CB    1 
ATOM 8367  C CG    . LEU D 3 119 ? -101.719 164.840 140.773 1.00 69.07  ? 119 LEU E CG    1 
ATOM 8368  C CD1   . LEU D 3 119 ? -100.730 165.936 140.590 1.00 69.07  ? 119 LEU E CD1   1 
ATOM 8369  C CD2   . LEU D 3 119 ? -102.823 164.981 139.770 1.00 69.07  ? 119 LEU E CD2   1 
ATOM 8370  N N     . PRO D 3 120 ? -98.330  162.699 142.019 1.00 74.03  ? 120 PRO E N     1 
ATOM 8371  C CA    . PRO D 3 120 ? -97.045  163.149 142.548 1.00 74.03  ? 120 PRO E CA    1 
ATOM 8372  C C     . PRO D 3 120 ? -96.778  164.597 142.190 1.00 74.03  ? 120 PRO E C     1 
ATOM 8373  O O     . PRO D 3 120 ? -97.339  165.150 141.247 1.00 74.03  ? 120 PRO E O     1 
ATOM 8374  C CB    . PRO D 3 120 ? -96.040  162.222 141.861 1.00 74.03  ? 120 PRO E CB    1 
ATOM 8375  C CG    . PRO D 3 120 ? -96.834  161.071 141.395 1.00 74.03  ? 120 PRO E CG    1 
ATOM 8376  C CD    . PRO D 3 120 ? -98.177  161.590 141.071 1.00 74.03  ? 120 PRO E CD    1 
ATOM 8377  N N     . VAL D 3 121 ? -95.879  165.204 142.952 1.00 79.39  ? 121 VAL E N     1 
ATOM 8378  C CA    . VAL D 3 121 ? -95.559  166.617 142.762 1.00 79.39  ? 121 VAL E CA    1 
ATOM 8379  C C     . VAL D 3 121 ? -94.886  166.907 141.422 1.00 79.39  ? 121 VAL E C     1 
ATOM 8380  O O     . VAL D 3 121 ? -95.326  167.825 140.711 1.00 79.39  ? 121 VAL E O     1 
ATOM 8381  C CB    . VAL D 3 121 ? -94.733  167.130 143.943 1.00 79.39  ? 121 VAL E CB    1 
ATOM 8382  C CG1   . VAL D 3 121 ? -94.430  168.590 143.773 1.00 79.39  ? 121 VAL E CG1   1 
ATOM 8383  C CG2   . VAL D 3 121 ? -95.464  166.882 145.234 1.00 79.39  ? 121 VAL E CG2   1 
ATOM 8384  N N     . PRO D 3 122 ? -93.849  166.182 141.008 1.00 81.78  ? 122 PRO E N     1 
ATOM 8385  C CA    . PRO D 3 122 ? -93.277  166.497 139.701 1.00 81.78  ? 122 PRO E CA    1 
ATOM 8386  C C     . PRO D 3 122 ? -94.247  166.329 138.550 1.00 81.78  ? 122 PRO E C     1 
ATOM 8387  O O     . PRO D 3 122 ? -94.105  167.021 137.531 1.00 81.78  ? 122 PRO E O     1 
ATOM 8388  C CB    . PRO D 3 122 ? -92.099  165.527 139.592 1.00 81.78  ? 122 PRO E CB    1 
ATOM 8389  C CG    . PRO D 3 122 ? -92.448  164.425 140.503 1.00 81.78  ? 122 PRO E CG    1 
ATOM 8390  C CD    . PRO D 3 122 ? -93.131  165.073 141.649 1.00 81.78  ? 122 PRO E CD    1 
ATOM 8391  N N     . ALA D 3 123 ? -95.270  165.483 138.687 1.00 84.06  ? 123 ALA E N     1 
ATOM 8392  C CA    . ALA D 3 123 ? -96.269  165.412 137.631 1.00 84.06  ? 123 ALA E CA    1 
ATOM 8393  C C     . ALA D 3 123 ? -97.099  166.678 137.531 1.00 84.06  ? 123 ALA E C     1 
ATOM 8394  O O     . ALA D 3 123 ? -97.446  167.102 136.425 1.00 84.06  ? 123 ALA E O     1 
ATOM 8395  C CB    . ALA D 3 123 ? -97.183  164.214 137.867 1.00 84.06  ? 123 ALA E CB    1 
ATOM 8396  N N     . ILE D 3 124 ? -97.392  167.317 138.658 1.00 84.53  ? 124 ILE E N     1 
ATOM 8397  C CA    . ILE D 3 124 ? -98.089  168.594 138.610 1.00 84.53  ? 124 ILE E CA    1 
ATOM 8398  C C     . ILE D 3 124 ? -97.230  169.627 137.894 1.00 84.53  ? 124 ILE E C     1 
ATOM 8399  O O     . ILE D 3 124 ? -97.727  170.422 137.082 1.00 84.53  ? 124 ILE E O     1 
ATOM 8400  C CB    . ILE D 3 124 ? -98.532  169.027 140.020 1.00 84.53  ? 124 ILE E CB    1 
ATOM 8401  C CG1   . ILE D 3 124 ? -99.646  170.049 139.937 1.00 84.53  ? 124 ILE E CG1   1 
ATOM 8402  C CG2   . ILE D 3 124 ? -97.453  169.670 140.767 1.00 84.53  ? 124 ILE E CG2   1 
ATOM 8403  C CD1   . ILE D 3 124 ? -100.167 170.414 141.292 1.00 84.53  ? 124 ILE E CD1   1 
ATOM 8404  N N     . ASP D 3 125 ? -95.922  169.609 138.151 1.00 87.98  ? 125 ASP E N     1 
ATOM 8405  C CA    . ASP D 3 125 ? -95.056  170.541 137.441 1.00 87.98  ? 125 ASP E CA    1 
ATOM 8406  C C     . ASP D 3 125 ? -95.027  170.251 135.945 1.00 87.98  ? 125 ASP E C     1 
ATOM 8407  O O     . ASP D 3 125 ? -94.973  171.181 135.129 1.00 87.98  ? 125 ASP E O     1 
ATOM 8408  C CB    . ASP D 3 125 ? -93.647  170.464 138.014 1.00 87.98  ? 125 ASP E CB    1 
ATOM 8409  C CG    . ASP D 3 125 ? -92.720  171.481 137.404 1.00 87.98  ? 125 ASP E CG    1 
ATOM 8410  O OD1   . ASP D 3 125 ? -93.214  172.504 136.895 1.00 87.98  ? 125 ASP E OD1   1 
ATOM 8411  O OD2   . ASP D 3 125 ? -91.493  171.256 137.429 1.00 87.98  ? 125 ASP E OD2   1 
ATOM 8412  N N     . GLU D 3 126 ? -95.104  168.979 135.557 1.00 88.94  ? 126 GLU E N     1 
ATOM 8413  C CA    . GLU D 3 126 ? -95.146  168.673 134.132 1.00 88.94  ? 126 GLU E CA    1 
ATOM 8414  C C     . GLU D 3 126 ? -96.448  169.149 133.508 1.00 88.94  ? 126 GLU E C     1 
ATOM 8415  O O     . GLU D 3 126 ? -96.463  169.574 132.347 1.00 88.94  ? 126 GLU E O     1 
ATOM 8416  C CB    . GLU D 3 126 ? -94.918  167.189 133.890 1.00 88.94  ? 126 GLU E CB    1 
ATOM 8417  C CG    . GLU D 3 126 ? -93.542  166.756 134.321 1.00 88.94  ? 126 GLU E CG    1 
ATOM 8418  C CD    . GLU D 3 126 ? -93.010  165.642 133.467 1.00 88.94  ? 126 GLU E CD    1 
ATOM 8419  O OE1   . GLU D 3 126 ? -93.702  165.251 132.509 1.00 88.94  ? 126 GLU E OE1   1 
ATOM 8420  O OE2   . GLU D 3 126 ? -91.886  165.171 133.737 1.00 88.94  ? 126 GLU E OE2   1 
ATOM 8421  N N     . LEU D 3 127 ? -97.552  169.078 134.249 1.00 87.65  ? 127 LEU E N     1 
ATOM 8422  C CA    . LEU D 3 127 ? -98.782  169.672 133.742 1.00 87.65  ? 127 LEU E CA    1 
ATOM 8423  C C     . LEU D 3 127 ? -98.598  171.159 133.516 1.00 87.65  ? 127 LEU E C     1 
ATOM 8424  O O     . LEU D 3 127 ? -99.094  171.715 132.527 1.00 87.65  ? 127 LEU E O     1 
ATOM 8425  C CB    . LEU D 3 127 ? -99.935  169.449 134.715 1.00 87.65  ? 127 LEU E CB    1 
ATOM 8426  C CG    . LEU D 3 127 ? -100.467 168.046 134.902 1.00 87.65  ? 127 LEU E CG    1 
ATOM 8427  C CD1   . LEU D 3 127 ? -101.517 168.065 135.969 1.00 87.65  ? 127 LEU E CD1   1 
ATOM 8428  C CD2   . LEU D 3 127 ? -101.054 167.595 133.602 1.00 87.65  ? 127 LEU E CD2   1 
ATOM 8429  N N     . ALA D 3 128 ? -97.852  171.818 134.399 1.00 90.51  ? 128 ALA E N     1 
ATOM 8430  C CA    . ALA D 3 128 ? -97.564  173.224 134.167 1.00 90.51  ? 128 ALA E CA    1 
ATOM 8431  C C     . ALA D 3 128 ? -96.757  173.426 132.894 1.00 90.51  ? 128 ALA E C     1 
ATOM 8432  O O     . ALA D 3 128 ? -97.001  174.380 132.149 1.00 90.51  ? 128 ALA E O     1 
ATOM 8433  C CB    . ALA D 3 128 ? -96.824  173.812 135.363 1.00 90.51  ? 128 ALA E CB    1 
ATOM 8434  N N     . ALA D 3 129 ? -95.809  172.536 132.607 1.00 92.26  ? 129 ALA E N     1 
ATOM 8435  C CA    . ALA D 3 129 ? -95.052  172.695 131.368 1.00 92.26  ? 129 ALA E CA    1 
ATOM 8436  C C     . ALA D 3 129 ? -95.921  172.482 130.132 1.00 92.26  ? 129 ALA E C     1 
ATOM 8437  O O     . ALA D 3 129 ? -95.791  173.221 129.145 1.00 92.26  ? 129 ALA E O     1 
ATOM 8438  C CB    . ALA D 3 129 ? -93.868  171.737 131.349 1.00 92.26  ? 129 ALA E CB    1 
ATOM 8439  N N     . ILE D 3 130 ? -96.866  171.543 130.195 1.00 91.76  ? 130 ILE E N     1 
ATOM 8440  C CA    . ILE D 3 130 ? -97.756  171.337 129.058 1.00 91.76  ? 130 ILE E CA    1 
ATOM 8441  C C     . ILE D 3 130 ? -98.634  172.550 128.841 1.00 91.76  ? 130 ILE E C     1 
ATOM 8442  O O     . ILE D 3 130 ? -98.861  172.969 127.703 1.00 91.76  ? 130 ILE E O     1 
ATOM 8443  C CB    . ILE D 3 130 ? -98.603  170.072 129.250 1.00 91.76  ? 130 ILE E CB    1 
ATOM 8444  C CG1   . ILE D 3 130 ? -97.707  168.848 129.349 1.00 91.76  ? 130 ILE E CG1   1 
ATOM 8445  C CG2   . ILE D 3 130 ? -99.588  169.926 128.122 1.00 91.76  ? 130 ILE E CG2   1 
ATOM 8446  C CD1   . ILE D 3 130 ? -98.475  167.586 129.577 1.00 91.76  ? 130 ILE E CD1   1 
ATOM 8447  N N     . ALA D 3 131 ? -99.146  173.133 129.915 1.00 93.17  ? 131 ALA E N     1 
ATOM 8448  C CA    . ALA D 3 131 ? -99.891  174.365 129.725 1.00 93.17  ? 131 ALA E CA    1 
ATOM 8449  C C     . ALA D 3 131 ? -98.982  175.501 129.306 1.00 93.17  ? 131 ALA E C     1 
ATOM 8450  O O     . ALA D 3 131 ? -99.469  176.515 128.801 1.00 93.17  ? 131 ALA E O     1 
ATOM 8451  C CB    . ALA D 3 131 ? -100.630 174.755 130.997 1.00 93.17  ? 131 ALA E CB    1 
ATOM 8452  N N     . ASP D 3 132 ? -97.675  175.355 129.496 1.00 95.60  ? 132 ASP E N     1 
ATOM 8453  C CA    . ASP D 3 132 ? -96.770  176.450 129.185 1.00 95.60  ? 132 ASP E CA    1 
ATOM 8454  C C     . ASP D 3 132 ? -96.439  176.530 127.703 1.00 95.60  ? 132 ASP E C     1 
ATOM 8455  O O     . ASP D 3 132 ? -96.435  177.622 127.130 1.00 95.60  ? 132 ASP E O     1 
ATOM 8456  C CB    . ASP D 3 132 ? -95.484  176.299 129.987 1.00 95.60  ? 132 ASP E CB    1 
ATOM 8457  C CG    . ASP D 3 132 ? -94.571  177.484 129.837 1.00 95.60  ? 132 ASP E CG    1 
ATOM 8458  O OD1   . ASP D 3 132 ? -95.076  178.585 129.540 1.00 95.60  ? 132 ASP E OD1   1 
ATOM 8459  O OD2   . ASP D 3 132 ? -93.347  177.311 129.993 1.00 95.60  ? 132 ASP E OD2   1 
ATOM 8460  N N     . GLU D 3 133 ? -96.199  175.398 127.078 1.00 99.29  ? 133 GLU E N     1 
ATOM 8461  C CA    . GLU D 3 133 ? -95.817  175.387 125.683 1.00 99.29  ? 133 GLU E CA    1 
ATOM 8462  C C     . GLU D 3 133 ? -96.863  176.054 124.798 1.00 99.29  ? 133 GLU E C     1 
ATOM 8463  O O     . GLU D 3 133 ? -96.531  176.702 123.813 1.00 99.29  ? 133 GLU E O     1 
ATOM 8464  C CB    . GLU D 3 133 ? -95.576  173.942 125.249 1.00 99.29  ? 133 GLU E CB    1 
ATOM 8465  C CG    . GLU D 3 133 ? -95.676  173.677 123.762 1.00 99.29  ? 133 GLU E CG    1 
ATOM 8466  C CD    . GLU D 3 133 ? -95.160  172.302 123.399 1.00 99.29  ? 133 GLU E CD    1 
ATOM 8467  O OE1   . GLU D 3 133 ? -94.199  171.841 124.047 1.00 99.29  ? 133 GLU E OE1   1 
ATOM 8468  O OE2   . GLU D 3 133 ? -95.715  171.681 122.472 1.00 99.29  ? 133 GLU E OE2   1 
ATOM 8469  N N     . HIS D 3 134 ? -98.123  175.877 125.152 1.00 100.55 ? 134 HIS E N     1 
ATOM 8470  C CA    . HIS D 3 134 ? -99.256  176.394 124.380 1.00 100.55 ? 134 HIS E CA    1 
ATOM 8471  C C     . HIS D 3 134 ? -99.727  177.739 124.916 1.00 100.55 ? 134 HIS E C     1 
ATOM 8472  O O     . HIS D 3 134 ? -100.923 177.969 125.071 1.00 100.55 ? 134 HIS E O     1 
ATOM 8473  C CB    . HIS D 3 134 ? -100.396 175.385 124.380 1.00 100.55 ? 134 HIS E CB    1 
ATOM 8474  C CG    . HIS D 3 134 ? -100.011 174.043 123.844 1.00 100.55 ? 134 HIS E CG    1 
ATOM 8475  N ND1   . HIS D 3 134 ? -99.868  173.792 122.498 1.00 100.55 ? 134 HIS E ND1   1 
ATOM 8476  C CD2   . HIS D 3 134 ? -99.724  172.882 124.475 1.00 100.55 ? 134 HIS E CD2   1 
ATOM 8477  C CE1   . HIS D 3 134 ? -99.524  172.529 122.321 1.00 100.55 ? 134 HIS E CE1   1 
ATOM 8478  N NE2   . HIS D 3 134 ? -99.426  171.954 123.505 1.00 100.55 ? 134 HIS E NE2   1 
ATOM 8479  N N     . ARG D 3 135 ? -98.799  178.652 125.183 1.00 98.74  ? 135 ARG E N     1 
ATOM 8480  C CA    . ARG D 3 135 ? -99.172  179.907 125.824 1.00 98.74  ? 135 ARG E CA    1 
ATOM 8481  C C     . ARG D 3 135 ? -100.007 180.815 124.930 1.00 98.74  ? 135 ARG E C     1 
ATOM 8482  O O     . ARG D 3 135 ? -100.936 181.470 125.414 1.00 98.74  ? 135 ARG E O     1 
ATOM 8483  C CB    . ARG D 3 135 ? -97.912  180.646 126.252 1.00 98.74  ? 135 ARG E CB    1 
ATOM 8484  C CG    . ARG D 3 135 ? -98.152  181.952 126.949 1.00 98.74  ? 135 ARG E CG    1 
ATOM 8485  C CD    . ARG D 3 135 ? -96.848  182.473 127.485 1.00 98.74  ? 135 ARG E CD    1 
ATOM 8486  N NE    . ARG D 3 135 ? -97.019  183.689 128.270 1.00 98.74  ? 135 ARG E NE    1 
ATOM 8487  C CZ    . ARG D 3 135 ? -96.046  184.254 128.970 1.00 98.74  ? 135 ARG E CZ    1 
ATOM 8488  N NH1   . ARG D 3 135 ? -96.271  185.366 129.650 1.00 98.74  ? 135 ARG E NH1   1 
ATOM 8489  N NH2   . ARG D 3 135 ? -94.844  183.707 128.981 1.00 98.74  ? 135 ARG E NH2   1 
ATOM 8490  N N     . ASP D 3 136 ? -99.723  180.862 123.630 1.00 103.60 ? 136 ASP E N     1 
ATOM 8491  C CA    . ASP D 3 136 ? -100.479 181.752 122.754 1.00 103.60 ? 136 ASP E CA    1 
ATOM 8492  C C     . ASP D 3 136 ? -101.901 181.263 122.533 1.00 103.60 ? 136 ASP E C     1 
ATOM 8493  O O     . ASP D 3 136 ? -102.843 182.063 122.531 1.00 103.60 ? 136 ASP E O     1 
ATOM 8494  C CB    . ASP D 3 136 ? -99.745  181.886 121.428 1.00 103.60 ? 136 ASP E CB    1 
ATOM 8495  C CG    . ASP D 3 136 ? -99.169  180.569 120.955 1.00 103.60 ? 136 ASP E CG    1 
ATOM 8496  O OD1   . ASP D 3 136 ? -99.481  179.527 121.571 1.00 103.60 ? 136 ASP E OD1   1 
ATOM 8497  O OD2   . ASP D 3 136 ? -98.384  180.579 119.984 1.00 103.60 ? 136 ASP E OD2   1 
ATOM 8498  N N     . ALA D 3 137 ? -102.079 179.955 122.369 1.00 103.11 ? 137 ALA E N     1 
ATOM 8499  C CA    . ALA D 3 137 ? -103.423 179.420 122.219 1.00 103.11 ? 137 ALA E CA    1 
ATOM 8500  C C     . ALA D 3 137 ? -104.238 179.664 123.476 1.00 103.11 ? 137 ALA E C     1 
ATOM 8501  O O     . ALA D 3 137 ? -105.428 179.993 123.408 1.00 103.11 ? 137 ALA E O     1 
ATOM 8502  C CB    . ALA D 3 137 ? -103.360 177.930 121.892 1.00 103.11 ? 137 ALA E CB    1 
ATOM 8503  N N     . VAL D 3 138 ? -103.595 179.556 124.635 1.00 101.52 ? 138 VAL E N     1 
ATOM 8504  C CA    . VAL D 3 138 ? -104.266 179.873 125.886 1.00 101.52 ? 138 VAL E CA    1 
ATOM 8505  C C     . VAL D 3 138 ? -104.622 181.349 125.935 1.00 101.52 ? 138 VAL E C     1 
ATOM 8506  O O     . VAL D 3 138 ? -105.693 181.724 126.416 1.00 101.52 ? 138 VAL E O     1 
ATOM 8507  C CB    . VAL D 3 138 ? -103.386 179.462 127.076 1.00 101.52 ? 138 VAL E CB    1 
ATOM 8508  C CG1   . VAL D 3 138 ? -103.957 180.000 128.356 1.00 101.52 ? 138 VAL E CG1   1 
ATOM 8509  C CG2   . VAL D 3 138 ? -103.304 177.960 127.152 1.00 101.52 ? 138 VAL E CG2   1 
ATOM 8510  N N     . ALA D 3 139 ? -103.734 182.211 125.448 1.00 100.59 ? 139 ALA E N     1 
ATOM 8511  C CA    . ALA D 3 139 ? -104.046 183.634 125.454 1.00 100.59 ? 139 ALA E CA    1 
ATOM 8512  C C     . ALA D 3 139 ? -105.229 183.949 124.552 1.00 100.59 ? 139 ALA E C     1 
ATOM 8513  O O     . ALA D 3 139 ? -106.090 184.770 124.905 1.00 100.59 ? 139 ALA E O     1 
ATOM 8514  C CB    . ALA D 3 139 ? -102.821 184.436 125.024 1.00 100.59 ? 139 ALA E CB    1 
ATOM 8515  N N     . LYS D 3 140 ? -105.353 183.225 123.440 1.00 103.32 ? 140 LYS E N     1 
ATOM 8516  C CA    . LYS D 3 140 ? -106.488 183.449 122.558 1.00 103.32 ? 140 LYS E CA    1 
ATOM 8517  C C     . LYS D 3 140 ? -107.777 182.930 123.165 1.00 103.32 ? 140 LYS E C     1 
ATOM 8518  O O     . LYS D 3 140 ? -108.824 183.570 123.035 1.00 103.32 ? 140 LYS E O     1 
ATOM 8519  C CB    . LYS D 3 140 ? -106.232 182.777 121.215 1.00 103.32 ? 140 LYS E CB    1 
ATOM 8520  C CG    . LYS D 3 140 ? -105.122 183.422 120.423 1.00 103.32 ? 140 LYS E CG    1 
ATOM 8521  C CD    . LYS D 3 140 ? -104.913 182.703 119.109 1.00 103.32 ? 140 LYS E CD    1 
ATOM 8522  C CE    . LYS D 3 140 ? -103.802 183.345 118.304 1.00 103.32 ? 140 LYS E CE    1 
ATOM 8523  N NZ    . LYS D 3 140 ? -104.086 184.769 117.987 1.00 103.32 ? 140 LYS E NZ    1 
ATOM 8524  N N     . GLU D 3 141 ? -107.725 181.805 123.864 1.00 105.05 ? 141 GLU E N     1 
ATOM 8525  C CA    . GLU D 3 141 ? -108.952 181.305 124.459 1.00 105.05 ? 141 GLU E CA    1 
ATOM 8526  C C     . GLU D 3 141 ? -109.299 182.044 125.734 1.00 105.05 ? 141 GLU E C     1 
ATOM 8527  O O     . GLU D 3 141 ? -110.453 182.002 126.169 1.00 105.05 ? 141 GLU E O     1 
ATOM 8528  C CB    . GLU D 3 141 ? -108.848 179.815 124.719 1.00 105.05 ? 141 GLU E CB    1 
ATOM 8529  C CG    . GLU D 3 141 ? -108.699 179.051 123.454 1.00 105.05 ? 141 GLU E CG    1 
ATOM 8530  C CD    . GLU D 3 141 ? -109.979 179.042 122.659 1.00 105.05 ? 141 GLU E CD    1 
ATOM 8531  O OE1   . GLU D 3 141 ? -111.057 179.003 123.291 1.00 105.05 ? 141 GLU E OE1   1 
ATOM 8532  O OE2   . GLU D 3 141 ? -109.917 179.084 121.419 1.00 105.05 ? 141 GLU E OE2   1 
ATOM 8533  N N     . ALA D 3 142 ? -108.326 182.717 126.343 1.00 104.30 ? 142 ALA E N     1 
ATOM 8534  C CA    . ALA D 3 142 ? -108.611 183.515 127.522 1.00 104.30 ? 142 ALA E CA    1 
ATOM 8535  C C     . ALA D 3 142 ? -109.452 184.726 127.173 1.00 104.30 ? 142 ALA E C     1 
ATOM 8536  O O     . ALA D 3 142 ? -110.148 185.259 128.043 1.00 104.30 ? 142 ALA E O     1 
ATOM 8537  C CB    . ALA D 3 142 ? -107.309 183.951 128.198 1.00 104.30 ? 142 ALA E CB    1 
ATOM 8538  N N     . ALA D 3 143 ? -109.403 185.175 125.917 1.00 104.06 ? 143 ALA E N     1 
ATOM 8539  C CA    . ALA D 3 143 ? -110.225 186.315 125.526 1.00 104.06 ? 143 ALA E CA    1 
ATOM 8540  C C     . ALA D 3 143 ? -111.691 185.959 125.280 1.00 104.06 ? 143 ALA E C     1 
ATOM 8541  O O     . ALA D 3 143 ? -112.554 186.836 125.394 1.00 104.06 ? 143 ALA E O     1 
ATOM 8542  C CB    . ALA D 3 143 ? -109.645 186.971 124.278 1.00 104.06 ? 143 ALA E CB    1 
ATOM 8543  N N     . LYS D 3 144 ? -111.987 184.711 124.924 1.00 104.74 ? 144 LYS E N     1 
ATOM 8544  C CA    . LYS D 3 144 ? -113.347 184.248 124.661 1.00 104.74 ? 144 LYS E CA    1 
ATOM 8545  C C     . LYS D 3 144 ? -114.150 184.127 125.953 1.00 104.74 ? 144 LYS E C     1 
ATOM 8546  O O     . LYS D 3 144 ? -113.594 184.078 127.048 1.00 104.74 ? 144 LYS E O     1 
ATOM 8547  C CB    . LYS D 3 144 ? -113.325 182.905 123.937 1.00 104.74 ? 144 LYS E CB    1 
ATOM 8548  C CG    . LYS D 3 144 ? -112.703 182.957 122.564 1.00 104.74 ? 144 LYS E CG    1 
ATOM 8549  C CD    . LYS D 3 144 ? -112.794 181.608 121.909 1.00 104.74 ? 144 LYS E CD    1 
ATOM 8550  C CE    . LYS D 3 144 ? -112.254 181.640 120.500 1.00 104.74 ? 144 LYS E CE    1 
ATOM 8551  N NZ    . LYS D 3 144 ? -112.317 180.294 119.868 1.00 104.74 ? 144 LYS E NZ    1 
ATOM 8552  N N     . LYS D 3 145 ? -115.476 184.147 125.829 1.00 104.27 ? 145 LYS E N     1 
ATOM 8553  C CA    . LYS D 3 145 ? -116.308 184.084 127.022 1.00 104.27 ? 145 LYS E CA    1 
ATOM 8554  C C     . LYS D 3 145 ? -116.306 182.691 127.643 1.00 104.27 ? 145 LYS E C     1 
ATOM 8555  O O     . LYS D 3 145 ? -116.217 182.557 128.866 1.00 104.27 ? 145 LYS E O     1 
ATOM 8556  C CB    . LYS D 3 145 ? -117.736 184.495 126.710 1.00 104.27 ? 145 LYS E CB    1 
ATOM 8557  C CG    . LYS D 3 145 ? -117.983 185.903 126.247 1.00 104.27 ? 145 LYS E CG    1 
ATOM 8558  C CD    . LYS D 3 145 ? -119.463 186.043 125.978 1.00 104.27 ? 145 LYS E CD    1 
ATOM 8559  C CE    . LYS D 3 145 ? -119.805 187.421 125.502 1.00 104.27 ? 145 LYS E CE    1 
ATOM 8560  N NZ    . LYS D 3 145 ? -121.241 187.429 125.149 1.00 104.27 ? 145 LYS E NZ    1 
ATOM 8561  N N     . THR D 3 146 ? -116.402 181.650 126.816 1.00 101.57 ? 146 THR E N     1 
ATOM 8562  C CA    . THR D 3 146 ? -116.415 180.258 127.265 1.00 101.57 ? 146 THR E CA    1 
ATOM 8563  C C     . THR D 3 146 ? -115.310 179.462 126.590 1.00 101.57 ? 146 THR E C     1 
ATOM 8564  O O     . THR D 3 146 ? -115.560 178.762 125.600 1.00 101.57 ? 146 THR E O     1 
ATOM 8565  C CB    . THR D 3 146 ? -117.769 179.598 127.010 1.00 101.57 ? 146 THR E CB    1 
ATOM 8566  O OG1   . THR D 3 146 ? -118.064 179.627 125.608 1.00 101.57 ? 146 THR E OG1   1 
ATOM 8567  C CG2   . THR D 3 146 ? -118.865 180.276 127.827 1.00 101.57 ? 146 THR E CG2   1 
ATOM 8568  N N     . PRO D 3 147 ? -114.090 179.540 127.083 1.00 100.30 ? 147 PRO E N     1 
ATOM 8569  C CA    . PRO D 3 147 ? -112.990 178.864 126.400 1.00 100.30 ? 147 PRO E CA    1 
ATOM 8570  C C     . PRO D 3 147 ? -113.126 177.354 126.497 1.00 100.30 ? 147 PRO E C     1 
ATOM 8571  O O     . PRO D 3 147 ? -113.675 176.819 127.459 1.00 100.30 ? 147 PRO E O     1 
ATOM 8572  C CB    . PRO D 3 147 ? -111.756 179.376 127.132 1.00 100.30 ? 147 PRO E CB    1 
ATOM 8573  C CG    . PRO D 3 147 ? -112.255 179.753 128.451 1.00 100.30 ? 147 PRO E CG    1 
ATOM 8574  C CD    . PRO D 3 147 ? -113.639 180.262 128.278 1.00 100.30 ? 147 PRO E CD    1 
ATOM 8575  N N     . LYS D 3 148 ? -112.669 176.674 125.454 1.00 97.57  ? 148 LYS E N     1 
ATOM 8576  C CA    . LYS D 3 148 ? -112.690 175.222 125.351 1.00 97.57  ? 148 LYS E CA    1 
ATOM 8577  C C     . LYS D 3 148 ? -111.314 174.623 125.612 1.00 97.57  ? 148 LYS E C     1 
ATOM 8578  O O     . LYS D 3 148 ? -110.288 175.300 125.574 1.00 97.57  ? 148 LYS E O     1 
ATOM 8579  C CB    . LYS D 3 148 ? -113.211 174.802 123.983 1.00 97.57  ? 148 LYS E CB    1 
ATOM 8580  C CG    . LYS D 3 148 ? -114.614 175.285 123.739 1.00 97.57  ? 148 LYS E CG    1 
ATOM 8581  C CD    . LYS D 3 148 ? -115.129 174.846 122.391 1.00 97.57  ? 148 LYS E CD    1 
ATOM 8582  C CE    . LYS D 3 148 ? -116.552 175.321 122.213 1.00 97.57  ? 148 LYS E CE    1 
ATOM 8583  N NZ    . LYS D 3 148 ? -116.647 176.792 122.406 1.00 97.57  ? 148 LYS E NZ    1 
ATOM 8584  N N     . GLY D 3 149 ? -111.310 173.321 125.869 1.00 97.90  ? 149 GLY E N     1 
ATOM 8585  C CA    . GLY D 3 149 ? -110.076 172.602 126.123 1.00 97.90  ? 149 GLY E CA    1 
ATOM 8586  C C     . GLY D 3 149 ? -109.161 172.448 124.925 1.00 97.90  ? 149 GLY E C     1 
ATOM 8587  O O     . GLY D 3 149 ? -109.298 171.526 124.117 1.00 97.90  ? 149 GLY E O     1 
ATOM 8588  N N     . ILE D 3 150 ? -108.219 173.378 124.809 1.00 96.96  ? 150 ILE E N     1 
ATOM 8589  C CA    . ILE D 3 150 ? -107.305 173.424 123.680 1.00 96.96  ? 150 ILE E CA    1 
ATOM 8590  C C     . ILE D 3 150 ? -106.139 172.461 123.850 1.00 96.96  ? 150 ILE E C     1 
ATOM 8591  O O     . ILE D 3 150 ? -105.678 171.868 122.870 1.00 96.96  ? 150 ILE E O     1 
ATOM 8592  C CB    . ILE D 3 150 ? -106.796 174.860 123.504 1.00 96.96  ? 150 ILE E CB    1 
ATOM 8593  C CG1   . ILE D 3 150 ? -107.990 175.782 123.335 1.00 96.96  ? 150 ILE E CG1   1 
ATOM 8594  C CG2   . ILE D 3 150 ? -105.868 174.961 122.319 1.00 96.96  ? 150 ILE E CG2   1 
ATOM 8595  C CD1   . ILE D 3 150 ? -108.838 175.434 122.153 1.00 96.96  ? 150 ILE E CD1   1 
ATOM 8596  N N     . LEU D 3 151 ? -105.655 172.283 125.073 1.00 97.89  ? 151 LEU E N     1 
ATOM 8597  C CA    . LEU D 3 151 ? -104.482 171.456 125.287 1.00 97.89  ? 151 LEU E CA    1 
ATOM 8598  C C     . LEU D 3 151 ? -104.726 170.015 124.858 1.00 97.89  ? 151 LEU E C     1 
ATOM 8599  O O     . LEU D 3 151 ? -105.862 169.536 124.868 1.00 97.89  ? 151 LEU E O     1 
ATOM 8600  C CB    . LEU D 3 151 ? -104.053 171.480 126.747 1.00 97.89  ? 151 LEU E CB    1 
ATOM 8601  C CG    . LEU D 3 151 ? -103.533 172.815 127.251 1.00 97.89  ? 151 LEU E CG    1 
ATOM 8602  C CD1   . LEU D 3 151 ? -102.965 173.644 126.118 1.00 97.89  ? 151 LEU E CD1   1 
