data_5U5S
# 
_entry.id   5U5S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5U5S         
WWPDB D_1000225380 
BMRB  30206        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'Solution structures of Brd2 second bromodomain in complex with stat3 peptide' 
_pdbx_database_related.db_id          30206 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        5U5S 
_pdbx_database_status.recvd_initial_deposition_date   2016-12-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zeng, L.'    1 ? 
'Zhou, M.-M.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            65 
_citation.language                  ? 
_citation.page_first                1068 
_citation.page_last                 1080.e5 
_citation.title                     
'Distinct Roles of Brd2 and Brd4 in Potentiating the Transcriptional Program for Th17 Cell Differentiation.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2016.12.022 
_citation.pdbx_database_id_PubMed   28262505 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cheung, K.L.'   1  ? 
primary 'Zhang, F.'      2  ? 
primary 'Jaganathan, A.' 3  ? 
primary 'Sharma, R.'     4  ? 
primary 'Zhang, Q.'      5  ? 
primary 'Konuma, T.'     6  ? 
primary 'Shen, T.'       7  ? 
primary 'Lee, J.Y.'      8  ? 
primary 'Ren, C.'        9  ? 
primary 'Chen, C.H.'     10 ? 
primary 'Lu, G.'         11 ? 
primary 'Olson, M.R.'    12 ? 
primary 'Zhang, W.'      13 ? 
primary 'Kaplan, M.H.'   14 ? 
primary 'Littman, D.R.'  15 ? 
primary 'Walsh, M.J.'    16 ? 
primary 'Xiong, H.'      17 ? 
primary 'Zeng, L.'       18 ? 
primary 'Zhou, M.M.'     19 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Bromodomain-containing protein 2' 13157.136 1 ? ? 'UNP residues 344-455' ? 
2 polymer syn 'Stat3 peptide'                    1540.808  1 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'O27.1.1,Really interesting new gene 3 protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFS
NCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
;
;GKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFS
NCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
;
A ? 
2 'polypeptide(L)' no yes 'HNLLRI(ALY)QFLQS' HNLLRIKQFLQS B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   LYS n 
1 3   LEU n 
1 4   SER n 
1 5   GLU n 
1 6   GLN n 
1 7   LEU n 
1 8   LYS n 
1 9   HIS n 
1 10  CYS n 
1 11  ASN n 
1 12  GLY n 
1 13  ILE n 
1 14  LEU n 
1 15  LYS n 
1 16  GLU n 
1 17  LEU n 
1 18  LEU n 
1 19  SER n 
1 20  LYS n 
1 21  LYS n 
1 22  HIS n 
1 23  ALA n 
1 24  ALA n 
1 25  TYR n 
1 26  ALA n 
1 27  TRP n 
1 28  PRO n 
1 29  PHE n 
1 30  TYR n 
1 31  LYS n 
1 32  PRO n 
1 33  VAL n 
1 34  ASP n 
1 35  ALA n 
1 36  SER n 
1 37  ALA n 
1 38  LEU n 
1 39  GLY n 
1 40  LEU n 
1 41  HIS n 
1 42  ASP n 
1 43  TYR n 
1 44  HIS n 
1 45  ASP n 
1 46  ILE n 
1 47  ILE n 
1 48  LYS n 
1 49  HIS n 
1 50  PRO n 
1 51  MET n 
1 52  ASP n 
1 53  LEU n 
1 54  SER n 
1 55  THR n 
1 56  VAL n 
1 57  LYS n 
1 58  ARG n 
1 59  LYS n 
1 60  MET n 
1 61  GLU n 
1 62  ASN n 
1 63  ARG n 
1 64  ASP n 
1 65  TYR n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  GLN n 
1 70  GLU n 
1 71  PHE n 
1 72  ALA n 
1 73  ALA n 
1 74  ASP n 
1 75  VAL n 
1 76  ARG n 
1 77  LEU n 
1 78  MET n 
1 79  PHE n 
1 80  SER n 
1 81  ASN n 
1 82  CYS n 
1 83  TYR n 
1 84  LYS n 
1 85  TYR n 
1 86  ASN n 
1 87  PRO n 
1 88  PRO n 
1 89  ASP n 
1 90  HIS n 
1 91  ASP n 
1 92  VAL n 
1 93  VAL n 
1 94  ALA n 
1 95  MET n 
1 96  ALA n 
1 97  ARG n 
1 98  LYS n 
1 99  LEU n 
1 100 GLN n 
1 101 ASP n 
1 102 VAL n 
1 103 PHE n 
1 104 GLU n 
1 105 PHE n 
1 106 ARG n 
1 107 TYR n 
1 108 ALA n 
1 109 LYS n 
1 110 MET n 
1 111 PRO n 
1 112 ASP n 
2 1   HIS n 
2 2   ASN n 
2 3   LEU n 
2 4   LEU n 
2 5   ARG n 
2 6   ILE n 
2 7   ALY n 
2 8   GLN n 
2 9   PHE n 
2 10  LEU n 
2 11  GLN n 
2 12  SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   112 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BRD2, KIAA9001, RING3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       12 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP BRD2_HUMAN P25440 ? 1 
;GKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFS
NCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
;
344 
2 PDB 5U5S       5U5S   ? 2 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5U5S A 1 ? 112 ? P25440 344 ? 455 ? 1   112 
2 2 5U5S B 1 ? 12  ? 5U5S   281 ? 292 ? 281 292 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ? 'C3 H7 N O2'     89.093  
ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3'   188.224 
ARG 'L-peptide linking' y ARGININE            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE           ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 2 '3D HNCACB'                          1 isotropic 
2 1 2 '3D HN(COCA)CB'                      1 isotropic 
3 1 2 '3D 1H-15N NOESY'                    2 isotropic 
4 1 1 '3D 1H-13C NOESY aliphatic'          3 isotropic 
5 1 1 '3D 1H-13C NOESY aromatic'           3 isotropic 
6 1 1 '3D 1H-13C filtered NOESY aliphatic' 2 isotropic 
7 1 1 '3D 1H-13C filtered NOESY aromatic'  2 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.4 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         null 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   'Not defined' 
_pdbx_nmr_exptl_sample_conditions.label                  conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 '10 mM sodium phosphate, 100 mM sodium chloride, 2 mM EDTA, 2 mM [U-2H] DTT, 100% D2O'        '100% D2O'        sample_1 
solution ? 
2 '10 mM sodium phosphate, 100 mM sodium chloride, 2 mM EDTA, 2 mM [U-2H] DTT, 90% H2O/10% D2O' '90% H2O/10% D2O' sample_2 
solution ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 AVANCE ? Bruker 600 ? 
2 AVANCE ? Bruker 800 ? 
3 AVANCE ? Bruker 900 ? 
# 
_pdbx_nmr_refine.entry_id           5U5S 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   2 
# 
_pdbx_nmr_ensemble.entry_id                                      5U5S 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             5U5S 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 refinement                  ARIA        2.3  
;Linge, O'Donoghue and Nilges
;
2 'structure calculation'     CNS         ?    'Brunger, Adams, Clore, Gros, Nilges and Read'      
3 'chemical shift assignment' NMRView     5.04 'Johnson, One Moon Scientific'                      
4 'peak picking'              NMRView     5.04 'Johnson, One Moon Scientific'                      
5 refinement                  TALOS       ?    'Cornilescu, Delaglio and Bax'                      
6 collection                  TopSpin     ?    'Bruker Biospin'                                    
7 processing                  NMRPipe     ?    'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
8 'data analysis'             ProcheckNMR ?    'Laskowski and MacArthur'                           
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5U5S 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5U5S 
_struct.title                        'Solution structures of Brd2 second bromodomain in complex with stat3 peptide' 
_struct.pdbx_descriptor              'Bromodomain-containing protein 2, Stat3 peptide' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5U5S 
_struct_keywords.text            'Brd2, Brd4, bromodomain, stat3, th17, p300, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 4  ? SER A 19  ? SER A 4  SER A 19  1 ? 16 
HELX_P HELX_P2 AA2 SER A 19 ? LYS A 31  ? SER A 19 LYS A 31  1 ? 13 
HELX_P HELX_P3 AA3 ASP A 34 ? GLY A 39  ? ASP A 34 GLY A 39  1 ? 6  
HELX_P HELX_P4 AA4 ASP A 42 ? ILE A 47  ? ASP A 42 ILE A 47  1 ? 6  
HELX_P HELX_P5 AA5 ASP A 52 ? ASN A 62  ? ASP A 52 ASN A 62  1 ? 11 
HELX_P HELX_P6 AA6 ASP A 67 ? ASN A 86  ? ASP A 67 ASN A 86  1 ? 20 
HELX_P HELX_P7 AA7 HIS A 90 ? MET A 110 ? HIS A 90 MET A 110 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? B ILE 6 C ? ? ? 1_555 B ALY 7 N ? ? B ILE 286 B ALY 287 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2 covale both ? B ALY 7 C ? ? ? 1_555 B GLN 8 N ? ? B ALY 287 B GLN 288 1_555 ? ? ? ? ? ? ? 1.326 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    5U5S 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . GLY A 1 1   ? 24.355  10.358  -2.774  1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C CA   . GLY A 1 1   ? 24.597  9.101   -3.517  1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C C    . GLY A 1 1   ? 23.329  8.575   -4.148  1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O O    . GLY A 1 1   ? 22.234  9.024   -3.812  1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H H1   . GLY A 1 1   ? 24.016  11.095  -3.424  1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H H2   . GLY A 1 1   ? 25.231  10.686  -2.323  1.00 0.00 ? 1   GLY A H2   1  
ATOM   7     H H3   . GLY A 1 1   ? 23.634  10.205  -2.041  1.00 0.00 ? 1   GLY A H3   1  
ATOM   8     H HA2  . GLY A 1 1   ? 25.324  9.285   -4.293  1.00 0.00 ? 1   GLY A HA2  1  
ATOM   9     H HA3  . GLY A 1 1   ? 24.987  8.359   -2.837  1.00 0.00 ? 1   GLY A HA3  1  
ATOM   10    N N    . LYS A 1 2   ? 23.464  7.629   -5.063  1.00 0.00 ? 2   LYS A N    1  
ATOM   11    C CA   . LYS A 1 2   ? 22.310  7.058   -5.739  1.00 0.00 ? 2   LYS A CA   1  
ATOM   12    C C    . LYS A 1 2   ? 21.709  5.931   -4.908  1.00 0.00 ? 2   LYS A C    1  
ATOM   13    O O    . LYS A 1 2   ? 22.074  4.767   -5.077  1.00 0.00 ? 2   LYS A O    1  
ATOM   14    C CB   . LYS A 1 2   ? 22.700  6.543   -7.127  1.00 0.00 ? 2   LYS A CB   1  
ATOM   15    C CG   . LYS A 1 2   ? 23.296  7.610   -8.031  1.00 0.00 ? 2   LYS A CG   1  
ATOM   16    C CD   . LYS A 1 2   ? 22.323  8.750   -8.281  1.00 0.00 ? 2   LYS A CD   1  
ATOM   17    C CE   . LYS A 1 2   ? 22.941  9.824   -9.162  1.00 0.00 ? 2   LYS A CE   1  
ATOM   18    N NZ   . LYS A 1 2   ? 23.359  9.293   -10.487 1.00 0.00 ? 2   LYS A NZ   1  
ATOM   19    H H    . LYS A 1 2   ? 24.364  7.299   -5.284  1.00 0.00 ? 2   LYS A H    1  
ATOM   20    H HA   . LYS A 1 2   ? 21.573  7.837   -5.849  1.00 0.00 ? 2   LYS A HA   1  
ATOM   21    H HB2  . LYS A 1 2   ? 23.427  5.753   -7.015  1.00 0.00 ? 2   LYS A HB2  1  
ATOM   22    H HB3  . LYS A 1 2   ? 21.821  6.145   -7.609  1.00 0.00 ? 2   LYS A HB3  1  
ATOM   23    H HG2  . LYS A 1 2   ? 24.184  8.008   -7.564  1.00 0.00 ? 2   LYS A HG2  1  
ATOM   24    H HG3  . LYS A 1 2   ? 23.557  7.158   -8.976  1.00 0.00 ? 2   LYS A HG3  1  
ATOM   25    H HD2  . LYS A 1 2   ? 21.443  8.359   -8.768  1.00 0.00 ? 2   LYS A HD2  1  
ATOM   26    H HD3  . LYS A 1 2   ? 22.047  9.189   -7.333  1.00 0.00 ? 2   LYS A HD3  1  
ATOM   27    H HE2  . LYS A 1 2   ? 22.214  10.607  -9.314  1.00 0.00 ? 2   LYS A HE2  1  
ATOM   28    H HE3  . LYS A 1 2   ? 23.805  10.230  -8.657  1.00 0.00 ? 2   LYS A HE3  1  
ATOM   29    H HZ1  . LYS A 1 2   ? 22.524  9.008   -11.039 1.00 0.00 ? 2   LYS A HZ1  1  
ATOM   30    H HZ2  . LYS A 1 2   ? 23.977  8.467   -10.365 1.00 0.00 ? 2   LYS A HZ2  1  
ATOM   31    H HZ3  . LYS A 1 2   ? 23.877  10.023  -11.017 1.00 0.00 ? 2   LYS A HZ3  1  
ATOM   32    N N    . LEU A 1 3   ? 20.796  6.298   -4.005  1.00 0.00 ? 3   LEU A N    1  
ATOM   33    C CA   . LEU A 1 3   ? 20.118  5.343   -3.126  1.00 0.00 ? 3   LEU A CA   1  
ATOM   34    C C    . LEU A 1 3   ? 21.090  4.692   -2.151  1.00 0.00 ? 3   LEU A C    1  
ATOM   35    O O    . LEU A 1 3   ? 21.903  3.847   -2.530  1.00 0.00 ? 3   LEU A O    1  
ATOM   36    C CB   . LEU A 1 3   ? 19.387  4.258   -3.930  1.00 0.00 ? 3   LEU A CB   1  
ATOM   37    C CG   . LEU A 1 3   ? 18.112  4.706   -4.645  1.00 0.00 ? 3   LEU A CG   1  
ATOM   38    C CD1  . LEU A 1 3   ? 17.632  3.621   -5.594  1.00 0.00 ? 3   LEU A CD1  1  
ATOM   39    C CD2  . LEU A 1 3   ? 17.019  5.033   -3.636  1.00 0.00 ? 3   LEU A CD2  1  
ATOM   40    H H    . LEU A 1 3   ? 20.580  7.251   -3.917  1.00 0.00 ? 3   LEU A H    1  
ATOM   41    H HA   . LEU A 1 3   ? 19.388  5.897   -2.555  1.00 0.00 ? 3   LEU A HA   1  
ATOM   42    H HB2  . LEU A 1 3   ? 20.072  3.869   -4.671  1.00 0.00 ? 3   LEU A HB2  1  
ATOM   43    H HB3  . LEU A 1 3   ? 19.127  3.461   -3.251  1.00 0.00 ? 3   LEU A HB3  1  
ATOM   44    H HG   . LEU A 1 3   ? 18.317  5.596   -5.223  1.00 0.00 ? 3   LEU A HG   1  
ATOM   45    H HD11 . LEU A 1 3   ? 17.419  2.721   -5.035  1.00 0.00 ? 3   LEU A HD11 1  
ATOM   46    H HD12 . LEU A 1 3   ? 18.399  3.417   -6.325  1.00 0.00 ? 3   LEU A HD12 1  
ATOM   47    H HD13 . LEU A 1 3   ? 16.736  3.952   -6.096  1.00 0.00 ? 3   LEU A HD13 1  
ATOM   48    H HD21 . LEU A 1 3   ? 17.379  5.774   -2.936  1.00 0.00 ? 3   LEU A HD21 1  
ATOM   49    H HD22 . LEU A 1 3   ? 16.744  4.136   -3.101  1.00 0.00 ? 3   LEU A HD22 1  
ATOM   50    H HD23 . LEU A 1 3   ? 16.155  5.420   -4.156  1.00 0.00 ? 3   LEU A HD23 1  
ATOM   51    N N    . SER A 1 4   ? 21.005  5.095   -0.894  1.00 0.00 ? 4   SER A N    1  
ATOM   52    C CA   . SER A 1 4   ? 21.792  4.480   0.160   1.00 0.00 ? 4   SER A CA   1  
ATOM   53    C C    . SER A 1 4   ? 21.377  3.017   0.338   1.00 0.00 ? 4   SER A C    1  
ATOM   54    O O    . SER A 1 4   ? 20.340  2.604   -0.188  1.00 0.00 ? 4   SER A O    1  
ATOM   55    C CB   . SER A 1 4   ? 21.604  5.264   1.460   1.00 0.00 ? 4   SER A CB   1  
ATOM   56    O OG   . SER A 1 4   ? 21.841  6.648   1.248   1.00 0.00 ? 4   SER A OG   1  
ATOM   57    H H    . SER A 1 4   ? 20.404  5.833   -0.668  1.00 0.00 ? 4   SER A H    1  
ATOM   58    H HA   . SER A 1 4   ? 22.830  4.519   -0.132  1.00 0.00 ? 4   SER A HA   1  
ATOM   59    H HB2  . SER A 1 4   ? 20.592  5.135   1.816   1.00 0.00 ? 4   SER A HB2  1  
ATOM   60    H HB3  . SER A 1 4   ? 22.297  4.902   2.203   1.00 0.00 ? 4   SER A HB3  1  
ATOM   61    H HG   . SER A 1 4   ? 22.687  6.760   0.796   1.00 0.00 ? 4   SER A HG   1  
ATOM   62    N N    . GLU A 1 5   ? 22.170  2.240   1.069   1.00 0.00 ? 5   GLU A N    1  
ATOM   63    C CA   . GLU A 1 5   ? 21.937  0.800   1.191   1.00 0.00 ? 5   GLU A CA   1  
ATOM   64    C C    . GLU A 1 5   ? 20.510  0.496   1.648   1.00 0.00 ? 5   GLU A C    1  
ATOM   65    O O    . GLU A 1 5   ? 19.835  -0.365  1.078   1.00 0.00 ? 5   GLU A O    1  
ATOM   66    C CB   . GLU A 1 5   ? 22.942  0.173   2.155   1.00 0.00 ? 5   GLU A CB   1  
ATOM   67    C CG   . GLU A 1 5   ? 24.383  0.302   1.691   1.00 0.00 ? 5   GLU A CG   1  
ATOM   68    C CD   . GLU A 1 5   ? 24.605  -0.272  0.306   1.00 0.00 ? 5   GLU A CD   1  
ATOM   69    O OE1  . GLU A 1 5   ? 24.640  -1.512  0.166   1.00 0.00 ? 5   GLU A OE1  1  
ATOM   70    O OE2  . GLU A 1 5   ? 24.743  0.517   -0.653  1.00 0.00 ? 5   GLU A OE2  1  
ATOM   71    H H    . GLU A 1 5   ? 22.932  2.643   1.543   1.00 0.00 ? 5   GLU A H    1  
ATOM   72    H HA   . GLU A 1 5   ? 22.084  0.366   0.214   1.00 0.00 ? 5   GLU A HA   1  
ATOM   73    H HB2  . GLU A 1 5   ? 22.851  0.655   3.117   1.00 0.00 ? 5   GLU A HB2  1  
ATOM   74    H HB3  . GLU A 1 5   ? 22.714  -0.877  2.264   1.00 0.00 ? 5   GLU A HB3  1  
ATOM   75    H HG2  . GLU A 1 5   ? 24.645  1.347   1.672   1.00 0.00 ? 5   GLU A HG2  1  
ATOM   76    H HG3  . GLU A 1 5   ? 25.024  -0.218  2.388   1.00 0.00 ? 5   GLU A HG3  1  
ATOM   77    N N    . GLN A 1 6   ? 20.053  1.225   2.658   1.00 0.00 ? 6   GLN A N    1  
ATOM   78    C CA   . GLN A 1 6   ? 18.702  1.058   3.190   1.00 0.00 ? 6   GLN A CA   1  
ATOM   79    C C    . GLN A 1 6   ? 17.660  1.344   2.107   1.00 0.00 ? 6   GLN A C    1  
ATOM   80    O O    . GLN A 1 6   ? 16.665  0.627   1.980   1.00 0.00 ? 6   GLN A O    1  
ATOM   81    C CB   . GLN A 1 6   ? 18.480  1.993   4.391   1.00 0.00 ? 6   GLN A CB   1  
ATOM   82    C CG   . GLN A 1 6   ? 19.178  1.570   5.688   1.00 0.00 ? 6   GLN A CG   1  
ATOM   83    C CD   . GLN A 1 6   ? 20.622  1.137   5.506   1.00 0.00 ? 6   GLN A CD   1  
ATOM   84    O OE1  . GLN A 1 6   ? 21.541  1.955   5.550   1.00 0.00 ? 6   GLN A OE1  1  
ATOM   85    N NE2  . GLN A 1 6   ? 20.830  -0.154  5.309   1.00 0.00 ? 6   GLN A NE2  1  
ATOM   86    H H    . GLN A 1 6   ? 20.645  1.894   3.065   1.00 0.00 ? 6   GLN A H    1  
ATOM   87    H HA   . GLN A 1 6   ? 18.593  0.031   3.516   1.00 0.00 ? 6   GLN A HA   1  
ATOM   88    H HB2  . GLN A 1 6   ? 18.833  2.978   4.129   1.00 0.00 ? 6   GLN A HB2  1  
ATOM   89    H HB3  . GLN A 1 6   ? 17.416  2.048   4.590   1.00 0.00 ? 6   GLN A HB3  1  
ATOM   90    H HG2  . GLN A 1 6   ? 19.168  2.409   6.371   1.00 0.00 ? 6   GLN A HG2  1  
ATOM   91    H HG3  . GLN A 1 6   ? 18.625  0.750   6.125   1.00 0.00 ? 6   GLN A HG3  1  
ATOM   92    H HE21 . GLN A 1 6   ? 20.053  -0.755  5.291   1.00 0.00 ? 6   GLN A HE21 1  
ATOM   93    H HE22 . GLN A 1 6   ? 21.754  -0.461  5.191   1.00 0.00 ? 6   GLN A HE22 1  
ATOM   94    N N    . LEU A 1 7   ? 17.913  2.376   1.305   1.00 0.00 ? 7   LEU A N    1  
ATOM   95    C CA   . LEU A 1 7   ? 16.967  2.802   0.276   1.00 0.00 ? 7   LEU A CA   1  
ATOM   96    C C    . LEU A 1 7   ? 16.973  1.849   -0.914  1.00 0.00 ? 7   LEU A C    1  
ATOM   97    O O    . LEU A 1 7   ? 15.949  1.649   -1.568  1.00 0.00 ? 7   LEU A O    1  
ATOM   98    C CB   . LEU A 1 7   ? 17.276  4.232   -0.181  1.00 0.00 ? 7   LEU A CB   1  
ATOM   99    C CG   . LEU A 1 7   ? 17.005  5.313   0.863   1.00 0.00 ? 7   LEU A CG   1  
ATOM   100   C CD1  . LEU A 1 7   ? 17.517  6.659   0.379   1.00 0.00 ? 7   LEU A CD1  1  
ATOM   101   C CD2  . LEU A 1 7   ? 15.520  5.392   1.176   1.00 0.00 ? 7   LEU A CD2  1  
ATOM   102   H H    . LEU A 1 7   ? 18.762  2.855   1.400   1.00 0.00 ? 7   LEU A H    1  
ATOM   103   H HA   . LEU A 1 7   ? 15.989  2.783   0.720   1.00 0.00 ? 7   LEU A HA   1  
ATOM   104   H HB2  . LEU A 1 7   ? 18.318  4.283   -0.461  1.00 0.00 ? 7   LEU A HB2  1  
ATOM   105   H HB3  . LEU A 1 7   ? 16.679  4.454   -1.053  1.00 0.00 ? 7   LEU A HB3  1  
ATOM   106   H HG   . LEU A 1 7   ? 17.523  5.060   1.774   1.00 0.00 ? 7   LEU A HG   1  
ATOM   107   H HD11 . LEU A 1 7   ? 18.577  6.596   0.197   1.00 0.00 ? 7   LEU A HD11 1  
ATOM   108   H HD12 . LEU A 1 7   ? 17.325  7.410   1.132   1.00 0.00 ? 7   LEU A HD12 1  
ATOM   109   H HD13 . LEU A 1 7   ? 17.011  6.929   -0.536  1.00 0.00 ? 7   LEU A HD13 1  
ATOM   110   H HD21 . LEU A 1 7   ? 15.236  4.555   1.796   1.00 0.00 ? 7   LEU A HD21 1  
ATOM   111   H HD22 . LEU A 1 7   ? 14.956  5.366   0.255   1.00 0.00 ? 7   LEU A HD22 1  
ATOM   112   H HD23 . LEU A 1 7   ? 15.312  6.314   1.699   1.00 0.00 ? 7   LEU A HD23 1  
ATOM   113   N N    . LYS A 1 8   ? 18.124  1.257   -1.188  1.00 0.00 ? 8   LYS A N    1  
ATOM   114   C CA   . LYS A 1 8   ? 18.237  0.263   -2.245  1.00 0.00 ? 8   LYS A CA   1  
ATOM   115   C C    . LYS A 1 8   ? 17.437  -0.977  -1.882  1.00 0.00 ? 8   LYS A C    1  
ATOM   116   O O    . LYS A 1 8   ? 16.788  -1.582  -2.735  1.00 0.00 ? 8   LYS A O    1  
ATOM   117   C CB   . LYS A 1 8   ? 19.704  -0.099  -2.474  1.00 0.00 ? 8   LYS A CB   1  
ATOM   118   C CG   . LYS A 1 8   ? 19.925  -1.169  -3.537  1.00 0.00 ? 8   LYS A CG   1  
ATOM   119   C CD   . LYS A 1 8   ? 19.392  -0.745  -4.898  1.00 0.00 ? 8   LYS A CD   1  
ATOM   120   C CE   . LYS A 1 8   ? 20.046  0.539   -5.390  1.00 0.00 ? 8   LYS A CE   1  
ATOM   121   N NZ   . LYS A 1 8   ? 21.524  0.413   -5.483  1.00 0.00 ? 8   LYS A NZ   1  
ATOM   122   H H    . LYS A 1 8   ? 18.924  1.499   -0.669  1.00 0.00 ? 8   LYS A H    1  
ATOM   123   H HA   . LYS A 1 8   ? 17.829  0.684   -3.150  1.00 0.00 ? 8   LYS A HA   1  
ATOM   124   H HB2  . LYS A 1 8   ? 20.240  0.789   -2.772  1.00 0.00 ? 8   LYS A HB2  1  
ATOM   125   H HB3  . LYS A 1 8   ? 20.114  -0.458  -1.546  1.00 0.00 ? 8   LYS A HB3  1  
ATOM   126   H HG2  . LYS A 1 8   ? 20.983  -1.361  -3.624  1.00 0.00 ? 8   LYS A HG2  1  
ATOM   127   H HG3  . LYS A 1 8   ? 19.418  -2.072  -3.229  1.00 0.00 ? 8   LYS A HG3  1  
ATOM   128   H HD2  . LYS A 1 8   ? 19.590  -1.531  -5.611  1.00 0.00 ? 8   LYS A HD2  1  
ATOM   129   H HD3  . LYS A 1 8   ? 18.326  -0.590  -4.821  1.00 0.00 ? 8   LYS A HD3  1  
ATOM   130   H HE2  . LYS A 1 8   ? 19.653  0.776   -6.367  1.00 0.00 ? 8   LYS A HE2  1  
ATOM   131   H HE3  . LYS A 1 8   ? 19.804  1.337   -4.703  1.00 0.00 ? 8   LYS A HE3  1  
ATOM   132   H HZ1  . LYS A 1 8   ? 21.939  1.303   -5.827  1.00 0.00 ? 8   LYS A HZ1  1  
ATOM   133   H HZ2  . LYS A 1 8   ? 21.781  -0.349  -6.141  1.00 0.00 ? 8   LYS A HZ2  1  
ATOM   134   H HZ3  . LYS A 1 8   ? 21.926  0.198   -4.549  1.00 0.00 ? 8   LYS A HZ3  1  
ATOM   135   N N    . HIS A 1 9   ? 17.467  -1.337  -0.607  1.00 0.00 ? 9   HIS A N    1  
ATOM   136   C CA   . HIS A 1 9   ? 16.706  -2.478  -0.134  1.00 0.00 ? 9   HIS A CA   1  
ATOM   137   C C    . HIS A 1 9   ? 15.216  -2.188  -0.264  1.00 0.00 ? 9   HIS A C    1  
ATOM   138   O O    . HIS A 1 9   ? 14.418  -3.089  -0.517  1.00 0.00 ? 9   HIS A O    1  
ATOM   139   C CB   . HIS A 1 9   ? 17.055  -2.802  1.317   1.00 0.00 ? 9   HIS A CB   1  
ATOM   140   C CG   . HIS A 1 9   ? 17.037  -4.270  1.612   1.00 0.00 ? 9   HIS A CG   1  
ATOM   141   N ND1  . HIS A 1 9   ? 18.170  -4.985  1.936   1.00 0.00 ? 9   HIS A ND1  1  
ATOM   142   C CD2  . HIS A 1 9   ? 16.016  -5.158  1.636   1.00 0.00 ? 9   HIS A CD2  1  
ATOM   143   C CE1  . HIS A 1 9   ? 17.848  -6.247  2.144   1.00 0.00 ? 9   HIS A CE1  1  
ATOM   144   N NE2  . HIS A 1 9   ? 16.546  -6.380  1.970   1.00 0.00 ? 9   HIS A NE2  1  
ATOM   145   H H    . HIS A 1 9   ? 18.020  -0.830  0.027   1.00 0.00 ? 9   HIS A H    1  
ATOM   146   H HA   . HIS A 1 9   ? 16.953  -3.324  -0.757  1.00 0.00 ? 9   HIS A HA   1  
ATOM   147   H HB2  . HIS A 1 9   ? 18.041  -2.426  1.540   1.00 0.00 ? 9   HIS A HB2  1  
ATOM   148   H HB3  . HIS A 1 9   ? 16.337  -2.323  1.966   1.00 0.00 ? 9   HIS A HB3  1  
ATOM   149   H HD1  . HIS A 1 9   ? 19.085  -4.619  1.995   1.00 0.00 ? 9   HIS A HD1  1  
ATOM   150   H HD2  . HIS A 1 9   ? 14.977  -4.945  1.421   1.00 0.00 ? 9   HIS A HD2  1  
ATOM   151   H HE1  . HIS A 1 9   ? 18.533  -7.038  2.408   1.00 0.00 ? 9   HIS A HE1  1  
ATOM   152   H HE2  . HIS A 1 9   ? 16.069  -7.240  1.919   1.00 0.00 ? 9   HIS A HE2  1  
ATOM   153   N N    . CYS A 1 10  ? 14.852  -0.917  -0.102  1.00 0.00 ? 10  CYS A N    1  
ATOM   154   C CA   . CYS A 1 10  ? 13.473  -0.489  -0.284  1.00 0.00 ? 10  CYS A CA   1  
ATOM   155   C C    . CYS A 1 10  ? 13.036  -0.714  -1.720  1.00 0.00 ? 10  CYS A C    1  
ATOM   156   O O    . CYS A 1 10  ? 11.933  -1.197  -1.982  1.00 0.00 ? 10  CYS A O    1  
ATOM   157   C CB   . CYS A 1 10  ? 13.331  0.988   0.055   1.00 0.00 ? 10  CYS A CB   1  
ATOM   158   S SG   . CYS A 1 10  ? 13.807  1.399   1.739   1.00 0.00 ? 10  CYS A SG   1  
ATOM   159   H H    . CYS A 1 10  ? 15.531  -0.247  0.149   1.00 0.00 ? 10  CYS A H    1  
ATOM   160   H HA   . CYS A 1 10  ? 12.849  -1.071  0.372   1.00 0.00 ? 10  CYS A HA   1  
ATOM   161   H HB2  . CYS A 1 10  ? 13.966  1.560   -0.608  1.00 0.00 ? 10  CYS A HB2  1  
ATOM   162   H HB3  . CYS A 1 10  ? 12.296  1.284   -0.084  1.00 0.00 ? 10  CYS A HB3  1  
ATOM   163   H HG   . CYS A 1 10  ? 15.030  0.925   1.946   1.00 0.00 ? 10  CYS A HG   1  
ATOM   164   N N    . ASN A 1 11  ? 13.922  -0.358  -2.639  1.00 0.00 ? 11  ASN A N    1  
ATOM   165   C CA   . ASN A 1 11  ? 13.676  -0.520  -4.061  1.00 0.00 ? 11  ASN A CA   1  
ATOM   166   C C    . ASN A 1 11  ? 13.366  -1.977  -4.385  1.00 0.00 ? 11  ASN A C    1  
ATOM   167   O O    . ASN A 1 11  ? 12.484  -2.273  -5.191  1.00 0.00 ? 11  ASN A O    1  
ATOM   168   C CB   . ASN A 1 11  ? 14.901  -0.050  -4.849  1.00 0.00 ? 11  ASN A CB   1  
ATOM   169   C CG   . ASN A 1 11  ? 14.690  -0.097  -6.349  1.00 0.00 ? 11  ASN A CG   1  
ATOM   170   O OD1  . ASN A 1 11  ? 14.945  -1.116  -6.997  1.00 0.00 ? 11  ASN A OD1  1  
ATOM   171   N ND2  . ASN A 1 11  ? 14.231  1.009   -6.911  1.00 0.00 ? 11  ASN A ND2  1  
ATOM   172   H H    . ASN A 1 11  ? 14.775  0.034   -2.347  1.00 0.00 ? 11  ASN A H    1  
ATOM   173   H HA   . ASN A 1 11  ? 12.827  0.089   -4.328  1.00 0.00 ? 11  ASN A HA   1  
ATOM   174   H HB2  . ASN A 1 11  ? 15.131  0.968   -4.570  1.00 0.00 ? 11  ASN A HB2  1  
ATOM   175   H HB3  . ASN A 1 11  ? 15.739  -0.681  -4.601  1.00 0.00 ? 11  ASN A HB3  1  
ATOM   176   H HD21 . ASN A 1 11  ? 14.053  1.784   -6.334  1.00 0.00 ? 11  ASN A HD21 1  
ATOM   177   H HD22 . ASN A 1 11  ? 14.097  1.015   -7.883  1.00 0.00 ? 11  ASN A HD22 1  
ATOM   178   N N    . GLY A 1 12  ? 14.084  -2.879  -3.725  1.00 0.00 ? 12  GLY A N    1  
ATOM   179   C CA   . GLY A 1 12  ? 13.894  -4.300  -3.952  1.00 0.00 ? 12  GLY A CA   1  
ATOM   180   C C    . GLY A 1 12  ? 12.596  -4.823  -3.362  1.00 0.00 ? 12  GLY A C    1  
ATOM   181   O O    . GLY A 1 12  ? 11.896  -5.616  -3.995  1.00 0.00 ? 12  GLY A O    1  
ATOM   182   H H    . GLY A 1 12  ? 14.755  -2.572  -3.074  1.00 0.00 ? 12  GLY A H    1  
ATOM   183   H HA2  . GLY A 1 12  ? 13.890  -4.484  -5.017  1.00 0.00 ? 12  GLY A HA2  1  
ATOM   184   H HA3  . GLY A 1 12  ? 14.720  -4.836  -3.508  1.00 0.00 ? 12  GLY A HA3  1  
ATOM   185   N N    . ILE A 1 13  ? 12.276  -4.384  -2.148  1.00 0.00 ? 13  ILE A N    1  
ATOM   186   C CA   . ILE A 1 13  ? 11.051  -4.812  -1.474  1.00 0.00 ? 13  ILE A CA   1  
ATOM   187   C C    . ILE A 1 13  ? 9.821   -4.328  -2.240  1.00 0.00 ? 13  ILE A C    1  
ATOM   188   O O    . ILE A 1 13  ? 8.906   -5.102  -2.521  1.00 0.00 ? 13  ILE A O    1  
ATOM   189   C CB   . ILE A 1 13  ? 10.984  -4.280  -0.025  1.00 0.00 ? 13  ILE A CB   1  
ATOM   190   C CG1  . ILE A 1 13  ? 12.181  -4.785  0.793   1.00 0.00 ? 13  ILE A CG1  1  
ATOM   191   C CG2  . ILE A 1 13  ? 9.678   -4.701  0.638   1.00 0.00 ? 13  ILE A CG2  1  
ATOM   192   C CD1  . ILE A 1 13  ? 12.274  -4.187  2.178   1.00 0.00 ? 13  ILE A CD1  1  
ATOM   193   H H    . ILE A 1 13  ? 12.877  -3.750  -1.695  1.00 0.00 ? 13  ILE A H    1  
ATOM   194   H HA   . ILE A 1 13  ? 11.045  -5.892  -1.442  1.00 0.00 ? 13  ILE A HA   1  
ATOM   195   H HB   . ILE A 1 13  ? 11.008  -3.205  -0.066  1.00 0.00 ? 13  ILE A HB   1  
ATOM   196   H HG12 . ILE A 1 13  ? 12.094  -5.851  0.914   1.00 0.00 ? 13  ILE A HG12 1  
ATOM   197   H HG13 . ILE A 1 13  ? 13.097  -4.560  0.268   1.00 0.00 ? 13  ILE A HG13 1  
ATOM   198   H HG21 . ILE A 1 13  ? 8.986   -5.041  -0.117  1.00 0.00 ? 13  ILE A HG21 1  
ATOM   199   H HG22 . ILE A 1 13  ? 9.253   -3.859  1.163   1.00 0.00 ? 13  ILE A HG22 1  
ATOM   200   H HG23 . ILE A 1 13  ? 9.871   -5.501  1.336   1.00 0.00 ? 13  ILE A HG23 1  
ATOM   201   H HD11 . ILE A 1 13  ? 11.513  -4.627  2.803   1.00 0.00 ? 13  ILE A HD11 1  
ATOM   202   H HD12 . ILE A 1 13  ? 12.124  -3.119  2.121   1.00 0.00 ? 13  ILE A HD12 1  
ATOM   203   H HD13 . ILE A 1 13  ? 13.248  -4.394  2.596   1.00 0.00 ? 13  ILE A HD13 1  
ATOM   204   N N    . LEU A 1 14  ? 9.817   -3.041  -2.580  1.00 0.00 ? 14  LEU A N    1  
ATOM   205   C CA   . LEU A 1 14  ? 8.726   -2.441  -3.332  1.00 0.00 ? 14  LEU A CA   1  
ATOM   206   C C    . LEU A 1 14  ? 8.520   -3.175  -4.650  1.00 0.00 ? 14  LEU A C    1  
ATOM   207   O O    . LEU A 1 14  ? 7.394   -3.460  -5.051  1.00 0.00 ? 14  LEU A O    1  
ATOM   208   C CB   . LEU A 1 14  ? 9.041   -0.972  -3.606  1.00 0.00 ? 14  LEU A CB   1  
ATOM   209   C CG   . LEU A 1 14  ? 7.847   -0.039  -3.561  1.00 0.00 ? 14  LEU A CG   1  
ATOM   210   C CD1  . LEU A 1 14  ? 8.327   1.391   -3.528  1.00 0.00 ? 14  LEU A CD1  1  
ATOM   211   C CD2  . LEU A 1 14  ? 6.942   -0.251  -4.757  1.00 0.00 ? 14  LEU A CD2  1  
ATOM   212   H H    . LEU A 1 14  ? 10.566  -2.470  -2.305  1.00 0.00 ? 14  LEU A H    1  
ATOM   213   H HA   . LEU A 1 14  ? 7.826   -2.510  -2.740  1.00 0.00 ? 14  LEU A HA   1  
ATOM   214   H HB2  . LEU A 1 14  ? 9.764   -0.628  -2.883  1.00 0.00 ? 14  LEU A HB2  1  
ATOM   215   H HB3  . LEU A 1 14  ? 9.484   -0.901  -4.589  1.00 0.00 ? 14  LEU A HB3  1  
ATOM   216   H HG   . LEU A 1 14  ? 7.284   -0.232  -2.663  1.00 0.00 ? 14  LEU A HG   1  
ATOM   217   H HD11 . LEU A 1 14  ? 9.115   1.514   -4.259  1.00 0.00 ? 14  LEU A HD11 1  
ATOM   218   H HD12 . LEU A 1 14  ? 8.706   1.626   -2.545  1.00 0.00 ? 14  LEU A HD12 1  
ATOM   219   H HD13 . LEU A 1 14  ? 7.509   2.053   -3.768  1.00 0.00 ? 14  LEU A HD13 1  
ATOM   220   H HD21 . LEU A 1 14  ? 6.712   -1.306  -4.864  1.00 0.00 ? 14  LEU A HD21 1  
ATOM   221   H HD22 . LEU A 1 14  ? 7.439   0.099   -5.649  1.00 0.00 ? 14  LEU A HD22 1  
ATOM   222   H HD23 . LEU A 1 14  ? 6.028   0.304   -4.616  1.00 0.00 ? 14  LEU A HD23 1  
ATOM   223   N N    . LYS A 1 15  ? 9.630   -3.483  -5.305  1.00 0.00 ? 15  LYS A N    1  
ATOM   224   C CA   . LYS A 1 15  ? 9.631   -4.179  -6.567  1.00 0.00 ? 15  LYS A CA   1  
ATOM   225   C C    . LYS A 1 15  ? 8.930   -5.527  -6.445  1.00 0.00 ? 15  LYS A C    1  
ATOM   226   O O    . LYS A 1 15  ? 8.211   -5.952  -7.348  1.00 0.00 ? 15  LYS A O    1  
ATOM   227   C CB   . LYS A 1 15  ? 11.083  -4.349  -7.010  1.00 0.00 ? 15  LYS A CB   1  
ATOM   228   C CG   . LYS A 1 15  ? 11.336  -5.595  -7.813  1.00 0.00 ? 15  LYS A CG   1  
ATOM   229   C CD   . LYS A 1 15  ? 10.938  -5.428  -9.266  1.00 0.00 ? 15  LYS A CD   1  
ATOM   230   C CE   . LYS A 1 15  ? 11.060  -6.739  -10.011 1.00 0.00 ? 15  LYS A CE   1  
ATOM   231   N NZ   . LYS A 1 15  ? 10.948  -6.554  -11.480 1.00 0.00 ? 15  LYS A NZ   1  
ATOM   232   H H    . LYS A 1 15  ? 10.491  -3.250  -4.912  1.00 0.00 ? 15  LYS A H    1  
ATOM   233   H HA   . LYS A 1 15  ? 9.111   -3.577  -7.285  1.00 0.00 ? 15  LYS A HA   1  
ATOM   234   H HB2  . LYS A 1 15  ? 11.363  -3.499  -7.614  1.00 0.00 ? 15  LYS A HB2  1  
ATOM   235   H HB3  . LYS A 1 15  ? 11.713  -4.377  -6.133  1.00 0.00 ? 15  LYS A HB3  1  
ATOM   236   H HG2  . LYS A 1 15  ? 12.380  -5.839  -7.754  1.00 0.00 ? 15  LYS A HG2  1  
ATOM   237   H HG3  . LYS A 1 15  ? 10.758  -6.391  -7.381  1.00 0.00 ? 15  LYS A HG3  1  
ATOM   238   H HD2  . LYS A 1 15  ? 9.914   -5.088  -9.314  1.00 0.00 ? 15  LYS A HD2  1  
ATOM   239   H HD3  . LYS A 1 15  ? 11.587  -4.698  -9.727  1.00 0.00 ? 15  LYS A HD3  1  
ATOM   240   H HE2  . LYS A 1 15  ? 12.014  -7.179  -9.776  1.00 0.00 ? 15  LYS A HE2  1  
ATOM   241   H HE3  . LYS A 1 15  ? 10.271  -7.399  -9.679  1.00 0.00 ? 15  LYS A HE3  1  
ATOM   242   H HZ1  . LYS A 1 15  ? 10.013  -6.168  -11.722 1.00 0.00 ? 15  LYS A HZ1  1  
ATOM   243   H HZ2  . LYS A 1 15  ? 11.068  -7.464  -11.966 1.00 0.00 ? 15  LYS A HZ2  1  
ATOM   244   H HZ3  . LYS A 1 15  ? 11.680  -5.896  -11.816 1.00 0.00 ? 15  LYS A HZ3  1  
ATOM   245   N N    . GLU A 1 16  ? 9.130   -6.175  -5.314  1.00 0.00 ? 16  GLU A N    1  
ATOM   246   C CA   . GLU A 1 16  ? 8.566   -7.501  -5.079  1.00 0.00 ? 16  GLU A CA   1  
ATOM   247   C C    . GLU A 1 16  ? 7.050   -7.436  -4.938  1.00 0.00 ? 16  GLU A C    1  
ATOM   248   O O    . GLU A 1 16  ? 6.326   -8.200  -5.579  1.00 0.00 ? 16  GLU A O    1  
ATOM   249   C CB   . GLU A 1 16  ? 9.156   -8.151  -3.828  1.00 0.00 ? 16  GLU A CB   1  
ATOM   250   C CG   . GLU A 1 16  ? 8.619   -9.554  -3.603  1.00 0.00 ? 16  GLU A CG   1  
ATOM   251   C CD   . GLU A 1 16  ? 8.117   -9.795  -2.205  1.00 0.00 ? 16  GLU A CD   1  
ATOM   252   O OE1  . GLU A 1 16  ? 8.031   -10.978 -1.808  1.00 0.00 ? 16  GLU A OE1  1  
ATOM   253   O OE2  . GLU A 1 16  ? 7.773   -8.829  -1.514  1.00 0.00 ? 16  GLU A OE2  1  
ATOM   254   H H    . GLU A 1 16  ? 9.666   -5.743  -4.617  1.00 0.00 ? 16  GLU A H    1  
ATOM   255   H HA   . GLU A 1 16  ? 8.805   -8.110  -5.938  1.00 0.00 ? 16  GLU A HA   1  
ATOM   256   H HB2  . GLU A 1 16  ? 10.231  -8.205  -3.931  1.00 0.00 ? 16  GLU A HB2  1  
ATOM   257   H HB3  . GLU A 1 16  ? 8.908   -7.549  -2.966  1.00 0.00 ? 16  GLU A HB3  1  
ATOM   258   H HG2  . GLU A 1 16  ? 7.797   -9.717  -4.281  1.00 0.00 ? 16  GLU A HG2  1  
ATOM   259   H HG3  . GLU A 1 16  ? 9.402   -10.262 -3.809  1.00 0.00 ? 16  GLU A HG3  1  
ATOM   260   N N    . LEU A 1 17  ? 6.578   -6.527  -4.094  1.00 0.00 ? 17  LEU A N    1  
ATOM   261   C CA   . LEU A 1 17  ? 5.141   -6.326  -3.898  1.00 0.00 ? 17  LEU A CA   1  
ATOM   262   C C    . LEU A 1 17  ? 4.483   -5.915  -5.220  1.00 0.00 ? 17  LEU A C    1  
ATOM   263   O O    . LEU A 1 17  ? 3.286   -6.110  -5.421  1.00 0.00 ? 17  LEU A O    1  
ATOM   264   C CB   . LEU A 1 17  ? 4.898   -5.256  -2.823  1.00 0.00 ? 17  LEU A CB   1  
ATOM   265   C CG   . LEU A 1 17  ? 5.534   -5.527  -1.455  1.00 0.00 ? 17  LEU A CG   1  
ATOM   266   C CD1  . LEU A 1 17  ? 5.666   -4.226  -0.686  1.00 0.00 ? 17  LEU A CD1  1  
ATOM   267   C CD2  . LEU A 1 17  ? 4.703   -6.518  -0.647  1.00 0.00 ? 17  LEU A CD2  1  
ATOM   268   H H    . LEU A 1 17  ? 7.215   -5.978  -3.583  1.00 0.00 ? 17  LEU A H    1  
ATOM   269   H HA   . LEU A 1 17  ? 4.710   -7.262  -3.568  1.00 0.00 ? 17  LEU A HA   1  
ATOM   270   H HB2  . LEU A 1 17  ? 5.278   -4.316  -3.188  1.00 0.00 ? 17  LEU A HB2  1  
ATOM   271   H HB3  . LEU A 1 17  ? 3.835   -5.158  -2.678  1.00 0.00 ? 17  LEU A HB3  1  
ATOM   272   H HG   . LEU A 1 17  ? 6.522   -5.942  -1.593  1.00 0.00 ? 17  LEU A HG   1  
ATOM   273   H HD11 . LEU A 1 17  ? 6.125   -3.484  -1.319  1.00 0.00 ? 17  LEU A HD11 1  
ATOM   274   H HD12 . LEU A 1 17  ? 6.279   -4.384  0.188   1.00 0.00 ? 17  LEU A HD12 1  
ATOM   275   H HD13 . LEU A 1 17  ? 4.686   -3.885  -0.383  1.00 0.00 ? 17  LEU A HD13 1  
ATOM   276   H HD21 . LEU A 1 17  ? 4.636   -7.459  -1.170  1.00 0.00 ? 17  LEU A HD21 1  
ATOM   277   H HD22 . LEU A 1 17  ? 3.712   -6.119  -0.500  1.00 0.00 ? 17  LEU A HD22 1  
ATOM   278   H HD23 . LEU A 1 17  ? 5.170   -6.676  0.314   1.00 0.00 ? 17  LEU A HD23 1  
ATOM   279   N N    . LEU A 1 18  ? 5.290   -5.364  -6.124  1.00 0.00 ? 18  LEU A N    1  
ATOM   280   C CA   . LEU A 1 18  ? 4.816   -4.944  -7.442  1.00 0.00 ? 18  LEU A CA   1  
ATOM   281   C C    . LEU A 1 18  ? 4.944   -6.057  -8.477  1.00 0.00 ? 18  LEU A C    1  
ATOM   282   O O    . LEU A 1 18  ? 4.364   -5.981  -9.561  1.00 0.00 ? 18  LEU A O    1  
ATOM   283   C CB   . LEU A 1 18  ? 5.606   -3.733  -7.922  1.00 0.00 ? 18  LEU A CB   1  
ATOM   284   C CG   . LEU A 1 18  ? 5.340   -2.440  -7.165  1.00 0.00 ? 18  LEU A CG   1  
ATOM   285   C CD1  . LEU A 1 18  ? 6.237   -1.341  -7.699  1.00 0.00 ? 18  LEU A CD1  1  
ATOM   286   C CD2  . LEU A 1 18  ? 3.880   -2.036  -7.271  1.00 0.00 ? 18  LEU A CD2  1  
ATOM   287   H H    . LEU A 1 18  ? 6.232   -5.228  -5.893  1.00 0.00 ? 18  LEU A H    1  
ATOM   288   H HA   . LEU A 1 18  ? 3.778   -4.669  -7.349  1.00 0.00 ? 18  LEU A HA   1  
ATOM   289   H HB2  . LEU A 1 18  ? 6.657   -3.965  -7.837  1.00 0.00 ? 18  LEU A HB2  1  
ATOM   290   H HB3  . LEU A 1 18  ? 5.377   -3.571  -8.960  1.00 0.00 ? 18  LEU A HB3  1  
ATOM   291   H HG   . LEU A 1 18  ? 5.574   -2.586  -6.120  1.00 0.00 ? 18  LEU A HG   1  
ATOM   292   H HD11 . LEU A 1 18  ? 7.255   -1.537  -7.393  1.00 0.00 ? 18  LEU A HD11 1  
ATOM   293   H HD12 . LEU A 1 18  ? 5.917   -0.388  -7.302  1.00 0.00 ? 18  LEU A HD12 1  
ATOM   294   H HD13 . LEU A 1 18  ? 6.182   -1.320  -8.776  1.00 0.00 ? 18  LEU A HD13 1  
ATOM   295   H HD21 . LEU A 1 18  ? 3.596   -1.513  -6.374  1.00 0.00 ? 18  LEU A HD21 1  
ATOM   296   H HD22 . LEU A 1 18  ? 3.264   -2.913  -7.387  1.00 0.00 ? 18  LEU A HD22 1  
ATOM   297   H HD23 . LEU A 1 18  ? 3.747   -1.386  -8.123  1.00 0.00 ? 18  LEU A HD23 1  
ATOM   298   N N    . SER A 1 19  ? 5.719   -7.074  -8.153  1.00 0.00 ? 19  SER A N    1  
ATOM   299   C CA   . SER A 1 19  ? 5.916   -8.201  -9.053  1.00 0.00 ? 19  SER A CA   1  
ATOM   300   C C    . SER A 1 19  ? 4.630   -9.018  -9.181  1.00 0.00 ? 19  SER A C    1  
ATOM   301   O O    . SER A 1 19  ? 3.863   -9.151  -8.221  1.00 0.00 ? 19  SER A O    1  
ATOM   302   C CB   . SER A 1 19  ? 7.055   -9.084  -8.540  1.00 0.00 ? 19  SER A CB   1  
ATOM   303   O OG   . SER A 1 19  ? 8.267   -8.353  -8.437  1.00 0.00 ? 19  SER A OG   1  
ATOM   304   H H    . SER A 1 19  ? 6.169   -7.068  -7.283  1.00 0.00 ? 19  SER A H    1  
ATOM   305   H HA   . SER A 1 19  ? 6.181   -7.810  -10.024 1.00 0.00 ? 19  SER A HA   1  
ATOM   306   H HB2  . SER A 1 19  ? 6.797   -9.467  -7.564  1.00 0.00 ? 19  SER A HB2  1  
ATOM   307   H HB3  . SER A 1 19  ? 7.202   -9.908  -9.221  1.00 0.00 ? 19  SER A HB3  1  
ATOM   308   H HG   . SER A 1 19  ? 8.071   -7.439  -8.180  1.00 0.00 ? 19  SER A HG   1  
ATOM   309   N N    . LYS A 1 20  ? 4.419   -9.574  -10.379 1.00 0.00 ? 20  LYS A N    1  
ATOM   310   C CA   . LYS A 1 20  ? 3.213   -10.341 -10.703 1.00 0.00 ? 20  LYS A CA   1  
ATOM   311   C C    . LYS A 1 20  ? 3.016   -11.506 -9.733  1.00 0.00 ? 20  LYS A C    1  
ATOM   312   O O    . LYS A 1 20  ? 1.914   -12.042 -9.607  1.00 0.00 ? 20  LYS A O    1  
ATOM   313   C CB   . LYS A 1 20  ? 3.286   -10.857 -12.141 1.00 0.00 ? 20  LYS A CB   1  
ATOM   314   C CG   . LYS A 1 20  ? 1.946   -11.352 -12.660 1.00 0.00 ? 20  LYS A CG   1  
ATOM   315   C CD   . LYS A 1 20  ? 0.993   -10.201 -12.960 1.00 0.00 ? 20  LYS A CD   1  
ATOM   316   C CE   . LYS A 1 20  ? -0.349  -10.704 -13.475 1.00 0.00 ? 20  LYS A CE   1  
ATOM   317   N NZ   . LYS A 1 20  ? -1.298  -9.590  -13.749 1.00 0.00 ? 20  LYS A NZ   1  
ATOM   318   H H    . LYS A 1 20  ? 5.102   -9.461  -11.074 1.00 0.00 ? 20  LYS A H    1  
ATOM   319   H HA   . LYS A 1 20  ? 2.365   -9.685  -10.619 1.00 0.00 ? 20  LYS A HA   1  
ATOM   320   H HB2  . LYS A 1 20  ? 3.625   -10.056 -12.782 1.00 0.00 ? 20  LYS A HB2  1  
ATOM   321   H HB3  . LYS A 1 20  ? 3.995   -11.673 -12.189 1.00 0.00 ? 20  LYS A HB3  1  
ATOM   322   H HG2  . LYS A 1 20  ? 2.103   -11.926 -13.560 1.00 0.00 ? 20  LYS A HG2  1  
ATOM   323   H HG3  . LYS A 1 20  ? 1.504   -11.975 -11.900 1.00 0.00 ? 20  LYS A HG3  1  
ATOM   324   H HD2  . LYS A 1 20  ? 0.829   -9.637  -12.054 1.00 0.00 ? 20  LYS A HD2  1  
ATOM   325   H HD3  . LYS A 1 20  ? 1.439   -9.563  -13.708 1.00 0.00 ? 20  LYS A HD3  1  
ATOM   326   H HE2  . LYS A 1 20  ? -0.185  -11.256 -14.389 1.00 0.00 ? 20  LYS A HE2  1  
ATOM   327   H HE3  . LYS A 1 20  ? -0.785  -11.360 -12.734 1.00 0.00 ? 20  LYS A HE3  1  
ATOM   328   H HZ1  . LYS A 1 20  ? -0.891  -8.932  -14.440 1.00 0.00 ? 20  LYS A HZ1  1  
ATOM   329   H HZ2  . LYS A 1 20  ? -1.504  -9.070  -12.874 1.00 0.00 ? 20  LYS A HZ2  1  
ATOM   330   H HZ3  . LYS A 1 20  ? -2.193  -9.966  -14.131 1.00 0.00 ? 20  LYS A HZ3  1  
ATOM   331   N N    . LYS A 1 21  ? 4.094   -11.884 -9.058  1.00 0.00 ? 21  LYS A N    1  
ATOM   332   C CA   . LYS A 1 21  ? 4.052   -12.882 -7.997  1.00 0.00 ? 21  LYS A CA   1  
ATOM   333   C C    . LYS A 1 21  ? 3.009   -12.527 -6.935  1.00 0.00 ? 21  LYS A C    1  
ATOM   334   O O    . LYS A 1 21  ? 2.302   -13.400 -6.428  1.00 0.00 ? 21  LYS A O    1  
ATOM   335   C CB   . LYS A 1 21  ? 5.436   -12.992 -7.349  1.00 0.00 ? 21  LYS A CB   1  
ATOM   336   C CG   . LYS A 1 21  ? 5.462   -13.834 -6.086  1.00 0.00 ? 21  LYS A CG   1  
ATOM   337   C CD   . LYS A 1 21  ? 6.853   -13.927 -5.505  1.00 0.00 ? 21  LYS A CD   1  
ATOM   338   C CE   . LYS A 1 21  ? 6.934   -15.077 -4.526  1.00 0.00 ? 21  LYS A CE   1  
ATOM   339   N NZ   . LYS A 1 21  ? 6.879   -16.396 -5.211  1.00 0.00 ? 21  LYS A NZ   1  
ATOM   340   H H    . LYS A 1 21  ? 4.958   -11.487 -9.298  1.00 0.00 ? 21  LYS A H    1  
ATOM   341   H HA   . LYS A 1 21  ? 3.795   -13.831 -8.440  1.00 0.00 ? 21  LYS A HA   1  
ATOM   342   H HB2  . LYS A 1 21  ? 6.118   -13.428 -8.058  1.00 0.00 ? 21  LYS A HB2  1  
ATOM   343   H HB3  . LYS A 1 21  ? 5.782   -12.002 -7.100  1.00 0.00 ? 21  LYS A HB3  1  
ATOM   344   H HG2  . LYS A 1 21  ? 4.813   -13.379 -5.353  1.00 0.00 ? 21  LYS A HG2  1  
ATOM   345   H HG3  . LYS A 1 21  ? 5.111   -14.828 -6.304  1.00 0.00 ? 21  LYS A HG3  1  
ATOM   346   H HD2  . LYS A 1 21  ? 7.563   -14.088 -6.303  1.00 0.00 ? 21  LYS A HD2  1  
ATOM   347   H HD3  . LYS A 1 21  ? 7.082   -13.007 -4.990  1.00 0.00 ? 21  LYS A HD3  1  
ATOM   348   H HE2  . LYS A 1 21  ? 7.852   -15.003 -3.966  1.00 0.00 ? 21  LYS A HE2  1  
ATOM   349   H HE3  . LYS A 1 21  ? 6.092   -15.002 -3.859  1.00 0.00 ? 21  LYS A HE3  1  
ATOM   350   H HZ1  . LYS A 1 21  ? 7.660   -16.479 -5.894  1.00 0.00 ? 21  LYS A HZ1  1  
ATOM   351   H HZ2  . LYS A 1 21  ? 5.977   -16.500 -5.718  1.00 0.00 ? 21  LYS A HZ2  1  
ATOM   352   H HZ3  . LYS A 1 21  ? 6.961   -17.164 -4.512  1.00 0.00 ? 21  LYS A HZ3  1  
ATOM   353   N N    . HIS A 1 22  ? 2.908   -11.245 -6.606  1.00 0.00 ? 22  HIS A N    1  
ATOM   354   C CA   . HIS A 1 22  ? 1.995   -10.807 -5.558  1.00 0.00 ? 22  HIS A CA   1  
ATOM   355   C C    . HIS A 1 22  ? 0.800   -10.083 -6.154  1.00 0.00 ? 22  HIS A C    1  
ATOM   356   O O    . HIS A 1 22  ? -0.210  -9.910  -5.482  1.00 0.00 ? 22  HIS A O    1  
ATOM   357   C CB   . HIS A 1 22  ? 2.710   -9.892  -4.546  1.00 0.00 ? 22  HIS A CB   1  
ATOM   358   C CG   . HIS A 1 22  ? 3.793   -10.579 -3.765  1.00 0.00 ? 22  HIS A CG   1  
ATOM   359   N ND1  . HIS A 1 22  ? 3.540   -11.430 -2.706  1.00 0.00 ? 22  HIS A ND1  1  
ATOM   360   C CD2  . HIS A 1 22  ? 5.140   -10.527 -3.883  1.00 0.00 ? 22  HIS A CD2  1  
ATOM   361   C CE1  . HIS A 1 22  ? 4.679   -11.866 -2.207  1.00 0.00 ? 22  HIS A CE1  1  
ATOM   362   N NE2  . HIS A 1 22  ? 5.671   -11.333 -2.898  1.00 0.00 ? 22  HIS A NE2  1  
ATOM   363   H H    . HIS A 1 22  ? 3.443   -10.575 -7.095  1.00 0.00 ? 22  HIS A H    1  
ATOM   364   H HA   . HIS A 1 22  ? 1.638   -11.690 -5.044  1.00 0.00 ? 22  HIS A HA   1  
ATOM   365   H HB2  . HIS A 1 22  ? 3.159   -9.058  -5.081  1.00 0.00 ? 22  HIS A HB2  1  
ATOM   366   H HB3  . HIS A 1 22  ? 1.986   -9.507  -3.836  1.00 0.00 ? 22  HIS A HB3  1  
ATOM   367   H HD1  . HIS A 1 22  ? 2.652   -11.684 -2.367  1.00 0.00 ? 22  HIS A HD1  1  
ATOM   368   H HD2  . HIS A 1 22  ? 5.698   -9.966  -4.631  1.00 0.00 ? 22  HIS A HD2  1  
ATOM   369   H HE1  . HIS A 1 22  ? 4.784   -12.554 -1.371  1.00 0.00 ? 22  HIS A HE1  1  
ATOM   370   H HE2  . HIS A 1 22  ? 6.604   -11.268 -2.563  1.00 0.00 ? 22  HIS A HE2  1  
ATOM   371   N N    . ALA A 1 23  ? 0.916   -9.699  -7.424  1.00 0.00 ? 23  ALA A N    1  
ATOM   372   C CA   . ALA A 1 23  ? -0.103  -8.904  -8.120  1.00 0.00 ? 23  ALA A CA   1  
ATOM   373   C C    . ALA A 1 23  ? -1.516  -9.439  -7.920  1.00 0.00 ? 23  ALA A C    1  
ATOM   374   O O    . ALA A 1 23  ? -2.467  -8.666  -7.820  1.00 0.00 ? 23  ALA A O    1  
ATOM   375   C CB   . ALA A 1 23  ? 0.221   -8.847  -9.598  1.00 0.00 ? 23  ALA A CB   1  
ATOM   376   H H    . ALA A 1 23  ? 1.727   -9.948  -7.915  1.00 0.00 ? 23  ALA A H    1  
ATOM   377   H HA   . ALA A 1 23  ? -0.056  -7.898  -7.734  1.00 0.00 ? 23  ALA A HA   1  
ATOM   378   H HB1  . ALA A 1 23  ? 1.238   -8.510  -9.723  1.00 0.00 ? 23  ALA A HB1  1  
ATOM   379   H HB2  . ALA A 1 23  ? -0.451  -8.158  -10.089 1.00 0.00 ? 23  ALA A HB2  1  
ATOM   380   H HB3  . ALA A 1 23  ? 0.110   -9.830  -10.031 1.00 0.00 ? 23  ALA A HB3  1  
ATOM   381   N N    . ALA A 1 24  ? -1.638  -10.760 -7.840  1.00 0.00 ? 24  ALA A N    1  
ATOM   382   C CA   . ALA A 1 24  ? -2.928  -11.422 -7.660  1.00 0.00 ? 24  ALA A CA   1  
ATOM   383   C C    . ALA A 1 24  ? -3.665  -10.915 -6.415  1.00 0.00 ? 24  ALA A C    1  
ATOM   384   O O    . ALA A 1 24  ? -4.888  -11.032 -6.314  1.00 0.00 ? 24  ALA A O    1  
ATOM   385   C CB   . ALA A 1 24  ? -2.708  -12.922 -7.568  1.00 0.00 ? 24  ALA A CB   1  
ATOM   386   H H    . ALA A 1 24  ? -0.831  -11.310 -7.905  1.00 0.00 ? 24  ALA A H    1  
ATOM   387   H HA   . ALA A 1 24  ? -3.533  -11.224 -8.532  1.00 0.00 ? 24  ALA A HA   1  
ATOM   388   H HB1  . ALA A 1 24  ? -1.880  -13.119 -6.902  1.00 0.00 ? 24  ALA A HB1  1  
ATOM   389   H HB2  . ALA A 1 24  ? -2.484  -13.315 -8.550  1.00 0.00 ? 24  ALA A HB2  1  
ATOM   390   H HB3  . ALA A 1 24  ? -3.599  -13.395 -7.185  1.00 0.00 ? 24  ALA A HB3  1  
ATOM   391   N N    . TYR A 1 25  ? -2.917  -10.360 -5.471  1.00 0.00 ? 25  TYR A N    1  
ATOM   392   C CA   . TYR A 1 25  ? -3.490  -9.807  -4.251  1.00 0.00 ? 25  TYR A CA   1  
ATOM   393   C C    . TYR A 1 25  ? -2.758  -8.526  -3.842  1.00 0.00 ? 25  TYR A C    1  
ATOM   394   O O    . TYR A 1 25  ? -2.855  -8.078  -2.701  1.00 0.00 ? 25  TYR A O    1  
ATOM   395   C CB   . TYR A 1 25  ? -3.453  -10.855 -3.126  1.00 0.00 ? 25  TYR A CB   1  
ATOM   396   C CG   . TYR A 1 25  ? -2.162  -11.639 -3.046  1.00 0.00 ? 25  TYR A CG   1  
ATOM   397   C CD1  . TYR A 1 25  ? -1.017  -11.082 -2.504  1.00 0.00 ? 25  TYR A CD1  1  
ATOM   398   C CD2  . TYR A 1 25  ? -2.098  -12.948 -3.508  1.00 0.00 ? 25  TYR A CD2  1  
ATOM   399   C CE1  . TYR A 1 25  ? 0.157   -11.803 -2.431  1.00 0.00 ? 25  TYR A CE1  1  
ATOM   400   C CE2  . TYR A 1 25  ? -0.927  -13.674 -3.438  1.00 0.00 ? 25  TYR A CE2  1  
ATOM   401   C CZ   . TYR A 1 25  ? 0.198   -13.097 -2.901  1.00 0.00 ? 25  TYR A CZ   1  
ATOM   402   O OH   . TYR A 1 25  ? 1.370   -13.814 -2.832  1.00 0.00 ? 25  TYR A OH   1  
ATOM   403   H H    . TYR A 1 25  ? -1.942  -10.321 -5.598  1.00 0.00 ? 25  TYR A H    1  
ATOM   404   H HA   . TYR A 1 25  ? -4.522  -9.558  -4.455  1.00 0.00 ? 25  TYR A HA   1  
ATOM   405   H HB2  . TYR A 1 25  ? -3.598  -10.363 -2.176  1.00 0.00 ? 25  TYR A HB2  1  
ATOM   406   H HB3  . TYR A 1 25  ? -4.253  -11.563 -3.286  1.00 0.00 ? 25  TYR A HB3  1  
ATOM   407   H HD1  . TYR A 1 25  ? -1.047  -10.064 -2.143  1.00 0.00 ? 25  TYR A HD1  1  
ATOM   408   H HD2  . TYR A 1 25  ? -2.984  -13.399 -3.926  1.00 0.00 ? 25  TYR A HD2  1  
ATOM   409   H HE1  . TYR A 1 25  ? 1.035   -11.356 -1.998  1.00 0.00 ? 25  TYR A HE1  1  
ATOM   410   H HE2  . TYR A 1 25  ? -0.897  -14.690 -3.803  1.00 0.00 ? 25  TYR A HE2  1  
ATOM   411   H HH   . TYR A 1 25  ? 1.442   -14.389 -3.605  1.00 0.00 ? 25  TYR A HH   1  
ATOM   412   N N    . ALA A 1 26  ? -2.031  -7.939  -4.793  1.00 0.00 ? 26  ALA A N    1  
ATOM   413   C CA   . ALA A 1 26  ? -1.288  -6.704  -4.549  1.00 0.00 ? 26  ALA A CA   1  
ATOM   414   C C    . ALA A 1 26  ? -1.826  -5.556  -5.402  1.00 0.00 ? 26  ALA A C    1  
ATOM   415   O O    . ALA A 1 26  ? -1.525  -4.383  -5.147  1.00 0.00 ? 26  ALA A O    1  
ATOM   416   C CB   . ALA A 1 26  ? 0.199   -6.902  -4.836  1.00 0.00 ? 26  ALA A CB   1  
ATOM   417   H H    . ALA A 1 26  ? -1.984  -8.354  -5.678  1.00 0.00 ? 26  ALA A H    1  
ATOM   418   H HA   . ALA A 1 26  ? -1.399  -6.448  -3.505  1.00 0.00 ? 26  ALA A HA   1  
ATOM   419   H HB1  . ALA A 1 26  ? 0.602   -7.682  -4.202  1.00 0.00 ? 26  ALA A HB1  1  
ATOM   420   H HB2  . ALA A 1 26  ? 0.726   -5.979  -4.643  1.00 0.00 ? 26  ALA A HB2  1  
ATOM   421   H HB3  . ALA A 1 26  ? 0.329   -7.179  -5.871  1.00 0.00 ? 26  ALA A HB3  1  
ATOM   422   N N    . TRP A 1 27  ? -2.638  -5.887  -6.407  1.00 0.00 ? 27  TRP A N    1  
ATOM   423   C CA   . TRP A 1 27  ? -3.145  -4.878  -7.334  1.00 0.00 ? 27  TRP A CA   1  
ATOM   424   C C    . TRP A 1 27  ? -3.902  -3.721  -6.637  1.00 0.00 ? 27  TRP A C    1  
ATOM   425   O O    . TRP A 1 27  ? -3.821  -2.590  -7.119  1.00 0.00 ? 27  TRP A O    1  
ATOM   426   C CB   . TRP A 1 27  ? -4.014  -5.507  -8.441  1.00 0.00 ? 27  TRP A CB   1  
ATOM   427   C CG   . TRP A 1 27  ? -5.241  -6.229  -7.958  1.00 0.00 ? 27  TRP A CG   1  
ATOM   428   C CD1  . TRP A 1 27  ? -5.339  -7.555  -7.652  1.00 0.00 ? 27  TRP A CD1  1  
ATOM   429   C CD2  . TRP A 1 27  ? -6.548  -5.670  -7.741  1.00 0.00 ? 27  TRP A CD2  1  
ATOM   430   N NE1  . TRP A 1 27  ? -6.617  -7.855  -7.251  1.00 0.00 ? 27  TRP A NE1  1  
ATOM   431   C CE2  . TRP A 1 27  ? -7.378  -6.716  -7.297  1.00 0.00 ? 27  TRP A CE2  1  
ATOM   432   C CE3  . TRP A 1 27  ? -7.097  -4.387  -7.872  1.00 0.00 ? 27  TRP A CE3  1  
ATOM   433   C CZ2  . TRP A 1 27  ? -8.721  -6.523  -6.990  1.00 0.00 ? 27  TRP A CZ2  1  
ATOM   434   C CZ3  . TRP A 1 27  ? -8.430  -4.200  -7.565  1.00 0.00 ? 27  TRP A CZ3  1  
ATOM   435   C CH2  . TRP A 1 27  ? -9.229  -5.261  -7.129  1.00 0.00 ? 27  TRP A CH2  1  
ATOM   436   H H    . TRP A 1 27  ? -2.894  -6.825  -6.534  1.00 0.00 ? 27  TRP A H    1  
ATOM   437   H HA   . TRP A 1 27  ? -2.269  -4.449  -7.808  1.00 0.00 ? 27  TRP A HA   1  
ATOM   438   H HB2  . TRP A 1 27  ? -4.338  -4.727  -9.112  1.00 0.00 ? 27  TRP A HB2  1  
ATOM   439   H HB3  . TRP A 1 27  ? -3.411  -6.214  -8.993  1.00 0.00 ? 27  TRP A HB3  1  
ATOM   440   H HD1  . TRP A 1 27  ? -4.521  -8.256  -7.716  1.00 0.00 ? 27  TRP A HD1  1  
ATOM   441   H HE1  . TRP A 1 27  ? -6.934  -8.743  -6.973  1.00 0.00 ? 27  TRP A HE1  1  
ATOM   442   H HE3  . TRP A 1 27  ? -6.497  -3.551  -8.198  1.00 0.00 ? 27  TRP A HE3  1  
ATOM   443   H HZ2  . TRP A 1 27  ? -9.352  -7.331  -6.652  1.00 0.00 ? 27  TRP A HZ2  1  
ATOM   444   H HZ3  . TRP A 1 27  ? -8.871  -3.218  -7.663  1.00 0.00 ? 27  TRP A HZ3  1  
ATOM   445   H HH2  . TRP A 1 27  ? -10.267 -5.068  -6.902  1.00 0.00 ? 27  TRP A HH2  1  
ATOM   446   N N    . PRO A 1 28  ? -4.651  -3.950  -5.511  1.00 0.00 ? 28  PRO A N    1  
ATOM   447   C CA   . PRO A 1 28  ? -5.319  -2.855  -4.788  1.00 0.00 ? 28  PRO A CA   1  
ATOM   448   C C    . PRO A 1 28  ? -4.364  -1.731  -4.392  1.00 0.00 ? 28  PRO A C    1  
ATOM   449   O O    . PRO A 1 28  ? -4.790  -0.600  -4.161  1.00 0.00 ? 28  PRO A O    1  
ATOM   450   C CB   . PRO A 1 28  ? -5.874  -3.498  -3.506  1.00 0.00 ? 28  PRO A CB   1  
ATOM   451   C CG   . PRO A 1 28  ? -5.421  -4.921  -3.504  1.00 0.00 ? 28  PRO A CG   1  
ATOM   452   C CD   . PRO A 1 28  ? -4.958  -5.258  -4.898  1.00 0.00 ? 28  PRO A CD   1  
ATOM   453   H HA   . PRO A 1 28  ? -6.133  -2.442  -5.365  1.00 0.00 ? 28  PRO A HA   1  
ATOM   454   H HB2  . PRO A 1 28  ? -5.476  -2.968  -2.651  1.00 0.00 ? 28  PRO A HB2  1  
ATOM   455   H HB3  . PRO A 1 28  ? -6.954  -3.425  -3.494  1.00 0.00 ? 28  PRO A HB3  1  
ATOM   456   H HG2  . PRO A 1 28  ? -4.607  -5.040  -2.801  1.00 0.00 ? 28  PRO A HG2  1  
ATOM   457   H HG3  . PRO A 1 28  ? -6.247  -5.561  -3.223  1.00 0.00 ? 28  PRO A HG3  1  
ATOM   458   H HD2  . PRO A 1 28  ? -4.075  -5.878  -4.864  1.00 0.00 ? 28  PRO A HD2  1  
ATOM   459   H HD3  . PRO A 1 28  ? -5.742  -5.764  -5.448  1.00 0.00 ? 28  PRO A HD3  1  
ATOM   460   N N    . PHE A 1 29  ? -3.079  -2.044  -4.315  1.00 0.00 ? 29  PHE A N    1  
ATOM   461   C CA   . PHE A 1 29  ? -2.102  -1.095  -3.787  1.00 0.00 ? 29  PHE A CA   1  
ATOM   462   C C    . PHE A 1 29  ? -1.152  -0.593  -4.868  1.00 0.00 ? 29  PHE A C    1  
ATOM   463   O O    . PHE A 1 29  ? -0.345  0.304   -4.616  1.00 0.00 ? 29  PHE A O    1  
ATOM   464   C CB   . PHE A 1 29  ? -1.286  -1.730  -2.664  1.00 0.00 ? 29  PHE A CB   1  
ATOM   465   C CG   . PHE A 1 29  ? -2.048  -2.740  -1.856  1.00 0.00 ? 29  PHE A CG   1  
ATOM   466   C CD1  . PHE A 1 29  ? -1.726  -4.083  -1.937  1.00 0.00 ? 29  PHE A CD1  1  
ATOM   467   C CD2  . PHE A 1 29  ? -3.087  -2.351  -1.026  1.00 0.00 ? 29  PHE A CD2  1  
ATOM   468   C CE1  . PHE A 1 29  ? -2.424  -5.020  -1.208  1.00 0.00 ? 29  PHE A CE1  1  
ATOM   469   C CE2  . PHE A 1 29  ? -3.788  -3.287  -0.292  1.00 0.00 ? 29  PHE A CE2  1  
ATOM   470   C CZ   . PHE A 1 29  ? -3.455  -4.623  -0.385  1.00 0.00 ? 29  PHE A CZ   1  
ATOM   471   H H    . PHE A 1 29  ? -2.785  -2.932  -4.620  1.00 0.00 ? 29  PHE A H    1  
ATOM   472   H HA   . PHE A 1 29  ? -2.646  -0.252  -3.389  1.00 0.00 ? 29  PHE A HA   1  
ATOM   473   H HB2  . PHE A 1 29  ? -0.425  -2.224  -3.088  1.00 0.00 ? 29  PHE A HB2  1  
ATOM   474   H HB3  . PHE A 1 29  ? -0.952  -0.947  -1.992  1.00 0.00 ? 29  PHE A HB3  1  
ATOM   475   H HD1  . PHE A 1 29  ? -0.917  -4.400  -2.581  1.00 0.00 ? 29  PHE A HD1  1  
ATOM   476   H HD2  . PHE A 1 29  ? -3.346  -1.306  -0.953  1.00 0.00 ? 29  PHE A HD2  1  
ATOM   477   H HE1  . PHE A 1 29  ? -2.159  -6.065  -1.280  1.00 0.00 ? 29  PHE A HE1  1  
ATOM   478   H HE2  . PHE A 1 29  ? -4.596  -2.976  0.351   1.00 0.00 ? 29  PHE A HE2  1  
ATOM   479   H HZ   . PHE A 1 29  ? -4.002  -5.357  0.183   1.00 0.00 ? 29  PHE A HZ   1  
ATOM   480   N N    . TYR A 1 30  ? -1.221  -1.193  -6.052  1.00 0.00 ? 30  TYR A N    1  
ATOM   481   C CA   . TYR A 1 30  ? -0.412  -0.737  -7.180  1.00 0.00 ? 30  TYR A CA   1  
ATOM   482   C C    . TYR A 1 30  ? -0.654  0.745   -7.451  1.00 0.00 ? 30  TYR A C    1  
ATOM   483   O O    . TYR A 1 30  ? 0.284   1.537   -7.467  1.00 0.00 ? 30  TYR A O    1  
ATOM   484   C CB   . TYR A 1 30  ? -0.715  -1.561  -8.439  1.00 0.00 ? 30  TYR A CB   1  
ATOM   485   C CG   . TYR A 1 30  ? -0.004  -2.894  -8.486  1.00 0.00 ? 30  TYR A CG   1  
ATOM   486   C CD1  . TYR A 1 30  ? 0.390   -3.522  -7.320  1.00 0.00 ? 30  TYR A CD1  1  
ATOM   487   C CD2  . TYR A 1 30  ? 0.278   -3.521  -9.694  1.00 0.00 ? 30  TYR A CD2  1  
ATOM   488   C CE1  . TYR A 1 30  ? 1.041   -4.733  -7.345  1.00 0.00 ? 30  TYR A CE1  1  
ATOM   489   C CE2  . TYR A 1 30  ? 0.930   -4.738  -9.728  1.00 0.00 ? 30  TYR A CE2  1  
ATOM   490   C CZ   . TYR A 1 30  ? 1.308   -5.338  -8.547  1.00 0.00 ? 30  TYR A CZ   1  
ATOM   491   O OH   . TYR A 1 30  ? 1.956   -6.548  -8.568  1.00 0.00 ? 30  TYR A OH   1  
ATOM   492   H H    . TYR A 1 30  ? -1.816  -1.967  -6.165  1.00 0.00 ? 30  TYR A H    1  
ATOM   493   H HA   . TYR A 1 30  ? 0.629   -0.874  -6.915  1.00 0.00 ? 30  TYR A HA   1  
ATOM   494   H HB2  . TYR A 1 30  ? -1.773  -1.755  -8.483  1.00 0.00 ? 30  TYR A HB2  1  
ATOM   495   H HB3  . TYR A 1 30  ? -0.421  -0.996  -9.310  1.00 0.00 ? 30  TYR A HB3  1  
ATOM   496   H HD1  . TYR A 1 30  ? 0.171   -3.051  -6.378  1.00 0.00 ? 30  TYR A HD1  1  
ATOM   497   H HD2  . TYR A 1 30  ? -0.021  -3.047  -10.617 1.00 0.00 ? 30  TYR A HD2  1  
ATOM   498   H HE1  . TYR A 1 30  ? 1.341   -5.201  -6.420  1.00 0.00 ? 30  TYR A HE1  1  
ATOM   499   H HE2  . TYR A 1 30  ? 1.140   -5.212  -10.675 1.00 0.00 ? 30  TYR A HE2  1  
ATOM   500   H HH   . TYR A 1 30  ? 2.728   -6.487  -9.145  1.00 0.00 ? 30  TYR A HH   1  
ATOM   501   N N    . LYS A 1 31  ? -1.912  1.111   -7.648  1.00 0.00 ? 31  LYS A N    1  
ATOM   502   C CA   . LYS A 1 31  ? -2.285  2.494   -7.908  1.00 0.00 ? 31  LYS A CA   1  
ATOM   503   C C    . LYS A 1 31  ? -3.479  2.887   -7.047  1.00 0.00 ? 31  LYS A C    1  
ATOM   504   O O    . LYS A 1 31  ? -4.206  2.017   -6.566  1.00 0.00 ? 31  LYS A O    1  
ATOM   505   C CB   . LYS A 1 31  ? -2.627  2.666   -9.389  1.00 0.00 ? 31  LYS A CB   1  
ATOM   506   C CG   . LYS A 1 31  ? -1.414  2.608   -10.301 1.00 0.00 ? 31  LYS A CG   1  
ATOM   507   C CD   . LYS A 1 31  ? -1.808  2.629   -11.769 1.00 0.00 ? 31  LYS A CD   1  
ATOM   508   C CE   . LYS A 1 31  ? -2.709  1.454   -12.131 1.00 0.00 ? 31  LYS A CE   1  
ATOM   509   N NZ   . LYS A 1 31  ? -2.106  0.149   -11.747 1.00 0.00 ? 31  LYS A NZ   1  
ATOM   510   H H    . LYS A 1 31  ? -2.618  0.432   -7.614  1.00 0.00 ? 31  LYS A H    1  
ATOM   511   H HA   . LYS A 1 31  ? -1.445  3.124   -7.660  1.00 0.00 ? 31  LYS A HA   1  
ATOM   512   H HB2  . LYS A 1 31  ? -3.304  1.876   -9.676  1.00 0.00 ? 31  LYS A HB2  1  
ATOM   513   H HB3  . LYS A 1 31  ? -3.117  3.618   -9.530  1.00 0.00 ? 31  LYS A HB3  1  
ATOM   514   H HG2  . LYS A 1 31  ? -0.785  3.461   -10.098 1.00 0.00 ? 31  LYS A HG2  1  
ATOM   515   H HG3  . LYS A 1 31  ? -0.868  1.702   -10.096 1.00 0.00 ? 31  LYS A HG3  1  
ATOM   516   H HD2  . LYS A 1 31  ? -2.332  3.549   -11.975 1.00 0.00 ? 31  LYS A HD2  1  
ATOM   517   H HD3  . LYS A 1 31  ? -0.912  2.582   -12.370 1.00 0.00 ? 31  LYS A HD3  1  
ATOM   518   H HE2  . LYS A 1 31  ? -3.653  1.569   -11.621 1.00 0.00 ? 31  LYS A HE2  1  
ATOM   519   H HE3  . LYS A 1 31  ? -2.877  1.463   -13.199 1.00 0.00 ? 31  LYS A HE3  1  
ATOM   520   H HZ1  . LYS A 1 31  ? -1.141  0.073   -12.129 1.00 0.00 ? 31  LYS A HZ1  1  
ATOM   521   H HZ2  . LYS A 1 31  ? -2.676  -0.633  -12.125 1.00 0.00 ? 31  LYS A HZ2  1  
ATOM   522   H HZ3  . LYS A 1 31  ? -2.068  0.061   -10.712 1.00 0.00 ? 31  LYS A HZ3  1  
ATOM   523   N N    . PRO A 1 32  ? -3.695  4.198   -6.833  1.00 0.00 ? 32  PRO A N    1  
ATOM   524   C CA   . PRO A 1 32  ? -4.832  4.692   -6.054  1.00 0.00 ? 32  PRO A CA   1  
ATOM   525   C C    . PRO A 1 32  ? -6.154  4.241   -6.658  1.00 0.00 ? 32  PRO A C    1  
ATOM   526   O O    . PRO A 1 32  ? -6.292  4.147   -7.882  1.00 0.00 ? 32  PRO A O    1  
ATOM   527   C CB   . PRO A 1 32  ? -4.699  6.220   -6.127  1.00 0.00 ? 32  PRO A CB   1  
ATOM   528   C CG   . PRO A 1 32  ? -3.784  6.477   -7.274  1.00 0.00 ? 32  PRO A CG   1  
ATOM   529   C CD   . PRO A 1 32  ? -2.856  5.301   -7.328  1.00 0.00 ? 32  PRO A CD   1  
ATOM   530   H HA   . PRO A 1 32  ? -4.777  4.366   -5.024  1.00 0.00 ? 32  PRO A HA   1  
ATOM   531   H HB2  . PRO A 1 32  ? -5.672  6.659   -6.294  1.00 0.00 ? 32  PRO A HB2  1  
ATOM   532   H HB3  . PRO A 1 32  ? -4.285  6.596   -5.203  1.00 0.00 ? 32  PRO A HB3  1  
ATOM   533   H HG2  . PRO A 1 32  ? -4.353  6.549   -8.188  1.00 0.00 ? 32  PRO A HG2  1  
ATOM   534   H HG3  . PRO A 1 32  ? -3.227  7.386   -7.104  1.00 0.00 ? 32  PRO A HG3  1  
ATOM   535   H HD2  . PRO A 1 32  ? -2.534  5.120   -8.342  1.00 0.00 ? 32  PRO A HD2  1  
ATOM   536   H HD3  . PRO A 1 32  ? -2.006  5.460   -6.682  1.00 0.00 ? 32  PRO A HD3  1  
ATOM   537   N N    . VAL A 1 33  ? -7.116  3.959   -5.792  1.00 0.00 ? 33  VAL A N    1  
ATOM   538   C CA   . VAL A 1 33  ? -8.404  3.427   -6.212  1.00 0.00 ? 33  VAL A CA   1  
ATOM   539   C C    . VAL A 1 33  ? -9.140  4.436   -7.088  1.00 0.00 ? 33  VAL A C    1  
ATOM   540   O O    . VAL A 1 33  ? -8.971  5.649   -6.932  1.00 0.00 ? 33  VAL A O    1  
ATOM   541   C CB   . VAL A 1 33  ? -9.276  3.040   -4.986  1.00 0.00 ? 33  VAL A CB   1  
ATOM   542   C CG1  . VAL A 1 33  ? -8.404  2.550   -3.846  1.00 0.00 ? 33  VAL A CG1  1  
ATOM   543   C CG2  . VAL A 1 33  ? -10.173 4.180   -4.524  1.00 0.00 ? 33  VAL A CG2  1  
ATOM   544   H H    . VAL A 1 33  ? -6.954  4.110   -4.839  1.00 0.00 ? 33  VAL A H    1  
ATOM   545   H HA   . VAL A 1 33  ? -8.220  2.533   -6.792  1.00 0.00 ? 33  VAL A HA   1  
ATOM   546   H HB   . VAL A 1 33  ? -9.912  2.220   -5.279  1.00 0.00 ? 33  VAL A HB   1  
ATOM   547   H HG11 . VAL A 1 33  ? -7.836  1.694   -4.170  1.00 0.00 ? 33  VAL A HG11 1  
ATOM   548   H HG12 . VAL A 1 33  ? -9.030  2.270   -3.011  1.00 0.00 ? 33  VAL A HG12 1  
ATOM   549   H HG13 . VAL A 1 33  ? -7.731  3.337   -3.541  1.00 0.00 ? 33  VAL A HG13 1  
ATOM   550   H HG21 . VAL A 1 33  ? -11.161 4.055   -4.948  1.00 0.00 ? 33  VAL A HG21 1  
ATOM   551   H HG22 . VAL A 1 33  ? -9.757  5.121   -4.854  1.00 0.00 ? 33  VAL A HG22 1  
ATOM   552   H HG23 . VAL A 1 33  ? -10.239 4.173   -3.446  1.00 0.00 ? 33  VAL A HG23 1  
ATOM   553   N N    . ASP A 1 34  ? -9.947  3.936   -8.011  1.00 0.00 ? 34  ASP A N    1  
ATOM   554   C CA   . ASP A 1 34  ? -10.707 4.802   -8.907  1.00 0.00 ? 34  ASP A CA   1  
ATOM   555   C C    . ASP A 1 34  ? -12.004 5.184   -8.222  1.00 0.00 ? 34  ASP A C    1  
ATOM   556   O O    . ASP A 1 34  ? -13.086 4.792   -8.649  1.00 0.00 ? 34  ASP A O    1  
ATOM   557   C CB   . ASP A 1 34  ? -10.993 4.107   -10.246 1.00 0.00 ? 34  ASP A CB   1  
ATOM   558   C CG   . ASP A 1 34  ? -9.729  3.640   -10.946 1.00 0.00 ? 34  ASP A CG   1  
ATOM   559   O OD1  . ASP A 1 34  ? -9.111  4.448   -11.671 1.00 0.00 ? 34  ASP A OD1  1  
ATOM   560   O OD2  . ASP A 1 34  ? -9.342  2.462   -10.772 1.00 0.00 ? 34  ASP A OD2  1  
ATOM   561   H H    . ASP A 1 34  ? -10.055 2.960   -8.077  1.00 0.00 ? 34  ASP A H    1  
ATOM   562   H HA   . ASP A 1 34  ? -10.126 5.695   -9.083  1.00 0.00 ? 34  ASP A HA   1  
ATOM   563   H HB2  . ASP A 1 34  ? -11.629 3.251   -10.077 1.00 0.00 ? 34  ASP A HB2  1  
ATOM   564   H HB3  . ASP A 1 34  ? -11.504 4.801   -10.897 1.00 0.00 ? 34  ASP A HB3  1  
ATOM   565   N N    . ALA A 1 35  ? -11.869 5.950   -7.147  1.00 0.00 ? 35  ALA A N    1  
ATOM   566   C CA   . ALA A 1 35  ? -12.960 6.205   -6.216  1.00 0.00 ? 35  ALA A CA   1  
ATOM   567   C C    . ALA A 1 35  ? -14.223 6.713   -6.901  1.00 0.00 ? 35  ALA A C    1  
ATOM   568   O O    . ALA A 1 35  ? -15.317 6.236   -6.609  1.00 0.00 ? 35  ALA A O    1  
ATOM   569   C CB   . ALA A 1 35  ? -12.508 7.173   -5.138  1.00 0.00 ? 35  ALA A CB   1  
ATOM   570   H H    . ALA A 1 35  ? -10.995 6.361   -6.973  1.00 0.00 ? 35  ALA A H    1  
ATOM   571   H HA   . ALA A 1 35  ? -13.192 5.268   -5.732  1.00 0.00 ? 35  ALA A HA   1  
ATOM   572   H HB1  . ALA A 1 35  ? -13.010 6.935   -4.209  1.00 0.00 ? 35  ALA A HB1  1  
ATOM   573   H HB2  . ALA A 1 35  ? -12.754 8.182   -5.434  1.00 0.00 ? 35  ALA A HB2  1  
ATOM   574   H HB3  . ALA A 1 35  ? -11.439 7.088   -5.002  1.00 0.00 ? 35  ALA A HB3  1  
ATOM   575   N N    . SER A 1 36  ? -14.073 7.658   -7.817  1.00 0.00 ? 36  SER A N    1  
ATOM   576   C CA   . SER A 1 36  ? -15.220 8.232   -8.509  1.00 0.00 ? 36  SER A CA   1  
ATOM   577   C C    . SER A 1 36  ? -15.983 7.152   -9.279  1.00 0.00 ? 36  SER A C    1  
ATOM   578   O O    . SER A 1 36  ? -17.213 7.075   -9.207  1.00 0.00 ? 36  SER A O    1  
ATOM   579   C CB   . SER A 1 36  ? -14.760 9.343   -9.452  1.00 0.00 ? 36  SER A CB   1  
ATOM   580   O OG   . SER A 1 36  ? -13.931 10.271  -8.769  1.00 0.00 ? 36  SER A OG   1  
ATOM   581   H H    . SER A 1 36  ? -13.171 7.976   -8.037  1.00 0.00 ? 36  SER A H    1  
ATOM   582   H HA   . SER A 1 36  ? -15.877 8.654   -7.763  1.00 0.00 ? 36  SER A HA   1  
ATOM   583   H HB2  . SER A 1 36  ? -14.202 8.913   -10.270 1.00 0.00 ? 36  SER A HB2  1  
ATOM   584   H HB3  . SER A 1 36  ? -15.623 9.866   -9.839  1.00 0.00 ? 36  SER A HB3  1  
ATOM   585   H HG   . SER A 1 36  ? -13.006 10.078  -8.969  1.00 0.00 ? 36  SER A HG   1  
ATOM   586   N N    . ALA A 1 37  ? -15.245 6.298   -9.985  1.00 0.00 ? 37  ALA A N    1  
ATOM   587   C CA   . ALA A 1 37  ? -15.841 5.208   -10.748 1.00 0.00 ? 37  ALA A CA   1  
ATOM   588   C C    . ALA A 1 37  ? -16.358 4.117   -9.816  1.00 0.00 ? 37  ALA A C    1  
ATOM   589   O O    . ALA A 1 37  ? -17.331 3.434   -10.122 1.00 0.00 ? 37  ALA A O    1  
ATOM   590   C CB   . ALA A 1 37  ? -14.824 4.631   -11.724 1.00 0.00 ? 37  ALA A CB   1  
ATOM   591   H H    . ALA A 1 37  ? -14.269 6.402   -9.993  1.00 0.00 ? 37  ALA A H    1  
ATOM   592   H HA   . ALA A 1 37  ? -16.668 5.607   -11.316 1.00 0.00 ? 37  ALA A HA   1  
ATOM   593   H HB1  . ALA A 1 37  ? -13.952 4.290   -11.180 1.00 0.00 ? 37  ALA A HB1  1  
ATOM   594   H HB2  . ALA A 1 37  ? -14.532 5.392   -12.432 1.00 0.00 ? 37  ALA A HB2  1  
ATOM   595   H HB3  . ALA A 1 37  ? -15.265 3.798   -12.253 1.00 0.00 ? 37  ALA A HB3  1  
ATOM   596   N N    . LEU A 1 38  ? -15.708 3.979   -8.669  1.00 0.00 ? 38  LEU A N    1  
ATOM   597   C CA   . LEU A 1 38  ? -16.070 2.969   -7.683  1.00 0.00 ? 38  LEU A CA   1  
ATOM   598   C C    . LEU A 1 38  ? -17.330 3.371   -6.917  1.00 0.00 ? 38  LEU A C    1  
ATOM   599   O O    . LEU A 1 38  ? -17.869 2.586   -6.136  1.00 0.00 ? 38  LEU A O    1  
ATOM   600   C CB   . LEU A 1 38  ? -14.901 2.758   -6.715  1.00 0.00 ? 38  LEU A CB   1  
ATOM   601   C CG   . LEU A 1 38  ? -13.707 1.989   -7.287  1.00 0.00 ? 38  LEU A CG   1  
ATOM   602   C CD1  . LEU A 1 38  ? -12.454 2.243   -6.461  1.00 0.00 ? 38  LEU A CD1  1  
ATOM   603   C CD2  . LEU A 1 38  ? -14.008 0.501   -7.335  1.00 0.00 ? 38  LEU A CD2  1  
ATOM   604   H H    . LEU A 1 38  ? -14.954 4.580   -8.476  1.00 0.00 ? 38  LEU A H    1  
ATOM   605   H HA   . LEU A 1 38  ? -16.261 2.045   -8.206  1.00 0.00 ? 38  LEU A HA   1  
ATOM   606   H HB2  . LEU A 1 38  ? -14.553 3.727   -6.393  1.00 0.00 ? 38  LEU A HB2  1  
ATOM   607   H HB3  . LEU A 1 38  ? -15.265 2.221   -5.853  1.00 0.00 ? 38  LEU A HB3  1  
ATOM   608   H HG   . LEU A 1 38  ? -13.518 2.327   -8.297  1.00 0.00 ? 38  LEU A HG   1  
ATOM   609   H HD11 . LEU A 1 38  ? -12.667 2.105   -5.411  1.00 0.00 ? 38  LEU A HD11 1  
ATOM   610   H HD12 . LEU A 1 38  ? -12.114 3.254   -6.628  1.00 0.00 ? 38  LEU A HD12 1  
ATOM   611   H HD13 . LEU A 1 38  ? -11.682 1.552   -6.762  1.00 0.00 ? 38  LEU A HD13 1  
ATOM   612   H HD21 . LEU A 1 38  ? -14.137 0.129   -6.327  1.00 0.00 ? 38  LEU A HD21 1  
ATOM   613   H HD22 . LEU A 1 38  ? -13.187 -0.017  -7.807  1.00 0.00 ? 38  LEU A HD22 1  
ATOM   614   H HD23 . LEU A 1 38  ? -14.912 0.333   -7.900  1.00 0.00 ? 38  LEU A HD23 1  
ATOM   615   N N    . GLY A 1 39  ? -17.795 4.596   -7.147  1.00 0.00 ? 39  GLY A N    1  
ATOM   616   C CA   . GLY A 1 39  ? -18.971 5.095   -6.454  1.00 0.00 ? 39  GLY A CA   1  
ATOM   617   C C    . GLY A 1 39  ? -18.611 5.708   -5.116  1.00 0.00 ? 39  GLY A C    1  
ATOM   618   O O    . GLY A 1 39  ? -19.476 6.135   -4.349  1.00 0.00 ? 39  GLY A O    1  
ATOM   619   H H    . GLY A 1 39  ? -17.333 5.167   -7.797  1.00 0.00 ? 39  GLY A H    1  
ATOM   620   H HA2  . GLY A 1 39  ? -19.454 5.841   -7.068  1.00 0.00 ? 39  GLY A HA2  1  
ATOM   621   H HA3  . GLY A 1 39  ? -19.654 4.274   -6.291  1.00 0.00 ? 39  GLY A HA3  1  
ATOM   622   N N    . LEU A 1 40  ? -17.318 5.762   -4.855  1.00 0.00 ? 40  LEU A N    1  
ATOM   623   C CA   . LEU A 1 40  ? -16.795 6.203   -3.581  1.00 0.00 ? 40  LEU A CA   1  
ATOM   624   C C    . LEU A 1 40  ? -16.482 7.693   -3.607  1.00 0.00 ? 40  LEU A C    1  
ATOM   625   O O    . LEU A 1 40  ? -15.320 8.096   -3.610  1.00 0.00 ? 40  LEU A O    1  
ATOM   626   C CB   . LEU A 1 40  ? -15.530 5.416   -3.260  1.00 0.00 ? 40  LEU A CB   1  
ATOM   627   C CG   . LEU A 1 40  ? -15.574 3.938   -3.649  1.00 0.00 ? 40  LEU A CG   1  
ATOM   628   C CD1  . LEU A 1 40  ? -14.298 3.243   -3.242  1.00 0.00 ? 40  LEU A CD1  1  
ATOM   629   C CD2  . LEU A 1 40  ? -16.789 3.244   -3.052  1.00 0.00 ? 40  LEU A CD2  1  
ATOM   630   H H    . LEU A 1 40  ? -16.686 5.488   -5.549  1.00 0.00 ? 40  LEU A H    1  
ATOM   631   H HA   . LEU A 1 40  ? -17.536 6.007   -2.827  1.00 0.00 ? 40  LEU A HA   1  
ATOM   632   H HB2  . LEU A 1 40  ? -14.700 5.882   -3.776  1.00 0.00 ? 40  LEU A HB2  1  
ATOM   633   H HB3  . LEU A 1 40  ? -15.355 5.479   -2.202  1.00 0.00 ? 40  LEU A HB3  1  
ATOM   634   H HG   . LEU A 1 40  ? -15.648 3.868   -4.722  1.00 0.00 ? 40  LEU A HG   1  
ATOM   635   H HD11 . LEU A 1 40  ? -13.473 3.695   -3.759  1.00 0.00 ? 40  LEU A HD11 1  
ATOM   636   H HD12 . LEU A 1 40  ? -14.359 2.202   -3.510  1.00 0.00 ? 40  LEU A HD12 1  
ATOM   637   H HD13 . LEU A 1 40  ? -14.155 3.337   -2.176  1.00 0.00 ? 40  LEU A HD13 1  
ATOM   638   H HD21 . LEU A 1 40  ? -16.864 3.487   -2.007  1.00 0.00 ? 40  LEU A HD21 1  
ATOM   639   H HD22 . LEU A 1 40  ? -16.686 2.176   -3.166  1.00 0.00 ? 40  LEU A HD22 1  
ATOM   640   H HD23 . LEU A 1 40  ? -17.680 3.576   -3.564  1.00 0.00 ? 40  LEU A HD23 1  
ATOM   641   N N    . HIS A 1 41  ? -17.523 8.506   -3.616  1.00 0.00 ? 41  HIS A N    1  
ATOM   642   C CA   . HIS A 1 41  ? -17.361 9.959   -3.631  1.00 0.00 ? 41  HIS A CA   1  
ATOM   643   C C    . HIS A 1 41  ? -17.039 10.513  -2.240  1.00 0.00 ? 41  HIS A C    1  
ATOM   644   O O    . HIS A 1 41  ? -17.019 11.724  -2.038  1.00 0.00 ? 41  HIS A O    1  
ATOM   645   C CB   . HIS A 1 41  ? -18.603 10.662  -4.219  1.00 0.00 ? 41  HIS A CB   1  
ATOM   646   C CG   . HIS A 1 41  ? -19.917 10.024  -3.876  1.00 0.00 ? 41  HIS A CG   1  
ATOM   647   N ND1  . HIS A 1 41  ? -20.743 9.473   -4.829  1.00 0.00 ? 41  HIS A ND1  1  
ATOM   648   C CD2  . HIS A 1 41  ? -20.565 9.880   -2.694  1.00 0.00 ? 41  HIS A CD2  1  
ATOM   649   C CE1  . HIS A 1 41  ? -21.840 9.023   -4.253  1.00 0.00 ? 41  HIS A CE1  1  
ATOM   650   N NE2  . HIS A 1 41  ? -21.760 9.257   -2.957  1.00 0.00 ? 41  HIS A NE2  1  
ATOM   651   H H    . HIS A 1 41  ? -18.425 8.121   -3.633  1.00 0.00 ? 41  HIS A H    1  
ATOM   652   H HA   . HIS A 1 41  ? -16.511 10.167  -4.275  1.00 0.00 ? 41  HIS A HA   1  
ATOM   653   H HB2  . HIS A 1 41  ? -18.638 11.680  -3.854  1.00 0.00 ? 41  HIS A HB2  1  
ATOM   654   H HB3  . HIS A 1 41  ? -18.515 10.679  -5.296  1.00 0.00 ? 41  HIS A HB3  1  
ATOM   655   H HD1  . HIS A 1 41  ? -20.554 9.425   -5.797  1.00 0.00 ? 41  HIS A HD1  1  
ATOM   656   H HD2  . HIS A 1 41  ? -20.202 10.180  -1.719  1.00 0.00 ? 41  HIS A HD2  1  
ATOM   657   H HE1  . HIS A 1 41  ? -22.669 8.553   -4.758  1.00 0.00 ? 41  HIS A HE1  1  
ATOM   658   H HE2  . HIS A 1 41  ? -22.526 9.237   -2.342  1.00 0.00 ? 41  HIS A HE2  1  
ATOM   659   N N    . ASP A 1 42  ? -16.800 9.624   -1.285  1.00 0.00 ? 42  ASP A N    1  
ATOM   660   C CA   . ASP A 1 42  ? -16.414 10.031  0.066   1.00 0.00 ? 42  ASP A CA   1  
ATOM   661   C C    . ASP A 1 42  ? -15.025 9.501   0.407   1.00 0.00 ? 42  ASP A C    1  
ATOM   662   O O    . ASP A 1 42  ? -14.663 9.368   1.574   1.00 0.00 ? 42  ASP A O    1  
ATOM   663   C CB   . ASP A 1 42  ? -17.431 9.536   1.098   1.00 0.00 ? 42  ASP A CB   1  
ATOM   664   C CG   . ASP A 1 42  ? -18.730 10.316  1.064   1.00 0.00 ? 42  ASP A CG   1  
ATOM   665   O OD1  . ASP A 1 42  ? -19.631 9.955   0.277   1.00 0.00 ? 42  ASP A OD1  1  
ATOM   666   O OD2  . ASP A 1 42  ? -18.858 11.302  1.823   1.00 0.00 ? 42  ASP A OD2  1  
ATOM   667   H H    . ASP A 1 42  ? -16.877 8.672   -1.492  1.00 0.00 ? 42  ASP A H    1  
ATOM   668   H HA   . ASP A 1 42  ? -16.391 11.105  0.091   1.00 0.00 ? 42  ASP A HA   1  
ATOM   669   H HB2  . ASP A 1 42  ? -17.652 8.502   0.900   1.00 0.00 ? 42  ASP A HB2  1  
ATOM   670   H HB3  . ASP A 1 42  ? -17.003 9.625   2.086   1.00 0.00 ? 42  ASP A HB3  1  
ATOM   671   N N    . TYR A 1 43  ? -14.241 9.222   -0.624  1.00 0.00 ? 43  TYR A N    1  
ATOM   672   C CA   . TYR A 1 43  ? -12.938 8.591   -0.455  1.00 0.00 ? 43  TYR A CA   1  
ATOM   673   C C    . TYR A 1 43  ? -11.906 9.573   0.086   1.00 0.00 ? 43  TYR A C    1  
ATOM   674   O O    . TYR A 1 43  ? -11.084 9.217   0.930   1.00 0.00 ? 43  TYR A O    1  
ATOM   675   C CB   . TYR A 1 43  ? -12.482 8.000   -1.797  1.00 0.00 ? 43  TYR A CB   1  
ATOM   676   C CG   . TYR A 1 43  ? -11.078 7.435   -1.819  1.00 0.00 ? 43  TYR A CG   1  
ATOM   677   C CD1  . TYR A 1 43  ? -10.838 6.127   -1.438  1.00 0.00 ? 43  TYR A CD1  1  
ATOM   678   C CD2  . TYR A 1 43  ? -10.002 8.199   -2.256  1.00 0.00 ? 43  TYR A CD2  1  
ATOM   679   C CE1  . TYR A 1 43  ? -9.569  5.588   -1.488  1.00 0.00 ? 43  TYR A CE1  1  
ATOM   680   C CE2  . TYR A 1 43  ? -8.726  7.670   -2.304  1.00 0.00 ? 43  TYR A CE2  1  
ATOM   681   C CZ   . TYR A 1 43  ? -8.516  6.364   -1.921  1.00 0.00 ? 43  TYR A CZ   1  
ATOM   682   O OH   . TYR A 1 43  ? -7.250  5.829   -1.979  1.00 0.00 ? 43  TYR A OH   1  
ATOM   683   H H    . TYR A 1 43  ? -14.541 9.460   -1.530  1.00 0.00 ? 43  TYR A H    1  
ATOM   684   H HA   . TYR A 1 43  ? -13.057 7.791   0.261   1.00 0.00 ? 43  TYR A HA   1  
ATOM   685   H HB2  . TYR A 1 43  ? -13.151 7.200   -2.065  1.00 0.00 ? 43  TYR A HB2  1  
ATOM   686   H HB3  . TYR A 1 43  ? -12.538 8.764   -2.557  1.00 0.00 ? 43  TYR A HB3  1  
ATOM   687   H HD1  . TYR A 1 43  ? -11.661 5.527   -1.099  1.00 0.00 ? 43  TYR A HD1  1  
ATOM   688   H HD2  . TYR A 1 43  ? -10.171 9.223   -2.554  1.00 0.00 ? 43  TYR A HD2  1  
ATOM   689   H HE1  . TYR A 1 43  ? -9.406  4.564   -1.189  1.00 0.00 ? 43  TYR A HE1  1  
ATOM   690   H HE2  . TYR A 1 43  ? -7.903  8.278   -2.646  1.00 0.00 ? 43  TYR A HE2  1  
ATOM   691   H HH   . TYR A 1 43  ? -6.638  6.406   -1.518  1.00 0.00 ? 43  TYR A HH   1  
ATOM   692   N N    . HIS A 1 44  ? -11.965 10.813  -0.377  1.00 0.00 ? 44  HIS A N    1  
ATOM   693   C CA   . HIS A 1 44  ? -10.977 11.811  0.017   1.00 0.00 ? 44  HIS A CA   1  
ATOM   694   C C    . HIS A 1 44  ? -11.257 12.338  1.421   1.00 0.00 ? 44  HIS A C    1  
ATOM   695   O O    . HIS A 1 44  ? -10.414 12.998  2.027   1.00 0.00 ? 44  HIS A O    1  
ATOM   696   C CB   . HIS A 1 44  ? -10.929 12.966  -0.988  1.00 0.00 ? 44  HIS A CB   1  
ATOM   697   C CG   . HIS A 1 44  ? -10.304 12.596  -2.298  1.00 0.00 ? 44  HIS A CG   1  
ATOM   698   N ND1  . HIS A 1 44  ? -8.944  12.631  -2.517  1.00 0.00 ? 44  HIS A ND1  1  
ATOM   699   C CD2  . HIS A 1 44  ? -10.858 12.181  -3.462  1.00 0.00 ? 44  HIS A CD2  1  
ATOM   700   C CE1  . HIS A 1 44  ? -8.688  12.256  -3.756  1.00 0.00 ? 44  HIS A CE1  1  
ATOM   701   N NE2  . HIS A 1 44  ? -9.832  11.976  -4.350  1.00 0.00 ? 44  HIS A NE2  1  
ATOM   702   H H    . HIS A 1 44  ? -12.700 11.069  -0.978  1.00 0.00 ? 44  HIS A H    1  
ATOM   703   H HA   . HIS A 1 44  ? -10.014 11.322  0.026   1.00 0.00 ? 44  HIS A HA   1  
ATOM   704   H HB2  . HIS A 1 44  ? -11.934 13.306  -1.184  1.00 0.00 ? 44  HIS A HB2  1  
ATOM   705   H HB3  . HIS A 1 44  ? -10.357 13.779  -0.564  1.00 0.00 ? 44  HIS A HB3  1  
ATOM   706   H HD1  . HIS A 1 44  ? -8.263  12.890  -1.855  1.00 0.00 ? 44  HIS A HD1  1  
ATOM   707   H HD2  . HIS A 1 44  ? -11.911 12.044  -3.657  1.00 0.00 ? 44  HIS A HD2  1  
ATOM   708   H HE1  . HIS A 1 44  ? -7.708  12.193  -4.207  1.00 0.00 ? 44  HIS A HE1  1  
ATOM   709   H HE2  . HIS A 1 44  ? -9.936  11.758  -5.304  1.00 0.00 ? 44  HIS A HE2  1  
ATOM   710   N N    . ASP A 1 45  ? -12.445 12.045  1.932   1.00 0.00 ? 45  ASP A N    1  
ATOM   711   C CA   . ASP A 1 45  ? -12.805 12.424  3.293   1.00 0.00 ? 45  ASP A CA   1  
ATOM   712   C C    . ASP A 1 45  ? -12.197 11.457  4.297   1.00 0.00 ? 45  ASP A C    1  
ATOM   713   O O    . ASP A 1 45  ? -11.626 11.869  5.308   1.00 0.00 ? 45  ASP A O    1  
ATOM   714   C CB   . ASP A 1 45  ? -14.326 12.464  3.472   1.00 0.00 ? 45  ASP A CB   1  
ATOM   715   C CG   . ASP A 1 45  ? -14.944 13.744  2.952   1.00 0.00 ? 45  ASP A CG   1  
ATOM   716   O OD1  . ASP A 1 45  ? -15.186 14.663  3.765   1.00 0.00 ? 45  ASP A OD1  1  
ATOM   717   O OD2  . ASP A 1 45  ? -15.189 13.846  1.734   1.00 0.00 ? 45  ASP A OD2  1  
ATOM   718   H H    . ASP A 1 45  ? -13.098 11.567  1.378   1.00 0.00 ? 45  ASP A H    1  
ATOM   719   H HA   . ASP A 1 45  ? -12.405 13.409  3.477   1.00 0.00 ? 45  ASP A HA   1  
ATOM   720   H HB2  . ASP A 1 45  ? -14.766 11.634  2.939   1.00 0.00 ? 45  ASP A HB2  1  
ATOM   721   H HB3  . ASP A 1 45  ? -14.561 12.374  4.523   1.00 0.00 ? 45  ASP A HB3  1  
ATOM   722   N N    . ILE A 1 46  ? -12.318 10.169  4.016   1.00 0.00 ? 46  ILE A N    1  
ATOM   723   C CA   . ILE A 1 46  ? -11.812 9.148   4.920   1.00 0.00 ? 46  ILE A CA   1  
ATOM   724   C C    . ILE A 1 46  ? -10.296 9.008   4.794   1.00 0.00 ? 46  ILE A C    1  
ATOM   725   O O    . ILE A 1 46  ? -9.585  8.940   5.797   1.00 0.00 ? 46  ILE A O    1  
ATOM   726   C CB   . ILE A 1 46  ? -12.499 7.775   4.684   1.00 0.00 ? 46  ILE A CB   1  
ATOM   727   C CG1  . ILE A 1 46  ? -13.922 7.761   5.234   1.00 0.00 ? 46  ILE A CG1  1  
ATOM   728   C CG2  . ILE A 1 46  ? -11.717 6.642   5.335   1.00 0.00 ? 46  ILE A CG2  1  
ATOM   729   C CD1  . ILE A 1 46  ? -14.904 8.670   4.521   1.00 0.00 ? 46  ILE A CD1  1  
ATOM   730   H H    . ILE A 1 46  ? -12.763 9.897   3.182   1.00 0.00 ? 46  ILE A H    1  
ATOM   731   H HA   . ILE A 1 46  ? -12.041 9.465   5.927   1.00 0.00 ? 46  ILE A HA   1  
ATOM   732   H HB   . ILE A 1 46  ? -12.533 7.593   3.618   1.00 0.00 ? 46  ILE A HB   1  
ATOM   733   H HG12 . ILE A 1 46  ? -14.293 6.754   5.164   1.00 0.00 ? 46  ILE A HG12 1  
ATOM   734   H HG13 . ILE A 1 46  ? -13.896 8.053   6.275   1.00 0.00 ? 46  ILE A HG13 1  
ATOM   735   H HG21 . ILE A 1 46  ? -10.914 6.342   4.691   1.00 0.00 ? 46  ILE A HG21 1  
ATOM   736   H HG22 . ILE A 1 46  ? -12.375 5.803   5.503   1.00 0.00 ? 46  ILE A HG22 1  
ATOM   737   H HG23 . ILE A 1 46  ? -11.315 6.979   6.279   1.00 0.00 ? 46  ILE A HG23 1  
ATOM   738   H HD11 . ILE A 1 46  ? -15.096 8.294   3.527   1.00 0.00 ? 46  ILE A HD11 1  
ATOM   739   H HD12 . ILE A 1 46  ? -14.487 9.664   4.454   1.00 0.00 ? 46  ILE A HD12 1  
ATOM   740   H HD13 . ILE A 1 46  ? -15.830 8.707   5.076   1.00 0.00 ? 46  ILE A HD13 1  
ATOM   741   N N    . ILE A 1 47  ? -9.803  8.989   3.566   1.00 0.00 ? 47  ILE A N    1  
ATOM   742   C CA   . ILE A 1 47  ? -8.378  8.806   3.330   1.00 0.00 ? 47  ILE A CA   1  
ATOM   743   C C    . ILE A 1 47  ? -7.639  10.143  3.372   1.00 0.00 ? 47  ILE A C    1  
ATOM   744   O O    . ILE A 1 47  ? -7.761  10.960  2.457   1.00 0.00 ? 47  ILE A O    1  
ATOM   745   C CB   . ILE A 1 47  ? -8.110  8.124   1.975   1.00 0.00 ? 47  ILE A CB   1  
ATOM   746   C CG1  . ILE A 1 47  ? -8.942  6.847   1.834   1.00 0.00 ? 47  ILE A CG1  1  
ATOM   747   C CG2  . ILE A 1 47  ? -6.630  7.808   1.842   1.00 0.00 ? 47  ILE A CG2  1  
ATOM   748   C CD1  . ILE A 1 47  ? -8.484  5.725   2.727   1.00 0.00 ? 47  ILE A CD1  1  
ATOM   749   H H    . ILE A 1 47  ? -10.407 9.104   2.800   1.00 0.00 ? 47  ILE A H    1  
ATOM   750   H HA   . ILE A 1 47  ? -7.994  8.168   4.112   1.00 0.00 ? 47  ILE A HA   1  
ATOM   751   H HB   . ILE A 1 47  ? -8.380  8.811   1.190   1.00 0.00 ? 47  ILE A HB   1  
ATOM   752   H HG12 . ILE A 1 47  ? -9.966  7.066   2.089   1.00 0.00 ? 47  ILE A HG12 1  
ATOM   753   H HG13 . ILE A 1 47  ? -8.894  6.502   0.812   1.00 0.00 ? 47  ILE A HG13 1  
ATOM   754   H HG21 . ILE A 1 47  ? -6.487  7.063   1.077   1.00 0.00 ? 47  ILE A HG21 1  
ATOM   755   H HG22 . ILE A 1 47  ? -6.255  7.433   2.782   1.00 0.00 ? 47  ILE A HG22 1  
ATOM   756   H HG23 . ILE A 1 47  ? -6.093  8.705   1.574   1.00 0.00 ? 47  ILE A HG23 1  
ATOM   757   H HD11 . ILE A 1 47  ? -8.496  6.061   3.751   1.00 0.00 ? 47  ILE A HD11 1  
ATOM   758   H HD12 . ILE A 1 47  ? -7.483  5.434   2.452   1.00 0.00 ? 47  ILE A HD12 1  
ATOM   759   H HD13 . ILE A 1 47  ? -9.146  4.884   2.615   1.00 0.00 ? 47  ILE A HD13 1  
ATOM   760   N N    . LYS A 1 48  ? -6.879  10.362  4.439   1.00 0.00 ? 48  LYS A N    1  
ATOM   761   C CA   . LYS A 1 48  ? -6.100  11.588  4.591   1.00 0.00 ? 48  LYS A CA   1  
ATOM   762   C C    . LYS A 1 48  ? -4.699  11.434  4.004   1.00 0.00 ? 48  LYS A C    1  
ATOM   763   O O    . LYS A 1 48  ? -4.057  12.417  3.631   1.00 0.00 ? 48  LYS A O    1  
ATOM   764   C CB   . LYS A 1 48  ? -6.013  11.975  6.064   1.00 0.00 ? 48  LYS A CB   1  
ATOM   765   C CG   . LYS A 1 48  ? -7.330  12.484  6.624   1.00 0.00 ? 48  LYS A CG   1  
ATOM   766   C CD   . LYS A 1 48  ? -7.702  13.833  6.028   1.00 0.00 ? 48  LYS A CD   1  
ATOM   767   C CE   . LYS A 1 48  ? -9.176  14.132  6.195   1.00 0.00 ? 48  LYS A CE   1  
ATOM   768   N NZ   . LYS A 1 48  ? -9.625  14.037  7.608   1.00 0.00 ? 48  LYS A NZ   1  
ATOM   769   H H    . LYS A 1 48  ? -6.850  9.687   5.151   1.00 0.00 ? 48  LYS A H    1  
ATOM   770   H HA   . LYS A 1 48  ? -6.616  12.370  4.056   1.00 0.00 ? 48  LYS A HA   1  
ATOM   771   H HB2  . LYS A 1 48  ? -5.709  11.110  6.636   1.00 0.00 ? 48  LYS A HB2  1  
ATOM   772   H HB3  . LYS A 1 48  ? -5.273  12.748  6.174   1.00 0.00 ? 48  LYS A HB3  1  
ATOM   773   H HG2  . LYS A 1 48  ? -8.107  11.772  6.390   1.00 0.00 ? 48  LYS A HG2  1  
ATOM   774   H HG3  . LYS A 1 48  ? -7.241  12.584  7.696   1.00 0.00 ? 48  LYS A HG3  1  
ATOM   775   H HD2  . LYS A 1 48  ? -7.131  14.605  6.518   1.00 0.00 ? 48  LYS A HD2  1  
ATOM   776   H HD3  . LYS A 1 48  ? -7.473  13.824  4.976   1.00 0.00 ? 48  LYS A HD3  1  
ATOM   777   H HE2  . LYS A 1 48  ? -9.368  15.131  5.835   1.00 0.00 ? 48  LYS A HE2  1  
ATOM   778   H HE3  . LYS A 1 48  ? -9.726  13.425  5.598   1.00 0.00 ? 48  LYS A HE3  1  
ATOM   779   H HZ1  . LYS A 1 48  ? -9.501  13.067  7.961   1.00 0.00 ? 48  LYS A HZ1  1  
ATOM   780   H HZ2  . LYS A 1 48  ? -10.630 14.294  7.682   1.00 0.00 ? 48  LYS A HZ2  1  
ATOM   781   H HZ3  . LYS A 1 48  ? -9.072  14.684  8.205   1.00 0.00 ? 48  LYS A HZ3  1  
ATOM   782   N N    . HIS A 1 49  ? -4.225  10.199  3.942   1.00 0.00 ? 49  HIS A N    1  
ATOM   783   C CA   . HIS A 1 49  ? -2.946  9.889   3.307   1.00 0.00 ? 49  HIS A CA   1  
ATOM   784   C C    . HIS A 1 49  ? -3.126  8.851   2.201   1.00 0.00 ? 49  HIS A C    1  
ATOM   785   O O    . HIS A 1 49  ? -2.762  7.686   2.377   1.00 0.00 ? 49  HIS A O    1  
ATOM   786   C CB   . HIS A 1 49  ? -1.933  9.376   4.334   1.00 0.00 ? 49  HIS A CB   1  
ATOM   787   C CG   . HIS A 1 49  ? -1.316  10.456  5.165   1.00 0.00 ? 49  HIS A CG   1  
ATOM   788   N ND1  . HIS A 1 49  ? -0.134  11.081  4.831   1.00 0.00 ? 49  HIS A ND1  1  
ATOM   789   C CD2  . HIS A 1 49  ? -1.721  11.021  6.324   1.00 0.00 ? 49  HIS A CD2  1  
ATOM   790   C CE1  . HIS A 1 49  ? 0.161   11.980  5.749   1.00 0.00 ? 49  HIS A CE1  1  
ATOM   791   N NE2  . HIS A 1 49  ? -0.786  11.965  6.665   1.00 0.00 ? 49  HIS A NE2  1  
ATOM   792   H H    . HIS A 1 49  ? -4.747  9.472   4.338   1.00 0.00 ? 49  HIS A H    1  
ATOM   793   H HA   . HIS A 1 49  ? -2.562  10.799  2.873   1.00 0.00 ? 49  HIS A HA   1  
ATOM   794   H HB2  . HIS A 1 49  ? -2.427  8.687   5.002   1.00 0.00 ? 49  HIS A HB2  1  
ATOM   795   H HB3  . HIS A 1 49  ? -1.137  8.859   3.817   1.00 0.00 ? 49  HIS A HB3  1  
ATOM   796   H HD1  . HIS A 1 49  ? 0.411   10.892  4.032   1.00 0.00 ? 49  HIS A HD1  1  
ATOM   797   H HD2  . HIS A 1 49  ? -2.612  10.771  6.882   1.00 0.00 ? 49  HIS A HD2  1  
ATOM   798   H HE1  . HIS A 1 49  ? 1.031   12.620  5.749   1.00 0.00 ? 49  HIS A HE1  1  
ATOM   799   H HE2  . HIS A 1 49  ? -0.878  12.623  7.388   1.00 0.00 ? 49  HIS A HE2  1  
ATOM   800   N N    . PRO A 1 50  ? -3.725  9.243   1.056   1.00 0.00 ? 50  PRO A N    1  
ATOM   801   C CA   . PRO A 1 50  ? -3.848  8.355   -0.102  1.00 0.00 ? 50  PRO A CA   1  
ATOM   802   C C    . PRO A 1 50  ? -2.488  8.042   -0.710  1.00 0.00 ? 50  PRO A C    1  
ATOM   803   O O    . PRO A 1 50  ? -1.919  8.849   -1.446  1.00 0.00 ? 50  PRO A O    1  
ATOM   804   C CB   . PRO A 1 50  ? -4.713  9.146   -1.089  1.00 0.00 ? 50  PRO A CB   1  
ATOM   805   C CG   . PRO A 1 50  ? -4.552  10.569  -0.687  1.00 0.00 ? 50  PRO A CG   1  
ATOM   806   C CD   . PRO A 1 50  ? -4.348  10.557  0.806   1.00 0.00 ? 50  PRO A CD   1  
ATOM   807   H HA   . PRO A 1 50  ? -4.344  7.431   0.160   1.00 0.00 ? 50  PRO A HA   1  
ATOM   808   H HB2  . PRO A 1 50  ? -4.358  8.978   -2.096  1.00 0.00 ? 50  PRO A HB2  1  
ATOM   809   H HB3  . PRO A 1 50  ? -5.741  8.827   -1.007  1.00 0.00 ? 50  PRO A HB3  1  
ATOM   810   H HG2  . PRO A 1 50  ? -3.692  10.995  -1.184  1.00 0.00 ? 50  PRO A HG2  1  
ATOM   811   H HG3  . PRO A 1 50  ? -5.444  11.122  -0.940  1.00 0.00 ? 50  PRO A HG3  1  
ATOM   812   H HD2  . PRO A 1 50  ? -3.691  11.359  1.108   1.00 0.00 ? 50  PRO A HD2  1  
ATOM   813   H HD3  . PRO A 1 50  ? -5.300  10.634  1.318   1.00 0.00 ? 50  PRO A HD3  1  
ATOM   814   N N    . MET A 1 51  ? -1.965  6.876   -0.382  1.00 0.00 ? 51  MET A N    1  
ATOM   815   C CA   . MET A 1 51  ? -0.661  6.469   -0.865  1.00 0.00 ? 51  MET A CA   1  
ATOM   816   C C    . MET A 1 51  ? -0.728  5.074   -1.464  1.00 0.00 ? 51  MET A C    1  
ATOM   817   O O    . MET A 1 51  ? -1.496  4.227   -1.007  1.00 0.00 ? 51  MET A O    1  
ATOM   818   C CB   . MET A 1 51  ? 0.370   6.522   0.272   1.00 0.00 ? 51  MET A CB   1  
ATOM   819   C CG   . MET A 1 51  ? 1.746   5.983   -0.109  1.00 0.00 ? 51  MET A CG   1  
ATOM   820   S SD   . MET A 1 51  ? 2.418   6.791   -1.577  1.00 0.00 ? 51  MET A SD   1  
ATOM   821   C CE   . MET A 1 51  ? 2.320   8.505   -1.087  1.00 0.00 ? 51  MET A CE   1  
ATOM   822   H H    . MET A 1 51  ? -2.469  6.270   0.198   1.00 0.00 ? 51  MET A H    1  
ATOM   823   H HA   . MET A 1 51  ? -0.368  7.166   -1.642  1.00 0.00 ? 51  MET A HA   1  
ATOM   824   H HB2  . MET A 1 51  ? 0.489   7.552   0.573   1.00 0.00 ? 51  MET A HB2  1  
ATOM   825   H HB3  . MET A 1 51  ? -0.004  5.952   1.115   1.00 0.00 ? 51  MET A HB3  1  
ATOM   826   H HG2  . MET A 1 51  ? 2.428   6.141   0.719   1.00 0.00 ? 51  MET A HG2  1  
ATOM   827   H HG3  . MET A 1 51  ? 1.664   4.923   -0.308  1.00 0.00 ? 51  MET A HG3  1  
ATOM   828   H HE1  . MET A 1 51  ? 2.756   8.616   -0.112  1.00 0.00 ? 51  MET A HE1  1  
ATOM   829   H HE2  . MET A 1 51  ? 1.286   8.815   -1.058  1.00 0.00 ? 51  MET A HE2  1  
ATOM   830   H HE3  . MET A 1 51  ? 2.860   9.114   -1.796  1.00 0.00 ? 51  MET A HE3  1  
ATOM   831   N N    . ASP A 1 52  ? 0.079   4.859   -2.487  1.00 0.00 ? 52  ASP A N    1  
ATOM   832   C CA   . ASP A 1 52  ? 0.132   3.591   -3.196  1.00 0.00 ? 52  ASP A CA   1  
ATOM   833   C C    . ASP A 1 52  ? 1.581   3.244   -3.501  1.00 0.00 ? 52  ASP A C    1  
ATOM   834   O O    . ASP A 1 52  ? 2.448   4.112   -3.420  1.00 0.00 ? 52  ASP A O    1  
ATOM   835   C CB   . ASP A 1 52  ? -0.670  3.668   -4.496  1.00 0.00 ? 52  ASP A CB   1  
ATOM   836   C CG   . ASP A 1 52  ? -0.136  4.732   -5.428  1.00 0.00 ? 52  ASP A CG   1  
ATOM   837   O OD1  . ASP A 1 52  ? 0.707   4.414   -6.287  1.00 0.00 ? 52  ASP A OD1  1  
ATOM   838   O OD2  . ASP A 1 52  ? -0.546  5.903   -5.295  1.00 0.00 ? 52  ASP A OD2  1  
ATOM   839   H H    . ASP A 1 52  ? 0.682   5.580   -2.769  1.00 0.00 ? 52  ASP A H    1  
ATOM   840   H HA   . ASP A 1 52  ? -0.287  2.828   -2.557  1.00 0.00 ? 52  ASP A HA   1  
ATOM   841   H HB2  . ASP A 1 52  ? -0.623  2.714   -5.001  1.00 0.00 ? 52  ASP A HB2  1  
ATOM   842   H HB3  . ASP A 1 52  ? -1.701  3.900   -4.267  1.00 0.00 ? 52  ASP A HB3  1  
ATOM   843   N N    . LEU A 1 53  ? 1.846   2.003   -3.868  1.00 0.00 ? 53  LEU A N    1  
ATOM   844   C CA   . LEU A 1 53  ? 3.219   1.555   -4.089  1.00 0.00 ? 53  LEU A CA   1  
ATOM   845   C C    . LEU A 1 53  ? 3.887   2.294   -5.245  1.00 0.00 ? 53  LEU A C    1  
ATOM   846   O O    . LEU A 1 53  ? 5.092   2.557   -5.207  1.00 0.00 ? 53  LEU A O    1  
ATOM   847   C CB   . LEU A 1 53  ? 3.254   0.048   -4.315  1.00 0.00 ? 53  LEU A CB   1  
ATOM   848   C CG   . LEU A 1 53  ? 3.091   -0.782  -3.047  1.00 0.00 ? 53  LEU A CG   1  
ATOM   849   C CD1  . LEU A 1 53  ? 2.800   -2.218  -3.403  1.00 0.00 ? 53  LEU A CD1  1  
ATOM   850   C CD2  . LEU A 1 53  ? 4.333   -0.700  -2.181  1.00 0.00 ? 53  LEU A CD2  1  
ATOM   851   H H    . LEU A 1 53  ? 1.102   1.372   -4.005  1.00 0.00 ? 53  LEU A H    1  
ATOM   852   H HA   . LEU A 1 53  ? 3.772   1.772   -3.191  1.00 0.00 ? 53  LEU A HA   1  
ATOM   853   H HB2  . LEU A 1 53  ? 2.457   -0.215  -4.997  1.00 0.00 ? 53  LEU A HB2  1  
ATOM   854   H HB3  . LEU A 1 53  ? 4.195   -0.211  -4.773  1.00 0.00 ? 53  LEU A HB3  1  
ATOM   855   H HG   . LEU A 1 53  ? 2.262   -0.393  -2.477  1.00 0.00 ? 53  LEU A HG   1  
ATOM   856   H HD11 . LEU A 1 53  ? 2.017   -2.235  -4.134  1.00 0.00 ? 53  LEU A HD11 1  
ATOM   857   H HD12 . LEU A 1 53  ? 2.485   -2.755  -2.520  1.00 0.00 ? 53  LEU A HD12 1  
ATOM   858   H HD13 . LEU A 1 53  ? 3.687   -2.678  -3.812  1.00 0.00 ? 53  LEU A HD13 1  
ATOM   859   H HD21 . LEU A 1 53  ? 4.422   0.295   -1.787  1.00 0.00 ? 53  LEU A HD21 1  
ATOM   860   H HD22 . LEU A 1 53  ? 5.204   -0.932  -2.777  1.00 0.00 ? 53  LEU A HD22 1  
ATOM   861   H HD23 . LEU A 1 53  ? 4.254   -1.406  -1.368  1.00 0.00 ? 53  LEU A HD23 1  
ATOM   862   N N    . SER A 1 54  ? 3.109   2.649   -6.257  1.00 0.00 ? 54  SER A N    1  
ATOM   863   C CA   . SER A 1 54  ? 3.640   3.385   -7.394  1.00 0.00 ? 54  SER A CA   1  
ATOM   864   C C    . SER A 1 54  ? 4.122   4.774   -6.969  1.00 0.00 ? 54  SER A C    1  
ATOM   865   O O    . SER A 1 54  ? 5.171   5.233   -7.418  1.00 0.00 ? 54  SER A O    1  
ATOM   866   C CB   . SER A 1 54  ? 2.593   3.496   -8.499  1.00 0.00 ? 54  SER A CB   1  
ATOM   867   O OG   . SER A 1 54  ? 2.255   2.214   -9.000  1.00 0.00 ? 54  SER A OG   1  
ATOM   868   H H    . SER A 1 54  ? 2.153   2.422   -6.233  1.00 0.00 ? 54  SER A H    1  
ATOM   869   H HA   . SER A 1 54  ? 4.486   2.828   -7.777  1.00 0.00 ? 54  SER A HA   1  
ATOM   870   H HB2  . SER A 1 54  ? 1.701   3.961   -8.107  1.00 0.00 ? 54  SER A HB2  1  
ATOM   871   H HB3  . SER A 1 54  ? 2.986   4.091   -9.306  1.00 0.00 ? 54  SER A HB3  1  
ATOM   872   H HG   . SER A 1 54  ? 1.523   1.854   -8.474  1.00 0.00 ? 54  SER A HG   1  
ATOM   873   N N    . THR A 1 55  ? 3.367   5.430   -6.091  1.00 0.00 ? 55  THR A N    1  
ATOM   874   C CA   . THR A 1 55  ? 3.755   6.740   -5.581  1.00 0.00 ? 55  THR A CA   1  
ATOM   875   C C    . THR A 1 55  ? 4.902   6.620   -4.578  1.00 0.00 ? 55  THR A C    1  
ATOM   876   O O    . THR A 1 55  ? 5.767   7.494   -4.514  1.00 0.00 ? 55  THR A O    1  
ATOM   877   C CB   . THR A 1 55  ? 2.577   7.481   -4.928  1.00 0.00 ? 55  THR A CB   1  
ATOM   878   O OG1  . THR A 1 55  ? 1.440   7.453   -5.803  1.00 0.00 ? 55  THR A OG1  1  
ATOM   879   C CG2  . THR A 1 55  ? 2.957   8.921   -4.658  1.00 0.00 ? 55  THR A CG2  1  
ATOM   880   H H    . THR A 1 55  ? 2.522   5.026   -5.789  1.00 0.00 ? 55  THR A H    1  
ATOM   881   H HA   . THR A 1 55  ? 4.097   7.335   -6.414  1.00 0.00 ? 55  THR A HA   1  
ATOM   882   H HB   . THR A 1 55  ? 2.335   7.004   -3.987  1.00 0.00 ? 55  THR A HB   1  
ATOM   883   H HG1  . THR A 1 55  ? 0.847   6.722   -5.545  1.00 0.00 ? 55  THR A HG1  1  
ATOM   884   H HG21 . THR A 1 55  ? 3.938   8.943   -4.215  1.00 0.00 ? 55  THR A HG21 1  
ATOM   885   H HG22 . THR A 1 55  ? 2.243   9.364   -3.979  1.00 0.00 ? 55  THR A HG22 1  
ATOM   886   H HG23 . THR A 1 55  ? 2.966   9.474   -5.585  1.00 0.00 ? 55  THR A HG23 1  
ATOM   887   N N    . VAL A 1 56  ? 4.915   5.536   -3.807  1.00 0.00 ? 56  VAL A N    1  
ATOM   888   C CA   . VAL A 1 56  ? 6.024   5.265   -2.897  1.00 0.00 ? 56  VAL A CA   1  
ATOM   889   C C    . VAL A 1 56  ? 7.313   5.151   -3.693  1.00 0.00 ? 56  VAL A C    1  
ATOM   890   O O    . VAL A 1 56  ? 8.339   5.736   -3.344  1.00 0.00 ? 56  VAL A O    1  
ATOM   891   C CB   . VAL A 1 56  ? 5.801   3.966   -2.094  1.00 0.00 ? 56  VAL A CB   1  
ATOM   892   C CG1  . VAL A 1 56  ? 7.022   3.638   -1.248  1.00 0.00 ? 56  VAL A CG1  1  
ATOM   893   C CG2  . VAL A 1 56  ? 4.571   4.087   -1.209  1.00 0.00 ? 56  VAL A CG2  1  
ATOM   894   H H    . VAL A 1 56  ? 4.161   4.904   -3.850  1.00 0.00 ? 56  VAL A H    1  
ATOM   895   H HA   . VAL A 1 56  ? 6.107   6.086   -2.204  1.00 0.00 ? 56  VAL A HA   1  
ATOM   896   H HB   . VAL A 1 56  ? 5.642   3.157   -2.793  1.00 0.00 ? 56  VAL A HB   1  
ATOM   897   H HG11 . VAL A 1 56  ? 7.892   3.563   -1.886  1.00 0.00 ? 56  VAL A HG11 1  
ATOM   898   H HG12 . VAL A 1 56  ? 6.866   2.698   -0.739  1.00 0.00 ? 56  VAL A HG12 1  
ATOM   899   H HG13 . VAL A 1 56  ? 7.177   4.420   -0.519  1.00 0.00 ? 56  VAL A HG13 1  
ATOM   900   H HG21 . VAL A 1 56  ? 3.744   4.469   -1.792  1.00 0.00 ? 56  VAL A HG21 1  
ATOM   901   H HG22 . VAL A 1 56  ? 4.779   4.763   -0.394  1.00 0.00 ? 56  VAL A HG22 1  
ATOM   902   H HG23 . VAL A 1 56  ? 4.315   3.116   -0.814  1.00 0.00 ? 56  VAL A HG23 1  
ATOM   903   N N    . LYS A 1 57  ? 7.236   4.412   -4.785  1.00 0.00 ? 57  LYS A N    1  
ATOM   904   C CA   . LYS A 1 57  ? 8.370   4.248   -5.670  1.00 0.00 ? 57  LYS A CA   1  
ATOM   905   C C    . LYS A 1 57  ? 8.690   5.559   -6.358  1.00 0.00 ? 57  LYS A C    1  
ATOM   906   O O    . LYS A 1 57  ? 9.847   5.920   -6.500  1.00 0.00 ? 57  LYS A O    1  
ATOM   907   C CB   . LYS A 1 57  ? 8.090   3.181   -6.718  1.00 0.00 ? 57  LYS A CB   1  
ATOM   908   C CG   . LYS A 1 57  ? 9.251   2.227   -6.906  1.00 0.00 ? 57  LYS A CG   1  
ATOM   909   C CD   . LYS A 1 57  ? 9.050   1.299   -8.084  1.00 0.00 ? 57  LYS A CD   1  
ATOM   910   C CE   . LYS A 1 57  ? 10.086  0.192   -8.056  1.00 0.00 ? 57  LYS A CE   1  
ATOM   911   N NZ   . LYS A 1 57  ? 10.021  -0.677  -9.259  1.00 0.00 ? 57  LYS A NZ   1  
ATOM   912   H H    . LYS A 1 57  ? 6.391   3.960   -4.994  1.00 0.00 ? 57  LYS A H    1  
ATOM   913   H HA   . LYS A 1 57  ? 9.216   3.946   -5.072  1.00 0.00 ? 57  LYS A HA   1  
ATOM   914   H HB2  . LYS A 1 57  ? 7.223   2.616   -6.415  1.00 0.00 ? 57  LYS A HB2  1  
ATOM   915   H HB3  . LYS A 1 57  ? 7.886   3.661   -7.663  1.00 0.00 ? 57  LYS A HB3  1  
ATOM   916   H HG2  . LYS A 1 57  ? 10.150  2.799   -7.062  1.00 0.00 ? 57  LYS A HG2  1  
ATOM   917   H HG3  . LYS A 1 57  ? 9.360   1.634   -6.015  1.00 0.00 ? 57  LYS A HG3  1  
ATOM   918   H HD2  . LYS A 1 57  ? 8.060   0.867   -8.031  1.00 0.00 ? 57  LYS A HD2  1  
ATOM   919   H HD3  . LYS A 1 57  ? 9.156   1.860   -9.001  1.00 0.00 ? 57  LYS A HD3  1  
ATOM   920   H HE2  . LYS A 1 57  ? 11.067  0.639   -8.000  1.00 0.00 ? 57  LYS A HE2  1  
ATOM   921   H HE3  . LYS A 1 57  ? 9.914   -0.410  -7.170  1.00 0.00 ? 57  LYS A HE3  1  
ATOM   922   H HZ1  . LYS A 1 57  ? 10.135  -0.107  -10.122 1.00 0.00 ? 57  LYS A HZ1  1  
ATOM   923   H HZ2  . LYS A 1 57  ? 9.108   -1.169  -9.302  1.00 0.00 ? 57  LYS A HZ2  1  
ATOM   924   H HZ3  . LYS A 1 57  ? 10.782  -1.386  -9.228  1.00 0.00 ? 57  LYS A HZ3  1  
ATOM   925   N N    . ARG A 1 58  ? 7.649   6.255   -6.786  1.00 0.00 ? 58  ARG A N    1  
ATOM   926   C CA   . ARG A 1 58  ? 7.786   7.565   -7.417  1.00 0.00 ? 58  ARG A CA   1  
ATOM   927   C C    . ARG A 1 58  ? 8.619   8.503   -6.547  1.00 0.00 ? 58  ARG A C    1  
ATOM   928   O O    . ARG A 1 58  ? 9.619   9.071   -6.991  1.00 0.00 ? 58  ARG A O    1  
ATOM   929   C CB   . ARG A 1 58  ? 6.405   8.172   -7.627  1.00 0.00 ? 58  ARG A CB   1  
ATOM   930   C CG   . ARG A 1 58  ? 6.424   9.482   -8.390  1.00 0.00 ? 58  ARG A CG   1  
ATOM   931   C CD   . ARG A 1 58  ? 5.113   10.231  -8.239  1.00 0.00 ? 58  ARG A CD   1  
ATOM   932   N NE   . ARG A 1 58  ? 3.956   9.420   -8.619  1.00 0.00 ? 58  ARG A NE   1  
ATOM   933   C CZ   . ARG A 1 58  ? 2.698   9.750   -8.337  1.00 0.00 ? 58  ARG A CZ   1  
ATOM   934   N NH1  . ARG A 1 58  ? 2.435   10.874  -7.679  1.00 0.00 ? 58  ARG A NH1  1  
ATOM   935   N NH2  . ARG A 1 58  ? 1.704   8.956   -8.713  1.00 0.00 ? 58  ARG A NH2  1  
ATOM   936   H H    . ARG A 1 58  ? 6.748   5.867   -6.683  1.00 0.00 ? 58  ARG A H    1  
ATOM   937   H HA   . ARG A 1 58  ? 8.270   7.436   -8.374  1.00 0.00 ? 58  ARG A HA   1  
ATOM   938   H HB2  . ARG A 1 58  ? 5.796   7.466   -8.171  1.00 0.00 ? 58  ARG A HB2  1  
ATOM   939   H HB3  . ARG A 1 58  ? 5.956   8.350   -6.662  1.00 0.00 ? 58  ARG A HB3  1  
ATOM   940   H HG2  . ARG A 1 58  ? 7.221   10.096  -8.005  1.00 0.00 ? 58  ARG A HG2  1  
ATOM   941   H HG3  . ARG A 1 58  ? 6.598   9.279   -9.434  1.00 0.00 ? 58  ARG A HG3  1  
ATOM   942   H HD2  . ARG A 1 58  ? 5.006   10.529  -7.207  1.00 0.00 ? 58  ARG A HD2  1  
ATOM   943   H HD3  . ARG A 1 58  ? 5.143   11.110  -8.863  1.00 0.00 ? 58  ARG A HD3  1  
ATOM   944   H HE   . ARG A 1 58  ? 4.128   8.586   -9.111  1.00 0.00 ? 58  ARG A HE   1  
ATOM   945   H HH11 . ARG A 1 58  ? 3.182   11.478  -7.395  1.00 0.00 ? 58  ARG A HH11 1  
ATOM   946   H HH12 . ARG A 1 58  ? 1.489   11.122  -7.460  1.00 0.00 ? 58  ARG A HH12 1  
ATOM   947   H HH21 . ARG A 1 58  ? 1.900   8.104   -9.210  1.00 0.00 ? 58  ARG A HH21 1  
ATOM   948   H HH22 . ARG A 1 58  ? 0.753   9.202   -8.508  1.00 0.00 ? 58  ARG A HH22 1  
ATOM   949   N N    . LYS A 1 59  ? 8.189   8.648   -5.304  1.00 0.00 ? 59  LYS A N    1  
ATOM   950   C CA   . LYS A 1 59  ? 8.869   9.491   -4.332  1.00 0.00 ? 59  LYS A CA   1  
ATOM   951   C C    . LYS A 1 59  ? 10.282  8.965   -4.056  1.00 0.00 ? 59  LYS A C    1  
ATOM   952   O O    . LYS A 1 59  ? 11.228  9.741   -3.904  1.00 0.00 ? 59  LYS A O    1  
ATOM   953   C CB   . LYS A 1 59  ? 8.046   9.534   -3.044  1.00 0.00 ? 59  LYS A CB   1  
ATOM   954   C CG   . LYS A 1 59  ? 6.746   10.331  -3.161  1.00 0.00 ? 59  LYS A CG   1  
ATOM   955   C CD   . LYS A 1 59  ? 5.797   10.131  -1.963  1.00 0.00 ? 59  LYS A CD   1  
ATOM   956   C CE   . LYS A 1 59  ? 6.375   10.611  -0.613  1.00 0.00 ? 59  LYS A CE   1  
ATOM   957   N NZ   . LYS A 1 59  ? 5.297   10.982  0.341   1.00 0.00 ? 59  LYS A NZ   1  
ATOM   958   H H    . LYS A 1 59  ? 7.378   8.165   -5.027  1.00 0.00 ? 59  LYS A H    1  
ATOM   959   H HA   . LYS A 1 59  ? 8.939   10.487  -4.742  1.00 0.00 ? 59  LYS A HA   1  
ATOM   960   H HB2  . LYS A 1 59  ? 7.800   8.516   -2.779  1.00 0.00 ? 59  LYS A HB2  1  
ATOM   961   H HB3  . LYS A 1 59  ? 8.643   9.977   -2.263  1.00 0.00 ? 59  LYS A HB3  1  
ATOM   962   H HG2  . LYS A 1 59  ? 6.992   11.382  -3.232  1.00 0.00 ? 59  LYS A HG2  1  
ATOM   963   H HG3  . LYS A 1 59  ? 6.234   10.025  -4.070  1.00 0.00 ? 59  LYS A HG3  1  
ATOM   964   H HD2  . LYS A 1 59  ? 4.892   10.694  -2.156  1.00 0.00 ? 59  LYS A HD2  1  
ATOM   965   H HD3  . LYS A 1 59  ? 5.549   9.079   -1.891  1.00 0.00 ? 59  LYS A HD3  1  
ATOM   966   H HE2  . LYS A 1 59  ? 6.957   9.822   -0.142  1.00 0.00 ? 59  LYS A HE2  1  
ATOM   967   H HE3  . LYS A 1 59  ? 7.007   11.469  -0.789  1.00 0.00 ? 59  LYS A HE3  1  
ATOM   968   H HZ1  . LYS A 1 59  ? 4.638   11.652  -0.098  1.00 0.00 ? 59  LYS A HZ1  1  
ATOM   969   H HZ2  . LYS A 1 59  ? 5.711   11.426  1.187   1.00 0.00 ? 59  LYS A HZ2  1  
ATOM   970   H HZ3  . LYS A 1 59  ? 4.774   10.130  0.636   1.00 0.00 ? 59  LYS A HZ3  1  
ATOM   971   N N    . MET A 1 60  ? 10.414  7.640   -3.987  1.00 0.00 ? 60  MET A N    1  
ATOM   972   C CA   . MET A 1 60  ? 11.725  6.997   -3.856  1.00 0.00 ? 60  MET A CA   1  
ATOM   973   C C    . MET A 1 60  ? 12.620  7.322   -5.053  1.00 0.00 ? 60  MET A C    1  
ATOM   974   O O    . MET A 1 60  ? 13.816  7.560   -4.895  1.00 0.00 ? 60  MET A O    1  
ATOM   975   C CB   . MET A 1 60  ? 11.587  5.476   -3.745  1.00 0.00 ? 60  MET A CB   1  
ATOM   976   C CG   . MET A 1 60  ? 12.918  4.772   -3.518  1.00 0.00 ? 60  MET A CG   1  
ATOM   977   S SD   . MET A 1 60  ? 12.962  3.108   -4.210  1.00 0.00 ? 60  MET A SD   1  
ATOM   978   C CE   . MET A 1 60  ? 11.464  2.433   -3.517  1.00 0.00 ? 60  MET A CE   1  
ATOM   979   H H    . MET A 1 60  ? 9.605   7.081   -3.994  1.00 0.00 ? 60  MET A H    1  
ATOM   980   H HA   . MET A 1 60  ? 12.192  7.375   -2.959  1.00 0.00 ? 60  MET A HA   1  
ATOM   981   H HB2  . MET A 1 60  ? 10.933  5.242   -2.917  1.00 0.00 ? 60  MET A HB2  1  
ATOM   982   H HB3  . MET A 1 60  ? 11.150  5.092   -4.656  1.00 0.00 ? 60  MET A HB3  1  
ATOM   983   H HG2  . MET A 1 60  ? 13.700  5.357   -3.976  1.00 0.00 ? 60  MET A HG2  1  
ATOM   984   H HG3  . MET A 1 60  ? 13.098  4.708   -2.454  1.00 0.00 ? 60  MET A HG3  1  
ATOM   985   H HE1  . MET A 1 60  ? 11.435  2.636   -2.460  1.00 0.00 ? 60  MET A HE1  1  
ATOM   986   H HE2  . MET A 1 60  ? 11.439  1.366   -3.679  1.00 0.00 ? 60  MET A HE2  1  
ATOM   987   H HE3  . MET A 1 60  ? 10.611  2.889   -3.994  1.00 0.00 ? 60  MET A HE3  1  
ATOM   988   N N    . GLU A 1 61  ? 12.035  7.321   -6.247  1.00 0.00 ? 61  GLU A N    1  
ATOM   989   C CA   . GLU A 1 61  ? 12.766  7.626   -7.473  1.00 0.00 ? 61  GLU A CA   1  
ATOM   990   C C    . GLU A 1 61  ? 13.261  9.062   -7.458  1.00 0.00 ? 61  GLU A C    1  
ATOM   991   O O    . GLU A 1 61  ? 14.319  9.374   -7.997  1.00 0.00 ? 61  GLU A O    1  
ATOM   992   C CB   . GLU A 1 61  ? 11.880  7.393   -8.700  1.00 0.00 ? 61  GLU A CB   1  
ATOM   993   C CG   . GLU A 1 61  ? 11.583  5.927   -8.968  1.00 0.00 ? 61  GLU A CG   1  
ATOM   994   C CD   . GLU A 1 61  ? 10.686  5.719   -10.171 1.00 0.00 ? 61  GLU A CD   1  
ATOM   995   O OE1  . GLU A 1 61  ? 9.544   6.226   -10.166 1.00 0.00 ? 61  GLU A OE1  1  
ATOM   996   O OE2  . GLU A 1 61  ? 11.112  5.029   -11.121 1.00 0.00 ? 61  GLU A OE2  1  
ATOM   997   H H    . GLU A 1 61  ? 11.075  7.095   -6.307  1.00 0.00 ? 61  GLU A H    1  
ATOM   998   H HA   . GLU A 1 61  ? 13.619  6.964   -7.521  1.00 0.00 ? 61  GLU A HA   1  
ATOM   999   H HB2  . GLU A 1 61  ? 10.939  7.903   -8.547  1.00 0.00 ? 61  GLU A HB2  1  
ATOM   1000  H HB3  . GLU A 1 61  ? 12.364  7.811   -9.568  1.00 0.00 ? 61  GLU A HB3  1  
ATOM   1001  H HG2  . GLU A 1 61  ? 12.516  5.412   -9.141  1.00 0.00 ? 61  GLU A HG2  1  
ATOM   1002  H HG3  . GLU A 1 61  ? 11.098  5.508   -8.098  1.00 0.00 ? 61  GLU A HG3  1  
ATOM   1003  N N    . ASN A 1 62  ? 12.493  9.930   -6.820  1.00 0.00 ? 62  ASN A N    1  
ATOM   1004  C CA   . ASN A 1 62  ? 12.884  11.327  -6.656  1.00 0.00 ? 62  ASN A CA   1  
ATOM   1005  C C    . ASN A 1 62  ? 13.847  11.453  -5.487  1.00 0.00 ? 62  ASN A C    1  
ATOM   1006  O O    . ASN A 1 62  ? 14.343  12.534  -5.179  1.00 0.00 ? 62  ASN A O    1  
ATOM   1007  C CB   . ASN A 1 62  ? 11.663  12.225  -6.429  1.00 0.00 ? 62  ASN A CB   1  
ATOM   1008  C CG   . ASN A 1 62  ? 10.859  12.481  -7.694  1.00 0.00 ? 62  ASN A CG   1  
ATOM   1009  O OD1  . ASN A 1 62  ? 10.241  13.536  -7.842  1.00 0.00 ? 62  ASN A OD1  1  
ATOM   1010  N ND2  . ASN A 1 62  ? 10.851  11.526  -8.611  1.00 0.00 ? 62  ASN A ND2  1  
ATOM   1011  H H    . ASN A 1 62  ? 11.644  9.619   -6.436  1.00 0.00 ? 62  ASN A H    1  
ATOM   1012  H HA   . ASN A 1 62  ? 13.390  11.637  -7.559  1.00 0.00 ? 62  ASN A HA   1  
ATOM   1013  H HB2  . ASN A 1 62  ? 11.014  11.759  -5.704  1.00 0.00 ? 62  ASN A HB2  1  
ATOM   1014  H HB3  . ASN A 1 62  ? 11.998  13.177  -6.043  1.00 0.00 ? 62  ASN A HB3  1  
ATOM   1015  H HD21 . ASN A 1 62  ? 11.358  10.707  -8.433  1.00 0.00 ? 62  ASN A HD21 1  
ATOM   1016  H HD22 . ASN A 1 62  ? 10.342  11.679  -9.437  1.00 0.00 ? 62  ASN A HD22 1  
ATOM   1017  N N    . ARG A 1 63  ? 14.097  10.311  -4.850  1.00 0.00 ? 63  ARG A N    1  
ATOM   1018  C CA   . ARG A 1 63  ? 15.043  10.190  -3.748  1.00 0.00 ? 63  ARG A CA   1  
ATOM   1019  C C    . ARG A 1 63  ? 14.671  11.106  -2.591  1.00 0.00 ? 63  ARG A C    1  
ATOM   1020  O O    . ARG A 1 63  ? 15.535  11.610  -1.872  1.00 0.00 ? 63  ARG A O    1  
ATOM   1021  C CB   . ARG A 1 63  ? 16.458  10.472  -4.251  1.00 0.00 ? 63  ARG A CB   1  
ATOM   1022  C CG   . ARG A 1 63  ? 16.821  9.662   -5.486  1.00 0.00 ? 63  ARG A CG   1  
ATOM   1023  C CD   . ARG A 1 63  ? 16.984  8.180   -5.177  1.00 0.00 ? 63  ARG A CD   1  
ATOM   1024  N NE   . ARG A 1 63  ? 16.856  7.348   -6.379  1.00 0.00 ? 63  ARG A NE   1  
ATOM   1025  C CZ   . ARG A 1 63  ? 17.799  7.223   -7.316  1.00 0.00 ? 63  ARG A CZ   1  
ATOM   1026  N NH1  . ARG A 1 63  ? 18.931  7.911   -7.233  1.00 0.00 ? 63  ARG A NH1  1  
ATOM   1027  N NH2  . ARG A 1 63  ? 17.598  6.416   -8.348  1.00 0.00 ? 63  ARG A NH2  1  
ATOM   1028  H H    . ARG A 1 63  ? 13.634  9.504   -5.151  1.00 0.00 ? 63  ARG A H    1  
ATOM   1029  H HA   . ARG A 1 63  ? 14.995  9.170   -3.398  1.00 0.00 ? 63  ARG A HA   1  
ATOM   1030  H HB2  . ARG A 1 63  ? 16.541  11.520  -4.494  1.00 0.00 ? 63  ARG A HB2  1  
ATOM   1031  H HB3  . ARG A 1 63  ? 17.163  10.233  -3.473  1.00 0.00 ? 63  ARG A HB3  1  
ATOM   1032  H HG2  . ARG A 1 63  ? 16.040  9.781   -6.227  1.00 0.00 ? 63  ARG A HG2  1  
ATOM   1033  H HG3  . ARG A 1 63  ? 17.751  10.037  -5.878  1.00 0.00 ? 63  ARG A HG3  1  
ATOM   1034  H HD2  . ARG A 1 63  ? 17.962  8.025   -4.748  1.00 0.00 ? 63  ARG A HD2  1  
ATOM   1035  H HD3  . ARG A 1 63  ? 16.230  7.882   -4.461  1.00 0.00 ? 63  ARG A HD3  1  
ATOM   1036  H HE   . ARG A 1 63  ? 16.018  6.841   -6.484  1.00 0.00 ? 63  ARG A HE   1  
ATOM   1037  H HH11 . ARG A 1 63  ? 19.091  8.534   -6.462  1.00 0.00 ? 63  ARG A HH11 1  
ATOM   1038  H HH12 . ARG A 1 63  ? 19.629  7.818   -7.947  1.00 0.00 ? 63  ARG A HH12 1  
ATOM   1039  H HH21 . ARG A 1 63  ? 16.739  5.901   -8.429  1.00 0.00 ? 63  ARG A HH21 1  
ATOM   1040  H HH22 . ARG A 1 63  ? 18.305  6.312   -9.054  1.00 0.00 ? 63  ARG A HH22 1  
ATOM   1041  N N    . ASP A 1 64  ? 13.370  11.297  -2.409  1.00 0.00 ? 64  ASP A N    1  
ATOM   1042  C CA   . ASP A 1 64  ? 12.851  12.109  -1.309  1.00 0.00 ? 64  ASP A CA   1  
ATOM   1043  C C    . ASP A 1 64  ? 12.929  11.353  0.009   1.00 0.00 ? 64  ASP A C    1  
ATOM   1044  O O    . ASP A 1 64  ? 12.782  11.936  1.083   1.00 0.00 ? 64  ASP A O    1  
ATOM   1045  C CB   . ASP A 1 64  ? 11.406  12.522  -1.581  1.00 0.00 ? 64  ASP A CB   1  
ATOM   1046  C CG   . ASP A 1 64  ? 11.298  13.894  -2.210  1.00 0.00 ? 64  ASP A CG   1  
ATOM   1047  O OD1  . ASP A 1 64  ? 11.284  13.987  -3.455  1.00 0.00 ? 64  ASP A OD1  1  
ATOM   1048  O OD2  . ASP A 1 64  ? 11.211  14.889  -1.458  1.00 0.00 ? 64  ASP A OD2  1  
ATOM   1049  H H    . ASP A 1 64  ? 12.737  10.888  -3.043  1.00 0.00 ? 64  ASP A H    1  
ATOM   1050  H HA   . ASP A 1 64  ? 13.462  12.996  -1.237  1.00 0.00 ? 64  ASP A HA   1  
ATOM   1051  H HB2  . ASP A 1 64  ? 10.960  11.806  -2.253  1.00 0.00 ? 64  ASP A HB2  1  
ATOM   1052  H HB3  . ASP A 1 64  ? 10.858  12.526  -0.651  1.00 0.00 ? 64  ASP A HB3  1  
ATOM   1053  N N    . TYR A 1 65  ? 13.142  10.051  -0.081  1.00 0.00 ? 65  TYR A N    1  
ATOM   1054  C CA   . TYR A 1 65  ? 13.317  9.220   1.101   1.00 0.00 ? 65  TYR A CA   1  
ATOM   1055  C C    . TYR A 1 65  ? 14.767  9.286   1.542   1.00 0.00 ? 65  TYR A C    1  
ATOM   1056  O O    . TYR A 1 65  ? 15.672  9.293   0.707   1.00 0.00 ? 65  TYR A O    1  
ATOM   1057  C CB   . TYR A 1 65  ? 12.951  7.758   0.816   1.00 0.00 ? 65  TYR A CB   1  
ATOM   1058  C CG   . TYR A 1 65  ? 11.492  7.505   0.493   1.00 0.00 ? 65  TYR A CG   1  
ATOM   1059  C CD1  . TYR A 1 65  ? 10.924  6.262   0.732   1.00 0.00 ? 65  TYR A CD1  1  
ATOM   1060  C CD2  . TYR A 1 65  ? 10.689  8.489   -0.062  1.00 0.00 ? 65  TYR A CD2  1  
ATOM   1061  C CE1  . TYR A 1 65  ? 9.598   6.011   0.428   1.00 0.00 ? 65  TYR A CE1  1  
ATOM   1062  C CE2  . TYR A 1 65  ? 9.368   8.245   -0.362  1.00 0.00 ? 65  TYR A CE2  1  
ATOM   1063  C CZ   . TYR A 1 65  ? 8.827   7.010   -0.117  1.00 0.00 ? 65  TYR A CZ   1  
ATOM   1064  O OH   . TYR A 1 65  ? 7.508   6.775   -0.423  1.00 0.00 ? 65  TYR A OH   1  
ATOM   1065  H H    . TYR A 1 65  ? 13.194  9.638   -0.966  1.00 0.00 ? 65  TYR A H    1  
ATOM   1066  H HA   . TYR A 1 65  ? 12.681  9.605   1.887   1.00 0.00 ? 65  TYR A HA   1  
ATOM   1067  H HB2  . TYR A 1 65  ? 13.534  7.412   -0.024  1.00 0.00 ? 65  TYR A HB2  1  
ATOM   1068  H HB3  . TYR A 1 65  ? 13.205  7.165   1.685   1.00 0.00 ? 65  TYR A HB3  1  
ATOM   1069  H HD1  . TYR A 1 65  ? 11.532  5.483   1.170   1.00 0.00 ? 65  TYR A HD1  1  
ATOM   1070  H HD2  . TYR A 1 65  ? 11.112  9.464   -0.256  1.00 0.00 ? 65  TYR A HD2  1  
ATOM   1071  H HE1  . TYR A 1 65  ? 9.175   5.037   0.613   1.00 0.00 ? 65  TYR A HE1  1  
ATOM   1072  H HE2  . TYR A 1 65  ? 8.763   9.021   -0.791  1.00 0.00 ? 65  TYR A HE2  1  
ATOM   1073  H HH   . TYR A 1 65  ? 7.050   6.448   0.359   1.00 0.00 ? 65  TYR A HH   1  
ATOM   1074  N N    . ARG A 1 66  ? 14.990  9.354   2.839   1.00 0.00 ? 66  ARG A N    1  
ATOM   1075  C CA   . ARG A 1 66  ? 16.342  9.383   3.368   1.00 0.00 ? 66  ARG A CA   1  
ATOM   1076  C C    . ARG A 1 66  ? 16.758  7.998   3.837   1.00 0.00 ? 66  ARG A C    1  
ATOM   1077  O O    . ARG A 1 66  ? 17.932  7.632   3.761   1.00 0.00 ? 66  ARG A O    1  
ATOM   1078  C CB   . ARG A 1 66  ? 16.431  10.384  4.526   1.00 0.00 ? 66  ARG A CB   1  
ATOM   1079  C CG   . ARG A 1 66  ? 17.830  10.564  5.091   1.00 0.00 ? 66  ARG A CG   1  
ATOM   1080  C CD   . ARG A 1 66  ? 18.693  11.424  4.182   1.00 0.00 ? 66  ARG A CD   1  
ATOM   1081  N NE   . ARG A 1 66  ? 20.099  11.394  4.571   1.00 0.00 ? 66  ARG A NE   1  
ATOM   1082  C CZ   . ARG A 1 66  ? 21.053  12.084  3.948   1.00 0.00 ? 66  ARG A CZ   1  
ATOM   1083  N NH1  . ARG A 1 66  ? 20.745  12.867  2.920   1.00 0.00 ? 66  ARG A NH1  1  
ATOM   1084  N NH2  . ARG A 1 66  ? 22.313  11.992  4.352   1.00 0.00 ? 66  ARG A NH2  1  
ATOM   1085  H H    . ARG A 1 66  ? 14.228  9.403   3.464   1.00 0.00 ? 66  ARG A H    1  
ATOM   1086  H HA   . ARG A 1 66  ? 17.004  9.689   2.573   1.00 0.00 ? 66  ARG A HA   1  
ATOM   1087  H HB2  . ARG A 1 66  ? 16.084  11.346  4.179   1.00 0.00 ? 66  ARG A HB2  1  
ATOM   1088  H HB3  . ARG A 1 66  ? 15.783  10.047  5.323   1.00 0.00 ? 66  ARG A HB3  1  
ATOM   1089  H HG2  . ARG A 1 66  ? 17.760  11.039  6.058   1.00 0.00 ? 66  ARG A HG2  1  
ATOM   1090  H HG3  . ARG A 1 66  ? 18.291  9.593   5.197   1.00 0.00 ? 66  ARG A HG3  1  
ATOM   1091  H HD2  . ARG A 1 66  ? 18.600  11.064  3.169   1.00 0.00 ? 66  ARG A HD2  1  
ATOM   1092  H HD3  . ARG A 1 66  ? 18.341  12.447  4.236   1.00 0.00 ? 66  ARG A HD3  1  
ATOM   1093  H HE   . ARG A 1 66  ? 20.345  10.822  5.336   1.00 0.00 ? 66  ARG A HE   1  
ATOM   1094  H HH11 . ARG A 1 66  ? 19.795  12.944  2.607   1.00 0.00 ? 66  ARG A HH11 1  
ATOM   1095  H HH12 . ARG A 1 66  ? 21.463  13.387  2.449   1.00 0.00 ? 66  ARG A HH12 1  
ATOM   1096  H HH21 . ARG A 1 66  ? 22.554  11.402  5.127   1.00 0.00 ? 66  ARG A HH21 1  
ATOM   1097  H HH22 . ARG A 1 66  ? 23.032  12.512  3.881   1.00 0.00 ? 66  ARG A HH22 1  
ATOM   1098  N N    . ASP A 1 67  ? 15.795  7.222   4.308   1.00 0.00 ? 67  ASP A N    1  
ATOM   1099  C CA   . ASP A 1 67  ? 16.078  5.913   4.845   1.00 0.00 ? 67  ASP A CA   1  
ATOM   1100  C C    . ASP A 1 67  ? 14.933  4.958   4.582   1.00 0.00 ? 67  ASP A C    1  
ATOM   1101  O O    . ASP A 1 67  ? 13.869  5.356   4.102   1.00 0.00 ? 67  ASP A O    1  
ATOM   1102  C CB   . ASP A 1 67  ? 16.345  6.022   6.344   1.00 0.00 ? 67  ASP A CB   1  
ATOM   1103  C CG   . ASP A 1 67  ? 15.252  6.755   7.094   1.00 0.00 ? 67  ASP A CG   1  
ATOM   1104  O OD1  . ASP A 1 67  ? 14.107  6.279   7.112   1.00 0.00 ? 67  ASP A OD1  1  
ATOM   1105  O OD2  . ASP A 1 67  ? 15.549  7.815   7.687   1.00 0.00 ? 67  ASP A OD2  1  
ATOM   1106  H H    . ASP A 1 67  ? 14.871  7.538   4.308   1.00 0.00 ? 67  ASP A H    1  
ATOM   1107  H HA   . ASP A 1 67  ? 16.964  5.534   4.351   1.00 0.00 ? 67  ASP A HA   1  
ATOM   1108  H HB2  . ASP A 1 67  ? 16.447  5.036   6.764   1.00 0.00 ? 67  ASP A HB2  1  
ATOM   1109  H HB3  . ASP A 1 67  ? 17.254  6.566   6.485   1.00 0.00 ? 67  ASP A HB3  1  
ATOM   1110  N N    . ALA A 1 68  ? 15.163  3.696   4.906   1.00 0.00 ? 68  ALA A N    1  
ATOM   1111  C CA   . ALA A 1 68  ? 14.181  2.656   4.673   1.00 0.00 ? 68  ALA A CA   1  
ATOM   1112  C C    . ALA A 1 68  ? 13.047  2.760   5.666   1.00 0.00 ? 68  ALA A C    1  
ATOM   1113  O O    . ALA A 1 68  ? 11.982  2.180   5.468   1.00 0.00 ? 68  ALA A O    1  
ATOM   1114  C CB   . ALA A 1 68  ? 14.823  1.289   4.763   1.00 0.00 ? 68  ALA A CB   1  
ATOM   1115  H H    . ALA A 1 68  ? 16.015  3.460   5.330   1.00 0.00 ? 68  ALA A H    1  
ATOM   1116  H HA   . ALA A 1 68  ? 13.790  2.782   3.675   1.00 0.00 ? 68  ALA A HA   1  
ATOM   1117  H HB1  . ALA A 1 68  ? 15.220  1.146   5.753   1.00 0.00 ? 68  ALA A HB1  1  
ATOM   1118  H HB2  . ALA A 1 68  ? 15.622  1.218   4.039   1.00 0.00 ? 68  ALA A HB2  1  
ATOM   1119  H HB3  . ALA A 1 68  ? 14.084  0.530   4.558   1.00 0.00 ? 68  ALA A HB3  1  
ATOM   1120  N N    . GLN A 1 69  ? 13.275  3.505   6.735   1.00 0.00 ? 69  GLN A N    1  
ATOM   1121  C CA   . GLN A 1 69  ? 12.239  3.709   7.726   1.00 0.00 ? 69  GLN A CA   1  
ATOM   1122  C C    . GLN A 1 69  ? 11.171  4.634   7.153   1.00 0.00 ? 69  GLN A C    1  
ATOM   1123  O O    . GLN A 1 69  ? 9.978   4.434   7.375   1.00 0.00 ? 69  GLN A O    1  
ATOM   1124  C CB   . GLN A 1 69  ? 12.812  4.293   9.014   1.00 0.00 ? 69  GLN A CB   1  
ATOM   1125  C CG   . GLN A 1 69  ? 11.781  4.417   10.113  1.00 0.00 ? 69  GLN A CG   1  
ATOM   1126  C CD   . GLN A 1 69  ? 11.442  3.090   10.757  1.00 0.00 ? 69  GLN A CD   1  
ATOM   1127  O OE1  . GLN A 1 69  ? 12.277  2.191   10.838  1.00 0.00 ? 69  GLN A OE1  1  
ATOM   1128  N NE2  . GLN A 1 69  ? 10.210  2.959   11.217  1.00 0.00 ? 69  GLN A NE2  1  
ATOM   1129  H H    . GLN A 1 69  ? 14.155  3.940   6.849   1.00 0.00 ? 69  GLN A H    1  
ATOM   1130  H HA   . GLN A 1 69  ? 11.795  2.749   7.938   1.00 0.00 ? 69  GLN A HA   1  
ATOM   1131  H HB2  . GLN A 1 69  ? 13.610  3.657   9.364   1.00 0.00 ? 69  GLN A HB2  1  
ATOM   1132  H HB3  . GLN A 1 69  ? 13.206  5.275   8.807   1.00 0.00 ? 69  GLN A HB3  1  
ATOM   1133  H HG2  . GLN A 1 69  ? 12.150  5.090   10.872  1.00 0.00 ? 69  GLN A HG2  1  
ATOM   1134  H HG3  . GLN A 1 69  ? 10.882  4.820   9.676   1.00 0.00 ? 69  GLN A HG3  1  
ATOM   1135  H HE21 . GLN A 1 69  ? 9.594   3.718   11.113  1.00 0.00 ? 69  GLN A HE21 1  
ATOM   1136  H HE22 . GLN A 1 69  ? 9.963   2.115   11.648  1.00 0.00 ? 69  GLN A HE22 1  
ATOM   1137  N N    . GLU A 1 70  ? 11.612  5.640   6.398   1.00 0.00 ? 70  GLU A N    1  
ATOM   1138  C CA   . GLU A 1 70  ? 10.700  6.533   5.703   1.00 0.00 ? 70  GLU A CA   1  
ATOM   1139  C C    . GLU A 1 70  ? 9.934   5.775   4.638   1.00 0.00 ? 70  GLU A C    1  
ATOM   1140  O O    . GLU A 1 70  ? 8.760   6.044   4.389   1.00 0.00 ? 70  GLU A O    1  
ATOM   1141  C CB   . GLU A 1 70  ? 11.436  7.712   5.074   1.00 0.00 ? 70  GLU A CB   1  
ATOM   1142  C CG   . GLU A 1 70  ? 11.902  8.740   6.084   1.00 0.00 ? 70  GLU A CG   1  
ATOM   1143  C CD   . GLU A 1 70  ? 12.273  10.052  5.435   1.00 0.00 ? 70  GLU A CD   1  
ATOM   1144  O OE1  . GLU A 1 70  ? 13.411  10.173  4.942   1.00 0.00 ? 70  GLU A OE1  1  
ATOM   1145  O OE2  . GLU A 1 70  ? 11.427  10.971  5.413   1.00 0.00 ? 70  GLU A OE2  1  
ATOM   1146  H H    . GLU A 1 70  ? 12.582  5.787   6.317   1.00 0.00 ? 70  GLU A H    1  
ATOM   1147  H HA   . GLU A 1 70  ? 10.001  6.910   6.426   1.00 0.00 ? 70  GLU A HA   1  
ATOM   1148  H HB2  . GLU A 1 70  ? 12.306  7.344   4.541   1.00 0.00 ? 70  GLU A HB2  1  
ATOM   1149  H HB3  . GLU A 1 70  ? 10.774  8.199   4.378   1.00 0.00 ? 70  GLU A HB3  1  
ATOM   1150  H HG2  . GLU A 1 70  ? 11.107  8.917   6.792   1.00 0.00 ? 70  GLU A HG2  1  
ATOM   1151  H HG3  . GLU A 1 70  ? 12.767  8.353   6.601   1.00 0.00 ? 70  GLU A HG3  1  
ATOM   1152  N N    . PHE A 1 71  ? 10.605  4.820   4.014   1.00 0.00 ? 71  PHE A N    1  
ATOM   1153  C CA   . PHE A 1 71  ? 9.945   3.938   3.072   1.00 0.00 ? 71  PHE A CA   1  
ATOM   1154  C C    . PHE A 1 71  ? 8.897   3.119   3.795   1.00 0.00 ? 71  PHE A C    1  
ATOM   1155  O O    . PHE A 1 71  ? 7.733   3.113   3.399   1.00 0.00 ? 71  PHE A O    1  
ATOM   1156  C CB   . PHE A 1 71  ? 10.947  3.020   2.362   1.00 0.00 ? 71  PHE A CB   1  
ATOM   1157  C CG   . PHE A 1 71  ? 10.322  1.763   1.811   1.00 0.00 ? 71  PHE A CG   1  
ATOM   1158  C CD1  . PHE A 1 71  ? 9.693   1.761   0.575   1.00 0.00 ? 71  PHE A CD1  1  
ATOM   1159  C CD2  . PHE A 1 71  ? 10.363  0.585   2.538   1.00 0.00 ? 71  PHE A CD2  1  
ATOM   1160  C CE1  . PHE A 1 71  ? 9.117   0.602   0.078   1.00 0.00 ? 71  PHE A CE1  1  
ATOM   1161  C CE2  . PHE A 1 71  ? 9.791   -0.570  2.051   1.00 0.00 ? 71  PHE A CE2  1  
ATOM   1162  C CZ   . PHE A 1 71  ? 9.167   -0.564  0.818   1.00 0.00 ? 71  PHE A CZ   1  
ATOM   1163  H H    . PHE A 1 71  ? 11.558  4.705   4.202   1.00 0.00 ? 71  PHE A H    1  
ATOM   1164  H HA   . PHE A 1 71  ? 9.452   4.557   2.339   1.00 0.00 ? 71  PHE A HA   1  
ATOM   1165  H HB2  . PHE A 1 71  ? 11.392  3.555   1.537   1.00 0.00 ? 71  PHE A HB2  1  
ATOM   1166  H HB3  . PHE A 1 71  ? 11.724  2.734   3.057   1.00 0.00 ? 71  PHE A HB3  1  
ATOM   1167  H HD1  . PHE A 1 71  ? 9.651   2.674   0.001   1.00 0.00 ? 71  PHE A HD1  1  
ATOM   1168  H HD2  . PHE A 1 71  ? 10.848  0.578   3.504   1.00 0.00 ? 71  PHE A HD2  1  
ATOM   1169  H HE1  . PHE A 1 71  ? 8.627   0.608   -0.887  1.00 0.00 ? 71  PHE A HE1  1  
ATOM   1170  H HE2  . PHE A 1 71  ? 9.827   -1.475  2.635   1.00 0.00 ? 71  PHE A HE2  1  
ATOM   1171  H HZ   . PHE A 1 71  ? 8.719   -1.468  0.435   1.00 0.00 ? 71  PHE A HZ   1  
ATOM   1172  N N    . ALA A 1 72  ? 9.319   2.440   4.862   1.00 0.00 ? 72  ALA A N    1  
ATOM   1173  C CA   . ALA A 1 72  ? 8.423   1.633   5.665   1.00 0.00 ? 72  ALA A CA   1  
ATOM   1174  C C    . ALA A 1 72  ? 7.231   2.457   6.112   1.00 0.00 ? 72  ALA A C    1  
ATOM   1175  O O    . ALA A 1 72  ? 6.101   1.987   6.078   1.00 0.00 ? 72  ALA A O    1  
ATOM   1176  C CB   . ALA A 1 72  ? 9.161   1.052   6.864   1.00 0.00 ? 72  ALA A CB   1  
ATOM   1177  H H    . ALA A 1 72  ? 10.270  2.476   5.108   1.00 0.00 ? 72  ALA A H    1  
ATOM   1178  H HA   . ALA A 1 72  ? 8.075   0.818   5.051   1.00 0.00 ? 72  ALA A HA   1  
ATOM   1179  H HB1  . ALA A 1 72  ? 9.686   1.842   7.386   1.00 0.00 ? 72  ALA A HB1  1  
ATOM   1180  H HB2  . ALA A 1 72  ? 9.871   0.313   6.525   1.00 0.00 ? 72  ALA A HB2  1  
ATOM   1181  H HB3  . ALA A 1 72  ? 8.451   0.589   7.533   1.00 0.00 ? 72  ALA A HB3  1  
ATOM   1182  N N    . ALA A 1 73  ? 7.501   3.695   6.493   1.00 0.00 ? 73  ALA A N    1  
ATOM   1183  C CA   . ALA A 1 73  ? 6.472   4.633   6.906   1.00 0.00 ? 73  ALA A CA   1  
ATOM   1184  C C    . ALA A 1 73  ? 5.433   4.841   5.806   1.00 0.00 ? 73  ALA A C    1  
ATOM   1185  O O    . ALA A 1 73  ? 4.231   4.753   6.052   1.00 0.00 ? 73  ALA A O    1  
ATOM   1186  C CB   . ALA A 1 73  ? 7.123   5.955   7.279   1.00 0.00 ? 73  ALA A CB   1  
ATOM   1187  H H    . ALA A 1 73  ? 8.437   3.993   6.500   1.00 0.00 ? 73  ALA A H    1  
ATOM   1188  H HA   . ALA A 1 73  ? 5.988   4.234   7.784   1.00 0.00 ? 73  ALA A HA   1  
ATOM   1189  H HB1  . ALA A 1 73  ? 7.888   6.199   6.547   1.00 0.00 ? 73  ALA A HB1  1  
ATOM   1190  H HB2  . ALA A 1 73  ? 7.573   5.872   8.257   1.00 0.00 ? 73  ALA A HB2  1  
ATOM   1191  H HB3  . ALA A 1 73  ? 6.375   6.734   7.292   1.00 0.00 ? 73  ALA A HB3  1  
ATOM   1192  N N    . ASP A 1 74  ? 5.902   5.095   4.591   1.00 0.00 ? 74  ASP A N    1  
ATOM   1193  C CA   . ASP A 1 74  ? 5.023   5.386   3.472   1.00 0.00 ? 74  ASP A CA   1  
ATOM   1194  C C    . ASP A 1 74  ? 4.271   4.142   2.997   1.00 0.00 ? 74  ASP A C    1  
ATOM   1195  O O    . ASP A 1 74  ? 3.067   4.201   2.740   1.00 0.00 ? 74  ASP A O    1  
ATOM   1196  C CB   . ASP A 1 74  ? 5.834   5.990   2.329   1.00 0.00 ? 74  ASP A CB   1  
ATOM   1197  C CG   . ASP A 1 74  ? 5.825   7.509   2.340   1.00 0.00 ? 74  ASP A CG   1  
ATOM   1198  O OD1  . ASP A 1 74  ? 6.501   8.107   3.205   1.00 0.00 ? 74  ASP A OD1  1  
ATOM   1199  O OD2  . ASP A 1 74  ? 5.145   8.117   1.484   1.00 0.00 ? 74  ASP A OD2  1  
ATOM   1200  H H    . ASP A 1 74  ? 6.870   5.089   4.436   1.00 0.00 ? 74  ASP A H    1  
ATOM   1201  H HA   . ASP A 1 74  ? 4.301   6.116   3.806   1.00 0.00 ? 74  ASP A HA   1  
ATOM   1202  H HB2  . ASP A 1 74  ? 6.858   5.657   2.412   1.00 0.00 ? 74  ASP A HB2  1  
ATOM   1203  H HB3  . ASP A 1 74  ? 5.430   5.648   1.399   1.00 0.00 ? 74  ASP A HB3  1  
ATOM   1204  N N    . VAL A 1 75  ? 4.968   3.012   2.897   1.00 0.00 ? 75  VAL A N    1  
ATOM   1205  C CA   . VAL A 1 75  ? 4.337   1.779   2.430   1.00 0.00 ? 75  VAL A CA   1  
ATOM   1206  C C    . VAL A 1 75  ? 3.307   1.276   3.442   1.00 0.00 ? 75  VAL A C    1  
ATOM   1207  O O    . VAL A 1 75  ? 2.211   0.849   3.067   1.00 0.00 ? 75  VAL A O    1  
ATOM   1208  C CB   . VAL A 1 75  ? 5.373   0.667   2.114   1.00 0.00 ? 75  VAL A CB   1  
ATOM   1209  C CG1  . VAL A 1 75  ? 6.379   0.504   3.233   1.00 0.00 ? 75  VAL A CG1  1  
ATOM   1210  C CG2  . VAL A 1 75  ? 4.695   -0.665  1.840   1.00 0.00 ? 75  VAL A CG2  1  
ATOM   1211  H H    . VAL A 1 75  ? 5.923   3.006   3.146   1.00 0.00 ? 75  VAL A H    1  
ATOM   1212  H HA   . VAL A 1 75  ? 3.817   2.016   1.512   1.00 0.00 ? 75  VAL A HA   1  
ATOM   1213  H HB   . VAL A 1 75  ? 5.908   0.953   1.224   1.00 0.00 ? 75  VAL A HB   1  
ATOM   1214  H HG11 . VAL A 1 75  ? 7.040   1.360   3.255   1.00 0.00 ? 75  VAL A HG11 1  
ATOM   1215  H HG12 . VAL A 1 75  ? 6.958   -0.393  3.069   1.00 0.00 ? 75  VAL A HG12 1  
ATOM   1216  H HG13 . VAL A 1 75  ? 5.858   0.428   4.176   1.00 0.00 ? 75  VAL A HG13 1  
ATOM   1217  H HG21 . VAL A 1 75  ? 5.420   -1.460  1.949   1.00 0.00 ? 75  VAL A HG21 1  
ATOM   1218  H HG22 . VAL A 1 75  ? 4.300   -0.669  0.835   1.00 0.00 ? 75  VAL A HG22 1  
ATOM   1219  H HG23 . VAL A 1 75  ? 3.890   -0.811  2.545   1.00 0.00 ? 75  VAL A HG23 1  
ATOM   1220  N N    . ARG A 1 76  ? 3.637   1.357   4.726   1.00 0.00 ? 76  ARG A N    1  
ATOM   1221  C CA   . ARG A 1 76  ? 2.713   0.912   5.755   1.00 0.00 ? 76  ARG A CA   1  
ATOM   1222  C C    . ARG A 1 76  ? 1.534   1.876   5.856   1.00 0.00 ? 76  ARG A C    1  
ATOM   1223  O O    . ARG A 1 76  ? 0.430   1.474   6.210   1.00 0.00 ? 76  ARG A O    1  
ATOM   1224  C CB   . ARG A 1 76  ? 3.412   0.760   7.111   1.00 0.00 ? 76  ARG A CB   1  
ATOM   1225  C CG   . ARG A 1 76  ? 3.789   2.080   7.772   1.00 0.00 ? 76  ARG A CG   1  
ATOM   1226  C CD   . ARG A 1 76  ? 4.411   1.878   9.145   1.00 0.00 ? 76  ARG A CD   1  
ATOM   1227  N NE   . ARG A 1 76  ? 5.388   0.785   9.170   1.00 0.00 ? 76  ARG A NE   1  
ATOM   1228  C CZ   . ARG A 1 76  ? 6.447   0.749   9.982   1.00 0.00 ? 76  ARG A CZ   1  
ATOM   1229  N NH1  . ARG A 1 76  ? 6.716   1.777   10.777  1.00 0.00 ? 76  ARG A NH1  1  
ATOM   1230  N NH2  . ARG A 1 76  ? 7.241   -0.315  9.990   1.00 0.00 ? 76  ARG A NH2  1  
ATOM   1231  H H    . ARG A 1 76  ? 4.517   1.717   4.982   1.00 0.00 ? 76  ARG A H    1  
ATOM   1232  H HA   . ARG A 1 76  ? 2.334   -0.052  5.452   1.00 0.00 ? 76  ARG A HA   1  
ATOM   1233  H HB2  . ARG A 1 76  ? 2.764   0.217   7.773   1.00 0.00 ? 76  ARG A HB2  1  
ATOM   1234  H HB3  . ARG A 1 76  ? 4.317   0.188   6.967   1.00 0.00 ? 76  ARG A HB3  1  
ATOM   1235  H HG2  . ARG A 1 76  ? 4.498   2.594   7.142   1.00 0.00 ? 76  ARG A HG2  1  
ATOM   1236  H HG3  . ARG A 1 76  ? 2.898   2.683   7.877   1.00 0.00 ? 76  ARG A HG3  1  
ATOM   1237  H HD2  . ARG A 1 76  ? 4.908   2.792   9.433   1.00 0.00 ? 76  ARG A HD2  1  
ATOM   1238  H HD3  . ARG A 1 76  ? 3.628   1.665   9.851   1.00 0.00 ? 76  ARG A HD3  1  
ATOM   1239  H HE   . ARG A 1 76  ? 5.228   0.022   8.569   1.00 0.00 ? 76  ARG A HE   1  
ATOM   1240  H HH11 . ARG A 1 76  ? 6.128   2.590   10.768  1.00 0.00 ? 76  ARG A HH11 1  
ATOM   1241  H HH12 . ARG A 1 76  ? 7.501   1.741   11.399  1.00 0.00 ? 76  ARG A HH12 1  
ATOM   1242  H HH21 . ARG A 1 76  ? 7.045   -1.093  9.387   1.00 0.00 ? 76  ARG A HH21 1  
ATOM   1243  H HH22 . ARG A 1 76  ? 8.037   -0.351  10.600  1.00 0.00 ? 76  ARG A HH22 1  
ATOM   1244  N N    . LEU A 1 77  ? 1.769   3.146   5.520   1.00 0.00 ? 77  LEU A N    1  
ATOM   1245  C CA   . LEU A 1 77  ? 0.705   4.141   5.485   1.00 0.00 ? 77  LEU A CA   1  
ATOM   1246  C C    . LEU A 1 77  ? -0.319  3.774   4.420   1.00 0.00 ? 77  LEU A C    1  
ATOM   1247  O O    . LEU A 1 77  ? -1.512  4.043   4.568   1.00 0.00 ? 77  LEU A O    1  
ATOM   1248  C CB   . LEU A 1 77  ? 1.281   5.528   5.198   1.00 0.00 ? 77  LEU A CB   1  
ATOM   1249  C CG   . LEU A 1 77  ? 0.962   6.599   6.241   1.00 0.00 ? 77  LEU A CG   1  
ATOM   1250  C CD1  . LEU A 1 77  ? 1.504   7.938   5.789   1.00 0.00 ? 77  LEU A CD1  1  
ATOM   1251  C CD2  . LEU A 1 77  ? -0.537  6.675   6.492   1.00 0.00 ? 77  LEU A CD2  1  
ATOM   1252  H H    . LEU A 1 77  ? 2.685   3.424   5.296   1.00 0.00 ? 77  LEU A H    1  
ATOM   1253  H HA   . LEU A 1 77  ? 0.219   4.152   6.448   1.00 0.00 ? 77  LEU A HA   1  
ATOM   1254  H HB2  . LEU A 1 77  ? 2.354   5.440   5.121   1.00 0.00 ? 77  LEU A HB2  1  
ATOM   1255  H HB3  . LEU A 1 77  ? 0.896   5.861   4.246   1.00 0.00 ? 77  LEU A HB3  1  
ATOM   1256  H HG   . LEU A 1 77  ? 1.447   6.345   7.169   1.00 0.00 ? 77  LEU A HG   1  
ATOM   1257  H HD11 . LEU A 1 77  ? 1.198   8.115   4.773   1.00 0.00 ? 77  LEU A HD11 1  
ATOM   1258  H HD12 . LEU A 1 77  ? 2.582   7.930   5.846   1.00 0.00 ? 77  LEU A HD12 1  
ATOM   1259  H HD13 . LEU A 1 77  ? 1.114   8.720   6.425   1.00 0.00 ? 77  LEU A HD13 1  
ATOM   1260  H HD21 . LEU A 1 77  ? -1.059  6.644   5.547   1.00 0.00 ? 77  LEU A HD21 1  
ATOM   1261  H HD22 . LEU A 1 77  ? -0.770  7.598   7.002   1.00 0.00 ? 77  LEU A HD22 1  
ATOM   1262  H HD23 . LEU A 1 77  ? -0.845  5.839   7.102   1.00 0.00 ? 77  LEU A HD23 1  
ATOM   1263  N N    . MET A 1 78  ? 0.159   3.155   3.349   1.00 0.00 ? 78  MET A N    1  
ATOM   1264  C CA   . MET A 1 78  ? -0.716  2.661   2.299   1.00 0.00 ? 78  MET A CA   1  
ATOM   1265  C C    . MET A 1 78  ? -1.636  1.567   2.844   1.00 0.00 ? 78  MET A C    1  
ATOM   1266  O O    . MET A 1 78  ? -2.855  1.647   2.700   1.00 0.00 ? 78  MET A O    1  
ATOM   1267  C CB   . MET A 1 78  ? 0.108   2.168   1.104   1.00 0.00 ? 78  MET A CB   1  
ATOM   1268  C CG   . MET A 1 78  ? -0.700  1.404   0.068   1.00 0.00 ? 78  MET A CG   1  
ATOM   1269  S SD   . MET A 1 78  ? -0.715  -0.367  0.393   1.00 0.00 ? 78  MET A SD   1  
ATOM   1270  C CE   . MET A 1 78  ? 0.975   -0.804  -0.019  1.00 0.00 ? 78  MET A CE   1  
ATOM   1271  H H    . MET A 1 78  ? 1.130   3.034   3.260   1.00 0.00 ? 78  MET A H    1  
ATOM   1272  H HA   . MET A 1 78  ? -1.331  3.489   1.978   1.00 0.00 ? 78  MET A HA   1  
ATOM   1273  H HB2  . MET A 1 78  ? 0.558   3.021   0.617   1.00 0.00 ? 78  MET A HB2  1  
ATOM   1274  H HB3  . MET A 1 78  ? 0.892   1.518   1.468   1.00 0.00 ? 78  MET A HB3  1  
ATOM   1275  H HG2  . MET A 1 78  ? -1.721  1.771   0.080   1.00 0.00 ? 78  MET A HG2  1  
ATOM   1276  H HG3  . MET A 1 78  ? -0.265  1.574   -0.907  1.00 0.00 ? 78  MET A HG3  1  
ATOM   1277  H HE1  . MET A 1 78  ? 1.664   -0.215  0.569   1.00 0.00 ? 78  MET A HE1  1  
ATOM   1278  H HE2  . MET A 1 78  ? 1.144   -0.616  -1.065  1.00 0.00 ? 78  MET A HE2  1  
ATOM   1279  H HE3  . MET A 1 78  ? 1.133   -1.853  0.186   1.00 0.00 ? 78  MET A HE3  1  
ATOM   1280  N N    . PHE A 1 79  ? -1.059  0.562   3.494   1.00 0.00 ? 79  PHE A N    1  
ATOM   1281  C CA   . PHE A 1 79  ? -1.866  -0.482  4.127   1.00 0.00 ? 79  PHE A CA   1  
ATOM   1282  C C    . PHE A 1 79  ? -2.778  0.117   5.205   1.00 0.00 ? 79  PHE A C    1  
ATOM   1283  O O    . PHE A 1 79  ? -3.909  -0.337  5.405   1.00 0.00 ? 79  PHE A O    1  
ATOM   1284  C CB   . PHE A 1 79  ? -0.983  -1.576  4.742   1.00 0.00 ? 79  PHE A CB   1  
ATOM   1285  C CG   . PHE A 1 79  ? -0.112  -2.300  3.750   1.00 0.00 ? 79  PHE A CG   1  
ATOM   1286  C CD1  . PHE A 1 79  ? -0.669  -3.009  2.698   1.00 0.00 ? 79  PHE A CD1  1  
ATOM   1287  C CD2  . PHE A 1 79  ? 1.265   -2.277  3.880   1.00 0.00 ? 79  PHE A CD2  1  
ATOM   1288  C CE1  . PHE A 1 79  ? 0.134   -3.678  1.790   1.00 0.00 ? 79  PHE A CE1  1  
ATOM   1289  C CE2  . PHE A 1 79  ? 2.073   -2.942  2.980   1.00 0.00 ? 79  PHE A CE2  1  
ATOM   1290  C CZ   . PHE A 1 79  ? 1.514   -3.643  1.932   1.00 0.00 ? 79  PHE A CZ   1  
ATOM   1291  H H    . PHE A 1 79  ? -0.076  0.506   3.523   1.00 0.00 ? 79  PHE A H    1  
ATOM   1292  H HA   . PHE A 1 79  ? -2.486  -0.923  3.361   1.00 0.00 ? 79  PHE A HA   1  
ATOM   1293  H HB2  . PHE A 1 79  ? -0.336  -1.132  5.484   1.00 0.00 ? 79  PHE A HB2  1  
ATOM   1294  H HB3  . PHE A 1 79  ? -1.618  -2.308  5.218   1.00 0.00 ? 79  PHE A HB3  1  
ATOM   1295  H HD1  . PHE A 1 79  ? -1.743  -3.031  2.586   1.00 0.00 ? 79  PHE A HD1  1  
ATOM   1296  H HD2  . PHE A 1 79  ? 1.710   -1.732  4.698   1.00 0.00 ? 79  PHE A HD2  1  
ATOM   1297  H HE1  . PHE A 1 79  ? -0.316  -4.227  0.976   1.00 0.00 ? 79  PHE A HE1  1  
ATOM   1298  H HE2  . PHE A 1 79  ? 3.142   -2.913  3.097   1.00 0.00 ? 79  PHE A HE2  1  
ATOM   1299  H HZ   . PHE A 1 79  ? 2.155   -4.159  1.221   1.00 0.00 ? 79  PHE A HZ   1  
ATOM   1300  N N    . SER A 1 80  ? -2.289  1.153   5.883   1.00 0.00 ? 80  SER A N    1  
ATOM   1301  C CA   . SER A 1 80  ? -3.043  1.799   6.949   1.00 0.00 ? 80  SER A CA   1  
ATOM   1302  C C    . SER A 1 80  ? -4.299  2.486   6.416   1.00 0.00 ? 80  SER A C    1  
ATOM   1303  O O    . SER A 1 80  ? -5.375  2.340   6.998   1.00 0.00 ? 80  SER A O    1  
ATOM   1304  C CB   . SER A 1 80  ? -2.165  2.807   7.695   1.00 0.00 ? 80  SER A CB   1  
ATOM   1305  O OG   . SER A 1 80  ? -1.034  2.171   8.268   1.00 0.00 ? 80  SER A OG   1  
ATOM   1306  H H    . SER A 1 80  ? -1.395  1.487   5.664   1.00 0.00 ? 80  SER A H    1  
ATOM   1307  H HA   . SER A 1 80  ? -3.346  1.028   7.642   1.00 0.00 ? 80  SER A HA   1  
ATOM   1308  H HB2  . SER A 1 80  ? -1.826  3.565   7.005   1.00 0.00 ? 80  SER A HB2  1  
ATOM   1309  H HB3  . SER A 1 80  ? -2.741  3.269   8.483   1.00 0.00 ? 80  SER A HB3  1  
ATOM   1310  H HG   . SER A 1 80  ? -0.559  1.681   7.580   1.00 0.00 ? 80  SER A HG   1  
ATOM   1311  N N    . ASN A 1 81  ? -4.183  3.225   5.308   1.00 0.00 ? 81  ASN A N    1  
ATOM   1312  C CA   . ASN A 1 81  ? -5.350  3.922   4.771   1.00 0.00 ? 81  ASN A CA   1  
ATOM   1313  C C    . ASN A 1 81  ? -6.388  2.916   4.270   1.00 0.00 ? 81  ASN A C    1  
ATOM   1314  O O    . ASN A 1 81  ? -7.590  3.177   4.328   1.00 0.00 ? 81  ASN A O    1  
ATOM   1315  C CB   . ASN A 1 81  ? -4.995  4.956   3.676   1.00 0.00 ? 81  ASN A CB   1  
ATOM   1316  C CG   . ASN A 1 81  ? -4.511  4.357   2.370   1.00 0.00 ? 81  ASN A CG   1  
ATOM   1317  O OD1  . ASN A 1 81  ? -5.304  3.917   1.544   1.00 0.00 ? 81  ASN A OD1  1  
ATOM   1318  N ND2  . ASN A 1 81  ? -3.209  4.396   2.147   1.00 0.00 ? 81  ASN A ND2  1  
ATOM   1319  H H    . ASN A 1 81  ? -3.311  3.303   4.858   1.00 0.00 ? 81  ASN A H    1  
ATOM   1320  H HA   . ASN A 1 81  ? -5.785  4.455   5.602   1.00 0.00 ? 81  ASN A HA   1  
ATOM   1321  H HB2  . ASN A 1 81  ? -5.870  5.553   3.459   1.00 0.00 ? 81  ASN A HB2  1  
ATOM   1322  H HB3  . ASN A 1 81  ? -4.219  5.606   4.056   1.00 0.00 ? 81  ASN A HB3  1  
ATOM   1323  H HD21 . ASN A 1 81  ? -2.633  4.803   2.829   1.00 0.00 ? 81  ASN A HD21 1  
ATOM   1324  H HD22 . ASN A 1 81  ? -2.875  4.013   1.307   1.00 0.00 ? 81  ASN A HD22 1  
ATOM   1325  N N    . CYS A 1 82  ? -5.924  1.750   3.824   1.00 0.00 ? 82  CYS A N    1  
ATOM   1326  C CA   . CYS A 1 82  ? -6.825  0.672   3.421   1.00 0.00 ? 82  CYS A CA   1  
ATOM   1327  C C    . CYS A 1 82  ? -7.712  0.239   4.588   1.00 0.00 ? 82  CYS A C    1  
ATOM   1328  O O    . CYS A 1 82  ? -8.923  0.059   4.421   1.00 0.00 ? 82  CYS A O    1  
ATOM   1329  C CB   . CYS A 1 82  ? -6.034  -0.538  2.911   1.00 0.00 ? 82  CYS A CB   1  
ATOM   1330  S SG   . CYS A 1 82  ? -4.899  -0.172  1.553   1.00 0.00 ? 82  CYS A SG   1  
ATOM   1331  H H    . CYS A 1 82  ? -4.954  1.618   3.745   1.00 0.00 ? 82  CYS A H    1  
ATOM   1332  H HA   . CYS A 1 82  ? -7.459  1.044   2.626   1.00 0.00 ? 82  CYS A HA   1  
ATOM   1333  H HB2  . CYS A 1 82  ? -5.451  -0.946  3.724   1.00 0.00 ? 82  CYS A HB2  1  
ATOM   1334  H HB3  . CYS A 1 82  ? -6.729  -1.289  2.565   1.00 0.00 ? 82  CYS A HB3  1  
ATOM   1335  H HG   . CYS A 1 82  ? -4.025  0.732   1.979   1.00 0.00 ? 82  CYS A HG   1  
ATOM   1336  N N    . TYR A 1 83  ? -7.110  0.080   5.771   1.00 0.00 ? 83  TYR A N    1  
ATOM   1337  C CA   . TYR A 1 83  ? -7.862  -0.339  6.953   1.00 0.00 ? 83  TYR A CA   1  
ATOM   1338  C C    . TYR A 1 83  ? -8.774  0.771   7.456   1.00 0.00 ? 83  TYR A C    1  
ATOM   1339  O O    . TYR A 1 83  ? -9.763  0.503   8.132   1.00 0.00 ? 83  TYR A O    1  
ATOM   1340  C CB   . TYR A 1 83  ? -6.940  -0.767  8.098   1.00 0.00 ? 83  TYR A CB   1  
ATOM   1341  C CG   . TYR A 1 83  ? -6.125  -2.017  7.825   1.00 0.00 ? 83  TYR A CG   1  
ATOM   1342  C CD1  . TYR A 1 83  ? -6.679  -3.089  7.137   1.00 0.00 ? 83  TYR A CD1  1  
ATOM   1343  C CD2  . TYR A 1 83  ? -4.806  -2.138  8.275   1.00 0.00 ? 83  TYR A CD2  1  
ATOM   1344  C CE1  . TYR A 1 83  ? -5.954  -4.239  6.901   1.00 0.00 ? 83  TYR A CE1  1  
ATOM   1345  C CE2  . TYR A 1 83  ? -4.079  -3.286  8.039   1.00 0.00 ? 83  TYR A CE2  1  
ATOM   1346  C CZ   . TYR A 1 83  ? -4.655  -4.331  7.355   1.00 0.00 ? 83  TYR A CZ   1  
ATOM   1347  O OH   . TYR A 1 83  ? -3.928  -5.474  7.125   1.00 0.00 ? 83  TYR A OH   1  
ATOM   1348  H H    . TYR A 1 83  ? -6.142  0.242   5.845   1.00 0.00 ? 83  TYR A H    1  
ATOM   1349  H HA   . TYR A 1 83  ? -8.475  -1.183  6.666   1.00 0.00 ? 83  TYR A HA   1  
ATOM   1350  H HB2  . TYR A 1 83  ? -6.251  0.036   8.313   1.00 0.00 ? 83  TYR A HB2  1  
ATOM   1351  H HB3  . TYR A 1 83  ? -7.555  -0.952  8.973   1.00 0.00 ? 83  TYR A HB3  1  
ATOM   1352  H HD1  . TYR A 1 83  ? -7.696  -3.016  6.783   1.00 0.00 ? 83  TYR A HD1  1  
ATOM   1353  H HD2  . TYR A 1 83  ? -4.344  -1.318  8.810   1.00 0.00 ? 83  TYR A HD2  1  
ATOM   1354  H HE1  . TYR A 1 83  ? -6.405  -5.059  6.363   1.00 0.00 ? 83  TYR A HE1  1  
ATOM   1355  H HE2  . TYR A 1 83  ? -3.065  -3.365  8.398   1.00 0.00 ? 83  TYR A HE2  1  
ATOM   1356  H HH   . TYR A 1 83  ? -3.596  -5.816  7.962   1.00 0.00 ? 83  TYR A HH   1  
ATOM   1357  N N    . LYS A 1 84  ? -8.437  2.015   7.142   1.00 0.00 ? 84  LYS A N    1  
ATOM   1358  C CA   . LYS A 1 84  ? -9.289  3.141   7.507   1.00 0.00 ? 84  LYS A CA   1  
ATOM   1359  C C    . LYS A 1 84  ? -10.615 3.050   6.786   1.00 0.00 ? 84  LYS A C    1  
ATOM   1360  O O    . LYS A 1 84  ? -11.684 3.224   7.378   1.00 0.00 ? 84  LYS A O    1  
ATOM   1361  C CB   . LYS A 1 84  ? -8.647  4.473   7.128   1.00 0.00 ? 84  LYS A CB   1  
ATOM   1362  C CG   . LYS A 1 84  ? -7.453  4.870   7.975   1.00 0.00 ? 84  LYS A CG   1  
ATOM   1363  C CD   . LYS A 1 84  ? -7.770  6.106   8.801   1.00 0.00 ? 84  LYS A CD   1  
ATOM   1364  C CE   . LYS A 1 84  ? -8.108  7.301   7.917   1.00 0.00 ? 84  LYS A CE   1  
ATOM   1365  N NZ   . LYS A 1 84  ? -8.617  8.453   8.707   1.00 0.00 ? 84  LYS A NZ   1  
ATOM   1366  H H    . LYS A 1 84  ? -7.598  2.179   6.660   1.00 0.00 ? 84  LYS A H    1  
ATOM   1367  H HA   . LYS A 1 84  ? -9.457  3.113   8.572   1.00 0.00 ? 84  LYS A HA   1  
ATOM   1368  H HB2  . LYS A 1 84  ? -8.334  4.423   6.100   1.00 0.00 ? 84  LYS A HB2  1  
ATOM   1369  H HB3  . LYS A 1 84  ? -9.395  5.244   7.222   1.00 0.00 ? 84  LYS A HB3  1  
ATOM   1370  H HG2  . LYS A 1 84  ? -7.204  4.056   8.638   1.00 0.00 ? 84  LYS A HG2  1  
ATOM   1371  H HG3  . LYS A 1 84  ? -6.616  5.084   7.329   1.00 0.00 ? 84  LYS A HG3  1  
ATOM   1372  H HD2  . LYS A 1 84  ? -8.614  5.892   9.437   1.00 0.00 ? 84  LYS A HD2  1  
ATOM   1373  H HD3  . LYS A 1 84  ? -6.911  6.350   9.409   1.00 0.00 ? 84  LYS A HD3  1  
ATOM   1374  H HE2  . LYS A 1 84  ? -7.213  7.607   7.396   1.00 0.00 ? 84  LYS A HE2  1  
ATOM   1375  H HE3  . LYS A 1 84  ? -8.861  7.008   7.194   1.00 0.00 ? 84  LYS A HE3  1  
ATOM   1376  H HZ1  . LYS A 1 84  ? -9.462  8.174   9.247   1.00 0.00 ? 84  LYS A HZ1  1  
ATOM   1377  H HZ2  . LYS A 1 84  ? -8.873  9.236   8.072   1.00 0.00 ? 84  LYS A HZ2  1  
ATOM   1378  H HZ3  . LYS A 1 84  ? -7.887  8.784   9.371   1.00 0.00 ? 84  LYS A HZ3  1  
ATOM   1379  N N    . TYR A 1 85  ? -10.524 2.775   5.498   1.00 0.00 ? 85  TYR A N    1  
ATOM   1380  C CA   . TYR A 1 85  ? -11.672 2.826   4.628   1.00 0.00 ? 85  TYR A CA   1  
ATOM   1381  C C    . TYR A 1 85  ? -12.518 1.569   4.736   1.00 0.00 ? 85  TYR A C    1  
ATOM   1382  O O    . TYR A 1 85  ? -13.689 1.619   5.113   1.00 0.00 ? 85  TYR A O    1  
ATOM   1383  C CB   . TYR A 1 85  ? -11.226 3.011   3.181   1.00 0.00 ? 85  TYR A CB   1  
ATOM   1384  C CG   . TYR A 1 85  ? -12.392 3.278   2.259   1.00 0.00 ? 85  TYR A CG   1  
ATOM   1385  C CD1  . TYR A 1 85  ? -13.032 4.498   2.334   1.00 0.00 ? 85  TYR A CD1  1  
ATOM   1386  C CD2  . TYR A 1 85  ? -12.869 2.336   1.347   1.00 0.00 ? 85  TYR A CD2  1  
ATOM   1387  C CE1  . TYR A 1 85  ? -14.112 4.793   1.534   1.00 0.00 ? 85  TYR A CE1  1  
ATOM   1388  C CE2  . TYR A 1 85  ? -13.951 2.623   0.538   1.00 0.00 ? 85  TYR A CE2  1  
ATOM   1389  C CZ   . TYR A 1 85  ? -14.569 3.854   0.637   1.00 0.00 ? 85  TYR A CZ   1  
ATOM   1390  O OH   . TYR A 1 85  ? -15.646 4.150   -0.164  1.00 0.00 ? 85  TYR A OH   1  
ATOM   1391  H H    . TYR A 1 85  ? -9.650  2.529   5.123   1.00 0.00 ? 85  TYR A H    1  
ATOM   1392  H HA   . TYR A 1 85  ? -12.267 3.682   4.917   1.00 0.00 ? 85  TYR A HA   1  
ATOM   1393  H HB2  . TYR A 1 85  ? -10.561 3.857   3.129   1.00 0.00 ? 85  TYR A HB2  1  
ATOM   1394  H HB3  . TYR A 1 85  ? -10.704 2.125   2.845   1.00 0.00 ? 85  TYR A HB3  1  
ATOM   1395  H HD1  . TYR A 1 85  ? -12.667 5.226   3.039   1.00 0.00 ? 85  TYR A HD1  1  
ATOM   1396  H HD2  . TYR A 1 85  ? -12.387 1.372   1.270   1.00 0.00 ? 85  TYR A HD2  1  
ATOM   1397  H HE1  . TYR A 1 85  ? -14.596 5.754   1.618   1.00 0.00 ? 85  TYR A HE1  1  
ATOM   1398  H HE2  . TYR A 1 85  ? -14.313 1.882   -0.163  1.00 0.00 ? 85  TYR A HE2  1  
ATOM   1399  H HH   . TYR A 1 85  ? -15.560 5.047   -0.489  1.00 0.00 ? 85  TYR A HH   1  
ATOM   1400  N N    . ASN A 1 86  ? -11.908 0.443   4.414   1.00 0.00 ? 86  ASN A N    1  
ATOM   1401  C CA   . ASN A 1 86  ? -12.636 -0.805  4.278   1.00 0.00 ? 86  ASN A CA   1  
ATOM   1402  C C    . ASN A 1 86  ? -12.779 -1.494  5.621   1.00 0.00 ? 86  ASN A C    1  
ATOM   1403  O O    . ASN A 1 86  ? -11.796 -1.673  6.343   1.00 0.00 ? 86  ASN A O    1  
ATOM   1404  C CB   . ASN A 1 86  ? -11.921 -1.737  3.297   1.00 0.00 ? 86  ASN A CB   1  
ATOM   1405  C CG   . ASN A 1 86  ? -11.719 -1.109  1.936   1.00 0.00 ? 86  ASN A CG   1  
ATOM   1406  O OD1  . ASN A 1 86  ? -12.561 -1.244  1.047   1.00 0.00 ? 86  ASN A OD1  1  
ATOM   1407  N ND2  . ASN A 1 86  ? -10.595 -0.431  1.762   1.00 0.00 ? 86  ASN A ND2  1  
ATOM   1408  H H    . ASN A 1 86  ? -10.936 0.448   4.283   1.00 0.00 ? 86  ASN A H    1  
ATOM   1409  H HA   . ASN A 1 86  ? -13.617 -0.575  3.894   1.00 0.00 ? 86  ASN A HA   1  
ATOM   1410  H HB2  . ASN A 1 86  ? -10.952 -1.998  3.699   1.00 0.00 ? 86  ASN A HB2  1  
ATOM   1411  H HB3  . ASN A 1 86  ? -12.511 -2.634  3.172   1.00 0.00 ? 86  ASN A HB3  1  
ATOM   1412  H HD21 . ASN A 1 86  ? -9.962  -0.377  2.513   1.00 0.00 ? 86  ASN A HD21 1  
ATOM   1413  H HD22 . ASN A 1 86  ? -10.444 0.010   0.899   1.00 0.00 ? 86  ASN A HD22 1  
ATOM   1414  N N    . PRO A 1 87  ? -14.011 -1.869  5.985   1.00 0.00 ? 87  PRO A N    1  
ATOM   1415  C CA   . PRO A 1 87  ? -14.269 -2.637  7.201   1.00 0.00 ? 87  PRO A CA   1  
ATOM   1416  C C    . PRO A 1 87  ? -13.650 -4.029  7.109   1.00 0.00 ? 87  PRO A C    1  
ATOM   1417  O O    . PRO A 1 87  ? -13.389 -4.530  6.012   1.00 0.00 ? 87  PRO A O    1  
ATOM   1418  C CB   . PRO A 1 87  ? -15.799 -2.723  7.260   1.00 0.00 ? 87  PRO A CB   1  
ATOM   1419  C CG   . PRO A 1 87  ? -16.261 -2.484  5.866   1.00 0.00 ? 87  PRO A CG   1  
ATOM   1420  C CD   . PRO A 1 87  ? -15.248 -1.571  5.240   1.00 0.00 ? 87  PRO A CD   1  
ATOM   1421  H HA   . PRO A 1 87  ? -13.894 -2.131  8.079   1.00 0.00 ? 87  PRO A HA   1  
ATOM   1422  H HB2  . PRO A 1 87  ? -16.092 -3.701  7.610   1.00 0.00 ? 87  PRO A HB2  1  
ATOM   1423  H HB3  . PRO A 1 87  ? -16.177 -1.968  7.933   1.00 0.00 ? 87  PRO A HB3  1  
ATOM   1424  H HG2  . PRO A 1 87  ? -16.305 -3.420  5.329   1.00 0.00 ? 87  PRO A HG2  1  
ATOM   1425  H HG3  . PRO A 1 87  ? -17.233 -2.012  5.879   1.00 0.00 ? 87  PRO A HG3  1  
ATOM   1426  H HD2  . PRO A 1 87  ? -15.131 -1.802  4.191   1.00 0.00 ? 87  PRO A HD2  1  
ATOM   1427  H HD3  . PRO A 1 87  ? -15.537 -0.539  5.371   1.00 0.00 ? 87  PRO A HD3  1  
ATOM   1428  N N    . PRO A 1 88  ? -13.405 -4.659  8.279   1.00 0.00 ? 88  PRO A N    1  
ATOM   1429  C CA   . PRO A 1 88  ? -12.695 -5.947  8.395   1.00 0.00 ? 88  PRO A CA   1  
ATOM   1430  C C    . PRO A 1 88  ? -13.278 -7.053  7.523   1.00 0.00 ? 88  PRO A C    1  
ATOM   1431  O O    . PRO A 1 88  ? -12.611 -8.048  7.241   1.00 0.00 ? 88  PRO A O    1  
ATOM   1432  C CB   . PRO A 1 88  ? -12.852 -6.324  9.874   1.00 0.00 ? 88  PRO A CB   1  
ATOM   1433  C CG   . PRO A 1 88  ? -13.892 -5.405  10.416  1.00 0.00 ? 88  PRO A CG   1  
ATOM   1434  C CD   . PRO A 1 88  ? -13.797 -4.153  9.601   1.00 0.00 ? 88  PRO A CD   1  
ATOM   1435  H HA   . PRO A 1 88  ? -11.645 -5.835  8.167   1.00 0.00 ? 88  PRO A HA   1  
ATOM   1436  H HB2  . PRO A 1 88  ? -13.166 -7.354  9.947   1.00 0.00 ? 88  PRO A HB2  1  
ATOM   1437  H HB3  . PRO A 1 88  ? -11.910 -6.195  10.381  1.00 0.00 ? 88  PRO A HB3  1  
ATOM   1438  H HG2  . PRO A 1 88  ? -14.870 -5.851  10.307  1.00 0.00 ? 88  PRO A HG2  1  
ATOM   1439  H HG3  . PRO A 1 88  ? -13.690 -5.193  11.455  1.00 0.00 ? 88  PRO A HG3  1  
ATOM   1440  H HD2  . PRO A 1 88  ? -14.754 -3.654  9.558   1.00 0.00 ? 88  PRO A HD2  1  
ATOM   1441  H HD3  . PRO A 1 88  ? -13.040 -3.495  10.002  1.00 0.00 ? 88  PRO A HD3  1  
ATOM   1442  N N    . ASP A 1 89  ? -14.522 -6.882  7.112   1.00 0.00 ? 89  ASP A N    1  
ATOM   1443  C CA   . ASP A 1 89  ? -15.175 -7.856  6.242   1.00 0.00 ? 89  ASP A CA   1  
ATOM   1444  C C    . ASP A 1 89  ? -15.165 -7.348  4.803   1.00 0.00 ? 89  ASP A C    1  
ATOM   1445  O O    . ASP A 1 89  ? -16.202 -6.989  4.244   1.00 0.00 ? 89  ASP A O    1  
ATOM   1446  C CB   . ASP A 1 89  ? -16.619 -8.140  6.703   1.00 0.00 ? 89  ASP A CB   1  
ATOM   1447  C CG   . ASP A 1 89  ? -17.245 -9.313  5.972   1.00 0.00 ? 89  ASP A CG   1  
ATOM   1448  O OD1  . ASP A 1 89  ? -18.115 -9.092  5.104   1.00 0.00 ? 89  ASP A OD1  1  
ATOM   1449  O OD2  . ASP A 1 89  ? -16.877 -10.469 6.271   1.00 0.00 ? 89  ASP A OD2  1  
ATOM   1450  H H    . ASP A 1 89  ? -14.999 -6.071  7.382   1.00 0.00 ? 89  ASP A H    1  
ATOM   1451  H HA   . ASP A 1 89  ? -14.602 -8.773  6.288   1.00 0.00 ? 89  ASP A HA   1  
ATOM   1452  H HB2  . ASP A 1 89  ? -16.618 -8.368  7.760   1.00 0.00 ? 89  ASP A HB2  1  
ATOM   1453  H HB3  . ASP A 1 89  ? -17.231 -7.266  6.527   1.00 0.00 ? 89  ASP A HB3  1  
ATOM   1454  N N    . HIS A 1 90  ? -13.978 -7.291  4.209   1.00 0.00 ? 90  HIS A N    1  
ATOM   1455  C CA   . HIS A 1 90  ? -13.842 -6.837  2.833   1.00 0.00 ? 90  HIS A CA   1  
ATOM   1456  C C    . HIS A 1 90  ? -12.580 -7.426  2.200   1.00 0.00 ? 90  HIS A C    1  
ATOM   1457  O O    . HIS A 1 90  ? -11.641 -7.790  2.903   1.00 0.00 ? 90  HIS A O    1  
ATOM   1458  C CB   . HIS A 1 90  ? -13.785 -5.304  2.763   1.00 0.00 ? 90  HIS A CB   1  
ATOM   1459  C CG   . HIS A 1 90  ? -14.468 -4.727  1.546   1.00 0.00 ? 90  HIS A CG   1  
ATOM   1460  N ND1  . HIS A 1 90  ? -13.825 -4.584  0.336   1.00 0.00 ? 90  HIS A ND1  1  
ATOM   1461  C CD2  . HIS A 1 90  ? -15.739 -4.269  1.340   1.00 0.00 ? 90  HIS A CD2  1  
ATOM   1462  C CE1  . HIS A 1 90  ? -14.656 -4.073  -0.549  1.00 0.00 ? 90  HIS A CE1  1  
ATOM   1463  N NE2  . HIS A 1 90  ? -15.821 -3.874  0.030   1.00 0.00 ? 90  HIS A NE2  1  
ATOM   1464  H H    . HIS A 1 90  ? -13.177 -7.570  4.705   1.00 0.00 ? 90  HIS A H    1  
ATOM   1465  H HA   . HIS A 1 90  ? -14.705 -7.187  2.286   1.00 0.00 ? 90  HIS A HA   1  
ATOM   1466  H HB2  . HIS A 1 90  ? -14.235 -4.887  3.651   1.00 0.00 ? 90  HIS A HB2  1  
ATOM   1467  H HB3  . HIS A 1 90  ? -12.748 -5.001  2.728   1.00 0.00 ? 90  HIS A HB3  1  
ATOM   1468  H HD1  . HIS A 1 90  ? -12.899 -4.821  0.152   1.00 0.00 ? 90  HIS A HD1  1  
ATOM   1469  H HD2  . HIS A 1 90  ? -16.537 -4.211  2.063   1.00 0.00 ? 90  HIS A HD2  1  
ATOM   1470  H HE1  . HIS A 1 90  ? -14.422 -3.855  -1.580  1.00 0.00 ? 90  HIS A HE1  1  
ATOM   1471  H HE2  . HIS A 1 90  ? -16.658 -3.687  -0.449  1.00 0.00 ? 90  HIS A HE2  1  
ATOM   1472  N N    . ASP A 1 91  ? -12.556 -7.508  0.879   1.00 0.00 ? 91  ASP A N    1  
ATOM   1473  C CA   . ASP A 1 91  ? -11.410 -8.070  0.159   1.00 0.00 ? 91  ASP A CA   1  
ATOM   1474  C C    . ASP A 1 91  ? -10.126 -7.277  0.391   1.00 0.00 ? 91  ASP A C    1  
ATOM   1475  O O    . ASP A 1 91  ? -9.065  -7.855  0.617   1.00 0.00 ? 91  ASP A O    1  
ATOM   1476  C CB   . ASP A 1 91  ? -11.697 -8.128  -1.344  1.00 0.00 ? 91  ASP A CB   1  
ATOM   1477  C CG   . ASP A 1 91  ? -12.656 -9.239  -1.718  1.00 0.00 ? 91  ASP A CG   1  
ATOM   1478  O OD1  . ASP A 1 91  ? -12.239 -10.172 -2.440  1.00 0.00 ? 91  ASP A OD1  1  
ATOM   1479  O OD2  . ASP A 1 91  ? -13.824 -9.194  -1.280  1.00 0.00 ? 91  ASP A OD2  1  
ATOM   1480  H H    . ASP A 1 91  ? -13.344 -7.220  0.369   1.00 0.00 ? 91  ASP A H    1  
ATOM   1481  H HA   . ASP A 1 91  ? -11.260 -9.075  0.520   1.00 0.00 ? 91  ASP A HA   1  
ATOM   1482  H HB2  . ASP A 1 91  ? -12.124 -7.188  -1.658  1.00 0.00 ? 91  ASP A HB2  1  
ATOM   1483  H HB3  . ASP A 1 91  ? -10.770 -8.288  -1.871  1.00 0.00 ? 91  ASP A HB3  1  
ATOM   1484  N N    . VAL A 1 92  ? -10.227 -5.953  0.360   1.00 0.00 ? 92  VAL A N    1  
ATOM   1485  C CA   . VAL A 1 92  ? -9.037  -5.103  0.360   1.00 0.00 ? 92  VAL A CA   1  
ATOM   1486  C C    . VAL A 1 92  ? -8.305  -5.152  1.698   1.00 0.00 ? 92  VAL A C    1  
ATOM   1487  O O    . VAL A 1 92  ? -7.114  -4.875  1.757   1.00 0.00 ? 92  VAL A O    1  
ATOM   1488  C CB   . VAL A 1 92  ? -9.352  -3.634  -0.010  1.00 0.00 ? 92  VAL A CB   1  
ATOM   1489  C CG1  . VAL A 1 92  ? -8.361  -3.120  -1.039  1.00 0.00 ? 92  VAL A CG1  1  
ATOM   1490  C CG2  . VAL A 1 92  ? -10.766 -3.491  -0.537  1.00 0.00 ? 92  VAL A CG2  1  
ATOM   1491  H H    . VAL A 1 92  ? -11.108 -5.542  0.348   1.00 0.00 ? 92  VAL A H    1  
ATOM   1492  H HA   . VAL A 1 92  ? -8.372  -5.488  -0.391  1.00 0.00 ? 92  VAL A HA   1  
ATOM   1493  H HB   . VAL A 1 92  ? -9.253  -3.030  0.876   1.00 0.00 ? 92  VAL A HB   1  
ATOM   1494  H HG11 . VAL A 1 92  ? -7.361  -3.368  -0.733  1.00 0.00 ? 92  VAL A HG11 1  
ATOM   1495  H HG12 . VAL A 1 92  ? -8.456  -2.048  -1.125  1.00 0.00 ? 92  VAL A HG12 1  
ATOM   1496  H HG13 . VAL A 1 92  ? -8.567  -3.577  -1.995  1.00 0.00 ? 92  VAL A HG13 1  
ATOM   1497  H HG21 . VAL A 1 92  ? -11.458 -3.805  0.221   1.00 0.00 ? 92  VAL A HG21 1  
ATOM   1498  H HG22 . VAL A 1 92  ? -10.889 -4.107  -1.415  1.00 0.00 ? 92  VAL A HG22 1  
ATOM   1499  H HG23 . VAL A 1 92  ? -10.954 -2.458  -0.791  1.00 0.00 ? 92  VAL A HG23 1  
ATOM   1500  N N    . VAL A 1 93  ? -9.002  -5.528  2.766   1.00 0.00 ? 93  VAL A N    1  
ATOM   1501  C CA   . VAL A 1 93  ? -8.351  -5.652  4.064   1.00 0.00 ? 93  VAL A CA   1  
ATOM   1502  C C    . VAL A 1 93  ? -7.650  -7.003  4.172   1.00 0.00 ? 93  VAL A C    1  
ATOM   1503  O O    . VAL A 1 93  ? -6.565  -7.107  4.734   1.00 0.00 ? 93  VAL A O    1  
ATOM   1504  C CB   . VAL A 1 93  ? -9.331  -5.468  5.251   1.00 0.00 ? 93  VAL A CB   1  
ATOM   1505  C CG1  . VAL A 1 93  ? -10.041 -4.132  5.148   1.00 0.00 ? 93  VAL A CG1  1  
ATOM   1506  C CG2  . VAL A 1 93  ? -10.347 -6.594  5.324   1.00 0.00 ? 93  VAL A CG2  1  
ATOM   1507  H H    . VAL A 1 93  ? -9.954  -5.733  2.679   1.00 0.00 ? 93  VAL A H    1  
ATOM   1508  H HA   . VAL A 1 93  ? -7.601  -4.874  4.123   1.00 0.00 ? 93  VAL A HA   1  
ATOM   1509  H HB   . VAL A 1 93  ? -8.758  -5.474  6.167   1.00 0.00 ? 93  VAL A HB   1  
ATOM   1510  H HG11 . VAL A 1 93  ? -10.707 -4.148  4.297   1.00 0.00 ? 93  VAL A HG11 1  
ATOM   1511  H HG12 . VAL A 1 93  ? -9.313  -3.345  5.022   1.00 0.00 ? 93  VAL A HG12 1  
ATOM   1512  H HG13 . VAL A 1 93  ? -10.611 -3.956  6.048   1.00 0.00 ? 93  VAL A HG13 1  
ATOM   1513  H HG21 . VAL A 1 93  ? -10.953 -6.588  4.430   1.00 0.00 ? 93  VAL A HG21 1  
ATOM   1514  H HG22 . VAL A 1 93  ? -10.978 -6.455  6.189   1.00 0.00 ? 93  VAL A HG22 1  
ATOM   1515  H HG23 . VAL A 1 93  ? -9.830  -7.540  5.403   1.00 0.00 ? 93  VAL A HG23 1  
ATOM   1516  N N    . ALA A 1 94  ? -8.265  -8.031  3.597   1.00 0.00 ? 94  ALA A N    1  
ATOM   1517  C CA   . ALA A 1 94  ? -7.682  -9.364  3.589   1.00 0.00 ? 94  ALA A CA   1  
ATOM   1518  C C    . ALA A 1 94  ? -6.439  -9.395  2.707   1.00 0.00 ? 94  ALA A C    1  
ATOM   1519  O O    . ALA A 1 94  ? -5.437  -10.028 3.049   1.00 0.00 ? 94  ALA A O    1  
ATOM   1520  C CB   . ALA A 1 94  ? -8.706  -10.385 3.120   1.00 0.00 ? 94  ALA A CB   1  
ATOM   1521  H H    . ALA A 1 94  ? -9.138  -7.889  3.176   1.00 0.00 ? 94  ALA A H    1  
ATOM   1522  H HA   . ALA A 1 94  ? -7.397  -9.610  4.602   1.00 0.00 ? 94  ALA A HA   1  
ATOM   1523  H HB1  . ALA A 1 94  ? -9.018  -10.145 2.114   1.00 0.00 ? 94  ALA A HB1  1  
ATOM   1524  H HB2  . ALA A 1 94  ? -9.562  -10.365 3.777   1.00 0.00 ? 94  ALA A HB2  1  
ATOM   1525  H HB3  . ALA A 1 94  ? -8.265  -11.370 3.133   1.00 0.00 ? 94  ALA A HB3  1  
ATOM   1526  N N    . MET A 1 95  ? -6.508  -8.698  1.577   1.00 0.00 ? 95  MET A N    1  
ATOM   1527  C CA   . MET A 1 95  ? -5.357  -8.563  0.693   1.00 0.00 ? 95  MET A CA   1  
ATOM   1528  C C    . MET A 1 95  ? -4.276  -7.717  1.362   1.00 0.00 ? 95  MET A C    1  
ATOM   1529  O O    . MET A 1 95  ? -3.085  -8.002  1.226   1.00 0.00 ? 95  MET A O    1  
ATOM   1530  C CB   . MET A 1 95  ? -5.761  -7.951  -0.659  1.00 0.00 ? 95  MET A CB   1  
ATOM   1531  C CG   . MET A 1 95  ? -6.658  -8.854  -1.507  1.00 0.00 ? 95  MET A CG   1  
ATOM   1532  S SD   . MET A 1 95  ? -6.899  -8.232  -3.187  1.00 0.00 ? 95  MET A SD   1  
ATOM   1533  C CE   . MET A 1 95  ? -8.363  -7.217  -2.998  1.00 0.00 ? 95  MET A CE   1  
ATOM   1534  H H    . MET A 1 95  ? -7.358  -8.274  1.328   1.00 0.00 ? 95  MET A H    1  
ATOM   1535  H HA   . MET A 1 95  ? -4.955  -9.552  0.522   1.00 0.00 ? 95  MET A HA   1  
ATOM   1536  H HB2  . MET A 1 95  ? -6.287  -7.025  -0.478  1.00 0.00 ? 95  MET A HB2  1  
ATOM   1537  H HB3  . MET A 1 95  ? -4.863  -7.740  -1.224  1.00 0.00 ? 95  MET A HB3  1  
ATOM   1538  H HG2  . MET A 1 95  ? -6.212  -9.836  -1.568  1.00 0.00 ? 95  MET A HG2  1  
ATOM   1539  H HG3  . MET A 1 95  ? -7.625  -8.930  -1.025  1.00 0.00 ? 95  MET A HG3  1  
ATOM   1540  H HE1  . MET A 1 95  ? -8.222  -6.517  -2.190  1.00 0.00 ? 95  MET A HE1  1  
ATOM   1541  H HE2  . MET A 1 95  ? -9.209  -7.848  -2.783  1.00 0.00 ? 95  MET A HE2  1  
ATOM   1542  H HE3  . MET A 1 95  ? -8.543  -6.675  -3.915  1.00 0.00 ? 95  MET A HE3  1  
ATOM   1543  N N    . ALA A 1 96  ? -4.698  -6.698  2.113   1.00 0.00 ? 96  ALA A N    1  
ATOM   1544  C CA   . ALA A 1 96  ? -3.763  -5.836  2.832   1.00 0.00 ? 96  ALA A CA   1  
ATOM   1545  C C    . ALA A 1 96  ? -3.040  -6.617  3.922   1.00 0.00 ? 96  ALA A C    1  
ATOM   1546  O O    . ALA A 1 96  ? -1.840  -6.453  4.113   1.00 0.00 ? 96  ALA A O    1  
ATOM   1547  C CB   . ALA A 1 96  ? -4.480  -4.641  3.434   1.00 0.00 ? 96  ALA A CB   1  
ATOM   1548  H H    . ALA A 1 96  ? -5.661  -6.521  2.185   1.00 0.00 ? 96  ALA A H    1  
ATOM   1549  H HA   . ALA A 1 96  ? -3.039  -5.464  2.123   1.00 0.00 ? 96  ALA A HA   1  
ATOM   1550  H HB1  . ALA A 1 96  ? -4.772  -3.965  2.645   1.00 0.00 ? 96  ALA A HB1  1  
ATOM   1551  H HB2  . ALA A 1 96  ? -3.819  -4.132  4.120   1.00 0.00 ? 96  ALA A HB2  1  
ATOM   1552  H HB3  . ALA A 1 96  ? -5.359  -4.978  3.964   1.00 0.00 ? 96  ALA A HB3  1  
ATOM   1553  N N    . ARG A 1 97  ? -3.776  -7.469  4.630   1.00 0.00 ? 97  ARG A N    1  
ATOM   1554  C CA   . ARG A 1 97  ? -3.195  -8.288  5.691   1.00 0.00 ? 97  ARG A CA   1  
ATOM   1555  C C    . ARG A 1 97  ? -2.123  -9.221  5.143   1.00 0.00 ? 97  ARG A C    1  
ATOM   1556  O O    . ARG A 1 97  ? -1.042  -9.346  5.720   1.00 0.00 ? 97  ARG A O    1  
ATOM   1557  C CB   . ARG A 1 97  ? -4.267  -9.115  6.399   1.00 0.00 ? 97  ARG A CB   1  
ATOM   1558  C CG   . ARG A 1 97  ? -5.246  -8.283  7.208   1.00 0.00 ? 97  ARG A CG   1  
ATOM   1559  C CD   . ARG A 1 97  ? -6.180  -9.158  8.020   1.00 0.00 ? 97  ARG A CD   1  
ATOM   1560  N NE   . ARG A 1 97  ? -5.464  -9.917  9.042   1.00 0.00 ? 97  ARG A NE   1  
ATOM   1561  C CZ   . ARG A 1 97  ? -5.912  -11.044 9.587   1.00 0.00 ? 97  ARG A CZ   1  
ATOM   1562  N NH1  . ARG A 1 97  ? -7.077  -11.555 9.209   1.00 0.00 ? 97  ARG A NH1  1  
ATOM   1563  N NH2  . ARG A 1 97  ? -5.193  -11.656 10.516  1.00 0.00 ? 97  ARG A NH2  1  
ATOM   1564  H H    . ARG A 1 97  ? -4.739  -7.534  4.447   1.00 0.00 ? 97  ARG A H    1  
ATOM   1565  H HA   . ARG A 1 97  ? -2.741  -7.621  6.408   1.00 0.00 ? 97  ARG A HA   1  
ATOM   1566  H HB2  . ARG A 1 97  ? -4.825  -9.667  5.656   1.00 0.00 ? 97  ARG A HB2  1  
ATOM   1567  H HB3  . ARG A 1 97  ? -3.784  -9.814  7.066   1.00 0.00 ? 97  ARG A HB3  1  
ATOM   1568  H HG2  . ARG A 1 97  ? -4.690  -7.649  7.881   1.00 0.00 ? 97  ARG A HG2  1  
ATOM   1569  H HG3  . ARG A 1 97  ? -5.830  -7.674  6.534   1.00 0.00 ? 97  ARG A HG3  1  
ATOM   1570  H HD2  . ARG A 1 97  ? -6.913  -8.530  8.501   1.00 0.00 ? 97  ARG A HD2  1  
ATOM   1571  H HD3  . ARG A 1 97  ? -6.678  -9.848  7.354   1.00 0.00 ? 97  ARG A HD3  1  
ATOM   1572  H HE   . ARG A 1 97  ? -4.597  -9.558  9.344   1.00 0.00 ? 97  ARG A HE   1  
ATOM   1573  H HH11 . ARG A 1 97  ? -7.628  -11.094 8.510   1.00 0.00 ? 97  ARG A HH11 1  
ATOM   1574  H HH12 . ARG A 1 97  ? -7.411  -12.406 9.621   1.00 0.00 ? 97  ARG A HH12 1  
ATOM   1575  H HH21 . ARG A 1 97  ? -4.313  -11.267 10.808  1.00 0.00 ? 97  ARG A HH21 1  
ATOM   1576  H HH22 . ARG A 1 97  ? -5.520  -12.509 10.932  1.00 0.00 ? 97  ARG A HH22 1  
ATOM   1577  N N    . LYS A 1 98  ? -2.430  -9.870  4.029   1.00 0.00 ? 98  LYS A N    1  
ATOM   1578  C CA   . LYS A 1 98  ? -1.512  -10.829 3.429   1.00 0.00 ? 98  LYS A CA   1  
ATOM   1579  C C    . LYS A 1 98  ? -0.272  -10.123 2.883   1.00 0.00 ? 98  LYS A C    1  
ATOM   1580  O O    . LYS A 1 98  ? 0.855   -10.516 3.176   1.00 0.00 ? 98  LYS A O    1  
ATOM   1581  C CB   . LYS A 1 98  ? -2.214  -11.617 2.321   1.00 0.00 ? 98  LYS A CB   1  
ATOM   1582  C CG   . LYS A 1 98  ? -1.371  -12.750 1.767   1.00 0.00 ? 98  LYS A CG   1  
ATOM   1583  C CD   . LYS A 1 98  ? -2.068  -13.473 0.631   1.00 0.00 ? 98  LYS A CD   1  
ATOM   1584  C CE   . LYS A 1 98  ? -1.165  -14.531 0.030   1.00 0.00 ? 98  LYS A CE   1  
ATOM   1585  N NZ   . LYS A 1 98  ? -0.647  -15.473 1.059   1.00 0.00 ? 98  LYS A NZ   1  
ATOM   1586  H H    . LYS A 1 98  ? -3.296  -9.698  3.599   1.00 0.00 ? 98  LYS A H    1  
ATOM   1587  H HA   . LYS A 1 98  ? -1.203  -11.515 4.204   1.00 0.00 ? 98  LYS A HA   1  
ATOM   1588  H HB2  . LYS A 1 98  ? -3.124  -12.038 2.719   1.00 0.00 ? 98  LYS A HB2  1  
ATOM   1589  H HB3  . LYS A 1 98  ? -2.461  -10.946 1.514   1.00 0.00 ? 98  LYS A HB3  1  
ATOM   1590  H HG2  . LYS A 1 98  ? -0.434  -12.354 1.408   1.00 0.00 ? 98  LYS A HG2  1  
ATOM   1591  H HG3  . LYS A 1 98  ? -1.180  -13.455 2.560   1.00 0.00 ? 98  LYS A HG3  1  
ATOM   1592  H HD2  . LYS A 1 98  ? -2.962  -13.944 1.009   1.00 0.00 ? 98  LYS A HD2  1  
ATOM   1593  H HD3  . LYS A 1 98  ? -2.326  -12.758 -0.134  1.00 0.00 ? 98  LYS A HD3  1  
ATOM   1594  H HE2  . LYS A 1 98  ? -1.726  -15.088 -0.706  1.00 0.00 ? 98  LYS A HE2  1  
ATOM   1595  H HE3  . LYS A 1 98  ? -0.335  -14.039 -0.452  1.00 0.00 ? 98  LYS A HE3  1  
ATOM   1596  H HZ1  . LYS A 1 98  ? -1.432  -16.000 1.490   1.00 0.00 ? 98  LYS A HZ1  1  
ATOM   1597  H HZ2  . LYS A 1 98  ? -0.143  -14.952 1.805   1.00 0.00 ? 98  LYS A HZ2  1  
ATOM   1598  H HZ3  . LYS A 1 98  ? 0.012   -16.150 0.625   1.00 0.00 ? 98  LYS A HZ3  1  
ATOM   1599  N N    . LEU A 1 99  ? -0.485  -9.080  2.092   1.00 0.00 ? 99  LEU A N    1  
ATOM   1600  C CA   . LEU A 1 99  ? 0.613   -8.259  1.594   1.00 0.00 ? 99  LEU A CA   1  
ATOM   1601  C C    . LEU A 1 99  ? 1.398   -7.609  2.734   1.00 0.00 ? 99  LEU A C    1  
ATOM   1602  O O    . LEU A 1 99  ? 2.588   -7.326  2.592   1.00 0.00 ? 99  LEU A O    1  
ATOM   1603  C CB   . LEU A 1 99  ? 0.101   -7.172  0.651   1.00 0.00 ? 99  LEU A CB   1  
ATOM   1604  C CG   . LEU A 1 99  ? 0.217   -7.438  -0.857  1.00 0.00 ? 99  LEU A CG   1  
ATOM   1605  C CD1  . LEU A 1 99  ? 0.777   -6.211  -1.529  1.00 0.00 ? 99  LEU A CD1  1  
ATOM   1606  C CD2  . LEU A 1 99  ? 1.111   -8.622  -1.179  1.00 0.00 ? 99  LEU A CD2  1  
ATOM   1607  H H    . LEU A 1 99  ? -1.398  -8.869  1.817   1.00 0.00 ? 99  LEU A H    1  
ATOM   1608  H HA   . LEU A 1 99  ? 1.281   -8.903  1.052   1.00 0.00 ? 99  LEU A HA   1  
ATOM   1609  H HB2  . LEU A 1 99  ? -0.939  -6.995  0.875   1.00 0.00 ? 99  LEU A HB2  1  
ATOM   1610  H HB3  . LEU A 1 99  ? 0.642   -6.275  0.869   1.00 0.00 ? 99  LEU A HB3  1  
ATOM   1611  H HG   . LEU A 1 99  ? -0.764  -7.627  -1.265  1.00 0.00 ? 99  LEU A HG   1  
ATOM   1612  H HD11 . LEU A 1 99  ? 1.820   -6.130  -1.280  1.00 0.00 ? 99  LEU A HD11 1  
ATOM   1613  H HD12 . LEU A 1 99  ? 0.252   -5.335  -1.179  1.00 0.00 ? 99  LEU A HD12 1  
ATOM   1614  H HD13 . LEU A 1 99  ? 0.666   -6.298  -2.598  1.00 0.00 ? 99  LEU A HD13 1  
ATOM   1615  H HD21 . LEU A 1 99  ? 2.141   -8.349  -0.989  1.00 0.00 ? 99  LEU A HD21 1  
ATOM   1616  H HD22 . LEU A 1 99  ? 0.995   -8.880  -2.220  1.00 0.00 ? 99  LEU A HD22 1  
ATOM   1617  H HD23 . LEU A 1 99  ? 0.836   -9.467  -0.569  1.00 0.00 ? 99  LEU A HD23 1  
ATOM   1618  N N    . GLN A 1 100 ? 0.741   -7.358  3.858   1.00 0.00 ? 100 GLN A N    1  
ATOM   1619  C CA   . GLN A 1 100 ? 1.435   -6.822  5.019   1.00 0.00 ? 100 GLN A CA   1  
ATOM   1620  C C    . GLN A 1 100 ? 2.398   -7.863  5.564   1.00 0.00 ? 100 GLN A C    1  
ATOM   1621  O O    . GLN A 1 100 ? 3.481   -7.528  6.027   1.00 0.00 ? 100 GLN A O    1  
ATOM   1622  C CB   . GLN A 1 100 ? 0.443   -6.389  6.116   1.00 0.00 ? 100 GLN A CB   1  
ATOM   1623  C CG   . GLN A 1 100 ? 1.100   -5.876  7.398   1.00 0.00 ? 100 GLN A CG   1  
ATOM   1624  C CD   . GLN A 1 100 ? 0.100   -5.602  8.504   1.00 0.00 ? 100 GLN A CD   1  
ATOM   1625  O OE1  . GLN A 1 100 ? 0.413   -5.746  9.685   1.00 0.00 ? 100 GLN A OE1  1  
ATOM   1626  N NE2  . GLN A 1 100 ? -1.104  -5.200  8.137   1.00 0.00 ? 100 GLN A NE2  1  
ATOM   1627  H H    . GLN A 1 100 ? -0.226  -7.521  3.901   1.00 0.00 ? 100 GLN A H    1  
ATOM   1628  H HA   . GLN A 1 100 ? 2.006   -5.969  4.683   1.00 0.00 ? 100 GLN A HA   1  
ATOM   1629  H HB2  . GLN A 1 100 ? -0.189  -5.604  5.726   1.00 0.00 ? 100 GLN A HB2  1  
ATOM   1630  H HB3  . GLN A 1 100 ? -0.176  -7.237  6.376   1.00 0.00 ? 100 GLN A HB3  1  
ATOM   1631  H HG2  . GLN A 1 100 ? 1.801   -6.618  7.751   1.00 0.00 ? 100 GLN A HG2  1  
ATOM   1632  H HG3  . GLN A 1 100 ? 1.628   -4.957  7.185   1.00 0.00 ? 100 GLN A HG3  1  
ATOM   1633  H HE21 . GLN A 1 100 ? -1.291  -5.101  7.178   1.00 0.00 ? 100 GLN A HE21 1  
ATOM   1634  H HE22 . GLN A 1 100 ? -1.761  -5.008  8.840   1.00 0.00 ? 100 GLN A HE22 1  
ATOM   1635  N N    . ASP A 1 101 ? 1.999   -9.126  5.481   1.00 0.00 ? 101 ASP A N    1  
ATOM   1636  C CA   . ASP A 1 101 ? 2.824   -10.229 5.960   1.00 0.00 ? 101 ASP A CA   1  
ATOM   1637  C C    . ASP A 1 101 ? 4.137   -10.289 5.185   1.00 0.00 ? 101 ASP A C    1  
ATOM   1638  O O    . ASP A 1 101 ? 5.214   -10.241 5.776   1.00 0.00 ? 101 ASP A O    1  
ATOM   1639  C CB   . ASP A 1 101 ? 2.070   -11.555 5.827   1.00 0.00 ? 101 ASP A CB   1  
ATOM   1640  C CG   . ASP A 1 101 ? 2.789   -12.715 6.488   1.00 0.00 ? 101 ASP A CG   1  
ATOM   1641  O OD1  . ASP A 1 101 ? 2.424   -13.068 7.633   1.00 0.00 ? 101 ASP A OD1  1  
ATOM   1642  O OD2  . ASP A 1 101 ? 3.702   -13.297 5.863   1.00 0.00 ? 101 ASP A OD2  1  
ATOM   1643  H H    . ASP A 1 101 ? 1.124   -9.325  5.080   1.00 0.00 ? 101 ASP A H    1  
ATOM   1644  H HA   . ASP A 1 101 ? 3.043   -10.051 7.003   1.00 0.00 ? 101 ASP A HA   1  
ATOM   1645  H HB2  . ASP A 1 101 ? 1.098   -11.454 6.285   1.00 0.00 ? 101 ASP A HB2  1  
ATOM   1646  H HB3  . ASP A 1 101 ? 1.944   -11.785 4.779   1.00 0.00 ? 101 ASP A HB3  1  
ATOM   1647  N N    . VAL A 1 102 ? 4.041   -10.366 3.858   1.00 0.00 ? 102 VAL A N    1  
ATOM   1648  C CA   . VAL A 1 102 ? 5.232   -10.426 3.009   1.00 0.00 ? 102 VAL A CA   1  
ATOM   1649  C C    . VAL A 1 102 ? 6.136   -9.213  3.235   1.00 0.00 ? 102 VAL A C    1  
ATOM   1650  O O    . VAL A 1 102 ? 7.320   -9.369  3.542   1.00 0.00 ? 102 VAL A O    1  
ATOM   1651  C CB   . VAL A 1 102 ? 4.880   -10.555 1.501   1.00 0.00 ? 102 VAL A CB   1  
ATOM   1652  C CG1  . VAL A 1 102 ? 3.782   -9.599  1.094   1.00 0.00 ? 102 VAL A CG1  1  
ATOM   1653  C CG2  . VAL A 1 102 ? 6.104   -10.326 0.634   1.00 0.00 ? 102 VAL A CG2  1  
ATOM   1654  H H    . VAL A 1 102 ? 3.151   -10.386 3.442   1.00 0.00 ? 102 VAL A H    1  
ATOM   1655  H HA   . VAL A 1 102 ? 5.782   -11.311 3.296   1.00 0.00 ? 102 VAL A HA   1  
ATOM   1656  H HB   . VAL A 1 102 ? 4.525   -11.553 1.320   1.00 0.00 ? 102 VAL A HB   1  
ATOM   1657  H HG11 . VAL A 1 102 ? 3.713   -9.578  0.019   1.00 0.00 ? 102 VAL A HG11 1  
ATOM   1658  H HG12 . VAL A 1 102 ? 4.009   -8.610  1.460   1.00 0.00 ? 102 VAL A HG12 1  
ATOM   1659  H HG13 . VAL A 1 102 ? 2.843   -9.932  1.510   1.00 0.00 ? 102 VAL A HG13 1  
ATOM   1660  H HG21 . VAL A 1 102 ? 6.016   -9.364  0.136   1.00 0.00 ? 102 VAL A HG21 1  
ATOM   1661  H HG22 . VAL A 1 102 ? 6.174   -11.110 -0.107  1.00 0.00 ? 102 VAL A HG22 1  
ATOM   1662  H HG23 . VAL A 1 102 ? 6.989   -10.332 1.251   1.00 0.00 ? 102 VAL A HG23 1  
ATOM   1663  N N    . PHE A 1 103 ? 5.570   -8.018  3.107   1.00 0.00 ? 103 PHE A N    1  
ATOM   1664  C CA   . PHE A 1 103 ? 6.321   -6.781  3.312   1.00 0.00 ? 103 PHE A CA   1  
ATOM   1665  C C    . PHE A 1 103 ? 6.962   -6.731  4.706   1.00 0.00 ? 103 PHE A C    1  
ATOM   1666  O O    . PHE A 1 103 ? 8.091   -6.259  4.859   1.00 0.00 ? 103 PHE A O    1  
ATOM   1667  C CB   . PHE A 1 103 ? 5.420   -5.558  3.073   1.00 0.00 ? 103 PHE A CB   1  
ATOM   1668  C CG   . PHE A 1 103 ? 5.857   -4.323  3.824   1.00 0.00 ? 103 PHE A CG   1  
ATOM   1669  C CD1  . PHE A 1 103 ? 7.078   -3.729  3.543   1.00 0.00 ? 103 PHE A CD1  1  
ATOM   1670  C CD2  . PHE A 1 103 ? 5.060   -3.768  4.823   1.00 0.00 ? 103 PHE A CD2  1  
ATOM   1671  C CE1  . PHE A 1 103 ? 7.500   -2.615  4.238   1.00 0.00 ? 103 PHE A CE1  1  
ATOM   1672  C CE2  . PHE A 1 103 ? 5.479   -2.650  5.515   1.00 0.00 ? 103 PHE A CE2  1  
ATOM   1673  C CZ   . PHE A 1 103 ? 6.700   -2.075  5.226   1.00 0.00 ? 103 PHE A CZ   1  
ATOM   1674  H H    . PHE A 1 103 ? 4.621   -7.969  2.855   1.00 0.00 ? 103 PHE A H    1  
ATOM   1675  H HA   . PHE A 1 103 ? 7.113   -6.762  2.578   1.00 0.00 ? 103 PHE A HA   1  
ATOM   1676  H HB2  . PHE A 1 103 ? 5.437   -5.326  2.016   1.00 0.00 ? 103 PHE A HB2  1  
ATOM   1677  H HB3  . PHE A 1 103 ? 4.408   -5.796  3.363   1.00 0.00 ? 103 PHE A HB3  1  
ATOM   1678  H HD1  . PHE A 1 103 ? 7.705   -4.149  2.770   1.00 0.00 ? 103 PHE A HD1  1  
ATOM   1679  H HD2  . PHE A 1 103 ? 4.101   -4.211  5.057   1.00 0.00 ? 103 PHE A HD2  1  
ATOM   1680  H HE1  . PHE A 1 103 ? 8.455   -2.165  4.009   1.00 0.00 ? 103 PHE A HE1  1  
ATOM   1681  H HE2  . PHE A 1 103 ? 4.853   -2.228  6.286   1.00 0.00 ? 103 PHE A HE2  1  
ATOM   1682  H HZ   . PHE A 1 103 ? 7.029   -1.203  5.772   1.00 0.00 ? 103 PHE A HZ   1  
ATOM   1683  N N    . GLU A 1 104 ? 6.264   -7.255  5.707   1.00 0.00 ? 104 GLU A N    1  
ATOM   1684  C CA   . GLU A 1 104 ? 6.734   -7.224  7.069   1.00 0.00 ? 104 GLU A CA   1  
ATOM   1685  C C    . GLU A 1 104 ? 8.024   -8.026  7.196   1.00 0.00 ? 104 GLU A C    1  
ATOM   1686  O O    . GLU A 1 104 ? 9.011   -7.549  7.754   1.00 0.00 ? 104 GLU A O    1  
ATOM   1687  C CB   . GLU A 1 104 ? 5.640   -7.791  7.975   1.00 0.00 ? 104 GLU A CB   1  
ATOM   1688  C CG   . GLU A 1 104 ? 6.114   -8.146  9.357   1.00 0.00 ? 104 GLU A CG   1  
ATOM   1689  C CD   . GLU A 1 104 ? 6.416   -6.931  10.213  1.00 0.00 ? 104 GLU A CD   1  
ATOM   1690  O OE1  . GLU A 1 104 ? 7.540   -6.836  10.748  1.00 0.00 ? 104 GLU A OE1  1  
ATOM   1691  O OE2  . GLU A 1 104 ? 5.530   -6.056  10.346  1.00 0.00 ? 104 GLU A OE2  1  
ATOM   1692  H H    . GLU A 1 104 ? 5.419   -7.707  5.526   1.00 0.00 ? 104 GLU A H    1  
ATOM   1693  H HA   . GLU A 1 104 ? 6.924   -6.196  7.338   1.00 0.00 ? 104 GLU A HA   1  
ATOM   1694  H HB2  . GLU A 1 104 ? 4.851   -7.060  8.067   1.00 0.00 ? 104 GLU A HB2  1  
ATOM   1695  H HB3  . GLU A 1 104 ? 5.238   -8.683  7.516   1.00 0.00 ? 104 GLU A HB3  1  
ATOM   1696  H HG2  . GLU A 1 104 ? 5.358   -8.742  9.847   1.00 0.00 ? 104 GLU A HG2  1  
ATOM   1697  H HG3  . GLU A 1 104 ? 7.010   -8.724  9.239   1.00 0.00 ? 104 GLU A HG3  1  
ATOM   1698  N N    . PHE A 1 105 ? 8.025   -9.229  6.637   1.00 0.00 ? 105 PHE A N    1  
ATOM   1699  C CA   . PHE A 1 105 ? 9.192   -10.093 6.709   1.00 0.00 ? 105 PHE A CA   1  
ATOM   1700  C C    . PHE A 1 105 ? 10.283  -9.637  5.744   1.00 0.00 ? 105 PHE A C    1  
ATOM   1701  O O    . PHE A 1 105 ? 11.459  -9.930  5.953   1.00 0.00 ? 105 PHE A O    1  
ATOM   1702  C CB   . PHE A 1 105 ? 8.807   -11.549 6.452   1.00 0.00 ? 105 PHE A CB   1  
ATOM   1703  C CG   . PHE A 1 105 ? 7.989   -12.141 7.563   1.00 0.00 ? 105 PHE A CG   1  
ATOM   1704  C CD1  . PHE A 1 105 ? 6.611   -12.212 7.465   1.00 0.00 ? 105 PHE A CD1  1  
ATOM   1705  C CD2  . PHE A 1 105 ? 8.599   -12.616 8.712   1.00 0.00 ? 105 PHE A CD2  1  
ATOM   1706  C CE1  . PHE A 1 105 ? 5.856   -12.744 8.491   1.00 0.00 ? 105 PHE A CE1  1  
ATOM   1707  C CE2  . PHE A 1 105 ? 7.850   -13.151 9.739   1.00 0.00 ? 105 PHE A CE2  1  
ATOM   1708  C CZ   . PHE A 1 105 ? 6.476   -13.215 9.629   1.00 0.00 ? 105 PHE A CZ   1  
ATOM   1709  H H    . PHE A 1 105 ? 7.218   -9.544  6.171   1.00 0.00 ? 105 PHE A H    1  
ATOM   1710  H HA   . PHE A 1 105 ? 9.581   -10.017 7.713   1.00 0.00 ? 105 PHE A HA   1  
ATOM   1711  H HB2  . PHE A 1 105 ? 8.228   -11.607 5.543   1.00 0.00 ? 105 PHE A HB2  1  
ATOM   1712  H HB3  . PHE A 1 105 ? 9.704   -12.140 6.343   1.00 0.00 ? 105 PHE A HB3  1  
ATOM   1713  H HD1  . PHE A 1 105 ? 6.124   -11.845 6.574   1.00 0.00 ? 105 PHE A HD1  1  
ATOM   1714  H HD2  . PHE A 1 105 ? 9.672   -12.567 8.803   1.00 0.00 ? 105 PHE A HD2  1  
ATOM   1715  H HE1  . PHE A 1 105 ? 4.781   -12.792 8.401   1.00 0.00 ? 105 PHE A HE1  1  
ATOM   1716  H HE2  . PHE A 1 105 ? 8.339   -13.519 10.628  1.00 0.00 ? 105 PHE A HE2  1  
ATOM   1717  H HZ   . PHE A 1 105 ? 5.888   -13.630 10.432  1.00 0.00 ? 105 PHE A HZ   1  
ATOM   1718  N N    . ARG A 1 106 ? 9.904   -8.906  4.700   1.00 0.00 ? 106 ARG A N    1  
ATOM   1719  C CA   . ARG A 1 106 ? 10.884  -8.321  3.797   1.00 0.00 ? 106 ARG A CA   1  
ATOM   1720  C C    . ARG A 1 106 ? 11.695  -7.267  4.538   1.00 0.00 ? 106 ARG A C    1  
ATOM   1721  O O    . ARG A 1 106 ? 12.924  -7.248  4.471   1.00 0.00 ? 106 ARG A O    1  
ATOM   1722  C CB   . ARG A 1 106 ? 10.205  -7.692  2.577   1.00 0.00 ? 106 ARG A CB   1  
ATOM   1723  C CG   . ARG A 1 106 ? 9.597   -8.693  1.609   1.00 0.00 ? 106 ARG A CG   1  
ATOM   1724  C CD   . ARG A 1 106 ? 10.653  -9.616  1.025   1.00 0.00 ? 106 ARG A CD   1  
ATOM   1725  N NE   . ARG A 1 106 ? 10.084  -10.584 0.093   1.00 0.00 ? 106 ARG A NE   1  
ATOM   1726  C CZ   . ARG A 1 106 ? 10.716  -11.674 -0.339  1.00 0.00 ? 106 ARG A CZ   1  
ATOM   1727  N NH1  . ARG A 1 106 ? 11.933  -11.967 0.105   1.00 0.00 ? 106 ARG A NH1  1  
ATOM   1728  N NH2  . ARG A 1 106 ? 10.126  -12.469 -1.219  1.00 0.00 ? 106 ARG A NH2  1  
ATOM   1729  H H    . ARG A 1 106 ? 8.948   -8.758  4.532   1.00 0.00 ? 106 ARG A H    1  
ATOM   1730  H HA   . ARG A 1 106 ? 11.549  -9.107  3.472   1.00 0.00 ? 106 ARG A HA   1  
ATOM   1731  H HB2  . ARG A 1 106 ? 9.419   -7.037  2.919   1.00 0.00 ? 106 ARG A HB2  1  
ATOM   1732  H HB3  . ARG A 1 106 ? 10.935  -7.110  2.042   1.00 0.00 ? 106 ARG A HB3  1  
ATOM   1733  H HG2  . ARG A 1 106 ? 8.864   -9.287  2.132   1.00 0.00 ? 106 ARG A HG2  1  
ATOM   1734  H HG3  . ARG A 1 106 ? 9.118   -8.152  0.803   1.00 0.00 ? 106 ARG A HG3  1  
ATOM   1735  H HD2  . ARG A 1 106 ? 11.383  -9.018  0.503   1.00 0.00 ? 106 ARG A HD2  1  
ATOM   1736  H HD3  . ARG A 1 106 ? 11.134  -10.146 1.831   1.00 0.00 ? 106 ARG A HD3  1  
ATOM   1737  H HE   . ARG A 1 106 ? 9.173   -10.399 -0.250  1.00 0.00 ? 106 ARG A HE   1  
ATOM   1738  H HH11 . ARG A 1 106 ? 12.381  -11.370 0.770   1.00 0.00 ? 106 ARG A HH11 1  
ATOM   1739  H HH12 . ARG A 1 106 ? 12.411  -12.783 -0.233  1.00 0.00 ? 106 ARG A HH12 1  
ATOM   1740  H HH21 . ARG A 1 106 ? 9.202   -12.241 -1.556  1.00 0.00 ? 106 ARG A HH21 1  
ATOM   1741  H HH22 . ARG A 1 106 ? 10.593  -13.291 -1.559  1.00 0.00 ? 106 ARG A HH22 1  
ATOM   1742  N N    . TYR A 1 107 ? 10.995  -6.404  5.262   1.00 0.00 ? 107 TYR A N    1  
ATOM   1743  C CA   . TYR A 1 107 ? 11.651  -5.378  6.064   1.00 0.00 ? 107 TYR A CA   1  
ATOM   1744  C C    . TYR A 1 107 ? 12.340  -6.013  7.273   1.00 0.00 ? 107 TYR A C    1  
ATOM   1745  O O    . TYR A 1 107 ? 13.364  -5.522  7.745   1.00 0.00 ? 107 TYR A O    1  
ATOM   1746  C CB   . TYR A 1 107 ? 10.645  -4.308  6.515   1.00 0.00 ? 107 TYR A CB   1  
ATOM   1747  C CG   . TYR A 1 107 ? 11.297  -3.085  7.126   1.00 0.00 ? 107 TYR A CG   1  
ATOM   1748  C CD1  . TYR A 1 107 ? 11.610  -1.976  6.349   1.00 0.00 ? 107 TYR A CD1  1  
ATOM   1749  C CD2  . TYR A 1 107 ? 11.615  -3.047  8.477   1.00 0.00 ? 107 TYR A CD2  1  
ATOM   1750  C CE1  . TYR A 1 107 ? 12.222  -0.870  6.903   1.00 0.00 ? 107 TYR A CE1  1  
ATOM   1751  C CE2  . TYR A 1 107 ? 12.222  -1.941  9.036   1.00 0.00 ? 107 TYR A CE2  1  
ATOM   1752  C CZ   . TYR A 1 107 ? 12.525  -0.856  8.244   1.00 0.00 ? 107 TYR A CZ   1  
ATOM   1753  O OH   . TYR A 1 107 ? 13.141  0.243   8.794   1.00 0.00 ? 107 TYR A OH   1  
ATOM   1754  H H    . TYR A 1 107 ? 10.011  -6.452  5.246   1.00 0.00 ? 107 TYR A H    1  
ATOM   1755  H HA   . TYR A 1 107 ? 12.404  -4.911  5.445   1.00 0.00 ? 107 TYR A HA   1  
ATOM   1756  H HB2  . TYR A 1 107 ? 10.068  -3.988  5.660   1.00 0.00 ? 107 TYR A HB2  1  
ATOM   1757  H HB3  . TYR A 1 107 ? 9.981   -4.731  7.258   1.00 0.00 ? 107 TYR A HB3  1  
ATOM   1758  H HD1  . TYR A 1 107 ? 11.367  -1.983  5.299   1.00 0.00 ? 107 TYR A HD1  1  
ATOM   1759  H HD2  . TYR A 1 107 ? 11.378  -3.899  9.097   1.00 0.00 ? 107 TYR A HD2  1  
ATOM   1760  H HE1  . TYR A 1 107 ? 12.456  -0.019  6.287   1.00 0.00 ? 107 TYR A HE1  1  
ATOM   1761  H HE2  . TYR A 1 107 ? 12.459  -1.932  10.088  1.00 0.00 ? 107 TYR A HE2  1  
ATOM   1762  H HH   . TYR A 1 107 ? 13.862  -0.046  9.365   1.00 0.00 ? 107 TYR A HH   1  
ATOM   1763  N N    . ALA A 1 108 ? 11.782  -7.120  7.757   1.00 0.00 ? 108 ALA A N    1  
ATOM   1764  C CA   . ALA A 1 108 ? 12.356  -7.833  8.892   1.00 0.00 ? 108 ALA A CA   1  
ATOM   1765  C C    . ALA A 1 108 ? 13.693  -8.466  8.525   1.00 0.00 ? 108 ALA A C    1  
ATOM   1766  O O    . ALA A 1 108 ? 14.591  -8.565  9.360   1.00 0.00 ? 108 ALA A O    1  
ATOM   1767  C CB   . ALA A 1 108 ? 11.394  -8.896  9.403   1.00 0.00 ? 108 ALA A CB   1  
ATOM   1768  H H    . ALA A 1 108 ? 10.958  -7.460  7.348   1.00 0.00 ? 108 ALA A H    1  
ATOM   1769  H HA   . ALA A 1 108 ? 12.516  -7.117  9.686   1.00 0.00 ? 108 ALA A HA   1  
ATOM   1770  H HB1  . ALA A 1 108 ? 10.426  -8.451  9.578   1.00 0.00 ? 108 ALA A HB1  1  
ATOM   1771  H HB2  . ALA A 1 108 ? 11.772  -9.310  10.326  1.00 0.00 ? 108 ALA A HB2  1  
ATOM   1772  H HB3  . ALA A 1 108 ? 11.302  -9.681  8.668   1.00 0.00 ? 108 ALA A HB3  1  
ATOM   1773  N N    . LYS A 1 109 ? 13.825  -8.898  7.276   1.00 0.00 ? 109 LYS A N    1  
ATOM   1774  C CA   . LYS A 1 109 ? 15.084  -9.463  6.809   1.00 0.00 ? 109 LYS A CA   1  
ATOM   1775  C C    . LYS A 1 109 ? 16.053  -8.349  6.456   1.00 0.00 ? 109 LYS A C    1  
ATOM   1776  O O    . LYS A 1 109 ? 17.269  -8.527  6.509   1.00 0.00 ? 109 LYS A O    1  
ATOM   1777  C CB   . LYS A 1 109 ? 14.877  -10.375 5.597   1.00 0.00 ? 109 LYS A CB   1  
ATOM   1778  C CG   . LYS A 1 109 ? 15.267  -11.827 5.857   1.00 0.00 ? 109 LYS A CG   1  
ATOM   1779  C CD   . LYS A 1 109 ? 14.327  -12.513 6.839   1.00 0.00 ? 109 LYS A CD   1  
ATOM   1780  C CE   . LYS A 1 109 ? 12.928  -12.678 6.260   1.00 0.00 ? 109 LYS A CE   1  
ATOM   1781  N NZ   . LYS A 1 109 ? 12.914  -13.592 5.087   1.00 0.00 ? 109 LYS A NZ   1  
ATOM   1782  H H    . LYS A 1 109 ? 13.064  -8.832  6.657   1.00 0.00 ? 109 LYS A H    1  
ATOM   1783  H HA   . LYS A 1 109 ? 15.504  -10.043 7.617   1.00 0.00 ? 109 LYS A HA   1  
ATOM   1784  H HB2  . LYS A 1 109 ? 13.838  -10.342 5.304   1.00 0.00 ? 109 LYS A HB2  1  
ATOM   1785  H HB3  . LYS A 1 109 ? 15.481  -10.007 4.782   1.00 0.00 ? 109 LYS A HB3  1  
ATOM   1786  H HG2  . LYS A 1 109 ? 15.243  -12.366 4.924   1.00 0.00 ? 109 LYS A HG2  1  
ATOM   1787  H HG3  . LYS A 1 109 ? 16.270  -11.850 6.258   1.00 0.00 ? 109 LYS A HG3  1  
ATOM   1788  H HD2  . LYS A 1 109 ? 14.722  -13.490 7.071   1.00 0.00 ? 109 LYS A HD2  1  
ATOM   1789  H HD3  . LYS A 1 109 ? 14.269  -11.926 7.744   1.00 0.00 ? 109 LYS A HD3  1  
ATOM   1790  H HE2  . LYS A 1 109 ? 12.280  -13.078 7.025   1.00 0.00 ? 109 LYS A HE2  1  
ATOM   1791  H HE3  . LYS A 1 109 ? 12.563  -11.708 5.952   1.00 0.00 ? 109 LYS A HE3  1  
ATOM   1792  H HZ1  . LYS A 1 109 ? 13.332  -14.510 5.344   1.00 0.00 ? 109 LYS A HZ1  1  
ATOM   1793  H HZ2  . LYS A 1 109 ? 13.458  -13.181 4.302   1.00 0.00 ? 109 LYS A HZ2  1  
ATOM   1794  H HZ3  . LYS A 1 109 ? 11.934  -13.750 4.769   1.00 0.00 ? 109 LYS A HZ3  1  
ATOM   1795  N N    . MET A 1 110 ? 15.501  -7.202  6.088   1.00 0.00 ? 110 MET A N    1  
ATOM   1796  C CA   . MET A 1 110 ? 16.300  -6.021  5.794   1.00 0.00 ? 110 MET A CA   1  
ATOM   1797  C C    . MET A 1 110 ? 17.025  -5.545  7.049   1.00 0.00 ? 110 MET A C    1  
ATOM   1798  O O    . MET A 1 110 ? 16.388  -5.245  8.060   1.00 0.00 ? 110 MET A O    1  
ATOM   1799  C CB   . MET A 1 110 ? 15.409  -4.904  5.222   1.00 0.00 ? 110 MET A CB   1  
ATOM   1800  C CG   . MET A 1 110 ? 16.082  -3.539  5.134   1.00 0.00 ? 110 MET A CG   1  
ATOM   1801  S SD   . MET A 1 110 ? 15.884  -2.570  6.641   1.00 0.00 ? 110 MET A SD   1  
ATOM   1802  C CE   . MET A 1 110 ? 16.673  -1.043  6.158   1.00 0.00 ? 110 MET A CE   1  
ATOM   1803  H H    . MET A 1 110 ? 14.524  -7.149  6.015   1.00 0.00 ? 110 MET A H    1  
ATOM   1804  H HA   . MET A 1 110 ? 17.032  -6.301  5.053   1.00 0.00 ? 110 MET A HA   1  
ATOM   1805  H HB2  . MET A 1 110 ? 15.093  -5.186  4.229   1.00 0.00 ? 110 MET A HB2  1  
ATOM   1806  H HB3  . MET A 1 110 ? 14.535  -4.804  5.849   1.00 0.00 ? 110 MET A HB3  1  
ATOM   1807  H HG2  . MET A 1 110 ? 17.137  -3.687  4.959   1.00 0.00 ? 110 MET A HG2  1  
ATOM   1808  H HG3  . MET A 1 110 ? 15.657  -2.987  4.309   1.00 0.00 ? 110 MET A HG3  1  
ATOM   1809  H HE1  . MET A 1 110 ? 16.110  -0.590  5.350   1.00 0.00 ? 110 MET A HE1  1  
ATOM   1810  H HE2  . MET A 1 110 ? 17.681  -1.247  5.827   1.00 0.00 ? 110 MET A HE2  1  
ATOM   1811  H HE3  . MET A 1 110 ? 16.700  -0.368  7.001   1.00 0.00 ? 110 MET A HE3  1  
ATOM   1812  N N    . PRO A 1 111 ? 18.366  -5.503  7.019   1.00 0.00 ? 111 PRO A N    1  
ATOM   1813  C CA   . PRO A 1 111 ? 19.150  -5.005  8.135   1.00 0.00 ? 111 PRO A CA   1  
ATOM   1814  C C    . PRO A 1 111 ? 19.298  -3.491  8.092   1.00 0.00 ? 111 PRO A C    1  
ATOM   1815  O O    . PRO A 1 111 ? 19.380  -2.888  7.017   1.00 0.00 ? 111 PRO A O    1  
ATOM   1816  C CB   . PRO A 1 111 ? 20.499  -5.686  7.949   1.00 0.00 ? 111 PRO A CB   1  
ATOM   1817  C CG   . PRO A 1 111 ? 20.623  -5.920  6.478   1.00 0.00 ? 111 PRO A CG   1  
ATOM   1818  C CD   . PRO A 1 111 ? 19.224  -5.944  5.904   1.00 0.00 ? 111 PRO A CD   1  
ATOM   1819  H HA   . PRO A 1 111 ? 18.721  -5.297  9.082   1.00 0.00 ? 111 PRO A HA   1  
ATOM   1820  H HB2  . PRO A 1 111 ? 21.281  -5.036  8.316   1.00 0.00 ? 111 PRO A HB2  1  
ATOM   1821  H HB3  . PRO A 1 111 ? 20.512  -6.615  8.498   1.00 0.00 ? 111 PRO A HB3  1  
ATOM   1822  H HG2  . PRO A 1 111 ? 21.192  -5.120  6.031   1.00 0.00 ? 111 PRO A HG2  1  
ATOM   1823  H HG3  . PRO A 1 111 ? 21.113  -6.867  6.302   1.00 0.00 ? 111 PRO A HG3  1  
ATOM   1824  H HD2  . PRO A 1 111 ? 19.152  -5.256  5.071   1.00 0.00 ? 111 PRO A HD2  1  
ATOM   1825  H HD3  . PRO A 1 111 ? 18.964  -6.950  5.592   1.00 0.00 ? 111 PRO A HD3  1  
ATOM   1826  N N    . ASP A 1 112 ? 19.330  -2.888  9.262   1.00 0.00 ? 112 ASP A N    1  
ATOM   1827  C CA   . ASP A 1 112 ? 19.424  -1.444  9.378   1.00 0.00 ? 112 ASP A CA   1  
ATOM   1828  C C    . ASP A 1 112 ? 20.565  -1.076  10.308  1.00 0.00 ? 112 ASP A C    1  
ATOM   1829  O O    . ASP A 1 112 ? 21.610  -0.607  9.814   1.00 0.00 ? 112 ASP A O    1  
ATOM   1830  C CB   . ASP A 1 112 ? 18.109  -0.861  9.897   1.00 0.00 ? 112 ASP A CB   1  
ATOM   1831  C CG   . ASP A 1 112 ? 18.136  0.652   9.970   1.00 0.00 ? 112 ASP A CG   1  
ATOM   1832  O OD1  . ASP A 1 112 ? 18.335  1.199   11.075  1.00 0.00 ? 112 ASP A OD1  1  
ATOM   1833  O OD2  . ASP A 1 112 ? 17.959  1.303   8.921   1.00 0.00 ? 112 ASP A OD2  1  
ATOM   1834  O OXT  . ASP A 1 112 ? 20.434  -1.307  11.529  1.00 0.00 ? 112 ASP A OXT  1  
ATOM   1835  H H    . ASP A 1 112 ? 19.301  -3.432  10.076  1.00 0.00 ? 112 ASP A H    1  
ATOM   1836  H HA   . ASP A 1 112 ? 19.628  -1.044  8.396   1.00 0.00 ? 112 ASP A HA   1  
ATOM   1837  H HB2  . ASP A 1 112 ? 17.307  -1.156  9.237   1.00 0.00 ? 112 ASP A HB2  1  
ATOM   1838  H HB3  . ASP A 1 112 ? 17.917  -1.248  10.886  1.00 0.00 ? 112 ASP A HB3  1  
ATOM   1839  N N    . HIS B 2 1   ? -14.194 1.868   9.150   1.00 0.00 ? 281 HIS B N    1  
ATOM   1840  C CA   . HIS B 2 1   ? -15.212 2.440   10.060  1.00 0.00 ? 281 HIS B CA   1  
ATOM   1841  C C    . HIS B 2 1   ? -16.439 1.545   10.120  1.00 0.00 ? 281 HIS B C    1  
ATOM   1842  O O    . HIS B 2 1   ? -16.444 0.455   9.546   1.00 0.00 ? 281 HIS B O    1  
ATOM   1843  C CB   . HIS B 2 1   ? -15.621 3.845   9.606   1.00 0.00 ? 281 HIS B CB   1  
ATOM   1844  C CG   . HIS B 2 1   ? -14.750 4.936   10.142  1.00 0.00 ? 281 HIS B CG   1  
ATOM   1845  N ND1  . HIS B 2 1   ? -15.192 5.859   11.060  1.00 0.00 ? 281 HIS B ND1  1  
ATOM   1846  C CD2  . HIS B 2 1   ? -13.462 5.258   9.880   1.00 0.00 ? 281 HIS B CD2  1  
ATOM   1847  C CE1  . HIS B 2 1   ? -14.218 6.700   11.339  1.00 0.00 ? 281 HIS B CE1  1  
ATOM   1848  N NE2  . HIS B 2 1   ? -13.153 6.359   10.638  1.00 0.00 ? 281 HIS B NE2  1  
ATOM   1849  H H1   . HIS B 2 1   ? -13.327 2.440   9.166   1.00 0.00 ? 281 HIS B H1   1  
ATOM   1850  H H2   . HIS B 2 1   ? -14.560 1.838   8.178   1.00 0.00 ? 281 HIS B H2   1  
ATOM   1851  H H3   . HIS B 2 1   ? -13.960 0.898   9.446   1.00 0.00 ? 281 HIS B H3   1  
ATOM   1852  H HA   . HIS B 2 1   ? -14.781 2.501   11.048  1.00 0.00 ? 281 HIS B HA   1  
ATOM   1853  H HB2  . HIS B 2 1   ? -15.582 3.893   8.529   1.00 0.00 ? 281 HIS B HB2  1  
ATOM   1854  H HB3  . HIS B 2 1   ? -16.633 4.038   9.931   1.00 0.00 ? 281 HIS B HB3  1  
ATOM   1855  H HD1  . HIS B 2 1   ? -16.093 5.889   11.455  1.00 0.00 ? 281 HIS B HD1  1  
ATOM   1856  H HD2  . HIS B 2 1   ? -12.800 4.744   9.197   1.00 0.00 ? 281 HIS B HD2  1  
ATOM   1857  H HE1  . HIS B 2 1   ? -14.280 7.530   12.026  1.00 0.00 ? 281 HIS B HE1  1  
ATOM   1858  H HE2  . HIS B 2 1   ? -12.237 6.640   10.858  1.00 0.00 ? 281 HIS B HE2  1  
ATOM   1859  N N    . ASN B 2 2   ? -17.473 2.010   10.812  1.00 0.00 ? 282 ASN B N    1  
ATOM   1860  C CA   . ASN B 2 2   ? -18.711 1.249   10.971  1.00 0.00 ? 282 ASN B CA   1  
ATOM   1861  C C    . ASN B 2 2   ? -19.292 0.835   9.617   1.00 0.00 ? 282 ASN B C    1  
ATOM   1862  O O    . ASN B 2 2   ? -19.725 -0.306  9.444   1.00 0.00 ? 282 ASN B O    1  
ATOM   1863  C CB   . ASN B 2 2   ? -19.743 2.056   11.776  1.00 0.00 ? 282 ASN B CB   1  
ATOM   1864  C CG   . ASN B 2 2   ? -20.136 3.374   11.124  1.00 0.00 ? 282 ASN B CG   1  
ATOM   1865  O OD1  . ASN B 2 2   ? -19.343 4.002   10.416  1.00 0.00 ? 282 ASN B OD1  1  
ATOM   1866  N ND2  . ASN B 2 2   ? -21.362 3.809   11.365  1.00 0.00 ? 282 ASN B ND2  1  
ATOM   1867  H H    . ASN B 2 2   ? -17.403 2.893   11.239  1.00 0.00 ? 282 ASN B H    1  
ATOM   1868  H HA   . ASN B 2 2   ? -18.468 0.354   11.524  1.00 0.00 ? 282 ASN B HA   1  
ATOM   1869  H HB2  . ASN B 2 2   ? -20.636 1.461   11.892  1.00 0.00 ? 282 ASN B HB2  1  
ATOM   1870  H HB3  . ASN B 2 2   ? -19.334 2.269   12.753  1.00 0.00 ? 282 ASN B HB3  1  
ATOM   1871  H HD21 . ASN B 2 2   ? -21.940 3.267   11.944  1.00 0.00 ? 282 ASN B HD21 1  
ATOM   1872  H HD22 . ASN B 2 2   ? -21.646 4.653   10.951  1.00 0.00 ? 282 ASN B HD22 1  
ATOM   1873  N N    . LEU B 2 3   ? -19.290 1.757   8.660   1.00 0.00 ? 283 LEU B N    1  
ATOM   1874  C CA   . LEU B 2 3   ? -19.762 1.464   7.314   1.00 0.00 ? 283 LEU B CA   1  
ATOM   1875  C C    . LEU B 2 3   ? -19.316 2.548   6.340   1.00 0.00 ? 283 LEU B C    1  
ATOM   1876  O O    . LEU B 2 3   ? -18.388 2.340   5.557   1.00 0.00 ? 283 LEU B O    1  
ATOM   1877  C CB   . LEU B 2 3   ? -21.291 1.343   7.292   1.00 0.00 ? 283 LEU B CB   1  
ATOM   1878  C CG   . LEU B 2 3   ? -21.899 0.964   5.937   1.00 0.00 ? 283 LEU B CG   1  
ATOM   1879  C CD1  . LEU B 2 3   ? -21.417 -0.409  5.496   1.00 0.00 ? 283 LEU B CD1  1  
ATOM   1880  C CD2  . LEU B 2 3   ? -23.418 0.998   6.007   1.00 0.00 ? 283 LEU B CD2  1  
ATOM   1881  H H    . LEU B 2 3   ? -18.968 2.660   8.869   1.00 0.00 ? 283 LEU B H    1  
ATOM   1882  H HA   . LEU B 2 3   ? -19.330 0.523   7.009   1.00 0.00 ? 283 LEU B HA   1  
ATOM   1883  H HB2  . LEU B 2 3   ? -21.580 0.594   8.013   1.00 0.00 ? 283 LEU B HB2  1  
ATOM   1884  H HB3  . LEU B 2 3   ? -21.710 2.290   7.596   1.00 0.00 ? 283 LEU B HB3  1  
ATOM   1885  H HG   . LEU B 2 3   ? -21.582 1.682   5.195   1.00 0.00 ? 283 LEU B HG   1  
ATOM   1886  H HD11 . LEU B 2 3   ? -21.885 -0.672  4.559   1.00 0.00 ? 283 LEU B HD11 1  
ATOM   1887  H HD12 . LEU B 2 3   ? -21.678 -1.141  6.246   1.00 0.00 ? 283 LEU B HD12 1  
ATOM   1888  H HD13 . LEU B 2 3   ? -20.344 -0.391  5.369   1.00 0.00 ? 283 LEU B HD13 1  
ATOM   1889  H HD21 . LEU B 2 3   ? -23.744 1.988   6.287   1.00 0.00 ? 283 LEU B HD21 1  
ATOM   1890  H HD22 . LEU B 2 3   ? -23.760 0.284   6.742   1.00 0.00 ? 283 LEU B HD22 1  
ATOM   1891  H HD23 . LEU B 2 3   ? -23.828 0.743   5.041   1.00 0.00 ? 283 LEU B HD23 1  
ATOM   1892  N N    . LEU B 2 4   ? -19.962 3.710   6.425   1.00 0.00 ? 284 LEU B N    1  
ATOM   1893  C CA   . LEU B 2 4   ? -19.757 4.798   5.471   1.00 0.00 ? 284 LEU B CA   1  
ATOM   1894  C C    . LEU B 2 4   ? -20.039 4.314   4.049   1.00 0.00 ? 284 LEU B C    1  
ATOM   1895  O O    . LEU B 2 4   ? -21.196 4.171   3.648   1.00 0.00 ? 284 LEU B O    1  
ATOM   1896  C CB   . LEU B 2 4   ? -18.336 5.374   5.576   1.00 0.00 ? 284 LEU B CB   1  
ATOM   1897  C CG   . LEU B 2 4   ? -17.966 5.960   6.940   1.00 0.00 ? 284 LEU B CG   1  
ATOM   1898  C CD1  . LEU B 2 4   ? -16.501 6.348   6.975   1.00 0.00 ? 284 LEU B CD1  1  
ATOM   1899  C CD2  . LEU B 2 4   ? -18.840 7.162   7.265   1.00 0.00 ? 284 LEU B CD2  1  
ATOM   1900  H H    . LEU B 2 4   ? -20.604 3.841   7.156   1.00 0.00 ? 284 LEU B H    1  
ATOM   1901  H HA   . LEU B 2 4   ? -20.466 5.577   5.712   1.00 0.00 ? 284 LEU B HA   1  
ATOM   1902  H HB2  . LEU B 2 4   ? -17.636 4.584   5.347   1.00 0.00 ? 284 LEU B HB2  1  
ATOM   1903  H HB3  . LEU B 2 4   ? -18.231 6.151   4.834   1.00 0.00 ? 284 LEU B HB3  1  
ATOM   1904  H HG   . LEU B 2 4   ? -18.127 5.215   7.698   1.00 0.00 ? 284 LEU B HG   1  
ATOM   1905  H HD11 . LEU B 2 4   ? -15.893 5.480   6.769   1.00 0.00 ? 284 LEU B HD11 1  
ATOM   1906  H HD12 . LEU B 2 4   ? -16.255 6.736   7.952   1.00 0.00 ? 284 LEU B HD12 1  
ATOM   1907  H HD13 . LEU B 2 4   ? -16.311 7.105   6.230   1.00 0.00 ? 284 LEU B HD13 1  
ATOM   1908  H HD21 . LEU B 2 4   ? -18.712 7.916   6.503   1.00 0.00 ? 284 LEU B HD21 1  
ATOM   1909  H HD22 . LEU B 2 4   ? -18.552 7.567   8.223   1.00 0.00 ? 284 LEU B HD22 1  
ATOM   1910  H HD23 . LEU B 2 4   ? -19.874 6.857   7.299   1.00 0.00 ? 284 LEU B HD23 1  
ATOM   1911  N N    . ARG B 2 5   ? -18.985 4.031   3.303   1.00 0.00 ? 285 ARG B N    1  
ATOM   1912  C CA   . ARG B 2 5   ? -19.117 3.474   1.970   1.00 0.00 ? 285 ARG B CA   1  
ATOM   1913  C C    . ARG B 2 5   ? -18.049 2.409   1.780   1.00 0.00 ? 285 ARG B C    1  
ATOM   1914  O O    . ARG B 2 5   ? -16.921 2.571   2.242   1.00 0.00 ? 285 ARG B O    1  
ATOM   1915  C CB   . ARG B 2 5   ? -18.992 4.566   0.896   1.00 0.00 ? 285 ARG B CB   1  
ATOM   1916  C CG   . ARG B 2 5   ? -19.972 5.720   1.079   1.00 0.00 ? 285 ARG B CG   1  
ATOM   1917  C CD   . ARG B 2 5   ? -20.040 6.617   -0.143  1.00 0.00 ? 285 ARG B CD   1  
ATOM   1918  N NE   . ARG B 2 5   ? -20.596 5.924   -1.305  1.00 0.00 ? 285 ARG B NE   1  
ATOM   1919  C CZ   . ARG B 2 5   ? -21.845 6.088   -1.745  1.00 0.00 ? 285 ARG B CZ   1  
ATOM   1920  N NH1  . ARG B 2 5   ? -22.678 6.905   -1.107  1.00 0.00 ? 285 ARG B NH1  1  
ATOM   1921  N NH2  . ARG B 2 5   ? -22.262 5.426   -2.817  1.00 0.00 ? 285 ARG B NH2  1  
ATOM   1922  H H    . ARG B 2 5   ? -18.087 4.183   3.665   1.00 0.00 ? 285 ARG B H    1  
ATOM   1923  H HA   . ARG B 2 5   ? -20.090 3.011   1.898   1.00 0.00 ? 285 ARG B HA   1  
ATOM   1924  H HB2  . ARG B 2 5   ? -17.990 4.968   0.921   1.00 0.00 ? 285 ARG B HB2  1  
ATOM   1925  H HB3  . ARG B 2 5   ? -19.169 4.123   -0.073  1.00 0.00 ? 285 ARG B HB3  1  
ATOM   1926  H HG2  . ARG B 2 5   ? -20.955 5.316   1.269   1.00 0.00 ? 285 ARG B HG2  1  
ATOM   1927  H HG3  . ARG B 2 5   ? -19.657 6.313   1.925   1.00 0.00 ? 285 ARG B HG3  1  
ATOM   1928  H HD2  . ARG B 2 5   ? -20.662 7.469   0.088   1.00 0.00 ? 285 ARG B HD2  1  
ATOM   1929  H HD3  . ARG B 2 5   ? -19.044 6.956   -0.375  1.00 0.00 ? 285 ARG B HD3  1  
ATOM   1930  H HE   . ARG B 2 5   ? -20.003 5.299   -1.789  1.00 0.00 ? 285 ARG B HE   1  
ATOM   1931  H HH11 . ARG B 2 5   ? -22.374 7.401   -0.291  1.00 0.00 ? 285 ARG B HH11 1  
ATOM   1932  H HH12 . ARG B 2 5   ? -23.617 7.028   -1.439  1.00 0.00 ? 285 ARG B HH12 1  
ATOM   1933  H HH21 . ARG B 2 5   ? -21.635 4.803   -3.301  1.00 0.00 ? 285 ARG B HH21 1  
ATOM   1934  H HH22 . ARG B 2 5   ? -23.206 5.530   -3.144  1.00 0.00 ? 285 ARG B HH22 1  
ATOM   1935  N N    . ILE B 2 6   ? -18.410 1.308   1.143   1.00 0.00 ? 286 ILE B N    1  
ATOM   1936  C CA   . ILE B 2 6   ? -17.464 0.227   0.928   1.00 0.00 ? 286 ILE B CA   1  
ATOM   1937  C C    . ILE B 2 6   ? -16.948 0.252   -0.505  1.00 0.00 ? 286 ILE B C    1  
ATOM   1938  O O    . ILE B 2 6   ? -17.707 0.487   -1.447  1.00 0.00 ? 286 ILE B O    1  
ATOM   1939  C CB   . ILE B 2 6   ? -18.084 -1.158  1.238   1.00 0.00 ? 286 ILE B CB   1  
ATOM   1940  C CG1  . ILE B 2 6   ? -19.226 -1.477  0.268   1.00 0.00 ? 286 ILE B CG1  1  
ATOM   1941  C CG2  . ILE B 2 6   ? -18.572 -1.204  2.680   1.00 0.00 ? 286 ILE B CG2  1  
ATOM   1942  C CD1  . ILE B 2 6   ? -19.879 -2.818  0.511   1.00 0.00 ? 286 ILE B CD1  1  
ATOM   1943  H H    . ILE B 2 6   ? -19.324 1.224   0.804   1.00 0.00 ? 286 ILE B H    1  
ATOM   1944  H HA   . ILE B 2 6   ? -16.632 0.380   1.600   1.00 0.00 ? 286 ILE B HA   1  
ATOM   1945  H HB   . ILE B 2 6   ? -17.310 -1.903  1.127   1.00 0.00 ? 286 ILE B HB   1  
ATOM   1946  H HG12 . ILE B 2 6   ? -19.987 -0.717  0.352   1.00 0.00 ? 286 ILE B HG12 1  
ATOM   1947  H HG13 . ILE B 2 6   ? -18.836 -1.481  -0.736  1.00 0.00 ? 286 ILE B HG13 1  
ATOM   1948  H HG21 . ILE B 2 6   ? -17.738 -1.049  3.348   1.00 0.00 ? 286 ILE B HG21 1  
ATOM   1949  H HG22 . ILE B 2 6   ? -19.018 -2.168  2.878   1.00 0.00 ? 286 ILE B HG22 1  
ATOM   1950  H HG23 . ILE B 2 6   ? -19.308 -0.429  2.836   1.00 0.00 ? 286 ILE B HG23 1  
ATOM   1951  H HD11 . ILE B 2 6   ? -20.270 -2.847  1.514   1.00 0.00 ? 286 ILE B HD11 1  
ATOM   1952  H HD12 . ILE B 2 6   ? -19.148 -3.602  0.385   1.00 0.00 ? 286 ILE B HD12 1  
ATOM   1953  H HD13 . ILE B 2 6   ? -20.685 -2.960  -0.194  1.00 0.00 ? 286 ILE B HD13 1  
HETATM 1954  O OH   . ALY B 2 7   ? -9.319  1.831   0.510   1.00 0.00 ? 287 ALY B OH   1  
HETATM 1955  C CH   . ALY B 2 7   ? -8.709  1.354   -0.445  1.00 0.00 ? 287 ALY B CH   1  
HETATM 1956  C CH3  . ALY B 2 7   ? -7.178  1.372   -0.444  1.00 0.00 ? 287 ALY B CH3  1  
HETATM 1957  N NZ   . ALY B 2 7   ? -9.338  0.822   -1.482  1.00 0.00 ? 287 ALY B NZ   1  
HETATM 1958  C CE   . ALY B 2 7   ? -10.788 0.755   -1.605  1.00 0.00 ? 287 ALY B CE   1  
HETATM 1959  C CD   . ALY B 2 7   ? -11.217 -0.122  -2.772  1.00 0.00 ? 287 ALY B CD   1  
HETATM 1960  C CG   . ALY B 2 7   ? -12.707 -0.010  -3.044  1.00 0.00 ? 287 ALY B CG   1  
HETATM 1961  C CB   . ALY B 2 7   ? -13.529 -0.281  -1.798  1.00 0.00 ? 287 ALY B CB   1  
HETATM 1962  C CA   . ALY B 2 7   ? -15.013 0.005   -1.966  1.00 0.00 ? 287 ALY B CA   1  
HETATM 1963  N N    . ALY B 2 7   ? -15.648 0.038   -0.655  1.00 0.00 ? 287 ALY B N    1  
HETATM 1964  C C    . ALY B 2 7   ? -15.654 -1.066  -2.839  1.00 0.00 ? 287 ALY B C    1  
HETATM 1965  O O    . ALY B 2 7   ? -15.920 -2.174  -2.370  1.00 0.00 ? 287 ALY B O    1  
HETATM 1966  H HH31 . ALY B 2 7   ? -6.821  1.387   -1.465  1.00 0.00 ? 287 ALY B HH31 1  
HETATM 1967  H HH32 . ALY B 2 7   ? -6.828  2.254   0.073   1.00 0.00 ? 287 ALY B HH32 1  
HETATM 1968  H HH33 . ALY B 2 7   ? -6.807  0.489   0.055   1.00 0.00 ? 287 ALY B HH33 1  
HETATM 1969  H HZ   . ALY B 2 7   ? -8.802  0.458   -2.217  1.00 0.00 ? 287 ALY B HZ   1  
HETATM 1970  H HE3  . ALY B 2 7   ? -11.174 1.751   -1.757  1.00 0.00 ? 287 ALY B HE3  1  
HETATM 1971  H HE2  . ALY B 2 7   ? -11.197 0.346   -0.694  1.00 0.00 ? 287 ALY B HE2  1  
HETATM 1972  H HD3  . ALY B 2 7   ? -10.977 -1.150  -2.545  1.00 0.00 ? 287 ALY B HD3  1  
HETATM 1973  H HD2  . ALY B 2 7   ? -10.680 0.188   -3.658  1.00 0.00 ? 287 ALY B HD2  1  
HETATM 1974  H HG3  . ALY B 2 7   ? -12.977 -0.727  -3.805  1.00 0.00 ? 287 ALY B HG3  1  
HETATM 1975  H HG2  . ALY B 2 7   ? -12.923 0.986   -3.396  1.00 0.00 ? 287 ALY B HG2  1  
HETATM 1976  H HB3  . ALY B 2 7   ? -13.144 0.330   -0.997  1.00 0.00 ? 287 ALY B HB3  1  
HETATM 1977  H HB2  . ALY B 2 7   ? -13.414 -1.319  -1.534  1.00 0.00 ? 287 ALY B HB2  1  
HETATM 1978  H HCA  . ALY B 2 7   ? -15.132 0.969   -2.435  1.00 0.00 ? 287 ALY B HCA  1  
HETATM 1979  H H    . ALY B 2 7   ? -15.096 -0.095  0.142   1.00 0.00 ? 287 ALY B H    1  
ATOM   1980  N N    . GLN B 2 8   ? -15.899 -0.747  -4.102  1.00 0.00 ? 288 GLN B N    1  
ATOM   1981  C CA   . GLN B 2 8   ? -16.546 -1.688  -5.006  1.00 0.00 ? 288 GLN B CA   1  
ATOM   1982  C C    . GLN B 2 8   ? -15.538 -2.709  -5.535  1.00 0.00 ? 288 GLN B C    1  
ATOM   1983  O O    . GLN B 2 8   ? -15.270 -2.787  -6.733  1.00 0.00 ? 288 GLN B O    1  
ATOM   1984  C CB   . GLN B 2 8   ? -17.225 -0.943  -6.159  1.00 0.00 ? 288 GLN B CB   1  
ATOM   1985  C CG   . GLN B 2 8   ? -18.183 -1.810  -6.963  1.00 0.00 ? 288 GLN B CG   1  
ATOM   1986  C CD   . GLN B 2 8   ? -19.244 -2.461  -6.094  1.00 0.00 ? 288 GLN B CD   1  
ATOM   1987  O OE1  . GLN B 2 8   ? -19.635 -1.923  -5.059  1.00 0.00 ? 288 GLN B OE1  1  
ATOM   1988  N NE2  . GLN B 2 8   ? -19.719 -3.621  -6.511  1.00 0.00 ? 288 GLN B NE2  1  
ATOM   1989  H H    . GLN B 2 8   ? -15.644 0.139   -4.433  1.00 0.00 ? 288 GLN B H    1  
ATOM   1990  H HA   . GLN B 2 8   ? -17.301 -2.214  -4.440  1.00 0.00 ? 288 GLN B HA   1  
ATOM   1991  H HB2  . GLN B 2 8   ? -17.779 -0.108  -5.756  1.00 0.00 ? 288 GLN B HB2  1  
ATOM   1992  H HB3  . GLN B 2 8   ? -16.464 -0.569  -6.828  1.00 0.00 ? 288 GLN B HB3  1  
ATOM   1993  H HG2  . GLN B 2 8   ? -18.674 -1.194  -7.703  1.00 0.00 ? 288 GLN B HG2  1  
ATOM   1994  H HG3  . GLN B 2 8   ? -17.618 -2.585  -7.459  1.00 0.00 ? 288 GLN B HG3  1  
ATOM   1995  H HE21 . GLN B 2 8   ? -19.371 -3.994  -7.350  1.00 0.00 ? 288 GLN B HE21 1  
ATOM   1996  H HE22 . GLN B 2 8   ? -20.404 -4.064  -5.965  1.00 0.00 ? 288 GLN B HE22 1  
ATOM   1997  N N    . PHE B 2 9   ? -14.974 -3.481  -4.615  1.00 0.00 ? 289 PHE B N    1  
ATOM   1998  C CA   . PHE B 2 9   ? -14.030 -4.540  -4.953  1.00 0.00 ? 289 PHE B CA   1  
ATOM   1999  C C    . PHE B 2 9   ? -14.665 -5.903  -4.711  1.00 0.00 ? 289 PHE B C    1  
ATOM   2000  O O    . PHE B 2 9   ? -13.973 -6.887  -4.445  1.00 0.00 ? 289 PHE B O    1  
ATOM   2001  C CB   . PHE B 2 9   ? -12.744 -4.411  -4.124  1.00 0.00 ? 289 PHE B CB   1  
ATOM   2002  C CG   . PHE B 2 9   ? -11.747 -3.416  -4.657  1.00 0.00 ? 289 PHE B CG   1  
ATOM   2003  C CD1  . PHE B 2 9   ? -12.106 -2.488  -5.622  1.00 0.00 ? 289 PHE B CD1  1  
ATOM   2004  C CD2  . PHE B 2 9   ? -10.441 -3.417  -4.191  1.00 0.00 ? 289 PHE B CD2  1  
ATOM   2005  C CE1  . PHE B 2 9   ? -11.183 -1.583  -6.112  1.00 0.00 ? 289 PHE B CE1  1  
ATOM   2006  C CE2  . PHE B 2 9   ? -9.516  -2.512  -4.674  1.00 0.00 ? 289 PHE B CE2  1  
ATOM   2007  C CZ   . PHE B 2 9   ? -9.887  -1.594  -5.637  1.00 0.00 ? 289 PHE B CZ   1  
ATOM   2008  H H    . PHE B 2 9   ? -15.205 -3.334  -3.673  1.00 0.00 ? 289 PHE B H    1  
ATOM   2009  H HA   . PHE B 2 9   ? -13.787 -4.450  -6.002  1.00 0.00 ? 289 PHE B HA   1  
ATOM   2010  H HB2  . PHE B 2 9   ? -13.004 -4.106  -3.124  1.00 0.00 ? 289 PHE B HB2  1  
ATOM   2011  H HB3  . PHE B 2 9   ? -12.258 -5.376  -4.082  1.00 0.00 ? 289 PHE B HB3  1  
ATOM   2012  H HD1  . PHE B 2 9   ? -13.121 -2.474  -5.989  1.00 0.00 ? 289 PHE B HD1  1  
ATOM   2013  H HD2  . PHE B 2 9   ? -10.147 -4.133  -3.436  1.00 0.00 ? 289 PHE B HD2  1  
ATOM   2014  H HE1  . PHE B 2 9   ? -11.477 -0.866  -6.863  1.00 0.00 ? 289 PHE B HE1  1  
ATOM   2015  H HE2  . PHE B 2 9   ? -8.504  -2.523  -4.299  1.00 0.00 ? 289 PHE B HE2  1  
ATOM   2016  H HZ   . PHE B 2 9   ? -9.164  -0.888  -6.018  1.00 0.00 ? 289 PHE B HZ   1  
ATOM   2017  N N    . LEU B 2 10  ? -15.989 -5.947  -4.784  1.00 0.00 ? 290 LEU B N    1  
ATOM   2018  C CA   . LEU B 2 10  ? -16.721 -7.190  -4.602  1.00 0.00 ? 290 LEU B CA   1  
ATOM   2019  C C    . LEU B 2 10  ? -16.590 -8.048  -5.852  1.00 0.00 ? 290 LEU B C    1  
ATOM   2020  O O    . LEU B 2 10  ? -17.221 -7.763  -6.871  1.00 0.00 ? 290 LEU B O    1  
ATOM   2021  C CB   . LEU B 2 10  ? -18.204 -6.924  -4.296  1.00 0.00 ? 290 LEU B CB   1  
ATOM   2022  C CG   . LEU B 2 10  ? -18.503 -6.270  -2.940  1.00 0.00 ? 290 LEU B CG   1  
ATOM   2023  C CD1  . LEU B 2 10  ? -18.156 -4.788  -2.951  1.00 0.00 ? 290 LEU B CD1  1  
ATOM   2024  C CD2  . LEU B 2 10  ? -19.963 -6.472  -2.566  1.00 0.00 ? 290 LEU B CD2  1  
ATOM   2025  H H    . LEU B 2 10  ? -16.483 -5.126  -4.980  1.00 0.00 ? 290 LEU B H    1  
ATOM   2026  H HA   . LEU B 2 10  ? -16.277 -7.717  -3.769  1.00 0.00 ? 290 LEU B HA   1  
ATOM   2027  H HB2  . LEU B 2 10  ? -18.597 -6.283  -5.072  1.00 0.00 ? 290 LEU B HB2  1  
ATOM   2028  H HB3  . LEU B 2 10  ? -18.729 -7.866  -4.336  1.00 0.00 ? 290 LEU B HB3  1  
ATOM   2029  H HG   . LEU B 2 10  ? -17.898 -6.744  -2.182  1.00 0.00 ? 290 LEU B HG   1  
ATOM   2030  H HD11 . LEU B 2 10  ? -18.738 -4.287  -3.711  1.00 0.00 ? 290 LEU B HD11 1  
ATOM   2031  H HD12 . LEU B 2 10  ? -17.105 -4.666  -3.164  1.00 0.00 ? 290 LEU B HD12 1  
ATOM   2032  H HD13 . LEU B 2 10  ? -18.381 -4.358  -1.985  1.00 0.00 ? 290 LEU B HD13 1  
ATOM   2033  H HD21 . LEU B 2 10  ? -20.592 -6.036  -3.328  1.00 0.00 ? 290 LEU B HD21 1  
ATOM   2034  H HD22 . LEU B 2 10  ? -20.162 -5.993  -1.618  1.00 0.00 ? 290 LEU B HD22 1  
ATOM   2035  H HD23 . LEU B 2 10  ? -20.172 -7.528  -2.488  1.00 0.00 ? 290 LEU B HD23 1  
ATOM   2036  N N    . GLN B 2 11  ? -15.761 -9.085  -5.761  1.00 0.00 ? 291 GLN B N    1  
ATOM   2037  C CA   . GLN B 2 11  ? -15.448 -9.947  -6.898  1.00 0.00 ? 291 GLN B CA   1  
ATOM   2038  C C    . GLN B 2 11  ? -14.848 -9.127  -8.039  1.00 0.00 ? 291 GLN B C    1  
ATOM   2039  O O    . GLN B 2 11  ? -15.534 -8.762  -8.996  1.00 0.00 ? 291 GLN B O    1  
ATOM   2040  C CB   . GLN B 2 11  ? -16.694 -10.709 -7.366  1.00 0.00 ? 291 GLN B CB   1  
ATOM   2041  C CG   . GLN B 2 11  ? -16.422 -11.700 -8.488  1.00 0.00 ? 291 GLN B CG   1  
ATOM   2042  C CD   . GLN B 2 11  ? -17.628 -12.556 -8.814  1.00 0.00 ? 291 GLN B CD   1  
ATOM   2043  O OE1  . GLN B 2 11  ? -17.812 -13.629 -8.242  1.00 0.00 ? 291 GLN B OE1  1  
ATOM   2044  N NE2  . GLN B 2 11  ? -18.457 -12.091 -9.734  1.00 0.00 ? 291 GLN B NE2  1  
ATOM   2045  H H    . GLN B 2 11  ? -15.346 -9.280  -4.894  1.00 0.00 ? 291 GLN B H    1  
ATOM   2046  H HA   . GLN B 2 11  ? -14.708 -10.661 -6.567  1.00 0.00 ? 291 GLN B HA   1  
ATOM   2047  H HB2  . GLN B 2 11  ? -17.106 -11.251 -6.529  1.00 0.00 ? 291 GLN B HB2  1  
ATOM   2048  H HB3  . GLN B 2 11  ? -17.426 -9.996  -7.716  1.00 0.00 ? 291 GLN B HB3  1  
ATOM   2049  H HG2  . GLN B 2 11  ? -16.138 -11.152 -9.374  1.00 0.00 ? 291 GLN B HG2  1  
ATOM   2050  H HG3  . GLN B 2 11  ? -15.609 -12.346 -8.191  1.00 0.00 ? 291 GLN B HG3  1  
ATOM   2051  H HE21 . GLN B 2 11  ? -18.249 -11.227 -10.155 1.00 0.00 ? 291 GLN B HE21 1  
ATOM   2052  H HE22 . GLN B 2 11  ? -19.256 -12.621 -9.953  1.00 0.00 ? 291 GLN B HE22 1  
ATOM   2053  N N    . SER B 2 12  ? -13.566 -8.824  -7.921  1.00 0.00 ? 292 SER B N    1  
ATOM   2054  C CA   . SER B 2 12  ? -12.871 -8.043  -8.928  1.00 0.00 ? 292 SER B CA   1  
ATOM   2055  C C    . SER B 2 12  ? -11.745 -8.859  -9.557  1.00 0.00 ? 292 SER B C    1  
ATOM   2056  O O    . SER B 2 12  ? -10.690 -9.026  -8.910  1.00 0.00 ? 292 SER B O    1  
ATOM   2057  C CB   . SER B 2 12  ? -12.326 -6.754  -8.313  1.00 0.00 ? 292 SER B CB   1  
ATOM   2058  O OG   . SER B 2 12  ? -13.384 -5.940  -7.827  1.00 0.00 ? 292 SER B OG   1  
ATOM   2059  O OXT  . SER B 2 12  ? -11.924 -9.338  -10.698 1.00 0.00 ? 292 SER B OXT  1  
ATOM   2060  H H    . SER B 2 12  ? -13.070 -9.139  -7.135  1.00 0.00 ? 292 SER B H    1  
ATOM   2061  H HA   . SER B 2 12  ? -13.585 -7.790  -9.697  1.00 0.00 ? 292 SER B HA   1  
ATOM   2062  H HB2  . SER B 2 12  ? -11.670 -6.998  -7.491  1.00 0.00 ? 292 SER B HB2  1  
ATOM   2063  H HB3  . SER B 2 12  ? -11.777 -6.202  -9.061  1.00 0.00 ? 292 SER B HB3  1  
ATOM   2064  H HG   . SER B 2 12  ? -14.228 -6.303  -8.125  1.00 0.00 ? 292 SER B HG   1  
ATOM   2065  N N    . GLY A 1 1   ? 25.298  8.649   -2.412  1.00 0.00 ? 1   GLY A N    2  
ATOM   2066  C CA   . GLY A 1 1   ? 24.203  8.927   -3.369  1.00 0.00 ? 1   GLY A CA   2  
ATOM   2067  C C    . GLY A 1 1   ? 23.785  7.685   -4.120  1.00 0.00 ? 1   GLY A C    2  
ATOM   2068  O O    . GLY A 1 1   ? 24.262  6.587   -3.820  1.00 0.00 ? 1   GLY A O    2  
ATOM   2069  H H1   . GLY A 1 1   ? 26.122  8.271   -2.917  1.00 0.00 ? 1   GLY A H1   2  
ATOM   2070  H H2   . GLY A 1 1   ? 24.986  7.950   -1.709  1.00 0.00 ? 1   GLY A H2   2  
ATOM   2071  H H3   . GLY A 1 1   ? 25.574  9.521   -1.920  1.00 0.00 ? 1   GLY A H3   2  
ATOM   2072  H HA2  . GLY A 1 1   ? 23.352  9.313   -2.827  1.00 0.00 ? 1   GLY A HA2  2  
ATOM   2073  H HA3  . GLY A 1 1   ? 24.536  9.671   -4.076  1.00 0.00 ? 1   GLY A HA3  2  
ATOM   2074  N N    . LYS A 1 2   ? 22.900  7.860   -5.100  1.00 0.00 ? 2   LYS A N    2  
ATOM   2075  C CA   . LYS A 1 2   ? 22.394  6.754   -5.911  1.00 0.00 ? 2   LYS A CA   2  
ATOM   2076  C C    . LYS A 1 2   ? 21.793  5.656   -5.038  1.00 0.00 ? 2   LYS A C    2  
ATOM   2077  O O    . LYS A 1 2   ? 22.123  4.482   -5.201  1.00 0.00 ? 2   LYS A O    2  
ATOM   2078  C CB   . LYS A 1 2   ? 23.502  6.183   -6.800  1.00 0.00 ? 2   LYS A CB   2  
ATOM   2079  C CG   . LYS A 1 2   ? 23.971  7.137   -7.887  1.00 0.00 ? 2   LYS A CG   2  
ATOM   2080  C CD   . LYS A 1 2   ? 22.869  7.406   -8.898  1.00 0.00 ? 2   LYS A CD   2  
ATOM   2081  C CE   . LYS A 1 2   ? 23.345  8.307   -10.024 1.00 0.00 ? 2   LYS A CE   2  
ATOM   2082  N NZ   . LYS A 1 2   ? 22.298  8.480   -11.065 1.00 0.00 ? 2   LYS A NZ   2  
ATOM   2083  H H    . LYS A 1 2   ? 22.581  8.770   -5.289  1.00 0.00 ? 2   LYS A H    2  
ATOM   2084  H HA   . LYS A 1 2   ? 21.615  7.147   -6.545  1.00 0.00 ? 2   LYS A HA   2  
ATOM   2085  H HB2  . LYS A 1 2   ? 24.350  5.929   -6.182  1.00 0.00 ? 2   LYS A HB2  2  
ATOM   2086  H HB3  . LYS A 1 2   ? 23.131  5.288   -7.274  1.00 0.00 ? 2   LYS A HB3  2  
ATOM   2087  H HG2  . LYS A 1 2   ? 24.266  8.071   -7.430  1.00 0.00 ? 2   LYS A HG2  2  
ATOM   2088  H HG3  . LYS A 1 2   ? 24.817  6.699   -8.395  1.00 0.00 ? 2   LYS A HG3  2  
ATOM   2089  H HD2  . LYS A 1 2   ? 22.544  6.466   -9.317  1.00 0.00 ? 2   LYS A HD2  2  
ATOM   2090  H HD3  . LYS A 1 2   ? 22.042  7.882   -8.395  1.00 0.00 ? 2   LYS A HD3  2  
ATOM   2091  H HE2  . LYS A 1 2   ? 23.597  9.273   -9.614  1.00 0.00 ? 2   LYS A HE2  2  
ATOM   2092  H HE3  . LYS A 1 2   ? 24.221  7.867   -10.476 1.00 0.00 ? 2   LYS A HE3  2  
ATOM   2093  H HZ1  . LYS A 1 2   ? 21.460  8.937   -10.657 1.00 0.00 ? 2   LYS A HZ1  2  
ATOM   2094  H HZ2  . LYS A 1 2   ? 22.019  7.556   -11.450 1.00 0.00 ? 2   LYS A HZ2  2  
ATOM   2095  H HZ3  . LYS A 1 2   ? 22.658  9.070   -11.842 1.00 0.00 ? 2   LYS A HZ3  2  
ATOM   2096  N N    . LEU A 1 3   ? 20.906  6.057   -4.124  1.00 0.00 ? 3   LEU A N    2  
ATOM   2097  C CA   . LEU A 1 3   ? 20.240  5.132   -3.203  1.00 0.00 ? 3   LEU A CA   2  
ATOM   2098  C C    . LEU A 1 3   ? 21.227  4.525   -2.207  1.00 0.00 ? 3   LEU A C    2  
ATOM   2099  O O    . LEU A 1 3   ? 22.119  3.757   -2.576  1.00 0.00 ? 3   LEU A O    2  
ATOM   2100  C CB   . LEU A 1 3   ? 19.519  4.006   -3.963  1.00 0.00 ? 3   LEU A CB   2  
ATOM   2101  C CG   . LEU A 1 3   ? 18.289  4.418   -4.775  1.00 0.00 ? 3   LEU A CG   2  
ATOM   2102  C CD1  . LEU A 1 3   ? 17.854  3.276   -5.681  1.00 0.00 ? 3   LEU A CD1  2  
ATOM   2103  C CD2  . LEU A 1 3   ? 17.145  4.815   -3.852  1.00 0.00 ? 3   LEU A CD2  2  
ATOM   2104  H H    . LEU A 1 3   ? 20.698  7.014   -4.061  1.00 0.00 ? 3   LEU A H    2  
ATOM   2105  H HA   . LEU A 1 3   ? 19.507  5.699   -2.650  1.00 0.00 ? 3   LEU A HA   2  
ATOM   2106  H HB2  . LEU A 1 3   ? 20.229  3.544   -4.636  1.00 0.00 ? 3   LEU A HB2  2  
ATOM   2107  H HB3  . LEU A 1 3   ? 19.206  3.270   -3.240  1.00 0.00 ? 3   LEU A HB3  2  
ATOM   2108  H HG   . LEU A 1 3   ? 18.536  5.268   -5.395  1.00 0.00 ? 3   LEU A HG   2  
ATOM   2109  H HD11 . LEU A 1 3   ? 17.624  2.404   -5.080  1.00 0.00 ? 3   LEU A HD11 2  
ATOM   2110  H HD12 . LEU A 1 3   ? 18.651  3.038   -6.368  1.00 0.00 ? 3   LEU A HD12 2  
ATOM   2111  H HD13 . LEU A 1 3   ? 16.976  3.570   -6.237  1.00 0.00 ? 3   LEU A HD13 2  
ATOM   2112  H HD21 . LEU A 1 3   ? 17.468  5.606   -3.192  1.00 0.00 ? 3   LEU A HD21 2  
ATOM   2113  H HD22 . LEU A 1 3   ? 16.843  3.959   -3.267  1.00 0.00 ? 3   LEU A HD22 2  
ATOM   2114  H HD23 . LEU A 1 3   ? 16.310  5.159   -4.443  1.00 0.00 ? 3   LEU A HD23 2  
ATOM   2115  N N    . SER A 1 4   ? 21.066  4.870   -0.940  1.00 0.00 ? 4   SER A N    2  
ATOM   2116  C CA   . SER A 1 4   ? 21.850  4.245   0.117   1.00 0.00 ? 4   SER A CA   2  
ATOM   2117  C C    . SER A 1 4   ? 21.362  2.810   0.313   1.00 0.00 ? 4   SER A C    2  
ATOM   2118  O O    . SER A 1 4   ? 20.346  2.426   -0.264  1.00 0.00 ? 4   SER A O    2  
ATOM   2119  C CB   . SER A 1 4   ? 21.755  5.041   1.431   1.00 0.00 ? 4   SER A CB   2  
ATOM   2120  O OG   . SER A 1 4   ? 22.477  4.407   2.475   1.00 0.00 ? 4   SER A OG   2  
ATOM   2121  H H    . SER A 1 4   ? 20.407  5.559   -0.714  1.00 0.00 ? 4   SER A H    2  
ATOM   2122  H HA   . SER A 1 4   ? 22.877  4.221   -0.211  1.00 0.00 ? 4   SER A HA   2  
ATOM   2123  H HB2  . SER A 1 4   ? 22.173  6.029   1.287   1.00 0.00 ? 4   SER A HB2  2  
ATOM   2124  H HB3  . SER A 1 4   ? 20.720  5.127   1.726   1.00 0.00 ? 4   SER A HB3  2  
ATOM   2125  H HG   . SER A 1 4   ? 22.226  4.799   3.322   1.00 0.00 ? 4   SER A HG   2  
ATOM   2126  N N    . GLU A 1 5   ? 22.071  2.026   1.117   1.00 0.00 ? 5   GLU A N    2  
ATOM   2127  C CA   . GLU A 1 5   ? 21.739  0.613   1.303   1.00 0.00 ? 5   GLU A CA   2  
ATOM   2128  C C    . GLU A 1 5   ? 20.282  0.441   1.718   1.00 0.00 ? 5   GLU A C    2  
ATOM   2129  O O    . GLU A 1 5   ? 19.560  -0.385  1.159   1.00 0.00 ? 5   GLU A O    2  
ATOM   2130  C CB   . GLU A 1 5   ? 22.659  -0.014  2.348   1.00 0.00 ? 5   GLU A CB   2  
ATOM   2131  C CG   . GLU A 1 5   ? 24.124  0.028   1.960   1.00 0.00 ? 5   GLU A CG   2  
ATOM   2132  C CD   . GLU A 1 5   ? 25.010  -0.650  2.978   1.00 0.00 ? 5   GLU A CD   2  
ATOM   2133  O OE1  . GLU A 1 5   ? 25.222  -1.872  2.865   1.00 0.00 ? 5   GLU A OE1  2  
ATOM   2134  O OE2  . GLU A 1 5   ? 25.497  0.038   3.900   1.00 0.00 ? 5   GLU A OE2  2  
ATOM   2135  H H    . GLU A 1 5   ? 22.828  2.410   1.610   1.00 0.00 ? 5   GLU A H    2  
ATOM   2136  H HA   . GLU A 1 5   ? 21.889  0.113   0.358   1.00 0.00 ? 5   GLU A HA   2  
ATOM   2137  H HB2  . GLU A 1 5   ? 22.540  0.517   3.281   1.00 0.00 ? 5   GLU A HB2  2  
ATOM   2138  H HB3  . GLU A 1 5   ? 22.375  -1.046  2.490   1.00 0.00 ? 5   GLU A HB3  2  
ATOM   2139  H HG2  . GLU A 1 5   ? 24.247  -0.470  1.010   1.00 0.00 ? 5   GLU A HG2  2  
ATOM   2140  H HG3  . GLU A 1 5   ? 24.429  1.060   1.866   1.00 0.00 ? 5   GLU A HG3  2  
ATOM   2141  N N    . GLN A 1 6   ? 19.858  1.245   2.684   1.00 0.00 ? 6   GLN A N    2  
ATOM   2142  C CA   . GLN A 1 6   ? 18.481  1.239   3.161   1.00 0.00 ? 6   GLN A CA   2  
ATOM   2143  C C    . GLN A 1 6   ? 17.513  1.482   2.004   1.00 0.00 ? 6   GLN A C    2  
ATOM   2144  O O    . GLN A 1 6   ? 16.527  0.765   1.844   1.00 0.00 ? 6   GLN A O    2  
ATOM   2145  C CB   . GLN A 1 6   ? 18.276  2.319   4.239   1.00 0.00 ? 6   GLN A CB   2  
ATOM   2146  C CG   . GLN A 1 6   ? 18.892  2.002   5.602   1.00 0.00 ? 6   GLN A CG   2  
ATOM   2147  C CD   . GLN A 1 6   ? 20.366  1.626   5.539   1.00 0.00 ? 6   GLN A CD   2  
ATOM   2148  O OE1  . GLN A 1 6   ? 21.142  2.234   4.798   1.00 0.00 ? 6   GLN A OE1  2  
ATOM   2149  N NE2  . GLN A 1 6   ? 20.752  0.565   6.245   1.00 0.00 ? 6   GLN A NE2  2  
ATOM   2150  H H    . GLN A 1 6   ? 20.502  1.858   3.105   1.00 0.00 ? 6   GLN A H    2  
ATOM   2151  H HA   . GLN A 1 6   ? 18.278  0.268   3.589   1.00 0.00 ? 6   GLN A HA   2  
ATOM   2152  H HB2  . GLN A 1 6   ? 18.698  3.247   3.886   1.00 0.00 ? 6   GLN A HB2  2  
ATOM   2153  H HB3  . GLN A 1 6   ? 17.211  2.451   4.382   1.00 0.00 ? 6   GLN A HB3  2  
ATOM   2154  H HG2  . GLN A 1 6   ? 18.801  2.897   6.219   1.00 0.00 ? 6   GLN A HG2  2  
ATOM   2155  H HG3  . GLN A 1 6   ? 18.338  1.193   6.054   1.00 0.00 ? 6   GLN A HG3  2  
ATOM   2156  H HE21 . GLN A 1 6   ? 20.080  0.068   6.765   1.00 0.00 ? 6   GLN A HE21 2  
ATOM   2157  H HE22 . GLN A 1 6   ? 21.700  0.314   6.213   1.00 0.00 ? 6   GLN A HE22 2  
ATOM   2158  N N    . LEU A 1 7   ? 17.818  2.477   1.181   1.00 0.00 ? 7   LEU A N    2  
ATOM   2159  C CA   . LEU A 1 7   ? 16.934  2.852   0.085   1.00 0.00 ? 7   LEU A CA   2  
ATOM   2160  C C    . LEU A 1 7   ? 17.038  1.867   -1.081  1.00 0.00 ? 7   LEU A C    2  
ATOM   2161  O O    . LEU A 1 7   ? 16.100  1.707   -1.860  1.00 0.00 ? 7   LEU A O    2  
ATOM   2162  C CB   . LEU A 1 7   ? 17.233  4.272   -0.384  1.00 0.00 ? 7   LEU A CB   2  
ATOM   2163  C CG   . LEU A 1 7   ? 16.911  5.364   0.633   1.00 0.00 ? 7   LEU A CG   2  
ATOM   2164  C CD1  . LEU A 1 7   ? 17.323  6.723   0.098   1.00 0.00 ? 7   LEU A CD1  2  
ATOM   2165  C CD2  . LEU A 1 7   ? 15.430  5.357   0.989   1.00 0.00 ? 7   LEU A CD2  2  
ATOM   2166  H H    . LEU A 1 7   ? 18.660  2.963   1.307   1.00 0.00 ? 7   LEU A H    2  
ATOM   2167  H HA   . LEU A 1 7   ? 15.927  2.824   0.470   1.00 0.00 ? 7   LEU A HA   2  
ATOM   2168  H HB2  . LEU A 1 7   ? 18.283  4.335   -0.632  1.00 0.00 ? 7   LEU A HB2  2  
ATOM   2169  H HB3  . LEU A 1 7   ? 16.658  4.467   -1.279  1.00 0.00 ? 7   LEU A HB3  2  
ATOM   2170  H HG   . LEU A 1 7   ? 17.468  5.172   1.534   1.00 0.00 ? 7   LEU A HG   2  
ATOM   2171  H HD11 . LEU A 1 7   ? 18.384  6.725   -0.096  1.00 0.00 ? 7   LEU A HD11 2  
ATOM   2172  H HD12 . LEU A 1 7   ? 17.088  7.484   0.828   1.00 0.00 ? 7   LEU A HD12 2  
ATOM   2173  H HD13 . LEU A 1 7   ? 16.789  6.926   -0.819  1.00 0.00 ? 7   LEU A HD13 2  
ATOM   2174  H HD21 . LEU A 1 7   ? 15.225  4.558   1.688   1.00 0.00 ? 7   LEU A HD21 2  
ATOM   2175  H HD22 . LEU A 1 7   ? 14.846  5.208   0.093   1.00 0.00 ? 7   LEU A HD22 2  
ATOM   2176  H HD23 . LEU A 1 7   ? 15.166  6.302   1.437   1.00 0.00 ? 7   LEU A HD23 2  
ATOM   2177  N N    . LYS A 1 8   ? 18.172  1.203   -1.210  1.00 0.00 ? 8   LYS A N    2  
ATOM   2178  C CA   . LYS A 1 8   ? 18.304  0.150   -2.198  1.00 0.00 ? 8   LYS A CA   2  
ATOM   2179  C C    . LYS A 1 8   ? 17.481  -1.050  -1.764  1.00 0.00 ? 8   LYS A C    2  
ATOM   2180  O O    . LYS A 1 8   ? 16.839  -1.713  -2.580  1.00 0.00 ? 8   LYS A O    2  
ATOM   2181  C CB   . LYS A 1 8   ? 19.773  -0.238  -2.389  1.00 0.00 ? 8   LYS A CB   2  
ATOM   2182  C CG   . LYS A 1 8   ? 19.986  -1.370  -3.385  1.00 0.00 ? 8   LYS A CG   2  
ATOM   2183  C CD   . LYS A 1 8   ? 19.363  -1.064  -4.741  1.00 0.00 ? 8   LYS A CD   2  
ATOM   2184  C CE   . LYS A 1 8   ? 20.041  0.103   -5.439  1.00 0.00 ? 8   LYS A CE   2  
ATOM   2185  N NZ   . LYS A 1 8   ? 21.443  -0.211  -5.817  1.00 0.00 ? 8   LYS A NZ   2  
ATOM   2186  H H    . LYS A 1 8   ? 18.940  1.434   -0.638  1.00 0.00 ? 8   LYS A H    2  
ATOM   2187  H HA   . LYS A 1 8   ? 17.909  0.516   -3.128  1.00 0.00 ? 8   LYS A HA   2  
ATOM   2188  H HB2  . LYS A 1 8   ? 20.320  0.626   -2.734  1.00 0.00 ? 8   LYS A HB2  2  
ATOM   2189  H HB3  . LYS A 1 8   ? 20.171  -0.548  -1.436  1.00 0.00 ? 8   LYS A HB3  2  
ATOM   2190  H HG2  . LYS A 1 8   ? 21.045  -1.527  -3.516  1.00 0.00 ? 8   LYS A HG2  2  
ATOM   2191  H HG3  . LYS A 1 8   ? 19.533  -2.266  -2.988  1.00 0.00 ? 8   LYS A HG3  2  
ATOM   2192  H HD2  . LYS A 1 8   ? 19.446  -1.938  -5.366  1.00 0.00 ? 8   LYS A HD2  2  
ATOM   2193  H HD3  . LYS A 1 8   ? 18.321  -0.827  -4.596  1.00 0.00 ? 8   LYS A HD3  2  
ATOM   2194  H HE2  . LYS A 1 8   ? 19.483  0.343   -6.332  1.00 0.00 ? 8   LYS A HE2  2  
ATOM   2195  H HE3  . LYS A 1 8   ? 20.035  0.955   -4.774  1.00 0.00 ? 8   LYS A HE3  2  
ATOM   2196  H HZ1  . LYS A 1 8   ? 21.844  0.566   -6.379  1.00 0.00 ? 8   LYS A HZ1  2  
ATOM   2197  H HZ2  . LYS A 1 8   ? 21.477  -1.085  -6.381  1.00 0.00 ? 8   LYS A HZ2  2  
ATOM   2198  H HZ3  . LYS A 1 8   ? 22.026  -0.342  -4.964  1.00 0.00 ? 8   LYS A HZ3  2  
ATOM   2199  N N    . HIS A 1 9   ? 17.476  -1.302  -0.467  1.00 0.00 ? 9   HIS A N    2  
ATOM   2200  C CA   . HIS A 1 9   ? 16.702  -2.394  0.083   1.00 0.00 ? 9   HIS A CA   2  
ATOM   2201  C C    . HIS A 1 9   ? 15.211  -2.080  -0.018  1.00 0.00 ? 9   HIS A C    2  
ATOM   2202  O O    . HIS A 1 9   ? 14.400  -2.973  -0.255  1.00 0.00 ? 9   HIS A O    2  
ATOM   2203  C CB   . HIS A 1 9   ? 17.102  -2.655  1.537   1.00 0.00 ? 9   HIS A CB   2  
ATOM   2204  C CG   . HIS A 1 9   ? 17.005  -4.095  1.933   1.00 0.00 ? 9   HIS A CG   2  
ATOM   2205  N ND1  . HIS A 1 9   ? 18.090  -4.826  2.366   1.00 0.00 ? 9   HIS A ND1  2  
ATOM   2206  C CD2  . HIS A 1 9   ? 15.946  -4.937  1.975   1.00 0.00 ? 9   HIS A CD2  2  
ATOM   2207  C CE1  . HIS A 1 9   ? 17.702  -6.053  2.659   1.00 0.00 ? 9   HIS A CE1  2  
ATOM   2208  N NE2  . HIS A 1 9   ? 16.406  -6.146  2.432   1.00 0.00 ? 9   HIS A NE2  2  
ATOM   2209  H H    . HIS A 1 9   ? 18.021  -0.745  0.135   1.00 0.00 ? 9   HIS A H    2  
ATOM   2210  H HA   . HIS A 1 9   ? 16.911  -3.275  -0.504  1.00 0.00 ? 9   HIS A HA   2  
ATOM   2211  H HB2  . HIS A 1 9   ? 18.123  -2.339  1.686   1.00 0.00 ? 9   HIS A HB2  2  
ATOM   2212  H HB3  . HIS A 1 9   ? 16.455  -2.086  2.188   1.00 0.00 ? 9   HIS A HB3  2  
ATOM   2213  H HD1  . HIS A 1 9   ? 19.016  -4.494  2.438   1.00 0.00 ? 9   HIS A HD1  2  
ATOM   2214  H HD2  . HIS A 1 9   ? 14.929  -4.701  1.696   1.00 0.00 ? 9   HIS A HD2  2  
ATOM   2215  H HE1  . HIS A 1 9   ? 18.336  -6.844  3.024   1.00 0.00 ? 9   HIS A HE1  2  
ATOM   2216  H HE2  . HIS A 1 9   ? 15.896  -6.987  2.427   1.00 0.00 ? 9   HIS A HE2  2  
ATOM   2217  N N    . CYS A 1 10  ? 14.850  -0.803  0.141   1.00 0.00 ? 10  CYS A N    2  
ATOM   2218  C CA   . CYS A 1 10  ? 13.452  -0.398  0.018   1.00 0.00 ? 10  CYS A CA   2  
ATOM   2219  C C    . CYS A 1 10  ? 12.999  -0.513  -1.433  1.00 0.00 ? 10  CYS A C    2  
ATOM   2220  O O    . CYS A 1 10  ? 11.830  -0.779  -1.712  1.00 0.00 ? 10  CYS A O    2  
ATOM   2221  C CB   . CYS A 1 10  ? 13.214  1.027   0.552   1.00 0.00 ? 10  CYS A CB   2  
ATOM   2222  S SG   . CYS A 1 10  ? 13.765  2.373   -0.515  1.00 0.00 ? 10  CYS A SG   2  
ATOM   2223  H H    . CYS A 1 10  ? 15.531  -0.129  0.361   1.00 0.00 ? 10  CYS A H    2  
ATOM   2224  H HA   . CYS A 1 10  ? 12.867  -1.088  0.605   1.00 0.00 ? 10  CYS A HA   2  
ATOM   2225  H HB2  . CYS A 1 10  ? 12.152  1.166   0.707   1.00 0.00 ? 10  CYS A HB2  2  
ATOM   2226  H HB3  . CYS A 1 10  ? 13.730  1.137   1.498   1.00 0.00 ? 10  CYS A HB3  2  
ATOM   2227  H HG   . CYS A 1 10  ? 14.531  1.860   -1.471  1.00 0.00 ? 10  CYS A HG   2  
ATOM   2228  N N    . ASN A 1 11  ? 13.944  -0.339  -2.353  1.00 0.00 ? 11  ASN A N    2  
ATOM   2229  C CA   . ASN A 1 11  ? 13.661  -0.457  -3.777  1.00 0.00 ? 11  ASN A CA   2  
ATOM   2230  C C    . ASN A 1 11  ? 13.295  -1.894  -4.131  1.00 0.00 ? 11  ASN A C    2  
ATOM   2231  O O    . ASN A 1 11  ? 12.366  -2.140  -4.901  1.00 0.00 ? 11  ASN A O    2  
ATOM   2232  C CB   . ASN A 1 11  ? 14.881  -0.014  -4.590  1.00 0.00 ? 11  ASN A CB   2  
ATOM   2233  C CG   . ASN A 1 11  ? 14.641  -0.060  -6.087  1.00 0.00 ? 11  ASN A CG   2  
ATOM   2234  O OD1  . ASN A 1 11  ? 14.871  -1.083  -6.734  1.00 0.00 ? 11  ASN A OD1  2  
ATOM   2235  N ND2  . ASN A 1 11  ? 14.186  1.050   -6.649  1.00 0.00 ? 11  ASN A ND2  2  
ATOM   2236  H H    . ASN A 1 11  ? 14.860  -0.120  -2.066  1.00 0.00 ? 11  ASN A H    2  
ATOM   2237  H HA   . ASN A 1 11  ? 12.826  0.187   -4.009  1.00 0.00 ? 11  ASN A HA   2  
ATOM   2238  H HB2  . ASN A 1 11  ? 15.145  0.998   -4.319  1.00 0.00 ? 11  ASN A HB2  2  
ATOM   2239  H HB3  . ASN A 1 11  ? 15.708  -0.667  -4.360  1.00 0.00 ? 11  ASN A HB3  2  
ATOM   2240  H HD21 . ASN A 1 11  ? 14.026  1.830   -6.073  1.00 0.00 ? 11  ASN A HD21 2  
ATOM   2241  H HD22 . ASN A 1 11  ? 14.045  1.052   -7.620  1.00 0.00 ? 11  ASN A HD22 2  
ATOM   2242  N N    . GLY A 1 12  ? 14.014  -2.838  -3.534  1.00 0.00 ? 12  GLY A N    2  
ATOM   2243  C CA   . GLY A 1 12  ? 13.799  -4.243  -3.833  1.00 0.00 ? 12  GLY A CA   2  
ATOM   2244  C C    . GLY A 1 12  ? 12.512  -4.772  -3.232  1.00 0.00 ? 12  GLY A C    2  
ATOM   2245  O O    . GLY A 1 12  ? 11.799  -5.562  -3.856  1.00 0.00 ? 12  GLY A O    2  
ATOM   2246  H H    . GLY A 1 12  ? 14.693  -2.576  -2.874  1.00 0.00 ? 12  GLY A H    2  
ATOM   2247  H HA2  . GLY A 1 12  ? 13.760  -4.370  -4.906  1.00 0.00 ? 12  GLY A HA2  2  
ATOM   2248  H HA3  . GLY A 1 12  ? 14.627  -4.815  -3.441  1.00 0.00 ? 12  GLY A HA3  2  
ATOM   2249  N N    . ILE A 1 13  ? 12.216  -4.332  -2.017  1.00 0.00 ? 13  ILE A N    2  
ATOM   2250  C CA   . ILE A 1 13  ? 10.995  -4.734  -1.331  1.00 0.00 ? 13  ILE A CA   2  
ATOM   2251  C C    . ILE A 1 13  ? 9.763   -4.271  -2.110  1.00 0.00 ? 13  ILE A C    2  
ATOM   2252  O O    . ILE A 1 13  ? 8.854   -5.061  -2.380  1.00 0.00 ? 13  ILE A O    2  
ATOM   2253  C CB   . ILE A 1 13  ? 10.951  -4.156  0.098   1.00 0.00 ? 13  ILE A CB   2  
ATOM   2254  C CG1  . ILE A 1 13  ? 12.130  -4.687  0.924   1.00 0.00 ? 13  ILE A CG1  2  
ATOM   2255  C CG2  . ILE A 1 13  ? 9.634   -4.509  0.779   1.00 0.00 ? 13  ILE A CG2  2  
ATOM   2256  C CD1  . ILE A 1 13  ? 12.240  -4.071  2.299   1.00 0.00 ? 13  ILE A CD1  2  
ATOM   2257  H H    . ILE A 1 13  ? 12.838  -3.721  -1.568  1.00 0.00 ? 13  ILE A H    2  
ATOM   2258  H HA   . ILE A 1 13  ? 10.986  -5.812  -1.265  1.00 0.00 ? 13  ILE A HA   2  
ATOM   2259  H HB   . ILE A 1 13  ? 11.020  -3.084  0.026   1.00 0.00 ? 13  ILE A HB   2  
ATOM   2260  H HG12 . ILE A 1 13  ? 12.007  -5.745  1.061   1.00 0.00 ? 13  ILE A HG12 2  
ATOM   2261  H HG13 . ILE A 1 13  ? 13.055  -4.506  0.396   1.00 0.00 ? 13  ILE A HG13 2  
ATOM   2262  H HG21 . ILE A 1 13  ? 8.884   -4.706  0.032   1.00 0.00 ? 13  ILE A HG21 2  
ATOM   2263  H HG22 . ILE A 1 13  ? 9.318   -3.684  1.398   1.00 0.00 ? 13  ILE A HG22 2  
ATOM   2264  H HG23 . ILE A 1 13  ? 9.770   -5.387  1.393   1.00 0.00 ? 13  ILE A HG23 2  
ATOM   2265  H HD11 . ILE A 1 13  ? 11.429  -4.432  2.911   1.00 0.00 ? 13  ILE A HD11 2  
ATOM   2266  H HD12 . ILE A 1 13  ? 12.182  -2.995  2.220   1.00 0.00 ? 13  ILE A HD12 2  
ATOM   2267  H HD13 . ILE A 1 13  ? 13.182  -4.349  2.747   1.00 0.00 ? 13  ILE A HD13 2  
ATOM   2268  N N    . LEU A 1 14  ? 9.752   -2.990  -2.477  1.00 0.00 ? 14  LEU A N    2  
ATOM   2269  C CA   . LEU A 1 14  ? 8.677   -2.415  -3.274  1.00 0.00 ? 14  LEU A CA   2  
ATOM   2270  C C    . LEU A 1 14  ? 8.504   -3.195  -4.572  1.00 0.00 ? 14  LEU A C    2  
ATOM   2271  O O    . LEU A 1 14  ? 7.390   -3.540  -4.965  1.00 0.00 ? 14  LEU A O    2  
ATOM   2272  C CB   . LEU A 1 14  ? 9.005   -0.958  -3.596  1.00 0.00 ? 14  LEU A CB   2  
ATOM   2273  C CG   . LEU A 1 14  ? 7.816   -0.015  -3.621  1.00 0.00 ? 14  LEU A CG   2  
ATOM   2274  C CD1  . LEU A 1 14  ? 8.308   1.413   -3.612  1.00 0.00 ? 14  LEU A CD1  2  
ATOM   2275  C CD2  . LEU A 1 14  ? 6.947   -0.252  -4.842  1.00 0.00 ? 14  LEU A CD2  2  
ATOM   2276  H H    . LEU A 1 14  ? 10.483  -2.405  -2.188  1.00 0.00 ? 14  LEU A H    2  
ATOM   2277  H HA   . LEU A 1 14  ? 7.763   -2.461  -2.702  1.00 0.00 ? 14  LEU A HA   2  
ATOM   2278  H HB2  . LEU A 1 14  ? 9.708   -0.587  -2.867  1.00 0.00 ? 14  LEU A HB2  2  
ATOM   2279  H HB3  . LEU A 1 14  ? 9.475   -0.926  -4.568  1.00 0.00 ? 14  LEU A HB3  2  
ATOM   2280  H HG   . LEU A 1 14  ? 7.221   -0.179  -2.737  1.00 0.00 ? 14  LEU A HG   2  
ATOM   2281  H HD11 . LEU A 1 14  ? 9.096   1.520   -4.345  1.00 0.00 ? 14  LEU A HD11 2  
ATOM   2282  H HD12 . LEU A 1 14  ? 8.692   1.657   -2.633  1.00 0.00 ? 14  LEU A HD12 2  
ATOM   2283  H HD13 . LEU A 1 14  ? 7.495   2.078   -3.860  1.00 0.00 ? 14  LEU A HD13 2  
ATOM   2284  H HD21 . LEU A 1 14  ? 6.674   -1.301  -4.909  1.00 0.00 ? 14  LEU A HD21 2  
ATOM   2285  H HD22 . LEU A 1 14  ? 7.492   0.033   -5.730  1.00 0.00 ? 14  LEU A HD22 2  
ATOM   2286  H HD23 . LEU A 1 14  ? 6.053   0.347   -4.765  1.00 0.00 ? 14  LEU A HD23 2  
ATOM   2287  N N    . LYS A 1 15  ? 9.629   -3.472  -5.216  1.00 0.00 ? 15  LYS A N    2  
ATOM   2288  C CA   . LYS A 1 15  ? 9.663   -4.213  -6.461  1.00 0.00 ? 15  LYS A CA   2  
ATOM   2289  C C    . LYS A 1 15  ? 8.944   -5.551  -6.334  1.00 0.00 ? 15  LYS A C    2  
ATOM   2290  O O    . LYS A 1 15  ? 8.245   -5.978  -7.254  1.00 0.00 ? 15  LYS A O    2  
ATOM   2291  C CB   . LYS A 1 15  ? 11.125  -4.396  -6.881  1.00 0.00 ? 15  LYS A CB   2  
ATOM   2292  C CG   . LYS A 1 15  ? 11.458  -5.784  -7.371  1.00 0.00 ? 15  LYS A CG   2  
ATOM   2293  C CD   . LYS A 1 15  ? 11.024  -6.020  -8.804  1.00 0.00 ? 15  LYS A CD   2  
ATOM   2294  C CE   . LYS A 1 15  ? 11.494  -7.378  -9.282  1.00 0.00 ? 15  LYS A CE   2  
ATOM   2295  N NZ   . LYS A 1 15  ? 10.576  -7.962  -10.290 1.00 0.00 ? 15  LYS A NZ   2  
ATOM   2296  H H    . LYS A 1 15  ? 10.476  -3.171  -4.833  1.00 0.00 ? 15  LYS A H    2  
ATOM   2297  H HA   . LYS A 1 15  ? 9.166   -3.635  -7.205  1.00 0.00 ? 15  LYS A HA   2  
ATOM   2298  H HB2  . LYS A 1 15  ? 11.347  -3.699  -7.674  1.00 0.00 ? 15  LYS A HB2  2  
ATOM   2299  H HB3  . LYS A 1 15  ? 11.759  -4.177  -6.035  1.00 0.00 ? 15  LYS A HB3  2  
ATOM   2300  H HG2  . LYS A 1 15  ? 12.512  -5.943  -7.292  1.00 0.00 ? 15  LYS A HG2  2  
ATOM   2301  H HG3  . LYS A 1 15  ? 10.943  -6.484  -6.738  1.00 0.00 ? 15  LYS A HG3  2  