ATOM 8603  C CD2   . LEU D 3 151 ? -104.612 173.538 127.959 1.00 97.89  ? 151 LEU E CD2   1 
ATOM 8604  N N     . PRO D 3 152 ? -103.676 169.306 124.460 1.00 96.96  ? 152 PRO E N     1 
ATOM 8605  C CA    . PRO D 3 152 ? -103.855 167.919 124.034 1.00 96.96  ? 152 PRO E CA    1 
ATOM 8606  C C     . PRO D 3 152 ? -104.316 167.089 125.214 1.00 96.96  ? 152 PRO E C     1 
ATOM 8607  O O     . PRO D 3 152 ? -103.785 167.205 126.317 1.00 96.96  ? 152 PRO E O     1 
ATOM 8608  C CB    . PRO D 3 152 ? -102.455 167.503 123.576 1.00 96.96  ? 152 PRO E CB    1 
ATOM 8609  C CG    . PRO D 3 152 ? -101.545 168.432 124.277 1.00 96.96  ? 152 PRO E CG    1 
ATOM 8610  C CD    . PRO D 3 152 ? -102.271 169.726 124.377 1.00 96.96  ? 152 PRO E CD    1 
ATOM 8611  N N     . ALA D 3 153 ? -105.309 166.243 124.979 1.00 92.76  ? 153 ALA E N     1 
ATOM 8612  C CA    . ALA D 3 153 ? -105.814 165.450 126.085 1.00 92.76  ? 153 ALA E CA    1 
ATOM 8613  C C     . ALA D 3 153 ? -104.893 164.283 126.383 1.00 92.76  ? 153 ALA E C     1 
ATOM 8614  O O     . ALA D 3 153 ? -104.777 163.860 127.536 1.00 92.76  ? 153 ALA E O     1 
ATOM 8615  C CB    . ALA D 3 153 ? -107.223 164.949 125.776 1.00 92.76  ? 153 ALA E CB    1 
ATOM 8616  N N     . ASP D 3 154 ? -104.230 163.753 125.361 1.00 92.59  ? 154 ASP E N     1 
ATOM 8617  C CA    . ASP D 3 154 ? -103.427 162.559 125.564 1.00 92.59  ? 154 ASP E CA    1 
ATOM 8618  C C     . ASP D 3 154 ? -102.219 162.839 126.448 1.00 92.59  ? 154 ASP E C     1 
ATOM 8619  O O     . ASP D 3 154 ? -101.904 162.050 127.342 1.00 92.59  ? 154 ASP E O     1 
ATOM 8620  C CB    . ASP D 3 154 ? -102.995 161.991 124.221 1.00 92.59  ? 154 ASP E CB    1 
ATOM 8621  C CG    . ASP D 3 154 ? -103.102 160.488 124.179 1.00 92.59  ? 154 ASP E CG    1 
ATOM 8622  O OD1   . ASP D 3 154 ? -103.141 159.867 125.258 1.00 92.59  ? 154 ASP E OD1   1 
ATOM 8623  O OD2   . ASP D 3 154 ? -103.161 159.928 123.062 1.00 92.59  ? 154 ASP E OD2   1 
ATOM 8624  N N     . ARG D 3 155 ? -101.539 163.962 126.229 1.00 91.93  ? 155 ARG E N     1 
ATOM 8625  C CA    . ARG D 3 155 ? -100.377 164.285 127.049 1.00 91.93  ? 155 ARG E CA    1 
ATOM 8626  C C     . ARG D 3 155 ? -100.767 164.527 128.496 1.00 91.93  ? 155 ARG E C     1 
ATOM 8627  O O     . ARG D 3 155 ? -100.083 164.071 129.421 1.00 91.93  ? 155 ARG E O     1 
ATOM 8628  C CB    . ARG D 3 155 ? -99.651  165.496 126.482 1.00 91.93  ? 155 ARG E CB    1 
ATOM 8629  C CG    . ARG D 3 155 ? -99.058  165.232 125.130 1.00 91.93  ? 155 ARG E CG    1 
ATOM 8630  C CD    . ARG D 3 155 ? -98.313  166.434 124.653 1.00 91.93  ? 155 ARG E CD    1 
ATOM 8631  N NE    . ARG D 3 155 ? -97.180  166.707 125.526 1.00 91.93  ? 155 ARG E NE    1 
ATOM 8632  C CZ    . ARG D 3 155 ? -96.448  167.807 125.449 1.00 91.93  ? 155 ARG E CZ    1 
ATOM 8633  N NH1   . ARG D 3 155 ? -95.428  167.995 126.270 1.00 91.93  ? 155 ARG E NH1   1 
ATOM 8634  N NH2   . ARG D 3 155 ? -96.741  168.717 124.536 1.00 91.93  ? 155 ARG E NH2   1 
ATOM 8635  N N     . ILE D 3 156 ? -101.883 165.210 128.714 1.00 85.75  ? 156 ILE E N     1 
ATOM 8636  C CA    . ILE D 3 156 ? -102.303 165.468 130.079 1.00 85.75  ? 156 ILE E CA    1 
ATOM 8637  C C     . ILE D 3 156 ? -102.704 164.170 130.751 1.00 85.75  ? 156 ILE E C     1 
ATOM 8638  O O     . ILE D 3 156 ? -102.328 163.910 131.895 1.00 85.75  ? 156 ILE E O     1 
ATOM 8639  C CB    . ILE D 3 156 ? -103.440 166.493 130.101 1.00 85.75  ? 156 ILE E CB    1 
ATOM 8640  C CG1   . ILE D 3 156 ? -102.959 167.807 129.518 1.00 85.75  ? 156 ILE E CG1   1 
ATOM 8641  C CG2   . ILE D 3 156 ? -103.921 166.703 131.503 1.00 85.75  ? 156 ILE E CG2   1 
ATOM 8642  C CD1   . ILE D 3 156 ? -103.989 168.878 129.561 1.00 85.75  ? 156 ILE E CD1   1 
ATOM 8643  N N     . THR D 3 157 ? -103.456 163.328 130.053 1.00 83.98  ? 157 THR E N     1 
ATOM 8644  C CA    . THR D 3 157 ? -103.827 162.054 130.644 1.00 83.98  ? 157 THR E CA    1 
ATOM 8645  C C     . THR D 3 157 ? -102.603 161.198 130.935 1.00 83.98  ? 157 THR E C     1 
ATOM 8646  O O     . THR D 3 157 ? -102.595 160.443 131.910 1.00 83.98  ? 157 THR E O     1 
ATOM 8647  C CB    . THR D 3 157 ? -104.788 161.320 129.724 1.00 83.98  ? 157 THR E CB    1 
ATOM 8648  O OG1   . THR D 3 157 ? -105.860 162.195 129.376 1.00 83.98  ? 157 THR E OG1   1 
ATOM 8649  C CG2   . THR D 3 157 ? -105.355 160.119 130.429 1.00 83.98  ? 157 THR E CG2   1 
ATOM 8650  N N     . GLU D 3 158 ? -101.557 161.310 130.121 1.00 84.60  ? 158 GLU E N     1 
ATOM 8651  C CA    . GLU D 3 158 ? -100.334 160.573 130.407 1.00 84.60  ? 158 GLU E CA    1 
ATOM 8652  C C     . GLU D 3 158 ? -99.612  161.122 131.621 1.00 84.60  ? 158 GLU E C     1 
ATOM 8653  O O     . GLU D 3 158 ? -98.925  160.372 132.319 1.00 84.60  ? 158 GLU E O     1 
ATOM 8654  C CB    . GLU D 3 158 ? -99.396  160.586 129.207 1.00 84.60  ? 158 GLU E CB    1 
ATOM 8655  C CG    . GLU D 3 158 ? -99.909  159.801 128.030 1.00 84.60  ? 158 GLU E CG    1 
ATOM 8656  C CD    . GLU D 3 158 ? -100.123 158.347 128.368 1.00 84.60  ? 158 GLU E CD    1 
ATOM 8657  O OE1   . GLU D 3 158 ? -99.342  157.805 129.177 1.00 84.60  ? 158 GLU E OE1   1 
ATOM 8658  O OE2   . GLU D 3 158 ? -101.075 157.744 127.832 1.00 84.60  ? 158 GLU E OE2   1 
ATOM 8659  N N     . VAL D 3 159 ? -99.727  162.420 131.878 1.00 80.49  ? 159 VAL E N     1 
ATOM 8660  C CA    . VAL D 3 159 ? -99.137  162.958 133.095 1.00 80.49  ? 159 VAL E CA    1 
ATOM 8661  C C     . VAL D 3 159 ? -99.945  162.556 134.316 1.00 80.49  ? 159 VAL E C     1 
ATOM 8662  O O     . VAL D 3 159 ? -99.386  162.191 135.353 1.00 80.49  ? 159 VAL E O     1 
ATOM 8663  C CB    . VAL D 3 159 ? -99.005  164.480 132.988 1.00 80.49  ? 159 VAL E CB    1 
ATOM 8664  C CG1   . VAL D 3 159 ? -98.678  165.046 134.327 1.00 80.49  ? 159 VAL E CG1   1 
ATOM 8665  C CG2   . VAL D 3 159 ? -97.921  164.824 132.006 1.00 80.49  ? 159 VAL E CG2   1 
ATOM 8666  N N     . LEU D 3 160 ? -101.270 162.598 134.216 1.00 76.19  ? 160 LEU E N     1 
ATOM 8667  C CA    . LEU D 3 160 ? -102.117 162.183 135.323 1.00 76.19  ? 160 LEU E CA    1 
ATOM 8668  C C     . LEU D 3 160 ? -102.049 160.694 135.612 1.00 76.19  ? 160 LEU E C     1 
ATOM 8669  O O     . LEU D 3 160 ? -102.533 160.272 136.661 1.00 76.19  ? 160 LEU E O     1 
ATOM 8670  C CB    . LEU D 3 160 ? -103.560 162.589 135.057 1.00 76.19  ? 160 LEU E CB    1 
ATOM 8671  C CG    . LEU D 3 160 ? -103.736 164.089 134.864 1.00 76.19  ? 160 LEU E CG    1 
ATOM 8672  C CD1   . LEU D 3 160 ? -105.168 164.433 134.566 1.00 76.19  ? 160 LEU E CD1   1 
ATOM 8673  C CD2   . LEU D 3 160 ? -103.271 164.820 136.088 1.00 76.19  ? 160 LEU E CD2   1 
ATOM 8674  N N     . LYS D 3 161 ? -101.490 159.885 134.726 1.00 72.34  ? 161 LYS E N     1 
ATOM 8675  C CA    . LYS D 3 161 ? -101.329 158.472 135.033 1.00 72.34  ? 161 LYS E CA    1 
ATOM 8676  C C     . LYS D 3 161 ? -100.071 158.155 135.826 1.00 72.34  ? 161 LYS E C     1 
ATOM 8677  O O     . LYS D 3 161 ? -99.922  157.013 136.265 1.00 72.34  ? 161 LYS E O     1 
ATOM 8678  C CB    . LYS D 3 161 ? -101.296 157.631 133.761 1.00 72.34  ? 161 LYS E CB    1 
ATOM 8679  C CG    . LYS D 3 161 ? -102.605 157.457 133.053 1.00 72.34  ? 161 LYS E CG    1 
ATOM 8680  C CD    . LYS D 3 161 ? -102.384 156.607 131.820 1.00 72.34  ? 161 LYS E CD    1 
ATOM 8681  C CE    . LYS D 3 161 ? -103.655 156.428 131.033 1.00 72.34  ? 161 LYS E CE    1 
ATOM 8682  N NZ    . LYS D 3 161 ? -103.409 155.598 129.831 1.00 72.34  ? 161 LYS E NZ    1 
ATOM 8683  N N     . SER D 3 162 ? -99.165  159.113 136.007 1.00 71.59  ? 162 SER E N     1 
ATOM 8684  C CA    . SER D 3 162 ? -97.921  158.839 136.714 1.00 71.59  ? 162 SER E CA    1 
ATOM 8685  C C     . SER D 3 162 ? -98.185  158.412 138.146 1.00 71.59  ? 162 SER E C     1 
ATOM 8686  O O     . SER D 3 162 ? -99.045  158.966 138.835 1.00 71.59  ? 162 SER E O     1 
ATOM 8687  C CB    . SER D 3 162 ? -97.028  160.069 136.700 1.00 71.59  ? 162 SER E CB    1 
ATOM 8688  O OG    . SER D 3 162 ? -97.648  161.101 137.428 1.00 71.59  ? 162 SER E OG    1 
ATOM 8689  N N     . ARG D 3 163 ? -97.426  157.422 138.595 1.00 67.20  ? 163 ARG E N     1 
ATOM 8690  C CA    . ARG D 3 163 ? -97.663  156.797 139.880 1.00 67.20  ? 163 ARG E CA    1 
ATOM 8691  C C     . ARG D 3 163 ? -96.529  157.098 140.842 1.00 67.20  ? 163 ARG E C     1 
ATOM 8692  O O     . ARG D 3 163 ? -95.357  156.892 140.521 1.00 67.20  ? 163 ARG E O     1 
ATOM 8693  C CB    . ARG D 3 163 ? -97.789  155.284 139.731 1.00 67.20  ? 163 ARG E CB    1 
ATOM 8694  C CG    . ARG D 3 163 ? -98.944  154.829 138.895 1.00 67.20  ? 163 ARG E CG    1 
ATOM 8695  C CD    . ARG D 3 163 ? -98.924  153.327 138.831 1.00 67.20  ? 163 ARG E CD    1 
ATOM 8696  N NE    . ARG D 3 163 ? -100.006 152.785 138.036 1.00 67.20  ? 163 ARG E NE    1 
ATOM 8697  C CZ    . ARG D 3 163 ? -99.899  152.568 136.734 1.00 67.20  ? 163 ARG E CZ    1 
ATOM 8698  N NH1   . ARG D 3 163 ? -98.764  152.852 136.110 1.00 67.20  ? 163 ARG E NH1   1 
ATOM 8699  N NH2   . ARG D 3 163 ? -100.917 152.072 136.050 1.00 67.20  ? 163 ARG E NH2   1 
ATOM 8700  N N     . ASN D 3 164 ? -96.889  157.533 142.034 1.00 65.58  ? 164 ASN E N     1 
ATOM 8701  C CA    . ASN D 3 164 ? -95.961  157.560 143.144 1.00 65.58  ? 164 ASN E CA    1 
ATOM 8702  C C     . ASN D 3 164 ? -95.953  156.187 143.798 1.00 65.58  ? 164 ASN E C     1 
ATOM 8703  O O     . ASN D 3 164 ? -96.780  155.318 143.502 1.00 65.58  ? 164 ASN E O     1 
ATOM 8704  C CB    . ASN D 3 164 ? -96.344  158.622 144.158 1.00 65.58  ? 164 ASN E CB    1 
ATOM 8705  C CG    . ASN D 3 164 ? -95.290  158.840 145.215 1.00 65.58  ? 164 ASN E CG    1 
ATOM 8706  O OD1   . ASN D 3 164 ? -94.504  157.960 145.533 1.00 65.58  ? 164 ASN E OD1   1 
ATOM 8707  N ND2   . ASN D 3 164 ? -95.299  160.020 145.794 1.00 65.58  ? 164 ASN E ND2   1 
ATOM 8708  N N     . VAL D 3 165 ? -94.976  155.997 144.685 1.00 61.60  ? 165 VAL E N     1 
ATOM 8709  C CA    . VAL D 3 165 ? -94.923  154.806 145.529 1.00 61.60  ? 165 VAL E CA    1 
ATOM 8710  C C     . VAL D 3 165 ? -96.203  154.679 146.338 1.00 61.60  ? 165 VAL E C     1 
ATOM 8711  O O     . VAL D 3 165 ? -96.748  153.580 146.500 1.00 61.60  ? 165 VAL E O     1 
ATOM 8712  C CB    . VAL D 3 165 ? -93.699  154.863 146.462 1.00 61.60  ? 165 VAL E CB    1 
ATOM 8713  C CG1   . VAL D 3 165 ? -93.706  153.733 147.427 1.00 61.60  ? 165 VAL E CG1   1 
ATOM 8714  C CG2   . VAL D 3 165 ? -92.473  154.854 145.717 1.00 61.60  ? 165 VAL E CG2   1 
ATOM 8715  N N     . SER D 3 166 ? -96.733  155.805 146.821 1.00 61.38  ? 166 SER E N     1 
ATOM 8716  C CA    . SER D 3 166 ? -97.982  155.757 147.571 1.00 61.38  ? 166 SER E CA    1 
ATOM 8717  C C     . SER D 3 166 ? -99.145  155.390 146.679 1.00 61.38  ? 166 SER E C     1 
ATOM 8718  O O     . SER D 3 166 ? -100.094 154.749 147.131 1.00 61.38  ? 166 SER E O     1 
ATOM 8719  C CB    . SER D 3 166 ? -98.282  157.097 148.225 1.00 61.38  ? 166 SER E CB    1 
ATOM 8720  O OG    . SER D 3 166 ? -97.304  157.476 149.160 1.00 61.38  ? 166 SER E OG    1 
ATOM 8721  N N     . VAL D 3 167 ? -99.121  155.838 145.430 1.00 61.67  ? 167 VAL E N     1 
ATOM 8722  C CA    . VAL D 3 167 ? -100.157 155.438 144.491 1.00 61.67  ? 167 VAL E CA    1 
ATOM 8723  C C     . VAL D 3 167 ? -100.010 153.972 144.137 1.00 61.67  ? 167 VAL E C     1 
ATOM 8724  O O     . VAL D 3 167 ? -100.997 153.238 144.042 1.00 61.67  ? 167 VAL E O     1 
ATOM 8725  C CB    . VAL D 3 167 ? -100.129 156.317 143.241 1.00 61.67  ? 167 VAL E CB    1 
ATOM 8726  C CG1   . VAL D 3 167 ? -101.168 155.850 142.290 1.00 61.67  ? 167 VAL E CG1   1 
ATOM 8727  C CG2   . VAL D 3 167 ? -100.420 157.723 143.611 1.00 61.67  ? 167 VAL E CG2   1 
ATOM 8728  N N     . ASN D 3 168 ? -98.776  153.515 143.962 1.00 61.33  ? 168 ASN E N     1 
ATOM 8729  C CA    . ASN D 3 168 ? -98.551  152.106 143.688 1.00 61.33  ? 168 ASN E CA    1 
ATOM 8730  C C     . ASN D 3 168 ? -99.000  151.242 144.841 1.00 61.33  ? 168 ASN E C     1 
ATOM 8731  O O     . ASN D 3 168 ? -99.440  150.110 144.636 1.00 61.33  ? 168 ASN E O     1 
ATOM 8732  C CB    . ASN D 3 168 ? -97.071  151.863 143.449 1.00 61.33  ? 168 ASN E CB    1 
ATOM 8733  C CG    . ASN D 3 168 ? -96.579  152.545 142.230 1.00 61.33  ? 168 ASN E CG    1 
ATOM 8734  O OD1   . ASN D 3 168 ? -97.279  152.610 141.236 1.00 61.33  ? 168 ASN E OD1   1 
ATOM 8735  N ND2   . ASN D 3 168 ? -95.367  153.073 142.288 1.00 61.33  ? 168 ASN E ND2   1 
ATOM 8736  N N     . LEU D 3 169 ? -98.902  151.760 146.051 1.00 54.19  ? 169 LEU E N     1 
ATOM 8737  C CA    . LEU D 3 169 ? -99.101  150.963 147.244 1.00 54.19  ? 169 LEU E CA    1 
ATOM 8738  C C     . LEU D 3 169 ? -100.548 150.977 147.695 1.00 54.19  ? 169 LEU E C     1 
ATOM 8739  O O     . LEU D 3 169 ? -101.122 149.923 147.976 1.00 54.19  ? 169 LEU E O     1 
ATOM 8740  C CB    . LEU D 3 169 ? -98.194  151.496 148.348 1.00 54.19  ? 169 LEU E CB    1 
ATOM 8741  C CG    . LEU D 3 169 ? -97.718  150.541 149.417 1.00 54.19  ? 169 LEU E CG    1 
ATOM 8742  C CD1   . LEU D 3 169 ? -97.157  149.336 148.750 1.00 54.19  ? 169 LEU E CD1   1 
ATOM 8743  C CD2   . LEU D 3 169 ? -96.652  151.221 150.211 1.00 54.19  ? 169 LEU E CD2   1 
ATOM 8744  N N     . PHE D 3 170 ? -101.167 152.149 147.719 1.00 53.38  ? 170 PHE E N     1 
ATOM 8745  C CA    . PHE D 3 170 ? -102.518 152.280 148.221 1.00 53.38  ? 170 PHE E CA    1 
ATOM 8746  C C     . PHE D 3 170 ? -103.558 152.500 147.144 1.00 53.38  ? 170 PHE E C     1 
ATOM 8747  O O     . PHE D 3 170 ? -104.748 152.520 147.461 1.00 53.38  ? 170 PHE E O     1 
ATOM 8748  C CB    . PHE D 3 170 ? -102.599 153.432 149.216 1.00 53.38  ? 170 PHE E CB    1 
ATOM 8749  C CG    . PHE D 3 170 ? -101.718 153.259 150.389 1.00 53.38  ? 170 PHE E CG    1 
ATOM 8750  C CD1   . PHE D 3 170 ? -102.011 152.323 151.348 1.00 53.38  ? 170 PHE E CD1   1 
ATOM 8751  C CD2   . PHE D 3 170 ? -100.602 154.030 150.544 1.00 53.38  ? 170 PHE E CD2   1 
ATOM 8752  C CE1   . PHE D 3 170 ? -101.197 152.159 152.420 1.00 53.38  ? 170 PHE E CE1   1 
ATOM 8753  C CE2   . PHE D 3 170 ? -99.789  153.870 151.618 1.00 53.38  ? 170 PHE E CE2   1 
ATOM 8754  C CZ    . PHE D 3 170 ? -100.086 152.933 152.557 1.00 53.38  ? 170 PHE E CZ    1 
ATOM 8755  N N     . GLY D 3 171 ? -103.164 152.744 145.909 1.00 59.27  ? 171 GLY E N     1 
ATOM 8756  C CA    . GLY D 3 171 ? -104.136 152.917 144.853 1.00 59.27  ? 171 GLY E CA    1 
ATOM 8757  C C     . GLY D 3 171 ? -104.793 154.280 144.883 1.00 59.27  ? 171 GLY E C     1 
ATOM 8758  O O     . GLY D 3 171 ? -104.712 155.026 145.856 1.00 59.27  ? 171 GLY E O     1 
ATOM 8759  N N     . ARG D 3 172 ? -105.469 154.599 143.787 1.00 61.90  ? 172 ARG E N     1 
ATOM 8760  C CA    . ARG D 3 172 ? -106.156 155.868 143.660 1.00 61.90  ? 172 ARG E CA    1 
ATOM 8761  C C     . ARG D 3 172 ? -107.459 155.629 142.923 1.00 61.90  ? 172 ARG E C     1 
ATOM 8762  O O     . ARG D 3 172 ? -107.675 154.569 142.338 1.00 61.90  ? 172 ARG E O     1 
ATOM 8763  C CB    . ARG D 3 172 ? -105.359 156.901 142.880 1.00 61.90  ? 172 ARG E CB    1 
ATOM 8764  C CG    . ARG D 3 172 ? -105.530 156.695 141.417 1.00 61.90  ? 172 ARG E CG    1 
ATOM 8765  C CD    . ARG D 3 172 ? -104.962 157.808 140.603 1.00 61.90  ? 172 ARG E CD    1 
ATOM 8766  N NE    . ARG D 3 172 ? -103.519 157.847 140.567 1.00 61.90  ? 172 ARG E NE    1 
ATOM 8767  C CZ    . ARG D 3 172 ? -102.851 158.832 139.998 1.00 61.90  ? 172 ARG E CZ    1 
ATOM 8768  N NH1   . ARG D 3 172 ? -101.532 158.832 139.983 1.00 61.90  ? 172 ARG E NH1   1 
ATOM 8769  N NH2   . ARG D 3 172 ? -103.518 159.830 139.454 1.00 61.90  ? 172 ARG E NH2   1 
ATOM 8770  N N     . MET D 3 173 ? -108.327 156.630 142.949 1.00 66.41  ? 173 MET E N     1 
ATOM 8771  C CA    . MET D 3 173 ? -109.586 156.569 142.226 1.00 66.41  ? 173 MET E CA    1 
ATOM 8772  C C     . MET D 3 173 ? -109.890 157.948 141.679 1.00 66.41  ? 173 MET E C     1 
ATOM 8773  O O     . MET D 3 173 ? -109.796 158.940 142.407 1.00 66.41  ? 173 MET E O     1 
ATOM 8774  C CB    . MET D 3 173 ? -110.733 156.111 143.107 1.00 66.41  ? 173 MET E CB    1 
ATOM 8775  C CG    . MET D 3 173 ? -112.058 156.335 142.450 1.00 66.41  ? 173 MET E CG    1 
ATOM 8776  S SD    . MET D 3 173 ? -113.448 155.740 143.390 1.00 66.41  ? 173 MET E SD    1 
ATOM 8777  C CE    . MET D 3 173 ? -114.765 156.472 142.443 1.00 66.41  ? 173 MET E CE    1 
ATOM 8778  N N     . LEU D 3 174 ? -110.260 157.982 140.409 1.00 68.92  ? 174 LEU E N     1 
ATOM 8779  C CA    . LEU D 3 174 ? -110.679 159.184 139.731 1.00 68.92  ? 174 LEU E CA    1 
ATOM 8780  C C     . LEU D 3 174 ? -111.927 158.739 138.993 1.00 68.92  ? 174 LEU E C     1 
ATOM 8781  O O     . LEU D 3 174 ? -111.858 157.809 138.203 1.00 68.92  ? 174 LEU E O     1 
ATOM 8782  C CB    . LEU D 3 174 ? -109.612 159.633 138.740 1.00 68.92  ? 174 LEU E CB    1 
ATOM 8783  C CG    . LEU D 3 174 ? -108.990 161.009 138.951 1.00 68.92  ? 174 LEU E CG    1 
ATOM 8784  C CD1   . LEU D 3 174 ? -109.775 162.068 138.201 1.00 68.92  ? 174 LEU E CD1   1 
ATOM 8785  C CD2   . LEU D 3 174 ? -108.930 161.329 140.431 1.00 68.92  ? 174 LEU E CD2   1 
ATOM 8786  N N     . ALA D 3 175 ? -113.065 159.377 139.216 1.00 70.53  ? 175 ALA E N     1 
ATOM 8787  C CA    . ALA D 3 175 ? -114.258 158.948 138.500 1.00 70.53  ? 175 ALA E CA    1 
ATOM 8788  C C     . ALA D 3 175 ? -114.315 159.497 137.084 1.00 70.53  ? 175 ALA E C     1 
ATOM 8789  O O     . ALA D 3 175 ? -114.769 158.797 136.177 1.00 70.53  ? 175 ALA E O     1 
ATOM 8790  C CB    . ALA D 3 175 ? -115.500 159.368 139.275 1.00 70.53  ? 175 ALA E CB    1 
ATOM 8791  N N     . GLU D 3 176 ? -113.888 160.739 136.863 1.00 73.96  ? 176 GLU E N     1 
ATOM 8792  C CA    . GLU D 3 176 ? -113.932 161.267 135.504 1.00 73.96  ? 176 GLU E CA    1 
ATOM 8793  C C     . GLU D 3 176 ? -112.876 160.659 134.596 1.00 73.96  ? 176 GLU E C     1 
ATOM 8794  O O     . GLU D 3 176 ? -113.060 160.642 133.378 1.00 73.96  ? 176 GLU E O     1 
ATOM 8795  C CB    . GLU D 3 176 ? -113.777 162.780 135.502 1.00 73.96  ? 176 GLU E CB    1 
ATOM 8796  C CG    . GLU D 3 176 ? -114.924 163.528 136.111 1.00 73.96  ? 176 GLU E CG    1 
ATOM 8797  C CD    . GLU D 3 176 ? -114.824 163.603 137.598 1.00 73.96  ? 176 GLU E CD    1 
ATOM 8798  O OE1   . GLU D 3 176 ? -113.929 162.944 138.158 1.00 73.96  ? 176 GLU E OE1   1 
ATOM 8799  O OE2   . GLU D 3 176 ? -115.625 164.337 138.207 1.00 73.96  ? 176 GLU E OE2   1 
ATOM 8800  N N     . LEU D 3 177 ? -111.778 160.155 135.144 1.00 70.68  ? 177 LEU E N     1 
ATOM 8801  C CA    . LEU D 3 177 ? -110.708 159.577 134.342 1.00 70.68  ? 177 LEU E CA    1 
ATOM 8802  C C     . LEU D 3 177 ? -110.445 158.175 134.855 1.00 70.68  ? 177 LEU E C     1 
ATOM 8803  O O     . LEU D 3 177 ? -109.469 157.933 135.576 1.00 70.68  ? 177 LEU E O     1 
ATOM 8804  C CB    . LEU D 3 177 ? -109.442 160.421 134.409 1.00 70.68  ? 177 LEU E CB    1 
ATOM 8805  C CG    . LEU D 3 177 ? -109.570 161.777 133.746 1.00 70.68  ? 177 LEU E CG    1 
ATOM 8806  C CD1   . LEU D 3 177 ? -108.364 162.611 134.074 1.00 70.68  ? 177 LEU E CD1   1 
ATOM 8807  C CD2   . LEU D 3 177 ? -109.687 161.575 132.264 1.00 70.68  ? 177 LEU E CD2   1 
ATOM 8808  N N     . PRO D 3 178 ? -111.275 157.215 134.464 1.00 68.01  ? 178 PRO E N     1 
ATOM 8809  C CA    . PRO D 3 178 ? -111.064 155.831 134.891 1.00 68.01  ? 178 PRO E CA    1 
ATOM 8810  C C     . PRO D 3 178 ? -109.797 155.211 134.351 1.00 68.01  ? 178 PRO E C     1 
ATOM 8811  O O     . PRO D 3 178 ? -109.446 154.108 134.776 1.00 68.01  ? 178 PRO E O     1 
ATOM 8812  C CB    . PRO D 3 178 ? -112.308 155.117 134.363 1.00 68.01  ? 178 PRO E CB    1 
ATOM 8813  C CG    . PRO D 3 178 ? -112.721 155.932 133.228 1.00 68.01  ? 178 PRO E CG    1 
ATOM 8814  C CD    . PRO D 3 178 ? -112.421 157.344 133.562 1.00 68.01  ? 178 PRO E CD    1 
ATOM 8815  N N     . SER D 3 179 ? -109.116 155.859 133.413 1.00 67.33  ? 179 SER E N     1 
ATOM 8816  C CA    . SER D 3 179 ? -107.850 155.327 132.936 1.00 67.33  ? 179 SER E CA    1 
ATOM 8817  C C     . SER D 3 179 ? -106.746 155.484 133.967 1.00 67.33  ? 179 SER E C     1 
ATOM 8818  O O     . SER D 3 179 ? -105.768 154.732 133.938 1.00 67.33  ? 179 SER E O     1 
ATOM 8819  C CB    . SER D 3 179 ? -107.451 156.019 131.639 1.00 67.33  ? 179 SER E CB    1 
ATOM 8820  O OG    . SER D 3 179 ? -107.391 157.418 131.823 1.00 67.33  ? 179 SER E OG    1 
ATOM 8821  N N     . THR D 3 180 ? -106.880 156.443 134.875 1.00 67.28  ? 180 THR E N     1 
ATOM 8822  C CA    . THR D 3 180 ? -105.867 156.736 135.875 1.00 67.28  ? 180 THR E CA    1 
ATOM 8823  C C     . THR D 3 180 ? -106.019 155.923 137.151 1.00 67.28  ? 180 THR E C     1 
ATOM 8824  O O     . THR D 3 180 ? -105.101 155.918 137.975 1.00 67.28  ? 180 THR E O     1 
ATOM 8825  C CB    . THR D 3 180 ? -105.907 158.210 136.239 1.00 67.28  ? 180 THR E CB    1 
ATOM 8826  O OG1   . THR D 3 180 ? -107.150 158.494 136.876 1.00 67.28  ? 180 THR E OG1   1 
ATOM 8827  C CG2   . THR D 3 180 ? -105.808 159.036 135.000 1.00 67.28  ? 180 THR E CG2   1 
ATOM 8828  N N     . GLU D 3 181 ? -107.142 155.245 137.336 1.00 65.99  ? 181 GLU E N     1 
ATOM 8829  C CA    . GLU D 3 181 ? -107.366 154.488 138.557 1.00 65.99  ? 181 GLU E CA    1 
ATOM 8830  C C     . GLU D 3 181 ? -106.360 153.359 138.691 1.00 65.99  ? 181 GLU E C     1 
ATOM 8831  O O     . GLU D 3 181 ? -106.066 152.652 137.727 1.00 65.99  ? 181 GLU E O     1 
ATOM 8832  C CB    . GLU D 3 181 ? -108.778 153.921 138.579 1.00 65.99  ? 181 GLU E CB    1 
ATOM 8833  C CG    . GLU D 3 181 ? -109.860 154.965 138.692 1.00 65.99  ? 181 GLU E CG    1 
ATOM 8834  C CD    . GLU D 3 181 ? -111.244 154.356 138.724 1.00 65.99  ? 181 GLU E CD    1 
ATOM 8835  O OE1   . GLU D 3 181 ? -111.356 153.130 138.534 1.00 65.99  ? 181 GLU E OE1   1 
ATOM 8836  O OE2   . GLU D 3 181 ? -112.223 155.098 138.927 1.00 65.99  ? 181 GLU E OE2   1 
ATOM 8837  N N     . VAL D 3 182 ? -105.815 153.212 139.893 1.00 63.63  ? 182 VAL E N     1 
ATOM 8838  C CA    . VAL D 3 182 ? -104.802 152.215 140.197 1.00 63.63  ? 182 VAL E CA    1 