ATOM   2302  H HD2  . LYS A 1 15  ? 9.945   -5.980  -8.858  1.00 0.00 ? 15  LYS A HD2  2  
ATOM   2303  H HD3  . LYS A 1 15  ? 11.452  -5.254  -9.433  1.00 0.00 ? 15  LYS A HD3  2  
ATOM   2304  H HE2  . LYS A 1 15  ? 12.474  -7.269  -9.723  1.00 0.00 ? 15  LYS A HE2  2  
ATOM   2305  H HE3  . LYS A 1 15  ? 11.557  -8.037  -8.432  1.00 0.00 ? 15  LYS A HE3  2  
ATOM   2306  H HZ1  . LYS A 1 15  ? 10.935  -8.883  -10.611 1.00 0.00 ? 15  LYS A HZ1  2  
ATOM   2307  H HZ2  . LYS A 1 15  ? 10.487  -7.330  -11.110 1.00 0.00 ? 15  LYS A HZ2  2  
ATOM   2308  H HZ3  . LYS A 1 15  ? 9.631   -8.103  -9.870  1.00 0.00 ? 15  LYS A HZ3  2  
ATOM   2309  N N    . GLU A 1 16  ? 9.079   -6.190  -5.186  1.00 0.00 ? 16  GLU A N    2  
ATOM   2310  C CA   . GLU A 1 16  ? 8.533   -7.534  -5.021  1.00 0.00 ? 16  GLU A CA   2  
ATOM   2311  C C    . GLU A 1 16  ? 7.018   -7.486  -4.871  1.00 0.00 ? 16  GLU A C    2  
ATOM   2312  O O    . GLU A 1 16  ? 6.304   -8.308  -5.446  1.00 0.00 ? 16  GLU A O    2  
ATOM   2313  C CB   . GLU A 1 16  ? 9.153   -8.272  -3.816  1.00 0.00 ? 16  GLU A CB   2  
ATOM   2314  C CG   . GLU A 1 16  ? 8.653   -9.712  -3.649  1.00 0.00 ? 16  GLU A CG   2  
ATOM   2315  C CD   . GLU A 1 16  ? 8.943   -10.307 -2.294  1.00 0.00 ? 16  GLU A CD   2  
ATOM   2316  O OE1  . GLU A 1 16  ? 10.079  -10.177 -1.812  1.00 0.00 ? 16  GLU A OE1  2  
ATOM   2317  O OE2  . GLU A 1 16  ? 8.042   -10.962 -1.733  1.00 0.00 ? 16  GLU A OE2  2  
ATOM   2318  H H    . GLU A 1 16  ? 9.538   -5.742  -4.440  1.00 0.00 ? 16  GLU A H    2  
ATOM   2319  H HA   . GLU A 1 16  ? 8.763   -8.067  -5.933  1.00 0.00 ? 16  GLU A HA   2  
ATOM   2320  H HB2  . GLU A 1 16  ? 10.225  -8.298  -3.938  1.00 0.00 ? 16  GLU A HB2  2  
ATOM   2321  H HB3  . GLU A 1 16  ? 8.914   -7.725  -2.914  1.00 0.00 ? 16  GLU A HB3  2  
ATOM   2322  H HG2  . GLU A 1 16  ? 7.588   -9.731  -3.806  1.00 0.00 ? 16  GLU A HG2  2  
ATOM   2323  H HG3  . GLU A 1 16  ? 9.127   -10.339 -4.381  1.00 0.00 ? 16  GLU A HG3  2  
ATOM   2324  N N    . LEU A 1 17  ? 6.534   -6.518  -4.108  1.00 0.00 ? 17  LEU A N    2  
ATOM   2325  C CA   . LEU A 1 17  ? 5.095   -6.330  -3.931  1.00 0.00 ? 17  LEU A CA   2  
ATOM   2326  C C    . LEU A 1 17  ? 4.456   -5.946  -5.268  1.00 0.00 ? 17  LEU A C    2  
ATOM   2327  O O    . LEU A 1 17  ? 3.265   -6.149  -5.481  1.00 0.00 ? 17  LEU A O    2  
ATOM   2328  C CB   . LEU A 1 17  ? 4.825   -5.244  -2.879  1.00 0.00 ? 17  LEU A CB   2  
ATOM   2329  C CG   . LEU A 1 17  ? 5.431   -5.492  -1.494  1.00 0.00 ? 17  LEU A CG   2  
ATOM   2330  C CD1  . LEU A 1 17  ? 5.514   -4.186  -0.727  1.00 0.00 ? 17  LEU A CD1  2  
ATOM   2331  C CD2  . LEU A 1 17  ? 4.601   -6.497  -0.703  1.00 0.00 ? 17  LEU A CD2  2  
ATOM   2332  H H    . LEU A 1 17  ? 7.160   -5.908  -3.654  1.00 0.00 ? 17  LEU A H    2  
ATOM   2333  H HA   . LEU A 1 17  ? 4.668   -7.266  -3.596  1.00 0.00 ? 17  LEU A HA   2  
ATOM   2334  H HB2  . LEU A 1 17  ? 5.212   -4.308  -3.251  1.00 0.00 ? 17  LEU A HB2  2  
ATOM   2335  H HB3  . LEU A 1 17  ? 3.757   -5.145  -2.759  1.00 0.00 ? 17  LEU A HB3  2  
ATOM   2336  H HG   . LEU A 1 17  ? 6.431   -5.886  -1.605  1.00 0.00 ? 17  LEU A HG   2  
ATOM   2337  H HD11 . LEU A 1 17  ? 5.968   -3.434  -1.353  1.00 0.00 ? 17  LEU A HD11 2  
ATOM   2338  H HD12 . LEU A 1 17  ? 6.115   -4.326  0.160   1.00 0.00 ? 17  LEU A HD12 2  
ATOM   2339  H HD13 . LEU A 1 17  ? 4.521   -3.868  -0.444  1.00 0.00 ? 17  LEU A HD13 2  
ATOM   2340  H HD21 . LEU A 1 17  ? 4.544   -7.432  -1.235  1.00 0.00 ? 17  LEU A HD21 2  
ATOM   2341  H HD22 . LEU A 1 17  ? 3.608   -6.107  -0.557  1.00 0.00 ? 17  LEU A HD22 2  
ATOM   2342  H HD23 . LEU A 1 17  ? 5.064   -6.662  0.259   1.00 0.00 ? 17  LEU A HD23 2  
ATOM   2343  N N    . LEU A 1 18  ? 5.276   -5.409  -6.169  1.00 0.00 ? 18  LEU A N    2  
ATOM   2344  C CA   . LEU A 1 18  ? 4.817   -5.002  -7.495  1.00 0.00 ? 18  LEU A CA   2  
ATOM   2345  C C    . LEU A 1 18  ? 4.971   -6.123  -8.519  1.00 0.00 ? 18  LEU A C    2  
ATOM   2346  O O    . LEU A 1 18  ? 4.400   -6.062  -9.612  1.00 0.00 ? 18  LEU A O    2  
ATOM   2347  C CB   . LEU A 1 18  ? 5.603   -3.789  -7.972  1.00 0.00 ? 18  LEU A CB   2  
ATOM   2348  C CG   . LEU A 1 18  ? 5.326   -2.498  -7.219  1.00 0.00 ? 18  LEU A CG   2  
ATOM   2349  C CD1  . LEU A 1 18  ? 6.219   -1.401  -7.754  1.00 0.00 ? 18  LEU A CD1  2  
ATOM   2350  C CD2  . LEU A 1 18  ? 3.865   -2.099  -7.331  1.00 0.00 ? 18  LEU A CD2  2  
ATOM   2351  H H    . LEU A 1 18  ? 6.217   -5.272  -5.929  1.00 0.00 ? 18  LEU A H    2  
ATOM   2352  H HA   . LEU A 1 18  ? 3.775   -4.734  -7.417  1.00 0.00 ? 18  LEU A HA   2  
ATOM   2353  H HB2  . LEU A 1 18  ? 6.657   -4.015  -7.879  1.00 0.00 ? 18  LEU A HB2  2  
ATOM   2354  H HB3  . LEU A 1 18  ? 5.381   -3.629  -9.012  1.00 0.00 ? 18  LEU A HB3  2  
ATOM   2355  H HG   . LEU A 1 18  ? 5.559   -2.639  -6.173  1.00 0.00 ? 18  LEU A HG   2  
ATOM   2356  H HD11 . LEU A 1 18  ? 7.233   -1.581  -7.424  1.00 0.00 ? 18  LEU A HD11 2  
ATOM   2357  H HD12 . LEU A 1 18  ? 5.881   -0.445  -7.382  1.00 0.00 ? 18  LEU A HD12 2  
ATOM   2358  H HD13 . LEU A 1 18  ? 6.186   -1.402  -8.834  1.00 0.00 ? 18  LEU A HD13 2  
ATOM   2359  H HD21 . LEU A 1 18  ? 3.586   -1.538  -6.454  1.00 0.00 ? 18  LEU A HD21 2  
ATOM   2360  H HD22 . LEU A 1 18  ? 3.249   -2.980  -7.405  1.00 0.00 ? 18  LEU A HD22 2  
ATOM   2361  H HD23 . LEU A 1 18  ? 3.725   -1.486  -8.209  1.00 0.00 ? 18  LEU A HD23 2  
ATOM   2362  N N    . SER A 1 19  ? 5.760   -7.124  -8.179  1.00 0.00 ? 19  SER A N    2  
ATOM   2363  C CA   . SER A 1 19  ? 5.989   -8.253  -9.069  1.00 0.00 ? 19  SER A CA   2  
ATOM   2364  C C    . SER A 1 19  ? 4.737   -9.123  -9.174  1.00 0.00 ? 19  SER A C    2  
ATOM   2365  O O    . SER A 1 19  ? 3.977   -9.271  -8.210  1.00 0.00 ? 19  SER A O    2  
ATOM   2366  C CB   . SER A 1 19  ? 7.179   -9.077  -8.576  1.00 0.00 ? 19  SER A CB   2  
ATOM   2367  O OG   . SER A 1 19  ? 8.360   -8.291  -8.550  1.00 0.00 ? 19  SER A OG   2  
ATOM   2368  H H    . SER A 1 19  ? 6.201   -7.104  -7.306  1.00 0.00 ? 19  SER A H    2  
ATOM   2369  H HA   . SER A 1 19  ? 6.219   -7.858  -10.048 1.00 0.00 ? 19  SER A HA   2  
ATOM   2370  H HB2  . SER A 1 19  ? 6.978   -9.437  -7.577  1.00 0.00 ? 19  SER A HB2  2  
ATOM   2371  H HB3  . SER A 1 19  ? 7.334   -9.915  -9.238  1.00 0.00 ? 19  SER A HB3  2  
ATOM   2372  H HG   . SER A 1 19  ? 8.172   -7.442  -8.120  1.00 0.00 ? 19  SER A HG   2  
ATOM   2373  N N    . LYS A 1 20  ? 4.547   -9.707  -10.357 1.00 0.00 ? 20  LYS A N    2  
ATOM   2374  C CA   . LYS A 1 20  ? 3.337   -10.458 -10.689 1.00 0.00 ? 20  LYS A CA   2  
ATOM   2375  C C    . LYS A 1 20  ? 3.108   -11.642 -9.753  1.00 0.00 ? 20  LYS A C    2  
ATOM   2376  O O    . LYS A 1 20  ? 2.017   -12.215 -9.728  1.00 0.00 ? 20  LYS A O    2  
ATOM   2377  C CB   . LYS A 1 20  ? 3.391   -10.938 -12.137 1.00 0.00 ? 20  LYS A CB   2  
ATOM   2378  C CG   . LYS A 1 20  ? 3.167   -9.821  -13.141 1.00 0.00 ? 20  LYS A CG   2  
ATOM   2379  C CD   . LYS A 1 20  ? 1.714   -9.370  -13.160 1.00 0.00 ? 20  LYS A CD   2  
ATOM   2380  C CE   . LYS A 1 20  ? 1.455   -8.329  -14.239 1.00 0.00 ? 20  LYS A CE   2  
ATOM   2381  N NZ   . LYS A 1 20  ? 1.749   -8.852  -15.600 1.00 0.00 ? 20  LYS A NZ   2  
ATOM   2382  H H    . LYS A 1 20  ? 5.252   -9.629  -11.037 1.00 0.00 ? 20  LYS A H    2  
ATOM   2383  H HA   . LYS A 1 20  ? 2.507   -9.779  -10.592 1.00 0.00 ? 20  LYS A HA   2  
ATOM   2384  H HB2  . LYS A 1 20  ? 4.360   -11.380 -12.324 1.00 0.00 ? 20  LYS A HB2  2  
ATOM   2385  H HB3  . LYS A 1 20  ? 2.627   -11.686 -12.284 1.00 0.00 ? 20  LYS A HB3  2  
ATOM   2386  H HG2  . LYS A 1 20  ? 3.783   -8.982  -12.862 1.00 0.00 ? 20  LYS A HG2  2  
ATOM   2387  H HG3  . LYS A 1 20  ? 3.444   -10.168 -14.126 1.00 0.00 ? 20  LYS A HG3  2  
ATOM   2388  H HD2  . LYS A 1 20  ? 1.084   -10.226 -13.343 1.00 0.00 ? 20  LYS A HD2  2  
ATOM   2389  H HD3  . LYS A 1 20  ? 1.470   -8.944  -12.200 1.00 0.00 ? 20  LYS A HD3  2  
ATOM   2390  H HE2  . LYS A 1 20  ? 0.419   -8.033  -14.195 1.00 0.00 ? 20  LYS A HE2  2  
ATOM   2391  H HE3  . LYS A 1 20  ? 2.082   -7.469  -14.051 1.00 0.00 ? 20  LYS A HE3  2  
ATOM   2392  H HZ1  . LYS A 1 20  ? 2.767   -9.024  -15.705 1.00 0.00 ? 20  LYS A HZ1  2  
ATOM   2393  H HZ2  . LYS A 1 20  ? 1.453   -8.166  -16.321 1.00 0.00 ? 20  LYS A HZ2  2  
ATOM   2394  H HZ3  . LYS A 1 20  ? 1.240   -9.744  -15.760 1.00 0.00 ? 20  LYS A HZ3  2  
ATOM   2395  N N    . LYS A 1 21  ? 4.139   -12.008 -9.002  1.00 0.00 ? 21  LYS A N    2  
ATOM   2396  C CA   . LYS A 1 21  ? 4.026   -13.037 -7.980  1.00 0.00 ? 21  LYS A CA   2  
ATOM   2397  C C    . LYS A 1 21  ? 2.972   -12.658 -6.939  1.00 0.00 ? 21  LYS A C    2  
ATOM   2398  O O    . LYS A 1 21  ? 2.218   -13.508 -6.468  1.00 0.00 ? 21  LYS A O    2  
ATOM   2399  C CB   . LYS A 1 21  ? 5.380   -13.253 -7.295  1.00 0.00 ? 21  LYS A CB   2  
ATOM   2400  C CG   . LYS A 1 21  ? 5.308   -14.141 -6.064  1.00 0.00 ? 21  LYS A CG   2  
ATOM   2401  C CD   . LYS A 1 21  ? 6.659   -14.300 -5.402  1.00 0.00 ? 21  LYS A CD   2  
ATOM   2402  C CE   . LYS A 1 21  ? 6.619   -15.423 -4.386  1.00 0.00 ? 21  LYS A CE   2  
ATOM   2403  N NZ   . LYS A 1 21  ? 6.617   -16.766 -5.031  1.00 0.00 ? 21  LYS A NZ   2  
ATOM   2404  H H    . LYS A 1 21  ? 5.010   -11.579 -9.152  1.00 0.00 ? 21  LYS A H    2  
ATOM   2405  H HA   . LYS A 1 21  ? 3.726   -13.954 -8.464  1.00 0.00 ? 21  LYS A HA   2  
ATOM   2406  H HB2  . LYS A 1 21  ? 6.058   -13.705 -7.999  1.00 0.00 ? 21  LYS A HB2  2  
ATOM   2407  H HB3  . LYS A 1 21  ? 5.776   -12.296 -7.000  1.00 0.00 ? 21  LYS A HB3  2  
ATOM   2408  H HG2  . LYS A 1 21  ? 4.629   -13.691 -5.355  1.00 0.00 ? 21  LYS A HG2  2  
ATOM   2409  H HG3  . LYS A 1 21  ? 4.941   -15.116 -6.338  1.00 0.00 ? 21  LYS A HG3  2  
ATOM   2410  H HD2  . LYS A 1 21  ? 7.398   -14.528 -6.156  1.00 0.00 ? 21  LYS A HD2  2  
ATOM   2411  H HD3  . LYS A 1 21  ? 6.917   -13.379 -4.902  1.00 0.00 ? 21  LYS A HD3  2  
ATOM   2412  H HE2  . LYS A 1 21  ? 7.473   -15.342 -3.733  1.00 0.00 ? 21  LYS A HE2  2  
ATOM   2413  H HE3  . LYS A 1 21  ? 5.711   -15.316 -3.814  1.00 0.00 ? 21  LYS A HE3  2  
ATOM   2414  H HZ1  . LYS A 1 21  ? 6.713   -17.509 -4.310  1.00 0.00 ? 21  LYS A HZ1  2  
ATOM   2415  H HZ2  . LYS A 1 21  ? 7.407   -16.846 -5.699  1.00 0.00 ? 21  LYS A HZ2  2  
ATOM   2416  H HZ3  . LYS A 1 21  ? 5.725   -16.914 -5.546  1.00 0.00 ? 21  LYS A HZ3  2  
ATOM   2417  N N    . HIS A 1 22  ? 2.914   -11.377 -6.595  1.00 0.00 ? 22  HIS A N    2  
ATOM   2418  C CA   . HIS A 1 22  ? 1.999   -10.916 -5.558  1.00 0.00 ? 22  HIS A CA   2  
ATOM   2419  C C    . HIS A 1 22  ? 0.833   -10.159 -6.169  1.00 0.00 ? 22  HIS A C    2  
ATOM   2420  O O    . HIS A 1 22  ? -0.183  -9.965  -5.514  1.00 0.00 ? 22  HIS A O    2  
ATOM   2421  C CB   . HIS A 1 22  ? 2.720   -10.018 -4.538  1.00 0.00 ? 22  HIS A CB   2  
ATOM   2422  C CG   . HIS A 1 22  ? 3.824   -10.715 -3.794  1.00 0.00 ? 22  HIS A CG   2  
ATOM   2423  N ND1  . HIS A 1 22  ? 3.616   -11.482 -2.663  1.00 0.00 ? 22  HIS A ND1  2  
ATOM   2424  C CD2  . HIS A 1 22  ? 5.152   -10.749 -4.028  1.00 0.00 ? 22  HIS A CD2  2  
ATOM   2425  C CE1  . HIS A 1 22  ? 4.771   -11.955 -2.234  1.00 0.00 ? 22  HIS A CE1  2  
ATOM   2426  N NE2  . HIS A 1 22  ? 5.728   -11.523 -3.041  1.00 0.00 ? 22  HIS A NE2  2  
ATOM   2427  H H    . HIS A 1 22  ? 3.483   -10.724 -7.067  1.00 0.00 ? 22  HIS A H    2  
ATOM   2428  H HA   . HIS A 1 22  ? 1.614   -11.788 -5.050  1.00 0.00 ? 22  HIS A HA   2  
ATOM   2429  H HB2  . HIS A 1 22  ? 3.152   -9.166  -5.058  1.00 0.00 ? 22  HIS A HB2  2  
ATOM   2430  H HB3  . HIS A 1 22  ? 2.003   -9.661  -3.805  1.00 0.00 ? 22  HIS A HB3  2  
ATOM   2431  H HD1  . HIS A 1 22  ? 2.749   -11.653 -2.230  1.00 0.00 ? 22  HIS A HD1  2  
ATOM   2432  H HD2  . HIS A 1 22  ? 5.666   -10.264 -4.853  1.00 0.00 ? 22  HIS A HD2  2  
ATOM   2433  H HE1  . HIS A 1 22  ? 4.909   -12.595 -1.366  1.00 0.00 ? 22  HIS A HE1  2  
ATOM   2434  H HE2  . HIS A 1 22  ? 6.681   -11.471 -2.778  1.00 0.00 ? 22  HIS A HE2  2  
ATOM   2435  N N    . ALA A 1 23  ? 0.986   -9.767  -7.433  1.00 0.00 ? 23  ALA A N    2  
ATOM   2436  C CA   . ALA A 1 23  ? -0.004  -8.950  -8.145  1.00 0.00 ? 23  ALA A CA   2  
ATOM   2437  C C    . ALA A 1 23  ? -1.430  -9.466  -7.988  1.00 0.00 ? 23  ALA A C    2  
ATOM   2438  O O    . ALA A 1 23  ? -2.376  -8.680  -7.945  1.00 0.00 ? 23  ALA A O    2  
ATOM   2439  C CB   . ALA A 1 23  ? 0.364   -8.880  -9.613  1.00 0.00 ? 23  ALA A CB   2  
ATOM   2440  H H    . ALA A 1 23  ? 1.806   -10.021 -7.907  1.00 0.00 ? 23  ALA A H    2  
ATOM   2441  H HA   . ALA A 1 23  ? 0.047   -7.950  -7.747  1.00 0.00 ? 23  ALA A HA   2  
ATOM   2442  H HB1  . ALA A 1 23  ? 1.381   -8.529  -9.700  1.00 0.00 ? 23  ALA A HB1  2  
ATOM   2443  H HB2  . ALA A 1 23  ? -0.301  -8.196  -10.120 1.00 0.00 ? 23  ALA A HB2  2  
ATOM   2444  H HB3  . ALA A 1 23  ? 0.280   -9.862  -10.055 1.00 0.00 ? 23  ALA A HB3  2  
ATOM   2445  N N    . ALA A 1 24  ? -1.571  -10.781 -7.887  1.00 0.00 ? 24  ALA A N    2  
ATOM   2446  C CA   . ALA A 1 24  ? -2.875  -11.419 -7.727  1.00 0.00 ? 24  ALA A CA   2  
ATOM   2447  C C    . ALA A 1 24  ? -3.629  -10.867 -6.512  1.00 0.00 ? 24  ALA A C    2  
ATOM   2448  O O    . ALA A 1 24  ? -4.859  -10.838 -6.490  1.00 0.00 ? 24  ALA A O    2  
ATOM   2449  C CB   . ALA A 1 24  ? -2.686  -12.922 -7.600  1.00 0.00 ? 24  ALA A CB   2  
ATOM   2450  H H    . ALA A 1 24  ? -0.772  -11.344 -7.922  1.00 0.00 ? 24  ALA A H    2  
ATOM   2451  H HA   . ALA A 1 24  ? -3.454  -11.226 -8.617  1.00 0.00 ? 24  ALA A HA   2  
ATOM   2452  H HB1  . ALA A 1 24  ? -1.922  -13.125 -6.863  1.00 0.00 ? 24  ALA A HB1  2  
ATOM   2453  H HB2  . ALA A 1 24  ? -2.384  -13.329 -8.554  1.00 0.00 ? 24  ALA A HB2  2  
ATOM   2454  H HB3  . ALA A 1 24  ? -3.614  -13.376 -7.291  1.00 0.00 ? 24  ALA A HB3  2  
ATOM   2455  N N    . TYR A 1 25  ? -2.887  -10.422 -5.509  1.00 0.00 ? 25  TYR A N    2  
ATOM   2456  C CA   . TYR A 1 25  ? -3.479  -9.853  -4.305  1.00 0.00 ? 25  TYR A CA   2  
ATOM   2457  C C    . TYR A 1 25  ? -2.749  -8.573  -3.896  1.00 0.00 ? 25  TYR A C    2  
ATOM   2458  O O    . TYR A 1 25  ? -2.848  -8.123  -2.757  1.00 0.00 ? 25  TYR A O    2  
ATOM   2459  C CB   . TYR A 1 25  ? -3.472  -10.891 -3.169  1.00 0.00 ? 25  TYR A CB   2  
ATOM   2460  C CG   . TYR A 1 25  ? -2.197  -11.697 -3.061  1.00 0.00 ? 25  TYR A CG   2  
ATOM   2461  C CD1  . TYR A 1 25  ? -1.042  -11.153 -2.520  1.00 0.00 ? 25  TYR A CD1  2  
ATOM   2462  C CD2  . TYR A 1 25  ? -2.157  -13.016 -3.496  1.00 0.00 ? 25  TYR A CD2  2  
ATOM   2463  C CE1  . TYR A 1 25  ? 0.118   -11.897 -2.421  1.00 0.00 ? 25  TYR A CE1  2  
ATOM   2464  C CE2  . TYR A 1 25  ? -1.002  -13.767 -3.400  1.00 0.00 ? 25  TYR A CE2  2  
ATOM   2465  C CZ   . TYR A 1 25  ? 0.133   -13.201 -2.863  1.00 0.00 ? 25  TYR A CZ   2  
ATOM   2466  O OH   . TYR A 1 25  ? 1.288   -13.944 -2.767  1.00 0.00 ? 25  TYR A OH   2  
ATOM   2467  H H    . TYR A 1 25  ? -1.906  -10.471 -5.581  1.00 0.00 ? 25  TYR A H    2  
ATOM   2468  H HA   . TYR A 1 25  ? -4.503  -9.600  -4.534  1.00 0.00 ? 25  TYR A HA   2  
ATOM   2469  H HB2  . TYR A 1 25  ? -3.623  -10.387 -2.226  1.00 0.00 ? 25  TYR A HB2  2  
ATOM   2470  H HB3  . TYR A 1 25  ? -4.283  -11.587 -3.334  1.00 0.00 ? 25  TYR A HB3  2  
ATOM   2471  H HD1  . TYR A 1 25  ? -1.056  -10.128 -2.178  1.00 0.00 ? 25  TYR A HD1  2  
ATOM   2472  H HD2  . TYR A 1 25  ? -3.050  -13.457 -3.915  1.00 0.00 ? 25  TYR A HD2  2  
ATOM   2473  H HE1  . TYR A 1 25  ? 1.005   -11.459 -1.993  1.00 0.00 ? 25  TYR A HE1  2  
ATOM   2474  H HE2  . TYR A 1 25  ? -0.991  -14.790 -3.746  1.00 0.00 ? 25  TYR A HE2  2  
ATOM   2475  H HH   . TYR A 1 25  ? 1.381   -14.493 -3.558  1.00 0.00 ? 25  TYR A HH   2  
ATOM   2476  N N    . ALA A 1 26  ? -2.025  -7.987  -4.847  1.00 0.00 ? 26  ALA A N    2  
ATOM   2477  C CA   . ALA A 1 26  ? -1.292  -6.748  -4.605  1.00 0.00 ? 26  ALA A CA   2  
ATOM   2478  C C    . ALA A 1 26  ? -1.854  -5.602  -5.443  1.00 0.00 ? 26  ALA A C    2  
ATOM   2479  O O    . ALA A 1 26  ? -1.569  -4.427  -5.181  1.00 0.00 ? 26  ALA A O    2  
ATOM   2480  C CB   . ALA A 1 26  ? 0.192   -6.930  -4.906  1.00 0.00 ? 26  ALA A CB   2  
ATOM   2481  H H    . ALA A 1 26  ? -1.971  -8.408  -5.730  1.00 0.00 ? 26  ALA A H    2  
ATOM   2482  H HA   . ALA A 1 26  ? -1.395  -6.500  -3.558  1.00 0.00 ? 26  ALA A HA   2  
ATOM   2483  H HB1  . ALA A 1 26  ? 0.598   -7.736  -4.306  1.00 0.00 ? 26  ALA A HB1  2  
ATOM   2484  H HB2  . ALA A 1 26  ? 0.719   -6.015  -4.677  1.00 0.00 ? 26  ALA A HB2  2  
ATOM   2485  H HB3  . ALA A 1 26  ? 0.318   -7.163  -5.952  1.00 0.00 ? 26  ALA A HB3  2  
ATOM   2486  N N    . TRP A 1 27  ? -2.667  -5.940  -6.446  1.00 0.00 ? 27  TRP A N    2  
ATOM   2487  C CA   . TRP A 1 27  ? -3.218  -4.933  -7.354  1.00 0.00 ? 27  TRP A CA   2  
ATOM   2488  C C    . TRP A 1 27  ? -3.968  -3.788  -6.634  1.00 0.00 ? 27  TRP A C    2  
ATOM   2489  O O    . TRP A 1 27  ? -3.904  -2.653  -7.109  1.00 0.00 ? 27  TRP A O    2  
ATOM   2490  C CB   . TRP A 1 27  ? -4.108  -5.564  -8.448  1.00 0.00 ? 27  TRP A CB   2  
ATOM   2491  C CG   . TRP A 1 27  ? -5.253  -6.408  -7.953  1.00 0.00 ? 27  TRP A CG   2  
ATOM   2492  C CD1  . TRP A 1 27  ? -5.249  -7.761  -7.772  1.00 0.00 ? 27  TRP A CD1  2  
ATOM   2493  C CD2  . TRP A 1 27  ? -6.577  -5.963  -7.604  1.00 0.00 ? 27  TRP A CD2  2  
ATOM   2494  N NE1  . TRP A 1 27  ? -6.475  -8.185  -7.324  1.00 0.00 ? 27  TRP A NE1  2  
ATOM   2495  C CE2  . TRP A 1 27  ? -7.307  -7.103  -7.211  1.00 0.00 ? 27  TRP A CE2  2  
ATOM   2496  C CE3  . TRP A 1 27  ? -7.214  -4.717  -7.574  1.00 0.00 ? 27  TRP A CE3  2  
ATOM   2497  C CZ2  . TRP A 1 27  ? -8.636  -7.033  -6.802  1.00 0.00 ? 27  TRP A CZ2  2  
ATOM   2498  C CZ3  . TRP A 1 27  ? -8.532  -4.651  -7.167  1.00 0.00 ? 27  TRP A CZ3  2  
ATOM   2499  C CH2  . TRP A 1 27  ? -9.231  -5.802  -6.786  1.00 0.00 ? 27  TRP A CH2  2  
ATOM   2500  H H    . TRP A 1 27  ? -2.895  -6.883  -6.585  1.00 0.00 ? 27  TRP A H    2  
ATOM   2501  H HA   . TRP A 1 27  ? -2.362  -4.488  -7.848  1.00 0.00 ? 27  TRP A HA   2  
ATOM   2502  H HB2  . TRP A 1 27  ? -4.527  -4.773  -9.051  1.00 0.00 ? 27  TRP A HB2  2  
ATOM   2503  H HB3  . TRP A 1 27  ? -3.488  -6.186  -9.078  1.00 0.00 ? 27  TRP A HB3  2  
ATOM   2504  H HD1  . TRP A 1 27  ? -4.395  -8.396  -7.955  1.00 0.00 ? 27  TRP A HD1  2  
ATOM   2505  H HE1  . TRP A 1 27  ? -6.717  -9.116  -7.118  1.00 0.00 ? 27  TRP A HE1  2  
ATOM   2506  H HE3  . TRP A 1 27  ? -6.692  -3.814  -7.857  1.00 0.00 ? 27  TRP A HE3  2  
ATOM   2507  H HZ2  . TRP A 1 27  ? -9.188  -7.912  -6.504  1.00 0.00 ? 27  TRP A HZ2  2  
ATOM   2508  H HZ3  . TRP A 1 27  ? -9.039  -3.697  -7.140  1.00 0.00 ? 27  TRP A HZ3  2  
ATOM   2509  H HH2  . TRP A 1 27  ? -10.260 -5.703  -6.474  1.00 0.00 ? 27  TRP A HH2  2  
ATOM   2510  N N    . PRO A 1 28  ? -4.689  -4.026  -5.497  1.00 0.00 ? 28  PRO A N    2  
ATOM   2511  C CA   . PRO A 1 28  ? -5.356  -2.940  -4.763  1.00 0.00 ? 28  PRO A CA   2  
ATOM   2512  C C    . PRO A 1 28  ? -4.412  -1.798  -4.388  1.00 0.00 ? 28  PRO A C    2  
ATOM   2513  O O    . PRO A 1 28  ? -4.849  -0.664  -4.199  1.00 0.00 ? 28  PRO A O    2  
ATOM   2514  C CB   . PRO A 1 28  ? -5.879  -3.592  -3.472  1.00 0.00 ? 28  PRO A CB   2  
ATOM   2515  C CG   . PRO A 1 28  ? -5.396  -5.006  -3.475  1.00 0.00 ? 28  PRO A CG   2  
ATOM   2516  C CD   . PRO A 1 28  ? -4.962  -5.339  -4.878  1.00 0.00 ? 28  PRO A CD   2  
ATOM   2517  H HA   . PRO A 1 28  ? -6.186  -2.541  -5.326  1.00 0.00 ? 28  PRO A HA   2  
ATOM   2518  H HB2  . PRO A 1 28  ? -5.480  -3.052  -2.623  1.00 0.00 ? 28  PRO A HB2  2  
ATOM   2519  H HB3  . PRO A 1 28  ? -6.961  -3.540  -3.444  1.00 0.00 ? 28  PRO A HB3  2  
ATOM   2520  H HG2  . PRO A 1 28  ? -4.561  -5.103  -2.794  1.00 0.00 ? 28  PRO A HG2  2  
ATOM   2521  H HG3  . PRO A 1 28  ? -6.202  -5.661  -3.169  1.00 0.00 ? 28  PRO A HG3  2  
ATOM   2522  H HD2  . PRO A 1 28  ? -4.070  -5.946  -4.863  1.00 0.00 ? 28  PRO A HD2  2  
ATOM   2523  H HD3  . PRO A 1 28  ? -5.751  -5.856  -5.409  1.00 0.00 ? 28  PRO A HD3  2  
ATOM   2524  N N    . PHE A 1 29  ? -3.121  -2.099  -4.288  1.00 0.00 ? 29  PHE A N    2  
ATOM   2525  C CA   . PHE A 1 29  ? -2.159  -1.129  -3.768  1.00 0.00 ? 29  PHE A CA   2  
ATOM   2526  C C    . PHE A 1 29  ? -1.215  -0.624  -4.850  1.00 0.00 ? 29  PHE A C    2  
ATOM   2527  O O    . PHE A 1 29  ? -0.416  0.283   -4.602  1.00 0.00 ? 29  PHE A O    2  
ATOM   2528  C CB   . PHE A 1 29  ? -1.337  -1.742  -2.637  1.00 0.00 ? 29  PHE A CB   2  
ATOM   2529  C CG   . PHE A 1 29  ? -2.094  -2.746  -1.819  1.00 0.00 ? 29  PHE A CG   2  
ATOM   2530  C CD1  . PHE A 1 29  ? -1.775  -4.091  -1.897  1.00 0.00 ? 29  PHE A CD1  2  
ATOM   2531  C CD2  . PHE A 1 29  ? -3.129  -2.353  -0.986  1.00 0.00 ? 29  PHE A CD2  2  
ATOM   2532  C CE1  . PHE A 1 29  ? -2.472  -5.024  -1.164  1.00 0.00 ? 29  PHE A CE1  2  
ATOM   2533  C CE2  . PHE A 1 29  ? -3.829  -3.286  -0.247  1.00 0.00 ? 29  PHE A CE2  2  
ATOM   2534  C CZ   . PHE A 1 29  ? -3.499  -4.622  -0.337  1.00 0.00 ? 29  PHE A CZ   2  
ATOM   2535  H H    . PHE A 1 29  ? -2.814  -2.990  -4.569  1.00 0.00 ? 29  PHE A H    2  
ATOM   2536  H HA   . PHE A 1 29  ? -2.716  -0.291  -3.378  1.00 0.00 ? 29  PHE A HA   2  
ATOM   2537  H HB2  . PHE A 1 29  ? -0.473  -2.235  -3.055  1.00 0.00 ? 29  PHE A HB2  2  
ATOM   2538  H HB3  . PHE A 1 29  ? -1.009  -0.949  -1.974  1.00 0.00 ? 29  PHE A HB3  2  
ATOM   2539  H HD1  . PHE A 1 29  ? -0.968  -4.411  -2.544  1.00 0.00 ? 29  PHE A HD1  2  
ATOM   2540  H HD2  . PHE A 1 29  ? -3.386  -1.307  -0.917  1.00 0.00 ? 29  PHE A HD2  2  
ATOM   2541  H HE1  . PHE A 1 29  ? -2.209  -6.070  -1.234  1.00 0.00 ? 29  PHE A HE1  2  
ATOM   2542  H HE2  . PHE A 1 29  ? -4.634  -2.970  0.400   1.00 0.00 ? 29  PHE A HE2  2  
ATOM   2543  H HZ   . PHE A 1 29  ? -4.044  -5.354  0.235   1.00 0.00 ? 29  PHE A HZ   2  
ATOM   2544  N N    . TYR A 1 30  ? -1.279  -1.231  -6.032  1.00 0.00 ? 30  TYR A N    2  
ATOM   2545  C CA   . TYR A 1 30  ? -0.476  -0.775  -7.165  1.00 0.00 ? 30  TYR A CA   2  
ATOM   2546  C C    . TYR A 1 30  ? -0.709  0.708   -7.433  1.00 0.00 ? 30  TYR A C    2  
ATOM   2547  O O    . TYR A 1 30  ? 0.224   1.504   -7.407  1.00 0.00 ? 30  TYR A O    2  
ATOM   2548  C CB   . TYR A 1 30  ? -0.792  -1.591  -8.425  1.00 0.00 ? 30  TYR A CB   2  
ATOM   2549  C CG   . TYR A 1 30  ? -0.062  -2.915  -8.494  1.00 0.00 ? 30  TYR A CG   2  
ATOM   2550  C CD1  . TYR A 1 30  ? 0.357   -3.548  -7.338  1.00 0.00 ? 30  TYR A CD1  2  
ATOM   2551  C CD2  . TYR A 1 30  ? 0.217   -3.526  -9.711  1.00 0.00 ? 30  TYR A CD2  2  
ATOM   2552  C CE1  . TYR A 1 30  ? 1.031   -4.745  -7.383  1.00 0.00 ? 30  TYR A CE1  2  
ATOM   2553  C CE2  . TYR A 1 30  ? 0.890   -4.730  -9.764  1.00 0.00 ? 30  TYR A CE2  2  
ATOM   2554  C CZ   . TYR A 1 30  ? 1.293   -5.334  -8.593  1.00 0.00 ? 30  TYR A CZ   2  
ATOM   2555  O OH   . TYR A 1 30  ? 1.966   -6.527  -8.634  1.00 0.00 ? 30  TYR A OH   2  
ATOM   2556  H H    . TYR A 1 30  ? -1.864  -2.014  -6.138  1.00 0.00 ? 30  TYR A H    2  
ATOM   2557  H HA   . TYR A 1 30  ? 0.569   -0.920  -6.907  1.00 0.00 ? 30  TYR A HA   2  
ATOM   2558  H HB2  . TYR A 1 30  ? -1.850  -1.796  -8.453  1.00 0.00 ? 30  TYR A HB2  2  
ATOM   2559  H HB3  . TYR A 1 30  ? -0.520  -1.014  -9.296  1.00 0.00 ? 30  TYR A HB3  2  
ATOM   2560  H HD1  . TYR A 1 30  ? 0.143   -3.089  -6.388  1.00 0.00 ? 30  TYR A HD1  2  
ATOM   2561  H HD2  . TYR A 1 30  ? -0.101  -3.052  -10.625 1.00 0.00 ? 30  TYR A HD2  2  
ATOM   2562  H HE1  . TYR A 1 30  ? 1.350   -5.218  -6.466  1.00 0.00 ? 30  TYR A HE1  2  
ATOM   2563  H HE2  . TYR A 1 30  ? 1.097   -5.193  -10.718 1.00 0.00 ? 30  TYR A HE2  2  
ATOM   2564  H HH   . TYR A 1 30  ? 2.742   -6.439  -9.201  1.00 0.00 ? 30  TYR A HH   2  
ATOM   2565  N N    . LYS A 1 31  ? -1.961  1.072   -7.666  1.00 0.00 ? 31  LYS A N    2  
ATOM   2566  C CA   . LYS A 1 31  ? -2.316  2.446   -7.992  1.00 0.00 ? 31  LYS A CA   2  
ATOM   2567  C C    . LYS A 1 31  ? -3.503  2.906   -7.154  1.00 0.00 ? 31  LYS A C    2  
ATOM   2568  O O    . LYS A 1 31  ? -4.204  2.076   -6.575  1.00 0.00 ? 31  LYS A O    2  
ATOM   2569  C CB   . LYS A 1 31  ? -2.641  2.562   -9.485  1.00 0.00 ? 31  LYS A CB   2  
ATOM   2570  C CG   . LYS A 1 31  ? -1.408  2.639   -10.370 1.00 0.00 ? 31  LYS A CG   2  
ATOM   2571  C CD   . LYS A 1 31  ? -1.786  2.775   -11.835 1.00 0.00 ? 31  LYS A CD   2  
ATOM   2572  C CE   . LYS A 1 31  ? -0.555  2.916   -12.717 1.00 0.00 ? 31  LYS A CE   2  
ATOM   2573  N NZ   . LYS A 1 31  ? 0.362   1.754   -12.591 1.00 0.00 ? 31  LYS A NZ   2  
ATOM   2574  H H    . LYS A 1 31  ? -2.672  0.404   -7.600  1.00 0.00 ? 31  LYS A H    2  
ATOM   2575  H HA   . LYS A 1 31  ? -1.464  3.072   -7.767  1.00 0.00 ? 31  LYS A HA   2  
ATOM   2576  H HB2  . LYS A 1 31  ? -3.215  1.694   -9.780  1.00 0.00 ? 31  LYS A HB2  2  
ATOM   2577  H HB3  . LYS A 1 31  ? -3.234  3.449   -9.647  1.00 0.00 ? 31  LYS A HB3  2  
ATOM   2578  H HG2  . LYS A 1 31  ? -0.823  3.498   -10.080 1.00 0.00 ? 31  LYS A HG2  2  
ATOM   2579  H HG3  . LYS A 1 31  ? -0.825  1.742   -10.237 1.00 0.00 ? 31  LYS A HG3  2  
ATOM   2580  H HD2  . LYS A 1 31  ? -2.335  1.896   -12.138 1.00 0.00 ? 31  LYS A HD2  2  
ATOM   2581  H HD3  . LYS A 1 31  ? -2.406  3.650   -11.955 1.00 0.00 ? 31  LYS A HD3  2  
ATOM   2582  H HE2  . LYS A 1 31  ? -0.875  3.000   -13.745 1.00 0.00 ? 31  LYS A HE2  2  
ATOM   2583  H HE3  . LYS A 1 31  ? -0.027  3.814   -12.434 1.00 0.00 ? 31  LYS A HE3  2  
ATOM   2584  H HZ1  . LYS A 1 31  ? -0.132  0.877   -12.853 1.00 0.00 ? 31  LYS A HZ1  2  
ATOM   2585  H HZ2  . LYS A 1 31  ? 0.700   1.667   -11.613 1.00 0.00 ? 31  LYS A HZ2  2  
ATOM   2586  H HZ3  . LYS A 1 31  ? 1.183   1.875   -13.219 1.00 0.00 ? 31  LYS A HZ3  2  
ATOM   2587  N N    . PRO A 1 32  ? -3.734  4.230   -7.061  1.00 0.00 ? 32  PRO A N    2  
ATOM   2588  C CA   . PRO A 1 32  ? -4.877  4.793   -6.333  1.00 0.00 ? 32  PRO A CA   2  
ATOM   2589  C C    . PRO A 1 32  ? -6.202  4.201   -6.799  1.00 0.00 ? 32  PRO A C    2  
ATOM   2590  O O    . PRO A 1 32  ? -6.376  3.885   -7.980  1.00 0.00 ? 32  PRO A O    2  
ATOM   2591  C CB   . PRO A 1 32  ? -4.826  6.294   -6.664  1.00 0.00 ? 32  PRO A CB   2  
ATOM   2592  C CG   . PRO A 1 32  ? -3.876  6.415   -7.808  1.00 0.00 ? 32  PRO A CG   2  
ATOM   2593  C CD   . PRO A 1 32  ? -2.900  5.291   -7.645  1.00 0.00 ? 32  PRO A CD   2  
ATOM   2594  H HA   . PRO A 1 32  ? -4.777  4.649   -5.267  1.00 0.00 ? 32  PRO A HA   2  
ATOM   2595  H HB2  . PRO A 1 32  ? -5.813  6.637   -6.938  1.00 0.00 ? 32  PRO A HB2  2  
ATOM   2596  H HB3  . PRO A 1 32  ? -4.477  6.845   -5.805  1.00 0.00 ? 32  PRO A HB3  2  
ATOM   2597  H HG2  . PRO A 1 32  ? -4.410  6.313   -8.740  1.00 0.00 ? 32  PRO A HG2  2  
ATOM   2598  H HG3  . PRO A 1 32  ? -3.366  7.365   -7.766  1.00 0.00 ? 32  PRO A HG3  2  
ATOM   2599  H HD2  . PRO A 1 32  ? -2.500  4.994   -8.602  1.00 0.00 ? 32  PRO A HD2  2  
ATOM   2600  H HD3  . PRO A 1 32  ? -2.105  5.573   -6.970  1.00 0.00 ? 32  PRO A HD3  2  
ATOM   2601  N N    . VAL A 1 33  ? -7.129  4.047   -5.865  1.00 0.00 ? 33  VAL A N    2  
ATOM   2602  C CA   . VAL A 1 33  ? -8.429  3.478   -6.175  1.00 0.00 ? 33  VAL A CA   2  
ATOM   2603  C C    . VAL A 1 33  ? -9.217  4.440   -7.059  1.00 0.00 ? 33  VAL A C    2  
ATOM   2604  O O    . VAL A 1 33  ? -9.056  5.659   -6.966  1.00 0.00 ? 33  VAL A O    2  
ATOM   2605  C CB   . VAL A 1 33  ? -9.228  3.143   -4.885  1.00 0.00 ? 33  VAL A CB   2  
ATOM   2606  C CG1  . VAL A 1 33  ? -8.287  2.763   -3.758  1.00 0.00 ? 33  VAL A CG1  2  
ATOM   2607  C CG2  . VAL A 1 33  ? -10.153 4.275   -4.456  1.00 0.00 ? 33  VAL A CG2  2  
ATOM   2608  H H    . VAL A 1 33  ? -6.934  4.320   -4.947  1.00 0.00 ? 33  VAL A H    2  
ATOM   2609  H HA   . VAL A 1 33  ? -8.266  2.560   -6.721  1.00 0.00 ? 33  VAL A HA   2  
ATOM   2610  H HB   . VAL A 1 33  ? -9.840  2.281   -5.094  1.00 0.00 ? 33  VAL A HB   2  
ATOM   2611  H HG11 . VAL A 1 33  ? -7.695  1.914   -4.058  1.00 0.00 ? 33  VAL A HG11 2  
ATOM   2612  H HG12 . VAL A 1 33  ? -8.861  2.509   -2.880  1.00 0.00 ? 33  VAL A HG12 2  
ATOM   2613  H HG13 . VAL A 1 33  ? -7.636  3.596   -3.533  1.00 0.00 ? 33  VAL A HG13 2  
ATOM   2614  H HG21 . VAL A 1 33  ? -11.149 4.089   -4.842  1.00 0.00 ? 33  VAL A HG21 2  
ATOM   2615  H HG22 . VAL A 1 33  ? -9.784  5.211   -4.850  1.00 0.00 ? 33  VAL A HG22 2  
ATOM   2616  H HG23 . VAL A 1 33  ? -10.187 4.324   -3.379  1.00 0.00 ? 33  VAL A HG23 2  
ATOM   2617  N N    . ASP A 1 34  ? -10.050 3.892   -7.926  1.00 0.00 ? 34  ASP A N    2  
ATOM   2618  C CA   . ASP A 1 34  ? -10.841 4.710   -8.839  1.00 0.00 ? 34  ASP A CA   2  
ATOM   2619  C C    . ASP A 1 34  ? -12.124 5.126   -8.145  1.00 0.00 ? 34  ASP A C    2  
ATOM   2620  O O    . ASP A 1 34  ? -13.210 4.714   -8.537  1.00 0.00 ? 34  ASP A O    2  
ATOM   2621  C CB   . ASP A 1 34  ? -11.165 3.949   -10.133 1.00 0.00 ? 34  ASP A CB   2  
ATOM   2622  C CG   . ASP A 1 34  ? -9.923  3.496   -10.874 1.00 0.00 ? 34  ASP A CG   2  
ATOM   2623  O OD1  . ASP A 1 34  ? -9.413  4.261   -11.720 1.00 0.00 ? 34  ASP A OD1  2  
ATOM   2624  O OD2  . ASP A 1 34  ? -9.450  2.367   -10.622 1.00 0.00 ? 34  ASP A OD2  2  
ATOM   2625  H H    . ASP A 1 34  ? -10.151 2.915   -7.940  1.00 0.00 ? 34  ASP A H    2  
ATOM   2626  H HA   . ASP A 1 34  ? -10.267 5.594   -9.077  1.00 0.00 ? 34  ASP A HA   2  
ATOM   2627  H HB2  . ASP A 1 34  ? -11.757 3.077   -9.895  1.00 0.00 ? 34  ASP A HB2  2  
ATOM   2628  H HB3  . ASP A 1 34  ? -11.733 4.594   -10.785 1.00 0.00 ? 34  ASP A HB3  2  
ATOM   2629  N N    . ALA A 1 35  ? -11.980 5.947   -7.112  1.00 0.00 ? 35  ALA A N    2  
ATOM   2630  C CA   . ALA A 1 35  ? -13.080 6.278   -6.212  1.00 0.00 ? 35  ALA A CA   2  
ATOM   2631  C C    . ALA A 1 35  ? -14.286 6.858   -6.949  1.00 0.00 ? 35  ALA A C    2  
ATOM   2632  O O    . ALA A 1 35  ? -15.428 6.633   -6.551  1.00 0.00 ? 35  ALA A O    2  
ATOM   2633  C CB   . ALA A 1 35  ? -12.600 7.231   -5.129  1.00 0.00 ? 35  ALA A CB   2  
ATOM   2634  H H    . ALA A 1 35  ? -11.098 6.351   -6.953  1.00 0.00 ? 35  ALA A H    2  
ATOM   2635  H HA   . ALA A 1 35  ? -13.386 5.363   -5.728  1.00 0.00 ? 35  ALA A HA   2  
ATOM   2636  H HB1  . ALA A 1 35  ? -12.956 6.894   -4.163  1.00 0.00 ? 35  ALA A HB1  2  
ATOM   2637  H HB2  . ALA A 1 35  ? -12.982 8.221   -5.327  1.00 0.00 ? 35  ALA A HB2  2  
ATOM   2638  H HB3  . ALA A 1 35  ? -11.520 7.257   -5.126  1.00 0.00 ? 35  ALA A HB3  2  
ATOM   2639  N N    . SER A 1 36  ? -14.037 7.582   -8.030  1.00 0.00 ? 36  SER A N    2  
ATOM   2640  C CA   . SER A 1 36  ? -15.116 8.159   -8.819  1.00 0.00 ? 36  SER A CA   2  
ATOM   2641  C C    . SER A 1 36  ? -15.928 7.061   -9.508  1.00 0.00 ? 36  SER A C    2  
ATOM   2642  O O    . SER A 1 36  ? -17.158 7.119   -9.555  1.00 0.00 ? 36  SER A O    2  
ATOM   2643  C CB   . SER A 1 36  ? -14.547 9.130   -9.852  1.00 0.00 ? 36  SER A CB   2  
ATOM   2644  O OG   . SER A 1 36  ? -13.710 10.092  -9.230  1.00 0.00 ? 36  SER A OG   2  
ATOM   2645  H H    . SER A 1 36  ? -13.106 7.733   -8.306  1.00 0.00 ? 36  SER A H    2  
ATOM   2646  H HA   . SER A 1 36  ? -15.765 8.700   -8.147  1.00 0.00 ? 36  SER A HA   2  
ATOM   2647  H HB2  . SER A 1 36  ? -13.969 8.580   -10.578 1.00 0.00 ? 36  SER A HB2  2  
ATOM   2648  H HB3  . SER A 1 36  ? -15.358 9.641   -10.349 1.00 0.00 ? 36  SER A HB3  2  
ATOM   2649  H HG   . SER A 1 36  ? -14.154 10.440  -8.445  1.00 0.00 ? 36  SER A HG   2  
ATOM   2650  N N    . ALA A 1 37  ? -15.233 6.048   -10.008 1.00 0.00 ? 37  ALA A N    2  
ATOM   2651  C CA   . ALA A 1 37  ? -15.877 4.930   -10.687 1.00 0.00 ? 37  ALA A CA   2  
ATOM   2652  C C    . ALA A 1 37  ? -16.386 3.903   -9.679  1.00 0.00 ? 37  ALA A C    2  
ATOM   2653  O O    . ALA A 1 37  ? -17.311 3.138   -9.958  1.00 0.00 ? 37  ALA A O    2  
ATOM   2654  C CB   . ALA A 1 37  ? -14.901 4.284   -11.656 1.00 0.00 ? 37  ALA A CB   2  
ATOM   2655  H H    . ALA A 1 37  ? -14.255 6.049   -9.917  1.00 0.00 ? 37  ALA A H    2  
ATOM   2656  H HA   . ALA A 1 37  ? -16.712 5.316   -11.252 1.00 0.00 ? 37  ALA A HA   2  
ATOM   2657  H HB1  . ALA A 1 37  ? -14.032 3.941   -11.113 1.00 0.00 ? 37  ALA A HB1  2  
ATOM   2658  H HB2  . ALA A 1 37  ? -14.600 5.006   -12.399 1.00 0.00 ? 37  ALA A HB2  2  
ATOM   2659  H HB3  . ALA A 1 37  ? -15.376 3.444   -12.141 1.00 0.00 ? 37  ALA A HB3  2  
ATOM   2660  N N    . LEU A 1 38  ? -15.774 3.904   -8.504  1.00 0.00 ? 38  LEU A N    2  
ATOM   2661  C CA   . LEU A 1 38  ? -16.125 2.977   -7.434  1.00 0.00 ? 38  LEU A CA   2  
ATOM   2662  C C    . LEU A 1 38  ? -17.342 3.465   -6.653  1.00 0.00 ? 38  LEU A C    2  
ATOM   2663  O O    . LEU A 1 38  ? -17.824 2.779   -5.756  1.00 0.00 ? 38  LEU A O    2  
ATOM   2664  C CB   . LEU A 1 38  ? -14.928 2.799   -6.495  1.00 0.00 ? 38  LEU A CB   2  
ATOM   2665  C CG   . LEU A 1 38  ? -13.761 1.997   -7.075  1.00 0.00 ? 38  LEU A CG   2  
ATOM   2666  C CD1  . LEU A 1 38  ? -12.486 2.245   -6.281  1.00 0.00 ? 38  LEU A CD1  2  
ATOM   2667  C CD2  . LEU A 1 38  ? -14.089 0.513   -7.088  1.00 0.00 ? 38  LEU A CD2  2  
ATOM   2668  H H    . LEU A 1 38  ? -15.045 4.546   -8.354  1.00 0.00 ? 38  LEU A H    2  
ATOM   2669  H HA   . LEU A 1 38  ? -16.359 2.025   -7.883  1.00 0.00 ? 38  LEU A HA   2  
ATOM   2670  H HB2  . LEU A 1 38  ? -14.563 3.779   -6.225  1.00 0.00 ? 38  LEU A HB2  2  
ATOM   2671  H HB3  . LEU A 1 38  ? -15.267 2.302   -5.599  1.00 0.00 ? 38  LEU A HB3  2  
ATOM   2672  H HG   . LEU A 1 38  ? -13.586 2.310   -8.093  1.00 0.00 ? 38  LEU A HG   2  
ATOM   2673  H HD11 . LEU A 1 38  ? -12.684 2.140   -5.224  1.00 0.00 ? 38  LEU A HD11 2  
ATOM   2674  H HD12 . LEU A 1 38  ? -12.129 3.244   -6.480  1.00 0.00 ? 38  LEU A HD12 2  
ATOM   2675  H HD13 . LEU A 1 38  ? -11.733 1.530   -6.578  1.00 0.00 ? 38  LEU A HD13 2  
ATOM   2676  H HD21 . LEU A 1 38  ? -14.206 0.165   -6.073  1.00 0.00 ? 38  LEU A HD21 2  
ATOM   2677  H HD22 . LEU A 1 38  ? -13.286 -0.029  -7.565  1.00 0.00 ? 38  LEU A HD22 2  
ATOM   2678  H HD23 . LEU A 1 38  ? -15.007 0.351   -7.634  1.00 0.00 ? 38  LEU A HD23 2  
ATOM   2679  N N    . GLY A 1 39  ? -17.824 4.658   -6.989  1.00 0.00 ? 39  GLY A N    2  
ATOM   2680  C CA   . GLY A 1 39  ? -18.985 5.214   -6.312  1.00 0.00 ? 39  GLY A CA   2  
ATOM   2681  C C    . GLY A 1 39  ? -18.628 5.825   -4.974  1.00 0.00 ? 39  GLY A C    2  
ATOM   2682  O O    . GLY A 1 39  ? -19.491 6.309   -4.239  1.00 0.00 ? 39  GLY A O    2  
ATOM   2683  H H    . GLY A 1 39  ? -17.386 5.169   -7.700  1.00 0.00 ? 39  GLY A H    2  
ATOM   2684  H HA2  . GLY A 1 39  ? -19.424 5.974   -6.938  1.00 0.00 ? 39  GLY A HA2  2  
ATOM   2685  H HA3  . GLY A 1 39  ? -19.708 4.427   -6.156  1.00 0.00 ? 39  GLY A HA3  2  
ATOM   2686  N N    . LEU A 1 40  ? -17.345 5.812   -4.667  1.00 0.00 ? 40  LEU A N    2  
ATOM   2687  C CA   . LEU A 1 40  ? -16.849 6.315   -3.405  1.00 0.00 ? 40  LEU A CA   2  
ATOM   2688  C C    . LEU A 1 40  ? -16.651 7.826   -3.467  1.00 0.00 ? 40  LEU A C    2  
ATOM   2689  O O    . LEU A 1 40  ? -15.544 8.315   -3.705  1.00 0.00 ? 40  LEU A O    2  
ATOM   2690  C CB   . LEU A 1 40  ? -15.535 5.621   -3.067  1.00 0.00 ? 40  LEU A CB   2  
ATOM   2691  C CG   . LEU A 1 40  ? -15.514 4.113   -3.318  1.00 0.00 ? 40  LEU A CG   2  
ATOM   2692  C CD1  . LEU A 1 40  ? -14.223 3.511   -2.794  1.00 0.00 ? 40  LEU A CD1  2  
ATOM   2693  C CD2  . LEU A 1 40  ? -16.728 3.441   -2.696  1.00 0.00 ? 40  LEU A CD2  2  
ATOM   2694  H H    . LEU A 1 40  ? -16.709 5.441   -5.306  1.00 0.00 ? 40  LEU A H    2  
ATOM   2695  H HA   . LEU A 1 40  ? -17.575 6.082   -2.647  1.00 0.00 ? 40  LEU A HA   2  
ATOM   2696  H HB2  . LEU A 1 40  ? -14.751 6.076   -3.654  1.00 0.00 ? 40  LEU A HB2  2  
ATOM   2697  H HB3  . LEU A 1 40  ? -15.327 5.790   -2.025  1.00 0.00 ? 40  LEU A HB3  2  
ATOM   2698  H HG   . LEU A 1 40  ? -15.547 3.940   -4.384  1.00 0.00 ? 40  LEU A HG   2  
ATOM   2699  H HD11 . LEU A 1 40  ? -13.434 3.691   -3.500  1.00 0.00 ? 40  LEU A HD11 2  
ATOM   2700  H HD12 . LEU A 1 40  ? -14.345 2.452   -2.659  1.00 0.00 ? 40  LEU A HD12 2  
ATOM   2701  H HD13 . LEU A 1 40  ? -13.971 3.968   -1.849  1.00 0.00 ? 40  LEU A HD13 2  
ATOM   2702  H HD21 . LEU A 1 40  ? -16.763 3.671   -1.648  1.00 0.00 ? 40  LEU A HD21 2  
ATOM   2703  H HD22 . LEU A 1 40  ? -16.658 2.373   -2.829  1.00 0.00 ? 40  LEU A HD22 2  
ATOM   2704  H HD23 . LEU A 1 40  ? -17.625 3.804   -3.174  1.00 0.00 ? 40  LEU A HD23 2  
ATOM   2705  N N    . HIS A 1 41  ? -17.732 8.562   -3.243  1.00 0.00 ? 41  HIS A N    2  
ATOM   2706  C CA   . HIS A 1 41  ? -17.702 10.022  -3.322  1.00 0.00 ? 41  HIS A CA   2  
ATOM   2707  C C    . HIS A 1 41  ? -16.977 10.615  -2.123  1.00 0.00 ? 41  HIS A C    2  
ATOM   2708  O O    . HIS A 1 41  ? -16.616 11.789  -2.122  1.00 0.00 ? 41  HIS A O    2  
ATOM   2709  C CB   . HIS A 1 41  ? -19.123 10.603  -3.363  1.00 0.00 ? 41  HIS A CB   2  
ATOM   2710  C CG   . HIS A 1 41  ? -20.017 10.013  -4.422  1.00 0.00 ? 41  HIS A CG   2  
ATOM   2711  N ND1  . HIS A 1 41  ? -20.070 10.500  -5.709  1.00 0.00 ? 41  HIS A ND1  2  
ATOM   2712  C CD2  . HIS A 1 41  ? -20.912 8.986   -4.376  1.00 0.00 ? 41  HIS A CD2  2  
ATOM   2713  C CE1  . HIS A 1 41  ? -20.952 9.806   -6.405  1.00 0.00 ? 41  HIS A CE1  2  
ATOM   2714  N NE2  . HIS A 1 41  ? -21.474 8.887   -5.621  1.00 0.00 ? 41  HIS A NE2  2  
ATOM   2715  H H    . HIS A 1 41  ? -18.576 8.110   -3.032  1.00 0.00 ? 41  HIS A H    2  
ATOM   2716  H HA   . HIS A 1 41  ? -17.177 10.301  -4.224  1.00 0.00 ? 41  HIS A HA   2  
ATOM   2717  H HB2  . HIS A 1 41  ? -19.591 10.448  -2.404  1.00 0.00 ? 41  HIS A HB2  2  
ATOM   2718  H HB3  . HIS A 1 41  ? -19.054 11.667  -3.548  1.00 0.00 ? 41  HIS A HB3  2  
ATOM   2719  H HD1  . HIS A 1 41  ? -19.527 11.239  -6.066  1.00 0.00 ? 41  HIS A HD1  2  
ATOM   2720  H HD2  . HIS A 1 41  ? -21.143 8.355   -3.519  1.00 0.00 ? 41  HIS A HD2  2  
ATOM   2721  H HE1  . HIS A 1 41  ? -21.203 9.966   -7.442  1.00 0.00 ? 41  HIS A HE1  2  
ATOM   2722  H HE2  . HIS A 1 41  ? -22.060 8.153   -5.921  1.00 0.00 ? 41  HIS A HE2  2  
ATOM   2723  N N    . ASP A 1 42  ? -16.762 9.794   -1.107  1.00 0.00 ? 42  ASP A N    2  
ATOM   2724  C CA   . ASP A 1 42  ? -16.231 10.273  0.161   1.00 0.00 ? 42  ASP A CA   2  
ATOM   2725  C C    . ASP A 1 42  ? -14.843 9.705   0.440   1.00 0.00 ? 42  ASP A C    2  
ATOM   2726  O O    . ASP A 1 42  ? -14.414 9.634   1.589   1.00 0.00 ? 42  ASP A O    2  
ATOM   2727  C CB   . ASP A 1 42  ? -17.182 9.896   1.298   1.00 0.00 ? 42  ASP A CB   2  
ATOM   2728  C CG   . ASP A 1 42  ? -18.535 10.572  1.192   1.00 0.00 ? 42  ASP A CG   2  
ATOM   2729  O OD1  . ASP A 1 42  ? -18.651 11.752  1.582   1.00 0.00 ? 42  ASP A OD1  2  
ATOM   2730  O OD2  . ASP A 1 42  ? -19.499 9.919   0.731   1.00 0.00 ? 42  ASP A OD2  2  
ATOM   2731  H H    . ASP A 1 42  ? -16.959 8.842   -1.214  1.00 0.00 ? 42  ASP A H    2  
ATOM   2732  H HA   . ASP A 1 42  ? -16.166 11.344  0.107   1.00 0.00 ? 42  ASP A HA   2  
ATOM   2733  H HB2  . ASP A 1 42  ? -17.338 8.833   1.276   1.00 0.00 ? 42  ASP A HB2  2  
ATOM   2734  H HB3  . ASP A 1 42  ? -16.734 10.172  2.241   1.00 0.00 ? 42  ASP A HB3  2  
ATOM   2735  N N    . TYR A 1 43  ? -14.129 9.319   -0.611  1.00 0.00 ? 43  TYR A N    2  
ATOM   2736  C CA   . TYR A 1 43  ? -12.828 8.677   -0.447  1.00 0.00 ? 43  TYR A CA   2  
ATOM   2737  C C    . TYR A 1 43  ? -11.792 9.647   0.111   1.00 0.00 ? 43  TYR A C    2  
ATOM   2738  O O    . TYR A 1 43  ? -11.042 9.308   1.027   1.00 0.00 ? 43  TYR A O    2  
ATOM   2739  C CB   . TYR A 1 43  ? -12.348 8.088   -1.781  1.00 0.00 ? 43  TYR A CB   2  
ATOM   2740  C CG   . TYR A 1 43  ? -10.990 7.426   -1.724  1.00 0.00 ? 43  TYR A CG   2  
ATOM   2741  C CD1  . TYR A 1 43  ? -10.864 6.120   -1.285  1.00 0.00 ? 43  TYR A CD1  2  
ATOM   2742  C CD2  . TYR A 1 43  ? -9.839  8.095   -2.125  1.00 0.00 ? 43  TYR A CD2  2  
ATOM   2743  C CE1  . TYR A 1 43  ? -9.637  5.493   -1.242  1.00 0.00 ? 43  TYR A CE1  2  
ATOM   2744  C CE2  . TYR A 1 43  ? -8.603  7.476   -2.084  1.00 0.00 ? 43  TYR A CE2  2  
ATOM   2745  C CZ   . TYR A 1 43  ? -8.509  6.173   -1.642  1.00 0.00 ? 43  TYR A CZ   2  
ATOM   2746  O OH   . TYR A 1 43  ? -7.284  5.547   -1.602  1.00 0.00 ? 43  TYR A OH   2  
ATOM   2747  H H    . TYR A 1 43  ? -14.480 9.473   -1.513  1.00 0.00 ? 43  TYR A H    2  
ATOM   2748  H HA   . TYR A 1 43  ? -12.958 7.875   0.265   1.00 0.00 ? 43  TYR A HA   2  
ATOM   2749  H HB2  . TYR A 1 43  ? -13.054 7.345   -2.102  1.00 0.00 ? 43  TYR A HB2  2  
ATOM   2750  H HB3  . TYR A 1 43  ? -12.305 8.867   -2.525  1.00 0.00 ? 43  TYR A HB3  2  
ATOM   2751  H HD1  . TYR A 1 43  ? -11.746 5.592   -0.972  1.00 0.00 ? 43  TYR A HD1  2  
ATOM   2752  H HD2  . TYR A 1 43  ? -9.918  9.116   -2.471  1.00 0.00 ? 43  TYR A HD2  2  
ATOM   2753  H HE1  . TYR A 1 43  ? -9.570  4.474   -0.899  1.00 0.00 ? 43  TYR A HE1  2  
ATOM   2754  H HE2  . TYR A 1 43  ? -7.720  8.012   -2.399  1.00 0.00 ? 43  TYR A HE2  2  
ATOM   2755  H HH   . TYR A 1 43  ? -6.660  6.091   -1.115  1.00 0.00 ? 43  TYR A HH   2  
ATOM   2756  N N    . HIS A 1 44  ? -11.766 10.861  -0.420  1.00 0.00 ? 44  HIS A N    2  
ATOM   2757  C CA   . HIS A 1 44  ? -10.775 11.847  -0.000  1.00 0.00 ? 44  HIS A CA   2  
ATOM   2758  C C    . HIS A 1 44  ? -11.121 12.415  1.367   1.00 0.00 ? 44  HIS A C    2  
ATOM   2759  O O    . HIS A 1 44  ? -10.279 13.013  2.033   1.00 0.00 ? 44  HIS A O    2  
ATOM   2760  C CB   . HIS A 1 44  ? -10.646 12.972  -1.029  1.00 0.00 ? 44  HIS A CB   2  
ATOM   2761  C CG   . HIS A 1 44  ? -9.907  12.564  -2.265  1.00 0.00 ? 44  HIS A CG   2  
ATOM   2762  N ND1  . HIS A 1 44  ? -8.536  12.640  -2.374  1.00 0.00 ? 44  HIS A ND1  2  
ATOM   2763  C CD2  . HIS A 1 44  ? -10.348 12.065  -3.444  1.00 0.00 ? 44  HIS A CD2  2  
ATOM   2764  C CE1  . HIS A 1 44  ? -8.166  12.208  -3.563  1.00 0.00 ? 44  HIS A CE1  2  
ATOM   2765  N NE2  . HIS A 1 44  ? -9.244  11.851  -4.231  1.00 0.00 ? 44  HIS A NE2  2  
ATOM   2766  H H    . HIS A 1 44  ? -12.438 11.108  -1.094  1.00 0.00 ? 44  HIS A H    2  
ATOM   2767  H HA   . HIS A 1 44  ? -9.825  11.338  0.075   1.00 0.00 ? 44  HIS A HA   2  
ATOM   2768  H HB2  . HIS A 1 44  ? -11.632 13.297  -1.323  1.00 0.00 ? 44  HIS A HB2  2  
ATOM   2769  H HB3  . HIS A 1 44  ? -10.117 13.801  -0.581  1.00 0.00 ? 44  HIS A HB3  2  
ATOM   2770  H HD1  . HIS A 1 44  ? -7.923  12.967  -1.678  1.00 0.00 ? 44  HIS A HD1  2  
ATOM   2771  H HD2  . HIS A 1 44  ? -11.375 11.871  -3.712  1.00 0.00 ? 44  HIS A HD2  2  
ATOM   2772  H HE1  . HIS A 1 44  ? -7.151  12.152  -3.926  1.00 0.00 ? 44  HIS A HE1  2  
ATOM   2773  H HE2  . HIS A 1 44  ? -9.263  11.603  -5.181  1.00 0.00 ? 44  HIS A HE2  2  
ATOM   2774  N N    . ASP A 1 45  ? -12.363 12.213  1.783   1.00 0.00 ? 45  ASP A N    2  
ATOM   2775  C CA   . ASP A 1 45  ? -12.809 12.661  3.094   1.00 0.00 ? 45  ASP A CA   2  
ATOM   2776  C C    . ASP A 1 45  ? -12.263 11.745  4.176   1.00 0.00 ? 45  ASP A C    2  
ATOM   2777  O O    . ASP A 1 45  ? -11.770 12.204  5.203   1.00 0.00 ? 45  ASP A O    2  
ATOM   2778  C CB   . ASP A 1 45  ? -14.338 12.694  3.167   1.00 0.00 ? 45  ASP A CB   2  
ATOM   2779  C CG   . ASP A 1 45  ? -14.946 13.735  2.252   1.00 0.00 ? 45  ASP A CG   2  
ATOM   2780  O OD1  . ASP A 1 45  ? -15.108 13.456  1.043   1.00 0.00 ? 45  ASP A OD1  2  
ATOM   2781  O OD2  . ASP A 1 45  ? -15.262 14.844  2.732   1.00 0.00 ? 45  ASP A OD2  2  
ATOM   2782  H H    . ASP A 1 45  ? -12.995 11.750  1.194   1.00 0.00 ? 45  ASP A H    2  
ATOM   2783  H HA   . ASP A 1 45  ? -12.426 13.657  3.253   1.00 0.00 ? 45  ASP A HA   2  
ATOM   2784  H HB2  . ASP A 1 45  ? -14.724 11.726  2.887   1.00 0.00 ? 45  ASP A HB2  2  
ATOM   2785  H HB3  . ASP A 1 45  ? -14.636 12.914  4.182   1.00 0.00 ? 45  ASP A HB3  2  
ATOM   2786  N N    . ILE A 1 46  ? -12.342 10.444  3.934   1.00 0.00 ? 46  ILE A N    2  
ATOM   2787  C CA   . ILE A 1 46  ? -11.891 9.460   4.909   1.00 0.00 ? 46  ILE A CA   2  
ATOM   2788  C C    . ILE A 1 46  ? -10.373 9.303   4.881   1.00 0.00 ? 46  ILE A C    2  
ATOM   2789  O O    . ILE A 1 46  ? -9.720  9.302   5.927   1.00 0.00 ? 46  ILE A O    2  
ATOM   2790  C CB   . ILE A 1 46  ? -12.573 8.081   4.694   1.00 0.00 ? 46  ILE A CB   2  
ATOM   2791  C CG1  . ILE A 1 46  ? -13.995 8.068   5.260   1.00 0.00 ? 46  ILE A CG1  2  
ATOM   2792  C CG2  . ILE A 1 46  ? -11.773 6.947   5.319   1.00 0.00 ? 46  ILE A CG2  2  
ATOM   2793  C CD1  . ILE A 1 46  ? -14.976 8.939   4.512   1.00 0.00 ? 46  ILE A CD1  2  
ATOM   2794  H H    . ILE A 1 46  ? -12.717 10.138  3.080   1.00 0.00 ? 46  ILE A H    2  
ATOM   2795  H HA   . ILE A 1 46  ? -12.176 9.820   5.885   1.00 0.00 ? 46  ILE A HA   2  
ATOM   2796  H HB   . ILE A 1 46  ? -12.622 7.902   3.630   1.00 0.00 ? 46  ILE A HB   2  
ATOM   2797  H HG12 . ILE A 1 46  ? -14.364 7.056   5.228   1.00 0.00 ? 46  ILE A HG12 2  
ATOM   2798  H HG13 . ILE A 1 46  ? -13.969 8.403   6.287   1.00 0.00 ? 46  ILE A HG13 2  
ATOM   2799  H HG21 . ILE A 1 46  ? -11.124 6.513   4.579   1.00 0.00 ? 46  ILE A HG21 2  
ATOM   2800  H HG22 . ILE A 1 46  ? -12.448 6.193   5.694   1.00 0.00 ? 46  ILE A HG22 2  
ATOM   2801  H HG23 . ILE A 1 46  ? -11.178 7.335   6.134   1.00 0.00 ? 46  ILE A HG23 2  
ATOM   2802  H HD11 . ILE A 1 46  ? -15.022 8.620   3.482   1.00 0.00 ? 46  ILE A HD11 2  
ATOM   2803  H HD12 . ILE A 1 46  ? -14.651 9.969   4.555   1.00 0.00 ? 46  ILE A HD12 2  
ATOM   2804  H HD13 . ILE A 1 46  ? -15.954 8.850   4.961   1.00 0.00 ? 46  ILE A HD13 2  
ATOM   2805  N N    . ILE A 1 47  ? -9.811  9.187   3.687   1.00 0.00 ? 47  ILE A N    2  
ATOM   2806  C CA   . ILE A 1 47  ? -8.386  8.934   3.545   1.00 0.00 ? 47  ILE A CA   2  
ATOM   2807  C C    . ILE A 1 47  ? -7.585  10.233  3.588   1.00 0.00 ? 47  ILE A C    2  
ATOM   2808  O O    . ILE A 1 47  ? -7.504  10.958  2.593   1.00 0.00 ? 47  ILE A O    2  
ATOM   2809  C CB   . ILE A 1 47  ? -8.070  8.198   2.230   1.00 0.00 ? 47  ILE A CB   2  
ATOM   2810  C CG1  . ILE A 1 47  ? -8.919  6.932   2.089   1.00 0.00 ? 47  ILE A CG1  2  
ATOM   2811  C CG2  . ILE A 1 47  ? -6.588  7.853   2.175   1.00 0.00 ? 47  ILE A CG2  2  
ATOM   2812  C CD1  . ILE A 1 47  ? -8.466  5.795   2.966   1.00 0.00 ? 47  ILE A CD1  2  
ATOM   2813  H H    . ILE A 1 47  ? -10.366 9.279   2.881   1.00 0.00 ? 47  ILE A H    2  
ATOM   2814  H HA   . ILE A 1 47  ? -8.076  8.305   4.368   1.00 0.00 ? 47  ILE A HA   2  
ATOM   2815  H HB   . ILE A 1 47  ? -8.290  8.861   1.414   1.00 0.00 ? 47  ILE A HB   2  
ATOM   2816  H HG12 . ILE A 1 47  ? -9.940  7.161   2.356   1.00 0.00 ? 47  ILE A HG12 2  
ATOM   2817  H HG13 . ILE A 1 47  ? -8.886  6.595   1.063   1.00 0.00 ? 47  ILE A HG13 2  
ATOM   2818  H HG21 . ILE A 1 47  ? -6.412  7.126   1.399   1.00 0.00 ? 47  ILE A HG21 2  
ATOM   2819  H HG22 . ILE A 1 47  ? -6.276  7.448   3.125   1.00 0.00 ? 47  ILE A HG22 2  
ATOM   2820  H HG23 . ILE A 1 47  ? -6.019  8.747   1.964   1.00 0.00 ? 47  ILE A HG23 2  
ATOM   2821  H HD11 . ILE A 1 47  ? -8.563  6.079   4.004   1.00 0.00 ? 47  ILE A HD11 2  
ATOM   2822  H HD12 . ILE A 1 47  ? -7.436  5.569   2.748   1.00 0.00 ? 47  ILE A HD12 2  
ATOM   2823  H HD13 . ILE A 1 47  ? -9.068  4.927   2.769   1.00 0.00 ? 47  ILE A HD13 2  
ATOM   2824  N N    . LYS A 1 48  ? -7.010  10.532  4.748   1.00 0.00 ? 48  LYS A N    2  
ATOM   2825  C CA   . LYS A 1 48  ? -6.123  11.673  4.891   1.00 0.00 ? 48  LYS A CA   2  
ATOM   2826  C C    . LYS A 1 48  ? -4.811  11.463  4.141   1.00 0.00 ? 48  LYS A C    2  
ATOM   2827  O O    . LYS A 1 48  ? -4.260  12.400  3.567   1.00 0.00 ? 48  LYS A O    2  
ATOM   2828  C CB   . LYS A 1 48  ? -5.826  11.941  6.359   1.00 0.00 ? 48  LYS A CB   2  
ATOM   2829  C CG   . LYS A 1 48  ? -6.843  12.853  7.013   1.00 0.00 ? 48  LYS A CG   2  
ATOM   2830  C CD   . LYS A 1 48  ? -8.237  12.270  6.980   1.00 0.00 ? 48  LYS A CD   2  
ATOM   2831  C CE   . LYS A 1 48  ? -9.257  13.317  7.355   1.00 0.00 ? 48  LYS A CE   2  
ATOM   2832  N NZ   . LYS A 1 48  ? -10.617 12.749  7.534   1.00 0.00 ? 48  LYS A NZ   2  
ATOM   2833  H H    . LYS A 1 48  ? -7.212  9.993   5.537   1.00 0.00 ? 48  LYS A H    2  
ATOM   2834  H HA   . LYS A 1 48  ? -6.634  12.535  4.491   1.00 0.00 ? 48  LYS A HA   2  
ATOM   2835  H HB2  . LYS A 1 48  ? -5.814  11.002  6.893   1.00 0.00 ? 48  LYS A HB2  2  
ATOM   2836  H HB3  . LYS A 1 48  ? -4.856  12.403  6.433   1.00 0.00 ? 48  LYS A HB3  2  
ATOM   2837  H HG2  . LYS A 1 48  ? -6.559  13.025  8.039   1.00 0.00 ? 48  LYS A HG2  2  
ATOM   2838  H HG3  . LYS A 1 48  ? -6.854  13.788  6.480   1.00 0.00 ? 48  LYS A HG3  2  
ATOM   2839  H HD2  . LYS A 1 48  ? -8.443  11.932  5.975   1.00 0.00 ? 48  LYS A HD2  2  
ATOM   2840  H HD3  . LYS A 1 48  ? -8.299  11.443  7.670   1.00 0.00 ? 48  LYS A HD3  2  
ATOM   2841  H HE2  . LYS A 1 48  ? -8.947  13.795  8.272   1.00 0.00 ? 48  LYS A HE2  2  
ATOM   2842  H HE3  . LYS A 1 48  ? -9.283  14.044  6.559   1.00 0.00 ? 48  LYS A HE3  2  
ATOM   2843  H HZ1  . LYS A 1 48  ? -11.270 13.485  7.876   1.00 0.00 ? 48  LYS A HZ1  2  
ATOM   2844  H HZ2  . LYS A 1 48  ? -10.597 11.974  8.229   1.00 0.00 ? 48  LYS A HZ2  2  
ATOM   2845  H HZ3  . LYS A 1 48  ? -10.978 12.379  6.629   1.00 0.00 ? 48  LYS A HZ3  2  
ATOM   2846  N N    . HIS A 1 49  ? -4.312  10.232  4.147   1.00 0.00 ? 49  HIS A N    2  
ATOM   2847  C CA   . HIS A 1 49  ? -3.016  9.928   3.542   1.00 0.00 ? 49  HIS A CA   2  
ATOM   2848  C C    . HIS A 1 49  ? -3.146  8.885   2.423   1.00 0.00 ? 49  HIS A C    2  
ATOM   2849  O O    . HIS A 1 49  ? -2.752  7.731   2.604   1.00 0.00 ? 49  HIS A O    2  
ATOM   2850  C CB   . HIS A 1 49  ? -2.042  9.410   4.608   1.00 0.00 ? 49  HIS A CB   2  
ATOM   2851  C CG   . HIS A 1 49  ? -1.815  10.361  5.744   1.00 0.00 ? 49  HIS A CG   2  
ATOM   2852  N ND1  . HIS A 1 49  ? -0.939  11.421  5.678   1.00 0.00 ? 49  HIS A ND1  2  
ATOM   2853  C CD2  . HIS A 1 49  ? -2.352  10.401  6.988   1.00 0.00 ? 49  HIS A CD2  2  
ATOM   2854  C CE1  . HIS A 1 49  ? -0.947  12.071  6.826   1.00 0.00 ? 49  HIS A CE1  2  
ATOM   2855  N NE2  . HIS A 1 49  ? -1.795  11.475  7.639   1.00 0.00 ? 49  HIS A NE2  2  
ATOM   2856  H H    . HIS A 1 49  ? -4.826  9.507   4.568   1.00 0.00 ? 49  HIS A H    2  
ATOM   2857  H HA   . HIS A 1 49  ? -2.617  10.841  3.127   1.00 0.00 ? 49  HIS A HA   2  
ATOM   2858  H HB2  . HIS A 1 49  ? -2.429  8.491   5.019   1.00 0.00 ? 49  HIS A HB2  2  
ATOM   2859  H HB3  . HIS A 1 49  ? -1.086  9.213   4.144   1.00 0.00 ? 49  HIS A HB3  2  
ATOM   2860  H HD1  . HIS A 1 49  ? -0.404  11.674  4.894   1.00 0.00 ? 49  HIS A HD1  2  
ATOM   2861  H HD2  . HIS A 1 49  ? -3.080  9.713   7.395   1.00 0.00 ? 49  HIS A HD2  2  
ATOM   2862  H HE1  . HIS A 1 49  ? -0.356  12.945  7.059   1.00 0.00 ? 49  HIS A HE1  2  
ATOM   2863  H HE2  . HIS A 1 49  ? -2.146  11.875  8.465   1.00 0.00 ? 49  HIS A HE2  2  
ATOM   2864  N N    . PRO A 1 50  ? -3.713  9.259   1.257   1.00 0.00 ? 50  PRO A N    2  
ATOM   2865  C CA   . PRO A 1 50  ? -3.806  8.348   0.110   1.00 0.00 ? 50  PRO A CA   2  
ATOM   2866  C C    . PRO A 1 50  ? -2.440  8.064   -0.509  1.00 0.00 ? 50  PRO A C    2  
ATOM   2867  O O    . PRO A 1 50  ? -1.840  8.928   -1.153  1.00 0.00 ? 50  PRO A O    2  
ATOM   2868  C CB   . PRO A 1 50  ? -4.701  9.095   -0.880  1.00 0.00 ? 50  PRO A CB   2  
ATOM   2869  C CG   . PRO A 1 50  ? -4.534  10.531  -0.530  1.00 0.00 ? 50  PRO A CG   2  
ATOM   2870  C CD   . PRO A 1 50  ? -4.327  10.570  0.963   1.00 0.00 ? 50  PRO A CD   2  
ATOM   2871  H HA   . PRO A 1 50  ? -4.273  7.413   0.387   1.00 0.00 ? 50  PRO A HA   2  
ATOM   2872  H HB2  . PRO A 1 50  ? -4.372  8.893   -1.889  1.00 0.00 ? 50  PRO A HB2  2  
ATOM   2873  H HB3  . PRO A 1 50  ? -5.725  8.777   -0.757  1.00 0.00 ? 50  PRO A HB3  2  
ATOM   2874  H HG2  . PRO A 1 50  ? -3.672  10.936  -1.044  1.00 0.00 ? 50  PRO A HG2  2  
ATOM   2875  H HG3  . PRO A 1 50  ? -5.425  11.078  -0.803  1.00 0.00 ? 50  PRO A HG3  2  
ATOM   2876  H HD2  . PRO A 1 50  ? -3.662  11.378  1.235   1.00 0.00 ? 50  PRO A HD2  2  
ATOM   2877  H HD3  . PRO A 1 50  ? -5.278  10.671  1.473   1.00 0.00 ? 50  PRO A HD3  2  
ATOM   2878  N N    . MET A 1 51  ? -1.942  6.859   -0.293  1.00 0.00 ? 51  MET A N    2  
ATOM   2879  C CA   . MET A 1 51  ? -0.656  6.462   -0.840  1.00 0.00 ? 51  MET A CA   2  
ATOM   2880  C C    . MET A 1 51  ? -0.752  5.090   -1.493  1.00 0.00 ? 51  MET A C    2  
ATOM   2881  O O    . MET A 1 51  ? -1.559  4.255   -1.087  1.00 0.00 ? 51  MET A O    2  
ATOM   2882  C CB   . MET A 1 51  ? 0.421   6.470   0.258   1.00 0.00 ? 51  MET A CB   2  
ATOM   2883  C CG   . MET A 1 51  ? 1.784   5.962   -0.205  1.00 0.00 ? 51  MET A CG   2  
ATOM   2884  S SD   . MET A 1 51  ? 2.371   6.827   -1.678  1.00 0.00 ? 51  MET A SD   2  
ATOM   2885  C CE   . MET A 1 51  ? 2.312   8.523   -1.117  1.00 0.00 ? 51  MET A CE   2  
ATOM   2886  H H    . MET A 1 51  ? -2.453  6.218   0.245   1.00 0.00 ? 51  MET A H    2  
ATOM   2887  H HA   . MET A 1 51  ? -0.391  7.188   -1.601  1.00 0.00 ? 51  MET A HA   2  
ATOM   2888  H HB2  . MET A 1 51  ? 0.545   7.484   0.604   1.00 0.00 ? 51  MET A HB2  2  
ATOM   2889  H HB3  . MET A 1 51  ? 0.084   5.857   1.088   1.00 0.00 ? 51  MET A HB3  2  
ATOM   2890  H HG2  . MET A 1 51  ? 2.503   6.102   0.595   1.00 0.00 ? 51  MET A HG2  2  
ATOM   2891  H HG3  . MET A 1 51  ? 1.705   4.906   -0.435  1.00 0.00 ? 51  MET A HG3  2  
ATOM   2892  H HE1  . MET A 1 51  ? 2.794   8.593   -0.160  1.00 0.00 ? 51  MET A HE1  2  
ATOM   2893  H HE2  . MET A 1 51  ? 1.283   8.838   -1.026  1.00 0.00 ? 51  MET A HE2  2  
ATOM   2894  H HE3  . MET A 1 51  ? 2.824   9.155   -1.826  1.00 0.00 ? 51  MET A HE3  2  
ATOM   2895  N N    . ASP A 1 52  ? 0.063   4.886   -2.515  1.00 0.00 ? 52  ASP A N    2  
ATOM   2896  C CA   . ASP A 1 52  ? 0.117   3.625   -3.241  1.00 0.00 ? 52  ASP A CA   2  
ATOM   2897  C C    . ASP A 1 52  ? 1.566   3.279   -3.551  1.00 0.00 ? 52  ASP A C    2  
ATOM   2898  O O    . ASP A 1 52  ? 2.435   4.146   -3.471  1.00 0.00 ? 52  ASP A O    2  
ATOM   2899  C CB   . ASP A 1 52  ? -0.693  3.702   -4.540  1.00 0.00 ? 52  ASP A CB   2  
ATOM   2900  C CG   . ASP A 1 52  ? -0.198  4.798   -5.457  1.00 0.00 ? 52  ASP A CG   2  
ATOM   2901  O OD1  . ASP A 1 52  ? 0.699   4.539   -6.281  1.00 0.00 ? 52  ASP A OD1  2  
ATOM   2902  O OD2  . ASP A 1 52  ? -0.700  5.938   -5.349  1.00 0.00 ? 52  ASP A OD2  2  
ATOM   2903  H H    . ASP A 1 52  ? 0.674   5.609   -2.781  1.00 0.00 ? 52  ASP A H    2  
ATOM   2904  H HA   . ASP A 1 52  ? -0.297  2.855   -2.605  1.00 0.00 ? 52  ASP A HA   2  
ATOM   2905  H HB2  . ASP A 1 52  ? -0.620  2.760   -5.062  1.00 0.00 ? 52  ASP A HB2  2  
ATOM   2906  H HB3  . ASP A 1 52  ? -1.730  3.899   -4.303  1.00 0.00 ? 52  ASP A HB3  2  
ATOM   2907  N N    . LEU A 1 53  ? 1.831   2.037   -3.919  1.00 0.00 ? 53  LEU A N    2  
ATOM   2908  C CA   . LEU A 1 53  ? 3.204   1.589   -4.143  1.00 0.00 ? 53  LEU A CA   2  
ATOM   2909  C C    . LEU A 1 53  ? 3.872   2.331   -5.297  1.00 0.00 ? 53  LEU A C    2  
ATOM   2910  O O    . LEU A 1 53  ? 5.073   2.615   -5.249  1.00 0.00 ? 53  LEU A O    2  
ATOM   2911  C CB   . LEU A 1 53  ? 3.235   0.081   -4.376  1.00 0.00 ? 53  LEU A CB   2  
ATOM   2912  C CG   . LEU A 1 53  ? 3.094   -0.751  -3.105  1.00 0.00 ? 53  LEU A CG   2  
ATOM   2913  C CD1  . LEU A 1 53  ? 2.791   -2.187  -3.455  1.00 0.00 ? 53  LEU A CD1  2  
ATOM   2914  C CD2  . LEU A 1 53  ? 4.353   -0.673  -2.265  1.00 0.00 ? 53  LEU A CD2  2  
ATOM   2915  H H    . LEU A 1 53  ? 1.087   1.405   -4.048  1.00 0.00 ? 53  LEU A H    2  
ATOM   2916  H HA   . LEU A 1 53  ? 3.758   1.802   -3.244  1.00 0.00 ? 53  LEU A HA   2  
ATOM   2917  H HB2  . LEU A 1 53  ? 2.426   -0.181  -5.044  1.00 0.00 ? 53  LEU A HB2  2  
ATOM   2918  H HB3  . LEU A 1 53  ? 4.168   -0.177  -4.851  1.00 0.00 ? 53  LEU A HB3  2  
ATOM   2919  H HG   . LEU A 1 53  ? 2.278   -0.361  -2.516  1.00 0.00 ? 53  LEU A HG   2  
ATOM   2920  H HD11 . LEU A 1 53  ? 1.992   -2.201  -4.168  1.00 0.00 ? 53  LEU A HD11 2  
ATOM   2921  H HD12 . LEU A 1 53  ? 2.493   -2.723  -2.565  1.00 0.00 ? 53  LEU A HD12 2  
ATOM   2922  H HD13 . LEU A 1 53  ? 3.668   -2.650  -3.882  1.00 0.00 ? 53  LEU A HD13 2  
ATOM   2923  H HD21 . LEU A 1 53  ? 4.466   0.329   -1.893  1.00 0.00 ? 53  LEU A HD21 2  
ATOM   2924  H HD22 . LEU A 1 53  ? 5.208   -0.932  -2.871  1.00 0.00 ? 53  LEU A HD22 2  
ATOM   2925  H HD23 . LEU A 1 53  ? 4.277   -1.360  -1.434  1.00 0.00 ? 53  LEU A HD23 2  
ATOM   2926  N N    . SER A 1 54  ? 3.097   2.670   -6.316  1.00 0.00 ? 54  SER A N    2  
ATOM   2927  C CA   . SER A 1 54  ? 3.630   3.386   -7.466  1.00 0.00 ? 54  SER A CA   2  
ATOM   2928  C C    . SER A 1 54  ? 4.110   4.783   -7.066  1.00 0.00 ? 54  SER A C    2  
ATOM   2929  O O    . SER A 1 54  ? 5.120   5.270   -7.577  1.00 0.00 ? 54  SER A O    2  
ATOM   2930  C CB   . SER A 1 54  ? 2.578   3.480   -8.569  1.00 0.00 ? 54  SER A CB   2  
ATOM   2931  O OG   . SER A 1 54  ? 2.141   2.191   -8.958  1.00 0.00 ? 54  SER A OG   2  
ATOM   2932  H H    . SER A 1 54  ? 2.143   2.441   -6.290  1.00 0.00 ? 54  SER A H    2  
ATOM   2933  H HA   . SER A 1 54  ? 4.474   2.824   -7.839  1.00 0.00 ? 54  SER A HA   2  
ATOM   2934  H HB2  . SER A 1 54  ? 1.729   4.040   -8.208  1.00 0.00 ? 54  SER A HB2  2  
ATOM   2935  H HB3  . SER A 1 54  ? 3.001   3.978   -9.426  1.00 0.00 ? 54  SER A HB3  2  
ATOM   2936  H HG   . SER A 1 54  ? 1.438   1.904   -8.354  1.00 0.00 ? 54  SER A HG   2  
ATOM   2937  N N    . THR A 1 55  ? 3.392   5.420   -6.146  1.00 0.00 ? 55  THR A N    2  
ATOM   2938  C CA   . THR A 1 55  ? 3.777   6.734   -5.654  1.00 0.00 ? 55  THR A CA   2  
ATOM   2939  C C    . THR A 1 55  ? 4.946   6.633   -4.676  1.00 0.00 ? 55  THR A C    2  
ATOM   2940  O O    . THR A 1 55  ? 5.814   7.506   -4.650  1.00 0.00 ? 55  THR A O    2  
ATOM   2941  C CB   . THR A 1 55  ? 2.602   7.466   -4.986  1.00 0.00 ? 55  THR A CB   2  
ATOM   2942  O OG1  . THR A 1 55  ? 1.451   7.423   -5.841  1.00 0.00 ? 55  THR A OG1  2  
ATOM   2943  C CG2  . THR A 1 55  ? 2.968   8.912   -4.733  1.00 0.00 ? 55  THR A CG2  2  
ATOM   2944  H H    . THR A 1 55  ? 2.577   4.996   -5.797  1.00 0.00 ? 55  THR A H    2  
ATOM   2945  H HA   . THR A 1 55  ? 4.094   7.326   -6.499  1.00 0.00 ? 55  THR A HA   2  
ATOM   2946  H HB   . THR A 1 55  ? 2.379   6.993   -4.038  1.00 0.00 ? 55  THR A HB   2  
ATOM   2947  H HG1  . THR A 1 55  ? 0.885   6.675   -5.589  1.00 0.00 ? 55  THR A HG1  2  
ATOM   2948  H HG21 . THR A 1 55  ? 3.961   8.948   -4.321  1.00 0.00 ? 55  THR A HG21 2  
ATOM   2949  H HG22 . THR A 1 55  ? 2.270   9.348   -4.034  1.00 0.00 ? 55  THR A HG22 2  
ATOM   2950  H HG23 . THR A 1 55  ? 2.943   9.461   -5.662  1.00 0.00 ? 55  THR A HG23 2  
ATOM   2951  N N    . VAL A 1 56  ? 4.981   5.561   -3.890  1.00 0.00 ? 56  VAL A N    2  
ATOM   2952  C CA   . VAL A 1 56  ? 6.108   5.320   -2.995  1.00 0.00 ? 56  VAL A CA   2  
ATOM   2953  C C    . VAL A 1 56  ? 7.382   5.191   -3.815  1.00 0.00 ? 56  VAL A C    2  
ATOM   2954  O O    . VAL A 1 56  ? 8.402   5.814   -3.520  1.00 0.00 ? 56  VAL A O    2  
ATOM   2955  C CB   . VAL A 1 56  ? 5.916   4.040   -2.153  1.00 0.00 ? 56  VAL A CB   2  
ATOM   2956  C CG1  . VAL A 1 56  ? 7.151   3.759   -1.306  1.00 0.00 ? 56  VAL A CG1  2  
ATOM   2957  C CG2  . VAL A 1 56  ? 4.688   4.158   -1.267  1.00 0.00 ? 56  VAL A CG2  2  
ATOM   2958  H H    . VAL A 1 56  ? 4.236   4.919   -3.911  1.00 0.00 ? 56  VAL A H    2  
ATOM   2959  H HA   . VAL A 1 56  ? 6.198   6.165   -2.328  1.00 0.00 ? 56  VAL A HA   2  
ATOM   2960  H HB   . VAL A 1 56  ? 5.769   3.208   -2.827  1.00 0.00 ? 56  VAL A HB   2  
ATOM   2961  H HG11 . VAL A 1 56  ? 8.014   3.634   -1.952  1.00 0.00 ? 56  VAL A HG11 2  
ATOM   2962  H HG12 . VAL A 1 56  ? 6.996   2.858   -0.732  1.00 0.00 ? 56  VAL A HG12 2  
ATOM   2963  H HG13 . VAL A 1 56  ? 7.322   4.588   -0.635  1.00 0.00 ? 56  VAL A HG13 2  
ATOM   2964  H HG21 . VAL A 1 56  ? 3.844   4.484   -1.859  1.00 0.00 ? 56  VAL A HG21 2  
ATOM   2965  H HG22 . VAL A 1 56  ? 4.878   4.879   -0.484  1.00 0.00 ? 56  VAL A HG22 2  
ATOM   2966  H HG23 . VAL A 1 56  ? 4.469   3.198   -0.826  1.00 0.00 ? 56  VAL A HG23 2  
ATOM   2967  N N    . LYS A 1 57  ? 7.292   4.400   -4.872  1.00 0.00 ? 57  LYS A N    2  
ATOM   2968  C CA   . LYS A 1 57  ? 8.410   4.194   -5.774  1.00 0.00 ? 57  LYS A CA   2  
ATOM   2969  C C    . LYS A 1 57  ? 8.756   5.499   -6.469  1.00 0.00 ? 57  LYS A C    2  
ATOM   2970  O O    . LYS A 1 57  ? 9.922   5.843   -6.614  1.00 0.00 ? 57  LYS A O    2  
ATOM   2971  C CB   . LYS A 1 57  ? 8.052   3.134   -6.810  1.00 0.00 ? 57  LYS A CB   2  
ATOM   2972  C CG   . LYS A 1 57  ? 9.140   2.099   -7.034  1.00 0.00 ? 57  LYS A CG   2  
ATOM   2973  C CD   . LYS A 1 57  ? 8.733   1.100   -8.100  1.00 0.00 ? 57  LYS A CD   2  
ATOM   2974  C CE   . LYS A 1 57  ? 9.706   -0.064  -8.175  1.00 0.00 ? 57  LYS A CE   2  
ATOM   2975  N NZ   . LYS A 1 57  ? 10.996  0.324   -8.803  1.00 0.00 ? 57  LYS A NZ   2  
ATOM   2976  H H    . LYS A 1 57  ? 6.442   3.940   -5.049  1.00 0.00 ? 57  LYS A H    2  
ATOM   2977  H HA   . LYS A 1 57  ? 9.256   3.859   -5.192  1.00 0.00 ? 57  LYS A HA   2  
ATOM   2978  H HB2  . LYS A 1 57  ? 7.162   2.623   -6.484  1.00 0.00 ? 57  LYS A HB2  2  
ATOM   2979  H HB3  . LYS A 1 57  ? 7.850   3.622   -7.753  1.00 0.00 ? 57  LYS A HB3  2  
ATOM   2980  H HG2  . LYS A 1 57  ? 10.044  2.596   -7.338  1.00 0.00 ? 57  LYS A HG2  2  
ATOM   2981  H HG3  . LYS A 1 57  ? 9.315   1.571   -6.114  1.00 0.00 ? 57  LYS A HG3  2  
ATOM   2982  H HD2  . LYS A 1 57  ? 7.750   0.719   -7.867  1.00 0.00 ? 57  LYS A HD2  2  
ATOM   2983  H HD3  . LYS A 1 57  ? 8.709   1.599   -9.058  1.00 0.00 ? 57  LYS A HD3  2  
ATOM   2984  H HE2  . LYS A 1 57  ? 9.896   -0.416  -7.169  1.00 0.00 ? 57  LYS A HE2  2  
ATOM   2985  H HE3  . LYS A 1 57  ? 9.255   -0.856  -8.753  1.00 0.00 ? 57  LYS A HE3  2  
ATOM   2986  H HZ1  . LYS A 1 57  ? 11.475  1.046   -8.233  1.00 0.00 ? 57  LYS A HZ1  2  
ATOM   2987  H HZ2  . LYS A 1 57  ? 10.827  0.711   -9.753  1.00 0.00 ? 57  LYS A HZ2  2  
ATOM   2988  H HZ3  . LYS A 1 57  ? 11.617  -0.507  -8.891  1.00 0.00 ? 57  LYS A HZ3  2  
ATOM   2989  N N    . ARG A 1 58  ? 7.721   6.219   -6.874  1.00 0.00 ? 58  ARG A N    2  
ATOM   2990  C CA   . ARG A 1 58  ? 7.862   7.524   -7.511  1.00 0.00 ? 58  ARG A CA   2  
ATOM   2991  C C    . ARG A 1 58  ? 8.720   8.460   -6.664  1.00 0.00 ? 58  ARG A C    2  
ATOM   2992  O O    . ARG A 1 58  ? 9.708   9.025   -7.135  1.00 0.00 ? 58  ARG A O    2  
ATOM   2993  C CB   . ARG A 1 58  ? 6.476   8.130   -7.696  1.00 0.00 ? 58  ARG A CB   2  
ATOM   2994  C CG   . ARG A 1 58  ? 6.469   9.505   -8.337  1.00 0.00 ? 58  ARG A CG   2  
ATOM   2995  C CD   . ARG A 1 58  ? 5.068   10.082  -8.372  1.00 0.00 ? 58  ARG A CD   2  
ATOM   2996  N NE   . ARG A 1 58  ? 5.047   11.448  -8.888  1.00 0.00 ? 58  ARG A NE   2  
ATOM   2997  C CZ   . ARG A 1 58  ? 3.941   12.174  -9.032  1.00 0.00 ? 58  ARG A CZ   2  
ATOM   2998  N NH1  . ARG A 1 58  ? 2.757   11.659  -8.720  1.00 0.00 ? 58  ARG A NH1  2  
ATOM   2999  N NH2  . ARG A 1 58  ? 4.017   13.418  -9.490  1.00 0.00 ? 58  ARG A NH2  2  
ATOM   3000  H H    . ARG A 1 58  ? 6.816   5.853   -6.747  1.00 0.00 ? 58  ARG A H    2  
ATOM   3001  H HA   . ARG A 1 58  ? 8.324   7.387   -8.476  1.00 0.00 ? 58  ARG A HA   2  
ATOM   3002  H HB2  . ARG A 1 58  ? 5.890   7.462   -8.304  1.00 0.00 ? 58  ARG A HB2  2  
ATOM   3003  H HB3  . ARG A 1 58  ? 6.007   8.211   -6.726  1.00 0.00 ? 58  ARG A HB3  2  
ATOM   3004  H HG2  . ARG A 1 58  ? 7.099   10.161  -7.764  1.00 0.00 ? 58  ARG A HG2  2  
ATOM   3005  H HG3  . ARG A 1 58  ? 6.845   9.428   -9.344  1.00 0.00 ? 58  ARG A HG3  2  
ATOM   3006  H HD2  . ARG A 1 58  ? 4.450   9.460   -9.001  1.00 0.00 ? 58  ARG A HD2  2  
ATOM   3007  H HD3  . ARG A 1 58  ? 4.678   10.082  -7.369  1.00 0.00 ? 58  ARG A HD3  2  
ATOM   3008  H HE   . ARG A 1 58  ? 5.915   11.850  -9.131  1.00 0.00 ? 58  ARG A HE   2  
ATOM   3009  H HH11 . ARG A 1 58  ? 2.692   10.720  -8.373  1.00 0.00 ? 58  ARG A HH11 2  
ATOM   3010  H HH12 . ARG A 1 58  ? 1.924   12.207  -8.823  1.00 0.00 ? 58  ARG A HH12 2  
ATOM   3011  H HH21 . ARG A 1 58  ? 4.908   13.814  -9.725  1.00 0.00 ? 58  ARG A HH21 2  
ATOM   3012  H HH22 . ARG A 1 58  ? 3.183   13.963  -9.612  1.00 0.00 ? 58  ARG A HH22 2  
ATOM   3013  N N    . LYS A 1 59  ? 8.337   8.605   -5.407  1.00 0.00 ? 59  LYS A N    2  
ATOM   3014  C CA   . LYS A 1 59  ? 9.027   9.497   -4.491  1.00 0.00 ? 59  LYS A CA   2  
ATOM   3015  C C    . LYS A 1 59  ? 10.396  8.932   -4.111  1.00 0.00 ? 59  LYS A C    2  
ATOM   3016  O O    . LYS A 1 59  ? 11.329  9.684   -3.812  1.00 0.00 ? 59  LYS A O    2  
ATOM   3017  C CB   . LYS A 1 59  ? 8.152   9.734   -3.260  1.00 0.00 ? 59  LYS A CB   2  
ATOM   3018  C CG   . LYS A 1 59  ? 6.860   10.467  -3.589  1.00 0.00 ? 59  LYS A CG   2  
ATOM   3019  C CD   . LYS A 1 59  ? 5.774   10.257  -2.535  1.00 0.00 ? 59  LYS A CD   2  
ATOM   3020  C CE   . LYS A 1 59  ? 6.260   10.530  -1.119  1.00 0.00 ? 59  LYS A CE   2  
ATOM   3021  N NZ   . LYS A 1 59  ? 6.475   9.270   -0.360  1.00 0.00 ? 59  LYS A NZ   2  
ATOM   3022  H H    . LYS A 1 59  ? 7.559   8.095   -5.082  1.00 0.00 ? 59  LYS A H    2  
ATOM   3023  H HA   . LYS A 1 59  ? 9.174   10.438  -4.999  1.00 0.00 ? 59  LYS A HA   2  
ATOM   3024  H HB2  . LYS A 1 59  ? 7.903   8.782   -2.815  1.00 0.00 ? 59  LYS A HB2  2  
ATOM   3025  H HB3  . LYS A 1 59  ? 8.705   10.326  -2.549  1.00 0.00 ? 59  LYS A HB3  2  
ATOM   3026  H HG2  . LYS A 1 59  ? 7.071   11.524  -3.666  1.00 0.00 ? 59  LYS A HG2  2  
ATOM   3027  H HG3  . LYS A 1 59  ? 6.494   10.108  -4.540  1.00 0.00 ? 59  LYS A HG3  2  
ATOM   3028  H HD2  . LYS A 1 59  ? 4.952   10.920  -2.750  1.00 0.00 ? 59  LYS A HD2  2  
ATOM   3029  H HD3  . LYS A 1 59  ? 5.429   9.233   -2.594  1.00 0.00 ? 59  LYS A HD3  2  
ATOM   3030  H HE2  . LYS A 1 59  ? 7.195   11.076  -1.168  1.00 0.00 ? 59  LYS A HE2  2  
ATOM   3031  H HE3  . LYS A 1 59  ? 5.521   11.127  -0.602  1.00 0.00 ? 59  LYS A HE3  2  
ATOM   3032  H HZ1  . LYS A 1 59  ? 7.149   8.654   -0.860  1.00 0.00 ? 59  LYS A HZ1  2  
ATOM   3033  H HZ2  . LYS A 1 59  ? 5.576   8.751   -0.249  1.00 0.00 ? 59  LYS A HZ2  2  
ATOM   3034  H HZ3  . LYS A 1 59  ? 6.852   9.481   0.582   1.00 0.00 ? 59  LYS A HZ3  2  
ATOM   3035  N N    . MET A 1 60  ? 10.514  7.607   -4.134  1.00 0.00 ? 60  MET A N    2  
ATOM   3036  C CA   . MET A 1 60  ? 11.806  6.947   -3.959  1.00 0.00 ? 60  MET A CA   2  
ATOM   3037  C C    . MET A 1 60  ? 12.722  7.260   -5.142  1.00 0.00 ? 60  MET A C    2  
ATOM   3038  O O    . MET A 1 60  ? 13.925  7.454   -4.975  1.00 0.00 ? 60  MET A O    2  
ATOM   3039  C CB   . MET A 1 60  ? 11.639  5.426   -3.835  1.00 0.00 ? 60  MET A CB   2  
ATOM   3040  C CG   . MET A 1 60  ? 12.954  4.675   -3.686  1.00 0.00 ? 60  MET A CG   2  
ATOM   3041  S SD   . MET A 1 60  ? 12.798  2.929   -4.100  1.00 0.00 ? 60  MET A SD   2  
ATOM   3042  C CE   . MET A 1 60  ? 11.483  2.460   -2.984  1.00 0.00 ? 60  MET A CE   2  
ATOM   3043  H H    . MET A 1 60  ? 9.707   7.058   -4.253  1.00 0.00 ? 60  MET A H    2  
ATOM   3044  H HA   . MET A 1 60  ? 12.257  7.332   -3.056  1.00 0.00 ? 60  MET A HA   2  
ATOM   3045  H HB2  . MET A 1 60  ? 11.032  5.209   -2.967  1.00 0.00 ? 60  MET A HB2  2  
ATOM   3046  H HB3  . MET A 1 60  ? 11.136  5.055   -4.714  1.00 0.00 ? 60  MET A HB3  2  
ATOM   3047  H HG2  . MET A 1 60  ? 13.686  5.121   -4.338  1.00 0.00 ? 60  MET A HG2  2  
ATOM   3048  H HG3  . MET A 1 60  ? 13.286  4.758   -2.662  1.00 0.00 ? 60  MET A HG3  2  
ATOM   3049  H HE1  . MET A 1 60  ? 11.746  2.756   -1.981  1.00 0.00 ? 60  MET A HE1  2  
ATOM   3050  H HE2  . MET A 1 60  ? 11.342  1.390   -3.020  1.00 0.00 ? 60  MET A HE2  2  
ATOM   3051  H HE3  . MET A 1 60  ? 10.569  2.955   -3.278  1.00 0.00 ? 60  MET A HE3  2  
ATOM   3052  N N    . GLU A 1 61  ? 12.139  7.317   -6.338  1.00 0.00 ? 61  GLU A N    2  
ATOM   3053  C CA   . GLU A 1 61  ? 12.894  7.623   -7.551  1.00 0.00 ? 61  GLU A CA   2  
ATOM   3054  C C    . GLU A 1 61  ? 13.384  9.065   -7.536  1.00 0.00 ? 61  GLU A C    2  
ATOM   3055  O O    . GLU A 1 61  ? 14.440  9.379   -8.083  1.00 0.00 ? 61  GLU A O    2  
ATOM   3056  C CB   . GLU A 1 61  ? 12.035  7.370   -8.790  1.00 0.00 ? 61  GLU A CB   2  
ATOM   3057  C CG   . GLU A 1 61  ? 11.757  5.898   -9.044  1.00 0.00 ? 61  GLU A CG   2  
ATOM   3058  C CD   . GLU A 1 61  ? 10.939  5.649   -10.295 1.00 0.00 ? 61  GLU A CD   2  
ATOM   3059  O OE1  . GLU A 1 61  ? 11.329  4.776   -11.099 1.00 0.00 ? 61  GLU A OE1  2  
ATOM   3060  O OE2  . GLU A 1 61  ? 9.902   6.320   -10.484 1.00 0.00 ? 61  GLU A OE2  2  
ATOM   3061  H H    . GLU A 1 61  ? 11.169  7.132   -6.412  1.00 0.00 ? 61  GLU A H    2  
ATOM   3062  H HA   . GLU A 1 61  ? 13.753  6.965   -7.576  1.00 0.00 ? 61  GLU A HA   2  
ATOM   3063  H HB2  . GLU A 1 61  ? 11.087  7.874   -8.662  1.00 0.00 ? 61  GLU A HB2  2  
ATOM   3064  H HB3  . GLU A 1 61  ? 12.534  7.782   -9.654  1.00 0.00 ? 61  GLU A HB3  2  
ATOM   3065  H HG2  . GLU A 1 61  ? 12.699  5.381   -9.146  1.00 0.00 ? 61  GLU A HG2  2  
ATOM   3066  H HG3  . GLU A 1 61  ? 11.221  5.496   -8.196  1.00 0.00 ? 61  GLU A HG3  2  
ATOM   3067  N N    . ASN A 1 62  ? 12.614  9.935   -6.893  1.00 0.00 ? 62  ASN A N    2  
ATOM   3068  C CA   . ASN A 1 62  ? 13.010  11.333  -6.722  1.00 0.00 ? 62  ASN A CA   2  
ATOM   3069  C C    . ASN A 1 62  ? 13.961  11.449  -5.542  1.00 0.00 ? 62  ASN A C    2  
ATOM   3070  O O    . ASN A 1 62  ? 14.479  12.524  -5.241  1.00 0.00 ? 62  ASN A O    2  
ATOM   3071  C CB   . ASN A 1 62  ? 11.799  12.245  -6.494  1.00 0.00 ? 62  ASN A CB   2  
ATOM   3072  C CG   . ASN A 1 62  ? 10.934  12.458  -7.725  1.00 0.00 ? 62  ASN A CG   2  
ATOM   3073  O OD1  . ASN A 1 62  ? 10.300  13.505  -7.867  1.00 0.00 ? 62  ASN A OD1  2  
ATOM   3074  N ND2  . ASN A 1 62  ? 10.893  11.484  -8.619  1.00 0.00 ? 62  ASN A ND2  2  
ATOM   3075  H H    . ASN A 1 62  ? 11.762  9.626   -6.519  1.00 0.00 ? 62  ASN A H    2  
ATOM   3076  H HA   . ASN A 1 62  ? 13.529  11.643  -7.617  1.00 0.00 ? 62  ASN A HA   2  
ATOM   3077  H HB2  . ASN A 1 62  ? 11.180  11.821  -5.719  1.00 0.00 ? 62  ASN A HB2  2  
ATOM   3078  H HB3  . ASN A 1 62  ? 12.157  13.212  -6.167  1.00 0.00 ? 62  ASN A HB3  2  
ATOM   3079  H HD21 . ASN A 1 62  ? 11.418  10.674  -8.451  1.00 0.00 ? 62  ASN A HD21 2  
ATOM   3080  H HD22 . ASN A 1 62  ? 10.334  11.610  -9.418  1.00 0.00 ? 62  ASN A HD22 2  
ATOM   3081  N N    . ARG A 1 63  ? 14.164  10.315  -4.879  1.00 0.00 ? 63  ARG A N    2  
ATOM   3082  C CA   . ARG A 1 63  ? 15.097  10.189  -3.765  1.00 0.00 ? 63  ARG A CA   2  
ATOM   3083  C C    . ARG A 1 63  ? 14.730  11.109  -2.607  1.00 0.00 ? 63  ARG A C    2  
ATOM   3084  O O    . ARG A 1 63  ? 15.599  11.578  -1.874  1.00 0.00 ? 63  ARG A O    2  
ATOM   3085  C CB   . ARG A 1 63  ? 16.518  10.459  -4.258  1.00 0.00 ? 63  ARG A CB   2  
ATOM   3086  C CG   . ARG A 1 63  ? 16.892  9.618   -5.464  1.00 0.00 ? 63  ARG A CG   2  
ATOM   3087  C CD   . ARG A 1 63  ? 17.018  8.147   -5.104  1.00 0.00 ? 63  ARG A CD   2  
ATOM   3088  N NE   . ARG A 1 63  ? 16.721  7.274   -6.238  1.00 0.00 ? 63  ARG A NE   2  
ATOM   3089  C CZ   . ARG A 1 63  ? 17.627  6.865   -7.125  1.00 0.00 ? 63  ARG A CZ   2  
ATOM   3090  N NH1  . ARG A 1 63  ? 18.876  7.313   -7.062  1.00 0.00 ? 63  ARG A NH1  2  
ATOM   3091  N NH2  . ARG A 1 63  ? 17.279  6.014   -8.082  1.00 0.00 ? 63  ARG A NH2  2  
ATOM   3092  H H    . ARG A 1 63  ? 13.682  9.516   -5.171  1.00 0.00 ? 63  ARG A H    2  
ATOM   3093  H HA   . ARG A 1 63  ? 15.039  9.171   -3.414  1.00 0.00 ? 63  ARG A HA   2  
ATOM   3094  H HB2  . ARG A 1 63  ? 16.603  11.501  -4.526  1.00 0.00 ? 63  ARG A HB2  2  
ATOM   3095  H HB3  . ARG A 1 63  ? 17.214  10.240  -3.464  1.00 0.00 ? 63  ARG A HB3  2  
ATOM   3096  H HG2  . ARG A 1 63  ? 16.126  9.731   -6.224  1.00 0.00 ? 63  ARG A HG2  2  
ATOM   3097  H HG3  . ARG A 1 63  ? 17.838  9.965   -5.846  1.00 0.00 ? 63  ARG A HG3  2  
ATOM   3098  H HD2  . ARG A 1 63  ? 18.028  7.959   -4.776  1.00 0.00 ? 63  ARG A HD2  2  
ATOM   3099  H HD3  . ARG A 1 63  ? 16.335  7.921   -4.299  1.00 0.00 ? 63  ARG A HD3  2  
ATOM   3100  H HE   . ARG A 1 63  ? 15.795  6.952   -6.324  1.00 0.00 ? 63  ARG A HE   2  
ATOM   3101  H HH11 . ARG A 1 63  ? 19.147  7.960   -6.342  1.00 0.00 ? 63  ARG A HH11 2  
ATOM   3102  H HH12 . ARG A 1 63  ? 19.553  7.014   -7.741  1.00 0.00 ? 63  ARG A HH12 2  
ATOM   3103  H HH21 . ARG A 1 63  ? 16.336  5.676   -8.140  1.00 0.00 ? 63  ARG A HH21 2  
ATOM   3104  H HH22 . ARG A 1 63  ? 17.961  5.696   -8.748  1.00 0.00 ? 63  ARG A HH22 2  
ATOM   3105  N N    . ASP A 1 64  ? 13.430  11.342  -2.441  1.00 0.00 ? 64  ASP A N    2  
ATOM   3106  C CA   . ASP A 1 64  ? 12.931  12.146  -1.307  1.00 0.00 ? 64  ASP A CA   2  
ATOM   3107  C C    . ASP A 1 64  ? 13.243  11.451  0.008   1.00 0.00 ? 64  ASP A C    2  
ATOM   3108  O O    . ASP A 1 64  ? 13.450  12.092  1.040   1.00 0.00 ? 64  ASP A O    2  
ATOM   3109  C CB   . ASP A 1 64  ? 11.407  12.375  -1.378  1.00 0.00 ? 64  ASP A CB   2  
ATOM   3110  C CG   . ASP A 1 64  ? 11.031  13.803  -1.047  1.00 0.00 ? 64  ASP A CG   2  
ATOM   3111  O OD1  . ASP A 1 64  ? 10.943  14.135  0.154   1.00 0.00 ? 64  ASP A OD1  2  
ATOM   3112  O OD2  . ASP A 1 64  ? 10.814  14.595  -1.984  1.00 0.00 ? 64  ASP A OD2  2  
ATOM   3113  H H    . ASP A 1 64  ? 12.799  10.983  -3.109  1.00 0.00 ? 64  ASP A H    2  
ATOM   3114  H HA   . ASP A 1 64  ? 13.443  13.102  -1.324  1.00 0.00 ? 64  ASP A HA   2  
ATOM   3115  H HB2  . ASP A 1 64  ? 11.039  12.135  -2.365  1.00 0.00 ? 64  ASP A HB2  2  
ATOM   3116  H HB3  . ASP A 1 64  ? 10.919  11.732  -0.650  1.00 0.00 ? 64  ASP A HB3  2  
ATOM   3117  N N    . TYR A 1 65  ? 13.276  10.130  -0.047  1.00 0.00 ? 65  TYR A N    2  
ATOM   3118  C CA   . TYR A 1 65  ? 13.460  9.308   1.138   1.00 0.00 ? 65  TYR A CA   2  
ATOM   3119  C C    . TYR A 1 65  ? 14.907  9.371   1.587   1.00 0.00 ? 65  TYR A C    2  
ATOM   3120  O O    . TYR A 1 65  ? 15.818  9.451   0.761   1.00 0.00 ? 65  TYR A O    2  
ATOM   3121  C CB   . TYR A 1 65  ? 13.091  7.847   0.846   1.00 0.00 ? 65  TYR A CB   2  
ATOM   3122  C CG   . TYR A 1 65  ? 11.657  7.610   0.409   1.00 0.00 ? 65  TYR A CG   2  
ATOM   3123  C CD1  . TYR A 1 65  ? 11.042  6.388   0.639   1.00 0.00 ? 65  TYR A CD1  2  
ATOM   3124  C CD2  . TYR A 1 65  ? 10.926  8.589   -0.244  1.00 0.00 ? 65  TYR A CD2  2  
ATOM   3125  C CE1  . TYR A 1 65  ? 9.743   6.153   0.230   1.00 0.00 ? 65  TYR A CE1  2  
ATOM   3126  C CE2  . TYR A 1 65  ? 9.634   8.364   -0.649  1.00 0.00 ? 65  TYR A CE2  2  
ATOM   3127  C CZ   . TYR A 1 65  ? 9.045   7.149   -0.413  1.00 0.00 ? 65  TYR A CZ   2  
ATOM   3128  O OH   . TYR A 1 65  ? 7.754   6.938   -0.831  1.00 0.00 ? 65  TYR A OH   2  
ATOM   3129  H H    . TYR A 1 65  ? 13.190  9.693   -0.918  1.00 0.00 ? 65  TYR A H    2  
ATOM   3130  H HA   . TYR A 1 65  ? 12.821  9.690   1.921   1.00 0.00 ? 65  TYR A HA   2  
ATOM   3131  H HB2  . TYR A 1 65  ? 13.732  7.476   0.060   1.00 0.00 ? 65  TYR A HB2  2  
ATOM   3132  H HB3  . TYR A 1 65  ? 13.262  7.261   1.739   1.00 0.00 ? 65  TYR A HB3  2  
ATOM   3133  H HD1  . TYR A 1 65  ? 11.593  5.613   1.151   1.00 0.00 ? 65  TYR A HD1  2  
ATOM   3134  H HD2  . TYR A 1 65  ? 11.388  9.547   -0.432  1.00 0.00 ? 65  TYR A HD2  2  
ATOM   3135  H HE1  . TYR A 1 65  ? 9.284   5.195   0.412   1.00 0.00 ? 65  TYR A HE1  2  
ATOM   3136  H HE2  . TYR A 1 65  ? 9.087   9.142   -1.154  1.00 0.00 ? 65  TYR A HE2  2  
ATOM   3137  H HH   . TYR A 1 65  ? 7.249   6.498   -0.131  1.00 0.00 ? 65  TYR A HH   2  
ATOM   3138  N N    . ARG A 1 66  ? 15.118  9.366   2.887   1.00 0.00 ? 66  ARG A N    2  
ATOM   3139  C CA   . ARG A 1 66  ? 16.462  9.318   3.430   1.00 0.00 ? 66  ARG A CA   2  
ATOM   3140  C C    . ARG A 1 66  ? 16.809  7.912   3.887   1.00 0.00 ? 66  ARG A C    2  
ATOM   3141  O O    . ARG A 1 66  ? 17.967  7.501   3.822   1.00 0.00 ? 66  ARG A O    2  
ATOM   3142  C CB   . ARG A 1 66  ? 16.609  10.299  4.593   1.00 0.00 ? 66  ARG A CB   2  
ATOM   3143  C CG   . ARG A 1 66  ? 16.495  11.764  4.191   1.00 0.00 ? 66  ARG A CG   2  
ATOM   3144  C CD   . ARG A 1 66  ? 17.628  12.194  3.264   1.00 0.00 ? 66  ARG A CD   2  
ATOM   3145  N NE   . ARG A 1 66  ? 17.454  11.711  1.892   1.00 0.00 ? 66  ARG A NE   2  
ATOM   3146  C CZ   . ARG A 1 66  ? 18.400  11.775  0.954   1.00 0.00 ? 66  ARG A CZ   2  
ATOM   3147  N NH1  . ARG A 1 66  ? 19.605  12.250  1.249   1.00 0.00 ? 66  ARG A NH1  2  
ATOM   3148  N NH2  . ARG A 1 66  ? 18.142  11.358  -0.280  1.00 0.00 ? 66  ARG A NH2  2  
ATOM   3149  H H    . ARG A 1 66  ? 14.346  9.418   3.506   1.00 0.00 ? 66  ARG A H    2  
ATOM   3150  H HA   . ARG A 1 66  ? 17.145  9.602   2.645   1.00 0.00 ? 66  ARG A HA   2  
ATOM   3151  H HB2  . ARG A 1 66  ? 15.840  10.090  5.321   1.00 0.00 ? 66  ARG A HB2  2  
ATOM   3152  H HB3  . ARG A 1 66  ? 17.576  10.150  5.052   1.00 0.00 ? 66  ARG A HB3  2  
ATOM   3153  H HG2  . ARG A 1 66  ? 15.554  11.913  3.681   1.00 0.00 ? 66  ARG A HG2  2  
ATOM   3154  H HG3  . ARG A 1 66  ? 16.521  12.373  5.083   1.00 0.00 ? 66  ARG A HG3  2  
ATOM   3155  H HD2  . ARG A 1 66  ? 17.672  13.272  3.248   1.00 0.00 ? 66  ARG A HD2  2  
ATOM   3156  H HD3  . ARG A 1 66  ? 18.557  11.806  3.655   1.00 0.00 ? 66  ARG A HD3  2  
ATOM   3157  H HE   . ARG A 1 66  ? 16.577  11.333  1.655   1.00 0.00 ? 66  ARG A HE   2  
ATOM   3158  H HH11 . ARG A 1 66  ? 19.810  12.564  2.178   1.00 0.00 ? 66  ARG A HH11 2  
ATOM   3159  H HH12 . ARG A 1 66  ? 20.315  12.298  0.539   1.00 0.00 ? 66  ARG A HH12 2  
ATOM   3160  H HH21 . ARG A 1 66  ? 17.234  10.995  -0.511  1.00 0.00 ? 66  ARG A HH21 2  
ATOM   3161  H HH22 . ARG A 1 66  ? 18.852  11.407  -0.987  1.00 0.00 ? 66  ARG A HH22 2  
ATOM   3162  N N    . ASP A 1 67  ? 15.805  7.161   4.321   1.00 0.00 ? 67  ASP A N    2  
ATOM   3163  C CA   . ASP A 1 67  ? 16.040  5.838   4.869   1.00 0.00 ? 67  ASP A CA   2  
ATOM   3164  C C    . ASP A 1 67  ? 14.901  4.909   4.494   1.00 0.00 ? 67  ASP A C    2  
ATOM   3165  O O    . ASP A 1 67  ? 13.831  5.359   4.079   1.00 0.00 ? 67  ASP A O    2  
ATOM   3166  C CB   . ASP A 1 67  ? 16.174  5.900   6.397   1.00 0.00 ? 67  ASP A CB   2  
ATOM   3167  C CG   . ASP A 1 67  ? 17.446  6.580   6.858   1.00 0.00 ? 67  ASP A CG   2  
ATOM   3168  O OD1  . ASP A 1 67  ? 17.411  7.797   7.127   1.00 0.00 ? 67  ASP A OD1  2  
ATOM   3169  O OD2  . ASP A 1 67  ? 18.481  5.889   6.967   1.00 0.00 ? 67  ASP A OD2  2  
ATOM   3170  H H    . ASP A 1 67  ? 14.879  7.492   4.253   1.00 0.00 ? 67  ASP A H    2  
ATOM   3171  H HA   . ASP A 1 67  ? 16.958  5.459   4.448   1.00 0.00 ? 67  ASP A HA   2  
ATOM   3172  H HB2  . ASP A 1 67  ? 15.335  6.444   6.803   1.00 0.00 ? 67  ASP A HB2  2  
ATOM   3173  H HB3  . ASP A 1 67  ? 16.171  4.896   6.789   1.00 0.00 ? 67  ASP A HB3  2  
ATOM   3174  N N    . ALA A 1 68  ? 15.130  3.614   4.659   1.00 0.00 ? 68  ALA A N    2  
ATOM   3175  C CA   . ALA A 1 68  ? 14.122  2.611   4.346   1.00 0.00 ? 68  ALA A CA   2  
ATOM   3176  C C    . ALA A 1 68  ? 12.995  2.678   5.355   1.00 0.00 ? 68  ALA A C    2  
ATOM   3177  O O    . ALA A 1 68  ? 11.905  2.167   5.127   1.00 0.00 ? 68  ALA A O    2  
ATOM   3178  C CB   . ALA A 1 68  ? 14.737  1.224   4.344   1.00 0.00 ? 68  ALA A CB   2  
ATOM   3179  H H    . ALA A 1 68  ? 15.993  3.325   5.017   1.00 0.00 ? 68  ALA A H    2  
ATOM   3180  H HA   . ALA A 1 68  ? 13.732  2.815   3.359   1.00 0.00 ? 68  ALA A HA   2  
ATOM   3181  H HB1  . ALA A 1 68  ? 15.178  1.030   5.309   1.00 0.00 ? 68  ALA A HB1  2  
ATOM   3182  H HB2  . ALA A 1 68  ? 15.499  1.169   3.581   1.00 0.00 ? 68  ALA A HB2  2  
ATOM   3183  H HB3  . ALA A 1 68  ? 13.971  0.490   4.142   1.00 0.00 ? 68  ALA A HB3  2  
ATOM   3184  N N    . GLN A 1 69  ? 13.279  3.321   6.474   1.00 0.00 ? 69  GLN A N    2  
ATOM   3185  C CA   . GLN A 1 69  ? 12.291  3.513   7.510   1.00 0.00 ? 69  GLN A CA   2  
ATOM   3186  C C    . GLN A 1 69  ? 11.231  4.489   7.024   1.00 0.00 ? 69  GLN A C    2  
ATOM   3187  O O    . GLN A 1 69  ? 10.045  4.319   7.290   1.00 0.00 ? 69  GLN A O    2  
ATOM   3188  C CB   . GLN A 1 69  ? 12.944  4.047   8.782   1.00 0.00 ? 69  GLN A CB   2  
ATOM   3189  C CG   . GLN A 1 69  ? 12.033  3.980   9.987   1.00 0.00 ? 69  GLN A CG   2  
ATOM   3190  C CD   . GLN A 1 69  ? 11.800  2.558   10.453  1.00 0.00 ? 69  GLN A CD   2  
ATOM   3191  O OE1  . GLN A 1 69  ? 10.863  1.890   10.014  1.00 0.00 ? 69  GLN A OE1  2  
ATOM   3192  N NE2  . GLN A 1 69  ? 12.653  2.085   11.343  1.00 0.00 ? 69  GLN A NE2  2  
ATOM   3193  H H    . GLN A 1 69  ? 14.178  3.673   6.603   1.00 0.00 ? 69  GLN A H    2  
ATOM   3194  H HA   . GLN A 1 69  ? 11.834  2.558   7.716   1.00 0.00 ? 69  GLN A HA   2  
ATOM   3195  H HB2  . GLN A 1 69  ? 13.829  3.467   8.992   1.00 0.00 ? 69  GLN A HB2  2  
ATOM   3196  H HB3  . GLN A 1 69  ? 13.226  5.077   8.626   1.00 0.00 ? 69  GLN A HB3  2  
ATOM   3197  H HG2  . GLN A 1 69  ? 12.476  4.544   10.794  1.00 0.00 ? 69  GLN A HG2  2  
ATOM   3198  H HG3  . GLN A 1 69  ? 11.084  4.414   9.717   1.00 0.00 ? 69  GLN A HG3  2  
ATOM   3199  H HE21 . GLN A 1 69  ? 13.374  2.674   11.651  1.00 0.00 ? 69  GLN A HE21 2  
ATOM   3200  H HE22 . GLN A 1 69  ? 12.539  1.162   11.654  1.00 0.00 ? 69  GLN A HE22 2  
ATOM   3201  N N    . GLU A 1 70  ? 11.675  5.509   6.293   1.00 0.00 ? 70  GLU A N    2  
ATOM   3202  C CA   . GLU A 1 70  ? 10.768  6.473   5.696   1.00 0.00 ? 70  GLU A CA   2  
ATOM   3203  C C    . GLU A 1 70  ? 9.950   5.808   4.604   1.00 0.00 ? 70  GLU A C    2  
ATOM   3204  O O    . GLU A 1 70  ? 8.796   6.162   4.366   1.00 0.00 ? 70  GLU A O    2  
ATOM   3205  C CB   . GLU A 1 70  ? 11.530  7.672   5.134   1.00 0.00 ? 70  GLU A CB   2  
ATOM   3206  C CG   . GLU A 1 70  ? 12.183  8.522   6.209   1.00 0.00 ? 70  GLU A CG   2  
ATOM   3207  C CD   . GLU A 1 70  ? 12.587  9.886   5.700   1.00 0.00 ? 70  GLU A CD   2  
ATOM   3208  O OE1  . GLU A 1 70  ? 13.175  9.964   4.601   1.00 0.00 ? 70  GLU A OE1  2  
ATOM   3209  O OE2  . GLU A 1 70  ? 12.322  10.887  6.400   1.00 0.00 ? 70  GLU A OE2  2  
ATOM   3210  H H    . GLU A 1 70  ? 12.634  5.611   6.152   1.00 0.00 ? 70  GLU A H    2  
ATOM   3211  H HA   . GLU A 1 70  ? 10.101  6.815   6.471   1.00 0.00 ? 70  GLU A HA   2  
ATOM   3212  H HB2  . GLU A 1 70  ? 12.308  7.316   4.468   1.00 0.00 ? 70  GLU A HB2  2  
ATOM   3213  H HB3  . GLU A 1 70  ? 10.844  8.292   4.577   1.00 0.00 ? 70  GLU A HB3  2  
ATOM   3214  H HG2  . GLU A 1 70  ? 11.485  8.650   7.023   1.00 0.00 ? 70  GLU A HG2  2  
ATOM   3215  H HG3  . GLU A 1 70  ? 13.065  8.011   6.569   1.00 0.00 ? 70  GLU A HG3  2  
ATOM   3216  N N    . PHE A 1 71  ? 10.561  4.836   3.944   1.00 0.00 ? 71  PHE A N    2  
ATOM   3217  C CA   . PHE A 1 71  ? 9.847   4.004   2.994   1.00 0.00 ? 71  PHE A CA   2  
ATOM   3218  C C    . PHE A 1 71  ? 8.781   3.197   3.720   1.00 0.00 ? 71  PHE A C    2  
ATOM   3219  O O    . PHE A 1 71  ? 7.614   3.219   3.338   1.00 0.00 ? 71  PHE A O    2  
ATOM   3220  C CB   . PHE A 1 71  ? 10.809  3.073   2.242   1.00 0.00 ? 71  PHE A CB   2  
ATOM   3221  C CG   . PHE A 1 71  ? 10.150  1.821   1.724   1.00 0.00 ? 71  PHE A CG   2  
ATOM   3222  C CD1  . PHE A 1 71  ? 9.511   1.817   0.498   1.00 0.00 ? 71  PHE A CD1  2  
ATOM   3223  C CD2  . PHE A 1 71  ? 10.166  0.652   2.470   1.00 0.00 ? 71  PHE A CD2  2  
ATOM   3224  C CE1  . PHE A 1 71  ? 8.901   0.670   0.023   1.00 0.00 ? 71  PHE A CE1  2  
ATOM   3225  C CE2  . PHE A 1 71  ? 9.557   -0.493  2.004   1.00 0.00 ? 71  PHE A CE2  2  
ATOM   3226  C CZ   . PHE A 1 71  ? 8.923   -0.486  0.777   1.00 0.00 ? 71  PHE A CZ   2  
ATOM   3227  H H    . PHE A 1 71  ? 11.513  4.676   4.104   1.00 0.00 ? 71  PHE A H    2  
ATOM   3228  H HA   . PHE A 1 71  ? 9.361   4.659   2.283   1.00 0.00 ? 71  PHE A HA   2  
ATOM   3229  H HB2  . PHE A 1 71  ? 11.216  3.603   1.395   1.00 0.00 ? 71  PHE A HB2  2  
ATOM   3230  H HB3  . PHE A 1 71  ? 11.617  2.786   2.899   1.00 0.00 ? 71  PHE A HB3  2  
ATOM   3231  H HD1  . PHE A 1 71  ? 9.490   2.723   -0.087  1.00 0.00 ? 71  PHE A HD1  2  
ATOM   3232  H HD2  . PHE A 1 71  ? 10.657  0.645   3.431   1.00 0.00 ? 71  PHE A HD2  2  
ATOM   3233  H HE1  . PHE A 1 71  ? 8.404   0.678   -0.937  1.00 0.00 ? 71  PHE A HE1  2  
ATOM   3234  H HE2  . PHE A 1 71  ? 9.570   -1.390  2.601   1.00 0.00 ? 71  PHE A HE2  2  
ATOM   3235  H HZ   . PHE A 1 71  ? 8.447   -1.383  0.409   1.00 0.00 ? 71  PHE A HZ   2  
ATOM   3236  N N    . ALA A 1 72  ? 9.200   2.492   4.774   1.00 0.00 ? 72  ALA A N    2  
ATOM   3237  C CA   . ALA A 1 72  ? 8.297   1.692   5.582   1.00 0.00 ? 72  ALA A CA   2  
ATOM   3238  C C    . ALA A 1 72  ? 7.153   2.545   6.103   1.00 0.00 ? 72  ALA A C    2  
ATOM   3239  O O    . ALA A 1 72  ? 6.006   2.116   6.118   1.00 0.00 ? 72  ALA A O    2  
ATOM   3240  C CB   . ALA A 1 72  ? 9.054   1.043   6.732   1.00 0.00 ? 72  ALA A CB   2  
ATOM   3241  H H    . ALA A 1 72  ? 10.154  2.500   5.005   1.00 0.00 ? 72  ALA A H    2  
ATOM   3242  H HA   . ALA A 1 72  ? 7.897   0.911   4.955   1.00 0.00 ? 72  ALA A HA   2  
ATOM   3243  H HB1  . ALA A 1 72  ? 9.608   1.800   7.272   1.00 0.00 ? 72  ALA A HB1  2  
ATOM   3244  H HB2  . ALA A 1 72  ? 9.739   0.306   6.341   1.00 0.00 ? 72  ALA A HB2  2  
ATOM   3245  H HB3  . ALA A 1 72  ? 8.353   0.565   7.400   1.00 0.00 ? 72  ALA A HB3  2  
ATOM   3246  N N    . ALA A 1 73  ? 7.485   3.761   6.506   1.00 0.00 ? 73  ALA A N    2  
ATOM   3247  C CA   . ALA A 1 73  ? 6.503   4.728   6.963   1.00 0.00 ? 73  ALA A CA   2  
ATOM   3248  C C    . ALA A 1 73  ? 5.434   4.982   5.899   1.00 0.00 ? 73  ALA A C    2  
ATOM   3249  O O    . ALA A 1 73  ? 4.241   5.027   6.202   1.00 0.00 ? 73  ALA A O    2  
ATOM   3250  C CB   . ALA A 1 73  ? 7.213   6.022   7.325   1.00 0.00 ? 73  ALA A CB   2  
ATOM   3251  H H    . ALA A 1 73  ? 8.433   4.014   6.508   1.00 0.00 ? 73  ALA A H    2  
ATOM   3252  H HA   . ALA A 1 73  ? 6.038   4.339   7.851   1.00 0.00 ? 73  ALA A HA   2  
ATOM   3253  H HB1  . ALA A 1 73  ? 7.972   6.234   6.582   1.00 0.00 ? 73  ALA A HB1  2  
ATOM   3254  H HB2  . ALA A 1 73  ? 7.676   5.921   8.296   1.00 0.00 ? 73  ALA A HB2  2  
ATOM   3255  H HB3  . ALA A 1 73  ? 6.498   6.830   7.348   1.00 0.00 ? 73  ALA A HB3  2  
ATOM   3256  N N    . ASP A 1 74  ? 5.867   5.112   4.652   1.00 0.00 ? 74  ASP A N    2  
ATOM   3257  C CA   . ASP A 1 74  ? 4.975   5.474   3.553   1.00 0.00 ? 74  ASP A CA   2  
ATOM   3258  C C    . ASP A 1 74  ? 4.183   4.258   3.055   1.00 0.00 ? 74  ASP A C    2  
ATOM   3259  O O    . ASP A 1 74  ? 2.968   4.335   2.860   1.00 0.00 ? 74  ASP A O    2  
ATOM   3260  C CB   . ASP A 1 74  ? 5.793   6.087   2.407   1.00 0.00 ? 74  ASP A CB   2  
ATOM   3261  C CG   . ASP A 1 74  ? 4.976   7.006   1.519   1.00 0.00 ? 74  ASP A CG   2  
ATOM   3262  O OD1  . ASP A 1 74  ? 4.135   7.763   2.046   1.00 0.00 ? 74  ASP A OD1  2  
ATOM   3263  O OD2  . ASP A 1 74  ? 5.214   7.018   0.296   1.00 0.00 ? 74  ASP A OD2  2  
ATOM   3264  H H    . ASP A 1 74  ? 6.819   4.964   4.462   1.00 0.00 ? 74  ASP A H    2  
ATOM   3265  H HA   . ASP A 1 74  ? 4.274   6.212   3.923   1.00 0.00 ? 74  ASP A HA   2  
ATOM   3266  H HB2  . ASP A 1 74  ? 6.619   6.655   2.817   1.00 0.00 ? 74  ASP A HB2  2  
ATOM   3267  H HB3  . ASP A 1 74  ? 6.187   5.287   1.795   1.00 0.00 ? 74  ASP A HB3  2  
ATOM   3268  N N    . VAL A 1 75  ? 4.863   3.127   2.869   1.00 0.00 ? 75  VAL A N    2  
ATOM   3269  C CA   . VAL A 1 75  ? 4.199   1.908   2.395   1.00 0.00 ? 75  VAL A CA   2  
ATOM   3270  C C    . VAL A 1 75  ? 3.237   1.366   3.451   1.00 0.00 ? 75  VAL A C    2  
ATOM   3271  O O    . VAL A 1 75  ? 2.145   0.891   3.127   1.00 0.00 ? 75  VAL A O    2  
ATOM   3272  C CB   . VAL A 1 75  ? 5.207   0.804   1.980   1.00 0.00 ? 75  VAL A CB   2  
ATOM   3273  C CG1  . VAL A 1 75  ? 6.234   0.553   3.066   1.00 0.00 ? 75  VAL A CG1  2  
ATOM   3274  C CG2  . VAL A 1 75  ? 4.494   -0.496  1.627   1.00 0.00 ? 75  VAL A CG2  2  
ATOM   3275  H H    . VAL A 1 75  ? 5.831   3.111   3.053   1.00 0.00 ? 75  VAL A H    2  
ATOM   3276  H HA   . VAL A 1 75  ? 3.624   2.177   1.521   1.00 0.00 ? 75  VAL A HA   2  
ATOM   3277  H HB   . VAL A 1 75  ? 5.726   1.142   1.100   1.00 0.00 ? 75  VAL A HB   2  
ATOM   3278  H HG11 . VAL A 1 75  ? 6.867   1.423   3.174   1.00 0.00 ? 75  VAL A HG11 2  
ATOM   3279  H HG12 . VAL A 1 75  ? 6.839   -0.301  2.799   1.00 0.00 ? 75  VAL A HG12 2  
ATOM   3280  H HG13 . VAL A 1 75  ? 5.729   0.359   4.000   1.00 0.00 ? 75  VAL A HG13 2  
ATOM   3281  H HG21 . VAL A 1 75  ? 5.224   -1.288  1.506   1.00 0.00 ? 75  VAL A HG21 2  
ATOM   3282  H HG22 . VAL A 1 75  ? 3.946   -0.368  0.707   1.00 0.00 ? 75  VAL A HG22 2  
ATOM   3283  H HG23 . VAL A 1 75  ? 3.809   -0.758  2.421   1.00 0.00 ? 75  VAL A HG23 2  
ATOM   3284  N N    . ARG A 1 76  ? 3.628   1.464   4.715   1.00 0.00 ? 76  ARG A N    2  
ATOM   3285  C CA   . ARG A 1 76  ? 2.762   1.006   5.802   1.00 0.00 ? 76  ARG A CA   2  
ATOM   3286  C C    . ARG A 1 76  ? 1.553   1.927   5.909   1.00 0.00 ? 76  ARG A C    2  
ATOM   3287  O O    . ARG A 1 76  ? 0.447   1.482   6.213   1.00 0.00 ? 76  ARG A O    2  
ATOM   3288  C CB   . ARG A 1 76  ? 3.521   0.916   7.142   1.00 0.00 ? 76  ARG A CB   2  
ATOM   3289  C CG   . ARG A 1 76  ? 2.713   1.350   8.356   1.00 0.00 ? 76  ARG A CG   2  
ATOM   3290  C CD   . ARG A 1 76  ? 3.516   1.225   9.642   1.00 0.00 ? 76  ARG A CD   2  
ATOM   3291  N NE   . ARG A 1 76  ? 3.912   -0.156  9.919   1.00 0.00 ? 76  ARG A NE   2  
ATOM   3292  C CZ   . ARG A 1 76  ? 4.827   -0.500  10.826  1.00 0.00 ? 76  ARG A CZ   2  
ATOM   3293  N NH1  . ARG A 1 76  ? 5.470   0.436   11.516  1.00 0.00 ? 76  ARG A NH1  2  
ATOM   3294  N NH2  . ARG A 1 76  ? 5.107   -1.778  11.035  1.00 0.00 ? 76  ARG A NH2  2  
ATOM   3295  H H    . ARG A 1 76  ? 4.505   1.870   4.917   1.00 0.00 ? 76  ARG A H    2  
ATOM   3296  H HA   . ARG A 1 76  ? 2.412   0.018   5.533   1.00 0.00 ? 76  ARG A HA   2  
ATOM   3297  H HB2  . ARG A 1 76  ? 3.820   -0.117  7.309   1.00 0.00 ? 76  ARG A HB2  2  
ATOM   3298  H HB3  . ARG A 1 76  ? 4.406   1.534   7.081   1.00 0.00 ? 76  ARG A HB3  2  
ATOM   3299  H HG2  . ARG A 1 76  ? 2.417   2.381   8.229   1.00 0.00 ? 76  ARG A HG2  2  
ATOM   3300  H HG3  . ARG A 1 76  ? 1.832   0.729   8.430   1.00 0.00 ? 76  ARG A HG3  2  
ATOM   3301  H HD2  . ARG A 1 76  ? 4.405   1.832   9.559   1.00 0.00 ? 76  ARG A HD2  2  
ATOM   3302  H HD3  . ARG A 1 76  ? 2.913   1.586   10.461  1.00 0.00 ? 76  ARG A HD3  2  
ATOM   3303  H HE   . ARG A 1 76  ? 3.459   -0.867  9.406   1.00 0.00 ? 76  ARG A HE   2  
ATOM   3304  H HH11 . ARG A 1 76  ? 5.272   1.406   11.356  1.00 0.00 ? 76  ARG A HH11 2  
ATOM   3305  H HH12 . ARG A 1 76  ? 6.156   0.176   12.204  1.00 0.00 ? 76  ARG A HH12 2  
ATOM   3306  H HH21 . ARG A 1 76  ? 4.631   -2.492  10.515  1.00 0.00 ? 76  ARG A HH21 2  
ATOM   3307  H HH22 . ARG A 1 76  ? 5.796   -2.041  11.718  1.00 0.00 ? 76  ARG A HH22 2  
ATOM   3308  N N    . LEU A 1 77  ? 1.769   3.211   5.624   1.00 0.00 ? 77  LEU A N    2  
ATOM   3309  C CA   . LEU A 1 77  ? 0.690   4.188   5.590   1.00 0.00 ? 77  LEU A CA   2  
ATOM   3310  C C    . LEU A 1 77  ? -0.351  3.798   4.546   1.00 0.00 ? 77  LEU A C    2  
ATOM   3311  O O    . LEU A 1 77  ? -1.546  4.047   4.719   1.00 0.00 ? 77  LEU A O    2  
ATOM   3312  C CB   . LEU A 1 77  ? 1.246   5.575   5.271   1.00 0.00 ? 77  LEU A CB   2  
ATOM   3313  C CG   . LEU A 1 77  ? 0.953   6.656   6.308   1.00 0.00 ? 77  LEU A CG   2  
ATOM   3314  C CD1  . LEU A 1 77  ? 1.474   7.993   5.827   1.00 0.00 ? 77  LEU A CD1  2  
ATOM   3315  C CD2  . LEU A 1 77  ? -0.537  6.725   6.599   1.00 0.00 ? 77  LEU A CD2  2  
ATOM   3316  H H    . LEU A 1 77  ? 2.684   3.512   5.434   1.00 0.00 ? 77  LEU A H    2  
ATOM   3317  H HA   . LEU A 1 77  ? 0.222   4.208   6.562   1.00 0.00 ? 77  LEU A HA   2  
ATOM   3318  H HB2  . LEU A 1 77  ? 2.317   5.494   5.161   1.00 0.00 ? 77  LEU A HB2  2  
ATOM   3319  H HB3  . LEU A 1 77  ? 0.830   5.894   4.327   1.00 0.00 ? 77  LEU A HB3  2  
ATOM   3320  H HG   . LEU A 1 77  ? 1.464   6.414   7.226   1.00 0.00 ? 77  LEU A HG   2  
ATOM   3321  H HD11 . LEU A 1 77  ? 1.154   8.153   4.812   1.00 0.00 ? 77  LEU A HD11 2  
ATOM   3322  H HD12 . LEU A 1 77  ? 2.554   7.998   5.870   1.00 0.00 ? 77  LEU A HD12 2  
ATOM   3323  H HD13 . LEU A 1 77  ? 1.085   8.781   6.455   1.00 0.00 ? 77  LEU A HD13 2  
ATOM   3324  H HD21 . LEU A 1 77  ? -1.086  6.646   5.672   1.00 0.00 ? 77  LEU A HD21 2  
ATOM   3325  H HD22 . LEU A 1 77  ? -0.768  7.667   7.075   1.00 0.00 ? 77  LEU A HD22 2  
ATOM   3326  H HD23 . LEU A 1 77  ? -0.816  5.913   7.253   1.00 0.00 ? 77  LEU A HD23 2  
ATOM   3327  N N    . MET A 1 78  ? 0.109   3.183   3.463   1.00 0.00 ? 78  MET A N    2  
ATOM   3328  C CA   . MET A 1 78  ? -0.786  2.697   2.426   1.00 0.00 ? 78  MET A CA   2  
ATOM   3329  C C    . MET A 1 78  ? -1.689  1.589   2.969   1.00 0.00 ? 78  MET A C    2  
ATOM   3330  O O    . MET A 1 78  ? -2.914  1.677   2.871   1.00 0.00 ? 78  MET A O    2  
ATOM   3331  C CB   . MET A 1 78  ? 0.012   2.227   1.205   1.00 0.00 ? 78  MET A CB   2  
ATOM   3332  C CG   . MET A 1 78  ? -0.818  1.487   0.171   1.00 0.00 ? 78  MET A CG   2  
ATOM   3333  S SD   . MET A 1 78  ? -0.758  -0.298  0.403   1.00 0.00 ? 78  MET A SD   2  
ATOM   3334  C CE   . MET A 1 78  ? 0.928   -0.649  -0.094  1.00 0.00 ? 78  MET A CE   2  
ATOM   3335  H H    . MET A 1 78  ? 1.080   3.060   3.356   1.00 0.00 ? 78  MET A H    2  
ATOM   3336  H HA   . MET A 1 78  ? -1.412  3.525   2.128   1.00 0.00 ? 78  MET A HA   2  
ATOM   3337  H HB2  . MET A 1 78  ? 0.458   3.088   0.728   1.00 0.00 ? 78  MET A HB2  2  
ATOM   3338  H HB3  . MET A 1 78  ? 0.799   1.566   1.541   1.00 0.00 ? 78  MET A HB3  2  
ATOM   3339  H HG2  . MET A 1 78  ? -1.849  1.817   0.249   1.00 0.00 ? 78  MET A HG2  2  
ATOM   3340  H HG3  . MET A 1 78  ? -0.436  1.722   -0.815  1.00 0.00 ? 78  MET A HG3  2  
ATOM   3341  H HE1  . MET A 1 78  ? 1.617   -0.090  0.521   1.00 0.00 ? 78  MET A HE1  2  
ATOM   3342  H HE2  . MET A 1 78  ? 1.059   -0.367  -1.126  1.00 0.00 ? 78  MET A HE2  2  
ATOM   3343  H HE3  . MET A 1 78  ? 1.121   -1.705  0.017   1.00 0.00 ? 78  MET A HE3  2  
ATOM   3344  N N    . PHE A 1 79  ? -1.093  0.560   3.561   1.00 0.00 ? 79  PHE A N    2  
ATOM   3345  C CA   . PHE A 1 79  ? -1.878  -0.509  4.180   1.00 0.00 ? 79  PHE A CA   2  
ATOM   3346  C C    . PHE A 1 79  ? -2.781  0.052   5.287   1.00 0.00 ? 79  PHE A C    2  
ATOM   3347  O O    . PHE A 1 79  ? -3.899  -0.427  5.502   1.00 0.00 ? 79  PHE A O    2  
ATOM   3348  C CB   . PHE A 1 79  ? -0.970  -1.607  4.754   1.00 0.00 ? 79  PHE A CB   2  
ATOM   3349  C CG   . PHE A 1 79  ? -0.117  -2.303  3.729   1.00 0.00 ? 79  PHE A CG   2  
ATOM   3350  C CD1  . PHE A 1 79  ? -0.697  -2.993  2.677   1.00 0.00 ? 79  PHE A CD1  2  
ATOM   3351  C CD2  . PHE A 1 79  ? 1.264   -2.277  3.826   1.00 0.00 ? 79  PHE A CD2  2  
ATOM   3352  C CE1  . PHE A 1 79  ? 0.085   -3.641  1.738   1.00 0.00 ? 79  PHE A CE1  2  
ATOM   3353  C CE2  . PHE A 1 79  ? 2.052   -2.923  2.892   1.00 0.00 ? 79  PHE A CE2  2  
ATOM   3354  C CZ   . PHE A 1 79  ? 1.466   -3.606  1.845   1.00 0.00 ? 79  PHE A CZ   2  
ATOM   3355  H H    . PHE A 1 79  ? -0.110  0.506   3.562   1.00 0.00 ? 79  PHE A H    2  
ATOM   3356  H HA   . PHE A 1 79  ? -2.504  -0.939  3.413   1.00 0.00 ? 79  PHE A HA   2  
ATOM   3357  H HB2  . PHE A 1 79  ? -0.312  -1.174  5.492   1.00 0.00 ? 79  PHE A HB2  2  
ATOM   3358  H HB3  . PHE A 1 79  ? -1.589  -2.354  5.227   1.00 0.00 ? 79  PHE A HB3  2  
ATOM   3359  H HD1  . PHE A 1 79  ? -1.772  -3.018  2.592   1.00 0.00 ? 79  PHE A HD1  2  
ATOM   3360  H HD2  . PHE A 1 79  ? 1.726   -1.743  4.643   1.00 0.00 ? 79  PHE A HD2  2  
ATOM   3361  H HE1  . PHE A 1 79  ? -0.385  -4.175  0.926   1.00 0.00 ? 79  PHE A HE1  2  
ATOM   3362  H HE2  . PHE A 1 79  ? 3.126   -2.894  2.983   1.00 0.00 ? 79  PHE A HE2  2  
ATOM   3363  H HZ   . PHE A 1 79  ? 2.088   -4.107  1.110   1.00 0.00 ? 79  PHE A HZ   2  
ATOM   3364  N N    . SER A 1 80  ? -2.296  1.088   5.967   1.00 0.00 ? 80  SER A N    2  
ATOM   3365  C CA   . SER A 1 80  ? -3.039  1.717   7.051   1.00 0.00 ? 80  SER A CA   2  
ATOM   3366  C C    . SER A 1 80  ? -4.327  2.367   6.551   1.00 0.00 ? 80  SER A C    2  
ATOM   3367  O O    . SER A 1 80  ? -5.401  2.113   7.098   1.00 0.00 ? 80  SER A O    2  
ATOM   3368  C CB   . SER A 1 80  ? -2.171  2.758   7.754   1.00 0.00 ? 80  SER A CB   2  
ATOM   3369  O OG   . SER A 1 80  ? -1.006  2.165   8.303   1.00 0.00 ? 80  SER A OG   2  
ATOM   3370  H H    . SER A 1 80  ? -1.408  1.435   5.739   1.00 0.00 ? 80  SER A H    2  
ATOM   3371  H HA   . SER A 1 80  ? -3.296  0.946   7.760   1.00 0.00 ? 80  SER A HA   2  
ATOM   3372  H HB2  . SER A 1 80  ? -1.875  3.517   7.043   1.00 0.00 ? 80  SER A HB2  2  
ATOM   3373  H HB3  . SER A 1 80  ? -2.739  3.214   8.551   1.00 0.00 ? 80  SER A HB3  2  
ATOM   3374  H HG   . SER A 1 80  ? -0.582  1.611   7.632   1.00 0.00 ? 80  SER A HG   2  
ATOM   3375  N N    . ASN A 1 81  ? -4.232  3.196   5.506   1.00 0.00 ? 81  ASN A N    2  
ATOM   3376  C CA   . ASN A 1 81  ? -5.414  3.895   4.997   1.00 0.00 ? 81  ASN A CA   2  
ATOM   3377  C C    . ASN A 1 81  ? -6.429  2.896   4.435   1.00 0.00 ? 81  ASN A C    2  
ATOM   3378  O O    . ASN A 1 81  ? -7.630  3.160   4.428   1.00 0.00 ? 81  ASN A O    2  
ATOM   3379  C CB   . ASN A 1 81  ? -5.062  4.978   3.956   1.00 0.00 ? 81  ASN A CB   2  
ATOM   3380  C CG   . ASN A 1 81  ? -4.595  4.439   2.616   1.00 0.00 ? 81  ASN A CG   2  
ATOM   3381  O OD1  . ASN A 1 81  ? -5.400  4.066   1.767   1.00 0.00 ? 81  ASN A OD1  2  
ATOM   3382  N ND2  . ASN A 1 81  ? -3.292  4.453   2.394   1.00 0.00 ? 81  ASN A ND2  2  
ATOM   3383  H H    . ASN A 1 81  ? -3.359  3.343   5.081   1.00 0.00 ? 81  ASN A H    2  
ATOM   3384  H HA   . ASN A 1 81  ? -5.872  4.383   5.845   1.00 0.00 ? 81  ASN A HA   2  
ATOM   3385  H HB2  . ASN A 1 81  ? -5.933  5.592   3.779   1.00 0.00 ? 81  ASN A HB2  2  
ATOM   3386  H HB3  . ASN A 1 81  ? -4.277  5.601   4.360   1.00 0.00 ? 81  ASN A HB3  2  
ATOM   3387  H HD21 . ASN A 1 81  ? -2.705  4.807   3.097   1.00 0.00 ? 81  ASN A HD21 2  
ATOM   3388  H HD22 . ASN A 1 81  ? -2.968  4.102   1.540   1.00 0.00 ? 81  ASN A HD22 2  
ATOM   3389  N N    . CYS A 1 82  ? -5.945  1.733   4.009   1.00 0.00 ? 82  CYS A N    2  
ATOM   3390  C CA   . CYS A 1 82  ? -6.826  0.660   3.549   1.00 0.00 ? 82  CYS A CA   2  
ATOM   3391  C C    . CYS A 1 82  ? -7.738  0.189   4.681   1.00 0.00 ? 82  CYS A C    2  
ATOM   3392  O O    . CYS A 1 82  ? -8.951  0.052   4.489   1.00 0.00 ? 82  CYS A O    2  
ATOM   3393  C CB   . CYS A 1 82  ? -6.019  -0.526  3.006   1.00 0.00 ? 82  CYS A CB   2  
ATOM   3394  S SG   . CYS A 1 82  ? -4.916  -0.113  1.636   1.00 0.00 ? 82  CYS A SG   2  
ATOM   3395  H H    . CYS A 1 82  ? -4.975  1.602   3.989   1.00 0.00 ? 82  CYS A H    2  
ATOM   3396  H HA   . CYS A 1 82  ? -7.444  1.059   2.755   1.00 0.00 ? 82  CYS A HA   2  
ATOM   3397  H HB2  . CYS A 1 82  ? -5.415  -0.938  3.802   1.00 0.00 ? 82  CYS A HB2  2  
ATOM   3398  H HB3  . CYS A 1 82  ? -6.705  -1.284  2.657   1.00 0.00 ? 82  CYS A HB3  2  
ATOM   3399  H HG   . CYS A 1 82  ? -4.088  0.839   2.047   1.00 0.00 ? 82  CYS A HG   2  
ATOM   3400  N N    . TYR A 1 83  ? -7.160  -0.051  5.863   1.00 0.00 ? 83  TYR A N    2  
ATOM   3401  C CA   . TYR A 1 83  ? -7.956  -0.456  7.025   1.00 0.00 ? 83  TYR A CA   2  
ATOM   3402  C C    . TYR A 1 83  ? -8.768  0.718   7.549   1.00 0.00 ? 83  TYR A C    2  
ATOM   3403  O O    . TYR A 1 83  ? -9.797  0.540   8.199   1.00 0.00 ? 83  TYR A O    2  
ATOM   3404  C CB   . TYR A 1 83  ? -7.081  -0.974  8.171   1.00 0.00 ? 83  TYR A CB   2  
ATOM   3405  C CG   . TYR A 1 83  ? -6.242  -2.192  7.847   1.00 0.00 ? 83  TYR A CG   2  
ATOM   3406  C CD1  . TYR A 1 83  ? -6.782  -3.271  7.156   1.00 0.00 ? 83  TYR A CD1  2  
ATOM   3407  C CD2  . TYR A 1 83  ? -4.911  -2.276  8.258   1.00 0.00 ? 83  TYR A CD2  2  
ATOM   3408  C CE1  . TYR A 1 83  ? -6.026  -4.394  6.885   1.00 0.00 ? 83  TYR A CE1  2  
ATOM   3409  C CE2  . TYR A 1 83  ? -4.153  -3.395  7.985   1.00 0.00 ? 83  TYR A CE2  2  
ATOM   3410  C CZ   . TYR A 1 83  ? -4.713  -4.449  7.302   1.00 0.00 ? 83  TYR A CZ   2  
ATOM   3411  O OH   . TYR A 1 83  ? -3.955  -5.566  7.040   1.00 0.00 ? 83  TYR A OH   2  
ATOM   3412  H H    . TYR A 1 83  ? -6.182  0.042   5.952   1.00 0.00 ? 83  TYR A H    2  
ATOM   3413  H HA   . TYR A 1 83  ? -8.631  -1.238  6.713   1.00 0.00 ? 83  TYR A HA   2  
ATOM   3414  H HB2  . TYR A 1 83  ? -6.408  -0.187  8.479   1.00 0.00 ? 83  TYR A HB2  2  
ATOM   3415  H HB3  . TYR A 1 83  ? -7.730  -1.229  9.002   1.00 0.00 ? 83  TYR A HB3  2  
ATOM   3416  H HD1  . TYR A 1 83  ? -7.810  -3.224  6.830   1.00 0.00 ? 83  TYR A HD1  2  
ATOM   3417  H HD2  . TYR A 1 83  ? -4.464  -1.449  8.792   1.00 0.00 ? 83  TYR A HD2  2  
ATOM   3418  H HE1  . TYR A 1 83  ? -6.463  -5.222  6.347   1.00 0.00 ? 83  TYR A HE1  2  
ATOM   3419  H HE2  . TYR A 1 83  ? -3.128  -3.445  8.318   1.00 0.00 ? 83  TYR A HE2  2  
ATOM   3420  H HH   . TYR A 1 83  ? -4.060  -5.816  6.117   1.00 0.00 ? 83  TYR A HH   2  
ATOM   3421  N N    . LYS A 1 84  ? -8.289  1.916   7.264   1.00 0.00 ? 84  LYS A N    2  
ATOM   3422  C CA   . LYS A 1 84  ? -8.933  3.136   7.722   1.00 0.00 ? 84  LYS A CA   2  
ATOM   3423  C C    . LYS A 1 84  ? -10.239 3.360   6.968   1.00 0.00 ? 84  LYS A C    2  
ATOM   3424  O O    . LYS A 1 84  ? -11.171 3.972   7.486   1.00 0.00 ? 84  LYS A O    2  
ATOM   3425  C CB   . LYS A 1 84  ? -7.979  4.317   7.521   1.00 0.00 ? 84  LYS A CB   2  
ATOM   3426  C CG   . LYS A 1 84  ? -7.773  5.176   8.766   1.00 0.00 ? 84  LYS A CG   2  
ATOM   3427  C CD   . LYS A 1 84  ? -9.020  5.956   9.157   1.00 0.00 ? 84  LYS A CD   2  
ATOM   3428  C CE   . LYS A 1 84  ? -9.339  7.046   8.147   1.00 0.00 ? 84  LYS A CE   2  
ATOM   3429  N NZ   . LYS A 1 84  ? -10.444 7.928   8.606   1.00 0.00 ? 84  LYS A NZ   2  
ATOM   3430  H H    . LYS A 1 84  ? -7.467  1.984   6.732   1.00 0.00 ? 84  LYS A H    2  
ATOM   3431  H HA   . LYS A 1 84  ? -9.147  3.026   8.775   1.00 0.00 ? 84  LYS A HA   2  
ATOM   3432  H HB2  . LYS A 1 84  ? -7.018  3.928   7.226   1.00 0.00 ? 84  LYS A HB2  2  
ATOM   3433  H HB3  . LYS A 1 84  ? -8.359  4.946   6.726   1.00 0.00 ? 84  LYS A HB3  2  
ATOM   3434  H HG2  . LYS A 1 84  ? -7.498  4.533   9.588   1.00 0.00 ? 84  LYS A HG2  2  
ATOM   3435  H HG3  . LYS A 1 84  ? -6.971  5.873   8.574   1.00 0.00 ? 84  LYS A HG3  2  
ATOM   3436  H HD2  . LYS A 1 84  ? -9.856  5.275   9.212   1.00 0.00 ? 84  LYS A HD2  2  
ATOM   3437  H HD3  . LYS A 1 84  ? -8.859  6.411   10.123  1.00 0.00 ? 84  LYS A HD3  2  
ATOM   3438  H HE2  . LYS A 1 84  ? -8.455  7.644   7.990   1.00 0.00 ? 84  LYS A HE2  2  
ATOM   3439  H HE3  . LYS A 1 84  ? -9.625  6.580   7.215   1.00 0.00 ? 84  LYS A HE3  2  
ATOM   3440  H HZ1  . LYS A 1 84  ? -10.193 8.376   9.511   1.00 0.00 ? 84  LYS A HZ1  2  
ATOM   3441  H HZ2  . LYS A 1 84  ? -11.315 7.377   8.740   1.00 0.00 ? 84  LYS A HZ2  2  
ATOM   3442  H HZ3  . LYS A 1 84  ? -10.625 8.675   7.904   1.00 0.00 ? 84  LYS A HZ3  2  
ATOM   3443  N N    . TYR A 1 85  ? -10.296 2.860   5.742   1.00 0.00 ? 85  TYR A N    2  
ATOM   3444  C CA   . TYR A 1 85  ? -11.493 2.983   4.925   1.00 0.00 ? 85  TYR A CA   2  
ATOM   3445  C C    . TYR A 1 85  ? -12.364 1.730   5.002   1.00 0.00 ? 85  TYR A C    2  
ATOM   3446  O O    . TYR A 1 85  ? -13.520 1.790   5.424   1.00 0.00 ? 85  TYR A O    2  
ATOM   3447  C CB   . TYR A 1 85  ? -11.110 3.248   3.468   1.00 0.00 ? 85  TYR A CB   2  
ATOM   3448  C CG   . TYR A 1 85  ? -12.306 3.489   2.567   1.00 0.00 ? 85  TYR A CG   2  
ATOM   3449  C CD1  . TYR A 1 85  ? -12.927 4.726   2.573   1.00 0.00 ? 85  TYR A CD1  2  
ATOM   3450  C CD2  . TYR A 1 85  ? -12.823 2.499   1.725   1.00 0.00 ? 85  TYR A CD2  2  
ATOM   3451  C CE1  . TYR A 1 85  ? -14.022 4.984   1.776   1.00 0.00 ? 85  TYR A CE1  2  
ATOM   3452  C CE2  . TYR A 1 85  ? -13.921 2.754   0.923   1.00 0.00 ? 85  TYR A CE2  2  
ATOM   3453  C CZ   . TYR A 1 85  ? -14.514 4.000   0.955   1.00 0.00 ? 85  TYR A CZ   2  
ATOM   3454  O OH   . TYR A 1 85  ? -15.607 4.263   0.169   1.00 0.00 ? 85  TYR A OH   2  
ATOM   3455  H H    . TYR A 1 85  ? -9.502  2.420   5.370   1.00 0.00 ? 85  TYR A H    2  
ATOM   3456  H HA   . TYR A 1 85  ? -12.058 3.827   5.292   1.00 0.00 ? 85  TYR A HA   2  
ATOM   3457  H HB2  . TYR A 1 85  ? -10.495 4.130   3.435   1.00 0.00 ? 85  TYR A HB2  2  
ATOM   3458  H HB3  . TYR A 1 85  ? -10.547 2.407   3.085   1.00 0.00 ? 85  TYR A HB3  2  
ATOM   3459  H HD1  . TYR A 1 85  ? -12.536 5.497   3.219   1.00 0.00 ? 85  TYR A HD1  2  
ATOM   3460  H HD2  . TYR A 1 85  ? -12.362 1.523   1.702   1.00 0.00 ? 85  TYR A HD2  2  
ATOM   3461  H HE1  . TYR A 1 85  ? -14.493 5.954   1.801   1.00 0.00 ? 85  TYR A HE1  2  
ATOM   3462  H HE2  . TYR A 1 85  ? -14.313 1.978   0.276   1.00 0.00 ? 85  TYR A HE2  2  
ATOM   3463  H HH   . TYR A 1 85  ? -16.303 3.625   0.376   1.00 0.00 ? 85  TYR A HH   2  
ATOM   3464  N N    . ASN A 1 86  ? -11.797 0.599   4.605   1.00 0.00 ? 86  ASN A N    2  
ATOM   3465  C CA   . ASN A 1 86  ? -12.567 -0.627  4.423   1.00 0.00 ? 86  ASN A CA   2  
ATOM   3466  C C    . ASN A 1 86  ? -12.778 -1.354  5.742   1.00 0.00 ? 86  ASN A C    2  
ATOM   3467  O O    . ASN A 1 86  ? -11.851 -1.498  6.540   1.00 0.00 ? 86  ASN A O    2  
ATOM   3468  C CB   . ASN A 1 86  ? -11.858 -1.558  3.433   1.00 0.00 ? 86  ASN A CB   2  
ATOM   3469  C CG   . ASN A 1 86  ? -11.685 -0.936  2.063   1.00 0.00 ? 86  ASN A CG   2  
ATOM   3470  O OD1  . ASN A 1 86  ? -12.536 -1.090  1.184   1.00 0.00 ? 86  ASN A OD1  2  
ATOM   3471  N ND2  . ASN A 1 86  ? -10.577 -0.239  1.870   1.00 0.00 ? 86  ASN A ND2  2  
ATOM   3472  H H    . ASN A 1 86  ? -10.831 0.580   4.445   1.00 0.00 ? 86  ASN A H    2  
ATOM   3473  H HA   . ASN A 1 86  ? -13.529 -0.354  4.017   1.00 0.00 ? 86  ASN A HA   2  
ATOM   3474  H HB2  . ASN A 1 86  ? -10.879 -1.807  3.818   1.00 0.00 ? 86  ASN A HB2  2  
ATOM   3475  H HB3  . ASN A 1 86  ? -12.440 -2.465  3.321   1.00 0.00 ? 86  ASN A HB3  2  
ATOM   3476  H HD21 . ASN A 1 86  ? -9.938  -0.169  2.613   1.00 0.00 ? 86  ASN A HD21 2  
ATOM   3477  H HD22 . ASN A 1 86  ? -10.443 0.195   1.000   1.00 0.00 ? 86  ASN A HD22 2  
ATOM   3478  N N    . PRO A 1 87  ? -14.015 -1.805  5.993   1.00 0.00 ? 87  PRO A N    2  
ATOM   3479  C CA   . PRO A 1 87  ? -14.330 -2.636  7.155   1.00 0.00 ? 87  PRO A CA   2  
ATOM   3480  C C    . PRO A 1 87  ? -13.658 -4.008  7.057   1.00 0.00 ? 87  PRO A C    2  
ATOM   3481  O O    . PRO A 1 87  ? -13.379 -4.494  5.958   1.00 0.00 ? 87  PRO A O    2  
ATOM   3482  C CB   . PRO A 1 87  ? -15.858 -2.771  7.105   1.00 0.00 ? 87  PRO A CB   2  
ATOM   3483  C CG   . PRO A 1 87  ? -16.239 -2.474  5.696   1.00 0.00 ? 87  PRO A CG   2  
ATOM   3484  C CD   . PRO A 1 87  ? -15.204 -1.522  5.168   1.00 0.00 ? 87  PRO A CD   2  
ATOM   3485  H HA   . PRO A 1 87  ? -14.034 -2.155  8.076   1.00 0.00 ? 87  PRO A HA   2  
ATOM   3486  H HB2  . PRO A 1 87  ? -16.140 -3.774  7.387   1.00 0.00 ? 87  PRO A HB2  2  
ATOM   3487  H HB3  . PRO A 1 87  ? -16.303 -2.063  7.789   1.00 0.00 ? 87  PRO A HB3  2  
ATOM   3488  H HG2  . PRO A 1 87  ? -16.238 -3.386  5.117   1.00 0.00 ? 87  PRO A HG2  2  
ATOM   3489  H HG3  . PRO A 1 87  ? -17.219 -2.014  5.671   1.00 0.00 ? 87  PRO A HG3  2  
ATOM   3490  H HD2  . PRO A 1 87  ? -15.006 -1.723  4.125   1.00 0.00 ? 87  PRO A HD2  2  
ATOM   3491  H HD3  . PRO A 1 87  ? -15.529 -0.500  5.301   1.00 0.00 ? 87  PRO A HD3  2  
ATOM   3492  N N    . PRO A 1 88  ? -13.395 -4.640  8.222   1.00 0.00 ? 88  PRO A N    2  
ATOM   3493  C CA   . PRO A 1 88  ? -12.618 -5.893  8.324   1.00 0.00 ? 88  PRO A CA   2  
ATOM   3494  C C    . PRO A 1 88  ? -13.187 -7.041  7.496   1.00 0.00 ? 88  PRO A C    2  
ATOM   3495  O O    . PRO A 1 88  ? -12.487 -8.011  7.200   1.00 0.00 ? 88  PRO A O    2  
ATOM   3496  C CB   . PRO A 1 88  ? -12.686 -6.250  9.813   1.00 0.00 ? 88  PRO A CB   2  
ATOM   3497  C CG   . PRO A 1 88  ? -13.791 -5.423  10.373  1.00 0.00 ? 88  PRO A CG   2  
ATOM   3498  C CD   . PRO A 1 88  ? -13.832 -4.174  9.547   1.00 0.00 ? 88  PRO A CD   2  
ATOM   3499  H HA   . PRO A 1 88  ? -11.587 -5.734  8.043   1.00 0.00 ? 88  PRO A HA   2  
ATOM   3500  H HB2  . PRO A 1 88  ? -12.893 -7.303  9.917   1.00 0.00 ? 88  PRO A HB2  2  
ATOM   3501  H HB3  . PRO A 1 88  ? -11.742 -6.016  10.283  1.00 0.00 ? 88  PRO A HB3  2  
ATOM   3502  H HG2  . PRO A 1 88  ? -14.727 -5.958  10.291  1.00 0.00 ? 88  PRO A HG2  2  
ATOM   3503  H HG3  . PRO A 1 88  ? -13.585 -5.183  11.406  1.00 0.00 ? 88  PRO A HG3  2  
ATOM   3504  H HD2  . PRO A 1 88  ? -14.837 -3.779  9.506   1.00 0.00 ? 88  PRO A HD2  2  
ATOM   3505  H HD3  . PRO A 1 88  ? -13.149 -3.438  9.942   1.00 0.00 ? 88  PRO A HD3  2  
ATOM   3506  N N    . ASP A 1 89  ? -14.455 -6.938  7.145   1.00 0.00 ? 89  ASP A N    2  
ATOM   3507  C CA   . ASP A 1 89  ? -15.100 -7.948  6.307   1.00 0.00 ? 89  ASP A CA   2  
ATOM   3508  C C    . ASP A 1 89  ? -15.128 -7.484  4.852   1.00 0.00 ? 89  ASP A C    2  
ATOM   3509  O O    . ASP A 1 89  ? -16.194 -7.289  4.262   1.00 0.00 ? 89  ASP A O    2  
ATOM   3510  C CB   . ASP A 1 89  ? -16.525 -8.271  6.796   1.00 0.00 ? 89  ASP A CB   2  
ATOM   3511  C CG   . ASP A 1 89  ? -16.544 -8.873  8.189   1.00 0.00 ? 89  ASP A CG   2  
ATOM   3512  O OD1  . ASP A 1 89  ? -16.686 -10.109 8.304   1.00 0.00 ? 89  ASP A OD1  2  
ATOM   3513  O OD2  . ASP A 1 89  ? -16.411 -8.119  9.178   1.00 0.00 ? 89  ASP A OD2  2  
ATOM   3514  H H    . ASP A 1 89  ? -14.964 -6.164  7.456   1.00 0.00 ? 89  ASP A H    2  
ATOM   3515  H HA   . ASP A 1 89  ? -14.499 -8.845  6.364   1.00 0.00 ? 89  ASP A HA   2  
ATOM   3516  H HB2  . ASP A 1 89  ? -17.129 -7.374  6.798   1.00 0.00 ? 89  ASP A HB2  2  
ATOM   3517  H HB3  . ASP A 1 89  ? -16.967 -8.985  6.117   1.00 0.00 ? 89  ASP A HB3  2  
ATOM   3518  N N    . HIS A 1 90  ? -13.945 -7.305  4.278   1.00 0.00 ? 90  HIS A N    2  
ATOM   3519  C CA   . HIS A 1 90  ? -13.820 -6.853  2.900   1.00 0.00 ? 90  HIS A CA   2  
ATOM   3520  C C    . HIS A 1 90  ? -12.572 -7.472  2.271   1.00 0.00 ? 90  HIS A C    2  
ATOM   3521  O O    . HIS A 1 90  ? -11.702 -7.963  2.984   1.00 0.00 ? 90  HIS A O    2  
ATOM   3522  C CB   . HIS A 1 90  ? -13.728 -5.323  2.845   1.00 0.00 ? 90  HIS A CB   2  
ATOM   3523  C CG   . HIS A 1 90  ? -14.383 -4.720  1.632   1.00 0.00 ? 90  HIS A CG   2  
ATOM   3524  N ND1  . HIS A 1 90  ? -13.685 -4.415  0.488   1.00 0.00 ? 90  HIS A ND1  2  
ATOM   3525  C CD2  . HIS A 1 90  ? -15.672 -4.370  1.379   1.00 0.00 ? 90  HIS A CD2  2  
ATOM   3526  C CE1  . HIS A 1 90  ? -14.505 -3.908  -0.408  1.00 0.00 ? 90  HIS A CE1  2  
ATOM   3527  N NE2  . HIS A 1 90  ? -15.717 -3.869  0.104   1.00 0.00 ? 90  HIS A NE2  2  
ATOM   3528  H H    . HIS A 1 90  ? -13.132 -7.494  4.794   1.00 0.00 ? 90  HIS A H    2  
ATOM   3529  H HA   . HIS A 1 90  ? -14.693 -7.182  2.357   1.00 0.00 ? 90  HIS A HA   2  
ATOM   3530  H HB2  . HIS A 1 90  ? -14.187 -4.905  3.729   1.00 0.00 ? 90  HIS A HB2  2  
ATOM   3531  H HB3  . HIS A 1 90  ? -12.686 -5.041  2.829   1.00 0.00 ? 90  HIS A HB3  2  
ATOM   3532  H HD1  . HIS A 1 90  ? -12.734 -4.555  0.350   1.00 0.00 ? 90  HIS A HD1  2  
ATOM   3533  H HD2  . HIS A 1 90  ? -16.511 -4.466  2.048   1.00 0.00 ? 90  HIS A HD2  2  
ATOM   3534  H HE1  . HIS A 1 90  ? -14.231 -3.586  -1.400  1.00 0.00 ? 90  HIS A HE1  2  
ATOM   3535  H HE2  . HIS A 1 90  ? -16.540 -3.766  -0.428  1.00 0.00 ? 90  HIS A HE2  2  
ATOM   3536  N N    . ASP A 1 91  ? -12.473 -7.444  0.949   1.00 0.00 ? 91  ASP A N    2  
ATOM   3537  C CA   . ASP A 1 91  ? -11.328 -8.048  0.264   1.00 0.00 ? 91  ASP A CA   2  
ATOM   3538  C C    . ASP A 1 91  ? -10.051 -7.233  0.431   1.00 0.00 ? 91  ASP A C    2  
ATOM   3539  O O    . ASP A 1 91  ? -8.975  -7.795  0.617   1.00 0.00 ? 91  ASP A O    2  
ATOM   3540  C CB   . ASP A 1 91  ? -11.615 -8.232  -1.224  1.00 0.00 ? 91  ASP A CB   2  
ATOM   3541  C CG   . ASP A 1 91  ? -12.617 -9.337  -1.485  1.00 0.00 ? 91  ASP A CG   2  
ATOM   3542  O OD1  . ASP A 1 91  ? -12.220 -10.522 -1.462  1.00 0.00 ? 91  ASP A OD1  2  
ATOM   3543  O OD2  . ASP A 1 91  ? -13.805 -9.026  -1.703  1.00 0.00 ? 91  ASP A OD2  2  
ATOM   3544  H H    . ASP A 1 91  ? -13.195 -7.044  0.419   1.00 0.00 ? 91  ASP A H    2  
ATOM   3545  H HA   . ASP A 1 91  ? -11.167 -9.020  0.703   1.00 0.00 ? 91  ASP A HA   2  
ATOM   3546  H HB2  . ASP A 1 91  ? -12.005 -7.308  -1.627  1.00 0.00 ? 91  ASP A HB2  2  
ATOM   3547  H HB3  . ASP A 1 91  ? -10.694 -8.478  -1.731  1.00 0.00 ? 91  ASP A HB3  2  
ATOM   3548  N N    . VAL A 1 92  ? -10.165 -5.909  0.380   1.00 0.00 ? 92  VAL A N    2  
ATOM   3549  C CA   . VAL A 1 92  ? -8.981  -5.051  0.393   1.00 0.00 ? 92  VAL A CA   2  
ATOM   3550  C C    . VAL A 1 92  ? -8.254  -5.128  1.728   1.00 0.00 ? 92  VAL A C    2  
ATOM   3551  O O    . VAL A 1 92  ? -7.062  -4.858  1.799   1.00 0.00 ? 92  VAL A O    2  
ATOM   3552  C CB   . VAL A 1 92  ? -9.295  -3.575  0.068   1.00 0.00 ? 92  VAL A CB   2  
ATOM   3553  C CG1  . VAL A 1 92  ? -8.333  -3.049  -0.977  1.00 0.00 ? 92  VAL A CG1  2  
ATOM   3554  C CG2  . VAL A 1 92  ? -10.726 -3.405  -0.400  1.00 0.00 ? 92  VAL A CG2  2  
ATOM   3555  H H    . VAL A 1 92  ? -11.050 -5.509  0.336   1.00 0.00 ? 92  VAL A H    2  
ATOM   3556  H HA   . VAL A 1 92  ? -8.313  -5.416  -0.368  1.00 0.00 ? 92  VAL A HA   2  
ATOM   3557  H HB   . VAL A 1 92  ? -9.159  -2.993  0.966   1.00 0.00 ? 92  VAL A HB   2  
ATOM   3558  H HG11 . VAL A 1 92  ? -7.327  -3.313  -0.699  1.00 0.00 ? 92  VAL A HG11 2  
ATOM   3559  H HG12 . VAL A 1 92  ? -8.420  -1.975  -1.040  1.00 0.00 ? 92  VAL A HG12 2  
ATOM   3560  H HG13 . VAL A 1 92  ? -8.568  -3.486  -1.936  1.00 0.00 ? 92  VAL A HG13 2  
ATOM   3561  H HG21 . VAL A 1 92  ? -11.390 -3.721  0.383   1.00 0.00 ? 92  VAL A HG21 2  
ATOM   3562  H HG22 . VAL A 1 92  ? -10.892 -4.006  -1.281  1.00 0.00 ? 92  VAL A HG22 2  
ATOM   3563  H HG23 . VAL A 1 92  ? -10.909 -2.366  -0.629  1.00 0.00 ? 92  VAL A HG23 2  
ATOM   3564  N N    . VAL A 1 93  ? -8.962  -5.514  2.780   1.00 0.00 ? 93  VAL A N    2  
ATOM   3565  C CA   . VAL A 1 93  ? -8.329  -5.675  4.080   1.00 0.00 ? 93  VAL A CA   2  
ATOM   3566  C C    . VAL A 1 93  ? -7.645  -7.037  4.159   1.00 0.00 ? 93  VAL A C    2  
ATOM   3567  O O    . VAL A 1 93  ? -6.584  -7.177  4.764   1.00 0.00 ? 93  VAL A O    2  
ATOM   3568  C CB   . VAL A 1 93  ? -9.329  -5.509  5.251   1.00 0.00 ? 93  VAL A CB   2  
ATOM   3569  C CG1  . VAL A 1 93  ? -10.034 -4.168  5.161   1.00 0.00 ? 93  VAL A CG1  2  
ATOM   3570  C CG2  . VAL A 1 93  ? -10.347 -6.631  5.279   1.00 0.00 ? 93  VAL A CG2  2  
ATOM   3571  H H    . VAL A 1 93  ? -9.917  -5.701  2.681   1.00 0.00 ? 93  VAL A H    2  
ATOM   3572  H HA   . VAL A 1 93  ? -7.573  -4.906  4.169   1.00 0.00 ? 93  VAL A HA   2  
ATOM   3573  H HB   . VAL A 1 93  ? -8.773  -5.537  6.177   1.00 0.00 ? 93  VAL A HB   2  
ATOM   3574  H HG11 . VAL A 1 93  ? -10.683 -4.166  4.295   1.00 0.00 ? 93  VAL A HG11 2  
ATOM   3575  H HG12 . VAL A 1 93  ? -9.302  -3.380  5.065   1.00 0.00 ? 93  VAL A HG12 2  
ATOM   3576  H HG13 . VAL A 1 93  ? -10.622 -4.009  6.053   1.00 0.00 ? 93  VAL A HG13 2  
ATOM   3577  H HG21 . VAL A 1 93  ? -10.926 -6.612  4.367   1.00 0.00 ? 93  VAL A HG21 2  
ATOM   3578  H HG22 . VAL A 1 93  ? -11.004 -6.500  6.126   1.00 0.00 ? 93  VAL A HG22 2  
ATOM   3579  H HG23 . VAL A 1 93  ? -9.836  -7.579  5.362   1.00 0.00 ? 93  VAL A HG23 2  
ATOM   3580  N N    . ALA A 1 94  ? -8.251  -8.031  3.514   1.00 0.00 ? 94  ALA A N    2  
ATOM   3581  C CA   . ALA A 1 94  ? -7.680  -9.368  3.444   1.00 0.00 ? 94  ALA A CA   2  
ATOM   3582  C C    . ALA A 1 94  ? -6.414  -9.360  2.601   1.00 0.00 ? 94  ALA A C    2  
ATOM   3583  O O    . ALA A 1 94  ? -5.397  -9.946  2.977   1.00 0.00 ? 94  ALA A O    2  
ATOM   3584  C CB   . ALA A 1 94  ? -8.696  -10.356 2.886   1.00 0.00 ? 94  ALA A CB   2  
ATOM   3585  H H    . ALA A 1 94  ? -9.112  -7.859  3.082   1.00 0.00 ? 94  ALA A H    2  
ATOM   3586  H HA   . ALA A 1 94  ? -7.426  -9.674  4.443   1.00 0.00 ? 94  ALA A HA   2  
ATOM   3587  H HB1  . ALA A 1 94  ? -8.979  -10.062 1.887   1.00 0.00 ? 94  ALA A HB1  2  
ATOM   3588  H HB2  . ALA A 1 94  ? -9.572  -10.365 3.519   1.00 0.00 ? 94  ALA A HB2  2  
ATOM   3589  H HB3  . ALA A 1 94  ? -8.262  -11.344 2.861   1.00 0.00 ? 94  ALA A HB3  2  
ATOM   3590  N N    . MET A 1 95  ? -6.475  -8.663  1.473   1.00 0.00 ? 95  MET A N    2  
ATOM   3591  C CA   . MET A 1 95  ? -5.320  -8.525  0.601   1.00 0.00 ? 95  MET A CA   2  
ATOM   3592  C C    . MET A 1 95  ? -4.246  -7.688  1.290   1.00 0.00 ? 95  MET A C    2  
ATOM   3593  O O    . MET A 1 95  ? -3.051  -7.926  1.110   1.00 0.00 ? 95  MET A O    2  
ATOM   3594  C CB   . MET A 1 95  ? -5.725  -7.901  -0.744  1.00 0.00 ? 95  MET A CB   2  
ATOM   3595  C CG   . MET A 1 95  ? -6.648  -8.786  -1.583  1.00 0.00 ? 95  MET A CG   2  
ATOM   3596  S SD   . MET A 1 95  ? -6.942  -8.131  -3.241  1.00 0.00 ? 95  MET A SD   2  
ATOM   3597  C CE   . MET A 1 95  ? -8.410  -7.137  -2.982  1.00 0.00 ? 95  MET A CE   2  
ATOM   3598  H H    . MET A 1 95  ? -7.320  -8.229  1.222   1.00 0.00 ? 95  MET A H    2  
ATOM   3599  H HA   . MET A 1 95  ? -4.919  -9.514  0.422   1.00 0.00 ? 95  MET A HA   2  
ATOM   3600  H HB2  . MET A 1 95  ? -6.234  -6.968  -0.555  1.00 0.00 ? 95  MET A HB2  2  
ATOM   3601  H HB3  . MET A 1 95  ? -4.832  -7.702  -1.320  1.00 0.00 ? 95  MET A HB3  2  
ATOM   3602  H HG2  . MET A 1 95  ? -6.207  -9.767  -1.676  1.00 0.00 ? 95  MET A HG2  2  
ATOM   3603  H HG3  . MET A 1 95  ? -7.601  -8.870  -1.074  1.00 0.00 ? 95  MET A HG3  2  
ATOM   3604  H HE1  . MET A 1 95  ? -8.281  -6.510  -2.115  1.00 0.00 ? 95  MET A HE1  2  
ATOM   3605  H HE2  . MET A 1 95  ? -9.259  -7.784  -2.833  1.00 0.00 ? 95  MET A HE2  2  
ATOM   3606  H HE3  . MET A 1 95  ? -8.580  -6.517  -3.850  1.00 0.00 ? 95  MET A HE3  2  
ATOM   3607  N N    . ALA A 1 96  ? -4.680  -6.736  2.116   1.00 0.00 ? 96  ALA A N    2  
ATOM   3608  C CA   . ALA A 1 96  ? -3.754  -5.892  2.862   1.00 0.00 ? 96  ALA A CA   2  
ATOM   3609  C C    . ALA A 1 96  ? -3.025  -6.701  3.925   1.00 0.00 ? 96  ALA A C    2  
ATOM   3610  O O    . ALA A 1 96  ? -1.827  -6.533  4.112   1.00 0.00 ? 96  ALA A O    2  
ATOM   3611  C CB   . ALA A 1 96  ? -4.479  -4.720  3.501   1.00 0.00 ? 96  ALA A CB   2  
ATOM   3612  H H    . ALA A 1 96  ? -5.644  -6.597  2.224   1.00 0.00 ? 96  ALA A H    2  
ATOM   3613  H HA   . ALA A 1 96  ? -3.031  -5.493  2.165   1.00 0.00 ? 96  ALA A HA   2  
ATOM   3614  H HB1  . ALA A 1 96  ? -4.786  -4.028  2.732   1.00 0.00 ? 96  ALA A HB1  2  
ATOM   3615  H HB2  . ALA A 1 96  ? -3.818  -4.221  4.194   1.00 0.00 ? 96  ALA A HB2  2  
ATOM   3616  H HB3  . ALA A 1 96  ? -5.350  -5.080  4.029   1.00 0.00 ? 96  ALA A HB3  2  
ATOM   3617  N N    . ARG A 1 97  ? -3.748  -7.581  4.621   1.00 0.00 ? 97  ARG A N    2  
ATOM   3618  C CA   . ARG A 1 97  ? -3.145  -8.406  5.671   1.00 0.00 ? 97  ARG A CA   2  
ATOM   3619  C C    . ARG A 1 97  ? -2.071  -9.322  5.098   1.00 0.00 ? 97  ARG A C    2  
ATOM   3620  O O    . ARG A 1 97  ? -0.970  -9.422  5.638   1.00 0.00 ? 97  ARG A O    2  
ATOM   3621  C CB   . ARG A 1 97  ? -4.195  -9.255  6.397   1.00 0.00 ? 97  ARG A CB   2  
ATOM   3622  C CG   . ARG A 1 97  ? -5.145  -8.452  7.269   1.00 0.00 ? 97  ARG A CG   2  
ATOM   3623  C CD   . ARG A 1 97  ? -5.920  -9.345  8.224   1.00 0.00 ? 97  ARG A CD   2  
ATOM   3624  N NE   . ARG A 1 97  ? -6.890  -8.591  9.012   1.00 0.00 ? 97  ARG A NE   2  
ATOM   3625  C CZ   . ARG A 1 97  ? -8.130  -9.008  9.276   1.00 0.00 ? 97  ARG A CZ   2  
ATOM   3626  N NH1  . ARG A 1 97  ? -8.583  -10.140 8.749   1.00 0.00 ? 97  ARG A NH1  2  
ATOM   3627  N NH2  . ARG A 1 97  ? -8.924  -8.278  10.048  1.00 0.00 ? 97  ARG A NH2  2  
ATOM   3628  H H    . ARG A 1 97  ? -4.706  -7.677  4.422   1.00 0.00 ? 97  ARG A H    2  
ATOM   3629  H HA   . ARG A 1 97  ? -2.687  -7.739  6.385   1.00 0.00 ? 97  ARG A HA   2  
ATOM   3630  H HB2  . ARG A 1 97  ? -4.780  -9.785  5.660   1.00 0.00 ? 97  ARG A HB2  2  
ATOM   3631  H HB3  . ARG A 1 97  ? -3.687  -9.974  7.023   1.00 0.00 ? 97  ARG A HB3  2  
ATOM   3632  H HG2  . ARG A 1 97  ? -4.573  -7.740  7.843   1.00 0.00 ? 97  ARG A HG2  2  
ATOM   3633  H HG3  . ARG A 1 97  ? -5.844  -7.927  6.634   1.00 0.00 ? 97  ARG A HG3  2  
ATOM   3634  H HD2  . ARG A 1 97  ? -6.437  -10.102 7.660   1.00 0.00 ? 97  ARG A HD2  2  
ATOM   3635  H HD3  . ARG A 1 97  ? -5.220  -9.819  8.896   1.00 0.00 ? 97  ARG A HD3  2  
ATOM   3636  H HE   . ARG A 1 97  ? -6.592  -7.731  9.387   1.00 0.00 ? 97  ARG A HE   2  
ATOM   3637  H HH11 . ARG A 1 97  ? -8.000  -10.688 8.146   1.00 0.00 ? 97  ARG A HH11 2  
ATOM   3638  H HH12 . ARG A 1 97  ? -9.513  -10.458 8.957   1.00 0.00 ? 97  ARG A HH12 2  
ATOM   3639  H HH21 . ARG A 1 97  ? -8.592  -7.413  10.436  1.00 0.00 ? 97  ARG A HH21 2  
ATOM   3640  H HH22 . ARG A 1 97  ? -9.856  -8.587  10.250  1.00 0.00 ? 97  ARG A HH22 2  
ATOM   3641  N N    . LYS A 1 98  ? -2.400  -9.981  3.998   1.00 0.00 ? 98  LYS A N    2  
ATOM   3642  C CA   . LYS A 1 98  ? -1.495  -10.939 3.377   1.00 0.00 ? 98  LYS A CA   2  
ATOM   3643  C C    . LYS A 1 98  ? -0.257  -10.236 2.805   1.00 0.00 ? 98  LYS A C    2  
ATOM   3644  O O    . LYS A 1 98  ? 0.876   -10.672 3.019   1.00 0.00 ? 98  LYS A O    2  
ATOM   3645  C CB   . LYS A 1 98  ? -2.248  -11.707 2.291   1.00 0.00 ? 98  LYS A CB   2  
ATOM   3646  C CG   . LYS A 1 98  ? -1.489  -12.891 1.717   1.00 0.00 ? 98  LYS A CG   2  
ATOM   3647  C CD   . LYS A 1 98  ? -2.288  -13.569 0.617   1.00 0.00 ? 98  LYS A CD   2  
ATOM   3648  C CE   . LYS A 1 98  ? -1.536  -14.741 0.019   1.00 0.00 ? 98  LYS A CE   2  
ATOM   3649  N NZ   . LYS A 1 98  ? -1.186  -15.765 1.038   1.00 0.00 ? 98  LYS A NZ   2  
ATOM   3650  H H    . LYS A 1 98  ? -3.283  -9.823  3.593   1.00 0.00 ? 98  LYS A H    2  
ATOM   3651  H HA   . LYS A 1 98  ? -1.174  -11.632 4.141   1.00 0.00 ? 98  LYS A HA   2  
ATOM   3652  H HB2  . LYS A 1 98  ? -3.173  -12.075 2.710   1.00 0.00 ? 98  LYS A HB2  2  
ATOM   3653  H HB3  . LYS A 1 98  ? -2.480  -11.028 1.484   1.00 0.00 ? 98  LYS A HB3  2  
ATOM   3654  H HG2  . LYS A 1 98  ? -0.550  -12.549 1.313   1.00 0.00 ? 98  LYS A HG2  2  
ATOM   3655  H HG3  . LYS A 1 98  ? -1.304  -13.604 2.507   1.00 0.00 ? 98  LYS A HG3  2  
ATOM   3656  H HD2  . LYS A 1 98  ? -3.220  -13.923 1.026   1.00 0.00 ? 98  LYS A HD2  2  
ATOM   3657  H HD3  . LYS A 1 98  ? -2.483  -12.850 -0.163  1.00 0.00 ? 98  LYS A HD3  2  
ATOM   3658  H HE2  . LYS A 1 98  ? -2.153  -15.199 -0.740  1.00 0.00 ? 98  LYS A HE2  2  
ATOM   3659  H HE3  . LYS A 1 98  ? -0.632  -14.367 -0.432  1.00 0.00 ? 98  LYS A HE3  2  
ATOM   3660  H HZ1  . LYS A 1 98  ? -0.700  -16.567 0.586   1.00 0.00 ? 98  LYS A HZ1  2  
ATOM   3661  H HZ2  . LYS A 1 98  ? -2.044  -16.115 1.506   1.00 0.00 ? 98  LYS A HZ2  2  
ATOM   3662  H HZ3  . LYS A 1 98  ? -0.555  -15.355 1.755   1.00 0.00 ? 98  LYS A HZ3  2  
ATOM   3663  N N    . LEU A 1 99  ? -0.479  -9.148  2.080   1.00 0.00 ? 99  LEU A N    2  
ATOM   3664  C CA   . LEU A 1 99  ? 0.618   -8.319  1.586   1.00 0.00 ? 99  LEU A CA   2  
ATOM   3665  C C    . LEU A 1 99  ? 1.407   -7.678  2.729   1.00 0.00 ? 99  LEU A C    2  
ATOM   3666  O O    . LEU A 1 99  ? 2.601   -7.413  2.594   1.00 0.00 ? 99  LEU A O    2  
ATOM   3667  C CB   . LEU A 1 99  ? 0.108   -7.219  0.653   1.00 0.00 ? 99  LEU A CB   2  
ATOM   3668  C CG   . LEU A 1 99  ? 0.169   -7.496  -0.857  1.00 0.00 ? 99  LEU A CG   2  
ATOM   3669  C CD1  . LEU A 1 99  ? 0.699   -6.272  -1.562  1.00 0.00 ? 99  LEU A CD1  2  
ATOM   3670  C CD2  . LEU A 1 99  ? 1.059   -8.678  -1.199  1.00 0.00 ? 99  LEU A CD2  2  
ATOM   3671  H H    . LEU A 1 99  ? -1.397  -8.912  1.847   1.00 0.00 ? 99  LEU A H    2  
ATOM   3672  H HA   . LEU A 1 99  ? 1.285   -8.958  1.036   1.00 0.00 ? 99  LEU A HA   2  
ATOM   3673  H HB2  . LEU A 1 99  ? -0.920  -7.013  0.910   1.00 0.00 ? 99  LEU A HB2  2  
ATOM   3674  H HB3  . LEU A 1 99  ? 0.681   -6.336  0.850   1.00 0.00 ? 99  LEU A HB3  2  
ATOM   3675  H HG   . LEU A 1 99  ? -0.824  -7.694  -1.228  1.00 0.00 ? 99  LEU A HG   2  
ATOM   3676  H HD11 . LEU A 1 99  ? 1.755   -6.198  -1.375  1.00 0.00 ? 99  LEU A HD11 2  
ATOM   3677  H HD12 . LEU A 1 99  ? 0.200   -5.393  -1.184  1.00 0.00 ? 99  LEU A HD12 2  
ATOM   3678  H HD13 . LEU A 1 99  ? 0.525   -6.362  -2.623  1.00 0.00 ? 99  LEU A HD13 2  
ATOM   3679  H HD21 . LEU A 1 99  ? 2.092   -8.406  -1.023  1.00 0.00 ? 99  LEU A HD21 2  
ATOM   3680  H HD22 . LEU A 1 99  ? 0.927   -8.933  -2.240  1.00 0.00 ? 99  LEU A HD22 2  
ATOM   3681  H HD23 . LEU A 1 99  ? 0.794   -9.527  -0.587  1.00 0.00 ? 99  LEU A HD23 2  
ATOM   3682  N N    . GLN A 1 100 ? 0.743   -7.413  3.846   1.00 0.00 ? 100 GLN A N    2  
ATOM   3683  C CA   . GLN A 1 100 ? 1.425   -6.872  5.014   1.00 0.00 ? 100 GLN A CA   2  
ATOM   3684  C C    . GLN A 1 100 ? 2.405   -7.909  5.549   1.00 0.00 ? 100 GLN A C    2  
ATOM   3685  O O    . GLN A 1 100 ? 3.492   -7.569  6.007   1.00 0.00 ? 100 GLN A O    2  
ATOM   3686  C CB   . GLN A 1 100 ? 0.406   -6.476  6.102   1.00 0.00 ? 100 GLN A CB   2  
ATOM   3687  C CG   . GLN A 1 100 ? 1.002   -5.871  7.372   1.00 0.00 ? 100 GLN A CG   2  
ATOM   3688  C CD   . GLN A 1 100 ? -0.058  -5.597  8.423   1.00 0.00 ? 100 GLN A CD   2  
ATOM   3689  O OE1  . GLN A 1 100 ? -0.368  -6.456  9.249   1.00 0.00 ? 100 GLN A OE1  2  
ATOM   3690  N NE2  . GLN A 1 100 ? -0.618  -4.397  8.404   1.00 0.00 ? 100 GLN A NE2  2  
ATOM   3691  H H    . GLN A 1 100 ? -0.225  -7.571  3.882   1.00 0.00 ? 100 GLN A H    2  
ATOM   3692  H HA   . GLN A 1 100 ? 1.977   -5.999  4.691   1.00 0.00 ? 100 GLN A HA   2  
ATOM   3693  H HB2  . GLN A 1 100 ? -0.283  -5.758  5.683   1.00 0.00 ? 100 GLN A HB2  2  
ATOM   3694  H HB3  . GLN A 1 100 ? -0.147  -7.360  6.384   1.00 0.00 ? 100 GLN A HB3  2  
ATOM   3695  H HG2  . GLN A 1 100 ? 1.724   -6.559  7.783   1.00 0.00 ? 100 GLN A HG2  2  
ATOM   3696  H HG3  . GLN A 1 100 ? 1.490   -4.935  7.132   1.00 0.00 ? 100 GLN A HG3  2  
ATOM   3697  H HE21 . GLN A 1 100 ? -0.320  -3.758  7.723   1.00 0.00 ? 100 GLN A HE21 2  
ATOM   3698  H HE22 . GLN A 1 100 ? -1.308  -4.197  9.072   1.00 0.00 ? 100 GLN A HE22 2  
ATOM   3699  N N    . ASP A 1 101 ? 2.015   -9.179  5.461   1.00 0.00 ? 101 ASP A N    2  
ATOM   3700  C CA   . ASP A 1 101 ? 2.872   -10.284 5.879   1.00 0.00 ? 101 ASP A CA   2  
ATOM   3701  C C    . ASP A 1 101 ? 4.180   -10.298 5.089   1.00 0.00 ? 101 ASP A C    2  
ATOM   3702  O O    . ASP A 1 101 ? 5.265   -10.304 5.680   1.00 0.00 ? 101 ASP A O    2  
ATOM   3703  C CB   . ASP A 1 101 ? 2.140   -11.620 5.709   1.00 0.00 ? 101 ASP A CB   2  
ATOM   3704  C CG   . ASP A 1 101 ? 3.060   -12.817 5.858   1.00 0.00 ? 101 ASP A CG   2  
ATOM   3705  O OD1  . ASP A 1 101 ? 3.257   -13.293 6.994   1.00 0.00 ? 101 ASP A OD1  2  
ATOM   3706  O OD2  . ASP A 1 101 ? 3.585   -13.296 4.833   1.00 0.00 ? 101 ASP A OD2  2  
ATOM   3707  H H    . ASP A 1 101 ? 1.119   -9.379  5.107   1.00 0.00 ? 101 ASP A H    2  
ATOM   3708  H HA   . ASP A 1 101 ? 3.101   -10.144 6.926   1.00 0.00 ? 101 ASP A HA   2  
ATOM   3709  H HB2  . ASP A 1 101 ? 1.363   -11.694 6.455   1.00 0.00 ? 101 ASP A HB2  2  
ATOM   3710  H HB3  . ASP A 1 101 ? 1.692   -11.654 4.726   1.00 0.00 ? 101 ASP A HB3  2  
ATOM   3711  N N    . VAL A 1 102 ? 4.076   -10.293 3.759   1.00 0.00 ? 102 VAL A N    2  
ATOM   3712  C CA   . VAL A 1 102 ? 5.265   -10.314 2.904   1.00 0.00 ? 102 VAL A CA   2  
ATOM   3713  C C    . VAL A 1 102 ? 6.117   -9.064  3.103   1.00 0.00 ? 102 VAL A C    2  
ATOM   3714  O O    . VAL A 1 102 ? 7.313   -9.166  3.370   1.00 0.00 ? 102 VAL A O    2  
ATOM   3715  C CB   . VAL A 1 102 ? 4.919   -10.486 1.401   1.00 0.00 ? 102 VAL A CB   2  
ATOM   3716  C CG1  . VAL A 1 102 ? 3.749   -9.629  0.991   1.00 0.00 ? 102 VAL A CG1  2  
ATOM   3717  C CG2  . VAL A 1 102 ? 6.111   -10.164 0.520   1.00 0.00 ? 102 VAL A CG2  2  
ATOM   3718  H H    . VAL A 1 102 ? 3.182   -10.281 3.348   1.00 0.00 ? 102 VAL A H    2  
ATOM   3719  H HA   . VAL A 1 102 ? 5.855   -11.169 3.203   1.00 0.00 ? 102 VAL A HA   2  
ATOM   3720  H HB   . VAL A 1 102 ? 4.646   -11.508 1.232   1.00 0.00 ? 102 VAL A HB   2  
ATOM   3721  H HG11 . VAL A 1 102 ? 3.709   -9.586  -0.084  1.00 0.00 ? 102 VAL A HG11 2  
ATOM   3722  H HG12 . VAL A 1 102 ? 3.871   -8.634  1.390   1.00 0.00 ? 102 VAL A HG12 2  
ATOM   3723  H HG13 . VAL A 1 102 ? 2.837   -10.064 1.371   1.00 0.00 ? 102 VAL A HG13 2  
ATOM   3724  H HG21 . VAL A 1 102 ? 6.014   -9.154  0.145   1.00 0.00 ? 102 VAL A HG21 2  
ATOM   3725  H HG22 . VAL A 1 102 ? 6.145   -10.857 -0.308  1.00 0.00 ? 102 VAL A HG22 2  
ATOM   3726  H HG23 . VAL A 1 102 ? 7.021   -10.248 1.097   1.00 0.00 ? 102 VAL A HG23 2  
ATOM   3727  N N    . PHE A 1 103 ? 5.498   -7.894  2.986   1.00 0.00 ? 103 PHE A N    2  
ATOM   3728  C CA   . PHE A 1 103 ? 6.202   -6.629  3.184   1.00 0.00 ? 103 PHE A CA   2  
ATOM   3729  C C    . PHE A 1 103 ? 6.908   -6.593  4.545   1.00 0.00 ? 103 PHE A C    2  
ATOM   3730  O O    . PHE A 1 103 ? 8.039   -6.110  4.652   1.00 0.00 ? 103 PHE A O    2  
ATOM   3731  C CB   . PHE A 1 103 ? 5.246   -5.435  3.020   1.00 0.00 ? 103 PHE A CB   2  
ATOM   3732  C CG   . PHE A 1 103 ? 5.673   -4.211  3.798   1.00 0.00 ? 103 PHE A CG   2  
ATOM   3733  C CD1  . PHE A 1 103 ? 6.877   -3.586  3.506   1.00 0.00 ? 103 PHE A CD1  2  
ATOM   3734  C CD2  . PHE A 1 103 ? 4.891   -3.697  4.833   1.00 0.00 ? 103 PHE A CD2  2  
ATOM   3735  C CE1  . PHE A 1 103 ? 7.298   -2.486  4.224   1.00 0.00 ? 103 PHE A CE1  2  
ATOM   3736  C CE2  . PHE A 1 103 ? 5.310   -2.591  5.549   1.00 0.00 ? 103 PHE A CE2  2  
ATOM   3737  C CZ   . PHE A 1 103 ? 6.514   -1.987  5.245   1.00 0.00 ? 103 PHE A CZ   2  
ATOM   3738  H H    . PHE A 1 103 ? 4.542   -7.885  2.752   1.00 0.00 ? 103 PHE A H    2  
ATOM   3739  H HA   . PHE A 1 103 ? 6.959   -6.559  2.414   1.00 0.00 ? 103 PHE A HA   2  
ATOM   3740  H HB2  . PHE A 1 103 ? 5.214   -5.167  1.970   1.00 0.00 ? 103 PHE A HB2  2  
ATOM   3741  H HB3  . PHE A 1 103 ? 4.258   -5.722  3.338   1.00 0.00 ? 103 PHE A HB3  2  
ATOM   3742  H HD1  . PHE A 1 103 ? 7.492   -3.972  2.707   1.00 0.00 ? 103 PHE A HD1  2  
ATOM   3743  H HD2  . PHE A 1 103 ? 3.944   -4.161  5.077   1.00 0.00 ? 103 PHE A HD2  2  
ATOM   3744  H HE1  . PHE A 1 103 ? 8.241   -2.015  3.984   1.00 0.00 ? 103 PHE A HE1  2  
ATOM   3745  H HE2  . PHE A 1 103 ? 4.695   -2.201  6.348   1.00 0.00 ? 103 PHE A HE2  2  
ATOM   3746  H HZ   . PHE A 1 103 ? 6.842   -1.125  5.808   1.00 0.00 ? 103 PHE A HZ   2  
ATOM   3747  N N    . GLU A 1 104 ? 6.268   -7.139  5.571   1.00 0.00 ? 104 GLU A N    2  
ATOM   3748  C CA   . GLU A 1 104 ? 6.842   -7.138  6.897   1.00 0.00 ? 104 GLU A CA   2  
ATOM   3749  C C    . GLU A 1 104 ? 8.049   -8.064  6.945   1.00 0.00 ? 104 GLU A C    2  
ATOM   3750  O O    . GLU A 1 104 ? 9.086   -7.716  7.502   1.00 0.00 ? 104 GLU A O    2  
ATOM   3751  C CB   . GLU A 1 104 ? 5.792   -7.562  7.924   1.00 0.00 ? 104 GLU A CB   2  
ATOM   3752  C CG   . GLU A 1 104 ? 6.384   -8.234  9.137   1.00 0.00 ? 104 GLU A CG   2  
ATOM   3753  C CD   . GLU A 1 104 ? 5.348   -8.633  10.161  1.00 0.00 ? 104 GLU A CD   2  
ATOM   3754  O OE1  . GLU A 1 104 ? 4.780   -9.737  10.038  1.00 0.00 ? 104 GLU A OE1  2  
ATOM   3755  O OE2  . GLU A 1 104 ? 5.110   -7.850  11.107  1.00 0.00 ? 104 GLU A OE2  2  
ATOM   3756  H H    . GLU A 1 104 ? 5.402   -7.579  5.432   1.00 0.00 ? 104 GLU A H    2  
ATOM   3757  H HA   . GLU A 1 104 ? 7.165   -6.132  7.119   1.00 0.00 ? 104 GLU A HA   2  
ATOM   3758  H HB2  . GLU A 1 104 ? 5.250   -6.687  8.250   1.00 0.00 ? 104 GLU A HB2  2  
ATOM   3759  H HB3  . GLU A 1 104 ? 5.103   -8.249  7.455   1.00 0.00 ? 104 GLU A HB3  2  
ATOM   3760  H HG2  . GLU A 1 104 ? 6.896   -9.120  8.798   1.00 0.00 ? 104 GLU A HG2  2  
ATOM   3761  H HG3  . GLU A 1 104 ? 7.093   -7.562  9.597   1.00 0.00 ? 104 GLU A HG3  2  
ATOM   3762  N N    . PHE A 1 105 ? 7.912   -9.232  6.331   1.00 0.00 ? 105 PHE A N    2  
ATOM   3763  C CA   . PHE A 1 105 ? 8.985   -10.214 6.304   1.00 0.00 ? 105 PHE A CA   2  
ATOM   3764  C C    . PHE A 1 105 ? 10.177  -9.666  5.525   1.00 0.00 ? 105 PHE A C    2  
ATOM   3765  O O    . PHE A 1 105 ? 11.331  -9.962  5.838   1.00 0.00 ? 105 PHE A O    2  
ATOM   3766  C CB   . PHE A 1 105 ? 8.491   -11.517 5.673   1.00 0.00 ? 105 PHE A CB   2  
ATOM   3767  C CG   . PHE A 1 105 ? 9.346   -12.707 6.001   1.00 0.00 ? 105 PHE A CG   2  
ATOM   3768  C CD1  . PHE A 1 105 ? 9.162   -13.389 7.192   1.00 0.00 ? 105 PHE A CD1  2  
ATOM   3769  C CD2  . PHE A 1 105 ? 10.325  -13.147 5.124   1.00 0.00 ? 105 PHE A CD2  2  
ATOM   3770  C CE1  . PHE A 1 105 ? 9.939   -14.485 7.504   1.00 0.00 ? 105 PHE A CE1  2  
ATOM   3771  C CE2  . PHE A 1 105 ? 11.104  -14.244 5.433   1.00 0.00 ? 105 PHE A CE2  2  
ATOM   3772  C CZ   . PHE A 1 105 ? 10.911  -14.913 6.625   1.00 0.00 ? 105 PHE A CZ   2  
ATOM   3773  H H    . PHE A 1 105 ? 7.062   -9.439  5.881   1.00 0.00 ? 105 PHE A H    2  
ATOM   3774  H HA   . PHE A 1 105 ? 9.290   -10.405 7.322   1.00 0.00 ? 105 PHE A HA   2  
ATOM   3775  H HB2  . PHE A 1 105 ? 7.491   -11.720 6.022   1.00 0.00 ? 105 PHE A HB2  2  
ATOM   3776  H HB3  . PHE A 1 105 ? 8.476   -11.404 4.598   1.00 0.00 ? 105 PHE A HB3  2  
ATOM   3777  H HD1  . PHE A 1 105 ? 8.402   -13.055 7.883   1.00 0.00 ? 105 PHE A HD1  2  
ATOM   3778  H HD2  . PHE A 1 105 ? 10.479  -12.623 4.192   1.00 0.00 ? 105 PHE A HD2  2  
ATOM   3779  H HE1  . PHE A 1 105 ? 9.787   -15.007 8.436   1.00 0.00 ? 105 PHE A HE1  2  
ATOM   3780  H HE2  . PHE A 1 105 ? 11.863  -14.577 4.745   1.00 0.00 ? 105 PHE A HE2  2  
ATOM   3781  H HZ   . PHE A 1 105 ? 11.520  -15.770 6.867   1.00 0.00 ? 105 PHE A HZ   2  
ATOM   3782  N N    . ARG A 1 106 ? 9.879   -8.849  4.521   1.00 0.00 ? 106 ARG A N    2  
ATOM   3783  C CA   . ARG A 1 106 ? 10.901  -8.201  3.722   1.00 0.00 ? 106 ARG A CA   2  
ATOM   3784  C C    . ARG A 1 106 ? 11.712  -7.230  4.571   1.00 0.00 ? 106 ARG A C    2  
ATOM   3785  O O    . ARG A 1 106 ? 12.945  -7.246  4.547   1.00 0.00 ? 106 ARG A O    2  
ATOM   3786  C CB   . ARG A 1 106 ? 10.258  -7.460  2.552   1.00 0.00 ? 106 ARG A CB   2  
ATOM   3787  C CG   . ARG A 1 106 ? 9.687   -8.361  1.511   1.00 0.00 ? 106 ARG A CG   2  
ATOM   3788  C CD   . ARG A 1 106 ? 10.797  -9.088  0.808   1.00 0.00 ? 106 ARG A CD   2  
ATOM   3789  N NE   . ARG A 1 106 ? 12.009  -8.274  0.641   1.00 0.00 ? 106 ARG A NE   2  
ATOM   3790  C CZ   . ARG A 1 106 ? 12.648  -8.110  -0.523  1.00 0.00 ? 106 ARG A CZ   2  
ATOM   3791  N NH1  . ARG A 1 106 ? 12.169  -8.648  -1.636  1.00 0.00 ? 106 ARG A NH1  2  
ATOM   3792  N NH2  . ARG A 1 106 ? 13.769  -7.402  -0.566  1.00 0.00 ? 106 ARG A NH2  2  
ATOM   3793  H H    . ARG A 1 106 ? 8.934   -8.677  4.311   1.00 0.00 ? 106 ARG A H    2  
ATOM   3794  H HA   . ARG A 1 106 ? 11.559  -8.966  3.333   1.00 0.00 ? 106 ARG A HA   2  
ATOM   3795  H HB2  . ARG A 1 106 ? 9.474   -6.829  2.910   1.00 0.00 ? 106 ARG A HB2  2  
ATOM   3796  H HB3  . ARG A 1 106 ? 11.002  -6.864  2.066   1.00 0.00 ? 106 ARG A HB3  2  
ATOM   3797  H HG2  . ARG A 1 106 ? 9.030   -9.079  1.982   1.00 0.00 ? 106 ARG A HG2  2  
ATOM   3798  H HG3  . ARG A 1 106 ? 9.134   -7.772  0.791   1.00 0.00 ? 106 ARG A HG3  2  
ATOM   3799  H HD2  . ARG A 1 106 ? 11.043  -9.980  1.358   1.00 0.00 ? 106 ARG A HD2  2  
ATOM   3800  H HD3  . ARG A 1 106 ? 10.437  -9.345  -0.145  1.00 0.00 ? 106 ARG A HD3  2  
ATOM   3801  H HE   . ARG A 1 106 ? 12.378  -7.852  1.445   1.00 0.00 ? 106 ARG A HE   2  
ATOM   3802  H HH11 . ARG A 1 106 ? 11.313  -9.190  -1.615  1.00 0.00 ? 106 ARG A HH11 2  
ATOM   3803  H HH12 . ARG A 1 106 ? 12.653  -8.526  -2.507  1.00 0.00 ? 106 ARG A HH12 2  
ATOM   3804  H HH21 . ARG A 1 106 ? 14.138  -6.994  0.267   1.00 0.00 ? 106 ARG A HH21 2  
ATOM   3805  H HH22 . ARG A 1 106 ? 14.258  -7.280  -1.434  1.00 0.00 ? 106 ARG A HH22 2  
ATOM   3806  N N    . TYR A 1 107 ? 11.020  -6.392  5.334   1.00 0.00 ? 107 TYR A N    2  
ATOM   3807  C CA   . TYR A 1 107 ? 11.698  -5.425  6.187   1.00 0.00 ? 107 TYR A CA   2  
ATOM   3808  C C    . TYR A 1 107 ? 12.322  -6.129  7.395   1.00 0.00 ? 107 TYR A C    2  
ATOM   3809  O O    . TYR A 1 107 ? 13.299  -5.655  7.963   1.00 0.00 ? 107 TYR A O    2  
ATOM   3810  C CB   . TYR A 1 107 ? 10.741  -4.315  6.647   1.00 0.00 ? 107 TYR A CB   2  
ATOM   3811  C CG   . TYR A 1 107 ? 11.462  -3.080  7.152   1.00 0.00 ? 107 TYR A CG   2  
ATOM   3812  C CD1  . TYR A 1 107 ? 11.638  -1.972  6.332   1.00 0.00 ? 107 TYR A CD1  2  
ATOM   3813  C CD2  . TYR A 1 107 ? 11.982  -3.030  8.438   1.00 0.00 ? 107 TYR A CD2  2  
ATOM   3814  C CE1  . TYR A 1 107 ? 12.315  -0.851  6.781   1.00 0.00 ? 107 TYR A CE1  2  
ATOM   3815  C CE2  . TYR A 1 107 ? 12.655  -1.914  8.894   1.00 0.00 ? 107 TYR A CE2  2  
ATOM   3816  C CZ   . TYR A 1 107 ? 12.821  -0.828  8.063   1.00 0.00 ? 107 TYR A CZ   2  
ATOM   3817  O OH   . TYR A 1 107 ? 13.506  0.281   8.513   1.00 0.00 ? 107 TYR A OH   2  
ATOM   3818  H H    . TYR A 1 107 ? 10.036  -6.422  5.316   1.00 0.00 ? 107 TYR A H    2  
ATOM   3819  H HA   . TYR A 1 107 ? 12.490  -4.981  5.601   1.00 0.00 ? 107 TYR A HA   2  
ATOM   3820  H HB2  . TYR A 1 107 ? 10.114  -4.020  5.818   1.00 0.00 ? 107 TYR A HB2  2  
ATOM   3821  H HB3  . TYR A 1 107 ? 10.122  -4.691  7.449   1.00 0.00 ? 107 TYR A HB3  2  
ATOM   3822  H HD1  . TYR A 1 107 ? 11.241  -1.992  5.327   1.00 0.00 ? 107 TYR A HD1  2  
ATOM   3823  H HD2  . TYR A 1 107 ? 11.852  -3.881  9.089   1.00 0.00 ? 107 TYR A HD2  2  
ATOM   3824  H HE1  . TYR A 1 107 ? 12.437  0.002   6.132   1.00 0.00 ? 107 TYR A HE1  2  
ATOM   3825  H HE2  . TYR A 1 107 ? 13.051  -1.900  9.897   1.00 0.00 ? 107 TYR A HE2  2  
ATOM   3826  H HH   . TYR A 1 107 ? 14.290  -0.009  9.011   1.00 0.00 ? 107 TYR A HH   2  
ATOM   3827  N N    . ALA A 1 108 ? 11.756  -7.267  7.779   1.00 0.00 ? 108 ALA A N    2  
ATOM   3828  C CA   . ALA A 1 108 ? 12.295  -8.059  8.876   1.00 0.00 ? 108 ALA A CA   2  
ATOM   3829  C C    . ALA A 1 108 ? 13.679  -8.599  8.531   1.00 0.00 ? 108 ALA A C    2  
ATOM   3830  O O    . ALA A 1 108 ? 14.543  -8.717  9.398   1.00 0.00 ? 108 ALA A O    2  
ATOM   3831  C CB   . ALA A 1 108 ? 11.350  -9.198  9.222   1.00 0.00 ? 108 ALA A CB   2  
ATOM   3832  H H    . ALA A 1 108 ? 10.939  -7.573  7.328   1.00 0.00 ? 108 ALA A H    2  
ATOM   3833  H HA   . ALA A 1 108 ? 12.377  -7.417  9.739   1.00 0.00 ? 108 ALA A HA   2  
ATOM   3834  H HB1  . ALA A 1 108 ? 10.365  -8.801  9.421   1.00 0.00 ? 108 ALA A HB1  2  
ATOM   3835  H HB2  . ALA A 1 108 ? 11.714  -9.715  10.098  1.00 0.00 ? 108 ALA A HB2  2  
ATOM   3836  H HB3  . ALA A 1 108 ? 11.299  -9.888  8.393   1.00 0.00 ? 108 ALA A HB3  2  
ATOM   3837  N N    . LYS A 1 109 ? 13.884  -8.924  7.260   1.00 0.00 ? 109 LYS A N    2  
ATOM   3838  C CA   . LYS A 1 109 ? 15.180  -9.401  6.797   1.00 0.00 ? 109 LYS A CA   2  
ATOM   3839  C C    . LYS A 1 109 ? 16.109  -8.218  6.536   1.00 0.00 ? 109 LYS A C    2  
ATOM   3840  O O    . LYS A 1 109 ? 17.332  -8.353  6.543   1.00 0.00 ? 109 LYS A O    2  
ATOM   3841  C CB   . LYS A 1 109 ? 15.014  -10.255 5.534   1.00 0.00 ? 109 LYS A CB   2  
ATOM   3842  C CG   . LYS A 1 109 ? 16.332  -10.845 5.017   1.00 0.00 ? 109 LYS A CG   2  
ATOM   3843  C CD   . LYS A 1 109 ? 16.166  -12.073 4.098   1.00 0.00 ? 109 LYS A CD   2  
ATOM   3844  C CE   . LYS A 1 109 ? 15.782  -13.349 4.854   1.00 0.00 ? 109 LYS A CE   2  
ATOM   3845  N NZ   . LYS A 1 109 ? 14.427  -13.287 5.468   1.00 0.00 ? 109 LYS A NZ   2  
ATOM   3846  H H    . LYS A 1 109 ? 13.146  -8.842  6.619   1.00 0.00 ? 109 LYS A H    2  
ATOM   3847  H HA   . LYS A 1 109 ? 15.606  -10.010 7.581   1.00 0.00 ? 109 LYS A HA   2  
ATOM   3848  H HB2  . LYS A 1 109 ? 14.331  -11.062 5.750   1.00 0.00 ? 109 LYS A HB2  2  
ATOM   3849  H HB3  . LYS A 1 109 ? 14.589  -9.627  4.762   1.00 0.00 ? 109 LYS A HB3  2  
ATOM   3850  H HG2  . LYS A 1 109 ? 16.849  -10.078 4.462   1.00 0.00 ? 109 LYS A HG2  2  
ATOM   3851  H HG3  . LYS A 1 109 ? 16.936  -11.126 5.869   1.00 0.00 ? 109 LYS A HG3  2  
ATOM   3852  H HD2  . LYS A 1 109 ? 15.413  -11.878 3.349   1.00 0.00 ? 109 LYS A HD2  2  
ATOM   3853  H HD3  . LYS A 1 109 ? 17.110  -12.247 3.601   1.00 0.00 ? 109 LYS A HD3  2  
ATOM   3854  H HE2  . LYS A 1 109 ? 15.806  -14.181 4.162   1.00 0.00 ? 109 LYS A HE2  2  
ATOM   3855  H HE3  . LYS A 1 109 ? 16.512  -13.516 5.633   1.00 0.00 ? 109 LYS A HE3  2  
ATOM   3856  H HZ1  . LYS A 1 109 ? 14.424  -12.626 6.271   1.00 0.00 ? 109 LYS A HZ1  2  
ATOM   3857  H HZ2  . LYS A 1 109 ? 14.149  -14.227 5.811   1.00 0.00 ? 109 LYS A HZ2  2  
ATOM   3858  H HZ3  . LYS A 1 109 ? 13.731  -12.968 4.766   1.00 0.00 ? 109 LYS A HZ3  2  
ATOM   3859  N N    . MET A 1 110 ? 15.510  -7.057  6.313   1.00 0.00 ? 110 MET A N    2  
ATOM   3860  C CA   . MET A 1 110 ? 16.262  -5.821  6.139   1.00 0.00 ? 110 MET A CA   2  
ATOM   3861  C C    . MET A 1 110 ? 16.797  -5.330  7.485   1.00 0.00 ? 110 MET A C    2  
ATOM   3862  O O    . MET A 1 110 ? 16.025  -5.096  8.416   1.00 0.00 ? 110 MET A O    2  
ATOM   3863  C CB   . MET A 1 110 ? 15.369  -4.754  5.488   1.00 0.00 ? 110 MET A CB   2  
ATOM   3864  C CG   . MET A 1 110 ? 16.010  -3.378  5.379   1.00 0.00 ? 110 MET A CG   2  
ATOM   3865  S SD   . MET A 1 110 ? 15.808  -2.393  6.871   1.00 0.00 ? 110 MET A SD   2  
ATOM   3866  C CE   . MET A 1 110 ? 16.695  -0.919  6.398   1.00 0.00 ? 110 MET A CE   2  
ATOM   3867  H H    . MET A 1 110 ? 14.532  -7.030  6.265   1.00 0.00 ? 110 MET A H    2  
ATOM   3868  H HA   . MET A 1 110 ? 17.094  -6.030  5.484   1.00 0.00 ? 110 MET A HA   2  
ATOM   3869  H HB2  . MET A 1 110 ? 15.108  -5.082  4.495   1.00 0.00 ? 110 MET A HB2  2  
ATOM   3870  H HB3  . MET A 1 110 ? 14.466  -4.658  6.073   1.00 0.00 ? 110 MET A HB3  2  
ATOM   3871  H HG2  . MET A 1 110 ? 17.065  -3.501  5.189   1.00 0.00 ? 110 MET A HG2  2  
ATOM   3872  H HG3  . MET A 1 110 ? 15.560  -2.849  4.552   1.00 0.00 ? 110 MET A HG3  2  
ATOM   3873  H HE1  . MET A 1 110 ? 16.302  -0.556  5.460   1.00 0.00 ? 110 MET A HE1  2  
ATOM   3874  H HE2  . MET A 1 110 ? 17.744  -1.150  6.286   1.00 0.00 ? 110 MET A HE2  2  
ATOM   3875  H HE3  . MET A 1 110 ? 16.570  -0.163  7.158   1.00 0.00 ? 110 MET A HE3  2  
ATOM   3876  N N    . PRO A 1 111 ? 18.126  -5.206  7.622   1.00 0.00 ? 111 PRO A N    2  
ATOM   3877  C CA   . PRO A 1 111 ? 18.739  -4.707  8.845   1.00 0.00 ? 111 PRO A CA   2  
ATOM   3878  C C    . PRO A 1 111 ? 18.895  -3.188  8.868   1.00 0.00 ? 111 PRO A C    2  
ATOM   3879  O O    . PRO A 1 111 ? 19.146  -2.551  7.839   1.00 0.00 ? 111 PRO A O    2  
ATOM   3880  C CB   . PRO A 1 111 ? 20.104  -5.377  8.836   1.00 0.00 ? 111 PRO A CB   2  
ATOM   3881  C CG   . PRO A 1 111 ? 20.443  -5.552  7.388   1.00 0.00 ? 111 PRO A CG   2  
ATOM   3882  C CD   . PRO A 1 111 ? 19.140  -5.576  6.618   1.00 0.00 ? 111 PRO A CD   2  
ATOM   3883  H HA   . PRO A 1 111 ? 18.188  -5.022  9.717   1.00 0.00 ? 111 PRO A HA   2  
ATOM   3884  H HB2  . PRO A 1 111 ? 20.817  -4.739  9.339   1.00 0.00 ? 111 PRO A HB2  2  
ATOM   3885  H HB3  . PRO A 1 111 ? 20.043  -6.326  9.345   1.00 0.00 ? 111 PRO A HB3  2  
ATOM   3886  H HG2  . PRO A 1 111 ? 21.052  -4.725  7.057   1.00 0.00 ? 111 PRO A HG2  2  
ATOM   3887  H HG3  . PRO A 1 111 ? 20.973  -6.483  7.250   1.00 0.00 ? 111 PRO A HG3  2  
ATOM   3888  H HD2  . PRO A 1 111 ? 19.167  -4.849  5.815   1.00 0.00 ? 111 PRO A HD2  2  
ATOM   3889  H HD3  . PRO A 1 111 ? 18.953  -6.571  6.229   1.00 0.00 ? 111 PRO A HD3  2  
ATOM   3890  N N    . ASP A 1 112 ? 18.757  -2.626  10.058  1.00 0.00 ? 112 ASP A N    2  
ATOM   3891  C CA   . ASP A 1 112 ? 18.917  -1.195  10.269  1.00 0.00 ? 112 ASP A CA   2  
ATOM   3892  C C    . ASP A 1 112 ? 20.231  -0.922  10.984  1.00 0.00 ? 112 ASP A C    2  
ATOM   3893  O O    . ASP A 1 112 ? 21.263  -0.773  10.298  1.00 0.00 ? 112 ASP A O    2  
ATOM   3894  C CB   . ASP A 1 112 ? 17.757  -0.620  11.088  1.00 0.00 ? 112 ASP A CB   2  
ATOM   3895  C CG   . ASP A 1 112 ? 16.636  -0.062  10.232  1.00 0.00 ? 112 ASP A CG   2  
ATOM   3896  O OD1  . ASP A 1 112 ? 15.592  -0.734  10.090  1.00 0.00 ? 112 ASP A OD1  2  
ATOM   3897  O OD2  . ASP A 1 112 ? 16.789  1.067   9.716   1.00 0.00 ? 112 ASP A OD2  2  
ATOM   3898  O OXT  . ASP A 1 112 ? 20.232  -0.870  12.231  1.00 0.00 ? 112 ASP A OXT  2  
ATOM   3899  H H    . ASP A 1 112 ? 18.558  -3.198  10.826  1.00 0.00 ? 112 ASP A H    2  
ATOM   3900  H HA   . ASP A 1 112 ? 18.939  -0.714  9.305   1.00 0.00 ? 112 ASP A HA   2  
ATOM   3901  H HB2  . ASP A 1 112 ? 17.348  -1.396  11.717  1.00 0.00 ? 112 ASP A HB2  2  
ATOM   3902  H HB3  . ASP A 1 112 ? 18.135  0.176   11.709  1.00 0.00 ? 112 ASP A HB3  2  
ATOM   3903  N N    . HIS B 2 1   ? -24.078 -2.195  10.470  1.00 0.00 ? 281 HIS B N    2  
ATOM   3904  C CA   . HIS B 2 1   ? -24.565 -1.060  9.654   1.00 0.00 ? 281 HIS B CA   2  
ATOM   3905  C C    . HIS B 2 1   ? -23.410 -0.435  8.895   1.00 0.00 ? 281 HIS B C    2  
ATOM   3906  O O    . HIS B 2 1   ? -22.343 -0.205  9.461   1.00 0.00 ? 281 HIS B O    2  
ATOM   3907  C CB   . HIS B 2 1   ? -25.230 0.011   10.528  1.00 0.00 ? 281 HIS B CB   2  
ATOM   3908  C CG   . HIS B 2 1   ? -26.466 -0.448  11.237  1.00 0.00 ? 281 HIS B CG   2  
ATOM   3909  N ND1  . HIS B 2 1   ? -26.549 -0.552  12.609  1.00 0.00 ? 281 HIS B ND1  2  
ATOM   3910  C CD2  . HIS B 2 1   ? -27.681 -0.814  10.762  1.00 0.00 ? 281 HIS B CD2  2  
ATOM   3911  C CE1  . HIS B 2 1   ? -27.755 -0.966  12.944  1.00 0.00 ? 281 HIS B CE1  2  
ATOM   3912  N NE2  . HIS B 2 1   ? -28.460 -1.131  11.846  1.00 0.00 ? 281 HIS B NE2  2  
ATOM   3913  H H1   . HIS B 2 1   ? -23.358 -1.867  11.145  1.00 0.00 ? 281 HIS B H1   2  
ATOM   3914  H H2   . HIS B 2 1   ? -23.650 -2.917  9.855   1.00 0.00 ? 281 HIS B H2   2  
ATOM   3915  H H3   . HIS B 2 1   ? -24.861 -2.626  10.996  1.00 0.00 ? 281 HIS B H3   2  
ATOM   3916  H HA   . HIS B 2 1   ? -25.284 -1.437  8.943   1.00 0.00 ? 281 HIS B HA   2  
ATOM   3917  H HB2  . HIS B 2 1   ? -24.526 0.340   11.274  1.00 0.00 ? 281 HIS B HB2  2  
ATOM   3918  H HB3  . HIS B 2 1   ? -25.498 0.851   9.905   1.00 0.00 ? 281 HIS B HB3  2  
ATOM   3919  H HD1  . HIS B 2 1   ? -25.831 -0.339  13.247  1.00 0.00 ? 281 HIS B HD1  2  
ATOM   3920  H HD2  . HIS B 2 1   ? -27.981 -0.850  9.725   1.00 0.00 ? 281 HIS B HD2  2  
ATOM   3921  H HE1  . HIS B 2 1   ? -28.107 -1.134  13.951  1.00 0.00 ? 281 HIS B HE1  2  
ATOM   3922  H HE2  . HIS B 2 1   ? -29.367 -1.515  11.806  1.00 0.00 ? 281 HIS B HE2  2  
ATOM   3923  N N    . ASN B 2 2   ? -23.620 -0.163  7.621   1.00 0.00 ? 282 ASN B N    2  
ATOM   3924  C CA   . ASN B 2 2   ? -22.581 0.430   6.794   1.00 0.00 ? 282 ASN B CA   2  
ATOM   3925  C C    . ASN B 2 2   ? -22.725 1.944   6.789   1.00 0.00 ? 282 ASN B C    2  
ATOM   3926  O O    . ASN B 2 2   ? -23.484 2.501   5.996   1.00 0.00 ? 282 ASN B O    2  
ATOM   3927  C CB   . ASN B 2 2   ? -22.644 -0.110  5.358   1.00 0.00 ? 282 ASN B CB   2  
ATOM   3928  C CG   . ASN B 2 2   ? -22.307 -1.590  5.251   1.00 0.00 ? 282 ASN B CG   2  
ATOM   3929  O OD1  . ASN B 2 2   ? -22.516 -2.366  6.183   1.00 0.00 ? 282 ASN B OD1  2  
ATOM   3930  N ND2  . ASN B 2 2   ? -21.798 -1.993  4.098   1.00 0.00 ? 282 ASN B ND2  2  
ATOM   3931  H H    . ASN B 2 2   ? -24.499 -0.353  7.226   1.00 0.00 ? 282 ASN B H    2  
ATOM   3932  H HA   . ASN B 2 2   ? -21.625 0.172   7.227   1.00 0.00 ? 282 ASN B HA   2  
ATOM   3933  H HB2  . ASN B 2 2   ? -23.641 0.037   4.972   1.00 0.00 ? 282 ASN B HB2  2  
ATOM   3934  H HB3  . ASN B 2 2   ? -21.946 0.443   4.747   1.00 0.00 ? 282 ASN B HB3  2  
ATOM   3935  H HD21 . ASN B 2 2   ? -21.670 -1.327  3.392   1.00 0.00 ? 282 ASN B HD21 2  
ATOM   3936  H HD22 . ASN B 2 2   ? -21.573 -2.943  3.997   1.00 0.00 ? 282 ASN B HD22 2  
ATOM   3937  N N    . LEU B 2 3   ? -22.015 2.606   7.693   1.00 0.00 ? 283 LEU B N    2  
ATOM   3938  C CA   . LEU B 2 3   ? -22.062 4.061   7.783   1.00 0.00 ? 283 LEU B CA   2  
ATOM   3939  C C    . LEU B 2 3   ? -21.305 4.683   6.619   1.00 0.00 ? 283 LEU B C    2  
ATOM   3940  O O    . LEU B 2 3   ? -21.693 5.729   6.091   1.00 0.00 ? 283 LEU B O    2  
ATOM   3941  C CB   . LEU B 2 3   ? -21.474 4.555   9.113   1.00 0.00 ? 283 LEU B CB   2  
ATOM   3942  C CG   . LEU B 2 3   ? -22.341 4.331   10.359  1.00 0.00 ? 283 LEU B CG   2  
ATOM   3943  C CD1  . LEU B 2 3   ? -22.403 2.859   10.735  1.00 0.00 ? 283 LEU B CD1  2  
ATOM   3944  C CD2  . LEU B 2 3   ? -21.813 5.154   11.523  1.00 0.00 ? 283 LEU B CD2  2  
ATOM   3945  H H    . LEU B 2 3   ? -21.436 2.105   8.308   1.00 0.00 ? 283 LEU B H    2  
ATOM   3946  H HA   . LEU B 2 3   ? -23.098 4.360   7.725   1.00 0.00 ? 283 LEU B HA   2  
ATOM   3947  H HB2  . LEU B 2 3   ? -20.529 4.054   9.269   1.00 0.00 ? 283 LEU B HB2  2  
ATOM   3948  H HB3  . LEU B 2 3   ? -21.285 5.615   9.022   1.00 0.00 ? 283 LEU B HB3  2  
ATOM   3949  H HG   . LEU B 2 3   ? -23.349 4.662   10.149  1.00 0.00 ? 283 LEU B HG   2  
ATOM   3950  H HD11 . LEU B 2 3   ? -21.408 2.499   10.948  1.00 0.00 ? 283 LEU B HD11 2  
ATOM   3951  H HD12 . LEU B 2 3   ? -22.823 2.295   9.915   1.00 0.00 ? 283 LEU B HD12 2  
ATOM   3952  H HD13 . LEU B 2 3   ? -23.025 2.737   11.610  1.00 0.00 ? 283 LEU B HD13 2  
ATOM   3953  H HD21 . LEU B 2 3   ? -20.796 4.862   11.739  1.00 0.00 ? 283 LEU B HD21 2  
ATOM   3954  H HD22 . LEU B 2 3   ? -22.428 4.983   12.395  1.00 0.00 ? 283 LEU B HD22 2  
ATOM   3955  H HD23 . LEU B 2 3   ? -21.839 6.202   11.264  1.00 0.00 ? 283 LEU B HD23 2  
ATOM   3956  N N    . LEU B 2 4   ? -20.226 4.026   6.222   1.00 0.00 ? 284 LEU B N    2  
ATOM   3957  C CA   . LEU B 2 4   ? -19.417 4.487   5.107   1.00 0.00 ? 284 LEU B CA   2  
ATOM   3958  C C    . LEU B 2 4   ? -19.739 3.697   3.846   1.00 0.00 ? 284 LEU B C    2  
ATOM   3959  O O    . LEU B 2 4   ? -20.316 2.607   3.905   1.00 0.00 ? 284 LEU B O    2  
ATOM   3960  C CB   . LEU B 2 4   ? -17.924 4.349   5.427   1.00 0.00 ? 284 LEU B CB   2  
ATOM   3961  C CG   . LEU B 2 4   ? -17.384 5.310   6.489   1.00 0.00 ? 284 LEU B CG   2  
ATOM   3962  C CD1  . LEU B 2 4   ? -15.917 5.025   6.759   1.00 0.00 ? 284 LEU B CD1  2  
ATOM   3963  C CD2  . LEU B 2 4   ? -17.571 6.755   6.052   1.00 0.00 ? 284 LEU B CD2  2  
ATOM   3964  H H    . LEU B 2 4   ? -19.971 3.200   6.688   1.00 0.00 ? 284 LEU B H    2  
ATOM   3965  H HA   . LEU B 2 4   ? -19.645 5.527   4.935   1.00 0.00 ? 284 LEU B HA   2  
ATOM   3966  H HB2  . LEU B 2 4   ? -17.744 3.338   5.765   1.00 0.00 ? 284 LEU B HB2  2  
ATOM   3967  H HB3  . LEU B 2 4   ? -17.367 4.508   4.517   1.00 0.00 ? 284 LEU B HB3  2  
ATOM   3968  H HG   . LEU B 2 4   ? -17.927 5.166   7.408   1.00 0.00 ? 284 LEU B HG   2  
ATOM   3969  H HD11 . LEU B 2 4   ? -15.547 5.712   7.504   1.00 0.00 ? 284 LEU B HD11 2  
ATOM   3970  H HD12 . LEU B 2 4   ? -15.354 5.145   5.845   1.00 0.00 ? 284 LEU B HD12 2  
ATOM   3971  H HD13 . LEU B 2 4   ? -15.807 4.012   7.117   1.00 0.00 ? 284 LEU B HD13 2  
ATOM   3972  H HD21 . LEU B 2 4   ? -17.151 7.413   6.798   1.00 0.00 ? 284 LEU B HD21 2  
ATOM   3973  H HD22 . LEU B 2 4   ? -18.624 6.965   5.940   1.00 0.00 ? 284 LEU B HD22 2  
ATOM   3974  H HD23 . LEU B 2 4   ? -17.070 6.914   5.109   1.00 0.00 ? 284 LEU B HD23 2  
ATOM   3975  N N    . ARG B 2 5   ? -19.379 4.266   2.711   1.00 0.00 ? 285 ARG B N    2  
ATOM   3976  C CA   . ARG B 2 5   ? -19.513 3.590   1.434   1.00 0.00 ? 285 ARG B CA   2  
ATOM   3977  C C    . ARG B 2 5   ? -18.437 2.521   1.315   1.00 0.00 ? 285 ARG B C    2  
ATOM   3978  O O    . ARG B 2 5   ? -17.269 2.787   1.586   1.00 0.00 ? 285 ARG B O    2  
ATOM   3979  C CB   . ARG B 2 5   ? -19.374 4.596   0.291   1.00 0.00 ? 285 ARG B CB   2  
ATOM   3980  C CG   . ARG B 2 5   ? -20.434 5.685   0.299   1.00 0.00 ? 285 ARG B CG   2  
ATOM   3981  C CD   . ARG B 2 5   ? -20.080 6.807   -0.660  1.00 0.00 ? 285 ARG B CD   2  
ATOM   3982  N NE   . ARG B 2 5   ? -21.091 7.862   -0.667  1.00 0.00 ? 285 ARG B NE   2  
ATOM   3983  C CZ   . ARG B 2 5   ? -22.173 7.858   -1.448  1.00 0.00 ? 285 ARG B CZ   2  
ATOM   3984  N NH1  . ARG B 2 5   ? -22.378 6.861   -2.301  1.00 0.00 ? 285 ARG B NH1  2  
ATOM   3985  N NH2  . ARG B 2 5   ? -23.040 8.857   -1.384  1.00 0.00 ? 285 ARG B NH2  2  
ATOM   3986  H H    . ARG B 2 5   ? -19.005 5.172   2.732   1.00 0.00 ? 285 ARG B H    2  
ATOM   3987  H HA   . ARG B 2 5   ? -20.486 3.127   1.393   1.00 0.00 ? 285 ARG B HA   2  
ATOM   3988  H HB2  . ARG B 2 5   ? -18.405 5.068   0.360   1.00 0.00 ? 285 ARG B HB2  2  
ATOM   3989  H HB3  . ARG B 2 5   ? -19.440 4.066   -0.648  1.00 0.00 ? 285 ARG B HB3  2  
ATOM   3990  H HG2  . ARG B 2 5   ? -21.379 5.256   0.002   1.00 0.00 ? 285 ARG B HG2  2  
ATOM   3991  H HG3  . ARG B 2 5   ? -20.518 6.088   1.294   1.00 0.00 ? 285 ARG B HG3  2  
ATOM   3992  H HD2  . ARG B 2 5   ? -19.137 7.235   -0.350  1.00 0.00 ? 285 ARG B HD2  2  
ATOM   3993  H HD3  . ARG B 2 5   ? -19.985 6.402   -1.656  1.00 0.00 ? 285 ARG B HD3  2  
ATOM   3994  H HE   . ARG B 2 5   ? -20.951 8.621   -0.053  1.00 0.00 ? 285 ARG B HE   2  
ATOM   3995  H HH11 . ARG B 2 5   ? -21.722 6.105   -2.364  1.00 0.00 ? 285 ARG B HH11 2  
ATOM   3996  H HH12 . ARG B 2 5   ? -23.194 6.860   -2.888  1.00 0.00 ? 285 ARG B HH12 2  
ATOM   3997  H HH21 . ARG B 2 5   ? -22.887 9.623   -0.748  1.00 0.00 ? 285 ARG B HH21 2  
ATOM   3998  H HH22 . ARG B 2 5   ? -23.857 8.856   -1.968  1.00 0.00 ? 285 ARG B HH22 2  
ATOM   3999  N N    . ILE B 2 6   ? -18.816 1.319   0.925   1.00 0.00 ? 286 ILE B N    2  
ATOM   4000  C CA   . ILE B 2 6   ? -17.841 0.249   0.778   1.00 0.00 ? 286 ILE B CA   2  
ATOM   4001  C C    . ILE B 2 6   ? -17.259 0.245   -0.627  1.00 0.00 ? 286 ILE B C    2  
ATOM   4002  O O    . ILE B 2 6   ? -17.986 0.353   -1.618  1.00 0.00 ? 286 ILE B O    2  
ATOM   4003  C CB   . ILE B 2 6   ? -18.403 -1.158  1.112   1.00 0.00 ? 286 ILE B CB   2  
ATOM   4004  C CG1  . ILE B 2 6   ? -19.616 -1.528  0.236   1.00 0.00 ? 286 ILE B CG1  2  
ATOM   4005  C CG2  . ILE B 2 6   ? -18.755 -1.247  2.592   1.00 0.00 ? 286 ILE B CG2  2  
ATOM   4006  C CD1  . ILE B 2 6   ? -20.943 -0.992  0.734   1.00 0.00 ? 286 ILE B CD1  2  
ATOM   4007  H H    . ILE B 2 6   ? -19.757 1.150   0.723   1.00 0.00 ? 286 ILE B H    2  
ATOM   4008  H HA   . ILE B 2 6   ? -17.037 0.456   1.471   1.00 0.00 ? 286 ILE B HA   2  
ATOM   4009  H HB   . ILE B 2 6   ? -17.614 -1.874  0.927   1.00 0.00 ? 286 ILE B HB   2  
ATOM   4010  H HG12 . ILE B 2 6   ? -19.460 -1.136  -0.758  1.00 0.00 ? 286 ILE B HG12 2  
ATOM   4011  H HG13 . ILE B 2 6   ? -19.693 -2.604  0.182   1.00 0.00 ? 286 ILE B HG13 2  
ATOM   4012  H HG21 . ILE B 2 6   ? -17.867 -1.080  3.185   1.00 0.00 ? 286 ILE B HG21 2  
ATOM   4013  H HG22 . ILE B 2 6   ? -19.154 -2.227  2.809   1.00 0.00 ? 286 ILE B HG22 2  
ATOM   4014  H HG23 . ILE B 2 6   ? -19.494 -0.497  2.833   1.00 0.00 ? 286 ILE B HG23 2  
ATOM   4015  H HD11 . ILE B 2 6   ? -21.080 -1.284  1.766   1.00 0.00 ? 286 ILE B HD11 2  
ATOM   4016  H HD12 . ILE B 2 6   ? -21.743 -1.400  0.135   1.00 0.00 ? 286 ILE B HD12 2  
ATOM   4017  H HD13 . ILE B 2 6   ? -20.952 0.082   0.661   1.00 0.00 ? 286 ILE B HD13 2  
HETATM 4018  O OH   . ALY B 2 7   ? -9.525  2.102   0.545   1.00 0.00 ? 287 ALY B OH   2  
HETATM 4019  C CH   . ALY B 2 7   ? -8.900  1.570   -0.370  1.00 0.00 ? 287 ALY B CH   2  
HETATM 4020  C CH3  . ALY B 2 7   ? -7.370  1.536   -0.314  1.00 0.00 ? 287 ALY B CH3  2  
HETATM 4021  N NZ   . ALY B 2 7   ? -9.513  1.021   -1.409  1.00 0.00 ? 287 ALY B NZ   2  
HETATM 4022  C CE   . ALY B 2 7   ? -10.960 0.995   -1.580  1.00 0.00 ? 287 ALY B CE   2  
HETATM 4023  C CD   . ALY B 2 7   ? -11.387 -0.048  -2.600  1.00 0.00 ? 287 ALY B CD   2  
HETATM 4024  C CG   . ALY B 2 7   ? -12.868 0.046   -2.927  1.00 0.00 ? 287 ALY B CG   2  
HETATM 4025  C CB   . ALY B 2 7   ? -13.734 -0.080  -1.686  1.00 0.00 ? 287 ALY B CB   2  
HETATM 4026  C CA   . ALY B 2 7   ? -15.222 0.098   -1.956  1.00 0.00 ? 287 ALY B CA   2  
HETATM 4027  N N    . ALY B 2 7   ? -15.938 0.158   -0.692  1.00 0.00 ? 287 ALY B N    2  
HETATM 4028  C C    . ALY B 2 7   ? -15.742 -1.055  -2.803  1.00 0.00 ? 287 ALY B C    2  
HETATM 4029  O O    . ALY B 2 7   ? -15.800 -2.191  -2.338  1.00 0.00 ? 287 ALY B O    2  
HETATM 4030  H HH31 . ALY B 2 7   ? -6.978  1.334   -1.303  1.00 0.00 ? 287 ALY B HH31 2  
HETATM 4031  H HH32 . ALY B 2 7   ? -7.000  2.491   0.032   1.00 0.00 ? 287 ALY B HH32 2  
HETATM 4032  H HH33 . ALY B 2 7   ? -7.050  0.759   0.365   1.00 0.00 ? 287 ALY B HH33 2  
HETATM 4033  H HZ   . ALY B 2 7   ? -8.965  0.611   -2.110  1.00 0.00 ? 287 ALY B HZ   2  
HETATM 4034  H HE3  . ALY B 2 7   ? -11.292 1.967   -1.913  1.00 0.00 ? 287 ALY B HE3  2  
HETATM 4035  H HE2  . ALY B 2 7   ? -11.421 0.764   -0.631  1.00 0.00 ? 287 ALY B HE2  2  
HETATM 4036  H HD3  . ALY B 2 7   ? -11.179 -1.029  -2.204  1.00 0.00 ? 287 ALY B HD3  2  
HETATM 4037  H HD2  . ALY B 2 7   ? -10.823 0.102   -3.509  1.00 0.00 ? 287 ALY B HD2  2  
HETATM 4038  H HG3  . ALY B 2 7   ? -13.124 -0.748  -3.612  1.00 0.00 ? 287 ALY B HG3  2  
HETATM 4039  H HG2  . ALY B 2 7   ? -13.065 1.001   -3.393  1.00 0.00 ? 287 ALY B HG2  2  
HETATM 4040  H HB3  . ALY B 2 7   ? -13.417 0.667   -0.974  1.00 0.00 ? 287 ALY B HB3  2  
HETATM 4041  H HB2  . ALY B 2 7   ? -13.581 -1.058  -1.260  1.00 0.00 ? 287 ALY B HB2  2  
HETATM 4042  H HCA  . ALY B 2 7   ? -15.374 1.023   -2.484  1.00 0.00 ? 287 ALY B HCA  2  
HETATM 4043  H H    . ALY B 2 7   ? -15.426 0.138   0.141   1.00 0.00 ? 287 ALY B H    2  
ATOM   4044  N N    . GLN B 2 8   ? -16.119 -0.767  -4.040  1.00 0.00 ? 288 GLN B N    2  
ATOM   4045  C CA   . GLN B 2 8   ? -16.690 -1.784  -4.915  1.00 0.00 ? 288 GLN B CA   2  
ATOM   4046  C C    . GLN B 2 8   ? -15.607 -2.689  -5.502  1.00 0.00 ? 288 GLN B C    2  
ATOM   4047  O O    . GLN B 2 8   ? -15.450 -2.792  -6.718  1.00 0.00 ? 288 GLN B O    2  
ATOM   4048  C CB   . GLN B 2 8   ? -17.510 -1.137  -6.032  1.00 0.00 ? 288 GLN B CB   2  
ATOM   4049  C CG   . GLN B 2 8   ? -18.673 -0.300  -5.521  1.00 0.00 ? 288 GLN B CG   2  
ATOM   4050  C CD   . GLN B 2 8   ? -19.581 0.205   -6.630  1.00 0.00 ? 288 GLN B CD   2  
ATOM   4051  O OE1  . GLN B 2 8   ? -20.777 0.410   -6.419  1.00 0.00 ? 288 GLN B OE1  2  
ATOM   4052  N NE2  . GLN B 2 8   ? -19.029 0.396   -7.821  1.00 0.00 ? 288 GLN B NE2  2  
ATOM   4053  H H    . GLN B 2 8   ? -16.016 0.148   -4.374  1.00 0.00 ? 288 GLN B H    2  
ATOM   4054  H HA   . GLN B 2 8   ? -17.349 -2.393  -4.313  1.00 0.00 ? 288 GLN B HA   2  
ATOM   4055  H HB2  . GLN B 2 8   ? -16.863 -0.499  -6.615  1.00 0.00 ? 288 GLN B HB2  2  
ATOM   4056  H HB3  . GLN B 2 8   ? -17.907 -1.915  -6.668  1.00 0.00 ? 288 GLN B HB3  2  
ATOM   4057  H HG2  . GLN B 2 8   ? -19.262 -0.901  -4.845  1.00 0.00 ? 288 GLN B HG2  2  
ATOM   4058  H HG3  . GLN B 2 8   ? -18.277 0.552   -4.988  1.00 0.00 ? 288 GLN B HG3  2  
ATOM   4059  H HE21 . GLN B 2 8   ? -18.074 0.203   -7.925  1.00 0.00 ? 288 GLN B HE21 2  
ATOM   4060  H HE22 . GLN B 2 8   ? -19.598 0.726   -8.548  1.00 0.00 ? 288 GLN B HE22 2  
ATOM   4061  N N    . PHE B 2 9   ? -14.868 -3.342  -4.617  1.00 0.00 ? 289 PHE B N    2  
ATOM   4062  C CA   . PHE B 2 9   ? -13.858 -4.316  -5.009  1.00 0.00 ? 289 PHE B CA   2  
ATOM   4063  C C    . PHE B 2 9   ? -14.423 -5.722  -4.890  1.00 0.00 ? 289 PHE B C    2  
ATOM   4064  O O    . PHE B 2 9   ? -13.853 -6.582  -4.219  1.00 0.00 ? 289 PHE B O    2  
ATOM   4065  C CB   . PHE B 2 9   ? -12.605 -4.185  -4.136  1.00 0.00 ? 289 PHE B CB   2  
ATOM   4066  C CG   . PHE B 2 9   ? -11.601 -3.177  -4.629  1.00 0.00 ? 289 PHE B CG   2  
ATOM   4067  C CD1  . PHE B 2 9   ? -11.945 -2.225  -5.575  1.00 0.00 ? 289 PHE B CD1  2  
ATOM   4068  C CD2  . PHE B 2 9   ? -10.306 -3.192  -4.140  1.00 0.00 ? 289 PHE B CD2  2  
ATOM   4069  C CE1  . PHE B 2 9   ? -11.014 -1.306  -6.021  1.00 0.00 ? 289 PHE B CE1  2  
ATOM   4070  C CE2  . PHE B 2 9   ? -9.372  -2.276  -4.580  1.00 0.00 ? 289 PHE B CE2  2  
ATOM   4071  C CZ   . PHE B 2 9   ? -9.725  -1.330  -5.522  1.00 0.00 ? 289 PHE B CZ   2  
ATOM   4072  H H    . PHE B 2 9   ? -15.017 -3.170  -3.661  1.00 0.00 ? 289 PHE B H    2  
ATOM   4073  H HA   . PHE B 2 9   ? -13.596 -4.130  -6.040  1.00 0.00 ? 289 PHE B HA   2  
ATOM   4074  H HB2  . PHE B 2 9   ? -12.901 -3.890  -3.143  1.00 0.00 ? 289 PHE B HB2  2  
ATOM   4075  H HB3  . PHE B 2 9   ? -12.112 -5.146  -4.086  1.00 0.00 ? 289 PHE B HB3  2  
ATOM   4076  H HD1  . PHE B 2 9   ? -12.953 -2.201  -5.962  1.00 0.00 ? 289 PHE B HD1  2  
ATOM   4077  H HD2  . PHE B 2 9   ? -10.028 -3.931  -3.403  1.00 0.00 ? 289 PHE B HD2  2  
ATOM   4078  H HE1  . PHE B 2 9   ? -11.294 -0.569  -6.758  1.00 0.00 ? 289 PHE B HE1  2  
ATOM   4079  H HE2  . PHE B 2 9   ? -8.368  -2.296  -4.185  1.00 0.00 ? 289 PHE B HE2  2  
ATOM   4080  H HZ   . PHE B 2 9   ? -8.996  -0.613  -5.870  1.00 0.00 ? 289 PHE B HZ   2  
ATOM   4081  N N    . LEU B 2 10  ? -15.557 -5.943  -5.534  1.00 0.00 ? 290 LEU B N    2  
ATOM   4082  C CA   . LEU B 2 10  ? -16.197 -7.245  -5.517  1.00 0.00 ? 290 LEU B CA   2  
ATOM   4083  C C    . LEU B 2 10  ? -15.574 -8.135  -6.586  1.00 0.00 ? 290 LEU B C    2  
ATOM   4084  O O    . LEU B 2 10  ? -16.150 -8.359  -7.651  1.00 0.00 ? 290 LEU B O    2  
ATOM   4085  C CB   . LEU B 2 10  ? -17.723 -7.132  -5.705  1.00 0.00 ? 290 LEU B CB   2  
ATOM   4086  C CG   . LEU B 2 10  ? -18.213 -6.368  -6.945  1.00 0.00 ? 290 LEU B CG   2  
ATOM   4087  C CD1  . LEU B 2 10  ? -19.583 -6.874  -7.365  1.00 0.00 ? 290 LEU B CD1  2  
ATOM   4088  C CD2  . LEU B 2 10  ? -18.291 -4.870  -6.675  1.00 0.00 ? 290 LEU B CD2  2  
ATOM   4089  H H    . LEU B 2 10  ? -15.959 -5.219  -6.049  1.00 0.00 ? 290 LEU B H    2  
ATOM   4090  H HA   . LEU B 2 10  ? -15.998 -7.687  -4.551  1.00 0.00 ? 290 LEU B HA   2  
ATOM   4091  H HB2  . LEU B 2 10  ? -18.127 -8.132  -5.750  1.00 0.00 ? 290 LEU B HB2  2  
ATOM   4092  H HB3  . LEU B 2 10  ? -18.130 -6.644  -4.831  1.00 0.00 ? 290 LEU B HB3  2  
ATOM   4093  H HG   . LEU B 2 10  ? -17.526 -6.532  -7.762  1.00 0.00 ? 290 LEU B HG   2  
ATOM   4094  H HD11 . LEU B 2 10  ? -20.282 -6.732  -6.556  1.00 0.00 ? 290 LEU B HD11 2  
ATOM   4095  H HD12 . LEU B 2 10  ? -19.519 -7.923  -7.608  1.00 0.00 ? 290 LEU B HD12 2  
ATOM   4096  H HD13 . LEU B 2 10  ? -19.918 -6.324  -8.231  1.00 0.00 ? 290 LEU B HD13 2  
ATOM   4097  H HD21 . LEU B 2 10  ? -17.305 -4.488  -6.462  1.00 0.00 ? 290 LEU B HD21 2  
ATOM   4098  H HD22 . LEU B 2 10  ? -18.937 -4.690  -5.830  1.00 0.00 ? 290 LEU B HD22 2  
ATOM   4099  H HD23 . LEU B 2 10  ? -18.689 -4.370  -7.546  1.00 0.00 ? 290 LEU B HD23 2  
ATOM   4100  N N    . GLN B 2 11  ? -14.380 -8.630  -6.290  1.00 0.00 ? 291 GLN B N    2  
ATOM   4101  C CA   . GLN B 2 11  ? -13.631 -9.456  -7.227  1.00 0.00 ? 291 GLN B CA   2  
ATOM   4102  C C    . GLN B 2 11  ? -14.278 -10.832 -7.375  1.00 0.00 ? 291 GLN B C    2  
ATOM   4103  O O    . GLN B 2 11  ? -13.994 -11.568 -8.321  1.00 0.00 ? 291 GLN B O    2  
ATOM   4104  C CB   . GLN B 2 11  ? -12.177 -9.598  -6.761  1.00 0.00 ? 291 GLN B CB   2  
ATOM   4105  C CG   . GLN B 2 11  ? -12.027 -10.300 -5.419  1.00 0.00 ? 291 GLN B CG   2  
ATOM   4106  C CD   . GLN B 2 11  ? -10.586 -10.365 -4.953  1.00 0.00 ? 291 GLN B CD   2  
ATOM   4107  O OE1  . GLN B 2 11  ? -10.110 -9.483  -4.240  1.00 0.00 ? 291 GLN B OE1  2  
ATOM   4108  N NE2  . GLN B 2 11  ? -9.881  -11.408 -5.355  1.00 0.00 ? 291 GLN B NE2  2  
ATOM   4109  H H    . GLN B 2 11  ? -13.989 -8.433  -5.409  1.00 0.00 ? 291 GLN B H    2  
ATOM   4110  H HA   . GLN B 2 11  ? -13.644 -8.961  -8.186  1.00 0.00 ? 291 GLN B HA   2  
ATOM   4111  H HB2  . GLN B 2 11  ? -11.628 -10.163 -7.499  1.00 0.00 ? 291 GLN B HB2  2  
ATOM   4112  H HB3  . GLN B 2 11  ? -11.742 -8.613  -6.678  1.00 0.00 ? 291 GLN B HB3  2  
ATOM   4113  H HG2  . GLN B 2 11  ? -12.603 -9.763  -4.680  1.00 0.00 ? 291 GLN B HG2  2  
ATOM   4114  H HG3  . GLN B 2 11  ? -12.406 -11.306 -5.510  1.00 0.00 ? 291 GLN B HG3  2  
ATOM   4115  H HE21 . GLN B 2 11  ? -10.320 -12.075 -5.925  1.00 0.00 ? 291 GLN B HE21 2  
ATOM   4116  H HE22 . GLN B 2 11  ? -8.943  -11.469 -5.072  1.00 0.00 ? 291 GLN B HE22 2  
ATOM   4117  N N    . SER B 2 12  ? -15.145 -11.162 -6.434  1.00 0.00 ? 292 SER B N    2  
ATOM   4118  C CA   . SER B 2 12  ? -15.857 -12.424 -6.452  1.00 0.00 ? 292 SER B CA   2  
ATOM   4119  C C    . SER B 2 12  ? -17.233 -12.235 -7.085  1.00 0.00 ? 292 SER B C    2  
ATOM   4120  O O    . SER B 2 12  ? -18.170 -11.819 -6.369  1.00 0.00 ? 292 SER B O    2  
ATOM   4121  C CB   . SER B 2 12  ? -15.992 -12.961 -5.026  1.00 0.00 ? 292 SER B CB   2  
ATOM   4122  O OG   . SER B 2 12  ? -14.738 -12.940 -4.359  1.00 0.00 ? 292 SER B OG   2  
ATOM   4123  O OXT  . SER B 2 12  ? -17.369 -12.484 -8.301  1.00 0.00 ? 292 SER B OXT  2  
ATOM   4124  H H    . SER B 2 12  ? -15.316 -10.532 -5.705  1.00 0.00 ? 292 SER B H    2  
ATOM   4125  H HA   . SER B 2 12  ? -15.288 -13.124 -7.046  1.00 0.00 ? 292 SER B HA   2  
ATOM   4126  H HB2  . SER B 2 12  ? -16.689 -12.348 -4.477  1.00 0.00 ? 292 SER B HB2  2  
ATOM   4127  H HB3  . SER B 2 12  ? -16.353 -13.978 -5.058  1.00 0.00 ? 292 SER B HB3  2  
ATOM   4128  H HG   . SER B 2 12  ? -14.109 -13.484 -4.852  1.00 0.00 ? 292 SER B HG   2  
ATOM   4129  N N    . GLY A 1 1   ? 19.651  12.408  -6.375  1.00 0.00 ? 1   GLY A N    3  
ATOM   4130  C CA   . GLY A 1 1   ? 19.886  11.785  -5.050  1.00 0.00 ? 1   GLY A CA   3  
ATOM   4131  C C    . GLY A 1 1   ? 20.376  10.359  -5.172  1.00 0.00 ? 1   GLY A C    3  
ATOM   4132  O O    . GLY A 1 1   ? 20.230  9.737   -6.224  1.00 0.00 ? 1   GLY A O    3  
ATOM   4133  H H1   . GLY A 1 1   ? 20.541  12.459  -6.910  1.00 0.00 ? 1   GLY A H1   3  
ATOM   4134  H H2   . GLY A 1 1   ? 19.271  13.369  -6.261  1.00 0.00 ? 1   GLY A H2   3  
ATOM   4135  H H3   . GLY A 1 1   ? 18.968  11.843  -6.918  1.00 0.00 ? 1   GLY A H3   3  
ATOM   4136  H HA2  . GLY A 1 1   ? 20.624  12.364  -4.516  1.00 0.00 ? 1   GLY A HA2  3  
ATOM   4137  H HA3  . GLY A 1 1   ? 18.963  11.792  -4.491  1.00 0.00 ? 1   GLY A HA3  3  
ATOM   4138  N N    . LYS A 1 2   ? 20.941  9.833   -4.097  1.00 0.00 ? 2   LYS A N    3  
ATOM   4139  C CA   . LYS A 1 2   ? 21.482  8.480   -4.099  1.00 0.00 ? 2   LYS A CA   3  
ATOM   4140  C C    . LYS A 1 2   ? 20.570  7.515   -3.356  1.00 0.00 ? 2   LYS A C    3  
ATOM   4141  O O    . LYS A 1 2   ? 19.840  7.908   -2.442  1.00 0.00 ? 2   LYS A O    3  
ATOM   4142  C CB   . LYS A 1 2   ? 22.872  8.461   -3.463  1.00 0.00 ? 2   LYS A CB   3  
ATOM   4143  C CG   . LYS A 1 2   ? 23.960  9.068   -4.333  1.00 0.00 ? 2   LYS A CG   3  
ATOM   4144  C CD   . LYS A 1 2   ? 24.224  8.209   -5.558  1.00 0.00 ? 2   LYS A CD   3  
ATOM   4145  C CE   . LYS A 1 2   ? 25.377  8.745   -6.390  1.00 0.00 ? 2   LYS A CE   3  
ATOM   4146  N NZ   . LYS A 1 2   ? 25.666  7.866   -7.552  1.00 0.00 ? 2   LYS A NZ   3  
ATOM   4147  H H    . LYS A 1 2   ? 20.990  10.364  -3.273  1.00 0.00 ? 2   LYS A H    3  
ATOM   4148  H HA   . LYS A 1 2   ? 21.567  8.157   -5.122  1.00 0.00 ? 2   LYS A HA   3  
ATOM   4149  H HB2  . LYS A 1 2   ? 22.837  9.008   -2.533  1.00 0.00 ? 2   LYS A HB2  3  
ATOM   4150  H HB3  . LYS A 1 2   ? 23.136  7.438   -3.258  1.00 0.00 ? 2   LYS A HB3  3  
ATOM   4151  H HG2  . LYS A 1 2   ? 23.648  10.051  -4.655  1.00 0.00 ? 2   LYS A HG2  3  
ATOM   4152  H HG3  . LYS A 1 2   ? 24.870  9.146   -3.757  1.00 0.00 ? 2   LYS A HG3  3  
ATOM   4153  H HD2  . LYS A 1 2   ? 24.463  7.207   -5.237  1.00 0.00 ? 2   LYS A HD2  3  
ATOM   4154  H HD3  . LYS A 1 2   ? 23.333  8.189   -6.169  1.00 0.00 ? 2   LYS A HD3  3  
ATOM   4155  H HE2  . LYS A 1 2   ? 25.121  9.730   -6.748  1.00 0.00 ? 2   LYS A HE2  3  
ATOM   4156  H HE3  . LYS A 1 2   ? 26.256  8.806   -5.766  1.00 0.00 ? 2   LYS A HE3  3  
ATOM   4157  H HZ1  . LYS A 1 2   ? 24.820  7.768   -8.149  1.00 0.00 ? 2   LYS A HZ1  3  
ATOM   4158  H HZ2  . LYS A 1 2   ? 25.952  6.921   -7.224  1.00 0.00 ? 2   LYS A HZ2  3  
ATOM   4159  H HZ3  . LYS A 1 2   ? 26.436  8.266   -8.123  1.00 0.00 ? 2   LYS A HZ3  3  
ATOM   4160  N N    . LEU A 1 3   ? 20.607  6.256   -3.766  1.00 0.00 ? 3   LEU A N    3  
ATOM   4161  C CA   . LEU A 1 3   ? 19.908  5.201   -3.051  1.00 0.00 ? 3   LEU A CA   3  
ATOM   4162  C C    . LEU A 1 3   ? 20.868  4.482   -2.119  1.00 0.00 ? 3   LEU A C    3  
ATOM   4163  O O    . LEU A 1 3   ? 21.654  3.636   -2.549  1.00 0.00 ? 3   LEU A O    3  
ATOM   4164  C CB   . LEU A 1 3   ? 19.272  4.183   -4.002  1.00 0.00 ? 3   LEU A CB   3  
ATOM   4165  C CG   . LEU A 1 3   ? 18.037  4.662   -4.764  1.00 0.00 ? 3   LEU A CG   3  
ATOM   4166  C CD1  . LEU A 1 3   ? 17.567  3.591   -5.734  1.00 0.00 ? 3   LEU A CD1  3  
ATOM   4167  C CD2  . LEU A 1 3   ? 16.916  5.010   -3.797  1.00 0.00 ? 3   LEU A CD2  3  
ATOM   4168  H H    . LEU A 1 3   ? 21.132  6.027   -4.564  1.00 0.00 ? 3   LEU A H    3  
ATOM   4169  H HA   . LEU A 1 3   ? 19.133  5.663   -2.460  1.00 0.00 ? 3   LEU A HA   3  
ATOM   4170  H HB2  . LEU A 1 3   ? 20.021  3.876   -4.723  1.00 0.00 ? 3   LEU A HB2  3  
ATOM   4171  H HB3  . LEU A 1 3   ? 18.986  3.324   -3.414  1.00 0.00 ? 3   LEU A HB3  3  
ATOM   4172  H HG   . LEU A 1 3   ? 18.284  5.549   -5.330  1.00 0.00 ? 3   LEU A HG   3  
ATOM   4173  H HD11 . LEU A 1 3   ? 17.248  2.716   -5.183  1.00 0.00 ? 3   LEU A HD11 3  
ATOM   4174  H HD12 . LEU A 1 3   ? 18.378  3.323   -6.396  1.00 0.00 ? 3   LEU A HD12 3  
ATOM   4175  H HD13 . LEU A 1 3   ? 16.741  3.971   -6.316  1.00 0.00 ? 3   LEU A HD13 3  
ATOM   4176  H HD21 . LEU A 1 3   ? 17.271  5.731   -3.078  1.00 0.00 ? 3   LEU A HD21 3  
ATOM   4177  H HD22 . LEU A 1 3   ? 16.594  4.116   -3.283  1.00 0.00 ? 3   LEU A HD22 3  
ATOM   4178  H HD23 . LEU A 1 3   ? 16.085  5.428   -4.345  1.00 0.00 ? 3   LEU A HD23 3  
ATOM   4179  N N    . SER A 1 4   ? 20.803  4.833   -0.848  1.00 0.00 ? 4   SER A N    3  
ATOM   4180  C CA   . SER A 1 4   ? 21.621  4.197   0.172   1.00 0.00 ? 4   SER A CA   3  
ATOM   4181  C C    . SER A 1 4   ? 21.250  2.718   0.294   1.00 0.00 ? 4   SER A C    3  
ATOM   4182  O O    . SER A 1 4   ? 20.264  2.284   -0.300  1.00 0.00 ? 4   SER A O    3  
ATOM   4183  C CB   . SER A 1 4   ? 21.418  4.921   1.503   1.00 0.00 ? 4   SER A CB   3  
ATOM   4184  O OG   . SER A 1 4   ? 21.549  6.324   1.336   1.00 0.00 ? 4   SER A OG   3  
ATOM   4185  H H    . SER A 1 4   ? 20.190  5.545   -0.585  1.00 0.00 ? 4   SER A H    3  
ATOM   4186  H HA   . SER A 1 4   ? 22.655  4.281   -0.127  1.00 0.00 ? 4   SER A HA   3  
ATOM   4187  H HB2  . SER A 1 4   ? 20.429  4.706   1.882   1.00 0.00 ? 4   SER A HB2  3  
ATOM   4188  H HB3  . SER A 1 4   ? 22.158  4.583   2.214   1.00 0.00 ? 4   SER A HB3  3  
ATOM   4189  H HG   . SER A 1 4   ? 21.647  6.742   2.200   1.00 0.00 ? 4   SER A HG   3  
ATOM   4190  N N    . GLU A 1 5   ? 22.018  1.947   1.052   1.00 0.00 ? 5   GLU A N    3  
ATOM   4191  C CA   . GLU A 1 5   ? 21.761  0.511   1.174   1.00 0.00 ? 5   GLU A CA   3  
ATOM   4192  C C    . GLU A 1 5   ? 20.325  0.250   1.632   1.00 0.00 ? 5   GLU A C    3  
ATOM   4193  O O    . GLU A 1 5   ? 19.650  -0.648  1.122   1.00 0.00 ? 5   GLU A O    3  
ATOM   4194  C CB   . GLU A 1 5   ? 22.755  -0.130  2.140   1.00 0.00 ? 5   GLU A CB   3  
ATOM   4195  C CG   . GLU A 1 5   ? 24.201  0.001   1.687   1.00 0.00 ? 5   GLU A CG   3  
ATOM   4196  C CD   . GLU A 1 5   ? 24.461  -0.660  0.350   1.00 0.00 ? 5   GLU A CD   3  
ATOM   4197  O OE1  . GLU A 1 5   ? 24.767  -1.869  0.327   1.00 0.00 ? 5   GLU A OE1  3  
ATOM   4198  O OE2  . GLU A 1 5   ? 24.365  0.026   -0.690  1.00 0.00 ? 5   GLU A OE2  3  
ATOM   4199  H H    . GLU A 1 5   ? 22.774  2.345   1.541   1.00 0.00 ? 5   GLU A H    3  
ATOM   4200  H HA   . GLU A 1 5   ? 21.895  0.073   0.195   1.00 0.00 ? 5   GLU A HA   3  
ATOM   4201  H HB2  . GLU A 1 5   ? 22.658  0.341   3.107   1.00 0.00 ? 5   GLU A HB2  3  
ATOM   4202  H HB3  . GLU A 1 5   ? 22.523  -1.180  2.234   1.00 0.00 ? 5   GLU A HB3  3  
ATOM   4203  H HG2  . GLU A 1 5   ? 24.441  1.048   1.601   1.00 0.00 ? 5   GLU A HG2  3  
ATOM   4204  H HG3  . GLU A 1 5   ? 24.840  -0.456  2.429   1.00 0.00 ? 5   GLU A HG3  3  
ATOM   4205  N N    . GLN A 1 6   ? 19.862  1.066   2.574   1.00 0.00 ? 6   GLN A N    3  
ATOM   4206  C CA   . GLN A 1 6   ? 18.488  0.994   3.064   1.00 0.00 ? 6   GLN A CA   3  
ATOM   4207  C C    . GLN A 1 6   ? 17.501  1.246   1.921   1.00 0.00 ? 6   GLN A C    3  
ATOM   4208  O O    . GLN A 1 6   ? 16.506  0.537   1.773   1.00 0.00 ? 6   GLN A O    3  
ATOM   4209  C CB   . GLN A 1 6   ? 18.247  2.034   4.175   1.00 0.00 ? 6   GLN A CB   3  
ATOM   4210  C CG   . GLN A 1 6   ? 18.963  1.773   5.504   1.00 0.00 ? 6   GLN A CG   3  
ATOM   4211  C CD   . GLN A 1 6   ? 20.440  1.460   5.363   1.00 0.00 ? 6   GLN A CD   3  
ATOM   4212  O OE1  . GLN A 1 6   ? 21.277  2.361   5.327   1.00 0.00 ? 6   GLN A OE1  3  
ATOM   4213  N NE2  . GLN A 1 6   ? 20.769  0.181   5.303   1.00 0.00 ? 6   GLN A NE2  3  
ATOM   4214  H H    . GLN A 1 6   ? 20.470  1.728   2.966   1.00 0.00 ? 6   GLN A H    3  
ATOM   4215  H HA   . GLN A 1 6   ? 18.322  0.004   3.464   1.00 0.00 ? 6   GLN A HA   3  
ATOM   4216  H HB2  . GLN A 1 6   ? 18.561  3.000   3.814   1.00 0.00 ? 6   GLN A HB2  3  
ATOM   4217  H HB3  . GLN A 1 6   ? 17.183  2.070   4.378   1.00 0.00 ? 6   GLN A HB3  3  
ATOM   4218  H HG2  . GLN A 1 6   ? 18.869  2.655   6.120   1.00 0.00 ? 6   GLN A HG2  3  
ATOM   4219  H HG3  . GLN A 1 6   ? 18.480  0.942   5.997   1.00 0.00 ? 6   GLN A HG3  3  
ATOM   4220  H HE21 . GLN A 1 6   ? 20.051  -0.486  5.351   1.00 0.00 ? 6   GLN A HE21 3  
ATOM   4221  H HE22 . GLN A 1 6   ? 21.717  -0.051  5.226   1.00 0.00 ? 6   GLN A HE22 3  
ATOM   4222  N N    . LEU A 1 7   ? 17.805  2.242   1.095   1.00 0.00 ? 7   LEU A N    3  
ATOM   4223  C CA   . LEU A 1 7   ? 16.897  2.672   0.035   1.00 0.00 ? 7   LEU A CA   3  
ATOM   4224  C C    . LEU A 1 7   ? 16.954  1.735   -1.172  1.00 0.00 ? 7   LEU A C    3  
ATOM   4225  O O    . LEU A 1 7   ? 15.985  1.592   -1.912  1.00 0.00 ? 7   LEU A O    3  
ATOM   4226  C CB   . LEU A 1 7   ? 17.216  4.104   -0.388  1.00 0.00 ? 7   LEU A CB   3  
ATOM   4227  C CG   . LEU A 1 7   ? 17.021  5.148   0.705   1.00 0.00 ? 7   LEU A CG   3  
ATOM   4228  C CD1  . LEU A 1 7   ? 17.567  6.490   0.257   1.00 0.00 ? 7   LEU A CD1  3  
ATOM   4229  C CD2  . LEU A 1 7   ? 15.551  5.266   1.072   1.00 0.00 ? 7   LEU A CD2  3  
ATOM   4230  H H    . LEU A 1 7   ? 18.668  2.693   1.192   1.00 0.00 ? 7   LEU A H    3  
ATOM   4231  H HA   . LEU A 1 7   ? 15.897  2.648   0.442   1.00 0.00 ? 7   LEU A HA   3  
ATOM   4232  H HB2  . LEU A 1 7   ? 18.243  4.144   -0.718  1.00 0.00 ? 7   LEU A HB2  3  
ATOM   4233  H HB3  . LEU A 1 7   ? 16.577  4.371   -1.218  1.00 0.00 ? 7   LEU A HB3  3  
ATOM   4234  H HG   . LEU A 1 7   ? 17.558  4.837   1.583   1.00 0.00 ? 7   LEU A HG   3  
ATOM   4235  H HD11 . LEU A 1 7   ? 18.611  6.385   0.008   1.00 0.00 ? 7   LEU A HD11 3  
ATOM   4236  H HD12 . LEU A 1 7   ? 17.458  7.208   1.057   1.00 0.00 ? 7   LEU A HD12 3  
ATOM   4237  H HD13 . LEU A 1 7   ? 17.023  6.830   -0.611  1.00 0.00 ? 7   LEU A HD13 3  
ATOM   4238  H HD21 . LEU A 1 7   ? 15.245  4.393   1.628   1.00 0.00 ? 7   LEU A HD21 3  
ATOM   4239  H HD22 . LEU A 1 7   ? 14.960  5.344   0.171   1.00 0.00 ? 7   LEU A HD22 3  
ATOM   4240  H HD23 . LEU A 1 7   ? 15.402  6.147   1.677   1.00 0.00 ? 7   LEU A HD23 3  
ATOM   4241  N N    . LYS A 1 8   ? 18.087  1.095   -1.381  1.00 0.00 ? 8   LYS A N    3  
ATOM   4242  C CA   . LYS A 1 8   ? 18.186  0.092   -2.422  1.00 0.00 ? 8   LYS A CA   3  
ATOM   4243  C C    . LYS A 1 8   ? 17.423  -1.151  -1.990  1.00 0.00 ? 8   LYS A C    3  
ATOM   4244  O O    . LYS A 1 8   ? 16.830  -1.855  -2.810  1.00 0.00 ? 8   LYS A O    3  
ATOM   4245  C CB   . LYS A 1 8   ? 19.649  -0.235  -2.708  1.00 0.00 ? 8   LYS A CB   3  
ATOM   4246  C CG   . LYS A 1 8   ? 19.857  -1.263  -3.817  1.00 0.00 ? 8   LYS A CG   3  
ATOM   4247  C CD   . LYS A 1 8   ? 19.240  -0.817  -5.138  1.00 0.00 ? 8   LYS A CD   3  
ATOM   4248  C CE   . LYS A 1 8   ? 19.841  0.492   -5.636  1.00 0.00 ? 8   LYS A CE   3  
ATOM   4249  N NZ   . LYS A 1 8   ? 19.281  0.900   -6.954  1.00 0.00 ? 8   LYS A NZ   3  
ATOM   4250  H H    . LYS A 1 8   ? 18.877  1.306   -0.831  1.00 0.00 ? 8   LYS A H    3  
ATOM   4251  H HA   . LYS A 1 8   ? 17.727  0.489   -3.314  1.00 0.00 ? 8   LYS A HA   3  
ATOM   4252  H HB2  . LYS A 1 8   ? 20.159  0.673   -2.990  1.00 0.00 ? 8   LYS A HB2  3  
ATOM   4253  H HB3  . LYS A 1 8   ? 20.091  -0.618  -1.805  1.00 0.00 ? 8   LYS A HB3  3  
ATOM   4254  H HG2  . LYS A 1 8   ? 20.918  -1.408  -3.961  1.00 0.00 ? 8   LYS A HG2  3  
ATOM   4255  H HG3  . LYS A 1 8   ? 19.405  -2.196  -3.515  1.00 0.00 ? 8   LYS A HG3  3  
ATOM   4256  H HD2  . LYS A 1 8   ? 19.414  -1.583  -5.879  1.00 0.00 ? 8   LYS A HD2  3  
ATOM   4257  H HD3  . LYS A 1 8   ? 18.176  -0.687  -4.999  1.00 0.00 ? 8   LYS A HD3  3  
ATOM   4258  H HE2  . LYS A 1 8   ? 19.633  1.266   -4.912  1.00 0.00 ? 8   LYS A HE2  3  
ATOM   4259  H HE3  . LYS A 1 8   ? 20.910  0.369   -5.731  1.00 0.00 ? 8   LYS A HE3  3  
ATOM   4260  H HZ1  . LYS A 1 8   ? 19.715  1.791   -7.270  1.00 0.00 ? 8   LYS A HZ1  3  
ATOM   4261  H HZ2  . LYS A 1 8   ? 18.253  1.036   -6.886  1.00 0.00 ? 8   LYS A HZ2  3  
ATOM   4262  H HZ3  . LYS A 1 8   ? 19.471  0.169   -7.669  1.00 0.00 ? 8   LYS A HZ3  3  
ATOM   4263  N N    . HIS A 1 9   ? 17.422  -1.396  -0.687  1.00 0.00 ? 9   HIS A N    3  
ATOM   4264  C CA   . HIS A 1 9   ? 16.651  -2.490  -0.125  1.00 0.00 ? 9   HIS A CA   3  
ATOM   4265  C C    . HIS A 1 9   ? 15.160  -2.180  -0.233  1.00 0.00 ? 9   HIS A C    3  
ATOM   4266  O O    . HIS A 1 9   ? 14.358  -3.067  -0.522  1.00 0.00 ? 9   HIS A O    3  
ATOM   4267  C CB   . HIS A 1 9   ? 17.030  -2.737  1.338   1.00 0.00 ? 9   HIS A CB   3  
ATOM   4268  C CG   . HIS A 1 9   ? 16.888  -4.167  1.763   1.00 0.00 ? 9   HIS A CG   3  
ATOM   4269  N ND1  . HIS A 1 9   ? 17.925  -4.890  2.306   1.00 0.00 ? 9   HIS A ND1  3  
ATOM   4270  C CD2  . HIS A 1 9   ? 15.828  -5.010  1.723   1.00 0.00 ? 9   HIS A CD2  3  
ATOM   4271  C CE1  . HIS A 1 9   ? 17.513  -6.112  2.579   1.00 0.00 ? 9   HIS A CE1  3  
ATOM   4272  N NE2  . HIS A 1 9   ? 16.242  -6.214  2.234   1.00 0.00 ? 9   HIS A NE2  3  
ATOM   4273  H H    . HIS A 1 9   ? 17.966  -0.833  -0.092  1.00 0.00 ? 9   HIS A H    3  
ATOM   4274  H HA   . HIS A 1 9   ? 16.866  -3.379  -0.701  1.00 0.00 ? 9   HIS A HA   3  
ATOM   4275  H HB2  . HIS A 1 9   ? 18.058  -2.447  1.495   1.00 0.00 ? 9   HIS A HB2  3  
ATOM   4276  H HB3  . HIS A 1 9   ? 16.393  -2.136  1.973   1.00 0.00 ? 9   HIS A HB3  3  
ATOM   4277  H HD1  . HIS A 1 9   ? 18.838  -4.554  2.461   1.00 0.00 ? 9   HIS A HD1  3  
ATOM   4278  H HD2  . HIS A 1 9   ? 14.838  -4.777  1.355   1.00 0.00 ? 9   HIS A HD2  3  
ATOM   4279  H HE1  . HIS A 1 9   ? 18.114  -6.897  3.009   1.00 0.00 ? 9   HIS A HE1  3  
ATOM   4280  H HE2  . HIS A 1 9   ? 15.762  -7.066  2.123   1.00 0.00 ? 9   HIS A HE2  3  
ATOM   4281  N N    . CYS A 1 10  ? 14.791  -0.913  -0.014  1.00 0.00 ? 10  CYS A N    3  
ATOM   4282  C CA   . CYS A 1 10  ? 13.391  -0.511  -0.111  1.00 0.00 ? 10  CYS A CA   3  
ATOM   4283  C C    . CYS A 1 10  ? 12.918  -0.591  -1.555  1.00 0.00 ? 10  CYS A C    3  
ATOM   4284  O O    . CYS A 1 10  ? 11.746  -0.865  -1.820  1.00 0.00 ? 10  CYS A O    3  
ATOM   4285  C CB   . CYS A 1 10  ? 13.154  0.898   0.474   1.00 0.00 ? 10  CYS A CB   3  
ATOM   4286  S SG   . CYS A 1 10  ? 13.690  2.285   -0.549  1.00 0.00 ? 10  CYS A SG   3  
ATOM   4287  H H    . CYS A 1 10  ? 15.469  -0.247  0.232   1.00 0.00 ? 10  CYS A H    3  
ATOM   4288  H HA   . CYS A 1 10  ? 12.819  -1.222  0.463   1.00 0.00 ? 10  CYS A HA   3  
ATOM   4289  H HB2  . CYS A 1 10  ? 12.095  1.028   0.644   1.00 0.00 ? 10  CYS A HB2  3  
ATOM   4290  H HB3  . CYS A 1 10  ? 13.681  0.977   1.417   1.00 0.00 ? 10  CYS A HB3  3  
ATOM   4291  H HG   . CYS A 1 10  ? 14.407  1.808   -1.559  1.00 0.00 ? 10  CYS A HG   3  
ATOM   4292  N N    . ASN A 1 11  ? 13.842  -0.375  -2.487  1.00 0.00 ? 11  ASN A N    3  
ATOM   4293  C CA   . ASN A 1 11  ? 13.553  -0.537  -3.903  1.00 0.00 ? 11  ASN A CA   3  
ATOM   4294  C C    . ASN A 1 11  ? 13.160  -1.980  -4.193  1.00 0.00 ? 11  ASN A C    3  
ATOM   4295  O O    . ASN A 1 11  ? 12.175  -2.243  -4.881  1.00 0.00 ? 11  ASN A O    3  
ATOM   4296  C CB   . ASN A 1 11  ? 14.775  -0.161  -4.749  1.00 0.00 ? 11  ASN A CB   3  
ATOM   4297  C CG   . ASN A 1 11  ? 14.583  -0.485  -6.222  1.00 0.00 ? 11  ASN A CG   3  
ATOM   4298  O OD1  . ASN A 1 11  ? 14.006  0.298   -6.975  1.00 0.00 ? 11  ASN A OD1  3  
ATOM   4299  N ND2  . ASN A 1 11  ? 15.085  -1.636  -6.649  1.00 0.00 ? 11  ASN A ND2  3  
ATOM   4300  H H    . ASN A 1 11  ? 14.742  -0.091  -2.212  1.00 0.00 ? 11  ASN A H    3  
ATOM   4301  H HA   . ASN A 1 11  ? 12.729  0.114   -4.155  1.00 0.00 ? 11  ASN A HA   3  
ATOM   4302  H HB2  . ASN A 1 11  ? 14.971  0.898   -4.650  1.00 0.00 ? 11  ASN A HB2  3  
ATOM   4303  H HB3  . ASN A 1 11  ? 15.628  -0.713  -4.389  1.00 0.00 ? 11  ASN A HB3  3  
ATOM   4304  H HD21 . ASN A 1 11  ? 15.547  -2.209  -6.002  1.00 0.00 ? 11  ASN A HD21 3  
ATOM   4305  H HD22 . ASN A 1 11  ? 14.976  -1.867  -7.596  1.00 0.00 ? 11  ASN A HD22 3  
ATOM   4306  N N    . GLY A 1 12  ? 13.935  -2.907  -3.637  1.00 0.00 ? 12  GLY A N    3  
ATOM   4307  C CA   . GLY A 1 12  ? 13.702  -4.322  -3.871  1.00 0.00 ? 12  GLY A CA   3  
ATOM   4308  C C    . GLY A 1 12  ? 12.402  -4.804  -3.260  1.00 0.00 ? 12  GLY A C    3  
ATOM   4309  O O    . GLY A 1 12  ? 11.664  -5.572  -3.876  1.00 0.00 ? 12  GLY A O    3  
ATOM   4310  H H    . GLY A 1 12  ? 14.675  -2.623  -3.053  1.00 0.00 ? 12  GLY A H    3  
ATOM   4311  H HA2  . GLY A 1 12  ? 13.671  -4.498  -4.937  1.00 0.00 ? 12  GLY A HA2  3  
ATOM   4312  H HA3  . GLY A 1 12  ? 14.519  -4.887  -3.445  1.00 0.00 ? 12  GLY A HA3  3  
ATOM   4313  N N    . ILE A 1 13  ? 12.122  -4.348  -2.046  1.00 0.00 ? 13  ILE A N    3  
ATOM   4314  C CA   . ILE A 1 13  ? 10.891  -4.708  -1.354  1.00 0.00 ? 13  ILE A CA   3  
ATOM   4315  C C    . ILE A 1 13  ? 9.676   -4.210  -2.132  1.00 0.00 ? 13  ILE A C    3  
ATOM   4316  O O    . ILE A 1 13  ? 8.739   -4.966  -2.397  1.00 0.00 ? 13  ILE A O    3  
ATOM   4317  C CB   . ILE A 1 13  ? 10.876  -4.129  0.079   1.00 0.00 ? 13  ILE A CB   3  
ATOM   4318  C CG1  . ILE A 1 13  ? 12.019  -4.729  0.908   1.00 0.00 ? 13  ILE A CG1  3  
ATOM   4319  C CG2  . ILE A 1 13  ? 9.536   -4.376  0.748   1.00 0.00 ? 13  ILE A CG2  3  
ATOM   4320  C CD1  . ILE A 1 13  ? 12.250  -4.040  2.234   1.00 0.00 ? 13  ILE A CD1  3  
ATOM   4321  H H    . ILE A 1 13  ? 12.764  -3.754  -1.600  1.00 0.00 ? 13  ILE A H    3  
ATOM   4322  H HA   . ILE A 1 13  ? 10.847  -5.784  -1.289  1.00 0.00 ? 13  ILE A HA   3  
ATOM   4323  H HB   . ILE A 1 13  ? 11.010  -3.069  0.006   1.00 0.00 ? 13  ILE A HB   3  
ATOM   4324  H HG12 . ILE A 1 13  ? 11.788  -5.756  1.121   1.00 0.00 ? 13  ILE A HG12 3  
ATOM   4325  H HG13 . ILE A 1 13  ? 12.937  -4.683  0.340   1.00 0.00 ? 13  ILE A HG13 3  
ATOM   4326  H HG21 . ILE A 1 13  ? 9.021   -5.158  0.224   1.00 0.00 ? 13  ILE A HG21 3  
ATOM   4327  H HG22 . ILE A 1 13  ? 8.945   -3.472  0.720   1.00 0.00 ? 13  ILE A HG22 3  
ATOM   4328  H HG23 . ILE A 1 13  ? 9.694   -4.672  1.775   1.00 0.00 ? 13  ILE A HG23 3  
ATOM   4329  H HD11 . ILE A 1 13  ? 11.482  -4.338  2.929   1.00 0.00 ? 13  ILE A HD11 3  
ATOM   4330  H HD12 . ILE A 1 13  ? 12.216  -2.969  2.097   1.00 0.00 ? 13  ILE A HD12 3  
ATOM   4331  H HD13 . ILE A 1 13  ? 13.217  -4.322  2.625   1.00 0.00 ? 13  ILE A HD13 3  
ATOM   4332  N N    . LEU A 1 14  ? 9.712   -2.938  -2.516  1.00 0.00 ? 14  LEU A N    3  
ATOM   4333  C CA   . LEU A 1 14  ? 8.634   -2.332  -3.279  1.00 0.00 ? 14  LEU A CA   3  
ATOM   4334  C C    . LEU A 1 14  ? 8.434   -3.054  -4.603  1.00 0.00 ? 14  LEU A C    3  
ATOM   4335  O O    . LEU A 1 14  ? 7.310   -3.370  -4.986  1.00 0.00 ? 14  LEU A O    3  
ATOM   4336  C CB   . LEU A 1 14  ? 8.953   -0.867  -3.547  1.00 0.00 ? 14  LEU A CB   3  
ATOM   4337  C CG   . LEU A 1 14  ? 7.771   0.076   -3.431  1.00 0.00 ? 14  LEU A CG   3  
ATOM   4338  C CD1  . LEU A 1 14  ? 8.273   1.497   -3.434  1.00 0.00 ? 14  LEU A CD1  3  
ATOM   4339  C CD2  . LEU A 1 14  ? 6.781   -0.128  -4.565  1.00 0.00 ? 14  LEU A CD2  3  
ATOM   4340  H H    . LEU A 1 14  ? 10.483  -2.386  -2.267  1.00 0.00 ? 14  LEU A H    3  
ATOM   4341  H HA   . LEU A 1 14  ? 7.729   -2.399  -2.696  1.00 0.00 ? 14  LEU A HA   3  
ATOM   4342  H HB2  . LEU A 1 14  ? 9.712   -0.541  -2.852  1.00 0.00 ? 14  LEU A HB2  3  
ATOM   4343  H HB3  . LEU A 1 14  ? 9.349   -0.786  -4.548  1.00 0.00 ? 14  LEU A HB3  3  
ATOM   4344  H HG   . LEU A 1 14  ? 7.266   -0.106  -2.495  1.00 0.00 ? 14  LEU A HG   3  
ATOM   4345  H HD11 . LEU A 1 14  ? 9.032   1.601   -4.197  1.00 0.00 ? 14  LEU A HD11 3  
ATOM   4346  H HD12 . LEU A 1 14  ? 8.696   1.735   -2.471  1.00 0.00 ? 14  LEU A HD12 3  
ATOM   4347  H HD13 . LEU A 1 14  ? 7.455   2.169   -3.648  1.00 0.00 ? 14  LEU A HD13 3  
ATOM   4348  H HD21 . LEU A 1 14  ? 6.744   -1.177  -4.851  1.00 0.00 ? 14  LEU A HD21 3  
ATOM   4349  H HD22 . LEU A 1 14  ? 7.078   0.467   -5.411  1.00 0.00 ? 14  LEU A HD22 3  
ATOM   4350  H HD23 . LEU A 1 14  ? 5.806   0.188   -4.236  1.00 0.00 ? 14  LEU A HD23 3  
ATOM   4351  N N    . LYS A 1 15  ? 9.540   -3.315  -5.288  1.00 0.00 ? 15  LYS A N    3  
ATOM   4352  C CA   . LYS A 1 15  ? 9.521   -3.969  -6.573  1.00 0.00 ? 15  LYS A CA   3  
ATOM   4353  C C    . LYS A 1 15  ? 8.836   -5.325  -6.476  1.00 0.00 ? 15  LYS A C    3  
ATOM   4354  O O    . LYS A 1 15  ? 8.071   -5.713  -7.357  1.00 0.00 ? 15  LYS A O    3  
ATOM   4355  C CB   . LYS A 1 15  ? 10.958  -4.116  -7.072  1.00 0.00 ? 15  LYS A CB   3  
ATOM   4356  C CG   . LYS A 1 15  ? 11.165  -5.324  -7.946  1.00 0.00 ? 15  LYS A CG   3  
ATOM   4357  C CD   . LYS A 1 15  ? 10.589  -5.134  -9.337  1.00 0.00 ? 15  LYS A CD   3  
ATOM   4358  C CE   . LYS A 1 15  ? 11.052  -6.246  -10.254 1.00 0.00 ? 15  LYS A CE   3  
ATOM   4359  N NZ   . LYS A 1 15  ? 10.216  -6.357  -11.478 1.00 0.00 ? 15  LYS A NZ   3  
ATOM   4360  H H    . LYS A 1 15  ? 10.407  -3.077  -4.906  1.00 0.00 ? 15  LYS A H    3  
ATOM   4361  H HA   . LYS A 1 15  ? 8.974   -3.351  -7.255  1.00 0.00 ? 15  LYS A HA   3  
ATOM   4362  H HB2  . LYS A 1 15  ? 11.221  -3.236  -7.641  1.00 0.00 ? 15  LYS A HB2  3  
ATOM   4363  H HB3  . LYS A 1 15  ? 11.617  -4.195  -6.220  1.00 0.00 ? 15  LYS A HB3  3  
ATOM   4364  H HG2  . LYS A 1 15  ? 12.212  -5.540  -8.021  1.00 0.00 ? 15  LYS A HG2  3  
ATOM   4365  H HG3  . LYS A 1 15  ? 10.661  -6.147  -7.470  1.00 0.00 ? 15  LYS A HG3  3  
ATOM   4366  H HD2  . LYS A 1 15  ? 9.511   -5.149  -9.280  1.00 0.00 ? 15  LYS A HD2  3  
ATOM   4367  H HD3  . LYS A 1 15  ? 10.923  -4.186  -9.733  1.00 0.00 ? 15  LYS A HD3  3  
ATOM   4368  H HE2  . LYS A 1 15  ? 12.073  -6.047  -10.546 1.00 0.00 ? 15  LYS A HE2  3  
ATOM   4369  H HE3  . LYS A 1 15  ? 11.015  -7.172  -9.706  1.00 0.00 ? 15  LYS A HE3  3  
ATOM   4370  H HZ1  . LYS A 1 15  ? 10.588  -7.103  -12.099 1.00 0.00 ? 15  LYS A HZ1  3  
ATOM   4371  H HZ2  . LYS A 1 15  ? 10.218  -5.458  -11.999 1.00 0.00 ? 15  LYS A HZ2  3  
ATOM   4372  H HZ3  . LYS A 1 15  ? 9.234   -6.593  -11.224 1.00 0.00 ? 15  LYS A HZ3  3  
ATOM   4373  N N    . GLU A 1 16  ? 9.103   -6.025  -5.393  1.00 0.00 ? 16  GLU A N    3  
ATOM   4374  C CA   . GLU A 1 16  ? 8.552   -7.360  -5.198  1.00 0.00 ? 16  GLU A CA   3  
ATOM   4375  C C    . GLU A 1 16  ? 7.043   -7.297  -5.001  1.00 0.00 ? 16  GLU A C    3  
ATOM   4376  O O    . GLU A 1 16  ? 6.298   -8.069  -5.603  1.00 0.00 ? 16  GLU A O    3  
ATOM   4377  C CB   . GLU A 1 16  ? 9.195   -8.063  -3.995  1.00 0.00 ? 16  GLU A CB   3  
ATOM   4378  C CG   . GLU A 1 16  ? 8.643   -9.464  -3.740  1.00 0.00 ? 16  GLU A CG   3  
ATOM   4379  C CD   . GLU A 1 16  ? 8.693   -9.865  -2.290  1.00 0.00 ? 16  GLU A CD   3  
ATOM   4380  O OE1  . GLU A 1 16  ? 9.291   -9.131  -1.486  1.00 0.00 ? 16  GLU A OE1  3  
ATOM   4381  O OE2  . GLU A 1 16  ? 8.135   -10.934 -1.954  1.00 0.00 ? 16  GLU A OE2  3  
ATOM   4382  H H    . GLU A 1 16  ? 9.684   -5.628  -4.710  1.00 0.00 ? 16  GLU A H    3  
ATOM   4383  H HA   . GLU A 1 16  ? 8.758   -7.920  -6.097  1.00 0.00 ? 16  GLU A HA   3  
ATOM   4384  H HB2  . GLU A 1 16  ? 10.259  -8.143  -4.167  1.00 0.00 ? 16  GLU A HB2  3  
ATOM   4385  H HB3  . GLU A 1 16  ? 9.023   -7.465  -3.110  1.00 0.00 ? 16  GLU A HB3  3  
ATOM   4386  H HG2  . GLU A 1 16  ? 7.619   -9.500  -4.069  1.00 0.00 ? 16  GLU A HG2  3  
ATOM   4387  H HG3  . GLU A 1 16  ? 9.221   -10.176 -4.298  1.00 0.00 ? 16  GLU A HG3  3  
ATOM   4388  N N    . LEU A 1 17  ? 6.602   -6.372  -4.158  1.00 0.00 ? 17  LEU A N    3  
ATOM   4389  C CA   . LEU A 1 17  ? 5.174   -6.161  -3.926  1.00 0.00 ? 17  LEU A CA   3  
ATOM   4390  C C    . LEU A 1 17  ? 4.491   -5.737  -5.236  1.00 0.00 ? 17  LEU A C    3  
ATOM   4391  O O    . LEU A 1 17  ? 3.292   -5.937  -5.421  1.00 0.00 ? 17  LEU A O    3  
ATOM   4392  C CB   . LEU A 1 17  ? 4.963   -5.098  -2.829  1.00 0.00 ? 17  LEU A CB   3  
ATOM   4393  C CG   . LEU A 1 17  ? 5.589   -5.409  -1.461  1.00 0.00 ? 17  LEU A CG   3  
ATOM   4394  C CD1  . LEU A 1 17  ? 5.757   -4.128  -0.668  1.00 0.00 ? 17  LEU A CD1  3  
ATOM   4395  C CD2  . LEU A 1 17  ? 4.727   -6.379  -0.665  1.00 0.00 ? 17  LEU A CD2  3  
ATOM   4396  H H    . LEU A 1 17  ? 7.256   -5.813  -3.678  1.00 0.00 ? 17  LEU A H    3  
ATOM   4397  H HA   . LEU A 1 17  ? 4.745   -7.098  -3.598  1.00 0.00 ? 17  LEU A HA   3  
ATOM   4398  H HB2  . LEU A 1 17  ? 5.372   -4.164  -3.177  1.00 0.00 ? 17  LEU A HB2  3  
ATOM   4399  H HB3  . LEU A 1 17  ? 3.904   -4.968  -2.680  1.00 0.00 ? 17  LEU A HB3  3  
ATOM   4400  H HG   . LEU A 1 17  ? 6.563   -5.852  -1.603  1.00 0.00 ? 17  LEU A HG   3  
ATOM   4401  H HD11 . LEU A 1 17  ? 6.313   -3.419  -1.254  1.00 0.00 ? 17  LEU A HD11 3  
ATOM   4402  H HD12 . LEU A 1 17  ? 6.291   -4.337  0.247   1.00 0.00 ? 17  LEU A HD12 3  
ATOM   4403  H HD13 . LEU A 1 17  ? 4.786   -3.719  -0.433  1.00 0.00 ? 17  LEU A HD13 3  
ATOM   4404  H HD21 . LEU A 1 17  ? 4.644   -7.313  -1.190  1.00 0.00 ? 17  LEU A HD21 3  
ATOM   4405  H HD22 . LEU A 1 17  ? 3.745   -5.956  -0.526  1.00 0.00 ? 17  LEU A HD22 3  
ATOM   4406  H HD23 . LEU A 1 17  ? 5.181   -6.551  0.301   1.00 0.00 ? 17  LEU A HD23 3  
ATOM   4407  N N    . LEU A 1 18  ? 5.285   -5.177  -6.150  1.00 0.00 ? 18  LEU A N    3  
ATOM   4408  C CA   . LEU A 1 18  ? 4.798   -4.737  -7.460  1.00 0.00 ? 18  LEU A CA   3  
ATOM   4409  C C    . LEU A 1 18  ? 4.917   -5.833  -8.522  1.00 0.00 ? 18  LEU A C    3  
ATOM   4410  O O    . LEU A 1 18  ? 4.384   -5.704  -9.628  1.00 0.00 ? 18  LEU A O    3  
ATOM   4411  C CB   . LEU A 1 18  ? 5.595   -3.527  -7.930  1.00 0.00 ? 18  LEU A CB   3  
ATOM   4412  C CG   . LEU A 1 18  ? 5.337   -2.240  -7.163  1.00 0.00 ? 18  LEU A CG   3  
ATOM   4413  C CD1  . LEU A 1 18  ? 6.211   -1.127  -7.705  1.00 0.00 ? 18  LEU A CD1  3  
ATOM   4414  C CD2  . LEU A 1 18  ? 3.874   -1.849  -7.242  1.00 0.00 ? 18  LEU A CD2  3  
ATOM   4415  H H    . LEU A 1 18  ? 6.230   -5.042  -5.929  1.00 0.00 ? 18  LEU A H    3  
ATOM   4416  H HA   . LEU A 1 18  ? 3.763   -4.451  -7.352  1.00 0.00 ? 18  LEU A HA   3  
ATOM   4417  H HB2  . LEU A 1 18  ? 6.646   -3.764  -7.849  1.00 0.00 ? 18  LEU A HB2  3  
ATOM   4418  H HB3  . LEU A 1 18  ? 5.364   -3.355  -8.966  1.00 0.00 ? 18  LEU A HB3  3  
ATOM   4419  H HG   . LEU A 1 18  ? 5.590   -2.390  -6.123  1.00 0.00 ? 18  LEU A HG   3  
ATOM   4420  H HD11 . LEU A 1 18  ? 7.238   -1.292  -7.401  1.00 0.00 ? 18  LEU A HD11 3  
ATOM   4421  H HD12 . LEU A 1 18  ? 5.868   -0.179  -7.316  1.00 0.00 ? 18  LEU A HD12 3  
ATOM   4422  H HD13 . LEU A 1 18  ? 6.152   -1.115  -8.784  1.00 0.00 ? 18  LEU A HD13 3  
ATOM   4423  H HD21 . LEU A 1 18  ? 3.649   -1.181  -6.434  1.00 0.00 ? 18  LEU A HD21 3  
ATOM   4424  H HD22 . LEU A 1 18  ? 3.254   -2.727  -7.164  1.00 0.00 ? 18  LEU A HD22 3  
ATOM   4425  H HD23 . LEU A 1 18  ? 3.683   -1.354  -8.182  1.00 0.00 ? 18  LEU A HD23 3  
ATOM   4426  N N    . SER A 1 19  ? 5.649   -6.884  -8.201  1.00 0.00 ? 19  SER A N    3  
ATOM   4427  C CA   . SER A 1 19  ? 5.875   -7.979  -9.137  1.00 0.00 ? 19  SER A CA   3  
ATOM   4428  C C    . SER A 1 19  ? 4.642   -8.873  -9.266  1.00 0.00 ? 19  SER A C    3  
ATOM   4429  O O    . SER A 1 19  ? 3.857   -9.025  -8.324  1.00 0.00 ? 19  SER A O    3  
ATOM   4430  C CB   . SER A 1 19  ? 7.080   -8.805  -8.686  1.00 0.00 ? 19  SER A CB   3  
ATOM   4431  O OG   . SER A 1 19  ? 8.260   -8.014  -8.660  1.00 0.00 ? 19  SER A OG   3  
ATOM   4432  H H    . SER A 1 19  ? 6.056   -6.921  -7.312  1.00 0.00 ? 19  SER A H    3  
ATOM   4433  H HA   . SER A 1 19  ? 6.092   -7.547  -10.101 1.00 0.00 ? 19  SER A HA   3  
ATOM   4434  H HB2  . SER A 1 19  ? 6.897   -9.190  -7.693  1.00 0.00 ? 19  SER A HB2  3  
ATOM   4435  H HB3  . SER A 1 19  ? 7.226   -9.627  -9.370  1.00 0.00 ? 19  SER A HB3  3  
ATOM   4436  H HG   . SER A 1 19  ? 8.060   -7.156  -8.251  1.00 0.00 ? 19  SER A HG   3  
ATOM   4437  N N    . LYS A 1 20  ? 4.510   -9.480  -10.451 1.00 0.00 ? 20  LYS A N    3  
ATOM   4438  C CA   . LYS A 1 20  ? 3.345   -10.289 -10.820 1.00 0.00 ? 20  LYS A CA   3  
ATOM   4439  C C    . LYS A 1 20  ? 3.095   -11.434 -9.848  1.00 0.00 ? 20  LYS A C    3  
ATOM   4440  O O    . LYS A 1 20  ? 1.977   -11.943 -9.761  1.00 0.00 ? 20  LYS A O    3  
ATOM   4441  C CB   . LYS A 1 20  ? 3.516   -10.840 -12.235 1.00 0.00 ? 20  LYS A CB   3  
ATOM   4442  C CG   . LYS A 1 20  ? 3.257   -9.805  -13.315 1.00 0.00 ? 20  LYS A CG   3  
ATOM   4443  C CD   . LYS A 1 20  ? 1.769   -9.521  -13.466 1.00 0.00 ? 20  LYS A CD   3  
ATOM   4444  C CE   . LYS A 1 20  ? 1.500   -8.531  -14.586 1.00 0.00 ? 20  LYS A CE   3  
ATOM   4445  N NZ   . LYS A 1 20  ? 0.045   -8.294  -14.779 1.00 0.00 ? 20  LYS A NZ   3  
ATOM   4446  H H    . LYS A 1 20  ? 5.232   -9.378  -11.109 1.00 0.00 ? 20  LYS A H    3  
ATOM   4447  H HA   . LYS A 1 20  ? 2.486   -9.639  -10.810 1.00 0.00 ? 20  LYS A HA   3  
ATOM   4448  H HB2  . LYS A 1 20  ? 4.527   -11.209 -12.350 1.00 0.00 ? 20  LYS A HB2  3  
ATOM   4449  H HB3  . LYS A 1 20  ? 2.826   -11.658 -12.377 1.00 0.00 ? 20  LYS A HB3  3  
ATOM   4450  H HG2  . LYS A 1 20  ? 3.758   -8.890  -13.042 1.00 0.00 ? 20  LYS A HG2  3  
ATOM   4451  H HG3  . LYS A 1 20  ? 3.645   -10.168 -14.255 1.00 0.00 ? 20  LYS A HG3  3  
ATOM   4452  H HD2  . LYS A 1 20  ? 1.257   -10.446 -13.687 1.00 0.00 ? 20  LYS A HD2  3  
ATOM   4453  H HD3  . LYS A 1 20  ? 1.394   -9.113  -12.538 1.00 0.00 ? 20  LYS A HD3  3  
ATOM   4454  H HE2  . LYS A 1 20  ? 1.977   -7.592  -14.345 1.00 0.00 ? 20  LYS A HE2  3  
ATOM   4455  H HE3  . LYS A 1 20  ? 1.917   -8.921  -15.503 1.00 0.00 ? 20  LYS A HE3  3  
ATOM   4456  H HZ1  . LYS A 1 20  ? -0.433  -9.181  -15.031 1.00 0.00 ? 20  LYS A HZ1  3  
ATOM   4457  H HZ2  . LYS A 1 20  ? -0.107  -7.606  -15.540 1.00 0.00 ? 20  LYS A HZ2  3  
ATOM   4458  H HZ3  . LYS A 1 20  ? -0.377  -7.922  -13.906 1.00 0.00 ? 20  LYS A HZ3  3  
ATOM   4459  N N    . LYS A 1 21  ? 4.138   -11.838 -9.135  1.00 0.00 ? 21  LYS A N    3  
ATOM   4460  C CA   . LYS A 1 21  ? 4.021   -12.856 -8.100  1.00 0.00 ? 21  LYS A CA   3  
ATOM   4461  C C    . LYS A 1 21  ? 2.994   -12.451 -7.045  1.00 0.00 ? 21  LYS A C    3  
ATOM   4462  O O    . LYS A 1 21  ? 2.254   -13.286 -6.529  1.00 0.00 ? 21  LYS A O    3  
ATOM   4463  C CB   . LYS A 1 21  ? 5.382   -13.084 -7.437  1.00 0.00 ? 21  LYS A CB   3  
ATOM   4464  C CG   . LYS A 1 21  ? 5.308   -13.918 -6.172  1.00 0.00 ? 21  LYS A CG   3  
ATOM   4465  C CD   . LYS A 1 21  ? 6.658   -14.069 -5.514  1.00 0.00 ? 21  LYS A CD   3  
ATOM   4466  C CE   . LYS A 1 21  ? 6.586   -15.120 -4.430  1.00 0.00 ? 21  LYS A CE   3  
ATOM   4467  N NZ   . LYS A 1 21  ? 6.525   -16.494 -4.988  1.00 0.00 ? 21  LYS A NZ   3  
ATOM   4468  H H    . LYS A 1 21  ? 5.018   -11.449 -9.321  1.00 0.00 ? 21  LYS A H    3  
ATOM   4469  H HA   . LYS A 1 21  ? 3.700   -13.773 -8.568  1.00 0.00 ? 21  LYS A HA   3  
ATOM   4470  H HB2  . LYS A 1 21  ? 6.030   -13.585 -8.136  1.00 0.00 ? 21  LYS A HB2  3  
ATOM   4471  H HB3  . LYS A 1 21  ? 5.812   -12.128 -7.188  1.00 0.00 ? 21  LYS A HB3  3  
ATOM   4472  H HG2  . LYS A 1 21  ? 4.641   -13.431 -5.477  1.00 0.00 ? 21  LYS A HG2  3  
ATOM   4473  H HG3  . LYS A 1 21  ? 4.926   -14.897 -6.403  1.00 0.00 ? 21  LYS A HG3  3  
ATOM   4474  H HD2  . LYS A 1 21  ? 7.385   -14.368 -6.256  1.00 0.00 ? 21  LYS A HD2  3  
ATOM   4475  H HD3  . LYS A 1 21  ? 6.945   -13.125 -5.075  1.00 0.00 ? 21  LYS A HD3  3  
ATOM   4476  H HE2  . LYS A 1 21  ? 7.450   -15.031 -3.793  1.00 0.00 ? 21  LYS A HE2  3  
ATOM   4477  H HE3  . LYS A 1 21  ? 5.691   -14.942 -3.861  1.00 0.00 ? 21  LYS A HE3  3  
ATOM   4478  H HZ1  . LYS A 1 21  ? 5.712   -16.587 -5.627  1.00 0.00 ? 21  LYS A HZ1  3  
ATOM   4479  H HZ2  . LYS A 1 21  ? 6.427   -17.189 -4.221  1.00 0.00 ? 21  LYS A HZ2  3  
ATOM   4480  H HZ3  . LYS A 1 21  ? 7.394   -16.705 -5.520  1.00 0.00 ? 21  LYS A HZ3  3  
ATOM   4481  N N    . HIS A 1 22  ? 2.942   -11.164 -6.731  1.00 0.00 ? 22  HIS A N    3  
ATOM   4482  C CA   . HIS A 1 22  ? 2.039   -10.685 -5.693  1.00 0.00 ? 22  HIS A CA   3  
ATOM   4483  C C    . HIS A 1 22  ? 0.873   -9.933  -6.306  1.00 0.00 ? 22  HIS A C    3  
ATOM   4484  O O    . HIS A 1 22  ? -0.125  -9.701  -5.637  1.00 0.00 ? 22  HIS A O    3  
ATOM   4485  C CB   . HIS A 1 22  ? 2.779   -9.786  -4.689  1.00 0.00 ? 22  HIS A CB   3  
ATOM   4486  C CG   . HIS A 1 22  ? 3.869   -10.495 -3.938  1.00 0.00 ? 22  HIS A CG   3  
ATOM   4487  N ND1  . HIS A 1 22  ? 3.631   -11.309 -2.847  1.00 0.00 ? 22  HIS A ND1  3  
ATOM   4488  C CD2  . HIS A 1 22  ? 5.208   -10.499 -4.120  1.00 0.00 ? 22  HIS A CD2  3  
ATOM   4489  C CE1  . HIS A 1 22  ? 4.776   -11.779 -2.388  1.00 0.00 ? 22  HIS A CE1  3  
ATOM   4490  N NE2  . HIS A 1 22  ? 5.756   -11.303 -3.140  1.00 0.00 ? 22  HIS A NE2  3  
ATOM   4491  H H    . HIS A 1 22  ? 3.501   -10.521 -7.224  1.00 0.00 ? 22  HIS A H    3  
ATOM   4492  H HA   . HIS A 1 22  ? 1.652   -11.551 -5.174  1.00 0.00 ? 22  HIS A HA   3  
ATOM   4493  H HB2  . HIS A 1 22  ? 3.224   -8.950  -5.223  1.00 0.00 ? 22  HIS A HB2  3  
ATOM   4494  H HB3  . HIS A 1 22  ? 2.069   -9.404  -3.959  1.00 0.00 ? 22  HIS A HB3  3  
ATOM   4495  H HD1  . HIS A 1 22  ? 2.751   -11.526 -2.474  1.00 0.00 ? 22  HIS A HD1  3  
ATOM   4496  H HD2  . HIS A 1 22  ? 5.747   -9.978  -4.906  1.00 0.00 ? 22  HIS A HD2  3  
ATOM   4497  H HE1  . HIS A 1 22  ? 4.891   -12.446 -1.538  1.00 0.00 ? 22  HIS A HE1  3  
ATOM   4498  H HE2  . HIS A 1 22  ? 6.706   -11.269 -2.853  1.00 0.00 ? 22  HIS A HE2  3  
ATOM   4499  N N    . ALA A 1 23  ? 0.999   -9.593  -7.589  1.00 0.00 ? 23  ALA A N    3  
ATOM   4500  C CA   . ALA A 1 23  ? 0.002   -8.794  -8.305  1.00 0.00 ? 23  ALA A CA   3  
ATOM   4501  C C    . ALA A 1 23  ? -1.419  -9.299  -8.096  1.00 0.00 ? 23  ALA A C    3  
ATOM   4502  O O    . ALA A 1 23  ? -2.357  -8.507  -8.014  1.00 0.00 ? 23  ALA A O    3  
ATOM   4503  C CB   . ALA A 1 23  ? 0.332   -8.772  -9.786  1.00 0.00 ? 23  ALA A CB   3  
ATOM   4504  H H    . ALA A 1 23  ? 1.799   -9.886  -8.077  1.00 0.00 ? 23  ALA A H    3  
ATOM   4505  H HA   . ALA A 1 23  ? 0.066   -7.780  -7.939  1.00 0.00 ? 23  ALA A HA   3  
ATOM   4506  H HB1  . ALA A 1 23  ? 1.358   -8.463  -9.913  1.00 0.00 ? 23  ALA A HB1  3  
ATOM   4507  H HB2  . ALA A 1 23  ? -0.320  -8.077  -10.292 1.00 0.00 ? 23  ALA A HB2  3  
ATOM   4508  H HB3  . ALA A 1 23  ? 0.200   -9.761  -10.200 1.00 0.00 ? 23  ALA A HB3  3  
ATOM   4509  N N    . ALA A 1 24  ? -1.560  -10.615 -7.992  1.00 0.00 ? 24  ALA A N    3  
ATOM   4510  C CA   . ALA A 1 24  ? -2.859  -11.258 -7.803  1.00 0.00 ? 24  ALA A CA   3  
ATOM   4511  C C    . ALA A 1 24  ? -3.591  -10.724 -6.565  1.00 0.00 ? 24  ALA A C    3  
ATOM   4512  O O    . ALA A 1 24  ? -4.819  -10.764 -6.496  1.00 0.00 ? 24  ALA A O    3  
ATOM   4513  C CB   . ALA A 1 24  ? -2.662  -12.762 -7.697  1.00 0.00 ? 24  ALA A CB   3  
ATOM   4514  H H    . ALA A 1 24  ? -0.760  -11.178 -8.050  1.00 0.00 ? 24  ALA A H    3  
ATOM   4515  H HA   . ALA A 1 24  ? -3.460  -11.060 -8.679  1.00 0.00 ? 24  ALA A HA   3  
ATOM   4516  H HB1  . ALA A 1 24  ? -1.857  -12.969 -7.004  1.00 0.00 ? 24  ALA A HB1  3  
ATOM   4517  H HB2  . ALA A 1 24  ? -2.413  -13.162 -8.670  1.00 0.00 ? 24  ALA A HB2  3  
ATOM   4518  H HB3  . ALA A 1 24  ? -3.571  -13.220 -7.340  1.00 0.00 ? 24  ALA A HB3  3  
ATOM   4519  N N    . TYR A 1 25  ? -2.834  -10.227 -5.595  1.00 0.00 ? 25  TYR A N    3  
ATOM   4520  C CA   . TYR A 1 25  ? -3.410  -9.679  -4.373  1.00 0.00 ? 25  TYR A CA   3  
ATOM   4521  C C    . TYR A 1 25  ? -2.686  -8.397  -3.954  1.00 0.00 ? 25  TYR A C    3  
ATOM   4522  O O    . TYR A 1 25  ? -2.801  -7.948  -2.816  1.00 0.00 ? 25  TYR A O    3  
ATOM   4523  C CB   . TYR A 1 25  ? -3.372  -10.732 -3.251  1.00 0.00 ? 25  TYR A CB   3  
ATOM   4524  C CG   . TYR A 1 25  ? -2.069  -11.497 -3.152  1.00 0.00 ? 25  TYR A CG   3  
ATOM   4525  C CD1  . TYR A 1 25  ? -0.938  -10.918 -2.601  1.00 0.00 ? 25  TYR A CD1  3  
ATOM   4526  C CD2  . TYR A 1 25  ? -1.979  -12.809 -3.604  1.00 0.00 ? 25  TYR A CD2  3  
ATOM   4527  C CE1  . TYR A 1 25  ? 0.248   -11.620 -2.508  1.00 0.00 ? 25  TYR A CE1  3  
ATOM   4528  C CE2  . TYR A 1 25  ? -0.796  -13.515 -3.514  1.00 0.00 ? 25  TYR A CE2  3  
ATOM   4529  C CZ   . TYR A 1 25  ? 0.313   -12.913 -2.966  1.00 0.00 ? 25  TYR A CZ   3  
ATOM   4530  O OH   . TYR A 1 25  ? 1.497   -13.606 -2.871  1.00 0.00 ? 25  TYR A OH   3  
ATOM   4531  H H    . TYR A 1 25  ? -1.857  -10.225 -5.705  1.00 0.00 ? 25  TYR A H    3  
ATOM   4532  H HA   . TYR A 1 25  ? -4.443  -9.433  -4.580  1.00 0.00 ? 25  TYR A HA   3  
ATOM   4533  H HB2  . TYR A 1 25  ? -3.537  -10.244 -2.300  1.00 0.00 ? 25  TYR A HB2  3  
ATOM   4534  H HB3  . TYR A 1 25  ? -4.161  -11.450 -3.421  1.00 0.00 ? 25  TYR A HB3  3  
ATOM   4535  H HD1  . TYR A 1 25  ? -0.988  -9.898  -2.248  1.00 0.00 ? 25  TYR A HD1  3  
ATOM   4536  H HD2  . TYR A 1 25  ? -2.853  -13.278 -4.030  1.00 0.00 ? 25  TYR A HD2  3  
ATOM   4537  H HE1  . TYR A 1 25  ? 1.116   -11.156 -2.072  1.00 0.00 ? 25  TYR A HE1  3  
ATOM   4538  H HE2  . TYR A 1 25  ? -0.745  -14.532 -3.874  1.00 0.00 ? 25  TYR A HE2  3  
ATOM   4539  H HH   . TYR A 1 25  ? 1.631   -14.119 -3.681  1.00 0.00 ? 25  TYR A HH   3  
ATOM   4540  N N    . ALA A 1 26  ? -1.941  -7.812  -4.891  1.00 0.00 ? 26  ALA A N    3  
ATOM   4541  C CA   . ALA A 1 26  ? -1.218  -6.568  -4.638  1.00 0.00 ? 26  ALA A CA   3  
ATOM   4542  C C    . ALA A 1 26  ? -1.787  -5.423  -5.472  1.00 0.00 ? 26  ALA A C    3  
ATOM   4543  O O    . ALA A 1 26  ? -1.482  -4.250  -5.231  1.00 0.00 ? 26  ALA A O    3  
ATOM   4544  C CB   . ALA A 1 26  ? 0.268   -6.734  -4.935  1.00 0.00 ? 26  ALA A CB   3  
ATOM   4545  H H    . ALA A 1 26  ? -1.866  -8.237  -5.770  1.00 0.00 ? 26  ALA A H    3  
ATOM   4546  H HA   . ALA A 1 26  ? -1.327  -6.325  -3.591  1.00 0.00 ? 26  ALA A HA   3  
ATOM   4547  H HB1  . ALA A 1 26  ? 0.683   -7.530  -4.329  1.00 0.00 ? 26  ALA A HB1  3  
ATOM   4548  H HB2  . ALA A 1 26  ? 0.782   -5.811  -4.714  1.00 0.00 ? 26  ALA A HB2  3  
ATOM   4549  H HB3  . ALA A 1 26  ? 0.400   -6.974  -5.981  1.00 0.00 ? 26  ALA A HB3  3  
ATOM   4550  N N    . TRP A 1 27  ? -2.625  -5.763  -6.451  1.00 0.00 ? 27  TRP A N    3  
ATOM   4551  C CA   . TRP A 1 27  ? -3.208  -4.759  -7.340  1.00 0.00 ? 27  TRP A CA   3  
ATOM   4552  C C    . TRP A 1 27  ? -3.957  -3.627  -6.602  1.00 0.00 ? 27  TRP A C    3  
ATOM   4553  O O    . TRP A 1 27  ? -3.937  -2.493  -7.087  1.00 0.00 ? 27  TRP A O    3  
ATOM   4554  C CB   . TRP A 1 27  ? -4.111  -5.398  -8.413  1.00 0.00 ? 27  TRP A CB   3  
ATOM   4555  C CG   . TRP A 1 27  ? -5.214  -6.280  -7.897  1.00 0.00 ? 27  TRP A CG   3  
ATOM   4556  C CD1  . TRP A 1 27  ? -5.165  -7.632  -7.725  1.00 0.00 ? 27  TRP A CD1  3  
ATOM   4557  C CD2  . TRP A 1 27  ? -6.541  -5.880  -7.517  1.00 0.00 ? 27  TRP A CD2  3  
ATOM   4558  N NE1  . TRP A 1 27  ? -6.365  -8.096  -7.254  1.00 0.00 ? 27  TRP A NE1  3  
ATOM   4559  C CE2  . TRP A 1 27  ? -7.227  -7.042  -7.117  1.00 0.00 ? 27  TRP A CE2  3  
ATOM   4560  C CE3  . TRP A 1 27  ? -7.211  -4.653  -7.467  1.00 0.00 ? 27  TRP A CE3  3  
ATOM   4561  C CZ2  . TRP A 1 27  ? -8.548  -7.015  -6.681  1.00 0.00 ? 27  TRP A CZ2  3  
ATOM   4562  C CZ3  . TRP A 1 27  ? -8.522  -4.629  -7.034  1.00 0.00 ? 27  TRP A CZ3  3  
ATOM   4563  C CH2  . TRP A 1 27  ? -9.178  -5.802  -6.646  1.00 0.00 ? 27  TRP A CH2  3  
ATOM   4564  H H    . TRP A 1 27  ? -2.847  -6.710  -6.588  1.00 0.00 ? 27  TRP A H    3  
ATOM   4565  H HA   . TRP A 1 27  ? -2.369  -4.301  -7.852  1.00 0.00 ? 27  TRP A HA   3  
ATOM   4566  H HB2  . TRP A 1 27  ? -4.573  -4.610  -8.988  1.00 0.00 ? 27  TRP A HB2  3  
ATOM   4567  H HB3  . TRP A 1 27  ? -3.494  -5.992  -9.074  1.00 0.00 ? 27  TRP A HB3  3  
ATOM   4568  H HD1  . TRP A 1 27  ? -4.294  -8.237  -7.930  1.00 0.00 ? 27  TRP A HD1  3  
ATOM   4569  H HE1  . TRP A 1 27  ? -6.572  -9.035  -7.049  1.00 0.00 ? 27  TRP A HE1  3  
ATOM   4570  H HE3  . TRP A 1 27  ? -6.720  -3.735  -7.754  1.00 0.00 ? 27  TRP A HE3  3  
ATOM   4571  H HZ2  . TRP A 1 27  ? -9.069  -7.911  -6.379  1.00 0.00 ? 27  TRP A HZ2  3  
ATOM   4572  H HZ3  . TRP A 1 27  ? -9.056  -3.692  -6.991  1.00 0.00 ? 27  TRP A HZ3  3  
ATOM   4573  H HH2  . TRP A 1 27  ? -10.204 -5.735  -6.314  1.00 0.00 ? 27  TRP A HH2  3  
ATOM   4574  N N    . PRO A 1 28  ? -4.636  -3.878  -5.441  1.00 0.00 ? 28  PRO A N    3  
ATOM   4575  C CA   . PRO A 1 28  ? -5.288  -2.802  -4.677  1.00 0.00 ? 28  PRO A CA   3  
ATOM   4576  C C    . PRO A 1 28  ? -4.345  -1.647  -4.339  1.00 0.00 ? 28  PRO A C    3  
ATOM   4577  O O    . PRO A 1 28  ? -4.784  -0.513  -4.152  1.00 0.00 ? 28  PRO A O    3  
ATOM   4578  C CB   . PRO A 1 28  ? -5.744  -3.463  -3.365  1.00 0.00 ? 28  PRO A CB   3  
ATOM   4579  C CG   . PRO A 1 28  ? -5.266  -4.879  -3.401  1.00 0.00 ? 28  PRO A CG   3  
ATOM   4580  C CD   . PRO A 1 28  ? -4.878  -5.197  -4.821  1.00 0.00 ? 28  PRO A CD   3  
ATOM   4581  H HA   . PRO A 1 28  ? -6.148  -2.414  -5.203  1.00 0.00 ? 28  PRO A HA   3  
ATOM   4582  H HB2  . PRO A 1 28  ? -5.300  -2.931  -2.535  1.00 0.00 ? 28  PRO A HB2  3  
ATOM   4583  H HB3  . PRO A 1 28  ? -6.822  -3.412  -3.279  1.00 0.00 ? 28  PRO A HB3  3  
ATOM   4584  H HG2  . PRO A 1 28  ? -4.410  -4.988  -2.748  1.00 0.00 ? 28  PRO A HG2  3  
ATOM   4585  H HG3  . PRO A 1 28  ? -6.062  -5.536  -3.079  1.00 0.00 ? 28  PRO A HG3  3  
ATOM   4586  H HD2  . PRO A 1 28  ? -3.980  -5.797  -4.842  1.00 0.00 ? 28  PRO A HD2  3  
ATOM   4587  H HD3  . PRO A 1 28  ? -5.681  -5.717  -5.328  1.00 0.00 ? 28  PRO A HD3  3  
ATOM   4588  N N    . PHE A 1 29  ? -3.052  -1.940  -4.270  1.00 0.00 ? 29  PHE A N    3  
ATOM   4589  C CA   . PHE A 1 29  ? -2.084  -0.970  -3.759  1.00 0.00 ? 29  PHE A CA   3  
ATOM   4590  C C    . PHE A 1 29  ? -1.150  -0.461  -4.849  1.00 0.00 ? 29  PHE A C    3  
ATOM   4591  O O    . PHE A 1 29  ? -0.352  0.446   -4.605  1.00 0.00 ? 29  PHE A O    3  
ATOM   4592  C CB   . PHE A 1 29  ? -1.248  -1.587  -2.638  1.00 0.00 ? 29  PHE A CB   3  
ATOM   4593  C CG   . PHE A 1 29  ? -1.984  -2.617  -1.832  1.00 0.00 ? 29  PHE A CG   3  
ATOM   4594  C CD1  . PHE A 1 29  ? -1.640  -3.955  -1.929  1.00 0.00 ? 29  PHE A CD1  3  
ATOM   4595  C CD2  . PHE A 1 29  ? -3.023  -2.255  -0.993  1.00 0.00 ? 29  PHE A CD2  3  
ATOM   4596  C CE1  . PHE A 1 29  ? -2.318  -4.910  -1.204  1.00 0.00 ? 29  PHE A CE1  3  
ATOM   4597  C CE2  . PHE A 1 29  ? -3.704  -3.208  -0.264  1.00 0.00 ? 29  PHE A CE2  3  
ATOM   4598  C CZ   . PHE A 1 29  ? -3.350  -4.537  -0.372  1.00 0.00 ? 29  PHE A CZ   3  
ATOM   4599  H H    . PHE A 1 29  ? -2.748  -2.825  -4.568  1.00 0.00 ? 29  PHE A H    3  
ATOM   4600  H HA   . PHE A 1 29  ? -2.637  -0.134  -3.359  1.00 0.00 ? 29  PHE A HA   3  
ATOM   4601  H HB2  . PHE A 1 29  ? -0.377  -2.059  -3.066  1.00 0.00 ? 29  PHE A HB2  3  
ATOM   4602  H HB3  . PHE A 1 29  ? -0.932  -0.798  -1.965  1.00 0.00 ? 29  PHE A HB3  3  
ATOM   4603  H HD1  . PHE A 1 29  ? -0.829  -4.253  -2.579  1.00 0.00 ? 29  PHE A HD1  3  
ATOM   4604  H HD2  . PHE A 1 29  ? -3.300  -1.214  -0.909  1.00 0.00 ? 29  PHE A HD2  3  
ATOM   4605  H HE1  . PHE A 1 29  ? -2.038  -5.950  -1.289  1.00 0.00 ? 29  PHE A HE1  3  
ATOM   4606  H HE2  . PHE A 1 29  ? -4.512  -2.915  0.389   1.00 0.00 ? 29  PHE A HE2  3  
ATOM   4607  H HZ   . PHE A 1 29  ? -3.880  -5.285  0.191   1.00 0.00 ? 29  PHE A HZ   3  
ATOM   4608  N N    . TYR A 1 30  ? -1.217  -1.065  -6.032  1.00 0.00 ? 30  TYR A N    3  
ATOM   4609  C CA   . TYR A 1 30  ? -0.410  -0.611  -7.166  1.00 0.00 ? 30  TYR A CA   3  
ATOM   4610  C C    . TYR A 1 30  ? -0.632  0.872   -7.436  1.00 0.00 ? 30  TYR A C    3  
ATOM   4611  O O    . TYR A 1 30  ? 0.317   1.650   -7.482  1.00 0.00 ? 30  TYR A O    3  
ATOM   4612  C CB   . TYR A 1 30  ? -0.730  -1.428  -8.424  1.00 0.00 ? 30  TYR A CB   3  
ATOM   4613  C CG   . TYR A 1 30  ? -0.041  -2.769  -8.464  1.00 0.00 ? 30  TYR A CG   3  
ATOM   4614  C CD1  . TYR A 1 30  ? 0.536   -3.289  -7.323  1.00 0.00 ? 30  TYR A CD1  3  
ATOM   4615  C CD2  . TYR A 1 30  ? 0.046   -3.508  -9.636  1.00 0.00 ? 30  TYR A CD2  3  
ATOM   4616  C CE1  . TYR A 1 30  ? 1.182   -4.500  -7.333  1.00 0.00 ? 30  TYR A CE1  3  
ATOM   4617  C CE2  . TYR A 1 30  ? 0.689   -4.729  -9.656  1.00 0.00 ? 30  TYR A CE2  3  
ATOM   4618  C CZ   . TYR A 1 30  ? 1.257   -5.218  -8.499  1.00 0.00 ? 30  TYR A CZ   3  
ATOM   4619  O OH   . TYR A 1 30  ? 1.903   -6.429  -8.508  1.00 0.00 ? 30  TYR A OH   3  
ATOM   4620  H H    . TYR A 1 30  ? -1.805  -1.845  -6.140  1.00 0.00 ? 30  TYR A H    3  
ATOM   4621  H HA   . TYR A 1 30  ? 0.630   -0.761  -6.909  1.00 0.00 ? 30  TYR A HA   3  
ATOM   4622  H HB2  . TYR A 1 30  ? -1.793  -1.601  -8.469  1.00 0.00 ? 30  TYR A HB2  3  
ATOM   4623  H HB3  . TYR A 1 30  ? -0.424  -0.868  -9.294  1.00 0.00 ? 30  TYR A HB3  3  
ATOM   4624  H HD1  . TYR A 1 30  ? 0.467   -2.727  -6.411  1.00 0.00 ? 30  TYR A HD1  3  
ATOM   4625  H HD2  . TYR A 1 30  ? -0.399  -3.122  -10.540 1.00 0.00 ? 30  TYR A HD2  3  
ATOM   4626  H HE1  . TYR A 1 30  ? 1.623   -4.884  -6.426  1.00 0.00 ? 30  TYR A HE1  3  
ATOM   4627  H HE2  . TYR A 1 30  ? 0.747   -5.294  -10.573 1.00 0.00 ? 30  TYR A HE2  3  
ATOM   4628  H HH   . TYR A 1 30  ? 1.857   -6.823  -7.634  1.00 0.00 ? 30  TYR A HH   3  
ATOM   4629  N N    . LYS A 1 31  ? -1.888  1.251   -7.605  1.00 0.00 ? 31  LYS A N    3  
ATOM   4630  C CA   . LYS A 1 31  ? -2.246  2.633   -7.870  1.00 0.00 ? 31  LYS A CA   3  
ATOM   4631  C C    . LYS A 1 31  ? -3.433  3.034   -7.001  1.00 0.00 ? 31  LYS A C    3  
ATOM   4632  O O    . LYS A 1 31  ? -4.193  2.169   -6.562  1.00 0.00 ? 31  LYS A O    3  
ATOM   4633  C CB   . LYS A 1 31  ? -2.597  2.795   -9.346  1.00 0.00 ? 31  LYS A CB   3  
ATOM   4634  C CG   . LYS A 1 31  ? -1.399  2.645   -10.267 1.00 0.00 ? 31  LYS A CG   3  
ATOM   4635  C CD   . LYS A 1 31  ? -1.788  2.766   -11.731 1.00 0.00 ? 31  LYS A CD   3  
ATOM   4636  C CE   . LYS A 1 31  ? -2.865  1.762   -12.123 1.00 0.00 ? 31  LYS A CE   3  
ATOM   4637  N NZ   . LYS A 1 31  ? -2.439  0.360   -11.870 1.00 0.00 ? 31  LYS A NZ   3  
ATOM   4638  H H    . LYS A 1 31  ? -2.602  0.585   -7.540  1.00 0.00 ? 31  LYS A H    3  
ATOM   4639  H HA   . LYS A 1 31  ? -1.393  3.254   -7.634  1.00 0.00 ? 31  LYS A HA   3  
ATOM   4640  H HB2  . LYS A 1 31  ? -3.322  2.040   -9.608  1.00 0.00 ? 31  LYS A HB2  3  
ATOM   4641  H HB3  . LYS A 1 31  ? -3.029  3.772   -9.503  1.00 0.00 ? 31  LYS A HB3  3  
ATOM   4642  H HG2  . LYS A 1 31  ? -0.684  3.420   -10.033 1.00 0.00 ? 31  LYS A HG2  3  
ATOM   4643  H HG3  . LYS A 1 31  ? -0.950  1.680   -10.099 1.00 0.00 ? 31  LYS A HG3  3  
ATOM   4644  H HD2  . LYS A 1 31  ? -2.157  3.763   -11.909 1.00 0.00 ? 31  LYS A HD2  3  
ATOM   4645  H HD3  . LYS A 1 31  ? -0.912  2.594   -12.339 1.00 0.00 ? 31  LYS A HD3  3  
ATOM   4646  H HE2  . LYS A 1 31  ? -3.758  1.966   -11.551 1.00 0.00 ? 31  LYS A HE2  3  
ATOM   4647  H HE3  . LYS A 1 31  ? -3.080  1.878   -13.176 1.00 0.00 ? 31  LYS A HE3  3  
ATOM   4648  H HZ1  . LYS A 1 31  ? -1.554  0.158   -12.379 1.00 0.00 ? 31  LYS A HZ1  3  
ATOM   4649  H HZ2  . LYS A 1 31  ? -3.169  -0.300  -12.200 1.00 0.00 ? 31  LYS A HZ2  3  
ATOM   4650  H HZ3  . LYS A 1 31  ? -2.285  0.205   -10.854 1.00 0.00 ? 31  LYS A HZ3  3  
ATOM   4651  N N    . PRO A 1 32  ? -3.619  4.343   -6.750  1.00 0.00 ? 32  PRO A N    3  
ATOM   4652  C CA   . PRO A 1 32  ? -4.729  4.843   -5.932  1.00 0.00 ? 32  PRO A CA   3  
ATOM   4653  C C    . PRO A 1 32  ? -6.075  4.421   -6.506  1.00 0.00 ? 32  PRO A C    3  
ATOM   4654  O O    . PRO A 1 32  ? -6.280  4.450   -7.724  1.00 0.00 ? 32  PRO A O    3  
ATOM   4655  C CB   . PRO A 1 32  ? -4.572  6.370   -5.987  1.00 0.00 ? 32  PRO A CB   3  
ATOM   4656  C CG   . PRO A 1 32  ? -3.684  6.627   -7.155  1.00 0.00 ? 32  PRO A CG   3  
ATOM   4657  C CD   . PRO A 1 32  ? -2.776  5.439   -7.245  1.00 0.00 ? 32  PRO A CD   3  
ATOM   4658  H HA   . PRO A 1 32  ? -4.651  4.501   -4.909  1.00 0.00 ? 32  PRO A HA   3  
ATOM   4659  H HB2  . PRO A 1 32  ? -5.542  6.827   -6.122  1.00 0.00 ? 32  PRO A HB2  3  
ATOM   4660  H HB3  . PRO A 1 32  ? -4.127  6.723   -5.069  1.00 0.00 ? 32  PRO A HB3  3  
ATOM   4661  H HG2  . PRO A 1 32  ? -4.275  6.716   -8.053  1.00 0.00 ? 32  PRO A HG2  3  
ATOM   4662  H HG3  . PRO A 1 32  ? -3.109  7.526   -6.990  1.00 0.00 ? 32  PRO A HG3  3  
ATOM   4663  H HD2  . PRO A 1 32  ? -2.478  5.267   -8.269  1.00 0.00 ? 32  PRO A HD2  3  
ATOM   4664  H HD3  . PRO A 1 32  ? -1.911  5.574   -6.615  1.00 0.00 ? 32  PRO A HD3  3  
ATOM   4665  N N    . VAL A 1 33  ? -6.982  4.028   -5.620  1.00 0.00 ? 33  VAL A N    3  
ATOM   4666  C CA   . VAL A 1 33  ? -8.262  3.468   -6.026  1.00 0.00 ? 33  VAL A CA   3  
ATOM   4667  C C    . VAL A 1 33  ? -9.060  4.481   -6.842  1.00 0.00 ? 33  VAL A C    3  
ATOM   4668  O O    . VAL A 1 33  ? -8.957  5.695   -6.632  1.00 0.00 ? 33  VAL A O    3  
ATOM   4669  C CB   . VAL A 1 33  ? -9.094  2.982   -4.808  1.00 0.00 ? 33  VAL A CB   3  
ATOM   4670  C CG1  . VAL A 1 33  ? -8.187  2.547   -3.673  1.00 0.00 ? 33  VAL A CG1  3  
ATOM   4671  C CG2  . VAL A 1 33  ? -10.096 4.022   -4.334  1.00 0.00 ? 33  VAL A CG2  3  
ATOM   4672  H H    . VAL A 1 33  ? -6.782  4.121   -4.666  1.00 0.00 ? 33  VAL A H    3  
ATOM   4673  H HA   . VAL A 1 33  ? -8.055  2.611   -6.652  1.00 0.00 ? 33  VAL A HA   3  
ATOM   4674  H HB   . VAL A 1 33  ? -9.653  2.114   -5.121  1.00 0.00 ? 33  VAL A HB   3  
ATOM   4675  H HG11 . VAL A 1 33  ? -7.586  1.711   -3.992  1.00 0.00 ? 33  VAL A HG11 3  
ATOM   4676  H HG12 . VAL A 1 33  ? -8.789  2.252   -2.827  1.00 0.00 ? 33  VAL A HG12 3  
ATOM   4677  H HG13 . VAL A 1 33  ? -7.545  3.366   -3.388  1.00 0.00 ? 33  VAL A HG13 3  
ATOM   4678  H HG21 . VAL A 1 33  ? -11.027 3.888   -4.869  1.00 0.00 ? 33  VAL A HG21 3  
ATOM   4679  H HG22 . VAL A 1 33  ? -9.708  5.012   -4.529  1.00 0.00 ? 33  VAL A HG22 3  
ATOM   4680  H HG23 . VAL A 1 33  ? -10.268 3.903   -3.276  1.00 0.00 ? 33  VAL A HG23 3  
ATOM   4681  N N    . ASP A 1 34  ? -9.847  3.975   -7.772  1.00 0.00 ? 34  ASP A N    3  
ATOM   4682  C CA   . ASP A 1 34  ? -10.619 4.822   -8.667  1.00 0.00 ? 34  ASP A CA   3  
ATOM   4683  C C    . ASP A 1 34  ? -11.990 5.075   -8.078  1.00 0.00 ? 34  ASP A C    3  
ATOM   4684  O O    . ASP A 1 34  ? -12.984 4.543   -8.558  1.00 0.00 ? 34  ASP A O    3  
ATOM   4685  C CB   . ASP A 1 34  ? -10.747 4.181   -10.056 1.00 0.00 ? 34  ASP A CB   3  
ATOM   4686  C CG   . ASP A 1 34  ? -9.401  3.929   -10.702 1.00 0.00 ? 34  ASP A CG   3  
ATOM   4687  O OD1  . ASP A 1 34  ? -9.000  2.748   -10.826 1.00 0.00 ? 34  ASP A OD1  3  
ATOM   4688  O OD2  . ASP A 1 34  ? -8.726  4.910   -11.075 1.00 0.00 ? 34  ASP A OD2  3  
ATOM   4689  H H    . ASP A 1 34  ? -9.929  2.997   -7.845  1.00 0.00 ? 34  ASP A H    3  
ATOM   4690  H HA   . ASP A 1 34  ? -10.103 5.764   -8.762  1.00 0.00 ? 34  ASP A HA   3  
ATOM   4691  H HB2  . ASP A 1 34  ? -11.269 3.239   -9.968  1.00 0.00 ? 34  ASP A HB2  3  
ATOM   4692  H HB3  . ASP A 1 34  ? -11.315 4.841   -10.696 1.00 0.00 ? 34  ASP A HB3  3  
ATOM   4693  N N    . ALA A 1 35  ? -12.030 5.895   -7.034  1.00 0.00 ? 35  ALA A N    3  