ATOM 8839  C C     . VAL D 3 182 ? -105.330 151.353 141.329 1.00 63.63  ? 182 VAL E C     1 
ATOM 8840  O O     . VAL D 3 182 ? -105.817 151.875 142.336 1.00 63.63  ? 182 VAL E O     1 
ATOM 8841  C CB    . VAL D 3 182 ? -103.473 152.867 140.598 1.00 63.63  ? 182 VAL E CB    1 
ATOM 8842  C CG1   . VAL D 3 182 ? -102.459 151.813 140.918 1.00 63.63  ? 182 VAL E CG1   1 
ATOM 8843  C CG2   . VAL D 3 182 ? -102.983 153.761 139.497 1.00 63.63  ? 182 VAL E CG2   1 
ATOM 8844  N N     . ASP D 3 183 ? -105.236 150.039 141.165 1.00 68.58  ? 183 ASP E N     1 
ATOM 8845  C CA    . ASP D 3 183 ? -105.669 149.121 142.206 1.00 68.58  ? 183 ASP E CA    1 
ATOM 8846  C C     . ASP D 3 183 ? -104.687 149.149 143.363 1.00 68.58  ? 183 ASP E C     1 
ATOM 8847  O O     . ASP D 3 183 ? -103.479 149.033 143.162 1.00 68.58  ? 183 ASP E O     1 
ATOM 8848  C CB    . ASP D 3 183 ? -105.731 147.707 141.653 1.00 68.58  ? 183 ASP E CB    1 
ATOM 8849  C CG    . ASP D 3 183 ? -105.467 147.655 140.168 1.00 68.58  ? 183 ASP E CG    1 
ATOM 8850  O OD1   . ASP D 3 183 ? -105.697 148.672 139.487 1.00 68.58  ? 183 ASP E OD1   1 
ATOM 8851  O OD2   . ASP D 3 183 ? -104.959 146.619 139.689 1.00 68.58  ? 183 ASP E OD2   1 
ATOM 8852  N N     . GLY D 3 184 ? -105.197 149.285 144.578 1.00 59.34  ? 184 GLY E N     1 
ATOM 8853  C CA    . GLY D 3 184 ? -104.317 149.287 145.726 1.00 59.34  ? 184 GLY E CA    1 
ATOM 8854  C C     . GLY D 3 184 ? -103.717 147.919 145.973 1.00 59.34  ? 184 GLY E C     1 
ATOM 8855  O O     . GLY D 3 184 ? -104.322 146.888 145.682 1.00 59.34  ? 184 GLY E O     1 
ATOM 8856  N N     . ALA D 3 185 ? -102.485 147.908 146.468 1.00 52.22  ? 185 ALA E N     1 
ATOM 8857  C CA    . ALA D 3 185 ? -101.813 146.667 146.801 1.00 52.22  ? 185 ALA E CA    1 
ATOM 8858  C C     . ALA D 3 185 ? -101.783 146.381 148.292 1.00 52.22  ? 185 ALA E C     1 
ATOM 8859  O O     . ALA D 3 185 ? -101.120 145.430 148.704 1.00 52.22  ? 185 ALA E O     1 
ATOM 8860  C CB    . ALA D 3 185 ? -100.388 146.677 146.259 1.00 52.22  ? 185 ALA E CB    1 
ATOM 8861  N N     . VAL D 3 186 ? -102.475 147.164 149.112 1.00 45.56  ? 186 VAL E N     1 
ATOM 8862  C CA    . VAL D 3 186 ? -102.390 147.039 150.562 1.00 45.56  ? 186 VAL E CA    1 
ATOM 8863  C C     . VAL D 3 186 ? -103.781 147.023 151.161 1.00 45.56  ? 186 VAL E C     1 
ATOM 8864  O O     . VAL D 3 186 ? -104.588 147.910 150.876 1.00 45.56  ? 186 VAL E O     1 
ATOM 8865  C CB    . VAL D 3 186 ? -101.568 148.183 151.164 1.00 45.56  ? 186 VAL E CB    1 
ATOM 8866  C CG1   . VAL D 3 186 ? -101.914 148.367 152.606 1.00 45.56  ? 186 VAL E CG1   1 
ATOM 8867  C CG2   . VAL D 3 186 ? -100.121 147.883 151.016 1.00 45.56  ? 186 VAL E CG2   1 
ATOM 8868  N N     . GLN D 3 187 ? -104.060 146.032 152.000 1.00 43.02  ? 187 GLN E N     1 
ATOM 8869  C CA    . GLN D 3 187 ? -105.281 146.009 152.797 1.00 43.02  ? 187 GLN E CA    1 
ATOM 8870  C C     . GLN D 3 187 ? -104.958 146.399 154.228 1.00 43.02  ? 187 GLN E C     1 
ATOM 8871  O O     . GLN D 3 187 ? -104.191 145.714 154.897 1.00 43.02  ? 187 GLN E O     1 
ATOM 8872  C CB    . GLN D 3 187 ? -105.911 144.631 152.745 1.00 43.02  ? 187 GLN E CB    1 
ATOM 8873  C CG    . GLN D 3 187 ? -106.227 144.201 151.354 1.00 43.02  ? 187 GLN E CG    1 
ATOM 8874  C CD    . GLN D 3 187 ? -106.771 142.811 151.308 1.00 43.02  ? 187 GLN E CD    1 
ATOM 8875  O OE1   . GLN D 3 187 ? -106.597 142.044 152.243 1.00 43.02  ? 187 GLN E OE1   1 
ATOM 8876  N NE2   . GLN D 3 187 ? -107.439 142.472 150.225 1.00 43.02  ? 187 GLN E NE2   1 
ATOM 8877  N N     . PHE D 3 188 ? -105.560 147.469 154.715 1.00 40.77  ? 188 PHE E N     1 
ATOM 8878  C CA    . PHE D 3 188 ? -105.220 147.986 156.030 1.00 40.77  ? 188 PHE E CA    1 
ATOM 8879  C C     . PHE D 3 188 ? -106.437 147.852 156.937 1.00 40.77  ? 188 PHE E C     1 
ATOM 8880  O O     . PHE D 3 188 ? -107.416 148.574 156.755 1.00 40.77  ? 188 PHE E O     1 
ATOM 8881  C CB    . PHE D 3 188 ? -104.823 149.441 155.872 1.00 40.77  ? 188 PHE E CB    1 
ATOM 8882  C CG    . PHE D 3 188 ? -103.733 149.863 156.752 1.00 40.77  ? 188 PHE E CG    1 
ATOM 8883  C CD1   . PHE D 3 188 ? -103.945 150.192 158.055 1.00 40.77  ? 188 PHE E CD1   1 
ATOM 8884  C CD2   . PHE D 3 188 ? -102.452 149.848 156.272 1.00 40.77  ? 188 PHE E CD2   1 
ATOM 8885  C CE1   . PHE D 3 188 ? -102.904 150.550 158.840 1.00 40.77  ? 188 PHE E CE1   1 
ATOM 8886  C CE2   . PHE D 3 188 ? -101.420 150.216 157.044 1.00 40.77  ? 188 PHE E CE2   1 
ATOM 8887  C CZ    . PHE D 3 188 ? -101.639 150.563 158.333 1.00 40.77  ? 188 PHE E CZ    1 
ATOM 8888  N N     . ALA D 3 189 ? -106.382 146.970 157.927 1.00 39.53  ? 189 ALA E N     1 
ATOM 8889  C CA    . ALA D 3 189 ? -107.516 146.793 158.831 1.00 39.53  ? 189 ALA E CA    1 
ATOM 8890  C C     . ALA D 3 189 ? -107.624 147.871 159.905 1.00 39.53  ? 189 ALA E C     1 
ATOM 8891  O O     . ALA D 3 189 ? -106.638 148.477 160.314 1.00 39.53  ? 189 ALA E O     1 
ATOM 8892  C CB    . ALA D 3 189 ? -107.443 145.434 159.509 1.00 39.53  ? 189 ALA E CB    1 
ATOM 8893  N N     . HIS D 3 190 ? -108.849 148.060 160.389 1.00 39.11  ? 190 HIS E N     1 
ATOM 8894  C CA    . HIS D 3 190 ? -109.139 148.926 161.526 1.00 39.11  ? 190 HIS E CA    1 
ATOM 8895  C C     . HIS D 3 190 ? -108.613 148.339 162.828 1.00 39.11  ? 190 HIS E C     1 
ATOM 8896  O O     . HIS D 3 190 ? -109.096 147.311 163.299 1.00 39.11  ? 190 HIS E O     1 
ATOM 8897  C CB    . HIS D 3 190 ? -110.645 149.127 161.639 1.00 39.11  ? 190 HIS E CB    1 
ATOM 8898  C CG    . HIS D 3 190 ? -111.232 150.000 160.578 1.00 39.11  ? 190 HIS E CG    1 
ATOM 8899  N ND1   . HIS D 3 190 ? -111.398 151.354 160.743 1.00 39.11  ? 190 HIS E ND1   1 
ATOM 8900  C CD2   . HIS D 3 190 ? -111.618 149.728 159.312 1.00 39.11  ? 190 HIS E CD2   1 
ATOM 8901  C CE1   . HIS D 3 190 ? -111.920 151.867 159.646 1.00 39.11  ? 190 HIS E CE1   1 
ATOM 8902  N NE2   . HIS D 3 190 ? -112.055 150.903 158.759 1.00 39.11  ? 190 HIS E NE2   1 
ATOM 8903  N N     . ALA D 3 191 ? -107.637 149.007 163.418 1.00 38.72  ? 191 ALA E N     1 
ATOM 8904  C CA    . ALA D 3 191 ? -107.026 148.586 164.672 1.00 38.72  ? 191 ALA E CA    1 
ATOM 8905  C C     . ALA D 3 191 ? -107.998 148.721 165.832 1.00 38.72  ? 191 ALA E C     1 
ATOM 8906  O O     . ALA D 3 191 ? -108.321 149.832 166.239 1.00 38.72  ? 191 ALA E O     1 
ATOM 8907  C CB    . ALA D 3 191 ? -105.773 149.405 164.940 1.00 38.72  ? 191 ALA E CB    1 
ATOM 8908  N N     . PHE D 3 192 ? -108.474 147.603 166.367 1.00 38.82  ? 192 PHE E N     1 
ATOM 8909  C CA    . PHE D 3 192 ? -109.361 147.616 167.523 1.00 38.82  ? 192 PHE E CA    1 
ATOM 8910  C C     . PHE D 3 192 ? -108.656 147.051 168.747 1.00 38.82  ? 192 PHE E C     1 
ATOM 8911  O O     . PHE D 3 192 ? -107.598 146.440 168.639 1.00 38.82  ? 192 PHE E O     1 
ATOM 8912  C CB    . PHE D 3 192 ? -110.629 146.815 167.257 1.00 38.82  ? 192 PHE E CB    1 
ATOM 8913  C CG    . PHE D 3 192 ? -110.378 145.386 166.934 1.00 38.82  ? 192 PHE E CG    1 
ATOM 8914  C CD1   . PHE D 3 192 ? -110.147 144.988 165.648 1.00 38.82  ? 192 PHE E CD1   1 
ATOM 8915  C CD2   . PHE D 3 192 ? -110.385 144.441 167.919 1.00 38.82  ? 192 PHE E CD2   1 
ATOM 8916  C CE1   . PHE D 3 192 ? -109.923 143.682 165.363 1.00 38.82  ? 192 PHE E CE1   1 
ATOM 8917  C CE2   . PHE D 3 192 ? -110.160 143.139 167.630 1.00 38.82  ? 192 PHE E CE2   1 
ATOM 8918  C CZ    . PHE D 3 192 ? -109.929 142.760 166.357 1.00 38.82  ? 192 PHE E CZ    1 
ATOM 8919  N N     . THR D 3 193 ? -109.244 147.275 169.924 1.00 44.16  ? 193 THR E N     1 
ATOM 8920  C CA    . THR D 3 193 ? -108.653 146.781 171.160 1.00 44.16  ? 193 THR E CA    1 
ATOM 8921  C C     . THR D 3 193 ? -108.937 145.309 171.345 1.00 44.16  ? 193 THR E C     1 
ATOM 8922  O O     . THR D 3 193 ? -109.988 144.804 170.961 1.00 44.16  ? 193 THR E O     1 
ATOM 8923  C CB    . THR D 3 193 ? -109.225 147.443 172.398 1.00 44.16  ? 193 THR E CB    1 
ATOM 8924  O OG1   . THR D 3 193 ? -110.638 147.326 172.370 1.00 44.16  ? 193 THR E OG1   1 
ATOM 8925  C CG2   . THR D 3 193 ? -108.907 148.823 172.472 1.00 44.16  ? 193 THR E CG2   1 
ATOM 8926  N N     . VAL D 3 194 ? -107.986 144.622 171.958 1.00 46.19  ? 194 VAL E N     1 
ATOM 8927  C CA    . VAL D 3 194 ? -108.209 143.240 172.330 1.00 46.19  ? 194 VAL E CA    1 
ATOM 8928  C C     . VAL D 3 194 ? -109.303 143.129 173.382 1.00 46.19  ? 194 VAL E C     1 
ATOM 8929  O O     . VAL D 3 194 ? -110.105 142.195 173.360 1.00 46.19  ? 194 VAL E O     1 
ATOM 8930  C CB    . VAL D 3 194 ? -106.895 142.636 172.822 1.00 46.19  ? 194 VAL E CB    1 
ATOM 8931  C CG1   . VAL D 3 194 ? -107.144 141.297 173.373 1.00 46.19  ? 194 VAL E CG1   1 
ATOM 8932  C CG2   . VAL D 3 194 ? -105.937 142.554 171.684 1.00 46.19  ? 194 VAL E CG2   1 
ATOM 8933  N N     . HIS D 3 195 ? -109.364 144.080 174.303 1.00 50.10  ? 195 HIS E N     1 
ATOM 8934  C CA    . HIS D 3 195 ? -110.281 144.057 175.432 1.00 50.10  ? 195 HIS E CA    1 
ATOM 8935  C C     . HIS D 3 195 ? -111.344 145.135 175.314 1.00 50.10  ? 195 HIS E C     1 
ATOM 8936  O O     . HIS D 3 195 ? -111.157 146.142 174.638 1.00 50.10  ? 195 HIS E O     1 
ATOM 8937  C CB    . HIS D 3 195 ? -109.520 144.295 176.710 1.00 50.10  ? 195 HIS E CB    1 
ATOM 8938  C CG    . HIS D 3 195 ? -108.838 145.617 176.727 1.00 50.10  ? 195 HIS E CG    1 
ATOM 8939  N ND1   . HIS D 3 195 ? -107.635 145.831 176.104 1.00 50.10  ? 195 HIS E ND1   1 
ATOM 8940  C CD2   . HIS D 3 195 ? -109.218 146.808 177.235 1.00 50.10  ? 195 HIS E CD2   1 
ATOM 8941  C CE1   . HIS D 3 195 ? -107.284 147.092 176.255 1.00 50.10  ? 195 HIS E CE1   1 
ATOM 8942  N NE2   . HIS D 3 195 ? -108.228 147.708 176.939 1.00 50.10  ? 195 HIS E NE2   1 
ATOM 8943  N N     . GLY D 3 196 ? -112.454 144.940 176.016 1.00 50.52  ? 196 GLY E N     1 
ATOM 8944  C CA    . GLY D 3 196 ? -113.504 145.943 176.010 1.00 50.52  ? 196 GLY E CA    1 
ATOM 8945  C C     . GLY D 3 196 ? -113.109 147.191 176.774 1.00 50.52  ? 196 GLY E C     1 
ATOM 8946  O O     . GLY D 3 196 ? -112.520 147.122 177.852 1.00 50.52  ? 196 GLY E O     1 
ATOM 8947  N N     . THR D 3 197 ? -113.421 148.350 176.198 1.00 53.61  ? 197 THR E N     1 
ATOM 8948  C CA    . THR D 3 197 ? -112.996 149.630 176.745 1.00 53.61  ? 197 THR E CA    1 
ATOM 8949  C C     . THR D 3 197 ? -114.178 150.572 176.856 1.00 53.61  ? 197 THR E C     1 
ATOM 8950  O O     . THR D 3 197 ? -114.852 150.832 175.859 1.00 53.61  ? 197 THR E O     1 
ATOM 8951  C CB    . THR D 3 197 ? -111.950 150.296 175.865 1.00 53.61  ? 197 THR E CB    1 
ATOM 8952  O OG1   . THR D 3 197 ? -112.526 150.554 174.586 1.00 53.61  ? 197 THR E OG1   1 
ATOM 8953  C CG2   . THR D 3 197 ? -110.775 149.397 175.680 1.00 53.61  ? 197 THR E CG2   1 
ATOM 8954  N N     . THR D 3 198 ? -114.424 151.094 178.043 1.00 61.70  ? 198 THR E N     1 
ATOM 8955  C CA    . THR D 3 198 ? -115.409 152.151 178.197 1.00 61.70  ? 198 THR E CA    1 
ATOM 8956  C C     . THR D 3 198 ? -114.714 153.490 177.998 1.00 61.70  ? 198 THR E C     1 
ATOM 8957  O O     . THR D 3 198 ? -113.564 153.675 178.401 1.00 61.70  ? 198 THR E O     1 
ATOM 8958  C CB    . THR D 3 198 ? -116.120 152.103 179.544 1.00 61.70  ? 198 THR E CB    1 
ATOM 8959  O OG1   . THR D 3 198 ? -117.126 153.117 179.575 1.00 61.70  ? 198 THR E OG1   1 
ATOM 8960  C CG2   . THR D 3 198 ? -115.165 152.359 180.640 1.00 61.70  ? 198 THR E CG2   1 
ATOM 8961  N N     . VAL D 3 199 ? -115.392 154.404 177.314 1.00 63.72  ? 199 VAL E N     1 
ATOM 8962  C CA    . VAL D 3 199 ? -114.789 155.684 176.981 1.00 63.72  ? 199 VAL E CA    1 
ATOM 8963  C C     . VAL D 3 199 ? -114.639 156.475 178.269 1.00 63.72  ? 199 VAL E C     1 
ATOM 8964  O O     . VAL D 3 199 ? -115.594 156.643 179.034 1.00 63.72  ? 199 VAL E O     1 
ATOM 8965  C CB    . VAL D 3 199 ? -115.639 156.423 175.940 1.00 63.72  ? 199 VAL E CB    1 
ATOM 8966  C CG1   . VAL D 3 199 ? -117.022 156.770 176.486 1.00 63.72  ? 199 VAL E CG1   1 
ATOM 8967  C CG2   . VAL D 3 199 ? -114.918 157.644 175.453 1.00 63.72  ? 199 VAL E CG2   1 
ATOM 8968  N N     . GLU D 3 200 ? -113.424 156.941 178.528 1.00 70.40  ? 200 GLU E N     1 
ATOM 8969  C CA    . GLU D 3 200 ? -113.107 157.657 179.754 1.00 70.40  ? 200 GLU E CA    1 
ATOM 8970  C C     . GLU D 3 200 ? -113.141 159.151 179.499 1.00 70.40  ? 200 GLU E C     1 
ATOM 8971  O O     . GLU D 3 200 ? -112.403 159.644 178.650 1.00 70.40  ? 200 GLU E O     1 
ATOM 8972  C CB    . GLU D 3 200 ? -111.711 157.249 180.217 1.00 70.40  ? 200 GLU E CB    1 
ATOM 8973  C CG    . GLU D 3 200 ? -111.187 158.006 181.408 1.00 70.40  ? 200 GLU E CG    1 
ATOM 8974  C CD    . GLU D 3 200 ? -111.777 157.506 182.686 1.00 70.40  ? 200 GLU E CD    1 
ATOM 8975  O OE1   . GLU D 3 200 ? -111.843 156.271 182.825 1.00 70.40  ? 200 GLU E OE1   1 
ATOM 8976  O OE2   . GLU D 3 200 ? -112.184 158.325 183.539 1.00 70.40  ? 200 GLU E OE2   1 
ATOM 8977  N N     . VAL D 3 201 ? -113.972 159.871 180.249 1.00 70.84  ? 201 VAL E N     1 
ATOM 8978  C CA    . VAL D 3 201 ? -114.159 161.303 180.047 1.00 70.84  ? 201 VAL E CA    1 
ATOM 8979  C C     . VAL D 3 201 ? -113.283 162.102 180.998 1.00 70.84  ? 201 VAL E C     1 
ATOM 8980  O O     . VAL D 3 201 ? -113.348 161.902 182.213 1.00 70.84  ? 201 VAL E O     1 
ATOM 8981  C CB    . VAL D 3 201 ? -115.623 161.706 180.267 1.00 70.84  ? 201 VAL E CB    1 
ATOM 8982  C CG1   . VAL D 3 201 ? -115.814 163.113 179.824 1.00 70.84  ? 201 VAL E CG1   1 
ATOM 8983  C CG2   . VAL D 3 201 ? -116.550 160.796 179.541 1.00 70.84  ? 201 VAL E CG2   1 
ATOM 8984  N N     . ASP D 3 202 ? -112.490 163.028 180.461 1.00 72.75  ? 202 ASP E N     1 
ATOM 8985  C CA    . ASP D 3 202 ? -111.638 163.902 181.262 1.00 72.75  ? 202 ASP E CA    1 
ATOM 8986  C C     . ASP D 3 202 ? -112.288 165.278 181.226 1.00 72.75  ? 202 ASP E C     1 
ATOM 8987  O O     . ASP D 3 202 ? -112.295 165.928 180.179 1.00 72.75  ? 202 ASP E O     1 
ATOM 8988  C CB    . ASP D 3 202 ? -110.216 163.965 180.718 1.00 72.75  ? 202 ASP E CB    1 
ATOM 8989  C CG    . ASP D 3 202 ? -109.384 165.042 181.384 1.00 72.75  ? 202 ASP E CG    1 
ATOM 8990  O OD1   . ASP D 3 202 ? -108.944 164.818 182.532 1.00 72.75  ? 202 ASP E OD1   1 
ATOM 8991  O OD2   . ASP D 3 202 ? -109.143 166.089 180.754 1.00 72.75  ? 202 ASP E OD2   1 
ATOM 8992  N N     . PHE D 3 203 ? -112.819 165.735 182.354 1.00 74.92  ? 203 PHE E N     1 
ATOM 8993  C CA    . PHE D 3 203 ? -113.357 167.089 182.451 1.00 74.92  ? 203 PHE E CA    1 
ATOM 8994  C C     . PHE D 3 203 ? -112.198 168.073 182.579 1.00 74.92  ? 203 PHE E C     1 
ATOM 8995  O O     . PHE D 3 203 ? -111.439 167.987 183.543 1.00 74.92  ? 203 PHE E O     1 
ATOM 8996  C CB    . PHE D 3 203 ? -114.288 167.198 183.647 1.00 74.92  ? 203 PHE E CB    1 
ATOM 8997  C CG    . PHE D 3 203 ? -114.744 168.582 183.923 1.00 74.92  ? 203 PHE E CG    1 
ATOM 8998  C CD1   . PHE D 3 203 ? -115.854 169.064 183.269 1.00 74.92  ? 203 PHE E CD1   1 
ATOM 8999  C CD2   . PHE D 3 203 ? -114.055 169.421 184.769 1.00 74.92  ? 203 PHE E CD2   1 
ATOM 9000  C CE1   . PHE D 3 203 ? -116.304 170.327 183.492 1.00 74.92  ? 203 PHE E CE1   1 
ATOM 9001  C CE2   . PHE D 3 203 ? -114.497 170.697 184.986 1.00 74.92  ? 203 PHE E CE2   1 
ATOM 9002  C CZ    . PHE D 3 203 ? -115.620 171.149 184.347 1.00 74.92  ? 203 PHE E CZ    1 
ATOM 9003  N N     . PHE D 3 204 ? -112.085 169.021 181.657 1.00 74.91  ? 204 PHE E N     1 
ATOM 9004  C CA    . PHE D 3 204 ? -111.011 170.003 181.711 1.00 74.91  ? 204 PHE E CA    1 
ATOM 9005  C C     . PHE D 3 204 ? -111.489 171.443 181.592 1.00 74.91  ? 204 PHE E C     1 
ATOM 9006  O O     . PHE D 3 204 ? -112.522 171.716 181.003 1.00 74.91  ? 204 PHE E O     1 
ATOM 9007  C CB    . PHE D 3 204 ? -109.979 169.730 180.618 1.00 74.91  ? 204 PHE E CB    1 
ATOM 9008  C CG    . PHE D 3 204 ? -110.384 170.229 179.261 1.00 74.91  ? 204 PHE E CG    1 
ATOM 9009  C CD1   . PHE D 3 204 ? -110.380 171.576 178.973 1.00 74.91  ? 204 PHE E CD1   1 
ATOM 9010  C CD2   . PHE D 3 204 ? -110.770 169.350 178.282 1.00 74.91  ? 204 PHE E CD2   1 
ATOM 9011  C CE1   . PHE D 3 204 ? -110.761 172.037 177.737 1.00 74.91  ? 204 PHE E CE1   1 
ATOM 9012  C CE2   . PHE D 3 204 ? -111.149 169.803 177.043 1.00 74.91  ? 204 PHE E CE2   1 
ATOM 9013  C CZ    . PHE D 3 204 ? -111.146 171.149 176.769 1.00 74.91  ? 204 PHE E CZ    1 
ATOM 9014  N N     . THR D 3 205 ? -110.704 172.356 182.146 1.00 78.81  ? 205 THR E N     1 
ATOM 9015  C CA    . THR D 3 205 ? -110.978 173.792 182.121 1.00 78.81  ? 205 THR E CA    1 
ATOM 9016  C C     . THR D 3 205 ? -109.735 174.613 181.822 1.00 78.81  ? 205 THR E C     1 
ATOM 9017  O O     . THR D 3 205 ? -108.684 174.397 182.429 1.00 78.81  ? 205 THR E O     1 
ATOM 9018  C CB    . THR D 3 205 ? -111.503 174.268 183.457 1.00 78.81  ? 205 THR E CB    1 
ATOM 9019  O OG1   . THR D 3 205 ? -110.547 173.930 184.462 1.00 78.81  ? 205 THR E OG1   1 
ATOM 9020  C CG2   . THR D 3 205 ? -112.799 173.593 183.770 1.00 78.81  ? 205 THR E CG2   1 
ATOM 9021  N N     . ALA D 3 206 ? -109.869 175.568 180.904 1.00 85.21  ? 206 ALA E N     1 
ATOM 9022  C CA    . ALA D 3 206 ? -108.857 176.587 180.642 1.00 85.21  ? 206 ALA E CA    1 
ATOM 9023  C C     . ALA D 3 206 ? -109.020 177.773 181.582 1.00 85.21  ? 206 ALA E C     1 
ATOM 9024  O O     . ALA D 3 206 ? -110.113 178.336 181.696 1.00 85.21  ? 206 ALA E O     1 
ATOM 9025  C CB    . ALA D 3 206 ? -108.939 177.069 179.199 1.00 85.21  ? 206 ALA E CB    1 
ATOM 9026  N N     . VAL D 3 207 ? -107.932 178.147 182.253 1.00 89.97  ? 207 VAL E N     1 
ATOM 9027  C CA    . VAL D 3 207 ? -107.942 179.202 183.260 1.00 89.97  ? 207 VAL E CA    1 
ATOM 9028  C C     . VAL D 3 207 ? -107.607 180.542 182.625 1.00 89.97  ? 207 VAL E C     1 
ATOM 9029  O O     . VAL D 3 207 ? -106.655 180.653 181.847 1.00 89.97  ? 207 VAL E O     1 
ATOM 9030  C CB    . VAL D 3 207 ? -106.960 178.887 184.394 1.00 89.97  ? 207 VAL E CB    1 
ATOM 9031  C CG1   . VAL D 3 207 ? -105.593 178.691 183.846 1.00 89.97  ? 207 VAL E CG1   1 
ATOM 9032  C CG2   . VAL D 3 207 ? -106.931 180.023 185.366 1.00 89.97  ? 207 VAL E CG2   1 
ATOM 9033  N N     . ASP D 3 208 ? -108.396 181.559 182.952 1.00 98.25  ? 208 ASP E N     1 
ATOM 9034  C CA    . ASP D 3 208 ? -108.141 182.916 182.496 1.00 98.25  ? 208 ASP E CA    1 
ATOM 9035  C C     . ASP D 3 208 ? -107.005 183.556 183.282 1.00 98.25  ? 208 ASP E C     1 
ATOM 9036  O O     . ASP D 3 208 ? -106.846 183.325 184.481 1.00 98.25  ? 208 ASP E O     1 
ATOM 9037  C CB    . ASP D 3 208 ? -109.398 183.761 182.656 1.00 98.25  ? 208 ASP E CB    1 
ATOM 9038  C CG    . ASP D 3 208 ? -109.415 184.948 181.741 1.00 98.25  ? 208 ASP E CG    1 
ATOM 9039  O OD1   . ASP D 3 208 ? -108.328 185.388 181.327 1.00 98.25  ? 208 ASP E OD1   1 
ATOM 9040  O OD2   . ASP D 3 208 ? -110.517 185.430 181.424 1.00 98.25  ? 208 ASP E OD2   1 
ATOM 9041  N N     . ASP D 3 209 ? -106.217 184.379 182.591 1.00 101.20 ? 209 ASP E N     1 
ATOM 9042  C CA    . ASP D 3 209 ? -105.010 184.951 183.172 1.00 101.20 ? 209 ASP E CA    1 
ATOM 9043  C C     . ASP D 3 209 ? -105.176 186.386 183.660 1.00 101.20 ? 209 ASP E C     1 
ATOM 9044  O O     . ASP D 3 209 ? -104.303 186.878 184.379 1.00 101.20 ? 209 ASP E O     1 
ATOM 9045  C CB    . ASP D 3 209 ? -103.873 184.928 182.151 1.00 101.20 ? 209 ASP E CB    1 
ATOM 9046  C CG    . ASP D 3 209 ? -103.234 183.568 182.007 1.00 101.20 ? 209 ASP E CG    1 
ATOM 9047  O OD1   . ASP D 3 209 ? -103.302 182.753 182.947 1.00 101.20 ? 209 ASP E OD1   1 
ATOM 9048  O OD2   . ASP D 3 209 ? -102.657 183.317 180.930 1.00 101.20 ? 209 ASP E OD2   1 
ATOM 9049  N N     . ILE D 3 210 ? -106.243 187.079 183.273 1.00 104.10 ? 210 ILE E N     1 
ATOM 9050  C CA    . ILE D 3 210 ? -106.547 188.405 183.797 1.00 104.10 ? 210 ILE E CA    1 
ATOM 9051  C C     . ILE D 3 210 ? -107.692 188.261 184.796 1.00 104.10 ? 210 ILE E C     1 
ATOM 9052  O O     . ILE D 3 210 ? -108.832 187.991 184.381 1.00 104.10 ? 210 ILE E O     1 
ATOM 9053  C CB    . ILE D 3 210 ? -106.907 189.371 182.665 1.00 104.10 ? 210 ILE E CB    1 
ATOM 9054  C CG1   . ILE D 3 210 ? -105.632 189.799 181.944 1.00 104.10 ? 210 ILE E CG1   1 
ATOM 9055  C CG2   . ILE D 3 210 ? -107.682 190.558 183.190 1.00 104.10 ? 210 ILE E CG2   1 
ATOM 9056  C CD1   . ILE D 3 210 ? -104.502 190.086 182.879 1.00 104.10 ? 210 ILE E CD1   1 
ATOM 9057  N N     . PRO D 3 211 ? -107.444 188.403 186.090 1.00 109.70 ? 211 PRO E N     1 
ATOM 9058  C CA    . PRO D 3 211 ? -108.499 188.165 187.079 1.00 109.70 ? 211 PRO E CA    1 
ATOM 9059  C C     . PRO D 3 211 ? -109.503 189.304 187.230 1.00 109.70 ? 211 PRO E C     1 
ATOM 9060  O O     . PRO D 3 211 ? -109.236 190.463 186.918 1.00 109.70 ? 211 PRO E O     1 
ATOM 9061  C CB    . PRO D 3 211 ? -107.699 187.977 188.373 1.00 109.70 ? 211 PRO E CB    1 
ATOM 9062  C CG    . PRO D 3 211 ? -106.456 188.793 188.145 1.00 109.70 ? 211 PRO E CG    1 
ATOM 9063  C CD    . PRO D 3 211 ? -106.133 188.662 186.699 1.00 109.70 ? 211 PRO E CD    1 
ATOM 9064  N N     . LYS D 3 212 ? -110.686 188.936 187.724 1.00 119.48 ? 212 LYS E N     1 
ATOM 9065  C CA    . LYS D 3 212 ? -111.719 189.869 188.149 1.00 119.48 ? 212 LYS E CA    1 
ATOM 9066  C C     . LYS D 3 212 ? -112.019 189.597 189.614 1.00 119.48 ? 212 LYS E C     1 
ATOM 9067  O O     . LYS D 3 212 ? -111.794 188.488 190.113 1.00 119.48 ? 212 LYS E O     1 
ATOM 9068  C CB    . LYS D 3 212 ? -112.988 189.824 187.311 1.00 119.48 ? 212 LYS E CB    1 
ATOM 9069  C CG    . LYS D 3 212 ? -113.840 188.607 187.457 1.00 119.48 ? 212 LYS E CG    1 
ATOM 9070  C CD    . LYS D 3 212 ? -115.058 188.772 186.562 1.00 119.48 ? 212 LYS E CD    1 
ATOM 9071  C CE    . LYS D 3 212 ? -115.928 187.530 186.529 1.00 119.48 ? 212 LYS E CE    1 
ATOM 9072  N NZ    . LYS D 3 212 ? -116.583 187.252 187.831 1.00 119.48 ? 212 LYS E NZ    1 
ATOM 9073  N N     . GLU D 3 213 ? -112.505 190.614 190.312 1.00 126.42 ? 213 GLU E N     1 
ATOM 9074  C CA    . GLU D 3 213 ? -112.786 190.446 191.732 1.00 126.42 ? 213 GLU E CA    1 
ATOM 9075  C C     . GLU D 3 213 ? -113.890 189.432 192.022 1.00 126.42 ? 213 GLU E C     1 
ATOM 9076  O O     . GLU D 3 213 ? -114.924 189.361 191.352 1.00 126.42 ? 213 GLU E O     1 
ATOM 9077  C CB    . GLU D 3 213 ? -113.097 191.770 192.425 1.00 126.42 ? 213 GLU E CB    1 
ATOM 9078  C CG    . GLU D 3 213 ? -112.940 191.602 193.958 1.00 126.42 ? 213 GLU E CG    1 
ATOM 9079  C CD    . GLU D 3 213 ? -113.323 192.817 194.774 1.00 126.42 ? 213 GLU E CD    1 
ATOM 9080  O OE1   . GLU D 3 213 ? -113.677 193.849 194.176 1.00 126.42 ? 213 GLU E OE1   1 
ATOM 9081  O OE2   . GLU D 3 213 ? -113.262 192.746 196.019 1.00 126.42 ? 213 GLU E OE2   1 
ATOM 9082  N N     . ASN D 3 214 ? -113.638 188.665 193.066 1.00 127.06 ? 214 ASN E N     1 
ATOM 9083  C CA    . ASN D 3 214 ? -114.490 187.608 193.586 1.00 127.06 ? 214 ASN E CA    1 
ATOM 9084  C C     . ASN D 3 214 ? -114.789 186.518 192.563 1.00 127.06 ? 214 ASN E C     1 
ATOM 9085  O O     . ASN D 3 214 ? -115.939 186.120 192.340 1.00 127.06 ? 214 ASN E O     1 
ATOM 9086  C CB    . ASN D 3 214 ? -115.806 188.190 194.095 1.00 127.06 ? 214 ASN E CB    1 
ATOM 9087  C CG    . ASN D 3 214 ? -115.628 189.365 195.001 1.00 127.06 ? 214 ASN E CG    1 
ATOM 9088  O OD1   . ASN D 3 214 ? -114.553 189.606 195.538 1.00 127.06 ? 214 ASN E OD1   1 
ATOM 9089  N ND2   . ASN D 3 214 ? -116.725 190.099 195.206 1.00 127.06 ? 214 ASN E ND2   1 
ATOM 9090  N N     . ASP D 3 215 ? -113.712 186.007 191.992 1.00 121.23 ? 215 ASP E N     1 
ATOM 9091  C CA    . ASP D 3 215 ? -113.797 184.989 190.962 1.00 121.23 ? 215 ASP E CA    1 
ATOM 9092  C C     . ASP D 3 215 ? -112.388 184.497 190.685 1.00 121.23 ? 215 ASP E C     1 
ATOM 9093  O O     . ASP D 3 215 ? -111.529 185.330 190.387 1.00 121.23 ? 215 ASP E O     1 
ATOM 9094  C CB    . ASP D 3 215 ? -114.421 185.545 189.678 1.00 121.23 ? 215 ASP E CB    1 
ATOM 9095  C CG    . ASP D 3 215 ? -114.673 184.473 188.640 1.00 121.23 ? 215 ASP E CG    1 
ATOM 9096  O OD1   . ASP D 3 215 ? -114.808 183.283 188.993 1.00 121.23 ? 215 ASP E OD1   1 
ATOM 9097  O OD2   . ASP D 3 215 ? -114.667 184.821 187.451 1.00 121.23 ? 215 ASP E OD2   1 
ATOM 9098  N N     . HIS D 3 216 ? -112.096 183.194 190.743 1.00 116.74 ? 216 HIS E N     1 
ATOM 9099  C CA    . HIS D 3 216 ? -110.823 182.800 190.143 1.00 116.74 ? 216 HIS E CA    1 
ATOM 9100  C C     . HIS D 3 216 ? -110.923 182.936 188.638 1.00 116.74 ? 216 HIS E C     1 
ATOM 9101  O O     . HIS D 3 216 ? -109.910 183.145 187.970 1.00 116.74 ? 216 HIS E O     1 
ATOM 9102  C CB    . HIS D 3 216 ? -110.264 181.429 190.565 1.00 116.74 ? 216 HIS E CB    1 
ATOM 9103  C CG    . HIS D 3 216 ? -110.347 181.144 192.030 1.00 116.74 ? 216 HIS E CG    1 
ATOM 9104  N ND1   . HIS D 3 216 ? -111.517 181.062 192.757 1.00 116.74 ? 216 HIS E ND1   1 
ATOM 9105  C CD2   . HIS D 3 216 ? -109.341 180.939 192.908 1.00 116.74 ? 216 HIS E CD2   1 
ATOM 9106  C CE1   . HIS D 3 216 ? -111.227 180.809 194.018 1.00 116.74 ? 216 HIS E CE1   1 
ATOM 9107  N NE2   . HIS D 3 216 ? -109.915 180.733 194.140 1.00 116.74 ? 216 HIS E NE2   1 
ATOM 9108  N N     . GLY D 3 217 ? -112.134 182.883 188.080 1.00 108.58 ? 217 GLY E N     1 
ATOM 9109  C CA    . GLY D 3 217 ? -112.158 183.177 186.671 1.00 108.58 ? 217 GLY E CA    1 
ATOM 9110  C C     . GLY D 3 217 ? -111.478 182.129 185.828 1.00 108.58 ? 217 GLY E C     1 
ATOM 9111  O O     . GLY D 3 217 ? -110.456 182.383 185.196 1.00 108.58 ? 217 GLY E O     1 
ATOM 9112  N N     . SER D 3 218 ? -112.023 180.924 185.841 1.00 96.71  ? 218 SER E N     1 
ATOM 9113  C CA    . SER D 3 218 ? -111.636 179.951 184.838 1.00 96.71  ? 218 SER E CA    1 
ATOM 9114  C C     . SER D 3 218 ? -112.352 180.306 183.549 1.00 96.71  ? 218 SER E C     1 
ATOM 9115  O O     . SER D 3 218 ? -113.552 180.575 183.539 1.00 96.71  ? 218 SER E O     1 
ATOM 9116  C CB    . SER D 3 218 ? -112.035 178.550 185.274 1.00 96.71  ? 218 SER E CB    1 
ATOM 9117  O OG    . SER D 3 218 ? -113.368 178.309 184.868 1.00 96.71  ? 218 SER E OG    1 
ATOM 9118  N N     . GLY D 3 219 ? -111.598 180.301 182.463 1.00 89.57  ? 219 GLY E N     1 
ATOM 9119  C CA    . GLY D 3 219 ? -112.053 180.817 181.194 1.00 89.57  ? 219 GLY E CA    1 
ATOM 9120  C C     . GLY D 3 219 ? -112.990 179.901 180.453 1.00 89.57  ? 219 GLY E C     1 
ATOM 9121  O O     . GLY D 3 219 ? -113.936 180.364 179.818 1.00 89.57  ? 219 GLY E O     1 
ATOM 9122  N N     . HIS D 3 220 ? -112.754 178.600 180.510 1.00 83.39  ? 220 HIS E N     1 
ATOM 9123  C CA    . HIS D 3 220 ? -113.485 177.715 179.631 1.00 83.39  ? 220 HIS E CA    1 
ATOM 9124  C C     . HIS D 3 220 ? -113.597 176.354 180.297 1.00 83.39  ? 220 HIS E C     1 
ATOM 9125  O O     . HIS D 3 220 ? -112.745 175.968 181.094 1.00 83.39  ? 220 HIS E O     1 
ATOM 9126  C CB    . HIS D 3 220 ? -112.783 177.665 178.290 1.00 83.39  ? 220 HIS E CB    1 
ATOM 9127  C CG    . HIS D 3 220 ? -113.456 176.799 177.294 1.00 83.39  ? 220 HIS E CG    1 
ATOM 9128  N ND1   . HIS D 3 220 ? -114.727 177.053 176.836 1.00 83.39  ? 220 HIS E ND1   1 
ATOM 9129  C CD2   . HIS D 3 220 ? -113.007 175.734 176.600 1.00 83.39  ? 220 HIS E CD2   1 
ATOM 9130  C CE1   . HIS D 3 220 ? -115.056 176.142 175.940 1.00 83.39  ? 220 HIS E CE1   1 
ATOM 9131  N NE2   . HIS D 3 220 ? -114.025 175.335 175.773 1.00 83.39  ? 220 HIS E NE2   1 
ATOM 9132  N N     . MET D 3 221 ? -114.651 175.626 179.952 1.00 83.64  ? 221 MET E N     1 
ATOM 9133  C CA    . MET D 3 221 ? -114.891 174.296 180.486 1.00 83.64  ? 221 MET E CA    1 
ATOM 9134  C C     . MET D 3 221 ? -115.306 173.381 179.346 1.00 83.64  ? 221 MET E C     1 
ATOM 9135  O O     . MET D 3 221 ? -115.945 173.827 178.394 1.00 83.64  ? 221 MET E O     1 
ATOM 9136  C CB    . MET D 3 221 ? -116.005 174.378 181.536 1.00 83.64  ? 221 MET E CB    1 
ATOM 9137  C CG    . MET D 3 221 ? -115.681 175.346 182.651 1.00 83.64  ? 221 MET E CG    1 
ATOM 9138  S SD    . MET D 3 221 ? -117.034 175.659 183.787 1.00 83.64  ? 221 MET E SD    1 
ATOM 9139  C CE    . MET D 3 221 ? -117.292 174.055 184.516 1.00 83.64  ? 221 MET E CE    1 
ATOM 9140  N N     . ASN D 3 222 ? -114.931 172.109 179.466 1.00 78.33  ? 222 ASN E N     1 
ATOM 9141  C CA    . ASN D 3 222 ? -115.241 171.091 178.471 1.00 78.33  ? 222 ASN E CA    1 
ATOM 9142  C C     . ASN D 3 222 ? -114.878 169.691 178.969 1.00 78.33  ? 222 ASN E C     1 
ATOM 9143  O O     . ASN D 3 222 ? -114.109 169.535 179.917 1.00 78.33  ? 222 ASN E O     1 
ATOM 9144  C CB    . ASN D 3 222 ? -114.518 171.387 177.156 1.00 78.33  ? 222 ASN E CB    1 
ATOM 9145  C CG    . ASN D 3 222 ? -115.289 172.345 176.270 1.00 78.33  ? 222 ASN E CG    1 
ATOM 9146  O OD1   . ASN D 3 222 ? -114.704 173.089 175.482 1.00 78.33  ? 222 ASN E OD1   1 
ATOM 9147  N ND2   . ASN D 3 222 ? -116.611 172.331 176.394 1.00 78.33  ? 222 ASN E ND2   1 
ATOM 9148  N N     . ALA D 3 223 ? -115.441 168.677 178.319 1.00 73.52  ? 223 ALA E N     1 
ATOM 9149  C CA    . ALA D 3 223 ? -115.203 167.283 178.667 1.00 73.52  ? 223 ALA E CA    1 
ATOM 9150  C C     . ALA D 3 223 ? -114.603 166.606 177.448 1.00 73.52  ? 223 ALA E C     1 
ATOM 9151  O O     . ALA D 3 223 ? -115.304 166.373 176.459 1.00 73.52  ? 223 ALA E O     1 
ATOM 9152  C CB    . ALA D 3 223 ? -116.488 166.597 179.134 1.00 73.52  ? 223 ALA E CB    1 
ATOM 9153  N N     . GLY D 3 224 ? -113.307 166.308 177.499 1.00 69.53  ? 224 GLY E N     1 
ATOM 9154  C CA    . GLY D 3 224 ? -112.639 165.614 176.420 1.00 69.53  ? 224 GLY E CA    1 
ATOM 9155  C C     . GLY D 3 224 ? -112.456 164.152 176.763 1.00 69.53  ? 224 GLY E C     1 
ATOM 9156  O O     . GLY D 3 224 ? -111.859 163.819 177.790 1.00 69.53  ? 224 GLY E O     1 
ATOM 9157  N N     . GLN D 3 225 ? -112.945 163.282 175.890 1.00 62.10  ? 225 GLN E N     1 
ATOM 9158  C CA    . GLN D 3 225 ? -112.971 161.853 176.177 1.00 62.10  ? 225 GLN E CA    1 
ATOM 9159  C C     . GLN D 3 225 ? -111.808 161.133 175.517 1.00 62.10  ? 225 GLN E C     1 
ATOM 9160  O O     . GLN D 3 225 ? -111.643 161.191 174.291 1.00 62.10  ? 225 GLN E O     1 
ATOM 9161  C CB    . GLN D 3 225 ? -114.269 161.203 175.728 1.00 62.10  ? 225 GLN E CB    1 
ATOM 9162  C CG    . GLN D 3 225 ? -114.826 161.605 174.394 1.00 62.10  ? 225 GLN E CG    1 
ATOM 9163  C CD    . GLN D 3 225 ? -115.573 162.880 174.412 1.00 62.10  ? 225 GLN E CD    1 
ATOM 9164  O OE1   . GLN D 3 225 ? -115.038 163.923 174.803 1.00 62.10  ? 225 GLN E OE1   1 
ATOM 9165  N NE2   . GLN D 3 225 ? -116.844 162.833 174.035 1.00 62.10  ? 225 GLN E NE2   1 
ATOM 9166  N N     . PHE D 3 226 ? -111.029 160.417 176.314 1.00 57.86  ? 226 PHE E N     1 
ATOM 9167  C CA    . PHE D 3 226 ? -109.904 159.642 175.833 1.00 57.86  ? 226 PHE E CA    1 
ATOM 9168  C C     . PHE D 3 226 ? -110.073 158.194 176.279 1.00 57.86  ? 226 PHE E C     1 
ATOM 9169  O O     . PHE D 3 226 ? -110.974 157.855 177.056 1.00 57.86  ? 226 PHE E O     1 
ATOM 9170  C CB    . PHE D 3 226 ? -108.515 160.184 176.237 1.00 57.86  ? 226 PHE E CB    1 
ATOM 9171  C CG    . PHE D 3 226 ? -108.299 161.665 175.977 1.00 57.86  ? 226 PHE E CG    1 
ATOM 9172  C CD1   . PHE D 3 226 ? -108.809 162.275 174.866 1.00 57.86  ? 226 PHE E CD1   1 
ATOM 9173  C CD2   . PHE D 3 226 ? -107.357 162.360 176.687 1.00 57.86  ? 226 PHE E CD2   1 
ATOM 9174  C CE1   . PHE D 3 226 ? -108.537 163.583 174.571 1.00 57.86  ? 226 PHE E CE1   1 
ATOM 9175  C CE2   . PHE D 3 226 ? -107.066 163.673 176.387 1.00 57.86  ? 226 PHE E CE2   1 
ATOM 9176  C CZ    . PHE D 3 226 ? -107.661 164.280 175.330 1.00 57.86  ? 226 PHE E CZ    1 
ATOM 9177  N N     . SER D 3 227 ? -109.160 157.350 175.815 1.00 51.82  ? 227 SER E N     1 
ATOM 9178  C CA    . SER D 3 227 ? -109.189 155.925 176.104 1.00 51.82  ? 227 SER E CA    1 
ATOM 9179  C C     . SER D 3 227 ? -107.800 155.337 175.906 1.00 51.82  ? 227 SER E C     1 
ATOM 9180  O O     . SER D 3 227 ? -106.932 155.957 175.293 1.00 51.82  ? 227 SER E O     1 
ATOM 9181  C CB    . SER D 3 227 ? -110.203 155.201 175.234 1.00 51.82  ? 227 SER E CB    1 
ATOM 9182  O OG    . SER D 3 227 ? -109.897 153.824 175.183 1.00 51.82  ? 227 SER E OG    1 
ATOM 9183  N N     . ALA D 3 228 ? -107.601 154.126 176.423 1.00 47.17  ? 228 ALA E N     1 
ATOM 9184  C CA    . ALA D 3 228 ? -106.324 153.428 176.333 1.00 47.17  ? 228 ALA E CA    1 
ATOM 9185  C C     . ALA D 3 228 ? -106.553 151.947 176.124 1.00 47.17  ? 228 ALA E C     1 
ATOM 9186  O O     . ALA D 3 228 ? -107.627 151.428 176.423 1.00 47.17  ? 228 ALA E O     1 
ATOM 9187  C CB    . ALA D 3 228 ? -105.502 153.606 177.604 1.00 47.17  ? 228 ALA E CB    1 
ATOM 9188  N N     . GLY D 3 229 ? -105.534 151.256 175.638 1.00 47.73  ? 229 GLY E N     1 
ATOM 9189  C CA    . GLY D 3 229 ? -105.655 149.818 175.516 1.00 47.73  ? 229 GLY E CA    1 
ATOM 9190  C C     . GLY D 3 229 ? -104.637 149.230 174.569 1.00 47.73  ? 229 GLY E C     1 
ATOM 9191  O O     . GLY D 3 229 ? -103.865 149.933 173.935 1.00 47.73  ? 229 GLY E O     1 
ATOM 9192  N N     . THR D 3 230 ? -104.681 147.908 174.465 1.00 46.86  ? 230 THR E N     1 
ATOM 9193  C CA    . THR D 3 230 ? -103.781 147.144 173.607 1.00 46.86  ? 230 THR E CA    1 
ATOM 9194  C C     . THR D 3 230 ? -104.477 146.828 172.293 1.00 46.86  ? 230 THR E C     1 
ATOM 9195  O O     . THR D 3 230 ? -105.288 145.910 172.218 1.00 46.86  ? 230 THR E O     1 
ATOM 9196  C CB    . THR D 3 230 ? -103.355 145.865 174.300 1.00 46.86  ? 230 THR E CB    1 
ATOM 9197  O OG1   . THR D 3 230 ? -104.472 144.985 174.341 1.00 46.86  ? 230 THR E OG1   1 
ATOM 9198  C CG2   . THR D 3 230 ? -102.952 146.174 175.704 1.00 46.86  ? 230 THR E CG2   1 
ATOM 9199  N N     . PHE D 3 231 ? -104.143 147.568 171.251 1.00 42.97  ? 231 PHE E N     1 
ATOM 9200  C CA    . PHE D 3 231 ? -104.776 147.383 169.959 1.00 42.97  ? 231 PHE E CA    1 
ATOM 9201  C C     . PHE D 3 231 ? -104.195 146.204 169.205 1.00 42.97  ? 231 PHE E C     1 
ATOM 9202  O O     . PHE D 3 231 ? -103.010 145.892 169.327 1.00 42.97  ? 231 PHE E O     1 
ATOM 9203  C CB    . PHE D 3 231 ? -104.612 148.627 169.106 1.00 42.97  ? 231 PHE E CB    1 
ATOM 9204  C CG    . PHE D 3 231 ? -105.324 149.807 169.626 1.00 42.97  ? 231 PHE E CG    1 
ATOM 9205  C CD1   . PHE D 3 231 ? -106.338 149.683 170.511 1.00 42.97  ? 231 PHE E CD1   1 
ATOM 9206  C CD2   . PHE D 3 231 ? -104.983 151.049 169.216 1.00 42.97  ? 231 PHE E CD2   1 
ATOM 9207  C CE1   . PHE D 3 231 ? -106.981 150.780 170.975 1.00 42.97  ? 231 PHE E CE1   1 
ATOM 9208  C CE2   . PHE D 3 231 ? -105.639 152.132 169.688 1.00 42.97  ? 231 PHE E CE2   1 
ATOM 9209  C CZ    . PHE D 3 231 ? -106.637 151.991 170.566 1.00 42.97  ? 231 PHE E CZ    1 
ATOM 9210  N N     . TYR D 3 232 ? -105.050 145.532 168.443 1.00 39.17  ? 232 TYR E N     1 
ATOM 9211  C CA    . TYR D 3 232 ? -104.626 144.542 167.468 1.00 39.17  ? 232 TYR E CA    1 
ATOM 9212  C C     . TYR D 3 232 ? -104.602 145.199 166.097 1.00 39.17  ? 232 TYR E C     1 
ATOM 9213  O O     . TYR D 3 232 ? -105.546 145.899 165.731 1.00 39.17  ? 232 TYR E O     1 
ATOM 9214  C CB    . TYR D 3 232 ? -105.564 143.350 167.447 1.00 39.17  ? 232 TYR E CB    1 
ATOM 9215  C CG    . TYR D 3 232 ? -105.298 142.442 166.287 1.00 39.17  ? 232 TYR E CG    1 
ATOM 9216  C CD1   . TYR D 3 232 ? -104.209 141.617 166.280 1.00 39.17  ? 232 TYR E CD1   1 
ATOM 9217  C CD2   . TYR D 3 232 ? -106.136 142.411 165.202 1.00 39.17  ? 232 TYR E CD2   1 
ATOM 9218  C CE1   . TYR D 3 232 ? -103.956 140.791 165.235 1.00 39.17  ? 232 TYR E CE1   1 
ATOM 9219  C CE2   . TYR D 3 232 ? -105.886 141.581 164.147 1.00 39.17  ? 232 TYR E CE2   1 
ATOM 9220  C CZ    . TYR D 3 232 ? -104.795 140.777 164.171 1.00 39.17  ? 232 TYR E CZ    1 
ATOM 9221  O OH    . TYR D 3 232 ? -104.535 139.943 163.122 1.00 39.17  ? 232 TYR E OH    1 
ATOM 9222  N N     . ARG D 3 233 ? -103.535 144.983 165.343 1.00 40.85  ? 233 ARG E N     1 
ATOM 9223  C CA    . ARG D 3 233 ? -103.346 145.637 164.059 1.00 40.85  ? 233 ARG E CA    1 
ATOM 9224  C C     . ARG D 3 233 ? -102.994 144.607 163.003 1.00 40.85  ? 233 ARG E C     1 
ATOM 9225  O O     . ARG D 3 233 ? -102.248 143.668 163.277 1.00 40.85  ? 233 ARG E O     1 
ATOM 9226  C CB    . ARG D 3 233 ? -102.255 146.686 164.129 1.00 40.85  ? 233 ARG E CB    1 
ATOM 9227  C CG    . ARG D 3 233 ? -102.448 147.693 165.219 1.00 40.85  ? 233 ARG E CG    1 
ATOM 9228  C CD    . ARG D 3 233 ? -101.248 148.588 165.344 1.00 40.85  ? 233 ARG E CD    1 
ATOM 9229  N NE    . ARG D 3 233 ? -100.766 149.006 164.038 1.00 40.85  ? 233 ARG E NE    1 
ATOM 9230  C CZ    . ARG D 3 233 ? -99.569  149.522 163.822 1.00 40.85  ? 233 ARG E CZ    1 
ATOM 9231  N NH1   . ARG D 3 233 ? -98.729  149.691 164.828 1.00 40.85  ? 233 ARG E NH1   1 
ATOM 9232  N NH2   . ARG D 3 233 ? -99.220  149.874 162.602 1.00 40.85  ? 233 ARG E NH2   1 
ATOM 9233  N N     . TYR D 3 234 ? -103.495 144.800 161.791 1.00 39.44  ? 234 TYR E N     1 
ATOM 9234  C CA    . TYR D 3 234 ? -103.279 143.837 160.726 1.00 39.44  ? 234 TYR E CA    1 
ATOM 9235  C C     . TYR D 3 234 ? -103.213 144.541 159.386 1.00 39.44  ? 234 TYR E C     1 
ATOM 9236  O O     . TYR D 3 234 ? -103.854 145.571 159.192 1.00 39.44  ? 234 TYR E O     1 
ATOM 9237  C CB    . TYR D 3 234 ? -104.401 142.813 160.703 1.00 39.44  ? 234 TYR E CB    1 
ATOM 9238  C CG    . TYR D 3 234 ? -104.361 141.889 159.530 1.00 39.44  ? 234 TYR E CG    1 
ATOM 9239  C CD1   . TYR D 3 234 ? -103.464 140.857 159.460 1.00 39.44  ? 234 TYR E CD1   1 
ATOM 9240  C CD2   . TYR D 3 234 ? -105.225 142.063 158.486 1.00 39.44  ? 234 TYR E CD2   1 
ATOM 9241  C CE1   . TYR D 3 234 ? -103.438 140.027 158.387 1.00 39.44  ? 234 TYR E CE1   1 
ATOM 9242  C CE2   . TYR D 3 234 ? -105.204 141.241 157.417 1.00 39.44  ? 234 TYR E CE2   1 
ATOM 9243  C CZ    . TYR D 3 234 ? -104.312 140.226 157.370 1.00 39.44  ? 234 TYR E CZ    1 
ATOM 9244  O OH    . TYR D 3 234 ? -104.303 139.404 156.282 1.00 39.44  ? 234 TYR E OH    1 
ATOM 9245  N N     . ALA D 3 235 ? -102.412 143.997 158.473 1.00 40.80  ? 235 ALA E N     1 
ATOM 9246  C CA    . ALA D 3 235 ? -102.330 144.602 157.151 1.00 40.80  ? 235 ALA E CA    1 
ATOM 9247  C C     . ALA D 3 235 ? -101.787 143.597 156.150 1.00 40.80  ? 235 ALA E C     1 
ATOM 9248  O O     . ALA D 3 235 ? -100.999 142.720 156.497 1.00 40.80  ? 235 ALA E O     1 
ATOM 9249  C CB    . ALA D 3 235 ? -101.457 145.846 157.163 1.00 40.80  ? 235 ALA E CB    1 
ATOM 9250  N N     . ASN D 3 236 ? -102.211 143.740 154.900 1.00 42.72  ? 236 ASN E N     1 
ATOM 9251  C CA    . ASN D 3 236 ? -101.786 142.886 153.808 1.00 42.72  ? 236 ASN E CA    1 
ATOM 9252  C C     . ASN D 3 236 ? -101.039 143.695 152.772 1.00 42.72  ? 236 ASN E C     1 
ATOM 9253  O O     . ASN D 3 236 ? -101.284 144.890 152.590 1.00 42.72  ? 236 ASN E O     1 
ATOM 9254  C CB    . ASN D 3 236 ? -102.949 142.232 153.085 1.00 42.72  ? 236 ASN E CB    1 
ATOM 9255  C CG    . ASN D 3 236 ? -103.607 141.196 153.892 1.00 42.72  ? 236 ASN E CG    1 
ATOM 9256  O OD1   . ASN D 3 236 ? -102.984 140.567 154.723 1.00 42.72  ? 236 ASN E OD1   1 
ATOM 9257  N ND2   . ASN D 3 236 ? -104.882 140.979 153.643 1.00 42.72  ? 236 ASN E ND2   1 
ATOM 9258  N N     . VAL D 3 237 ? -100.195 142.997 152.029 1.00 48.40  ? 237 VAL E N     1 
ATOM 9259  C CA    . VAL D 3 237 ? -99.514  143.533 150.867 1.00 48.40  ? 237 VAL E CA    1 
ATOM 9260  C C     . VAL D 3 237 ? -99.572  142.475 149.781 1.00 48.40  ? 237 VAL E C     1 
ATOM 9261  O O     . VAL D 3 237 ? -98.992  141.396 149.933 1.00 48.40  ? 237 VAL E O     1 
ATOM 9262  C CB    . VAL D 3 237 ? -98.068  143.927 151.164 1.00 48.40  ? 237 VAL E CB    1 
ATOM 9263  C CG1   . VAL D 3 237 ? -97.417  144.399 149.911 1.00 48.40  ? 237 VAL E CG1   1 
ATOM 9264  C CG2   . VAL D 3 237 ? -98.037  145.006 152.185 1.00 48.40  ? 237 VAL E CG2   1 
ATOM 9265  N N     . ASN D 3 238 ? -100.303 142.757 148.717 1.00 55.83  ? 238 ASN E N     1 
ATOM 9266  C CA    . ASN D 3 238 ? -100.436 141.853 147.584 1.00 55.83  ? 238 ASN E CA    1 
ATOM 9267  C C     . ASN D 3 238 ? -99.242  142.063 146.673 1.00 55.83  ? 238 ASN E C     1 
ATOM 9268  O O     . ASN D 3 238 ? -99.213  142.999 145.878 1.00 55.83  ? 238 ASN E O     1 
ATOM 9269  C CB    . ASN D 3 238 ? -101.732 142.099 146.838 1.00 55.83  ? 238 ASN E CB    1 
ATOM 9270  C CG    . ASN D 3 238 ? -102.062 140.989 145.901 1.00 55.83  ? 238 ASN E CG    1 
ATOM 9271  O OD1   . ASN D 3 238 ? -101.190 140.235 145.496 1.00 55.83  ? 238 ASN E OD1   1 
ATOM 9272  N ND2   . ASN D 3 238 ? -103.325 140.875 145.542 1.00 55.83  ? 238 ASN E ND2   1 
ATOM 9273  N N     . LEU D 3 239 ? -98.256  141.178 146.774 1.00 57.45  ? 239 LEU E N     1 
ATOM 9274  C CA    . LEU D 3 239 ? -97.040  141.366 146.000 1.00 57.45  ? 239 LEU E CA    1 
ATOM 9275  C C     . LEU D 3 239 ? -97.302  141.333 144.510 1.00 57.45  ? 239 LEU E C     1 
ATOM 9276  O O     . LEU D 3 239 ? -96.637  142.045 143.756 1.00 57.45  ? 239 LEU E O     1 
ATOM 9277  C CB    . LEU D 3 239 ? -96.010  140.310 146.362 1.00 57.45  ? 239 LEU E CB    1 
ATOM 9278  C CG    . LEU D 3 239 ? -95.496  140.490 147.773 1.00 57.45  ? 239 LEU E CG    1 
ATOM 9279  C CD1   . LEU D 3 239 ? -94.464  139.453 148.077 1.00 57.45  ? 239 LEU E CD1   1 
ATOM 9280  C CD2   . LEU D 3 239 ? -94.920  141.854 147.873 1.00 57.45  ? 239 LEU E CD2   1 
ATOM 9281  N N     . ASP D 3 240 ? -98.240  140.515 144.051 1.00 62.88  ? 240 ASP E N     1 
ATOM 9282  C CA    . ASP D 3 240 ? -98.483  140.503 142.619 1.00 62.88  ? 240 ASP E CA    1 
ATOM 9283  C C     . ASP D 3 240 ? -98.967  141.857 142.124 1.00 62.88  ? 240 ASP E C     1 
ATOM 9284  O O     . ASP D 3 240 ? -98.522  142.329 141.077 1.00 62.88  ? 240 ASP E O     1 
ATOM 9285  C CB    . ASP D 3 240 ? -99.490  139.412 142.282 1.00 62.88  ? 240 ASP E CB    1 
ATOM 9286  C CG    . ASP D 3 240 ? -98.945  138.033 142.556 1.00 62.88  ? 240 ASP E CG    1 
ATOM 9287  O OD1   . ASP D 3 240 ? -97.708  137.894 142.610 1.00 62.88  ? 240 ASP E OD1   1 
ATOM 9288  O OD2   . ASP D 3 240 ? -99.741  137.089 142.715 1.00 62.88  ? 240 ASP E OD2   1 
ATOM 9289  N N     . ARG D 3 241 ? -99.852  142.518 142.861 1.00 64.19  ? 241 ARG E N     1 
ATOM 9290  C CA    . ARG D 3 241 ? -100.281 143.838 142.416 1.00 64.19  ? 241 ARG E CA    1 
ATOM 9291  C C     . ARG D 3 241 ? -99.238  144.913 142.616 1.00 64.19  ? 241 ARG E C     1 
ATOM 9292  O O     . ARG D 3 241 ? -99.193  145.866 141.841 1.00 64.19  ? 241 ARG E O     1 
ATOM 9293  C CB    . ARG D 3 241 ? -101.555 144.289 143.096 1.00 64.19  ? 241 ARG E CB    1 
ATOM 9294  C CG    . ARG D 3 241 ? -102.759 143.595 142.609 1.00 64.19  ? 241 ARG E CG    1 
ATOM 9295  C CD    . ARG D 3 241 ? -103.937 144.106 143.354 1.00 64.19  ? 241 ARG E CD    1 
ATOM 9296  N NE    . ARG D 3 241 ? -105.146 143.416 142.956 1.00 64.19  ? 241 ARG E NE    1 
ATOM 9297  C CZ    . ARG D 3 241 ? -106.300 143.539 143.592 1.00 64.19  ? 241 ARG E CZ    1 
ATOM 9298  N NH1   . ARG D 3 241 ? -106.382 144.324 144.656 1.00 64.19  ? 241 ARG E NH1   1 
ATOM 9299  N NH2   . ARG D 3 241 ? -107.366 142.878 143.169 1.00 64.19  ? 241 ARG E NH2   1 
ATOM 9300  N N     . LEU D 3 242 ? -98.419  144.824 143.655 1.00 62.40  ? 242 LEU E N     1 
ATOM 9301  C CA    . LEU D 3 242 ? -97.419  145.868 143.817 1.00 62.40  ? 242 LEU E CA    1 
ATOM 9302  C C     . LEU D 3 242 ? -96.342  145.750 142.757 1.00 62.40  ? 242 LEU E C     1 
ATOM 9303  O O     . LEU D 3 242 ? -95.877  146.758 142.213 1.00 62.40  ? 242 LEU E O     1 
ATOM 9304  C CB    . LEU D 3 242 ? -96.823  145.797 145.209 1.00 62.40  ? 242 LEU E CB    1 
ATOM 9305  C CG    . LEU D 3 242 ? -95.846  146.916 145.491 1.00 62.40  ? 242 LEU E CG    1 
ATOM 9306  C CD1   . LEU D 3 242 ? -96.518  148.247 145.296 1.00 62.40  ? 242 LEU E CD1   1 
ATOM 9307  C CD2   . LEU D 3 242 ? -95.377  146.786 146.894 1.00 62.40  ? 242 LEU E CD2   1 
ATOM 9308  N N     . VAL D 3 243 ? -95.973  144.520 142.414 1.00 65.29  ? 243 VAL E N     1 
ATOM 9309  C CA    . VAL D 3 243 ? -95.055  144.287 141.312 1.00 65.29  ? 243 VAL E CA    1 
ATOM 9310  C C     . VAL D 3 243 ? -95.689  144.691 139.998 1.00 65.29  ? 243 VAL E C     1 
ATOM 9311  O O     . VAL D 3 243 ? -95.016  145.209 139.105 1.00 65.29  ? 243 VAL E O     1 