ATOM   4694  C CA   . ALA A 1 35  ? -13.261 6.154   -6.291  1.00 0.00 ? 35  ALA A CA   3  
ATOM   4695  C C    . ALA A 1 35  ? -14.379 6.638   -7.212  1.00 0.00 ? 35  ALA A C    3  
ATOM   4696  O O    . ALA A 1 35  ? -15.556 6.356   -6.977  1.00 0.00 ? 35  ALA A O    3  
ATOM   4697  C CB   . ALA A 1 35  ? -12.998 7.163   -5.184  1.00 0.00 ? 35  ALA A CB   3  
ATOM   4698  H H    . ALA A 1 35  ? -11.204 6.348   -6.757  1.00 0.00 ? 35  ALA A H    3  
ATOM   4699  H HA   . ALA A 1 35  ? -13.567 5.226   -5.830  1.00 0.00 ? 35  ALA A HA   3  
ATOM   4700  H HB1  . ALA A 1 35  ? -12.731 6.640   -4.272  1.00 0.00 ? 35  ALA A HB1  3  
ATOM   4701  H HB2  . ALA A 1 35  ? -13.889 7.750   -5.014  1.00 0.00 ? 35  ALA A HB2  3  
ATOM   4702  H HB3  . ALA A 1 35  ? -12.187 7.814   -5.474  1.00 0.00 ? 35  ALA A HB3  3  
ATOM   4703  N N    . SER A 1 36  ? -14.009 7.345   -8.269  1.00 0.00 ? 36  SER A N    3  
ATOM   4704  C CA   . SER A 1 36  ? -14.964 7.791   -9.270  1.00 0.00 ? 36  SER A CA   3  
ATOM   4705  C C    . SER A 1 36  ? -15.679 6.589   -9.896  1.00 0.00 ? 36  SER A C    3  
ATOM   4706  O O    . SER A 1 36  ? -16.909 6.537   -9.950  1.00 0.00 ? 36  SER A O    3  
ATOM   4707  C CB   . SER A 1 36  ? -14.234 8.592   -10.346 1.00 0.00 ? 36  SER A CB   3  
ATOM   4708  O OG   . SER A 1 36  ? -13.370 9.553   -9.759  1.00 0.00 ? 36  SER A OG   3  
ATOM   4709  H H    . SER A 1 36  ? -13.063 7.581   -8.377  1.00 0.00 ? 36  SER A H    3  
ATOM   4710  H HA   . SER A 1 36  ? -15.692 8.424   -8.784  1.00 0.00 ? 36  SER A HA   3  
ATOM   4711  H HB2  . SER A 1 36  ? -13.647 7.922   -10.956 1.00 0.00 ? 36  SER A HB2  3  
ATOM   4712  H HB3  . SER A 1 36  ? -14.956 9.103   -10.964 1.00 0.00 ? 36  SER A HB3  3  
ATOM   4713  H HG   . SER A 1 36  ? -13.821 10.407  -9.724  1.00 0.00 ? 36  SER A HG   3  
ATOM   4714  N N    . ALA A 1 37  ? -14.896 5.608   -10.324 1.00 0.00 ? 37  ALA A N    3  
ATOM   4715  C CA   . ALA A 1 37  ? -15.423 4.415   -10.971 1.00 0.00 ? 37  ALA A CA   3  
ATOM   4716  C C    . ALA A 1 37  ? -15.992 3.442   -9.943  1.00 0.00 ? 37  ALA A C    3  
ATOM   4717  O O    . ALA A 1 37  ? -16.894 2.658   -10.239 1.00 0.00 ? 37  ALA A O    3  
ATOM   4718  C CB   . ALA A 1 37  ? -14.319 3.745   -11.774 1.00 0.00 ? 37  ALA A CB   3  
ATOM   4719  H H    . ALA A 1 37  ? -13.927 5.684   -10.191 1.00 0.00 ? 37  ALA A H    3  
ATOM   4720  H HA   . ALA A 1 37  ? -16.207 4.715   -11.653 1.00 0.00 ? 37  ALA A HA   3  
ATOM   4721  H HB1  . ALA A 1 37  ? -13.463 3.577   -11.133 1.00 0.00 ? 37  ALA A HB1  3  
ATOM   4722  H HB2  . ALA A 1 37  ? -14.034 4.384   -12.596 1.00 0.00 ? 37  ALA A HB2  3  
ATOM   4723  H HB3  . ALA A 1 37  ? -14.674 2.801   -12.158 1.00 0.00 ? 37  ALA A HB3  3  
ATOM   4724  N N    . LEU A 1 38  ? -15.468 3.520   -8.731  1.00 0.00 ? 38  LEU A N    3  
ATOM   4725  C CA   . LEU A 1 38  ? -15.830 2.601   -7.659  1.00 0.00 ? 38  LEU A CA   3  
ATOM   4726  C C    . LEU A 1 38  ? -17.103 3.042   -6.944  1.00 0.00 ? 38  LEU A C    3  
ATOM   4727  O O    . LEU A 1 38  ? -17.650 2.305   -6.124  1.00 0.00 ? 38  LEU A O    3  
ATOM   4728  C CB   . LEU A 1 38  ? -14.673 2.497   -6.664  1.00 0.00 ? 38  LEU A CB   3  
ATOM   4729  C CG   . LEU A 1 38  ? -13.427 1.784   -7.192  1.00 0.00 ? 38  LEU A CG   3  
ATOM   4730  C CD1  . LEU A 1 38  ? -12.234 2.066   -6.299  1.00 0.00 ? 38  LEU A CD1  3  
ATOM   4731  C CD2  . LEU A 1 38  ? -13.671 0.290   -7.294  1.00 0.00 ? 38  LEU A CD2  3  
ATOM   4732  H H    . LEU A 1 38  ? -14.800 4.221   -8.551  1.00 0.00 ? 38  LEU A H    3  
ATOM   4733  H HA   . LEU A 1 38  ? -15.997 1.630   -8.099  1.00 0.00 ? 38  LEU A HA   3  
ATOM   4734  H HB2  . LEU A 1 38  ? -14.391 3.498   -6.373  1.00 0.00 ? 38  LEU A HB2  3  
ATOM   4735  H HB3  . LEU A 1 38  ? -15.019 1.971   -5.787  1.00 0.00 ? 38  LEU A HB3  3  
ATOM   4736  H HG   . LEU A 1 38  ? -13.196 2.154   -8.180  1.00 0.00 ? 38  LEU A HG   3  
ATOM   4737  H HD11 . LEU A 1 38  ? -12.511 1.931   -5.264  1.00 0.00 ? 38  LEU A HD11 3  
ATOM   4738  H HD12 . LEU A 1 38  ? -11.905 3.082   -6.453  1.00 0.00 ? 38  LEU A HD12 3  
ATOM   4739  H HD13 . LEU A 1 38  ? -11.432 1.388   -6.547  1.00 0.00 ? 38  LEU A HD13 3  
ATOM   4740  H HD21 . LEU A 1 38  ? -13.873 -0.108  -6.310  1.00 0.00 ? 38  LEU A HD21 3  
ATOM   4741  H HD22 . LEU A 1 38  ? -12.796 -0.191  -7.705  1.00 0.00 ? 38  LEU A HD22 3  
ATOM   4742  H HD23 . LEU A 1 38  ? -14.518 0.105   -7.939  1.00 0.00 ? 38  LEU A HD23 3  
ATOM   4743  N N    . GLY A 1 39  ? -17.561 4.251   -7.249  1.00 0.00 ? 39  GLY A N    3  
ATOM   4744  C CA   . GLY A 1 39  ? -18.778 4.762   -6.643  1.00 0.00 ? 39  GLY A CA   3  
ATOM   4745  C C    . GLY A 1 39  ? -18.530 5.366   -5.278  1.00 0.00 ? 39  GLY A C    3  
ATOM   4746  O O    . GLY A 1 39  ? -19.463 5.668   -4.536  1.00 0.00 ? 39  GLY A O    3  
ATOM   4747  H H    . GLY A 1 39  ? -17.068 4.801   -7.891  1.00 0.00 ? 39  GLY A H    3  
ATOM   4748  H HA2  . GLY A 1 39  ? -19.199 5.517   -7.288  1.00 0.00 ? 39  GLY A HA2  3  
ATOM   4749  H HA3  . GLY A 1 39  ? -19.484 3.952   -6.542  1.00 0.00 ? 39  GLY A HA3  3  
ATOM   4750  N N    . LEU A 1 40  ? -17.265 5.535   -4.949  1.00 0.00 ? 40  LEU A N    3  
ATOM   4751  C CA   . LEU A 1 40  ? -16.864 6.068   -3.665  1.00 0.00 ? 40  LEU A CA   3  
ATOM   4752  C C    . LEU A 1 40  ? -16.726 7.586   -3.742  1.00 0.00 ? 40  LEU A C    3  
ATOM   4753  O O    . LEU A 1 40  ? -15.711 8.099   -4.195  1.00 0.00 ? 40  LEU A O    3  
ATOM   4754  C CB   . LEU A 1 40  ? -15.537 5.435   -3.253  1.00 0.00 ? 40  LEU A CB   3  
ATOM   4755  C CG   . LEU A 1 40  ? -15.425 3.928   -3.519  1.00 0.00 ? 40  LEU A CG   3  
ATOM   4756  C CD1  . LEU A 1 40  ? -14.151 3.372   -2.912  1.00 0.00 ? 40  LEU A CD1  3  
ATOM   4757  C CD2  . LEU A 1 40  ? -16.645 3.186   -2.997  1.00 0.00 ? 40  LEU A CD2  3  
ATOM   4758  H H    . LEU A 1 40  ? -16.572 5.282   -5.588  1.00 0.00 ? 40  LEU A H    3  
ATOM   4759  H HA   . LEU A 1 40  ? -17.620 5.813   -2.944  1.00 0.00 ? 40  LEU A HA   3  
ATOM   4760  H HB2  . LEU A 1 40  ? -14.743 5.934   -3.790  1.00 0.00 ? 40  LEU A HB2  3  
ATOM   4761  H HB3  . LEU A 1 40  ? -15.397 5.602   -2.199  1.00 0.00 ? 40  LEU A HB3  3  
ATOM   4762  H HG   . LEU A 1 40  ? -15.375 3.767   -4.587  1.00 0.00 ? 40  LEU A HG   3  
ATOM   4763  H HD11 . LEU A 1 40  ? -13.349 3.459   -3.622  1.00 0.00 ? 40  LEU A HD11 3  
ATOM   4764  H HD12 . LEU A 1 40  ? -14.295 2.337   -2.656  1.00 0.00 ? 40  LEU A HD12 3  
ATOM   4765  H HD13 . LEU A 1 40  ? -13.903 3.930   -2.020  1.00 0.00 ? 40  LEU A HD13 3  
ATOM   4766  H HD21 . LEU A 1 40  ? -16.786 3.420   -1.960  1.00 0.00 ? 40  LEU A HD21 3  
ATOM   4767  H HD22 . LEU A 1 40  ? -16.498 2.124   -3.111  1.00 0.00 ? 40  LEU A HD22 3  
ATOM   4768  H HD23 . LEU A 1 40  ? -17.517 3.490   -3.556  1.00 0.00 ? 40  LEU A HD23 3  
ATOM   4769  N N    . HIS A 1 41  ? -17.750 8.301   -3.300  1.00 0.00 ? 41  HIS A N    3  
ATOM   4770  C CA   . HIS A 1 41  ? -17.772 9.759   -3.425  1.00 0.00 ? 41  HIS A CA   3  
ATOM   4771  C C    . HIS A 1 41  ? -17.054 10.426  -2.256  1.00 0.00 ? 41  HIS A C    3  
ATOM   4772  O O    . HIS A 1 41  ? -16.864 11.643  -2.246  1.00 0.00 ? 41  HIS A O    3  
ATOM   4773  C CB   . HIS A 1 41  ? -19.213 10.283  -3.479  1.00 0.00 ? 41  HIS A CB   3  
ATOM   4774  C CG   . HIS A 1 41  ? -20.104 9.576   -4.465  1.00 0.00 ? 41  HIS A CG   3  
ATOM   4775  N ND1  . HIS A 1 41  ? -20.231 9.978   -5.776  1.00 0.00 ? 41  HIS A ND1  3  
ATOM   4776  C CD2  . HIS A 1 41  ? -20.931 8.500   -4.326  1.00 0.00 ? 41  HIS A CD2  3  
ATOM   4777  C CE1  . HIS A 1 41  ? -21.089 9.192   -6.397  1.00 0.00 ? 41  HIS A CE1  3  
ATOM   4778  N NE2  . HIS A 1 41  ? -21.526 8.289   -5.543  1.00 0.00 ? 41  HIS A NE2  3  
ATOM   4779  H H    . HIS A 1 41  ? -18.510 7.843   -2.881  1.00 0.00 ? 41  HIS A H    3  
ATOM   4780  H HA   . HIS A 1 41  ? -17.264 10.024  -4.342  1.00 0.00 ? 41  HIS A HA   3  
ATOM   4781  H HB2  . HIS A 1 41  ? -19.654 10.193  -2.501  1.00 0.00 ? 41  HIS A HB2  3  
ATOM   4782  H HB3  . HIS A 1 41  ? -19.187 11.329  -3.751  1.00 0.00 ? 41  HIS A HB3  3  
ATOM   4783  H HD1  . HIS A 1 41  ? -19.759 10.733  -6.194  1.00 0.00 ? 41  HIS A HD1  3  
ATOM   4784  H HD2  . HIS A 1 41  ? -21.090 7.910   -3.423  1.00 0.00 ? 41  HIS A HD2  3  
ATOM   4785  H HE1  . HIS A 1 41  ? -21.384 9.274   -7.431  1.00 0.00 ? 41  HIS A HE1  3  
ATOM   4786  H HE2  . HIS A 1 41  ? -22.299 7.700   -5.698  1.00 0.00 ? 41  HIS A HE2  3  
ATOM   4787  N N    . ASP A 1 42  ? -16.658 9.632   -1.275  1.00 0.00 ? 42  ASP A N    3  
ATOM   4788  C CA   . ASP A 1 42  ? -16.114 10.173  -0.035  1.00 0.00 ? 42  ASP A CA   3  
ATOM   4789  C C    . ASP A 1 42  ? -14.746 9.583   0.288   1.00 0.00 ? 42  ASP A C    3  
ATOM   4790  O O    . ASP A 1 42  ? -14.328 9.562   1.443   1.00 0.00 ? 42  ASP A O    3  
ATOM   4791  C CB   . ASP A 1 42  ? -17.080 9.903   1.120   1.00 0.00 ? 42  ASP A CB   3  
ATOM   4792  C CG   . ASP A 1 42  ? -18.336 10.747  1.041   1.00 0.00 ? 42  ASP A CG   3  
ATOM   4793  O OD1  . ASP A 1 42  ? -18.407 11.780  1.736   1.00 0.00 ? 42  ASP A OD1  3  
ATOM   4794  O OD2  . ASP A 1 42  ? -19.253 10.390  0.275   1.00 0.00 ? 42  ASP A OD2  3  
ATOM   4795  H H    . ASP A 1 42  ? -16.736 8.662   -1.382  1.00 0.00 ? 42  ASP A H    3  
ATOM   4796  H HA   . ASP A 1 42  ? -16.012 11.235  -0.158  1.00 0.00 ? 42  ASP A HA   3  
ATOM   4797  H HB2  . ASP A 1 42  ? -17.370 8.868   1.094   1.00 0.00 ? 42  ASP A HB2  3  
ATOM   4798  H HB3  . ASP A 1 42  ? -16.583 10.114  2.055   1.00 0.00 ? 42  ASP A HB3  3  
ATOM   4799  N N    . TYR A 1 43  ? -14.037 9.133   -0.735  1.00 0.00 ? 43  TYR A N    3  
ATOM   4800  C CA   . TYR A 1 43  ? -12.761 8.465   -0.535  1.00 0.00 ? 43  TYR A CA   3  
ATOM   4801  C C    . TYR A 1 43  ? -11.706 9.430   -0.009  1.00 0.00 ? 43  TYR A C    3  
ATOM   4802  O O    . TYR A 1 43  ? -10.967 9.110   0.922   1.00 0.00 ? 43  TYR A O    3  
ATOM   4803  C CB   . TYR A 1 43  ? -12.296 7.834   -1.851  1.00 0.00 ? 43  TYR A CB   3  
ATOM   4804  C CG   . TYR A 1 43  ? -10.950 7.146   -1.780  1.00 0.00 ? 43  TYR A CG   3  
ATOM   4805  C CD1  . TYR A 1 43  ? -10.846 5.855   -1.295  1.00 0.00 ? 43  TYR A CD1  3  
ATOM   4806  C CD2  . TYR A 1 43  ? -9.789  7.777   -2.214  1.00 0.00 ? 43  TYR A CD2  3  
ATOM   4807  C CE1  . TYR A 1 43  ? -9.633  5.206   -1.238  1.00 0.00 ? 43  TYR A CE1  3  
ATOM   4808  C CE2  . TYR A 1 43  ? -8.568  7.134   -2.159  1.00 0.00 ? 43  TYR A CE2  3  
ATOM   4809  C CZ   . TYR A 1 43  ? -8.495  5.847   -1.673  1.00 0.00 ? 43  TYR A CZ   3  
ATOM   4810  O OH   . TYR A 1 43  ? -7.283  5.199   -1.623  1.00 0.00 ? 43  TYR A OH   3  
ATOM   4811  H H    . TYR A 1 43  ? -14.369 9.265   -1.651  1.00 0.00 ? 43  TYR A H    3  
ATOM   4812  H HA   . TYR A 1 43  ? -12.913 7.688   0.199   1.00 0.00 ? 43  TYR A HA   3  
ATOM   4813  H HB2  . TYR A 1 43  ? -13.020 7.097   -2.157  1.00 0.00 ? 43  TYR A HB2  3  
ATOM   4814  H HB3  . TYR A 1 43  ? -12.235 8.600   -2.610  1.00 0.00 ? 43  TYR A HB3  3  
ATOM   4815  H HD1  . TYR A 1 43  ? -11.736 5.357   -0.960  1.00 0.00 ? 43  TYR A HD1  3  
ATOM   4816  H HD2  . TYR A 1 43  ? -9.850  8.787   -2.591  1.00 0.00 ? 43  TYR A HD2  3  
ATOM   4817  H HE1  . TYR A 1 43  ? -9.579  4.199   -0.858  1.00 0.00 ? 43  TYR A HE1  3  
ATOM   4818  H HE2  . TYR A 1 43  ? -7.680  7.636   -2.504  1.00 0.00 ? 43  TYR A HE2  3  
ATOM   4819  H HH   . TYR A 1 43  ? -6.665  5.714   -1.099  1.00 0.00 ? 43  TYR A HH   3  
ATOM   4820  N N    . HIS A 1 44  ? -11.659 10.621  -0.586  1.00 0.00 ? 44  HIS A N    3  
ATOM   4821  C CA   . HIS A 1 44  ? -10.628 11.593  -0.234  1.00 0.00 ? 44  HIS A CA   3  
ATOM   4822  C C    . HIS A 1 44  ? -10.965 12.320  1.064   1.00 0.00 ? 44  HIS A C    3  
ATOM   4823  O O    . HIS A 1 44  ? -10.195 13.154  1.536   1.00 0.00 ? 44  HIS A O    3  
ATOM   4824  C CB   . HIS A 1 44  ? -10.418 12.595  -1.370  1.00 0.00 ? 44  HIS A CB   3  
ATOM   4825  C CG   . HIS A 1 44  ? -9.750  12.000  -2.573  1.00 0.00 ? 44  HIS A CG   3  
ATOM   4826  N ND1  . HIS A 1 44  ? -8.398  12.114  -2.820  1.00 0.00 ? 44  HIS A ND1  3  
ATOM   4827  C CD2  . HIS A 1 44  ? -10.256 11.279  -3.602  1.00 0.00 ? 44  HIS A CD2  3  
ATOM   4828  C CE1  . HIS A 1 44  ? -8.105  11.491  -3.947  1.00 0.00 ? 44  HIS A CE1  3  
ATOM   4829  N NE2  . HIS A 1 44  ? -9.214  10.974  -4.439  1.00 0.00 ? 44  HIS A NE2  3  
ATOM   4830  H H    . HIS A 1 44  ? -12.337 10.857  -1.259  1.00 0.00 ? 44  HIS A H    3  
ATOM   4831  H HA   . HIS A 1 44  ? -9.710  11.046  -0.086  1.00 0.00 ? 44  HIS A HA   3  
ATOM   4832  H HB2  . HIS A 1 44  ? -11.376 12.981  -1.681  1.00 0.00 ? 44  HIS A HB2  3  
ATOM   4833  H HB3  . HIS A 1 44  ? -9.804  13.410  -1.016  1.00 0.00 ? 44  HIS A HB3  3  
ATOM   4834  H HD1  . HIS A 1 44  ? -7.746  12.583  -2.250  1.00 0.00 ? 44  HIS A HD1  3  
ATOM   4835  H HD2  . HIS A 1 44  ? -11.290 10.996  -3.737  1.00 0.00 ? 44  HIS A HD2  3  
ATOM   4836  H HE1  . HIS A 1 44  ? -7.125  11.418  -4.391  1.00 0.00 ? 44  HIS A HE1  3  
ATOM   4837  H HE2  . HIS A 1 44  ? -9.260  10.352  -5.200  1.00 0.00 ? 44  HIS A HE2  3  
ATOM   4838  N N    . ASP A 1 45  ? -12.113 11.996  1.640   1.00 0.00 ? 45  ASP A N    3  
ATOM   4839  C CA   . ASP A 1 45  ? -12.500 12.556  2.928   1.00 0.00 ? 45  ASP A CA   3  
ATOM   4840  C C    . ASP A 1 45  ? -12.091 11.626  4.058   1.00 0.00 ? 45  ASP A C    3  
ATOM   4841  O O    . ASP A 1 45  ? -11.582 12.071  5.085   1.00 0.00 ? 45  ASP A O    3  
ATOM   4842  C CB   . ASP A 1 45  ? -14.005 12.826  2.985   1.00 0.00 ? 45  ASP A CB   3  
ATOM   4843  C CG   . ASP A 1 45  ? -14.391 14.090  2.247   1.00 0.00 ? 45  ASP A CG   3  
ATOM   4844  O OD1  . ASP A 1 45  ? -14.225 15.188  2.822   1.00 0.00 ? 45  ASP A OD1  3  
ATOM   4845  O OD2  . ASP A 1 45  ? -14.866 13.996  1.092   1.00 0.00 ? 45  ASP A OD2  3  
ATOM   4846  H H    . ASP A 1 45  ? -12.713 11.366  1.189   1.00 0.00 ? 45  ASP A H    3  
ATOM   4847  H HA   . ASP A 1 45  ? -11.974 13.491  3.045   1.00 0.00 ? 45  ASP A HA   3  
ATOM   4848  H HB2  . ASP A 1 45  ? -14.531 11.995  2.539   1.00 0.00 ? 45  ASP A HB2  3  
ATOM   4849  H HB3  . ASP A 1 45  ? -14.307 12.926  4.017   1.00 0.00 ? 45  ASP A HB3  3  
ATOM   4850  N N    . ILE A 1 46  ? -12.309 10.332  3.864   1.00 0.00 ? 46  ILE A N    3  
ATOM   4851  C CA   . ILE A 1 46  ? -11.920 9.335   4.855   1.00 0.00 ? 46  ILE A CA   3  
ATOM   4852  C C    . ILE A 1 46  ? -10.411 9.125   4.820   1.00 0.00 ? 46  ILE A C    3  
ATOM   4853  O O    . ILE A 1 46  ? -9.752  9.079   5.861   1.00 0.00 ? 46  ILE A O    3  
ATOM   4854  C CB   . ILE A 1 46  ? -12.652 7.980   4.640   1.00 0.00 ? 46  ILE A CB   3  
ATOM   4855  C CG1  . ILE A 1 46  ? -14.096 8.043   5.137   1.00 0.00 ? 46  ILE A CG1  3  
ATOM   4856  C CG2  . ILE A 1 46  ? -11.933 6.835   5.342   1.00 0.00 ? 46  ILE A CG2  3  
ATOM   4857  C CD1  . ILE A 1 46  ? -15.003 8.958   4.343   1.00 0.00 ? 46  ILE A CD1  3  
ATOM   4858  H H    . ILE A 1 46  ? -12.743 10.039  3.034   1.00 0.00 ? 46  ILE A H    3  
ATOM   4859  H HA   . ILE A 1 46  ? -12.194 9.717   5.829   1.00 0.00 ? 46  ILE A HA   3  
ATOM   4860  H HB   . ILE A 1 46  ? -12.657 7.768   3.579   1.00 0.00 ? 46  ILE A HB   3  
ATOM   4861  H HG12 . ILE A 1 46  ? -14.512 7.050   5.092   1.00 0.00 ? 46  ILE A HG12 3  
ATOM   4862  H HG13 . ILE A 1 46  ? -14.099 8.381   6.164   1.00 0.00 ? 46  ILE A HG13 3  
ATOM   4863  H HG21 . ILE A 1 46  ? -11.236 6.373   4.663   1.00 0.00 ? 46  ILE A HG21 3  
ATOM   4864  H HG22 . ILE A 1 46  ? -12.655 6.102   5.669   1.00 0.00 ? 46  ILE A HG22 3  
ATOM   4865  H HG23 . ILE A 1 46  ? -11.398 7.219   6.199   1.00 0.00 ? 46  ILE A HG23 3  
ATOM   4866  H HD11 . ILE A 1 46  ? -15.048 8.621   3.317   1.00 0.00 ? 46  ILE A HD11 3  
ATOM   4867  H HD12 . ILE A 1 46  ? -14.613 9.965   4.372   1.00 0.00 ? 46  ILE A HD12 3  
ATOM   4868  H HD13 . ILE A 1 46  ? -15.993 8.944   4.770   1.00 0.00 ? 46  ILE A HD13 3  
ATOM   4869  N N    . ILE A 1 47  ? -9.869  9.020   3.621   1.00 0.00 ? 47  ILE A N    3  
ATOM   4870  C CA   . ILE A 1 47  ? -8.444  8.805   3.447   1.00 0.00 ? 47  ILE A CA   3  
ATOM   4871  C C    . ILE A 1 47  ? -7.715  10.140  3.310   1.00 0.00 ? 47  ILE A C    3  
ATOM   4872  O O    . ILE A 1 47  ? -7.763  10.777  2.257   1.00 0.00 ? 47  ILE A O    3  
ATOM   4873  C CB   . ILE A 1 47  ? -8.156  7.950   2.200   1.00 0.00 ? 47  ILE A CB   3  
ATOM   4874  C CG1  . ILE A 1 47  ? -9.001  6.672   2.200   1.00 0.00 ? 47  ILE A CG1  3  
ATOM   4875  C CG2  . ILE A 1 47  ? -6.675  7.616   2.136   1.00 0.00 ? 47  ILE A CG2  3  
ATOM   4876  C CD1  . ILE A 1 47  ? -8.560  5.640   3.206   1.00 0.00 ? 47  ILE A CD1  3  
ATOM   4877  H H    . ILE A 1 47  ? -10.442 9.088   2.825   1.00 0.00 ? 47  ILE A H    3  
ATOM   4878  H HA   . ILE A 1 47  ? -8.071  8.283   4.317   1.00 0.00 ? 47  ILE A HA   3  
ATOM   4879  H HB   . ILE A 1 47  ? -8.403  8.534   1.332   1.00 0.00 ? 47  ILE A HB   3  
ATOM   4880  H HG12 . ILE A 1 47  ? -10.023 6.928   2.428   1.00 0.00 ? 47  ILE A HG12 3  
ATOM   4881  H HG13 . ILE A 1 47  ? -8.957  6.221   1.218   1.00 0.00 ? 47  ILE A HG13 3  
ATOM   4882  H HG21 . ILE A 1 47  ? -6.514  6.823   1.425   1.00 0.00 ? 47  ILE A HG21 3  
ATOM   4883  H HG22 . ILE A 1 47  ? -6.336  7.302   3.110   1.00 0.00 ? 47  ILE A HG22 3  
ATOM   4884  H HG23 . ILE A 1 47  ? -6.122  8.492   1.829   1.00 0.00 ? 47  ILE A HG23 3  
ATOM   4885  H HD11 . ILE A 1 47  ? -8.644  6.046   4.201   1.00 0.00 ? 47  ILE A HD11 3  
ATOM   4886  H HD12 . ILE A 1 47  ? -7.537  5.369   3.009   1.00 0.00 ? 47  ILE A HD12 3  
ATOM   4887  H HD13 . ILE A 1 47  ? -9.181  4.767   3.118   1.00 0.00 ? 47  ILE A HD13 3  
ATOM   4888  N N    . LYS A 1 48  ? -7.052  10.567  4.376   1.00 0.00 ? 48  LYS A N    3  
ATOM   4889  C CA   . LYS A 1 48  ? -6.305  11.818  4.352   1.00 0.00 ? 48  LYS A CA   3  
ATOM   4890  C C    . LYS A 1 48  ? -4.880  11.602  3.852   1.00 0.00 ? 48  LYS A C    3  
ATOM   4891  O O    . LYS A 1 48  ? -4.251  12.521  3.323   1.00 0.00 ? 48  LYS A O    3  
ATOM   4892  C CB   . LYS A 1 48  ? -6.291  12.460  5.735   1.00 0.00 ? 48  LYS A CB   3  
ATOM   4893  C CG   . LYS A 1 48  ? -7.638  13.049  6.131   1.00 0.00 ? 48  LYS A CG   3  
ATOM   4894  C CD   . LYS A 1 48  ? -8.010  14.228  5.240   1.00 0.00 ? 48  LYS A CD   3  
ATOM   4895  C CE   . LYS A 1 48  ? -9.491  14.527  5.287   1.00 0.00 ? 48  LYS A CE   3  
ATOM   4896  N NZ   . LYS A 1 48  ? -9.981  14.805  6.662   1.00 0.00 ? 48  LYS A NZ   3  
ATOM   4897  H H    . LYS A 1 48  ? -7.072  10.035  5.200   1.00 0.00 ? 48  LYS A H    3  
ATOM   4898  H HA   . LYS A 1 48  ? -6.813  12.486  3.672   1.00 0.00 ? 48  LYS A HA   3  
ATOM   4899  H HB2  . LYS A 1 48  ? -6.014  11.714  6.464   1.00 0.00 ? 48  LYS A HB2  3  
ATOM   4900  H HB3  . LYS A 1 48  ? -5.557  13.247  5.743   1.00 0.00 ? 48  LYS A HB3  3  
ATOM   4901  H HG2  . LYS A 1 48  ? -8.395  12.285  6.036   1.00 0.00 ? 48  LYS A HG2  3  
ATOM   4902  H HG3  . LYS A 1 48  ? -7.587  13.384  7.156   1.00 0.00 ? 48  LYS A HG3  3  
ATOM   4903  H HD2  . LYS A 1 48  ? -7.468  15.102  5.565   1.00 0.00 ? 48  LYS A HD2  3  
ATOM   4904  H HD3  . LYS A 1 48  ? -7.743  13.995  4.224   1.00 0.00 ? 48  LYS A HD3  3  
ATOM   4905  H HE2  . LYS A 1 48  ? -9.688  15.388  4.665   1.00 0.00 ? 48  LYS A HE2  3  
ATOM   4906  H HE3  . LYS A 1 48  ? -10.013 13.673  4.887   1.00 0.00 ? 48  LYS A HE3  3  
ATOM   4907  H HZ1  . LYS A 1 48  ? -9.494  15.634  7.057   1.00 0.00 ? 48  LYS A HZ1  3  
ATOM   4908  H HZ2  . LYS A 1 48  ? -9.805  13.988  7.280   1.00 0.00 ? 48  LYS A HZ2  3  
ATOM   4909  H HZ3  . LYS A 1 48  ? -11.005 14.995  6.647   1.00 0.00 ? 48  LYS A HZ3  3  
ATOM   4910  N N    . HIS A 1 49  ? -4.372  10.388  4.026   1.00 0.00 ? 49  HIS A N    3  
ATOM   4911  C CA   . HIS A 1 49  ? -3.052  10.016  3.512   1.00 0.00 ? 49  HIS A CA   3  
ATOM   4912  C C    . HIS A 1 49  ? -3.160  8.890   2.471   1.00 0.00 ? 49  HIS A C    3  
ATOM   4913  O O    . HIS A 1 49  ? -2.746  7.757   2.736   1.00 0.00 ? 49  HIS A O    3  
ATOM   4914  C CB   . HIS A 1 49  ? -2.136  9.566   4.660   1.00 0.00 ? 49  HIS A CB   3  
ATOM   4915  C CG   . HIS A 1 49  ? -1.708  10.674  5.583   1.00 0.00 ? 49  HIS A CG   3  
ATOM   4916  N ND1  . HIS A 1 49  ? -1.234  10.444  6.859   1.00 0.00 ? 49  HIS A ND1  3  
ATOM   4917  C CD2  . HIS A 1 49  ? -1.667  12.018  5.411   1.00 0.00 ? 49  HIS A CD2  3  
ATOM   4918  C CE1  . HIS A 1 49  ? -0.923  11.595  7.426   1.00 0.00 ? 49  HIS A CE1  3  
ATOM   4919  N NE2  . HIS A 1 49  ? -1.176  12.564  6.570   1.00 0.00 ? 49  HIS A NE2  3  
ATOM   4920  H H    . HIS A 1 49  ? -4.892  9.722   4.524   1.00 0.00 ? 49  HIS A H    3  
ATOM   4921  H HA   . HIS A 1 49  ? -2.618  10.885  3.044   1.00 0.00 ? 49  HIS A HA   3  
ATOM   4922  H HB2  . HIS A 1 49  ? -2.659  8.832   5.253   1.00 0.00 ? 49  HIS A HB2  3  
ATOM   4923  H HB3  . HIS A 1 49  ? -1.246  9.112   4.243   1.00 0.00 ? 49  HIS A HB3  3  
ATOM   4924  H HD1  . HIS A 1 49  ? -1.141  9.566   7.290   1.00 0.00 ? 49  HIS A HD1  3  
ATOM   4925  H HD2  . HIS A 1 49  ? -1.972  12.563  4.526   1.00 0.00 ? 49  HIS A HD2  3  
ATOM   4926  H HE1  . HIS A 1 49  ? -0.528  11.720  8.422   1.00 0.00 ? 49  HIS A HE1  3  
ATOM   4927  H HE2  . HIS A 1 49  ? -1.172  13.521  6.789   1.00 0.00 ? 49  HIS A HE2  3  
ATOM   4928  N N    . PRO A 1 50  ? -3.739  9.166   1.282   1.00 0.00 ? 50  PRO A N    3  
ATOM   4929  C CA   . PRO A 1 50  ? -3.827  8.173   0.205   1.00 0.00 ? 50  PRO A CA   3  
ATOM   4930  C C    . PRO A 1 50  ? -2.485  7.933   -0.472  1.00 0.00 ? 50  PRO A C    3  
ATOM   4931  O O    . PRO A 1 50  ? -2.066  8.690   -1.352  1.00 0.00 ? 50  PRO A O    3  
ATOM   4932  C CB   . PRO A 1 50  ? -4.809  8.804   -0.783  1.00 0.00 ? 50  PRO A CB   3  
ATOM   4933  C CG   . PRO A 1 50  ? -4.649  10.267  -0.574  1.00 0.00 ? 50  PRO A CG   3  
ATOM   4934  C CD   . PRO A 1 50  ? -4.383  10.437  0.897   1.00 0.00 ? 50  PRO A CD   3  
ATOM   4935  H HA   . PRO A 1 50  ? -4.223  7.233   0.562   1.00 0.00 ? 50  PRO A HA   3  
ATOM   4936  H HB2  . PRO A 1 50  ? -4.548  8.515   -1.791  1.00 0.00 ? 50  PRO A HB2  3  
ATOM   4937  H HB3  . PRO A 1 50  ? -5.813  8.480   -0.557  1.00 0.00 ? 50  PRO A HB3  3  
ATOM   4938  H HG2  . PRO A 1 50  ? -3.813  10.635  -1.155  1.00 0.00 ? 50  PRO A HG2  3  
ATOM   4939  H HG3  . PRO A 1 50  ? -5.558  10.777  -0.855  1.00 0.00 ? 50  PRO A HG3  3  
ATOM   4940  H HD2  . PRO A 1 50  ? -3.723  11.274  1.074   1.00 0.00 ? 50  PRO A HD2  3  
ATOM   4941  H HD3  . PRO A 1 50  ? -5.313  10.568  1.430   1.00 0.00 ? 50  PRO A HD3  3  
ATOM   4942  N N    . MET A 1 51  ? -1.821  6.868   -0.075  1.00 0.00 ? 51  MET A N    3  
ATOM   4943  C CA   . MET A 1 51  ? -0.545  6.518   -0.662  1.00 0.00 ? 51  MET A CA   3  
ATOM   4944  C C    . MET A 1 51  ? -0.625  5.140   -1.299  1.00 0.00 ? 51  MET A C    3  
ATOM   4945  O O    . MET A 1 51  ? -1.384  4.283   -0.849  1.00 0.00 ? 51  MET A O    3  
ATOM   4946  C CB   . MET A 1 51  ? 0.569   6.581   0.397   1.00 0.00 ? 51  MET A CB   3  
ATOM   4947  C CG   . MET A 1 51  ? 1.928   6.084   -0.094  1.00 0.00 ? 51  MET A CG   3  
ATOM   4948  S SD   . MET A 1 51  ? 2.421   6.840   -1.660  1.00 0.00 ? 51  MET A SD   3  
ATOM   4949  C CE   . MET A 1 51  ? 2.344   8.576   -1.247  1.00 0.00 ? 51  MET A CE   3  
ATOM   4950  H H    . MET A 1 51  ? -2.197  6.301   0.631   1.00 0.00 ? 51  MET A H    3  
ATOM   4951  H HA   . MET A 1 51  ? -0.338  7.244   -1.440  1.00 0.00 ? 51  MET A HA   3  
ATOM   4952  H HB2  . MET A 1 51  ? 0.685   7.608   0.706   1.00 0.00 ? 51  MET A HB2  3  
ATOM   4953  H HB3  . MET A 1 51  ? 0.273   5.989   1.255   1.00 0.00 ? 51  MET A HB3  3  
ATOM   4954  H HG2  . MET A 1 51  ? 2.678   6.314   0.654   1.00 0.00 ? 51  MET A HG2  3  
ATOM   4955  H HG3  . MET A 1 51  ? 1.879   5.010   -0.233  1.00 0.00 ? 51  MET A HG3  3  
ATOM   4956  H HE1  . MET A 1 51  ? 2.926   8.748   -0.362  1.00 0.00 ? 51  MET A HE1  3  
ATOM   4957  H HE2  . MET A 1 51  ? 1.318   8.861   -1.067  1.00 0.00 ? 51  MET A HE2  3  
ATOM   4958  H HE3  . MET A 1 51  ? 2.744   9.160   -2.061  1.00 0.00 ? 51  MET A HE3  3  
ATOM   4959  N N    . ASP A 1 52  ? 0.148   4.953   -2.351  1.00 0.00 ? 52  ASP A N    3  
ATOM   4960  C CA   . ASP A 1 52  ? 0.155   3.712   -3.106  1.00 0.00 ? 52  ASP A CA   3  
ATOM   4961  C C    . ASP A 1 52  ? 1.586   3.335   -3.458  1.00 0.00 ? 52  ASP A C    3  
ATOM   4962  O O    . ASP A 1 52  ? 2.467   4.194   -3.454  1.00 0.00 ? 52  ASP A O    3  
ATOM   4963  C CB   . ASP A 1 52  ? -0.678  3.859   -4.380  1.00 0.00 ? 52  ASP A CB   3  
ATOM   4964  C CG   . ASP A 1 52  ? -0.151  4.962   -5.271  1.00 0.00 ? 52  ASP A CG   3  
ATOM   4965  O OD1  . ASP A 1 52  ? 0.635   4.667   -6.190  1.00 0.00 ? 52  ASP A OD1  3  
ATOM   4966  O OD2  . ASP A 1 52  ? -0.510  6.137   -5.046  1.00 0.00 ? 52  ASP A OD2  3  
ATOM   4967  H H    . ASP A 1 52  ? 0.755   5.677   -2.627  1.00 0.00 ? 52  ASP A H    3  
ATOM   4968  H HA   . ASP A 1 52  ? -0.269  2.937   -2.484  1.00 0.00 ? 52  ASP A HA   3  
ATOM   4969  H HB2  . ASP A 1 52  ? -0.654  2.930   -4.931  1.00 0.00 ? 52  ASP A HB2  3  
ATOM   4970  H HB3  . ASP A 1 52  ? -1.701  4.092   -4.116  1.00 0.00 ? 52  ASP A HB3  3  
ATOM   4971  N N    . LEU A 1 53  ? 1.822   2.075   -3.776  1.00 0.00 ? 53  LEU A N    3  
ATOM   4972  C CA   . LEU A 1 53  ? 3.183   1.588   -3.983  1.00 0.00 ? 53  LEU A CA   3  
ATOM   4973  C C    . LEU A 1 53  ? 3.877   2.280   -5.154  1.00 0.00 ? 53  LEU A C    3  
ATOM   4974  O O    . LEU A 1 53  ? 5.070   2.587   -5.075  1.00 0.00 ? 53  LEU A O    3  
ATOM   4975  C CB   . LEU A 1 53  ? 3.184   0.073   -4.164  1.00 0.00 ? 53  LEU A CB   3  
ATOM   4976  C CG   . LEU A 1 53  ? 3.025   -0.713  -2.866  1.00 0.00 ? 53  LEU A CG   3  
ATOM   4977  C CD1  . LEU A 1 53  ? 2.731   -2.160  -3.168  1.00 0.00 ? 53  LEU A CD1  3  
ATOM   4978  C CD2  . LEU A 1 53  ? 4.267   -0.604  -2.006  1.00 0.00 ? 53  LEU A CD2  3  
ATOM   4979  H H    . LEU A 1 53  ? 1.064   1.455   -3.885  1.00 0.00 ? 53  LEU A H    3  
ATOM   4980  H HA   . LEU A 1 53  ? 3.740   1.818   -3.091  1.00 0.00 ? 53  LEU A HA   3  
ATOM   4981  H HB2  . LEU A 1 53  ? 2.372   -0.195  -4.826  1.00 0.00 ? 53  LEU A HB2  3  
ATOM   4982  H HB3  . LEU A 1 53  ? 4.111   -0.217  -4.626  1.00 0.00 ? 53  LEU A HB3  3  
ATOM   4983  H HG   . LEU A 1 53  ? 2.200   -0.301  -2.309  1.00 0.00 ? 53  LEU A HG   3  
ATOM   4984  H HD11 . LEU A 1 53  ? 1.936   -2.205  -3.882  1.00 0.00 ? 53  LEU A HD11 3  
ATOM   4985  H HD12 . LEU A 1 53  ? 2.435   -2.668  -2.261  1.00 0.00 ? 53  LEU A HD12 3  
ATOM   4986  H HD13 . LEU A 1 53  ? 3.611   -2.633  -3.577  1.00 0.00 ? 53  LEU A HD13 3  
ATOM   4987  H HD21 . LEU A 1 53  ? 4.387   0.415   -1.690  1.00 0.00 ? 53  LEU A HD21 3  
ATOM   4988  H HD22 . LEU A 1 53  ? 5.131   -0.910  -2.577  1.00 0.00 ? 53  LEU A HD22 3  
ATOM   4989  H HD23 . LEU A 1 53  ? 4.162   -1.240  -1.139  1.00 0.00 ? 53  LEU A HD23 3  
ATOM   4990  N N    . SER A 1 54  ? 3.137   2.558   -6.220  1.00 0.00 ? 54  SER A N    3  
ATOM   4991  C CA   . SER A 1 54  ? 3.730   3.197   -7.389  1.00 0.00 ? 54  SER A CA   3  
ATOM   4992  C C    . SER A 1 54  ? 4.240   4.600   -7.027  1.00 0.00 ? 54  SER A C    3  
ATOM   4993  O O    . SER A 1 54  ? 5.313   5.009   -7.471  1.00 0.00 ? 54  SER A O    3  
ATOM   4994  C CB   . SER A 1 54  ? 2.725   3.266   -8.551  1.00 0.00 ? 54  SER A CB   3  
ATOM   4995  O OG   . SER A 1 54  ? 1.820   4.347   -8.411  1.00 0.00 ? 54  SER A OG   3  
ATOM   4996  H H    . SER A 1 54  ? 2.181   2.329   -6.219  1.00 0.00 ? 54  SER A H    3  
ATOM   4997  H HA   . SER A 1 54  ? 4.579   2.593   -7.699  1.00 0.00 ? 54  SER A HA   3  
ATOM   4998  H HB2  . SER A 1 54  ? 3.263   3.387   -9.476  1.00 0.00 ? 54  SER A HB2  3  
ATOM   4999  H HB3  . SER A 1 54  ? 2.154   2.348   -8.588  1.00 0.00 ? 54  SER A HB3  3  
ATOM   5000  H HG   . SER A 1 54  ? 1.352   4.270   -7.558  1.00 0.00 ? 54  SER A HG   3  
ATOM   5001  N N    . THR A 1 55  ? 3.480   5.322   -6.200  1.00 0.00 ? 55  THR A N    3  
ATOM   5002  C CA   . THR A 1 55  ? 3.879   6.654   -5.756  1.00 0.00 ? 55  THR A CA   3  
ATOM   5003  C C    . THR A 1 55  ? 5.009   6.573   -4.737  1.00 0.00 ? 55  THR A C    3  
ATOM   5004  O O    . THR A 1 55  ? 5.891   7.435   -4.710  1.00 0.00 ? 55  THR A O    3  
ATOM   5005  C CB   . THR A 1 55  ? 2.709   7.438   -5.142  1.00 0.00 ? 55  THR A CB   3  
ATOM   5006  O OG1  . THR A 1 55  ? 1.578   7.393   -6.020  1.00 0.00 ? 55  THR A OG1  3  
ATOM   5007  C CG2  . THR A 1 55  ? 3.108   8.881   -4.929  1.00 0.00 ? 55  THR A CG2  3  
ATOM   5008  H H    . THR A 1 55  ? 2.625   4.953   -5.889  1.00 0.00 ? 55  THR A H    3  
ATOM   5009  H HA   . THR A 1 55  ? 4.232   7.204   -6.615  1.00 0.00 ? 55  THR A HA   3  
ATOM   5010  H HB   . THR A 1 55  ? 2.454   7.004   -4.183  1.00 0.00 ? 55  THR A HB   3  
ATOM   5011  H HG1  . THR A 1 55  ? 0.909   6.789   -5.653  1.00 0.00 ? 55  THR A HG1  3  
ATOM   5012  H HG21 . THR A 1 55  ? 4.096   8.908   -4.504  1.00 0.00 ? 55  THR A HG21 3  
ATOM   5013  H HG22 . THR A 1 55  ? 2.410   9.355   -4.254  1.00 0.00 ? 55  THR A HG22 3  
ATOM   5014  H HG23 . THR A 1 55  ? 3.107   9.401   -5.875  1.00 0.00 ? 55  THR A HG23 3  
ATOM   5015  N N    . VAL A 1 56  ? 4.990   5.540   -3.901  1.00 0.00 ? 56  VAL A N    3  
ATOM   5016  C CA   . VAL A 1 56  ? 6.075   5.323   -2.957  1.00 0.00 ? 56  VAL A CA   3  
ATOM   5017  C C    . VAL A 1 56  ? 7.378   5.201   -3.724  1.00 0.00 ? 56  VAL A C    3  
ATOM   5018  O O    . VAL A 1 56  ? 8.381   5.833   -3.386  1.00 0.00 ? 56  VAL A O    3  
ATOM   5019  C CB   . VAL A 1 56  ? 5.865   4.054   -2.106  1.00 0.00 ? 56  VAL A CB   3  
ATOM   5020  C CG1  . VAL A 1 56  ? 7.077   3.795   -1.219  1.00 0.00 ? 56  VAL A CG1  3  
ATOM   5021  C CG2  . VAL A 1 56  ? 4.612   4.185   -1.259  1.00 0.00 ? 56  VAL A CG2  3  
ATOM   5022  H H    . VAL A 1 56  ? 4.231   4.911   -3.923  1.00 0.00 ? 56  VAL A H    3  
ATOM   5023  H HA   . VAL A 1 56  ? 6.129   6.178   -2.301  1.00 0.00 ? 56  VAL A HA   3  
ATOM   5024  H HB   . VAL A 1 56  ? 5.742   3.213   -2.772  1.00 0.00 ? 56  VAL A HB   3  
ATOM   5025  H HG11 . VAL A 1 56  ? 7.963   3.690   -1.838  1.00 0.00 ? 56  VAL A HG11 3  
ATOM   5026  H HG12 . VAL A 1 56  ? 6.922   2.889   -0.654  1.00 0.00 ? 56  VAL A HG12 3  
ATOM   5027  H HG13 . VAL A 1 56  ? 7.209   4.625   -0.540  1.00 0.00 ? 56  VAL A HG13 3  
ATOM   5028  H HG21 . VAL A 1 56  ? 3.789   4.508   -1.882  1.00 0.00 ? 56  VAL A HG21 3  
ATOM   5029  H HG22 . VAL A 1 56  ? 4.779   4.912   -0.480  1.00 0.00 ? 56  VAL A HG22 3  
ATOM   5030  H HG23 . VAL A 1 56  ? 4.375   3.229   -0.816  1.00 0.00 ? 56  VAL A HG23 3  
ATOM   5031  N N    . LYS A 1 57  ? 7.326   4.413   -4.785  1.00 0.00 ? 57  LYS A N    3  
ATOM   5032  C CA   . LYS A 1 57  ? 8.467   4.201   -5.643  1.00 0.00 ? 57  LYS A CA   3  
ATOM   5033  C C    . LYS A 1 57  ? 8.814   5.473   -6.390  1.00 0.00 ? 57  LYS A C    3  
ATOM   5034  O O    . LYS A 1 57  ? 9.980   5.799   -6.558  1.00 0.00 ? 57  LYS A O    3  
ATOM   5035  C CB   . LYS A 1 57  ? 8.159   3.091   -6.626  1.00 0.00 ? 57  LYS A CB   3  
ATOM   5036  C CG   . LYS A 1 57  ? 9.288   2.096   -6.765  1.00 0.00 ? 57  LYS A CG   3  
ATOM   5037  C CD   . LYS A 1 57  ? 8.838   0.859   -7.503  1.00 0.00 ? 57  LYS A CD   3  
ATOM   5038  C CE   . LYS A 1 57  ? 9.986   -0.110  -7.704  1.00 0.00 ? 57  LYS A CE   3  
ATOM   5039  N NZ   . LYS A 1 57  ? 11.176  0.544   -8.319  1.00 0.00 ? 57  LYS A NZ   3  
ATOM   5040  H H    . LYS A 1 57  ? 6.485   3.950   -4.993  1.00 0.00 ? 57  LYS A H    3  
ATOM   5041  H HA   . LYS A 1 57  ? 9.300   3.908   -5.027  1.00 0.00 ? 57  LYS A HA   3  
ATOM   5042  H HB2  . LYS A 1 57  ? 7.273   2.571   -6.298  1.00 0.00 ? 57  LYS A HB2  3  
ATOM   5043  H HB3  . LYS A 1 57  ? 7.970   3.528   -7.595  1.00 0.00 ? 57  LYS A HB3  3  
ATOM   5044  H HG2  . LYS A 1 57  ? 10.093  2.554   -7.300  1.00 0.00 ? 57  LYS A HG2  3  
ATOM   5045  H HG3  . LYS A 1 57  ? 9.635   1.814   -5.792  1.00 0.00 ? 57  LYS A HG3  3  
ATOM   5046  H HD2  . LYS A 1 57  ? 8.077   0.371   -6.919  1.00 0.00 ? 57  LYS A HD2  3  
ATOM   5047  H HD3  . LYS A 1 57  ? 8.424   1.143   -8.456  1.00 0.00 ? 57  LYS A HD3  3  
ATOM   5048  H HE2  . LYS A 1 57  ? 10.259  -0.513  -6.740  1.00 0.00 ? 57  LYS A HE2  3  
ATOM   5049  H HE3  . LYS A 1 57  ? 9.653   -0.914  -8.344  1.00 0.00 ? 57  LYS A HE3  3  
ATOM   5050  H HZ1  . LYS A 1 57  ? 10.922  0.959   -9.238  1.00 0.00 ? 57  LYS A HZ1  3  
ATOM   5051  H HZ2  . LYS A 1 57  ? 11.935  -0.153  -8.466  1.00 0.00 ? 57  LYS A HZ2  3  
ATOM   5052  H HZ3  . LYS A 1 57  ? 11.535  1.298   -7.699  1.00 0.00 ? 57  LYS A HZ3  3  
ATOM   5053  N N    . ARG A 1 58  ? 7.787   6.181   -6.837  1.00 0.00 ? 58  ARG A N    3  
ATOM   5054  C CA   . ARG A 1 58  ? 7.965   7.463   -7.506  1.00 0.00 ? 58  ARG A CA   3  
ATOM   5055  C C    . ARG A 1 58  ? 8.787   8.417   -6.644  1.00 0.00 ? 58  ARG A C    3  
ATOM   5056  O O    . ARG A 1 58  ? 9.784   8.985   -7.091  1.00 0.00 ? 58  ARG A O    3  
ATOM   5057  C CB   . ARG A 1 58  ? 6.602   8.083   -7.798  1.00 0.00 ? 58  ARG A CB   3  
ATOM   5058  C CG   . ARG A 1 58  ? 6.680   9.407   -8.541  1.00 0.00 ? 58  ARG A CG   3  
ATOM   5059  C CD   . ARG A 1 58  ? 5.311   10.036  -8.711  1.00 0.00 ? 58  ARG A CD   3  
ATOM   5060  N NE   . ARG A 1 58  ? 5.383   11.310  -9.426  1.00 0.00 ? 58  ARG A NE   3  
ATOM   5061  C CZ   . ARG A 1 58  ? 4.321   12.011  -9.817  1.00 0.00 ? 58  ARG A CZ   3  
ATOM   5062  N NH1  . ARG A 1 58  ? 3.093   11.587  -9.533  1.00 0.00 ? 58  ARG A NH1  3  
ATOM   5063  N NH2  . ARG A 1 58  ? 4.490   13.146  -10.486 1.00 0.00 ? 58  ARG A NH2  3  
ATOM   5064  H H    . ARG A 1 58  ? 6.875   5.819   -6.730  1.00 0.00 ? 58  ARG A H    3  
ATOM   5065  H HA   . ARG A 1 58  ? 8.484   7.290   -8.436  1.00 0.00 ? 58  ARG A HA   3  
ATOM   5066  H HB2  . ARG A 1 58  ? 6.028   7.387   -8.389  1.00 0.00 ? 58  ARG A HB2  3  
ATOM   5067  H HB3  . ARG A 1 58  ? 6.091   8.251   -6.862  1.00 0.00 ? 58  ARG A HB3  3  
ATOM   5068  H HG2  . ARG A 1 58  ? 7.300   10.083  -7.980  1.00 0.00 ? 58  ARG A HG2  3  
ATOM   5069  H HG3  . ARG A 1 58  ? 7.115   9.242   -9.512  1.00 0.00 ? 58  ARG A HG3  3  
ATOM   5070  H HD2  . ARG A 1 58  ? 4.680   9.356   -9.265  1.00 0.00 ? 58  ARG A HD2  3  
ATOM   5071  H HD3  . ARG A 1 58  ? 4.888   10.207  -7.733  1.00 0.00 ? 58  ARG A HD3  3  
ATOM   5072  H HE   . ARG A 1 58  ? 6.283   11.660  -9.630  1.00 0.00 ? 58  ARG A HE   3  
ATOM   5073  H HH11 . ARG A 1 58  ? 2.961   10.732  -9.021  1.00 0.00 ? 58  ARG A HH11 3  
ATOM   5074  H HH12 . ARG A 1 58  ? 2.293   12.120  -9.819  1.00 0.00 ? 58  ARG A HH12 3  
ATOM   5075  H HH21 . ARG A 1 58  ? 5.418   13.474  -10.692 1.00 0.00 ? 58  ARG A HH21 3  
ATOM   5076  H HH22 . ARG A 1 58  ? 3.696   13.675  -10.795 1.00 0.00 ? 58  ARG A HH22 3  
ATOM   5077  N N    . LYS A 1 59  ? 8.370   8.567   -5.396  1.00 0.00 ? 59  LYS A N    3  
ATOM   5078  C CA   . LYS A 1 59  ? 9.046   9.455   -4.464  1.00 0.00 ? 59  LYS A CA   3  
ATOM   5079  C C    . LYS A 1 59  ? 10.420  8.896   -4.085  1.00 0.00 ? 59  LYS A C    3  
ATOM   5080  O O    . LYS A 1 59  ? 11.348  9.650   -3.780  1.00 0.00 ? 59  LYS A O    3  
ATOM   5081  C CB   . LYS A 1 59  ? 8.175   9.676   -3.228  1.00 0.00 ? 59  LYS A CB   3  
ATOM   5082  C CG   . LYS A 1 59  ? 6.863   10.388  -3.530  1.00 0.00 ? 59  LYS A CG   3  
ATOM   5083  C CD   . LYS A 1 59  ? 5.850   10.266  -2.389  1.00 0.00 ? 59  LYS A CD   3  
ATOM   5084  C CE   . LYS A 1 59  ? 6.415   10.715  -1.045  1.00 0.00 ? 59  LYS A CE   3  
ATOM   5085  N NZ   . LYS A 1 59  ? 6.715   9.561   -0.153  1.00 0.00 ? 59  LYS A NZ   3  
ATOM   5086  H H    . LYS A 1 59  ? 7.580   8.063   -5.095  1.00 0.00 ? 59  LYS A H    3  
ATOM   5087  H HA   . LYS A 1 59  ? 9.189   10.400  -4.960  1.00 0.00 ? 59  LYS A HA   3  
ATOM   5088  H HB2  . LYS A 1 59  ? 7.949   8.720   -2.780  1.00 0.00 ? 59  LYS A HB2  3  
ATOM   5089  H HB3  . LYS A 1 59  ? 8.727   10.277  -2.522  1.00 0.00 ? 59  LYS A HB3  3  
ATOM   5090  H HG2  . LYS A 1 59  ? 7.069   11.435  -3.706  1.00 0.00 ? 59  LYS A HG2  3  
ATOM   5091  H HG3  . LYS A 1 59  ? 6.436   9.954   -4.423  1.00 0.00 ? 59  LYS A HG3  3  
ATOM   5092  H HD2  . LYS A 1 59  ? 4.990   10.878  -2.624  1.00 0.00 ? 59  LYS A HD2  3  
ATOM   5093  H HD3  . LYS A 1 59  ? 5.541   9.232   -2.312  1.00 0.00 ? 59  LYS A HD3  3  
ATOM   5094  H HE2  . LYS A 1 59  ? 7.326   11.274  -1.217  1.00 0.00 ? 59  LYS A HE2  3  
ATOM   5095  H HE3  . LYS A 1 59  ? 5.690   11.351  -0.558  1.00 0.00 ? 59  LYS A HE3  3  
ATOM   5096  H HZ1  . LYS A 1 59  ? 7.214   9.888   0.699   1.00 0.00 ? 59  LYS A HZ1  3  
ATOM   5097  H HZ2  . LYS A 1 59  ? 7.308   8.864   -0.642  1.00 0.00 ? 59  LYS A HZ2  3  
ATOM   5098  H HZ3  . LYS A 1 59  ? 5.829   9.089   0.144   1.00 0.00 ? 59  LYS A HZ3  3  
ATOM   5099  N N    . MET A 1 60  ? 10.546  7.572   -4.108  1.00 0.00 ? 60  MET A N    3  
ATOM   5100  C CA   . MET A 1 60  ? 11.842  6.923   -3.925  1.00 0.00 ? 60  MET A CA   3  
ATOM   5101  C C    . MET A 1 60  ? 12.753  7.234   -5.110  1.00 0.00 ? 60  MET A C    3  
ATOM   5102  O O    . MET A 1 60  ? 13.946  7.479   -4.940  1.00 0.00 ? 60  MET A O    3  
ATOM   5103  C CB   . MET A 1 60  ? 11.686  5.404   -3.789  1.00 0.00 ? 60  MET A CB   3  
ATOM   5104  C CG   . MET A 1 60  ? 13.001  4.670   -3.579  1.00 0.00 ? 60  MET A CG   3  
ATOM   5105  S SD   . MET A 1 60  ? 12.896  2.931   -4.035  1.00 0.00 ? 60  MET A SD   3  
ATOM   5106  C CE   . MET A 1 60  ? 11.483  2.429   -3.061  1.00 0.00 ? 60  MET A CE   3  
ATOM   5107  H H    . MET A 1 60  ? 9.746   7.016   -4.238  1.00 0.00 ? 60  MET A H    3  
ATOM   5108  H HA   . MET A 1 60  ? 12.290  7.317   -3.023  1.00 0.00 ? 60  MET A HA   3  
ATOM   5109  H HB2  . MET A 1 60  ? 11.047  5.189   -2.944  1.00 0.00 ? 60  MET A HB2  3  
ATOM   5110  H HB3  . MET A 1 60  ? 11.226  5.019   -4.686  1.00 0.00 ? 60  MET A HB3  3  
ATOM   5111  H HG2  . MET A 1 60  ? 13.762  5.142   -4.179  1.00 0.00 ? 60  MET A HG2  3  
ATOM   5112  H HG3  . MET A 1 60  ? 13.273  4.739   -2.536  1.00 0.00 ? 60  MET A HG3  3  
ATOM   5113  H HE1  . MET A 1 60  ? 11.663  2.662   -2.023  1.00 0.00 ? 60  MET A HE1  3  
ATOM   5114  H HE2  . MET A 1 60  ? 11.329  1.366   -3.170  1.00 0.00 ? 60  MET A HE2  3  
ATOM   5115  H HE3  . MET A 1 60  ? 10.605  2.957   -3.400  1.00 0.00 ? 60  MET A HE3  3  
ATOM   5116  N N    . GLU A 1 61  ? 12.177  7.236   -6.310  1.00 0.00 ? 61  GLU A N    3  
ATOM   5117  C CA   . GLU A 1 61  ? 12.916  7.556   -7.527  1.00 0.00 ? 61  GLU A CA   3  
ATOM   5118  C C    . GLU A 1 61  ? 13.364  9.007   -7.523  1.00 0.00 ? 61  GLU A C    3  
ATOM   5119  O O    . GLU A 1 61  ? 14.390  9.348   -8.104  1.00 0.00 ? 61  GLU A O    3  
ATOM   5120  C CB   . GLU A 1 61  ? 12.066  7.287   -8.767  1.00 0.00 ? 61  GLU A CB   3  
ATOM   5121  C CG   . GLU A 1 61  ? 11.928  5.815   -9.106  1.00 0.00 ? 61  GLU A CG   3  
ATOM   5122  C CD   . GLU A 1 61  ? 11.242  5.589   -10.435 1.00 0.00 ? 61  GLU A CD   3  
ATOM   5123  O OE1  . GLU A 1 61  ? 11.936  5.594   -11.474 1.00 0.00 ? 61  GLU A OE1  3  
ATOM   5124  O OE2  . GLU A 1 61  ? 10.008  5.397   -10.449 1.00 0.00 ? 61  GLU A OE2  3  
ATOM   5125  H H    . GLU A 1 61  ? 11.218  7.000   -6.382  1.00 0.00 ? 61  GLU A H    3  
ATOM   5126  H HA   . GLU A 1 61  ? 13.791  6.922   -7.556  1.00 0.00 ? 61  GLU A HA   3  
ATOM   5127  H HB2  . GLU A 1 61  ? 11.076  7.688   -8.601  1.00 0.00 ? 61  GLU A HB2  3  
ATOM   5128  H HB3  . GLU A 1 61  ? 12.509  7.793   -9.610  1.00 0.00 ? 61  GLU A HB3  3  
ATOM   5129  H HG2  . GLU A 1 61  ? 12.913  5.374   -9.147  1.00 0.00 ? 61  GLU A HG2  3  
ATOM   5130  H HG3  . GLU A 1 61  ? 11.351  5.333   -8.331  1.00 0.00 ? 61  GLU A HG3  3  
ATOM   5131  N N    . ASN A 1 62  ? 12.593  9.854   -6.858  1.00 0.00 ? 62  ASN A N    3  
ATOM   5132  C CA   . ASN A 1 62  ? 12.953  11.261  -6.712  1.00 0.00 ? 62  ASN A CA   3  
ATOM   5133  C C    . ASN A 1 62  ? 13.994  11.409  -5.624  1.00 0.00 ? 62  ASN A C    3  
ATOM   5134  O O    . ASN A 1 62  ? 14.529  12.494  -5.388  1.00 0.00 ? 62  ASN A O    3  
ATOM   5135  C CB   . ASN A 1 62  ? 11.739  12.130  -6.370  1.00 0.00 ? 62  ASN A CB   3  
ATOM   5136  C CG   . ASN A 1 62  ? 10.829  12.405  -7.556  1.00 0.00 ? 62  ASN A CG   3  
ATOM   5137  O OD1  . ASN A 1 62  ? 10.220  13.469  -7.643  1.00 0.00 ? 62  ASN A OD1  3  
ATOM   5138  N ND2  . ASN A 1 62  ? 10.713  11.453  -8.472  1.00 0.00 ? 62  ASN A ND2  3  
ATOM   5139  H H    . ASN A 1 62  ? 11.768  9.524   -6.447  1.00 0.00 ? 62  ASN A H    3  
ATOM   5140  H HA   . ASN A 1 62  ? 13.377  11.592  -7.646  1.00 0.00 ? 62  ASN A HA   3  
ATOM   5141  H HB2  . ASN A 1 62  ? 11.157  11.635  -5.606  1.00 0.00 ? 62  ASN A HB2  3  
ATOM   5142  H HB3  . ASN A 1 62  ? 12.092  13.077  -5.982  1.00 0.00 ? 62  ASN A HB3  3  
ATOM   5143  H HD21 . ASN A 1 62  ? 11.215  10.619  -8.345  1.00 0.00 ? 62  ASN A HD21 3  
ATOM   5144  H HD22 . ASN A 1 62  ? 10.127  11.620  -9.240  1.00 0.00 ? 62  ASN A HD22 3  
ATOM   5145  N N    . ARG A 1 63  ? 14.267  10.283  -4.974  1.00 0.00 ? 63  ARG A N    3  
ATOM   5146  C CA   . ARG A 1 63  ? 15.235  10.196  -3.900  1.00 0.00 ? 63  ARG A CA   3  
ATOM   5147  C C    . ARG A 1 63  ? 14.888  11.176  -2.796  1.00 0.00 ? 63  ARG A C    3  
ATOM   5148  O O    . ARG A 1 63  ? 15.753  11.845  -2.237  1.00 0.00 ? 63  ARG A O    3  
ATOM   5149  C CB   . ARG A 1 63  ? 16.639  10.434  -4.449  1.00 0.00 ? 63  ARG A CB   3  
ATOM   5150  C CG   . ARG A 1 63  ? 16.932  9.600   -5.686  1.00 0.00 ? 63  ARG A CG   3  
ATOM   5151  C CD   . ARG A 1 63  ? 17.004  8.116   -5.364  1.00 0.00 ? 63  ARG A CD   3  
ATOM   5152  N NE   . ARG A 1 63  ? 16.797  7.281   -6.551  1.00 0.00 ? 63  ARG A NE   3  
ATOM   5153  C CZ   . ARG A 1 63  ? 17.779  6.831   -7.339  1.00 0.00 ? 63  ARG A CZ   3  
ATOM   5154  N NH1  . ARG A 1 63  ? 19.032  7.224   -7.142  1.00 0.00 ? 63  ARG A NH1  3  
ATOM   5155  N NH2  . ARG A 1 63  ? 17.500  6.002   -8.339  1.00 0.00 ? 63  ARG A NH2  3  
ATOM   5156  H H    . ARG A 1 63  ? 13.803  9.467   -5.245  1.00 0.00 ? 63  ARG A H    3  
ATOM   5157  H HA   . ARG A 1 63  ? 15.182  9.196   -3.497  1.00 0.00 ? 63  ARG A HA   3  
ATOM   5158  H HB2  . ARG A 1 63  ? 16.740  11.477  -4.707  1.00 0.00 ? 63  ARG A HB2  3  
ATOM   5159  H HB3  . ARG A 1 63  ? 17.363  10.183  -3.692  1.00 0.00 ? 63  ARG A HB3  3  
ATOM   5160  H HG2  . ARG A 1 63  ? 16.145  9.762   -6.413  1.00 0.00 ? 63  ARG A HG2  3  
ATOM   5161  H HG3  . ARG A 1 63  ? 17.879  9.911   -6.094  1.00 0.00 ? 63  ARG A HG3  3  
ATOM   5162  H HD2  . ARG A 1 63  ? 17.978  7.900   -4.951  1.00 0.00 ? 63  ARG A HD2  3  
ATOM   5163  H HD3  . ARG A 1 63  ? 16.246  7.876   -4.630  1.00 0.00 ? 63  ARG A HD3  3  
ATOM   5164  H HE   . ARG A 1 63  ? 15.873  7.013   -6.752  1.00 0.00 ? 63  ARG A HE   3  
ATOM   5165  H HH11 . ARG A 1 63  ? 19.252  7.869   -6.408  1.00 0.00 ? 63  ARG A HH11 3  
ATOM   5166  H HH12 . ARG A 1 63  ? 19.772  6.868   -7.725  1.00 0.00 ? 63  ARG A HH12 3  
ATOM   5167  H HH21 . ARG A 1 63  ? 16.554  5.709   -8.506  1.00 0.00 ? 63  ARG A HH21 3  
ATOM   5168  H HH22 . ARG A 1 63  ? 18.236  5.661   -8.933  1.00 0.00 ? 63  ARG A HH22 3  
ATOM   5169  N N    . ASP A 1 64  ? 13.600  11.250  -2.496  1.00 0.00 ? 64  ASP A N    3  
ATOM   5170  C CA   . ASP A 1 64  ? 13.121  12.104  -1.394  1.00 0.00 ? 64  ASP A CA   3  
ATOM   5171  C C    . ASP A 1 64  ? 13.326  11.368  -0.082  1.00 0.00 ? 64  ASP A C    3  
ATOM   5172  O O    . ASP A 1 64  ? 13.482  11.965  0.986   1.00 0.00 ? 64  ASP A O    3  
ATOM   5173  C CB   . ASP A 1 64  ? 11.631  12.490  -1.563  1.00 0.00 ? 64  ASP A CB   3  
ATOM   5174  C CG   . ASP A 1 64  ? 11.045  13.122  -0.315  1.00 0.00 ? 64  ASP A CG   3  
ATOM   5175  O OD1  . ASP A 1 64  ? 11.587  14.149  0.145   1.00 0.00 ? 64  ASP A OD1  3  
ATOM   5176  O OD2  . ASP A 1 64  ? 10.024  12.610  0.195   1.00 0.00 ? 64  ASP A OD2  3  
ATOM   5177  H H    . ASP A 1 64  ? 12.961  10.695  -3.019  1.00 0.00 ? 64  ASP A H    3  
ATOM   5178  H HA   . ASP A 1 64  ? 13.731  12.998  -1.383  1.00 0.00 ? 64  ASP A HA   3  
ATOM   5179  H HB2  . ASP A 1 64  ? 11.522  13.206  -2.366  1.00 0.00 ? 64  ASP A HB2  3  
ATOM   5180  H HB3  . ASP A 1 64  ? 11.060  11.603  -1.795  1.00 0.00 ? 64  ASP A HB3  3  
ATOM   5181  N N    . TYR A 1 65  ? 13.343  10.058  -0.198  1.00 0.00 ? 65  TYR A N    3  
ATOM   5182  C CA   . TYR A 1 65  ? 13.571  9.171   0.937   1.00 0.00 ? 65  TYR A CA   3  
ATOM   5183  C C    . TYR A 1 65  ? 15.044  9.176   1.311   1.00 0.00 ? 65  TYR A C    3  
ATOM   5184  O O    . TYR A 1 65  ? 15.912  9.233   0.438   1.00 0.00 ? 65  TYR A O    3  
ATOM   5185  C CB   . TYR A 1 65  ? 13.159  7.731   0.608   1.00 0.00 ? 65  TYR A CB   3  
ATOM   5186  C CG   . TYR A 1 65  ? 11.696  7.533   0.268   1.00 0.00 ? 65  TYR A CG   3  
ATOM   5187  C CD1  . TYR A 1 65  ? 11.059  6.336   0.560   1.00 0.00 ? 65  TYR A CD1  3  
ATOM   5188  C CD2  . TYR A 1 65  ? 10.961  8.523   -0.361  1.00 0.00 ? 65  TYR A CD2  3  
ATOM   5189  C CE1  . TYR A 1 65  ? 9.731   6.138   0.233   1.00 0.00 ? 65  TYR A CE1  3  
ATOM   5190  C CE2  . TYR A 1 65  ? 9.640   8.333   -0.682  1.00 0.00 ? 65  TYR A CE2  3  
ATOM   5191  C CZ   . TYR A 1 65  ? 9.028   7.144   -0.384  1.00 0.00 ? 65  TYR A CZ   3  
ATOM   5192  O OH   . TYR A 1 65  ? 7.709   6.958   -0.726  1.00 0.00 ? 65  TYR A OH   3  
ATOM   5193  H H    . TYR A 1 65  ? 13.196  9.674   -1.086  1.00 0.00 ? 65  TYR A H    3  
ATOM   5194  H HA   . TYR A 1 65  ? 12.989  9.529   1.772   1.00 0.00 ? 65  TYR A HA   3  
ATOM   5195  H HB2  . TYR A 1 65  ? 13.736  7.389   -0.236  1.00 0.00 ? 65  TYR A HB2  3  
ATOM   5196  H HB3  . TYR A 1 65  ? 13.385  7.106   1.463   1.00 0.00 ? 65  TYR A HB3  3  
ATOM   5197  H HD1  . TYR A 1 65  ? 11.615  5.554   1.053   1.00 0.00 ? 65  TYR A HD1  3  
ATOM   5198  H HD2  . TYR A 1 65  ? 11.439  9.462   -0.597  1.00 0.00 ? 65  TYR A HD2  3  
ATOM   5199  H HE1  . TYR A 1 65  ? 9.254   5.199   0.462   1.00 0.00 ? 65  TYR A HE1  3  
ATOM   5200  H HE2  . TYR A 1 65  ? 9.089   9.118   -1.166  1.00 0.00 ? 65  TYR A HE2  3  
ATOM   5201  H HH   . TYR A 1 65  ? 7.643   6.844   -1.681  1.00 0.00 ? 65  TYR A HH   3  
ATOM   5202  N N    . ARG A 1 66  ? 15.323  9.121   2.600   1.00 0.00 ? 66  ARG A N    3  
ATOM   5203  C CA   . ARG A 1 66  ? 16.696  9.057   3.071   1.00 0.00 ? 66  ARG A CA   3  
ATOM   5204  C C    . ARG A 1 66  ? 17.000  7.713   3.718   1.00 0.00 ? 66  ARG A C    3  
ATOM   5205  O O    . ARG A 1 66  ? 18.158  7.296   3.770   1.00 0.00 ? 66  ARG A O    3  
ATOM   5206  C CB   . ARG A 1 66  ? 16.976  10.189  4.054   1.00 0.00 ? 66  ARG A CB   3  
ATOM   5207  C CG   . ARG A 1 66  ? 16.902  11.572  3.424   1.00 0.00 ? 66  ARG A CG   3  
ATOM   5208  C CD   . ARG A 1 66  ? 17.784  11.681  2.188   1.00 0.00 ? 66  ARG A CD   3  
ATOM   5209  N NE   . ARG A 1 66  ? 19.168  11.297  2.459   1.00 0.00 ? 66  ARG A NE   3  
ATOM   5210  C CZ   . ARG A 1 66  ? 20.228  11.873  1.899   1.00 0.00 ? 66  ARG A CZ   3  
ATOM   5211  N NH1  . ARG A 1 66  ? 20.077  12.898  1.069   1.00 0.00 ? 66  ARG A NH1  3  
ATOM   5212  N NH2  . ARG A 1 66  ? 21.443  11.423  2.173   1.00 0.00 ? 66  ARG A NH2  3  
ATOM   5213  H H    . ARG A 1 66  ? 14.586  9.154   3.257   1.00 0.00 ? 66  ARG A H    3  
ATOM   5214  H HA   . ARG A 1 66  ? 17.342  9.175   2.214   1.00 0.00 ? 66  ARG A HA   3  
ATOM   5215  H HB2  . ARG A 1 66  ? 16.246  10.142  4.851   1.00 0.00 ? 66  ARG A HB2  3  
ATOM   5216  H HB3  . ARG A 1 66  ? 17.962  10.055  4.470   1.00 0.00 ? 66  ARG A HB3  3  
ATOM   5217  H HG2  . ARG A 1 66  ? 15.882  11.772  3.140   1.00 0.00 ? 66  ARG A HG2  3  
ATOM   5218  H HG3  . ARG A 1 66  ? 17.225  12.303  4.150   1.00 0.00 ? 66  ARG A HG3  3  
ATOM   5219  H HD2  . ARG A 1 66  ? 17.387  11.035  1.420   1.00 0.00 ? 66  ARG A HD2  3  
ATOM   5220  H HD3  . ARG A 1 66  ? 17.767  12.702  1.839   1.00 0.00 ? 66  ARG A HD3  3  
ATOM   5221  H HE   . ARG A 1 66  ? 19.314  10.554  3.088   1.00 0.00 ? 66  ARG A HE   3  
ATOM   5222  H HH11 . ARG A 1 66  ? 19.161  13.246  0.854   1.00 0.00 ? 66  ARG A HH11 3  
ATOM   5223  H HH12 . ARG A 1 66  ? 20.882  13.333  0.658   1.00 0.00 ? 66  ARG A HH12 3  
ATOM   5224  H HH21 . ARG A 1 66  ? 21.562  10.648  2.801   1.00 0.00 ? 66  ARG A HH21 3  
ATOM   5225  H HH22 . ARG A 1 66  ? 22.246  11.854  1.754   1.00 0.00 ? 66  ARG A HH22 3  
ATOM   5226  N N    . ASP A 1 67  ? 15.965  7.027   4.194   1.00 0.00 ? 67  ASP A N    3  
ATOM   5227  C CA   . ASP A 1 67  ? 16.136  5.741   4.848   1.00 0.00 ? 67  ASP A CA   3  
ATOM   5228  C C    . ASP A 1 67  ? 14.959  4.851   4.506   1.00 0.00 ? 67  ASP A C    3  
ATOM   5229  O O    . ASP A 1 67  ? 13.913  5.333   4.068   1.00 0.00 ? 67  ASP A O    3  
ATOM   5230  C CB   . ASP A 1 67  ? 16.241  5.899   6.370   1.00 0.00 ? 67  ASP A CB   3  
ATOM   5231  C CG   . ASP A 1 67  ? 17.555  6.506   6.816   1.00 0.00 ? 67  ASP A CG   3  
ATOM   5232  O OD1  . ASP A 1 67  ? 17.587  7.719   7.108   1.00 0.00 ? 67  ASP A OD1  3  
ATOM   5233  O OD2  . ASP A 1 67  ? 18.558  5.766   6.893   1.00 0.00 ? 67  ASP A OD2  3  
ATOM   5234  H H    . ASP A 1 67  ? 15.053  7.380   4.087   1.00 0.00 ? 67  ASP A H    3  
ATOM   5235  H HA   . ASP A 1 67  ? 17.040  5.288   4.471   1.00 0.00 ? 67  ASP A HA   3  
ATOM   5236  H HB2  . ASP A 1 67  ? 15.441  6.535   6.715   1.00 0.00 ? 67  ASP A HB2  3  
ATOM   5237  H HB3  . ASP A 1 67  ? 16.147  4.931   6.831   1.00 0.00 ? 67  ASP A HB3  3  
ATOM   5238  N N    . ALA A 1 68  ? 15.125  3.557   4.720   1.00 0.00 ? 68  ALA A N    3  
ATOM   5239  C CA   . ALA A 1 68  ? 14.086  2.593   4.397   1.00 0.00 ? 68  ALA A CA   3  
ATOM   5240  C C    . ALA A 1 68  ? 12.959  2.677   5.405   1.00 0.00 ? 68  ALA A C    3  
ATOM   5241  O O    . ALA A 1 68  ? 11.867  2.173   5.173   1.00 0.00 ? 68  ALA A O    3  
ATOM   5242  C CB   . ALA A 1 68  ? 14.650  1.191   4.367   1.00 0.00 ? 68  ALA A CB   3  
ATOM   5243  H H    . ALA A 1 68  ? 15.962  3.240   5.125   1.00 0.00 ? 68  ALA A H    3  
ATOM   5244  H HA   . ALA A 1 68  ? 13.704  2.827   3.414   1.00 0.00 ? 68  ALA A HA   3  
ATOM   5245  H HB1  . ALA A 1 68  ? 15.021  0.942   5.350   1.00 0.00 ? 68  ALA A HB1  3  
ATOM   5246  H HB2  . ALA A 1 68  ? 15.457  1.139   3.651   1.00 0.00 ? 68  ALA A HB2  3  
ATOM   5247  H HB3  . ALA A 1 68  ? 13.873  0.495   4.088   1.00 0.00 ? 68  ALA A HB3  3  
ATOM   5248  N N    . GLN A 1 69  ? 13.236  3.326   6.525   1.00 0.00 ? 69  GLN A N    3  
ATOM   5249  C CA   . GLN A 1 69  ? 12.229  3.545   7.547   1.00 0.00 ? 69  GLN A CA   3  
ATOM   5250  C C    . GLN A 1 69  ? 11.247  4.601   7.062   1.00 0.00 ? 69  GLN A C    3  
ATOM   5251  O O    . GLN A 1 69  ? 10.061  4.571   7.387   1.00 0.00 ? 69  GLN A O    3  
ATOM   5252  C CB   . GLN A 1 69  ? 12.875  3.976   8.859   1.00 0.00 ? 69  GLN A CB   3  
ATOM   5253  C CG   . GLN A 1 69  ? 11.877  4.161   9.984   1.00 0.00 ? 69  GLN A CG   3  
ATOM   5254  C CD   . GLN A 1 69  ? 11.275  2.857   10.475  1.00 0.00 ? 69  GLN A CD   3  
ATOM   5255  O OE1  . GLN A 1 69  ? 10.236  2.416   9.984   1.00 0.00 ? 69  GLN A OE1  3  
ATOM   5256  N NE2  . GLN A 1 69  ? 11.912  2.241   11.455  1.00 0.00 ? 69  GLN A NE2  3  
ATOM   5257  H H    . GLN A 1 69  ? 14.144  3.666   6.662   1.00 0.00 ? 69  GLN A H    3  
ATOM   5258  H HA   . GLN A 1 69  ? 11.701  2.618   7.699   1.00 0.00 ? 69  GLN A HA   3  
ATOM   5259  H HB2  . GLN A 1 69  ? 13.589  3.224   9.160   1.00 0.00 ? 69  GLN A HB2  3  
ATOM   5260  H HB3  . GLN A 1 69  ? 13.391  4.911   8.706   1.00 0.00 ? 69  GLN A HB3  3  
ATOM   5261  H HG2  . GLN A 1 69  ? 12.364  4.653   10.812  1.00 0.00 ? 69  GLN A HG2  3  
ATOM   5262  H HG3  . GLN A 1 69  ? 11.081  4.781   9.613   1.00 0.00 ? 69  GLN A HG3  3  
ATOM   5263  H HE21 . GLN A 1 69  ? 12.731  2.654   11.808  1.00 0.00 ? 69  GLN A HE21 3  
ATOM   5264  H HE22 . GLN A 1 69  ? 11.539  1.401   11.793  1.00 0.00 ? 69  GLN A HE22 3  
ATOM   5265  N N    . GLU A 1 70  ? 11.757  5.527   6.261   1.00 0.00 ? 70  GLU A N    3  
ATOM   5266  C CA   . GLU A 1 70  ? 10.931  6.527   5.617   1.00 0.00 ? 70  GLU A CA   3  
ATOM   5267  C C    . GLU A 1 70  ? 10.084  5.867   4.543   1.00 0.00 ? 70  GLU A C    3  
ATOM   5268  O O    . GLU A 1 70  ? 8.937   6.246   4.314   1.00 0.00 ? 70  GLU A O    3  
ATOM   5269  C CB   . GLU A 1 70  ? 11.799  7.628   5.017   1.00 0.00 ? 70  GLU A CB   3  
ATOM   5270  C CG   . GLU A 1 70  ? 12.563  8.428   6.058   1.00 0.00 ? 70  GLU A CG   3  
ATOM   5271  C CD   . GLU A 1 70  ? 13.468  9.468   5.438   1.00 0.00 ? 70  GLU A CD   3  
ATOM   5272  O OE1  . GLU A 1 70  ? 13.310  9.754   4.234   1.00 0.00 ? 70  GLU A OE1  3  
ATOM   5273  O OE2  . GLU A 1 70  ? 14.340  10.006  6.149   1.00 0.00 ? 70  GLU A OE2  3  
ATOM   5274  H H    . GLU A 1 70  ? 12.717  5.533   6.095   1.00 0.00 ? 70  GLU A H    3  
ATOM   5275  H HA   . GLU A 1 70  ? 10.281  6.954   6.361   1.00 0.00 ? 70  GLU A HA   3  
ATOM   5276  H HB2  . GLU A 1 70  ? 12.516  7.183   4.340   1.00 0.00 ? 70  GLU A HB2  3  
ATOM   5277  H HB3  . GLU A 1 70  ? 11.166  8.306   4.464   1.00 0.00 ? 70  GLU A HB3  3  
ATOM   5278  H HG2  . GLU A 1 70  ? 11.856  8.926   6.703   1.00 0.00 ? 70  GLU A HG2  3  
ATOM   5279  H HG3  . GLU A 1 70  ? 13.167  7.750   6.643   1.00 0.00 ? 70  GLU A HG3  3  
ATOM   5280  N N    . PHE A 1 71  ? 10.661  4.863   3.897   1.00 0.00 ? 71  PHE A N    3  
ATOM   5281  C CA   . PHE A 1 71  ? 9.915   4.036   2.967   1.00 0.00 ? 71  PHE A CA   3  
ATOM   5282  C C    . PHE A 1 71  ? 8.837   3.274   3.716   1.00 0.00 ? 71  PHE A C    3  
ATOM   5283  O O    . PHE A 1 71  ? 7.667   3.315   3.339   1.00 0.00 ? 71  PHE A O    3  
ATOM   5284  C CB   . PHE A 1 71  ? 10.838  3.057   2.231   1.00 0.00 ? 71  PHE A CB   3  
ATOM   5285  C CG   . PHE A 1 71  ? 10.128  1.827   1.728   1.00 0.00 ? 71  PHE A CG   3  
ATOM   5286  C CD1  . PHE A 1 71  ? 9.446   1.848   0.526   1.00 0.00 ? 71  PHE A CD1  3  
ATOM   5287  C CD2  . PHE A 1 71  ? 10.138  0.649   2.464   1.00 0.00 ? 71  PHE A CD2  3  
ATOM   5288  C CE1  . PHE A 1 71  ? 8.788   0.723   0.065   1.00 0.00 ? 71  PHE A CE1  3  
ATOM   5289  C CE2  . PHE A 1 71  ? 9.481   -0.477  2.010   1.00 0.00 ? 71  PHE A CE2  3  
ATOM   5290  C CZ   . PHE A 1 71  ? 8.805   -0.439  0.809   1.00 0.00 ? 71  PHE A CZ   3  
ATOM   5291  H H    . PHE A 1 71  ? 11.607  4.674   4.057   1.00 0.00 ? 71  PHE A H    3  
ATOM   5292  H HA   . PHE A 1 71  ? 9.443   4.689   2.248   1.00 0.00 ? 71  PHE A HA   3  
ATOM   5293  H HB2  . PHE A 1 71  ? 11.271  3.558   1.378   1.00 0.00 ? 71  PHE A HB2  3  
ATOM   5294  H HB3  . PHE A 1 71  ? 11.629  2.744   2.894   1.00 0.00 ? 71  PHE A HB3  3  
ATOM   5295  H HD1  . PHE A 1 71  ? 9.430   2.759   -0.052  1.00 0.00 ? 71  PHE A HD1  3  
ATOM   5296  H HD2  . PHE A 1 71  ? 10.664  0.620   3.407   1.00 0.00 ? 71  PHE A HD2  3  
ATOM   5297  H HE1  . PHE A 1 71  ? 8.258   0.754   -0.873  1.00 0.00 ? 71  PHE A HE1  3  
ATOM   5298  H HE2  . PHE A 1 71  ? 9.491   -1.382  2.596   1.00 0.00 ? 71  PHE A HE2  3  
ATOM   5299  H HZ   . PHE A 1 71  ? 8.291   -1.319  0.450   1.00 0.00 ? 71  PHE A HZ   3  
ATOM   5300  N N    . ALA A 1 72  ? 9.249   2.584   4.780   1.00 0.00 ? 72  ALA A N    3  
ATOM   5301  C CA   . ALA A 1 72  ? 8.335   1.832   5.614   1.00 0.00 ? 72  ALA A CA   3  
ATOM   5302  C C    . ALA A 1 72  ? 7.188   2.714   6.073   1.00 0.00 ? 72  ALA A C    3  
ATOM   5303  O O    . ALA A 1 72  ? 6.044   2.282   6.099   1.00 0.00 ? 72  ALA A O    3  
ATOM   5304  C CB   . ALA A 1 72  ? 9.072   1.235   6.803   1.00 0.00 ? 72  ALA A CB   3  
ATOM   5305  H H    . ALA A 1 72  ? 10.208  2.566   4.997   1.00 0.00 ? 72  ALA A H    3  
ATOM   5306  H HA   . ALA A 1 72  ? 7.939   1.022   5.022   1.00 0.00 ? 72  ALA A HA   3  
ATOM   5307  H HB1  . ALA A 1 72  ? 9.586   2.018   7.342   1.00 0.00 ? 72  ALA A HB1  3  
ATOM   5308  H HB2  . ALA A 1 72  ? 9.791   0.509   6.454   1.00 0.00 ? 72  ALA A HB2  3  
ATOM   5309  H HB3  . ALA A 1 72  ? 8.364   0.750   7.461   1.00 0.00 ? 72  ALA A HB3  3  
ATOM   5310  N N    . ALA A 1 73  ? 7.511   3.958   6.396   1.00 0.00 ? 73  ALA A N    3  
ATOM   5311  C CA   . ALA A 1 73  ? 6.521   4.946   6.798   1.00 0.00 ? 73  ALA A CA   3  
ATOM   5312  C C    . ALA A 1 73  ? 5.449   5.123   5.722   1.00 0.00 ? 73  ALA A C    3  
ATOM   5313  O O    . ALA A 1 73  ? 4.253   5.084   6.010   1.00 0.00 ? 73  ALA A O    3  
ATOM   5314  C CB   . ALA A 1 73  ? 7.217   6.271   7.077   1.00 0.00 ? 73  ALA A CB   3  
ATOM   5315  H H    . ALA A 1 73  ? 8.454   4.224   6.364   1.00 0.00 ? 73  ALA A H    3  
ATOM   5316  H HA   . ALA A 1 73  ? 6.058   4.605   7.713   1.00 0.00 ? 73  ALA A HA   3  
ATOM   5317  H HB1  . ALA A 1 73  ? 8.054   6.392   6.393   1.00 0.00 ? 73  ALA A HB1  3  
ATOM   5318  H HB2  . ALA A 1 73  ? 7.580   6.281   8.094   1.00 0.00 ? 73  ALA A HB2  3  
ATOM   5319  H HB3  . ALA A 1 73  ? 6.517   7.081   6.937   1.00 0.00 ? 73  ALA A HB3  3  
ATOM   5320  N N    . ASP A 1 74  ? 5.889   5.295   4.482   1.00 0.00 ? 74  ASP A N    3  
ATOM   5321  C CA   . ASP A 1 74  ? 4.986   5.530   3.365   1.00 0.00 ? 74  ASP A CA   3  
ATOM   5322  C C    . ASP A 1 74  ? 4.177   4.278   3.019   1.00 0.00 ? 74  ASP A C    3  
ATOM   5323  O O    . ASP A 1 74  ? 2.952   4.335   2.875   1.00 0.00 ? 74  ASP A O    3  
ATOM   5324  C CB   . ASP A 1 74  ? 5.790   5.992   2.150   1.00 0.00 ? 74  ASP A CB   3  
ATOM   5325  C CG   . ASP A 1 74  ? 5.679   7.487   1.896   1.00 0.00 ? 74  ASP A CG   3  
ATOM   5326  O OD1  . ASP A 1 74  ? 6.338   8.271   2.608   1.00 0.00 ? 74  ASP A OD1  3  
ATOM   5327  O OD2  . ASP A 1 74  ? 4.943   7.890   0.970   1.00 0.00 ? 74  ASP A OD2  3  
ATOM   5328  H H    . ASP A 1 74  ? 6.854   5.260   4.307   1.00 0.00 ? 74  ASP A H    3  
ATOM   5329  H HA   . ASP A 1 74  ? 4.303   6.316   3.650   1.00 0.00 ? 74  ASP A HA   3  
ATOM   5330  H HB2  . ASP A 1 74  ? 6.832   5.754   2.306   1.00 0.00 ? 74  ASP A HB2  3  
ATOM   5331  H HB3  . ASP A 1 74  ? 5.439   5.469   1.282   1.00 0.00 ? 74  ASP A HB3  3  
ATOM   5332  N N    . VAL A 1 75  ? 4.860   3.142   2.904   1.00 0.00 ? 75  VAL A N    3  
ATOM   5333  C CA   . VAL A 1 75  ? 4.204   1.890   2.525   1.00 0.00 ? 75  VAL A CA   3  
ATOM   5334  C C    . VAL A 1 75  ? 3.223   1.423   3.603   1.00 0.00 ? 75  VAL A C    3  
ATOM   5335  O O    . VAL A 1 75  ? 2.113   0.983   3.292   1.00 0.00 ? 75  VAL A O    3  
ATOM   5336  C CB   . VAL A 1 75  ? 5.226   0.765   2.217   1.00 0.00 ? 75  VAL A CB   3  
ATOM   5337  C CG1  . VAL A 1 75  ? 6.261   0.636   3.314   1.00 0.00 ? 75  VAL A CG1  3  
ATOM   5338  C CG2  . VAL A 1 75  ? 4.536   -0.571  2.000   1.00 0.00 ? 75  VAL A CG2  3  
ATOM   5339  H H    . VAL A 1 75  ? 5.830   3.145   3.075   1.00 0.00 ? 75  VAL A H    3  
ATOM   5340  H HA   . VAL A 1 75  ? 3.644   2.083   1.622   1.00 0.00 ? 75  VAL A HA   3  
ATOM   5341  H HB   . VAL A 1 75  ? 5.738   1.023   1.304   1.00 0.00 ? 75  VAL A HB   3  
ATOM   5342  H HG11 . VAL A 1 75  ? 6.901   1.506   3.312   1.00 0.00 ? 75  VAL A HG11 3  
ATOM   5343  H HG12 . VAL A 1 75  ? 6.857   -0.249  3.146   1.00 0.00 ? 75  VAL A HG12 3  
ATOM   5344  H HG13 . VAL A 1 75  ? 5.764   0.558   4.270   1.00 0.00 ? 75  VAL A HG13 3  
ATOM   5345  H HG21 . VAL A 1 75  ? 5.263   -1.366  2.098   1.00 0.00 ? 75  VAL A HG21 3  
ATOM   5346  H HG22 . VAL A 1 75  ? 4.103   -0.598  1.011   1.00 0.00 ? 75  VAL A HG22 3  
ATOM   5347  H HG23 . VAL A 1 75  ? 3.758   -0.701  2.739   1.00 0.00 ? 75  VAL A HG23 3  
ATOM   5348  N N    . ARG A 1 76  ? 3.615   1.539   4.867   1.00 0.00 ? 76  ARG A N    3  
ATOM   5349  C CA   . ARG A 1 76  ? 2.755   1.105   5.958   1.00 0.00 ? 76  ARG A CA   3  
ATOM   5350  C C    . ARG A 1 76  ? 1.531   2.009   6.046   1.00 0.00 ? 76  ARG A C    3  
ATOM   5351  O O    . ARG A 1 76  ? 0.450   1.568   6.433   1.00 0.00 ? 76  ARG A O    3  
ATOM   5352  C CB   . ARG A 1 76  ? 3.511   1.087   7.293   1.00 0.00 ? 76  ARG A CB   3  
ATOM   5353  C CG   . ARG A 1 76  ? 3.786   2.473   7.871   1.00 0.00 ? 76  ARG A CG   3  
ATOM   5354  C CD   . ARG A 1 76  ? 4.521   2.413   9.202   1.00 0.00 ? 76  ARG A CD   3  
ATOM   5355  N NE   . ARG A 1 76  ? 5.726   1.580   9.148   1.00 0.00 ? 76  ARG A NE   3  
ATOM   5356  C CZ   . ARG A 1 76  ? 6.707   1.627   10.054  1.00 0.00 ? 76  ARG A CZ   3  
ATOM   5357  N NH1  . ARG A 1 76  ? 6.635   2.478   11.070  1.00 0.00 ? 76  ARG A NH1  3  
ATOM   5358  N NH2  . ARG A 1 76  ? 7.750   0.812   9.950   1.00 0.00 ? 76  ARG A NH2  3  
ATOM   5359  H H    . ARG A 1 76  ? 4.501   1.920   5.069   1.00 0.00 ? 76  ARG A H    3  
ATOM   5360  H HA   . ARG A 1 76  ? 2.423   0.102   5.731   1.00 0.00 ? 76  ARG A HA   3  
ATOM   5361  H HB2  . ARG A 1 76  ? 2.937   0.524   8.005   1.00 0.00 ? 76  ARG A HB2  3  
ATOM   5362  H HB3  . ARG A 1 76  ? 4.460   0.592   7.144   1.00 0.00 ? 76  ARG A HB3  3  
ATOM   5363  H HG2  . ARG A 1 76  ? 4.388   3.029   7.168   1.00 0.00 ? 76  ARG A HG2  3  
ATOM   5364  H HG3  . ARG A 1 76  ? 2.843   2.981   8.014   1.00 0.00 ? 76  ARG A HG3  3  
ATOM   5365  H HD2  . ARG A 1 76  ? 4.807   3.416   9.482   1.00 0.00 ? 76  ARG A HD2  3  
ATOM   5366  H HD3  . ARG A 1 76  ? 3.855   2.016   9.946   1.00 0.00 ? 76  ARG A HD3  3  
ATOM   5367  H HE   . ARG A 1 76  ? 5.800   0.943   8.405   1.00 0.00 ? 76  ARG A HE   3  
ATOM   5368  H HH11 . ARG A 1 76  ? 5.842   3.088   11.164  1.00 0.00 ? 76  ARG A HH11 3  
ATOM   5369  H HH12 . ARG A 1 76  ? 7.373   2.519   11.749  1.00 0.00 ? 76  ARG A HH12 3  
ATOM   5370  H HH21 . ARG A 1 76  ? 7.801   0.152   9.195   1.00 0.00 ? 76  ARG A HH21 3  
ATOM   5371  H HH22 . ARG A 1 76  ? 8.496   0.852   10.624  1.00 0.00 ? 76  ARG A HH22 3  
ATOM   5372  N N    . LEU A 1 77  ? 1.708   3.274   5.664   1.00 0.00 ? 77  LEU A N    3  
ATOM   5373  C CA   . LEU A 1 77  ? 0.612   4.232   5.633   1.00 0.00 ? 77  LEU A CA   3  
ATOM   5374  C C    . LEU A 1 77  ? -0.427  3.806   4.607   1.00 0.00 ? 77  LEU A C    3  
ATOM   5375  O O    . LEU A 1 77  ? -1.628  4.006   4.798   1.00 0.00 ? 77  LEU A O    3  
ATOM   5376  C CB   . LEU A 1 77  ? 1.139   5.624   5.287   1.00 0.00 ? 77  LEU A CB   3  
ATOM   5377  C CG   . LEU A 1 77  ? 0.709   6.745   6.231   1.00 0.00 ? 77  LEU A CG   3  
ATOM   5378  C CD1  . LEU A 1 77  ? 1.170   8.084   5.692   1.00 0.00 ? 77  LEU A CD1  3  
ATOM   5379  C CD2  . LEU A 1 77  ? -0.799  6.727   6.447   1.00 0.00 ? 77  LEU A CD2  3  
ATOM   5380  H H    . LEU A 1 77  ? 2.605   3.572   5.397   1.00 0.00 ? 77  LEU A H    3  
ATOM   5381  H HA   . LEU A 1 77  ? 0.154   4.259   6.611   1.00 0.00 ? 77  LEU A HA   3  
ATOM   5382  H HB2  . LEU A 1 77  ? 2.218   5.585   5.280   1.00 0.00 ? 77  LEU A HB2  3  
ATOM   5383  H HB3  . LEU A 1 77  ? 0.801   5.872   4.292   1.00 0.00 ? 77  LEU A HB3  3  
ATOM   5384  H HG   . LEU A 1 77  ? 1.185   6.600   7.187   1.00 0.00 ? 77  LEU A HG   3  
ATOM   5385  H HD11 . LEU A 1 77  ? 0.922   8.146   4.646   1.00 0.00 ? 77  LEU A HD11 3  
ATOM   5386  H HD12 . LEU A 1 77  ? 2.238   8.175   5.817   1.00 0.00 ? 77  LEU A HD12 3  
ATOM   5387  H HD13 . LEU A 1 77  ? 0.674   8.880   6.229   1.00 0.00 ? 77  LEU A HD13 3  
ATOM   5388  H HD21 . LEU A 1 77  ? -1.299  6.555   5.506   1.00 0.00 ? 77  LEU A HD21 3  
ATOM   5389  H HD22 . LEU A 1 77  ? -1.114  7.675   6.854   1.00 0.00 ? 77  LEU A HD22 3  
ATOM   5390  H HD23 . LEU A 1 77  ? -1.053  5.938   7.139   1.00 0.00 ? 77  LEU A HD23 3  
ATOM   5391  N N    . MET A 1 78  ? 0.047   3.218   3.516   1.00 0.00 ? 78  MET A N    3  
ATOM   5392  C CA   . MET A 1 78  ? -0.836  2.708   2.480   1.00 0.00 ? 78  MET A CA   3  
ATOM   5393  C C    . MET A 1 78  ? -1.731  1.598   3.032   1.00 0.00 ? 78  MET A C    3  
ATOM   5394  O O    . MET A 1 78  ? -2.955  1.672   2.926   1.00 0.00 ? 78  MET A O    3  
ATOM   5395  C CB   . MET A 1 78  ? -0.018  2.227   1.275   1.00 0.00 ? 78  MET A CB   3  
ATOM   5396  C CG   . MET A 1 78  ? -0.824  1.445   0.251   1.00 0.00 ? 78  MET A CG   3  
ATOM   5397  S SD   . MET A 1 78  ? -0.776  -0.328  0.563   1.00 0.00 ? 78  MET A SD   3  
ATOM   5398  C CE   . MET A 1 78  ? 0.923   -0.704  0.132   1.00 0.00 ? 78  MET A CE   3  
ATOM   5399  H H    . MET A 1 78  ? 1.020   3.130   3.405   1.00 0.00 ? 78  MET A H    3  
ATOM   5400  H HA   . MET A 1 78  ? -1.467  3.526   2.164   1.00 0.00 ? 78  MET A HA   3  
ATOM   5401  H HB2  . MET A 1 78  ? 0.409   3.088   0.780   1.00 0.00 ? 78  MET A HB2  3  
ATOM   5402  H HB3  . MET A 1 78  ? 0.781   1.594   1.630   1.00 0.00 ? 78  MET A HB3  3  
ATOM   5403  H HG2  . MET A 1 78  ? -1.856  1.779   0.287   1.00 0.00 ? 78  MET A HG2  3  
ATOM   5404  H HG3  . MET A 1 78  ? -0.416  1.636   -0.733  1.00 0.00 ? 78  MET A HG3  3  
ATOM   5405  H HE1  . MET A 1 78  ? 1.597   -0.111  0.731   1.00 0.00 ? 78  MET A HE1  3  
ATOM   5406  H HE2  . MET A 1 78  ? 1.080   -0.482  -0.909  1.00 0.00 ? 78  MET A HE2  3  
ATOM   5407  H HE3  . MET A 1 78  ? 1.113   -1.753  0.309   1.00 0.00 ? 78  MET A HE3  3  
ATOM   5408  N N    . PHE A 1 79  ? -1.127  0.587   3.649   1.00 0.00 ? 79  PHE A N    3  
ATOM   5409  C CA   . PHE A 1 79  ? -1.902  -0.492  4.263   1.00 0.00 ? 79  PHE A CA   3  
ATOM   5410  C C    . PHE A 1 79  ? -2.838  0.061   5.349   1.00 0.00 ? 79  PHE A C    3  
ATOM   5411  O O    . PHE A 1 79  ? -3.969  -0.407  5.512   1.00 0.00 ? 79  PHE A O    3  
ATOM   5412  C CB   . PHE A 1 79  ? -0.990  -1.568  4.870   1.00 0.00 ? 79  PHE A CB   3  
ATOM   5413  C CG   . PHE A 1 79  ? -0.102  -2.281  3.882   1.00 0.00 ? 79  PHE A CG   3  
ATOM   5414  C CD1  . PHE A 1 79  ? -0.633  -2.921  2.773   1.00 0.00 ? 79  PHE A CD1  3  
ATOM   5415  C CD2  . PHE A 1 79  ? 1.269   -2.322  4.078   1.00 0.00 ? 79  PHE A CD2  3  
ATOM   5416  C CE1  . PHE A 1 79  ? 0.188   -3.582  1.874   1.00 0.00 ? 79  PHE A CE1  3  
ATOM   5417  C CE2  . PHE A 1 79  ? 2.094   -2.982  3.186   1.00 0.00 ? 79  PHE A CE2  3  
ATOM   5418  C CZ   . PHE A 1 79  ? 1.557   -3.612  2.083   1.00 0.00 ? 79  PHE A CZ   3  
ATOM   5419  H H    . PHE A 1 79  ? -0.143  0.555   3.672   1.00 0.00 ? 79  PHE A H    3  
ATOM   5420  H HA   . PHE A 1 79  ? -2.505  -0.942  3.488   1.00 0.00 ? 79  PHE A HA   3  
ATOM   5421  H HB2  . PHE A 1 79  ? -0.351  -1.111  5.610   1.00 0.00 ? 79  PHE A HB2  3  
ATOM   5422  H HB3  . PHE A 1 79  ? -1.607  -2.312  5.348   1.00 0.00 ? 79  PHE A HB3  3  
ATOM   5423  H HD1  . PHE A 1 79  ? -1.701  -2.896  2.607   1.00 0.00 ? 79  PHE A HD1  3  
ATOM   5424  H HD2  . PHE A 1 79  ? 1.695   -1.831  4.940   1.00 0.00 ? 79  PHE A HD2  3  
ATOM   5425  H HE1  . PHE A 1 79  ? -0.241  -4.076  1.016   1.00 0.00 ? 79  PHE A HE1  3  
ATOM   5426  H HE2  . PHE A 1 79  ? 3.156   -3.010  3.357   1.00 0.00 ? 79  PHE A HE2  3  
ATOM   5427  H HZ   . PHE A 1 79  ? 2.211   -4.121  1.381   1.00 0.00 ? 79  PHE A HZ   3  
ATOM   5428  N N    . SER A 1 80  ? -2.364  1.073   6.072   1.00 0.00 ? 80  SER A N    3  
ATOM   5429  C CA   . SER A 1 80  ? -3.133  1.675   7.156   1.00 0.00 ? 80  SER A CA   3  
ATOM   5430  C C    . SER A 1 80  ? -4.431  2.301   6.651   1.00 0.00 ? 80  SER A C    3  
ATOM   5431  O O    . SER A 1 80  ? -5.513  2.010   7.170   1.00 0.00 ? 80  SER A O    3  
ATOM   5432  C CB   . SER A 1 80  ? -2.295  2.729   7.882   1.00 0.00 ? 80  SER A CB   3  
ATOM   5433  O OG   . SER A 1 80  ? -1.132  2.150   8.452   1.00 0.00 ? 80  SER A OG   3  
ATOM   5434  H H    . SER A 1 80  ? -1.471  1.423   5.872   1.00 0.00 ? 80  SER A H    3  
ATOM   5435  H HA   . SER A 1 80  ? -3.382  0.890   7.854   1.00 0.00 ? 80  SER A HA   3  
ATOM   5436  H HB2  . SER A 1 80  ? -1.994  3.497   7.181   1.00 0.00 ? 80  SER A HB2  3  
ATOM   5437  H HB3  . SER A 1 80  ? -2.884  3.174   8.672   1.00 0.00 ? 80  SER A HB3  3  
ATOM   5438  H HG   . SER A 1 80  ? -0.597  1.749   7.750   1.00 0.00 ? 80  SER A HG   3  
ATOM   5439  N N    . ASN A 1 81  ? -4.337  3.150   5.629   1.00 0.00 ? 81  ASN A N    3  
ATOM   5440  C CA   . ASN A 1 81  ? -5.516  3.853   5.142   1.00 0.00 ? 81  ASN A CA   3  
ATOM   5441  C C    . ASN A 1 81  ? -6.528  2.865   4.562   1.00 0.00 ? 81  ASN A C    3  
ATOM   5442  O O    . ASN A 1 81  ? -7.734  3.097   4.636   1.00 0.00 ? 81  ASN A O    3  
ATOM   5443  C CB   . ASN A 1 81  ? -5.160  4.967   4.134   1.00 0.00 ? 81  ASN A CB   3  
ATOM   5444  C CG   . ASN A 1 81  ? -4.692  4.470   2.779   1.00 0.00 ? 81  ASN A CG   3  
ATOM   5445  O OD1  . ASN A 1 81  ? -5.499  4.140   1.915   1.00 0.00 ? 81  ASN A OD1  3  
ATOM   5446  N ND2  . ASN A 1 81  ? -3.388  4.470   2.564   1.00 0.00 ? 81  ASN A ND2  3  
ATOM   5447  H H    . ASN A 1 81  ? -3.465  3.304   5.203   1.00 0.00 ? 81  ASN A H    3  
ATOM   5448  H HA   . ASN A 1 81  ? -5.975  4.315   6.005   1.00 0.00 ? 81  ASN A HA   3  
ATOM   5449  H HB2  . ASN A 1 81  ? -6.026  5.589   3.975   1.00 0.00 ? 81  ASN A HB2  3  
ATOM   5450  H HB3  . ASN A 1 81  ? -4.372  5.574   4.558   1.00 0.00 ? 81  ASN A HB3  3  
ATOM   5451  H HD21 . ASN A 1 81  ? -2.798  4.787   3.281   1.00 0.00 ? 81  ASN A HD21 3  
ATOM   5452  H HD22 . ASN A 1 81  ? -3.066  4.146   1.698   1.00 0.00 ? 81  ASN A HD22 3  
ATOM   5453  N N    . CYS A 1 82  ? -6.039  1.741   4.038   1.00 0.00 ? 82  CYS A N    3  
ATOM   5454  C CA   . CYS A 1 82  ? -6.919  0.680   3.553   1.00 0.00 ? 82  CYS A CA   3  
ATOM   5455  C C    . CYS A 1 82  ? -7.823  0.166   4.674   1.00 0.00 ? 82  CYS A C    3  
ATOM   5456  O O    . CYS A 1 82  ? -9.033  0.012   4.479   1.00 0.00 ? 82  CYS A O    3  
ATOM   5457  C CB   . CYS A 1 82  ? -6.106  -0.488  2.980   1.00 0.00 ? 82  CYS A CB   3  
ATOM   5458  S SG   . CYS A 1 82  ? -4.971  -0.034  1.648   1.00 0.00 ? 82  CYS A SG   3  
ATOM   5459  H H    . CYS A 1 82  ? -5.065  1.632   3.961   1.00 0.00 ? 82  CYS A H    3  
ATOM   5460  H HA   . CYS A 1 82  ? -7.545  1.096   2.773   1.00 0.00 ? 82  CYS A HA   3  
ATOM   5461  H HB2  . CYS A 1 82  ? -5.521  -0.932  3.772   1.00 0.00 ? 82  CYS A HB2  3  
ATOM   5462  H HB3  . CYS A 1 82  ? -6.788  -1.230  2.590   1.00 0.00 ? 82  CYS A HB3  3  
ATOM   5463  H HG   . CYS A 1 82  ? -4.095  0.836   2.133   1.00 0.00 ? 82  CYS A HG   3  
ATOM   5464  N N    . TYR A 1 83  ? -7.238  -0.090  5.849   1.00 0.00 ? 83  TYR A N    3  
ATOM   5465  C CA   . TYR A 1 83  ? -8.014  -0.601  6.983   1.00 0.00 ? 83  TYR A CA   3  
ATOM   5466  C C    . TYR A 1 83  ? -8.978  0.451   7.519   1.00 0.00 ? 83  TYR A C    3  
ATOM   5467  O O    . TYR A 1 83  ? -9.999  0.114   8.124   1.00 0.00 ? 83  TYR A O    3  
ATOM   5468  C CB   . TYR A 1 83  ? -7.115  -1.055  8.141   1.00 0.00 ? 83  TYR A CB   3  
ATOM   5469  C CG   . TYR A 1 83  ? -6.212  -2.238  7.838   1.00 0.00 ? 83  TYR A CG   3  
ATOM   5470  C CD1  . TYR A 1 83  ? -6.673  -3.317  7.094   1.00 0.00 ? 83  TYR A CD1  3  
ATOM   5471  C CD2  . TYR A 1 83  ? -4.901  -2.287  8.320   1.00 0.00 ? 83  TYR A CD2  3  
ATOM   5472  C CE1  . TYR A 1 83  ? -5.860  -4.405  6.836   1.00 0.00 ? 83  TYR A CE1  3  
ATOM   5473  C CE2  . TYR A 1 83  ? -4.089  -3.372  8.063   1.00 0.00 ? 83  TYR A CE2  3  
ATOM   5474  C CZ   . TYR A 1 83  ? -4.572  -4.427  7.324   1.00 0.00 ? 83  TYR A CZ   3  
ATOM   5475  O OH   . TYR A 1 83  ? -3.757  -5.504  7.061   1.00 0.00 ? 83  TYR A OH   3  
ATOM   5476  H H    . TYR A 1 83  ? -6.268  0.060   5.952   1.00 0.00 ? 83  TYR A H    3  
ATOM   5477  H HA   . TYR A 1 83  ? -8.585  -1.447  6.634   1.00 0.00 ? 83  TYR A HA   3  
ATOM   5478  H HB2  . TYR A 1 83  ? -6.485  -0.231  8.439   1.00 0.00 ? 83  TYR A HB2  3  
ATOM   5479  H HB3  . TYR A 1 83  ? -7.755  -1.331  8.973   1.00 0.00 ? 83  TYR A HB3  3  
ATOM   5480  H HD1  . TYR A 1 83  ? -7.682  -3.299  6.713   1.00 0.00 ? 83  TYR A HD1  3  
ATOM   5481  H HD2  . TYR A 1 83  ? -4.512  -1.459  8.898   1.00 0.00 ? 83  TYR A HD2  3  
ATOM   5482  H HE1  . TYR A 1 83  ? -6.238  -5.234  6.254   1.00 0.00 ? 83  TYR A HE1  3  
ATOM   5483  H HE2  . TYR A 1 83  ? -3.085  -3.398  8.455   1.00 0.00 ? 83  TYR A HE2  3  
ATOM   5484  H HH   . TYR A 1 83  ? -3.126  -5.614  7.780   1.00 0.00 ? 83  TYR A HH   3  
ATOM   5485  N N    . LYS A 1 84  ? -8.661  1.723   7.301   1.00 0.00 ? 84  LYS A N    3  
ATOM   5486  C CA   . LYS A 1 84  ? -9.510  2.794   7.805   1.00 0.00 ? 84  LYS A CA   3  
ATOM   5487  C C    . LYS A 1 84  ? -10.783 2.911   6.982   1.00 0.00 ? 84  LYS A C    3  
ATOM   5488  O O    . LYS A 1 84  ? -11.854 3.186   7.522   1.00 0.00 ? 84  LYS A O    3  
ATOM   5489  C CB   . LYS A 1 84  ? -8.778  4.140   7.819   1.00 0.00 ? 84  LYS A CB   3  
ATOM   5490  C CG   . LYS A 1 84  ? -9.599  5.246   8.472   1.00 0.00 ? 84  LYS A CG   3  
ATOM   5491  C CD   . LYS A 1 84  ? -8.785  6.499   8.763   1.00 0.00 ? 84  LYS A CD   3  
ATOM   5492  C CE   . LYS A 1 84  ? -8.111  7.050   7.519   1.00 0.00 ? 84  LYS A CE   3  
ATOM   5493  N NZ   . LYS A 1 84  ? -6.757  6.473   7.319   1.00 0.00 ? 84  LYS A NZ   3  
ATOM   5494  H H    . LYS A 1 84  ? -7.839  1.940   6.809   1.00 0.00 ? 84  LYS A H    3  
ATOM   5495  H HA   . LYS A 1 84  ? -9.782  2.538   8.818   1.00 0.00 ? 84  LYS A HA   3  
ATOM   5496  H HB2  . LYS A 1 84  ? -7.851  4.032   8.364   1.00 0.00 ? 84  LYS A HB2  3  
ATOM   5497  H HB3  . LYS A 1 84  ? -8.561  4.438   6.796   1.00 0.00 ? 84  LYS A HB3  3  
ATOM   5498  H HG2  . LYS A 1 84  ? -10.410 5.510   7.811   1.00 0.00 ? 84  LYS A HG2  3  
ATOM   5499  H HG3  . LYS A 1 84  ? -10.005 4.870   9.401   1.00 0.00 ? 84  LYS A HG3  3  
ATOM   5500  H HD2  . LYS A 1 84  ? -9.442  7.255   9.166   1.00 0.00 ? 84  LYS A HD2  3  
ATOM   5501  H HD3  . LYS A 1 84  ? -8.026  6.257   9.492   1.00 0.00 ? 84  LYS A HD3  3  
ATOM   5502  H HE2  . LYS A 1 84  ? -8.725  6.816   6.662   1.00 0.00 ? 84  LYS A HE2  3  
ATOM   5503  H HE3  . LYS A 1 84  ? -8.027  8.120   7.616   1.00 0.00 ? 84  LYS A HE3  3  
ATOM   5504  H HZ1  . LYS A 1 84  ? -6.811  5.439   7.240   1.00 0.00 ? 84  LYS A HZ1  3  
ATOM   5505  H HZ2  . LYS A 1 84  ? -6.146  6.710   8.129   1.00 0.00 ? 84  LYS A HZ2  3  
ATOM   5506  H HZ3  . LYS A 1 84  ? -6.325  6.857   6.456   1.00 0.00 ? 84  LYS A HZ3  3  
ATOM   5507  N N    . TYR A 1 85  ? -10.669 2.698   5.683   1.00 0.00 ? 85  TYR A N    3  
ATOM   5508  C CA   . TYR A 1 85  ? -11.816 2.837   4.805   1.00 0.00 ? 85  TYR A CA   3  
ATOM   5509  C C    . TYR A 1 85  ? -12.680 1.582   4.821   1.00 0.00 ? 85  TYR A C    3  
ATOM   5510  O O    . TYR A 1 85  ? -13.886 1.645   5.066   1.00 0.00 ? 85  TYR A O    3  
ATOM   5511  C CB   . TYR A 1 85  ? -11.378 3.134   3.372   1.00 0.00 ? 85  TYR A CB   3  
ATOM   5512  C CG   . TYR A 1 85  ? -12.556 3.333   2.440   1.00 0.00 ? 85  TYR A CG   3  
ATOM   5513  C CD1  . TYR A 1 85  ? -13.249 4.532   2.466   1.00 0.00 ? 85  TYR A CD1  3  
ATOM   5514  C CD2  . TYR A 1 85  ? -12.994 2.340   1.562   1.00 0.00 ? 85  TYR A CD2  3  
ATOM   5515  C CE1  . TYR A 1 85  ? -14.342 4.750   1.649   1.00 0.00 ? 85  TYR A CE1  3  
ATOM   5516  C CE2  . TYR A 1 85  ? -14.085 2.552   0.740   1.00 0.00 ? 85  TYR A CE2  3  
ATOM   5517  C CZ   . TYR A 1 85  ? -14.752 3.759   0.789   1.00 0.00 ? 85  TYR A CZ   3  
ATOM   5518  O OH   . TYR A 1 85  ? -15.845 3.972   -0.016  1.00 0.00 ? 85  TYR A OH   3  
ATOM   5519  H H    . TYR A 1 85  ? -9.798  2.443   5.306   1.00 0.00 ? 85  TYR A H    3  
ATOM   5520  H HA   . TYR A 1 85  ? -12.401 3.672   5.165   1.00 0.00 ? 85  TYR A HA   3  
ATOM   5521  H HB2  . TYR A 1 85  ? -10.801 4.044   3.370   1.00 0.00 ? 85  TYR A HB2  3  
ATOM   5522  H HB3  . TYR A 1 85  ? -10.766 2.320   3.001   1.00 0.00 ? 85  TYR A HB3  3  
ATOM   5523  H HD1  . TYR A 1 85  ? -12.918 5.302   3.143   1.00 0.00 ? 85  TYR A HD1  3  
ATOM   5524  H HD2  . TYR A 1 85  ? -12.476 1.393   1.525   1.00 0.00 ? 85  TYR A HD2  3  
ATOM   5525  H HE1  . TYR A 1 85  ? -14.873 5.694   1.688   1.00 0.00 ? 85  TYR A HE1  3  
ATOM   5526  H HE2  . TYR A 1 85  ? -14.412 1.770   0.065   1.00 0.00 ? 85  TYR A HE2  3  
ATOM   5527  H HH   . TYR A 1 85  ? -16.500 3.285   0.160   1.00 0.00 ? 85  TYR A HH   3  
ATOM   5528  N N    . ASN A 1 86  ? -12.053 0.446   4.572   1.00 0.00 ? 86  ASN A N    3  
ATOM   5529  C CA   . ASN A 1 86  ? -12.779 -0.800  4.379   1.00 0.00 ? 86  ASN A CA   3  
ATOM   5530  C C    . ASN A 1 86  ? -12.963 -1.532  5.698   1.00 0.00 ? 86  ASN A C    3  
ATOM   5531  O O    . ASN A 1 86  ? -12.013 -1.682  6.469   1.00 0.00 ? 86  ASN A O    3  
ATOM   5532  C CB   . ASN A 1 86  ? -12.035 -1.703  3.387   1.00 0.00 ? 86  ASN A CB   3  
ATOM   5533  C CG   . ASN A 1 86  ? -11.832 -1.050  2.037   1.00 0.00 ? 86  ASN A CG   3  
ATOM   5534  O OD1  . ASN A 1 86  ? -12.659 -1.192  1.135   1.00 0.00 ? 86  ASN A OD1  3  
ATOM   5535  N ND2  . ASN A 1 86  ? -10.722 -0.344  1.888   1.00 0.00 ? 86  ASN A ND2  3  
ATOM   5536  H H    . ASN A 1 86  ? -11.072 0.441   4.535   1.00 0.00 ? 86  ASN A H    3  
ATOM   5537  H HA   . ASN A 1 86  ? -13.748 -0.556  3.972   1.00 0.00 ? 86  ASN A HA   3  
ATOM   5538  H HB2  . ASN A 1 86  ? -11.063 -1.948  3.793   1.00 0.00 ? 86  ASN A HB2  3  
ATOM   5539  H HB3  . ASN A 1 86  ? -12.600 -2.613  3.240   1.00 0.00 ? 86  ASN A HB3  3  
ATOM   5540  H HD21 . ASN A 1 86  ? -10.101 -0.290  2.649   1.00 0.00 ? 86  ASN A HD21 3  
ATOM   5541  H HD22 . ASN A 1 86  ? -10.568 0.112   1.033   1.00 0.00 ? 86  ASN A HD22 3  
ATOM   5542  N N    . PRO A 1 87  ? -14.197 -1.981  5.981   1.00 0.00 ? 87  PRO A N    3  
ATOM   5543  C CA   . PRO A 1 87  ? -14.486 -2.805  7.158   1.00 0.00 ? 87  PRO A CA   3  
ATOM   5544  C C    . PRO A 1 87  ? -13.694 -4.112  7.128   1.00 0.00 ? 87  PRO A C    3  
ATOM   5545  O O    . PRO A 1 87  ? -13.321 -4.595  6.055   1.00 0.00 ? 87  PRO A O    3  
ATOM   5546  C CB   . PRO A 1 87  ? -15.993 -3.083  7.053   1.00 0.00 ? 87  PRO A CB   3  
ATOM   5547  C CG   . PRO A 1 87  ? -16.362 -2.774  5.643   1.00 0.00 ? 87  PRO A CG   3  
ATOM   5548  C CD   . PRO A 1 87  ? -15.406 -1.711  5.186   1.00 0.00 ? 87  PRO A CD   3  
ATOM   5549  H HA   . PRO A 1 87  ? -14.272 -2.276  8.074   1.00 0.00 ? 87  PRO A HA   3  
ATOM   5550  H HB2  . PRO A 1 87  ? -16.184 -4.120  7.289   1.00 0.00 ? 87  PRO A HB2  3  
ATOM   5551  H HB3  . PRO A 1 87  ? -16.526 -2.450  7.747   1.00 0.00 ? 87  PRO A HB3  3  
ATOM   5552  H HG2  . PRO A 1 87  ? -16.257 -3.660  5.033   1.00 0.00 ? 87  PRO A HG2  3  
ATOM   5553  H HG3  . PRO A 1 87  ? -17.380 -2.408  5.601   1.00 0.00 ? 87  PRO A HG3  3  
ATOM   5554  H HD2  . PRO A 1 87  ? -15.208 -1.815  4.130   1.00 0.00 ? 87  PRO A HD2  3  
ATOM   5555  H HD3  . PRO A 1 87  ? -15.800 -0.730  5.404   1.00 0.00 ? 87  PRO A HD3  3  
ATOM   5556  N N    . PRO A 1 88  ? -13.436 -4.694  8.323   1.00 0.00 ? 88  PRO A N    3  
ATOM   5557  C CA   . PRO A 1 88  ? -12.576 -5.879  8.497   1.00 0.00 ? 88  PRO A CA   3  
ATOM   5558  C C    . PRO A 1 88  ? -12.979 -7.062  7.626   1.00 0.00 ? 88  PRO A C    3  
ATOM   5559  O O    . PRO A 1 88  ? -12.182 -7.972  7.394   1.00 0.00 ? 88  PRO A O    3  
ATOM   5560  C CB   . PRO A 1 88  ? -12.740 -6.245  9.978   1.00 0.00 ? 88  PRO A CB   3  
ATOM   5561  C CG   . PRO A 1 88  ? -13.908 -5.457  10.465  1.00 0.00 ? 88  PRO A CG   3  
ATOM   5562  C CD   . PRO A 1 88  ? -13.962 -4.225  9.613   1.00 0.00 ? 88  PRO A CD   3  
ATOM   5563  H HA   . PRO A 1 88  ? -11.541 -5.639  8.303   1.00 0.00 ? 88  PRO A HA   3  
ATOM   5564  H HB2  . PRO A 1 88  ? -12.921 -7.306  10.065  1.00 0.00 ? 88  PRO A HB2  3  
ATOM   5565  H HB3  . PRO A 1 88  ? -11.840 -5.986  10.514  1.00 0.00 ? 88  PRO A HB3  3  
ATOM   5566  H HG2  . PRO A 1 88  ? -14.814 -6.032  10.351  1.00 0.00 ? 88  PRO A HG2  3  
ATOM   5567  H HG3  . PRO A 1 88  ? -13.763 -5.188  11.501  1.00 0.00 ? 88  PRO A HG3  3  
ATOM   5568  H HD2  . PRO A 1 88  ? -14.980 -3.877  9.513   1.00 0.00 ? 88  PRO A HD2  3  
ATOM   5569  H HD3  . PRO A 1 88  ? -13.334 -3.450  10.026  1.00 0.00 ? 88  PRO A HD3  3  
ATOM   5570  N N    . ASP A 1 89  ? -14.216 -7.051  7.163   1.00 0.00 ? 89  ASP A N    3  
ATOM   5571  C CA   . ASP A 1 89  ? -14.697 -8.077  6.247   1.00 0.00 ? 89  ASP A CA   3  
ATOM   5572  C C    . ASP A 1 89  ? -14.787 -7.509  4.841   1.00 0.00 ? 89  ASP A C    3  
ATOM   5573  O O    . ASP A 1 89  ? -15.864 -7.139  4.377   1.00 0.00 ? 89  ASP A O    3  
ATOM   5574  C CB   . ASP A 1 89  ? -16.068 -8.630  6.670   1.00 0.00 ? 89  ASP A CB   3  
ATOM   5575  C CG   . ASP A 1 89  ? -16.035 -9.303  8.024   1.00 0.00 ? 89  ASP A CG   3  
ATOM   5576  O OD1  . ASP A 1 89  ? -16.341 -8.637  9.035   1.00 0.00 ? 89  ASP A OD1  3  
ATOM   5577  O OD2  . ASP A 1 89  ? -15.717 -10.510 8.084   1.00 0.00 ? 89  ASP A OD2  3  
ATOM   5578  H H    . ASP A 1 89  ? -14.813 -6.326  7.436   1.00 0.00 ? 89  ASP A H    3  
ATOM   5579  H HA   . ASP A 1 89  ? -13.975 -8.883  6.248   1.00 0.00 ? 89  ASP A HA   3  
ATOM   5580  H HB2  . ASP A 1 89  ? -16.794 -7.830  6.702   1.00 0.00 ? 89  ASP A HB2  3  
ATOM   5581  H HB3  . ASP A 1 89  ? -16.386 -9.359  5.940   1.00 0.00 ? 89  ASP A HB3  3  
ATOM   5582  N N    . HIS A 1 90  ? -13.648 -7.418  4.169   1.00 0.00 ? 90  HIS A N    3  
ATOM   5583  C CA   . HIS A 1 90  ? -13.617 -6.917  2.805   1.00 0.00 ? 90  HIS A CA   3  
ATOM   5584  C C    . HIS A 1 90  ? -12.363 -7.406  2.086   1.00 0.00 ? 90  HIS A C    3  
ATOM   5585  O O    . HIS A 1 90  ? -11.360 -7.710  2.726   1.00 0.00 ? 90  HIS A O    3  
ATOM   5586  C CB   . HIS A 1 90  ? -13.660 -5.385  2.779   1.00 0.00 ? 90  HIS A CB   3  
ATOM   5587  C CG   . HIS A 1 90  ? -14.276 -4.825  1.522   1.00 0.00 ? 90  HIS A CG   3  
ATOM   5588  N ND1  . HIS A 1 90  ? -13.540 -4.570  0.390   1.00 0.00 ? 90  HIS A ND1  3  
ATOM   5589  C CD2  . HIS A 1 90  ? -15.560 -4.486  1.209   1.00 0.00 ? 90  HIS A CD2  3  
ATOM   5590  C CE1  . HIS A 1 90  ? -14.328 -4.103  -0.555  1.00 0.00 ? 90  HIS A CE1  3  
ATOM   5591  N NE2  . HIS A 1 90  ? -15.558 -4.042  -0.088  1.00 0.00 ? 90  HIS A NE2  3  
ATOM   5592  H H    . HIS A 1 90  ? -12.810 -7.703  4.596   1.00 0.00 ? 90  HIS A H    3  
ATOM   5593  H HA   . HIS A 1 90  ? -14.487 -7.303  2.293   1.00 0.00 ? 90  HIS A HA   3  
ATOM   5594  H HB2  . HIS A 1 90  ? -14.212 -5.027  3.632   1.00 0.00 ? 90  HIS A HB2  3  
ATOM   5595  H HB3  . HIS A 1 90  ? -12.647 -5.013  2.840   1.00 0.00 ? 90  HIS A HB3  3  
ATOM   5596  H HD1  . HIS A 1 90  ? -12.585 -4.713  0.292   1.00 0.00 ? 90  HIS A HD1  3  
ATOM   5597  H HD2  . HIS A 1 90  ? -16.424 -4.555  1.849   1.00 0.00 ? 90  HIS A HD2  3  
ATOM   5598  H HE1  . HIS A 1 90  ? -14.021 -3.832  -1.553  1.00 0.00 ? 90  HIS A HE1  3  
ATOM   5599  H HE2  . HIS A 1 90  ? -16.357 -3.971  -0.656  1.00 0.00 ? 90  HIS A HE2  3  
ATOM   5600  N N    . ASP A 1 91  ? -12.417 -7.473  0.768   1.00 0.00 ? 91  ASP A N    3  
ATOM   5601  C CA   . ASP A 1 91  ? -11.293 -7.968  -0.029  1.00 0.00 ? 91  ASP A CA   3  
ATOM   5602  C C    . ASP A 1 91  ? -10.003 -7.185  0.225   1.00 0.00 ? 91  ASP A C    3  
ATOM   5603  O O    . ASP A 1 91  ? -8.949  -7.775  0.457   1.00 0.00 ? 91  ASP A O    3  
ATOM   5604  C CB   . ASP A 1 91  ? -11.640 -7.914  -1.519  1.00 0.00 ? 91  ASP A CB   3  
ATOM   5605  C CG   . ASP A 1 91  ? -12.800 -8.817  -1.876  1.00 0.00 ? 91  ASP A CG   3  
ATOM   5606  O OD1  . ASP A 1 91  ? -12.558 -9.940  -2.366  1.00 0.00 ? 91  ASP A OD1  3  
ATOM   5607  O OD2  . ASP A 1 91  ? -13.961 -8.411  -1.656  1.00 0.00 ? 91  ASP A OD2  3  
ATOM   5608  H H    . ASP A 1 91  ? -13.248 -7.221  0.312   1.00 0.00 ? 91  ASP A H    3  
ATOM   5609  H HA   . ASP A 1 91  ? -11.125 -8.995  0.251   1.00 0.00 ? 91  ASP A HA   3  
ATOM   5610  H HB2  . ASP A 1 91  ? -11.902 -6.902  -1.785  1.00 0.00 ? 91  ASP A HB2  3  
ATOM   5611  H HB3  . ASP A 1 91  ? -10.779 -8.222  -2.092  1.00 0.00 ? 91  ASP A HB3  3  
ATOM   5612  N N    . VAL A 1 92  ? -10.096 -5.857  0.205   1.00 0.00 ? 92  VAL A N    3  
ATOM   5613  C CA   . VAL A 1 92  ? -8.908  -5.003  0.277   1.00 0.00 ? 92  VAL A CA   3  
ATOM   5614  C C    . VAL A 1 92  ? -8.174  -5.173  1.598   1.00 0.00 ? 92  VAL A C    3  
ATOM   5615  O O    . VAL A 1 92  ? -6.955  -5.084  1.640   1.00 0.00 ? 92  VAL A O    3  
ATOM   5616  C CB   . VAL A 1 92  ? -9.233  -3.505  0.079   1.00 0.00 ? 92  VAL A CB   3  
ATOM   5617  C CG1  . VAL A 1 92  ? -8.222  -2.858  -0.851  1.00 0.00 ? 92  VAL A CG1  3  
ATOM   5618  C CG2  . VAL A 1 92  ? -10.641 -3.311  -0.450  1.00 0.00 ? 92  VAL A CG2  3  
ATOM   5619  H H    . VAL A 1 92  ? -10.974 -5.446  0.147   1.00 0.00 ? 92  VAL A H    3  
ATOM   5620  H HA   . VAL A 1 92  ? -8.243  -5.301  -0.515  1.00 0.00 ? 92  VAL A HA   3  
ATOM   5621  H HB   . VAL A 1 92  ? -9.160  -3.015  1.036   1.00 0.00 ? 92  VAL A HB   3  
ATOM   5622  H HG11 . VAL A 1 92  ? -7.224  -3.109  -0.530  1.00 0.00 ? 92  VAL A HG11 3  
ATOM   5623  H HG12 . VAL A 1 92  ? -8.347  -1.785  -0.830  1.00 0.00 ? 92  VAL A HG12 3  
ATOM   5624  H HG13 . VAL A 1 92  ? -8.377  -3.218  -1.857  1.00 0.00 ? 92  VAL A HG13 3  
ATOM   5625  H HG21 . VAL A 1 92  ? -11.343 -3.691  0.272   1.00 0.00 ? 92  VAL A HG21 3  
ATOM   5626  H HG22 . VAL A 1 92  ? -10.754 -3.847  -1.380  1.00 0.00 ? 92  VAL A HG22 3  
ATOM   5627  H HG23 . VAL A 1 92  ? -10.823 -2.259  -0.613  1.00 0.00 ? 92  VAL A HG23 3  
ATOM   5628  N N    . VAL A 1 93  ? -8.910  -5.442  2.671   1.00 0.00 ? 93  VAL A N    3  
ATOM   5629  C CA   . VAL A 1 93  ? -8.284  -5.594  3.976   1.00 0.00 ? 93  VAL A CA   3  
ATOM   5630  C C    . VAL A 1 93  ? -7.594  -6.949  4.070   1.00 0.00 ? 93  VAL A C    3  
ATOM   5631  O O    . VAL A 1 93  ? -6.534  -7.075  4.670   1.00 0.00 ? 93  VAL A O    3  
ATOM   5632  C CB   . VAL A 1 93  ? -9.285  -5.421  5.146   1.00 0.00 ? 93  VAL A CB   3  
ATOM   5633  C CG1  . VAL A 1 93  ? -10.040 -4.112  5.010   1.00 0.00 ? 93  VAL A CG1  3  
ATOM   5634  C CG2  . VAL A 1 93  ? -10.263 -6.580  5.231   1.00 0.00 ? 93  VAL A CG2  3  
ATOM   5635  H H    . VAL A 1 93  ? -9.877  -5.557  2.581   1.00 0.00 ? 93  VAL A H    3  
ATOM   5636  H HA   . VAL A 1 93  ? -7.529  -4.822  4.060   1.00 0.00 ? 93  VAL A HA   3  
ATOM   5637  H HB   . VAL A 1 93  ? -8.723  -5.392  6.069   1.00 0.00 ? 93  VAL A HB   3  
ATOM   5638  H HG11 . VAL A 1 93  ? -10.707 -4.171  4.159   1.00 0.00 ? 93  VAL A HG11 3  
ATOM   5639  H HG12 . VAL A 1 93  ? -9.338  -3.304  4.862   1.00 0.00 ? 93  VAL A HG12 3  
ATOM   5640  H HG13 . VAL A 1 93  ? -10.615 -3.930  5.906   1.00 0.00 ? 93  VAL A HG13 3  
ATOM   5641  H HG21 . VAL A 1 93  ? -10.855 -6.616  4.329   1.00 0.00 ? 93  VAL A HG21 3  
ATOM   5642  H HG22 . VAL A 1 93  ? -10.912 -6.444  6.083   1.00 0.00 ? 93  VAL A HG22 3  
ATOM   5643  H HG23 . VAL A 1 93  ? -9.716  -7.506  5.340   1.00 0.00 ? 93  VAL A HG23 3  
ATOM   5644  N N    . ALA A 1 94  ? -8.194  -7.955  3.445   1.00 0.00 ? 94  ALA A N    3  
ATOM   5645  C CA   . ALA A 1 94  ? -7.610  -9.287  3.407   1.00 0.00 ? 94  ALA A CA   3  
ATOM   5646  C C    . ALA A 1 94  ? -6.354  -9.291  2.548   1.00 0.00 ? 94  ALA A C    3  
ATOM   5647  O O    . ALA A 1 94  ? -5.349  -9.914  2.897   1.00 0.00 ? 94  ALA A O    3  
ATOM   5648  C CB   . ALA A 1 94  ? -8.621  -10.293 2.882   1.00 0.00 ? 94  ALA A CB   3  
ATOM   5649  H H    . ALA A 1 94  ? -9.058  -7.797  3.007   1.00 0.00 ? 94  ALA A H    3  
ATOM   5650  H HA   . ALA A 1 94  ? -7.346  -9.566  4.415   1.00 0.00 ? 94  ALA A HA   3  
ATOM   5651  H HB1  . ALA A 1 94  ? -8.893  -10.037 1.869   1.00 0.00 ? 94  ALA A HB1  3  
ATOM   5652  H HB2  . ALA A 1 94  ? -9.501  -10.277 3.506   1.00 0.00 ? 94  ALA A HB2  3  
ATOM   5653  H HB3  . ALA A 1 94  ? -8.184  -11.280 2.898   1.00 0.00 ? 94  ALA A HB3  3  
ATOM   5654  N N    . MET A 1 95  ? -6.413  -8.580  1.428   1.00 0.00 ? 95  MET A N    3  
ATOM   5655  C CA   . MET A 1 95  ? -5.260  -8.449  0.550   1.00 0.00 ? 95  MET A CA   3  
ATOM   5656  C C    . MET A 1 95  ? -4.177  -7.615  1.226   1.00 0.00 ? 95  MET A C    3  
ATOM   5657  O O    . MET A 1 95  ? -2.986  -7.879  1.055   1.00 0.00 ? 95  MET A O    3  
ATOM   5658  C CB   . MET A 1 95  ? -5.665  -7.831  -0.798  1.00 0.00 ? 95  MET A CB   3  
ATOM   5659  C CG   . MET A 1 95  ? -6.585  -8.722  -1.632  1.00 0.00 ? 95  MET A CG   3  
ATOM   5660  S SD   . MET A 1 95  ? -6.856  -8.094  -3.303  1.00 0.00 ? 95  MET A SD   3  
ATOM   5661  C CE   . MET A 1 95  ? -8.326  -7.096  -3.081  1.00 0.00 ? 95  MET A CE   3  
ATOM   5662  H H    . MET A 1 95  ? -7.255  -8.135  1.187   1.00 0.00 ? 95  MET A H    3  
ATOM   5663  H HA   . MET A 1 95  ? -4.865  -9.440  0.373   1.00 0.00 ? 95  MET A HA   3  
ATOM   5664  H HB2  . MET A 1 95  ? -6.176  -6.898  -0.612  1.00 0.00 ? 95  MET A HB2  3  
ATOM   5665  H HB3  . MET A 1 95  ? -4.771  -7.633  -1.373  1.00 0.00 ? 95  MET A HB3  3  
ATOM   5666  H HG2  . MET A 1 95  ? -6.148  -9.707  -1.706  1.00 0.00 ? 95  MET A HG2  3  
ATOM   5667  H HG3  . MET A 1 95  ? -7.542  -8.790  -1.131  1.00 0.00 ? 95  MET A HG3  3  
ATOM   5668  H HE1  . MET A 1 95  ? -8.205  -6.448  -2.228  1.00 0.00 ? 95  MET A HE1  3  
ATOM   5669  H HE2  . MET A 1 95  ? -9.175  -7.741  -2.924  1.00 0.00 ? 95  MET A HE2  3  
ATOM   5670  H HE3  . MET A 1 95  ? -8.490  -6.498  -3.965  1.00 0.00 ? 95  MET A HE3  3  
ATOM   5671  N N    . ALA A 1 96  ? -4.597  -6.635  2.026   1.00 0.00 ? 96  ALA A N    3  
ATOM   5672  C CA   . ALA A 1 96  ? -3.659  -5.804  2.773   1.00 0.00 ? 96  ALA A CA   3  
ATOM   5673  C C    . ALA A 1 96  ? -2.946  -6.637  3.827   1.00 0.00 ? 96  ALA A C    3  
ATOM   5674  O O    . ALA A 1 96  ? -1.745  -6.494  4.033   1.00 0.00 ? 96  ALA A O    3  
ATOM   5675  C CB   . ALA A 1 96  ? -4.372  -4.628  3.425   1.00 0.00 ? 96  ALA A CB   3  
ATOM   5676  H H    . ALA A 1 96  ? -5.562  -6.469  2.116   1.00 0.00 ? 96  ALA A H    3  
ATOM   5677  H HA   . ALA A 1 96  ? -2.932  -5.410  2.078   1.00 0.00 ? 96  ALA A HA   3  
ATOM   5678  H HB1  . ALA A 1 96  ? -4.689  -3.934  2.661   1.00 0.00 ? 96  ALA A HB1  3  
ATOM   5679  H HB2  . ALA A 1 96  ? -3.698  -4.130  4.106   1.00 0.00 ? 96  ALA A HB2  3  
ATOM   5680  H HB3  . ALA A 1 96  ? -5.234  -4.985  3.969   1.00 0.00 ? 96  ALA A HB3  3  
ATOM   5681  N N    . ARG A 1 97  ? -3.699  -7.517  4.477   1.00 0.00 ? 97  ARG A N    3  
ATOM   5682  C CA   . ARG A 1 97  ? -3.154  -8.395  5.507   1.00 0.00 ? 97  ARG A CA   3  
ATOM   5683  C C    . ARG A 1 97  ? -2.082  -9.318  4.944   1.00 0.00 ? 97  ARG A C    3  
ATOM   5684  O O    . ARG A 1 97  ? -0.996  -9.436  5.507   1.00 0.00 ? 97  ARG A O    3  
ATOM   5685  C CB   . ARG A 1 97  ? -4.266  -9.229  6.144   1.00 0.00 ? 97  ARG A CB   3  
ATOM   5686  C CG   . ARG A 1 97  ? -5.200  -8.418  7.022   1.00 0.00 ? 97  ARG A CG   3  
ATOM   5687  C CD   . ARG A 1 97  ? -6.379  -9.245  7.493   1.00 0.00 ? 97  ARG A CD   3  
ATOM   5688  N NE   . ARG A 1 97  ? -7.232  -8.496  8.408   1.00 0.00 ? 97  ARG A NE   3  
ATOM   5689  C CZ   . ARG A 1 97  ? -8.372  -8.958  8.910   1.00 0.00 ? 97  ARG A CZ   3  
ATOM   5690  N NH1  . ARG A 1 97  ? -8.840  -10.140 8.530   1.00 0.00 ? 97  ARG A NH1  3  
ATOM   5691  N NH2  . ARG A 1 97  ? -9.054  -8.226  9.780   1.00 0.00 ? 97  ARG A NH2  3  
ATOM   5692  H H    . ARG A 1 97  ? -4.657  -7.565  4.268   1.00 0.00 ? 97  ARG A H    3  
ATOM   5693  H HA   . ARG A 1 97  ? -2.713  -7.770  6.267   1.00 0.00 ? 97  ARG A HA   3  
ATOM   5694  H HB2  . ARG A 1 97  ? -4.851  -9.690  5.361   1.00 0.00 ? 97  ARG A HB2  3  
ATOM   5695  H HB3  . ARG A 1 97  ? -3.818  -10.003 6.750   1.00 0.00 ? 97  ARG A HB3  3  
ATOM   5696  H HG2  . ARG A 1 97  ? -4.653  -8.068  7.884   1.00 0.00 ? 97  ARG A HG2  3  
ATOM   5697  H HG3  . ARG A 1 97  ? -5.566  -7.573  6.457   1.00 0.00 ? 97  ARG A HG3  3  
ATOM   5698  H HD2  . ARG A 1 97  ? -6.961  -9.540  6.633   1.00 0.00 ? 97  ARG A HD2  3  
ATOM   5699  H HD3  . ARG A 1 97  ? -6.009  -10.125 7.997   1.00 0.00 ? 97  ARG A HD3  3  
ATOM   5700  H HE   . ARG A 1 97  ? -6.925  -7.600  8.678   1.00 0.00 ? 97  ARG A HE   3  
ATOM   5701  H HH11 . ARG A 1 97  ? -8.336  -10.691 7.857   1.00 0.00 ? 97  ARG A HH11 3  
ATOM   5702  H HH12 . ARG A 1 97  ? -9.697  -10.491 8.915   1.00 0.00 ? 97  ARG A HH12 3  
ATOM   5703  H HH21 . ARG A 1 97  ? -8.709  -7.324  10.059  1.00 0.00 ? 97  ARG A HH21 3  
ATOM   5704  H HH22 . ARG A 1 97  ? -9.913  -8.572  10.169  1.00 0.00 ? 97  ARG A HH22 3  
ATOM   5705  N N    . LYS A 1 98  ? -2.385  -9.962  3.830   1.00 0.00 ? 98  LYS A N    3  
ATOM   5706  C CA   . LYS A 1 98  ? -1.469  -10.928 3.236   1.00 0.00 ? 98  LYS A CA   3  
ATOM   5707  C C    . LYS A 1 98  ? -0.204  -10.235 2.714   1.00 0.00 ? 98  LYS A C    3  
ATOM   5708  O O    . LYS A 1 98  ? 0.921   -10.709 2.925   1.00 0.00 ? 98  LYS A O    3  
ATOM   5709  C CB   . LYS A 1 98  ? -2.181  -11.692 2.119   1.00 0.00 ? 98  LYS A CB   3  
ATOM   5710  C CG   . LYS A 1 98  ? -1.355  -12.820 1.533   1.00 0.00 ? 98  LYS A CG   3  
ATOM   5711  C CD   . LYS A 1 98  ? -2.079  -13.515 0.394   1.00 0.00 ? 98  LYS A CD   3  
ATOM   5712  C CE   . LYS A 1 98  ? -1.252  -14.657 -0.163  1.00 0.00 ? 98  LYS A CE   3  
ATOM   5713  N NZ   . LYS A 1 98  ? -0.910  -15.658 0.879   1.00 0.00 ? 98  LYS A NZ   3  
ATOM   5714  H H    . LYS A 1 98  ? -3.249  -9.786  3.394   1.00 0.00 ? 98  LYS A H    3  
ATOM   5715  H HA   . LYS A 1 98  ? -1.184  -11.626 4.009   1.00 0.00 ? 98  LYS A HA   3  
ATOM   5716  H HB2  . LYS A 1 98  ? -3.092  -12.113 2.515   1.00 0.00 ? 98  LYS A HB2  3  
ATOM   5717  H HB3  . LYS A 1 98  ? -2.432  -11.002 1.329   1.00 0.00 ? 98  LYS A HB3  3  
ATOM   5718  H HG2  . LYS A 1 98  ? -0.424  -12.424 1.166   1.00 0.00 ? 98  LYS A HG2  3  
ATOM   5719  H HG3  . LYS A 1 98  ? -1.157  -13.542 2.310   1.00 0.00 ? 98  LYS A HG3  3  
ATOM   5720  H HD2  . LYS A 1 98  ? -3.018  -13.905 0.757   1.00 0.00 ? 98  LYS A HD2  3  
ATOM   5721  H HD3  . LYS A 1 98  ? -2.260  -12.801 -0.394  1.00 0.00 ? 98  LYS A HD3  3  
ATOM   5722  H HE2  . LYS A 1 98  ? -1.813  -15.143 -0.947  1.00 0.00 ? 98  LYS A HE2  3  
ATOM   5723  H HE3  . LYS A 1 98  ? -0.343  -14.248 -0.573  1.00 0.00 ? 98  LYS A HE3  3  
ATOM   5724  H HZ1  . LYS A 1 98  ? -0.334  -16.420 0.469   1.00 0.00 ? 98  LYS A HZ1  3  
ATOM   5725  H HZ2  . LYS A 1 98  ? -1.778  -16.074 1.277   1.00 0.00 ? 98  LYS A HZ2  3  
ATOM   5726  H HZ3  . LYS A 1 98  ? -0.373  -15.210 1.648   1.00 0.00 ? 98  LYS A HZ3  3  
ATOM   5727  N N    . LEU A 1 99  ? -0.390  -9.114  2.031   1.00 0.00 ? 99  LEU A N    3  
ATOM   5728  C CA   . LEU A 1 99  ? 0.731   -8.288  1.596   1.00 0.00 ? 99  LEU A CA   3  
ATOM   5729  C C    . LEU A 1 99  ? 1.487   -7.708  2.794   1.00 0.00 ? 99  LEU A C    3  
ATOM   5730  O O    . LEU A 1 99  ? 2.683   -7.426  2.701   1.00 0.00 ? 99  LEU A O    3  
ATOM   5731  C CB   . LEU A 1 99  ? 0.267   -7.149  0.684   1.00 0.00 ? 99  LEU A CB   3  
ATOM   5732  C CG   . LEU A 1 99  ? 0.309   -7.396  -0.835  1.00 0.00 ? 99  LEU A CG   3  
ATOM   5733  C CD1  . LEU A 1 99  ? 0.844   -6.163  -1.524  1.00 0.00 ? 99  LEU A CD1  3  
ATOM   5734  C CD2  . LEU A 1 99  ? 1.177   -8.581  -1.212  1.00 0.00 ? 99  LEU A CD2  3  
ATOM   5735  H H    . LEU A 1 99  ? -1.300  -8.843  1.800   1.00 0.00 ? 99  LEU A H    3  
ATOM   5736  H HA   . LEU A 1 99  ? 1.406   -8.921  1.047   1.00 0.00 ? 99  LEU A HA   3  
ATOM   5737  H HB2  . LEU A 1 99  ? -0.749  -6.904  0.950   1.00 0.00 ? 99  LEU A HB2  3  
ATOM   5738  H HB3  . LEU A 1 99  ? 0.878   -6.299  0.895   1.00 0.00 ? 99  LEU A HB3  3  
ATOM   5739  H HG   . LEU A 1 99  ? -0.690  -7.571  -1.200  1.00 0.00 ? 99  LEU A HG   3  
ATOM   5740  H HD11 . LEU A 1 99  ? 1.906   -6.107  -1.353  1.00 0.00 ? 99  LEU A HD11 3  
ATOM   5741  H HD12 . LEU A 1 99  ? 0.364   -5.283  -1.121  1.00 0.00 ? 99  LEU A HD12 3  
ATOM   5742  H HD13 . LEU A 1 99  ? 0.652   -6.228  -2.584  1.00 0.00 ? 99  LEU A HD13 3  
ATOM   5743  H HD21 . LEU A 1 99  ? 2.215   -8.318  -1.065  1.00 0.00 ? 99  LEU A HD21 3  
ATOM   5744  H HD22 . LEU A 1 99  ? 1.013   -8.826  -2.250  1.00 0.00 ? 99  LEU A HD22 3  
ATOM   5745  H HD23 . LEU A 1 99  ? 0.924   -9.431  -0.599  1.00 0.00 ? 99  LEU A HD23 3  
ATOM   5746  N N    . GLN A 1 100 ? 0.793   -7.520  3.912   1.00 0.00 ? 100 GLN A N    3  
ATOM   5747  C CA   . GLN A 1 100 ? 1.444   -7.086  5.142   1.00 0.00 ? 100 GLN A CA   3  
ATOM   5748  C C    . GLN A 1 100 ? 2.445   -8.143  5.588   1.00 0.00 ? 100 GLN A C    3  
ATOM   5749  O O    . GLN A 1 100 ? 3.538   -7.819  6.039   1.00 0.00 ? 100 GLN A O    3  
ATOM   5750  C CB   . GLN A 1 100 ? 0.407   -6.846  6.258   1.00 0.00 ? 100 GLN A CB   3  
ATOM   5751  C CG   . GLN A 1 100 ? 0.996   -6.437  7.608   1.00 0.00 ? 100 GLN A CG   3  
ATOM   5752  C CD   . GLN A 1 100 ? -0.027  -6.478  8.729   1.00 0.00 ? 100 GLN A CD   3  
ATOM   5753  O OE1  . GLN A 1 100 ? -1.223  -6.265  8.519   1.00 0.00 ? 100 GLN A OE1  3  
ATOM   5754  N NE2  . GLN A 1 100 ? 0.441   -6.752  9.937   1.00 0.00 ? 100 GLN A NE2  3  
ATOM   5755  H H    . GLN A 1 100 ? -0.181  -7.656  3.904   1.00 0.00 ? 100 GLN A H    3  
ATOM   5756  H HA   . GLN A 1 100 ? 1.973   -6.165  4.923   1.00 0.00 ? 100 GLN A HA   3  
ATOM   5757  H HB2  . GLN A 1 100 ? -0.273  -6.068  5.941   1.00 0.00 ? 100 GLN A HB2  3  
ATOM   5758  H HB3  . GLN A 1 100 ? -0.153  -7.759  6.403   1.00 0.00 ? 100 GLN A HB3  3  
ATOM   5759  H HG2  . GLN A 1 100 ? 1.800   -7.115  7.860   1.00 0.00 ? 100 GLN A HG2  3  
ATOM   5760  H HG3  . GLN A 1 100 ? 1.381   -5.430  7.536   1.00 0.00 ? 100 GLN A HG3  3  
ATOM   5761  H HE21 . GLN A 1 100 ? 1.407   -6.906  10.036  1.00 0.00 ? 100 GLN A HE21 3  
ATOM   5762  H HE22 . GLN A 1 100 ? -0.193  -6.796  10.682  1.00 0.00 ? 100 GLN A HE22 3  
ATOM   5763  N N    . ASP A 1 101 ? 2.060   -9.413  5.455   1.00 0.00 ? 101 ASP A N    3  
ATOM   5764  C CA   . ASP A 1 101 ? 2.942   -10.526 5.802   1.00 0.00 ? 101 ASP A CA   3  
ATOM   5765  C C    . ASP A 1 101 ? 4.256   -10.433 5.042   1.00 0.00 ? 101 ASP A C    3  
ATOM   5766  O O    . ASP A 1 101 ? 5.325   -10.345 5.654   1.00 0.00 ? 101 ASP A O    3  
ATOM   5767  C CB   . ASP A 1 101 ? 2.281   -11.881 5.513   1.00 0.00 ? 101 ASP A CB   3  
ATOM   5768  C CG   . ASP A 1 101 ? 1.309   -12.313 6.593   1.00 0.00 ? 101 ASP A CG   3  
ATOM   5769  O OD1  . ASP A 1 101 ? 0.084   -12.186 6.389   1.00 0.00 ? 101 ASP A OD1  3  
ATOM   5770  O OD2  . ASP A 1 101 ? 1.764   -12.789 7.654   1.00 0.00 ? 101 ASP A OD2  3  
ATOM   5771  H H    . ASP A 1 101 ? 1.157   -9.604  5.115   1.00 0.00 ? 101 ASP A H    3  
ATOM   5772  H HA   . ASP A 1 101 ? 3.151   -10.460 6.859   1.00 0.00 ? 101 ASP A HA   3  
ATOM   5773  H HB2  . ASP A 1 101 ? 1.742   -11.817 4.580   1.00 0.00 ? 101 ASP A HB2  3  
ATOM   5774  H HB3  . ASP A 1 101 ? 3.050   -12.636 5.425   1.00 0.00 ? 101 ASP A HB3  3  
ATOM   5775  N N    . VAL A 1 102 ? 4.176   -10.426 3.711   1.00 0.00 ? 102 VAL A N    3  
ATOM   5776  C CA   . VAL A 1 102 ? 5.380   -10.382 2.878   1.00 0.00 ? 102 VAL A CA   3  
ATOM   5777  C C    . VAL A 1 102 ? 6.231   -9.149  3.188   1.00 0.00 ? 102 VAL A C    3  
ATOM   5778  O O    . VAL A 1 102 ? 7.398   -9.279  3.556   1.00 0.00 ? 102 VAL A O    3  
ATOM   5779  C CB   . VAL A 1 102 ? 5.061   -10.452 1.358   1.00 0.00 ? 102 VAL A CB   3  
ATOM   5780  C CG1  . VAL A 1 102 ? 3.911   -9.550  0.983   1.00 0.00 ? 102 VAL A CG1  3  
ATOM   5781  C CG2  . VAL A 1 102 ? 6.279   -10.100 0.518   1.00 0.00 ? 102 VAL A CG2  3  
ATOM   5782  H H    . VAL A 1 102 ? 3.288   -10.449 3.284   1.00 0.00 ? 102 VAL A H    3  
ATOM   5783  H HA   . VAL A 1 102 ? 5.966   -11.258 3.129   1.00 0.00 ? 102 VAL A HA   3  
ATOM   5784  H HB   . VAL A 1 102 ? 4.774   -11.458 1.121   1.00 0.00 ? 102 VAL A HB   3  
ATOM   5785  H HG11 . VAL A 1 102 ? 3.851   -9.485  -0.089  1.00 0.00 ? 102 VAL A HG11 3  
ATOM   5786  H HG12 . VAL A 1 102 ? 4.072   -8.567  1.397   1.00 0.00 ? 102 VAL A HG12 3  
ATOM   5787  H HG13 . VAL A 1 102 ? 2.993   -9.961  1.372   1.00 0.00 ? 102 VAL A HG13 3  
ATOM   5788  H HG21 . VAL A 1 102 ? 6.147   -9.111  0.094   1.00 0.00 ? 102 VAL A HG21 3  
ATOM   5789  H HG22 . VAL A 1 102 ? 6.389   -10.823 -0.278  1.00 0.00 ? 102 VAL A HG22 3  
ATOM   5790  H HG23 . VAL A 1 102 ? 7.161   -10.111 1.140   1.00 0.00 ? 102 VAL A HG23 3  
ATOM   5791  N N    . PHE A 1 103 ? 5.635   -7.966  3.075   1.00 0.00 ? 103 PHE A N    3  
ATOM   5792  C CA   . PHE A 1 103 ? 6.346   -6.711  3.326   1.00 0.00 ? 103 PHE A CA   3  
ATOM   5793  C C    . PHE A 1 103 ? 7.000   -6.688  4.713   1.00 0.00 ? 103 PHE A C    3  
ATOM   5794  O O    . PHE A 1 103 ? 8.112   -6.175  4.875   1.00 0.00 ? 103 PHE A O    3  
ATOM   5795  C CB   . PHE A 1 103 ? 5.400   -5.513  3.138   1.00 0.00 ? 103 PHE A CB   3  
ATOM   5796  C CG   . PHE A 1 103 ? 5.807   -4.284  3.917   1.00 0.00 ? 103 PHE A CG   3  
ATOM   5797  C CD1  . PHE A 1 103 ? 6.984   -3.619  3.607   1.00 0.00 ? 103 PHE A CD1  3  
ATOM   5798  C CD2  . PHE A 1 103 ? 5.029   -3.801  4.969   1.00 0.00 ? 103 PHE A CD2  3  
ATOM   5799  C CE1  . PHE A 1 103 ? 7.381   -2.508  4.324   1.00 0.00 ? 103 PHE A CE1  3  
ATOM   5800  C CE2  . PHE A 1 103 ? 5.423   -2.685  5.683   1.00 0.00 ? 103 PHE A CE2  3  
ATOM   5801  C CZ   . PHE A 1 103 ? 6.600   -2.041  5.362   1.00 0.00 ? 103 PHE A CZ   3  
ATOM   5802  H H    . PHE A 1 103 ? 4.689   -7.936  2.809   1.00 0.00 ? 103 PHE A H    3  
ATOM   5803  H HA   . PHE A 1 103 ? 7.130   -6.635  2.587   1.00 0.00 ? 103 PHE A HA   3  
ATOM   5804  H HB2  . PHE A 1 103 ? 5.391   -5.250  2.089   1.00 0.00 ? 103 PHE A HB2  3  
ATOM   5805  H HB3  . PHE A 1 103 ? 4.403   -5.793  3.436   1.00 0.00 ? 103 PHE A HB3  3  
ATOM   5806  H HD1  . PHE A 1 103 ? 7.598   -3.981  2.795   1.00 0.00 ? 103 PHE A HD1  3  
ATOM   5807  H HD2  . PHE A 1 103 ? 4.103   -4.297  5.226   1.00 0.00 ? 103 PHE A HD2  3  
ATOM   5808  H HE1  . PHE A 1 103 ? 8.301   -2.004  4.072   1.00 0.00 ? 103 PHE A HE1  3  
ATOM   5809  H HE2  . PHE A 1 103 ? 4.811   -2.320  6.496   1.00 0.00 ? 103 PHE A HE2  3  
ATOM   5810  H HZ   . PHE A 1 103 ? 6.910   -1.171  5.923   1.00 0.00 ? 103 PHE A HZ   3  
ATOM   5811  N N    . GLU A 1 104 ? 6.339   -7.275  5.704   1.00 0.00 ? 104 GLU A N    3  
ATOM   5812  C CA   . GLU A 1 104 ? 6.839   -7.263  7.054   1.00 0.00 ? 104 GLU A CA   3  
ATOM   5813  C C    . GLU A 1 104 ? 8.084   -8.137  7.164   1.00 0.00 ? 104 GLU A C    3  
ATOM   5814  O O    . GLU A 1 104 ? 9.095   -7.714  7.720   1.00 0.00 ? 104 GLU A O    3  
ATOM   5815  C CB   . GLU A 1 104 ? 5.739   -7.736  8.001   1.00 0.00 ? 104 GLU A CB   3  
ATOM   5816  C CG   . GLU A 1 104 ? 6.244   -8.148  9.358   1.00 0.00 ? 104 GLU A CG   3  
ATOM   5817  C CD   . GLU A 1 104 ? 6.847   -6.999  10.143  1.00 0.00 ? 104 GLU A CD   3  
ATOM   5818  O OE1  . GLU A 1 104 ? 6.264   -5.892  10.135  1.00 0.00 ? 104 GLU A OE1  3  
ATOM   5819  O OE2  . GLU A 1 104 ? 7.896   -7.199  10.790  1.00 0.00 ? 104 GLU A OE2  3  
ATOM   5820  H H    . GLU A 1 104 ? 5.510   -7.756  5.520   1.00 0.00 ? 104 GLU A H    3  
ATOM   5821  H HA   . GLU A 1 104 ? 7.105   -6.246  7.301   1.00 0.00 ? 104 GLU A HA   3  
ATOM   5822  H HB2  . GLU A 1 104 ? 5.027   -6.935  8.135   1.00 0.00 ? 104 GLU A HB2  3  
ATOM   5823  H HB3  . GLU A 1 104 ? 5.237   -8.582  7.555   1.00 0.00 ? 104 GLU A HB3  3  
ATOM   5824  H HG2  . GLU A 1 104 ? 5.427   -8.570  9.925   1.00 0.00 ? 104 GLU A HG2  3  
ATOM   5825  H HG3  . GLU A 1 104 ? 6.998   -8.894  9.197   1.00 0.00 ? 104 GLU A HG3  3  
ATOM   5826  N N    . PHE A 1 105 ? 8.014   -9.342  6.599   1.00 0.00 ? 105 PHE A N    3  
ATOM   5827  C CA   . PHE A 1 105 ? 9.156   -10.254 6.600   1.00 0.00 ? 105 PHE A CA   3  
ATOM   5828  C C    . PHE A 1 105 ? 10.335  -9.654  5.847   1.00 0.00 ? 105 PHE A C    3  
ATOM   5829  O O    . PHE A 1 105 ? 11.491  -9.893  6.196   1.00 0.00 ? 105 PHE A O    3  
ATOM   5830  C CB   . PHE A 1 105 ? 8.787   -11.603 5.977   1.00 0.00 ? 105 PHE A CB   3  
ATOM   5831  C CG   . PHE A 1 105 ? 8.054   -12.529 6.906   1.00 0.00 ? 105 PHE A CG   3  
ATOM   5832  C CD1  . PHE A 1 105 ? 6.701   -12.770 6.745   1.00 0.00 ? 105 PHE A CD1  3  
ATOM   5833  C CD2  . PHE A 1 105 ? 8.725   -13.165 7.937   1.00 0.00 ? 105 PHE A CD2  3  
ATOM   5834  C CE1  . PHE A 1 105 ? 6.030   -13.627 7.594   1.00 0.00 ? 105 PHE A CE1  3  
ATOM   5835  C CE2  . PHE A 1 105 ? 8.060   -14.021 8.792   1.00 0.00 ? 105 PHE A CE2  3  
ATOM   5836  C CZ   . PHE A 1 105 ? 6.711   -14.253 8.619   1.00 0.00 ? 105 PHE A CZ   3  
ATOM   5837  H H    . PHE A 1 105 ? 7.176   -9.621  6.166   1.00 0.00 ? 105 PHE A H    3  
ATOM   5838  H HA   . PHE A 1 105 ? 9.447   -10.414 7.628   1.00 0.00 ? 105 PHE A HA   3  
ATOM   5839  H HB2  . PHE A 1 105 ? 8.155   -11.431 5.118   1.00 0.00 ? 105 PHE A HB2  3  
ATOM   5840  H HB3  . PHE A 1 105 ? 9.690   -12.098 5.656   1.00 0.00 ? 105 PHE A HB3  3  
ATOM   5841  H HD1  . PHE A 1 105 ? 6.167   -12.280 5.943   1.00 0.00 ? 105 PHE A HD1  3  
ATOM   5842  H HD2  . PHE A 1 105 ? 9.781   -12.983 8.072   1.00 0.00 ? 105 PHE A HD2  3  
ATOM   5843  H HE1  . PHE A 1 105 ? 4.974   -13.806 7.457   1.00 0.00 ? 105 PHE A HE1  3  
ATOM   5844  H HE2  . PHE A 1 105 ? 8.595   -14.510 9.592   1.00 0.00 ? 105 PHE A HE2  3  
ATOM   5845  H HZ   . PHE A 1 105 ? 6.188   -14.923 9.284   1.00 0.00 ? 105 PHE A HZ   3  
ATOM   5846  N N    . ARG A 1 106 ? 10.038  -8.870  4.819   1.00 0.00 ? 106 ARG A N    3  
ATOM   5847  C CA   . ARG A 1 106 ? 11.073  -8.255  4.014   1.00 0.00 ? 106 ARG A CA   3  
ATOM   5848  C C    . ARG A 1 106 ? 11.828  -7.211  4.824   1.00 0.00 ? 106 ARG A C    3  
ATOM   5849  O O    . ARG A 1 106 ? 13.057  -7.227  4.880   1.00 0.00 ? 106 ARG A O    3  
ATOM   5850  C CB   . ARG A 1 106 ? 10.473  -7.612  2.765   1.00 0.00 ? 106 ARG A CB   3  
ATOM   5851  C CG   . ARG A 1 106 ? 9.750   -8.582  1.847   1.00 0.00 ? 106 ARG A CG   3  
ATOM   5852  C CD   . ARG A 1 106 ? 10.642  -9.728  1.403   1.00 0.00 ? 106 ARG A CD   3  
ATOM   5853  N NE   . ARG A 1 106 ? 9.922   -10.653 0.537   1.00 0.00 ? 106 ARG A NE   3  
ATOM   5854  C CZ   . ARG A 1 106 ? 9.872   -11.970 0.705   1.00 0.00 ? 106 ARG A CZ   3  
ATOM   5855  N NH1  . ARG A 1 106 ? 10.533  -12.555 1.696   1.00 0.00 ? 106 ARG A NH1  3  
ATOM   5856  N NH2  . ARG A 1 106 ? 9.162   -12.704 -0.139  1.00 0.00 ? 106 ARG A NH2  3  
ATOM   5857  H H    . ARG A 1 106 ? 9.097   -8.699  4.600   1.00 0.00 ? 106 ARG A H    3  
ATOM   5858  H HA   . ARG A 1 106 ? 11.764  -9.028  3.719   1.00 0.00 ? 106 ARG A HA   3  
ATOM   5859  H HB2  . ARG A 1 106 ? 9.767   -6.855  3.072   1.00 0.00 ? 106 ARG A HB2  3  
ATOM   5860  H HB3  . ARG A 1 106 ? 11.263  -7.145  2.207   1.00 0.00 ? 106 ARG A HB3  3  
ATOM   5861  H HG2  . ARG A 1 106 ? 8.898   -8.989  2.372   1.00 0.00 ? 106 ARG A HG2  3  
ATOM   5862  H HG3  . ARG A 1 106 ? 9.409   -8.045  0.973   1.00 0.00 ? 106 ARG A HG3  3  
ATOM   5863  H HD2  . ARG A 1 106 ? 11.482  -9.324  0.856   1.00 0.00 ? 106 ARG A HD2  3  
ATOM   5864  H HD3  . ARG A 1 106 ? 10.994  -10.258 2.273   1.00 0.00 ? 106 ARG A HD3  3  
ATOM   5865  H HE   . ARG A 1 106 ? 9.434   -10.250 -0.230  1.00 0.00 ? 106 ARG A HE   3  
ATOM   5866  H HH11 . ARG A 1 106 ? 11.085  -12.005 2.331   1.00 0.00 ? 106 ARG A HH11 3  
ATOM   5867  H HH12 . ARG A 1 106 ? 10.480  -13.549 1.819   1.00 0.00 ? 106 ARG A HH12 3  
ATOM   5868  H HH21 . ARG A 1 106 ? 8.667   -12.257 -0.899  1.00 0.00 ? 106 ARG A HH21 3  
ATOM   5869  H HH22 . ARG A 1 106 ? 9.117   -13.700 -0.032  1.00 0.00 ? 106 ARG A HH22 3  
ATOM   5870  N N    . TYR A 1 107 ? 11.089  -6.317  5.467   1.00 0.00 ? 107 TYR A N    3  
ATOM   5871  C CA   . TYR A 1 107 ? 11.710  -5.275  6.279   1.00 0.00 ? 107 TYR A CA   3  
ATOM   5872  C C    . TYR A 1 107 ? 12.359  -5.890  7.519   1.00 0.00 ? 107 TYR A C    3  
ATOM   5873  O O    . TYR A 1 107 ? 13.367  -5.392  8.015   1.00 0.00 ? 107 TYR A O    3  
ATOM   5874  C CB   . TYR A 1 107 ? 10.693  -4.199  6.689   1.00 0.00 ? 107 TYR A CB   3  
ATOM   5875  C CG   . TYR A 1 107 ? 11.343  -2.942  7.244   1.00 0.00 ? 107 TYR A CG   3  
ATOM   5876  C CD1  . TYR A 1 107 ? 11.567  -1.834  6.435   1.00 0.00 ? 107 TYR A CD1  3  
ATOM   5877  C CD2  . TYR A 1 107 ? 11.751  -2.875  8.571   1.00 0.00 ? 107 TYR A CD2  3  
ATOM   5878  C CE1  . TYR A 1 107 ? 12.180  -0.699  6.932   1.00 0.00 ? 107 TYR A CE1  3  
ATOM   5879  C CE2  . TYR A 1 107 ? 12.360  -1.740  9.074   1.00 0.00 ? 107 TYR A CE2  3  
ATOM   5880  C CZ   . TYR A 1 107 ? 12.573  -0.656  8.252   1.00 0.00 ? 107 TYR A CZ   3  
ATOM   5881  O OH   . TYR A 1 107 ? 13.195  0.471   8.744   1.00 0.00 ? 107 TYR A OH   3  
ATOM   5882  H H    . TYR A 1 107 ? 10.109  -6.356  5.390   1.00 0.00 ? 107 TYR A H    3  
ATOM   5883  H HA   . TYR A 1 107 ? 12.480  -4.815  5.676   1.00 0.00 ? 107 TYR A HA   3  
ATOM   5884  H HB2  . TYR A 1 107 ? 10.107  -3.919  5.825   1.00 0.00 ? 107 TYR A HB2  3  
ATOM   5885  H HB3  . TYR A 1 107 ? 10.042  -4.598  7.451   1.00 0.00 ? 107 TYR A HB3  3  
ATOM   5886  H HD1  . TYR A 1 107 ? 11.254  -1.863  5.402   1.00 0.00 ? 107 TYR A HD1  3  
ATOM   5887  H HD2  . TYR A 1 107 ? 11.584  -3.725  9.215   1.00 0.00 ? 107 TYR A HD2  3  
ATOM   5888  H HE1  . TYR A 1 107 ? 12.346  0.150   6.288   1.00 0.00 ? 107 TYR A HE1  3  
ATOM   5889  H HE2  . TYR A 1 107 ? 12.666  -1.709  10.109  1.00 0.00 ? 107 TYR A HE2  3  