ATOM 9312  C CB    . VAL D 3 243 ? -94.615  142.816 141.307 1.00 65.29  ? 243 VAL E CB    1 
ATOM 9313  C CG1   . VAL D 3 243 ? -93.885  142.494 140.035 1.00 65.29  ? 243 VAL E CG1   1 
ATOM 9314  C CG2   . VAL D 3 243 ? -93.738  142.553 142.491 1.00 65.29  ? 243 VAL E CG2   1 
ATOM 9315  N N     . GLU D 3 244 ? -96.991  144.487 139.860 1.00 67.90  ? 244 GLU E N     1 
ATOM 9316  C CA    . GLU D 3 244 ? -97.653  144.917 138.639 1.00 67.90  ? 244 GLU E CA    1 
ATOM 9317  C C     . GLU D 3 244 ? -97.699  146.434 138.536 1.00 67.90  ? 244 GLU E C     1 
ATOM 9318  O O     . GLU D 3 244 ? -97.576  146.984 137.439 1.00 67.90  ? 244 GLU E O     1 
ATOM 9319  C CB    . GLU D 3 244 ? -99.067  144.356 138.605 1.00 67.90  ? 244 GLU E CB    1 
ATOM 9320  C CG    . GLU D 3 244 ? -99.895  144.862 137.466 1.00 67.90  ? 244 GLU E CG    1 
ATOM 9321  C CD    . GLU D 3 244 ? -101.271 144.237 137.425 1.00 67.90  ? 244 GLU E CD    1 
ATOM 9322  O OE1   . GLU D 3 244 ? -101.567 143.366 138.270 1.00 67.90  ? 244 GLU E OE1   1 
ATOM 9323  O OE2   . GLU D 3 244 ? -102.091 144.666 136.582 1.00 67.90  ? 244 GLU E OE2   1 
ATOM 9324  N N     . ASN D 3 245 ? -97.856  147.128 139.661 1.00 66.45  ? 245 ASN E N     1 
ATOM 9325  C CA    . ASN D 3 245 ? -97.948  148.581 139.633 1.00 66.45  ? 245 ASN E CA    1 
ATOM 9326  C C     . ASN D 3 245 ? -96.601  149.234 139.371 1.00 66.45  ? 245 ASN E C     1 
ATOM 9327  O O     . ASN D 3 245 ? -96.454  150.014 138.428 1.00 66.45  ? 245 ASN E O     1 
ATOM 9328  C CB    . ASN D 3 245 ? -98.521  149.095 140.946 1.00 66.45  ? 245 ASN E CB    1 
ATOM 9329  C CG    . ASN D 3 245 ? -99.979  148.797 141.090 1.00 66.45  ? 245 ASN E CG    1 
ATOM 9330  O OD1   . ASN D 3 245 ? -100.686 148.641 140.104 1.00 66.45  ? 245 ASN E OD1   1 
ATOM 9331  N ND2   . ASN D 3 245 ? -100.443 148.703 142.319 1.00 66.45  ? 245 ASN E ND2   1 
ATOM 9332  N N     . THR D 3 246 ? -95.600  148.936 140.196 1.00 68.88  ? 246 THR E N     1 
ATOM 9333  C CA    . THR D 3 246 ? -94.291  149.530 139.959 1.00 68.88  ? 246 THR E CA    1 
ATOM 9334  C C     . THR D 3 246 ? -93.636  148.992 138.698 1.00 68.88  ? 246 THR E C     1 
ATOM 9335  O O     . THR D 3 246 ? -92.829  149.679 138.072 1.00 68.88  ? 246 THR E O     1 
ATOM 9336  C CB    . THR D 3 246 ? -93.396  149.284 141.159 1.00 68.88  ? 246 THR E CB    1 
ATOM 9337  O OG1   . THR D 3 246 ? -93.282  147.878 141.376 1.00 68.88  ? 246 THR E OG1   1 
ATOM 9338  C CG2   . THR D 3 246 ? -94.012  149.900 142.381 1.00 68.88  ? 246 THR E CG2   1 
ATOM 9339  N N     . GLY D 3 247 ? -93.975  147.769 138.322 1.00 70.21  ? 247 GLY E N     1 
ATOM 9340  C CA    . GLY D 3 247 ? -93.376  147.135 137.163 1.00 70.21  ? 247 GLY E CA    1 
ATOM 9341  C C     . GLY D 3 247 ? -92.164  146.297 137.506 1.00 70.21  ? 247 GLY E C     1 
ATOM 9342  O O     . GLY D 3 247 ? -92.157  145.089 137.260 1.00 70.21  ? 247 GLY E O     1 
ATOM 9343  N N     . ASP D 3 248 ? -91.129  146.925 138.054 1.00 75.17  ? 248 ASP E N     1 
ATOM 9344  C CA    . ASP D 3 248 ? -89.909  146.204 138.410 1.00 75.17  ? 248 ASP E CA    1 
ATOM 9345  C C     . ASP D 3 248 ? -89.996  145.640 139.821 1.00 75.17  ? 248 ASP E C     1 
ATOM 9346  O O     . ASP D 3 248 ? -90.547  146.282 140.717 1.00 75.17  ? 248 ASP E O     1 
ATOM 9347  C CB    . ASP D 3 248 ? -88.690  147.119 138.282 1.00 75.17  ? 248 ASP E CB    1 
ATOM 9348  C CG    . ASP D 3 248 ? -88.698  148.246 139.298 1.00 75.17  ? 248 ASP E CG    1 
ATOM 9349  O OD1   . ASP D 3 248 ? -89.787  148.793 139.571 1.00 75.17  ? 248 ASP E OD1   1 
ATOM 9350  O OD2   . ASP D 3 248 ? -87.617  148.583 139.823 1.00 75.17  ? 248 ASP E OD2   1 
ATOM 9351  N N     . ALA D 3 249 ? -89.455  144.442 140.024 1.00 72.10  ? 249 ALA E N     1 
ATOM 9352  C CA    . ALA D 3 249 ? -89.497  143.835 141.344 1.00 72.10  ? 249 ALA E CA    1 
ATOM 9353  C C     . ALA D 3 249 ? -88.584  144.513 142.354 1.00 72.10  ? 249 ALA E C     1 
ATOM 9354  O O     . ALA D 3 249 ? -88.827  144.402 143.557 1.00 72.10  ? 249 ALA E O     1 
ATOM 9355  C CB    . ALA D 3 249 ? -89.138  142.355 141.246 1.00 72.10  ? 249 ALA E CB    1 
ATOM 9356  N N     . GLN D 3 250 ? -87.539  145.207 141.914 1.00 74.31  ? 250 GLN E N     1 
ATOM 9357  C CA    . GLN D 3 250 ? -86.679  145.875 142.883 1.00 74.31  ? 250 GLN E CA    1 
ATOM 9358  C C     . GLN D 3 250 ? -87.332  147.073 143.568 1.00 74.31  ? 250 GLN E C     1 
ATOM 9359  O O     . GLN D 3 250 ? -87.211  147.221 144.792 1.00 74.31  ? 250 GLN E O     1 
ATOM 9360  C CB    . GLN D 3 250 ? -85.388  146.311 142.204 1.00 74.31  ? 250 GLN E CB    1 
ATOM 9361  C CG    . GLN D 3 250 ? -84.361  146.782 143.188 1.00 74.31  ? 250 GLN E CG    1 
ATOM 9362  C CD    . GLN D 3 250 ? -83.931  145.662 144.104 1.00 74.31  ? 250 GLN E CD    1 
ATOM 9363  O OE1   . GLN D 3 250 ? -83.755  144.526 143.671 1.00 74.31  ? 250 GLN E OE1   1 
ATOM 9364  N NE2   . GLN D 3 250 ? -83.770  145.973 145.385 1.00 74.31  ? 250 GLN E NE2   1 
ATOM 9365  N N     . THR D 3 251 ? -88.066  147.908 142.834 1.00 71.76  ? 251 THR E N     1 
ATOM 9366  C CA    . THR D 3 251 ? -88.783  148.973 143.523 1.00 71.76  ? 251 THR E CA    1 
ATOM 9367  C C     . THR D 3 251 ? -89.929  148.437 144.352 1.00 71.76  ? 251 THR E C     1 
ATOM 9368  O O     . THR D 3 251 ? -90.269  149.026 145.380 1.00 71.76  ? 251 THR E O     1 
ATOM 9369  C CB    . THR D 3 251 ? -89.316  150.014 142.550 1.00 71.76  ? 251 THR E CB    1 
ATOM 9370  O OG1   . THR D 3 251 ? -90.241  149.395 141.656 1.00 71.76  ? 251 THR E OG1   1 
ATOM 9371  C CG2   . THR D 3 251 ? -88.197  150.657 141.783 1.00 71.76  ? 251 THR E CG2   1 
ATOM 9372  N N     . ALA D 3 252 ? -90.542  147.337 143.932 1.00 67.35  ? 252 ALA E N     1 
ATOM 9373  C CA    . ALA D 3 252 ? -91.544  146.738 144.792 1.00 67.35  ? 252 ALA E CA    1 
ATOM 9374  C C     . ALA D 3 252 ? -90.921  146.211 146.066 1.00 67.35  ? 252 ALA E C     1 
ATOM 9375  O O     . ALA D 3 252 ? -91.548  146.252 147.125 1.00 67.35  ? 252 ALA E O     1 
ATOM 9376  C CB    . ALA D 3 252 ? -92.261  145.612 144.059 1.00 67.35  ? 252 ALA E CB    1 
ATOM 9377  N N     . ARG D 3 253 ? -89.691  145.714 145.991 1.00 66.28  ? 253 ARG E N     1 
ATOM 9378  C CA    . ARG D 3 253 ? -89.049  145.191 147.188 1.00 66.28  ? 253 ARG E CA    1 
ATOM 9379  C C     . ARG D 3 253 ? -88.789  146.308 148.187 1.00 66.28  ? 253 ARG E C     1 
ATOM 9380  O O     . ARG D 3 253 ? -89.113  146.186 149.376 1.00 66.28  ? 253 ARG E O     1 
ATOM 9381  C CB    . ARG D 3 253 ? -87.771  144.457 146.797 1.00 66.28  ? 253 ARG E CB    1 
ATOM 9382  C CG    . ARG D 3 253 ? -87.118  143.674 147.904 1.00 66.28  ? 253 ARG E CG    1 
ATOM 9383  C CD    . ARG D 3 253 ? -85.902  142.947 147.363 1.00 66.28  ? 253 ARG E CD    1 
ATOM 9384  N NE    . ARG D 3 253 ? -85.350  142.012 148.330 1.00 66.28  ? 253 ARG E NE    1 
ATOM 9385  C CZ    . ARG D 3 253 ? -84.460  142.333 149.256 1.00 66.28  ? 253 ARG E CZ    1 
ATOM 9386  N NH1   . ARG D 3 253 ? -84.017  143.577 149.346 1.00 66.28  ? 253 ARG E NH1   1 
ATOM 9387  N NH2   . ARG D 3 253 ? -84.013  141.409 150.093 1.00 66.28  ? 253 ARG E NH2   1 
ATOM 9388  N N     . THR D 3 254 ? -88.257  147.434 147.708 1.00 64.95  ? 254 THR E N     1 
ATOM 9389  C CA    . THR D 3 254 ? -88.057  148.569 148.602 1.00 64.95  ? 254 THR E CA    1 
ATOM 9390  C C     . THR D 3 254 ? -89.378  149.108 149.117 1.00 64.95  ? 254 THR E C     1 
ATOM 9391  O O     . THR D 3 254 ? -89.477  149.517 150.276 1.00 64.95  ? 254 THR E O     1 
ATOM 9392  C CB    . THR D 3 254 ? -87.307  149.685 147.890 1.00 64.95  ? 254 THR E CB    1 
ATOM 9393  O OG1   . THR D 3 254 ? -88.104  150.161 146.804 1.00 64.95  ? 254 THR E OG1   1 
ATOM 9394  C CG2   . THR D 3 254 ? -86.000  149.172 147.343 1.00 64.95  ? 254 THR E CG2   1 
ATOM 9395  N N     . ALA D 3 255 ? -90.406  149.112 148.276 1.00 61.16  ? 255 ALA E N     1 
ATOM 9396  C CA    . ALA D 3 255 ? -91.707  149.588 148.719 1.00 61.16  ? 255 ALA E CA    1 
ATOM 9397  C C     . ALA D 3 255 ? -92.288  148.709 149.814 1.00 61.16  ? 255 ALA E C     1 
ATOM 9398  O O     . ALA D 3 255 ? -92.888  149.217 150.760 1.00 61.16  ? 255 ALA E O     1 
ATOM 9399  C CB    . ALA D 3 255 ? -92.665  149.664 147.540 1.00 61.16  ? 255 ALA E CB    1 
ATOM 9400  N N     . VAL D 3 256 ? -92.112  147.396 149.717 1.00 59.64  ? 256 VAL E N     1 
ATOM 9401  C CA    . VAL D 3 256 ? -92.663  146.512 150.736 1.00 59.64  ? 256 VAL E CA    1 
ATOM 9402  C C     . VAL D 3 256 ? -91.903  146.658 152.039 1.00 59.64  ? 256 VAL E C     1 
ATOM 9403  O O     . VAL D 3 256 ? -92.503  146.802 153.108 1.00 59.64  ? 256 VAL E O     1 
ATOM 9404  C CB    . VAL D 3 256 ? -92.642  145.057 150.261 1.00 59.64  ? 256 VAL E CB    1 
ATOM 9405  C CG1   . VAL D 3 256 ? -93.031  144.160 151.385 1.00 59.64  ? 256 VAL E CG1   1 
ATOM 9406  C CG2   . VAL D 3 256 ? -93.590  144.879 149.146 1.00 59.64  ? 256 VAL E CG2   1 
ATOM 9407  N N     . ALA D 3 257 ? -90.574  146.636 151.975 1.00 57.14  ? 257 ALA E N     1 
ATOM 9408  C CA    . ALA D 3 257 ? -89.804  146.758 153.205 1.00 57.14  ? 257 ALA E CA    1 
ATOM 9409  C C     . ALA D 3 257 ? -90.072  148.091 153.875 1.00 57.14  ? 257 ALA E C     1 
ATOM 9410  O O     . ALA D 3 257 ? -90.278  148.169 155.095 1.00 57.14  ? 257 ALA E O     1 
ATOM 9411  C CB    . ALA D 3 257 ? -88.319  146.597 152.905 1.00 57.14  ? 257 ALA E CB    1 
ATOM 9412  N N     . GLU D 3 258 ? -90.161  149.135 153.053 1.00 58.50  ? 258 GLU E N     1 
ATOM 9413  C CA    . GLU D 3 258 ? -90.463  150.484 153.519 1.00 58.50  ? 258 GLU E CA    1 
ATOM 9414  C C     . GLU D 3 258 ? -91.843  150.544 154.154 1.00 58.50  ? 258 GLU E C     1 
ATOM 9415  O O     . GLU D 3 258 ? -92.022  151.190 155.174 1.00 58.50  ? 258 GLU E O     1 
ATOM 9416  C CB    . GLU D 3 258 ? -90.413  151.470 152.358 1.00 58.50  ? 258 GLU E CB    1 
ATOM 9417  C CG    . GLU D 3 258 ? -89.099  152.215 152.228 1.00 58.50  ? 258 GLU E CG    1 
ATOM 9418  C CD    . GLU D 3 258 ? -88.515  152.570 153.573 1.00 58.50  ? 258 GLU E CD    1 
ATOM 9419  O OE1   . GLU D 3 258 ? -87.278  152.700 153.684 1.00 58.50  ? 258 GLU E OE1   1 
ATOM 9420  O OE2   . GLU D 3 258 ? -89.306  152.711 154.524 1.00 58.50  ? 258 GLU E OE2   1 
ATOM 9421  N N     . PHE D 3 259 ? -92.816  149.873 153.551 1.00 50.93  ? 259 PHE E N     1 
ATOM 9422  C CA    . PHE D 3 259 ? -94.163  149.846 154.097 1.00 50.93  ? 259 PHE E CA    1 
ATOM 9423  C C     . PHE D 3 259 ? -94.209  149.149 155.440 1.00 50.93  ? 259 PHE E C     1 
ATOM 9424  O O     . PHE D 3 259 ? -94.833  149.637 156.376 1.00 50.93  ? 259 PHE E O     1 
ATOM 9425  C CB    . PHE D 3 259 ? -95.129  149.176 153.137 1.00 50.93  ? 259 PHE E CB    1 
ATOM 9426  C CG    . PHE D 3 259 ? -96.443  148.865 153.760 1.00 50.93  ? 259 PHE E CG    1 
ATOM 9427  C CD1   . PHE D 3 259 ? -97.395  149.835 153.894 1.00 50.93  ? 259 PHE E CD1   1 
ATOM 9428  C CD2   . PHE D 3 259 ? -96.734  147.597 154.194 1.00 50.93  ? 259 PHE E CD2   1 
ATOM 9429  C CE1   . PHE D 3 259 ? -98.594  149.558 154.464 1.00 50.93  ? 259 PHE E CE1   1 
ATOM 9430  C CE2   . PHE D 3 259 ? -97.939  147.319 154.765 1.00 50.93  ? 259 PHE E CE2   1 
ATOM 9431  C CZ    . PHE D 3 259 ? -98.869  148.299 154.897 1.00 50.93  ? 259 PHE E CZ    1 
ATOM 9432  N N     . LEU D 3 260 ? -93.591  147.985 155.546 1.00 50.06  ? 260 LEU E N     1 
ATOM 9433  C CA    . LEU D 3 260 ? -93.639  147.254 156.803 1.00 50.06  ? 260 LEU E CA    1 
ATOM 9434  C C     . LEU D 3 260 ? -92.987  148.047 157.924 1.00 50.06  ? 260 LEU E C     1 
ATOM 9435  O O     . LEU D 3 260 ? -93.532  148.148 159.034 1.00 50.06  ? 260 LEU E O     1 
ATOM 9436  C CB    . LEU D 3 260 ? -92.962  145.906 156.617 1.00 50.06  ? 260 LEU E CB    1 
ATOM 9437  C CG    . LEU D 3 260 ? -93.863  144.739 156.263 1.00 50.06  ? 260 LEU E CG    1 
ATOM 9438  C CD1   . LEU D 3 260 ? -94.624  145.047 155.040 1.00 50.06  ? 260 LEU E CD1   1 
ATOM 9439  C CD2   . LEU D 3 260 ? -92.989  143.576 155.964 1.00 50.06  ? 260 LEU E CD2   1 
ATOM 9440  N N     . ARG D 3 261 ? -91.868  148.698 157.626 1.00 53.43  ? 261 ARG E N     1 
ATOM 9441  C CA    . ARG D 3 261 ? -91.238  149.522 158.643 1.00 53.43  ? 261 ARG E CA    1 
ATOM 9442  C C     . ARG D 3 261 ? -92.103  150.707 159.029 1.00 53.43  ? 261 ARG E C     1 
ATOM 9443  O O     . ARG D 3 261 ? -92.195  151.052 160.212 1.00 53.43  ? 261 ARG E O     1 
ATOM 9444  C CB    . ARG D 3 261 ? -89.899  150.017 158.131 1.00 53.43  ? 261 ARG E CB    1 
ATOM 9445  C CG    . ARG D 3 261 ? -89.208  150.897 159.099 1.00 53.43  ? 261 ARG E CG    1 
ATOM 9446  C CD    . ARG D 3 261 ? -87.946  151.446 158.522 1.00 53.43  ? 261 ARG E CD    1 
ATOM 9447  N NE    . ARG D 3 261 ? -87.352  152.377 159.463 1.00 53.43  ? 261 ARG E NE    1 
ATOM 9448  C CZ    . ARG D 3 261 ? -86.561  152.011 160.460 1.00 53.43  ? 261 ARG E CZ    1 
ATOM 9449  N NH1   . ARG D 3 261 ? -86.273  150.732 160.636 1.00 53.43  ? 261 ARG E NH1   1 
ATOM 9450  N NH2   . ARG D 3 261 ? -86.066  152.921 161.280 1.00 53.43  ? 261 ARG E NH2   1 
ATOM 9451  N N     . ALA D 3 262 ? -92.779  151.316 158.061 1.00 49.20  ? 262 ALA E N     1 
ATOM 9452  C CA    . ALA D 3 262 ? -93.696  152.395 158.392 1.00 49.20  ? 262 ALA E CA    1 
ATOM 9453  C C     . ALA D 3 262 ? -94.848  151.889 159.233 1.00 49.20  ? 262 ALA E C     1 
ATOM 9454  O O     . ALA D 3 262 ? -95.317  152.587 160.133 1.00 49.20  ? 262 ALA E O     1 
ATOM 9455  C CB    . ALA D 3 262 ? -94.226  153.038 157.122 1.00 49.20  ? 262 ALA E CB    1 
ATOM 9456  N N     . PHE D 3 263 ? -95.322  150.685 158.943 1.00 45.40  ? 263 PHE E N     1 
ATOM 9457  C CA    . PHE D 3 263 ? -96.426  150.112 159.691 1.00 45.40  ? 263 PHE E CA    1 
ATOM 9458  C C     . PHE D 3 263 ? -96.058  149.954 161.152 1.00 45.40  ? 263 PHE E C     1 
ATOM 9459  O O     . PHE D 3 263 ? -96.909  150.093 162.032 1.00 45.40  ? 263 PHE E O     1 
ATOM 9460  C CB    . PHE D 3 263 ? -96.837  148.789 159.066 1.00 45.40  ? 263 PHE E CB    1 
ATOM 9461  C CG    . PHE D 3 263 ? -97.935  148.098 159.788 1.00 45.40  ? 263 PHE E CG    1 
ATOM 9462  C CD1   . PHE D 3 263 ? -99.237  148.421 159.530 1.00 45.40  ? 263 PHE E CD1   1 
ATOM 9463  C CD2   . PHE D 3 263 ? -97.676  147.080 160.665 1.00 45.40  ? 263 PHE E CD2   1 
ATOM 9464  C CE1   . PHE D 3 263 ? -100.249 147.791 160.173 1.00 45.40  ? 263 PHE E CE1   1 
ATOM 9465  C CE2   . PHE D 3 263 ? -98.696  146.439 161.301 1.00 45.40  ? 263 PHE E CE2   1 
ATOM 9466  C CZ    . PHE D 3 263 ? -99.981  146.800 161.054 1.00 45.40  ? 263 PHE E CZ    1 
ATOM 9467  N N     . LEU D 3 264 ? -94.797  149.649 161.431 1.00 46.55  ? 264 LEU E N     1 
ATOM 9468  C CA    . LEU D 3 264 ? -94.376  149.438 162.810 1.00 46.55  ? 264 LEU E CA    1 
ATOM 9469  C C     . LEU D 3 264 ? -94.037  150.742 163.511 1.00 46.55  ? 264 LEU E C     1 
ATOM 9470  O O     . LEU D 3 264 ? -94.319  150.902 164.700 1.00 46.55  ? 264 LEU E O     1 
ATOM 9471  C CB    . LEU D 3 264 ? -93.166  148.524 162.857 1.00 46.55  ? 264 LEU E CB    1 
ATOM 9472  C CG    . LEU D 3 264 ? -93.496  147.161 162.293 1.00 46.55  ? 264 LEU E CG    1 
ATOM 9473  C CD1   . LEU D 3 264 ? -92.366  146.226 162.550 1.00 46.55  ? 264 LEU E CD1   1 
ATOM 9474  C CD2   . LEU D 3 264 ? -94.740  146.675 162.961 1.00 46.55  ? 264 LEU E CD2   1 
ATOM 9475  N N     . SER D 3 265 ? -93.435  151.675 162.792 1.00 48.85  ? 265 SER E N     1 
ATOM 9476  C CA    . SER D 3 265 ? -92.902  152.891 163.381 1.00 48.85  ? 265 SER E CA    1 
ATOM 9477  C C     . SER D 3 265 ? -93.936  153.978 163.621 1.00 48.85  ? 265 SER E C     1 
ATOM 9478  O O     . SER D 3 265 ? -93.864  154.678 164.632 1.00 48.85  ? 265 SER E O     1 
ATOM 9479  C CB    . SER D 3 265 ? -91.818  153.443 162.467 1.00 48.85  ? 265 SER E CB    1 
ATOM 9480  O OG    . SER D 3 265 ? -91.345  154.680 162.944 1.00 48.85  ? 265 SER E OG    1 
ATOM 9481  N N     . THR D 3 266 ? -94.888  154.149 162.721 1.00 47.43  ? 266 THR E N     1 
ATOM 9482  C CA    . THR D 3 266 ? -95.752  155.318 162.743 1.00 47.43  ? 266 THR E CA    1 
ATOM 9483  C C     . THR D 3 266 ? -96.932  155.192 163.708 1.00 47.43  ? 266 THR E C     1 
ATOM 9484  O O     . THR D 3 266 ? -97.373  154.102 164.062 1.00 47.43  ? 266 THR E O     1 
ATOM 9485  C CB    . THR D 3 266 ? -96.244  155.604 161.341 1.00 47.43  ? 266 THR E CB    1 
ATOM 9486  O OG1   . THR D 3 266 ? -96.700  156.954 161.276 1.00 47.43  ? 266 THR E OG1   1 
ATOM 9487  C CG2   . THR D 3 266 ? -97.358  154.679 161.006 1.00 47.43  ? 266 THR E CG2   1 
ATOM 9488  N N     . VAL D 3 267 ? -97.493  156.337 164.079 1.00 46.43  ? 267 VAL E N     1 
ATOM 9489  C CA    . VAL D 3 267 ? -98.674  156.399 164.940 1.00 46.43  ? 267 VAL E CA    1 
ATOM 9490  C C     . VAL D 3 267 ? -99.629  157.465 164.381 1.00 46.43  ? 267 VAL E C     1 
ATOM 9491  O O     . VAL D 3 267 ? -99.200  158.330 163.631 1.00 46.43  ? 267 VAL E O     1 
ATOM 9492  C CB    . VAL D 3 267 ? -98.334  156.593 166.421 1.00 46.43  ? 267 VAL E CB    1 
ATOM 9493  C CG1   . VAL D 3 267 ? -99.589  156.498 167.262 1.00 46.43  ? 267 VAL E CG1   1 
ATOM 9494  C CG2   . VAL D 3 267 ? -97.380  155.508 166.864 1.00 46.43  ? 267 VAL E CG2   1 
ATOM 9495  N N     . PRO D 3 268 ? -100.968 157.380 164.748 1.00 45.61  ? 268 PRO E N     1 
ATOM 9496  C CA    . PRO D 3 268 ? -101.850 158.383 164.124 1.00 45.61  ? 268 PRO E CA    1 
ATOM 9497  C C     . PRO D 3 268 ? -101.537 159.855 164.361 1.00 45.61  ? 268 PRO E C     1 
ATOM 9498  O O     . PRO D 3 268 ? -101.726 160.628 163.429 1.00 45.61  ? 268 PRO E O     1 
ATOM 9499  C CB    . PRO D 3 268 ? -103.220 158.064 164.706 1.00 45.61  ? 268 PRO E CB    1 
ATOM 9500  C CG    . PRO D 3 268 ? -103.189 156.613 164.891 1.00 45.61  ? 268 PRO E CG    1 
ATOM 9501  C CD    . PRO D 3 268 ? -101.867 156.436 165.545 1.00 45.61  ? 268 PRO E CD    1 
ATOM 9502  N N     . SER D 3 269 ? -101.091 160.253 165.540 1.00 47.75  ? 269 SER E N     1 
ATOM 9503  C CA    . SER D 3 269 ? -100.775 161.663 165.773 1.00 47.75  ? 269 SER E CA    1 
ATOM 9504  C C     . SER D 3 269 ? -101.936 162.614 166.011 1.00 47.75  ? 269 SER E C     1 
ATOM 9505  O O     . SER D 3 269 ? -101.806 163.806 165.783 1.00 47.75  ? 269 SER E O     1 
ATOM 9506  C CB    . SER D 3 269 ? -99.916  162.219 164.639 1.00 47.75  ? 269 SER E CB    1 
ATOM 9507  O OG    . SER D 3 269 ? -100.734 162.662 163.578 1.00 47.75  ? 269 SER E OG    1 
ATOM 9508  N N     . GLY D 3 270 ? -103.068 162.106 166.463 1.00 51.24  ? 270 GLY E N     1 
ATOM 9509  C CA    . GLY D 3 270 ? -104.190 162.971 166.748 1.00 51.24  ? 270 GLY E CA    1 
ATOM 9510  C C     . GLY D 3 270 ? -104.194 163.197 168.240 1.00 51.24  ? 270 GLY E C     1 
ATOM 9511  O O     . GLY D 3 270 ? -104.220 162.254 169.000 1.00 51.24  ? 270 GLY E O     1 
ATOM 9512  N N     . LYS D 3 271 ? -104.180 164.446 168.669 1.00 54.07  ? 271 LYS E N     1 
ATOM 9513  C CA    . LYS D 3 271 ? -104.155 164.751 170.092 1.00 54.07  ? 271 LYS E CA    1 
ATOM 9514  C C     . LYS D 3 271 ? -102.944 164.171 170.823 1.00 54.07  ? 271 LYS E C     1 
ATOM 9515  O O     . LYS D 3 271 ? -103.074 163.630 171.912 1.00 54.07  ? 271 LYS E O     1 
ATOM 9516  C CB    . LYS D 3 271 ? -105.433 164.270 170.752 1.00 54.07  ? 271 LYS E CB    1 
ATOM 9517  C CG    . LYS D 3 271 ? -105.794 165.064 171.982 1.00 54.07  ? 271 LYS E CG    1 
ATOM 9518  C CD    . LYS D 3 271 ? -106.653 166.257 171.623 1.00 54.07  ? 271 LYS E CD    1 
ATOM 9519  C CE    . LYS D 3 271 ? -107.969 166.224 172.370 1.00 54.07  ? 271 LYS E CE    1 
ATOM 9520  N NZ    . LYS D 3 271 ? -108.439 164.832 172.582 1.00 54.07  ? 271 LYS E NZ    1 
ATOM 9521  N N     . GLN D 3 272 ? -101.772 164.284 170.204 1.00 51.60  ? 272 GLN E N     1 
ATOM 9522  C CA    . GLN D 3 272 ? -100.517 163.805 170.756 1.00 51.60  ? 272 GLN E CA    1 
ATOM 9523  C C     . GLN D 3 272 ? -99.726  164.872 171.469 1.00 51.60  ? 272 GLN E C     1 
ATOM 9524  O O     . GLN D 3 272 ? -98.781  164.547 172.190 1.00 51.60  ? 272 GLN E O     1 
ATOM 9525  C CB    . GLN D 3 272 ? -99.688  163.110 169.704 1.00 51.60  ? 272 GLN E CB    1 
ATOM 9526  C CG    . GLN D 3 272 ? -100.446 161.914 169.381 1.00 51.60  ? 272 GLN E CG    1 
ATOM 9527  C CD    . GLN D 3 272 ? -99.651  160.862 168.739 1.00 51.60  ? 272 GLN E CD    1 
ATOM 9528  O OE1   . GLN D 3 272 ? -98.548  161.085 168.266 1.00 51.60  ? 272 GLN E OE1   1 
ATOM 9529  N NE2   . GLN D 3 272 ? -100.197 159.675 168.743 1.00 51.60  ? 272 GLN E NE2   1 
ATOM 9530  N N     . ASN D 3 273 ? -100.068 166.127 171.282 1.00 53.67  ? 273 ASN E N     1 
ATOM 9531  C CA    . ASN D 3 273 ? -99.395  167.136 172.068 1.00 53.67  ? 273 ASN E CA    1 
ATOM 9532  C C     . ASN D 3 273 ? -99.956  167.088 173.472 1.00 53.67  ? 273 ASN E C     1 
ATOM 9533  O O     . ASN D 3 273 ? -99.216  167.188 174.451 1.00 53.67  ? 273 ASN E O     1 
ATOM 9534  C CB    . ASN D 3 273 ? -99.570  168.497 171.426 1.00 53.67  ? 273 ASN E CB    1 
ATOM 9535  C CG    . ASN D 3 273 ? -98.910  168.566 170.080 1.00 53.67  ? 273 ASN E CG    1 
ATOM 9536  O OD1   . ASN D 3 273 ? -99.552  168.857 169.084 1.00 53.67  ? 273 ASN E OD1   1 
ATOM 9537  N ND2   . ASN D 3 273 ? -97.637  168.225 170.030 1.00 53.67  ? 273 ASN E ND2   1 
ATOM 9538  N N     . ALA D 3 274 ? -101.266 166.914 173.575 1.00 52.72  ? 274 ALA E N     1 
ATOM 9539  C CA    . ALA D 3 274 ? -101.910 166.810 174.872 1.00 52.72  ? 274 ALA E CA    1 
ATOM 9540  C C     . ALA D 3 274 ? -101.600 165.484 175.541 1.00 52.72  ? 274 ALA E C     1 
ATOM 9541  O O     . ALA D 3 274 ? -101.612 165.406 176.771 1.00 52.72  ? 274 ALA E O     1 
ATOM 9542  C CB    . ALA D 3 274 ? -103.418 166.968 174.726 1.00 52.72  ? 274 ALA E CB    1 
ATOM 9543  N N     . THR D 3 275 ? -101.334 164.433 174.763 1.00 54.13  ? 275 THR E N     1 
ATOM 9544  C CA    . THR D 3 275 ? -100.998 163.120 175.308 1.00 54.13  ? 275 THR E CA    1 
ATOM 9545  C C     . THR D 3 275 ? -99.958  162.477 174.411 1.00 54.13  ? 275 THR E C     1 
ATOM 9546  O O     . THR D 3 275 ? -100.234 162.224 173.242 1.00 54.13  ? 275 THR E O     1 
ATOM 9547  C CB    . THR D 3 275 ? -102.221 162.205 175.315 1.00 54.13  ? 275 THR E CB    1 
ATOM 9548  O OG1   . THR D 3 275 ? -102.510 161.838 173.964 1.00 54.13  ? 275 THR E OG1   1 
ATOM 9549  C CG2   . THR D 3 275 ? -103.437 162.906 175.827 1.00 54.13  ? 275 THR E CG2   1 
ATOM 9550  N N     . ALA D 3 276 ? -98.806  162.134 174.963 1.00 51.45  ? 276 ALA E N     1 
ATOM 9551  C CA    . ALA D 3 276 ? -97.744  161.526 174.168 1.00 51.45  ? 276 ALA E CA    1 
ATOM 9552  C C     . ALA D 3 276 ? -98.058  160.049 174.020 1.00 51.45  ? 276 ALA E C     1 
ATOM 9553  O O     . ALA D 3 276 ? -97.740  159.238 174.883 1.00 51.45  ? 276 ALA E O     1 
ATOM 9554  C CB    . ALA D 3 276 ? -96.391  161.759 174.805 1.00 51.45  ? 276 ALA E CB    1 
ATOM 9555  N N     . ALA D 3 277 ? -98.692  159.684 172.920 1.00 51.14  ? 277 ALA E N     1 
ATOM 9556  C CA    . ALA D 3 277 ? -99.049  158.296 172.675 1.00 51.14  ? 277 ALA E CA    1 
ATOM 9557  C C     . ALA D 3 277 ? -98.014  157.518 171.877 1.00 51.14  ? 277 ALA E C     1 
ATOM 9558  O O     . ALA D 3 277 ? -98.302  156.403 171.448 1.00 51.14  ? 277 ALA E O     1 
ATOM 9559  C CB    . ALA D 3 277 ? -100.390 158.234 171.958 1.00 51.14  ? 277 ALA E CB    1 
ATOM 9560  N N     . MET D 3 278 ? -96.836  158.073 171.643 1.00 50.90  ? 278 MET E N     1 
ATOM 9561  C CA    . MET D 3 278 ? -95.829  157.348 170.882 1.00 50.90  ? 278 MET E CA    1 
ATOM 9562  C C     . MET D 3 278 ? -95.450  156.048 171.577 1.00 50.90  ? 278 MET E C     1 
ATOM 9563  O O     . MET D 3 278 ? -95.141  156.032 172.768 1.00 50.90  ? 278 MET E O     1 
ATOM 9564  C CB    . MET D 3 278 ? -94.621  158.239 170.667 1.00 50.90  ? 278 MET E CB    1 
ATOM 9565  C CG    . MET D 3 278 ? -95.062  159.607 170.206 1.00 50.90  ? 278 MET E CG    1 
ATOM 9566  S SD    . MET D 3 278 ? -96.042  159.721 168.689 1.00 50.90  ? 278 MET E SD    1 
ATOM 9567  C CE    . MET D 3 278 ? -95.013  159.023 167.414 1.00 50.90  ? 278 MET E CE    1 
ATOM 9568  N N     . THR D 3 279 ? -95.486  154.955 170.827 1.00 47.38  ? 279 THR E N     1 
ATOM 9569  C CA    . THR D 3 279 ? -95.201  153.643 171.377 1.00 47.38  ? 279 THR E CA    1 
ATOM 9570  C C     . THR D 3 279 ? -94.824  152.673 170.270 1.00 47.38  ? 279 THR E C     1 
ATOM 9571  O O     . THR D 3 279 ? -95.319  152.779 169.149 1.00 47.38  ? 279 THR E O     1 
ATOM 9572  C CB    . THR D 3 279 ? -96.424  153.138 172.135 1.00 47.38  ? 279 THR E CB    1 
ATOM 9573  O OG1   . THR D 3 279 ? -96.629  153.948 173.293 1.00 47.38  ? 279 THR E OG1   1 
ATOM 9574  C CG2   . THR D 3 279 ? -96.253  151.725 172.551 1.00 47.38  ? 279 THR E CG2   1 
ATOM 9575  N N     . LEU D 3 280 ? -93.931  151.739 170.583 1.00 46.32  ? 280 LEU E N     1 
ATOM 9576  C CA    . LEU D 3 280 ? -93.613  150.633 169.687 1.00 46.32  ? 280 LEU E CA    1 
ATOM 9577  C C     . LEU D 3 280 ? -94.498  149.433 169.964 1.00 46.32  ? 280 LEU E C     1 
ATOM 9578  O O     . LEU D 3 280 ? -94.867  149.181 171.113 1.00 46.32  ? 280 LEU E O     1 
ATOM 9579  C CB    . LEU D 3 280 ? -92.170  150.195 169.780 1.00 46.32  ? 280 LEU E CB    1 
ATOM 9580  C CG    . LEU D 3 280 ? -91.155  151.144 169.199 1.00 46.32  ? 280 LEU E CG    1 
ATOM 9581  C CD1   . LEU D 3 280 ? -89.837  150.498 169.428 1.00 46.32  ? 280 LEU E CD1   1 
ATOM 9582  C CD2   . LEU D 3 280 ? -91.430  151.299 167.741 1.00 46.32  ? 280 LEU E CD2   1 
ATOM 9583  N N     . PRO D 3 281 ? -94.861  148.700 168.923 1.00 46.39  ? 281 PRO E N     1 
ATOM 9584  C CA    . PRO D 3 281 ? -95.717  147.538 169.117 1.00 46.39  ? 281 PRO E CA    1 
ATOM 9585  C C     . PRO D 3 281 ? -95.079  146.508 170.025 1.00 46.39  ? 281 PRO E C     1 
ATOM 9586  O O     . PRO D 3 281 ? -93.873  146.277 169.992 1.00 46.39  ? 281 PRO E O     1 
ATOM 9587  C CB    . PRO D 3 281 ? -95.853  146.974 167.707 1.00 46.39  ? 281 PRO E CB    1 
ATOM 9588  C CG    . PRO D 3 281 ? -95.633  148.103 166.839 1.00 46.39  ? 281 PRO E CG    1 
ATOM 9589  C CD    . PRO D 3 281 ? -94.620  148.959 167.506 1.00 46.39  ? 281 PRO E CD    1 
ATOM 9590  N N     . ASP D 3 282 ? -95.914  145.900 170.858 1.00 54.38  ? 282 ASP E N     1 
ATOM 9591  C CA    . ASP D 3 282 ? -95.436  144.902 171.795 1.00 54.38  ? 282 ASP E CA    1 
ATOM 9592  C C     . ASP D 3 282 ? -95.055  143.616 171.095 1.00 54.38  ? 282 ASP E C     1 
ATOM 9593  O O     . ASP D 3 282 ? -94.148  142.914 171.541 1.00 54.38  ? 282 ASP E O     1 
ATOM 9594  C CB    . ASP D 3 282 ? -96.499  144.615 172.843 1.00 54.38  ? 282 ASP E CB    1 
ATOM 9595  C CG    . ASP D 3 282 ? -95.903  144.278 174.177 1.00 54.38  ? 282 ASP E CG    1 
ATOM 9596  O OD1   . ASP D 3 282 ? -94.799  144.763 174.476 1.00 54.38  ? 282 ASP E OD1   1 
ATOM 9597  O OD2   . ASP D 3 282 ? -96.531  143.503 174.924 1.00 54.38  ? 282 ASP E OD2   1 
ATOM 9598  N N     . LEU D 3 283 ? -95.737  143.278 170.011 1.00 47.20  ? 283 LEU E N     1 
ATOM 9599  C CA    . LEU D 3 283 ? -95.392  142.073 169.278 1.00 47.20  ? 283 LEU E CA    1 
ATOM 9600  C C     . LEU D 3 283 ? -95.686  142.269 167.808 1.00 47.20  ? 283 LEU E C     1 
ATOM 9601  O O     . LEU D 3 283 ? -96.663  142.924 167.446 1.00 47.20  ? 283 LEU E O     1 
ATOM 9602  C CB    . LEU D 3 283 ? -96.180  140.875 169.794 1.00 47.20  ? 283 LEU E CB    1 
ATOM 9603  C CG    . LEU D 3 283 ? -96.011  139.539 169.092 1.00 47.20  ? 283 LEU E CG    1 
ATOM 9604  C CD1   . LEU D 3 283 ? -96.100  138.452 170.095 1.00 47.20  ? 283 LEU E CD1   1 
ATOM 9605  C CD2   . LEU D 3 283 ? -97.085  139.339 168.081 1.00 47.20  ? 283 LEU E CD2   1 
ATOM 9606  N N     . VAL D 3 284 ? -94.838  141.717 166.956 1.00 44.77  ? 284 VAL E N     1 
ATOM 9607  C CA    . VAL D 3 284 ? -95.071  141.794 165.525 1.00 44.77  ? 284 VAL E CA    1 
ATOM 9608  C C     . VAL D 3 284 ? -94.868  140.411 164.933 1.00 44.77  ? 284 VAL E C     1 
ATOM 9609  O O     . VAL D 3 284 ? -94.016  139.643 165.388 1.00 44.77  ? 284 VAL E O     1 
ATOM 9610  C CB    . VAL D 3 284 ? -94.165  142.831 164.854 1.00 44.77  ? 284 VAL E CB    1 
ATOM 9611  C CG1   . VAL D 3 284 ? -92.816  142.290 164.676 1.00 44.77  ? 284 VAL E CG1   1 
ATOM 9612  C CG2   . VAL D 3 284 ? -94.719  143.197 163.530 1.00 44.77  ? 284 VAL E CG2   1 
ATOM 9613  N N     . HIS D 3 285 ? -95.704  140.065 163.967 1.00 46.56  ? 285 HIS E N     1 
ATOM 9614  C CA    . HIS D 3 285 ? -95.680  138.744 163.355 1.00 46.56  ? 285 HIS E CA    1 
ATOM 9615  C C     . HIS D 3 285 ? -95.905  138.871 161.859 1.00 46.56  ? 285 HIS E C     1 
ATOM 9616  O O     . HIS D 3 285 ? -97.030  139.110 161.425 1.00 46.56  ? 285 HIS E O     1 
ATOM 9617  C CB    . HIS D 3 285 ? -96.720  137.837 163.975 1.00 46.56  ? 285 HIS E CB    1 
ATOM 9618  C CG    . HIS D 3 285 ? -96.870  136.536 163.266 1.00 46.56  ? 285 HIS E CG    1 
ATOM 9619  N ND1   . HIS D 3 285 ? -97.672  136.391 162.162 1.00 46.56  ? 285 HIS E ND1   1 
ATOM 9620  C CD2   . HIS D 3 285 ? -96.296  135.331 163.472 1.00 46.56  ? 285 HIS E CD2   1 
ATOM 9621  C CE1   . HIS D 3 285 ? -97.613  135.145 161.736 1.00 46.56  ? 285 HIS E CE1   1 
ATOM 9622  N NE2   . HIS D 3 285 ? -96.781  134.481 162.512 1.00 46.56  ? 285 HIS E NE2   1 
ATOM 9623  N N     . ILE D 3 286 ? -94.838  138.784 161.088 1.00 47.57  ? 286 ILE E N     1 
ATOM 9624  C CA    . ILE D 3 286 ? -94.924  138.811 159.637 1.00 47.57  ? 286 ILE E CA    1 
ATOM 9625  C C     . ILE D 3 286 ? -94.983  137.403 159.079 1.00 47.57  ? 286 ILE E C     1 
ATOM 9626  O O     . ILE D 3 286 ? -94.133  136.558 159.389 1.00 47.57  ? 286 ILE E O     1 
ATOM 9627  C CB    . ILE D 3 286 ? -93.760  139.583 159.014 1.00 47.57  ? 286 ILE E CB    1 
ATOM 9628  C CG1   . ILE D 3 286 ? -93.690  140.966 159.620 1.00 47.57  ? 286 ILE E CG1   1 
ATOM 9629  C CG2   . ILE D 3 286 ? -93.927  139.648 157.530 1.00 47.57  ? 286 ILE E CG2   1 
ATOM 9630  C CD1   . ILE D 3 286 ? -92.598  141.787 159.058 1.00 47.57  ? 286 ILE E CD1   1 
ATOM 9631  N N     . ALA D 3 287 ? -96.037  137.126 158.323 1.00 47.26  ? 287 ALA E N     1 
ATOM 9632  C CA    . ALA D 3 287 ? -96.149  135.868 157.608 1.00 47.26  ? 287 ALA E CA    1 
ATOM 9633  C C     . ALA D 3 287 ? -96.100  136.177 156.119 1.00 47.26  ? 287 ALA E C     1 
ATOM 9634  O O     . ALA D 3 287 ? -96.644  137.189 155.670 1.00 47.26  ? 287 ALA E O     1 
ATOM 9635  C CB    . ALA D 3 287 ? -97.431  135.136 157.966 1.00 47.26  ? 287 ALA E CB    1 
ATOM 9636  N N     . VAL D 3 288 ? -95.431  135.314 155.366 1.00 50.56  ? 288 VAL E N     1 
ATOM 9637  C CA    . VAL D 3 288 ? -95.366  135.401 153.915 1.00 50.56  ? 288 VAL E CA    1 
ATOM 9638  C C     . VAL D 3 288 ? -96.176  134.236 153.384 1.00 50.56  ? 288 VAL E C     1 
ATOM 9639  O O     . VAL D 3 288 ? -95.679  133.110 153.311 1.00 50.56  ? 288 VAL E O     1 
ATOM 9640  C CB    . VAL D 3 288 ? -93.933  135.364 153.393 1.00 50.56  ? 288 VAL E CB    1 
ATOM 9641  C CG1   . VAL D 3 288 ? -93.947  135.442 151.898 1.00 50.56  ? 288 VAL E CG1   1 
ATOM 9642  C CG2   . VAL D 3 288 ? -93.158  136.500 153.963 1.00 50.56  ? 288 VAL E CG2   1 
ATOM 9643  N N     . ARG D 3 289 ? -97.444  134.491 153.081 1.00 51.65  ? 289 ARG E N     1 
ATOM 9644  C CA    . ARG D 3 289 ? -98.333  133.440 152.611 1.00 51.65  ? 289 ARG E CA    1 
ATOM 9645  C C     . ARG D 3 289 ? -98.517  133.483 151.109 1.00 51.65  ? 289 ARG E C     1 
ATOM 9646  O O     . ARG D 3 289 ? -98.513  134.553 150.499 1.00 51.65  ? 289 ARG E O     1 
ATOM 9647  C CB    . ARG D 3 289 ? -99.692  133.541 153.307 1.00 51.65  ? 289 ARG E CB    1 
ATOM 9648  C CG    . ARG D 3 289 ? -100.042 134.941 153.786 1.00 51.65  ? 289 ARG E CG    1 
ATOM 9649  C CD    . ARG D 3 289 ? -101.136 134.906 154.841 1.00 51.65  ? 289 ARG E CD    1 
ATOM 9650  N NE    . ARG D 3 289 ? -101.068 133.699 155.660 1.00 51.65  ? 289 ARG E NE    1 
ATOM 9651  C CZ    . ARG D 3 289 ? -101.519 132.509 155.277 1.00 51.65  ? 289 ARG E CZ    1 
ATOM 9652  N NH1   . ARG D 3 289 ? -102.072 132.362 154.081 1.00 51.65  ? 289 ARG E NH1   1 
ATOM 9653  N NH2   . ARG D 3 289 ? -101.415 131.466 156.088 1.00 51.65  ? 289 ARG E NH2   1 
ATOM 9654  N N     . PHE D 3 290 ? -98.681  132.309 150.513 1.00 52.06  ? 290 PHE E N     1 
ATOM 9655  C CA    . PHE D 3 290 ? -98.872  132.232 149.079 1.00 52.06  ? 290 PHE E CA    1 
ATOM 9656  C C     . PHE D 3 290 ? -100.318 132.013 148.664 1.00 52.06  ? 290 PHE E C     1 
ATOM 9657  O O     . PHE D 3 290 ? -100.706 132.466 147.585 1.00 52.06  ? 290 PHE E O     1 
ATOM 9658  C CB    . PHE D 3 290 ? -98.002  131.105 148.537 1.00 52.06  ? 290 PHE E CB    1 
ATOM 9659  C CG    . PHE D 3 290 ? -96.562  131.273 148.872 1.00 52.06  ? 290 PHE E CG    1 
ATOM 9660  C CD1   . PHE D 3 290 ? -95.760  132.115 148.139 1.00 52.06  ? 290 PHE E CD1   1 
ATOM 9661  C CD2   . PHE D 3 290 ? -96.019  130.616 149.949 1.00 52.06  ? 290 PHE E CD2   1 
ATOM 9662  C CE1   . PHE D 3 290 ? -94.444  132.277 148.465 1.00 52.06  ? 290 PHE E CE1   1 
ATOM 9663  C CE2   . PHE D 3 290 ? -94.704  130.776 150.274 1.00 52.06  ? 290 PHE E CE2   1 
ATOM 9664  C CZ    . PHE D 3 290 ? -93.916  131.609 149.532 1.00 52.06  ? 290 PHE E CZ    1 
ATOM 9665  N N     . ASP D 3 291 ? -101.126 131.319 149.459 1.00 51.48  ? 291 ASP E N     1 
ATOM 9666  C CA    . ASP D 3 291 ? -102.501 131.095 149.032 1.00 51.48  ? 291 ASP E CA    1 
ATOM 9667  C C     . ASP D 3 291 ? -103.426 132.285 149.264 1.00 51.48  ? 291 ASP E C     1 
ATOM 9668  O O     . ASP D 3 291 ? -104.090 132.737 148.329 1.00 51.48  ? 291 ASP E O     1 
ATOM 9669  C CB    . ASP D 3 291 ? -103.055 129.871 149.740 1.00 51.48  ? 291 ASP E CB    1 
ATOM 9670  C CG    . ASP D 3 291 ? -102.842 129.933 151.218 1.00 51.48  ? 291 ASP E CG    1 
ATOM 9671  O OD1   . ASP D 3 291 ? -101.976 130.721 151.638 1.00 51.48  ? 291 ASP E OD1   1 
ATOM 9672  O OD2   . ASP D 3 291 ? -103.545 129.229 151.967 1.00 51.48  ? 291 ASP E OD2   1 
ATOM 9673  N N     . ARG D 3 292 ? -103.478 132.810 150.487 1.00 46.79  ? 292 ARG E N     1 
ATOM 9674  C CA    . ARG D 3 292 ? -104.424 133.864 150.839 1.00 46.79  ? 292 ARG E CA    1 
ATOM 9675  C C     . ARG D 3 292 ? -104.037 134.466 152.178 1.00 46.79  ? 292 ARG E C     1 
ATOM 9676  O O     . ARG D 3 292 ? -103.508 133.761 153.040 1.00 46.79  ? 292 ARG E O     1 
ATOM 9677  C CB    . ARG D 3 292 ? -105.864 133.364 150.902 1.00 46.79  ? 292 ARG E CB    1 
ATOM 9678  C CG    . ARG D 3 292 ? -106.135 132.360 151.976 1.00 46.79  ? 292 ARG E CG    1 
ATOM 9679  C CD    . ARG D 3 292 ? -107.596 132.020 151.988 1.00 46.79  ? 292 ARG E CD    1 
ATOM 9680  N NE    . ARG D 3 292 ? -108.418 133.201 152.215 1.00 46.79  ? 292 ARG E NE    1 
ATOM 9681  C CZ    . ARG D 3 292 ? -108.721 133.664 153.418 1.00 46.79  ? 292 ARG E CZ    1 
ATOM 9682  N NH1   . ARG D 3 292 ? -109.468 134.741 153.558 1.00 46.79  ? 292 ARG E NH1   1 
ATOM 9683  N NH2   . ARG D 3 292 ? -108.301 133.025 154.485 1.00 46.79  ? 292 ARG E NH2   1 
ATOM 9684  N N     . PRO D 3 293 ? -104.275 135.751 152.385 1.00 44.18  ? 293 PRO E N     1 
ATOM 9685  C CA    . PRO D 3 293 ? -104.025 136.355 153.693 1.00 44.18  ? 293 PRO E CA    1 
ATOM 9686  C C     . PRO D 3 293 ? -105.101 136.035 154.711 1.00 44.18  ? 293 PRO E C     1 
ATOM 9687  O O     . PRO D 3 293 ? -106.272 135.873 154.376 1.00 44.18  ? 293 PRO E O     1 
ATOM 9688  C CB    . PRO D 3 293 ? -104.028 137.851 153.382 1.00 44.18  ? 293 PRO E CB    1 
ATOM 9689  C CG    . PRO D 3 293 ? -104.882 137.965 152.214 1.00 44.18  ? 293 PRO E CG    1 
ATOM 9690  C CD    . PRO D 3 293 ? -104.689 136.748 151.398 1.00 44.18  ? 293 PRO E CD    1 
ATOM 9691  N N     . ILE D 3 294 ? -104.684 135.907 155.968 1.00 43.16  ? 294 ILE E N     1 
ATOM 9692  C CA    . ILE D 3 294 ? -105.579 135.553 157.067 1.00 43.16  ? 294 ILE E CA    1 
ATOM 9693  C C     . ILE D 3 294 ? -105.318 136.456 158.252 1.00 43.16  ? 294 ILE E C     1 
ATOM 9694  O O     . ILE D 3 294 ? -104.236 136.411 158.837 1.00 43.16  ? 294 ILE E O     1 
ATOM 9695  C CB    . ILE D 3 294 ? -105.478 134.102 157.524 1.00 43.16  ? 294 ILE E CB    1 
ATOM 9696  C CG1   . ILE D 3 294 ? -105.735 133.137 156.406 1.00 43.16  ? 294 ILE E CG1   1 
ATOM 9697  C CG2   . ILE D 3 294 ? -106.424 133.855 158.649 1.00 43.16  ? 294 ILE E CG2   1 
ATOM 9698  C CD1   . ILE D 3 294 ? -105.467 131.789 156.865 1.00 43.16  ? 294 ILE E CD1   1 
ATOM 9699  N N     . SER D 3 295 ? -106.302 137.260 158.617 1.00 43.33  ? 295 SER E N     1 
ATOM 9700  C CA    . SER D 3 295 ? -106.162 138.082 159.799 1.00 43.33  ? 295 SER E CA    1 
ATOM 9701  C C     . SER D 3 295 ? -106.509 137.238 161.010 1.00 43.33  ? 295 SER E C     1 
ATOM 9702  O O     . SER D 3 295 ? -107.360 136.356 160.942 1.00 43.33  ? 295 SER E O     1 
ATOM 9703  C CB    . SER D 3 295 ? -107.082 139.284 159.739 1.00 43.33  ? 295 SER E CB    1 
ATOM 9704  O OG    . SER D 3 295 ? -108.397 138.881 160.025 1.00 43.33  ? 295 SER E OG    1 
ATOM 9705  N N     . PHE D 3 296 ? -105.837 137.506 162.122 1.00 42.93  ? 296 PHE E N     1 
ATOM 9706  C CA    . PHE D 3 296 ? -106.122 136.837 163.379 1.00 42.93  ? 296 PHE E CA    1 
ATOM 9707  C C     . PHE D 3 296 ? -107.108 137.602 164.231 1.00 42.93  ? 296 PHE E C     1 
ATOM 9708  O O     . PHE D 3 296 ? -107.143 137.408 165.447 1.00 42.93  ? 296 PHE E O     1 
ATOM 9709  C CB    . PHE D 3 296 ? -104.838 136.618 164.161 1.00 42.93  ? 296 PHE E CB    1 
ATOM 9710  C CG    . PHE D 3 296 ? -103.882 135.709 163.487 1.00 42.93  ? 296 PHE E CG    1 
ATOM 9711  C CD1   . PHE D 3 296 ? -104.304 134.855 162.507 1.00 42.93  ? 296 PHE E CD1   1 
ATOM 9712  C CD2   . PHE D 3 296 ? -102.558 135.721 163.825 1.00 42.93  ? 296 PHE E CD2   1 
ATOM 9713  C CE1   . PHE D 3 296 ? -103.424 134.033 161.879 1.00 42.93  ? 296 PHE E CE1   1 
ATOM 9714  C CE2   . PHE D 3 296 ? -101.681 134.898 163.200 1.00 42.93  ? 296 PHE E CE2   1 
ATOM 9715  C CZ    . PHE D 3 296 ? -102.115 134.054 162.225 1.00 42.93  ? 296 PHE E CZ    1 
ATOM 9716  N N     . ALA D 3 297 ? -107.952 138.413 163.623 1.00 43.86  ? 297 ALA E N     1 
ATOM 9717  C CA    . ALA D 3 297 ? -108.913 139.169 164.403 1.00 43.86  ? 297 ALA E CA    1 
ATOM 9718  C C     . ALA D 3 297 ? -109.949 138.302 165.101 1.00 43.86  ? 297 ALA E C     1 
ATOM 9719  O O     . ALA D 3 297 ? -110.309 138.622 166.242 1.00 43.86  ? 297 ALA E O     1 
ATOM 9720  C CB    . ALA D 3 297 ? -109.610 140.190 163.512 1.00 43.86  ? 297 ALA E CB    1 
ATOM 9721  N N     . PRO D 3 298 ? -110.391 137.178 164.545 1.00 44.27  ? 298 PRO E N     1 
ATOM 9722  C CA    . PRO D 3 298 ? -111.271 136.308 165.322 1.00 44.27  ? 298 PRO E CA    1 
ATOM 9723  C C     . PRO D 3 298 ? -110.659 135.837 166.611 1.00 44.27  ? 298 PRO E C     1 
ATOM 9724  O O     . PRO D 3 298 ? -111.398 135.469 167.528 1.00 44.27  ? 298 PRO E O     1 
ATOM 9725  C CB    . PRO D 3 298 ? -111.510 135.134 164.378 1.00 44.27  ? 298 PRO E CB    1 
ATOM 9726  C CG    . PRO D 3 298 ? -111.361 135.696 163.088 1.00 44.27  ? 298 PRO E CG    1 
ATOM 9727  C CD    . PRO D 3 298 ? -110.299 136.711 163.159 1.00 44.27  ? 298 PRO E CD    1 
ATOM 9728  N N     . ALA D 3 299 ? -109.336 135.830 166.718 1.00 45.53  ? 299 ALA E N     1 
ATOM 9729  C CA    . ALA D 3 299 ? -108.729 135.379 167.955 1.00 45.53  ? 299 ALA E CA    1 
ATOM 9730  C C     . ALA D 3 299 ? -109.155 136.246 169.117 1.00 45.53  ? 299 ALA E C     1 
ATOM 9731  O O     . ALA D 3 299 ? -109.271 135.757 170.241 1.00 45.53  ? 299 ALA E O     1 
ATOM 9732  C CB    . ALA D 3 299 ? -107.215 135.397 167.834 1.00 45.53  ? 299 ALA E CB    1 
ATOM 9733  N N     . PHE D 3 300 ? -109.410 137.526 168.869 1.00 44.23  ? 300 PHE E N     1 
ATOM 9734  C CA    . PHE D 3 300 ? -109.774 138.447 169.932 1.00 44.23  ? 300 PHE E CA    1 
ATOM 9735  C C     . PHE D 3 300 ? -111.233 138.840 169.872 1.00 44.23  ? 300 PHE E C     1 
ATOM 9736  O O     . PHE D 3 300 ? -111.600 139.914 170.341 1.00 44.23  ? 300 PHE E O     1 
ATOM 9737  C CB    . PHE D 3 300 ? -108.915 139.697 169.862 1.00 44.23  ? 300 PHE E CB    1 
ATOM 9738  C CG    . PHE D 3 300 ? -107.474 139.415 169.723 1.00 44.23  ? 300 PHE E CG    1 
ATOM 9739  C CD1   . PHE D 3 300 ? -106.747 138.980 170.793 1.00 44.23  ? 300 PHE E CD1   1 
ATOM 9740  C CD2   . PHE D 3 300 ? -106.842 139.589 168.524 1.00 44.23  ? 300 PHE E CD2   1 
ATOM 9741  C CE1   . PHE D 3 300 ? -105.430 138.724 170.667 1.00 44.23  ? 300 PHE E CE1   1 
ATOM 9742  C CE2   . PHE D 3 300 ? -105.522 139.331 168.399 1.00 44.23  ? 300 PHE E CE2   1 
ATOM 9743  C CZ    . PHE D 3 300 ? -104.815 138.900 169.470 1.00 44.23  ? 300 PHE E CZ    1 
ATOM 9744  N N     . GLU D 3 301 ? -112.071 138.007 169.277 1.00 47.33  ? 301 GLU E N     1 
ATOM 9745  C CA    . GLU D 3 301 ? -113.490 138.308 169.290 1.00 47.33  ? 301 GLU E CA    1 
ATOM 9746  C C     . GLU D 3 301 ? -114.067 138.144 170.691 1.00 47.33  ? 301 GLU E C     1 
ATOM 9747  O O     . GLU D 3 301 ? -114.883 138.960 171.124 1.00 47.33  ? 301 GLU E O     1 
ATOM 9748  C CB    . GLU D 3 301 ? -114.171 137.456 168.220 1.00 47.33  ? 301 GLU E CB    1 
ATOM 9749  C CG    . GLU D 3 301 ? -115.657 137.330 168.229 1.00 47.33  ? 301 GLU E CG    1 
ATOM 9750  C CD    . GLU D 3 301 ? -116.143 136.354 169.218 1.00 47.33  ? 301 GLU E CD    1 
ATOM 9751  O OE1   . GLU D 3 301 ? -115.306 135.583 169.715 1.00 47.33  ? 301 GLU E OE1   1 
ATOM 9752  O OE2   . GLU D 3 301 ? -117.365 136.307 169.449 1.00 47.33  ? 301 GLU E OE2   1 
ATOM 9753  N N     . THR D 3 302 ? -113.646 137.116 171.421 1.00 48.47  ? 302 THR E N     1 
ATOM 9754  C CA    . THR D 3 302 ? -113.964 136.972 172.840 1.00 48.47  ? 302 THR E CA    1 
ATOM 9755  C C     . THR D 3 302 ? -113.110 137.956 173.625 1.00 48.47  ? 302 THR E C     1 
ATOM 9756  O O     . THR D 3 302 ? -111.914 137.735 173.803 1.00 48.47  ? 302 THR E O     1 
ATOM 9757  C CB    . THR D 3 302 ? -113.696 135.562 173.338 1.00 48.47  ? 302 THR E CB    1 
ATOM 9758  O OG1   . THR D 3 302 ? -112.289 135.314 173.284 1.00 48.47  ? 302 THR E OG1   1 
ATOM 9759  C CG2   . THR D 3 302 ? -114.410 134.542 172.498 1.00 48.47  ? 302 THR E CG2   1 
ATOM 9760  N N     . ALA D 3 303 ? -113.716 139.024 174.121 1.00 52.06  ? 303 ALA E N     1 
ATOM 9761  C CA    . ALA D 3 303 ? -112.963 140.061 174.811 1.00 52.06  ? 303 ALA E CA    1 
ATOM 9762  C C     . ALA D 3 303 ? -112.277 139.514 176.051 1.00 52.06  ? 303 ALA E C     1 
ATOM 9763  O O     . ALA D 3 303 ? -112.780 138.599 176.705 1.00 52.06  ? 303 ALA E O     1 
ATOM 9764  C CB    . ALA D 3 303 ? -113.886 141.203 175.209 1.00 52.06  ? 303 ALA E CB    1 
ATOM 9765  N N     . LEU D 3 304 ? -111.099 140.051 176.354 1.00 58.51  ? 304 LEU E N     1 
ATOM 9766  C CA    . LEU D 3 304 ? -110.378 139.641 177.550 1.00 58.51  ? 304 LEU E CA    1 
ATOM 9767  C C     . LEU D 3 304 ? -111.049 140.236 178.782 1.00 58.51  ? 304 LEU E C     1 
ATOM 9768  O O     . LEU D 3 304 ? -111.531 141.368 178.758 1.00 58.51  ? 304 LEU E O     1 
ATOM 9769  C CB    . LEU D 3 304 ? -108.920 140.067 177.469 1.00 58.51  ? 304 LEU E CB    1 
ATOM 9770  C CG    . LEU D 3 304 ? -108.175 139.366 176.336 1.00 58.51  ? 304 LEU E CG    1 
ATOM 9771  C CD1   . LEU D 3 304 ? -106.716 139.683 176.390 1.00 58.51  ? 304 LEU E CD1   1 
ATOM 9772  C CD2   . LEU D 3 304 ? -108.394 137.891 176.374 1.00 58.51  ? 304 LEU E CD2   1 
ATOM 9773  N N     . TYR D 3 305 ? -111.107 139.447 179.863 1.00 71.21  ? 305 TYR E N     1 
ATOM 9774  C CA    . TYR D 3 305 ? -111.743 139.887 181.116 1.00 71.21  ? 305 TYR E CA    1 
ATOM 9775  C C     . TYR D 3 305 ? -111.079 141.032 181.877 1.00 71.21  ? 305 TYR E C     1 
ATOM 9776  O O     . TYR D 3 305 ? -111.755 141.991 182.221 1.00 71.21  ? 305 TYR E O     1 
ATOM 9777  C CB    . TYR D 3 305 ? -112.027 138.710 182.040 1.00 71.21  ? 305 TYR E CB    1 
ATOM 9778  C CG    . TYR D 3 305 ? -113.447 138.722 182.527 1.00 71.21  ? 305 TYR E CG    1 
ATOM 9779  C CD1   . TYR D 3 305 ? -114.038 139.907 182.931 1.00 71.21  ? 305 TYR E CD1   1 
ATOM 9780  C CD2   . TYR D 3 305 ? -114.203 137.566 182.562 1.00 71.21  ? 305 TYR E CD2   1 
ATOM 9781  C CE1   . TYR D 3 305 ? -115.341 139.940 183.374 1.00 71.21  ? 305 TYR E CE1   1 
ATOM 9782  C CE2   . TYR D 3 305 ? -115.508 137.588 183.002 1.00 71.21  ? 305 TYR E CE2   1 
ATOM 9783  C CZ    . TYR D 3 305 ? -116.071 138.780 183.406 1.00 71.21  ? 305 TYR E CZ    1 