ATOM   5890  H HH   . TYR A 1 107 ? 14.123  0.264   8.948   1.00 0.00 ? 107 TYR A HH   3  
ATOM   5891  N N    . ALA A 1 108 ? 11.782  -6.982  8.008   1.00 0.00 ? 108 ALA A N    3  
ATOM   5892  C CA   . ALA A 1 108 ? 12.330  -7.687  9.162   1.00 0.00 ? 108 ALA A CA   3  
ATOM   5893  C C    . ALA A 1 108 ? 13.682  -8.309  8.833   1.00 0.00 ? 108 ALA A C    3  
ATOM   5894  O O    . ALA A 1 108 ? 14.579  -8.361  9.677   1.00 0.00 ? 108 ALA A O    3  
ATOM   5895  C CB   . ALA A 1 108 ? 11.361  -8.756  9.635   1.00 0.00 ? 108 ALA A CB   3  
ATOM   5896  H H    . ALA A 1 108 ? 10.959  -7.318  7.590   1.00 0.00 ? 108 ALA A H    3  
ATOM   5897  H HA   . ALA A 1 108 ? 12.457  -6.971  9.962   1.00 0.00 ? 108 ALA A HA   3  
ATOM   5898  H HB1  . ALA A 1 108 ? 10.397  -8.309  9.825   1.00 0.00 ? 108 ALA A HB1  3  
ATOM   5899  H HB2  . ALA A 1 108 ? 11.737  -9.205  10.541  1.00 0.00 ? 108 ALA A HB2  3  
ATOM   5900  H HB3  . ALA A 1 108 ? 11.262  -9.514  8.872   1.00 0.00 ? 108 ALA A HB3  3  
ATOM   5901  N N    . LYS A 1 109 ? 13.822  -8.783  7.600   1.00 0.00 ? 109 LYS A N    3  
ATOM   5902  C CA   . LYS A 1 109 ? 15.083  -9.344  7.135   1.00 0.00 ? 109 LYS A CA   3  
ATOM   5903  C C    . LYS A 1 109 ? 16.046  -8.221  6.771   1.00 0.00 ? 109 LYS A C    3  
ATOM   5904  O O    . LYS A 1 109 ? 17.257  -8.423  6.669   1.00 0.00 ? 109 LYS A O    3  
ATOM   5905  C CB   . LYS A 1 109 ? 14.856  -10.229 5.910   1.00 0.00 ? 109 LYS A CB   3  
ATOM   5906  C CG   . LYS A 1 109 ? 15.468  -11.615 6.029   1.00 0.00 ? 109 LYS A CG   3  
ATOM   5907  C CD   . LYS A 1 109 ? 14.722  -12.491 7.028   1.00 0.00 ? 109 LYS A CD   3  
ATOM   5908  C CE   . LYS A 1 109 ? 13.293  -12.774 6.580   1.00 0.00 ? 109 LYS A CE   3  
ATOM   5909  N NZ   . LYS A 1 109 ? 12.606  -13.731 7.485   1.00 0.00 ? 109 LYS A NZ   3  
ATOM   5910  H H    . LYS A 1 109 ? 13.054  -8.756  6.988   1.00 0.00 ? 109 LYS A H    3  
ATOM   5911  H HA   . LYS A 1 109 ? 15.508  -9.935  7.932   1.00 0.00 ? 109 LYS A HA   3  
ATOM   5912  H HB2  . LYS A 1 109 ? 13.793  -10.333 5.742   1.00 0.00 ? 109 LYS A HB2  3  
ATOM   5913  H HB3  . LYS A 1 109 ? 15.296  -9.743  5.054   1.00 0.00 ? 109 LYS A HB3  3  
ATOM   5914  H HG2  . LYS A 1 109 ? 15.439  -12.093 5.061   1.00 0.00 ? 109 LYS A HG2  3  
ATOM   5915  H HG3  . LYS A 1 109 ? 16.497  -11.513 6.351   1.00 0.00 ? 109 LYS A HG3  3  
ATOM   5916  H HD2  . LYS A 1 109 ? 15.247  -13.429 7.128   1.00 0.00 ? 109 LYS A HD2  3  
ATOM   5917  H HD3  . LYS A 1 109 ? 14.697  -11.991 7.983   1.00 0.00 ? 109 LYS A HD3  3  
ATOM   5918  H HE2  . LYS A 1 109 ? 12.741  -11.848 6.570   1.00 0.00 ? 109 LYS A HE2  3  
ATOM   5919  H HE3  . LYS A 1 109 ? 13.314  -13.190 5.585   1.00 0.00 ? 109 LYS A HE3  3  
ATOM   5920  H HZ1  . LYS A 1 109 ? 12.492  -13.315 8.431   1.00 0.00 ? 109 LYS A HZ1  3  
ATOM   5921  H HZ2  . LYS A 1 109 ? 13.164  -14.604 7.573   1.00 0.00 ? 109 LYS A HZ2  3  
ATOM   5922  H HZ3  . LYS A 1 109 ? 11.667  -13.972 7.109   1.00 0.00 ? 109 LYS A HZ3  3  
ATOM   5923  N N    . MET A 1 110 ? 15.482  -7.045  6.563   1.00 0.00 ? 110 MET A N    3  
ATOM   5924  C CA   . MET A 1 110 ? 16.248  -5.863  6.196   1.00 0.00 ? 110 MET A CA   3  
ATOM   5925  C C    . MET A 1 110 ? 16.864  -5.213  7.432   1.00 0.00 ? 110 MET A C    3  
ATOM   5926  O O    . MET A 1 110 ? 16.171  -4.948  8.411   1.00 0.00 ? 110 MET A O    3  
ATOM   5927  C CB   . MET A 1 110 ? 15.341  -4.867  5.446   1.00 0.00 ? 110 MET A CB   3  
ATOM   5928  C CG   . MET A 1 110 ? 15.921  -3.471  5.288   1.00 0.00 ? 110 MET A CG   3  
ATOM   5929  S SD   . MET A 1 110 ? 15.572  -2.417  6.706   1.00 0.00 ? 110 MET A SD   3  
ATOM   5930  C CE   . MET A 1 110 ? 16.434  -0.936  6.220   1.00 0.00 ? 110 MET A CE   3  
ATOM   5931  H H    . MET A 1 110 ? 14.511  -6.967  6.670   1.00 0.00 ? 110 MET A H    3  
ATOM   5932  H HA   . MET A 1 110 ? 17.042  -6.178  5.536   1.00 0.00 ? 110 MET A HA   3  
ATOM   5933  H HB2  . MET A 1 110 ? 15.136  -5.257  4.461   1.00 0.00 ? 110 MET A HB2  3  
ATOM   5934  H HB3  . MET A 1 110 ? 14.409  -4.777  5.985   1.00 0.00 ? 110 MET A HB3  3  
ATOM   5935  H HG2  . MET A 1 110 ? 16.990  -3.549  5.173   1.00 0.00 ? 110 MET A HG2  3  
ATOM   5936  H HG3  . MET A 1 110 ? 15.500  -3.014  4.404   1.00 0.00 ? 110 MET A HG3  3  
ATOM   5937  H HE1  . MET A 1 110 ? 16.091  -0.633  5.241   1.00 0.00 ? 110 MET A HE1  3  
ATOM   5938  H HE2  . MET A 1 110 ? 17.496  -1.130  6.187   1.00 0.00 ? 110 MET A HE2  3  
ATOM   5939  H HE3  . MET A 1 110 ? 16.233  -0.150  6.933   1.00 0.00 ? 110 MET A HE3  3  
ATOM   5940  N N    . PRO A 1 111 ? 18.186  -5.002  7.429   1.00 0.00 ? 111 PRO A N    3  
ATOM   5941  C CA   . PRO A 1 111 ? 18.862  -4.270  8.489   1.00 0.00 ? 111 PRO A CA   3  
ATOM   5942  C C    . PRO A 1 111 ? 18.952  -2.776  8.200   1.00 0.00 ? 111 PRO A C    3  
ATOM   5943  O O    . PRO A 1 111 ? 19.098  -2.357  7.047   1.00 0.00 ? 111 PRO A O    3  
ATOM   5944  C CB   . PRO A 1 111 ? 20.248  -4.892  8.494   1.00 0.00 ? 111 PRO A CB   3  
ATOM   5945  C CG   . PRO A 1 111 ? 20.491  -5.317  7.079   1.00 0.00 ? 111 PRO A CG   3  
ATOM   5946  C CD   . PRO A 1 111 ? 19.140  -5.492  6.419   1.00 0.00 ? 111 PRO A CD   3  
ATOM   5947  H HA   . PRO A 1 111 ? 18.388  -4.427  9.446   1.00 0.00 ? 111 PRO A HA   3  
ATOM   5948  H HB2  . PRO A 1 111 ? 20.968  -4.154  8.817   1.00 0.00 ? 111 PRO A HB2  3  
ATOM   5949  H HB3  . PRO A 1 111 ? 20.261  -5.734  9.167   1.00 0.00 ? 111 PRO A HB3  3  
ATOM   5950  H HG2  . PRO A 1 111 ? 21.056  -4.553  6.565   1.00 0.00 ? 111 PRO A HG2  3  
ATOM   5951  H HG3  . PRO A 1 111 ? 21.033  -6.250  7.068   1.00 0.00 ? 111 PRO A HG3  3  
ATOM   5952  H HD2  . PRO A 1 111 ? 19.084  -4.894  5.516   1.00 0.00 ? 111 PRO A HD2  3  
ATOM   5953  H HD3  . PRO A 1 111 ? 18.966  -6.538  6.195   1.00 0.00 ? 111 PRO A HD3  3  
ATOM   5954  N N    . ASP A 1 112 ? 18.883  -1.980  9.255   1.00 0.00 ? 112 ASP A N    3  
ATOM   5955  C CA   . ASP A 1 112 ? 18.953  -0.531  9.130   1.00 0.00 ? 112 ASP A CA   3  
ATOM   5956  C C    . ASP A 1 112 ? 20.375  -0.066  9.397   1.00 0.00 ? 112 ASP A C    3  
ATOM   5957  O O    . ASP A 1 112 ? 21.223  -0.161  8.484   1.00 0.00 ? 112 ASP A O    3  
ATOM   5958  C CB   . ASP A 1 112 ? 18.003  0.157   10.121  1.00 0.00 ? 112 ASP A CB   3  
ATOM   5959  C CG   . ASP A 1 112 ? 16.542  -0.183  9.903   1.00 0.00 ? 112 ASP A CG   3  
ATOM   5960  O OD1  . ASP A 1 112 ? 16.083  -1.215  10.439  1.00 0.00 ? 112 ASP A OD1  3  
ATOM   5961  O OD2  . ASP A 1 112 ? 15.837  0.603   9.233   1.00 0.00 ? 112 ASP A OD2  3  
ATOM   5962  O OXT  . ASP A 1 112 ? 20.647  0.378   10.531  1.00 0.00 ? 112 ASP A OXT  3  
ATOM   5963  H H    . ASP A 1 112 ? 18.801  -2.379  10.144  1.00 0.00 ? 112 ASP A H    3  
ATOM   5964  H HA   . ASP A 1 112 ? 18.675  -0.264  8.121   1.00 0.00 ? 112 ASP A HA   3  
ATOM   5965  H HB2  . ASP A 1 112 ? 18.269  -0.140  11.123  1.00 0.00 ? 112 ASP A HB2  3  
ATOM   5966  H HB3  . ASP A 1 112 ? 18.119  1.224   10.029  1.00 0.00 ? 112 ASP A HB3  3  
ATOM   5967  N N    . HIS B 2 1   ? -26.027 9.894   7.489   1.00 0.00 ? 281 HIS B N    3  
ATOM   5968  C CA   . HIS B 2 1   ? -25.409 8.714   6.838   1.00 0.00 ? 281 HIS B CA   3  
ATOM   5969  C C    . HIS B 2 1   ? -24.250 8.190   7.676   1.00 0.00 ? 281 HIS B C    3  
ATOM   5970  O O    . HIS B 2 1   ? -23.088 8.307   7.286   1.00 0.00 ? 281 HIS B O    3  
ATOM   5971  C CB   . HIS B 2 1   ? -24.907 9.071   5.432   1.00 0.00 ? 281 HIS B CB   3  
ATOM   5972  C CG   . HIS B 2 1   ? -25.991 9.469   4.477   1.00 0.00 ? 281 HIS B CG   3  
ATOM   5973  N ND1  . HIS B 2 1   ? -26.256 10.781  4.144   1.00 0.00 ? 281 HIS B ND1  3  
ATOM   5974  C CD2  . HIS B 2 1   ? -26.871 8.721   3.771   1.00 0.00 ? 281 HIS B CD2  3  
ATOM   5975  C CE1  . HIS B 2 1   ? -27.253 10.822  3.280   1.00 0.00 ? 281 HIS B CE1  3  
ATOM   5976  N NE2  . HIS B 2 1   ? -27.643 9.586   3.037   1.00 0.00 ? 281 HIS B NE2  3  
ATOM   5977  H H1   . HIS B 2 1   ? -26.372 9.641   8.434   1.00 0.00 ? 281 HIS B H1   3  
ATOM   5978  H H2   . HIS B 2 1   ? -26.829 10.239  6.925   1.00 0.00 ? 281 HIS B H2   3  
ATOM   5979  H H3   . HIS B 2 1   ? -25.328 10.659  7.584   1.00 0.00 ? 281 HIS B H3   3  
ATOM   5980  H HA   . HIS B 2 1   ? -26.156 7.939   6.760   1.00 0.00 ? 281 HIS B HA   3  
ATOM   5981  H HB2  . HIS B 2 1   ? -24.214 9.895   5.506   1.00 0.00 ? 281 HIS B HB2  3  
ATOM   5982  H HB3  . HIS B 2 1   ? -24.395 8.216   5.015   1.00 0.00 ? 281 HIS B HB3  3  
ATOM   5983  H HD1  . HIS B 2 1   ? -25.777 11.570  4.488   1.00 0.00 ? 281 HIS B HD1  3  
ATOM   5984  H HD2  . HIS B 2 1   ? -26.951 7.643   3.784   1.00 0.00 ? 281 HIS B HD2  3  
ATOM   5985  H HE1  . HIS B 2 1   ? -27.676 11.715  2.847   1.00 0.00 ? 281 HIS B HE1  3  
ATOM   5986  H HE2  . HIS B 2 1   ? -28.292 9.325   2.346   1.00 0.00 ? 281 HIS B HE2  3  
ATOM   5987  N N    . ASN B 2 2   ? -24.566 7.599   8.823   1.00 0.00 ? 282 ASN B N    3  
ATOM   5988  C CA   . ASN B 2 2   ? -23.541 7.079   9.727   1.00 0.00 ? 282 ASN B CA   3  
ATOM   5989  C C    . ASN B 2 2   ? -23.034 5.720   9.264   1.00 0.00 ? 282 ASN B C    3  
ATOM   5990  O O    . ASN B 2 2   ? -23.171 4.721   9.969   1.00 0.00 ? 282 ASN B O    3  
ATOM   5991  C CB   . ASN B 2 2   ? -24.077 6.979   11.158  1.00 0.00 ? 282 ASN B CB   3  
ATOM   5992  C CG   . ASN B 2 2   ? -24.112 8.321   11.862  1.00 0.00 ? 282 ASN B CG   3  
ATOM   5993  O OD1  . ASN B 2 2   ? -25.103 9.050   11.794  1.00 0.00 ? 282 ASN B OD1  3  
ATOM   5994  N ND2  . ASN B 2 2   ? -23.032 8.653   12.552  1.00 0.00 ? 282 ASN B ND2  3  
ATOM   5995  H H    . ASN B 2 2   ? -25.514 7.504   9.069   1.00 0.00 ? 282 ASN B H    3  
ATOM   5996  H HA   . ASN B 2 2   ? -22.715 7.774   9.714   1.00 0.00 ? 282 ASN B HA   3  
ATOM   5997  H HB2  . ASN B 2 2   ? -25.081 6.584   11.133  1.00 0.00 ? 282 ASN B HB2  3  
ATOM   5998  H HB3  . ASN B 2 2   ? -23.445 6.311   11.725  1.00 0.00 ? 282 ASN B HB3  3  
ATOM   5999  H HD21 . ASN B 2 2   ? -22.279 8.020   12.572  1.00 0.00 ? 282 ASN B HD21 3  
ATOM   6000  H HD22 . ASN B 2 2   ? -23.025 9.518   13.014  1.00 0.00 ? 282 ASN B HD22 3  
ATOM   6001  N N    . LEU B 2 3   ? -22.451 5.696   8.077   1.00 0.00 ? 283 LEU B N    3  
ATOM   6002  C CA   . LEU B 2 3   ? -21.887 4.479   7.515   1.00 0.00 ? 283 LEU B CA   3  
ATOM   6003  C C    . LEU B 2 3   ? -20.930 4.837   6.390   1.00 0.00 ? 283 LEU B C    3  
ATOM   6004  O O    . LEU B 2 3   ? -21.031 5.915   5.800   1.00 0.00 ? 283 LEU B O    3  
ATOM   6005  C CB   . LEU B 2 3   ? -22.987 3.539   6.986   1.00 0.00 ? 283 LEU B CB   3  
ATOM   6006  C CG   . LEU B 2 3   ? -23.655 3.948   5.664   1.00 0.00 ? 283 LEU B CG   3  
ATOM   6007  C CD1  . LEU B 2 3   ? -24.528 2.818   5.144   1.00 0.00 ? 283 LEU B CD1  3  
ATOM   6008  C CD2  . LEU B 2 3   ? -24.488 5.210   5.830   1.00 0.00 ? 283 LEU B CD2  3  
ATOM   6009  H H    . LEU B 2 3   ? -22.390 6.530   7.560   1.00 0.00 ? 283 LEU B H    3  
ATOM   6010  H HA   . LEU B 2 3   ? -21.336 3.976   8.296   1.00 0.00 ? 283 LEU B HA   3  
ATOM   6011  H HB2  . LEU B 2 3   ? -22.553 2.560   6.852   1.00 0.00 ? 283 LEU B HB2  3  
ATOM   6012  H HB3  . LEU B 2 3   ? -23.755 3.468   7.741   1.00 0.00 ? 283 LEU B HB3  3  
ATOM   6013  H HG   . LEU B 2 3   ? -22.890 4.145   4.927   1.00 0.00 ? 283 LEU B HG   3  
ATOM   6014  H HD11 . LEU B 2 3   ? -23.920 1.946   4.968   1.00 0.00 ? 283 LEU B HD11 3  
ATOM   6015  H HD12 . LEU B 2 3   ? -24.998 3.121   4.220   1.00 0.00 ? 283 LEU B HD12 3  
ATOM   6016  H HD13 . LEU B 2 3   ? -25.287 2.586   5.875   1.00 0.00 ? 283 LEU B HD13 3  
ATOM   6017  H HD21 . LEU B 2 3   ? -24.944 5.467   4.885   1.00 0.00 ? 283 LEU B HD21 3  
ATOM   6018  H HD22 . LEU B 2 3   ? -23.854 6.020   6.156   1.00 0.00 ? 283 LEU B HD22 3  
ATOM   6019  H HD23 . LEU B 2 3   ? -25.258 5.038   6.566   1.00 0.00 ? 283 LEU B HD23 3  
ATOM   6020  N N    . LEU B 2 4   ? -19.992 3.952   6.106   1.00 0.00 ? 284 LEU B N    3  
ATOM   6021  C CA   . LEU B 2 4   ? -19.075 4.152   5.000   1.00 0.00 ? 284 LEU B CA   3  
ATOM   6022  C C    . LEU B 2 4   ? -19.399 3.195   3.866   1.00 0.00 ? 284 LEU B C    3  
ATOM   6023  O O    . LEU B 2 4   ? -19.683 2.015   4.090   1.00 0.00 ? 284 LEU B O    3  
ATOM   6024  C CB   . LEU B 2 4   ? -17.621 3.968   5.446   1.00 0.00 ? 284 LEU B CB   3  
ATOM   6025  C CG   . LEU B 2 4   ? -17.084 5.044   6.395   1.00 0.00 ? 284 LEU B CG   3  
ATOM   6026  C CD1  . LEU B 2 4   ? -15.631 4.767   6.748   1.00 0.00 ? 284 LEU B CD1  3  
ATOM   6027  C CD2  . LEU B 2 4   ? -17.228 6.424   5.771   1.00 0.00 ? 284 LEU B CD2  3  
ATOM   6028  H H    . LEU B 2 4   ? -19.913 3.141   6.654   1.00 0.00 ? 284 LEU B H    3  
ATOM   6029  H HA   . LEU B 2 4   ? -19.207 5.164   4.645   1.00 0.00 ? 284 LEU B HA   3  
ATOM   6030  H HB2  . LEU B 2 4   ? -17.535 3.010   5.938   1.00 0.00 ? 284 LEU B HB2  3  
ATOM   6031  H HB3  . LEU B 2 4   ? -16.997 3.957   4.566   1.00 0.00 ? 284 LEU B HB3  3  
ATOM   6032  H HG   . LEU B 2 4   ? -17.657 5.030   7.308   1.00 0.00 ? 284 LEU B HG   3  
ATOM   6033  H HD11 . LEU B 2 4   ? -15.034 4.774   5.848   1.00 0.00 ? 284 LEU B HD11 3  
ATOM   6034  H HD12 . LEU B 2 4   ? -15.554 3.802   7.224   1.00 0.00 ? 284 LEU B HD12 3  
ATOM   6035  H HD13 . LEU B 2 4   ? -15.273 5.530   7.425   1.00 0.00 ? 284 LEU B HD13 3  
ATOM   6036  H HD21 . LEU B 2 4   ? -16.775 7.159   6.418   1.00 0.00 ? 284 LEU B HD21 3  
ATOM   6037  H HD22 . LEU B 2 4   ? -18.276 6.653   5.645   1.00 0.00 ? 284 LEU B HD22 3  
ATOM   6038  H HD23 . LEU B 2 4   ? -16.738 6.437   4.809   1.00 0.00 ? 284 LEU B HD23 3  
ATOM   6039  N N    . ARG B 2 5   ? -19.384 3.722   2.653   1.00 0.00 ? 285 ARG B N    3  
ATOM   6040  C CA   . ARG B 2 5   ? -19.608 2.922   1.459   1.00 0.00 ? 285 ARG B CA   3  
ATOM   6041  C C    . ARG B 2 5   ? -18.449 1.961   1.275   1.00 0.00 ? 285 ARG B C    3  
ATOM   6042  O O    . ARG B 2 5   ? -17.304 2.324   1.524   1.00 0.00 ? 285 ARG B O    3  
ATOM   6043  C CB   . ARG B 2 5   ? -19.721 3.830   0.235   1.00 0.00 ? 285 ARG B CB   3  
ATOM   6044  C CG   . ARG B 2 5   ? -20.739 4.943   0.397   1.00 0.00 ? 285 ARG B CG   3  
ATOM   6045  C CD   . ARG B 2 5   ? -20.636 5.951   -0.726  1.00 0.00 ? 285 ARG B CD   3  
ATOM   6046  N NE   . ARG B 2 5   ? -20.982 5.373   -2.025  1.00 0.00 ? 285 ARG B NE   3  
ATOM   6047  C CZ   . ARG B 2 5   ? -22.131 5.611   -2.661  1.00 0.00 ? 285 ARG B CZ   3  
ATOM   6048  N NH1  . ARG B 2 5   ? -23.058 6.380   -2.100  1.00 0.00 ? 285 ARG B NH1  3  
ATOM   6049  N NH2  . ARG B 2 5   ? -22.355 5.071   -3.854  1.00 0.00 ? 285 ARG B NH2  3  
ATOM   6050  H H    . ARG B 2 5   ? -19.209 4.680   2.556   1.00 0.00 ? 285 ARG B H    3  
ATOM   6051  H HA   . ARG B 2 5   ? -20.523 2.364   1.585   1.00 0.00 ? 285 ARG B HA   3  
ATOM   6052  H HB2  . ARG B 2 5   ? -18.757 4.278   0.044   1.00 0.00 ? 285 ARG B HB2  3  
ATOM   6053  H HB3  . ARG B 2 5   ? -20.006 3.232   -0.617  1.00 0.00 ? 285 ARG B HB3  3  
ATOM   6054  H HG2  . ARG B 2 5   ? -21.731 4.518   0.397   1.00 0.00 ? 285 ARG B HG2  3  
ATOM   6055  H HG3  . ARG B 2 5   ? -20.562 5.449   1.331   1.00 0.00 ? 285 ARG B HG3  3  
ATOM   6056  H HD2  . ARG B 2 5   ? -21.304 6.770   -0.518  1.00 0.00 ? 285 ARG B HD2  3  
ATOM   6057  H HD3  . ARG B 2 5   ? -19.618 6.318   -0.759  1.00 0.00 ? 285 ARG B HD3  3  
ATOM   6058  H HE   . ARG B 2 5   ? -20.317 4.784   -2.451  1.00 0.00 ? 285 ARG B HE   3  
ATOM   6059  H HH11 . ARG B 2 5   ? -22.903 6.787   -1.196  1.00 0.00 ? 285 ARG B HH11 3  
ATOM   6060  H HH12 . ARG B 2 5   ? -23.924 6.556   -2.579  1.00 0.00 ? 285 ARG B HH12 3  
ATOM   6061  H HH21 . ARG B 2 5   ? -21.663 4.481   -4.281  1.00 0.00 ? 285 ARG B HH21 3  
ATOM   6062  H HH22 . ARG B 2 5   ? -23.218 5.251   -4.338  1.00 0.00 ? 285 ARG B HH22 3  
ATOM   6063  N N    . ILE B 2 6   ? -18.727 0.745   0.854   1.00 0.00 ? 286 ILE B N    3  
ATOM   6064  C CA   . ILE B 2 6   ? -17.662 -0.225  0.678   1.00 0.00 ? 286 ILE B CA   3  
ATOM   6065  C C    . ILE B 2 6   ? -17.090 -0.154  -0.732  1.00 0.00 ? 286 ILE B C    3  
ATOM   6066  O O    . ILE B 2 6   ? -17.821 0.009   -1.714  1.00 0.00 ? 286 ILE B O    3  
ATOM   6067  C CB   . ILE B 2 6   ? -18.118 -1.663  1.006   1.00 0.00 ? 286 ILE B CB   3  
ATOM   6068  C CG1  . ILE B 2 6   ? -19.294 -2.094  0.128   1.00 0.00 ? 286 ILE B CG1  3  
ATOM   6069  C CG2  . ILE B 2 6   ? -18.478 -1.770  2.479   1.00 0.00 ? 286 ILE B CG2  3  
ATOM   6070  C CD1  . ILE B 2 6   ? -19.827 -3.470  0.470   1.00 0.00 ? 286 ILE B CD1  3  
ATOM   6071  H H    . ILE B 2 6   ? -19.653 0.498   0.649   1.00 0.00 ? 286 ILE B H    3  
ATOM   6072  H HA   . ILE B 2 6   ? -16.876 0.037   1.373   1.00 0.00 ? 286 ILE B HA   3  
ATOM   6073  H HB   . ILE B 2 6   ? -17.282 -2.324  0.823   1.00 0.00 ? 286 ILE B HB   3  
ATOM   6074  H HG12 . ILE B 2 6   ? -20.101 -1.386  0.245   1.00 0.00 ? 286 ILE B HG12 3  
ATOM   6075  H HG13 . ILE B 2 6   ? -18.978 -2.107  -0.903  1.00 0.00 ? 286 ILE B HG13 3  
ATOM   6076  H HG21 . ILE B 2 6   ? -18.821 -2.771  2.694   1.00 0.00 ? 286 ILE B HG21 3  
ATOM   6077  H HG22 . ILE B 2 6   ? -19.261 -1.063  2.710   1.00 0.00 ? 286 ILE B HG22 3  
ATOM   6078  H HG23 . ILE B 2 6   ? -17.608 -1.550  3.080   1.00 0.00 ? 286 ILE B HG23 3  
ATOM   6079  H HD11 . ILE B 2 6   ? -19.001 -4.157  0.588   1.00 0.00 ? 286 ILE B HD11 3  
ATOM   6080  H HD12 . ILE B 2 6   ? -20.472 -3.815  -0.325  1.00 0.00 ? 286 ILE B HD12 3  
ATOM   6081  H HD13 . ILE B 2 6   ? -20.388 -3.421  1.392   1.00 0.00 ? 286 ILE B HD13 3  
HETATM 6082  O OH   . ALY B 2 7   ? -9.455  1.930   0.619   1.00 0.00 ? 287 ALY B OH   3  
HETATM 6083  C CH   . ALY B 2 7   ? -8.807  1.444   -0.307  1.00 0.00 ? 287 ALY B CH   3  
HETATM 6084  C CH3  . ALY B 2 7   ? -7.277  1.464   -0.247  1.00 0.00 ? 287 ALY B CH3  3  
HETATM 6085  N NZ   . ALY B 2 7   ? -9.393  0.898   -1.359  1.00 0.00 ? 287 ALY B NZ   3  
HETATM 6086  C CE   . ALY B 2 7   ? -10.835 0.825   -1.542  1.00 0.00 ? 287 ALY B CE   3  
HETATM 6087  C CD   . ALY B 2 7   ? -11.207 -0.134  -2.660  1.00 0.00 ? 287 ALY B CD   3  
HETATM 6088  C CG   . ALY B 2 7   ? -12.683 -0.058  -3.006  1.00 0.00 ? 287 ALY B CG   3  
HETATM 6089  C CB   . ALY B 2 7   ? -13.555 -0.328  -1.796  1.00 0.00 ? 287 ALY B CB   3  
HETATM 6090  C CA   . ALY B 2 7   ? -15.045 -0.187  -2.068  1.00 0.00 ? 287 ALY B CA   3  
HETATM 6091  N N    . ALY B 2 7   ? -15.768 -0.229  -0.805  1.00 0.00 ? 287 ALY B N    3  
HETATM 6092  C C    . ALY B 2 7   ? -15.521 -1.297  -2.997  1.00 0.00 ? 287 ALY B C    3  
HETATM 6093  O O    . ALY B 2 7   ? -15.687 -2.443  -2.578  1.00 0.00 ? 287 ALY B O    3  
HETATM 6094  H HH31 . ALY B 2 7   ? -6.877  1.170   -1.210  1.00 0.00 ? 287 ALY B HH31 3  
HETATM 6095  H HH32 . ALY B 2 7   ? -6.940  2.462   -0.005  1.00 0.00 ? 287 ALY B HH32 3  
HETATM 6096  H HH33 . ALY B 2 7   ? -6.937  0.775   0.512   1.00 0.00 ? 287 ALY B HH33 3  
HETATM 6097  H HZ   . ALY B 2 7   ? -8.827  0.527   -2.068  1.00 0.00 ? 287 ALY B HZ   3  
HETATM 6098  H HE3  . ALY B 2 7   ? -11.210 1.807   -1.784  1.00 0.00 ? 287 ALY B HE3  3  
HETATM 6099  H HE2  . ALY B 2 7   ? -11.286 0.480   -0.623  1.00 0.00 ? 287 ALY B HE2  3  
HETATM 6100  H HD3  . ALY B 2 7   ? -10.973 -1.140  -2.349  1.00 0.00 ? 287 ALY B HD3  3  
HETATM 6101  H HD2  . ALY B 2 7   ? -10.630 0.115   -3.539  1.00 0.00 ? 287 ALY B HD2  3  
HETATM 6102  H HG3  . ALY B 2 7   ? -12.903 -0.793  -3.765  1.00 0.00 ? 287 ALY B HG3  3  
HETATM 6103  H HG2  . ALY B 2 7   ? -12.906 0.929   -3.383  1.00 0.00 ? 287 ALY B HG2  3  
HETATM 6104  H HB3  . ALY B 2 7   ? -13.277 0.365   -1.016  1.00 0.00 ? 287 ALY B HB3  3  
HETATM 6105  H HB2  . ALY B 2 7   ? -13.365 -1.329  -1.456  1.00 0.00 ? 287 ALY B HB2  3  
HETATM 6106  H HCA  . ALY B 2 7   ? -15.222 0.768   -2.537  1.00 0.00 ? 287 ALY B HCA  3  
HETATM 6107  H H    . ALY B 2 7   ? -15.256 -0.309  0.026   1.00 0.00 ? 287 ALY B H    3  
ATOM   6108  N N    . GLN B 2 8   ? -15.732 -0.954  -4.257  1.00 0.00 ? 288 GLN B N    3  
ATOM   6109  C CA   . GLN B 2 8   ? -16.270 -1.891  -5.231  1.00 0.00 ? 288 GLN B CA   3  
ATOM   6110  C C    . GLN B 2 8   ? -15.159 -2.788  -5.790  1.00 0.00 ? 288 GLN B C    3  
ATOM   6111  O O    . GLN B 2 8   ? -14.860 -2.770  -6.983  1.00 0.00 ? 288 GLN B O    3  
ATOM   6112  C CB   . GLN B 2 8   ? -16.964 -1.108  -6.348  1.00 0.00 ? 288 GLN B CB   3  
ATOM   6113  C CG   . GLN B 2 8   ? -17.778 -1.960  -7.303  1.00 0.00 ? 288 GLN B CG   3  
ATOM   6114  C CD   . GLN B 2 8   ? -18.465 -1.123  -8.362  1.00 0.00 ? 288 GLN B CD   3  
ATOM   6115  O OE1  . GLN B 2 8   ? -17.901 -0.860  -9.422  1.00 0.00 ? 288 GLN B OE1  3  
ATOM   6116  N NE2  . GLN B 2 8   ? -19.684 -0.694  -8.078  1.00 0.00 ? 288 GLN B NE2  3  
ATOM   6117  H H    . GLN B 2 8   ? -15.515 -0.044  -4.544  1.00 0.00 ? 288 GLN B H    3  
ATOM   6118  H HA   . GLN B 2 8   ? -16.999 -2.511  -4.728  1.00 0.00 ? 288 GLN B HA   3  
ATOM   6119  H HB2  . GLN B 2 8   ? -17.626 -0.383  -5.900  1.00 0.00 ? 288 GLN B HB2  3  
ATOM   6120  H HB3  . GLN B 2 8   ? -16.212 -0.586  -6.920  1.00 0.00 ? 288 GLN B HB3  3  
ATOM   6121  H HG2  . GLN B 2 8   ? -17.120 -2.665  -7.791  1.00 0.00 ? 288 GLN B HG2  3  
ATOM   6122  H HG3  . GLN B 2 8   ? -18.530 -2.495  -6.742  1.00 0.00 ? 288 GLN B HG3  3  
ATOM   6123  H HE21 . GLN B 2 8   ? -20.070 -0.937  -7.208  1.00 0.00 ? 288 GLN B HE21 3  
ATOM   6124  H HE22 . GLN B 2 8   ? -20.155 -0.155  -8.749  1.00 0.00 ? 288 GLN B HE22 3  
ATOM   6125  N N    . PHE B 2 9   ? -14.547 -3.568  -4.909  1.00 0.00 ? 289 PHE B N    3  
ATOM   6126  C CA   . PHE B 2 9   ? -13.459 -4.464  -5.289  1.00 0.00 ? 289 PHE B CA   3  
ATOM   6127  C C    . PHE B 2 9   ? -13.939 -5.910  -5.333  1.00 0.00 ? 289 PHE B C    3  
ATOM   6128  O O    . PHE B 2 9   ? -13.323 -6.804  -4.751  1.00 0.00 ? 289 PHE B O    3  
ATOM   6129  C CB   . PHE B 2 9   ? -12.279 -4.324  -4.319  1.00 0.00 ? 289 PHE B CB   3  
ATOM   6130  C CG   . PHE B 2 9   ? -11.287 -3.260  -4.709  1.00 0.00 ? 289 PHE B CG   3  
ATOM   6131  C CD1  . PHE B 2 9   ? -11.611 -2.289  -5.644  1.00 0.00 ? 289 PHE B CD1  3  
ATOM   6132  C CD2  . PHE B 2 9   ? -10.022 -3.241  -4.144  1.00 0.00 ? 289 PHE B CD2  3  
ATOM   6133  C CE1  . PHE B 2 9   ? -10.692 -1.322  -6.008  1.00 0.00 ? 289 PHE B CE1  3  
ATOM   6134  C CE2  . PHE B 2 9   ? -9.101  -2.274  -4.502  1.00 0.00 ? 289 PHE B CE2  3  
ATOM   6135  C CZ   . PHE B 2 9   ? -9.436  -1.314  -5.435  1.00 0.00 ? 289 PHE B CZ   3  
ATOM   6136  H H    . PHE B 2 9   ? -14.843 -3.548  -3.972  1.00 0.00 ? 289 PHE B H    3  
ATOM   6137  H HA   . PHE B 2 9   ? -13.133 -4.182  -6.279  1.00 0.00 ? 289 PHE B HA   3  
ATOM   6138  H HB2  . PHE B 2 9   ? -12.656 -4.078  -3.339  1.00 0.00 ? 289 PHE B HB2  3  
ATOM   6139  H HB3  . PHE B 2 9   ? -11.751 -5.266  -4.270  1.00 0.00 ? 289 PHE B HB3  3  
ATOM   6140  H HD1  . PHE B 2 9   ? -12.596 -2.287  -6.086  1.00 0.00 ? 289 PHE B HD1  3  
ATOM   6141  H HD2  . PHE B 2 9   ? -9.757  -3.990  -3.412  1.00 0.00 ? 289 PHE B HD2  3  
ATOM   6142  H HE1  . PHE B 2 9   ? -10.956 -0.574  -6.738  1.00 0.00 ? 289 PHE B HE1  3  
ATOM   6143  H HE2  . PHE B 2 9   ? -8.122  -2.267  -4.050  1.00 0.00 ? 289 PHE B HE2  3  
ATOM   6144  H HZ   . PHE B 2 9   ? -8.717  -0.560  -5.717  1.00 0.00 ? 289 PHE B HZ   3  
ATOM   6145  N N    . LEU B 2 10  ? -15.040 -6.128  -6.029  1.00 0.00 ? 290 LEU B N    3  
ATOM   6146  C CA   . LEU B 2 10  ? -15.593 -7.462  -6.190  1.00 0.00 ? 290 LEU B CA   3  
ATOM   6147  C C    . LEU B 2 10  ? -15.846 -7.740  -7.665  1.00 0.00 ? 290 LEU B C    3  
ATOM   6148  O O    . LEU B 2 10  ? -15.868 -6.808  -8.472  1.00 0.00 ? 290 LEU B O    3  
ATOM   6149  C CB   . LEU B 2 10  ? -16.887 -7.645  -5.375  1.00 0.00 ? 290 LEU B CB   3  
ATOM   6150  C CG   . LEU B 2 10  ? -18.082 -6.765  -5.776  1.00 0.00 ? 290 LEU B CG   3  
ATOM   6151  C CD1  . LEU B 2 10  ? -19.366 -7.336  -5.199  1.00 0.00 ? 290 LEU B CD1  3  
ATOM   6152  C CD2  . LEU B 2 10  ? -17.899 -5.333  -5.291  1.00 0.00 ? 290 LEU B CD2  3  
ATOM   6153  H H    . LEU B 2 10  ? -15.488 -5.373  -6.464  1.00 0.00 ? 290 LEU B H    3  
ATOM   6154  H HA   . LEU B 2 10  ? -14.854 -8.164  -5.832  1.00 0.00 ? 290 LEU B HA   3  
ATOM   6155  H HB2  . LEU B 2 10  ? -17.191 -8.677  -5.462  1.00 0.00 ? 290 LEU B HB2  3  
ATOM   6156  H HB3  . LEU B 2 10  ? -16.659 -7.446  -4.340  1.00 0.00 ? 290 LEU B HB3  3  
ATOM   6157  H HG   . LEU B 2 10  ? -18.171 -6.751  -6.853  1.00 0.00 ? 290 LEU B HG   3  
ATOM   6158  H HD11 . LEU B 2 10  ? -20.201 -6.721  -5.499  1.00 0.00 ? 290 LEU B HD11 3  
ATOM   6159  H HD12 . LEU B 2 10  ? -19.301 -7.354  -4.121  1.00 0.00 ? 290 LEU B HD12 3  
ATOM   6160  H HD13 . LEU B 2 10  ? -19.510 -8.341  -5.568  1.00 0.00 ? 290 LEU B HD13 3  
ATOM   6161  H HD21 . LEU B 2 10  ? -17.012 -4.911  -5.737  1.00 0.00 ? 290 LEU B HD21 3  
ATOM   6162  H HD22 . LEU B 2 10  ? -17.799 -5.327  -4.216  1.00 0.00 ? 290 LEU B HD22 3  
ATOM   6163  H HD23 . LEU B 2 10  ? -18.759 -4.744  -5.575  1.00 0.00 ? 290 LEU B HD23 3  
ATOM   6164  N N    . GLN B 2 11  ? -16.027 -9.004  -8.018  1.00 0.00 ? 291 GLN B N    3  
ATOM   6165  C CA   . GLN B 2 11  ? -16.177 -9.396  -9.416  1.00 0.00 ? 291 GLN B CA   3  
ATOM   6166  C C    . GLN B 2 11  ? -17.373 -8.695  -10.057 1.00 0.00 ? 291 GLN B C    3  
ATOM   6167  O O    . GLN B 2 11  ? -17.235 -8.016  -11.079 1.00 0.00 ? 291 GLN B O    3  
ATOM   6168  C CB   . GLN B 2 11  ? -16.337 -10.914 -9.527  1.00 0.00 ? 291 GLN B CB   3  
ATOM   6169  C CG   . GLN B 2 11  ? -16.294 -11.427 -10.956 1.00 0.00 ? 291 GLN B CG   3  
ATOM   6170  C CD   . GLN B 2 11  ? -14.943 -11.221 -11.613 1.00 0.00 ? 291 GLN B CD   3  
ATOM   6171  O OE1  . GLN B 2 11  ? -13.904 -11.238 -10.949 1.00 0.00 ? 291 GLN B OE1  3  
ATOM   6172  N NE2  . GLN B 2 11  ? -14.946 -11.013 -12.919 1.00 0.00 ? 291 GLN B NE2  3  
ATOM   6173  H H    . GLN B 2 11  ? -16.061 -9.696  -7.322  1.00 0.00 ? 291 GLN B H    3  
ATOM   6174  H HA   . GLN B 2 11  ? -15.280 -9.099  -9.939  1.00 0.00 ? 291 GLN B HA   3  
ATOM   6175  H HB2  . GLN B 2 11  ? -15.541 -11.389 -8.973  1.00 0.00 ? 291 GLN B HB2  3  
ATOM   6176  H HB3  . GLN B 2 11  ? -17.284 -11.197 -9.093  1.00 0.00 ? 291 GLN B HB3  3  
ATOM   6177  H HG2  . GLN B 2 11  ? -16.517 -12.483 -10.953 1.00 0.00 ? 291 GLN B HG2  3  
ATOM   6178  H HG3  . GLN B 2 11  ? -17.043 -10.905 -11.533 1.00 0.00 ? 291 GLN B HG3  3  
ATOM   6179  H HE21 . GLN B 2 11  ? -15.809 -11.000 -13.385 1.00 0.00 ? 291 GLN B HE21 3  
ATOM   6180  H HE22 . GLN B 2 11  ? -14.085 -10.886 -13.371 1.00 0.00 ? 291 GLN B HE22 3  
ATOM   6181  N N    . SER B 2 12  ? -18.535 -8.845  -9.446  1.00 0.00 ? 292 SER B N    3  
ATOM   6182  C CA   . SER B 2 12  ? -19.749 -8.241  -9.965  1.00 0.00 ? 292 SER B CA   3  
ATOM   6183  C C    . SER B 2 12  ? -20.435 -7.430  -8.871  1.00 0.00 ? 292 SER B C    3  
ATOM   6184  O O    . SER B 2 12  ? -21.172 -8.024  -8.060  1.00 0.00 ? 292 SER B O    3  
ATOM   6185  C CB   . SER B 2 12  ? -20.683 -9.326  -10.510 1.00 0.00 ? 292 SER B CB   3  
ATOM   6186  O OG   . SER B 2 12  ? -21.766 -8.768  -11.238 1.00 0.00 ? 292 SER B OG   3  
ATOM   6187  O OXT  . SER B 2 12  ? -20.217 -6.199  -8.817  1.00 0.00 ? 292 SER B OXT  3  
ATOM   6188  H H    . SER B 2 12  ? -18.579 -9.371  -8.618  1.00 0.00 ? 292 SER B H    3  
ATOM   6189  H HA   . SER B 2 12  ? -19.470 -7.576  -10.768 1.00 0.00 ? 292 SER B HA   3  
ATOM   6190  H HB2  . SER B 2 12  ? -20.126 -9.980  -11.166 1.00 0.00 ? 292 SER B HB2  3  
ATOM   6191  H HB3  . SER B 2 12  ? -21.079 -9.902  -9.685  1.00 0.00 ? 292 SER B HB3  3  
ATOM   6192  H HG   . SER B 2 12  ? -21.449 -8.016  -11.753 1.00 0.00 ? 292 SER B HG   3  
ATOM   6193  N N    . GLY A 1 1   ? 21.755  12.656  -4.571  1.00 0.00 ? 1   GLY A N    4  
ATOM   6194  C CA   . GLY A 1 1   ? 20.825  11.611  -5.058  1.00 0.00 ? 1   GLY A CA   4  
ATOM   6195  C C    . GLY A 1 1   ? 21.266  10.229  -4.635  1.00 0.00 ? 1   GLY A C    4  
ATOM   6196  O O    . GLY A 1 1   ? 21.660  10.037  -3.486  1.00 0.00 ? 1   GLY A O    4  
ATOM   6197  H H1   . GLY A 1 1   ? 21.826  12.615  -3.534  1.00 0.00 ? 1   GLY A H1   4  
ATOM   6198  H H2   . GLY A 1 1   ? 21.415  13.596  -4.848  1.00 0.00 ? 1   GLY A H2   4  
ATOM   6199  H H3   . GLY A 1 1   ? 22.699  12.507  -4.978  1.00 0.00 ? 1   GLY A H3   4  
ATOM   6200  H HA2  . GLY A 1 1   ? 19.840  11.801  -4.660  1.00 0.00 ? 1   GLY A HA2  4  
ATOM   6201  H HA3  . GLY A 1 1   ? 20.782  11.652  -6.137  1.00 0.00 ? 1   GLY A HA3  4  
ATOM   6202  N N    . LYS A 1 2   ? 21.206  9.281   -5.570  1.00 0.00 ? 2   LYS A N    4  
ATOM   6203  C CA   . LYS A 1 2   ? 21.581  7.887   -5.321  1.00 0.00 ? 2   LYS A CA   4  
ATOM   6204  C C    . LYS A 1 2   ? 20.620  7.196   -4.357  1.00 0.00 ? 2   LYS A C    4  
ATOM   6205  O O    . LYS A 1 2   ? 19.782  7.830   -3.716  1.00 0.00 ? 2   LYS A O    4  
ATOM   6206  C CB   . LYS A 1 2   ? 23.014  7.777   -4.795  1.00 0.00 ? 2   LYS A CB   4  
ATOM   6207  C CG   . LYS A 1 2   ? 24.077  8.120   -5.825  1.00 0.00 ? 2   LYS A CG   4  
ATOM   6208  C CD   . LYS A 1 2   ? 24.028  7.168   -7.008  1.00 0.00 ? 2   LYS A CD   4  
ATOM   6209  C CE   . LYS A 1 2   ? 25.156  7.431   -7.988  1.00 0.00 ? 2   LYS A CE   4  
ATOM   6210  N NZ   . LYS A 1 2   ? 25.091  6.516   -9.155  1.00 0.00 ? 2   LYS A NZ   4  
ATOM   6211  H H    . LYS A 1 2   ? 20.896  9.527   -6.467  1.00 0.00 ? 2   LYS A H    4  
ATOM   6212  H HA   . LYS A 1 2   ? 21.531  7.371   -6.264  1.00 0.00 ? 2   LYS A HA   4  
ATOM   6213  H HB2  . LYS A 1 2   ? 23.131  8.445   -3.954  1.00 0.00 ? 2   LYS A HB2  4  
ATOM   6214  H HB3  . LYS A 1 2   ? 23.180  6.764   -4.465  1.00 0.00 ? 2   LYS A HB3  4  
ATOM   6215  H HG2  . LYS A 1 2   ? 23.909  9.126   -6.179  1.00 0.00 ? 2   LYS A HG2  4  
ATOM   6216  H HG3  . LYS A 1 2   ? 25.049  8.055   -5.360  1.00 0.00 ? 2   LYS A HG3  4  
ATOM   6217  H HD2  . LYS A 1 2   ? 24.112  6.155   -6.644  1.00 0.00 ? 2   LYS A HD2  4  
ATOM   6218  H HD3  . LYS A 1 2   ? 23.084  7.291   -7.518  1.00 0.00 ? 2   LYS A HD3  4  
ATOM   6219  H HE2  . LYS A 1 2   ? 25.085  8.452   -8.335  1.00 0.00 ? 2   LYS A HE2  4  
ATOM   6220  H HE3  . LYS A 1 2   ? 26.098  7.288   -7.480  1.00 0.00 ? 2   LYS A HE3  4  
ATOM   6221  H HZ1  . LYS A 1 2   ? 25.082  5.527   -8.834  1.00 0.00 ? 2   LYS A HZ1  4  
ATOM   6222  H HZ2  . LYS A 1 2   ? 25.914  6.659   -9.771  1.00 0.00 ? 2   LYS A HZ2  4  
ATOM   6223  H HZ3  . LYS A 1 2   ? 24.227  6.697   -9.705  1.00 0.00 ? 2   LYS A HZ3  4  
ATOM   6224  N N    . LEU A 1 3   ? 20.717  5.880   -4.311  1.00 0.00 ? 3   LEU A N    4  
ATOM   6225  C CA   . LEU A 1 3   ? 19.945  5.079   -3.378  1.00 0.00 ? 3   LEU A CA   4  
ATOM   6226  C C    . LEU A 1 3   ? 20.887  4.322   -2.454  1.00 0.00 ? 3   LEU A C    4  
ATOM   6227  O O    . LEU A 1 3   ? 21.599  3.415   -2.890  1.00 0.00 ? 3   LEU A O    4  
ATOM   6228  C CB   . LEU A 1 3   ? 19.047  4.087   -4.127  1.00 0.00 ? 3   LEU A CB   4  
ATOM   6229  C CG   . LEU A 1 3   ? 17.805  4.678   -4.799  1.00 0.00 ? 3   LEU A CG   4  
ATOM   6230  C CD1  . LEU A 1 3   ? 17.124  3.619   -5.650  1.00 0.00 ? 3   LEU A CD1  4  
ATOM   6231  C CD2  . LEU A 1 3   ? 16.830  5.212   -3.759  1.00 0.00 ? 3   LEU A CD2  4  
ATOM   6232  H H    . LEU A 1 3   ? 21.333  5.427   -4.928  1.00 0.00 ? 3   LEU A H    4  
ATOM   6233  H HA   . LEU A 1 3   ? 19.333  5.743   -2.790  1.00 0.00 ? 3   LEU A HA   4  
ATOM   6234  H HB2  . LEU A 1 3   ? 19.646  3.599   -4.891  1.00 0.00 ? 3   LEU A HB2  4  
ATOM   6235  H HB3  . LEU A 1 3   ? 18.716  3.342   -3.422  1.00 0.00 ? 3   LEU A HB3  4  
ATOM   6236  H HG   . LEU A 1 3   ? 18.099  5.495   -5.443  1.00 0.00 ? 3   LEU A HG   4  
ATOM   6237  H HD11 . LEU A 1 3   ? 16.948  2.735   -5.051  1.00 0.00 ? 3   LEU A HD11 4  
ATOM   6238  H HD12 . LEU A 1 3   ? 17.758  3.366   -6.487  1.00 0.00 ? 3   LEU A HD12 4  
ATOM   6239  H HD13 . LEU A 1 3   ? 16.182  4.001   -6.015  1.00 0.00 ? 3   LEU A HD13 4  
ATOM   6240  H HD21 . LEU A 1 3   ? 17.335  5.908   -3.107  1.00 0.00 ? 3   LEU A HD21 4  
ATOM   6241  H HD22 . LEU A 1 3   ? 16.443  4.390   -3.176  1.00 0.00 ? 3   LEU A HD22 4  
ATOM   6242  H HD23 . LEU A 1 3   ? 16.013  5.714   -4.256  1.00 0.00 ? 3   LEU A HD23 4  
ATOM   6243  N N    . SER A 1 4   ? 20.902  4.710   -1.187  1.00 0.00 ? 4   SER A N    4  
ATOM   6244  C CA   . SER A 1 4   ? 21.757  4.073   -0.196  1.00 0.00 ? 4   SER A CA   4  
ATOM   6245  C C    . SER A 1 4   ? 21.323  2.626   0.047   1.00 0.00 ? 4   SER A C    4  
ATOM   6246  O O    . SER A 1 4   ? 20.332  2.178   -0.522  1.00 0.00 ? 4   SER A O    4  
ATOM   6247  C CB   . SER A 1 4   ? 21.708  4.866   1.107   1.00 0.00 ? 4   SER A CB   4  
ATOM   6248  O OG   . SER A 1 4   ? 21.908  6.248   0.874   1.00 0.00 ? 4   SER A OG   4  
ATOM   6249  H H    . SER A 1 4   ? 20.332  5.455   -0.910  1.00 0.00 ? 4   SER A H    4  
ATOM   6250  H HA   . SER A 1 4   ? 22.765  4.078   -0.576  1.00 0.00 ? 4   SER A HA   4  
ATOM   6251  H HB2  . SER A 1 4   ? 20.743  4.729   1.576   1.00 0.00 ? 4   SER A HB2  4  
ATOM   6252  H HB3  . SER A 1 4   ? 22.484  4.512   1.769   1.00 0.00 ? 4   SER A HB3  4  
ATOM   6253  H HG   . SER A 1 4   ? 21.783  6.732   1.703   1.00 0.00 ? 4   SER A HG   4  
ATOM   6254  N N    . GLU A 1 5   ? 22.050  1.906   0.899   1.00 0.00 ? 5   GLU A N    4  
ATOM   6255  C CA   . GLU A 1 5   ? 21.754  0.495   1.166   1.00 0.00 ? 5   GLU A CA   4  
ATOM   6256  C C    . GLU A 1 5   ? 20.302  0.311   1.596   1.00 0.00 ? 5   GLU A C    4  
ATOM   6257  O O    . GLU A 1 5   ? 19.584  -0.538  1.062   1.00 0.00 ? 5   GLU A O    4  
ATOM   6258  C CB   . GLU A 1 5   ? 22.680  -0.069  2.252   1.00 0.00 ? 5   GLU A CB   4  
ATOM   6259  C CG   . GLU A 1 5   ? 24.131  -0.233  1.824   1.00 0.00 ? 5   GLU A CG   4  
ATOM   6260  C CD   . GLU A 1 5   ? 24.842  1.084   1.605   1.00 0.00 ? 5   GLU A CD   4  
ATOM   6261  O OE1  . GLU A 1 5   ? 25.174  1.405   0.444   1.00 0.00 ? 5   GLU A OE1  4  
ATOM   6262  O OE2  . GLU A 1 5   ? 25.070  1.811   2.594   1.00 0.00 ? 5   GLU A OE2  4  
ATOM   6263  H H    . GLU A 1 5   ? 22.801  2.333   1.365   1.00 0.00 ? 5   GLU A H    4  
ATOM   6264  H HA   . GLU A 1 5   ? 21.916  -0.053  0.250   1.00 0.00 ? 5   GLU A HA   4  
ATOM   6265  H HB2  . GLU A 1 5   ? 22.656  0.594   3.103   1.00 0.00 ? 5   GLU A HB2  4  
ATOM   6266  H HB3  . GLU A 1 5   ? 22.307  -1.036  2.553   1.00 0.00 ? 5   GLU A HB3  4  
ATOM   6267  H HG2  . GLU A 1 5   ? 24.657  -0.781  2.591   1.00 0.00 ? 5   GLU A HG2  4  
ATOM   6268  H HG3  . GLU A 1 5   ? 24.157  -0.796  0.903   1.00 0.00 ? 5   GLU A HG3  4  
ATOM   6269  N N    . GLN A 1 6   ? 19.871  1.128   2.547   1.00 0.00 ? 6   GLN A N    4  
ATOM   6270  C CA   . GLN A 1 6   ? 18.510  1.060   3.066   1.00 0.00 ? 6   GLN A CA   4  
ATOM   6271  C C    . GLN A 1 6   ? 17.497  1.385   1.965   1.00 0.00 ? 6   GLN A C    4  
ATOM   6272  O O    . GLN A 1 6   ? 16.467  0.722   1.844   1.00 0.00 ? 6   GLN A O    4  
ATOM   6273  C CB   . GLN A 1 6   ? 18.341  2.020   4.257   1.00 0.00 ? 6   GLN A CB   4  
ATOM   6274  C CG   . GLN A 1 6   ? 18.935  1.520   5.580   1.00 0.00 ? 6   GLN A CG   4  
ATOM   6275  C CD   . GLN A 1 6   ? 20.333  0.937   5.456   1.00 0.00 ? 6   GLN A CD   4  
ATOM   6276  O OE1  . GLN A 1 6   ? 21.331  1.639   5.609   1.00 0.00 ? 6   GLN A OE1  4  
ATOM   6277  N NE2  . GLN A 1 6   ? 20.417  -0.357  5.184   1.00 0.00 ? 6   GLN A NE2  4  
ATOM   6278  H H    . GLN A 1 6   ? 20.491  1.796   2.914   1.00 0.00 ? 6   GLN A H    4  
ATOM   6279  H HA   . GLN A 1 6   ? 18.336  0.047   3.406   1.00 0.00 ? 6   GLN A HA   4  
ATOM   6280  H HB2  . GLN A 1 6   ? 18.809  2.961   4.012   1.00 0.00 ? 6   GLN A HB2  4  
ATOM   6281  H HB3  . GLN A 1 6   ? 17.281  2.187   4.411   1.00 0.00 ? 6   GLN A HB3  4  
ATOM   6282  H HG2  . GLN A 1 6   ? 18.986  2.357   6.266   1.00 0.00 ? 6   GLN A HG2  4  
ATOM   6283  H HG3  . GLN A 1 6   ? 18.281  0.766   5.989   1.00 0.00 ? 6   GLN A HG3  4  
ATOM   6284  H HE21 . GLN A 1 6   ? 19.586  -0.866  5.083   1.00 0.00 ? 6   GLN A HE21 4  
ATOM   6285  H HE22 . GLN A 1 6   ? 21.310  -0.751  5.086   1.00 0.00 ? 6   GLN A HE22 4  
ATOM   6286  N N    . LEU A 1 7   ? 17.811  2.380   1.139   1.00 0.00 ? 7   LEU A N    4  
ATOM   6287  C CA   . LEU A 1 7   ? 16.907  2.797   0.069   1.00 0.00 ? 7   LEU A CA   4  
ATOM   6288  C C    . LEU A 1 7   ? 16.978  1.828   -1.116  1.00 0.00 ? 7   LEU A C    4  
ATOM   6289  O O    . LEU A 1 7   ? 16.077  1.777   -1.951  1.00 0.00 ? 7   LEU A O    4  
ATOM   6290  C CB   . LEU A 1 7   ? 17.218  4.233   -0.372  1.00 0.00 ? 7   LEU A CB   4  
ATOM   6291  C CG   . LEU A 1 7   ? 17.014  5.289   0.709   1.00 0.00 ? 7   LEU A CG   4  
ATOM   6292  C CD1  . LEU A 1 7   ? 17.577  6.625   0.255   1.00 0.00 ? 7   LEU A CD1  4  
ATOM   6293  C CD2  . LEU A 1 7   ? 15.538  5.426   1.055   1.00 0.00 ? 7   LEU A CD2  4  
ATOM   6294  H H    . LEU A 1 7   ? 18.670  2.839   1.248   1.00 0.00 ? 7   LEU A H    4  
ATOM   6295  H HA   . LEU A 1 7   ? 15.906  2.769   0.475   1.00 0.00 ? 7   LEU A HA   4  
ATOM   6296  H HB2  . LEU A 1 7   ? 18.245  4.276   -0.704  1.00 0.00 ? 7   LEU A HB2  4  
ATOM   6297  H HB3  . LEU A 1 7   ? 16.579  4.488   -1.205  1.00 0.00 ? 7   LEU A HB3  4  
ATOM   6298  H HG   . LEU A 1 7   ? 17.537  4.985   1.601   1.00 0.00 ? 7   LEU A HG   4  
ATOM   6299  H HD11 . LEU A 1 7   ? 18.622  6.512   0.018   1.00 0.00 ? 7   LEU A HD11 4  
ATOM   6300  H HD12 . LEU A 1 7   ? 17.462  7.352   1.045   1.00 0.00 ? 7   LEU A HD12 4  
ATOM   6301  H HD13 . LEU A 1 7   ? 17.043  6.960   -0.622  1.00 0.00 ? 7   LEU A HD13 4  
ATOM   6302  H HD21 . LEU A 1 7   ? 15.224  4.584   1.654   1.00 0.00 ? 7   LEU A HD21 4  
ATOM   6303  H HD22 . LEU A 1 7   ? 14.958  5.456   0.145   1.00 0.00 ? 7   LEU A HD22 4  
ATOM   6304  H HD23 . LEU A 1 7   ? 15.383  6.340   1.609   1.00 0.00 ? 7   LEU A HD23 4  
ATOM   6305  N N    . LYS A 1 8   ? 18.051  1.059   -1.191  1.00 0.00 ? 8   LYS A N    4  
ATOM   6306  C CA   . LYS A 1 8   ? 18.136  -0.030  -2.153  1.00 0.00 ? 8   LYS A CA   4  
ATOM   6307  C C    . LYS A 1 8   ? 17.209  -1.137  -1.738  1.00 0.00 ? 8   LYS A C    4  
ATOM   6308  O O    . LYS A 1 8   ? 16.437  -1.667  -2.535  1.00 0.00 ? 8   LYS A O    4  
ATOM   6309  C CB   . LYS A 1 8   ? 19.552  -0.596  -2.226  1.00 0.00 ? 8   LYS A CB   4  
ATOM   6310  C CG   . LYS A 1 8   ? 20.290  -0.226  -3.477  1.00 0.00 ? 8   LYS A CG   4  
ATOM   6311  C CD   . LYS A 1 8   ? 19.474  -0.557  -4.708  1.00 0.00 ? 8   LYS A CD   4  
ATOM   6312  C CE   . LYS A 1 8   ? 19.113  0.707   -5.445  1.00 0.00 ? 8   LYS A CE   4  
ATOM   6313  N NZ   . LYS A 1 8   ? 20.252  1.227   -6.247  1.00 0.00 ? 8   LYS A NZ   4  
ATOM   6314  H H    . LYS A 1 8   ? 18.815  1.236   -0.595  1.00 0.00 ? 8   LYS A H    4  
ATOM   6315  H HA   . LYS A 1 8   ? 17.837  0.346   -3.122  1.00 0.00 ? 8   LYS A HA   4  
ATOM   6316  H HB2  . LYS A 1 8   ? 20.111  -0.216  -1.393  1.00 0.00 ? 8   LYS A HB2  4  
ATOM   6317  H HB3  . LYS A 1 8   ? 19.504  -1.672  -2.161  1.00 0.00 ? 8   LYS A HB3  4  
ATOM   6318  H HG2  . LYS A 1 8   ? 20.473  0.831   -3.448  1.00 0.00 ? 8   LYS A HG2  4  
ATOM   6319  H HG3  . LYS A 1 8   ? 21.226  -0.762  -3.512  1.00 0.00 ? 8   LYS A HG3  4  
ATOM   6320  H HD2  . LYS A 1 8   ? 20.052  -1.197  -5.358  1.00 0.00 ? 8   LYS A HD2  4  
ATOM   6321  H HD3  . LYS A 1 8   ? 18.563  -1.063  -4.407  1.00 0.00 ? 8   LYS A HD3  4  
ATOM   6322  H HE2  . LYS A 1 8   ? 18.275  0.512   -6.097  1.00 0.00 ? 8   LYS A HE2  4  
ATOM   6323  H HE3  . LYS A 1 8   ? 18.840  1.446   -4.703  1.00 0.00 ? 8   LYS A HE3  4  
ATOM   6324  H HZ1  . LYS A 1 8   ? 19.970  2.085   -6.760  1.00 0.00 ? 8   LYS A HZ1  4  
ATOM   6325  H HZ2  . LYS A 1 8   ? 20.559  0.511   -6.938  1.00 0.00 ? 8   LYS A HZ2  4  
ATOM   6326  H HZ3  . LYS A 1 8   ? 21.054  1.455   -5.626  1.00 0.00 ? 8   LYS A HZ3  4  
ATOM   6327  N N    . HIS A 1 9   ? 17.310  -1.487  -0.475  1.00 0.00 ? 9   HIS A N    4  
ATOM   6328  C CA   . HIS A 1 9   ? 16.464  -2.522  0.087   1.00 0.00 ? 9   HIS A CA   4  
ATOM   6329  C C    . HIS A 1 9   ? 14.995  -2.127  -0.025  1.00 0.00 ? 9   HIS A C    4  
ATOM   6330  O O    . HIS A 1 9   ? 14.141  -2.981  -0.255  1.00 0.00 ? 9   HIS A O    4  
ATOM   6331  C CB   . HIS A 1 9   ? 16.821  -2.814  1.546   1.00 0.00 ? 9   HIS A CB   4  
ATOM   6332  C CG   . HIS A 1 9   ? 16.548  -4.239  1.927   1.00 0.00 ? 9   HIS A CG   4  
ATOM   6333  N ND1  . HIS A 1 9   ? 17.534  -5.122  2.305   1.00 0.00 ? 9   HIS A ND1  4  
ATOM   6334  C CD2  . HIS A 1 9   ? 15.391  -4.938  1.964   1.00 0.00 ? 9   HIS A CD2  4  
ATOM   6335  C CE1  . HIS A 1 9   ? 16.994  -6.301  2.554   1.00 0.00 ? 9   HIS A CE1  4  
ATOM   6336  N NE2  . HIS A 1 9   ? 15.695  -6.215  2.356   1.00 0.00 ? 9   HIS A NE2  4  
ATOM   6337  H H    . HIS A 1 9   ? 17.999  -1.053  0.081   1.00 0.00 ? 9   HIS A H    4  
ATOM   6338  H HA   . HIS A 1 9   ? 16.619  -3.416  -0.495  1.00 0.00 ? 9   HIS A HA   4  
ATOM   6339  H HB2  . HIS A 1 9   ? 17.870  -2.616  1.708   1.00 0.00 ? 9   HIS A HB2  4  
ATOM   6340  H HB3  . HIS A 1 9   ? 16.233  -2.179  2.190   1.00 0.00 ? 9   HIS A HB3  4  
ATOM   6341  H HD1  . HIS A 1 9   ? 18.497  -4.919  2.367   1.00 0.00 ? 9   HIS A HD1  4  
ATOM   6342  H HD2  . HIS A 1 9   ? 14.412  -4.561  1.718   1.00 0.00 ? 9   HIS A HD2  4  
ATOM   6343  H HE1  . HIS A 1 9   ? 17.527  -7.188  2.857   1.00 0.00 ? 9   HIS A HE1  4  
ATOM   6344  H HE2  . HIS A 1 9   ? 15.081  -6.984  2.309   1.00 0.00 ? 9   HIS A HE2  4  
ATOM   6345  N N    . CYS A 1 10  ? 14.697  -0.836  0.119   1.00 0.00 ? 10  CYS A N    4  
ATOM   6346  C CA   . CYS A 1 10  ? 13.322  -0.377  -0.020  1.00 0.00 ? 10  CYS A CA   4  
ATOM   6347  C C    . CYS A 1 10  ? 12.886  -0.472  -1.477  1.00 0.00 ? 10  CYS A C    4  
ATOM   6348  O O    . CYS A 1 10  ? 11.711  -0.698  -1.769  1.00 0.00 ? 10  CYS A O    4  
ATOM   6349  C CB   . CYS A 1 10  ? 13.138  1.051   0.522   1.00 0.00 ? 10  CYS A CB   4  
ATOM   6350  S SG   . CYS A 1 10  ? 13.743  2.383   -0.534  1.00 0.00 ? 10  CYS A SG   4  
ATOM   6351  H H    . CYS A 1 10  ? 15.408  -0.190  0.332   1.00 0.00 ? 10  CYS A H    4  
ATOM   6352  H HA   . CYS A 1 10  ? 12.704  -1.049  0.553   1.00 0.00 ? 10  CYS A HA   4  
ATOM   6353  H HB2  . CYS A 1 10  ? 12.081  1.229   0.677   1.00 0.00 ? 10  CYS A HB2  4  
ATOM   6354  H HB3  . CYS A 1 10  ? 13.655  1.134   1.470   1.00 0.00 ? 10  CYS A HB3  4  
ATOM   6355  H HG   . CYS A 1 10  ? 14.486  1.850   -1.496  1.00 0.00 ? 10  CYS A HG   4  
ATOM   6356  N N    . ASN A 1 11  ? 13.846  -0.333  -2.387  1.00 0.00 ? 11  ASN A N    4  
ATOM   6357  C CA   . ASN A 1 11  ? 13.577  -0.496  -3.807  1.00 0.00 ? 11  ASN A CA   4  
ATOM   6358  C C    . ASN A 1 11  ? 13.228  -1.951  -4.101  1.00 0.00 ? 11  ASN A C    4  
ATOM   6359  O O    . ASN A 1 11  ? 12.302  -2.245  -4.860  1.00 0.00 ? 11  ASN A O    4  
ATOM   6360  C CB   . ASN A 1 11  ? 14.800  -0.089  -4.636  1.00 0.00 ? 11  ASN A CB   4  
ATOM   6361  C CG   . ASN A 1 11  ? 14.520  -0.095  -6.125  1.00 0.00 ? 11  ASN A CG   4  
ATOM   6362  O OD1  . ASN A 1 11  ? 13.416  0.223   -6.564  1.00 0.00 ? 11  ASN A OD1  4  
ATOM   6363  N ND2  . ASN A 1 11  ? 15.510  -0.484  -6.912  1.00 0.00 ? 11  ASN A ND2  4  
ATOM   6364  H H    . ASN A 1 11  ? 14.761  -0.116  -2.095  1.00 0.00 ? 11  ASN A H    4  
ATOM   6365  H HA   . ASN A 1 11  ? 12.740  0.135   -4.067  1.00 0.00 ? 11  ASN A HA   4  
ATOM   6366  H HB2  . ASN A 1 11  ? 15.113  0.904   -4.350  1.00 0.00 ? 11  ASN A HB2  4  
ATOM   6367  H HB3  . ASN A 1 11  ? 15.604  -0.783  -4.440  1.00 0.00 ? 11  ASN A HB3  4  
ATOM   6368  H HD21 . ASN A 1 11  ? 16.358  -0.746  -6.494  1.00 0.00 ? 11  ASN A HD21 4  
ATOM   6369  H HD22 . ASN A 1 11  ? 15.358  -0.491  -7.880  1.00 0.00 ? 11  ASN A HD22 4  
ATOM   6370  N N    . GLY A 1 12  ? 13.972  -2.857  -3.472  1.00 0.00 ? 12  GLY A N    4  
ATOM   6371  C CA   . GLY A 1 12  ? 13.775  -4.281  -3.687  1.00 0.00 ? 12  GLY A CA   4  
ATOM   6372  C C    . GLY A 1 12  ? 12.454  -4.781  -3.133  1.00 0.00 ? 12  GLY A C    4  
ATOM   6373  O O    . GLY A 1 12  ? 11.771  -5.587  -3.770  1.00 0.00 ? 12  GLY A O    4  
ATOM   6374  H H    . GLY A 1 12  ? 14.673  -2.548  -2.851  1.00 0.00 ? 12  GLY A H    4  
ATOM   6375  H HA2  . GLY A 1 12  ? 13.804  -4.479  -4.749  1.00 0.00 ? 12  GLY A HA2  4  
ATOM   6376  H HA3  . GLY A 1 12  ? 14.580  -4.820  -3.209  1.00 0.00 ? 12  GLY A HA3  4  
ATOM   6377  N N    . ILE A 1 13  ? 12.099  -4.309  -1.945  1.00 0.00 ? 13  ILE A N    4  
ATOM   6378  C CA   . ILE A 1 13  ? 10.840  -4.685  -1.311  1.00 0.00 ? 13  ILE A CA   4  
ATOM   6379  C C    . ILE A 1 13  ? 9.657   -4.222  -2.155  1.00 0.00 ? 13  ILE A C    4  
ATOM   6380  O O    . ILE A 1 13  ? 8.767   -5.008  -2.485  1.00 0.00 ? 13  ILE A O    4  
ATOM   6381  C CB   . ILE A 1 13  ? 10.731  -4.080  0.106   1.00 0.00 ? 13  ILE A CB   4  
ATOM   6382  C CG1  . ILE A 1 13  ? 11.837  -4.632  1.013   1.00 0.00 ? 13  ILE A CG1  4  
ATOM   6383  C CG2  . ILE A 1 13  ? 9.361   -4.343  0.701   1.00 0.00 ? 13  ILE A CG2  4  
ATOM   6384  C CD1  . ILE A 1 13  ? 11.935  -3.943  2.356   1.00 0.00 ? 13  ILE A CD1  4  
ATOM   6385  H H    . ILE A 1 13  ? 12.705  -3.690  -1.479  1.00 0.00 ? 13  ILE A H    4  
ATOM   6386  H HA   . ILE A 1 13  ? 10.813  -5.760  -1.227  1.00 0.00 ? 13  ILE A HA   4  
ATOM   6387  H HB   . ILE A 1 13  ? 10.845  -3.020  0.016   1.00 0.00 ? 13  ILE A HB   4  
ATOM   6388  H HG12 . ILE A 1 13  ? 11.643  -5.673  1.202   1.00 0.00 ? 13  ILE A HG12 4  
ATOM   6389  H HG13 . ILE A 1 13  ? 12.792  -4.536  0.514   1.00 0.00 ? 13  ILE A HG13 4  
ATOM   6390  H HG21 . ILE A 1 13  ? 8.958   -5.235  0.265   1.00 0.00 ? 13  ILE A HG21 4  
ATOM   6391  H HG22 . ILE A 1 13  ? 8.707   -3.509  0.488   1.00 0.00 ? 13  ILE A HG22 4  
ATOM   6392  H HG23 . ILE A 1 13  ? 9.448   -4.470  1.769   1.00 0.00 ? 13  ILE A HG23 4  
ATOM   6393  H HD11 . ILE A 1 13  ? 11.197  -4.355  3.018   1.00 0.00 ? 13  ILE A HD11 4  
ATOM   6394  H HD12 . ILE A 1 13  ? 11.758  -2.885  2.232   1.00 0.00 ? 13  ILE A HD12 4  
ATOM   6395  H HD13 . ILE A 1 13  ? 12.918  -4.097  2.773   1.00 0.00 ? 13  ILE A HD13 4  
ATOM   6396  N N    . LEU A 1 14  ? 9.673   -2.943  -2.512  1.00 0.00 ? 14  LEU A N    4  
ATOM   6397  C CA   . LEU A 1 14  ? 8.631   -2.345  -3.327  1.00 0.00 ? 14  LEU A CA   4  
ATOM   6398  C C    . LEU A 1 14  ? 8.465   -3.098  -4.642  1.00 0.00 ? 14  LEU A C    4  
ATOM   6399  O O    . LEU A 1 14  ? 7.351   -3.423  -5.048  1.00 0.00 ? 14  LEU A O    4  
ATOM   6400  C CB   . LEU A 1 14  ? 8.987   -0.891  -3.612  1.00 0.00 ? 14  LEU A CB   4  
ATOM   6401  C CG   . LEU A 1 14  ? 7.813   0.066   -3.650  1.00 0.00 ? 14  LEU A CG   4  
ATOM   6402  C CD1  . LEU A 1 14  ? 8.331   1.484   -3.605  1.00 0.00 ? 14  LEU A CD1  4  
ATOM   6403  C CD2  . LEU A 1 14  ? 6.971   -0.142  -4.896  1.00 0.00 ? 14  LEU A CD2  4  
ATOM   6404  H H    . LEU A 1 14  ? 10.405  -2.373  -2.198  1.00 0.00 ? 14  LEU A H    4  
ATOM   6405  H HA   . LEU A 1 14  ? 7.704   -2.382  -2.776  1.00 0.00 ? 14  LEU A HA   4  
ATOM   6406  H HB2  . LEU A 1 14  ? 9.676   -0.548  -2.856  1.00 0.00 ? 14  LEU A HB2  4  
ATOM   6407  H HB3  . LEU A 1 14  ? 9.483   -0.850  -4.571  1.00 0.00 ? 14  LEU A HB3  4  
ATOM   6408  H HG   . LEU A 1 14  ? 7.194   -0.102  -2.779  1.00 0.00 ? 14  LEU A HG   4  
ATOM   6409  H HD11 . LEU A 1 14  ? 9.167   1.576   -4.287  1.00 0.00 ? 14  LEU A HD11 4  
ATOM   6410  H HD12 . LEU A 1 14  ? 8.652   1.720   -2.602  1.00 0.00 ? 14  LEU A HD12 4  
ATOM   6411  H HD13 . LEU A 1 14  ? 7.547   2.165   -3.903  1.00 0.00 ? 14  LEU A HD13 4  
ATOM   6412  H HD21 . LEU A 1 14  ? 6.748   -1.197  -5.025  1.00 0.00 ? 14  LEU A HD21 4  
ATOM   6413  H HD22 . LEU A 1 14  ? 7.515   0.217   -5.757  1.00 0.00 ? 14  LEU A HD22 4  
ATOM   6414  H HD23 . LEU A 1 14  ? 6.049   0.412   -4.801  1.00 0.00 ? 14  LEU A HD23 4  
ATOM   6415  N N    . LYS A 1 15  ? 9.587   -3.377  -5.294  1.00 0.00 ? 15  LYS A N    4  
ATOM   6416  C CA   . LYS A 1 15  ? 9.603   -4.071  -6.560  1.00 0.00 ? 15  LYS A CA   4  
ATOM   6417  C C    . LYS A 1 15  ? 8.894   -5.416  -6.453  1.00 0.00 ? 15  LYS A C    4  
ATOM   6418  O O    . LYS A 1 15  ? 8.173   -5.829  -7.362  1.00 0.00 ? 15  LYS A O    4  
ATOM   6419  C CB   . LYS A 1 15  ? 11.056  -4.260  -6.995  1.00 0.00 ? 15  LYS A CB   4  
ATOM   6420  C CG   . LYS A 1 15  ? 11.281  -5.510  -7.806  1.00 0.00 ? 15  LYS A CG   4  
ATOM   6421  C CD   . LYS A 1 15  ? 10.807  -5.358  -9.238  1.00 0.00 ? 15  LYS A CD   4  
ATOM   6422  C CE   . LYS A 1 15  ? 11.269  -6.527  -10.081 1.00 0.00 ? 15  LYS A CE   4  
ATOM   6423  N NZ   . LYS A 1 15  ? 12.698  -6.410  -10.468 1.00 0.00 ? 15  LYS A NZ   4  
ATOM   6424  H H    . LYS A 1 15  ? 10.442  -3.122  -4.901  1.00 0.00 ? 15  LYS A H    4  
ATOM   6425  H HA   . LYS A 1 15  ? 9.094   -3.465  -7.284  1.00 0.00 ? 15  LYS A HA   4  
ATOM   6426  H HB2  . LYS A 1 15  ? 11.355  -3.411  -7.591  1.00 0.00 ? 15  LYS A HB2  4  
ATOM   6427  H HB3  . LYS A 1 15  ? 11.680  -4.308  -6.115  1.00 0.00 ? 15  LYS A HB3  4  
ATOM   6428  H HG2  . LYS A 1 15  ? 12.322  -5.763  -7.801  1.00 0.00 ? 15  LYS A HG2  4  
ATOM   6429  H HG3  . LYS A 1 15  ? 10.718  -6.298  -7.335  1.00 0.00 ? 15  LYS A HG3  4  
ATOM   6430  H HD2  . LYS A 1 15  ? 9.729   -5.315  -9.251  1.00 0.00 ? 15  LYS A HD2  4  
ATOM   6431  H HD3  . LYS A 1 15  ? 11.214  -4.446  -9.649  1.00 0.00 ? 15  LYS A HD3  4  
ATOM   6432  H HE2  . LYS A 1 15  ? 11.147  -7.426  -9.497  1.00 0.00 ? 15  LYS A HE2  4  
ATOM   6433  H HE3  . LYS A 1 15  ? 10.660  -6.584  -10.972 1.00 0.00 ? 15  LYS A HE3  4  
ATOM   6434  H HZ1  . LYS A 1 15  ? 12.868  -5.502  -10.944 1.00 0.00 ? 15  LYS A HZ1  4  
ATOM   6435  H HZ2  . LYS A 1 15  ? 12.956  -7.179  -11.119 1.00 0.00 ? 15  LYS A HZ2  4  
ATOM   6436  H HZ3  . LYS A 1 15  ? 13.307  -6.469  -9.627  1.00 0.00 ? 15  LYS A HZ3  4  
ATOM   6437  N N    . GLU A 1 16  ? 9.093   -6.082  -5.335  1.00 0.00 ? 16  GLU A N    4  
ATOM   6438  C CA   . GLU A 1 16  ? 8.527   -7.409  -5.137  1.00 0.00 ? 16  GLU A CA   4  
ATOM   6439  C C    . GLU A 1 16  ? 7.017   -7.332  -4.949  1.00 0.00 ? 16  GLU A C    4  
ATOM   6440  O O    . GLU A 1 16  ? 6.269   -8.112  -5.541  1.00 0.00 ? 16  GLU A O    4  
ATOM   6441  C CB   . GLU A 1 16  ? 9.157   -8.120  -3.932  1.00 0.00 ? 16  GLU A CB   4  
ATOM   6442  C CG   . GLU A 1 16  ? 8.570   -9.505  -3.673  1.00 0.00 ? 16  GLU A CG   4  
ATOM   6443  C CD   . GLU A 1 16  ? 8.647   -9.923  -2.231  1.00 0.00 ? 16  GLU A CD   4  
ATOM   6444  O OE1  . GLU A 1 16  ? 9.231   -9.183  -1.423  1.00 0.00 ? 16  GLU A OE1  4  
ATOM   6445  O OE2  . GLU A 1 16  ? 8.123   -11.014 -1.907  1.00 0.00 ? 16  GLU A OE2  4  
ATOM   6446  H H    . GLU A 1 16  ? 9.628   -5.663  -4.629  1.00 0.00 ? 16  GLU A H    4  
ATOM   6447  H HA   . GLU A 1 16  ? 8.732   -7.971  -6.034  1.00 0.00 ? 16  GLU A HA   4  
ATOM   6448  H HB2  . GLU A 1 16  ? 10.218  -8.228  -4.107  1.00 0.00 ? 16  GLU A HB2  4  
ATOM   6449  H HB3  . GLU A 1 16  ? 9.003   -7.515  -3.049  1.00 0.00 ? 16  GLU A HB3  4  
ATOM   6450  H HG2  . GLU A 1 16  ? 7.535   -9.507  -3.973  1.00 0.00 ? 16  GLU A HG2  4  
ATOM   6451  H HG3  . GLU A 1 16  ? 9.108   -10.232 -4.252  1.00 0.00 ? 16  GLU A HG3  4  
ATOM   6452  N N    . LEU A 1 17  ? 6.577   -6.390  -4.124  1.00 0.00 ? 17  LEU A N    4  
ATOM   6453  C CA   . LEU A 1 17  ? 5.148   -6.163  -3.907  1.00 0.00 ? 17  LEU A CA   4  
ATOM   6454  C C    . LEU A 1 17  ? 4.485   -5.743  -5.226  1.00 0.00 ? 17  LEU A C    4  
ATOM   6455  O O    . LEU A 1 17  ? 3.280   -5.899  -5.408  1.00 0.00 ? 17  LEU A O    4  
ATOM   6456  C CB   . LEU A 1 17  ? 4.941   -5.089  -2.824  1.00 0.00 ? 17  LEU A CB   4  
ATOM   6457  C CG   . LEU A 1 17  ? 5.573   -5.383  -1.457  1.00 0.00 ? 17  LEU A CG   4  
ATOM   6458  C CD1  . LEU A 1 17  ? 5.789   -4.088  -0.702  1.00 0.00 ? 17  LEU A CD1  4  
ATOM   6459  C CD2  . LEU A 1 17  ? 4.693   -6.310  -0.630  1.00 0.00 ? 17  LEU A CD2  4  
ATOM   6460  H H    . LEU A 1 17  ? 7.232   -5.829  -3.649  1.00 0.00 ? 17  LEU A H    4  
ATOM   6461  H HA   . LEU A 1 17  ? 4.703   -7.093  -3.575  1.00 0.00 ? 17  LEU A HA   4  
ATOM   6462  H HB2  . LEU A 1 17  ? 5.352   -4.161  -3.187  1.00 0.00 ? 17  LEU A HB2  4  
ATOM   6463  H HB3  . LEU A 1 17  ? 3.883   -4.954  -2.674  1.00 0.00 ? 17  LEU A HB3  4  
ATOM   6464  H HG   . LEU A 1 17  ? 6.532   -5.859  -1.599  1.00 0.00 ? 17  LEU A HG   4  
ATOM   6465  H HD11 . LEU A 1 17  ? 6.360   -3.415  -1.316  1.00 0.00 ? 17  LEU A HD11 4  
ATOM   6466  H HD12 . LEU A 1 17  ? 6.328   -4.288  0.213   1.00 0.00 ? 17  LEU A HD12 4  
ATOM   6467  H HD13 . LEU A 1 17  ? 4.834   -3.641  -0.468  1.00 0.00 ? 17  LEU A HD13 4  
ATOM   6468  H HD21 . LEU A 1 17  ? 4.600   -7.261  -1.123  1.00 0.00 ? 17  LEU A HD21 4  
ATOM   6469  H HD22 . LEU A 1 17  ? 3.716   -5.869  -0.513  1.00 0.00 ? 17  LEU A HD22 4  
ATOM   6470  H HD23 . LEU A 1 17  ? 5.141   -6.454  0.342   1.00 0.00 ? 17  LEU A HD23 4  
ATOM   6471  N N    . LEU A 1 18  ? 5.298   -5.228  -6.147  1.00 0.00 ? 18  LEU A N    4  
ATOM   6472  C CA   . LEU A 1 18  ? 4.829   -4.834  -7.475  1.00 0.00 ? 18  LEU A CA   4  
ATOM   6473  C C    . LEU A 1 18  ? 4.951   -5.970  -8.488  1.00 0.00 ? 18  LEU A C    4  
ATOM   6474  O O    . LEU A 1 18  ? 4.378   -5.907  -9.579  1.00 0.00 ? 18  LEU A O    4  
ATOM   6475  C CB   . LEU A 1 18  ? 5.631   -3.645  -7.987  1.00 0.00 ? 18  LEU A CB   4  
ATOM   6476  C CG   . LEU A 1 18  ? 5.365   -2.324  -7.282  1.00 0.00 ? 18  LEU A CG   4  
ATOM   6477  C CD1  . LEU A 1 18  ? 6.278   -1.255  -7.846  1.00 0.00 ? 18  LEU A CD1  4  
ATOM   6478  C CD2  . LEU A 1 18  ? 3.910   -1.911  -7.425  1.00 0.00 ? 18  LEU A CD2  4  
ATOM   6479  H H    . LEU A 1 18  ? 6.242   -5.093  -5.918  1.00 0.00 ? 18  LEU A H    4  
ATOM   6480  H HA   . LEU A 1 18  ? 3.793   -4.546  -7.391  1.00 0.00 ? 18  LEU A HA   4  
ATOM   6481  H HB2  . LEU A 1 18  ? 6.680   -3.877  -7.880  1.00 0.00 ? 18  LEU A HB2  4  
ATOM   6482  H HB3  . LEU A 1 18  ? 5.417   -3.518  -9.034  1.00 0.00 ? 18  LEU A HB3  4  
ATOM   6483  H HG   . LEU A 1 18  ? 5.583   -2.433  -6.230  1.00 0.00 ? 18  LEU A HG   4  
ATOM   6484  H HD11 . LEU A 1 18  ? 7.293   -1.455  -7.531  1.00 0.00 ? 18  LEU A HD11 4  
ATOM   6485  H HD12 . LEU A 1 18  ? 5.969   -0.288  -7.481  1.00 0.00 ? 18  LEU A HD12 4  
ATOM   6486  H HD13 . LEU A 1 18  ? 6.226   -1.268  -8.926  1.00 0.00 ? 18  LEU A HD13 4  
ATOM   6487  H HD21 . LEU A 1 18  ? 3.629   -1.321  -6.569  1.00 0.00 ? 18  LEU A HD21 4  
ATOM   6488  H HD22 . LEU A 1 18  ? 3.284   -2.786  -7.480  1.00 0.00 ? 18  LEU A HD22 4  
ATOM   6489  H HD23 . LEU A 1 18  ? 3.789   -1.322  -8.322  1.00 0.00 ? 18  LEU A HD23 4  
ATOM   6490  N N    . SER A 1 19  ? 5.716   -6.989  -8.145  1.00 0.00 ? 19  SER A N    4  
ATOM   6491  C CA   . SER A 1 19  ? 5.926   -8.117  -9.041  1.00 0.00 ? 19  SER A CA   4  
ATOM   6492  C C    . SER A 1 19  ? 4.652   -8.938  -9.196  1.00 0.00 ? 19  SER A C    4  
ATOM   6493  O O    . SER A 1 19  ? 3.842   -9.041  -8.270  1.00 0.00 ? 19  SER A O    4  
ATOM   6494  C CB   . SER A 1 19  ? 7.058   -8.999  -8.518  1.00 0.00 ? 19  SER A CB   4  
ATOM   6495  O OG   . SER A 1 19  ? 8.284   -8.284  -8.482  1.00 0.00 ? 19  SER A OG   4  
ATOM   6496  H H    . SER A 1 19  ? 6.148   -6.983  -7.267  1.00 0.00 ? 19  SER A H    4  
ATOM   6497  H HA   . SER A 1 19  ? 6.206   -7.725  -10.007 1.00 0.00 ? 19  SER A HA   4  
ATOM   6498  H HB2  . SER A 1 19  ? 6.819   -9.333  -7.520  1.00 0.00 ? 19  SER A HB2  4  
ATOM   6499  H HB3  . SER A 1 19  ? 7.173   -9.855  -9.169  1.00 0.00 ? 19  SER A HB3  4  
ATOM   6500  H HG   . SER A 1 19  ? 8.123   -7.387  -8.151  1.00 0.00 ? 19  SER A HG   4  
ATOM   6501  N N    . LYS A 1 20  ? 4.504   -9.537  -10.378 1.00 0.00 ? 20  LYS A N    4  
ATOM   6502  C CA   . LYS A 1 20  ? 3.303   -10.286 -10.747 1.00 0.00 ? 20  LYS A CA   4  
ATOM   6503  C C    . LYS A 1 20  ? 3.058   -11.459 -9.807  1.00 0.00 ? 20  LYS A C    4  
ATOM   6504  O O    . LYS A 1 20  ? 1.956   -12.006 -9.762  1.00 0.00 ? 20  LYS A O    4  
ATOM   6505  C CB   . LYS A 1 20  ? 3.398   -10.783 -12.195 1.00 0.00 ? 20  LYS A CB   4  
ATOM   6506  C CG   . LYS A 1 20  ? 3.033   -9.729  -13.247 1.00 0.00 ? 20  LYS A CG   4  
ATOM   6507  C CD   . LYS A 1 20  ? 3.892   -8.473  -13.146 1.00 0.00 ? 20  LYS A CD   4  
ATOM   6508  C CE   . LYS A 1 20  ? 3.530   -7.441  -14.212 1.00 0.00 ? 20  LYS A CE   4  
ATOM   6509  N NZ   . LYS A 1 20  ? 3.759   -7.956  -15.588 1.00 0.00 ? 20  LYS A NZ   4  
ATOM   6510  H H    . LYS A 1 20  ? 5.237   -9.476  -11.031 1.00 0.00 ? 20  LYS A H    4  
ATOM   6511  H HA   . LYS A 1 20  ? 2.466   -9.609  -10.672 1.00 0.00 ? 20  LYS A HA   4  
ATOM   6512  H HB2  . LYS A 1 20  ? 4.410   -11.126 -12.383 1.00 0.00 ? 20  LYS A HB2  4  
ATOM   6513  H HB3  . LYS A 1 20  ? 2.725   -11.619 -12.313 1.00 0.00 ? 20  LYS A HB3  4  
ATOM   6514  H HG2  . LYS A 1 20  ? 3.164   -10.158 -14.228 1.00 0.00 ? 20  LYS A HG2  4  
ATOM   6515  H HG3  . LYS A 1 20  ? 1.997   -9.453  -13.113 1.00 0.00 ? 20  LYS A HG3  4  
ATOM   6516  H HD2  . LYS A 1 20  ? 3.749   -8.032  -12.172 1.00 0.00 ? 20  LYS A HD2  4  
ATOM   6517  H HD3  . LYS A 1 20  ? 4.929   -8.751  -13.266 1.00 0.00 ? 20  LYS A HD3  4  
ATOM   6518  H HE2  . LYS A 1 20  ? 2.486   -7.167  -14.108 1.00 0.00 ? 20  LYS A HE2  4  
ATOM   6519  H HE3  . LYS A 1 20  ? 4.143   -6.563  -14.062 1.00 0.00 ? 20  LYS A HE3  4  
ATOM   6520  H HZ1  . LYS A 1 20  ? 3.171   -8.798  -15.760 1.00 0.00 ? 20  LYS A HZ1  4  
ATOM   6521  H HZ2  . LYS A 1 20  ? 4.758   -8.215  -15.713 1.00 0.00 ? 20  LYS A HZ2  4  
ATOM   6522  H HZ3  . LYS A 1 20  ? 3.514   -7.227  -16.288 1.00 0.00 ? 20  LYS A HZ3  4  
ATOM   6523  N N    . LYS A 1 21  ? 4.088   -11.840 -9.064  1.00 0.00 ? 21  LYS A N    4  
ATOM   6524  C CA   . LYS A 1 21  ? 3.958   -12.847 -8.022  1.00 0.00 ? 21  LYS A CA   4  
ATOM   6525  C C    . LYS A 1 21  ? 2.894   -12.439 -7.004  1.00 0.00 ? 21  LYS A C    4  
ATOM   6526  O O    . LYS A 1 21  ? 2.089   -13.257 -6.565  1.00 0.00 ? 21  LYS A O    4  
ATOM   6527  C CB   . LYS A 1 21  ? 5.301   -13.046 -7.314  1.00 0.00 ? 21  LYS A CB   4  
ATOM   6528  C CG   . LYS A 1 21  ? 5.217   -13.952 -6.097  1.00 0.00 ? 21  LYS A CG   4  
ATOM   6529  C CD   . LYS A 1 21  ? 6.550   -14.075 -5.394  1.00 0.00 ? 21  LYS A CD   4  
ATOM   6530  C CE   . LYS A 1 21  ? 6.537   -15.257 -4.449  1.00 0.00 ? 21  LYS A CE   4  
ATOM   6531  N NZ   . LYS A 1 21  ? 6.626   -16.551 -5.174  1.00 0.00 ? 21  LYS A NZ   4  
ATOM   6532  H H    . LYS A 1 21  ? 4.969   -11.441 -9.232  1.00 0.00 ? 21  LYS A H    4  
ATOM   6533  H HA   . LYS A 1 21  ? 3.663   -13.775 -8.488  1.00 0.00 ? 21  LYS A HA   4  
ATOM   6534  H HB2  . LYS A 1 21  ? 6.001   -13.476 -8.009  1.00 0.00 ? 21  LYS A HB2  4  
ATOM   6535  H HB3  . LYS A 1 21  ? 5.673   -12.086 -6.995  1.00 0.00 ? 21  LYS A HB3  4  
ATOM   6536  H HG2  . LYS A 1 21  ? 4.500   -13.535 -5.408  1.00 0.00 ? 21  LYS A HG2  4  
ATOM   6537  H HG3  . LYS A 1 21  ? 4.893   -14.935 -6.400  1.00 0.00 ? 21  LYS A HG3  4  
ATOM   6538  H HD2  . LYS A 1 21  ? 7.327   -14.219 -6.129  1.00 0.00 ? 21  LYS A HD2  4  
ATOM   6539  H HD3  . LYS A 1 21  ? 6.738   -13.173 -4.832  1.00 0.00 ? 21  LYS A HD3  4  
ATOM   6540  H HE2  . LYS A 1 21  ? 7.367   -15.173 -3.766  1.00 0.00 ? 21  LYS A HE2  4  
ATOM   6541  H HE3  . LYS A 1 21  ? 5.609   -15.233 -3.900  1.00 0.00 ? 21  LYS A HE3  4  
ATOM   6542  H HZ1  . LYS A 1 21  ? 7.475   -16.569 -5.774  1.00 0.00 ? 21  LYS A HZ1  4  
ATOM   6543  H HZ2  . LYS A 1 21  ? 5.787   -16.687 -5.772  1.00 0.00 ? 21  LYS A HZ2  4  
ATOM   6544  H HZ3  . LYS A 1 21  ? 6.680   -17.338 -4.496  1.00 0.00 ? 21  LYS A HZ3  4  
ATOM   6545  N N    . HIS A 1 22  ? 2.881   -11.161 -6.648  1.00 0.00 ? 22  HIS A N    4  
ATOM   6546  C CA   . HIS A 1 22  ? 1.973   -10.674 -5.618  1.00 0.00 ? 22  HIS A CA   4  
ATOM   6547  C C    . HIS A 1 22  ? 0.823   -9.907  -6.240  1.00 0.00 ? 22  HIS A C    4  
ATOM   6548  O O    . HIS A 1 22  ? -0.200  -9.707  -5.597  1.00 0.00 ? 22  HIS A O    4  
ATOM   6549  C CB   . HIS A 1 22  ? 2.712   -9.782  -4.608  1.00 0.00 ? 22  HIS A CB   4  
ATOM   6550  C CG   . HIS A 1 22  ? 3.817   -10.489 -3.880  1.00 0.00 ? 22  HIS A CG   4  
ATOM   6551  N ND1  . HIS A 1 22  ? 3.610   -11.287 -2.769  1.00 0.00 ? 22  HIS A ND1  4  
ATOM   6552  C CD2  . HIS A 1 22  ? 5.147   -10.516 -4.113  1.00 0.00 ? 22  HIS A CD2  4  
ATOM   6553  C CE1  . HIS A 1 22  ? 4.766   -11.770 -2.353  1.00 0.00 ? 22  HIS A CE1  4  
ATOM   6554  N NE2  . HIS A 1 22  ? 5.721   -11.317 -3.148  1.00 0.00 ? 22  HIS A NE2  4  
ATOM   6555  H H    . HIS A 1 22  ? 3.476   -10.525 -7.109  1.00 0.00 ? 22  HIS A H    4  
ATOM   6556  H HA   . HIS A 1 22  ? 1.573   -11.535 -5.101  1.00 0.00 ? 22  HIS A HA   4  
ATOM   6557  H HB2  . HIS A 1 22  ? 3.144   -8.933  -5.136  1.00 0.00 ? 22  HIS A HB2  4  
ATOM   6558  H HB3  . HIS A 1 22  ? 2.008   -9.417  -3.868  1.00 0.00 ? 22  HIS A HB3  4  
ATOM   6559  H HD1  . HIS A 1 22  ? 2.742   -11.480 -2.349  1.00 0.00 ? 22  HIS A HD1  4  
ATOM   6560  H HD2  . HIS A 1 22  ? 5.661   -10.005 -4.923  1.00 0.00 ? 22  HIS A HD2  4  
ATOM   6561  H HE1  . HIS A 1 22  ? 4.906   -12.435 -1.504  1.00 0.00 ? 22  HIS A HE1  4  
ATOM   6562  H HE2  . HIS A 1 22  ? 6.681   -11.295 -2.899  1.00 0.00 ? 22  HIS A HE2  4  
ATOM   6563  N N    . ALA A 1 23  ? 0.993   -9.513  -7.500  1.00 0.00 ? 23  ALA A N    4  
ATOM   6564  C CA   . ALA A 1 23  ? 0.015   -8.697  -8.224  1.00 0.00 ? 23  ALA A CA   4  
ATOM   6565  C C    . ALA A 1 23  ? -1.412  -9.212  -8.076  1.00 0.00 ? 23  ALA A C    4  
ATOM   6566  O O    . ALA A 1 23  ? -2.357  -8.425  -8.013  1.00 0.00 ? 23  ALA A O    4  
ATOM   6567  C CB   . ALA A 1 23  ? 0.392   -8.636  -9.691  1.00 0.00 ? 23  ALA A CB   4  
ATOM   6568  H H    . ALA A 1 23  ? 1.819   -9.766  -7.962  1.00 0.00 ? 23  ALA A H    4  
ATOM   6569  H HA   . ALA A 1 23  ? 0.064   -7.694  -7.829  1.00 0.00 ? 23  ALA A HA   4  
ATOM   6570  H HB1  . ALA A 1 23  ? 1.422   -8.321  -9.777  1.00 0.00 ? 23  ALA A HB1  4  
ATOM   6571  H HB2  . ALA A 1 23  ? -0.246  -7.927  -10.199 1.00 0.00 ? 23  ALA A HB2  4  
ATOM   6572  H HB3  . ALA A 1 23  ? 0.274   -9.613  -10.136 1.00 0.00 ? 23  ALA A HB3  4  
ATOM   6573  N N    . ALA A 1 24  ? -1.553  -10.529 -8.006  1.00 0.00 ? 24  ALA A N    4  
ATOM   6574  C CA   . ALA A 1 24  ? -2.853  -11.179 -7.864  1.00 0.00 ? 24  ALA A CA   4  
ATOM   6575  C C    . ALA A 1 24  ? -3.610  -10.686 -6.627  1.00 0.00 ? 24  ALA A C    4  
ATOM   6576  O O    . ALA A 1 24  ? -4.835  -10.784 -6.558  1.00 0.00 ? 24  ALA A O    4  
ATOM   6577  C CB   . ALA A 1 24  ? -2.656  -12.684 -7.798  1.00 0.00 ? 24  ALA A CB   4  
ATOM   6578  H H    . ALA A 1 24  ? -0.751  -11.090 -8.054  1.00 0.00 ? 24  ALA A H    4  
ATOM   6579  H HA   . ALA A 1 24  ? -3.437  -10.956 -8.746  1.00 0.00 ? 24  ALA A HA   4  
ATOM   6580  H HB1  . ALA A 1 24  ? -1.848  -12.911 -7.115  1.00 0.00 ? 24  ALA A HB1  4  
ATOM   6581  H HB2  . ALA A 1 24  ? -2.415  -13.060 -8.781  1.00 0.00 ? 24  ALA A HB2  4  
ATOM   6582  H HB3  . ALA A 1 24  ? -3.564  -13.151 -7.448  1.00 0.00 ? 24  ALA A HB3  4  
ATOM   6583  N N    . TYR A 1 25  ? -2.878  -10.168 -5.650  1.00 0.00 ? 25  TYR A N    4  
ATOM   6584  C CA   . TYR A 1 25  ? -3.478  -9.632  -4.435  1.00 0.00 ? 25  TYR A CA   4  
ATOM   6585  C C    . TYR A 1 25  ? -2.775  -8.345  -4.001  1.00 0.00 ? 25  TYR A C    4  
ATOM   6586  O O    . TYR A 1 25  ? -2.928  -7.895  -2.867  1.00 0.00 ? 25  TYR A O    4  
ATOM   6587  C CB   . TYR A 1 25  ? -3.445  -10.685 -3.313  1.00 0.00 ? 25  TYR A CB   4  
ATOM   6588  C CG   . TYR A 1 25  ? -2.135  -11.435 -3.193  1.00 0.00 ? 25  TYR A CG   4  
ATOM   6589  C CD1  . TYR A 1 25  ? -1.028  -10.859 -2.586  1.00 0.00 ? 25  TYR A CD1  4  
ATOM   6590  C CD2  . TYR A 1 25  ? -2.013  -12.732 -3.679  1.00 0.00 ? 25  TYR A CD2  4  
ATOM   6591  C CE1  . TYR A 1 25  ? 0.162   -11.551 -2.472  1.00 0.00 ? 25  TYR A CE1  4  
ATOM   6592  C CE2  . TYR A 1 25  ? -0.824  -13.426 -3.569  1.00 0.00 ? 25  TYR A CE2  4  
ATOM   6593  C CZ   . TYR A 1 25  ? 0.259   -12.828 -2.965  1.00 0.00 ? 25  TYR A CZ   4  
ATOM   6594  O OH   . TYR A 1 25  ? 1.445   -13.511 -2.843  1.00 0.00 ? 25  TYR A OH   4  
ATOM   6595  H H    . TYR A 1 25  ? -1.898  -10.144 -5.747  1.00 0.00 ? 25  TYR A H    4  
ATOM   6596  H HA   . TYR A 1 25  ? -4.510  -9.397  -4.658  1.00 0.00 ? 25  TYR A HA   4  
ATOM   6597  H HB2  . TYR A 1 25  ? -3.631  -10.201 -2.364  1.00 0.00 ? 25  TYR A HB2  4  
ATOM   6598  H HB3  . TYR A 1 25  ? -4.222  -11.414 -3.496  1.00 0.00 ? 25  TYR A HB3  4  
ATOM   6599  H HD1  . TYR A 1 25  ? -1.102  -9.851  -2.204  1.00 0.00 ? 25  TYR A HD1  4  
ATOM   6600  H HD2  . TYR A 1 25  ? -2.866  -13.198 -4.149  1.00 0.00 ? 25  TYR A HD2  4  
ATOM   6601  H HE1  . TYR A 1 25  ? 1.010   -11.090 -1.995  1.00 0.00 ? 25  TYR A HE1  4  
ATOM   6602  H HE2  . TYR A 1 25  ? -0.748  -14.432 -3.956  1.00 0.00 ? 25  TYR A HE2  4  
ATOM   6603  H HH   . TYR A 1 25  ? 1.602   -14.026 -3.644  1.00 0.00 ? 25  TYR A HH   4  
ATOM   6604  N N    . ALA A 1 26  ? -2.014  -7.753  -4.917  1.00 0.00 ? 26  ALA A N    4  
ATOM   6605  C CA   . ALA A 1 26  ? -1.287  -6.518  -4.636  1.00 0.00 ? 26  ALA A CA   4  
ATOM   6606  C C    . ALA A 1 26  ? -1.821  -5.360  -5.475  1.00 0.00 ? 26  ALA A C    4  
ATOM   6607  O O    . ALA A 1 26  ? -1.535  -4.189  -5.196  1.00 0.00 ? 26  ALA A O    4  
ATOM   6608  C CB   . ALA A 1 26  ? 0.207   -6.698  -4.896  1.00 0.00 ? 26  ALA A CB   4  
ATOM   6609  H H    . ALA A 1 26  ? -1.929  -8.163  -5.803  1.00 0.00 ? 26  ALA A H    4  
ATOM   6610  H HA   . ALA A 1 26  ? -1.421  -6.283  -3.589  1.00 0.00 ? 26  ALA A HA   4  
ATOM   6611  H HB1  . ALA A 1 26  ? 0.600   -7.503  -4.287  1.00 0.00 ? 26  ALA A HB1  4  
ATOM   6612  H HB2  . ALA A 1 26  ? 0.724   -5.782  -4.652  1.00 0.00 ? 26  ALA A HB2  4  
ATOM   6613  H HB3  . ALA A 1 26  ? 0.362   -6.928  -5.939  1.00 0.00 ? 26  ALA A HB3  4  
ATOM   6614  N N    . TRP A 1 27  ? -2.614  -5.678  -6.498  1.00 0.00 ? 27  TRP A N    4  
ATOM   6615  C CA   . TRP A 1 27  ? -3.107  -4.656  -7.421  1.00 0.00 ? 27  TRP A CA   4  
ATOM   6616  C C    . TRP A 1 27  ? -3.865  -3.503  -6.727  1.00 0.00 ? 27  TRP A C    4  
ATOM   6617  O O    . TRP A 1 27  ? -3.765  -2.369  -7.194  1.00 0.00 ? 27  TRP A O    4  
ATOM   6618  C CB   . TRP A 1 27  ? -3.955  -5.262  -8.556  1.00 0.00 ? 27  TRP A CB   4  
ATOM   6619  C CG   . TRP A 1 27  ? -5.151  -6.062  -8.121  1.00 0.00 ? 27  TRP A CG   4  
ATOM   6620  C CD1  . TRP A 1 27  ? -5.199  -7.410  -7.916  1.00 0.00 ? 27  TRP A CD1  4  
ATOM   6621  C CD2  . TRP A 1 27  ? -6.479  -5.573  -7.869  1.00 0.00 ? 27  TRP A CD2  4  
ATOM   6622  N NE1  . TRP A 1 27  ? -6.464  -7.789  -7.547  1.00 0.00 ? 27  TRP A NE1  4  
ATOM   6623  C CE2  . TRP A 1 27  ? -7.269  -6.682  -7.509  1.00 0.00 ? 27  TRP A CE2  4  
ATOM   6624  C CE3  . TRP A 1 27  ? -7.076  -4.307  -7.905  1.00 0.00 ? 27  TRP A CE3  4  
ATOM   6625  C CZ2  . TRP A 1 27  ? -8.620  -6.566  -7.192  1.00 0.00 ? 27  TRP A CZ2  4  
ATOM   6626  C CZ3  . TRP A 1 27  ? -8.417  -4.195  -7.590  1.00 0.00 ? 27  TRP A CZ3  4  
ATOM   6627  C CH2  . TRP A 1 27  ? -9.175  -5.317  -7.238  1.00 0.00 ? 27  TRP A CH2  4  
ATOM   6628  H H    . TRP A 1 27  ? -2.864  -6.616  -6.641  1.00 0.00 ? 27  TRP A H    4  
ATOM   6629  H HA   . TRP A 1 27  ? -2.221  -4.224  -7.873  1.00 0.00 ? 27  TRP A HA   4  
ATOM   6630  H HB2  . TRP A 1 27  ? -4.313  -4.461  -9.184  1.00 0.00 ? 27  TRP A HB2  4  
ATOM   6631  H HB3  . TRP A 1 27  ? -3.324  -5.908  -9.148  1.00 0.00 ? 27  TRP A HB3  4  
ATOM   6632  H HD1  . TRP A 1 27  ? -4.353  -8.072  -8.030  1.00 0.00 ? 27  TRP A HD1  4  
ATOM   6633  H HE1  . TRP A 1 27  ? -6.746  -8.709  -7.340  1.00 0.00 ? 27  TRP A HE1  4  
ATOM   6634  H HE3  . TRP A 1 27  ? -6.508  -3.427  -8.165  1.00 0.00 ? 27  TRP A HE3  4  
ATOM   6635  H HZ2  . TRP A 1 27  ? -9.219  -7.420  -6.919  1.00 0.00 ? 27  TRP A HZ2  4  
ATOM   6636  H HZ3  . TRP A 1 27  ? -8.893  -3.226  -7.615  1.00 0.00 ? 27  TRP A HZ3  4  
ATOM   6637  H HH2  . TRP A 1 27  ? -10.220 -5.179  -7.000  1.00 0.00 ? 27  TRP A HH2  4  
ATOM   6638  N N    . PRO A 1 28  ? -4.635  -3.731  -5.622  1.00 0.00 ? 28  PRO A N    4  
ATOM   6639  C CA   . PRO A 1 28  ? -5.305  -2.630  -4.909  1.00 0.00 ? 28  PRO A CA   4  
ATOM   6640  C C    . PRO A 1 28  ? -4.346  -1.521  -4.475  1.00 0.00 ? 28  PRO A C    4  
ATOM   6641  O O    . PRO A 1 28  ? -4.765  -0.385  -4.259  1.00 0.00 ? 28  PRO A O    4  
ATOM   6642  C CB   . PRO A 1 28  ? -5.916  -3.276  -3.657  1.00 0.00 ? 28  PRO A CB   4  
ATOM   6643  C CG   . PRO A 1 28  ? -5.451  -4.696  -3.634  1.00 0.00 ? 28  PRO A CG   4  
ATOM   6644  C CD   . PRO A 1 28  ? -4.964  -5.039  -5.018  1.00 0.00 ? 28  PRO A CD   4  
ATOM   6645  H HA   . PRO A 1 28  ? -6.092  -2.201  -5.512  1.00 0.00 ? 28  PRO A HA   4  
ATOM   6646  H HB2  . PRO A 1 28  ? -5.565  -2.744  -2.783  1.00 0.00 ? 28  PRO A HB2  4  
ATOM   6647  H HB3  . PRO A 1 28  ? -6.996  -3.212  -3.699  1.00 0.00 ? 28  PRO A HB3  4  
ATOM   6648  H HG2  . PRO A 1 28  ? -4.645  -4.802  -2.919  1.00 0.00 ? 28  PRO A HG2  4  
ATOM   6649  H HG3  . PRO A 1 28  ? -6.275  -5.341  -3.360  1.00 0.00 ? 28  PRO A HG3  4  
ATOM   6650  H HD2  . PRO A 1 28  ? -4.086  -5.666  -4.966  1.00 0.00 ? 28  PRO A HD2  4  
ATOM   6651  H HD3  . PRO A 1 28  ? -5.740  -5.539  -5.584  1.00 0.00 ? 28  PRO A HD3  4  
ATOM   6652  N N    . PHE A 1 29  ? -3.067  -1.855  -4.355  1.00 0.00 ? 29  PHE A N    4  
ATOM   6653  C CA   . PHE A 1 29  ? -2.086  -0.917  -3.811  1.00 0.00 ? 29  PHE A CA   4  
ATOM   6654  C C    . PHE A 1 29  ? -1.166  -0.372  -4.898  1.00 0.00 ? 29  PHE A C    4  
ATOM   6655  O O    . PHE A 1 29  ? -0.406  0.568   -4.661  1.00 0.00 ? 29  PHE A O    4  
ATOM   6656  C CB   . PHE A 1 29  ? -1.243  -1.592  -2.728  1.00 0.00 ? 29  PHE A CB   4  
ATOM   6657  C CG   . PHE A 1 29  ? -2.003  -2.592  -1.911  1.00 0.00 ? 29  PHE A CG   4  
ATOM   6658  C CD1  . PHE A 1 29  ? -1.704  -3.942  -2.002  1.00 0.00 ? 29  PHE A CD1  4  
ATOM   6659  C CD2  . PHE A 1 29  ? -3.026  -2.192  -1.066  1.00 0.00 ? 29  PHE A CD2  4  
ATOM   6660  C CE1  . PHE A 1 29  ? -2.406  -4.871  -1.270  1.00 0.00 ? 29  PHE A CE1  4  
ATOM   6661  C CE2  . PHE A 1 29  ? -3.731  -3.122  -0.328  1.00 0.00 ? 29  PHE A CE2  4  
ATOM   6662  C CZ   . PHE A 1 29  ? -3.420  -4.464  -0.433  1.00 0.00 ? 29  PHE A CZ   4  
ATOM   6663  H H    . PHE A 1 29  ? -2.779  -2.751  -4.641  1.00 0.00 ? 29  PHE A H    4  
ATOM   6664  H HA   . PHE A 1 29  ? -2.625  -0.093  -3.371  1.00 0.00 ? 29  PHE A HA   4  
ATOM   6665  H HB2  . PHE A 1 29  ? -0.412  -2.103  -3.191  1.00 0.00 ? 29  PHE A HB2  4  
ATOM   6666  H HB3  . PHE A 1 29  ? -0.864  -0.828  -2.056  1.00 0.00 ? 29  PHE A HB3  4  
ATOM   6667  H HD1  . PHE A 1 29  ? -0.905  -4.270  -2.657  1.00 0.00 ? 29  PHE A HD1  4  
ATOM   6668  H HD2  . PHE A 1 29  ? -3.267  -1.143  -0.985  1.00 0.00 ? 29  PHE A HD2  4  
ATOM   6669  H HE1  . PHE A 1 29  ? -2.158  -5.920  -1.351  1.00 0.00 ? 29  PHE A HE1  4  
ATOM   6670  H HE2  . PHE A 1 29  ? -4.526  -2.800  0.329   1.00 0.00 ? 29  PHE A HE2  4  
ATOM   6671  H HZ   . PHE A 1 29  ? -3.970  -5.192  0.136   1.00 0.00 ? 29  PHE A HZ   4  
ATOM   6672  N N    . TYR A 1 30  ? -1.217  -0.984  -6.076  1.00 0.00 ? 30  TYR A N    4  
ATOM   6673  C CA   . TYR A 1 30  ? -0.433  -0.514  -7.216  1.00 0.00 ? 30  TYR A CA   4  
ATOM   6674  C C    . TYR A 1 30  ? -0.731  0.949   -7.517  1.00 0.00 ? 30  TYR A C    4  
ATOM   6675  O O    . TYR A 1 30  ? 0.172   1.786   -7.542  1.00 0.00 ? 30  TYR A O    4  
ATOM   6676  C CB   . TYR A 1 30  ? -0.735  -1.356  -8.461  1.00 0.00 ? 30  TYR A CB   4  
ATOM   6677  C CG   . TYR A 1 30  ? -0.012  -2.681  -8.500  1.00 0.00 ? 30  TYR A CG   4  
ATOM   6678  C CD1  . TYR A 1 30  ? 0.383   -3.303  -7.332  1.00 0.00 ? 30  TYR A CD1  4  
ATOM   6679  C CD2  . TYR A 1 30  ? 0.280   -3.305  -9.706  1.00 0.00 ? 30  TYR A CD2  4  
ATOM   6680  C CE1  . TYR A 1 30  ? 1.044   -4.506  -7.352  1.00 0.00 ? 30  TYR A CE1  4  
ATOM   6681  C CE2  . TYR A 1 30  ? 0.943   -4.516  -9.735  1.00 0.00 ? 30  TYR A CE2  4  
ATOM   6682  C CZ   . TYR A 1 30  ? 1.321   -5.110  -8.552  1.00 0.00 ? 30  TYR A CZ   4  
ATOM   6683  O OH   . TYR A 1 30  ? 1.977   -6.312  -8.566  1.00 0.00 ? 30  TYR A OH   4  
ATOM   6684  H H    . TYR A 1 30  ? -1.783  -1.780  -6.178  1.00 0.00 ? 30  TYR A H    4  
ATOM   6685  H HA   . TYR A 1 30  ? 0.616   -0.617  -6.967  1.00 0.00 ? 30  TYR A HA   4  
ATOM   6686  H HB2  . TYR A 1 30  ? -1.792  -1.560  -8.493  1.00 0.00 ? 30  TYR A HB2  4  
ATOM   6687  H HB3  . TYR A 1 30  ? -0.454  -0.797  -9.341  1.00 0.00 ? 30  TYR A HB3  4  
ATOM   6688  H HD1  . TYR A 1 30  ? 0.158   -2.831  -6.392  1.00 0.00 ? 30  TYR A HD1  4  
ATOM   6689  H HD2  . TYR A 1 30  ? -0.019  -2.834  -10.629 1.00 0.00 ? 30  TYR A HD2  4  
ATOM   6690  H HE1  . TYR A 1 30  ? 1.345   -4.971  -6.426  1.00 0.00 ? 30  TYR A HE1  4  
ATOM   6691  H HE2  . TYR A 1 30  ? 1.162   -4.991  -10.681 1.00 0.00 ? 30  TYR A HE2  4  
ATOM   6692  H HH   . TYR A 1 30  ? 2.752   -6.248  -9.140  1.00 0.00 ? 30  TYR A HH   4  
ATOM   6693  N N    . LYS A 1 31  ? -2.002  1.245   -7.734  1.00 0.00 ? 31  LYS A N    4  
ATOM   6694  C CA   . LYS A 1 31  ? -2.428  2.563   -8.156  1.00 0.00 ? 31  LYS A CA   4  
ATOM   6695  C C    . LYS A 1 31  ? -3.598  3.023   -7.288  1.00 0.00 ? 31  LYS A C    4  
ATOM   6696  O O    . LYS A 1 31  ? -4.284  2.184   -6.701  1.00 0.00 ? 31  LYS A O    4  
ATOM   6697  C CB   . LYS A 1 31  ? -2.865  2.485   -9.618  1.00 0.00 ? 31  LYS A CB   4  
ATOM   6698  C CG   . LYS A 1 31  ? -1.867  1.777   -10.526 1.00 0.00 ? 31  LYS A CG   4  
ATOM   6699  C CD   . LYS A 1 31  ? -2.220  1.962   -11.986 1.00 0.00 ? 31  LYS A CD   4  
ATOM   6700  C CE   . LYS A 1 31  ? -1.265  1.194   -12.882 1.00 0.00 ? 31  LYS A CE   4  
ATOM   6701  N NZ   . LYS A 1 31  ? -1.211  -0.250  -12.528 1.00 0.00 ? 31  LYS A NZ   4  
ATOM   6702  H H    . LYS A 1 31  ? -2.684  0.557   -7.600  1.00 0.00 ? 31  LYS A H    4  
ATOM   6703  H HA   . LYS A 1 31  ? -1.600  3.248   -8.056  1.00 0.00 ? 31  LYS A HA   4  
ATOM   6704  H HB2  . LYS A 1 31  ? -3.794  1.932   -9.658  1.00 0.00 ? 31  LYS A HB2  4  
ATOM   6705  H HB3  . LYS A 1 31  ? -3.026  3.484   -9.993  1.00 0.00 ? 31  LYS A HB3  4  
ATOM   6706  H HG2  . LYS A 1 31  ? -0.875  2.165   -10.354 1.00 0.00 ? 31  LYS A HG2  4  
ATOM   6707  H HG3  . LYS A 1 31  ? -1.880  0.723   -10.297 1.00 0.00 ? 31  LYS A HG3  4  
ATOM   6708  H HD2  . LYS A 1 31  ? -3.226  1.605   -12.154 1.00 0.00 ? 31  LYS A HD2  4  
ATOM   6709  H HD3  . LYS A 1 31  ? -2.161  3.015   -12.228 1.00 0.00 ? 31  LYS A HD3  4  
ATOM   6710  H HE2  . LYS A 1 31  ? -1.593  1.292   -13.906 1.00 0.00 ? 31  LYS A HE2  4  
ATOM   6711  H HE3  . LYS A 1 31  ? -0.277  1.618   -12.781 1.00 0.00 ? 31  LYS A HE3  4  
ATOM   6712  H HZ1  . LYS A 1 31  ? -0.664  -0.774  -13.241 1.00 0.00 ? 31  LYS A HZ1  4  
ATOM   6713  H HZ2  . LYS A 1 31  ? -2.173  -0.647  -12.484 1.00 0.00 ? 31  LYS A HZ2  4  
ATOM   6714  H HZ3  . LYS A 1 31  ? -0.755  -0.373  -11.602 1.00 0.00 ? 31  LYS A HZ3  4  
ATOM   6715  N N    . PRO A 1 32  ? -3.849  4.345   -7.190  1.00 0.00 ? 32  PRO A N    4  
ATOM   6716  C CA   . PRO A 1 32  ? -4.978  4.882   -6.416  1.00 0.00 ? 32  PRO A CA   4  
ATOM   6717  C C    . PRO A 1 32  ? -6.307  4.266   -6.836  1.00 0.00 ? 32  PRO A C    4  
ATOM   6718  O O    . PRO A 1 32  ? -6.585  4.120   -8.031  1.00 0.00 ? 32  PRO A O    4  
ATOM   6719  C CB   . PRO A 1 32  ? -4.968  6.385   -6.749  1.00 0.00 ? 32  PRO A CB   4  
ATOM   6720  C CG   . PRO A 1 32  ? -4.090  6.511   -7.946  1.00 0.00 ? 32  PRO A CG   4  
ATOM   6721  C CD   . PRO A 1 32  ? -3.063  5.433   -7.797  1.00 0.00 ? 32  PRO A CD   4  
ATOM   6722  H HA   . PRO A 1 32  ? -4.835  4.740   -5.356  1.00 0.00 ? 32  PRO A HA   4  
ATOM   6723  H HB2  . PRO A 1 32  ? -5.975  6.715   -6.961  1.00 0.00 ? 32  PRO A HB2  4  
ATOM   6724  H HB3  . PRO A 1 32  ? -4.573  6.942   -5.911  1.00 0.00 ? 32  PRO A HB3  4  
ATOM   6725  H HG2  . PRO A 1 32  ? -4.668  6.359   -8.845  1.00 0.00 ? 32  PRO A HG2  4  
ATOM   6726  H HG3  . PRO A 1 32  ? -3.618  7.481   -7.958  1.00 0.00 ? 32  PRO A HG3  4  
ATOM   6727  H HD2  . PRO A 1 32  ? -2.664  5.149   -8.757  1.00 0.00 ? 32  PRO A HD2  4  
ATOM   6728  H HD3  . PRO A 1 32  ? -2.277  5.758   -7.131  1.00 0.00 ? 32  PRO A HD3  4  
ATOM   6729  N N    . VAL A 1 33  ? -7.119  3.893   -5.849  1.00 0.00 ? 33  VAL A N    4  
ATOM   6730  C CA   . VAL A 1 33  ? -8.437  3.338   -6.120  1.00 0.00 ? 33  VAL A CA   4  
ATOM   6731  C C    . VAL A 1 33  ? -9.263  4.363   -6.888  1.00 0.00 ? 33  VAL A C    4  
ATOM   6732  O O    . VAL A 1 33  ? -9.165  5.569   -6.635  1.00 0.00 ? 33  VAL A O    4  
ATOM   6733  C CB   . VAL A 1 33  ? -9.174  2.903   -4.819  1.00 0.00 ? 33  VAL A CB   4  
ATOM   6734  C CG1  . VAL A 1 33  ? -8.187  2.420   -3.774  1.00 0.00 ? 33  VAL A CG1  4  
ATOM   6735  C CG2  . VAL A 1 33  ? -10.075 3.995   -4.260  1.00 0.00 ? 33  VAL A CG2  4  
ATOM   6736  H H    . VAL A 1 33  ? -6.817  3.988   -4.921  1.00 0.00 ? 33  VAL A H    4  
ATOM   6737  H HA   . VAL A 1 33  ? -8.304  2.464   -6.745  1.00 0.00 ? 33  VAL A HA   4  
ATOM   6738  H HB   . VAL A 1 33  ? -9.804  2.065   -5.066  1.00 0.00 ? 33  VAL A HB   4  
ATOM   6739  H HG11 . VAL A 1 33  ? -7.651  1.569   -4.160  1.00 0.00 ? 33  VAL A HG11 4  
ATOM   6740  H HG12 . VAL A 1 33  ? -8.719  2.134   -2.879  1.00 0.00 ? 33  VAL A HG12 4  
ATOM   6741  H HG13 . VAL A 1 33  ? -7.489  3.210   -3.541  1.00 0.00 ? 33  VAL A HG13 4  
ATOM   6742  H HG21 . VAL A 1 33  ? -11.052 3.922   -4.727  1.00 0.00 ? 33  VAL A HG21 4  
ATOM   6743  H HG22 . VAL A 1 33  ? -9.644  4.962   -4.472  1.00 0.00 ? 33  VAL A HG22 4  
ATOM   6744  H HG23 . VAL A 1 33  ? -10.176 3.871   -3.192  1.00 0.00 ? 33  VAL A HG23 4  
ATOM   6745  N N    . ASP A 1 34  ? -10.053 3.896   -7.834  1.00 0.00 ? 34  ASP A N    4  
ATOM   6746  C CA   . ASP A 1 34  ? -10.802 4.799   -8.700  1.00 0.00 ? 34  ASP A CA   4  
ATOM   6747  C C    . ASP A 1 34  ? -12.104 5.195   -8.032  1.00 0.00 ? 34  ASP A C    4  
ATOM   6748  O O    . ASP A 1 34  ? -13.177 4.814   -8.482  1.00 0.00 ? 34  ASP A O    4  
ATOM   6749  C CB   . ASP A 1 34  ? -11.082 4.160   -10.068 1.00 0.00 ? 34  ASP A CB   4  
ATOM   6750  C CG   . ASP A 1 34  ? -9.813  3.812   -10.820 1.00 0.00 ? 34  ASP A CG   4  
ATOM   6751  O OD1  . ASP A 1 34  ? -9.274  4.688   -11.524 1.00 0.00 ? 34  ASP A OD1  4  
ATOM   6752  O OD2  . ASP A 1 34  ? -9.349  2.657   -10.713 1.00 0.00 ? 34  ASP A OD2  4  
ATOM   6753  H H    . ASP A 1 34  ? -10.154 2.923   -7.937  1.00 0.00 ? 34  ASP A H    4  
ATOM   6754  H HA   . ASP A 1 34  ? -10.206 5.688   -8.844  1.00 0.00 ? 34  ASP A HA   4  
ATOM   6755  H HB2  . ASP A 1 34  ? -11.656 3.257   -9.930  1.00 0.00 ? 34  ASP A HB2  4  
ATOM   6756  H HB3  . ASP A 1 34  ? -11.652 4.854   -10.669 1.00 0.00 ? 34  ASP A HB3  4  
ATOM   6757  N N    . ALA A 1 35  ? -11.990 5.967   -6.955  1.00 0.00 ? 35  ALA A N    4  
ATOM   6758  C CA   . ALA A 1 35  ? -13.135 6.346   -6.131  1.00 0.00 ? 35  ALA A CA   4  
ATOM   6759  C C    . ALA A 1 35  ? -14.282 6.909   -6.966  1.00 0.00 ? 35  ALA A C    4  
ATOM   6760  O O    . ALA A 1 35  ? -15.441 6.582   -6.726  1.00 0.00 ? 35  ALA A O    4  
ATOM   6761  C CB   . ALA A 1 35  ? -12.708 7.350   -5.073  1.00 0.00 ? 35  ALA A CB   4  
ATOM   6762  H H    . ALA A 1 35  ? -11.098 6.293   -6.704  1.00 0.00 ? 35  ALA A H    4  
ATOM   6763  H HA   . ALA A 1 35  ? -13.480 5.458   -5.623  1.00 0.00 ? 35  ALA A HA   4  
ATOM   6764  H HB1  . ALA A 1 35  ? -12.398 6.824   -4.178  1.00 0.00 ? 35  ALA A HB1  4  
ATOM   6765  H HB2  . ALA A 1 35  ? -13.538 7.999   -4.839  1.00 0.00 ? 35  ALA A HB2  4  
ATOM   6766  H HB3  . ALA A 1 35  ? -11.885 7.938   -5.448  1.00 0.00 ? 35  ALA A HB3  4  
ATOM   6767  N N    . SER A 1 36  ? -13.959 7.734   -7.952  1.00 0.00 ? 36  SER A N    4  
ATOM   6768  C CA   . SER A 1 36  ? -14.972 8.317   -8.821  1.00 0.00 ? 36  SER A CA   4  
ATOM   6769  C C    . SER A 1 36  ? -15.764 7.232   -9.560  1.00 0.00 ? 36  SER A C    4  
ATOM   6770  O O    . SER A 1 36  ? -16.984 7.326   -9.698  1.00 0.00 ? 36  SER A O    4  
ATOM   6771  C CB   . SER A 1 36  ? -14.314 9.268   -9.817  1.00 0.00 ? 36  SER A CB   4  
ATOM   6772  O OG   . SER A 1 36  ? -13.597 10.288  -9.139  1.00 0.00 ? 36  SER A OG   4  
ATOM   6773  H H    . SER A 1 36  ? -13.014 7.965   -8.094  1.00 0.00 ? 36  SER A H    4  
ATOM   6774  H HA   . SER A 1 36  ? -15.652 8.879   -8.200  1.00 0.00 ? 36  SER A HA   4  
ATOM   6775  H HB2  . SER A 1 36  ? -13.628 8.711   -10.440 1.00 0.00 ? 36  SER A HB2  4  
ATOM   6776  H HB3  . SER A 1 36  ? -15.073 9.725   -10.434 1.00 0.00 ? 36  SER A HB3  4  
ATOM   6777  H HG   . SER A 1 36  ? -13.914 10.350  -8.230  1.00 0.00 ? 36  SER A HG   4  
ATOM   6778  N N    . ALA A 1 37  ? -15.070 6.196   -10.012 1.00 0.00 ? 37  ALA A N    4  
ATOM   6779  C CA   . ALA A 1 37  ? -15.709 5.096   -10.725 1.00 0.00 ? 37  ALA A CA   4  
ATOM   6780  C C    . ALA A 1 37  ? -16.256 4.051   -9.752  1.00 0.00 ? 37  ALA A C    4  
ATOM   6781  O O    . ALA A 1 37  ? -17.113 3.242   -10.107 1.00 0.00 ? 37  ALA A O    4  
ATOM   6782  C CB   . ALA A 1 37  ? -14.719 4.456   -11.683 1.00 0.00 ? 37  ALA A CB   4  
ATOM   6783  H H    . ALA A 1 37  ? -14.101 6.169   -9.864  1.00 0.00 ? 37  ALA A H    4  
ATOM   6784  H HA   . ALA A 1 37  ? -16.526 5.500   -11.304 1.00 0.00 ? 37  ALA A HA   4  
ATOM   6785  H HB1  . ALA A 1 37  ? -13.860 4.107   -11.128 1.00 0.00 ? 37  ALA A HB1  4  
ATOM   6786  H HB2  . ALA A 1 37  ? -14.403 5.184   -12.415 1.00 0.00 ? 37  ALA A HB2  4  
ATOM   6787  H HB3  . ALA A 1 37  ? -15.188 3.622   -12.183 1.00 0.00 ? 37  ALA A HB3  4  
ATOM   6788  N N    . LEU A 1 38  ? -15.750 4.084   -8.527  1.00 0.00 ? 38  LEU A N    4  
ATOM   6789  C CA   . LEU A 1 38  ? -16.149 3.143   -7.483  1.00 0.00 ? 38  LEU A CA   4  
ATOM   6790  C C    . LEU A 1 38  ? -17.359 3.661   -6.706  1.00 0.00 ? 38  LEU A C    4  
ATOM   6791  O O    . LEU A 1 38  ? -17.848 3.000   -5.790  1.00 0.00 ? 38  LEU A O    4  
ATOM   6792  C CB   . LEU A 1 38  ? -14.971 2.898   -6.532  1.00 0.00 ? 38  LEU A CB   4  
ATOM   6793  C CG   . LEU A 1 38  ? -13.840 2.035   -7.102  1.00 0.00 ? 38  LEU A CG   4  
ATOM   6794  C CD1  . LEU A 1 38  ? -12.551 2.236   -6.314  1.00 0.00 ? 38  LEU A CD1  4  
ATOM   6795  C CD2  . LEU A 1 38  ? -14.239 0.569   -7.091  1.00 0.00 ? 38  LEU A CD2  4  
ATOM   6796  H H    . LEU A 1 38  ? -15.070 4.761   -8.317  1.00 0.00 ? 38  LEU A H    4  
ATOM   6797  H HA   . LEU A 1 38  ? -16.414 2.212   -7.957  1.00 0.00 ? 38  LEU A HA   4  
ATOM   6798  H HB2  . LEU A 1 38  ? -14.558 3.855   -6.253  1.00 0.00 ? 38  LEU A HB2  4  
ATOM   6799  H HB3  . LEU A 1 38  ? -15.346 2.416   -5.642  1.00 0.00 ? 38  LEU A HB3  4  
ATOM   6800  H HG   . LEU A 1 38  ? -13.655 2.325   -8.127  1.00 0.00 ? 38  LEU A HG   4  
ATOM   6801  H HD11 . LEU A 1 38  ? -12.738 2.119   -5.257  1.00 0.00 ? 38  LEU A HD11 4  
ATOM   6802  H HD12 . LEU A 1 38  ? -12.168 3.228   -6.502  1.00 0.00 ? 38  LEU A HD12 4  
ATOM   6803  H HD13 . LEU A 1 38  ? -11.821 1.505   -6.632  1.00 0.00 ? 38  LEU A HD13 4  
ATOM   6804  H HD21 . LEU A 1 38  ? -14.334 0.233   -6.070  1.00 0.00 ? 38  LEU A HD21 4  
ATOM   6805  H HD22 . LEU A 1 38  ? -13.483 -0.013  -7.595  1.00 0.00 ? 38  LEU A HD22 4  
ATOM   6806  H HD23 . LEU A 1 38  ? -15.184 0.449   -7.599  1.00 0.00 ? 38  LEU A HD23 4  
ATOM   6807  N N    . GLY A 1 39  ? -17.827 4.850   -7.071  1.00 0.00 ? 39  GLY A N    4  
ATOM   6808  C CA   . GLY A 1 39  ? -18.967 5.451   -6.394  1.00 0.00 ? 39  GLY A CA   4  
ATOM   6809  C C    . GLY A 1 39  ? -18.577 6.090   -5.076  1.00 0.00 ? 39  GLY A C    4  
ATOM   6810  O O    . GLY A 1 39  ? -19.411 6.648   -4.364  1.00 0.00 ? 39  GLY A O    4  
ATOM   6811  H H    . GLY A 1 39  ? -17.397 5.326   -7.811  1.00 0.00 ? 39  GLY A H    4  
ATOM   6812  H HA2  . GLY A 1 39  ? -19.398 6.204   -7.035  1.00 0.00 ? 39  GLY A HA2  4  
ATOM   6813  H HA3  . GLY A 1 39  ? -19.705 4.686   -6.206  1.00 0.00 ? 39  GLY A HA3  4  
ATOM   6814  N N    . LEU A 1 40  ? -17.296 6.016   -4.760  1.00 0.00 ? 40  LEU A N    4  
ATOM   6815  C CA   . LEU A 1 40  ? -16.773 6.537   -3.515  1.00 0.00 ? 40  LEU A CA   4  
ATOM   6816  C C    . LEU A 1 40  ? -16.510 8.030   -3.637  1.00 0.00 ? 40  LEU A C    4  
ATOM   6817  O O    . LEU A 1 40  ? -15.423 8.448   -4.025  1.00 0.00 ? 40  LEU A O    4  
ATOM   6818  C CB   . LEU A 1 40  ? -15.475 5.808   -3.152  1.00 0.00 ? 40  LEU A CB   4  
ATOM   6819  C CG   . LEU A 1 40  ? -15.485 4.296   -3.391  1.00 0.00 ? 40  LEU A CG   4  
ATOM   6820  C CD1  . LEU A 1 40  ? -14.221 3.662   -2.837  1.00 0.00 ? 40  LEU A CD1  4  
ATOM   6821  C CD2  . LEU A 1 40  ? -16.720 3.659   -2.785  1.00 0.00 ? 40  LEU A CD2  4  
ATOM   6822  H H    . LEU A 1 40  ? -16.680 5.590   -5.387  1.00 0.00 ? 40  LEU A H    4  
ATOM   6823  H HA   . LEU A 1 40  ? -17.506 6.365   -2.741  1.00 0.00 ? 40  LEU A HA   4  
ATOM   6824  H HB2  . LEU A 1 40  ? -14.670 6.237   -3.735  1.00 0.00 ? 40  LEU A HB2  4  
ATOM   6825  H HB3  . LEU A 1 40  ? -15.271 5.982   -2.107  1.00 0.00 ? 40  LEU A HB3  4  
ATOM   6826  H HG   . LEU A 1 40  ? -15.504 4.112   -4.455  1.00 0.00 ? 40  LEU A HG   4  
ATOM   6827  H HD11 . LEU A 1 40  ? -13.433 3.741   -3.563  1.00 0.00 ? 40  LEU A HD11 4  
ATOM   6828  H HD12 . LEU A 1 40  ? -14.402 2.624   -2.615  1.00 0.00 ? 40  LEU A HD12 4  
ATOM   6829  H HD13 . LEU A 1 40  ? -13.928 4.176   -1.933  1.00 0.00 ? 40  LEU A HD13 4  
ATOM   6830  H HD21 . LEU A 1 40  ? -16.726 3.843   -1.730  1.00 0.00 ? 40  LEU A HD21 4  
ATOM   6831  H HD22 . LEU A 1 40  ? -16.710 2.598   -2.970  1.00 0.00 ? 40  LEU A HD22 4  
ATOM   6832  H HD23 . LEU A 1 40  ? -17.602 4.094   -3.230  1.00 0.00 ? 40  LEU A HD23 4  
ATOM   6833  N N    . HIS A 1 41  ? -17.505 8.838   -3.309  1.00 0.00 ? 41  HIS A N    4  
ATOM   6834  C CA   . HIS A 1 41  ? -17.350 10.290  -3.377  1.00 0.00 ? 41  HIS A CA   4  
ATOM   6835  C C    . HIS A 1 41  ? -16.724 10.806  -2.091  1.00 0.00 ? 41  HIS A C    4  
ATOM   6836  O O    . HIS A 1 41  ? -16.545 12.009  -1.912  1.00 0.00 ? 41  HIS A O    4  
ATOM   6837  C CB   . HIS A 1 41  ? -18.700 10.991  -3.593  1.00 0.00 ? 41  HIS A CB   4  
ATOM   6838  C CG   . HIS A 1 41  ? -19.531 10.420  -4.711  1.00 0.00 ? 41  HIS A CG   4  
ATOM   6839  N ND1  . HIS A 1 41  ? -19.398 10.824  -6.022  1.00 0.00 ? 41  HIS A ND1  4  
ATOM   6840  C CD2  . HIS A 1 41  ? -20.511 9.475   -4.713  1.00 0.00 ? 41  HIS A CD2  4  
ATOM   6841  C CE1  . HIS A 1 41  ? -20.254 10.159  -6.775  1.00 0.00 ? 41  HIS A CE1  4  
ATOM   6842  N NE2  . HIS A 1 41  ? -20.937 9.337   -6.006  1.00 0.00 ? 41  HIS A NE2  4  
ATOM   6843  H H    . HIS A 1 41  ? -18.360 8.455   -3.015  1.00 0.00 ? 41  HIS A H    4  
ATOM   6844  H HA   . HIS A 1 41  ? -16.693 10.520  -4.205  1.00 0.00 ? 41  HIS A HA   4  
ATOM   6845  H HB2  . HIS A 1 41  ? -19.272 10.932  -2.681  1.00 0.00 ? 41  HIS A HB2  4  
ATOM   6846  H HB3  . HIS A 1 41  ? -18.513 12.033  -3.819  1.00 0.00 ? 41  HIS A HB3  4  
ATOM   6847  H HD1  . HIS A 1 41  ? -18.771 11.505  -6.355  1.00 0.00 ? 41  HIS A HD1  4  
ATOM   6848  H HD2  . HIS A 1 41  ? -20.884 8.921   -3.858  1.00 0.00 ? 41  HIS A HD2  4  
ATOM   6849  H HE1  . HIS A 1 41  ? -20.374 10.269  -7.842  1.00 0.00 ? 41  HIS A HE1  4  
ATOM   6850  H HE2  . HIS A 1 41  ? -21.722 8.816   -6.291  1.00 0.00 ? 41  HIS A HE2  4  
ATOM   6851  N N    . ASP A 1 42  ? -16.398 9.884   -1.194  1.00 0.00 ? 42  ASP A N    4  
ATOM   6852  C CA   . ASP A 1 42  ? -15.918 10.246  0.133   1.00 0.00 ? 42  ASP A CA   4  
ATOM   6853  C C    . ASP A 1 42  ? -14.525 9.685   0.420   1.00 0.00 ? 42  ASP A C    4  
ATOM   6854  O O    . ASP A 1 42  ? -14.095 9.652   1.572   1.00 0.00 ? 42  ASP A O    4  
ATOM   6855  C CB   . ASP A 1 42  ? -16.891 9.731   1.193   1.00 0.00 ? 42  ASP A CB   4  
ATOM   6856  C CG   . ASP A 1 42  ? -18.299 10.256  1.012   1.00 0.00 ? 42  ASP A CG   4  
ATOM   6857  O OD1  . ASP A 1 42  ? -19.129 9.538   0.418   1.00 0.00 ? 42  ASP A OD1  4  
ATOM   6858  O OD2  . ASP A 1 42  ? -18.578 11.389  1.459   1.00 0.00 ? 42  ASP A OD2  4  
ATOM   6859  H H    . ASP A 1 42  ? -16.504 8.939   -1.423  1.00 0.00 ? 42  ASP A H    4  
ATOM   6860  H HA   . ASP A 1 42  ? -15.883 11.317  0.189   1.00 0.00 ? 42  ASP A HA   4  
ATOM   6861  H HB2  . ASP A 1 42  ? -16.924 8.657   1.136   1.00 0.00 ? 42  ASP A HB2  4  
ATOM   6862  H HB3  . ASP A 1 42  ? -16.537 10.024  2.171   1.00 0.00 ? 42  ASP A HB3  4  
ATOM   6863  N N    . TYR A 1 43  ? -13.803 9.260   -0.612  1.00 0.00 ? 43  TYR A N    4  
ATOM   6864  C CA   . TYR A 1 43  ? -12.517 8.607   -0.404  1.00 0.00 ? 43  TYR A CA   4  
ATOM   6865  C C    . TYR A 1 43  ? -11.482 9.587   0.140   1.00 0.00 ? 43  TYR A C    4  
ATOM   6866  O O    . TYR A 1 43  ? -10.727 9.257   1.053   1.00 0.00 ? 43  TYR A O    4  
ATOM   6867  C CB   . TYR A 1 43  ? -12.022 7.971   -1.714  1.00 0.00 ? 43  TYR A CB   4  
ATOM   6868  C CG   . TYR A 1 43  ? -10.658 7.310   -1.627  1.00 0.00 ? 43  TYR A CG   4  
ATOM   6869  C CD1  . TYR A 1 43  ? -10.533 5.982   -1.244  1.00 0.00 ? 43  TYR A CD1  4  
ATOM   6870  C CD2  . TYR A 1 43  ? -9.498  8.010   -1.942  1.00 0.00 ? 43  TYR A CD2  4  
ATOM   6871  C CE1  . TYR A 1 43  ? -9.297  5.369   -1.171  1.00 0.00 ? 43  TYR A CE1  4  
ATOM   6872  C CE2  . TYR A 1 43  ? -8.258  7.405   -1.873  1.00 0.00 ? 43  TYR A CE2  4  
ATOM   6873  C CZ   . TYR A 1 43  ? -8.161  6.084   -1.486  1.00 0.00 ? 43  TYR A CZ   4  
ATOM   6874  O OH   . TYR A 1 43  ? -6.926  5.479   -1.411  1.00 0.00 ? 43  TYR A OH   4  
ATOM   6875  H H    . TYR A 1 43  ? -14.128 9.402   -1.528  1.00 0.00 ? 43  TYR A H    4  
ATOM   6876  H HA   . TYR A 1 43  ? -12.668 7.832   0.331   1.00 0.00 ? 43  TYR A HA   4  
ATOM   6877  H HB2  . TYR A 1 43  ? -12.730 7.216   -2.021  1.00 0.00 ? 43  TYR A HB2  4  
ATOM   6878  H HB3  . TYR A 1 43  ? -11.971 8.732   -2.478  1.00 0.00 ? 43  TYR A HB3  4  
ATOM   6879  H HD1  . TYR A 1 43  ? -11.421 5.429   -0.996  1.00 0.00 ? 43  TYR A HD1  4  
ATOM   6880  H HD2  . TYR A 1 43  ? -9.574  9.043   -2.245  1.00 0.00 ? 43  TYR A HD2  4  
ATOM   6881  H HE1  . TYR A 1 43  ? -9.226  4.332   -0.877  1.00 0.00 ? 43  TYR A HE1  4  
ATOM   6882  H HE2  . TYR A 1 43  ? -7.370  7.966   -2.121  1.00 0.00 ? 43  TYR A HE2  4  
ATOM   6883  H HH   . TYR A 1 43  ? -6.960  4.622   -1.846  1.00 0.00 ? 43  TYR A HH   4  
ATOM   6884  N N    . HIS A 1 44  ? -11.471 10.800  -0.396  1.00 0.00 ? 44  HIS A N    4  
ATOM   6885  C CA   . HIS A 1 44  ? -10.472 11.789  -0.002  1.00 0.00 ? 44  HIS A CA   4  
ATOM   6886  C C    . HIS A 1 44  ? -10.842 12.455  1.319   1.00 0.00 ? 44  HIS A C    4  
ATOM   6887  O O    . HIS A 1 44  ? -10.075 13.248  1.861   1.00 0.00 ? 44  HIS A O    4  
ATOM   6888  C CB   . HIS A 1 44  ? -10.276 12.842  -1.099  1.00 0.00 ? 44  HIS A CB   4  
ATOM   6889  C CG   . HIS A 1 44  ? -9.467  12.352  -2.266  1.00 0.00 ? 44  HIS A CG   4  
ATOM   6890  N ND1  . HIS A 1 44  ? -8.160  12.731  -2.488  1.00 0.00 ? 44  HIS A ND1  4  
ATOM   6891  C CD2  . HIS A 1 44  ? -9.785  11.504  -3.275  1.00 0.00 ? 44  HIS A CD2  4  
ATOM   6892  C CE1  . HIS A 1 44  ? -7.712  12.139  -3.579  1.00 0.00 ? 44  HIS A CE1  4  
ATOM   6893  N NE2  . HIS A 1 44  ? -8.676  11.389  -4.075  1.00 0.00 ? 44  HIS A NE2  4  
ATOM   6894  H H    . HIS A 1 44  ? -12.158 11.041  -1.058  1.00 0.00 ? 44  HIS A H    4  
ATOM   6895  H HA   . HIS A 1 44  ? -9.539  11.263  0.137   1.00 0.00 ? 44  HIS A HA   4  
ATOM   6896  H HB2  . HIS A 1 44  ? -11.242 13.147  -1.470  1.00 0.00 ? 44  HIS A HB2  4  
ATOM   6897  H HB3  . HIS A 1 44  ? -9.770  13.699  -0.679  1.00 0.00 ? 44  HIS A HB3  4  
ATOM   6898  H HD1  . HIS A 1 44  ? -7.638  13.352  -1.931  1.00 0.00 ? 44  HIS A HD1  4  
ATOM   6899  H HD2  . HIS A 1 44  ? -10.734 11.009  -3.421  1.00 0.00 ? 44  HIS A HD2  4  
ATOM   6900  H HE1  . HIS A 1 44  ? -6.721  12.250  -3.995  1.00 0.00 ? 44  HIS A HE1  4  
ATOM   6901  H HE2  . HIS A 1 44  ? -8.661  10.976  -4.970  1.00 0.00 ? 44  HIS A HE2  4  
ATOM   6902  N N    . ASP A 1 45  ? -12.015 12.123  1.838   1.00 0.00 ? 45  ASP A N    4  
ATOM   6903  C CA   . ASP A 1 45  ? -12.446 12.637  3.132   1.00 0.00 ? 45  ASP A CA   4  
ATOM   6904  C C    . ASP A 1 45  ? -11.966 11.723  4.249   1.00 0.00 ? 45  ASP A C    4  
ATOM   6905  O O    . ASP A 1 45  ? -11.531 12.185  5.304   1.00 0.00 ? 45  ASP A O    4  
ATOM   6906  C CB   . ASP A 1 45  ? -13.970 12.763  3.196   1.00 0.00 ? 45  ASP A CB   4  
ATOM   6907  C CG   . ASP A 1 45  ? -14.509 13.854  2.295   1.00 0.00 ? 45  ASP A CG   4  
ATOM   6908  O OD1  . ASP A 1 45  ? -14.811 13.569  1.118   1.00 0.00 ? 45  ASP A OD1  4  
ATOM   6909  O OD2  . ASP A 1 45  ? -14.643 15.004  2.765   1.00 0.00 ? 45  ASP A OD2  4  
ATOM   6910  H H    . ASP A 1 45  ? -12.607 11.520  1.341   1.00 0.00 ? 45  ASP A H    4  
ATOM   6911  H HA   . ASP A 1 45  ? -12.005 13.614  3.266   1.00 0.00 ? 45  ASP A HA   4  
ATOM   6912  H HB2  . ASP A 1 45  ? -14.412 11.826  2.901   1.00 0.00 ? 45  ASP A HB2  4  
ATOM   6913  H HB3  . ASP A 1 45  ? -14.259 12.986  4.211   1.00 0.00 ? 45  ASP A HB3  4  
ATOM   6914  N N    . ILE A 1 46  ? -12.047 10.423  4.011   1.00 0.00 ? 46  ILE A N    4  
ATOM   6915  C CA   . ILE A 1 46  ? -11.623 9.439   4.998   1.00 0.00 ? 46  ILE A CA   4  
ATOM   6916  C C    . ILE A 1 46  ? -10.112 9.267   4.962   1.00 0.00 ? 46  ILE A C    4  
ATOM   6917  O O    . ILE A 1 46  ? -9.446  9.350   5.994   1.00 0.00 ? 46  ILE A O    4  
ATOM   6918  C CB   . ILE A 1 46  ? -12.318 8.064   4.791   1.00 0.00 ? 46  ILE A CB   4  
ATOM   6919  C CG1  . ILE A 1 46  ? -13.758 8.090   5.298   1.00 0.00 ? 46  ILE A CG1  4  
ATOM   6920  C CG2  . ILE A 1 46  ? -11.565 6.940   5.494   1.00 0.00 ? 46  ILE A CG2  4  
ATOM   6921  C CD1  . ILE A 1 46  ? -14.678 9.022   4.540   1.00 0.00 ? 46  ILE A CD1  4  
ATOM   6922  H H    . ILE A 1 46  ? -12.407 10.116  3.151   1.00 0.00 ? 46  ILE A H    4  
ATOM   6923  H HA   . ILE A 1 46  ? -11.903 9.814   5.972   1.00 0.00 ? 46  ILE A HA   4  
ATOM   6924  H HB   . ILE A 1 46  ? -12.326 7.849   3.730   1.00 0.00 ? 46  ILE A HB   4  
ATOM   6925  H HG12 . ILE A 1 46  ? -14.161 7.094   5.220   1.00 0.00 ? 46  ILE A HG12 4  
ATOM   6926  H HG13 . ILE A 1 46  ? -13.760 8.393   6.335   1.00 0.00 ? 46  ILE A HG13 4  
ATOM   6927  H HG21 . ILE A 1 46  ? -10.838 6.515   4.823   1.00 0.00 ? 46  ILE A HG21 4  
ATOM   6928  H HG22 . ILE A 1 46  ? -12.263 6.174   5.798   1.00 0.00 ? 46  ILE A HG22 4  
ATOM   6929  H HG23 . ILE A 1 46  ? -11.063 7.334   6.367   1.00 0.00 ? 46  ILE A HG23 4  
ATOM   6930  H HD11 . ILE A 1 46  ? -14.734 8.710   3.508   1.00 0.00 ? 46  ILE A HD11 4  
ATOM   6931  H HD12 . ILE A 1 46  ? -14.290 10.029  4.590   1.00 0.00 ? 46  ILE A HD12 4  
ATOM   6932  H HD13 . ILE A 1 46  ? -15.663 8.993   4.979   1.00 0.00 ? 46  ILE A HD13 4  
ATOM   6933  N N    . ILE A 1 47  ? -9.573  9.047   3.773   1.00 0.00 ? 47  ILE A N    4  
ATOM   6934  C CA   . ILE A 1 47  ? -8.148  8.807   3.623   1.00 0.00 ? 47  ILE A CA   4  
ATOM   6935  C C    . ILE A 1 47  ? -7.374  10.119  3.697   1.00 0.00 ? 47  ILE A C    4  
ATOM   6936  O O    . ILE A 1 47  ? -7.519  10.984  2.833   1.00 0.00 ? 47  ILE A O    4  
ATOM   6937  C CB   . ILE A 1 47  ? -7.829  8.111   2.288   1.00 0.00 ? 47  ILE A CB   4  
ATOM   6938  C CG1  . ILE A 1 47  ? -8.705  6.869   2.097   1.00 0.00 ? 47  ILE A CG1  4  
ATOM   6939  C CG2  . ILE A 1 47  ? -6.355  7.738   2.238   1.00 0.00 ? 47  ILE A CG2  4  
ATOM   6940  C CD1  . ILE A 1 47  ? -8.356  5.725   3.012   1.00 0.00 ? 47  ILE A CD1  4  
ATOM   6941  H H    . ILE A 1 47  ? -10.144 9.059   2.973   1.00 0.00 ? 47  ILE A H    4  
ATOM   6942  H HA   . ILE A 1 47  ? -7.831  8.161   4.429   1.00 0.00 ? 47  ILE A HA   4  
ATOM   6943  H HB   . ILE A 1 47  ? -8.026  8.806   1.490   1.00 0.00 ? 47  ILE A HB   4  
ATOM   6944  H HG12 . ILE A 1 47  ? -9.733  7.133   2.290   1.00 0.00 ? 47  ILE A HG12 4  
ATOM   6945  H HG13 . ILE A 1 47  ? -8.612  6.522   1.079   1.00 0.00 ? 47  ILE A HG13 4  
ATOM   6946  H HG21 . ILE A 1 47  ? -6.189  7.024   1.450   1.00 0.00 ? 47  ILE A HG21 4  
ATOM   6947  H HG22 . ILE A 1 47  ? -6.061  7.309   3.183   1.00 0.00 ? 47  ILE A HG22 4  
ATOM   6948  H HG23 . ILE A 1 47  ? -5.767  8.625   2.048   1.00 0.00 ? 47  ILE A HG23 4  
ATOM   6949  H HD11 . ILE A 1 47  ? -8.454  6.043   4.038   1.00 0.00 ? 47  ILE A HD11 4  
ATOM   6950  H HD12 . ILE A 1 47  ? -7.342  5.415   2.822   1.00 0.00 ? 47  ILE A HD12 4  
ATOM   6951  H HD13 . ILE A 1 47  ? -9.020  4.901   2.824   1.00 0.00 ? 47  ILE A HD13 4  
ATOM   6952  N N    . LYS A 1 48  ? -6.569  10.270  4.739   1.00 0.00 ? 48  LYS A N    4  
ATOM   6953  C CA   . LYS A 1 48  ? -5.775  11.478  4.920   1.00 0.00 ? 48  LYS A CA   4  
ATOM   6954  C C    . LYS A 1 48  ? -4.369  11.317  4.349   1.00 0.00 ? 48  LYS A C    4  
ATOM   6955  O O    . LYS A 1 48  ? -3.702  12.297  4.019   1.00 0.00 ? 48  LYS A O    4  
ATOM   6956  C CB   . LYS A 1 48  ? -5.706  11.833  6.398   1.00 0.00 ? 48  LYS A CB   4  
ATOM   6957  C CG   . LYS A 1 48  ? -7.050  12.255  6.964   1.00 0.00 ? 48  LYS A CG   4  
ATOM   6958  C CD   . LYS A 1 48  ? -7.539  13.556  6.347   1.00 0.00 ? 48  LYS A CD   4  
ATOM   6959  C CE   . LYS A 1 48  ? -9.037  13.708  6.498   1.00 0.00 ? 48  LYS A CE   4  
ATOM   6960  N NZ   . LYS A 1 48  ? -9.481  13.566  7.909   1.00 0.00 ? 48  LYS A NZ   4  
ATOM   6961  H H    . LYS A 1 48  ? -6.517  9.558   5.412   1.00 0.00 ? 48  LYS A H    4  
ATOM   6962  H HA   . LYS A 1 48  ? -6.276  12.277  4.396   1.00 0.00 ? 48  LYS A HA   4  
ATOM   6963  H HB2  . LYS A 1 48  ? -5.358  10.971  6.948   1.00 0.00 ? 48  LYS A HB2  4  
ATOM   6964  H HB3  . LYS A 1 48  ? -5.005  12.638  6.529   1.00 0.00 ? 48  LYS A HB3  4  
ATOM   6965  H HG2  . LYS A 1 48  ? -7.771  11.480  6.756   1.00 0.00 ? 48  LYS A HG2  4  
ATOM   6966  H HG3  . LYS A 1 48  ? -6.956  12.385  8.032   1.00 0.00 ? 48  LYS A HG3  4  
ATOM   6967  H HD2  . LYS A 1 48  ? -7.051  14.386  6.833   1.00 0.00 ? 48  LYS A HD2  4  
ATOM   6968  H HD3  . LYS A 1 48  ? -7.301  13.558  5.297   1.00 0.00 ? 48  LYS A HD3  4  
ATOM   6969  H HE2  . LYS A 1 48  ? -9.325  14.683  6.136   1.00 0.00 ? 48  LYS A HE2  4  
ATOM   6970  H HE3  . LYS A 1 48  ? -9.509  12.949  5.897   1.00 0.00 ? 48  LYS A HE3  4  
ATOM   6971  H HZ1  . LYS A 1 48  ? -9.192  12.642  8.286   1.00 0.00 ? 48  LYS A HZ1  4  
ATOM   6972  H HZ2  . LYS A 1 48  ? -10.518 13.640  7.966   1.00 0.00 ? 48  LYS A HZ2  4  
ATOM   6973  H HZ3  . LYS A 1 48  ? -9.060  14.315  8.493   1.00 0.00 ? 48  LYS A HZ3  4  
ATOM   6974  N N    . HIS A 1 49  ? -3.919  10.077  4.256   1.00 0.00 ? 49  HIS A N    4  
ATOM   6975  C CA   . HIS A 1 49  ? -2.627  9.758   3.654   1.00 0.00 ? 49  HIS A CA   4  
ATOM   6976  C C    . HIS A 1 49  ? -2.798  8.790   2.479   1.00 0.00 ? 49  HIS A C    4  
ATOM   6977  O O    . HIS A 1 49  ? -2.406  7.624   2.577   1.00 0.00 ? 49  HIS A O    4  
ATOM   6978  C CB   . HIS A 1 49  ? -1.687  9.135   4.693   1.00 0.00 ? 49  HIS A CB   4  
ATOM   6979  C CG   . HIS A 1 49  ? -1.247  10.081  5.768   1.00 0.00 ? 49  HIS A CG   4  
ATOM   6980  N ND1  . HIS A 1 49  ? -0.041  10.745  5.737   1.00 0.00 ? 49  HIS A ND1  4  
ATOM   6981  C CD2  . HIS A 1 49  ? -1.852  10.462  6.918   1.00 0.00 ? 49  HIS A CD2  4  
ATOM   6982  C CE1  . HIS A 1 49  ? 0.079   11.490  6.817   1.00 0.00 ? 49  HIS A CE1  4  
ATOM   6983  N NE2  . HIS A 1 49  ? -1.006  11.337  7.549   1.00 0.00 ? 49  HIS A NE2  4  
ATOM   6984  H H    . HIS A 1 49  ? -4.464  9.351   4.613   1.00 0.00 ? 49  HIS A H    4  
ATOM   6985  H HA   . HIS A 1 49  ? -2.187  10.675  3.297   1.00 0.00 ? 49  HIS A HA   4  
ATOM   6986  H HB2  . HIS A 1 49  ? -2.189  8.308   5.170   1.00 0.00 ? 49  HIS A HB2  4  
ATOM   6987  H HB3  . HIS A 1 49  ? -0.803  8.770   4.191   1.00 0.00 ? 49  HIS A HB3  4  
ATOM   6988  H HD1  . HIS A 1 49  ? 0.634   10.675  5.026   1.00 0.00 ? 49  HIS A HD1  4  
ATOM   6989  H HD2  . HIS A 1 49  ? -2.821  10.138  7.271   1.00 0.00 ? 49  HIS A HD2  4  
ATOM   6990  H HE1  . HIS A 1 49  ? 0.920   12.121  7.059   1.00 0.00 ? 49  HIS A HE1  4  
ATOM   6991  H HE2  . HIS A 1 49  ? -1.218  11.854  8.357   1.00 0.00 ? 49  HIS A HE2  4  
ATOM   6992  N N    . PRO A 1 50  ? -3.412  9.237   1.362   1.00 0.00 ? 50  PRO A N    4  
ATOM   6993  C CA   . PRO A 1 50  ? -3.552  8.404   0.165   1.00 0.00 ? 50  PRO A CA   4  
ATOM   6994  C C    . PRO A 1 50  ? -2.209  8.154   -0.512  1.00 0.00 ? 50  PRO A C    4  
ATOM   6995  O O    . PRO A 1 50  ? -1.592  9.067   -1.068  1.00 0.00 ? 50  PRO A O    4  
ATOM   6996  C CB   . PRO A 1 50  ? -4.480  9.211   -0.746  1.00 0.00 ? 50  PRO A CB   4  
ATOM   6997  C CG   . PRO A 1 50  ? -4.333  10.620  -0.295  1.00 0.00 ? 50  PRO A CG   4  
ATOM   6998  C CD   . PRO A 1 50  ? -4.032  10.563  1.182   1.00 0.00 ? 50  PRO A CD   4  
ATOM   6999  H HA   . PRO A 1 50  ? -4.014  7.457   0.403   1.00 0.00 ? 50  PRO A HA   4  
ATOM   7000  H HB2  . PRO A 1 50  ? -4.170  9.092   -1.774  1.00 0.00 ? 50  PRO A HB2  4  
ATOM   7001  H HB3  . PRO A 1 50  ? -5.496  8.864   -0.628  1.00 0.00 ? 50  PRO A HB3  4  
ATOM   7002  H HG2  . PRO A 1 50  ? -3.519  11.091  -0.829  1.00 0.00 ? 50  PRO A HG2  4  
ATOM   7003  H HG3  . PRO A 1 50  ? -5.256  11.153  -0.471  1.00 0.00 ? 50  PRO A HG3  4  
ATOM   7004  H HD2  . PRO A 1 50  ? -3.348  11.351  1.464   1.00 0.00 ? 50  PRO A HD2  4  
ATOM   7005  H HD3  . PRO A 1 50  ? -4.948  10.636  1.756   1.00 0.00 ? 50  PRO A HD3  4  
ATOM   7006  N N    . MET A 1 51  ? -1.754  6.918   -0.440  1.00 0.00 ? 51  MET A N    4  
ATOM   7007  C CA   . MET A 1 51  ? -0.465  6.543   -0.977  1.00 0.00 ? 51  MET A CA   4  
ATOM   7008  C C    . MET A 1 51  ? -0.580  5.238   -1.749  1.00 0.00 ? 51  MET A C    4  
ATOM   7009  O O    . MET A 1 51  ? -1.421  4.397   -1.440  1.00 0.00 ? 51  MET A O    4  
ATOM   7010  C CB   . MET A 1 51  ? 0.570   6.429   0.154   1.00 0.00 ? 51  MET A CB   4  
ATOM   7011  C CG   . MET A 1 51  ? 1.924   5.884   -0.293  1.00 0.00 ? 51  MET A CG   4  
ATOM   7012  S SD   . MET A 1 51  ? 2.585   6.764   -1.727  1.00 0.00 ? 51  MET A SD   4  
ATOM   7013  C CE   . MET A 1 51  ? 2.567   8.445   -1.128  1.00 0.00 ? 51  MET A CE   4  
ATOM   7014  H H    . MET A 1 51  ? -2.319  6.225   -0.052  1.00 0.00 ? 51  MET A H    4  
ATOM   7015  H HA   . MET A 1 51  ? -0.159  7.324   -1.664  1.00 0.00 ? 51  MET A HA   4  
ATOM   7016  H HB2  . MET A 1 51  ? 0.729   7.412   0.570   1.00 0.00 ? 51  MET A HB2  4  
ATOM   7017  H HB3  . MET A 1 51  ? 0.176   5.782   0.930   1.00 0.00 ? 51  MET A HB3  4  
ATOM   7018  H HG2  . MET A 1 51  ? 2.629   5.974   0.526   1.00 0.00 ? 51  MET A HG2  4  
ATOM   7019  H HG3  . MET A 1 51  ? 1.811   4.839   -0.554  1.00 0.00 ? 51  MET A HG3  4  
ATOM   7020  H HE1  . MET A 1 51  ? 3.066   8.481   -0.179  1.00 0.00 ? 51  MET A HE1  4  
ATOM   7021  H HE2  . MET A 1 51  ? 1.547   8.778   -1.013  1.00 0.00 ? 51  MET A HE2  4  
ATOM   7022  H HE3  . MET A 1 51  ? 3.080   9.085   -1.830  1.00 0.00 ? 51  MET A HE3  4  
ATOM   7023  N N    . ASP A 1 52  ? 0.274   5.081   -2.747  1.00 0.00 ? 52  ASP A N    4  
ATOM   7024  C CA   . ASP A 1 52  ? 0.254   3.913   -3.612  1.00 0.00 ? 52  ASP A CA   4  
ATOM   7025  C C    . ASP A 1 52  ? 1.684   3.444   -3.824  1.00 0.00 ? 52  ASP A C    4  
ATOM   7026  O O    . ASP A 1 52  ? 2.594   4.269   -3.821  1.00 0.00 ? 52  ASP A O    4  
ATOM   7027  C CB   . ASP A 1 52  ? -0.382  4.264   -4.966  1.00 0.00 ? 52  ASP A CB   4  
ATOM   7028  C CG   . ASP A 1 52  ? -1.513  5.264   -4.837  1.00 0.00 ? 52  ASP A CG   4  
ATOM   7029  O OD1  . ASP A 1 52  ? -2.628  4.866   -4.444  1.00 0.00 ? 52  ASP A OD1  4  
ATOM   7030  O OD2  . ASP A 1 52  ? -1.281  6.463   -5.127  1.00 0.00 ? 52  ASP A OD2  4  
ATOM   7031  H H    . ASP A 1 52  ? 0.956   5.767   -2.895  1.00 0.00 ? 52  ASP A H    4  
ATOM   7032  H HA   . ASP A 1 52  ? -0.316  3.135   -3.128  1.00 0.00 ? 52  ASP A HA   4  
ATOM   7033  H HB2  . ASP A 1 52  ? 0.372   4.691   -5.612  1.00 0.00 ? 52  ASP A HB2  4  
ATOM   7034  H HB3  . ASP A 1 52  ? -0.771  3.362   -5.422  1.00 0.00 ? 52  ASP A HB3  4  
ATOM   7035  N N    . LEU A 1 53  ? 1.900   2.148   -4.001  1.00 0.00 ? 53  LEU A N    4  
ATOM   7036  C CA   . LEU A 1 53  ? 3.255   1.628   -4.192  1.00 0.00 ? 53  LEU A CA   4  
ATOM   7037  C C    . LEU A 1 53  ? 3.957   2.297   -5.373  1.00 0.00 ? 53  LEU A C    4  
ATOM   7038  O O    . LEU A 1 53  ? 5.153   2.591   -5.308  1.00 0.00 ? 53  LEU A O    4  
ATOM   7039  C CB   . LEU A 1 53  ? 3.233   0.114   -4.365  1.00 0.00 ? 53  LEU A CB   4  
ATOM   7040  C CG   . LEU A 1 53  ? 3.064   -0.664  -3.065  1.00 0.00 ? 53  LEU A CG   4  
ATOM   7041  C CD1  . LEU A 1 53  ? 2.752   -2.109  -3.364  1.00 0.00 ? 53  LEU A CD1  4  
ATOM   7042  C CD2  . LEU A 1 53  ? 4.309   -0.563  -2.209  1.00 0.00 ? 53  LEU A CD2  4  
ATOM   7043  H H    . LEU A 1 53  ? 1.137   1.522   -3.995  1.00 0.00 ? 53  LEU A H    4  
ATOM   7044  H HA   . LEU A 1 53  ? 3.812   1.856   -3.298  1.00 0.00 ? 53  LEU A HA   4  
ATOM   7045  H HB2  . LEU A 1 53  ? 2.418   -0.145  -5.025  1.00 0.00 ? 53  LEU A HB2  4  
ATOM   7046  H HB3  . LEU A 1 53  ? 4.161   -0.192  -4.824  1.00 0.00 ? 53  LEU A HB3  4  
ATOM   7047  H HG   . LEU A 1 53  ? 2.241   -0.242  -2.509  1.00 0.00 ? 53  LEU A HG   4  
ATOM   7048  H HD11 . LEU A 1 53  ? 1.954   -2.142  -4.078  1.00 0.00 ? 53  LEU A HD11 4  
ATOM   7049  H HD12 . LEU A 1 53  ? 2.450   -2.610  -2.457  1.00 0.00 ? 53  LEU A HD12 4  
ATOM   7050  H HD13 . LEU A 1 53  ? 3.626   -2.592  -3.773  1.00 0.00 ? 53  LEU A HD13 4  
ATOM   7051  H HD21 . LEU A 1 53  ? 4.423   0.452   -1.872  1.00 0.00 ? 53  LEU A HD21 4  
ATOM   7052  H HD22 . LEU A 1 53  ? 5.173   -0.849  -2.792  1.00 0.00 ? 53  LEU A HD22 4  
ATOM   7053  H HD23 . LEU A 1 53  ? 4.216   -1.218  -1.355  1.00 0.00 ? 53  LEU A HD23 4  
ATOM   7054  N N    . SER A 1 54  ? 3.208   2.564   -6.436  1.00 0.00 ? 54  SER A N    4  
ATOM   7055  C CA   . SER A 1 54  ? 3.760   3.246   -7.601  1.00 0.00 ? 54  SER A CA   4  
ATOM   7056  C C    . SER A 1 54  ? 4.193   4.673   -7.243  1.00 0.00 ? 54  SER A C    4  
ATOM   7057  O O    . SER A 1 54  ? 5.156   5.197   -7.804  1.00 0.00 ? 54  SER A O    4  
ATOM   7058  C CB   . SER A 1 54  ? 2.737   3.266   -8.738  1.00 0.00 ? 54  SER A CB   4  
ATOM   7059  O OG   . SER A 1 54  ? 2.321   1.951   -9.067  1.00 0.00 ? 54  SER A OG   4  
ATOM   7060  H H    . SER A 1 54  ? 2.266   2.289   -6.442  1.00 0.00 ? 54  SER A H    4  
ATOM   7061  H HA   . SER A 1 54  ? 4.630   2.693   -7.924  1.00 0.00 ? 54  SER A HA   4  
ATOM   7062  H HB2  . SER A 1 54  ? 1.872   3.839   -8.438  1.00 0.00 ? 54  SER A HB2  4  
ATOM   7063  H HB3  . SER A 1 54  ? 3.183   3.716   -9.610  1.00 0.00 ? 54  SER A HB3  4  
ATOM   7064  H HG   . SER A 1 54  ? 1.497   1.755   -8.596  1.00 0.00 ? 54  SER A HG   4  
ATOM   7065  N N    . THR A 1 55  ? 3.495   5.282   -6.288  1.00 0.00 ? 55  THR A N    4  
ATOM   7066  C CA   . THR A 1 55  ? 3.815   6.628   -5.839  1.00 0.00 ? 55  THR A CA   4  
ATOM   7067  C C    . THR A 1 55  ? 4.972   6.598   -4.847  1.00 0.00 ? 55  THR A C    4  
ATOM   7068  O O    . THR A 1 55  ? 5.811   7.498   -4.829  1.00 0.00 ? 55  THR A O    4  
ATOM   7069  C CB   . THR A 1 55  ? 2.598   7.304   -5.187  1.00 0.00 ? 55  THR A CB   4  
ATOM   7070  O OG1  . THR A 1 55  ? 1.407   6.935   -5.903  1.00 0.00 ? 55  THR A OG1  4  
ATOM   7071  C CG2  . THR A 1 55  ? 2.759   8.811   -5.221  1.00 0.00 ? 55  THR A CG2  4  
ATOM   7072  H H    . THR A 1 55  ? 2.749   4.810   -5.870  1.00 0.00 ? 55  THR A H    4  
ATOM   7073  H HA   . THR A 1 55  ? 4.107   7.213   -6.700  1.00 0.00 ? 55  THR A HA   4  
ATOM   7074  H HB   . THR A 1 55  ? 2.526   6.986   -4.154  1.00 0.00 ? 55  THR A HB   4  
ATOM   7075  H HG1  . THR A 1 55  ? 0.660   6.871   -5.289  1.00 0.00 ? 55  THR A HG1  4  
ATOM   7076  H HG21 . THR A 1 55  ? 3.732   9.068   -4.838  1.00 0.00 ? 55  THR A HG21 4  
ATOM   7077  H HG22 . THR A 1 55  ? 1.995   9.271   -4.609  1.00 0.00 ? 55  THR A HG22 4  
ATOM   7078  H HG23 . THR A 1 55  ? 2.666   9.162   -6.238  1.00 0.00 ? 55  THR A HG23 4  
ATOM   7079  N N    . VAL A 1 56  ? 5.018   5.550   -4.029  1.00 0.00 ? 56  VAL A N    4  
ATOM   7080  C CA   . VAL A 1 56  ? 6.127   5.350   -3.104  1.00 0.00 ? 56  VAL A CA   4  
ATOM   7081  C C    . VAL A 1 56  ? 7.417   5.231   -3.890  1.00 0.00 ? 56  VAL A C    4  
ATOM   7082  O O    . VAL A 1 56  ? 8.420   5.874   -3.580  1.00 0.00 ? 56  VAL A O    4  
ATOM   7083  C CB   . VAL A 1 56  ? 5.953   4.076   -2.245  1.00 0.00 ? 56  VAL A CB   4  
ATOM   7084  C CG1  . VAL A 1 56  ? 7.167   3.855   -1.355  1.00 0.00 ? 56  VAL A CG1  4  