ATOM 9784  O OH    . TYR D 3 305 ? -117.374 138.817 183.844 1.00 71.21  ? 305 TYR E OH    1 
ATOM 9785  N N     . GLY D 3 306 ? -109.769 140.980 182.107 1.00 70.62  ? 306 GLY E N     1 
ATOM 9786  C CA    . GLY D 3 306 ? -109.111 142.138 182.671 1.00 70.62  ? 306 GLY E CA    1 
ATOM 9787  C C     . GLY D 3 306 ? -108.430 141.935 184.007 1.00 70.62  ? 306 GLY E C     1 
ATOM 9788  O O     . GLY D 3 306 ? -108.013 140.836 184.373 1.00 70.62  ? 306 GLY E O     1 
ATOM 9789  N N     . SER D 3 307 ? -108.306 143.050 184.732 1.00 71.87  ? 307 SER E N     1 
ATOM 9790  C CA    . SER D 3 307 ? -107.679 143.143 186.047 1.00 71.87  ? 307 SER E CA    1 
ATOM 9791  C C     . SER D 3 307 ? -106.179 142.893 185.977 1.00 71.87  ? 307 SER E C     1 
ATOM 9792  O O     . SER D 3 307 ? -105.443 143.314 186.871 1.00 71.87  ? 307 SER E O     1 
ATOM 9793  C CB    . SER D 3 307 ? -108.330 142.184 187.038 1.00 71.87  ? 307 SER E CB    1 
ATOM 9794  O OG    . SER D 3 307 ? -107.945 142.510 188.359 1.00 71.87  ? 307 SER E OG    1 
ATOM 9795  N N     . ASP D 3 308 ? -105.714 142.225 184.928 1.00 73.95  ? 308 ASP E N     1 
ATOM 9796  C CA    . ASP D 3 308 ? -104.301 141.935 184.757 1.00 73.95  ? 308 ASP E CA    1 
ATOM 9797  C C     . ASP D 3 308 ? -103.823 142.409 183.395 1.00 73.95  ? 308 ASP E C     1 
ATOM 9798  O O     . ASP D 3 308 ? -104.622 142.592 182.479 1.00 73.95  ? 308 ASP E O     1 
ATOM 9799  C CB    . ASP D 3 308 ? -104.027 140.448 184.915 1.00 73.95  ? 308 ASP E CB    1 
ATOM 9800  C CG    . ASP D 3 308 ? -104.337 139.958 186.296 1.00 73.95  ? 308 ASP E CG    1 
ATOM 9801  O OD1   . ASP D 3 308 ? -104.260 140.770 187.238 1.00 73.95  ? 308 ASP E OD1   1 
ATOM 9802  O OD2   . ASP D 3 308 ? -104.662 138.763 186.445 1.00 73.95  ? 308 ASP E OD2   1 
ATOM 9803  N N     . GLY D 3 309 ? -102.522 142.600 183.262 1.00 68.90  ? 309 GLY E N     1 
ATOM 9804  C CA    . GLY D 3 309 ? -101.964 143.101 182.025 1.00 68.90  ? 309 GLY E CA    1 
ATOM 9805  C C     . GLY D 3 309 ? -102.343 142.272 180.812 1.00 68.90  ? 309 GLY E C     1 
ATOM 9806  O O     . GLY D 3 309 ? -102.105 141.065 180.743 1.00 68.90  ? 309 GLY E O     1 
ATOM 9807  N N     . TYR D 3 310 ? -102.967 142.941 179.846 1.00 60.32  ? 310 TYR E N     1 
ATOM 9808  C CA    . TYR D 3 310 ? -103.474 142.293 178.648 1.00 60.32  ? 310 TYR E CA    1 
ATOM 9809  C C     . TYR D 3 310 ? -102.395 141.927 177.652 1.00 60.32  ? 310 TYR E C     1 
ATOM 9810  O O     . TYR D 3 310 ? -102.666 141.142 176.748 1.00 60.32  ? 310 TYR E O     1 
ATOM 9811  C CB    . TYR D 3 310 ? -104.465 143.194 177.919 1.00 60.32  ? 310 TYR E CB    1 
ATOM 9812  C CG    . TYR D 3 310 ? -105.685 143.563 178.690 1.00 60.32  ? 310 TYR E CG    1 
ATOM 9813  C CD1   . TYR D 3 310 ? -106.556 142.603 179.130 1.00 60.32  ? 310 TYR E CD1   1 
ATOM 9814  C CD2   . TYR D 3 310 ? -105.964 144.875 178.978 1.00 60.32  ? 310 TYR E CD2   1 
ATOM 9815  C CE1   . TYR D 3 310 ? -107.673 142.936 179.821 1.00 60.32  ? 310 TYR E CE1   1 
ATOM 9816  C CE2   . TYR D 3 310 ? -107.077 145.216 179.678 1.00 60.32  ? 310 TYR E CE2   1 
ATOM 9817  C CZ    . TYR D 3 310 ? -107.928 144.245 180.101 1.00 60.32  ? 310 TYR E CZ    1 
ATOM 9818  O OH    . TYR D 3 310 ? -109.050 144.601 180.800 1.00 60.32  ? 310 TYR E OH    1 
ATOM 9819  N N     . THR D 3 311 ? -101.192 142.473 177.775 1.00 63.21  ? 311 THR E N     1 
ATOM 9820  C CA    . THR D 3 311 ? -100.169 142.208 176.771 1.00 63.21  ? 311 THR E CA    1 
ATOM 9821  C C     . THR D 3 311 ? -99.791  140.737 176.722 1.00 63.21  ? 311 THR E C     1 
ATOM 9822  O O     . THR D 3 311 ? -99.758  140.133 175.645 1.00 63.21  ? 311 THR E O     1 
ATOM 9823  C CB    . THR D 3 311 ? -98.943  143.055 177.054 1.00 63.21  ? 311 THR E CB    1 
ATOM 9824  O OG1   . THR D 3 311 ? -98.500  142.793 178.388 1.00 63.21  ? 311 THR E OG1   1 
ATOM 9825  C CG2   . THR D 3 311 ? -99.291  144.505 176.939 1.00 63.21  ? 311 THR E CG2   1 
ATOM 9826  N N     . LEU D 3 312 ? -99.481  140.143 177.870 1.00 64.50  ? 312 LEU E N     1 
ATOM 9827  C CA    . LEU D 3 312 ? -99.049  138.754 177.859 1.00 64.50  ? 312 LEU E CA    1 
ATOM 9828  C C     . LEU D 3 312 ? -100.158 137.827 177.386 1.00 64.50  ? 312 LEU E C     1 
ATOM 9829  O O     . LEU D 3 312 ? -99.913  136.895 176.609 1.00 64.50  ? 312 LEU E O     1 
ATOM 9830  C CB    . LEU D 3 312 ? -98.589  138.346 179.248 1.00 64.50  ? 312 LEU E CB    1 
ATOM 9831  C CG    . LEU D 3 312 ? -98.072  136.918 179.319 1.00 64.50  ? 312 LEU E CG    1 
ATOM 9832  C CD1   . LEU D 3 312 ? -96.859  136.783 178.437 1.00 64.50  ? 312 LEU E CD1   1 
ATOM 9833  C CD2   . LEU D 3 312 ? -97.757  136.532 180.746 1.00 64.50  ? 312 LEU E CD2   1 
ATOM 9834  N N     . ARG D 3 313 ? -101.391 138.090 177.804 1.00 64.23  ? 313 ARG E N     1 
ATOM 9835  C CA    . ARG D 3 313 ? -102.494 137.249 177.375 1.00 64.23  ? 313 ARG E CA    1 
ATOM 9836  C C     . ARG D 3 313 ? -102.842 137.466 175.917 1.00 64.23  ? 313 ARG E C     1 
ATOM 9837  O O     . ARG D 3 313 ? -103.277 136.530 175.246 1.00 64.23  ? 313 ARG E O     1 
ATOM 9838  C CB    . ARG D 3 313 ? -103.718 137.536 178.224 1.00 64.23  ? 313 ARG E CB    1 
ATOM 9839  C CG    . ARG D 3 313 ? -103.551 137.242 179.676 1.00 64.23  ? 313 ARG E CG    1 
ATOM 9840  C CD    . ARG D 3 313 ? -104.830 137.577 180.394 1.00 64.23  ? 313 ARG E CD    1 
ATOM 9841  N NE    . ARG D 3 313 ? -105.954 136.827 179.858 1.00 64.23  ? 313 ARG E NE    1 
ATOM 9842  C CZ    . ARG D 3 313 ? -107.205 136.984 180.266 1.00 64.23  ? 313 ARG E CZ    1 
ATOM 9843  N NH1   . ARG D 3 313 ? -107.483 137.866 181.213 1.00 64.23  ? 313 ARG E NH1   1 
ATOM 9844  N NH2   . ARG D 3 313 ? -108.175 136.259 179.731 1.00 64.23  ? 313 ARG E NH2   1 
ATOM 9845  N N     . ALA D 3 314 ? -102.671 138.680 175.411 1.00 56.70  ? 314 ALA E N     1 
ATOM 9846  C CA    . ALA D 3 314 ? -102.936 138.920 174.002 1.00 56.70  ? 314 ALA E CA    1 
ATOM 9847  C C     . ALA D 3 314 ? -101.901 138.251 173.122 1.00 56.70  ? 314 ALA E C     1 
ATOM 9848  O O     . ALA D 3 314 ? -102.242 137.650 172.101 1.00 56.70  ? 314 ALA E O     1 
ATOM 9849  C CB    . ALA D 3 314 ? -102.975 140.415 173.724 1.00 56.70  ? 314 ALA E CB    1 
ATOM 9850  N N     . CYS D 3 315 ? -100.637 138.308 173.518 1.00 58.21  ? 315 CYS E N     1 
ATOM 9851  C CA    . CYS D 3 315 ? -99.607  137.635 172.744 1.00 58.21  ? 315 CYS E CA    1 
ATOM 9852  C C     . CYS D 3 315 ? -99.790  136.129 172.795 1.00 58.21  ? 315 CYS E C     1 
ATOM 9853  O O     . CYS D 3 315 ? -99.666  135.443 171.775 1.00 58.21  ? 315 CYS E O     1 
ATOM 9854  C CB    . CYS D 3 315 ? -98.236  138.034 173.257 1.00 58.21  ? 315 CYS E CB    1 
ATOM 9855  S SG    . CYS D 3 315 ? -97.875  139.799 173.154 1.00 58.21  ? 315 CYS E SG    1 
ATOM 9856  N N     . GLN D 3 316 ? -100.138 135.605 173.960 1.00 59.33  ? 316 GLN E N     1 
ATOM 9857  C CA    . GLN D 3 316 ? -100.323 134.168 174.083 1.00 59.33  ? 316 GLN E CA    1 
ATOM 9858  C C     . GLN D 3 316 ? -101.564 133.701 173.344 1.00 59.33  ? 316 GLN E C     1 
ATOM 9859  O O     . GLN D 3 316 ? -101.585 132.597 172.789 1.00 59.33  ? 316 GLN E O     1 
ATOM 9860  C CB    . GLN D 3 316 ? -100.413 133.803 175.555 1.00 59.33  ? 316 GLN E CB    1 
ATOM 9861  C CG    . GLN D 3 316 ? -100.521 132.342 175.825 1.00 59.33  ? 316 GLN E CG    1 
ATOM 9862  C CD    . GLN D 3 316 ? -100.480 132.061 177.301 1.00 59.33  ? 316 GLN E CD    1 
ATOM 9863  O OE1   . GLN D 3 316 ? -100.071 132.904 178.092 1.00 59.33  ? 316 GLN E OE1   1 
ATOM 9864  N NE2   . GLN D 3 316 ? -100.936 130.876 177.689 1.00 59.33  ? 316 GLN E NE2   1 
ATOM 9865  N N     . GLU D 3 317 ? -102.592 134.537 173.295 1.00 56.79  ? 317 GLU E N     1 
ATOM 9866  C CA    . GLU D 3 317 ? -103.809 134.167 172.592 1.00 56.79  ? 317 GLU E CA    1 
ATOM 9867  C C     . GLU D 3 317 ? -103.619 134.228 171.089 1.00 56.79  ? 317 GLU E C     1 
ATOM 9868  O O     . GLU D 3 317 ? -104.081 133.342 170.364 1.00 56.79  ? 317 GLU E O     1 
ATOM 9869  C CB    . GLU D 3 317 ? -104.948 135.081 173.012 1.00 56.79  ? 317 GLU E CB    1 
ATOM 9870  C CG    . GLU D 3 317 ? -106.275 134.613 172.517 1.00 56.79  ? 317 GLU E CG    1 
ATOM 9871  C CD    . GLU D 3 317 ? -106.729 133.349 173.206 1.00 56.79  ? 317 GLU E CD    1 
ATOM 9872  O OE1   . GLU D 3 317 ? -106.130 132.981 174.239 1.00 56.79  ? 317 GLU E OE1   1 
ATOM 9873  O OE2   . GLU D 3 317 ? -107.680 132.712 172.708 1.00 56.79  ? 317 GLU E OE2   1 
ATOM 9874  N N     . LEU D 3 318 ? -102.924 135.251 170.606 1.00 52.26  ? 318 LEU E N     1 
ATOM 9875  C CA    . LEU D 3 318 ? -102.567 135.278 169.199 1.00 52.26  ? 318 LEU E CA    1 
ATOM 9876  C C     . LEU D 3 318 ? -101.691 134.095 168.844 1.00 52.26  ? 318 LEU E C     1 
ATOM 9877  O O     . LEU D 3 318 ? -101.770 133.571 167.729 1.00 52.26  ? 318 LEU E O     1 
ATOM 9878  C CB    . LEU D 3 318 ? -101.850 136.579 168.876 1.00 52.26  ? 318 LEU E CB    1 
ATOM 9879  C CG    . LEU D 3 318 ? -101.610 136.891 167.412 1.00 52.26  ? 318 LEU E CG    1 
ATOM 9880  C CD1   . LEU D 3 318 ? -101.698 138.364 167.221 1.00 52.26  ? 318 LEU E CD1   1 
ATOM 9881  C CD2   . LEU D 3 318 ? -100.257 136.420 167.005 1.00 52.26  ? 318 LEU E CD2   1 
ATOM 9882  N N     . ASN D 3 319 ? -100.877 133.638 169.786 1.00 55.43  ? 319 ASN E N     1 
ATOM 9883  C CA    . ASN D 3 319 ? -100.082 132.447 169.536 1.00 55.43  ? 319 ASN E CA    1 
ATOM 9884  C C     . ASN D 3 319 ? -100.961 131.221 169.387 1.00 55.43  ? 319 ASN E C     1 
ATOM 9885  O O     . ASN D 3 319 ? -100.819 130.458 168.426 1.00 55.43  ? 319 ASN E O     1 
ATOM 9886  C CB    . ASN D 3 319 ? -99.092  132.234 170.664 1.00 55.43  ? 319 ASN E CB    1 
ATOM 9887  C CG    . ASN D 3 319 ? -98.267  131.007 170.465 1.00 55.43  ? 319 ASN E CG    1 
ATOM 9888  O OD1   . ASN D 3 319 ? -98.090  130.545 169.352 1.00 55.43  ? 319 ASN E OD1   1 
ATOM 9889  N ND2   . ASN D 3 319 ? -97.768  130.451 171.554 1.00 55.43  ? 319 ASN E ND2   1 
ATOM 9890  N N     . ASN D 3 320 ? -101.900 131.022 170.308 1.00 55.51  ? 320 ASN E N     1 
ATOM 9891  C CA    . ASN D 3 320 ? -102.737 129.836 170.213 1.00 55.51  ? 320 ASN E CA    1 
ATOM 9892  C C     . ASN D 3 320 ? -103.589 129.850 168.961 1.00 55.51  ? 320 ASN E C     1 
ATOM 9893  O O     . ASN D 3 320 ? -103.790 128.807 168.335 1.00 55.51  ? 320 ASN E O     1 
ATOM 9894  C CB    . ASN D 3 320 ? -103.645 129.724 171.427 1.00 55.51  ? 320 ASN E CB    1 
ATOM 9895  C CG    . ASN D 3 320 ? -102.885 129.497 172.692 1.00 55.51  ? 320 ASN E CG    1 
ATOM 9896  O OD1   . ASN D 3 320 ? -101.794 128.938 172.680 1.00 55.51  ? 320 ASN E OD1   1 
ATOM 9897  N ND2   . ASN D 3 320 ? -103.462 129.911 173.805 1.00 55.51  ? 320 ASN E ND2   1 
ATOM 9898  N N     . TYR D 3 321 ? -104.079 131.016 168.561 1.00 48.88  ? 321 TYR E N     1 
ATOM 9899  C CA    . TYR D 3 321 ? -104.872 131.052 167.345 1.00 48.88  ? 321 TYR E CA    1 
ATOM 9900  C C     . TYR D 3 321 ? -104.016 130.832 166.111 1.00 48.88  ? 321 TYR E C     1 
ATOM 9901  O O     . TYR D 3 321 ? -104.472 130.210 165.149 1.00 48.88  ? 321 TYR E O     1 
ATOM 9902  C CB    . TYR D 3 321 ? -105.617 132.373 167.257 1.00 48.88  ? 321 TYR E CB    1 
ATOM 9903  C CG    . TYR D 3 321 ? -106.638 132.433 166.158 1.00 48.88  ? 321 TYR E CG    1 
ATOM 9904  C CD1   . TYR D 3 321 ? -107.873 131.852 166.323 1.00 48.88  ? 321 TYR E CD1   1 
ATOM 9905  C CD2   . TYR D 3 321 ? -106.383 133.081 164.978 1.00 48.88  ? 321 TYR E CD2   1 
ATOM 9906  C CE1   . TYR D 3 321 ? -108.811 131.905 165.344 1.00 48.88  ? 321 TYR E CE1   1 
ATOM 9907  C CE2   . TYR D 3 321 ? -107.321 133.141 163.995 1.00 48.88  ? 321 TYR E CE2   1 
ATOM 9908  C CZ    . TYR D 3 321 ? -108.530 132.547 164.179 1.00 48.88  ? 321 TYR E CZ    1 
ATOM 9909  O OH    . TYR D 3 321 ? -109.476 132.605 163.190 1.00 48.88  ? 321 TYR E OH    1 
ATOM 9910  N N     . ALA D 3 322 ? -102.773 131.305 166.118 1.00 50.62  ? 322 ALA E N     1 
ATOM 9911  C CA    . ALA D 3 322 ? -101.901 131.043 164.980 1.00 50.62  ? 322 ALA E CA    1 
ATOM 9912  C C     . ALA D 3 322 ? -101.563 129.566 164.876 1.00 50.62  ? 322 ALA E C     1 
ATOM 9913  O O     . ALA D 3 322 ? -101.515 129.006 163.775 1.00 50.62  ? 322 ALA E O     1 
ATOM 9914  C CB    . ALA D 3 322 ? -100.632 131.868 165.087 1.00 50.62  ? 322 ALA E CB    1 
ATOM 9915  N N     . GLU D 3 323 ? -101.377 128.913 166.018 1.00 55.16  ? 323 GLU E N     1 
ATOM 9916  C CA    . GLU D 3 323 ? -101.117 127.482 166.034 1.00 55.16  ? 323 GLU E CA    1 
ATOM 9917  C C     . GLU D 3 323 ? -102.308 126.714 165.516 1.00 55.16  ? 323 GLU E C     1 
ATOM 9918  O O     . GLU D 3 323 ? -102.181 125.837 164.654 1.00 55.16  ? 323 GLU E O     1 
ATOM 9919  C CB    . GLU D 3 323 ? -100.817 127.037 167.455 1.00 55.16  ? 323 GLU E CB    1 
ATOM 9920  C CG    . GLU D 3 323 ? -100.621 125.563 167.581 1.00 55.16  ? 323 GLU E CG    1 
ATOM 9921  C CD    . GLU D 3 323 ? -100.374 125.145 169.004 1.00 55.16  ? 323 GLU E CD    1 
ATOM 9922  O OE1   . GLU D 3 323 ? -100.345 126.030 169.886 1.00 55.16  ? 323 GLU E OE1   1 
ATOM 9923  O OE2   . GLU D 3 323 ? -100.230 123.932 169.248 1.00 55.16  ? 323 GLU E OE2   1 
ATOM 9924  N N     . ARG D 3 324 ? -103.484 127.049 166.030 1.00 54.37  ? 324 ARG E N     1 
ATOM 9925  C CA    . ARG D 3 324 ? -104.712 126.382 165.630 1.00 54.37  ? 324 ARG E CA    1 
ATOM 9926  C C     . ARG D 3 324 ? -104.976 126.564 164.152 1.00 54.37  ? 324 ARG E C     1 
ATOM 9927  O O     . ARG D 3 324 ? -105.412 125.641 163.494 1.00 54.37  ? 324 ARG E O     1 
ATOM 9928  C CB    . ARG D 3 324 ? -105.891 126.890 166.438 1.00 54.37  ? 324 ARG E CB    1 
ATOM 9929  C CG    . ARG D 3 324 ? -106.029 126.240 167.795 1.00 54.37  ? 324 ARG E CG    1 
ATOM 9930  C CD    . ARG D 3 324 ? -106.745 127.164 168.758 1.00 54.37  ? 324 ARG E CD    1 
ATOM 9931  N NE    . ARG D 3 324 ? -107.465 126.423 169.785 1.00 54.37  ? 324 ARG E NE    1 
ATOM 9932  C CZ    . ARG D 3 324 ? -106.963 125.386 170.450 1.00 54.37  ? 324 ARG E CZ    1 
ATOM 9933  N NH1   . ARG D 3 324 ? -107.692 124.762 171.370 1.00 54.37  ? 324 ARG E NH1   1 
ATOM 9934  N NH2   . ARG D 3 324 ? -105.730 124.972 170.192 1.00 54.37  ? 324 ARG E NH2   1 
ATOM 9935  N N     . LEU D 3 325 ? -104.720 127.745 163.615 1.00 51.27  ? 325 LEU E N     1 
ATOM 9936  C CA    . LEU D 3 325 ? -104.935 127.922 162.186 1.00 51.27  ? 325 LEU E CA    1 
ATOM 9937  C C     . LEU D 3 325 ? -103.905 127.210 161.335 1.00 51.27  ? 325 LEU E C     1 
ATOM 9938  O O     . LEU D 3 325 ? -104.249 126.697 160.269 1.00 51.27  ? 325 LEU E O     1 
ATOM 9939  C CB    . LEU D 3 325 ? -104.922 129.390 161.797 1.00 51.27  ? 325 LEU E CB    1 
ATOM 9940  C CG    . LEU D 3 325 ? -106.169 130.202 162.032 1.00 51.27  ? 325 LEU E CG    1 
ATOM 9941  C CD1   . LEU D 3 325 ? -105.927 131.558 161.449 1.00 51.27  ? 325 LEU E CD1   1 
ATOM 9942  C CD2   . LEU D 3 325 ? -107.339 129.541 161.372 1.00 51.27  ? 325 LEU E CD2   1 
ATOM 9943  N N     . ARG D 3 326 ? -102.650 127.152 161.766 1.00 55.47  ? 326 ARG E N     1 
ATOM 9944  C CA    . ARG D 3 326 ? -101.710 126.394 160.956 1.00 55.47  ? 326 ARG E CA    1 
ATOM 9945  C C     . ARG D 3 326 ? -102.043 124.919 160.974 1.00 55.47  ? 326 ARG E C     1 
ATOM 9946  O O     . ARG D 3 326 ? -101.736 124.208 160.013 1.00 55.47  ? 326 ARG E O     1 
ATOM 9947  C CB    . ARG D 3 326 ? -100.271 126.629 161.384 1.00 55.47  ? 326 ARG E CB    1 
ATOM 9948  C CG    . ARG D 3 326 ? -99.826  125.950 162.626 1.00 55.47  ? 326 ARG E CG    1 
ATOM 9949  C CD    . ARG D 3 326 ? -98.397  126.350 162.856 1.00 55.47  ? 326 ARG E CD    1 
ATOM 9950  N NE    . ARG D 3 326 ? -97.587  125.987 161.699 1.00 55.47  ? 326 ARG E NE    1 
ATOM 9951  C CZ    . ARG D 3 326 ? -96.296  126.263 161.576 1.00 55.47  ? 326 ARG E CZ    1 
ATOM 9952  N NH1   . ARG D 3 326 ? -95.662  126.910 162.543 1.00 55.47  ? 326 ARG E NH1   1 
ATOM 9953  N NH2   . ARG D 3 326 ? -95.645  125.896 160.486 1.00 55.47  ? 326 ARG E NH2   1 
ATOM 9954  N N     . GLU D 3 327 ? -102.654 124.427 162.046 1.00 56.30  ? 327 GLU E N     1 
ATOM 9955  C CA    . GLU D 3 327 ? -103.059 123.032 161.991 1.00 56.30  ? 327 GLU E CA    1 
ATOM 9956  C C     . GLU D 3 327 ? -104.300 122.847 161.129 1.00 56.30  ? 327 GLU E C     1 
ATOM 9957  O O     . GLU D 3 327 ? -104.381 121.890 160.360 1.00 56.30  ? 327 GLU E O     1 
ATOM 9958  C CB    . GLU D 3 327 ? -103.309 122.516 163.401 1.00 56.30  ? 327 GLU E CB    1 
ATOM 9959  C CG    . GLU D 3 327 ? -103.729 121.082 163.459 1.00 56.30  ? 327 GLU E CG    1 
ATOM 9960  C CD    . GLU D 3 327 ? -103.979 120.632 164.874 1.00 56.30  ? 327 GLU E CD    1 
ATOM 9961  O OE1   . GLU D 3 327 ? -103.948 121.493 165.779 1.00 56.30  ? 327 GLU E OE1   1 
ATOM 9962  O OE2   . GLU D 3 327 ? -104.191 119.422 165.090 1.00 56.30  ? 327 GLU E OE2   1 
ATOM 9963  N N     . VAL D 3 328 ? -105.274 123.747 161.250 1.00 51.07  ? 328 VAL E N     1 
ATOM 9964  C CA    . VAL D 3 328 ? -106.532 123.608 160.521 1.00 51.07  ? 328 VAL E CA    1 
ATOM 9965  C C     . VAL D 3 328 ? -106.362 123.898 159.036 1.00 51.07  ? 328 VAL E C     1 
ATOM 9966  O O     . VAL D 3 328 ? -106.960 123.226 158.192 1.00 51.07  ? 328 VAL E O     1 
ATOM 9967  C CB    . VAL D 3 328 ? -107.608 124.512 161.137 1.00 51.07  ? 328 VAL E CB    1 
ATOM 9968  C CG1   . VAL D 3 328 ? -108.791 124.551 160.256 1.00 51.07  ? 328 VAL E CG1   1 
ATOM 9969  C CG2   . VAL D 3 328 ? -108.025 123.961 162.457 1.00 51.07  ? 328 VAL E CG2   1 
ATOM 9970  N N     . TRP D 3 329 ? -105.562 124.897 158.692 1.00 50.69  ? 329 TRP E N     1 
ATOM 9971  C CA    . TRP D 3 329 ? -105.316 125.287 157.308 1.00 50.69  ? 329 TRP E CA    1 
ATOM 9972  C C     . TRP D 3 329 ? -103.839 125.120 156.990 1.00 50.69  ? 329 TRP E C     1 
ATOM 9973  O O     . TRP D 3 329 ? -103.056 126.064 157.144 1.00 50.69  ? 329 TRP E O     1 
ATOM 9974  C CB    . TRP D 3 329 ? -105.761 126.728 157.097 1.00 50.69  ? 329 TRP E CB    1 
ATOM 9975  C CG    . TRP D 3 329 ? -105.786 127.191 155.699 1.00 50.69  ? 329 TRP E CG    1 
ATOM 9976  C CD1   . TRP D 3 329 ? -104.866 127.962 155.081 1.00 50.69  ? 329 TRP E CD1   1 
ATOM 9977  C CD2   . TRP D 3 329 ? -106.810 126.943 154.740 1.00 50.69  ? 329 TRP E CD2   1 
ATOM 9978  N NE1   . TRP D 3 329 ? -105.240 128.204 153.788 1.00 50.69  ? 329 TRP E NE1   1 
ATOM 9979  C CE2   . TRP D 3 329 ? -106.435 127.585 153.558 1.00 50.69  ? 329 TRP E CE2   1 
ATOM 9980  C CE3   . TRP D 3 329 ? -108.005 126.233 154.766 1.00 50.69  ? 329 TRP E CE3   1 
ATOM 9981  C CZ2   . TRP D 3 329 ? -107.207 127.538 152.417 1.00 50.69  ? 329 TRP E CZ2   1 
ATOM 9982  C CZ3   . TRP D 3 329 ? -108.768 126.190 153.636 1.00 50.69  ? 329 TRP E CZ3   1 
ATOM 9983  C CH2   . TRP D 3 329 ? -108.371 126.836 152.479 1.00 50.69  ? 329 TRP E CH2   1 
ATOM 9984  N N     . PRO D 3 330 ? -103.422 123.951 156.525 1.00 52.71  ? 330 PRO E N     1 
ATOM 9985  C CA    . PRO D 3 330 ? -101.995 123.709 156.324 1.00 52.71  ? 330 PRO E CA    1 
ATOM 9986  C C     . PRO D 3 330 ? -101.457 124.529 155.173 1.00 52.71  ? 330 PRO E C     1 
ATOM 9987  O O     . PRO D 3 330 ? -102.135 124.749 154.171 1.00 52.71  ? 330 PRO E O     1 
ATOM 9988  C CB    . PRO D 3 330 ? -101.934 122.216 156.006 1.00 52.71  ? 330 PRO E CB    1 
ATOM 9989  C CG    . PRO D 3 330 ? -103.220 121.672 156.473 1.00 52.71  ? 330 PRO E CG    1 
ATOM 9990  C CD    . PRO D 3 330 ? -104.219 122.746 156.296 1.00 52.71  ? 330 PRO E CD    1 
ATOM 9991  N N     . ASP D 3 331 ? -100.222 124.991 155.330 1.00 58.70  ? 331 ASP E N     1 
ATOM 9992  C CA    . ASP D 3 331 ? -99.607  125.870 154.353 1.00 58.70  ? 331 ASP E CA    1 
ATOM 9993  C C     . ASP D 3 331 ? -98.100  125.850 154.536 1.00 58.70  ? 331 ASP E C     1 
ATOM 9994  O O     . ASP D 3 331 ? -97.592  125.515 155.607 1.00 58.70  ? 331 ASP E O     1 
ATOM 9995  C CB    . ASP D 3 331 ? -100.168 127.283 154.481 1.00 58.70  ? 331 ASP E CB    1 
ATOM 9996  C CG    . ASP D 3 331 ? -100.188 127.768 155.910 1.00 58.70  ? 331 ASP E CG    1 
ATOM 9997  O OD1   . ASP D 3 331 ? -100.187 126.917 156.820 1.00 58.70  ? 331 ASP E OD1   1 
ATOM 9998  O OD2   . ASP D 3 331 ? -100.267 128.992 156.133 1.00 58.70  ? 331 ASP E OD2   1 
ATOM 9999  N N     . ASP D 3 332 ? -97.400  126.217 153.470 1.00 67.29  ? 332 ASP E N     1 
ATOM 10000 C CA    . ASP D 3 332 ? -95.956  126.388 153.464 1.00 67.29  ? 332 ASP E CA    1 
ATOM 10001 C C     . ASP D 3 332 ? -95.527  127.832 153.673 1.00 67.29  ? 332 ASP E C     1 
ATOM 10002 O O     . ASP D 3 332 ? -94.420  128.201 153.281 1.00 67.29  ? 332 ASP E O     1 
ATOM 10003 C CB    . ASP D 3 332 ? -95.388  125.888 152.146 1.00 67.29  ? 332 ASP E CB    1 
ATOM 10004 C CG    . ASP D 3 332 ? -96.236  124.825 151.522 1.00 67.29  ? 332 ASP E CG    1 
ATOM 10005 O OD1   . ASP D 3 332 ? -97.093  124.258 152.235 1.00 67.29  ? 332 ASP E OD1   1 
ATOM 10006 O OD2   . ASP D 3 332 ? -96.081  124.585 150.314 1.00 67.29  ? 332 ASP E OD2   1 
ATOM 10007 N N     . ALA D 3 333 ? -96.353  128.648 154.300 1.00 58.52  ? 333 ALA E N     1 
ATOM 10008 C CA    . ALA D 3 333 ? -96.028  130.059 154.405 1.00 58.52  ? 333 ALA E CA    1 
ATOM 10009 C C     . ALA D 3 333 ? -94.861  130.296 155.347 1.00 58.52  ? 333 ALA E C     1 
ATOM 10010 O O     . ALA D 3 333 ? -94.790  129.725 156.433 1.00 58.52  ? 333 ALA E O     1 
ATOM 10011 C CB    . ALA D 3 333 ? -97.240  130.829 154.899 1.00 58.52  ? 333 ALA E CB    1 
ATOM 10012 N N     . ILE D 3 334 ? -93.929  131.132 154.896 1.00 55.09  ? 334 ILE E N     1 
ATOM 10013 C CA    . ILE D 3 334 ? -92.769  131.517 155.687 1.00 55.09  ? 334 ILE E CA    1 
ATOM 10014 C C     . ILE D 3 334 ? -93.177  132.486 156.782 1.00 55.09  ? 334 ILE E C     1 
ATOM 10015 O O     . ILE D 3 334 ? -93.486  133.647 156.517 1.00 55.09  ? 334 ILE E O     1 
ATOM 10016 C CB    . ILE D 3 334 ? -91.700  132.134 154.779 1.00 55.09  ? 334 ILE E CB    1 
ATOM 10017 C CG1   . ILE D 3 334 ? -91.502  131.250 153.557 1.00 55.09  ? 334 ILE E CG1   1 
ATOM 10018 C CG2   . ILE D 3 334 ? -90.424  132.337 155.528 1.00 55.09  ? 334 ILE E CG2   1 
ATOM 10019 C CD1   . ILE D 3 334 ? -90.623  131.857 152.516 1.00 55.09  ? 334 ILE E CD1   1 
ATOM 10020 N N     . ARG D 3 335 ? -93.109  132.037 158.026 1.00 54.72  ? 335 ARG E N     1 