ATOM   7085  C CG2  . VAL A 1 56  ? 4.698   4.161   -1.401  1.00 0.00 ? 56  VAL A CG2  4  
ATOM   7086  H H    . VAL A 1 56  ? 4.285   4.896   -4.051  1.00 0.00 ? 56  VAL A H    4  
ATOM   7087  H HA   . VAL A 1 56  ? 6.181   6.207   -2.449  1.00 0.00 ? 56  VAL A HA   4  
ATOM   7088  H HB   . VAL A 1 56  ? 5.860   3.228   -2.908  1.00 0.00 ? 56  VAL A HB   4  
ATOM   7089  H HG11 . VAL A 1 56  ? 8.057   3.778   -1.969  1.00 0.00 ? 56  VAL A HG11 4  
ATOM   7090  H HG12 . VAL A 1 56  ? 7.039   2.943   -0.792  1.00 0.00 ? 56  VAL A HG12 4  
ATOM   7091  H HG13 . VAL A 1 56  ? 7.269   4.687   -0.675  1.00 0.00 ? 56  VAL A HG13 4  
ATOM   7092  H HG21 . VAL A 1 56  ? 3.858   4.394   -2.035  1.00 0.00 ? 56  VAL A HG21 4  
ATOM   7093  H HG22 . VAL A 1 56  ? 4.815   4.937   -0.660  1.00 0.00 ? 56  VAL A HG22 4  
ATOM   7094  H HG23 . VAL A 1 56  ? 4.527   3.215   -0.910  1.00 0.00 ? 56  VAL A HG23 4  
ATOM   7095  N N    . LYS A 1 57  ? 7.364   4.416   -4.932  1.00 0.00 ? 57  LYS A N    4  
ATOM   7096  C CA   . LYS A 1 57  ? 8.509   4.202   -5.792  1.00 0.00 ? 57  LYS A CA   4  
ATOM   7097  C C    . LYS A 1 57  ? 8.863   5.490   -6.505  1.00 0.00 ? 57  LYS A C    4  
ATOM   7098  O O    . LYS A 1 57  ? 10.030  5.840   -6.627  1.00 0.00 ? 57  LYS A O    4  
ATOM   7099  C CB   . LYS A 1 57  ? 8.207   3.115   -6.816  1.00 0.00 ? 57  LYS A CB   4  
ATOM   7100  C CG   . LYS A 1 57  ? 9.339   2.122   -6.971  1.00 0.00 ? 57  LYS A CG   4  
ATOM   7101  C CD   . LYS A 1 57  ? 9.066   1.113   -8.066  1.00 0.00 ? 57  LYS A CD   4  
ATOM   7102  C CE   . LYS A 1 57  ? 10.126  0.029   -8.066  1.00 0.00 ? 57  LYS A CE   4  
ATOM   7103  N NZ   . LYS A 1 57  ? 11.469  0.571   -8.413  1.00 0.00 ? 57  LYS A NZ   4  
ATOM   7104  H H    . LYS A 1 57  ? 6.525   3.943   -5.123  1.00 0.00 ? 57  LYS A H    4  
ATOM   7105  H HA   . LYS A 1 57  ? 9.339   3.894   -5.177  1.00 0.00 ? 57  LYS A HA   4  
ATOM   7106  H HB2  . LYS A 1 57  ? 7.320   2.584   -6.509  1.00 0.00 ? 57  LYS A HB2  4  
ATOM   7107  H HB3  . LYS A 1 57  ? 8.026   3.577   -7.773  1.00 0.00 ? 57  LYS A HB3  4  
ATOM   7108  H HG2  . LYS A 1 57  ? 10.241  2.657   -7.203  1.00 0.00 ? 57  LYS A HG2  4  
ATOM   7109  H HG3  . LYS A 1 57  ? 9.470   1.595   -6.041  1.00 0.00 ? 57  LYS A HG3  4  
ATOM   7110  H HD2  . LYS A 1 57  ? 8.098   0.663   -7.901  1.00 0.00 ? 57  LYS A HD2  4  
ATOM   7111  H HD3  . LYS A 1 57  ? 9.077   1.616   -9.021  1.00 0.00 ? 57  LYS A HD3  4  
ATOM   7112  H HE2  . LYS A 1 57  ? 10.165  -0.408  -7.074  1.00 0.00 ? 57  LYS A HE2  4  
ATOM   7113  H HE3  . LYS A 1 57  ? 9.852   -0.730  -8.785  1.00 0.00 ? 57  LYS A HE3  4  
ATOM   7114  H HZ1  . LYS A 1 57  ? 11.454  0.985   -9.366  1.00 0.00 ? 57  LYS A HZ1  4  
ATOM   7115  H HZ2  . LYS A 1 57  ? 12.179  -0.189  -8.389  1.00 0.00 ? 57  LYS A HZ2  4  
ATOM   7116  H HZ3  . LYS A 1 57  ? 11.750  1.306   -7.733  1.00 0.00 ? 57  LYS A HZ3  4  
ATOM   7117  N N    . ARG A 1 58  ? 7.833   6.185   -6.958  1.00 0.00 ? 58  ARG A N    4  
ATOM   7118  C CA   . ARG A 1 58  ? 7.986   7.464   -7.635  1.00 0.00 ? 58  ARG A CA   4  
ATOM   7119  C C    . ARG A 1 58  ? 8.771   8.454   -6.778  1.00 0.00 ? 58  ARG A C    4  
ATOM   7120  O O    . ARG A 1 58  ? 9.753   9.050   -7.230  1.00 0.00 ? 58  ARG A O    4  
ATOM   7121  C CB   . ARG A 1 58  ? 6.605   8.033   -7.945  1.00 0.00 ? 58  ARG A CB   4  
ATOM   7122  C CG   . ARG A 1 58  ? 6.636   9.333   -8.725  1.00 0.00 ? 58  ARG A CG   4  
ATOM   7123  C CD   . ARG A 1 58  ? 5.238   9.865   -8.960  1.00 0.00 ? 58  ARG A CD   4  
ATOM   7124  N NE   . ARG A 1 58  ? 5.238   11.062  -9.797  1.00 0.00 ? 58  ARG A NE   4  
ATOM   7125  C CZ   . ARG A 1 58  ? 4.233   11.408  -10.599 1.00 0.00 ? 58  ARG A CZ   4  
ATOM   7126  N NH1  . ARG A 1 58  ? 3.174   10.616  -10.726 1.00 0.00 ? 58  ARG A NH1  4  
ATOM   7127  N NH2  . ARG A 1 58  ? 4.296   12.539  -11.290 1.00 0.00 ? 58  ARG A NH2  4  
ATOM   7128  H H    . ARG A 1 58  ? 6.928   5.817   -6.843  1.00 0.00 ? 58  ARG A H    4  
ATOM   7129  H HA   . ARG A 1 58  ? 8.516   7.296   -8.560  1.00 0.00 ? 58  ARG A HA   4  
ATOM   7130  H HB2  . ARG A 1 58  ? 6.054   7.301   -8.514  1.00 0.00 ? 58  ARG A HB2  4  
ATOM   7131  H HB3  . ARG A 1 58  ? 6.089   8.210   -7.013  1.00 0.00 ? 58  ARG A HB3  4  
ATOM   7132  H HG2  . ARG A 1 58  ? 7.196   10.062  -8.165  1.00 0.00 ? 58  ARG A HG2  4  
ATOM   7133  H HG3  . ARG A 1 58  ? 7.114   9.164   -9.676  1.00 0.00 ? 58  ARG A HG3  4  
ATOM   7134  H HD2  . ARG A 1 58  ? 4.651   9.101   -9.440  1.00 0.00 ? 58  ARG A HD2  4  
ATOM   7135  H HD3  . ARG A 1 58  ? 4.799   10.109  -8.005  1.00 0.00 ? 58  ARG A HD3  4  
ATOM   7136  H HE   . ARG A 1 58  ? 6.030   11.648  -9.746  1.00 0.00 ? 58  ARG A HE   4  
ATOM   7137  H HH11 . ARG A 1 58  ? 3.127   9.751   -10.223 1.00 0.00 ? 58  ARG A HH11 4  
ATOM   7138  H HH12 . ARG A 1 58  ? 2.413   10.884  -11.323 1.00 0.00 ? 58  ARG A HH12 4  
ATOM   7139  H HH21 . ARG A 1 58  ? 5.100   13.134  -11.207 1.00 0.00 ? 58  ARG A HH21 4  
ATOM   7140  H HH22 . ARG A 1 58  ? 3.538   12.809  -11.889 1.00 0.00 ? 58  ARG A HH22 4  
ATOM   7141  N N    . LYS A 1 59  ? 8.337   8.611   -5.537  1.00 0.00 ? 59  LYS A N    4  
ATOM   7142  C CA   . LYS A 1 59  ? 8.973   9.533   -4.608  1.00 0.00 ? 59  LYS A CA   4  
ATOM   7143  C C    . LYS A 1 59  ? 10.340  9.001   -4.173  1.00 0.00 ? 59  LYS A C    4  
ATOM   7144  O O    . LYS A 1 59  ? 11.263  9.773   -3.911  1.00 0.00 ? 59  LYS A O    4  
ATOM   7145  C CB   . LYS A 1 59  ? 8.054   9.772   -3.408  1.00 0.00 ? 59  LYS A CB   4  
ATOM   7146  C CG   . LYS A 1 59  ? 6.745   10.453  -3.788  1.00 0.00 ? 59  LYS A CG   4  
ATOM   7147  C CD   . LYS A 1 59  ? 5.675   10.324  -2.705  1.00 0.00 ? 59  LYS A CD   4  
ATOM   7148  C CE   . LYS A 1 59  ? 6.131   10.871  -1.359  1.00 0.00 ? 59  LYS A CE   4  
ATOM   7149  N NZ   . LYS A 1 59  ? 6.576   9.792   -0.440  1.00 0.00 ? 59  LYS A NZ   4  
ATOM   7150  H H    . LYS A 1 59  ? 7.558   8.089   -5.237  1.00 0.00 ? 59  LYS A H    4  
ATOM   7151  H HA   . LYS A 1 59  ? 9.121   10.469  -5.127  1.00 0.00 ? 59  LYS A HA   4  
ATOM   7152  H HB2  . LYS A 1 59  ? 7.823   8.826   -2.943  1.00 0.00 ? 59  LYS A HB2  4  
ATOM   7153  H HB3  . LYS A 1 59  ? 8.566   10.401  -2.695  1.00 0.00 ? 59  LYS A HB3  4  
ATOM   7154  H HG2  . LYS A 1 59  ? 6.939   11.502  -3.962  1.00 0.00 ? 59  LYS A HG2  4  
ATOM   7155  H HG3  . LYS A 1 59  ? 6.375   10.003  -4.699  1.00 0.00 ? 59  LYS A HG3  4  
ATOM   7156  H HD2  . LYS A 1 59  ? 4.797   10.870  -3.019  1.00 0.00 ? 59  LYS A HD2  4  
ATOM   7157  H HD3  . LYS A 1 59  ? 5.423   9.280   -2.589  1.00 0.00 ? 59  LYS A HD3  4  
ATOM   7158  H HE2  . LYS A 1 59  ? 6.954   11.555  -1.522  1.00 0.00 ? 59  LYS A HE2  4  
ATOM   7159  H HE3  . LYS A 1 59  ? 5.308   11.401  -0.903  1.00 0.00 ? 59  LYS A HE3  4  
ATOM   7160  H HZ1  . LYS A 1 59  ? 7.067   10.202  0.379   1.00 0.00 ? 59  LYS A HZ1  4  
ATOM   7161  H HZ2  . LYS A 1 59  ? 7.221   9.140   -0.928  1.00 0.00 ? 59  LYS A HZ2  4  
ATOM   7162  H HZ3  . LYS A 1 59  ? 5.754   9.247   -0.092  1.00 0.00 ? 59  LYS A HZ3  4  
ATOM   7163  N N    . MET A 1 60  ? 10.466  7.678   -4.104  1.00 0.00 ? 60  MET A N    4  
ATOM   7164  C CA   . MET A 1 60  ? 11.764  7.042   -3.876  1.00 0.00 ? 60  MET A CA   4  
ATOM   7165  C C    . MET A 1 60  ? 12.721  7.376   -5.017  1.00 0.00 ? 60  MET A C    4  
ATOM   7166  O O    . MET A 1 60  ? 13.908  7.612   -4.797  1.00 0.00 ? 60  MET A O    4  
ATOM   7167  C CB   . MET A 1 60  ? 11.626  5.519   -3.769  1.00 0.00 ? 60  MET A CB   4  
ATOM   7168  C CG   . MET A 1 60  ? 12.951  4.804   -3.561  1.00 0.00 ? 60  MET A CG   4  
ATOM   7169  S SD   . MET A 1 60  ? 12.879  3.074   -4.054  1.00 0.00 ? 60  MET A SD   4  
ATOM   7170  C CE   . MET A 1 60  ? 11.523  2.516   -3.036  1.00 0.00 ? 60  MET A CE   4  
ATOM   7171  H H    . MET A 1 60  ? 9.664   7.115   -4.187  1.00 0.00 ? 60  MET A H    4  
ATOM   7172  H HA   . MET A 1 60  ? 12.169  7.430   -2.953  1.00 0.00 ? 60  MET A HA   4  
ATOM   7173  H HB2  . MET A 1 60  ? 10.983  5.281   -2.934  1.00 0.00 ? 60  MET A HB2  4  
ATOM   7174  H HB3  . MET A 1 60  ? 11.178  5.141   -4.676  1.00 0.00 ? 60  MET A HB3  4  
ATOM   7175  H HG2  . MET A 1 60  ? 13.711  5.300   -4.141  1.00 0.00 ? 60  MET A HG2  4  
ATOM   7176  H HG3  . MET A 1 60  ? 13.210  4.854   -2.513  1.00 0.00 ? 60  MET A HG3  4  
ATOM   7177  H HE1  . MET A 1 60  ? 11.722  2.775   -2.010  1.00 0.00 ? 60  MET A HE1  4  
ATOM   7178  H HE2  . MET A 1 60  ? 11.419  1.445   -3.124  1.00 0.00 ? 60  MET A HE2  4  
ATOM   7179  H HE3  . MET A 1 60  ? 10.610  2.996   -3.357  1.00 0.00 ? 60  MET A HE3  4  
ATOM   7180  N N    . GLU A 1 61  ? 12.192  7.400   -6.239  1.00 0.00 ? 61  GLU A N    4  
ATOM   7181  C CA   . GLU A 1 61  ? 12.993  7.696   -7.422  1.00 0.00 ? 61  GLU A CA   4  
ATOM   7182  C C    . GLU A 1 61  ? 13.519  9.122   -7.378  1.00 0.00 ? 61  GLU A C    4  
ATOM   7183  O O    . GLU A 1 61  ? 14.628  9.397   -7.827  1.00 0.00 ? 61  GLU A O    4  
ATOM   7184  C CB   . GLU A 1 61  ? 12.172  7.487   -8.692  1.00 0.00 ? 61  GLU A CB   4  
ATOM   7185  C CG   . GLU A 1 61  ? 11.859  6.033   -8.986  1.00 0.00 ? 61  GLU A CG   4  
ATOM   7186  C CD   . GLU A 1 61  ? 11.151  5.849   -10.309 1.00 0.00 ? 61  GLU A CD   4  
ATOM   7187  O OE1  . GLU A 1 61  ? 9.945   6.165   -10.393 1.00 0.00 ? 61  GLU A OE1  4  
ATOM   7188  O OE2  . GLU A 1 61  ? 11.797  5.379   -11.269 1.00 0.00 ? 61  GLU A OE2  4  
ATOM   7189  H H    . GLU A 1 61  ? 11.228  7.206   -6.349  1.00 0.00 ? 61  GLU A H    4  
ATOM   7190  H HA   . GLU A 1 61  ? 13.833  7.015   -7.428  1.00 0.00 ? 61  GLU A HA   4  
ATOM   7191  H HB2  . GLU A 1 61  ? 11.238  8.015   -8.586  1.00 0.00 ? 61  GLU A HB2  4  
ATOM   7192  H HB3  . GLU A 1 61  ? 12.711  7.898   -9.531  1.00 0.00 ? 61  GLU A HB3  4  
ATOM   7193  H HG2  . GLU A 1 61  ? 12.783  5.476   -9.011  1.00 0.00 ? 61  GLU A HG2  4  
ATOM   7194  H HG3  . GLU A 1 61  ? 11.228  5.647   -8.199  1.00 0.00 ? 61  GLU A HG3  4  
ATOM   7195  N N    . ASN A 1 62  ? 12.723  10.017  -6.807  1.00 0.00 ? 62  ASN A N    4  
ATOM   7196  C CA   . ASN A 1 62  ? 13.129  11.413  -6.637  1.00 0.00 ? 62  ASN A CA   4  
ATOM   7197  C C    . ASN A 1 62  ? 14.015  11.543  -5.403  1.00 0.00 ? 62  ASN A C    4  
ATOM   7198  O O    . ASN A 1 62  ? 14.424  12.639  -5.015  1.00 0.00 ? 62  ASN A O    4  
ATOM   7199  C CB   . ASN A 1 62  ? 11.906  12.325  -6.501  1.00 0.00 ? 62  ASN A CB   4  
ATOM   7200  C CG   . ASN A 1 62  ? 11.174  12.570  -7.814  1.00 0.00 ? 62  ASN A CG   4  
ATOM   7201  O OD1  . ASN A 1 62  ? 10.564  13.623  -8.006  1.00 0.00 ? 62  ASN A OD1  4  
ATOM   7202  N ND2  . ASN A 1 62  ? 11.225  11.609  -8.725  1.00 0.00 ? 62  ASN A ND2  4  
ATOM   7203  H H    . ASN A 1 62  ? 11.844  9.727   -6.479  1.00 0.00 ? 62  ASN A H    4  
ATOM   7204  H HA   . ASN A 1 62  ? 13.696  11.704  -7.508  1.00 0.00 ? 62  ASN A HA   4  
ATOM   7205  H HB2  . ASN A 1 62  ? 11.210  11.876  -5.809  1.00 0.00 ? 62  ASN A HB2  4  
ATOM   7206  H HB3  . ASN A 1 62  ? 12.226  13.279  -6.108  1.00 0.00 ? 62  ASN A HB3  4  
ATOM   7207  H HD21 . ASN A 1 62  ? 11.729  10.796  -8.513  1.00 0.00 ? 62  ASN A HD21 4  
ATOM   7208  H HD22 . ASN A 1 62  ? 10.758  11.752  -9.575  1.00 0.00 ? 62  ASN A HD22 4  
ATOM   7209  N N    . ARG A 1 63  ? 14.291  10.387  -4.804  1.00 0.00 ? 63  ARG A N    4  
ATOM   7210  C CA   . ARG A 1 63  ? 15.151  10.247  -3.636  1.00 0.00 ? 63  ARG A CA   4  
ATOM   7211  C C    . ARG A 1 63  ? 14.679  11.119  -2.485  1.00 0.00 ? 63  ARG A C    4  
ATOM   7212  O O    . ARG A 1 63  ? 15.480  11.576  -1.669  1.00 0.00 ? 63  ARG A O    4  
ATOM   7213  C CB   . ARG A 1 63  ? 16.600  10.564  -3.998  1.00 0.00 ? 63  ARG A CB   4  
ATOM   7214  C CG   . ARG A 1 63  ? 17.018  9.980   -5.333  1.00 0.00 ? 63  ARG A CG   4  
ATOM   7215  C CD   . ARG A 1 63  ? 17.018  8.459   -5.344  1.00 0.00 ? 63  ARG A CD   4  
ATOM   7216  N NE   . ARG A 1 63  ? 16.745  7.960   -6.693  1.00 0.00 ? 63  ARG A NE   4  
ATOM   7217  C CZ   . ARG A 1 63  ? 17.577  7.210   -7.411  1.00 0.00 ? 63  ARG A CZ   4  
ATOM   7218  N NH1  . ARG A 1 63  ? 18.750  6.841   -6.916  1.00 0.00 ? 63  ARG A NH1  4  
ATOM   7219  N NH2  . ARG A 1 63  ? 17.237  6.839   -8.639  1.00 0.00 ? 63  ARG A NH2  4  
ATOM   7220  H H    . ARG A 1 63  ? 13.905  9.575   -5.182  1.00 0.00 ? 63  ARG A H    4  
ATOM   7221  H HA   . ARG A 1 63  ? 15.092  9.217   -3.326  1.00 0.00 ? 63  ARG A HA   4  
ATOM   7222  H HB2  . ARG A 1 63  ? 16.724  11.637  -4.038  1.00 0.00 ? 63  ARG A HB2  4  
ATOM   7223  H HB3  . ARG A 1 63  ? 17.246  10.163  -3.235  1.00 0.00 ? 63  ARG A HB3  4  
ATOM   7224  H HG2  . ARG A 1 63  ? 16.323  10.325  -6.087  1.00 0.00 ? 63  ARG A HG2  4  
ATOM   7225  H HG3  . ARG A 1 63  ? 18.011  10.331  -5.567  1.00 0.00 ? 63  ARG A HG3  4  
ATOM   7226  H HD2  . ARG A 1 63  ? 17.986  8.105   -5.021  1.00 0.00 ? 63  ARG A HD2  4  
ATOM   7227  H HD3  . ARG A 1 63  ? 16.259  8.091   -4.668  1.00 0.00 ? 63  ARG A HD3  4  
ATOM   7228  H HE   . ARG A 1 63  ? 15.884  8.223   -7.095  1.00 0.00 ? 63  ARG A HE   4  
ATOM   7229  H HH11 . ARG A 1 63  ? 19.018  7.122   -5.994  1.00 0.00 ? 63  ARG A HH11 4  
ATOM   7230  H HH12 . ARG A 1 63  ? 19.378  6.286   -7.470  1.00 0.00 ? 63  ARG A HH12 4  
ATOM   7231  H HH21 . ARG A 1 63  ? 16.357  7.123   -9.027  1.00 0.00 ? 63  ARG A HH21 4  
ATOM   7232  H HH22 . ARG A 1 63  ? 17.861  6.272   -9.185  1.00 0.00 ? 63  ARG A HH22 4  
ATOM   7233  N N    . ASP A 1 64  ? 13.369  11.329  -2.419  1.00 0.00 ? 64  ASP A N    4  
ATOM   7234  C CA   . ASP A 1 64  ? 12.760  12.100  -1.335  1.00 0.00 ? 64  ASP A CA   4  
ATOM   7235  C C    . ASP A 1 64  ? 12.899  11.362  -0.014  1.00 0.00 ? 64  ASP A C    4  
ATOM   7236  O O    . ASP A 1 64  ? 12.737  11.937  1.060   1.00 0.00 ? 64  ASP A O    4  
ATOM   7237  C CB   . ASP A 1 64  ? 11.277  12.366  -1.615  1.00 0.00 ? 64  ASP A CB   4  
ATOM   7238  C CG   . ASP A 1 64  ? 11.051  13.526  -2.562  1.00 0.00 ? 64  ASP A CG   4  
ATOM   7239  O OD1  . ASP A 1 64  ? 10.723  13.286  -3.742  1.00 0.00 ? 64  ASP A OD1  4  
ATOM   7240  O OD2  . ASP A 1 64  ? 11.183  14.689  -2.123  1.00 0.00 ? 64  ASP A OD2  4  
ATOM   7241  H H    . ASP A 1 64  ? 12.796  10.955  -3.126  1.00 0.00 ? 64  ASP A H    4  
ATOM   7242  H HA   . ASP A 1 64  ? 13.280  13.043  -1.264  1.00 0.00 ? 64  ASP A HA   4  
ATOM   7243  H HB2  . ASP A 1 64  ? 10.838  11.483  -2.052  1.00 0.00 ? 64  ASP A HB2  4  
ATOM   7244  H HB3  . ASP A 1 64  ? 10.778  12.584  -0.684  1.00 0.00 ? 64  ASP A HB3  4  
ATOM   7245  N N    . TYR A 1 65  ? 13.194  10.079  -0.111  1.00 0.00 ? 65  TYR A N    4  
ATOM   7246  C CA   . TYR A 1 65  ? 13.363  9.233   1.054   1.00 0.00 ? 65  TYR A CA   4  
ATOM   7247  C C    . TYR A 1 65  ? 14.824  9.244   1.463   1.00 0.00 ? 65  TYR A C    4  
ATOM   7248  O O    . TYR A 1 65  ? 15.705  9.170   0.609   1.00 0.00 ? 65  TYR A O    4  
ATOM   7249  C CB   . TYR A 1 65  ? 12.934  7.790   0.748   1.00 0.00 ? 65  TYR A CB   4  
ATOM   7250  C CG   . TYR A 1 65  ? 11.487  7.623   0.318   1.00 0.00 ? 65  TYR A CG   4  
ATOM   7251  C CD1  . TYR A 1 65  ? 10.818  6.427   0.530   1.00 0.00 ? 65  TYR A CD1  4  
ATOM   7252  C CD2  . TYR A 1 65  ? 10.793  8.652   -0.302  1.00 0.00 ? 65  TYR A CD2  4  
ATOM   7253  C CE1  . TYR A 1 65  ? 9.503   6.268   0.137   1.00 0.00 ? 65  TYR A CE1  4  
ATOM   7254  C CE2  . TYR A 1 65  ? 9.488   8.498   -0.694  1.00 0.00 ? 65  TYR A CE2  4  
ATOM   7255  C CZ   . TYR A 1 65  ? 8.845   7.308   -0.474  1.00 0.00 ? 65  TYR A CZ   4  
ATOM   7256  O OH   . TYR A 1 65  ? 7.535   7.167   -0.863  1.00 0.00 ? 65  TYR A OH   4  
ATOM   7257  H H    . TYR A 1 65  ? 13.312  9.690   -1.000  1.00 0.00 ? 65  TYR A H    4  
ATOM   7258  H HA   . TYR A 1 65  ? 12.758  9.629   1.857   1.00 0.00 ? 65  TYR A HA   4  
ATOM   7259  H HB2  . TYR A 1 65  ? 13.554  7.405   -0.047  1.00 0.00 ? 65  TYR A HB2  4  
ATOM   7260  H HB3  . TYR A 1 65  ? 13.087  7.189   1.635   1.00 0.00 ? 65  TYR A HB3  4  
ATOM   7261  H HD1  . TYR A 1 65  ? 11.337  5.614   1.012   1.00 0.00 ? 65  TYR A HD1  4  
ATOM   7262  H HD2  . TYR A 1 65  ? 11.297  9.591   -0.477  1.00 0.00 ? 65  TYR A HD2  4  
ATOM   7263  H HE1  . TYR A 1 65  ? 8.999   5.330   0.305   1.00 0.00 ? 65  TYR A HE1  4  
ATOM   7264  H HE2  . TYR A 1 65  ? 8.972   9.312   -1.176  1.00 0.00 ? 65  TYR A HE2  4  
ATOM   7265  H HH   . TYR A 1 65  ? 7.042   6.707   -0.172  1.00 0.00 ? 65  TYR A HH   4  
ATOM   7266  N N    . ARG A 1 66  ? 15.083  9.364   2.750   1.00 0.00 ? 66  ARG A N    4  
ATOM   7267  C CA   . ARG A 1 66  ? 16.446  9.333   3.248   1.00 0.00 ? 66  ARG A CA   4  
ATOM   7268  C C    . ARG A 1 66  ? 16.800  7.944   3.746   1.00 0.00 ? 66  ARG A C    4  
ATOM   7269  O O    . ARG A 1 66  ? 17.956  7.532   3.682   1.00 0.00 ? 66  ARG A O    4  
ATOM   7270  C CB   . ARG A 1 66  ? 16.628  10.350  4.376   1.00 0.00 ? 66  ARG A CB   4  
ATOM   7271  C CG   . ARG A 1 66  ? 16.452  11.804  3.952   1.00 0.00 ? 66  ARG A CG   4  
ATOM   7272  C CD   . ARG A 1 66  ? 17.530  12.252  2.975   1.00 0.00 ? 66  ARG A CD   4  
ATOM   7273  N NE   . ARG A 1 66  ? 17.326  11.713  1.632   1.00 0.00 ? 66  ARG A NE   4  
ATOM   7274  C CZ   . ARG A 1 66  ? 18.309  11.299  0.835   1.00 0.00 ? 66  ARG A CZ   4  
ATOM   7275  N NH1  . ARG A 1 66  ? 19.573  11.374  1.234   1.00 0.00 ? 66  ARG A NH1  4  
ATOM   7276  N NH2  . ARG A 1 66  ? 18.029  10.822  -0.370  1.00 0.00 ? 66  ARG A NH2  4  
ATOM   7277  H H    . ARG A 1 66  ? 14.342  9.487   3.389   1.00 0.00 ? 66  ARG A H    4  
ATOM   7278  H HA   . ARG A 1 66  ? 17.107  9.588   2.433   1.00 0.00 ? 66  ARG A HA   4  
ATOM   7279  H HB2  . ARG A 1 66  ? 15.897  10.138  5.145   1.00 0.00 ? 66  ARG A HB2  4  
ATOM   7280  H HB3  . ARG A 1 66  ? 17.619  10.235  4.792   1.00 0.00 ? 66  ARG A HB3  4  
ATOM   7281  H HG2  . ARG A 1 66  ? 15.489  11.914  3.479   1.00 0.00 ? 66  ARG A HG2  4  
ATOM   7282  H HG3  . ARG A 1 66  ? 16.496  12.430  4.832   1.00 0.00 ? 66  ARG A HG3  4  
ATOM   7283  H HD2  . ARG A 1 66  ? 17.523  13.330  2.922   1.00 0.00 ? 66  ARG A HD2  4  
ATOM   7284  H HD3  . ARG A 1 66  ? 18.489  11.918  3.344   1.00 0.00 ? 66  ARG A HD3  4  
ATOM   7285  H HE   . ARG A 1 66  ? 16.399  11.661  1.305   1.00 0.00 ? 66  ARG A HE   4  
ATOM   7286  H HH11 . ARG A 1 66  ? 19.797  11.747  2.136   1.00 0.00 ? 66  ARG A HH11 4  
ATOM   7287  H HH12 . ARG A 1 66  ? 20.311  11.051  0.633   1.00 0.00 ? 66  ARG A HH12 4  
ATOM   7288  H HH21 . ARG A 1 66  ? 17.074  10.774  -0.686  1.00 0.00 ? 66  ARG A HH21 4  
ATOM   7289  H HH22 . ARG A 1 66  ? 18.768  10.500  -0.968  1.00 0.00 ? 66  ARG A HH22 4  
ATOM   7290  N N    . ASP A 1 67  ? 15.799  7.213   4.224   1.00 0.00 ? 67  ASP A N    4  
ATOM   7291  C CA   . ASP A 1 67  ? 16.038  5.909   4.813   1.00 0.00 ? 67  ASP A CA   4  
ATOM   7292  C C    . ASP A 1 67  ? 14.888  4.978   4.487   1.00 0.00 ? 67  ASP A C    4  
ATOM   7293  O O    . ASP A 1 67  ? 13.804  5.424   4.097   1.00 0.00 ? 67  ASP A O    4  
ATOM   7294  C CB   . ASP A 1 67  ? 16.197  6.026   6.334   1.00 0.00 ? 67  ASP A CB   4  
ATOM   7295  C CG   . ASP A 1 67  ? 17.456  6.763   6.745   1.00 0.00 ? 67  ASP A CG   4  
ATOM   7296  O OD1  . ASP A 1 67  ? 17.364  7.958   7.095   1.00 0.00 ? 67  ASP A OD1  4  
ATOM   7297  O OD2  . ASP A 1 67  ? 18.541  6.145   6.734   1.00 0.00 ? 67  ASP A OD2  4  
ATOM   7298  H H    . ASP A 1 67  ? 14.873  7.545   4.163   1.00 0.00 ? 67  ASP A H    4  
ATOM   7299  H HA   . ASP A 1 67  ? 16.947  5.510   4.390   1.00 0.00 ? 67  ASP A HA   4  
ATOM   7300  H HB2  . ASP A 1 67  ? 15.349  6.559   6.736   1.00 0.00 ? 67  ASP A HB2  4  
ATOM   7301  H HB3  . ASP A 1 67  ? 16.229  5.038   6.761   1.00 0.00 ? 67  ASP A HB3  4  
ATOM   7302  N N    . ALA A 1 68  ? 15.119  3.685   4.658   1.00 0.00 ? 68  ALA A N    4  
ATOM   7303  C CA   . ALA A 1 68  ? 14.102  2.686   4.370   1.00 0.00 ? 68  ALA A CA   4  
ATOM   7304  C C    . ALA A 1 68  ? 12.969  2.784   5.372   1.00 0.00 ? 68  ALA A C    4  
ATOM   7305  O O    . ALA A 1 68  ? 11.874  2.284   5.135   1.00 0.00 ? 68  ALA A O    4  
ATOM   7306  C CB   . ALA A 1 68  ? 14.697  1.293   4.389   1.00 0.00 ? 68  ALA A CB   4  
ATOM   7307  H H    . ALA A 1 68  ? 15.991  3.395   5.001   1.00 0.00 ? 68  ALA A H    4  
ATOM   7308  H HA   . ALA A 1 68  ? 13.715  2.877   3.379   1.00 0.00 ? 68  ALA A HA   4  
ATOM   7309  H HB1  . ALA A 1 68  ? 15.085  1.087   5.374   1.00 0.00 ? 68  ALA A HB1  4  
ATOM   7310  H HB2  . ALA A 1 68  ? 15.498  1.232   3.666   1.00 0.00 ? 68  ALA A HB2  4  
ATOM   7311  H HB3  . ALA A 1 68  ? 13.934  0.570   4.144   1.00 0.00 ? 68  ALA A HB3  4  
ATOM   7312  N N    . GLN A 1 69  ? 13.242  3.440   6.491   1.00 0.00 ? 69  GLN A N    4  
ATOM   7313  C CA   . GLN A 1 69  ? 12.227  3.665   7.504   1.00 0.00 ? 69  GLN A CA   4  
ATOM   7314  C C    . GLN A 1 69  ? 11.163  4.608   6.960   1.00 0.00 ? 69  GLN A C    4  
ATOM   7315  O O    . GLN A 1 69  ? 9.972   4.427   7.202   1.00 0.00 ? 69  GLN A O    4  
ATOM   7316  C CB   . GLN A 1 69  ? 12.840  4.258   8.772   1.00 0.00 ? 69  GLN A CB   4  
ATOM   7317  C CG   . GLN A 1 69  ? 11.835  4.413   9.896   1.00 0.00 ? 69  GLN A CG   4  
ATOM   7318  C CD   . GLN A 1 69  ? 11.536  3.111   10.613  1.00 0.00 ? 69  GLN A CD   4  
ATOM   7319  O OE1  . GLN A 1 69  ? 12.394  2.237   10.730  1.00 0.00 ? 69  GLN A OE1  4  
ATOM   7320  N NE2  . GLN A 1 69  ? 10.313  2.973   11.100  1.00 0.00 ? 69  GLN A NE2  4  
ATOM   7321  H H    . GLN A 1 69  ? 14.151  3.777   6.637   1.00 0.00 ? 69  GLN A H    4  
ATOM   7322  H HA   . GLN A 1 69  ? 11.773  2.714   7.736   1.00 0.00 ? 69  GLN A HA   4  
ATOM   7323  H HB2  . GLN A 1 69  ? 13.636  3.616   9.113   1.00 0.00 ? 69  GLN A HB2  4  
ATOM   7324  H HB3  . GLN A 1 69  ? 13.241  5.231   8.543   1.00 0.00 ? 69  GLN A HB3  4  
ATOM   7325  H HG2  . GLN A 1 69  ? 12.217  5.125   10.612  1.00 0.00 ? 69  GLN A HG2  4  
ATOM   7326  H HG3  . GLN A 1 69  ? 10.917  4.786   9.471   1.00 0.00 ? 69  GLN A HG3  4  
ATOM   7327  H HE21 . GLN A 1 69  ? 9.677   3.710   10.975  1.00 0.00 ? 69  GLN A HE21 4  
ATOM   7328  H HE22 . GLN A 1 69  ? 10.093  2.141   11.572  1.00 0.00 ? 69  GLN A HE22 4  
ATOM   7329  N N    . GLU A 1 70  ? 11.608  5.609   6.204   1.00 0.00 ? 70  GLU A N    4  
ATOM   7330  C CA   . GLU A 1 70  ? 10.704  6.552   5.572   1.00 0.00 ? 70  GLU A CA   4  
ATOM   7331  C C    . GLU A 1 70  ? 9.902   5.863   4.486   1.00 0.00 ? 70  GLU A C    4  
ATOM   7332  O O    . GLU A 1 70  ? 8.738   6.188   4.256   1.00 0.00 ? 70  GLU A O    4  
ATOM   7333  C CB   . GLU A 1 70  ? 11.471  7.739   5.002   1.00 0.00 ? 70  GLU A CB   4  
ATOM   7334  C CG   . GLU A 1 70  ? 11.950  8.702   6.068   1.00 0.00 ? 70  GLU A CG   4  
ATOM   7335  C CD   . GLU A 1 70  ? 12.683  9.879   5.481   1.00 0.00 ? 70  GLU A CD   4  
ATOM   7336  O OE1  . GLU A 1 70  ? 13.882  9.741   5.205   1.00 0.00 ? 70  GLU A OE1  4  
ATOM   7337  O OE2  . GLU A 1 70  ? 12.064  10.947  5.294   1.00 0.00 ? 70  GLU A OE2  4  
ATOM   7338  H H    . GLU A 1 70  ? 12.568  5.707   6.065   1.00 0.00 ? 70  GLU A H    4  
ATOM   7339  H HA   . GLU A 1 70  ? 10.027  6.909   6.326   1.00 0.00 ? 70  GLU A HA   4  
ATOM   7340  H HB2  . GLU A 1 70  ? 12.335  7.375   4.461   1.00 0.00 ? 70  GLU A HB2  4  
ATOM   7341  H HB3  . GLU A 1 70  ? 10.830  8.277   4.325   1.00 0.00 ? 70  GLU A HB3  4  
ATOM   7342  H HG2  . GLU A 1 70  ? 11.095  9.065   6.619   1.00 0.00 ? 70  GLU A HG2  4  
ATOM   7343  H HG3  . GLU A 1 70  ? 12.614  8.177   6.738   1.00 0.00 ? 70  GLU A HG3  4  
ATOM   7344  N N    . PHE A 1 71  ? 10.528  4.897   3.827   1.00 0.00 ? 71  PHE A N    4  
ATOM   7345  C CA   . PHE A 1 71  ? 9.816   4.048   2.888   1.00 0.00 ? 71  PHE A CA   4  
ATOM   7346  C C    . PHE A 1 71  ? 8.771   3.236   3.635   1.00 0.00 ? 71  PHE A C    4  
ATOM   7347  O O    . PHE A 1 71  ? 7.598   3.226   3.263   1.00 0.00 ? 71  PHE A O    4  
ATOM   7348  C CB   . PHE A 1 71  ? 10.769  3.108   2.136   1.00 0.00 ? 71  PHE A CB   4  
ATOM   7349  C CG   . PHE A 1 71  ? 10.089  1.849   1.659   1.00 0.00 ? 71  PHE A CG   4  
ATOM   7350  C CD1  . PHE A 1 71  ? 9.425   1.823   0.447   1.00 0.00 ? 71  PHE A CD1  4  
ATOM   7351  C CD2  . PHE A 1 71  ? 10.101  0.699   2.434   1.00 0.00 ? 71  PHE A CD2  4  
ATOM   7352  C CE1  . PHE A 1 71  ? 8.783   0.676   0.016   1.00 0.00 ? 71  PHE A CE1  4  
ATOM   7353  C CE2  . PHE A 1 71  ? 9.462   -0.446  2.010   1.00 0.00 ? 71  PHE A CE2  4  
ATOM   7354  C CZ   . PHE A 1 71  ? 8.801   -0.459  0.799   1.00 0.00 ? 71  PHE A CZ   4  
ATOM   7355  H H    . PHE A 1 71  ? 11.483  4.752   3.986   1.00 0.00 ? 71  PHE A H    4  
ATOM   7356  H HA   . PHE A 1 71  ? 9.316   4.690   2.175   1.00 0.00 ? 71  PHE A HA   4  
ATOM   7357  H HB2  . PHE A 1 71  ? 11.159  3.623   1.270   1.00 0.00 ? 71  PHE A HB2  4  
ATOM   7358  H HB3  . PHE A 1 71  ? 11.591  2.830   2.782   1.00 0.00 ? 71  PHE A HB3  4  
ATOM   7359  H HD1  . PHE A 1 71  ? 9.403   2.711   -0.159  1.00 0.00 ? 71  PHE A HD1  4  
ATOM   7360  H HD2  . PHE A 1 71  ? 10.614  0.707   3.383   1.00 0.00 ? 71  PHE A HD2  4  
ATOM   7361  H HE1  . PHE A 1 71  ? 8.266   0.669   -0.932  1.00 0.00 ? 71  PHE A HE1  4  
ATOM   7362  H HE2  . PHE A 1 71  ? 9.469   -1.324  2.632   1.00 0.00 ? 71  PHE A HE2  4  
ATOM   7363  H HZ   . PHE A 1 71  ? 8.301   -1.356  0.465   1.00 0.00 ? 71  PHE A HZ   4  
ATOM   7364  N N    . ALA A 1 72  ? 9.214   2.555   4.693   1.00 0.00 ? 72  ALA A N    4  
ATOM   7365  C CA   . ALA A 1 72  ? 8.341   1.734   5.504   1.00 0.00 ? 72  ALA A CA   4  
ATOM   7366  C C    . ALA A 1 72  ? 7.179   2.552   6.033   1.00 0.00 ? 72  ALA A C    4  
ATOM   7367  O O    . ALA A 1 72  ? 6.071   2.049   6.158   1.00 0.00 ? 72  ALA A O    4  
ATOM   7368  C CB   . ALA A 1 72  ? 9.119   1.099   6.646   1.00 0.00 ? 72  ALA A CB   4  
ATOM   7369  H H    . ALA A 1 72  ? 10.170  2.597   4.924   1.00 0.00 ? 72  ALA A H    4  
ATOM   7370  H HA   . ALA A 1 72  ? 7.957   0.945   4.878   1.00 0.00 ? 72  ALA A HA   4  
ATOM   7371  H HB1  . ALA A 1 72  ? 9.660   1.864   7.185   1.00 0.00 ? 72  ALA A HB1  4  
ATOM   7372  H HB2  . ALA A 1 72  ? 9.818   0.378   6.249   1.00 0.00 ? 72  ALA A HB2  4  
ATOM   7373  H HB3  . ALA A 1 72  ? 8.433   0.604   7.316   1.00 0.00 ? 72  ALA A HB3  4  
ATOM   7374  N N    . ALA A 1 73  ? 7.452   3.811   6.330   1.00 0.00 ? 73  ALA A N    4  
ATOM   7375  C CA   . ALA A 1 73  ? 6.430   4.750   6.756   1.00 0.00 ? 73  ALA A CA   4  
ATOM   7376  C C    . ALA A 1 73  ? 5.369   4.937   5.668   1.00 0.00 ? 73  ALA A C    4  
ATOM   7377  O O    . ALA A 1 73  ? 4.173   4.830   5.934   1.00 0.00 ? 73  ALA A O    4  
ATOM   7378  C CB   . ALA A 1 73  ? 7.086   6.078   7.107   1.00 0.00 ? 73  ALA A CB   4  
ATOM   7379  H H    . ALA A 1 73  ? 8.382   4.120   6.276   1.00 0.00 ? 73  ALA A H    4  
ATOM   7380  H HA   . ALA A 1 73  ? 5.964   4.354   7.648   1.00 0.00 ? 73  ALA A HA   4  
ATOM   7381  H HB1  . ALA A 1 73  ? 7.872   6.291   6.388   1.00 0.00 ? 73  ALA A HB1  4  
ATOM   7382  H HB2  . ALA A 1 73  ? 7.510   6.021   8.099   1.00 0.00 ? 73  ALA A HB2  4  
ATOM   7383  H HB3  . ALA A 1 73  ? 6.347   6.865   7.076   1.00 0.00 ? 73  ALA A HB3  4  
ATOM   7384  N N    . ASP A 1 74  ? 5.818   5.190   4.442   1.00 0.00 ? 74  ASP A N    4  
ATOM   7385  C CA   . ASP A 1 74  ? 4.927   5.434   3.317   1.00 0.00 ? 74  ASP A CA   4  
ATOM   7386  C C    . ASP A 1 74  ? 4.119   4.188   2.950   1.00 0.00 ? 74  ASP A C    4  
ATOM   7387  O O    . ASP A 1 74  ? 2.896   4.252   2.809   1.00 0.00 ? 74  ASP A O    4  
ATOM   7388  C CB   . ASP A 1 74  ? 5.749   5.893   2.112   1.00 0.00 ? 74  ASP A CB   4  
ATOM   7389  C CG   . ASP A 1 74  ? 5.893   7.404   2.020   1.00 0.00 ? 74  ASP A CG   4  
ATOM   7390  O OD1  . ASP A 1 74  ? 6.660   7.986   2.813   1.00 0.00 ? 74  ASP A OD1  4  
ATOM   7391  O OD2  . ASP A 1 74  ? 5.261   8.018   1.132   1.00 0.00 ? 74  ASP A OD2  4  
ATOM   7392  H H    . ASP A 1 74  ? 6.783   5.212   4.280   1.00 0.00 ? 74  ASP A H    4  
ATOM   7393  H HA   . ASP A 1 74  ? 4.245   6.222   3.597   1.00 0.00 ? 74  ASP A HA   4  
ATOM   7394  H HB2  . ASP A 1 74  ? 6.738   5.467   2.183   1.00 0.00 ? 74  ASP A HB2  4  
ATOM   7395  H HB3  . ASP A 1 74  ? 5.281   5.538   1.220   1.00 0.00 ? 74  ASP A HB3  4  
ATOM   7396  N N    . VAL A 1 75  ? 4.799   3.054   2.809   1.00 0.00 ? 75  VAL A N    4  
ATOM   7397  C CA   . VAL A 1 75  ? 4.140   1.813   2.401   1.00 0.00 ? 75  VAL A CA   4  
ATOM   7398  C C    . VAL A 1 75  ? 3.140   1.336   3.456   1.00 0.00 ? 75  VAL A C    4  
ATOM   7399  O O    . VAL A 1 75  ? 2.038   0.894   3.127   1.00 0.00 ? 75  VAL A O    4  
ATOM   7400  C CB   . VAL A 1 75  ? 5.165   0.691   2.091   1.00 0.00 ? 75  VAL A CB   4  
ATOM   7401  C CG1  . VAL A 1 75  ? 6.166   0.526   3.218   1.00 0.00 ? 75  VAL A CG1  4  
ATOM   7402  C CG2  . VAL A 1 75  ? 4.473   -0.634  1.817   1.00 0.00 ? 75  VAL A CG2  4  
ATOM   7403  H H    . VAL A 1 75  ? 5.770   3.052   2.980   1.00 0.00 ? 75  VAL A H    4  
ATOM   7404  H HA   . VAL A 1 75  ? 3.596   2.022   1.491   1.00 0.00 ? 75  VAL A HA   4  
ATOM   7405  H HB   . VAL A 1 75  ? 5.707   0.971   1.203   1.00 0.00 ? 75  VAL A HB   4  
ATOM   7406  H HG11 . VAL A 1 75  ? 6.808   1.393   3.259   1.00 0.00 ? 75  VAL A HG11 4  
ATOM   7407  H HG12 . VAL A 1 75  ? 6.763   -0.356  3.042   1.00 0.00 ? 75  VAL A HG12 4  
ATOM   7408  H HG13 . VAL A 1 75  ? 5.638   0.423   4.154   1.00 0.00 ? 75  VAL A HG13 4  
ATOM   7409  H HG21 . VAL A 1 75  ? 5.205   -1.430  1.850   1.00 0.00 ? 75  VAL A HG21 4  
ATOM   7410  H HG22 . VAL A 1 75  ? 4.014   -0.606  0.838   1.00 0.00 ? 75  VAL A HG22 4  
ATOM   7411  H HG23 . VAL A 1 75  ? 3.717   -0.808  2.567   1.00 0.00 ? 75  VAL A HG23 4  
ATOM   7412  N N    . ARG A 1 76  ? 3.509   1.448   4.725   1.00 0.00 ? 76  ARG A N    4  
ATOM   7413  C CA   . ARG A 1 76  ? 2.635   0.998   5.798   1.00 0.00 ? 76  ARG A CA   4  
ATOM   7414  C C    . ARG A 1 76  ? 1.436   1.932   5.933   1.00 0.00 ? 76  ARG A C    4  
ATOM   7415  O O    . ARG A 1 76  ? 0.343   1.504   6.304   1.00 0.00 ? 76  ARG A O    4  
ATOM   7416  C CB   . ARG A 1 76  ? 3.397   0.911   7.118   1.00 0.00 ? 76  ARG A CB   4  
ATOM   7417  C CG   . ARG A 1 76  ? 3.637   2.261   7.785   1.00 0.00 ? 76  ARG A CG   4  
ATOM   7418  C CD   . ARG A 1 76  ? 4.412   2.120   9.082   1.00 0.00 ? 76  ARG A CD   4  
ATOM   7419  N NE   . ARG A 1 76  ? 5.611   1.301   8.920   1.00 0.00 ? 76  ARG A NE   4  
ATOM   7420  C CZ   . ARG A 1 76  ? 6.253   0.719   9.932   1.00 0.00 ? 76  ARG A CZ   4  
ATOM   7421  N NH1  . ARG A 1 76  ? 5.830   0.893   11.180  1.00 0.00 ? 76  ARG A NH1  4  
ATOM   7422  N NH2  . ARG A 1 76  ? 7.318   -0.039  9.695   1.00 0.00 ? 76  ARG A NH2  4  
ATOM   7423  H H    . ARG A 1 76  ? 4.386   1.832   4.943   1.00 0.00 ? 76  ARG A H    4  
ATOM   7424  H HA   . ARG A 1 76  ? 2.277   0.013   5.535   1.00 0.00 ? 76  ARG A HA   4  
ATOM   7425  H HB2  . ARG A 1 76  ? 2.845   0.284   7.792   1.00 0.00 ? 76  ARG A HB2  4  
ATOM   7426  H HB3  . ARG A 1 76  ? 4.358   0.455   6.931   1.00 0.00 ? 76  ARG A HB3  4  
ATOM   7427  H HG2  . ARG A 1 76  ? 4.199   2.888   7.110   1.00 0.00 ? 76  ARG A HG2  4  
ATOM   7428  H HG3  . ARG A 1 76  ? 2.682   2.722   7.993   1.00 0.00 ? 76  ARG A HG3  4  
ATOM   7429  H HD2  . ARG A 1 76  ? 4.704   3.103   9.418   1.00 0.00 ? 76  ARG A HD2  4  
ATOM   7430  H HD3  . ARG A 1 76  ? 3.774   1.667   9.817   1.00 0.00 ? 76  ARG A HD3  4  
ATOM   7431  H HE   . ARG A 1 76  ? 5.943   1.173   8.004   1.00 0.00 ? 76  ARG A HE   4  
ATOM   7432  H HH11 . ARG A 1 76  ? 5.021   1.462   11.366  1.00 0.00 ? 76  ARG A HH11 4  
ATOM   7433  H HH12 . ARG A 1 76  ? 6.321   0.466   11.944  1.00 0.00 ? 76  ARG A HH12 4  
ATOM   7434  H HH21 . ARG A 1 76  ? 7.640   -0.177  8.760   1.00 0.00 ? 76  ARG A HH21 4  
ATOM   7435  H HH22 . ARG A 1 76  ? 7.803   -0.481  10.456  1.00 0.00 ? 76  ARG A HH22 4  
ATOM   7436  N N    . LEU A 1 77  ? 1.648   3.207   5.617   1.00 0.00 ? 77  LEU A N    4  
ATOM   7437  C CA   . LEU A 1 77  ? 0.575   4.192   5.611   1.00 0.00 ? 77  LEU A CA   4  
ATOM   7438  C C    . LEU A 1 77  ? -0.499  3.797   4.613   1.00 0.00 ? 77  LEU A C    4  
ATOM   7439  O O    . LEU A 1 77  ? -1.695  3.966   4.861   1.00 0.00 ? 77  LEU A O    4  
ATOM   7440  C CB   . LEU A 1 77  ? 1.134   5.569   5.261   1.00 0.00 ? 77  LEU A CB   4  
ATOM   7441  C CG   . LEU A 1 77  ? 1.279   6.521   6.439   1.00 0.00 ? 77  LEU A CG   4  
ATOM   7442  C CD1  . LEU A 1 77  ? 1.860   7.838   5.972   1.00 0.00 ? 77  LEU A CD1  4  
ATOM   7443  C CD2  . LEU A 1 77  ? -0.073  6.724   7.098   1.00 0.00 ? 77  LEU A CD2  4  
ATOM   7444  H H    . LEU A 1 77  ? 2.557   3.497   5.388   1.00 0.00 ? 77  LEU A H    4  
ATOM   7445  H HA   . LEU A 1 77  ? 0.144   4.223   6.599   1.00 0.00 ? 77  LEU A HA   4  
ATOM   7446  H HB2  . LEU A 1 77  ? 2.108   5.435   4.813   1.00 0.00 ? 77  LEU A HB2  4  
ATOM   7447  H HB3  . LEU A 1 77  ? 0.484   6.031   4.534   1.00 0.00 ? 77  LEU A HB3  4  
ATOM   7448  H HG   . LEU A 1 77  ? 1.951   6.096   7.164   1.00 0.00 ? 77  LEU A HG   4  
ATOM   7449  H HD11 . LEU A 1 77  ? 1.270   8.207   5.151   1.00 0.00 ? 77  LEU A HD11 4  
ATOM   7450  H HD12 . LEU A 1 77  ? 2.879   7.689   5.648   1.00 0.00 ? 77  LEU A HD12 4  
ATOM   7451  H HD13 . LEU A 1 77  ? 1.837   8.551   6.782   1.00 0.00 ? 77  LEU A HD13 4  
ATOM   7452  H HD21 . LEU A 1 77  ? -0.843  6.701   6.338   1.00 0.00 ? 77  LEU A HD21 4  
ATOM   7453  H HD22 . LEU A 1 77  ? -0.090  7.681   7.601   1.00 0.00 ? 77  LEU A HD22 4  
ATOM   7454  H HD23 . LEU A 1 77  ? -0.248  5.937   7.814   1.00 0.00 ? 77  LEU A HD23 4  
ATOM   7455  N N    . MET A 1 78  ? -0.047  3.272   3.486   1.00 0.00 ? 78  MET A N    4  
ATOM   7456  C CA   . MET A 1 78  ? -0.935  2.743   2.456   1.00 0.00 ? 78  MET A CA   4  
ATOM   7457  C C    . MET A 1 78  ? -1.806  1.627   3.033   1.00 0.00 ? 78  MET A C    4  
ATOM   7458  O O    . MET A 1 78  ? -3.026  1.653   2.900   1.00 0.00 ? 78  MET A O    4  
ATOM   7459  C CB   . MET A 1 78  ? -0.107  2.220   1.276   1.00 0.00 ? 78  MET A CB   4  
ATOM   7460  C CG   . MET A 1 78  ? -0.912  1.732   0.073   1.00 0.00 ? 78  MET A CG   4  
ATOM   7461  S SD   . MET A 1 78  ? 0.160   1.010   -1.183  1.00 0.00 ? 78  MET A SD   4  
ATOM   7462  C CE   . MET A 1 78  ? 0.976   -0.267  -0.222  1.00 0.00 ? 78  MET A CE   4  
ATOM   7463  H H    . MET A 1 78  ? 0.923   3.252   3.338   1.00 0.00 ? 78  MET A H    4  
ATOM   7464  H HA   . MET A 1 78  ? -1.570  3.550   2.119   1.00 0.00 ? 78  MET A HA   4  
ATOM   7465  H HB2  . MET A 1 78  ? 0.543   3.013   0.937   1.00 0.00 ? 78  MET A HB2  4  
ATOM   7466  H HB3  . MET A 1 78  ? 0.503   1.399   1.625   1.00 0.00 ? 78  MET A HB3  4  
ATOM   7467  H HG2  . MET A 1 78  ? -1.629  0.981   0.387   1.00 0.00 ? 78  MET A HG2  4  
ATOM   7468  H HG3  . MET A 1 78  ? -1.436  2.575   -0.362  1.00 0.00 ? 78  MET A HG3  4  
ATOM   7469  H HE1  . MET A 1 78  ? 1.671   0.188   0.470   1.00 0.00 ? 78  MET A HE1  4  
ATOM   7470  H HE2  . MET A 1 78  ? 1.510   -0.932  -0.882  1.00 0.00 ? 78  MET A HE2  4  
ATOM   7471  H HE3  . MET A 1 78  ? 0.236   -0.827  0.330   1.00 0.00 ? 78  MET A HE3  4  
ATOM   7472  N N    . PHE A 1 79  ? -1.182  0.659   3.699   1.00 0.00 ? 79  PHE A N    4  
ATOM   7473  C CA   . PHE A 1 79  ? -1.939  -0.441  4.301   1.00 0.00 ? 79  PHE A CA   4  
ATOM   7474  C C    . PHE A 1 79  ? -2.847  0.071   5.427   1.00 0.00 ? 79  PHE A C    4  
ATOM   7475  O O    . PHE A 1 79  ? -3.980  -0.399  5.593   1.00 0.00 ? 79  PHE A O    4  
ATOM   7476  C CB   . PHE A 1 79  ? -1.006  -1.539  4.831   1.00 0.00 ? 79  PHE A CB   4  
ATOM   7477  C CG   . PHE A 1 79  ? -0.156  -2.191  3.771   1.00 0.00 ? 79  PHE A CG   4  
ATOM   7478  C CD1  . PHE A 1 79  ? -0.720  -2.662  2.594   1.00 0.00 ? 79  PHE A CD1  4  
ATOM   7479  C CD2  . PHE A 1 79  ? 1.208   -2.338  3.958   1.00 0.00 ? 79  PHE A CD2  4  
ATOM   7480  C CE1  . PHE A 1 79  ? 0.063   -3.262  1.624   1.00 0.00 ? 79  PHE A CE1  4  
ATOM   7481  C CE2  . PHE A 1 79  ? 1.995   -2.940  2.995   1.00 0.00 ? 79  PHE A CE2  4  
ATOM   7482  C CZ   . PHE A 1 79  ? 1.426   -3.401  1.825   1.00 0.00 ? 79  PHE A CZ   4  
ATOM   7483  H H    . PHE A 1 79  ? -0.197  0.681   3.783   1.00 0.00 ? 79  PHE A H    4  
ATOM   7484  H HA   . PHE A 1 79  ? -2.565  -0.862  3.527   1.00 0.00 ? 79  PHE A HA   4  
ATOM   7485  H HB2  . PHE A 1 79  ? -0.342  -1.114  5.569   1.00 0.00 ? 79  PHE A HB2  4  
ATOM   7486  H HB3  . PHE A 1 79  ? -1.605  -2.311  5.295   1.00 0.00 ? 79  PHE A HB3  4  
ATOM   7487  H HD1  . PHE A 1 79  ? -1.783  -2.552  2.436   1.00 0.00 ? 79  PHE A HD1  4  
ATOM   7488  H HD2  . PHE A 1 79  ? 1.658   -1.980  4.871   1.00 0.00 ? 79  PHE A HD2  4  
ATOM   7489  H HE1  . PHE A 1 79  ? -0.391  -3.625  0.714   1.00 0.00 ? 79  PHE A HE1  4  
ATOM   7490  H HE2  . PHE A 1 79  ? 3.054   -3.049  3.159   1.00 0.00 ? 79  PHE A HE2  4  
ATOM   7491  H HZ   . PHE A 1 79  ? 2.050   -3.865  1.066   1.00 0.00 ? 79  PHE A HZ   4  
ATOM   7492  N N    . SER A 1 80  ? -2.352  1.048   6.185   1.00 0.00 ? 80  SER A N    4  
ATOM   7493  C CA   . SER A 1 80  ? -3.117  1.650   7.269   1.00 0.00 ? 80  SER A CA   4  
ATOM   7494  C C    . SER A 1 80  ? -4.404  2.287   6.748   1.00 0.00 ? 80  SER A C    4  
ATOM   7495  O O    . SER A 1 80  ? -5.477  2.091   7.324   1.00 0.00 ? 80  SER A O    4  
ATOM   7496  C CB   . SER A 1 80  ? -2.272  2.701   7.995   1.00 0.00 ? 80  SER A CB   4  
ATOM   7497  O OG   . SER A 1 80  ? -1.099  2.126   8.547   1.00 0.00 ? 80  SER A OG   4  
ATOM   7498  H H    . SER A 1 80  ? -1.440  1.366   6.018   1.00 0.00 ? 80  SER A H    4  
ATOM   7499  H HA   . SER A 1 80  ? -3.374  0.867   7.965   1.00 0.00 ? 80  SER A HA   4  
ATOM   7500  H HB2  . SER A 1 80  ? -1.982  3.477   7.297   1.00 0.00 ? 80  SER A HB2  4  
ATOM   7501  H HB3  . SER A 1 80  ? -2.854  3.137   8.793   1.00 0.00 ? 80  SER A HB3  4  
ATOM   7502  H HG   . SER A 1 80  ? -0.599  1.676   7.854   1.00 0.00 ? 80  SER A HG   4  
ATOM   7503  N N    . ASN A 1 81  ? -4.299  3.036   5.651   1.00 0.00 ? 81  ASN A N    4  
ATOM   7504  C CA   . ASN A 1 81  ? -5.456  3.733   5.095   1.00 0.00 ? 81  ASN A CA   4  
ATOM   7505  C C    . ASN A 1 81  ? -6.476  2.737   4.539   1.00 0.00 ? 81  ASN A C    4  
ATOM   7506  O O    . ASN A 1 81  ? -7.676  3.011   4.528   1.00 0.00 ? 81  ASN A O    4  
ATOM   7507  C CB   . ASN A 1 81  ? -5.028  4.781   4.040   1.00 0.00 ? 81  ASN A CB   4  
ATOM   7508  C CG   . ASN A 1 81  ? -4.570  4.212   2.704   1.00 0.00 ? 81  ASN A CG   4  
ATOM   7509  O OD1  . ASN A 1 81  ? -5.169  3.301   2.140   1.00 0.00 ? 81  ASN A OD1  4  
ATOM   7510  N ND2  . ASN A 1 81  ? -3.480  4.754   2.193   1.00 0.00 ? 81  ASN A ND2  4  
ATOM   7511  H H    . ASN A 1 81  ? -3.422  3.131   5.213   1.00 0.00 ? 81  ASN A H    4  
ATOM   7512  H HA   . ASN A 1 81  ? -5.925  4.256   5.915   1.00 0.00 ? 81  ASN A HA   4  
ATOM   7513  H HB2  . ASN A 1 81  ? -5.857  5.442   3.845   1.00 0.00 ? 81  ASN A HB2  4  
ATOM   7514  H HB3  . ASN A 1 81  ? -4.215  5.363   4.449   1.00 0.00 ? 81  ASN A HB3  4  
ATOM   7515  H HD21 . ASN A 1 81  ? -3.040  5.474   2.696   1.00 0.00 ? 81  ASN A HD21 4  
ATOM   7516  H HD22 . ASN A 1 81  ? -3.162  4.417   1.329   1.00 0.00 ? 81  ASN A HD22 4  
ATOM   7517  N N    . CYS A 1 82  ? -6.000  1.568   4.114   1.00 0.00 ? 82  CYS A N    4  
ATOM   7518  C CA   . CYS A 1 82  ? -6.888  0.519   3.623   1.00 0.00 ? 82  CYS A CA   4  
ATOM   7519  C C    . CYS A 1 82  ? -7.825  0.047   4.726   1.00 0.00 ? 82  CYS A C    4  
ATOM   7520  O O    . CYS A 1 82  ? -9.030  -0.089  4.504   1.00 0.00 ? 82  CYS A O    4  
ATOM   7521  C CB   . CYS A 1 82  ? -6.090  -0.668  3.072   1.00 0.00 ? 82  CYS A CB   4  
ATOM   7522  S SG   . CYS A 1 82  ? -4.943  -0.237  1.742   1.00 0.00 ? 82  CYS A SG   4  
ATOM   7523  H H    . CYS A 1 82  ? -5.030  1.421   4.108   1.00 0.00 ? 82  CYS A H    4  
ATOM   7524  H HA   . CYS A 1 82  ? -7.486  0.943   2.826   1.00 0.00 ? 82  CYS A HA   4  
ATOM   7525  H HB2  . CYS A 1 82  ? -5.515  -1.113  3.871   1.00 0.00 ? 82  CYS A HB2  4  
ATOM   7526  H HB3  . CYS A 1 82  ? -6.780  -1.402  2.683   1.00 0.00 ? 82  CYS A HB3  4  
ATOM   7527  H HG   . CYS A 1 82  ? -4.483  0.987   1.979   1.00 0.00 ? 82  CYS A HG   4  
ATOM   7528  N N    . TYR A 1 83  ? -7.280  -0.190  5.921   1.00 0.00 ? 83  TYR A N    4  
ATOM   7529  C CA   . TYR A 1 83  ? -8.113  -0.603  7.050   1.00 0.00 ? 83  TYR A CA   4  
ATOM   7530  C C    . TYR A 1 83  ? -8.923  0.577   7.563   1.00 0.00 ? 83  TYR A C    4  
ATOM   7531  O O    . TYR A 1 83  ? -9.986  0.407   8.159   1.00 0.00 ? 83  TYR A O    4  
ATOM   7532  C CB   . TYR A 1 83  ? -7.279  -1.150  8.212   1.00 0.00 ? 83  TYR A CB   4  
ATOM   7533  C CG   . TYR A 1 83  ? -6.284  -2.228  7.838   1.00 0.00 ? 83  TYR A CG   4  
ATOM   7534  C CD1  . TYR A 1 83  ? -6.626  -3.240  6.952   1.00 0.00 ? 83  TYR A CD1  4  
ATOM   7535  C CD2  . TYR A 1 83  ? -5.001  -2.243  8.388   1.00 0.00 ? 83  TYR A CD2  4  
ATOM   7536  C CE1  . TYR A 1 83  ? -5.728  -4.234  6.623   1.00 0.00 ? 83  TYR A CE1  4  
ATOM   7537  C CE2  . TYR A 1 83  ? -4.101  -3.232  8.062   1.00 0.00 ? 83  TYR A CE2  4  
ATOM   7538  C CZ   . TYR A 1 83  ? -4.467  -4.225  7.182   1.00 0.00 ? 83  TYR A CZ   4  
ATOM   7539  O OH   . TYR A 1 83  ? -3.564  -5.214  6.862   1.00 0.00 ? 83  TYR A OH   4  
ATOM   7540  H H    . TYR A 1 83  ? -6.306  -0.092  6.042   1.00 0.00 ? 83  TYR A H    4  
ATOM   7541  H HA   . TYR A 1 83  ? -8.791  -1.371  6.704   1.00 0.00 ? 83  TYR A HA   4  
ATOM   7542  H HB2  . TYR A 1 83  ? -6.729  -0.337  8.660   1.00 0.00 ? 83  TYR A HB2  4  
ATOM   7543  H HB3  . TYR A 1 83  ? -7.960  -1.566  8.948   1.00 0.00 ? 83  TYR A HB3  4  
ATOM   7544  H HD1  . TYR A 1 83  ? -7.614  -3.243  6.517   1.00 0.00 ? 83  TYR A HD1  4  
ATOM   7545  H HD2  . TYR A 1 83  ? -4.707  -1.462  9.079   1.00 0.00 ? 83  TYR A HD2  4  
ATOM   7546  H HE1  . TYR A 1 83  ? -6.015  -5.010  5.930   1.00 0.00 ? 83  TYR A HE1  4  
ATOM   7547  H HE2  . TYR A 1 83  ? -3.116  -3.231  8.503   1.00 0.00 ? 83  TYR A HE2  4  
ATOM   7548  H HH   . TYR A 1 83  ? -3.479  -5.275  5.906   1.00 0.00 ? 83  TYR A HH   4  
ATOM   7549  N N    . LYS A 1 84  ? -8.410  1.772   7.318   1.00 0.00 ? 84  LYS A N    4  
ATOM   7550  C CA   . LYS A 1 84  ? -9.053  2.992   7.774   1.00 0.00 ? 84  LYS A CA   4  
ATOM   7551  C C    . LYS A 1 84  ? -10.350 3.214   7.013   1.00 0.00 ? 84  LYS A C    4  
ATOM   7552  O O    . LYS A 1 84  ? -11.328 3.728   7.554   1.00 0.00 ? 84  LYS A O    4  
ATOM   7553  C CB   . LYS A 1 84  ? -8.114  4.181   7.572   1.00 0.00 ? 84  LYS A CB   4  
ATOM   7554  C CG   . LYS A 1 84  ? -8.042  5.113   8.770   1.00 0.00 ? 84  LYS A CG   4  
ATOM   7555  C CD   . LYS A 1 84  ? -7.138  6.302   8.496   1.00 0.00 ? 84  LYS A CD   4  
ATOM   7556  C CE   . LYS A 1 84  ? -7.826  7.336   7.621   1.00 0.00 ? 84  LYS A CE   4  
ATOM   7557  N NZ   . LYS A 1 84  ? -8.938  8.013   8.338   1.00 0.00 ? 84  LYS A NZ   4  
ATOM   7558  H H    . LYS A 1 84  ? -7.567  1.834   6.821   1.00 0.00 ? 84  LYS A H    4  
ATOM   7559  H HA   . LYS A 1 84  ? -9.272  2.884   8.826   1.00 0.00 ? 84  LYS A HA   4  
ATOM   7560  H HB2  . LYS A 1 84  ? -7.122  3.806   7.379   1.00 0.00 ? 84  LYS A HB2  4  
ATOM   7561  H HB3  . LYS A 1 84  ? -8.449  4.750   6.714   1.00 0.00 ? 84  LYS A HB3  4  
ATOM   7562  H HG2  . LYS A 1 84  ? -9.034  5.473   8.994   1.00 0.00 ? 84  LYS A HG2  4  
ATOM   7563  H HG3  . LYS A 1 84  ? -7.656  4.565   9.617   1.00 0.00 ? 84  LYS A HG3  4  
ATOM   7564  H HD2  . LYS A 1 84  ? -6.870  6.762   9.435   1.00 0.00 ? 84  LYS A HD2  4  
ATOM   7565  H HD3  . LYS A 1 84  ? -6.246  5.955   7.995   1.00 0.00 ? 84  LYS A HD3  4  
ATOM   7566  H HE2  . LYS A 1 84  ? -7.100  8.075   7.321   1.00 0.00 ? 84  LYS A HE2  4  
ATOM   7567  H HE3  . LYS A 1 84  ? -8.224  6.844   6.743   1.00 0.00 ? 84  LYS A HE3  4  
ATOM   7568  H HZ1  . LYS A 1 84  ? -9.659  7.323   8.619   1.00 0.00 ? 84  LYS A HZ1  4  
ATOM   7569  H HZ2  . LYS A 1 84  ? -9.377  8.728   7.723   1.00 0.00 ? 84  LYS A HZ2  4  
ATOM   7570  H HZ3  . LYS A 1 84  ? -8.577  8.486   9.191   1.00 0.00 ? 84  LYS A HZ3  4  
ATOM   7571  N N    . TYR A 1 85  ? -10.347 2.821   5.750   1.00 0.00 ? 85  TYR A N    4  
ATOM   7572  C CA   . TYR A 1 85  ? -11.524 2.957   4.912   1.00 0.00 ? 85  TYR A CA   4  
ATOM   7573  C C    . TYR A 1 85  ? -12.423 1.732   5.025   1.00 0.00 ? 85  TYR A C    4  
ATOM   7574  O O    . TYR A 1 85  ? -13.578 1.828   5.438   1.00 0.00 ? 85  TYR A O    4  
ATOM   7575  C CB   . TYR A 1 85  ? -11.119 3.151   3.453   1.00 0.00 ? 85  TYR A CB   4  
ATOM   7576  C CG   . TYR A 1 85  ? -12.300 3.446   2.547   1.00 0.00 ? 85  TYR A CG   4  
ATOM   7577  C CD1  . TYR A 1 85  ? -12.878 4.703   2.576   1.00 0.00 ? 85  TYR A CD1  4  
ATOM   7578  C CD2  . TYR A 1 85  ? -12.841 2.494   1.679   1.00 0.00 ? 85  TYR A CD2  4  
ATOM   7579  C CE1  . TYR A 1 85  ? -13.956 5.017   1.773   1.00 0.00 ? 85  TYR A CE1  4  
ATOM   7580  C CE2  . TYR A 1 85  ? -13.923 2.803   0.873   1.00 0.00 ? 85  TYR A CE2  4  
ATOM   7581  C CZ   . TYR A 1 85  ? -14.473 4.066   0.926   1.00 0.00 ? 85  TYR A CZ   4  
ATOM   7582  O OH   . TYR A 1 85  ? -15.541 4.384   0.125   1.00 0.00 ? 85  TYR A OH   4  
ATOM   7583  H H    . TYR A 1 85  ? -9.527  2.440   5.368   1.00 0.00 ? 85  TYR A H    4  
ATOM   7584  H HA   . TYR A 1 85  ? -12.067 3.831   5.241   1.00 0.00 ? 85  TYR A HA   4  
ATOM   7585  H HB2  . TYR A 1 85  ? -10.445 3.987   3.391   1.00 0.00 ? 85  TYR A HB2  4  
ATOM   7586  H HB3  . TYR A 1 85  ? -10.618 2.263   3.095   1.00 0.00 ? 85  TYR A HB3  4  
ATOM   7587  H HD1  . TYR A 1 85  ? -12.469 5.442   3.246   1.00 0.00 ? 85  TYR A HD1  4  
ATOM   7588  H HD2  . TYR A 1 85  ? -12.414 1.503   1.636   1.00 0.00 ? 85  TYR A HD2  4  
ATOM   7589  H HE1  . TYR A 1 85  ? -14.393 6.004   1.813   1.00 0.00 ? 85  TYR A HE1  4  
ATOM   7590  H HE2  . TYR A 1 85  ? -14.335 2.057   0.206   1.00 0.00 ? 85  TYR A HE2  4  
ATOM   7591  H HH   . TYR A 1 85  ? -15.386 5.234   -0.289  1.00 0.00 ? 85  TYR A HH   4  
ATOM   7592  N N    . ASN A 1 86  ? -11.868 0.582   4.676   1.00 0.00 ? 86  ASN A N    4  
ATOM   7593  C CA   . ASN A 1 86  ? -12.643 -0.643  4.542   1.00 0.00 ? 86  ASN A CA   4  
ATOM   7594  C C    . ASN A 1 86  ? -12.875 -1.294  5.897   1.00 0.00 ? 86  ASN A C    4  
ATOM   7595  O O    . ASN A 1 86  ? -11.964 -1.375  6.724   1.00 0.00 ? 86  ASN A O    4  
ATOM   7596  C CB   . ASN A 1 86  ? -11.919 -1.622  3.610   1.00 0.00 ? 86  ASN A CB   4  
ATOM   7597  C CG   . ASN A 1 86  ? -11.674 -1.036  2.234   1.00 0.00 ? 86  ASN A CG   4  
ATOM   7598  O OD1  . ASN A 1 86  ? -12.492 -1.187  1.328   1.00 0.00 ? 86  ASN A OD1  4  
ATOM   7599  N ND2  . ASN A 1 86  ? -10.538 -0.378  2.065   1.00 0.00 ? 86  ASN A ND2  4  
ATOM   7600  H H    . ASN A 1 86  ? -10.902 0.550   4.515   1.00 0.00 ? 86  ASN A H    4  
ATOM   7601  H HA   . ASN A 1 86  ? -13.597 -0.386  4.108   1.00 0.00 ? 86  ASN A HA   4  
ATOM   7602  H HB2  . ASN A 1 86  ? -10.965 -1.883  4.044   1.00 0.00 ? 86  ASN A HB2  4  
ATOM   7603  H HB3  . ASN A 1 86  ? -12.520 -2.516  3.497   1.00 0.00 ? 86  ASN A HB3  4  
ATOM   7604  H HD21 . ASN A 1 86  ? -9.923  -0.311  2.830   1.00 0.00 ? 86  ASN A HD21 4  
ATOM   7605  H HD22 . ASN A 1 86  ? -10.365 0.037   1.193   1.00 0.00 ? 86  ASN A HD22 4  
ATOM   7606  N N    . PRO A 1 87  ? -14.112 -1.752  6.137   1.00 0.00 ? 87  PRO A N    4  
ATOM   7607  C CA   . PRO A 1 87  ? -14.479 -2.442  7.377   1.00 0.00 ? 87  PRO A CA   4  
ATOM   7608  C C    . PRO A 1 87  ? -13.777 -3.796  7.511   1.00 0.00 ? 87  PRO A C    4  
ATOM   7609  O O    . PRO A 1 87  ? -13.248 -4.316  6.528   1.00 0.00 ? 87  PRO A O    4  
ATOM   7610  C CB   . PRO A 1 87  ? -15.997 -2.622  7.256   1.00 0.00 ? 87  PRO A CB   4  
ATOM   7611  C CG   . PRO A 1 87  ? -16.288 -2.544  5.802   1.00 0.00 ? 87  PRO A CG   4  
ATOM   7612  C CD   . PRO A 1 87  ? -15.258 -1.619  5.219   1.00 0.00 ? 87  PRO A CD   4  
ATOM   7613  H HA   . PRO A 1 87  ? -14.254 -1.839  8.243   1.00 0.00 ? 87  PRO A HA   4  
ATOM   7614  H HB2  . PRO A 1 87  ? -16.279 -3.579  7.663   1.00 0.00 ? 87  PRO A HB2  4  
ATOM   7615  H HB3  . PRO A 1 87  ? -16.497 -1.834  7.800   1.00 0.00 ? 87  PRO A HB3  4  
ATOM   7616  H HG2  . PRO A 1 87  ? -16.207 -3.525  5.358   1.00 0.00 ? 87  PRO A HG2  4  
ATOM   7617  H HG3  . PRO A 1 87  ? -17.280 -2.143  5.650   1.00 0.00 ? 87  PRO A HG3  4  
ATOM   7618  H HD2  . PRO A 1 87  ? -14.992 -1.935  4.220   1.00 0.00 ? 87  PRO A HD2  4  
ATOM   7619  H HD3  . PRO A 1 87  ? -15.627 -0.604  5.209   1.00 0.00 ? 87  PRO A HD3  4  
ATOM   7620  N N    . PRO A 1 88  ? -13.774 -4.378  8.733   1.00 0.00 ? 88  PRO A N    4  
ATOM   7621  C CA   . PRO A 1 88  ? -13.005 -5.586  9.076   1.00 0.00 ? 88  PRO A CA   4  
ATOM   7622  C C    . PRO A 1 88  ? -13.043 -6.692  8.020   1.00 0.00 ? 88  PRO A C    4  
ATOM   7623  O O    . PRO A 1 88  ? -12.023 -7.334  7.754   1.00 0.00 ? 88  PRO A O    4  
ATOM   7624  C CB   . PRO A 1 88  ? -13.657 -6.080  10.381  1.00 0.00 ? 88  PRO A CB   4  
ATOM   7625  C CG   . PRO A 1 88  ? -14.826 -5.181  10.622  1.00 0.00 ? 88  PRO A CG   4  
ATOM   7626  C CD   . PRO A 1 88  ? -14.527 -3.905  9.897   1.00 0.00 ? 88  PRO A CD   4  
ATOM   7627  H HA   . PRO A 1 88  ? -11.975 -5.338  9.274   1.00 0.00 ? 88  PRO A HA   4  
ATOM   7628  H HB2  . PRO A 1 88  ? -13.972 -7.106  10.258  1.00 0.00 ? 88  PRO A HB2  4  
ATOM   7629  H HB3  . PRO A 1 88  ? -12.941 -6.017  11.187  1.00 0.00 ? 88  PRO A HB3  4  
ATOM   7630  H HG2  . PRO A 1 88  ? -15.725 -5.634  10.226  1.00 0.00 ? 88  PRO A HG2  4  
ATOM   7631  H HG3  . PRO A 1 88  ? -14.936 -4.996  11.681  1.00 0.00 ? 88  PRO A HG3  4  
ATOM   7632  H HD2  . PRO A 1 88  ? -15.440 -3.412  9.599   1.00 0.00 ? 88  PRO A HD2  4  
ATOM   7633  H HD3  . PRO A 1 88  ? -13.921 -3.252  10.508  1.00 0.00 ? 88  PRO A HD3  4  
ATOM   7634  N N    . ASP A 1 89  ? -14.202 -6.915  7.419   1.00 0.00 ? 89  ASP A N    4  
ATOM   7635  C CA   . ASP A 1 89  ? -14.335 -7.981  6.431   1.00 0.00 ? 89  ASP A CA   4  
ATOM   7636  C C    . ASP A 1 89  ? -14.569 -7.411  5.040   1.00 0.00 ? 89  ASP A C    4  
ATOM   7637  O O    . ASP A 1 89  ? -15.707 -7.167  4.633   1.00 0.00 ? 89  ASP A O    4  
ATOM   7638  C CB   . ASP A 1 89  ? -15.468 -8.950  6.804   1.00 0.00 ? 89  ASP A CB   4  
ATOM   7639  C CG   . ASP A 1 89  ? -15.559 -10.130 5.851   1.00 0.00 ? 89  ASP A CG   4  
ATOM   7640  O OD1  . ASP A 1 89  ? -16.637 -10.753 5.772   1.00 0.00 ? 89  ASP A OD1  4  
ATOM   7641  O OD2  . ASP A 1 89  ? -14.554 -10.449 5.177   1.00 0.00 ? 89  ASP A OD2  4  
ATOM   7642  H H    . ASP A 1 89  ? -14.972 -6.345  7.629   1.00 0.00 ? 89  ASP A H    4  
ATOM   7643  H HA   . ASP A 1 89  ? -13.401 -8.528  6.421   1.00 0.00 ? 89  ASP A HA   4  
ATOM   7644  H HB2  . ASP A 1 89  ? -15.295 -9.329  7.800   1.00 0.00 ? 89  ASP A HB2  4  
ATOM   7645  H HB3  . ASP A 1 89  ? -16.414 -8.424  6.784   1.00 0.00 ? 89  ASP A HB3  4  
ATOM   7646  N N    . HIS A 1 90  ? -13.483 -7.183  4.318   1.00 0.00 ? 90  HIS A N    4  
ATOM   7647  C CA   . HIS A 1 90  ? -13.564 -6.745  2.934   1.00 0.00 ? 90  HIS A CA   4  
ATOM   7648  C C    . HIS A 1 90  ? -12.338 -7.243  2.172   1.00 0.00 ? 90  HIS A C    4  
ATOM   7649  O O    . HIS A 1 90  ? -11.309 -7.517  2.779   1.00 0.00 ? 90  HIS A O    4  
ATOM   7650  C CB   . HIS A 1 90  ? -13.651 -5.215  2.839   1.00 0.00 ? 90  HIS A CB   4  
ATOM   7651  C CG   . HIS A 1 90  ? -14.406 -4.723  1.630   1.00 0.00 ? 90  HIS A CG   4  
ATOM   7652  N ND1  . HIS A 1 90  ? -13.782 -4.346  0.458   1.00 0.00 ? 90  HIS A ND1  4  
ATOM   7653  C CD2  . HIS A 1 90  ? -15.738 -4.559  1.402   1.00 0.00 ? 90  HIS A CD2  4  
ATOM   7654  C CE1  . HIS A 1 90  ? -14.691 -3.980  -0.427  1.00 0.00 ? 90  HIS A CE1  4  
ATOM   7655  N NE2  . HIS A 1 90  ? -15.880 -4.102  0.120   1.00 0.00 ? 90  HIS A NE2  4  
ATOM   7656  H H    . HIS A 1 90  ? -12.602 -7.319  4.727   1.00 0.00 ? 90  HIS A H    4  
ATOM   7657  H HA   . HIS A 1 90  ? -14.454 -7.183  2.500   1.00 0.00 ? 90  HIS A HA   4  
ATOM   7658  H HB2  . HIS A 1 90  ? -14.128 -4.830  3.727   1.00 0.00 ? 90  HIS A HB2  4  
ATOM   7659  H HB3  . HIS A 1 90  ? -12.648 -4.817  2.784   1.00 0.00 ? 90  HIS A HB3  4  
ATOM   7660  H HD1  . HIS A 1 90  ? -12.821 -4.322  0.307   1.00 0.00 ? 90  HIS A HD1  4  
ATOM   7661  H HD2  . HIS A 1 90  ? -16.538 -4.731  2.101   1.00 0.00 ? 90  HIS A HD2  4  
ATOM   7662  H HE1  . HIS A 1 90  ? -14.492 -3.633  -1.429  1.00 0.00 ? 90  HIS A HE1  4  
ATOM   7663  H HE2  . HIS A 1 90  ? -16.732 -3.988  -0.354  1.00 0.00 ? 90  HIS A HE2  4  
ATOM   7664  N N    . ASP A 1 91  ? -12.432 -7.360  0.861   1.00 0.00 ? 91  ASP A N    4  
ATOM   7665  C CA   . ASP A 1 91  ? -11.324 -7.897  0.067   1.00 0.00 ? 91  ASP A CA   4  
ATOM   7666  C C    . ASP A 1 91  ? -10.032 -7.102  0.249   1.00 0.00 ? 91  ASP A C    4  
ATOM   7667  O O    . ASP A 1 91  ? -8.957  -7.683  0.392   1.00 0.00 ? 91  ASP A O    4  
ATOM   7668  C CB   . ASP A 1 91  ? -11.696 -7.944  -1.413  1.00 0.00 ? 91  ASP A CB   4  
ATOM   7669  C CG   . ASP A 1 91  ? -12.620 -9.100  -1.732  1.00 0.00 ? 91  ASP A CG   4  
ATOM   7670  O OD1  . ASP A 1 91  ? -13.618 -9.285  -1.003  1.00 0.00 ? 91  ASP A OD1  4  
ATOM   7671  O OD2  . ASP A 1 91  ? -12.352 -9.825  -2.711  1.00 0.00 ? 91  ASP A OD2  4  
ATOM   7672  H H    . ASP A 1 91  ? -13.271 -7.112  0.413   1.00 0.00 ? 91  ASP A H    4  
ATOM   7673  H HA   . ASP A 1 91  ? -11.147 -8.905  0.405   1.00 0.00 ? 91  ASP A HA   4  
ATOM   7674  H HB2  . ASP A 1 91  ? -12.190 -7.024  -1.686  1.00 0.00 ? 91  ASP A HB2  4  
ATOM   7675  H HB3  . ASP A 1 91  ? -10.798 -8.054  -1.999  1.00 0.00 ? 91  ASP A HB3  4  
ATOM   7676  N N    . VAL A 1 92  ? -10.138 -5.779  0.278   1.00 0.00 ? 92  VAL A N    4  
ATOM   7677  C CA   . VAL A 1 92  ? -8.950  -4.926  0.314   1.00 0.00 ? 92  VAL A CA   4  
ATOM   7678  C C    . VAL A 1 92  ? -8.218  -5.025  1.647   1.00 0.00 ? 92  VAL A C    4  
ATOM   7679  O O    . VAL A 1 92  ? -7.031  -4.732  1.718   1.00 0.00 ? 92  VAL A O    4  
ATOM   7680  C CB   . VAL A 1 92  ? -9.267  -3.445  0.010   1.00 0.00 ? 92  VAL A CB   4  
ATOM   7681  C CG1  . VAL A 1 92  ? -8.435  -2.955  -1.159  1.00 0.00 ? 92  VAL A CG1  4  
ATOM   7682  C CG2  . VAL A 1 92  ? -10.739 -3.251  -0.281  1.00 0.00 ? 92  VAL A CG2  4  
ATOM   7683  H H    . VAL A 1 92  ? -11.022 -5.373  0.282   1.00 0.00 ? 92  VAL A H    4  
ATOM   7684  H HA   . VAL A 1 92  ? -8.283  -5.275  -0.451  1.00 0.00 ? 92  VAL A HA   4  
ATOM   7685  H HB   . VAL A 1 92  ? -9.009  -2.856  0.875   1.00 0.00 ? 92  VAL A HB   4  
ATOM   7686  H HG11 . VAL A 1 92  ? -7.402  -3.201  -0.991  1.00 0.00 ? 92  VAL A HG11 4  
ATOM   7687  H HG12 . VAL A 1 92  ? -8.540  -1.885  -1.252  1.00 0.00 ? 92  VAL A HG12 4  
ATOM   7688  H HG13 . VAL A 1 92  ? -8.774  -3.431  -2.068  1.00 0.00 ? 92  VAL A HG13 4  
ATOM   7689  H HG21 . VAL A 1 92  ? -11.311 -3.627  0.545   1.00 0.00 ? 92  VAL A HG21 4  
ATOM   7690  H HG22 . VAL A 1 92  ? -11.005 -3.788  -1.180  1.00 0.00 ? 92  VAL A HG22 4  
ATOM   7691  H HG23 . VAL A 1 92  ? -10.945 -2.200  -0.413  1.00 0.00 ? 92  VAL A HG23 4  
ATOM   7692  N N    . VAL A 1 93  ? -8.906  -5.453  2.699   1.00 0.00 ? 93  VAL A N    4  
ATOM   7693  C CA   . VAL A 1 93  ? -8.243  -5.644  3.982   1.00 0.00 ? 93  VAL A CA   4  
ATOM   7694  C C    . VAL A 1 93  ? -7.593  -7.022  4.024   1.00 0.00 ? 93  VAL A C    4  
ATOM   7695  O O    . VAL A 1 93  ? -6.521  -7.198  4.599   1.00 0.00 ? 93  VAL A O    4  
ATOM   7696  C CB   . VAL A 1 93  ? -9.195  -5.460  5.193   1.00 0.00 ? 93  VAL A CB   4  
ATOM   7697  C CG1  . VAL A 1 93  ? -9.915  -4.126  5.110   1.00 0.00 ? 93  VAL A CG1  4  
ATOM   7698  C CG2  . VAL A 1 93  ? -10.200 -6.590  5.297   1.00 0.00 ? 93  VAL A CG2  4  
ATOM   7699  H H    . VAL A 1 93  ? -9.861  -5.654  2.611   1.00 0.00 ? 93  VAL A H    4  
ATOM   7700  H HA   . VAL A 1 93  ? -7.461  -4.897  4.051   1.00 0.00 ? 93  VAL A HA   4  
ATOM   7701  H HB   . VAL A 1 93  ? -8.597  -5.465  6.092   1.00 0.00 ? 93  VAL A HB   4  
ATOM   7702  H HG11 . VAL A 1 93  ? -10.609 -4.148  4.281   1.00 0.00 ? 93  VAL A HG11 4  
ATOM   7703  H HG12 . VAL A 1 93  ? -9.194  -3.336  4.956   1.00 0.00 ? 93  VAL A HG12 4  
ATOM   7704  H HG13 . VAL A 1 93  ? -10.454 -3.950  6.028   1.00 0.00 ? 93  VAL A HG13 4  
ATOM   7705  H HG21 . VAL A 1 93  ? -10.828 -6.591  4.418   1.00 0.00 ? 93  VAL A HG21 4  
ATOM   7706  H HG22 . VAL A 1 93  ? -10.812 -6.449  6.176   1.00 0.00 ? 93  VAL A HG22 4  
ATOM   7707  H HG23 . VAL A 1 93  ? -9.679  -7.533  5.368   1.00 0.00 ? 93  VAL A HG23 4  
ATOM   7708  N N    . ALA A 1 94  ? -8.240  -7.989  3.380   1.00 0.00 ? 94  ALA A N    4  
ATOM   7709  C CA   . ALA A 1 94  ? -7.692  -9.334  3.251   1.00 0.00 ? 94  ALA A CA   4  
ATOM   7710  C C    . ALA A 1 94  ? -6.418  -9.310  2.419   1.00 0.00 ? 94  ALA A C    4  
ATOM   7711  O O    . ALA A 1 94  ? -5.423  -9.955  2.764   1.00 0.00 ? 94  ALA A O    4  
ATOM   7712  C CB   . ALA A 1 94  ? -8.718  -10.275 2.634   1.00 0.00 ? 94  ALA A CB   4  
ATOM   7713  H H    . ALA A 1 94  ? -9.119  -7.794  2.994   1.00 0.00 ? 94  ALA A H    4  
ATOM   7714  H HA   . ALA A 1 94  ? -7.455  -9.693  4.237   1.00 0.00 ? 94  ALA A HA   4  
ATOM   7715  H HB1  . ALA A 1 94  ? -8.955  -9.949  1.634   1.00 0.00 ? 94  ALA A HB1  4  
ATOM   7716  H HB2  . ALA A 1 94  ? -9.615  -10.271 3.235   1.00 0.00 ? 94  ALA A HB2  4  
ATOM   7717  H HB3  . ALA A 1 94  ? -8.313  -11.276 2.600   1.00 0.00 ? 94  ALA A HB3  4  
ATOM   7718  N N    . MET A 1 95  ? -6.451  -8.545  1.334   1.00 0.00 ? 95  MET A N    4  
ATOM   7719  C CA   . MET A 1 95  ? -5.294  -8.397  0.467   1.00 0.00 ? 95  MET A CA   4  
ATOM   7720  C C    . MET A 1 95  ? -4.208  -7.580  1.165   1.00 0.00 ? 95  MET A C    4  
ATOM   7721  O O    . MET A 1 95  ? -3.018  -7.835  0.984   1.00 0.00 ? 95  MET A O    4  
ATOM   7722  C CB   . MET A 1 95  ? -5.700  -7.747  -0.869  1.00 0.00 ? 95  MET A CB   4  
ATOM   7723  C CG   . MET A 1 95  ? -6.632  -8.613  -1.719  1.00 0.00 ? 95  MET A CG   4  
ATOM   7724  S SD   . MET A 1 95  ? -6.937  -7.928  -3.365  1.00 0.00 ? 95  MET A SD   4  
ATOM   7725  C CE   . MET A 1 95  ? -8.396  -6.924  -3.087  1.00 0.00 ? 95  MET A CE   4  
ATOM   7726  H H    . MET A 1 95  ? -7.281  -8.070  1.109   1.00 0.00 ? 95  MET A H    4  
ATOM   7727  H HA   . MET A 1 95  ? -4.901  -9.384  0.270   1.00 0.00 ? 95  MET A HA   4  
ATOM   7728  H HB2  . MET A 1 95  ? -6.202  -6.814  -0.662  1.00 0.00 ? 95  MET A HB2  4  
ATOM   7729  H HB3  . MET A 1 95  ? -4.808  -7.543  -1.444  1.00 0.00 ? 95  MET A HB3  4  
ATOM   7730  H HG2  . MET A 1 95  ? -6.195  -9.594  -1.834  1.00 0.00 ? 95  MET A HG2  4  
ATOM   7731  H HG3  . MET A 1 95  ? -7.580  -8.705  -1.204  1.00 0.00 ? 95  MET A HG3  4  
ATOM   7732  H HE1  . MET A 1 95  ? -8.242  -6.280  -2.235  1.00 0.00 ? 95  MET A HE1  4  
ATOM   7733  H HE2  . MET A 1 95  ? -9.242  -7.565  -2.905  1.00 0.00 ? 95  MET A HE2  4  
ATOM   7734  H HE3  . MET A 1 95  ? -8.588  -6.320  -3.962  1.00 0.00 ? 95  MET A HE3  4  
ATOM   7735  N N    . ALA A 1 96  ? -4.625  -6.621  1.994   1.00 0.00 ? 96  ALA A N    4  
ATOM   7736  C CA   . ALA A 1 96  ? -3.682  -5.783  2.732   1.00 0.00 ? 96  ALA A CA   4  
ATOM   7737  C C    . ALA A 1 96  ? -2.934  -6.594  3.788   1.00 0.00 ? 96  ALA A C    4  
ATOM   7738  O O    . ALA A 1 96  ? -1.725  -6.460  3.938   1.00 0.00 ? 96  ALA A O    4  
ATOM   7739  C CB   . ALA A 1 96  ? -4.398  -4.615  3.388   1.00 0.00 ? 96  ALA A CB   4  
ATOM   7740  H H    . ALA A 1 96  ? -5.587  -6.472  2.109   1.00 0.00 ? 96  ALA A H    4  
ATOM   7741  H HA   . ALA A 1 96  ? -2.969  -5.380  2.027   1.00 0.00 ? 96  ALA A HA   4  
ATOM   7742  H HB1  . ALA A 1 96  ? -4.719  -3.918  2.630   1.00 0.00 ? 96  ALA A HB1  4  
ATOM   7743  H HB2  . ALA A 1 96  ? -3.725  -4.118  4.071   1.00 0.00 ? 96  ALA A HB2  4  
ATOM   7744  H HB3  . ALA A 1 96  ? -5.257  -4.978  3.930   1.00 0.00 ? 96  ALA A HB3  4  
ATOM   7745  N N    . ARG A 1 97  ? -3.665  -7.434  4.520   1.00 0.00 ? 97  ARG A N    4  
ATOM   7746  C CA   . ARG A 1 97  ? -3.072  -8.229  5.597   1.00 0.00 ? 97  ARG A CA   4  
ATOM   7747  C C    . ARG A 1 97  ? -2.064  -9.236  5.057   1.00 0.00 ? 97  ARG A C    4  
ATOM   7748  O O    . ARG A 1 97  ? -1.001  -9.442  5.645   1.00 0.00 ? 97  ARG A O    4  
ATOM   7749  C CB   . ARG A 1 97  ? -4.151  -8.961  6.395   1.00 0.00 ? 97  ARG A CB   4  
ATOM   7750  C CG   . ARG A 1 97  ? -5.050  -8.023  7.184   1.00 0.00 ? 97  ARG A CG   4  
ATOM   7751  C CD   . ARG A 1 97  ? -6.045  -8.773  8.051   1.00 0.00 ? 97  ARG A CD   4  
ATOM   7752  N NE   . ARG A 1 97  ? -7.148  -7.909  8.474   1.00 0.00 ? 97  ARG A NE   4  
ATOM   7753  C CZ   . ARG A 1 97  ? -8.429  -8.143  8.189   1.00 0.00 ? 97  ARG A CZ   4  
ATOM   7754  N NH1  . ARG A 1 97  ? -8.776  -9.218  7.490   1.00 0.00 ? 97  ARG A NH1  4  
ATOM   7755  N NH2  . ARG A 1 97  ? -9.365  -7.294  8.592   1.00 0.00 ? 97  ARG A NH2  4  
ATOM   7756  H H    . ARG A 1 97  ? -4.626  -7.517  4.337   1.00 0.00 ? 97  ARG A H    4  
ATOM   7757  H HA   . ARG A 1 97  ? -2.562  -7.548  6.257   1.00 0.00 ? 97  ARG A HA   4  
ATOM   7758  H HB2  . ARG A 1 97  ? -4.764  -9.526  5.707   1.00 0.00 ? 97  ARG A HB2  4  
ATOM   7759  H HB3  . ARG A 1 97  ? -3.677  -9.641  7.087   1.00 0.00 ? 97  ARG A HB3  4  
ATOM   7760  H HG2  . ARG A 1 97  ? -4.432  -7.410  7.822   1.00 0.00 ? 97  ARG A HG2  4  
ATOM   7761  H HG3  . ARG A 1 97  ? -5.591  -7.393  6.492   1.00 0.00 ? 97  ARG A HG3  4  
ATOM   7762  H HD2  . ARG A 1 97  ? -6.440  -9.606  7.497   1.00 0.00 ? 97  ARG A HD2  4  
ATOM   7763  H HD3  . ARG A 1 97  ? -5.533  -9.138  8.929   1.00 0.00 ? 97  ARG A HD3  4  
ATOM   7764  H HE   . ARG A 1 97  ? -6.915  -7.106  8.994   1.00 0.00 ? 97  ARG A HE   4  
ATOM   7765  H HH11 . ARG A 1 97  ? -8.077  -9.861  7.172   1.00 0.00 ? 97  ARG A HH11 4  
ATOM   7766  H HH12 . ARG A 1 97  ? -9.744  -9.394  7.282   1.00 0.00 ? 97  ARG A HH12 4  
ATOM   7767  H HH21 . ARG A 1 97  ? -9.116  -6.473  9.111   1.00 0.00 ? 97  ARG A HH21 4  
ATOM   7768  H HH22 . ARG A 1 97  ? -10.333 -7.465  8.371   1.00 0.00 ? 97  ARG A HH22 4  
ATOM   7769  N N    . LYS A 1 98  ? -2.404  -9.867  3.946   1.00 0.00 ? 98  LYS A N    4  
ATOM   7770  C CA   . LYS A 1 98  ? -1.519  -10.847 3.326   1.00 0.00 ? 98  LYS A CA   4  
ATOM   7771  C C    . LYS A 1 98  ? -0.242  -10.178 2.795   1.00 0.00 ? 98  LYS A C    4  
ATOM   7772  O O    . LYS A 1 98  ? 0.875   -10.658 3.023   1.00 0.00 ? 98  LYS A O    4  
ATOM   7773  C CB   . LYS A 1 98  ? -2.258  -11.582 2.206   1.00 0.00 ? 98  LYS A CB   4  
ATOM   7774  C CG   . LYS A 1 98  ? -1.451  -12.707 1.584   1.00 0.00 ? 98  LYS A CG   4  
ATOM   7775  C CD   . LYS A 1 98  ? -2.185  -13.344 0.417   1.00 0.00 ? 98  LYS A CD   4  
ATOM   7776  C CE   . LYS A 1 98  ? -1.341  -14.412 -0.254  1.00 0.00 ? 98  LYS A CE   4  
ATOM   7777  N NZ   . LYS A 1 98  ? -0.934  -15.487 0.686   1.00 0.00 ? 98  LYS A NZ   4  
ATOM   7778  H H    . LYS A 1 98  ? -3.280  -9.681  3.541   1.00 0.00 ? 98  LYS A H    4  
ATOM   7779  H HA   . LYS A 1 98  ? -1.240  -11.562 4.086   1.00 0.00 ? 98  LYS A HA   4  
ATOM   7780  H HB2  . LYS A 1 98  ? -3.166  -12.003 2.610   1.00 0.00 ? 98  LYS A HB2  4  
ATOM   7781  H HB3  . LYS A 1 98  ? -2.515  -10.874 1.432   1.00 0.00 ? 98  LYS A HB3  4  
ATOM   7782  H HG2  . LYS A 1 98  ? -0.510  -12.314 1.238   1.00 0.00 ? 98  LYS A HG2  4  
ATOM   7783  H HG3  . LYS A 1 98  ? -1.271  -13.458 2.336   1.00 0.00 ? 98  LYS A HG3  4  
ATOM   7784  H HD2  . LYS A 1 98  ? -3.099  -13.794 0.777   1.00 0.00 ? 98  LYS A HD2  4  
ATOM   7785  H HD3  . LYS A 1 98  ? -2.417  -12.581 -0.309  1.00 0.00 ? 98  LYS A HD3  4  
ATOM   7786  H HE2  . LYS A 1 98  ? -1.912  -14.849 -1.059  1.00 0.00 ? 98  LYS A HE2  4  
ATOM   7787  H HE3  . LYS A 1 98  ? -0.458  -13.942 -0.657  1.00 0.00 ? 98  LYS A HE3  4  
ATOM   7788  H HZ1  . LYS A 1 98  ? -0.408  -15.085 1.488   1.00 0.00 ? 98  LYS A HZ1  4  
ATOM   7789  H HZ2  . LYS A 1 98  ? -0.323  -16.175 0.197   1.00 0.00 ? 98  LYS A HZ2  4  
ATOM   7790  H HZ3  . LYS A 1 98  ? -1.772  -15.983 1.048   1.00 0.00 ? 98  LYS A HZ3  4  
ATOM   7791  N N    . LEU A 1 99  ? -0.411  -9.065  2.091   1.00 0.00 ? 99  LEU A N    4  
ATOM   7792  C CA   . LEU A 1 99  ? 0.724   -8.265  1.633   1.00 0.00 ? 99  LEU A CA   4  
ATOM   7793  C C    . LEU A 1 99  ? 1.515   -7.697  2.812   1.00 0.00 ? 99  LEU A C    4  
ATOM   7794  O O    . LEU A 1 99  ? 2.710   -7.425  2.695   1.00 0.00 ? 99  LEU A O    4  
ATOM   7795  C CB   . LEU A 1 99  ? 0.277   -7.115  0.725   1.00 0.00 ? 99  LEU A CB   4  
ATOM   7796  C CG   . LEU A 1 99  ? 0.268   -7.375  -0.793  1.00 0.00 ? 99  LEU A CG   4  
ATOM   7797  C CD1  . LEU A 1 99  ? 0.746   -6.137  -1.512  1.00 0.00 ? 99  LEU A CD1  4  
ATOM   7798  C CD2  . LEU A 1 99  ? 1.157   -8.539  -1.182  1.00 0.00 ? 99  LEU A CD2  4  
ATOM   7799  H H    . LEU A 1 99  ? -1.314  -8.784  1.860   1.00 0.00 ? 99  LEU A H    4  
ATOM   7800  H HA   . LEU A 1 99  ? 1.376   -8.915  1.074   1.00 0.00 ? 99  LEU A HA   4  
ATOM   7801  H HB2  . LEU A 1 99  ? -0.723  -6.832  1.017   1.00 0.00 ? 99  LEU A HB2  4  
ATOM   7802  H HB3  . LEU A 1 99  ? 0.926   -6.284  0.913   1.00 0.00 ? 99  LEU A HB3  4  
ATOM   7803  H HG   . LEU A 1 99  ? -0.738  -7.583  -1.126  1.00 0.00 ? 99  LEU A HG   4  
ATOM   7804  H HD11 . LEU A 1 99  ? 1.814   -6.059  -1.392  1.00 0.00 ? 99  LEU A HD11 4  
ATOM   7805  H HD12 . LEU A 1 99  ? 0.269   -5.265  -1.090  1.00 0.00 ? 99  LEU A HD12 4  
ATOM   7806  H HD13 . LEU A 1 99  ? 0.505   -6.211  -2.561  1.00 0.00 ? 99  LEU A HD13 4  
ATOM   7807  H HD21 . LEU A 1 99  ? 2.188   -8.262  -1.024  1.00 0.00 ? 99  LEU A HD21 4  
ATOM   7808  H HD22 . LEU A 1 99  ? 1.003   -8.770  -2.226  1.00 0.00 ? 99  LEU A HD22 4  
ATOM   7809  H HD23 . LEU A 1 99  ? 0.914   -9.403  -0.586  1.00 0.00 ? 99  LEU A HD23 4  
ATOM   7810  N N    . GLN A 1 100 ? 0.847   -7.502  3.938   1.00 0.00 ? 100 GLN A N    4  
ATOM   7811  C CA   . GLN A 1 100 ? 1.524   -7.085  5.157   1.00 0.00 ? 100 GLN A CA   4  
ATOM   7812  C C    . GLN A 1 100 ? 2.485   -8.179  5.611   1.00 0.00 ? 100 GLN A C    4  
ATOM   7813  O O    . GLN A 1 100 ? 3.571   -7.893  6.099   1.00 0.00 ? 100 GLN A O    4  
ATOM   7814  C CB   . GLN A 1 100 ? 0.507   -6.785  6.266   1.00 0.00 ? 100 GLN A CB   4  
ATOM   7815  C CG   . GLN A 1 100 ? 1.124   -6.289  7.567   1.00 0.00 ? 100 GLN A CG   4  
ATOM   7816  C CD   . GLN A 1 100 ? 1.954   -5.032  7.392   1.00 0.00 ? 100 GLN A CD   4  
ATOM   7817  O OE1  . GLN A 1 100 ? 1.676   -4.203  6.531   1.00 0.00 ? 100 GLN A OE1  4  
ATOM   7818  N NE2  . GLN A 1 100 ? 2.981   -4.882  8.214   1.00 0.00 ? 100 GLN A NE2  4  
ATOM   7819  H H    . GLN A 1 100 ? -0.127  -7.623  3.946   1.00 0.00 ? 100 GLN A H    4  
ATOM   7820  H HA   . GLN A 1 100 ? 2.090   -6.189  4.937   1.00 0.00 ? 100 GLN A HA   4  
ATOM   7821  H HB2  . GLN A 1 100 ? -0.187  -6.037  5.913   1.00 0.00 ? 100 GLN A HB2  4  
ATOM   7822  H HB3  . GLN A 1 100 ? -0.038  -7.694  6.483   1.00 0.00 ? 100 GLN A HB3  4  
ATOM   7823  H HG2  . GLN A 1 100 ? 0.325   -6.075  8.264   1.00 0.00 ? 100 GLN A HG2  4  
ATOM   7824  H HG3  . GLN A 1 100 ? 1.755   -7.067  7.972   1.00 0.00 ? 100 GLN A HG3  4  
ATOM   7825  H HE21 . GLN A 1 100 ? 3.147   -5.581  8.881   1.00 0.00 ? 100 GLN A HE21 4  
ATOM   7826  H HE22 . GLN A 1 100 ? 3.536   -4.079  8.122   1.00 0.00 ? 100 GLN A HE22 4  
ATOM   7827  N N    . ASP A 1 101 ? 2.078   -9.432  5.421   1.00 0.00 ? 101 ASP A N    4  
ATOM   7828  C CA   . ASP A 1 101 ? 2.896   -10.578 5.814   1.00 0.00 ? 101 ASP A CA   4  
ATOM   7829  C C    . ASP A 1 101 ? 4.217   -10.583 5.055   1.00 0.00 ? 101 ASP A C    4  
ATOM   7830  O O    . ASP A 1 101 ? 5.287   -10.713 5.659   1.00 0.00 ? 101 ASP A O    4  
ATOM   7831  C CB   . ASP A 1 101 ? 2.146   -11.892 5.569   1.00 0.00 ? 101 ASP A CB   4  
ATOM   7832  C CG   . ASP A 1 101 ? 2.927   -13.108 6.037   1.00 0.00 ? 101 ASP A CG   4  
ATOM   7833  O OD1  . ASP A 1 101 ? 3.596   -13.756 5.205   1.00 0.00 ? 101 ASP A OD1  4  
ATOM   7834  O OD2  . ASP A 1 101 ? 2.872   -13.427 7.245   1.00 0.00 ? 101 ASP A OD2  4  
ATOM   7835  H H    . ASP A 1 101 ? 1.205   -9.591  5.002   1.00 0.00 ? 101 ASP A H    4  
ATOM   7836  H HA   . ASP A 1 101 ? 3.105   -10.486 6.871   1.00 0.00 ? 101 ASP A HA   4  
ATOM   7837  H HB2  . ASP A 1 101 ? 1.206   -11.868 6.098   1.00 0.00 ? 101 ASP A HB2  4  
ATOM   7838  H HB3  . ASP A 1 101 ? 1.955   -11.997 4.511   1.00 0.00 ? 101 ASP A HB3  4  
ATOM   7839  N N    . VAL A 1 102 ? 4.147   -10.431 3.734   1.00 0.00 ? 102 VAL A N    4  
ATOM   7840  C CA   . VAL A 1 102 ? 5.361   -10.383 2.915   1.00 0.00 ? 102 VAL A CA   4  
ATOM   7841  C C    . VAL A 1 102 ? 6.213   -9.156  3.255   1.00 0.00 ? 102 VAL A C    4  
ATOM   7842  O O    . VAL A 1 102 ? 7.381   -9.288  3.622   1.00 0.00 ? 102 VAL A O    4  
ATOM   7843  C CB   . VAL A 1 102 ? 5.058   -10.431 1.389   1.00 0.00 ? 102 VAL A CB   4  
ATOM   7844  C CG1  . VAL A 1 102 ? 3.893   -9.547  1.019   1.00 0.00 ? 102 VAL A CG1  4  
ATOM   7845  C CG2  . VAL A 1 102 ? 6.276   -10.040 0.568   1.00 0.00 ? 102 VAL A CG2  4  
ATOM   7846  H H    . VAL A 1 102 ? 3.262   -10.356 3.302   1.00 0.00 ? 102 VAL A H    4  
ATOM   7847  H HA   . VAL A 1 102 ? 5.939   -11.264 3.161   1.00 0.00 ? 102 VAL A HA   4  
ATOM   7848  H HB   . VAL A 1 102 ? 4.795   -11.439 1.131   1.00 0.00 ? 102 VAL A HB   4  
ATOM   7849  H HG11 . VAL A 1 102 ? 3.834   -9.473  -0.054  1.00 0.00 ? 102 VAL A HG11 4  
ATOM   7850  H HG12 . VAL A 1 102 ? 4.036   -8.563  1.441   1.00 0.00 ? 102 VAL A HG12 4  
ATOM   7851  H HG13 . VAL A 1 102 ? 2.981   -9.976  1.402   1.00 0.00 ? 102 VAL A HG13 4  
ATOM   7852  H HG21 . VAL A 1 102 ? 6.107   -9.069  0.119   1.00 0.00 ? 102 VAL A HG21 4  
ATOM   7853  H HG22 . VAL A 1 102 ? 6.438   -10.774 -0.209  1.00 0.00 ? 102 VAL A HG22 4  
ATOM   7854  H HG23 . VAL A 1 102 ? 7.144   -9.996  1.207   1.00 0.00 ? 102 VAL A HG23 4  
ATOM   7855  N N    . PHE A 1 103 ? 5.617   -7.970  3.158   1.00 0.00 ? 103 PHE A N    4  
ATOM   7856  C CA   . PHE A 1 103 ? 6.319   -6.716  3.452   1.00 0.00 ? 103 PHE A CA   4  
ATOM   7857  C C    . PHE A 1 103 ? 6.960   -6.727  4.852   1.00 0.00 ? 103 PHE A C    4  
ATOM   7858  O O    . PHE A 1 103 ? 8.078   -6.232  5.028   1.00 0.00 ? 103 PHE A O    4  
ATOM   7859  C CB   . PHE A 1 103 ? 5.367   -5.518  3.258   1.00 0.00 ? 103 PHE A CB   4  
ATOM   7860  C CG   . PHE A 1 103 ? 5.746   -4.281  4.043   1.00 0.00 ? 103 PHE A CG   4  
ATOM   7861  C CD1  . PHE A 1 103 ? 6.957   -3.644  3.805   1.00 0.00 ? 103 PHE A CD1  4  
ATOM   7862  C CD2  . PHE A 1 103 ? 4.898   -3.754  5.019   1.00 0.00 ? 103 PHE A CD2  4  
ATOM   7863  C CE1  . PHE A 1 103 ? 7.317   -2.519  4.521   1.00 0.00 ? 103 PHE A CE1  4  
ATOM   7864  C CE2  . PHE A 1 103 ? 5.259   -2.627  5.732   1.00 0.00 ? 103 PHE A CE2  4  
ATOM   7865  C CZ   . PHE A 1 103 ? 6.469   -2.011  5.485   1.00 0.00 ? 103 PHE A CZ   4  
ATOM   7866  H H    . PHE A 1 103 ? 4.678   -7.937  2.867   1.00 0.00 ? 103 PHE A H    4  
ATOM   7867  H HA   . PHE A 1 103 ? 7.115   -6.625  2.726   1.00 0.00 ? 103 PHE A HA   4  
ATOM   7868  H HB2  . PHE A 1 103 ? 5.372   -5.252  2.207   1.00 0.00 ? 103 PHE A HB2  4  
ATOM   7869  H HB3  . PHE A 1 103 ? 4.367   -5.809  3.536   1.00 0.00 ? 103 PHE A HB3  4  
ATOM   7870  H HD1  . PHE A 1 103 ? 7.623   -4.039  3.053   1.00 0.00 ? 103 PHE A HD1  4  
ATOM   7871  H HD2  . PHE A 1 103 ? 3.945   -4.226  5.218   1.00 0.00 ? 103 PHE A HD2  4  
ATOM   7872  H HE1  . PHE A 1 103 ? 8.263   -2.036  4.326   1.00 0.00 ? 103 PHE A HE1  4  
ATOM   7873  H HE2  . PHE A 1 103 ? 4.594   -2.231  6.485   1.00 0.00 ? 103 PHE A HE2  4  
ATOM   7874  H HZ   . PHE A 1 103 ? 6.751   -1.131  6.045   1.00 0.00 ? 103 PHE A HZ   4  
ATOM   7875  N N    . GLU A 1 104 ? 6.275   -7.306  5.838   1.00 0.00 ? 104 GLU A N    4  
ATOM   7876  C CA   . GLU A 1 104 ? 6.810   -7.427  7.182   1.00 0.00 ? 104 GLU A CA   4  
ATOM   7877  C C    . GLU A 1 104 ? 8.113   -8.218  7.188   1.00 0.00 ? 104 GLU A C    4  
ATOM   7878  O O    . GLU A 1 104 ? 9.134   -7.749  7.692   1.00 0.00 ? 104 GLU A O    4  
ATOM   7879  C CB   . GLU A 1 104 ? 5.782   -8.138  8.043   1.00 0.00 ? 104 GLU A CB   4  
ATOM   7880  C CG   . GLU A 1 104 ? 5.503   -7.463  9.360   1.00 0.00 ? 104 GLU A CG   4  
ATOM   7881  C CD   . GLU A 1 104 ? 6.544   -7.771  10.414  1.00 0.00 ? 104 GLU A CD   4  
ATOM   7882  O OE1  . GLU A 1 104 ? 7.372   -6.889  10.717  1.00 0.00 ? 104 GLU A OE1  4  
ATOM   7883  O OE2  . GLU A 1 104 ? 6.542   -8.904  10.940  1.00 0.00 ? 104 GLU A OE2  4  
ATOM   7884  H H    . GLU A 1 104 ? 5.369   -7.654  5.669   1.00 0.00 ? 104 GLU A H    4  
ATOM   7885  H HA   . GLU A 1 104 ? 6.986   -6.438  7.575   1.00 0.00 ? 104 GLU A HA   4  
ATOM   7886  H HB2  . GLU A 1 104 ? 4.854   -8.198  7.495   1.00 0.00 ? 104 GLU A HB2  4  
ATOM   7887  H HB3  . GLU A 1 104 ? 6.134   -9.138  8.245   1.00 0.00 ? 104 GLU A HB3  4  
ATOM   7888  H HG2  . GLU A 1 104 ? 5.470   -6.394  9.206   1.00 0.00 ? 104 GLU A HG2  4  
ATOM   7889  H HG3  . GLU A 1 104 ? 4.548   -7.804  9.699   1.00 0.00 ? 104 GLU A HG3  4  
ATOM   7890  N N    . PHE A 1 105 ? 8.069   -9.406  6.601   1.00 0.00 ? 105 PHE A N    4  
ATOM   7891  C CA   . PHE A 1 105 ? 9.208   -10.316 6.609   1.00 0.00 ? 105 PHE A CA   4  
ATOM   7892  C C    . PHE A 1 105 ? 10.379  -9.733  5.823   1.00 0.00 ? 105 PHE A C    4  
ATOM   7893  O O    . PHE A 1 105 ? 11.543  -9.938  6.175   1.00 0.00 ? 105 PHE A O    4  
ATOM   7894  C CB   . PHE A 1 105 ? 8.791   -11.671 6.030   1.00 0.00 ? 105 PHE A CB   4  
ATOM   7895  C CG   . PHE A 1 105 ? 9.854   -12.729 6.111   1.00 0.00 ? 105 PHE A CG   4  
ATOM   7896  C CD1  . PHE A 1 105 ? 10.341  -13.149 7.339   1.00 0.00 ? 105 PHE A CD1  4  
ATOM   7897  C CD2  . PHE A 1 105 ? 10.357  -13.313 4.961   1.00 0.00 ? 105 PHE A CD2  4  
ATOM   7898  C CE1  . PHE A 1 105 ? 11.310  -14.129 7.417   1.00 0.00 ? 105 PHE A CE1  4  
ATOM   7899  C CE2  . PHE A 1 105 ? 11.326  -14.294 5.033   1.00 0.00 ? 105 PHE A CE2  4  
ATOM   7900  C CZ   . PHE A 1 105 ? 11.804  -14.703 6.263   1.00 0.00 ? 105 PHE A CZ   4  
ATOM   7901  H H    . PHE A 1 105 ? 7.244   -9.681  6.143   1.00 0.00 ? 105 PHE A H    4  
ATOM   7902  H HA   . PHE A 1 105 ? 9.513   -10.454 7.635   1.00 0.00 ? 105 PHE A HA   4  
ATOM   7903  H HB2  . PHE A 1 105 ? 7.927   -12.031 6.568   1.00 0.00 ? 105 PHE A HB2  4  
ATOM   7904  H HB3  . PHE A 1 105 ? 8.529   -11.542 4.990   1.00 0.00 ? 105 PHE A HB3  4  
ATOM   7905  H HD1  . PHE A 1 105 ? 9.956   -12.701 8.244   1.00 0.00 ? 105 PHE A HD1  4  
ATOM   7906  H HD2  . PHE A 1 105 ? 9.984   -12.995 3.999   1.00 0.00 ? 105 PHE A HD2  4  
ATOM   7907  H HE1  . PHE A 1 105 ? 11.682  -14.448 8.380   1.00 0.00 ? 105 PHE A HE1  4  
ATOM   7908  H HE2  . PHE A 1 105 ? 11.711  -14.741 4.127   1.00 0.00 ? 105 PHE A HE2  4  
ATOM   7909  H HZ   . PHE A 1 105 ? 12.562  -15.469 6.320   1.00 0.00 ? 105 PHE A HZ   4  
ATOM   7910  N N    . ARG A 1 106 ? 10.067  -8.988  4.772   1.00 0.00 ? 106 ARG A N    4  
ATOM   7911  C CA   . ARG A 1 106 ? 11.087  -8.362  3.951   1.00 0.00 ? 106 ARG A CA   4  
ATOM   7912  C C    . ARG A 1 106 ? 11.832  -7.297  4.747   1.00 0.00 ? 106 ARG A C    4  
ATOM   7913  O O    . ARG A 1 106 ? 13.064  -7.257  4.754   1.00 0.00 ? 106 ARG A O    4  
ATOM   7914  C CB   . ARG A 1 106 ? 10.463  -7.730  2.707   1.00 0.00 ? 106 ARG A CB   4  
ATOM   7915  C CG   . ARG A 1 106 ? 9.714   -8.697  1.808   1.00 0.00 ? 106 ARG A CG   4  
ATOM   7916  C CD   . ARG A 1 106 ? 10.569  -9.877  1.384   1.00 0.00 ? 106 ARG A CD   4  
ATOM   7917  N NE   . ARG A 1 106 ? 9.800   -10.806 0.568   1.00 0.00 ? 106 ARG A NE   4  
ATOM   7918  C CZ   . ARG A 1 106 ? 9.648   -12.098 0.829   1.00 0.00 ? 106 ARG A CZ   4  
ATOM   7919  N NH1  . ARG A 1 106 ? 10.308  -12.667 1.828   1.00 0.00 ? 106 ARG A NH1  4  
ATOM   7920  N NH2  . ARG A 1 106 ? 8.853   -12.828 0.061   1.00 0.00 ? 106 ARG A NH2  4  
ATOM   7921  H H    . ARG A 1 106 ? 9.122   -8.857  4.541   1.00 0.00 ? 106 ARG A H    4  
ATOM   7922  H HA   . ARG A 1 106 ? 11.788  -9.125  3.652   1.00 0.00 ? 106 ARG A HA   4  
ATOM   7923  H HB2  . ARG A 1 106 ? 9.763   -6.973  3.024   1.00 0.00 ? 106 ARG A HB2  4  
ATOM   7924  H HB3  . ARG A 1 106 ? 11.241  -7.267  2.130   1.00 0.00 ? 106 ARG A HB3  4  
ATOM   7925  H HG2  . ARG A 1 106 ? 8.851   -9.068  2.335   1.00 0.00 ? 106 ARG A HG2  4  
ATOM   7926  H HG3  . ARG A 1 106 ? 9.392   -8.167  0.923   1.00 0.00 ? 106 ARG A HG3  4  
ATOM   7927  H HD2  . ARG A 1 106 ? 11.408  -9.514  0.806   1.00 0.00 ? 106 ARG A HD2  4  
ATOM   7928  H HD3  . ARG A 1 106 ? 10.924  -10.386 2.264   1.00 0.00 ? 106 ARG A HD3  4  
ATOM   7929  H HE   . ARG A 1 106 ? 9.339   -10.422 -0.224  1.00 0.00 ? 106 ARG A HE   4  
ATOM   7930  H HH11 . ARG A 1 106 ? 10.931  -12.125 2.392   1.00 0.00 ? 106 ARG A HH11 4  
ATOM   7931  H HH12 . ARG A 1 106 ? 10.177  -13.642 2.026   1.00 0.00 ? 106 ARG A HH12 4  
ATOM   7932  H HH21 . ARG A 1 106 ? 8.375   -12.398 -0.714  1.00 0.00 ? 106 ARG A HH21 4  
ATOM   7933  H HH22 . ARG A 1 106 ? 8.717   -13.805 0.253   1.00 0.00 ? 106 ARG A HH22 4  
ATOM   7934  N N    . TYR A 1 107 ? 11.079  -6.441  5.427   1.00 0.00 ? 107 TYR A N    4  
ATOM   7935  C CA   . TYR A 1 107 ? 11.678  -5.376  6.225   1.00 0.00 ? 107 TYR A CA   4  
ATOM   7936  C C    . TYR A 1 107 ? 12.337  -5.960  7.479   1.00 0.00 ? 107 TYR A C    4  
ATOM   7937  O O    . TYR A 1 107 ? 13.256  -5.368  8.042   1.00 0.00 ? 107 TYR A O    4  
ATOM   7938  C CB   . TYR A 1 107 ? 10.631  -4.317  6.608   1.00 0.00 ? 107 TYR A CB   4  
ATOM   7939  C CG   . TYR A 1 107 ? 11.234  -3.015  7.102   1.00 0.00 ? 107 TYR A CG   4  
ATOM   7940  C CD1  . TYR A 1 107 ? 11.492  -1.971  6.222   1.00 0.00 ? 107 TYR A CD1  4  
ATOM   7941  C CD2  . TYR A 1 107 ? 11.554  -2.832  8.442   1.00 0.00 ? 107 TYR A CD2  4  
ATOM   7942  C CE1  . TYR A 1 107 ? 12.052  -0.789  6.661   1.00 0.00 ? 107 TYR A CE1  4  
ATOM   7943  C CE2  . TYR A 1 107 ? 12.113  -1.648  8.888   1.00 0.00 ? 107 TYR A CE2  4  
ATOM   7944  C CZ   . TYR A 1 107 ? 12.359  -0.631  7.990   1.00 0.00 ? 107 TYR A CZ   4  
ATOM   7945  O OH   . TYR A 1 107 ? 12.914  0.550   8.421   1.00 0.00 ? 107 TYR A OH   4  
ATOM   7946  H H    . TYR A 1 107 ? 10.100  -6.525  5.382   1.00 0.00 ? 107 TYR A H    4  
ATOM   7947  H HA   . TYR A 1 107 ? 12.443  -4.910  5.620   1.00 0.00 ? 107 TYR A HA   4  
ATOM   7948  H HB2  . TYR A 1 107 ? 10.024  -4.091  5.744   1.00 0.00 ? 107 TYR A HB2  4  
ATOM   7949  H HB3  . TYR A 1 107 ? 10.001  -4.708  7.393   1.00 0.00 ? 107 TYR A HB3  4  
ATOM   7950  H HD1  . TYR A 1 107 ? 11.245  -2.087  5.180   1.00 0.00 ? 107 TYR A HD1  4  
ATOM   7951  H HD2  . TYR A 1 107 ? 11.360  -3.632  9.141   1.00 0.00 ? 107 TYR A HD2  4  
ATOM   7952  H HE1  . TYR A 1 107 ? 12.244  0.006   5.963   1.00 0.00 ? 107 TYR A HE1  4  
ATOM   7953  H HE2  . TYR A 1 107 ? 12.355  -1.525  9.932   1.00 0.00 ? 107 TYR A HE2  4  
ATOM   7954  H HH   . TYR A 1 107 ? 13.642  0.367   9.023   1.00 0.00 ? 107 TYR A HH   4  
ATOM   7955  N N    . ALA A 1 108 ? 11.870  -7.132  7.904   1.00 0.00 ? 108 ALA A N    4  
ATOM   7956  C CA   . ALA A 1 108 ? 12.449  -7.813  9.053   1.00 0.00 ? 108 ALA A CA   4  
ATOM   7957  C C    . ALA A 1 108 ? 13.836  -8.355  8.720   1.00 0.00 ? 108 ALA A C    4  
ATOM   7958  O O    . ALA A 1 108 ? 14.776  -8.204  9.499   1.00 0.00 ? 108 ALA A O    4  
ATOM   7959  C CB   . ALA A 1 108 ? 11.534  -8.934  9.519   1.00 0.00 ? 108 ALA A CB   4  
ATOM   7960  H H    . ALA A 1 108 ? 11.111  -7.543  7.438   1.00 0.00 ? 108 ALA A H    4  
ATOM   7961  H HA   . ALA A 1 108 ? 12.538  -7.095  9.855   1.00 0.00 ? 108 ALA A HA   4  
ATOM   7962  H HB1  . ALA A 1 108 ? 10.539  -8.544  9.673   1.00 0.00 ? 108 ALA A HB1  4  
ATOM   7963  H HB2  . ALA A 1 108 ? 11.908  -9.342  10.446  1.00 0.00 ? 108 ALA A HB2  4  
ATOM   7964  H HB3  . ALA A 1 108 ? 11.505  -9.711  8.769   1.00 0.00 ? 108 ALA A HB3  4  
ATOM   7965  N N    . LYS A 1 109 ? 13.959  -8.978  7.552   1.00 0.00 ? 109 LYS A N    4  
ATOM   7966  C CA   . LYS A 1 109 ? 15.247  -9.483  7.085   1.00 0.00 ? 109 LYS A CA   4  
ATOM   7967  C C    . LYS A 1 109 ? 16.177  -8.339  6.716   1.00 0.00 ? 109 LYS A C    4  
ATOM   7968  O O    . LYS A 1 109 ? 17.394  -8.505  6.667   1.00 0.00 ? 109 LYS A O    4  
ATOM   7969  C CB   . LYS A 1 109 ? 15.066  -10.395 5.875   1.00 0.00 ? 109 LYS A CB   4  
ATOM   7970  C CG   . LYS A 1 109 ? 14.568  -11.785 6.221   1.00 0.00 ? 109 LYS A CG   4  
ATOM   7971  C CD   . LYS A 1 109 ? 14.373  -12.631 4.971   1.00 0.00 ? 109 LYS A CD   4  
ATOM   7972  C CE   . LYS A 1 109 ? 15.640  -12.711 4.129   1.00 0.00 ? 109 LYS A CE   4  
ATOM   7973  N NZ   . LYS A 1 109 ? 16.774  -13.321 4.868   1.00 0.00 ? 109 LYS A NZ   4  
ATOM   7974  H H    . LYS A 1 109 ? 13.161  -9.108  6.993   1.00 0.00 ? 109 LYS A H    4  
ATOM   7975  H HA   . LYS A 1 109 ? 15.695  -10.048 7.888   1.00 0.00 ? 109 LYS A HA   4  
ATOM   7976  H HB2  . LYS A 1 109 ? 14.358  -9.940  5.199   1.00 0.00 ? 109 LYS A HB2  4  
ATOM   7977  H HB3  . LYS A 1 109 ? 16.017  -10.493 5.372   1.00 0.00 ? 109 LYS A HB3  4  
ATOM   7978  H HG2  . LYS A 1 109 ? 15.290  -12.269 6.861   1.00 0.00 ? 109 LYS A HG2  4  
ATOM   7979  H HG3  . LYS A 1 109 ? 13.624  -11.701 6.738   1.00 0.00 ? 109 LYS A HG3  4  
ATOM   7980  H HD2  . LYS A 1 109 ? 14.090  -13.629 5.266   1.00 0.00 ? 109 LYS A HD2  4  
ATOM   7981  H HD3  . LYS A 1 109 ? 13.585  -12.194 4.376   1.00 0.00 ? 109 LYS A HD3  4  
ATOM   7982  H HE2  . LYS A 1 109 ? 15.435  -13.308 3.255   1.00 0.00 ? 109 LYS A HE2  4  
ATOM   7983  H HE3  . LYS A 1 109 ? 15.917  -11.714 3.822   1.00 0.00 ? 109 LYS A HE3  4  
ATOM   7984  H HZ1  . LYS A 1 109 ? 17.020  -12.743 5.696   1.00 0.00 ? 109 LYS A HZ1  4  
ATOM   7985  H HZ2  . LYS A 1 109 ? 17.605  -13.390 4.251   1.00 0.00 ? 109 LYS A HZ2  4  
ATOM   7986  H HZ3  . LYS A 1 109 ? 16.517  -14.276 5.189   1.00 0.00 ? 109 LYS A HZ3  4  
ATOM   7987  N N    . MET A 1 110 ? 15.589  -7.188  6.442   1.00 0.00 ? 110 MET A N    4  
ATOM   7988  C CA   . MET A 1 110 ? 16.349  -5.993  6.106   1.00 0.00 ? 110 MET A CA   4  
ATOM   7989  C C    . MET A 1 110 ? 17.191  -5.529  7.297   1.00 0.00 ? 110 MET A C    4  
ATOM   7990  O O    . MET A 1 110 ? 16.655  -5.177  8.348   1.00 0.00 ? 110 MET A O    4  
ATOM   7991  C CB   . MET A 1 110 ? 15.396  -4.882  5.636   1.00 0.00 ? 110 MET A CB   4  
ATOM   7992  C CG   . MET A 1 110 ? 16.043  -3.513  5.508   1.00 0.00 ? 110 MET A CG   4  
ATOM   7993  S SD   . MET A 1 110 ? 15.817  -2.509  6.985   1.00 0.00 ? 110 MET A SD   4  
ATOM   7994  C CE   . MET A 1 110 ? 16.447  -0.948  6.395   1.00 0.00 ? 110 MET A CE   4  
ATOM   7995  H H    . MET A 1 110 ? 14.610  -7.141  6.465   1.00 0.00 ? 110 MET A H    4  
ATOM   7996  H HA   . MET A 1 110 ? 17.010  -6.250  5.294   1.00 0.00 ? 110 MET A HA   4  
ATOM   7997  H HB2  . MET A 1 110 ? 14.995  -5.153  4.670   1.00 0.00 ? 110 MET A HB2  4  
ATOM   7998  H HB3  . MET A 1 110 ? 14.582  -4.801  6.341   1.00 0.00 ? 110 MET A HB3  4  
ATOM   7999  H HG2  . MET A 1 110 ? 17.103  -3.646  5.340   1.00 0.00 ? 110 MET A HG2  4  
ATOM   8000  H HG3  . MET A 1 110 ? 15.610  -2.994  4.665   1.00 0.00 ? 110 MET A HG3  4  
ATOM   8001  H HE1  . MET A 1 110 ? 15.910  -0.666  5.497   1.00 0.00 ? 110 MET A HE1  4  
ATOM   8002  H HE2  . MET A 1 110 ? 17.499  -1.046  6.172   1.00 0.00 ? 110 MET A HE2  4  
ATOM   8003  H HE3  . MET A 1 110 ? 16.307  -0.191  7.153   1.00 0.00 ? 110 MET A HE3  4  
ATOM   8004  N N    . PRO A 1 111 ? 18.526  -5.561  7.161   1.00 0.00 ? 111 PRO A N    4  
ATOM   8005  C CA   . PRO A 1 111 ? 19.432  -5.082  8.189   1.00 0.00 ? 111 PRO A CA   4  
ATOM   8006  C C    . PRO A 1 111 ? 19.771  -3.604  8.011   1.00 0.00 ? 111 PRO A C    4  
ATOM   8007  O O    . PRO A 1 111 ? 19.700  -3.068  6.900   1.00 0.00 ? 111 PRO A O    4  
ATOM   8008  C CB   . PRO A 1 111 ? 20.666  -5.949  7.972   1.00 0.00 ? 111 PRO A CB   4  
ATOM   8009  C CG   . PRO A 1 111 ? 20.688  -6.220  6.503   1.00 0.00 ? 111 PRO A CG   4  
ATOM   8010  C CD   . PRO A 1 111 ? 19.267  -6.095  6.003   1.00 0.00 ? 111 PRO A CD   4  
ATOM   8011  H HA   . PRO A 1 111 ? 19.038  -5.249  9.179   1.00 0.00 ? 111 PRO A HA   4  
ATOM   8012  H HB2  . PRO A 1 111 ? 21.547  -5.409  8.290   1.00 0.00 ? 111 PRO A HB2  4  
ATOM   8013  H HB3  . PRO A 1 111 ? 20.572  -6.862  8.540   1.00 0.00 ? 111 PRO A HB3  4  
ATOM   8014  H HG2  . PRO A 1 111 ? 21.319  -5.497  6.008   1.00 0.00 ? 111 PRO A HG2  4  
ATOM   8015  H HG3  . PRO A 1 111 ? 21.058  -7.218  6.325   1.00 0.00 ? 111 PRO A HG3  4  
ATOM   8016  H HD2  . PRO A 1 111 ? 19.223  -5.407  5.168   1.00 0.00 ? 111 PRO A HD2  4  
ATOM   8017  H HD3  . PRO A 1 111 ? 18.883  -7.068  5.719   1.00 0.00 ? 111 PRO A HD3  4  
ATOM   8018  N N    . ASP A 1 112 ? 20.128  -2.955  9.106   1.00 0.00 ? 112 ASP A N    4  
ATOM   8019  C CA   . ASP A 1 112 ? 20.499  -1.550  9.080   1.00 0.00 ? 112 ASP A CA   4  
ATOM   8020  C C    . ASP A 1 112 ? 22.011  -1.411  9.080   1.00 0.00 ? 112 ASP A C    4  
ATOM   8021  O O    . ASP A 1 112 ? 22.612  -1.363  7.984   1.00 0.00 ? 112 ASP A O    4  
ATOM   8022  C CB   . ASP A 1 112 ? 19.903  -0.809  10.279  1.00 0.00 ? 112 ASP A CB   4  
ATOM   8023  C CG   . ASP A 1 112 ? 18.405  -0.627  10.164  1.00 0.00 ? 112 ASP A CG   4  
ATOM   8024  O OD1  . ASP A 1 112 ? 17.653  -1.461  10.715  1.00 0.00 ? 112 ASP A OD1  4  
ATOM   8025  O OD2  . ASP A 1 112 ? 17.971  0.356   9.529   1.00 0.00 ? 112 ASP A OD2  4  
ATOM   8026  O OXT  . ASP A 1 112 ? 22.602  -1.382  10.179  1.00 0.00 ? 112 ASP A OXT  4  
ATOM   8027  H H    . ASP A 1 112 ? 20.153  -3.437  9.958   1.00 0.00 ? 112 ASP A H    4  
ATOM   8028  H HA   . ASP A 1 112 ? 20.106  -1.121  8.171   1.00 0.00 ? 112 ASP A HA   4  
ATOM   8029  H HB2  . ASP A 1 112 ? 20.109  -1.369  11.178  1.00 0.00 ? 112 ASP A HB2  4  
ATOM   8030  H HB3  . ASP A 1 112 ? 20.362  0.166   10.356  1.00 0.00 ? 112 ASP A HB3  4  
ATOM   8031  N N    . HIS B 2 1   ? -18.662 8.596   9.413   1.00 0.00 ? 281 HIS B N    4  
ATOM   8032  C CA   . HIS B 2 1   ? -19.795 9.383   9.948   1.00 0.00 ? 281 HIS B CA   4  
ATOM   8033  C C    . HIS B 2 1   ? -20.915 9.446   8.926   1.00 0.00 ? 281 HIS B C    4  
ATOM   8034  O O    . HIS B 2 1   ? -20.655 9.492   7.723   1.00 0.00 ? 281 HIS B O    4  
ATOM   8035  C CB   . HIS B 2 1   ? -19.350 10.800  10.322  1.00 0.00 ? 281 HIS B CB   4  
ATOM   8036  C CG   . HIS B 2 1   ? -18.375 10.851  11.459  1.00 0.00 ? 281 HIS B CG   4  
ATOM   8037  N ND1  . HIS B 2 1   ? -17.072 11.280  11.319  1.00 0.00 ? 281 HIS B ND1  4  
ATOM   8038  C CD2  . HIS B 2 1   ? -18.523 10.529  12.766  1.00 0.00 ? 281 HIS B CD2  4  
ATOM   8039  C CE1  . HIS B 2 1   ? -16.462 11.216  12.488  1.00 0.00 ? 281 HIS B CE1  4  
ATOM   8040  N NE2  . HIS B 2 1   ? -17.321 10.764  13.381  1.00 0.00 ? 281 HIS B NE2  4  
ATOM   8041  H H1   . HIS B 2 1   ? -18.286 9.050   8.556   1.00 0.00 ? 281 HIS B H1   4  
ATOM   8042  H H2   . HIS B 2 1   ? -18.984 7.637   9.171   1.00 0.00 ? 281 HIS B H2   4  
ATOM   8043  H H3   . HIS B 2 1   ? -17.905 8.527   10.120  1.00 0.00 ? 281 HIS B H3   4  
ATOM   8044  H HA   . HIS B 2 1   ? -20.162 8.884   10.830  1.00 0.00 ? 281 HIS B HA   4  
ATOM   8045  H HB2  . HIS B 2 1   ? -18.884 11.262  9.466   1.00 0.00 ? 281 HIS B HB2  4  
ATOM   8046  H HB3  . HIS B 2 1   ? -20.219 11.376  10.604  1.00 0.00 ? 281 HIS B HB3  4  
ATOM   8047  H HD1  . HIS B 2 1   ? -16.654 11.589  10.484  1.00 0.00 ? 281 HIS B HD1  4  
ATOM   8048  H HD2  . HIS B 2 1   ? -19.421 10.155  13.238  1.00 0.00 ? 281 HIS B HD2  4  
ATOM   8049  H HE1  . HIS B 2 1   ? -15.435 11.489  12.681  1.00 0.00 ? 281 HIS B HE1  4  
ATOM   8050  H HE2  . HIS B 2 1   ? -17.101 10.536  14.314  1.00 0.00 ? 281 HIS B HE2  4  
ATOM   8051  N N    . ASN B 2 2   ? -22.152 9.440   9.423   1.00 0.00 ? 282 ASN B N    4  
ATOM   8052  C CA   . ASN B 2 2   ? -23.355 9.440   8.586   1.00 0.00 ? 282 ASN B CA   4  
ATOM   8053  C C    . ASN B 2 2   ? -23.478 8.138   7.801   1.00 0.00 ? 282 ASN B C    4  
ATOM   8054  O O    . ASN B 2 2   ? -24.223 7.236   8.187   1.00 0.00 ? 282 ASN B O    4  
ATOM   8055  C CB   . ASN B 2 2   ? -23.382 10.638  7.628   1.00 0.00 ? 282 ASN B CB   4  
ATOM   8056  C CG   . ASN B 2 2   ? -24.626 10.659  6.756   1.00 0.00 ? 282 ASN B CG   4  
ATOM   8057  O OD1  . ASN B 2 2   ? -25.697 10.209  7.166   1.00 0.00 ? 282 ASN B OD1  4  
ATOM   8058  N ND2  . ASN B 2 2   ? -24.488 11.166  5.541   1.00 0.00 ? 282 ASN B ND2  4  
ATOM   8059  H H    . ASN B 2 2   ? -22.264 9.432   10.398  1.00 0.00 ? 282 ASN B H    4  
ATOM   8060  H HA   . ASN B 2 2   ? -24.203 9.513   9.249   1.00 0.00 ? 282 ASN B HA   4  
ATOM   8061  H HB2  . ASN B 2 2   ? -23.354 11.552  8.202   1.00 0.00 ? 282 ASN B HB2  4  
ATOM   8062  H HB3  . ASN B 2 2   ? -22.514 10.596  6.986   1.00 0.00 ? 282 ASN B HB3  4  
ATOM   8063  H HD21 . ASN B 2 2   ? -23.601 11.495  5.273   1.00 0.00 ? 282 ASN B HD21 4  
ATOM   8064  H HD22 . ASN B 2 2   ? -25.276 11.199  4.960   1.00 0.00 ? 282 ASN B HD22 4  
ATOM   8065  N N    . LEU B 2 3   ? -22.730 8.039   6.714   1.00 0.00 ? 283 LEU B N    4  
ATOM   8066  C CA   . LEU B 2 3   ? -22.759 6.862   5.866   1.00 0.00 ? 283 LEU B CA   4  
ATOM   8067  C C    . LEU B 2 3   ? -21.419 6.692   5.166   1.00 0.00 ? 283 LEU B C    4  
ATOM   8068  O O    . LEU B 2 3   ? -21.076 7.457   4.264   1.00 0.00 ? 283 LEU B O    4  
ATOM   8069  C CB   . LEU B 2 3   ? -23.883 6.973   4.830   1.00 0.00 ? 283 LEU B CB   4  
ATOM   8070  C CG   . LEU B 2 3   ? -23.987 5.797   3.855   1.00 0.00 ? 283 LEU B CG   4  
ATOM   8071  C CD1  . LEU B 2 3   ? -24.251 4.501   4.606   1.00 0.00 ? 283 LEU B CD1  4  
ATOM   8072  C CD2  . LEU B 2 3   ? -25.082 6.052   2.831   1.00 0.00 ? 283 LEU B CD2  4  
ATOM   8073  H H    . LEU B 2 3   ? -22.126 8.778   6.481   1.00 0.00 ? 283 LEU B H    4  
ATOM   8074  H HA   . LEU B 2 3   ? -22.939 6.002   6.493   1.00 0.00 ? 283 LEU B HA   4  
ATOM   8075  H HB2  . LEU B 2 3   ? -24.822 7.060   5.357   1.00 0.00 ? 283 LEU B HB2  4  
ATOM   8076  H HB3  . LEU B 2 3   ? -23.728 7.874   4.255   1.00 0.00 ? 283 LEU B HB3  4  
ATOM   8077  H HG   . LEU B 2 3   ? -23.051 5.692   3.327   1.00 0.00 ? 283 LEU B HG   4  
ATOM   8078  H HD11 . LEU B 2 3   ? -24.317 3.686   3.903   1.00 0.00 ? 283 LEU B HD11 4  
ATOM   8079  H HD12 . LEU B 2 3   ? -25.182 4.584   5.150   1.00 0.00 ? 283 LEU B HD12 4  
ATOM   8080  H HD13 . LEU B 2 3   ? -23.444 4.316   5.298   1.00 0.00 ? 283 LEU B HD13 4  
ATOM   8081  H HD21 . LEU B 2 3   ? -26.027 6.178   3.338   1.00 0.00 ? 283 LEU B HD21 4  
ATOM   8082  H HD22 . LEU B 2 3   ? -25.145 5.213   2.156   1.00 0.00 ? 283 LEU B HD22 4  
ATOM   8083  H HD23 . LEU B 2 3   ? -24.850 6.947   2.273   1.00 0.00 ? 283 LEU B HD23 4  
ATOM   8084  N N    . LEU B 2 4   ? -20.656 5.702   5.592   1.00 0.00 ? 284 LEU B N    4  
ATOM   8085  C CA   . LEU B 2 4   ? -19.375 5.427   4.970   1.00 0.00 ? 284 LEU B CA   4  
ATOM   8086  C C    . LEU B 2 4   ? -19.494 4.279   3.984   1.00 0.00 ? 284 LEU B C    4  
ATOM   8087  O O    . LEU B 2 4   ? -20.212 3.305   4.219   1.00 0.00 ? 284 LEU B O    4  
ATOM   8088  C CB   . LEU B 2 4   ? -18.309 5.121   6.021   1.00 0.00 ? 284 LEU B CB   4  
ATOM   8089  C CG   . LEU B 2 4   ? -17.865 6.320   6.860   1.00 0.00 ? 284 LEU B CG   4  
ATOM   8090  C CD1  . LEU B 2 4   ? -16.738 5.926   7.798   1.00 0.00 ? 284 LEU B CD1  4  
ATOM   8091  C CD2  . LEU B 2 4   ? -17.436 7.471   5.965   1.00 0.00 ? 284 LEU B CD2  4  
ATOM   8092  H H    . LEU B 2 4   ? -20.962 5.140   6.335   1.00 0.00 ? 284 LEU B H    4  
ATOM   8093  H HA   . LEU B 2 4   ? -19.081 6.313   4.427   1.00 0.00 ? 284 LEU B HA   4  
ATOM   8094  H HB2  . LEU B 2 4   ? -18.698 4.366   6.688   1.00 0.00 ? 284 LEU B HB2  4  
ATOM   8095  H HB3  . LEU B 2 4   ? -17.443 4.721   5.519   1.00 0.00 ? 284 LEU B HB3  4  
ATOM   8096  H HG   . LEU B 2 4   ? -18.693 6.658   7.460   1.00 0.00 ? 284 LEU B HG   4  
ATOM   8097  H HD11 . LEU B 2 4   ? -16.351 6.809   8.282   1.00 0.00 ? 284 LEU B HD11 4  
ATOM   8098  H HD12 . LEU B 2 4   ? -15.951 5.449   7.234   1.00 0.00 ? 284 LEU B HD12 4  
ATOM   8099  H HD13 . LEU B 2 4   ? -17.114 5.240   8.543   1.00 0.00 ? 284 LEU B HD13 4  
ATOM   8100  H HD21 . LEU B 2 4   ? -17.025 8.264   6.572   1.00 0.00 ? 284 LEU B HD21 4  
ATOM   8101  H HD22 . LEU B 2 4   ? -18.292 7.843   5.421   1.00 0.00 ? 284 LEU B HD22 4  
ATOM   8102  H HD23 . LEU B 2 4   ? -16.687 7.126   5.267   1.00 0.00 ? 284 LEU B HD23 4  
ATOM   8103  N N    . ARG B 2 5   ? -18.790 4.422   2.874   1.00 0.00 ? 285 ARG B N    4  
ATOM   8104  C CA   . ARG B 2 5   ? -18.808 3.438   1.807   1.00 0.00 ? 285 ARG B CA   4  
ATOM   8105  C C    . ARG B 2 5   ? -17.765 2.357   2.064   1.00 0.00 ? 285 ARG B C    4  
ATOM   8106  O O    . ARG B 2 5   ? -16.894 2.518   2.920   1.00 0.00 ? 285 ARG B O    4  
ATOM   8107  C CB   . ARG B 2 5   ? -18.549 4.120   0.463   1.00 0.00 ? 285 ARG B CB   4  
ATOM   8108  C CG   . ARG B 2 5   ? -19.779 4.760   -0.164  1.00 0.00 ? 285 ARG B CG   4  
ATOM   8109  C CD   . ARG B 2 5   ? -20.268 5.966   0.625   1.00 0.00 ? 285 ARG B CD   4  
ATOM   8110  N NE   . ARG B 2 5   ? -21.488 6.523   0.045   1.00 0.00 ? 285 ARG B NE   4  
ATOM   8111  C CZ   . ARG B 2 5   ? -22.149 7.573   0.532   1.00 0.00 ? 285 ARG B CZ   4  
ATOM   8112  N NH1  . ARG B 2 5   ? -21.699 8.217   1.601   1.00 0.00 ? 285 ARG B NH1  4  
ATOM   8113  N NH2  . ARG B 2 5   ? -23.265 7.978   -0.055  1.00 0.00 ? 285 ARG B NH2  4  
ATOM   8114  H H    . ARG B 2 5   ? -18.226 5.216   2.773   1.00 0.00 ? 285 ARG B H    4  
ATOM   8115  H HA   . ARG B 2 5   ? -19.787 2.982   1.790   1.00 0.00 ? 285 ARG B HA   4  
ATOM   8116  H HB2  . ARG B 2 5   ? -17.813 4.896   0.614   1.00 0.00 ? 285 ARG B HB2  4  
ATOM   8117  H HB3  . ARG B 2 5   ? -18.155 3.391   -0.229  1.00 0.00 ? 285 ARG B HB3  4  
ATOM   8118  H HG2  . ARG B 2 5   ? -19.534 5.079   -1.165  1.00 0.00 ? 285 ARG B HG2  4  
ATOM   8119  H HG3  . ARG B 2 5   ? -20.571 4.025   -0.204  1.00 0.00 ? 285 ARG B HG3  4  
ATOM   8120  H HD2  . ARG B 2 5   ? -20.469 5.660   1.642   1.00 0.00 ? 285 ARG B HD2  4  
ATOM   8121  H HD3  . ARG B 2 5   ? -19.496 6.723   0.622   1.00 0.00 ? 285 ARG B HD3  4  
ATOM   8122  H HE   . ARG B 2 5   ? -21.843 6.074   -0.756  1.00 0.00 ? 285 ARG B HE   4  
ATOM   8123  H HH11 . ARG B 2 5   ? -20.856 7.922   2.054   1.00 0.00 ? 285 ARG B HH11 4  
ATOM   8124  H HH12 . ARG B 2 5   ? -22.205 9.005   1.965   1.00 0.00 ? 285 ARG B HH12 4  
ATOM   8125  H HH21 . ARG B 2 5   ? -23.615 7.497   -0.864  1.00 0.00 ? 285 ARG B HH21 4  
ATOM   8126  H HH22 . ARG B 2 5   ? -23.766 8.769   0.305   1.00 0.00 ? 285 ARG B HH22 4  
ATOM   8127  N N    . ILE B 2 6   ? -17.854 1.263   1.325   1.00 0.00 ? 286 ILE B N    4  
ATOM   8128  C CA   . ILE B 2 6   ? -17.013 0.103   1.584   1.00 0.00 ? 286 ILE B CA   4  
ATOM   8129  C C    . ILE B 2 6   ? -16.139 -0.264  0.391   1.00 0.00 ? 286 ILE B C    4  
ATOM   8130  O O    . ILE B 2 6   ? -15.432 -1.268  0.441   1.00 0.00 ? 286 ILE B O    4  
ATOM   8131  C CB   . ILE B 2 6   ? -17.861 -1.128  1.961   1.00 0.00 ? 286 ILE B CB   4  
ATOM   8132  C CG1  . ILE B 2 6   ? -18.896 -1.418  0.867   1.00 0.00 ? 286 ILE B CG1  4  
ATOM   8133  C CG2  . ILE B 2 6   ? -18.539 -0.912  3.305   1.00 0.00 ? 286 ILE B CG2  4  
ATOM   8134  C CD1  . ILE B 2 6   ? -19.741 -2.644  1.135   1.00 0.00 ? 286 ILE B CD1  4  
ATOM   8135  H H    . ILE B 2 6   ? -18.501 1.232   0.588   1.00 0.00 ? 286 ILE B H    4  
ATOM   8136  H HA   . ILE B 2 6   ? -16.376 0.338   2.423   1.00 0.00 ? 286 ILE B HA   4  
ATOM   8137  H HB   . ILE B 2 6   ? -17.200 -1.976  2.053   1.00 0.00 ? 286 ILE B HB   4  
ATOM   8138  H HG12 . ILE B 2 6   ? -19.562 -0.573  0.778   1.00 0.00 ? 286 ILE B HG12 4  
ATOM   8139  H HG13 . ILE B 2 6   ? -18.383 -1.566  -0.072  1.00 0.00 ? 286 ILE B HG13 4  
ATOM   8140  H HG21 . ILE B 2 6   ? -17.787 -0.841  4.076   1.00 0.00 ? 286 ILE B HG21 4  
ATOM   8141  H HG22 . ILE B 2 6   ? -19.194 -1.743  3.514   1.00 0.00 ? 286 ILE B HG22 4  
ATOM   8142  H HG23 . ILE B 2 6   ? -19.112 0.002   3.276   1.00 0.00 ? 286 ILE B HG23 4  
ATOM   8143  H HD11 . ILE B 2 6   ? -19.102 -3.512  1.203   1.00 0.00 ? 286 ILE B HD11 4  
ATOM   8144  H HD12 . ILE B 2 6   ? -20.447 -2.778  0.329   1.00 0.00 ? 286 ILE B HD12 4  
ATOM   8145  H HD13 . ILE B 2 6   ? -20.275 -2.518  2.065   1.00 0.00 ? 286 ILE B HD13 4  
HETATM 8146  O OH   . ALY B 2 7   ? -9.548  1.862   0.449   1.00 0.00 ? 287 ALY B OH   4  
HETATM 8147  C CH   . ALY B 2 7   ? -8.997  1.217   -0.440  1.00 0.00 ? 287 ALY B CH   4  
HETATM 8148  C CH3  . ALY B 2 7   ? -7.475  1.039   -0.403  1.00 0.00 ? 287 ALY B CH3  4  
HETATM 8149  N NZ   . ALY B 2 7   ? -9.681  0.666   -1.433  1.00 0.00 ? 287 ALY B NZ   4  
HETATM 8150  C CE   . ALY B 2 7   ? -11.129 0.771   -1.579  1.00 0.00 ? 287 ALY B CE   4  
HETATM 8151  C CD   . ALY B 2 7   ? -11.663 -0.223  -2.599  1.00 0.00 ? 287 ALY B CD   4  
HETATM 8152  C CG   . ALY B 2 7   ? -13.136 0.003   -2.902  1.00 0.00 ? 287 ALY B CG   4  
HETATM 8153  C CB   . ALY B 2 7   ? -13.994 -0.028  -1.648  1.00 0.00 ? 287 ALY B CB   4  
HETATM 8154  C CA   . ALY B 2 7   ? -15.465 0.293   -1.915  1.00 0.00 ? 287 ALY B CA   4  
HETATM 8155  N N    . ALY B 2 7   ? -16.198 0.551   -0.667  1.00 0.00 ? 287 ALY B N    4  
HETATM 8156  C C    . ALY B 2 7   ? -16.115 -0.850  -2.693  1.00 0.00 ? 287 ALY B C    4  
HETATM 8157  O O    . ALY B 2 7   ? -16.417 -1.905  -2.136  1.00 0.00 ? 287 ALY B O    4  
HETATM 8158  H HH31 . ALY B 2 7   ? -7.110  0.854   -1.405  1.00 0.00 ? 287 ALY B HH31 4  
HETATM 8159  H HH32 . ALY B 2 7   ? -7.017  1.937   -0.015  1.00 0.00 ? 287 ALY B HH32 4  
HETATM 8160  H HH33 . ALY B 2 7   ? -7.224  0.203   0.232   1.00 0.00 ? 287 ALY B HH33 4  
HETATM 8161  H HZ   . ALY B 2 7   ? -9.193  0.165   -2.117  1.00 0.00 ? 287 ALY B HZ   4  
HETATM 8162  H HE3  . ALY B 2 7   ? -11.381 1.770   -1.900  1.00 0.00 ? 287 ALY B HE3  4  
HETATM 8163  H HE2  . ALY B 2 7   ? -11.592 0.573   -0.622  1.00 0.00 ? 287 ALY B HE2  4  
HETATM 8164  H HD3  . ALY B 2 7   ? -11.536 -1.222  -2.213  1.00 0.00 ? 287 ALY B HD3  4  
HETATM 8165  H HD2  . ALY B 2 7   ? -11.102 -0.115  -3.517  1.00 0.00 ? 287 ALY B HD2  4  
HETATM 8166  H HG3  . ALY B 2 7   ? -13.473 -0.772  -3.573  1.00 0.00 ? 287 ALY B HG3  4  
HETATM 8167  H HG2  . ALY B 2 7   ? -13.251 0.965   -3.378  1.00 0.00 ? 287 ALY B HG2  4  
HETATM 8168  H HB3  . ALY B 2 7   ? -13.599 0.690   -0.946  1.00 0.00 ? 287 ALY B HB3  4  
HETATM 8169  H HB2  . ALY B 2 7   ? -13.936 -1.015  -1.214  1.00 0.00 ? 287 ALY B HB2  4  
HETATM 8170  H HCA  . ALY B 2 7   ? -15.513 1.187   -2.517  1.00 0.00 ? 287 ALY B HCA  4  
HETATM 8171  H H    . ALY B 2 7   ? -16.759 1.351   -0.610  1.00 0.00 ? 287 ALY B H    4  
ATOM   8172  N N    . GLN B 2 8   ? -16.323 -0.649  -3.987  1.00 0.00 ? 288 GLN B N    4  
ATOM   8173  C CA   . GLN B 2 8   ? -16.975 -1.663  -4.807  1.00 0.00 ? 288 GLN B CA   4  
ATOM   8174  C C    . GLN B 2 8   ? -15.974 -2.696  -5.319  1.00 0.00 ? 288 GLN B C    4  
ATOM   8175  O O    . GLN B 2 8   ? -15.826 -2.900  -6.525  1.00 0.00 ? 288 GLN B O    4  
ATOM   8176  C CB   . GLN B 2 8   ? -17.730 -1.025  -5.976  1.00 0.00 ? 288 GLN B CB   4  
ATOM   8177  C CG   . GLN B 2 8   ? -18.873 -0.119  -5.540  1.00 0.00 ? 288 GLN B CG   4  
ATOM   8178  C CD   . GLN B 2 8   ? -19.742 -0.748  -4.465  1.00 0.00 ? 288 GLN B CD   4  
ATOM   8179  O OE1  . GLN B 2 8   ? -19.505 -0.560  -3.271  1.00 0.00 ? 288 GLN B OE1  4  
ATOM   8180  N NE2  . GLN B 2 8   ? -20.741 -1.512  -4.875  1.00 0.00 ? 288 GLN B NE2  4  
ATOM   8181  H H    . GLN B 2 8   ? -16.037 0.192   -4.397  1.00 0.00 ? 288 GLN B H    4  
ATOM   8182  H HA   . GLN B 2 8   ? -17.688 -2.172  -4.177  1.00 0.00 ? 288 GLN B HA   4  
ATOM   8183  H HB2  . GLN B 2 8   ? -17.037 -0.437  -6.559  1.00 0.00 ? 288 GLN B HB2  4  
ATOM   8184  H HB3  . GLN B 2 8   ? -18.137 -1.808  -6.598  1.00 0.00 ? 288 GLN B HB3  4  
ATOM   8185  H HG2  . GLN B 2 8   ? -18.459 0.800   -5.153  1.00 0.00 ? 288 GLN B HG2  4  
ATOM   8186  H HG3  . GLN B 2 8   ? -19.490 0.098   -6.399  1.00 0.00 ? 288 GLN B HG3  4  
ATOM   8187  H HE21 . GLN B 2 8   ? -20.869 -1.635  -5.842  1.00 0.00 ? 288 GLN B HE21 4  
ATOM   8188  H HE22 . GLN B 2 8   ? -21.313 -1.930  -4.195  1.00 0.00 ? 288 GLN B HE22 4  
ATOM   8189  N N    . PHE B 2 9   ? -15.282 -3.335  -4.389  1.00 0.00 ? 289 PHE B N    4  
ATOM   8190  C CA   . PHE B 2 9   ? -14.412 -4.456  -4.712  1.00 0.00 ? 289 PHE B CA   4  
ATOM   8191  C C    . PHE B 2 9   ? -15.146 -5.755  -4.411  1.00 0.00 ? 289 PHE B C    4  
ATOM   8192  O O    . PHE B 2 9   ? -15.685 -5.924  -3.312  1.00 0.00 ? 289 PHE B O    4  
ATOM   8193  C CB   . PHE B 2 9   ? -13.092 -4.382  -3.926  1.00 0.00 ? 289 PHE B CB   4  
ATOM   8194  C CG   . PHE B 2 9   ? -12.069 -3.442  -4.514  1.00 0.00 ? 289 PHE B CG   4  
ATOM   8195  C CD1  . PHE B 2 9   ? -12.431 -2.501  -5.467  1.00 0.00 ? 289 PHE B CD1  4  
ATOM   8196  C CD2  . PHE B 2 9   ? -10.739 -3.502  -4.116  1.00 0.00 ? 289 PHE B CD2  4  
ATOM   8197  C CE1  . PHE B 2 9   ? -11.494 -1.643  -6.010  1.00 0.00 ? 289 PHE B CE1  4  
ATOM   8198  C CE2  . PHE B 2 9   ? -9.800  -2.644  -4.656  1.00 0.00 ? 289 PHE B CE2  4  
ATOM   8199  C CZ   . PHE B 2 9   ? -10.178 -1.715  -5.604  1.00 0.00 ? 289 PHE B CZ   4  
ATOM   8200  H H    . PHE B 2 9   ? -15.371 -3.053  -3.455  1.00 0.00 ? 289 PHE B H    4  
ATOM   8201  H HA   . PHE B 2 9   ? -14.199 -4.415  -5.769  1.00 0.00 ? 289 PHE B HA   4  
ATOM   8202  H HB2  . PHE B 2 9   ? -13.301 -4.049  -2.922  1.00 0.00 ? 289 PHE B HB2  4  
ATOM   8203  H HB3  . PHE B 2 9   ? -12.653 -5.368  -3.885  1.00 0.00 ? 289 PHE B HB3  4  
ATOM   8204  H HD1  . PHE B 2 9   ? -13.461 -2.441  -5.784  1.00 0.00 ? 289 PHE B HD1  4  
ATOM   8205  H HD2  . PHE B 2 9   ? -10.435 -4.228  -3.372  1.00 0.00 ? 289 PHE B HD2  4  
ATOM   8206  H HE1  . PHE B 2 9   ? -11.791 -0.916  -6.751  1.00 0.00 ? 289 PHE B HE1  4  
ATOM   8207  H HE2  . PHE B 2 9   ? -8.771  -2.700  -4.337  1.00 0.00 ? 289 PHE B HE2  4  
ATOM   8208  H HZ   . PHE B 2 9   ? -9.444  -1.044  -6.027  1.00 0.00 ? 289 PHE B HZ   4  
ATOM   8209  N N    . LEU B 2 10  ? -15.174 -6.647  -5.399  1.00 0.00 ? 290 LEU B N    4  
ATOM   8210  C CA   . LEU B 2 10  ? -15.926 -7.899  -5.321  1.00 0.00 ? 290 LEU B CA   4  
ATOM   8211  C C    . LEU B 2 10  ? -17.425 -7.615  -5.246  1.00 0.00 ? 290 LEU B C    4  
ATOM   8212  O O    . LEU B 2 10  ? -18.021 -7.615  -4.167  1.00 0.00 ? 290 LEU B O    4  
ATOM   8213  C CB   . LEU B 2 10  ? -15.488 -8.746  -4.122  1.00 0.00 ? 290 LEU B CB   4  
ATOM   8214  C CG   . LEU B 2 10  ? -16.093 -10.150 -4.067  1.00 0.00 ? 290 LEU B CG   4  
ATOM   8215  C CD1  . LEU B 2 10  ? -15.477 -11.042 -5.133  1.00 0.00 ? 290 LEU B CD1  4  
ATOM   8216  C CD2  . LEU B 2 10  ? -15.910 -10.754 -2.687  1.00 0.00 ? 290 LEU B CD2  4  
ATOM   8217  H H    . LEU B 2 10  ? -14.670 -6.457  -6.218  1.00 0.00 ? 290 LEU B H    4  
ATOM   8218  H HA   . LEU B 2 10  ? -15.729 -8.451  -6.229  1.00 0.00 ? 290 LEU B HA   4  
ATOM   8219  H HB2  . LEU B 2 10  ? -14.412 -8.839  -4.147  1.00 0.00 ? 290 LEU B HB2  4  
ATOM   8220  H HB3  . LEU B 2 10  ? -15.765 -8.224  -3.219  1.00 0.00 ? 290 LEU B HB3  4  
ATOM   8221  H HG   . LEU B 2 10  ? -17.152 -10.082 -4.265  1.00 0.00 ? 290 LEU B HG   4  
ATOM   8222  H HD11 . LEU B 2 10  ? -15.667 -10.622 -6.108  1.00 0.00 ? 290 LEU B HD11 4  
ATOM   8223  H HD12 . LEU B 2 10  ? -15.913 -12.028 -5.074  1.00 0.00 ? 290 LEU B HD12 4  
ATOM   8224  H HD13 . LEU B 2 10  ? -14.410 -11.110 -4.973  1.00 0.00 ? 290 LEU B HD13 4  
ATOM   8225  H HD21 . LEU B 2 10  ? -16.460 -10.170 -1.964  1.00 0.00 ? 290 LEU B HD21 4  
ATOM   8226  H HD22 . LEU B 2 10  ? -14.862 -10.751 -2.429  1.00 0.00 ? 290 LEU B HD22 4  
ATOM   8227  H HD23 . LEU B 2 10  ? -16.277 -11.768 -2.687  1.00 0.00 ? 290 LEU B HD23 4  
ATOM   8228  N N    . GLN B 2 11  ? -18.029 -7.365  -6.396  1.00 0.00 ? 291 GLN B N    4  
ATOM   8229  C CA   . GLN B 2 11  ? -19.456 -7.090  -6.460  1.00 0.00 ? 291 GLN B CA   4  
ATOM   8230  C C    . GLN B 2 11  ? -20.188 -8.250  -7.123  1.00 0.00 ? 291 GLN B C    4  
ATOM   8231  O O    . GLN B 2 11  ? -19.631 -8.939  -7.980  1.00 0.00 ? 291 GLN B O    4  
ATOM   8232  C CB   . GLN B 2 11  ? -19.729 -5.791  -7.228  1.00 0.00 ? 291 GLN B CB   4  
ATOM   8233  C CG   . GLN B 2 11  ? -19.174 -5.785  -8.645  1.00 0.00 ? 291 GLN B CG   4  
ATOM   8234  C CD   . GLN B 2 11  ? -19.664 -4.605  -9.460  1.00 0.00 ? 291 GLN B CD   4  
ATOM   8235  O OE1  . GLN B 2 11  ? -19.048 -3.537  -9.470  1.00 0.00 ? 291 GLN B OE1  4  
ATOM   8236  N NE2  . GLN B 2 11  ? -20.766 -4.794  -10.168 1.00 0.00 ? 291 GLN B NE2  4  
ATOM   8237  H H    . GLN B 2 11  ? -17.505 -7.381  -7.226  1.00 0.00 ? 291 GLN B H    4  
ATOM   8238  H HA   . GLN B 2 11  ? -19.817 -6.983  -5.449  1.00 0.00 ? 291 GLN B HA   4  
ATOM   8239  H HB2  . GLN B 2 11  ? -20.795 -5.638  -7.283  1.00 0.00 ? 291 GLN B HB2  4  
ATOM   8240  H HB3  . GLN B 2 11  ? -19.285 -4.968  -6.687  1.00 0.00 ? 291 GLN B HB3  4  
ATOM   8241  H HG2  . GLN B 2 11  ? -18.095 -5.744  -8.596  1.00 0.00 ? 291 GLN B HG2  4  
ATOM   8242  H HG3  . GLN B 2 11  ? -19.476 -6.696  -9.139  1.00 0.00 ? 291 GLN B HG3  4  
ATOM   8243  H HE21 . GLN B 2 11  ? -21.196 -5.676  -10.129 1.00 0.00 ? 291 GLN B HE21 4  
ATOM   8244  H HE22 . GLN B 2 11  ? -21.108 -4.048  -10.706 1.00 0.00 ? 291 GLN B HE22 4  
ATOM   8245  N N    . SER B 2 12  ? -21.424 -8.473  -6.711  1.00 0.00 ? 292 SER B N    4  
ATOM   8246  C CA   . SER B 2 12  ? -22.243 -9.521  -7.288  1.00 0.00 ? 292 SER B CA   4  
ATOM   8247  C C    . SER B 2 12  ? -23.019 -8.982  -8.486  1.00 0.00 ? 292 SER B C    4  
ATOM   8248  O O    . SER B 2 12  ? -22.746 -9.425  -9.622  1.00 0.00 ? 292 SER B O    4  
ATOM   8249  C CB   . SER B 2 12  ? -23.194 -10.084 -6.235  1.00 0.00 ? 292 SER B CB   4  
ATOM   8250  O OG   . SER B 2 12  ? -22.471 -10.598 -5.127  1.00 0.00 ? 292 SER B OG   4  
ATOM   8251  O OXT  . SER B 2 12  ? -23.866 -8.086  -8.294  1.00 0.00 ? 292 SER B OXT  4  
ATOM   8252  H H    . SER B 2 12  ? -21.797 -7.915  -5.996  1.00 0.00 ? 292 SER B H    4  
ATOM   8253  H HA   . SER B 2 12  ? -21.586 -10.308 -7.625  1.00 0.00 ? 292 SER B HA   4  
ATOM   8254  H HB2  . SER B 2 12  ? -23.851 -9.300  -5.889  1.00 0.00 ? 292 SER B HB2  4  
ATOM   8255  H HB3  . SER B 2 12  ? -23.779 -10.880 -6.670  1.00 0.00 ? 292 SER B HB3  4  
ATOM   8256  H HG   . SER B 2 12  ? -23.091 -10.840 -4.426  1.00 0.00 ? 292 SER B HG   4  
ATOM   8257  N N    . GLY A 1 1   ? 26.498  7.876   -3.333  1.00 0.00 ? 1   GLY A N    5  
ATOM   8258  C CA   . GLY A 1 1   ? 26.003  7.329   -4.617  1.00 0.00 ? 1   GLY A CA   5  
ATOM   8259  C C    . GLY A 1 1   ? 24.495  7.393   -4.720  1.00 0.00 ? 1   GLY A C    5  
ATOM   8260  O O    . GLY A 1 1   ? 23.848  8.144   -3.988  1.00 0.00 ? 1   GLY A O    5  
ATOM   8261  H H1   . GLY A 1 1   ? 26.094  7.342   -2.540  1.00 0.00 ? 1   GLY A H1   5  
ATOM   8262  H H2   . GLY A 1 1   ? 26.219  8.873   -3.239  1.00 0.00 ? 1   GLY A H2   5  
ATOM   8263  H H3   . GLY A 1 1   ? 27.534  7.809   -3.291  1.00 0.00 ? 1   GLY A H3   5  
ATOM   8264  H HA2  . GLY A 1 1   ? 26.432  7.894   -5.430  1.00 0.00 ? 1   GLY A HA2  5  
ATOM   8265  H HA3  . GLY A 1 1   ? 26.315  6.300   -4.701  1.00 0.00 ? 1   GLY A HA3  5  
ATOM   8266  N N    . LYS A 1 2   ? 23.935  6.602   -5.624  1.00 0.00 ? 2   LYS A N    5  
ATOM   8267  C CA   . LYS A 1 2   ? 22.496  6.567   -5.825  1.00 0.00 ? 2   LYS A CA   5  
ATOM   8268  C C    . LYS A 1 2   ? 21.857  5.506   -4.938  1.00 0.00 ? 2   LYS A C    5  
ATOM   8269  O O    . LYS A 1 2   ? 22.176  4.324   -5.070  1.00 0.00 ? 2   LYS A O    5  
ATOM   8270  C CB   . LYS A 1 2   ? 22.169  6.269   -7.288  1.00 0.00 ? 2   LYS A CB   5  
ATOM   8271  C CG   . LYS A 1 2   ? 22.632  7.340   -8.263  1.00 0.00 ? 2   LYS A CG   5  
ATOM   8272  C CD   . LYS A 1 2   ? 21.948  8.672   -8.008  1.00 0.00 ? 2   LYS A CD   5  
ATOM   8273  C CE   . LYS A 1 2   ? 22.221  9.661   -9.129  1.00 0.00 ? 2   LYS A CE   5  
ATOM   8274  N NZ   . LYS A 1 2   ? 23.673  9.916   -9.313  1.00 0.00 ? 2   LYS A NZ   5  
ATOM   8275  H H    . LYS A 1 2   ? 24.507  6.016   -6.166  1.00 0.00 ? 2   LYS A H    5  
ATOM   8276  H HA   . LYS A 1 2   ? 22.099  7.534   -5.565  1.00 0.00 ? 2   LYS A HA   5  
ATOM   8277  H HB2  . LYS A 1 2   ? 22.634  5.337   -7.565  1.00 0.00 ? 2   LYS A HB2  5  
ATOM   8278  H HB3  . LYS A 1 2   ? 21.099  6.168   -7.385  1.00 0.00 ? 2   LYS A HB3  5  
ATOM   8279  H HG2  . LYS A 1 2   ? 23.698  7.469   -8.158  1.00 0.00 ? 2   LYS A HG2  5  
ATOM   8280  H HG3  . LYS A 1 2   ? 22.408  7.017   -9.269  1.00 0.00 ? 2   LYS A HG3  5  