ATOM 10021 C CA    . ARG D 3 335 ? -93.553  132.826 159.161 1.00 54.72  ? 335 ARG E CA    1 
ATOM 10022 C C     . ARG D 3 335 ? -92.363  133.436 159.880 1.00 54.72  ? 335 ARG E C     1 
ATOM 10023 O O     . ARG D 3 335 ? -91.212  133.184 159.535 1.00 54.72  ? 335 ARG E O     1 
ATOM 10024 C CB    . ARG D 3 335 ? -94.354  131.967 160.126 1.00 54.72  ? 335 ARG E CB    1 
ATOM 10025 C CG    . ARG D 3 335 ? -95.671  131.553 159.580 1.00 54.72  ? 335 ARG E CG    1 
ATOM 10026 C CD    . ARG D 3 335 ? -96.347  130.582 160.485 1.00 54.72  ? 335 ARG E CD    1 
ATOM 10027 N NE    . ARG D 3 335 ? -97.624  130.190 159.925 1.00 54.72  ? 335 ARG E NE    1 
ATOM 10028 C CZ    . ARG D 3 335 ? -97.774  129.214 159.044 1.00 54.72  ? 335 ARG E CZ    1 
ATOM 10029 N NH1   . ARG D 3 335 ? -96.720  128.542 158.621 1.00 54.72  ? 335 ARG E NH1   1 
ATOM 10030 N NH2   . ARG D 3 335 ? -98.976  128.919 158.579 1.00 54.72  ? 335 ARG E NH2   1 
ATOM 10031 N N     . GLY D 3 336 ? -92.653  134.239 160.897 1.00 52.77  ? 336 GLY E N     1 
ATOM 10032 C CA    . GLY D 3 336 ? -91.603  134.878 161.664 1.00 52.77  ? 336 GLY E CA    1 
ATOM 10033 C C     . GLY D 3 336 ? -92.147  135.990 162.522 1.00 52.77  ? 336 GLY E C     1 
ATOM 10034 O O     . GLY D 3 336 ? -93.081  136.688 162.132 1.00 52.77  ? 336 GLY E O     1 
ATOM 10035 N N     . TYR D 3 337 ? -91.561  136.157 163.704 1.00 54.68  ? 337 TYR E N     1 
ATOM 10036 C CA    . TYR D 3 337 ? -92.078  137.126 164.651 1.00 54.68  ? 337 TYR E CA    1 
ATOM 10037 C C     . TYR D 3 337 ? -90.950  137.760 165.434 1.00 54.68  ? 337 TYR E C     1 
ATOM 10038 O O     . TYR D 3 337 ? -89.820  137.280 165.436 1.00 54.68  ? 337 TYR E O     1 
ATOM 10039 C CB    . TYR D 3 337 ? -93.046  136.503 165.637 1.00 54.68  ? 337 TYR E CB    1 
ATOM 10040 C CG    . TYR D 3 337 ? -92.397  135.685 166.707 1.00 54.68  ? 337 TYR E CG    1 
ATOM 10041 C CD1   . TYR D 3 337 ? -91.971  134.406 166.462 1.00 54.68  ? 337 TYR E CD1   1 
ATOM 10042 C CD2   . TYR D 3 337 ? -92.274  136.174 167.988 1.00 54.68  ? 337 TYR E CD2   1 
ATOM 10043 C CE1   . TYR D 3 337 ? -91.404  133.651 167.447 1.00 54.68  ? 337 TYR E CE1   1 
ATOM 10044 C CE2   . TYR D 3 337 ? -91.713  135.424 168.980 1.00 54.68  ? 337 TYR E CE2   1 
ATOM 10045 C CZ    . TYR D 3 337 ? -91.279  134.161 168.700 1.00 54.68  ? 337 TYR E CZ    1 
ATOM 10046 O OH    . TYR D 3 337 ? -90.710  133.397 169.678 1.00 54.68  ? 337 TYR E OH    1 
ATOM 10047 N N     . ALA D 3 338 ? -91.288  138.843 166.117 1.00 53.29  ? 338 ALA E N     1 
ATOM 10048 C CA    . ALA D 3 338 ? -90.357  139.562 166.970 1.00 53.29  ? 338 ALA E CA    1 
ATOM 10049 C C     . ALA D 3 338 ? -91.159  140.141 168.116 1.00 53.29  ? 338 ALA E C     1 
ATOM 10050 O O     . ALA D 3 338 ? -92.207  140.747 167.893 1.00 53.29  ? 338 ALA E O     1 
ATOM 10051 C CB    . ALA D 3 338 ? -89.641  140.660 166.207 1.00 53.29  ? 338 ALA E CB    1 
ATOM 10052 N N     . THR D 3 339 ? -90.682  139.940 169.335 1.00 58.48  ? 339 THR E N     1 
ATOM 10053 C CA    . THR D 3 339 ? -91.434  140.324 170.512 1.00 58.48  ? 339 THR E CA    1 
ATOM 10054 C C     . THR D 3 339 ? -90.541  141.026 171.519 1.00 58.48  ? 339 THR E C     1 
ATOM 10055 O O     . THR D 3 339 ? -89.330  140.816 171.552 1.00 58.48  ? 339 THR E O     1 
ATOM 10056 C CB    . THR D 3 339 ? -92.058  139.087 171.142 1.00 58.48  ? 339 THR E CB    1 
ATOM 10057 O OG1   . THR D 3 339 ? -92.847  138.418 170.159 1.00 58.48  ? 339 THR E OG1   1 
ATOM 10058 C CG2   . THR D 3 339 ? -92.942  139.457 172.285 1.00 58.48  ? 339 THR E CG2   1 
ATOM 10059 N N     . VAL D 3 340 ? -91.153  141.888 172.326 1.00 61.28  ? 340 VAL E N     1 
ATOM 10060 C CA    . VAL D 3 340 ? -90.486  142.466 173.483 1.00 61.28  ? 340 VAL E CA    1 
ATOM 10061 C C     . VAL D 3 340 ? -90.448  141.499 174.661 1.00 61.28  ? 340 VAL E C     1 
ATOM 10062 O O     . VAL D 3 340 ? -89.389  141.265 175.243 1.00 61.28  ? 340 VAL E O     1 
ATOM 10063 C CB    . VAL D 3 340 ? -91.162  143.786 173.868 1.00 61.28  ? 340 VAL E CB    1 
ATOM 10064 C CG1   . VAL D 3 340 ? -90.743  144.201 175.233 1.00 61.28  ? 340 VAL E CG1   1 
ATOM 10065 C CG2   . VAL D 3 340 ? -90.774  144.849 172.885 1.00 61.28  ? 340 VAL E CG2   1 
ATOM 10066 N N     . GLU D 3 341 ? -91.558  140.856 174.985 1.00 73.62  ? 341 GLU E N     1 
ATOM 10067 C CA    . GLU D 3 341 ? -91.562  139.977 176.148 1.00 73.62  ? 341 GLU E CA    1 
ATOM 10068 C C     . GLU D 3 341 ? -90.751  138.730 175.854 1.00 73.62  ? 341 GLU E C     1 
ATOM 10069 O O     . GLU D 3 341 ? -90.756  138.218 174.734 1.00 73.62  ? 341 GLU E O     1 
ATOM 10070 C CB    . GLU D 3 341 ? -92.976  139.610 176.570 1.00 73.62  ? 341 GLU E CB    1 
ATOM 10071 C CG    . GLU D 3 341 ? -93.732  138.870 175.535 1.00 73.62  ? 341 GLU E CG    1 
ATOM 10072 C CD    . GLU D 3 341 ? -95.195  138.825 175.830 1.00 73.62  ? 341 GLU E CD    1 
ATOM 10073 O OE1   . GLU D 3 341 ? -95.613  139.334 176.888 1.00 73.62  ? 341 GLU E OE1   1 
ATOM 10074 O OE2   . GLU D 3 341 ? -95.926  138.270 175.001 1.00 73.62  ? 341 GLU E OE2   1 
ATOM 10075 N N     . ASN D 3 342 ? -90.040  138.250 176.863 1.00 78.83  ? 342 ASN E N     1 
ATOM 10076 C CA    . ASN D 3 342 ? -89.283  137.016 176.759 1.00 78.83  ? 342 ASN E CA    1 
ATOM 10077 C C     . ASN D 3 342 ? -89.848  135.945 177.691 1.00 78.83  ? 342 ASN E C     1 
ATOM 10078 O O     . ASN D 3 342 ? -89.276  134.864 177.835 1.00 78.83  ? 342 ASN E O     1 
ATOM 10079 C CB    . ASN D 3 342 ? -87.815  137.317 177.066 1.00 78.83  ? 342 ASN E CB    1 
ATOM 10080 C CG    . ASN D 3 342 ? -86.873  136.256 176.560 1.00 78.83  ? 342 ASN E CG    1 
ATOM 10081 O OD1   . ASN D 3 342 ? -87.268  135.130 176.274 1.00 78.83  ? 342 ASN E OD1   1 
ATOM 10082 N ND2   . ASN D 3 342 ? -85.607  136.623 176.426 1.00 78.83  ? 342 ASN E ND2   1 
ATOM 10083 N N     . LYS D 3 343 ? -90.989  136.241 178.316 1.00 84.70  ? 343 LYS E N     1 
ATOM 10084 C CA    . LYS D 3 343 ? -91.613  135.309 179.251 1.00 84.70  ? 343 LYS E CA    1 
ATOM 10085 C C     . LYS D 3 343 ? -92.155  134.067 178.550 1.00 84.70  ? 343 LYS E C     1 
ATOM 10086 O O     . LYS D 3 343 ? -92.383  133.039 179.192 1.00 84.70  ? 343 LYS E O     1 
ATOM 10087 C CB    . LYS D 3 343 ? -92.741  135.998 180.020 1.00 84.70  ? 343 LYS E CB    1 
ATOM 10088 C CG    . LYS D 3 343 ? -92.294  136.949 181.122 1.00 84.70  ? 343 LYS E CG    1 
ATOM 10089 C CD    . LYS D 3 343 ? -91.805  138.290 180.585 1.00 84.70  ? 343 LYS E CD    1 
ATOM 10090 C CE    . LYS D 3 343 ? -91.445  139.232 181.729 1.00 84.70  ? 343 LYS E CE    1 
ATOM 10091 N NZ    . LYS D 3 343 ? -91.046  140.589 181.264 1.00 84.70  ? 343 LYS E NZ    1 
ATOM 10092 N N     . THR D 3 344 ? -92.375  134.137 177.240 1.00 81.89  ? 344 THR E N     1 
ATOM 10093 C CA    . THR D 3 344 ? -92.909  132.998 176.504 1.00 81.89  ? 344 THR E CA    1 
ATOM 10094 C C     . THR D 3 344 ? -92.142  132.849 175.198 1.00 81.89  ? 344 THR E C     1 
ATOM 10095 O O     . THR D 3 344 ? -91.601  133.818 174.662 1.00 81.89  ? 344 THR E O     1 
ATOM 10096 C CB    . THR D 3 344 ? -94.407  133.163 176.262 1.00 81.89  ? 344 THR E CB    1 
ATOM 10097 O OG1   . THR D 3 344 ? -95.045  133.484 177.504 1.00 81.89  ? 344 THR E OG1   1 
ATOM 10098 C CG2   . THR D 3 344 ? -95.012  131.876 175.733 1.00 81.89  ? 344 THR E CG2   1 
ATOM 10099 N N     . ASP D 3 345 ? -92.084  131.617 174.702 1.00 75.60  ? 345 ASP E N     1 
ATOM 10100 C CA    . ASP D 3 345 ? -91.412  131.326 173.445 1.00 75.60  ? 345 ASP E CA    1 
ATOM 10101 C C     . ASP D 3 345 ? -92.295  131.577 172.228 1.00 75.60  ? 345 ASP E C     1 
ATOM 10102 O O     . ASP D 3 345 ? -91.790  131.939 171.161 1.00 75.60  ? 345 ASP E O     1 
ATOM 10103 C CB    . ASP D 3 345 ? -90.951  129.873 173.434 1.00 75.60  ? 345 ASP E CB    1 
ATOM 10104 C CG    . ASP D 3 345 ? -90.189  129.517 172.184 1.00 75.60  ? 345 ASP E CG    1 
ATOM 10105 O OD1   . ASP D 3 345 ? -89.563  130.417 171.589 1.00 75.60  ? 345 ASP E OD1   1 
ATOM 10106 O OD2   . ASP D 3 345 ? -90.244  128.342 171.773 1.00 75.60  ? 345 ASP E OD2   1 
ATOM 10107 N N     . LEU D 3 346 ? -93.607  131.403 172.385 1.00 64.06  ? 346 LEU E N     1 
ATOM 10108 C CA    . LEU D 3 346 ? -94.574  131.583 171.300 1.00 64.06  ? 346 LEU E CA    1 
ATOM 10109 C C     . LEU D 3 346 ? -94.096  130.764 170.109 1.00 64.06  ? 346 LEU E C     1 
ATOM 10110 O O     . LEU D 3 346 ? -93.581  131.308 169.132 1.00 64.06  ? 346 LEU E O     1 
ATOM 10111 C CB    . LEU D 3 346 ? -94.714  133.050 170.926 1.00 64.06  ? 346 LEU E CB    1 
ATOM 10112 C CG    . LEU D 3 346 ? -95.093  133.963 172.078 1.00 64.06  ? 346 LEU E CG    1 
ATOM 10113 C CD1   . LEU D 3 346 ? -95.109  135.384 171.626 1.00 64.06  ? 346 LEU E CD1   1 
ATOM 10114 C CD2   . LEU D 3 346 ? -96.428  133.570 172.607 1.00 64.06  ? 346 LEU E CD2   1 
ATOM 10115 N N     . ALA D 3 347 ? -94.294  129.454 170.180 1.00 61.05  ? 347 ALA E N     1 
ATOM 10116 C CA    . ALA D 3 347 ? -93.681  128.586 169.188 1.00 61.05  ? 347 ALA E CA    1 
ATOM 10117 C C     . ALA D 3 347 ? -94.350  128.660 167.830 1.00 61.05  ? 347 ALA E C     1 
ATOM 10118 O O     . ALA D 3 347 ? -93.680  128.507 166.807 1.00 61.05  ? 347 ALA E O     1 
ATOM 10119 C CB    . ALA D 3 347 ? -93.705  127.146 169.687 1.00 61.05  ? 347 ALA E CB    1 
ATOM 10120 N N     . ALA D 3 348 ? -95.654  128.899 167.789 1.00 56.23  ? 348 ALA E N     1 
ATOM 10121 C CA    . ALA D 3 348 ? -96.356  128.856 166.517 1.00 56.23  ? 348 ALA E CA    1 
ATOM 10122 C C     . ALA D 3 348 ? -96.060  130.040 165.615 1.00 56.23  ? 348 ALA E C     1 
ATOM 10123 O O     . ALA D 3 348 ? -96.290  129.949 164.407 1.00 56.23  ? 348 ALA E O     1 
ATOM 10124 C CB    . ALA D 3 348 ? -97.855  128.765 166.751 1.00 56.23  ? 348 ALA E CB    1 
ATOM 10125 N N     . LEU D 3 349 ? -95.568  131.149 166.149 1.00 55.08  ? 349 LEU E N     1 
ATOM 10126 C CA    . LEU D 3 349 ? -95.369  132.294 165.277 1.00 55.08  ? 349 LEU E CA    1 
ATOM 10127 C C     . LEU D 3 349 ? -94.107  132.199 164.438 1.00 55.08  ? 349 LEU E C     1 
ATOM 10128 O O     . LEU D 3 349 ? -93.644  133.219 163.930 1.00 55.08  ? 349 LEU E O     1 
ATOM 10129 C CB    . LEU D 3 349 ? -95.338  133.571 166.101 1.00 55.08  ? 349 LEU E CB    1 
ATOM 10130 C CG    . LEU D 3 349 ? -96.595  133.791 166.930 1.00 55.08  ? 349 LEU E CG    1 
ATOM 10131 C CD1   . LEU D 3 349 ? -96.499  135.066 167.710 1.00 55.08  ? 349 LEU E CD1   1 
ATOM 10132 C CD2   . LEU D 3 349 ? -97.808  133.782 166.079 1.00 55.08  ? 349 LEU E CD2   1 
ATOM 10133 N N     . GLY D 3 350 ? -93.544  131.014 164.277 1.00 58.50  ? 350 GLY E N     1 
ATOM 10134 C CA    . GLY D 3 350 ? -92.395  130.819 163.417 1.00 58.50  ? 350 GLY E CA    1 
ATOM 10135 C C     . GLY D 3 350 ? -91.062  131.113 164.078 1.00 58.50  ? 350 GLY E C     1 
ATOM 10136 O O     . GLY D 3 350 ? -90.920  131.083 165.299 1.00 58.50  ? 350 GLY E O     1 
ATOM 10137 N N     . GLU D 3 351 ? -90.073  131.413 163.243 1.00 62.03  ? 351 GLU E N     1 
ATOM 10138 C CA    . GLU D 3 351 ? -88.726  131.699 163.712 1.00 62.03  ? 351 GLU E CA    1 
ATOM 10139 C C     . GLU D 3 351 ? -88.671  133.057 164.385 1.00 62.03  ? 351 GLU E C     1 
ATOM 10140 O O     . GLU D 3 351 ? -89.152  134.046 163.833 1.00 62.03  ? 351 GLU E O     1 
ATOM 10141 C CB    . GLU D 3 351 ? -87.733  131.665 162.559 1.00 62.03  ? 351 GLU E CB    1 
ATOM 10142 C CG    . GLU D 3 351 ? -86.306  131.727 163.037 1.00 62.03  ? 351 GLU E CG    1 
ATOM 10143 C CD    . GLU D 3 351 ? -85.316  131.828 161.905 1.00 62.03  ? 351 GLU E CD    1 
ATOM 10144 O OE1   . GLU D 3 351 ? -85.735  131.702 160.737 1.00 62.03  ? 351 GLU E OE1   1 
ATOM 10145 O OE2   . GLU D 3 351 ? -84.118  132.045 162.184 1.00 62.03  ? 351 GLU E OE2   1 
ATOM 10146 N N     . ARG D 3 352 ? -88.065  133.120 165.562 1.00 60.04  ? 352 ARG E N     1 
ATOM 10147 C CA    . ARG D 3 352 ? -87.992  134.387 166.274 1.00 60.04  ? 352 ARG E CA    1 
ATOM 10148 C C     . ARG D 3 352 ? -86.782  135.178 165.798 1.00 60.04  ? 352 ARG E C     1 
ATOM 10149 O O     . ARG D 3 352 ? -85.710  134.624 165.568 1.00 60.04  ? 352 ARG E O     1 
ATOM 10150 C CB    . ARG D 3 352 ? -87.964  134.154 167.775 1.00 60.04  ? 352 ARG E CB    1 
ATOM 10151 C CG    . ARG D 3 352 ? -87.954  135.424 168.565 1.00 60.04  ? 352 ARG E CG    1 
ATOM 10152 C CD    . ARG D 3 352 ? -88.141  135.096 170.008 1.00 60.04  ? 352 ARG E CD    1 
ATOM 10153 N NE    . ARG D 3 352 ? -88.112  136.266 170.865 1.00 60.04  ? 352 ARG E NE    1 
ATOM 10154 C CZ    . ARG D 3 352 ? -88.254  136.202 172.180 1.00 60.04  ? 352 ARG E CZ    1 
ATOM 10155 N NH1   . ARG D 3 352 ? -88.436  135.029 172.765 1.00 60.04  ? 352 ARG E NH1   1 
ATOM 10156 N NH2   . ARG D 3 352 ? -88.229  137.304 172.908 1.00 60.04  ? 352 ARG E NH2   1 
ATOM 10157 N N     . TYR D 3 353 ? -86.961  136.485 165.659 1.00 60.86  ? 353 TYR E N     1 
ATOM 10158 C CA    . TYR D 3 353 ? -85.892  137.395 165.289 1.00 60.86  ? 353 TYR E CA    1 
ATOM 10159 C C     . TYR D 3 353 ? -85.694  138.441 166.369 1.00 60.86  ? 353 TYR E C     1 
ATOM 10160 O O     . TYR D 3 353 ? -86.643  138.866 167.023 1.00 60.86  ? 353 TYR E O     1 
ATOM 10161 C CB    . TYR D 3 353 ? -86.213  138.074 163.972 1.00 60.86  ? 353 TYR E CB    1 
ATOM 10162 C CG    . TYR D 3 353 ? -86.193  137.141 162.807 1.00 60.86  ? 353 TYR E CG    1 
ATOM 10163 C CD1   . TYR D 3 353 ? -85.029  136.859 162.143 1.00 60.86  ? 353 TYR E CD1   1 
ATOM 10164 C CD2   . TYR D 3 353 ? -87.333  136.477 162.430 1.00 60.86  ? 353 TYR E CD2   1 
ATOM 10165 C CE1   . TYR D 3 353 ? -85.010  135.990 161.094 1.00 60.86  ? 353 TYR E CE1   1 
ATOM 10166 C CE2   . TYR D 3 353 ? -87.321  135.604 161.392 1.00 60.86  ? 353 TYR E CE2   1 
ATOM 10167 C CZ    . TYR D 3 353 ? -86.164  135.362 160.725 1.00 60.86  ? 353 TYR E CZ    1 
ATOM 10168 O OH    . TYR D 3 353 ? -86.166  134.485 159.676 1.00 60.86  ? 353 TYR E OH    1 
ATOM 10169 N N     . ASP D 3 354 ? -84.446  138.858 166.549 1.00 63.54  ? 354 ASP E N     1 
ATOM 10170 C CA    . ASP D 3 354 ? -84.117  139.698 167.690 1.00 63.54  ? 354 ASP E CA    1 
ATOM 10171 C C     . ASP D 3 354 ? -84.685  141.100 167.565 1.00 63.54  ? 354 ASP E C     1 
ATOM 10172 O O     . ASP D 3 354 ? -84.911  141.763 168.579 1.00 63.54  ? 354 ASP E O     1 
ATOM 10173 C CB    . ASP D 3 354 ? -82.611  139.764 167.862 1.00 63.54  ? 354 ASP E CB    1 
ATOM 10174 C CG    . ASP D 3 354 ? -82.021  138.428 168.218 1.00 63.54  ? 354 ASP E CG    1 
ATOM 10175 O OD1   . ASP D 3 354 ? -82.730  137.621 168.848 1.00 63.54  ? 354 ASP E OD1   1 
ATOM 10176 O OD2   . ASP D 3 354 ? -80.854  138.174 167.853 1.00 63.54  ? 354 ASP E OD2   1 
ATOM 10177 N N     . SER D 3 355 ? -84.930  141.573 166.349 1.00 60.10  ? 355 SER E N     1 
ATOM 10178 C CA    . SER D 3 355 ? -85.275  142.972 166.159 1.00 60.10  ? 355 SER E CA    1 
ATOM 10179 C C     . SER D 3 355 ? -86.271  143.101 165.027 1.00 60.10  ? 355 SER E C     1 
ATOM 10180 O O     . SER D 3 355 ? -86.347  142.250 164.143 1.00 60.10  ? 355 SER E O     1 
ATOM 10181 C CB    . SER D 3 355 ? -84.040  143.813 165.861 1.00 60.10  ? 355 SER E CB    1 
ATOM 10182 O OG    . SER D 3 355 ? -83.315  143.258 164.789 1.00 60.10  ? 355 SER E OG    1 
ATOM 10183 N N     . TYR D 3 356 ? -87.015  144.201 165.049 1.00 52.94  ? 356 TYR E N     1 
ATOM 10184 C CA    . TYR D 3 356 ? -87.985  144.445 163.985 1.00 52.94  ? 356 TYR E CA    1 
ATOM 10185 C C     . TYR D 3 356 ? -87.327  144.611 162.627 1.00 52.94  ? 356 TYR E C     1 
ATOM 10186 O O     . TYR D 3 356 ? -87.786  143.972 161.666 1.00 52.94  ? 356 TYR E O     1 
ATOM 10187 C CB    . TYR D 3 356 ? -88.846  145.657 164.327 1.00 52.94  ? 356 TYR E CB    1 
ATOM 10188 C CG    . TYR D 3 356 ? -89.754  145.451 165.500 1.00 52.94  ? 356 TYR E CG    1 
ATOM 10189 C CD1   . TYR D 3 356 ? -90.104  144.190 165.913 1.00 52.94  ? 356 TYR E CD1   1 
ATOM 10190 C CD2   . TYR D 3 356 ? -90.249  146.526 166.203 1.00 52.94  ? 356 TYR E CD2   1 
ATOM 10191 C CE1   . TYR D 3 356 ? -90.921  144.006 166.983 1.00 52.94  ? 356 TYR E CE1   1 
ATOM 10192 C CE2   . TYR D 3 356 ? -91.063  146.348 167.269 1.00 52.94  ? 356 TYR E CE2   1 
ATOM 10193 C CZ    . TYR D 3 356 ? -91.396  145.090 167.656 1.00 52.94  ? 356 TYR E CZ    1 
ATOM 10194 O OH    . TYR D 3 356 ? -92.219  144.918 168.732 1.00 52.94  ? 356 TYR E OH    1 
ATOM 10195 N N     . PRO D 3 357 ? -86.268  145.401 162.462 1.00 55.67  ? 357 PRO E N     1 
ATOM 10196 C CA    . PRO D 3 357 ? -85.631  145.458 161.144 1.00 55.67  ? 357 PRO E CA    1 
ATOM 10197 C C     . PRO D 3 357 ? -85.061  144.133 160.683 1.00 55.67  ? 357 PRO E C     1 
ATOM 10198 O O     . PRO D 3 357 ? -85.105  143.838 159.485 1.00 55.67  ? 357 PRO E O     1 
ATOM 10199 C CB    . PRO D 3 357 ? -84.539  146.512 161.333 1.00 55.67  ? 357 PRO E CB    1 
ATOM 10200 C CG    . PRO D 3 357 ? -85.013  147.334 162.443 1.00 55.67  ? 357 PRO E CG    1 
ATOM 10201 C CD    . PRO D 3 357 ? -85.713  146.416 163.365 1.00 55.67  ? 357 PRO E CD    1 
ATOM 10202 N N     . ALA D 3 358 ? -84.537  143.315 161.588 1.00 56.44  ? 358 ALA E N     1 
ATOM 10203 C CA    . ALA D 3 358 ? -84.072  141.997 161.178 1.00 56.44  ? 358 ALA E CA    1 
ATOM 10204 C C     . ALA D 3 358 ? -85.224  141.134 160.697 1.00 56.44  ? 358 ALA E C     1 
ATOM 10205 O O     . ALA D 3 358 ? -85.091  140.397 159.716 1.00 56.44  ? 358 ALA E O     1 
ATOM 10206 C CB    . ALA D 3 358 ? -83.347  141.313 162.328 1.00 56.44  ? 358 ALA E CB    1 
ATOM 10207 N N     . LEU D 3 359 ? -86.370  141.227 161.363 1.00 54.37  ? 359 LEU E N     1 
ATOM 10208 C CA    . LEU D 3 359 ? -87.537  140.470 160.933 1.00 54.37  ? 359 LEU E CA    1 
ATOM 10209 C C     . LEU D 3 359 ? -88.038  140.943 159.582 1.00 54.37  ? 359 LEU E C     1 
ATOM 10210 O O     . LEU D 3 359 ? -88.326  140.127 158.698 1.00 54.37  ? 359 LEU E O     1 
ATOM 10211 C CB    . LEU D 3 359 ? -88.640  140.588 161.968 1.00 54.37  ? 359 LEU E CB    1 
ATOM 10212 C CG    . LEU D 3 359 ? -89.994  140.101 161.495 1.00 54.37  ? 359 LEU E CG    1 
ATOM 10213 C CD1   . LEU D 3 359 ? -89.966  138.638 161.217 1.00 54.37  ? 359 LEU E CD1   1 
ATOM 10214 C CD2   . LEU D 3 359 ? -90.968  140.372 162.564 1.00 54.37  ? 359 LEU E CD2   1 
ATOM 10215 N N     . ILE D 3 360 ? -88.126  142.254 159.389 1.00 55.65  ? 360 ILE E N     1 
ATOM 10216 C CA    . ILE D 3 360 ? -88.607  142.771 158.118 1.00 55.65  ? 360 ILE E CA    1 
ATOM 10217 C C     . ILE D 3 360 ? -87.662  142.376 157.002 1.00 55.65  ? 360 ILE E C     1 
ATOM 10218 O O     . ILE D 3 360 ? -88.092  141.952 155.928 1.00 55.65  ? 360 ILE E O     1 
ATOM 10219 C CB    . ILE D 3 360 ? -88.787  144.288 158.190 1.00 55.65  ? 360 ILE E CB    1 
ATOM 10220 C CG1   . ILE D 3 360 ? -89.890  144.638 159.169 1.00 55.65  ? 360 ILE E CG1   1 
ATOM 10221 C CG2   . ILE D 3 360 ? -89.084  144.839 156.831 1.00 55.65  ? 360 ILE E CG2   1 
ATOM 10222 C CD1   . ILE D 3 360 ? -90.025  146.097 159.387 1.00 55.65  ? 360 ILE E CD1   1 
ATOM 10223 N N     . ASP D 3 361 ? -86.362  142.481 157.244 1.00 59.44  ? 361 ASP E N     1 
ATOM 10224 C CA    . ASP D 3 361 ? -85.416  142.123 156.202 1.00 59.44  ? 361 ASP E CA    1 
ATOM 10225 C C     . ASP D 3 361 ? -85.465  140.637 155.897 1.00 59.44  ? 361 ASP E C     1 
ATOM 10226 O O     . ASP D 3 361 ? -85.321  140.234 154.740 1.00 59.44  ? 361 ASP E O     1 
ATOM 10227 C CB    . ASP D 3 361 ? -84.009  142.537 156.600 1.00 59.44  ? 361 ASP E CB    1 
ATOM 10228 C CG    . ASP D 3 361 ? -83.804  144.021 156.504 1.00 59.44  ? 361 ASP E CG    1 
ATOM 10229 O OD1   . ASP D 3 361 ? -84.581  144.672 155.780 1.00 59.44  ? 361 ASP E OD1   1 
ATOM 10230 O OD2   . ASP D 3 361 ? -82.860  144.535 157.134 1.00 59.44  ? 361 ASP E OD2   1 
ATOM 10231 N N     . ALA D 3 362 ? -85.706  139.807 156.908 1.00 58.08  ? 362 ALA E N     1 
ATOM 10232 C CA    . ALA D 3 362 ? -85.748  138.373 156.663 1.00 58.08  ? 362 ALA E CA    1 
ATOM 10233 C C     . ALA D 3 362 ? -86.998  137.971 155.903 1.00 58.08  ? 362 ALA E C     1 
ATOM 10234 O O     . ALA D 3 362 ? -86.930  137.148 154.986 1.00 58.08  ? 362 ALA E O     1 
ATOM 10235 C CB    . ALA D 3 362 ? -85.672  137.607 157.972 1.00 58.08  ? 362 ALA E CB    1 
ATOM 10236 N N     . MET D 3 363 ? -88.146  138.546 156.241 1.00 55.70  ? 363 MET E N     1 
ATOM 10237 C CA    . MET D 3 363 ? -89.358  138.146 155.535 1.00 55.70  ? 363 MET E CA    1 
ATOM 10238 C C     . MET D 3 363 ? -89.481  138.781 154.164 1.00 55.70  ? 363 MET E C     1 
ATOM 10239 O O     . MET D 3 363 ? -89.966  138.135 153.231 1.00 55.70  ? 363 MET E O     1 
ATOM 10240 C CB    . MET D 3 363 ? -90.592  138.504 156.352 1.00 55.70  ? 363 MET E CB    1 
ATOM 10241 C CG    . MET D 3 363 ? -90.648  137.856 157.688 1.00 55.70  ? 363 MET E CG    1 
ATOM 10242 S SD    . MET D 3 363 ? -90.519  136.083 157.486 1.00 55.70  ? 363 MET E SD    1 
ATOM 10243 C CE    . MET D 3 363 ? -89.058  135.747 158.444 1.00 55.70  ? 363 MET E CE    1 
ATOM 10244 N N     . VAL D 3 364 ? -88.988  140.003 153.992 1.00 59.50  ? 364 VAL E N     1 
ATOM 10245 C CA    . VAL D 3 364 ? -88.975  140.572 152.655 1.00 59.50  ? 364 VAL E CA    1 
ATOM 10246 C C     . VAL D 3 364 ? -87.982  139.836 151.781 1.00 59.50  ? 364 VAL E C     1 
ATOM 10247 O O     . VAL D 3 364 ? -88.248  139.578 150.604 1.00 59.50  ? 364 VAL E O     1 
ATOM 10248 C CB    . VAL D 3 364 ? -88.670  142.075 152.721 1.00 59.50  ? 364 VAL E CB    1 
ATOM 10249 C CG1   . VAL D 3 364 ? -88.419  142.609 151.344 1.00 59.50  ? 364 VAL E CG1   1 
ATOM 10250 C CG2   . VAL D 3 364 ? -89.826  142.792 153.348 1.00 59.50  ? 364 VAL E CG2   1 
ATOM 10251 N N     . ALA D 3 365 ? -86.833  139.465 152.336 1.00 60.91  ? 365 ALA E N     1 
ATOM 10252 C CA    . ALA D 3 365 ? -85.901  138.679 151.549 1.00 60.91  ? 365 ALA E CA    1 
ATOM 10253 C C     . ALA D 3 365 ? -86.458  137.299 151.262 1.00 60.91  ? 365 ALA E C     1 
ATOM 10254 O O     . ALA D 3 365 ? -86.110  136.693 150.248 1.00 60.91  ? 365 ALA E O     1 
ATOM 10255 C CB    . ALA D 3 365 ? -84.566  138.562 152.272 1.00 60.91  ? 365 ALA E CB    1 
ATOM 10256 N N     . ALA D 3 366 ? -87.344  136.805 152.121 1.00 60.73