ATOM   8281  H HD2  . LYS A 1 2   ? 20.884  8.511   -7.935  1.00 0.00 ? 2   LYS A HD2  5  
ATOM   8282  H HD3  . LYS A 1 2   ? 22.318  9.082   -7.080  1.00 0.00 ? 2   LYS A HD3  5  
ATOM   8283  H HE2  . LYS A 1 2   ? 21.817  9.263   -10.047 1.00 0.00 ? 2   LYS A HE2  5  
ATOM   8284  H HE3  . LYS A 1 2   ? 21.728  10.593  -8.895  1.00 0.00 ? 2   LYS A HE3  5  
ATOM   8285  H HZ1  . LYS A 1 2   ? 24.172  9.026   -9.518  1.00 0.00 ? 2   LYS A HZ1  5  
ATOM   8286  H HZ2  . LYS A 1 2   ? 24.077  10.337  -8.455  1.00 0.00 ? 2   LYS A HZ2  5  
ATOM   8287  H HZ3  . LYS A 1 2   ? 23.823  10.572  -10.108 1.00 0.00 ? 2   LYS A HZ3  5  
ATOM   8288  N N    . LEU A 1 3   ? 20.958  5.934   -4.047  1.00 0.00 ? 3   LEU A N    5  
ATOM   8289  C CA   . LEU A 1 3   ? 20.249  5.028   -3.138  1.00 0.00 ? 3   LEU A CA   5  
ATOM   8290  C C    . LEU A 1 3   ? 21.199  4.383   -2.134  1.00 0.00 ? 3   LEU A C    5  
ATOM   8291  O O    . LEU A 1 3   ? 22.031  3.549   -2.491  1.00 0.00 ? 3   LEU A O    5  
ATOM   8292  C CB   . LEU A 1 3   ? 19.501  3.935   -3.912  1.00 0.00 ? 3   LEU A CB   5  
ATOM   8293  C CG   . LEU A 1 3   ? 18.273  4.396   -4.699  1.00 0.00 ? 3   LEU A CG   5  
ATOM   8294  C CD1  . LEU A 1 3   ? 17.812  3.294   -5.641  1.00 0.00 ? 3   LEU A CD1  5  
ATOM   8295  C CD2  . LEU A 1 3   ? 17.144  4.782   -3.753  1.00 0.00 ? 3   LEU A CD2  5  
ATOM   8296  H H    . LEU A 1 3   ? 20.770  6.895   -3.993  1.00 0.00 ? 3   LEU A H    5  
ATOM   8297  H HA   . LEU A 1 3   ? 19.529  5.619   -2.592  1.00 0.00 ? 3   LEU A HA   5  
ATOM   8298  H HB2  . LEU A 1 3   ? 20.194  3.478   -4.605  1.00 0.00 ? 3   LEU A HB2  5  
ATOM   8299  H HB3  . LEU A 1 3   ? 19.181  3.185   -3.204  1.00 0.00 ? 3   LEU A HB3  5  
ATOM   8300  H HG   . LEU A 1 3   ? 18.533  5.262   -5.291  1.00 0.00 ? 3   LEU A HG   5  
ATOM   8301  H HD11 . LEU A 1 3   ? 17.600  2.400   -5.073  1.00 0.00 ? 3   LEU A HD11 5  
ATOM   8302  H HD12 . LEU A 1 3   ? 18.590  3.087   -6.361  1.00 0.00 ? 3   LEU A HD12 5  
ATOM   8303  H HD13 . LEU A 1 3   ? 16.919  3.613   -6.157  1.00 0.00 ? 3   LEU A HD13 5  
ATOM   8304  H HD21 . LEU A 1 3   ? 17.481  5.558   -3.081  1.00 0.00 ? 3   LEU A HD21 5  
ATOM   8305  H HD22 . LEU A 1 3   ? 16.843  3.917   -3.182  1.00 0.00 ? 3   LEU A HD22 5  
ATOM   8306  H HD23 . LEU A 1 3   ? 16.304  5.145   -4.328  1.00 0.00 ? 3   LEU A HD23 5  
ATOM   8307  N N    . SER A 1 4   ? 21.074  4.781   -0.879  1.00 0.00 ? 4   SER A N    5  
ATOM   8308  C CA   . SER A 1 4   ? 21.825  4.156   0.196   1.00 0.00 ? 4   SER A CA   5  
ATOM   8309  C C    . SER A 1 4   ? 21.364  2.708   0.381   1.00 0.00 ? 4   SER A C    5  
ATOM   8310  O O    . SER A 1 4   ? 20.330  2.323   -0.161  1.00 0.00 ? 4   SER A O    5  
ATOM   8311  C CB   . SER A 1 4   ? 21.638  4.947   1.489   1.00 0.00 ? 4   SER A CB   5  
ATOM   8312  O OG   . SER A 1 4   ? 22.033  6.299   1.317   1.00 0.00 ? 4   SER A OG   5  
ATOM   8313  H H    . SER A 1 4   ? 20.468  5.518   -0.669  1.00 0.00 ? 4   SER A H    5  
ATOM   8314  H HA   . SER A 1 4   ? 22.868  4.164   -0.079  1.00 0.00 ? 4   SER A HA   5  
ATOM   8315  H HB2  . SER A 1 4   ? 20.597  4.923   1.778   1.00 0.00 ? 4   SER A HB2  5  
ATOM   8316  H HB3  . SER A 1 4   ? 22.239  4.506   2.270   1.00 0.00 ? 4   SER A HB3  5  
ATOM   8317  H HG   . SER A 1 4   ? 22.930  6.413   1.655   1.00 0.00 ? 4   SER A HG   5  
ATOM   8318  N N    . GLU A 1 5   ? 22.116  1.916   1.143   1.00 0.00 ? 5   GLU A N    5  
ATOM   8319  C CA   . GLU A 1 5   ? 21.810  0.492   1.308   1.00 0.00 ? 5   GLU A CA   5  
ATOM   8320  C C    . GLU A 1 5   ? 20.356  0.273   1.727   1.00 0.00 ? 5   GLU A C    5  
ATOM   8321  O O    . GLU A 1 5   ? 19.657  -0.576  1.169   1.00 0.00 ? 5   GLU A O    5  
ATOM   8322  C CB   . GLU A 1 5   ? 22.753  -0.141  2.332   1.00 0.00 ? 5   GLU A CB   5  
ATOM   8323  C CG   . GLU A 1 5   ? 24.215  -0.085  1.921   1.00 0.00 ? 5   GLU A CG   5  
ATOM   8324  C CD   . GLU A 1 5   ? 25.119  -0.850  2.862   1.00 0.00 ? 5   GLU A CD   5  
ATOM   8325  O OE1  . GLU A 1 5   ? 25.100  -2.095  2.829   1.00 0.00 ? 5   GLU A OE1  5  
ATOM   8326  O OE2  . GLU A 1 5   ? 25.865  -0.209  3.632   1.00 0.00 ? 5   GLU A OE2  5  
ATOM   8327  H H    . GLU A 1 5   ? 22.900  2.293   1.598   1.00 0.00 ? 5   GLU A H    5  
ATOM   8328  H HA   . GLU A 1 5   ? 21.966  0.013   0.353   1.00 0.00 ? 5   GLU A HA   5  
ATOM   8329  H HB2  . GLU A 1 5   ? 22.645  0.376   3.273   1.00 0.00 ? 5   GLU A HB2  5  
ATOM   8330  H HB3  . GLU A 1 5   ? 22.479  -1.177  2.466   1.00 0.00 ? 5   GLU A HB3  5  
ATOM   8331  H HG2  . GLU A 1 5   ? 24.313  -0.504  0.931   1.00 0.00 ? 5   GLU A HG2  5  
ATOM   8332  H HG3  . GLU A 1 5   ? 24.528  0.948   1.904   1.00 0.00 ? 5   GLU A HG3  5  
ATOM   8333  N N    . GLN A 1 6   ? 19.901  1.067   2.687   1.00 0.00 ? 6   GLN A N    5  
ATOM   8334  C CA   . GLN A 1 6   ? 18.529  0.982   3.183   1.00 0.00 ? 6   GLN A CA   5  
ATOM   8335  C C    . GLN A 1 6   ? 17.535  1.275   2.059   1.00 0.00 ? 6   GLN A C    5  
ATOM   8336  O O    . GLN A 1 6   ? 16.528  0.584   1.909   1.00 0.00 ? 6   GLN A O    5  
ATOM   8337  C CB   . GLN A 1 6   ? 18.315  1.971   4.339   1.00 0.00 ? 6   GLN A CB   5  
ATOM   8338  C CG   . GLN A 1 6   ? 18.972  1.578   5.665   1.00 0.00 ? 6   GLN A CG   5  
ATOM   8339  C CD   . GLN A 1 6   ? 20.359  0.985   5.512   1.00 0.00 ? 6   GLN A CD   5  
ATOM   8340  O OE1  . GLN A 1 6   ? 21.358  1.704   5.484   1.00 0.00 ? 6   GLN A OE1  5  
ATOM   8341  N NE2  . GLN A 1 6   ? 20.433  -0.333  5.418   1.00 0.00 ? 6   GLN A NE2  5  
ATOM   8342  H H    . GLN A 1 6   ? 20.508  1.727   3.081   1.00 0.00 ? 6   GLN A H    5  
ATOM   8343  H HA   . GLN A 1 6   ? 18.365  -0.024  3.544   1.00 0.00 ? 6   GLN A HA   5  
ATOM   8344  H HB2  . GLN A 1 6   ? 18.707  2.932   4.046   1.00 0.00 ? 6   GLN A HB2  5  
ATOM   8345  H HB3  . GLN A 1 6   ? 17.250  2.069   4.511   1.00 0.00 ? 6   GLN A HB3  5  
ATOM   8346  H HG2  . GLN A 1 6   ? 19.054  2.464   6.281   1.00 0.00 ? 6   GLN A HG2  5  
ATOM   8347  H HG3  . GLN A 1 6   ? 18.341  0.856   6.162   1.00 0.00 ? 6   GLN A HG3  5  
ATOM   8348  H HE21 . GLN A 1 6   ? 19.600  -0.850  5.455   1.00 0.00 ? 6   GLN A HE21 5  
ATOM   8349  H HE22 . GLN A 1 6   ? 21.317  -0.743  5.320   1.00 0.00 ? 6   GLN A HE22 5  
ATOM   8350  N N    . LEU A 1 7   ? 17.842  2.284   1.253   1.00 0.00 ? 7   LEU A N    5  
ATOM   8351  C CA   . LEU A 1 7   ? 16.962  2.696   0.165   1.00 0.00 ? 7   LEU A CA   5  
ATOM   8352  C C    . LEU A 1 7   ? 17.057  1.728   -1.013  1.00 0.00 ? 7   LEU A C    5  
ATOM   8353  O O    . LEU A 1 7   ? 16.145  1.621   -1.828  1.00 0.00 ? 7   LEU A O    5  
ATOM   8354  C CB   . LEU A 1 7   ? 17.302  4.117   -0.282  1.00 0.00 ? 7   LEU A CB   5  
ATOM   8355  C CG   . LEU A 1 7   ? 17.061  5.189   0.775   1.00 0.00 ? 7   LEU A CG   5  
ATOM   8356  C CD1  . LEU A 1 7   ? 17.631  6.519   0.314   1.00 0.00 ? 7   LEU A CD1  5  
ATOM   8357  C CD2  . LEU A 1 7   ? 15.576  5.319   1.081   1.00 0.00 ? 7   LEU A CD2  5  
ATOM   8358  H H    . LEU A 1 7   ? 18.688  2.760   1.387   1.00 0.00 ? 7   LEU A H    5  
ATOM   8359  H HA   . LEU A 1 7   ? 15.951  2.683   0.545   1.00 0.00 ? 7   LEU A HA   5  
ATOM   8360  H HB2  . LEU A 1 7   ? 18.344  4.144   -0.566  1.00 0.00 ? 7   LEU A HB2  5  
ATOM   8361  H HB3  . LEU A 1 7   ? 16.705  4.361   -1.150  1.00 0.00 ? 7   LEU A HB3  5  
ATOM   8362  H HG   . LEU A 1 7   ? 17.562  4.901   1.684   1.00 0.00 ? 7   LEU A HG   5  
ATOM   8363  H HD11 . LEU A 1 7   ? 18.679  6.402   0.091   1.00 0.00 ? 7   LEU A HD11 5  
ATOM   8364  H HD12 . LEU A 1 7   ? 17.508  7.253   1.096   1.00 0.00 ? 7   LEU A HD12 5  
ATOM   8365  H HD13 . LEU A 1 7   ? 17.108  6.847   -0.572  1.00 0.00 ? 7   LEU A HD13 5  
ATOM   8366  H HD21 . LEU A 1 7   ? 15.254  4.484   1.689   1.00 0.00 ? 7   LEU A HD21 5  
ATOM   8367  H HD22 . LEU A 1 7   ? 15.018  5.326   0.156   1.00 0.00 ? 7   LEU A HD22 5  
ATOM   8368  H HD23 . LEU A 1 7   ? 15.399  6.241   1.614   1.00 0.00 ? 7   LEU A HD23 5  
ATOM   8369  N N    . LYS A 1 8   ? 18.163  1.021   -1.102  1.00 0.00 ? 8   LYS A N    5  
ATOM   8370  C CA   . LYS A 1 8   ? 18.299  -0.022  -2.097  1.00 0.00 ? 8   LYS A CA   5  
ATOM   8371  C C    . LYS A 1 8   ? 17.438  -1.206  -1.702  1.00 0.00 ? 8   LYS A C    5  
ATOM   8372  O O    . LYS A 1 8   ? 16.807  -1.842  -2.548  1.00 0.00 ? 8   LYS A O    5  
ATOM   8373  C CB   . LYS A 1 8   ? 19.761  -0.439  -2.238  1.00 0.00 ? 8   LYS A CB   5  
ATOM   8374  C CG   . LYS A 1 8   ? 19.992  -1.565  -3.238  1.00 0.00 ? 8   LYS A CG   5  
ATOM   8375  C CD   . LYS A 1 8   ? 19.523  -1.188  -4.636  1.00 0.00 ? 8   LYS A CD   5  
ATOM   8376  C CE   . LYS A 1 8   ? 20.211  0.070   -5.144  1.00 0.00 ? 8   LYS A CE   5  
ATOM   8377  N NZ   . LYS A 1 8   ? 21.694  -0.053  -5.119  1.00 0.00 ? 8   LYS A NZ   5  
ATOM   8378  H H    . LYS A 1 8   ? 18.911  1.212   -0.494  1.00 0.00 ? 8   LYS A H    5  
ATOM   8379  H HA   . LYS A 1 8   ? 17.944  0.365   -3.037  1.00 0.00 ? 8   LYS A HA   5  
ATOM   8380  H HB2  . LYS A 1 8   ? 20.340  0.416   -2.553  1.00 0.00 ? 8   LYS A HB2  5  
ATOM   8381  H HB3  . LYS A 1 8   ? 20.117  -0.765  -1.276  1.00 0.00 ? 8   LYS A HB3  5  
ATOM   8382  H HG2  . LYS A 1 8   ? 21.046  -1.791  -3.273  1.00 0.00 ? 8   LYS A HG2  5  
ATOM   8383  H HG3  . LYS A 1 8   ? 19.446  -2.437  -2.910  1.00 0.00 ? 8   LYS A HG3  5  
ATOM   8384  H HD2  . LYS A 1 8   ? 19.745  -2.003  -5.310  1.00 0.00 ? 8   LYS A HD2  5  
ATOM   8385  H HD3  . LYS A 1 8   ? 18.454  -1.022  -4.611  1.00 0.00 ? 8   LYS A HD3  5  
ATOM   8386  H HE2  . LYS A 1 8   ? 19.893  0.252   -6.158  1.00 0.00 ? 8   LYS A HE2  5  
ATOM   8387  H HE3  . LYS A 1 8   ? 19.916  0.902   -4.520  1.00 0.00 ? 8   LYS A HE3  5  
ATOM   8388  H HZ1  . LYS A 1 8   ? 22.031  -0.157  -4.141  1.00 0.00 ? 8   LYS A HZ1  5  
ATOM   8389  H HZ2  . LYS A 1 8   ? 22.130  0.792   -5.536  1.00 0.00 ? 8   LYS A HZ2  5  
ATOM   8390  H HZ3  . LYS A 1 8   ? 21.993  -0.886  -5.666  1.00 0.00 ? 8   LYS A HZ3  5  
ATOM   8391  N N    . HIS A 1 9   ? 17.391  -1.482  -0.408  1.00 0.00 ? 9   HIS A N    5  
ATOM   8392  C CA   . HIS A 1 9   ? 16.561  -2.557  0.098   1.00 0.00 ? 9   HIS A CA   5  
ATOM   8393  C C    . HIS A 1 9   ? 15.089  -2.190  -0.054  1.00 0.00 ? 9   HIS A C    5  
ATOM   8394  O O    . HIS A 1 9   ? 14.259  -3.052  -0.337  1.00 0.00 ? 9   HIS A O    5  
ATOM   8395  C CB   . HIS A 1 9   ? 16.890  -2.862  1.563   1.00 0.00 ? 9   HIS A CB   5  
ATOM   8396  C CG   . HIS A 1 9   ? 16.629  -4.291  1.942   1.00 0.00 ? 9   HIS A CG   5  
ATOM   8397  N ND1  . HIS A 1 9   ? 17.574  -5.094  2.537   1.00 0.00 ? 9   HIS A ND1  5  
ATOM   8398  C CD2  . HIS A 1 9   ? 15.526  -5.061  1.797   1.00 0.00 ? 9   HIS A CD2  5  
ATOM   8399  C CE1  . HIS A 1 9   ? 17.066  -6.296  2.737   1.00 0.00 ? 9   HIS A CE1  5  
ATOM   8400  N NE2  . HIS A 1 9   ? 15.823  -6.301  2.300   1.00 0.00 ? 9   HIS A NE2  5  
ATOM   8401  H H    . HIS A 1 9   ? 17.941  -0.957  0.218   1.00 0.00 ? 9   HIS A H    5  
ATOM   8402  H HA   . HIS A 1 9   ? 16.761  -3.434  -0.496  1.00 0.00 ? 9   HIS A HA   5  
ATOM   8403  H HB2  . HIS A 1 9   ? 17.933  -2.655  1.744   1.00 0.00 ? 9   HIS A HB2  5  
ATOM   8404  H HB3  . HIS A 1 9   ? 16.285  -2.232  2.200   1.00 0.00 ? 9   HIS A HB3  5  
ATOM   8405  H HD1  . HIS A 1 9   ? 18.489  -4.822  2.782   1.00 0.00 ? 9   HIS A HD1  5  
ATOM   8406  H HD2  . HIS A 1 9   ? 14.584  -4.754  1.369   1.00 0.00 ? 9   HIS A HD2  5  
ATOM   8407  H HE1  . HIS A 1 9   ? 17.583  -7.134  3.181   1.00 0.00 ? 9   HIS A HE1  5  
ATOM   8408  H HE2  . HIS A 1 9   ? 15.272  -7.109  2.179   1.00 0.00 ? 9   HIS A HE2  5  
ATOM   8409  N N    . CYS A 1 10  ? 14.764  -0.907  0.111   1.00 0.00 ? 10  CYS A N    5  
ATOM   8410  C CA   . CYS A 1 10  ? 13.384  -0.464  -0.044  1.00 0.00 ? 10  CYS A CA   5  
ATOM   8411  C C    . CYS A 1 10  ? 12.966  -0.550  -1.505  1.00 0.00 ? 10  CYS A C    5  
ATOM   8412  O O    . CYS A 1 10  ? 11.797  -0.786  -1.813  1.00 0.00 ? 10  CYS A O    5  
ATOM   8413  C CB   . CYS A 1 10  ? 13.175  0.962   0.499   1.00 0.00 ? 10  CYS A CB   5  
ATOM   8414  S SG   . CYS A 1 10  ? 13.784  2.301   -0.546  1.00 0.00 ? 10  CYS A SG   5  
ATOM   8415  H H    . CYS A 1 10  ? 15.460  -0.256  0.353   1.00 0.00 ? 10  CYS A H    5  
ATOM   8416  H HA   . CYS A 1 10  ? 12.767  -1.143  0.519   1.00 0.00 ? 10  CYS A HA   5  
ATOM   8417  H HB2  . CYS A 1 10  ? 12.116  1.130   0.633   1.00 0.00 ? 10  CYS A HB2  5  
ATOM   8418  H HB3  . CYS A 1 10  ? 13.675  1.050   1.456   1.00 0.00 ? 10  CYS A HB3  5  
ATOM   8419  H HG   . CYS A 1 10  ? 14.576  1.780   -1.475  1.00 0.00 ? 10  CYS A HG   5  
ATOM   8420  N N    . ASN A 1 11  ? 13.936  -0.390  -2.401  1.00 0.00 ? 11  ASN A N    5  
ATOM   8421  C CA   . ASN A 1 11  ? 13.681  -0.487  -3.829  1.00 0.00 ? 11  ASN A CA   5  
ATOM   8422  C C    . ASN A 1 11  ? 13.300  -1.917  -4.196  1.00 0.00 ? 11  ASN A C    5  
ATOM   8423  O O    . ASN A 1 11  ? 12.386  -2.146  -4.990  1.00 0.00 ? 11  ASN A O    5  
ATOM   8424  C CB   . ASN A 1 11  ? 14.922  -0.051  -4.615  1.00 0.00 ? 11  ASN A CB   5  
ATOM   8425  C CG   . ASN A 1 11  ? 14.695  -0.036  -6.115  1.00 0.00 ? 11  ASN A CG   5  
ATOM   8426  O OD1  . ASN A 1 11  ? 14.949  -1.021  -6.804  1.00 0.00 ? 11  ASN A OD1  5  
ATOM   8427  N ND2  . ASN A 1 11  ? 14.219  1.085   -6.630  1.00 0.00 ? 11  ASN A ND2  5  
ATOM   8428  H H    . ASN A 1 11  ? 14.850  -0.198  -2.092  1.00 0.00 ? 11  ASN A H    5  
ATOM   8429  H HA   . ASN A 1 11  ? 12.858  0.169   -4.070  1.00 0.00 ? 11  ASN A HA   5  
ATOM   8430  H HB2  . ASN A 1 11  ? 15.209  0.942   -4.303  1.00 0.00 ? 11  ASN A HB2  5  
ATOM   8431  H HB3  . ASN A 1 11  ? 15.731  -0.735  -4.400  1.00 0.00 ? 11  ASN A HB3  5  
ATOM   8432  H HD21 . ASN A 1 11  ? 14.034  1.834   -6.022  1.00 0.00 ? 11  ASN A HD21 5  
ATOM   8433  H HD22 . ASN A 1 11  ? 14.074  1.126   -7.600  1.00 0.00 ? 11  ASN A HD22 5  
ATOM   8434  N N    . GLY A 1 12  ? 13.989  -2.872  -3.584  1.00 0.00 ? 12  GLY A N    5  
ATOM   8435  C CA   . GLY A 1 12  ? 13.737  -4.274  -3.868  1.00 0.00 ? 12  GLY A CA   5  
ATOM   8436  C C    . GLY A 1 12  ? 12.425  -4.761  -3.283  1.00 0.00 ? 12  GLY A C    5  
ATOM   8437  O O    . GLY A 1 12  ? 11.696  -5.518  -3.924  1.00 0.00 ? 12  GLY A O    5  
ATOM   8438  H H    . GLY A 1 12  ? 14.677  -2.621  -2.929  1.00 0.00 ? 12  GLY A H    5  
ATOM   8439  H HA2  . GLY A 1 12  ? 13.714  -4.413  -4.940  1.00 0.00 ? 12  GLY A HA2  5  
ATOM   8440  H HA3  . GLY A 1 12  ? 14.544  -4.863  -3.456  1.00 0.00 ? 12  GLY A HA3  5  
ATOM   8441  N N    . ILE A 1 13  ? 12.126  -4.327  -2.064  1.00 0.00 ? 13  ILE A N    5  
ATOM   8442  C CA   . ILE A 1 13  ? 10.881  -4.697  -1.394  1.00 0.00 ? 13  ILE A CA   5  
ATOM   8443  C C    . ILE A 1 13  ? 9.676   -4.207  -2.186  1.00 0.00 ? 13  ILE A C    5  
ATOM   8444  O O    . ILE A 1 13  ? 8.756   -4.976  -2.477  1.00 0.00 ? 13  ILE A O    5  
ATOM   8445  C CB   . ILE A 1 13  ? 10.834  -4.116  0.035   1.00 0.00 ? 13  ILE A CB   5  
ATOM   8446  C CG1  . ILE A 1 13  ? 11.930  -4.748  0.898   1.00 0.00 ? 13  ILE A CG1  5  
ATOM   8447  C CG2  . ILE A 1 13  ? 9.462   -4.304  0.664   1.00 0.00 ? 13  ILE A CG2  5  
ATOM   8448  C CD1  . ILE A 1 13  ? 12.037  -4.160  2.285   1.00 0.00 ? 13  ILE A CD1  5  
ATOM   8449  H H    . ILE A 1 13  ? 12.764  -3.743  -1.598  1.00 0.00 ? 13  ILE A H    5  
ATOM   8450  H HA   . ILE A 1 13  ? 10.843  -5.774  -1.325  1.00 0.00 ? 13  ILE A HA   5  
ATOM   8451  H HB   . ILE A 1 13  ? 11.009  -3.062  -0.040  1.00 0.00 ? 13  ILE A HB   5  
ATOM   8452  H HG12 . ILE A 1 13  ? 11.720  -5.794  1.011   1.00 0.00 ? 13  ILE A HG12 5  
ATOM   8453  H HG13 . ILE A 1 13  ? 12.886  -4.632  0.408   1.00 0.00 ? 13  ILE A HG13 5  
ATOM   8454  H HG21 . ILE A 1 13  ? 8.974   -5.142  0.207   1.00 0.00 ? 13  ILE A HG21 5  
ATOM   8455  H HG22 . ILE A 1 13  ? 8.869   -3.415  0.511   1.00 0.00 ? 13  ILE A HG22 5  
ATOM   8456  H HG23 . ILE A 1 13  ? 9.574   -4.484  1.723   1.00 0.00 ? 13  ILE A HG23 5  
ATOM   8457  H HD11 . ILE A 1 13  ? 11.206  -4.506  2.876   1.00 0.00 ? 13  ILE A HD11 5  
ATOM   8458  H HD12 . ILE A 1 13  ? 12.016  -3.082  2.224   1.00 0.00 ? 13  ILE A HD12 5  
ATOM   8459  H HD13 . ILE A 1 13  ? 12.962  -4.479  2.742   1.00 0.00 ? 13  ILE A HD13 5  
ATOM   8460  N N    . LEU A 1 14  ? 9.700   -2.926  -2.537  1.00 0.00 ? 14  LEU A N    5  
ATOM   8461  C CA   . LEU A 1 14  ? 8.646   -2.322  -3.329  1.00 0.00 ? 14  LEU A CA   5  
ATOM   8462  C C    . LEU A 1 14  ? 8.448   -3.095  -4.625  1.00 0.00 ? 14  LEU A C    5  
ATOM   8463  O O    . LEU A 1 14  ? 7.326   -3.418  -5.008  1.00 0.00 ? 14  LEU A O    5  
ATOM   8464  C CB   . LEU A 1 14  ? 9.019   -0.878  -3.647  1.00 0.00 ? 14  LEU A CB   5  
ATOM   8465  C CG   . LEU A 1 14  ? 7.854   0.088   -3.703  1.00 0.00 ? 14  LEU A CG   5  
ATOM   8466  C CD1  . LEU A 1 14  ? 8.381   1.501   -3.711  1.00 0.00 ? 14  LEU A CD1  5  
ATOM   8467  C CD2  . LEU A 1 14  ? 6.999   -0.152  -4.930  1.00 0.00 ? 14  LEU A CD2  5  
ATOM   8468  H H    . LEU A 1 14  ? 10.445  -2.363  -2.241  1.00 0.00 ? 14  LEU A H    5  
ATOM   8469  H HA   . LEU A 1 14  ? 7.733   -2.340  -2.755  1.00 0.00 ? 14  LEU A HA   5  
ATOM   8470  H HB2  . LEU A 1 14  ? 9.713   -0.523  -2.901  1.00 0.00 ? 14  LEU A HB2  5  
ATOM   8471  H HB3  . LEU A 1 14  ? 9.514   -0.862  -4.606  1.00 0.00 ? 14  LEU A HB3  5  
ATOM   8472  H HG   . LEU A 1 14  ? 7.245   -0.046  -2.823  1.00 0.00 ? 14  LEU A HG   5  
ATOM   8473  H HD11 . LEU A 1 14  ? 9.186   1.569   -4.428  1.00 0.00 ? 14  LEU A HD11 5  
ATOM   8474  H HD12 . LEU A 1 14  ? 8.748   1.757   -2.728  1.00 0.00 ? 14  LEU A HD12 5  
ATOM   8475  H HD13 . LEU A 1 14  ? 7.590   2.182   -3.990  1.00 0.00 ? 14  LEU A HD13 5  
ATOM   8476  H HD21 . LEU A 1 14  ? 6.787   -1.213  -5.032  1.00 0.00 ? 14  LEU A HD21 5  
ATOM   8477  H HD22 . LEU A 1 14  ? 7.527   0.191   -5.808  1.00 0.00 ? 14  LEU A HD22 5  
ATOM   8478  H HD23 . LEU A 1 14  ? 6.074   0.392   -4.834  1.00 0.00 ? 14  LEU A HD23 5  
ATOM   8479  N N    . LYS A 1 15  ? 9.560   -3.397  -5.279  1.00 0.00 ? 15  LYS A N    5  
ATOM   8480  C CA   . LYS A 1 15  ? 9.565   -4.112  -6.528  1.00 0.00 ? 15  LYS A CA   5  
ATOM   8481  C C    . LYS A 1 15  ? 8.873   -5.463  -6.395  1.00 0.00 ? 15  LYS A C    5  
ATOM   8482  O O    . LYS A 1 15  ? 8.115   -5.876  -7.272  1.00 0.00 ? 15  LYS A O    5  
ATOM   8483  C CB   . LYS A 1 15  ? 11.015  -4.288  -6.964  1.00 0.00 ? 15  LYS A CB   5  
ATOM   8484  C CG   . LYS A 1 15  ? 11.227  -5.463  -7.874  1.00 0.00 ? 15  LYS A CG   5  
ATOM   8485  C CD   . LYS A 1 15  ? 10.742  -5.185  -9.282  1.00 0.00 ? 15  LYS A CD   5  
ATOM   8486  C CE   . LYS A 1 15  ? 11.330  -6.185  -10.251 1.00 0.00 ? 15  LYS A CE   5  
ATOM   8487  N NZ   . LYS A 1 15  ? 10.674  -6.127  -11.582 1.00 0.00 ? 15  LYS A NZ   5  
ATOM   8488  H H    . LYS A 1 15  ? 10.421  -3.140  -4.900  1.00 0.00 ? 15  LYS A H    5  
ATOM   8489  H HA   . LYS A 1 15  ? 9.046   -3.521  -7.256  1.00 0.00 ? 15  LYS A HA   5  
ATOM   8490  H HB2  . LYS A 1 15  ? 11.334  -3.397  -7.482  1.00 0.00 ? 15  LYS A HB2  5  
ATOM   8491  H HB3  . LYS A 1 15  ? 11.631  -4.423  -6.087  1.00 0.00 ? 15  LYS A HB3  5  
ATOM   8492  H HG2  . LYS A 1 15  ? 12.269  -5.720  -7.899  1.00 0.00 ? 15  LYS A HG2  5  
ATOM   8493  H HG3  . LYS A 1 15  ? 10.665  -6.283  -7.465  1.00 0.00 ? 15  LYS A HG3  5  
ATOM   8494  H HD2  . LYS A 1 15  ? 9.665   -5.261  -9.307  1.00 0.00 ? 15  LYS A HD2  5  
ATOM   8495  H HD3  . LYS A 1 15  ? 11.046  -4.191  -9.571  1.00 0.00 ? 15  LYS A HD3  5  
ATOM   8496  H HE2  . LYS A 1 15  ? 12.382  -5.970  -10.370 1.00 0.00 ? 15  LYS A HE2  5  
ATOM   8497  H HE3  . LYS A 1 15  ? 11.214  -7.172  -9.833  1.00 0.00 ? 15  LYS A HE3  5  
ATOM   8498  H HZ1  . LYS A 1 15  ? 11.138  -6.786  -12.237 1.00 0.00 ? 15  LYS A HZ1  5  
ATOM   8499  H HZ2  . LYS A 1 15  ? 10.740  -5.166  -11.972 1.00 0.00 ? 15  LYS A HZ2  5  
ATOM   8500  H HZ3  . LYS A 1 15  ? 9.671   -6.388  -11.498 1.00 0.00 ? 15  LYS A HZ3  5  
ATOM   8501  N N    . GLU A 1 16  ? 9.128   -6.136  -5.289  1.00 0.00 ? 16  GLU A N    5  
ATOM   8502  C CA   . GLU A 1 16  ? 8.583   -7.476  -5.072  1.00 0.00 ? 16  GLU A CA   5  
ATOM   8503  C C    . GLU A 1 16  ? 7.072   -7.412  -4.893  1.00 0.00 ? 16  GLU A C    5  
ATOM   8504  O O    . GLU A 1 16  ? 6.336   -8.223  -5.457  1.00 0.00 ? 16  GLU A O    5  
ATOM   8505  C CB   . GLU A 1 16  ? 9.215   -8.174  -3.850  1.00 0.00 ? 16  GLU A CB   5  
ATOM   8506  C CG   . GLU A 1 16  ? 8.671   -9.587  -3.603  1.00 0.00 ? 16  GLU A CG   5  
ATOM   8507  C CD   . GLU A 1 16  ? 8.859   -10.087 -2.188  1.00 0.00 ? 16  GLU A CD   5  
ATOM   8508  O OE1  . GLU A 1 16  ? 9.652   -9.499  -1.434  1.00 0.00 ? 16  GLU A OE1  5  
ATOM   8509  O OE2  . GLU A 1 16  ? 8.219   -11.106 -1.835  1.00 0.00 ? 16  GLU A OE2  5  
ATOM   8510  H H    . GLU A 1 16  ? 9.692   -5.716  -4.607  1.00 0.00 ? 16  GLU A H    5  
ATOM   8511  H HA   . GLU A 1 16  ? 8.797   -8.041  -5.966  1.00 0.00 ? 16  GLU A HA   5  
ATOM   8512  H HB2  . GLU A 1 16  ? 10.284  -8.243  -4.003  1.00 0.00 ? 16  GLU A HB2  5  
ATOM   8513  H HB3  . GLU A 1 16  ? 9.021   -7.578  -2.969  1.00 0.00 ? 16  GLU A HB3  5  
ATOM   8514  H HG2  . GLU A 1 16  ? 7.619   -9.597  -3.826  1.00 0.00 ? 16  GLU A HG2  5  
ATOM   8515  H HG3  . GLU A 1 16  ? 9.174   -10.278 -4.256  1.00 0.00 ? 16  GLU A HG3  5  
ATOM   8516  N N    . LEU A 1 17  ? 6.618   -6.445  -4.111  1.00 0.00 ? 17  LEU A N    5  
ATOM   8517  C CA   . LEU A 1 17  ? 5.187   -6.231  -3.904  1.00 0.00 ? 17  LEU A CA   5  
ATOM   8518  C C    . LEU A 1 17  ? 4.526   -5.845  -5.233  1.00 0.00 ? 17  LEU A C    5  
ATOM   8519  O O    . LEU A 1 17  ? 3.333   -6.064  -5.435  1.00 0.00 ? 17  LEU A O    5  
ATOM   8520  C CB   . LEU A 1 17  ? 4.965   -5.140  -2.843  1.00 0.00 ? 17  LEU A CB   5  
ATOM   8521  C CG   . LEU A 1 17  ? 5.581   -5.416  -1.467  1.00 0.00 ? 17  LEU A CG   5  
ATOM   8522  C CD1  . LEU A 1 17  ? 5.737   -4.117  -0.702  1.00 0.00 ? 17  LEU A CD1  5  
ATOM   8523  C CD2  . LEU A 1 17  ? 4.720   -6.383  -0.664  1.00 0.00 ? 17  LEU A CD2  5  
ATOM   8524  H H    . LEU A 1 17  ? 7.264   -5.853  -3.660  1.00 0.00 ? 17  LEU A H    5  
ATOM   8525  H HA   . LEU A 1 17  ? 4.755   -7.160  -3.554  1.00 0.00 ? 17  LEU A HA   5  
ATOM   8526  H HB2  . LEU A 1 17  ? 5.377   -4.215  -3.214  1.00 0.00 ? 17  LEU A HB2  5  
ATOM   8527  H HB3  . LEU A 1 17  ? 3.904   -5.006  -2.706  1.00 0.00 ? 17  LEU A HB3  5  
ATOM   8528  H HG   . LEU A 1 17  ? 6.560   -5.855  -1.594  1.00 0.00 ? 17  LEU A HG   5  
ATOM   8529  H HD11 . LEU A 1 17  ? 6.294   -3.420  -1.303  1.00 0.00 ? 17  LEU A HD11 5  
ATOM   8530  H HD12 . LEU A 1 17  ? 6.267   -4.302  0.221   1.00 0.00 ? 17  LEU A HD12 5  
ATOM   8531  H HD13 . LEU A 1 17  ? 4.762   -3.706  -0.483  1.00 0.00 ? 17  LEU A HD13 5  
ATOM   8532  H HD21 . LEU A 1 17  ? 4.625   -7.317  -1.192  1.00 0.00 ? 17  LEU A HD21 5  
ATOM   8533  H HD22 . LEU A 1 17  ? 3.742   -5.952  -0.516  1.00 0.00 ? 17  LEU A HD22 5  
ATOM   8534  H HD23 . LEU A 1 17  ? 5.182   -6.559  0.296   1.00 0.00 ? 17  LEU A HD23 5  
ATOM   8535  N N    . LEU A 1 18  ? 5.331   -5.300  -6.144  1.00 0.00 ? 18  LEU A N    5  
ATOM   8536  C CA   . LEU A 1 18  ? 4.863   -4.903  -7.473  1.00 0.00 ? 18  LEU A CA   5  
ATOM   8537  C C    . LEU A 1 18  ? 5.016   -6.025  -8.495  1.00 0.00 ? 18  LEU A C    5  
ATOM   8538  O O    . LEU A 1 18  ? 4.546   -5.915  -9.629  1.00 0.00 ? 18  LEU A O    5  
ATOM   8539  C CB   . LEU A 1 18  ? 5.651   -3.703  -7.974  1.00 0.00 ? 18  LEU A CB   5  
ATOM   8540  C CG   . LEU A 1 18  ? 5.383   -2.394  -7.252  1.00 0.00 ? 18  LEU A CG   5  
ATOM   8541  C CD1  . LEU A 1 18  ? 6.256   -1.304  -7.837  1.00 0.00 ? 18  LEU A CD1  5  
ATOM   8542  C CD2  . LEU A 1 18  ? 3.917   -2.010  -7.340  1.00 0.00 ? 18  LEU A CD2  5  
ATOM   8543  H H    . LEU A 1 18  ? 6.271   -5.148  -5.910  1.00 0.00 ? 18  LEU A H    5  
ATOM   8544  H HA   . LEU A 1 18  ? 3.822   -4.630  -7.394  1.00 0.00 ? 18  LEU A HA   5  
ATOM   8545  H HB2  . LEU A 1 18  ? 6.703   -3.930  -7.878  1.00 0.00 ? 18  LEU A HB2  5  
ATOM   8546  H HB3  . LEU A 1 18  ? 5.427   -3.568  -9.017  1.00 0.00 ? 18  LEU A HB3  5  
ATOM   8547  H HG   . LEU A 1 18  ? 5.640   -2.506  -6.209  1.00 0.00 ? 18  LEU A HG   5  
ATOM   8548  H HD11 . LEU A 1 18  ? 7.282   -1.475  -7.539  1.00 0.00 ? 18  LEU A HD11 5  
ATOM   8549  H HD12 . LEU A 1 18  ? 5.928   -0.343  -7.471  1.00 0.00 ? 18  LEU A HD12 5  
ATOM   8550  H HD13 . LEU A 1 18  ? 6.186   -1.323  -8.914  1.00 0.00 ? 18  LEU A HD13 5  
ATOM   8551  H HD21 . LEU A 1 18  ? 3.674   -1.365  -6.516  1.00 0.00 ? 18  LEU A HD21 5  
ATOM   8552  H HD22 . LEU A 1 18  ? 3.303   -2.895  -7.296  1.00 0.00 ? 18  LEU A HD22 5  
ATOM   8553  H HD23 . LEU A 1 18  ? 3.735   -1.489  -8.269  1.00 0.00 ? 18  LEU A HD23 5  
ATOM   8554  N N    . SER A 1 19  ? 5.721   -7.072  -8.117  1.00 0.00 ? 19  SER A N    5  
ATOM   8555  C CA   . SER A 1 19  ? 5.933   -8.207  -9.004  1.00 0.00 ? 19  SER A CA   5  
ATOM   8556  C C    . SER A 1 19  ? 4.645   -9.011  -9.163  1.00 0.00 ? 19  SER A C    5  
ATOM   8557  O O    . SER A 1 19  ? 3.845   -9.123  -8.226  1.00 0.00 ? 19  SER A O    5  
ATOM   8558  C CB   . SER A 1 19  ? 7.053   -9.093  -8.458  1.00 0.00 ? 19  SER A CB   5  
ATOM   8559  O OG   . SER A 1 19  ? 8.250   -8.350  -8.284  1.00 0.00 ? 19  SER A OG   5  
ATOM   8560  H H    . SER A 1 19  ? 6.116   -7.078  -7.221  1.00 0.00 ? 19  SER A H    5  
ATOM   8561  H HA   . SER A 1 19  ? 6.227   -7.822  -9.970  1.00 0.00 ? 19  SER A HA   5  
ATOM   8562  H HB2  . SER A 1 19  ? 6.755   -9.501  -7.505  1.00 0.00 ? 19  SER A HB2  5  
ATOM   8563  H HB3  . SER A 1 19  ? 7.242   -9.899  -9.153  1.00 0.00 ? 19  SER A HB3  5  
ATOM   8564  H HG   . SER A 1 19  ? 8.031   -7.418  -8.134  1.00 0.00 ? 19  SER A HG   5  
ATOM   8565  N N    . LYS A 1 20  ? 4.469   -9.583  -10.359 1.00 0.00 ? 20  LYS A N    5  
ATOM   8566  C CA   . LYS A 1 20  ? 3.254   -10.318 -10.715 1.00 0.00 ? 20  LYS A CA   5  
ATOM   8567  C C    . LYS A 1 20  ? 3.006   -11.487 -9.774  1.00 0.00 ? 20  LYS A C    5  
ATOM   8568  O O    . LYS A 1 20  ? 1.894   -12.006 -9.695  1.00 0.00 ? 20  LYS A O    5  
ATOM   8569  C CB   . LYS A 1 20  ? 3.331   -10.809 -12.157 1.00 0.00 ? 20  LYS A CB   5  
ATOM   8570  C CG   . LYS A 1 20  ? 3.178   -9.685  -13.165 1.00 0.00 ? 20  LYS A CG   5  
ATOM   8571  C CD   . LYS A 1 20  ? 1.747   -9.171  -13.217 1.00 0.00 ? 20  LYS A CD   5  
ATOM   8572  C CE   . LYS A 1 20  ? 1.584   -8.070  -14.253 1.00 0.00 ? 20  LYS A CE   5  
ATOM   8573  N NZ   . LYS A 1 20  ? 0.200   -7.528  -14.275 1.00 0.00 ? 20  LYS A NZ   5  
ATOM   8574  H H    . LYS A 1 20  ? 5.186   -9.509  -11.026 1.00 0.00 ? 20  LYS A H    5  
ATOM   8575  H HA   . LYS A 1 20  ? 2.432   -9.629  -10.637 1.00 0.00 ? 20  LYS A HA   5  
ATOM   8576  H HB2  . LYS A 1 20  ? 4.288   -11.291 -12.317 1.00 0.00 ? 20  LYS A HB2  5  
ATOM   8577  H HB3  . LYS A 1 20  ? 2.541   -11.525 -12.325 1.00 0.00 ? 20  LYS A HB3  5  
ATOM   8578  H HG2  . LYS A 1 20  ? 3.821   -8.873  -12.867 1.00 0.00 ? 20  LYS A HG2  5  
ATOM   8579  H HG3  . LYS A 1 20  ? 3.464   -10.041 -14.143 1.00 0.00 ? 20  LYS A HG3  5  
ATOM   8580  H HD2  . LYS A 1 20  ? 1.090   -9.988  -13.472 1.00 0.00 ? 20  LYS A HD2  5  
ATOM   8581  H HD3  . LYS A 1 20  ? 1.479   -8.780  -12.248 1.00 0.00 ? 20  LYS A HD3  5  
ATOM   8582  H HE2  . LYS A 1 20  ? 2.269   -7.267  -14.021 1.00 0.00 ? 20  LYS A HE2  5  
ATOM   8583  H HE3  . LYS A 1 20  ? 1.820   -8.471  -15.227 1.00 0.00 ? 20  LYS A HE3  5  
ATOM   8584  H HZ1  . LYS A 1 20  ? 0.111   -6.807  -15.015 1.00 0.00 ? 20  LYS A HZ1  5  
ATOM   8585  H HZ2  . LYS A 1 20  ? -0.031  -7.093  -13.359 1.00 0.00 ? 20  LYS A HZ2  5  
ATOM   8586  H HZ3  . LYS A 1 20  ? -0.481  -8.289  -14.464 1.00 0.00 ? 20  LYS A HZ3  5  
ATOM   8587  N N    . LYS A 1 21  ? 4.057   -11.893 -9.074  1.00 0.00 ? 21  LYS A N    5  
ATOM   8588  C CA   . LYS A 1 21  ? 3.964   -12.909 -8.036  1.00 0.00 ? 21  LYS A CA   5  
ATOM   8589  C C    . LYS A 1 21  ? 2.924   -12.527 -6.985  1.00 0.00 ? 21  LYS A C    5  
ATOM   8590  O O    . LYS A 1 21  ? 2.156   -13.366 -6.518  1.00 0.00 ? 21  LYS A O    5  
ATOM   8591  C CB   . LYS A 1 21  ? 5.329   -13.077 -7.366  1.00 0.00 ? 21  LYS A CB   5  
ATOM   8592  C CG   . LYS A 1 21  ? 5.303   -13.980 -6.147  1.00 0.00 ? 21  LYS A CG   5  
ATOM   8593  C CD   . LYS A 1 21  ? 6.659   -14.075 -5.491  1.00 0.00 ? 21  LYS A CD   5  
ATOM   8594  C CE   . LYS A 1 21  ? 6.722   -15.306 -4.618  1.00 0.00 ? 21  LYS A CE   5  
ATOM   8595  N NZ   . LYS A 1 21  ? 6.717   -16.557 -5.424  1.00 0.00 ? 21  LYS A NZ   5  
ATOM   8596  H H    . LYS A 1 21  ? 4.933   -11.500 -9.276  1.00 0.00 ? 21  LYS A H    5  
ATOM   8597  H HA   . LYS A 1 21  ? 3.679   -13.840 -8.498  1.00 0.00 ? 21  LYS A HA   5  
ATOM   8598  H HB2  . LYS A 1 21  ? 6.019   -13.495 -8.081  1.00 0.00 ? 21  LYS A HB2  5  
ATOM   8599  H HB3  . LYS A 1 21  ? 5.690   -12.110 -7.060  1.00 0.00 ? 21  LYS A HB3  5  
ATOM   8600  H HG2  . LYS A 1 21  ? 4.602   -13.577 -5.432  1.00 0.00 ? 21  LYS A HG2  5  
ATOM   8601  H HG3  . LYS A 1 21  ? 4.988   -14.969 -6.436  1.00 0.00 ? 21  LYS A HG3  5  
ATOM   8602  H HD2  . LYS A 1 21  ? 7.421   -14.137 -6.253  1.00 0.00 ? 21  LYS A HD2  5  
ATOM   8603  H HD3  . LYS A 1 21  ? 6.818   -13.199 -4.880  1.00 0.00 ? 21  LYS A HD3  5  
ATOM   8604  H HE2  . LYS A 1 21  ? 7.619   -15.270 -4.017  1.00 0.00 ? 21  LYS A HE2  5  
ATOM   8605  H HE3  . LYS A 1 21  ? 5.854   -15.302 -3.980  1.00 0.00 ? 21  LYS A HE3  5  
ATOM   8606  H HZ1  . LYS A 1 21  ? 7.505   -16.550 -6.105  1.00 0.00 ? 21  LYS A HZ1  5  
ATOM   8607  H HZ2  . LYS A 1 21  ? 5.824   -16.643 -5.949  1.00 0.00 ? 21  LYS A HZ2  5  
ATOM   8608  H HZ3  . LYS A 1 21  ? 6.818   -17.384 -4.802  1.00 0.00 ? 21  LYS A HZ3  5  
ATOM   8609  N N    . HIS A 1 22  ? 2.895   -11.253 -6.621  1.00 0.00 ? 22  HIS A N    5  
ATOM   8610  C CA   . HIS A 1 22  ? 1.996   -10.791 -5.573  1.00 0.00 ? 22  HIS A CA   5  
ATOM   8611  C C    . HIS A 1 22  ? 0.828   -10.029 -6.175  1.00 0.00 ? 22  HIS A C    5  
ATOM   8612  O O    . HIS A 1 22  ? -0.178  -9.823  -5.511  1.00 0.00 ? 22  HIS A O    5  
ATOM   8613  C CB   . HIS A 1 22  ? 2.739   -9.905  -4.557  1.00 0.00 ? 22  HIS A CB   5  
ATOM   8614  C CG   . HIS A 1 22  ? 3.840   -10.618 -3.821  1.00 0.00 ? 22  HIS A CG   5  
ATOM   8615  N ND1  . HIS A 1 22  ? 3.620   -11.465 -2.751  1.00 0.00 ? 22  HIS A ND1  5  
ATOM   8616  C CD2  . HIS A 1 22  ? 5.178   -10.597 -4.009  1.00 0.00 ? 22  HIS A CD2  5  
ATOM   8617  C CE1  . HIS A 1 22  ? 4.776   -11.931 -2.312  1.00 0.00 ? 22  HIS A CE1  5  
ATOM   8618  N NE2  . HIS A 1 22  ? 5.744   -11.418 -3.056  1.00 0.00 ? 22  HIS A NE2  5  
ATOM   8619  H H    . HIS A 1 22  ? 3.471   -10.604 -7.086  1.00 0.00 ? 22  HIS A H    5  
ATOM   8620  H HA   . HIS A 1 22  ? 1.611   -11.664 -5.064  1.00 0.00 ? 22  HIS A HA   5  
ATOM   8621  H HB2  . HIS A 1 22  ? 3.179   -9.060  -5.083  1.00 0.00 ? 22  HIS A HB2  5  
ATOM   8622  H HB3  . HIS A 1 22  ? 2.034   -9.536  -3.819  1.00 0.00 ? 22  HIS A HB3  5  
ATOM   8623  H HD1  . HIS A 1 22  ? 2.744   -11.695 -2.365  1.00 0.00 ? 22  HIS A HD1  5  
ATOM   8624  H HD2  . HIS A 1 22  ? 5.704   -10.039 -4.780  1.00 0.00 ? 22  HIS A HD2  5  
ATOM   8625  H HE1  . HIS A 1 22  ? 4.907   -12.625 -1.485  1.00 0.00 ? 22  HIS A HE1  5  
ATOM   8626  H HE2  . HIS A 1 22  ? 6.694   -11.380 -2.777  1.00 0.00 ? 22  HIS A HE2  5  
ATOM   8627  N N    . ALA A 1 23  ? 0.966   -9.650  -7.446  1.00 0.00 ? 23  ALA A N    5  
ATOM   8628  C CA   . ALA A 1 23  ? -0.025  -8.829  -8.151  1.00 0.00 ? 23  ALA A CA   5  
ATOM   8629  C C    . ALA A 1 23  ? -1.448  -9.344  -7.985  1.00 0.00 ? 23  ALA A C    5  
ATOM   8630  O O    . ALA A 1 23  ? -2.390  -8.555  -7.900  1.00 0.00 ? 23  ALA A O    5  
ATOM   8631  C CB   . ALA A 1 23  ? 0.327   -8.759  -9.623  1.00 0.00 ? 23  ALA A CB   5  
ATOM   8632  H H    . ALA A 1 23  ? 1.771   -9.926  -7.932  1.00 0.00 ? 23  ALA A H    5  
ATOM   8633  H HA   . ALA A 1 23  ? 0.031   -7.828  -7.752  1.00 0.00 ? 23  ALA A HA   5  
ATOM   8634  H HB1  . ALA A 1 23  ? 1.353   -8.438  -9.722  1.00 0.00 ? 23  ALA A HB1  5  
ATOM   8635  H HB2  . ALA A 1 23  ? -0.323  -8.052  -10.118 1.00 0.00 ? 23  ALA A HB2  5  
ATOM   8636  H HB3  . ALA A 1 23  ? 0.209   -9.735  -10.070 1.00 0.00 ? 23  ALA A HB3  5  
ATOM   8637  N N    . ALA A 1 24  ? -1.589  -10.661 -7.920  1.00 0.00 ? 24  ALA A N    5  
ATOM   8638  C CA   . ALA A 1 24  ? -2.886  -11.308 -7.748  1.00 0.00 ? 24  ALA A CA   5  
ATOM   8639  C C    . ALA A 1 24  ? -3.632  -10.763 -6.524  1.00 0.00 ? 24  ALA A C    5  
ATOM   8640  O O    . ALA A 1 24  ? -4.863  -10.738 -6.499  1.00 0.00 ? 24  ALA A O    5  
ATOM   8641  C CB   . ALA A 1 24  ? -2.687  -12.811 -7.627  1.00 0.00 ? 24  ALA A CB   5  
ATOM   8642  H H    . ALA A 1 24  ? -0.789  -11.224 -7.994  1.00 0.00 ? 24  ALA A H    5  
ATOM   8643  H HA   . ALA A 1 24  ? -3.475  -11.116 -8.632  1.00 0.00 ? 24  ALA A HA   5  
ATOM   8644  H HB1  . ALA A 1 24  ? -1.899  -13.012 -6.915  1.00 0.00 ? 24  ALA A HB1  5  
ATOM   8645  H HB2  . ALA A 1 24  ? -2.417  -13.218 -8.590  1.00 0.00 ? 24  ALA A HB2  5  
ATOM   8646  H HB3  . ALA A 1 24  ? -3.604  -13.270 -7.287  1.00 0.00 ? 24  ALA A HB3  5  
ATOM   8647  N N    . TYR A 1 25  ? -2.881  -10.320 -5.523  1.00 0.00 ? 25  TYR A N    5  
ATOM   8648  C CA   . TYR A 1 25  ? -3.462  -9.772  -4.301  1.00 0.00 ? 25  TYR A CA   5  
ATOM   8649  C C    . TYR A 1 25  ? -2.733  -8.494  -3.871  1.00 0.00 ? 25  TYR A C    5  
ATOM   8650  O O    . TYR A 1 25  ? -2.858  -8.045  -2.735  1.00 0.00 ? 25  TYR A O    5  
ATOM   8651  C CB   . TYR A 1 25  ? -3.441  -10.830 -3.185  1.00 0.00 ? 25  TYR A CB   5  
ATOM   8652  C CG   . TYR A 1 25  ? -2.143  -11.602 -3.078  1.00 0.00 ? 25  TYR A CG   5  
ATOM   8653  C CD1  . TYR A 1 25  ? -1.009  -11.030 -2.522  1.00 0.00 ? 25  TYR A CD1  5  
ATOM   8654  C CD2  . TYR A 1 25  ? -2.060  -12.914 -3.530  1.00 0.00 ? 25  TYR A CD2  5  
ATOM   8655  C CE1  . TYR A 1 25  ? 0.171   -11.741 -2.425  1.00 0.00 ? 25  TYR A CE1  5  
ATOM   8656  C CE2  . TYR A 1 25  ? -0.883  -13.630 -3.435  1.00 0.00 ? 25  TYR A CE2  5  
ATOM   8657  C CZ   . TYR A 1 25  ? 0.230   -13.037 -2.884  1.00 0.00 ? 25  TYR A CZ   5  
ATOM   8658  O OH   . TYR A 1 25  ? 1.407   -13.742 -2.782  1.00 0.00 ? 25  TYR A OH   5  
ATOM   8659  H H    . TYR A 1 25  ? -1.902  -10.358 -5.608  1.00 0.00 ? 25  TYR A H    5  
ATOM   8660  H HA   . TYR A 1 25  ? -4.491  -9.517  -4.515  1.00 0.00 ? 25  TYR A HA   5  
ATOM   8661  H HB2  . TYR A 1 25  ? -3.616  -10.349 -2.232  1.00 0.00 ? 25  TYR A HB2  5  
ATOM   8662  H HB3  . TYR A 1 25  ? -4.229  -11.545 -3.370  1.00 0.00 ? 25  TYR A HB3  5  
ATOM   8663  H HD1  . TYR A 1 25  ? -1.054  -10.012 -2.168  1.00 0.00 ? 25  TYR A HD1  5  
ATOM   8664  H HD2  . TYR A 1 25  ? -2.936  -13.377 -3.957  1.00 0.00 ? 25  TYR A HD2  5  
ATOM   8665  H HE1  . TYR A 1 25  ? 1.043   -11.280 -1.986  1.00 0.00 ? 25  TYR A HE1  5  
ATOM   8666  H HE2  . TYR A 1 25  ? -0.838  -14.646 -3.796  1.00 0.00 ? 25  TYR A HE2  5  
ATOM   8667  H HH   . TYR A 1 25  ? 1.492   -14.340 -3.536  1.00 0.00 ? 25  TYR A HH   5  
ATOM   8668  N N    . ALA A 1 26  ? -1.974  -7.913  -4.797  1.00 0.00 ? 26  ALA A N    5  
ATOM   8669  C CA   . ALA A 1 26  ? -1.237  -6.677  -4.532  1.00 0.00 ? 26  ALA A CA   5  
ATOM   8670  C C    . ALA A 1 26  ? -1.780  -5.523  -5.369  1.00 0.00 ? 26  ALA A C    5  
ATOM   8671  O O    . ALA A 1 26  ? -1.461  -4.354  -5.124  1.00 0.00 ? 26  ALA A O    5  
ATOM   8672  C CB   . ALA A 1 26  ? 0.250   -6.859  -4.819  1.00 0.00 ? 26  ALA A CB   5  
ATOM   8673  H H    . ALA A 1 26  ? -1.895  -8.334  -5.677  1.00 0.00 ? 26  ALA A H    5  
ATOM   8674  H HA   . ALA A 1 26  ? -1.351  -6.437  -3.484  1.00 0.00 ? 26  ALA A HA   5  
ATOM   8675  H HB1  . ALA A 1 26  ? 0.662   -7.638  -4.188  1.00 0.00 ? 26  ALA A HB1  5  
ATOM   8676  H HB2  . ALA A 1 26  ? 0.768   -5.932  -4.627  1.00 0.00 ? 26  ALA A HB2  5  
ATOM   8677  H HB3  . ALA A 1 26  ? 0.383   -7.134  -5.855  1.00 0.00 ? 26  ALA A HB3  5  
ATOM   8678  N N    . TRP A 1 27  ? -2.615  -5.849  -6.352  1.00 0.00 ? 27  TRP A N    5  
ATOM   8679  C CA   . TRP A 1 27  ? -3.140  -4.840  -7.271  1.00 0.00 ? 27  TRP A CA   5  
ATOM   8680  C C    . TRP A 1 27  ? -3.876  -3.677  -6.565  1.00 0.00 ? 27  TRP A C    5  
ATOM   8681  O O    . TRP A 1 27  ? -3.804  -2.550  -7.054  1.00 0.00 ? 27  TRP A O    5  
ATOM   8682  C CB   . TRP A 1 27  ? -4.038  -5.471  -8.352  1.00 0.00 ? 27  TRP A CB   5  
ATOM   8683  C CG   . TRP A 1 27  ? -5.226  -6.226  -7.828  1.00 0.00 ? 27  TRP A CG   5  
ATOM   8684  C CD1  . TRP A 1 27  ? -5.289  -7.560  -7.553  1.00 0.00 ? 27  TRP A CD1  5  
ATOM   8685  C CD2  . TRP A 1 27  ? -6.528  -5.696  -7.529  1.00 0.00 ? 27  TRP A CD2  5  
ATOM   8686  N NE1  . TRP A 1 27  ? -6.540  -7.891  -7.095  1.00 0.00 ? 27  TRP A NE1  5  
ATOM   8687  C CE2  . TRP A 1 27  ? -7.317  -6.767  -7.073  1.00 0.00 ? 27  TRP A CE2  5  
ATOM   8688  C CE3  . TRP A 1 27  ? -7.102  -4.419  -7.596  1.00 0.00 ? 27  TRP A CE3  5  
ATOM   8689  C CZ2  . TRP A 1 27  ? -8.643  -6.604  -6.688  1.00 0.00 ? 27  TRP A CZ2  5  
ATOM   8690  C CZ3  . TRP A 1 27  ? -8.416  -4.261  -7.215  1.00 0.00 ? 27  TRP A CZ3  5  
ATOM   8691  C CH2  . TRP A 1 27  ? -9.175  -5.347  -6.767  1.00 0.00 ? 27  TRP A CH2  5  
ATOM   8692  H H    . TRP A 1 27  ? -2.877  -6.787  -6.469  1.00 0.00 ? 27  TRP A H    5  
ATOM   8693  H HA   . TRP A 1 27  ? -2.274  -4.417  -7.769  1.00 0.00 ? 27  TRP A HA   5  
ATOM   8694  H HB2  . TRP A 1 27  ? -4.406  -4.689  -8.996  1.00 0.00 ? 27  TRP A HB2  5  
ATOM   8695  H HB3  . TRP A 1 27  ? -3.443  -6.154  -8.939  1.00 0.00 ? 27  TRP A HB3  5  
ATOM   8696  H HD1  . TRP A 1 27  ? -4.464  -8.245  -7.679  1.00 0.00 ? 27  TRP A HD1  5  
ATOM   8697  H HE1  . TRP A 1 27  ? -6.831  -8.793  -6.826  1.00 0.00 ? 27  TRP A HE1  5  
ATOM   8698  H HE3  . TRP A 1 27  ? -6.532  -3.567  -7.932  1.00 0.00 ? 27  TRP A HE3  5  
ATOM   8699  H HZ2  . TRP A 1 27  ? -9.244  -7.432  -6.340  1.00 0.00 ? 27  TRP A HZ2  5  
ATOM   8700  H HZ3  . TRP A 1 27  ? -8.875  -3.284  -7.260  1.00 0.00 ? 27  TRP A HZ3  5  
ATOM   8701  H HH2  . TRP A 1 27  ? -10.201 -5.176  -6.478  1.00 0.00 ? 27  TRP A HH2  5  
ATOM   8702  N N    . PRO A 1 28  ? -4.603  -3.893  -5.425  1.00 0.00 ? 28  PRO A N    5  
ATOM   8703  C CA   . PRO A 1 28  ? -5.258  -2.788  -4.708  1.00 0.00 ? 28  PRO A CA   5  
ATOM   8704  C C    . PRO A 1 28  ? -4.293  -1.667  -4.325  1.00 0.00 ? 28  PRO A C    5  
ATOM   8705  O O    . PRO A 1 28  ? -4.708  -0.526  -4.127  1.00 0.00 ? 28  PRO A O    5  
ATOM   8706  C CB   . PRO A 1 28  ? -5.821  -3.419  -3.424  1.00 0.00 ? 28  PRO A CB   5  
ATOM   8707  C CG   . PRO A 1 28  ? -5.352  -4.838  -3.399  1.00 0.00 ? 28  PRO A CG   5  
ATOM   8708  C CD   . PRO A 1 28  ? -4.898  -5.193  -4.790  1.00 0.00 ? 28  PRO A CD   5  
ATOM   8709  H HA   . PRO A 1 28  ? -6.069  -2.372  -5.289  1.00 0.00 ? 28  PRO A HA   5  
ATOM   8710  H HB2  . PRO A 1 28  ? -5.439  -2.873  -2.572  1.00 0.00 ? 28  PRO A HB2  5  
ATOM   8711  H HB3  . PRO A 1 28  ? -6.902  -3.357  -3.426  1.00 0.00 ? 28  PRO A HB3  5  
ATOM   8712  H HG2  . PRO A 1 28  ? -4.529  -4.934  -2.704  1.00 0.00 ? 28  PRO A HG2  5  
ATOM   8713  H HG3  . PRO A 1 28  ? -6.167  -5.481  -3.100  1.00 0.00 ? 28  PRO A HG3  5  
ATOM   8714  H HD2  . PRO A 1 28  ? -4.011  -5.808  -4.753  1.00 0.00 ? 28  PRO A HD2  5  
ATOM   8715  H HD3  . PRO A 1 28  ? -5.683  -5.712  -5.326  1.00 0.00 ? 28  PRO A HD3  5  
ATOM   8716  N N    . PHE A 1 29  ? -3.011  -1.995  -4.227  1.00 0.00 ? 29  PHE A N    5  
ATOM   8717  C CA   . PHE A 1 29  ? -2.023  -1.044  -3.718  1.00 0.00 ? 29  PHE A CA   5  
ATOM   8718  C C    . PHE A 1 29  ? -1.091  -0.556  -4.819  1.00 0.00 ? 29  PHE A C    5  
ATOM   8719  O O    . PHE A 1 29  ? -0.277  0.340   -4.592  1.00 0.00 ? 29  PHE A O    5  
ATOM   8720  C CB   . PHE A 1 29  ? -1.196  -1.678  -2.601  1.00 0.00 ? 29  PHE A CB   5  
ATOM   8721  C CG   . PHE A 1 29  ? -1.949  -2.702  -1.806  1.00 0.00 ? 29  PHE A CG   5  
ATOM   8722  C CD1  . PHE A 1 29  ? -1.623  -4.043  -1.909  1.00 0.00 ? 29  PHE A CD1  5  
ATOM   8723  C CD2  . PHE A 1 29  ? -2.993  -2.331  -0.975  1.00 0.00 ? 29  PHE A CD2  5  
ATOM   8724  C CE1  . PHE A 1 29  ? -2.321  -4.994  -1.201  1.00 0.00 ? 29  PHE A CE1  5  
ATOM   8725  C CE2  . PHE A 1 29  ? -3.693  -3.282  -0.260  1.00 0.00 ? 29  PHE A CE2  5  
ATOM   8726  C CZ   . PHE A 1 29  ? -3.356  -4.616  -0.378  1.00 0.00 ? 29  PHE A CZ   5  
ATOM   8727  H H    . PHE A 1 29  ? -2.726  -2.894  -4.504  1.00 0.00 ? 29  PHE A H    5  
ATOM   8728  H HA   . PHE A 1 29  ? -2.558  -0.198  -3.318  1.00 0.00 ? 29  PHE A HA   5  
ATOM   8729  H HB2  . PHE A 1 29  ? -0.330  -2.160  -3.032  1.00 0.00 ? 29  PHE A HB2  5  
ATOM   8730  H HB3  . PHE A 1 29  ? -0.869  -0.898  -1.922  1.00 0.00 ? 29  PHE A HB3  5  
ATOM   8731  H HD1  . PHE A 1 29  ? -0.806  -4.345  -2.552  1.00 0.00 ? 29  PHE A HD1  5  
ATOM   8732  H HD2  . PHE A 1 29  ? -3.253  -1.287  -0.886  1.00 0.00 ? 29  PHE A HD2  5  
ATOM   8733  H HE1  . PHE A 1 29  ? -2.054  -6.037  -1.292  1.00 0.00 ? 29  PHE A HE1  5  
ATOM   8734  H HE2  . PHE A 1 29  ? -4.505  -2.984  0.385   1.00 0.00 ? 29  PHE A HE2  5  
ATOM   8735  H HZ   . PHE A 1 29  ? -3.903  -5.362  0.172   1.00 0.00 ? 29  PHE A HZ   5  
ATOM   8736  N N    . TYR A 1 30  ? -1.187  -1.165  -5.996  1.00 0.00 ? 30  TYR A N    5  
ATOM   8737  C CA   . TYR A 1 30  ? -0.406  -0.720  -7.149  1.00 0.00 ? 30  TYR A CA   5  
ATOM   8738  C C    . TYR A 1 30  ? -0.652  0.755   -7.430  1.00 0.00 ? 30  TYR A C    5  
ATOM   8739  O O    . TYR A 1 30  ? 0.287   1.547   -7.489  1.00 0.00 ? 30  TYR A O    5  
ATOM   8740  C CB   . TYR A 1 30  ? -0.748  -1.551  -8.392  1.00 0.00 ? 30  TYR A CB   5  
ATOM   8741  C CG   . TYR A 1 30  ? -0.032  -2.879  -8.447  1.00 0.00 ? 30  TYR A CG   5  
ATOM   8742  C CD1  . TYR A 1 30  ? 0.477   -3.448  -7.296  1.00 0.00 ? 30  TYR A CD1  5  
ATOM   8743  C CD2  . TYR A 1 30  ? 0.150   -3.552  -9.647  1.00 0.00 ? 30  TYR A CD2  5  
ATOM   8744  C CE1  . TYR A 1 30  ? 1.150   -4.645  -7.326  1.00 0.00 ? 30  TYR A CE1  5  
ATOM   8745  C CE2  . TYR A 1 30  ? 0.820   -4.760  -9.687  1.00 0.00 ? 30  TYR A CE2  5  
ATOM   8746  C CZ   . TYR A 1 30  ? 1.320   -5.298  -8.520  1.00 0.00 ? 30  TYR A CZ   5  
ATOM   8747  O OH   . TYR A 1 30  ? 1.994   -6.492  -8.545  1.00 0.00 ? 30  TYR A OH   5  
ATOM   8748  H H    . TYR A 1 30  ? -1.783  -1.941  -6.089  1.00 0.00 ? 30  TYR A H    5  
ATOM   8749  H HA   . TYR A 1 30  ? 0.642   -0.858  -6.913  1.00 0.00 ? 30  TYR A HA   5  
ATOM   8750  H HB2  . TYR A 1 30  ? -1.809  -1.747  -8.402  1.00 0.00 ? 30  TYR A HB2  5  
ATOM   8751  H HB3  . TYR A 1 30  ? -0.481  -0.990  -9.276  1.00 0.00 ? 30  TYR A HB3  5  
ATOM   8752  H HD1  . TYR A 1 30  ? 0.334   -2.937  -6.362  1.00 0.00 ? 30  TYR A HD1  5  
ATOM   8753  H HD2  . TYR A 1 30  ? -0.243  -3.123  -10.557 1.00 0.00 ? 30  TYR A HD2  5  
ATOM   8754  H HE1  . TYR A 1 30  ? 1.538   -5.069  -6.413  1.00 0.00 ? 30  TYR A HE1  5  
ATOM   8755  H HE2  . TYR A 1 30  ? 0.954   -5.273  -10.626 1.00 0.00 ? 30  TYR A HE2  5  
ATOM   8756  H HH   . TYR A 1 30  ? 1.921   -6.919  -7.687  1.00 0.00 ? 30  TYR A HH   5  
ATOM   8757  N N    . LYS A 1 31  ? -1.918  1.110   -7.601  1.00 0.00 ? 31  LYS A N    5  
ATOM   8758  C CA   . LYS A 1 31  ? -2.301  2.483   -7.874  1.00 0.00 ? 31  LYS A CA   5  
ATOM   8759  C C    . LYS A 1 31  ? -3.581  2.845   -7.126  1.00 0.00 ? 31  LYS A C    5  
ATOM   8760  O O    . LYS A 1 31  ? -4.370  1.965   -6.780  1.00 0.00 ? 31  LYS A O    5  
ATOM   8761  C CB   . LYS A 1 31  ? -2.460  2.679   -9.380  1.00 0.00 ? 31  LYS A CB   5  
ATOM   8762  C CG   . LYS A 1 31  ? -1.121  2.789   -10.093 1.00 0.00 ? 31  LYS A CG   5  
ATOM   8763  C CD   . LYS A 1 31  ? -1.271  3.180   -11.550 1.00 0.00 ? 31  LYS A CD   5  
ATOM   8764  C CE   . LYS A 1 31  ? 0.085   3.447   -12.185 1.00 0.00 ? 31  LYS A CE   5  
ATOM   8765  N NZ   . LYS A 1 31  ? 0.836   4.513   -11.467 1.00 0.00 ? 31  LYS A NZ   5  
ATOM   8766  H H    . LYS A 1 31  ? -2.617  0.430   -7.549  1.00 0.00 ? 31  LYS A H    5  
ATOM   8767  H HA   . LYS A 1 31  ? -1.508  3.121   -7.521  1.00 0.00 ? 31  LYS A HA   5  
ATOM   8768  H HB2  . LYS A 1 31  ? -2.994  1.828   -9.781  1.00 0.00 ? 31  LYS A HB2  5  
ATOM   8769  H HB3  . LYS A 1 31  ? -3.026  3.578   -9.567  1.00 0.00 ? 31  LYS A HB3  5  
ATOM   8770  H HG2  . LYS A 1 31  ? -0.525  3.536   -9.595  1.00 0.00 ? 31  LYS A HG2  5  
ATOM   8771  H HG3  . LYS A 1 31  ? -0.620  1.834   -10.035 1.00 0.00 ? 31  LYS A HG3  5  
ATOM   8772  H HD2  . LYS A 1 31  ? -1.756  2.377   -12.082 1.00 0.00 ? 31  LYS A HD2  5  
ATOM   8773  H HD3  . LYS A 1 31  ? -1.872  4.075   -11.613 1.00 0.00 ? 31  LYS A HD3  5  
ATOM   8774  H HE2  . LYS A 1 31  ? 0.664   2.536   -12.166 1.00 0.00 ? 31  LYS A HE2  5  
ATOM   8775  H HE3  . LYS A 1 31  ? -0.066  3.754   -13.210 1.00 0.00 ? 31  LYS A HE3  5  
ATOM   8776  H HZ1  . LYS A 1 31  ? 1.689   4.776   -12.001 1.00 0.00 ? 31  LYS A HZ1  5  
ATOM   8777  H HZ2  . LYS A 1 31  ? 1.125   4.181   -10.524 1.00 0.00 ? 31  LYS A HZ2  5  
ATOM   8778  H HZ3  . LYS A 1 31  ? 0.240   5.356   -11.352 1.00 0.00 ? 31  LYS A HZ3  5  
ATOM   8779  N N    . PRO A 1 32  ? -3.791  4.152   -6.862  1.00 0.00 ? 32  PRO A N    5  
ATOM   8780  C CA   . PRO A 1 32  ? -4.918  4.649   -6.060  1.00 0.00 ? 32  PRO A CA   5  
ATOM   8781  C C    . PRO A 1 32  ? -6.269  4.174   -6.573  1.00 0.00 ? 32  PRO A C    5  
ATOM   8782  O O    . PRO A 1 32  ? -6.487  4.058   -7.783  1.00 0.00 ? 32  PRO A O    5  
ATOM   8783  C CB   . PRO A 1 32  ? -4.815  6.176   -6.194  1.00 0.00 ? 32  PRO A CB   5  
ATOM   8784  C CG   . PRO A 1 32  ? -3.905  6.408   -7.346  1.00 0.00 ? 32  PRO A CG   5  
ATOM   8785  C CD   . PRO A 1 32  ? -2.948  5.260   -7.334  1.00 0.00 ? 32  PRO A CD   5  
ATOM   8786  H HA   . PRO A 1 32  ? -4.816  4.369   -5.021  1.00 0.00 ? 32  PRO A HA   5  
ATOM   8787  H HB2  . PRO A 1 32  ? -5.796  6.588   -6.379  1.00 0.00 ? 32  PRO A HB2  5  
ATOM   8788  H HB3  . PRO A 1 32  ? -4.411  6.595   -5.284  1.00 0.00 ? 32  PRO A HB3  5  
ATOM   8789  H HG2  . PRO A 1 32  ? -4.471  6.417   -8.266  1.00 0.00 ? 32  PRO A HG2  5  
ATOM   8790  H HG3  . PRO A 1 32  ? -3.377  7.340   -7.218  1.00 0.00 ? 32  PRO A HG3  5  
ATOM   8791  H HD2  . PRO A 1 32  ? -2.571  5.071   -8.327  1.00 0.00 ? 32  PRO A HD2  5  
ATOM   8792  H HD3  . PRO A 1 32  ? -2.137  5.448   -6.647  1.00 0.00 ? 32  PRO A HD3  5  
ATOM   8793  N N    . VAL A 1 33  ? -7.175  3.906   -5.639  1.00 0.00 ? 33  VAL A N    5  
ATOM   8794  C CA   . VAL A 1 33  ? -8.498  3.410   -5.975  1.00 0.00 ? 33  VAL A CA   5  
ATOM   8795  C C    . VAL A 1 33  ? -9.256  4.458   -6.780  1.00 0.00 ? 33  VAL A C    5  
ATOM   8796  O O    . VAL A 1 33  ? -9.120  5.662   -6.542  1.00 0.00 ? 33  VAL A O    5  
ATOM   8797  C CB   . VAL A 1 33  ? -9.302  3.006   -4.705  1.00 0.00 ? 33  VAL A CB   5  
ATOM   8798  C CG1  . VAL A 1 33  ? -8.374  2.491   -3.623  1.00 0.00 ? 33  VAL A CG1  5  
ATOM   8799  C CG2  . VAL A 1 33  ? -10.175 4.139   -4.179  1.00 0.00 ? 33  VAL A CG2  5  
ATOM   8800  H H    . VAL A 1 33  ? -6.946  4.052   -4.702  1.00 0.00 ? 33  VAL A H    5  
ATOM   8801  H HA   . VAL A 1 33  ? -8.371  2.529   -6.588  1.00 0.00 ? 33  VAL A HA   5  
ATOM   8802  H HB   . VAL A 1 33  ? -9.955  2.193   -4.977  1.00 0.00 ? 33  VAL A HB   5  
ATOM   8803  H HG11 . VAL A 1 33  ? -7.829  1.640   -3.995  1.00 0.00 ? 33  VAL A HG11 5  
ATOM   8804  H HG12 . VAL A 1 33  ? -8.954  2.197   -2.761  1.00 0.00 ? 33  VAL A HG12 5  
ATOM   8805  H HG13 . VAL A 1 33  ? -7.681  3.268   -3.341  1.00 0.00 ? 33  VAL A HG13 5  
ATOM   8806  H HG21 . VAL A 1 33  ? -11.177 4.038   -4.583  1.00 0.00 ? 33  VAL A HG21 5  
ATOM   8807  H HG22 . VAL A 1 33  ? -9.757  5.087   -4.484  1.00 0.00 ? 33  VAL A HG22 5  
ATOM   8808  H HG23 . VAL A 1 33  ? -10.216 4.092   -3.100  1.00 0.00 ? 33  VAL A HG23 5  
ATOM   8809  N N    . ASP A 1 34  ? -10.036 4.002   -7.740  1.00 0.00 ? 34  ASP A N    5  
ATOM   8810  C CA   . ASP A 1 34  ? -10.771 4.911   -8.609  1.00 0.00 ? 34  ASP A CA   5  
ATOM   8811  C C    . ASP A 1 34  ? -12.107 5.244   -7.976  1.00 0.00 ? 34  ASP A C    5  
ATOM   8812  O O    . ASP A 1 34  ? -13.145 4.769   -8.415  1.00 0.00 ? 34  ASP A O    5  
ATOM   8813  C CB   . ASP A 1 34  ? -10.973 4.319   -10.012 1.00 0.00 ? 34  ASP A CB   5  
ATOM   8814  C CG   . ASP A 1 34  ? -9.665  4.136   -10.760 1.00 0.00 ? 34  ASP A CG   5  
ATOM   8815  O OD1  . ASP A 1 34  ? -9.205  5.102   -11.410 1.00 0.00 ? 34  ASP A OD1  5  
ATOM   8816  O OD2  . ASP A 1 34  ? -9.086  3.031   -10.706 1.00 0.00 ? 34  ASP A OD2  5  
ATOM   8817  H H    . ASP A 1 34  ? -10.140 3.030   -7.851  1.00 0.00 ? 34  ASP A H    5  
ATOM   8818  H HA   . ASP A 1 34  ? -10.198 5.821   -8.694  1.00 0.00 ? 34  ASP A HA   5  
ATOM   8819  H HB2  . ASP A 1 34  ? -11.460 3.360   -9.929  1.00 0.00 ? 34  ASP A HB2  5  
ATOM   8820  H HB3  . ASP A 1 34  ? -11.602 4.984   -10.585 1.00 0.00 ? 34  ASP A HB3  5  
ATOM   8821  N N    . ALA A 1 35  ? -12.061 6.066   -6.930  1.00 0.00 ? 35  ALA A N    5  
ATOM   8822  C CA   . ALA A 1 35  ? -13.244 6.406   -6.143  1.00 0.00 ? 35  ALA A CA   5  
ATOM   8823  C C    . ALA A 1 35  ? -14.373 6.952   -7.019  1.00 0.00 ? 35  ALA A C    5  
ATOM   8824  O O    . ALA A 1 35  ? -15.549 6.779   -6.701  1.00 0.00 ? 35  ALA A O    5  
ATOM   8825  C CB   . ALA A 1 35  ? -12.883 7.406   -5.050  1.00 0.00 ? 35  ALA A CB   5  
ATOM   8826  H H    . ALA A 1 35  ? -11.195 6.459   -6.684  1.00 0.00 ? 35  ALA A H    5  
ATOM   8827  H HA   . ALA A 1 35  ? -13.587 5.501   -5.662  1.00 0.00 ? 35  ALA A HA   5  
ATOM   8828  H HB1  . ALA A 1 35  ? -12.880 6.909   -4.083  1.00 0.00 ? 35  ALA A HB1  5  
ATOM   8829  H HB2  . ALA A 1 35  ? -13.608 8.204   -5.039  1.00 0.00 ? 35  ALA A HB2  5  
ATOM   8830  H HB3  . ALA A 1 35  ? -11.902 7.813   -5.246  1.00 0.00 ? 35  ALA A HB3  5  
ATOM   8831  N N    . SER A 1 36  ? -14.016 7.598   -8.122  1.00 0.00 ? 36  SER A N    5  
ATOM   8832  C CA   . SER A 1 36  ? -15.006 8.101   -9.065  1.00 0.00 ? 36  SER A CA   5  
ATOM   8833  C C    . SER A 1 36  ? -15.753 6.943   -9.735  1.00 0.00 ? 36  SER A C    5  
ATOM   8834  O O    . SER A 1 36  ? -16.979 6.959   -9.839  1.00 0.00 ? 36  SER A O    5  
ATOM   8835  C CB   . SER A 1 36  ? -14.331 8.978   -10.125 1.00 0.00 ? 36  SER A CB   5  
ATOM   8836  O OG   . SER A 1 36  ? -15.282 9.536   -11.017 1.00 0.00 ? 36  SER A OG   5  
ATOM   8837  H H    . SER A 1 36  ? -13.062 7.748   -8.302  1.00 0.00 ? 36  SER A H    5  
ATOM   8838  H HA   . SER A 1 36  ? -15.716 8.699   -8.514  1.00 0.00 ? 36  SER A HA   5  
ATOM   8839  H HB2  . SER A 1 36  ? -13.802 9.783   -9.636  1.00 0.00 ? 36  SER A HB2  5  
ATOM   8840  H HB3  . SER A 1 36  ? -13.633 8.380   -10.691 1.00 0.00 ? 36  SER A HB3  5  
ATOM   8841  H HG   . SER A 1 36  ? -16.049 9.844   -10.518 1.00 0.00 ? 36  SER A HG   5  
ATOM   8842  N N    . ALA A 1 37  ? -15.007 5.931   -10.161 1.00 0.00 ? 37  ALA A N    5  
ATOM   8843  C CA   . ALA A 1 37  ? -15.587 4.780   -10.847 1.00 0.00 ? 37  ALA A CA   5  
ATOM   8844  C C    . ALA A 1 37  ? -16.164 3.784   -9.845  1.00 0.00 ? 37  ALA A C    5  
ATOM   8845  O O    . ALA A 1 37  ? -17.072 3.014   -10.160 1.00 0.00 ? 37  ALA A O    5  
ATOM   8846  C CB   . ALA A 1 37  ? -14.530 4.113   -11.714 1.00 0.00 ? 37  ALA A CB   5  
ATOM   8847  H H    . ALA A 1 37  ? -14.040 5.951   -10.003 1.00 0.00 ? 37  ALA A H    5  
ATOM   8848  H HA   . ALA A 1 37  ? -16.380 5.134   -11.489 1.00 0.00 ? 37  ALA A HA   5  
ATOM   8849  H HB1  . ALA A 1 37  ? -13.666 3.873   -11.106 1.00 0.00 ? 37  ALA A HB1  5  
ATOM   8850  H HB2  . ALA A 1 37  ? -14.239 4.785   -12.507 1.00 0.00 ? 37  ALA A HB2  5  
ATOM   8851  H HB3  . ALA A 1 37  ? -14.933 3.206   -12.139 1.00 0.00 ? 37  ALA A HB3  5  
ATOM   8852  N N    . LEU A 1 38  ? -15.627 3.817   -8.638  1.00 0.00 ? 38  LEU A N    5  
ATOM   8853  C CA   . LEU A 1 38  ? -16.054 2.930   -7.568  1.00 0.00 ? 38  LEU A CA   5  
ATOM   8854  C C    . LEU A 1 38  ? -17.322 3.445   -6.890  1.00 0.00 ? 38  LEU A C    5  
ATOM   8855  O O    . LEU A 1 38  ? -17.957 2.726   -6.120  1.00 0.00 ? 38  LEU A O    5  
ATOM   8856  C CB   . LEU A 1 38  ? -14.917 2.784   -6.551  1.00 0.00 ? 38  LEU A CB   5  
ATOM   8857  C CG   . LEU A 1 38  ? -13.731 1.943   -7.029  1.00 0.00 ? 38  LEU A CG   5  
ATOM   8858  C CD1  . LEU A 1 38  ? -12.484 2.240   -6.205  1.00 0.00 ? 38  LEU A CD1  5  
ATOM   8859  C CD2  . LEU A 1 38  ? -14.074 0.465   -6.960  1.00 0.00 ? 38  LEU A CD2  5  
ATOM   8860  H H    . LEU A 1 38  ? -14.899 4.452   -8.464  1.00 0.00 ? 38  LEU A H    5  
ATOM   8861  H HA   . LEU A 1 38  ? -16.259 1.964   -8.000  1.00 0.00 ? 38  LEU A HA   5  
ATOM   8862  H HB2  . LEU A 1 38  ? -14.554 3.771   -6.308  1.00 0.00 ? 38  LEU A HB2  5  
ATOM   8863  H HB3  . LEU A 1 38  ? -15.313 2.333   -5.655  1.00 0.00 ? 38  LEU A HB3  5  
ATOM   8864  H HG   . LEU A 1 38  ? -13.517 2.188   -8.059  1.00 0.00 ? 38  LEU A HG   5  
ATOM   8865  H HD11 . LEU A 1 38  ? -12.692 2.112   -5.154  1.00 0.00 ? 38  LEU A HD11 5  
ATOM   8866  H HD12 . LEU A 1 38  ? -12.171 3.258   -6.387  1.00 0.00 ? 38  LEU A HD12 5  
ATOM   8867  H HD13 . LEU A 1 38  ? -11.693 1.566   -6.499  1.00 0.00 ? 38  LEU A HD13 5  
ATOM   8868  H HD21 . LEU A 1 38  ? -14.233 0.181   -5.929  1.00 0.00 ? 38  LEU A HD21 5  
ATOM   8869  H HD22 . LEU A 1 38  ? -13.263 -0.114  -7.372  1.00 0.00 ? 38  LEU A HD22 5  
ATOM   8870  H HD23 . LEU A 1 38  ? -14.974 0.278   -7.525  1.00 0.00 ? 38  LEU A HD23 5  
ATOM   8871  N N    . GLY A 1 39  ? -17.688 4.687   -7.183  1.00 0.00 ? 39  GLY A N    5  
ATOM   8872  C CA   . GLY A 1 39  ? -18.884 5.272   -6.598  1.00 0.00 ? 39  GLY A CA   5  
ATOM   8873  C C    . GLY A 1 39  ? -18.638 5.806   -5.202  1.00 0.00 ? 39  GLY A C    5  
ATOM   8874  O O    . GLY A 1 39  ? -19.570 6.188   -4.494  1.00 0.00 ? 39  GLY A O    5  
ATOM   8875  H H    . GLY A 1 39  ? -17.149 5.211   -7.812  1.00 0.00 ? 39  GLY A H    5  
ATOM   8876  H HA2  . GLY A 1 39  ? -19.224 6.080   -7.227  1.00 0.00 ? 39  GLY A HA2  5  
ATOM   8877  H HA3  . GLY A 1 39  ? -19.654 4.517   -6.552  1.00 0.00 ? 39  GLY A HA3  5  
ATOM   8878  N N    . LEU A 1 40  ? -17.377 5.841   -4.812  1.00 0.00 ? 40  LEU A N    5  
ATOM   8879  C CA   . LEU A 1 40  ? -16.994 6.273   -3.480  1.00 0.00 ? 40  LEU A CA   5  
ATOM   8880  C C    . LEU A 1 40  ? -16.887 7.791   -3.425  1.00 0.00 ? 40  LEU A C    5  
ATOM   8881  O O    . LEU A 1 40  ? -15.852 8.366   -3.762  1.00 0.00 ? 40  LEU A O    5  
ATOM   8882  C CB   . LEU A 1 40  ? -15.658 5.638   -3.096  1.00 0.00 ? 40  LEU A CB   5  
ATOM   8883  C CG   . LEU A 1 40  ? -15.497 4.170   -3.499  1.00 0.00 ? 40  LEU A CG   5  
ATOM   8884  C CD1  . LEU A 1 40  ? -14.227 3.592   -2.903  1.00 0.00 ? 40  LEU A CD1  5  
ATOM   8885  C CD2  . LEU A 1 40  ? -16.712 3.350   -3.097  1.00 0.00 ? 40  LEU A CD2  5  
ATOM   8886  H H    . LEU A 1 40  ? -16.680 5.562   -5.437  1.00 0.00 ? 40  LEU A H    5  
ATOM   8887  H HA   . LEU A 1 40  ? -17.755 5.946   -2.788  1.00 0.00 ? 40  LEU A HA   5  
ATOM   8888  H HB2  . LEU A 1 40  ? -14.868 6.203   -3.567  1.00 0.00 ? 40  LEU A HB2  5  
ATOM   8889  H HB3  . LEU A 1 40  ? -15.543 5.709   -2.025  1.00 0.00 ? 40  LEU A HB3  5  
ATOM   8890  H HG   . LEU A 1 40  ? -15.405 4.118   -4.572  1.00 0.00 ? 40  LEU A HG   5  
ATOM   8891  H HD11 . LEU A 1 40  ? -13.420 3.715   -3.600  1.00 0.00 ? 40  LEU A HD11 5  
ATOM   8892  H HD12 . LEU A 1 40  ? -14.365 2.546   -2.699  1.00 0.00 ? 40  LEU A HD12 5  
ATOM   8893  H HD13 . LEU A 1 40  ? -13.991 4.109   -1.985  1.00 0.00 ? 40  LEU A HD13 5  
ATOM   8894  H HD21 . LEU A 1 40  ? -16.854 3.417   -2.039  1.00 0.00 ? 40  LEU A HD21 5  
ATOM   8895  H HD22 . LEU A 1 40  ? -16.561 2.319   -3.378  1.00 0.00 ? 40  LEU A HD22 5  
ATOM   8896  H HD23 . LEU A 1 40  ? -17.586 3.734   -3.603  1.00 0.00 ? 40  LEU A HD23 5  
ATOM   8897  N N    . HIS A 1 41  ? -17.966 8.435   -3.007  1.00 0.00 ? 41  HIS A N    5  
ATOM   8898  C CA   . HIS A 1 41  ? -18.022 9.895   -2.964  1.00 0.00 ? 41  HIS A CA   5  
ATOM   8899  C C    . HIS A 1 41  ? -17.429 10.434  -1.668  1.00 0.00 ? 41  HIS A C    5  
ATOM   8900  O O    . HIS A 1 41  ? -17.395 11.645  -1.452  1.00 0.00 ? 41  HIS A O    5  
ATOM   8901  C CB   . HIS A 1 41  ? -19.470 10.392  -3.098  1.00 0.00 ? 41  HIS A CB   5  
ATOM   8902  C CG   . HIS A 1 41  ? -20.158 9.987   -4.376  1.00 0.00 ? 41  HIS A CG   5  
ATOM   8903  N ND1  . HIS A 1 41  ? -20.062 10.725  -5.532  1.00 0.00 ? 41  HIS A ND1  5  
ATOM   8904  C CD2  . HIS A 1 41  ? -20.962 8.925   -4.682  1.00 0.00 ? 41  HIS A CD2  5  
ATOM   8905  C CE1  . HIS A 1 41  ? -20.764 10.146  -6.487  1.00 0.00 ? 41  HIS A CE1  5  
ATOM   8906  N NE2  . HIS A 1 41  ? -21.318 9.054   -5.999  1.00 0.00 ? 41  HIS A NE2  5  
ATOM   8907  H H    . HIS A 1 41  ? -18.747 7.917   -2.720  1.00 0.00 ? 41  HIS A H    5  
ATOM   8908  H HA   . HIS A 1 41  ? -17.438 10.278  -3.793  1.00 0.00 ? 41  HIS A HA   5  
ATOM   8909  H HB2  . HIS A 1 41  ? -20.049 10.013  -2.270  1.00 0.00 ? 41  HIS A HB2  5  
ATOM   8910  H HB3  . HIS A 1 41  ? -19.469 11.474  -3.054  1.00 0.00 ? 41  HIS A HB3  5  
ATOM   8911  H HD1  . HIS A 1 41  ? -19.550 11.560  -5.640  1.00 0.00 ? 41  HIS A HD1  5  
ATOM   8912  H HD2  . HIS A 1 41  ? -21.272 8.125   -4.015  1.00 0.00 ? 41  HIS A HD2  5  
ATOM   8913  H HE1  . HIS A 1 41  ? -20.864 10.505  -7.501  1.00 0.00 ? 41  HIS A HE1  5  
ATOM   8914  H HE2  . HIS A 1 41  ? -21.706 8.335   -6.547  1.00 0.00 ? 41  HIS A HE2  5  
ATOM   8915  N N    . ASP A 1 42  ? -16.971 9.540   -0.804  1.00 0.00 ? 42  ASP A N    5  
ATOM   8916  C CA   . ASP A 1 42  ? -16.435 9.946   0.491   1.00 0.00 ? 42  ASP A CA   5  
ATOM   8917  C C    . ASP A 1 42  ? -15.020 9.423   0.727   1.00 0.00 ? 42  ASP A C    5  
ATOM   8918  O O    . ASP A 1 42  ? -14.560 9.357   1.866   1.00 0.00 ? 42  ASP A O    5  
ATOM   8919  C CB   . ASP A 1 42  ? -17.358 9.480   1.625   1.00 0.00 ? 42  ASP A CB   5  
ATOM   8920  C CG   . ASP A 1 42  ? -17.829 8.044   1.464   1.00 0.00 ? 42  ASP A CG   5  
ATOM   8921  O OD1  . ASP A 1 42  ? -17.046 7.193   0.988   1.00 0.00 ? 42  ASP A OD1  5  
ATOM   8922  O OD2  . ASP A 1 42  ? -19.000 7.768   1.807   1.00 0.00 ? 42  ASP A OD2  5  
ATOM   8923  H H    . ASP A 1 42  ? -17.002 8.586   -1.033  1.00 0.00 ? 42  ASP A H    5  
ATOM   8924  H HA   . ASP A 1 42  ? -16.404 11.025  0.497   1.00 0.00 ? 42  ASP A HA   5  
ATOM   8925  H HB2  . ASP A 1 42  ? -16.829 9.558   2.563   1.00 0.00 ? 42  ASP A HB2  5  
ATOM   8926  H HB3  . ASP A 1 42  ? -18.227 10.121  1.656   1.00 0.00 ? 42  ASP A HB3  5  
ATOM   8927  N N    . TYR A 1 43  ? -14.308 9.093   -0.343  1.00 0.00 ? 43  TYR A N    5  
ATOM   8928  C CA   . TYR A 1 43  ? -12.978 8.520   -0.211  1.00 0.00 ? 43  TYR A CA   5  
ATOM   8929  C C    . TYR A 1 43  ? -11.987 9.531   0.362   1.00 0.00 ? 43  TYR A C    5  
ATOM   8930  O O    . TYR A 1 43  ? -11.159 9.188   1.205   1.00 0.00 ? 43  TYR A O    5  
ATOM   8931  C CB   . TYR A 1 43  ? -12.503 7.985   -1.568  1.00 0.00 ? 43  TYR A CB   5  
ATOM   8932  C CG   . TYR A 1 43  ? -11.082 7.471   -1.582  1.00 0.00 ? 43  TYR A CG   5  
ATOM   8933  C CD1  . TYR A 1 43  ? -10.797 6.169   -1.208  1.00 0.00 ? 43  TYR A CD1  5  
ATOM   8934  C CD2  . TYR A 1 43  ? -10.032 8.284   -1.981  1.00 0.00 ? 43  TYR A CD2  5  
ATOM   8935  C CE1  . TYR A 1 43  ? -9.503  5.687   -1.227  1.00 0.00 ? 43  TYR A CE1  5  
ATOM   8936  C CE2  . TYR A 1 43  ? -8.739  7.813   -2.003  1.00 0.00 ? 43  TYR A CE2  5  
ATOM   8937  C CZ   . TYR A 1 43  ? -8.477  6.515   -1.625  1.00 0.00 ? 43  TYR A CZ   5  
ATOM   8938  O OH   . TYR A 1 43  ? -7.183  6.047   -1.651  1.00 0.00 ? 43  TYR A OH   5  
ATOM   8939  H H    . TYR A 1 43  ? -14.678 9.244   -1.241  1.00 0.00 ? 43  TYR A H    5  
ATOM   8940  H HA   . TYR A 1 43  ? -13.052 7.699   0.481   1.00 0.00 ? 43  TYR A HA   5  
ATOM   8941  H HB2  . TYR A 1 43  ? -13.143 7.170   -1.860  1.00 0.00 ? 43  TYR A HB2  5  
ATOM   8942  H HB3  . TYR A 1 43  ? -12.578 8.768   -2.307  1.00 0.00 ? 43  TYR A HB3  5  
ATOM   8943  H HD1  . TYR A 1 43  ? -11.603 5.529   -0.899  1.00 0.00 ? 43  TYR A HD1  5  
ATOM   8944  H HD2  . TYR A 1 43  ? -10.237 9.303   -2.277  1.00 0.00 ? 43  TYR A HD2  5  
ATOM   8945  H HE1  . TYR A 1 43  ? -9.302  4.667   -0.937  1.00 0.00 ? 43  TYR A HE1  5  
ATOM   8946  H HE2  . TYR A 1 43  ? -7.940  8.459   -2.317  1.00 0.00 ? 43  TYR A HE2  5  
ATOM   8947  H HH   . TYR A 1 43  ? -7.188  5.099   -1.809  1.00 0.00 ? 43  TYR A HH   5  
ATOM   8948  N N    . HIS A 1 44  ? -12.096 10.781  -0.061  1.00 0.00 ? 44  HIS A N    5  
ATOM   8949  C CA   . HIS A 1 44  ? -11.168 11.811  0.397   1.00 0.00 ? 44  HIS A CA   5  
ATOM   8950  C C    . HIS A 1 44  ? -11.610 12.390  1.738   1.00 0.00 ? 44  HIS A C    5  
ATOM   8951  O O    . HIS A 1 44  ? -10.943 13.257  2.305   1.00 0.00 ? 44  HIS A O    5  
ATOM   8952  C CB   . HIS A 1 44  ? -11.019 12.922  -0.646  1.00 0.00 ? 44  HIS A CB   5  
ATOM   8953  C CG   . HIS A 1 44  ? -10.224 12.511  -1.849  1.00 0.00 ? 44  HIS A CG   5  
ATOM   8954  N ND1  . HIS A 1 44  ? -8.863  12.706  -1.954  1.00 0.00 ? 44  HIS A ND1  5  
ATOM   8955  C CD2  . HIS A 1 44  ? -10.603 11.909  -3.002  1.00 0.00 ? 44  HIS A CD2  5  
ATOM   8956  C CE1  . HIS A 1 44  ? -8.441  12.241  -3.116  1.00 0.00 ? 44  HIS A CE1  5  
ATOM   8957  N NE2  . HIS A 1 44  ? -9.477  11.753  -3.768  1.00 0.00 ? 44  HIS A NE2  5  
ATOM   8958  H H    . HIS A 1 44  ? -12.819 11.021  -0.680  1.00 0.00 ? 44  HIS A H    5  
ATOM   8959  H HA   . HIS A 1 44  ? -10.208 11.337  0.535   1.00 0.00 ? 44  HIS A HA   5  
ATOM   8960  H HB2  . HIS A 1 44  ? -11.998 13.224  -0.984  1.00 0.00 ? 44  HIS A HB2  5  
ATOM   8961  H HB3  . HIS A 1 44  ? -10.524 13.767  -0.192  1.00 0.00 ? 44  HIS A HB3  5  
ATOM   8962  H HD1  . HIS A 1 44  ? -8.284  13.126  -1.272  1.00 0.00 ? 44  HIS A HD1  5  
ATOM   8963  H HD2  . HIS A 1 44  ? -11.606 11.612  -3.270  1.00 0.00 ? 44  HIS A HD2  5  
ATOM   8964  H HE1  . HIS A 1 44  ? -7.421  12.255  -3.470  1.00 0.00 ? 44  HIS A HE1  5  
ATOM   8965  H HE2  . HIS A 1 44  ? -9.429  11.260  -4.621  1.00 0.00 ? 44  HIS A HE2  5  
ATOM   8966  N N    . ASP A 1 45  ? -12.740 11.910  2.241   1.00 0.00 ? 45  ASP A N    5  
ATOM   8967  C CA   . ASP A 1 45  ? -13.215 12.305  3.563   1.00 0.00 ? 45  ASP A CA   5  
ATOM   8968  C C    . ASP A 1 45  ? -12.624 11.397  4.630   1.00 0.00 ? 45  ASP A C    5  
ATOM   8969  O O    . ASP A 1 45  ? -12.401 11.815  5.766   1.00 0.00 ? 45  ASP A O    5  
ATOM   8970  C CB   . ASP A 1 45  ? -14.743 12.249  3.647   1.00 0.00 ? 45  ASP A CB   5  
ATOM   8971  C CG   . ASP A 1 45  ? -15.425 13.322  2.825   1.00 0.00 ? 45  ASP A CG   5  
ATOM   8972  O OD1  . ASP A 1 45  ? -15.526 14.468  3.307   1.00 0.00 ? 45  ASP A OD1  5  
ATOM   8973  O OD2  . ASP A 1 45  ? -15.882 13.029  1.703   1.00 0.00 ? 45  ASP A OD2  5  
ATOM   8974  H H    . ASP A 1 45  ? -13.268 11.277  1.710   1.00 0.00 ? 45  ASP A H    5  
ATOM   8975  H HA   . ASP A 1 45  ? -12.888 13.318  3.746   1.00 0.00 ? 45  ASP A HA   5  
ATOM   8976  H HB2  . ASP A 1 45  ? -15.078 11.287  3.295   1.00 0.00 ? 45  ASP A HB2  5  
ATOM   8977  H HB3  . ASP A 1 45  ? -15.041 12.369  4.677   1.00 0.00 ? 45  ASP A HB3  5  
ATOM   8978  N N    . ILE A 1 46  ? -12.382 10.147  4.259   1.00 0.00 ? 46  ILE A N    5  
ATOM   8979  C CA   . ILE A 1 46  ? -11.866 9.155   5.195   1.00 0.00 ? 46  ILE A CA   5  
ATOM   8980  C C    . ILE A 1 46  ? -10.346 9.039   5.093   1.00 0.00 ? 46  ILE A C    5  
ATOM   8981  O O    . ILE A 1 46  ? -9.645  9.013   6.106   1.00 0.00 ? 46  ILE A O    5  
ATOM   8982  C CB   . ILE A 1 46  ? -12.526 7.764   4.965   1.00 0.00 ? 46  ILE A CB   5  
ATOM   8983  C CG1  . ILE A 1 46  ? -13.954 7.721   5.511   1.00 0.00 ? 46  ILE A CG1  5  
ATOM   8984  C CG2  . ILE A 1 46  ? -11.718 6.647   5.612   1.00 0.00 ? 46  ILE A CG2  5  
ATOM   8985  C CD1  . ILE A 1 46  ? -14.933 8.652   4.827   1.00 0.00 ? 46  ILE A CD1  5  
ATOM   8986  H H    . ILE A 1 46  ? -12.567 9.880   3.333   1.00 0.00 ? 46  ILE A H    5  
ATOM   8987  H HA   . ILE A 1 46  ? -12.121 9.484   6.192   1.00 0.00 ? 46  ILE A HA   5  
ATOM   8988  H HB   . ILE A 1 46  ? -12.555 7.580   3.896   1.00 0.00 ? 46  ILE A HB   5  
ATOM   8989  H HG12 . ILE A 1 46  ? -14.323 6.718   5.394   1.00 0.00 ? 46  ILE A HG12 5  
ATOM   8990  H HG13 . ILE A 1 46  ? -13.937 7.972   6.564   1.00 0.00 ? 46  ILE A HG13 5  
ATOM   8991  H HG21 . ILE A 1 46  ? -10.948 6.319   4.941   1.00 0.00 ? 46  ILE A HG21 5  
ATOM   8992  H HG22 . ILE A 1 46  ? -12.371 5.818   5.842   1.00 0.00 ? 46  ILE A HG22 5  
ATOM   8993  H HG23 . ILE A 1 46  ? -11.268 7.011   6.523   1.00 0.00 ? 46  ILE A HG23 5  
ATOM   8994  H HD11 . ILE A 1 46  ? -14.935 8.463   3.763   1.00 0.00 ? 46  ILE A HD11 5  
ATOM   8995  H HD12 . ILE A 1 46  ? -14.639 9.675   5.009   1.00 0.00 ? 46  ILE A HD12 5  
ATOM   8996  H HD13 . ILE A 1 46  ? -15.923 8.488   5.224   1.00 0.00 ? 46  ILE A HD13 5  
ATOM   8997  N N    . ILE A 1 47  ? -9.835  8.988   3.873   1.00 0.00 ? 47  ILE A N    5  
ATOM   8998  C CA   . ILE A 1 47  ? -8.408  8.796   3.662   1.00 0.00 ? 47  ILE A CA   5  
ATOM   8999  C C    . ILE A 1 47  ? -7.664  10.127  3.670   1.00 0.00 ? 47  ILE A C    5  
ATOM   9000  O O    . ILE A 1 47  ? -7.789  10.922  2.739   1.00 0.00 ? 47  ILE A O    5  
ATOM   9001  C CB   . ILE A 1 47  ? -8.123  8.084   2.326   1.00 0.00 ? 47  ILE A CB   5  
ATOM   9002  C CG1  . ILE A 1 47  ? -8.938  6.793   2.211   1.00 0.00 ? 47  ILE A CG1  5  
ATOM   9003  C CG2  . ILE A 1 47  ? -6.636  7.790   2.208   1.00 0.00 ? 47  ILE A CG2  5  
ATOM   9004  C CD1  . ILE A 1 47  ? -8.460  5.690   3.118   1.00 0.00 ? 47  ILE A CD1  5  
ATOM   9005  H H    . ILE A 1 47  ? -10.428 9.084   3.096   1.00 0.00 ? 47  ILE A H    5  
ATOM   9006  H HA   . ILE A 1 47  ? -8.031  8.178   4.462   1.00 0.00 ? 47  ILE A HA   5  
ATOM   9007  H HB   . ILE A 1 47  ? -8.398  8.749   1.523   1.00 0.00 ? 47  ILE A HB   5  
ATOM   9008  H HG12 . ILE A 1 47  ? -9.963  7.001   2.470   1.00 0.00 ? 47  ILE A HG12 5  
ATOM   9009  H HG13 . ILE A 1 47  ? -8.892  6.433   1.194   1.00 0.00 ? 47  ILE A HG13 5  
ATOM   9010  H HG21 . ILE A 1 47  ? -6.467  7.086   1.413   1.00 0.00 ? 47  ILE A HG21 5  
ATOM   9011  H HG22 . ILE A 1 47  ? -6.277  7.375   3.137   1.00 0.00 ? 47  ILE A HG22 5  
ATOM   9012  H HG23 . ILE A 1 47  ? -6.104  8.706   1.997   1.00 0.00 ? 47  ILE A HG23 5  
ATOM   9013  H HD11 . ILE A 1 47  ? -8.476  6.036   4.137   1.00 0.00 ? 47  ILE A HD11 5  
ATOM   9014  H HD12 . ILE A 1 47  ? -7.456  5.412   2.843   1.00 0.00 ? 47  ILE A HD12 5  
ATOM   9015  H HD13 . ILE A 1 47  ? -9.106  4.837   3.017   1.00 0.00 ? 47  ILE A HD13 5  
ATOM   9016  N N    . LYS A 1 48  ? -6.908  10.377  4.732   1.00 0.00 ? 48  LYS A N    5  
ATOM   9017  C CA   . LYS A 1 48  ? -6.081  11.565  4.816   1.00 0.00 ? 48  LYS A CA   5  
ATOM   9018  C C    . LYS A 1 48  ? -4.704  11.337  4.202   1.00 0.00 ? 48  LYS A C    5  
ATOM   9019  O O    . LYS A 1 48  ? -4.039  12.281  3.785   1.00 0.00 ? 48  LYS A O    5  
ATOM   9020  C CB   . LYS A 1 48  ? -5.935  12.015  6.264   1.00 0.00 ? 48  LYS A CB   5  
ATOM   9021  C CG   . LYS A 1 48  ? -7.116  12.836  6.736   1.00 0.00 ? 48  LYS A CG   5  
ATOM   9022  C CD   . LYS A 1 48  ? -8.404  12.043  6.677   1.00 0.00 ? 48  LYS A CD   5  
ATOM   9023  C CE   . LYS A 1 48  ? -9.618  12.944  6.723   1.00 0.00 ? 48  LYS A CE   5  
ATOM   9024  N NZ   . LYS A 1 48  ? -9.566  13.915  7.846   1.00 0.00 ? 48  LYS A NZ   5  
ATOM   9025  H H    . LYS A 1 48  ? -6.932  9.768   5.493   1.00 0.00 ? 48  LYS A H    5  
ATOM   9026  H HA   . LYS A 1 48  ? -6.589  12.344  4.273   1.00 0.00 ? 48  LYS A HA   5  
ATOM   9027  H HB2  . LYS A 1 48  ? -5.846  11.145  6.896   1.00 0.00 ? 48  LYS A HB2  5  
ATOM   9028  H HB3  . LYS A 1 48  ? -5.042  12.612  6.350   1.00 0.00 ? 48  LYS A HB3  5  
ATOM   9029  H HG2  . LYS A 1 48  ? -6.943  13.157  7.751   1.00 0.00 ? 48  LYS A HG2  5  
ATOM   9030  H HG3  . LYS A 1 48  ? -7.213  13.692  6.093   1.00 0.00 ? 48  LYS A HG3  5  
ATOM   9031  H HD2  . LYS A 1 48  ? -8.417  11.502  5.741   1.00 0.00 ? 48  LYS A HD2  5  
ATOM   9032  H HD3  . LYS A 1 48  ? -8.437  11.350  7.505   1.00 0.00 ? 48  LYS A HD3  5  
ATOM   9033  H HE2  . LYS A 1 48  ? -9.667  13.484  5.792   1.00 0.00 ? 48  LYS A HE2  5  
ATOM   9034  H HE3  . LYS A 1 48  ? -10.501 12.330  6.827   1.00 0.00 ? 48  LYS A HE3  5  
ATOM   9035  H HZ1  . LYS A 1 48  ? -9.517  13.413  8.755   1.00 0.00 ? 48  LYS A HZ1  5  
ATOM   9036  H HZ2  . LYS A 1 48  ? -10.414 14.516  7.838   1.00 0.00 ? 48  LYS A HZ2  5  
ATOM   9037  H HZ3  . LYS A 1 48  ? -8.729  14.524  7.754   1.00 0.00 ? 48  LYS A HZ3  5  
ATOM   9038  N N    . HIS A 1 49  ? -4.276  10.081  4.154   1.00 0.00 ? 49  HIS A N    5  
ATOM   9039  C CA   . HIS A 1 49  ? -2.983  9.733   3.561   1.00 0.00 ? 49  HIS A CA   5  
ATOM   9040  C C    . HIS A 1 49  ? -3.144  8.752   2.395   1.00 0.00 ? 49  HIS A C    5  
ATOM   9041  O O    . HIS A 1 49  ? -2.767  7.585   2.512   1.00 0.00 ? 49  HIS A O    5  
ATOM   9042  C CB   . HIS A 1 49  ? -2.054  9.123   4.614   1.00 0.00 ? 49  HIS A CB   5  
ATOM   9043  C CG   . HIS A 1 49  ? -1.561  10.106  5.629   1.00 0.00 ? 49  HIS A CG   5  
ATOM   9044  N ND1  . HIS A 1 49  ? -0.405  10.836  5.467   1.00 0.00 ? 49  HIS A ND1  5  
ATOM   9045  C CD2  . HIS A 1 49  ? -2.071  10.476  6.825   1.00 0.00 ? 49  HIS A CD2  5  
ATOM   9046  C CE1  . HIS A 1 49  ? -0.224  11.610  6.518   1.00 0.00 ? 49  HIS A CE1  5  
ATOM   9047  N NE2  . HIS A 1 49  ? -1.222  11.412  7.357   1.00 0.00 ? 49  HIS A NE2  5  
ATOM   9048  H H    . HIS A 1 49  ? -4.838  9.370   4.531   1.00 0.00 ? 49  HIS A H    5  
ATOM   9049  H HA   . HIS A 1 49  ? -2.530  10.642  3.192   1.00 0.00 ? 49  HIS A HA   5  
ATOM   9050  H HB2  . HIS A 1 49  ? -2.585  8.343   5.140   1.00 0.00 ? 49  HIS A HB2  5  
ATOM   9051  H HB3  . HIS A 1 49  ? -1.195  8.695   4.119   1.00 0.00 ? 49  HIS A HB3  5  
ATOM   9052  H HD1  . HIS A 1 49  ? 0.199   10.790  4.692   1.00 0.00 ? 49  HIS A HD1  5  
ATOM   9053  H HD2  . HIS A 1 49  ? -2.977  10.100  7.279   1.00 0.00 ? 49  HIS A HD2  5  
ATOM   9054  H HE1  . HIS A 1 49  ? 0.599   12.291  6.664   1.00 0.00 ? 49  HIS A HE1  5  
ATOM   9055  H HE2  . HIS A 1 49  ? -1.233  11.715  8.291   1.00 0.00 ? 49  HIS A HE2  5  
ATOM   9056  N N    . PRO A 1 50  ? -3.719  9.200   1.261   1.00 0.00 ? 50  PRO A N    5  
ATOM   9057  C CA   . PRO A 1 50  ? -3.859  8.358   0.064   1.00 0.00 ? 50  PRO A CA   5  
ATOM   9058  C C    . PRO A 1 50  ? -2.516  8.096   -0.620  1.00 0.00 ? 50  PRO A C    5  
ATOM   9059  O O    . PRO A 1 50  ? -1.969  8.965   -1.304  1.00 0.00 ? 50  PRO A O    5  
ATOM   9060  C CB   . PRO A 1 50  ? -4.776  9.181   -0.845  1.00 0.00 ? 50  PRO A CB   5  
ATOM   9061  C CG   . PRO A 1 50  ? -4.555  10.591  -0.425  1.00 0.00 ? 50  PRO A CG   5  
ATOM   9062  C CD   . PRO A 1 50  ? -4.298  10.543  1.056   1.00 0.00 ? 50  PRO A CD   5  
ATOM   9063  H HA   . PRO A 1 50  ? -4.331  7.415   0.299   1.00 0.00 ? 50  PRO A HA   5  
ATOM   9064  H HB2  . PRO A 1 50  ? -4.497  9.025   -1.876  1.00 0.00 ? 50  PRO A HB2  5  
ATOM   9065  H HB3  . PRO A 1 50  ? -5.802  8.880   -0.694  1.00 0.00 ? 50  PRO A HB3  5  
ATOM   9066  H HG2  . PRO A 1 50  ? -3.700  10.999  -0.947  1.00 0.00 ? 50  PRO A HG2  5  
ATOM   9067  H HG3  . PRO A 1 50  ? -5.437  11.177  -0.634  1.00 0.00 ? 50  PRO A HG3  5  
ATOM   9068  H HD2  . PRO A 1 50  ? -3.598  11.314  1.347   1.00 0.00 ? 50  PRO A HD2  5  
ATOM   9069  H HD3  . PRO A 1 50  ? -5.227  10.647  1.603   1.00 0.00 ? 50  PRO A HD3  5  
ATOM   9070  N N    . MET A 1 51  ? -1.988  6.898   -0.422  1.00 0.00 ? 51  MET A N    5  
ATOM   9071  C CA   . MET A 1 51  ? -0.705  6.526   -0.998  1.00 0.00 ? 51  MET A CA   5  
ATOM   9072  C C    . MET A 1 51  ? -0.784  5.154   -1.658  1.00 0.00 ? 51  MET A C    5  
ATOM   9073  O O    . MET A 1 51  ? -1.601  4.318   -1.270  1.00 0.00 ? 51  MET A O    5  
ATOM   9074  C CB   . MET A 1 51  ? 0.383   6.535   0.087   1.00 0.00 ? 51  MET A CB   5  
ATOM   9075  C CG   . MET A 1 51  ? 1.749   6.040   -0.390  1.00 0.00 ? 51  MET A CG   5  
ATOM   9076  S SD   . MET A 1 51  ? 2.331   6.926   -1.853  1.00 0.00 ? 51  MET A SD   5  
ATOM   9077  C CE   . MET A 1 51  ? 2.253   8.613   -1.273  1.00 0.00 ? 51  MET A CE   5  
ATOM   9078  H H    . MET A 1 51  ? -2.476  6.244   0.119   1.00 0.00 ? 51  MET A H    5  
ATOM   9079  H HA   . MET A 1 51  ? -0.457  7.263   -1.755  1.00 0.00 ? 51  MET A HA   5  
ATOM   9080  H HB2  . MET A 1 51  ? 0.501   7.547   0.440   1.00 0.00 ? 51  MET A HB2  5  
ATOM   9081  H HB3  . MET A 1 51  ? 0.060   5.912   0.913   1.00 0.00 ? 51  MET A HB3  5  
ATOM   9082  H HG2  . MET A 1 51  ? 2.470   6.173   0.409   1.00 0.00 ? 51  MET A HG2  5  
ATOM   9083  H HG3  . MET A 1 51  ? 1.674   4.987   -0.634  1.00 0.00 ? 51  MET A HG3  5  
ATOM   9084  H HE1  . MET A 1 51  ? 2.752   8.681   -0.327  1.00 0.00 ? 51  MET A HE1  5  
ATOM   9085  H HE2  . MET A 1 51  ? 1.221   8.909   -1.160  1.00 0.00 ? 51  MET A HE2  5  
ATOM   9086  H HE3  . MET A 1 51  ? 2.741   9.263   -1.985  1.00 0.00 ? 51  MET A HE3  5  
ATOM   9087  N N    . ASP A 1 52  ? 0.064   4.944   -2.656  1.00 0.00 ? 52  ASP A N    5  
ATOM   9088  C CA   . ASP A 1 52  ? 0.149   3.675   -3.363  1.00 0.00 ? 52  ASP A CA   5  
ATOM   9089  C C    . ASP A 1 52  ? 1.612   3.334   -3.628  1.00 0.00 ? 52  ASP A C    5  
ATOM   9090  O O    . ASP A 1 52  ? 2.473   4.215   -3.571  1.00 0.00 ? 52  ASP A O    5  
ATOM   9091  C CB   . ASP A 1 52  ? -0.625  3.731   -4.685  1.00 0.00 ? 52  ASP A CB   5  
ATOM   9092  C CG   . ASP A 1 52  ? -0.088  4.789   -5.627  1.00 0.00 ? 52  ASP A CG   5  
ATOM   9093  O OD1  . ASP A 1 52  ? 0.797   4.478   -6.444  1.00 0.00 ? 52  ASP A OD1  5  
ATOM   9094  O OD2  . ASP A 1 52  ? -0.551  5.948   -5.552  1.00 0.00 ? 52  ASP A OD2  5  
ATOM   9095  H H    . ASP A 1 52  ? 0.677   5.666   -2.915  1.00 0.00 ? 52  ASP A H    5  
ATOM   9096  H HA   . ASP A 1 52  ? -0.277  2.910   -2.729  1.00 0.00 ? 52  ASP A HA   5  
ATOM   9097  H HB2  . ASP A 1 52  ? -0.556  2.772   -5.176  1.00 0.00 ? 52  ASP A HB2  5  
ATOM   9098  H HB3  . ASP A 1 52  ? -1.664  3.951   -4.480  1.00 0.00 ? 52  ASP A HB3  5  
ATOM   9099  N N    . LEU A 1 53  ? 1.893   2.075   -3.926  1.00 0.00 ? 53  LEU A N    5  
ATOM   9100  C CA   . LEU A 1 53  ? 3.269   1.623   -4.134  1.00 0.00 ? 53  LEU A CA   5  
ATOM   9101  C C    . LEU A 1 53  ? 3.937   2.329   -5.308  1.00 0.00 ? 53  LEU A C    5  
ATOM   9102  O O    . LEU A 1 53  ? 5.133   2.627   -5.267  1.00 0.00 ? 53  LEU A O    5  
ATOM   9103  C CB   . LEU A 1 53  ? 3.304   0.110   -4.331  1.00 0.00 ? 53  LEU A CB   5  
ATOM   9104  C CG   . LEU A 1 53  ? 3.187   -0.695  -3.043  1.00 0.00 ? 53  LEU A CG   5  
ATOM   9105  C CD1  . LEU A 1 53  ? 2.898   -2.141  -3.358  1.00 0.00 ? 53  LEU A CD1  5  
ATOM   9106  C CD2  . LEU A 1 53  ? 4.453   -0.583  -2.219  1.00 0.00 ? 53  LEU A CD2  5  
ATOM   9107  H H    . LEU A 1 53  ? 1.155   1.428   -4.012  1.00 0.00 ? 53  LEU A H    5  
ATOM   9108  H HA   . LEU A 1 53  ? 3.824   1.859   -3.241  1.00 0.00 ? 53  LEU A HA   5  
ATOM   9109  H HB2  . LEU A 1 53  ? 2.487   -0.169  -4.980  1.00 0.00 ? 53  LEU A HB2  5  
ATOM   9110  H HB3  . LEU A 1 53  ? 4.229   -0.155  -4.815  1.00 0.00 ? 53  LEU A HB3  5  
ATOM   9111  H HG   . LEU A 1 53  ? 2.372   -0.300  -2.456  1.00 0.00 ? 53  LEU A HG   5  
ATOM   9112  H HD11 . LEU A 1 53  ? 2.084   -2.183  -4.051  1.00 0.00 ? 53  LEU A HD11 5  
ATOM   9113  H HD12 . LEU A 1 53  ? 2.630   -2.664  -2.451  1.00 0.00 ? 53  LEU A HD12 5  
ATOM   9114  H HD13 . LEU A 1 53  ? 3.772   -2.600  -3.797  1.00 0.00 ? 53  LEU A HD13 5  
ATOM   9115  H HD21 . LEU A 1 53  ? 4.551   0.424   -1.858  1.00 0.00 ? 53  LEU A HD21 5  
ATOM   9116  H HD22 . LEU A 1 53  ? 5.305   -0.831  -2.833  1.00 0.00 ? 53  LEU A HD22 5  
ATOM   9117  H HD23 . LEU A 1 53  ? 4.400   -1.264  -1.383  1.00 0.00 ? 53  LEU A HD23 5  
ATOM   9118  N N    . SER A 1 54  ? 3.161   2.622   -6.338  1.00 0.00 ? 54  SER A N    5  
ATOM   9119  C CA   . SER A 1 54  ? 3.705   3.268   -7.527  1.00 0.00 ? 54  SER A CA   5  
ATOM   9120  C C    . SER A 1 54  ? 4.125   4.713   -7.215  1.00 0.00 ? 54  SER A C    5  
ATOM   9121  O O    . SER A 1 54  ? 5.062   5.239   -7.821  1.00 0.00 ? 54  SER A O    5  
ATOM   9122  C CB   . SER A 1 54  ? 2.699   3.209   -8.685  1.00 0.00 ? 54  SER A CB   5  
ATOM   9123  O OG   . SER A 1 54  ? 3.142   3.956   -9.804  1.00 0.00 ? 54  SER A OG   5  
ATOM   9124  H H    . SER A 1 54  ? 2.198   2.418   -6.286  1.00 0.00 ? 54  SER A H    5  
ATOM   9125  H HA   . SER A 1 54  ? 4.587   2.714   -7.816  1.00 0.00 ? 54  SER A HA   5  
ATOM   9126  H HB2  . SER A 1 54  ? 2.584   2.179   -9.001  1.00 0.00 ? 54  SER A HB2  5  
ATOM   9127  H HB3  . SER A 1 54  ? 1.747   3.596   -8.357  1.00 0.00 ? 54  SER A HB3  5  
ATOM   9128  H HG   . SER A 1 54  ? 4.008   3.630   -10.079 1.00 0.00 ? 54  SER A HG   5  
ATOM   9129  N N    . THR A 1 55  ? 3.452   5.345   -6.254  1.00 0.00 ? 55  THR A N    5  
ATOM   9130  C CA   . THR A 1 55  ? 3.829   6.684   -5.810  1.00 0.00 ? 55  THR A CA   5  
ATOM   9131  C C    . THR A 1 55  ? 4.989   6.628   -4.822  1.00 0.00 ? 55  THR A C    5  
ATOM   9132  O O    . THR A 1 55  ? 5.852   7.508   -4.821  1.00 0.00 ? 55  THR A O    5  
ATOM   9133  C CB   . THR A 1 55  ? 2.651   7.439   -5.171  1.00 0.00 ? 55  THR A CB   5  
ATOM   9134  O OG1  . THR A 1 55  ? 1.515   7.386   -6.039  1.00 0.00 ? 55  THR A OG1  5  
ATOM   9135  C CG2  . THR A 1 55  ? 3.025   8.887   -4.943  1.00 0.00 ? 55  THR A CG2  5  
ATOM   9136  H H    . THR A 1 55  ? 2.672   4.905   -5.847  1.00 0.00 ? 55  THR A H    5  
ATOM   9137  H HA   . THR A 1 55  ? 4.148   7.245   -6.675  1.00 0.00 ? 55  THR A HA   5  
ATOM   9138  H HB   . THR A 1 55  ? 2.415   6.989   -4.214  1.00 0.00 ? 55  THR A HB   5  
ATOM   9139  H HG1  . THR A 1 55  ? 0.929   6.656   -5.768  1.00 0.00 ? 55  THR A HG1  5  
ATOM   9140  H HG21 . THR A 1 55  ? 4.021   8.927   -4.540  1.00 0.00 ? 55  THR A HG21 5  
ATOM   9141  H HG22 . THR A 1 55  ? 2.333   9.336   -4.246  1.00 0.00 ? 55  THR A HG22 5  
ATOM   9142  H HG23 . THR A 1 55  ? 2.993   9.424   -5.880  1.00 0.00 ? 55  THR A HG23 5  
ATOM   9143  N N    . VAL A 1 56  ? 5.018   5.594   -3.988  1.00 0.00 ? 56  VAL A N    5  
ATOM   9144  C CA   . VAL A 1 56  ? 6.141   5.389   -3.078  1.00 0.00 ? 56  VAL A CA   5  
ATOM   9145  C C    . VAL A 1 56  ? 7.419   5.256   -3.887  1.00 0.00 ? 56  VAL A C    5  
ATOM   9146  O O    . VAL A 1 56  ? 8.442   5.872   -3.586  1.00 0.00 ? 56  VAL A O    5  
ATOM   9147  C CB   . VAL A 1 56  ? 5.956   4.124   -2.212  1.00 0.00 ? 56  VAL A CB   5  
ATOM   9148  C CG1  . VAL A 1 56  ? 7.196   3.860   -1.364  1.00 0.00 ? 56  VAL A CG1  5  
ATOM   9149  C CG2  . VAL A 1 56  ? 4.729   4.262   -1.327  1.00 0.00 ? 56  VAL A CG2  5  
ATOM   9150  H H    . VAL A 1 56  ? 4.270   4.954   -3.984  1.00 0.00 ? 56  VAL A H    5  
ATOM   9151  H HA   . VAL A 1 56  ? 6.218   6.248   -2.428  1.00 0.00 ? 56  VAL A HA   5  
ATOM   9152  H HB   . VAL A 1 56  ? 5.809   3.280   -2.872  1.00 0.00 ? 56  VAL A HB   5  
ATOM   9153  H HG11 . VAL A 1 56  ? 8.058   3.732   -2.011  1.00 0.00 ? 56  VAL A HG11 5  
ATOM   9154  H HG12 . VAL A 1 56  ? 7.048   2.964   -0.780  1.00 0.00 ? 56  VAL A HG12 5  
ATOM   9155  H HG13 . VAL A 1 56  ? 7.364   4.697   -0.704  1.00 0.00 ? 56  VAL A HG13 5  
ATOM   9156  H HG21 . VAL A 1 56  ? 3.881   4.558   -1.928  1.00 0.00 ? 56  VAL A HG21 5  
ATOM   9157  H HG22 . VAL A 1 56  ? 4.913   5.010   -0.570  1.00 0.00 ? 56  VAL A HG22 5  
ATOM   9158  H HG23 . VAL A 1 56  ? 4.520   3.315   -0.851  1.00 0.00 ? 56  VAL A HG23 5  
ATOM   9159  N N    . LYS A 1 57  ? 7.328   4.466   -4.942  1.00 0.00 ? 57  LYS A N    5  
ATOM   9160  C CA   . LYS A 1 57  ? 8.443   4.252   -5.842  1.00 0.00 ? 57  LYS A CA   5  
ATOM   9161  C C    . LYS A 1 57  ? 8.798   5.545   -6.552  1.00 0.00 ? 57  LYS A C    5  
ATOM   9162  O O    . LYS A 1 57  ? 9.967   5.867   -6.726  1.00 0.00 ? 57  LYS A O    5  
ATOM   9163  C CB   . LYS A 1 57  ? 8.087   3.185   -6.868  1.00 0.00 ? 57  LYS A CB   5  
ATOM   9164  C CG   . LYS A 1 57  ? 9.202   2.189   -7.098  1.00 0.00 ? 57  LYS A CG   5  
ATOM   9165  C CD   . LYS A 1 57  ? 8.845   1.180   -8.167  1.00 0.00 ? 57  LYS A CD   5  
ATOM   9166  C CE   . LYS A 1 57  ? 9.928   0.128   -8.288  1.00 0.00 ? 57  LYS A CE   5  
ATOM   9167  N NZ   . LYS A 1 57  ? 11.218  0.715   -8.749  1.00 0.00 ? 57  LYS A NZ   5  
ATOM   9168  H H    . LYS A 1 57  ? 6.480   4.006   -5.112  1.00 0.00 ? 57  LYS A H    5  
ATOM   9169  H HA   . LYS A 1 57  ? 9.288   3.920   -5.258  1.00 0.00 ? 57  LYS A HA   5  
ATOM   9170  H HB2  . LYS A 1 57  ? 7.215   2.653   -6.526  1.00 0.00 ? 57  LYS A HB2  5  
ATOM   9171  H HB3  . LYS A 1 57  ? 7.860   3.665   -7.809  1.00 0.00 ? 57  LYS A HB3  5  
ATOM   9172  H HG2  . LYS A 1 57  ? 10.089  2.717   -7.395  1.00 0.00 ? 57  LYS A HG2  5  
ATOM   9173  H HG3  . LYS A 1 57  ? 9.395   1.664   -6.180  1.00 0.00 ? 57  LYS A HG3  5  
ATOM   9174  H HD2  . LYS A 1 57  ? 7.915   0.700   -7.902  1.00 0.00 ? 57  LYS A HD2  5  
ATOM   9175  H HD3  . LYS A 1 57  ? 8.736   1.688   -9.112  1.00 0.00 ? 57  LYS A HD3  5  
ATOM   9176  H HE2  . LYS A 1 57  ? 10.070  -0.324  -7.313  1.00 0.00 ? 57  LYS A HE2  5  
ATOM   9177  H HE3  . LYS A 1 57  ? 9.608   -0.625  -8.993  1.00 0.00 ? 57  LYS A HE3  5  
ATOM   9178  H HZ1  . LYS A 1 57  ? 11.937  -0.029  -8.846  1.00 0.00 ? 57  LYS A HZ1  5  
ATOM   9179  H HZ2  . LYS A 1 57  ? 11.559  1.421   -8.067  1.00 0.00 ? 57  LYS A HZ2  5  
ATOM   9180  H HZ3  . LYS A 1 57  ? 11.090  1.180   -9.671  1.00 0.00 ? 57  LYS A HZ3  5  
ATOM   9181  N N    . ARG A 1 58  ? 7.765   6.272   -6.952  1.00 0.00 ? 58  ARG A N    5  
ATOM   9182  C CA   . ARG A 1 58  ? 7.917   7.571   -7.598  1.00 0.00 ? 58  ARG A CA   5  
ATOM   9183  C C    . ARG A 1 58  ? 8.731   8.527   -6.724  1.00 0.00 ? 58  ARG A C    5  
ATOM   9184  O O    . ARG A 1 58  ? 9.705   9.130   -7.176  1.00 0.00 ? 58  ARG A O    5  
ATOM   9185  C CB   . ARG A 1 58  ? 6.529   8.149   -7.860  1.00 0.00 ? 58  ARG A CB   5  
ATOM   9186  C CG   . ARG A 1 58  ? 6.522   9.494   -8.566  1.00 0.00 ? 58  ARG A CG   5  
ATOM   9187  C CD   . ARG A 1 58  ? 5.104   9.994   -8.762  1.00 0.00 ? 58  ARG A CD   5  
ATOM   9188  N NE   . ARG A 1 58  ? 5.052   11.330  -9.352  1.00 0.00 ? 58  ARG A NE   5  
ATOM   9189  C CZ   . ARG A 1 58  ? 3.918   11.950  -9.677  1.00 0.00 ? 58  ARG A CZ   5  
ATOM   9190  N NH1  . ARG A 1 58  ? 2.752   11.333  -9.513  1.00 0.00 ? 58  ARG A NH1  5  
ATOM   9191  N NH2  . ARG A 1 58  ? 3.950   13.179  -10.174 1.00 0.00 ? 58  ARG A NH2  5  
ATOM   9192  H H    . ARG A 1 58  ? 6.857   5.914   -6.814  1.00 0.00 ? 58  ARG A H    5  
ATOM   9193  H HA   . ARG A 1 58  ? 8.426   7.426   -8.538  1.00 0.00 ? 58  ARG A HA   5  
ATOM   9194  H HB2  . ARG A 1 58  ? 5.974   7.445   -8.459  1.00 0.00 ? 58  ARG A HB2  5  
ATOM   9195  H HB3  . ARG A 1 58  ? 6.025   8.267   -6.911  1.00 0.00 ? 58  ARG A HB3  5  
ATOM   9196  H HG2  . ARG A 1 58  ? 7.060   10.208  -7.967  1.00 0.00 ? 58  ARG A HG2  5  
ATOM   9197  H HG3  . ARG A 1 58  ? 6.998   9.394   -9.527  1.00 0.00 ? 58  ARG A HG3  5  
ATOM   9198  H HD2  . ARG A 1 58  ? 4.581   9.306   -9.408  1.00 0.00 ? 58  ARG A HD2  5  
ATOM   9199  H HD3  . ARG A 1 58  ? 4.621   10.020  -7.798  1.00 0.00 ? 58  ARG A HD3  5  
ATOM   9200  H HE   . ARG A 1 58  ? 5.908   11.793  -9.502  1.00 0.00 ? 58  ARG A HE   5  
ATOM   9201  H HH11 . ARG A 1 58  ? 2.722   10.401  -9.145  1.00 0.00 ? 58  ARG A HH11 5  
ATOM   9202  H HH12 . ARG A 1 58  ? 1.893   11.797  -9.753  1.00 0.00 ? 58  ARG A HH12 5  
ATOM   9203  H HH21 . ARG A 1 58  ? 4.828   13.647  -10.303 1.00 0.00 ? 58  ARG A HH21 5  
ATOM   9204  H HH22 . ARG A 1 58  ? 3.097   13.648  -10.422 1.00 0.00 ? 58  ARG A HH22 5  
ATOM   9205  N N    . LYS A 1 59  ? 8.334   8.643   -5.467  1.00 0.00 ? 59  LYS A N    5  
ATOM   9206  C CA   . LYS A 1 59  ? 9.009   9.523   -4.523  1.00 0.00 ? 59  LYS A CA   5  
ATOM   9207  C C    . LYS A 1 59  ? 10.378  8.959   -4.140  1.00 0.00 ? 59  LYS A C    5  
ATOM   9208  O O    . LYS A 1 59  ? 11.307  9.710   -3.834  1.00 0.00 ? 59  LYS A O    5  
ATOM   9209  C CB   . LYS A 1 59  ? 8.121   9.733   -3.293  1.00 0.00 ? 59  LYS A CB   5  
ATOM   9210  C CG   . LYS A 1 59  ? 6.819   10.458  -3.618  1.00 0.00 ? 59  LYS A CG   5  
ATOM   9211  C CD   . LYS A 1 59  ? 5.752   10.281  -2.537  1.00 0.00 ? 59  LYS A CD   5  
ATOM   9212  C CE   . LYS A 1 59  ? 6.246   10.666  -1.149  1.00 0.00 ? 59  LYS A CE   5  
ATOM   9213  N NZ   . LYS A 1 59  ? 6.619   9.475   -0.340  1.00 0.00 ? 59  LYS A NZ   5  
ATOM   9214  H H    . LYS A 1 59  ? 7.557   8.119   -5.163  1.00 0.00 ? 59  LYS A H    5  
ATOM   9215  H HA   . LYS A 1 59  ? 9.161   10.477  -5.009  1.00 0.00 ? 59  LYS A HA   5  
ATOM   9216  H HB2  . LYS A 1 59  ? 7.881   8.772   -2.863  1.00 0.00 ? 59  LYS A HB2  5  
ATOM   9217  H HB3  . LYS A 1 59  ? 8.663   10.323  -2.571  1.00 0.00 ? 59  LYS A HB3  5  
ATOM   9218  H HG2  . LYS A 1 59  ? 7.029   11.512  -3.728  1.00 0.00 ? 59  LYS A HG2  5  
ATOM   9219  H HG3  . LYS A 1 59  ? 6.435   10.072  -4.551  1.00 0.00 ? 59  LYS A HG3  5  
ATOM   9220  H HD2  . LYS A 1 59  ? 4.905   10.903  -2.784  1.00 0.00 ? 59  LYS A HD2  5  
ATOM   9221  H HD3  . LYS A 1 59  ? 5.443   9.246   -2.522  1.00 0.00 ? 59  LYS A HD3  5  
ATOM   9222  H HE2  . LYS A 1 59  ? 7.113   11.304  -1.253  1.00 0.00 ? 59  LYS A HE2  5  
ATOM   9223  H HE3  . LYS A 1 59  ? 5.462   11.206  -0.637  1.00 0.00 ? 59  LYS A HE3  5  
ATOM   9224  H HZ1  . LYS A 1 59  ? 5.785   8.857   -0.195  1.00 0.00 ? 59  LYS A HZ1  5  
ATOM   9225  H HZ2  . LYS A 1 59  ? 6.975   9.770   0.590   1.00 0.00 ? 59  LYS A HZ2  5  
ATOM   9226  H HZ3  . LYS A 1 59  ? 7.357   8.925   -0.823  1.00 0.00 ? 59  LYS A HZ3  5  
ATOM   9227  N N    . MET A 1 60  ? 10.503  7.636   -4.170  1.00 0.00 ? 60  MET A N    5  
ATOM   9228  C CA   . MET A 1 60  ? 11.801  6.988   -4.001  1.00 0.00 ? 60  MET A CA   5  
ATOM   9229  C C    . MET A 1 60  ? 12.711  7.323   -5.182  1.00 0.00 ? 60  MET A C    5  
ATOM   9230  O O    . MET A 1 60  ? 13.913  7.514   -5.014  1.00 0.00 ? 60  MET A O    5  
ATOM   9231  C CB   . MET A 1 60  ? 11.656  5.466   -3.888  1.00 0.00 ? 60  MET A CB   5  
ATOM   9232  C CG   . MET A 1 60  ? 12.983  4.741   -3.728  1.00 0.00 ? 60  MET A CG   5  
ATOM   9233  S SD   . MET A 1 60  ? 12.869  2.991   -4.141  1.00 0.00 ? 60  MET A SD   5  
ATOM   9234  C CE   . MET A 1 60  ? 11.536  2.494   -3.061  1.00 0.00 ? 60  MET A CE   5  
ATOM   9235  H H    . MET A 1 60  ? 9.699   7.081   -4.287  1.00 0.00 ? 60  MET A H    5  
ATOM   9236  H HA   . MET A 1 60  ? 12.248  7.372   -3.096  1.00 0.00 ? 60  MET A HA   5  
ATOM   9237  H HB2  . MET A 1 60  ? 11.041  5.232   -3.029  1.00 0.00 ? 60  MET A HB2  5  
ATOM   9238  H HB3  . MET A 1 60  ? 11.174  5.092   -4.777  1.00 0.00 ? 60  MET A HB3  5  
ATOM   9239  H HG2  . MET A 1 60  ? 13.712  5.202   -4.374  1.00 0.00 ? 60  MET A HG2  5  
ATOM   9240  H HG3  . MET A 1 60  ? 13.306  4.833   -2.701  1.00 0.00 ? 60  MET A HG3  5  
ATOM   9241  H HE1  . MET A 1 60  ? 11.774  2.775   -2.048  1.00 0.00 ? 60  MET A HE1  5  
ATOM   9242  H HE2  . MET A 1 60  ? 11.405  1.424   -3.116  1.00 0.00 ? 60  MET A HE2  5  
ATOM   9243  H HE3  . MET A 1 60  ? 10.623  2.985   -3.365  1.00 0.00 ? 60  MET A HE3  5  
ATOM   9244  N N    . GLU A 1 61  ? 12.127  7.400   -6.377  1.00 0.00 ? 61  GLU A N    5  
ATOM   9245  C CA   . GLU A 1 61  ? 12.874  7.755   -7.578  1.00 0.00 ? 61  GLU A CA   5  
ATOM   9246  C C    . GLU A 1 61  ? 13.398  9.176   -7.481  1.00 0.00 ? 61  GLU A C    5  
ATOM   9247  O O    . GLU A 1 61  ? 14.476  9.487   -7.981  1.00 0.00 ? 61  GLU A O    5  
ATOM   9248  C CB   . GLU A 1 61  ? 12.007  7.616   -8.832  1.00 0.00 ? 61  GLU A CB   5  
ATOM   9249  C CG   . GLU A 1 61  ? 11.772  6.181   -9.263  1.00 0.00 ? 61  GLU A CG   5  
ATOM   9250  C CD   . GLU A 1 61  ? 11.148  6.083   -10.637 1.00 0.00 ? 61  GLU A CD   5  
ATOM   9251  O OE1  . GLU A 1 61  ? 11.853  6.356   -11.630 1.00 0.00 ? 61  GLU A OE1  5  
ATOM   9252  O OE2  . GLU A 1 61  ? 9.957   5.713   -10.737 1.00 0.00 ? 61  GLU A OE2  5  
ATOM   9253  H H    . GLU A 1 61  ? 11.163  7.203   -6.454  1.00 0.00 ? 61  GLU A H    5  
ATOM   9254  H HA   . GLU A 1 61  ? 13.715  7.080   -7.655  1.00 0.00 ? 61  GLU A HA   5  
ATOM   9255  H HB2  . GLU A 1 61  ? 11.046  8.070   -8.639  1.00 0.00 ? 61  GLU A HB2  5  
ATOM   9256  H HB3  . GLU A 1 61  ? 12.482  8.143   -9.645  1.00 0.00 ? 61  GLU A HB3  5  
ATOM   9257  H HG2  . GLU A 1 61  ? 12.717  5.664   -9.279  1.00 0.00 ? 61  GLU A HG2  5  
ATOM   9258  H HG3  . GLU A 1 61  ? 11.114  5.706   -8.549  1.00 0.00 ? 61  GLU A HG3  5  
ATOM   9259  N N    . ASN A 1 62  ? 12.637  10.030  -6.814  1.00 0.00 ? 62  ASN A N    5  
ATOM   9260  C CA   . ASN A 1 62  ? 13.031  11.421  -6.632  1.00 0.00 ? 62  ASN A CA   5  
ATOM   9261  C C    . ASN A 1 62  ? 13.990  11.528  -5.463  1.00 0.00 ? 62  ASN A C    5  
ATOM   9262  O O    . ASN A 1 62  ? 14.515  12.600  -5.159  1.00 0.00 ? 62  ASN A O    5  
ATOM   9263  C CB   . ASN A 1 62  ? 11.806  12.316  -6.405  1.00 0.00 ? 62  ASN A CB   5  
ATOM   9264  C CG   . ASN A 1 62  ? 10.978  12.538  -7.665  1.00 0.00 ? 62  ASN A CG   5  
ATOM   9265  O OD1  . ASN A 1 62  ? 10.346  13.583  -7.831  1.00 0.00 ? 62  ASN A OD1  5  
ATOM   9266  N ND2  . ASN A 1 62  ? 10.969  11.562  -8.561  1.00 0.00 ? 62  ASN A ND2  5  
ATOM   9267  H H    . ASN A 1 62  ? 11.796  9.714   -6.419  1.00 0.00 ? 62  ASN A H    5  
ATOM   9268  H HA   . ASN A 1 62  ? 13.542  11.738  -7.527  1.00 0.00 ? 62  ASN A HA   5  
ATOM   9269  H HB2  . ASN A 1 62  ? 11.172  11.860  -5.660  1.00 0.00 ? 62  ASN A HB2  5  
ATOM   9270  H HB3  . ASN A 1 62  ? 12.138  13.278  -6.041  1.00 0.00 ? 62  ASN A HB3  5  
ATOM   9271  H HD21 . ASN A 1 62  ? 11.492  10.755  -8.373  1.00 0.00 ? 62  ASN A HD21 5  
ATOM   9272  H HD22 . ASN A 1 62  ? 10.436  11.683  -9.374  1.00 0.00 ? 62  ASN A HD22 5  
ATOM   9273  N N    . ARG A 1 63  ? 14.206  10.377  -4.827  1.00 0.00 ? 63  ARG A N    5  
ATOM   9274  C CA   . ARG A 1 63  ? 15.161  10.223  -3.742  1.00 0.00 ? 63  ARG A CA   5  
ATOM   9275  C C    . ARG A 1 63  ? 14.861  11.178  -2.604  1.00 0.00 ? 63  ARG A C    5  
ATOM   9276  O O    . ARG A 1 63  ? 15.767  11.703  -1.957  1.00 0.00 ? 63  ARG A O    5  
ATOM   9277  C CB   . ARG A 1 63  ? 16.580  10.421  -4.268  1.00 0.00 ? 63  ARG A CB   5  
ATOM   9278  C CG   . ARG A 1 63  ? 16.894  9.551   -5.473  1.00 0.00 ? 63  ARG A CG   5  
ATOM   9279  C CD   . ARG A 1 63  ? 17.003  8.078   -5.102  1.00 0.00 ? 63  ARG A CD   5  
ATOM   9280  N NE   . ARG A 1 63  ? 16.726  7.201   -6.241  1.00 0.00 ? 63  ARG A NE   5  
ATOM   9281  C CZ   . ARG A 1 63  ? 17.638  6.823   -7.137  1.00 0.00 ? 63  ARG A CZ   5  
ATOM   9282  N NH1  . ARG A 1 63  ? 18.882  7.278   -7.060  1.00 0.00 ? 63  ARG A NH1  5  
ATOM   9283  N NH2  . ARG A 1 63  ? 17.307  5.993   -8.114  1.00 0.00 ? 63  ARG A NH2  5  
ATOM   9284  H H    . ARG A 1 63  ? 13.705  9.590   -5.117  1.00 0.00 ? 63  ARG A H    5  
ATOM   9285  H HA   . ARG A 1 63  ? 15.067  9.214   -3.367  1.00 0.00 ? 63  ARG A HA   5  
ATOM   9286  H HB2  . ARG A 1 63  ? 16.706  11.454  -4.551  1.00 0.00 ? 63  ARG A HB2  5  
ATOM   9287  H HB3  . ARG A 1 63  ? 17.282  10.181  -3.487  1.00 0.00 ? 63  ARG A HB3  5  
ATOM   9288  H HG2  . ARG A 1 63  ? 16.108  9.673   -6.212  1.00 0.00 ? 63  ARG A HG2  5  
ATOM   9289  H HG3  . ARG A 1 63  ? 17.834  9.872   -5.889  1.00 0.00 ? 63  ARG A HG3  5  
ATOM   9290  H HD2  . ARG A 1 63  ? 18.005  7.886   -4.753  1.00 0.00 ? 63  ARG A HD2  5  
ATOM   9291  H HD3  . ARG A 1 63  ? 16.302  7.857   -4.309  1.00 0.00 ? 63  ARG A HD3  5  
ATOM   9292  H HE   . ARG A 1 63  ? 15.806  6.865   -6.332  1.00 0.00 ? 63  ARG A HE   5  
ATOM   9293  H HH11 . ARG A 1 63  ? 19.147  7.910   -6.326  1.00 0.00 ? 63  ARG A HH11 5  
ATOM   9294  H HH12 . ARG A 1 63  ? 19.560  6.997   -7.741  1.00 0.00 ? 63  ARG A HH12 5  
ATOM   9295  H HH21 . ARG A 1 63  ? 16.367  5.645   -8.186  1.00 0.00 ? 63  ARG A HH21 5  
ATOM   9296  H HH22 . ARG A 1 63  ? 17.991  5.710   -8.791  1.00 0.00 ? 63  ARG A HH22 5  
ATOM   9297  N N    . ASP A 1 64  ? 13.578  11.406  -2.366  1.00 0.00 ? 64  ASP A N    5  
ATOM   9298  C CA   . ASP A 1 64  ? 13.151  12.209  -1.225  1.00 0.00 ? 64  ASP A CA   5  
ATOM   9299  C C    . ASP A 1 64  ? 13.297  11.420  0.068   1.00 0.00 ? 64  ASP A C    5  
ATOM   9300  O O    . ASP A 1 64  ? 13.271  11.979  1.164   1.00 0.00 ? 64  ASP A O    5  
ATOM   9301  C CB   . ASP A 1 64  ? 11.705  12.673  -1.392  1.00 0.00 ? 64  ASP A CB   5  
ATOM   9302  C CG   . ASP A 1 64  ? 11.580  13.848  -2.338  1.00 0.00 ? 64  ASP A CG   5  
ATOM   9303  O OD1  . ASP A 1 64  ? 11.890  14.987  -1.926  1.00 0.00 ? 64  ASP A OD1  5  
ATOM   9304  O OD2  . ASP A 1 64  ? 11.163  13.647  -3.495  1.00 0.00 ? 64  ASP A OD2  5  
ATOM   9305  H H    . ASP A 1 64  ? 12.899  11.040  -2.990  1.00 0.00 ? 64  ASP A H    5  
ATOM   9306  H HA   . ASP A 1 64  ? 13.794  13.076  -1.175  1.00 0.00 ? 64  ASP A HA   5  
ATOM   9307  H HB2  . ASP A 1 64  ? 11.116  11.857  -1.784  1.00 0.00 ? 64  ASP A HB2  5  
ATOM   9308  H HB3  . ASP A 1 64  ? 11.316  12.961  -0.429  1.00 0.00 ? 64  ASP A HB3  5  
ATOM   9309  N N    . TYR A 1 65  ? 13.450  10.116  -0.071  1.00 0.00 ? 65  TYR A N    5  
ATOM   9310  C CA   . TYR A 1 65  ? 13.615  9.229   1.071   1.00 0.00 ? 65  TYR A CA   5  
ATOM   9311  C C    . TYR A 1 65  ? 15.068  9.236   1.519   1.00 0.00 ? 65  TYR A C    5  
ATOM   9312  O O    . TYR A 1 65  ? 15.978  9.233   0.690   1.00 0.00 ? 65  TYR A O    5  
ATOM   9313  C CB   . TYR A 1 65  ? 13.217  7.791   0.713   1.00 0.00 ? 65  TYR A CB   5  
ATOM   9314  C CG   . TYR A 1 65  ? 11.768  7.597   0.307   1.00 0.00 ? 65  TYR A CG   5  
ATOM   9315  C CD1  . TYR A 1 65  ? 11.121  6.395   0.553   1.00 0.00 ? 65  TYR A CD1  5  
ATOM   9316  C CD2  . TYR A 1 65  ? 11.054  8.601   -0.330  1.00 0.00 ? 65  TYR A CD2  5  
ATOM   9317  C CE1  . TYR A 1 65  ? 9.806   6.201   0.176   1.00 0.00 ? 65  TYR A CE1  5  
ATOM   9318  C CE2  . TYR A 1 65  ? 9.744   8.415   -0.703  1.00 0.00 ? 65  TYR A CE2  5  
ATOM   9319  C CZ   . TYR A 1 65  ? 9.124   7.218   -0.451  1.00 0.00 ? 65  TYR A CZ   5  
ATOM   9320  O OH   . TYR A 1 65  ? 7.815   7.045   -0.831  1.00 0.00 ? 65  TYR A OH   5  
ATOM   9321  H H    . TYR A 1 65  ? 13.455  9.737   -0.971  1.00 0.00 ? 65  TYR A H    5  
ATOM   9322  H HA   . TYR A 1 65  ? 12.989  9.587   1.874   1.00 0.00 ? 65  TYR A HA   5  
ATOM   9323  H HB2  . TYR A 1 65  ? 13.831  7.456   -0.109  1.00 0.00 ? 65  TYR A HB2  5  
ATOM   9324  H HB3  . TYR A 1 65  ? 13.406  7.159   1.571   1.00 0.00 ? 65  TYR A HB3  5  
ATOM   9325  H HD1  . TYR A 1 65  ? 11.659  5.602   1.051   1.00 0.00 ? 65  TYR A HD1  5  
ATOM   9326  H HD2  . TYR A 1 65  ? 11.540  9.544   -0.530  1.00 0.00 ? 65  TYR A HD2  5  
ATOM   9327  H HE1  . TYR A 1 65  ? 9.321   5.259   0.371   1.00 0.00 ? 65  TYR A HE1  5  
ATOM   9328  H HE2  . TYR A 1 65  ? 9.211   9.210   -1.197  1.00 0.00 ? 65  TYR A HE2  5  
ATOM   9329  H HH   . TYR A 1 65  ? 7.324   6.607   -0.124  1.00 0.00 ? 65  TYR A HH   5  
ATOM   9330  N N    . ARG A 1 66  ? 15.286  9.271   2.821   1.00 0.00 ? 66  ARG A N    5  
ATOM   9331  C CA   . ARG A 1 66  ? 16.629  9.191   3.358   1.00 0.00 ? 66  ARG A CA   5  
ATOM   9332  C C    . ARG A 1 66  ? 16.941  7.773   3.823   1.00 0.00 ? 66  ARG A C    5  
ATOM   9333  O O    . ARG A 1 66  ? 18.080  7.320   3.725   1.00 0.00 ? 66  ARG A O    5  
ATOM   9334  C CB   . ARG A 1 66  ? 16.804  10.185  4.515   1.00 0.00 ? 66  ARG A CB   5  
ATOM   9335  C CG   . ARG A 1 66  ? 18.135  10.064  5.243   1.00 0.00 ? 66  ARG A CG   5  
ATOM   9336  C CD   . ARG A 1 66  ? 19.306  10.449  4.356   1.00 0.00 ? 66  ARG A CD   5  
ATOM   9337  N NE   . ARG A 1 66  ? 20.556  9.865   4.833   1.00 0.00 ? 66  ARG A NE   5  
ATOM   9338  C CZ   . ARG A 1 66  ? 21.561  9.496   4.040   1.00 0.00 ? 66  ARG A CZ   5  
ATOM   9339  N NH1  . ARG A 1 66  ? 21.473  9.660   2.727   1.00 0.00 ? 66  ARG A NH1  5  
ATOM   9340  N NH2  . ARG A 1 66  ? 22.653  8.957   4.565   1.00 0.00 ? 66  ARG A NH2  5  
ATOM   9341  H H    . ARG A 1 66  ? 14.523  9.376   3.438   1.00 0.00 ? 66  ARG A H    5  
ATOM   9342  H HA   . ARG A 1 66  ? 17.311  9.445   2.563   1.00 0.00 ? 66  ARG A HA   5  
ATOM   9343  H HB2  . ARG A 1 66  ? 16.725  11.188  4.124   1.00 0.00 ? 66  ARG A HB2  5  
ATOM   9344  H HB3  . ARG A 1 66  ? 16.011  10.025  5.231   1.00 0.00 ? 66  ARG A HB3  5  
ATOM   9345  H HG2  . ARG A 1 66  ? 18.122  10.716  6.103   1.00 0.00 ? 66  ARG A HG2  5  
ATOM   9346  H HG3  . ARG A 1 66  ? 18.264  9.041   5.568   1.00 0.00 ? 66  ARG A HG3  5  
ATOM   9347  H HD2  . ARG A 1 66  ? 19.115  10.105  3.352   1.00 0.00 ? 66  ARG A HD2  5  
ATOM   9348  H HD3  . ARG A 1 66  ? 19.403  11.528  4.360   1.00 0.00 ? 66  ARG A HD3  5  
ATOM   9349  H HE   . ARG A 1 66  ? 20.646  9.727   5.807   1.00 0.00 ? 66  ARG A HE   5  
ATOM   9350  H HH11 . ARG A 1 66  ? 20.648  10.062  2.322   1.00 0.00 ? 66  ARG A HH11 5  
ATOM   9351  H HH12 . ARG A 1 66  ? 22.233  9.386   2.132   1.00 0.00 ? 66  ARG A HH12 5  
ATOM   9352  H HH21 . ARG A 1 66  ? 22.723  8.828   5.559   1.00 0.00 ? 66  ARG A HH21 5  
ATOM   9353  H HH22 . ARG A 1 66  ? 23.409  8.672   3.972   1.00 0.00 ? 66  ARG A HH22 5  
ATOM   9354  N N    . ASP A 1 67  ? 15.924  7.062   4.298   1.00 0.00 ? 67  ASP A N    5  
ATOM   9355  C CA   . ASP A 1 67  ? 16.127  5.737   4.857   1.00 0.00 ? 67  ASP A CA   5  
ATOM   9356  C C    . ASP A 1 67  ? 14.942  4.849   4.534   1.00 0.00 ? 67  ASP A C    5  
ATOM   9357  O O    . ASP A 1 67  ? 13.880  5.331   4.133   1.00 0.00 ? 67  ASP A O    5  
ATOM   9358  C CB   . ASP A 1 67  ? 16.327  5.801   6.378   1.00 0.00 ? 67  ASP A CB   5  
ATOM   9359  C CG   . ASP A 1 67  ? 17.686  6.335   6.782   1.00 0.00 ? 67  ASP A CG   5  
ATOM   9360  O OD1  . ASP A 1 67  ? 18.669  5.564   6.740   1.00 0.00 ? 67  ASP A OD1  5  
ATOM   9361  O OD2  . ASP A 1 67  ? 17.780  7.520   7.160   1.00 0.00 ? 67  ASP A OD2  5  
ATOM   9362  H H    . ASP A 1 67  ? 15.009  7.419   4.239   1.00 0.00 ? 67  ASP A H    5  
ATOM   9363  H HA   . ASP A 1 67  ? 17.012  5.317   4.402   1.00 0.00 ? 67  ASP A HA   5  
ATOM   9364  H HB2  . ASP A 1 67  ? 15.572  6.441   6.807   1.00 0.00 ? 67  ASP A HB2  5  
ATOM   9365  H HB3  . ASP A 1 67  ? 16.222  4.810   6.787   1.00 0.00 ? 67  ASP A HB3  5  
ATOM   9366  N N    . ALA A 1 68  ? 15.123  3.553   4.727   1.00 0.00 ? 68  ALA A N    5  
ATOM   9367  C CA   . ALA A 1 68  ? 14.081  2.586   4.435   1.00 0.00 ? 68  ALA A CA   5  
ATOM   9368  C C    . ALA A 1 68  ? 12.952  2.702   5.439   1.00 0.00 ? 68  ALA A C    5  
ATOM   9369  O O    . ALA A 1 68  ? 11.847  2.221   5.202   1.00 0.00 ? 68  ALA A O    5  
ATOM   9370  C CB   . ALA A 1 68  ? 14.643  1.182   4.446   1.00 0.00 ? 68  ALA A CB   5  
ATOM   9371  H H    . ALA A 1 68  ? 15.976  3.239   5.094   1.00 0.00 ? 68  ALA A H    5  
ATOM   9372  H HA   . ALA A 1 68  ? 13.698  2.792   3.445   1.00 0.00 ? 68  ALA A HA   5  
ATOM   9373  H HB1  . ALA A 1 68  ? 15.038  0.971   5.427   1.00 0.00 ? 68  ALA A HB1  5  
ATOM   9374  H HB2  . ALA A 1 68  ? 15.432  1.102   3.712   1.00 0.00 ? 68  ALA A HB2  5  
ATOM   9375  H HB3  . ALA A 1 68  ? 13.860  0.477   4.213   1.00 0.00 ? 68  ALA A HB3  5  
ATOM   9376  N N    . GLN A 1 69  ? 13.236  3.347   6.562   1.00 0.00 ? 69  GLN A N    5  
ATOM   9377  C CA   . GLN A 1 69  ? 12.222  3.588   7.569   1.00 0.00 ? 69  GLN A CA   5  
ATOM   9378  C C    . GLN A 1 69  ? 11.194  4.562   7.017   1.00 0.00 ? 69  GLN A C    5  
ATOM   9379  O O    . GLN A 1 69  ? 9.999   4.431   7.259   1.00 0.00 ? 69  GLN A O    5  
ATOM   9380  C CB   . GLN A 1 69  ? 12.833  4.160   8.849   1.00 0.00 ? 69  GLN A CB   5  
ATOM   9381  C CG   . GLN A 1 69  ? 11.809  4.363   9.948   1.00 0.00 ? 69  GLN A CG   5  
ATOM   9382  C CD   . GLN A 1 69  ? 11.459  3.084   10.686  1.00 0.00 ? 69  GLN A CD   5  
ATOM   9383  O OE1  . GLN A 1 69  ? 10.313  2.877   11.080  1.00 0.00 ? 69  GLN A OE1  5  
ATOM   9384  N NE2  . GLN A 1 69  ? 12.446  2.242   10.924  1.00 0.00 ? 69  GLN A NE2  5  
ATOM   9385  H H    . GLN A 1 69  ? 14.149  3.668   6.711   1.00 0.00 ? 69  GLN A H    5  
ATOM   9386  H HA   . GLN A 1 69  ? 11.741  2.647   7.788   1.00 0.00 ? 69  GLN A HA   5  
ATOM   9387  H HB2  . GLN A 1 69  ? 13.596  3.488   9.207   1.00 0.00 ? 69  GLN A HB2  5  
ATOM   9388  H HB3  . GLN A 1 69  ? 13.277  5.116   8.625   1.00 0.00 ? 69  GLN A HB3  5  
ATOM   9389  H HG2  . GLN A 1 69  ? 12.197  5.076   10.659  1.00 0.00 ? 69  GLN A HG2  5  
ATOM   9390  H HG3  . GLN A 1 69  ? 10.912  4.754   9.498   1.00 0.00 ? 69  GLN A HG3  5  
ATOM   9391  H HE21 . GLN A 1 69  ? 13.347  2.482   10.616  1.00 0.00 ? 69  GLN A HE21 5  
ATOM   9392  H HE22 . GLN A 1 69  ? 12.240  1.407   11.398  1.00 0.00 ? 69  GLN A HE22 5  
ATOM   9393  N N    . GLU A 1 70  ? 11.684  5.534   6.255   1.00 0.00 ? 70  GLU A N    5  
ATOM   9394  C CA   . GLU A 1 70  ? 10.834  6.514   5.605   1.00 0.00 ? 70  GLU A CA   5  
ATOM   9395  C C    . GLU A 1 70  ? 10.017  5.850   4.511   1.00 0.00 ? 70  GLU A C    5  
ATOM   9396  O O    . GLU A 1 70  ? 8.881   6.245   4.233   1.00 0.00 ? 70  GLU A O    5  
ATOM   9397  C CB   . GLU A 1 70  ? 11.681  7.647   5.040   1.00 0.00 ? 70  GLU A CB   5  
ATOM   9398  C CG   . GLU A 1 70  ? 12.346  8.473   6.123   1.00 0.00 ? 70  GLU A CG   5  
ATOM   9399  C CD   . GLU A 1 70  ? 13.253  9.549   5.574   1.00 0.00 ? 70  GLU A CD   5  
ATOM   9400  O OE1  . GLU A 1 70  ? 13.178  9.838   4.364   1.00 0.00 ? 70  GLU A OE1  5  
ATOM   9401  O OE2  . GLU A 1 70  ? 14.049  10.109  6.354   1.00 0.00 ? 70  GLU A OE2  5  
ATOM   9402  H H    . GLU A 1 70  ? 12.649  5.590   6.125   1.00 0.00 ? 70  GLU A H    5  
ATOM   9403  H HA   . GLU A 1 70  ? 10.164  6.914   6.347   1.00 0.00 ? 70  GLU A HA   5  
ATOM   9404  H HB2  . GLU A 1 70  ? 12.453  7.230   4.405   1.00 0.00 ? 70  GLU A HB2  5  
ATOM   9405  H HB3  . GLU A 1 70  ? 11.050  8.296   4.453   1.00 0.00 ? 70  GLU A HB3  5  
ATOM   9406  H HG2  . GLU A 1 70  ? 11.579  8.944   6.718   1.00 0.00 ? 70  GLU A HG2  5  
ATOM   9407  H HG3  . GLU A 1 70  ? 12.931  7.816   6.750   1.00 0.00 ? 70  GLU A HG3  5  
ATOM   9408  N N    . PHE A 1 71  ? 10.604  4.834   3.896   1.00 0.00 ? 71  PHE A N    5  
ATOM   9409  C CA   . PHE A 1 71  ? 9.875   4.000   2.960   1.00 0.00 ? 71  PHE A CA   5  
ATOM   9410  C C    . PHE A 1 71  ? 8.791   3.222   3.698   1.00 0.00 ? 71  PHE A C    5  
ATOM   9411  O O    . PHE A 1 71  ? 7.626   3.261   3.308   1.00 0.00 ? 71  PHE A O    5  
ATOM   9412  C CB   . PHE A 1 71  ? 10.824  3.047   2.221   1.00 0.00 ? 71  PHE A CB   5  
ATOM   9413  C CG   . PHE A 1 71  ? 10.142  1.818   1.681   1.00 0.00 ? 71  PHE A CG   5  
ATOM   9414  C CD1  . PHE A 1 71  ? 9.523   1.845   0.444   1.00 0.00 ? 71  PHE A CD1  5  
ATOM   9415  C CD2  . PHE A 1 71  ? 10.121  0.640   2.412   1.00 0.00 ? 71  PHE A CD2  5  
ATOM   9416  C CE1  . PHE A 1 71  ? 8.894   0.720   -0.055  1.00 0.00 ? 71  PHE A CE1  5  
ATOM   9417  C CE2  . PHE A 1 71  ? 9.492   -0.485  1.920   1.00 0.00 ? 71  PHE A CE2  5  
ATOM   9418  C CZ   . PHE A 1 71  ? 8.878   -0.446  0.685   1.00 0.00 ? 71  PHE A CZ   5  
ATOM   9419  H H    . PHE A 1 71  ? 11.548  4.644   4.079   1.00 0.00 ? 71  PHE A H    5  
ATOM   9420  H HA   . PHE A 1 71  ? 9.401   4.652   2.241   1.00 0.00 ? 71  PHE A HA   5  
ATOM   9421  H HB2  . PHE A 1 71  ? 11.261  3.571   1.385   1.00 0.00 ? 71  PHE A HB2  5  
ATOM   9422  H HB3  . PHE A 1 71  ? 11.613  2.734   2.889   1.00 0.00 ? 71  PHE A HB3  5  
ATOM   9423  H HD1  . PHE A 1 71  ? 9.531   2.758   -0.128  1.00 0.00 ? 71  PHE A HD1  5  
ATOM   9424  H HD2  . PHE A 1 71  ? 10.599  0.609   3.379   1.00 0.00 ? 71  PHE A HD2  5  
ATOM   9425  H HE1  . PHE A 1 71  ? 8.413   0.753   -1.020  1.00 0.00 ? 71  PHE A HE1  5  
ATOM   9426  H HE2  . PHE A 1 71  ? 9.474   -1.392  2.506   1.00 0.00 ? 71  PHE A HE2  5  
ATOM   9427  H HZ   . PHE A 1 71  ? 8.388   -1.326  0.295   1.00 0.00 ? 71  PHE A HZ   5  
ATOM   9428  N N    . ALA A 1 72  ? 9.184   2.528   4.770   1.00 0.00 ? 72  ALA A N    5  
ATOM   9429  C CA   . ALA A 1 72  ? 8.249   1.769   5.589   1.00 0.00 ? 72  ALA A CA   5  
ATOM   9430  C C    . ALA A 1 72  ? 7.124   2.661   6.085   1.00 0.00 ? 72  ALA A C    5  
ATOM   9431  O O    . ALA A 1 72  ? 5.966   2.248   6.136   1.00 0.00 ? 72  ALA A O    5  
ATOM   9432  C CB   . ALA A 1 72  ? 8.974   1.123   6.758   1.00 0.00 ? 72  ALA A CB   5  
ATOM   9433  H H    . ALA A 1 72  ? 10.137  2.516   5.009   1.00 0.00 ? 72  ALA A H    5  
ATOM   9434  H HA   . ALA A 1 72  ? 7.835   0.985   4.976   1.00 0.00 ? 72  ALA A HA   5  
ATOM   9435  H HB1  . ALA A 1 72  ? 9.558   1.869   7.279   1.00 0.00 ? 72  ALA A HB1  5  
ATOM   9436  H HB2  . ALA A 1 72  ? 9.629   0.346   6.391   1.00 0.00 ? 72  ALA A HB2  5  
ATOM   9437  H HB3  . ALA A 1 72  ? 8.251   0.694   7.436   1.00 0.00 ? 72  ALA A HB3  5  
ATOM   9438  N N    . ALA A 1 73  ? 7.481   3.891   6.433   1.00 0.00 ? 73  ALA A N    5  
ATOM   9439  C CA   . ALA A 1 73  ? 6.518   4.899   6.838   1.00 0.00 ? 73  ALA A CA   5  
ATOM   9440  C C    . ALA A 1 73  ? 5.436   5.068   5.774   1.00 0.00 ? 73  ALA A C    5  
ATOM   9441  O O    . ALA A 1 73  ? 4.240   5.021   6.068   1.00 0.00 ? 73  ALA A O    5  
ATOM   9442  C CB   . ALA A 1 73  ? 7.235   6.219   7.086   1.00 0.00 ? 73  ALA A CB   5  
ATOM   9443  H H    . ALA A 1 73  ? 8.436   4.125   6.428   1.00 0.00 ? 73  ALA A H    5  
ATOM   9444  H HA   . ALA A 1 73  ? 6.070   4.585   7.760   1.00 0.00 ? 73  ALA A HA   5  
ATOM   9445  H HB1  . ALA A 1 73  ? 7.978   6.375   6.314   1.00 0.00 ? 73  ALA A HB1  5  
ATOM   9446  H HB2  . ALA A 1 73  ? 7.721   6.188   8.051   1.00 0.00 ? 73  ALA A HB2  5  
ATOM   9447  H HB3  . ALA A 1 73  ? 6.520   7.027   7.068   1.00 0.00 ? 73  ALA A HB3  5  
ATOM   9448  N N    . ASP A 1 74  ? 5.872   5.213   4.532   1.00 0.00 ? 74  ASP A N    5  
ATOM   9449  C CA   . ASP A 1 74  ? 4.969   5.514   3.425   1.00 0.00 ? 74  ASP A CA   5  
ATOM   9450  C C    . ASP A 1 74  ? 4.170   4.280   2.994   1.00 0.00 ? 74  ASP A C    5  
ATOM   9451  O O    . ASP A 1 74  ? 2.953   4.355   2.799   1.00 0.00 ? 74  ASP A O    5  
ATOM   9452  C CB   . ASP A 1 74  ? 5.773   6.068   2.245   1.00 0.00 ? 74  ASP A CB   5  
ATOM   9453  C CG   . ASP A 1 74  ? 5.077   7.223   1.555   1.00 0.00 ? 74  ASP A CG   5  
ATOM   9454  O OD1  . ASP A 1 74  ? 4.465   8.059   2.255   1.00 0.00 ? 74  ASP A OD1  5  
ATOM   9455  O OD2  . ASP A 1 74  ? 5.180   7.332   0.318   1.00 0.00 ? 74  ASP A OD2  5  
ATOM   9456  H H    . ASP A 1 74  ? 6.833   5.117   4.351   1.00 0.00 ? 74  ASP A H    5  
ATOM   9457  H HA   . ASP A 1 74  ? 4.278   6.273   3.761   1.00 0.00 ? 74  ASP A HA   5  
ATOM   9458  H HB2  . ASP A 1 74  ? 6.733   6.411   2.602   1.00 0.00 ? 74  ASP A HB2  5  
ATOM   9459  H HB3  . ASP A 1 74  ? 5.925   5.279   1.523   1.00 0.00 ? 74  ASP A HB3  5  
ATOM   9460  N N    . VAL A 1 75  ? 4.849   3.141   2.862   1.00 0.00 ? 75  VAL A N    5  
ATOM   9461  C CA   . VAL A 1 75  ? 4.200   1.913   2.397   1.00 0.00 ? 75  VAL A CA   5  
ATOM   9462  C C    . VAL A 1 75  ? 3.229   1.348   3.436   1.00 0.00 ? 75  VAL A C    5  
ATOM   9463  O O    . VAL A 1 75  ? 2.133   0.907   3.086   1.00 0.00 ? 75  VAL A O    5  
ATOM   9464  C CB   . VAL A 1 75  ? 5.226   0.821   1.988   1.00 0.00 ? 75  VAL A CB   5  
ATOM   9465  C CG1  . VAL A 1 75  ? 6.240   0.578   3.087   1.00 0.00 ? 75  VAL A CG1  5  
ATOM   9466  C CG2  . VAL A 1 75  ? 4.530   -0.483  1.617   1.00 0.00 ? 75  VAL A CG2  5  
ATOM   9467  H H    . VAL A 1 75  ? 5.808   3.129   3.078   1.00 0.00 ? 75  VAL A H    5  
ATOM   9468  H HA   . VAL A 1 75  ? 3.630   2.171   1.516   1.00 0.00 ? 75  VAL A HA   5  
ATOM   9469  H HB   . VAL A 1 75  ? 5.754   1.173   1.117   1.00 0.00 ? 75  VAL A HB   5  
ATOM   9470  H HG11 . VAL A 1 75  ? 6.849   1.460   3.218   1.00 0.00 ? 75  VAL A HG11 5  
ATOM   9471  H HG12 . VAL A 1 75  ? 6.869   -0.258  2.817   1.00 0.00 ? 75  VAL A HG12 5  
ATOM   9472  H HG13 . VAL A 1 75  ? 5.723   0.357   4.010   1.00 0.00 ? 75  VAL A HG13 5  
ATOM   9473  H HG21 . VAL A 1 75  ? 5.266   -1.272  1.512   1.00 0.00 ? 75  VAL A HG21 5  
ATOM   9474  H HG22 . VAL A 1 75  ? 4.003   -0.357  0.683   1.00 0.00 ? 75  VAL A HG22 5  
ATOM   9475  H HG23 . VAL A 1 75  ? 3.827   -0.749  2.392   1.00 0.00 ? 75  VAL A HG23 5  
ATOM   9476  N N    . ARG A 1 76  ? 3.600   1.368   4.711   1.00 0.00 ? 76  ARG A N    5  
ATOM   9477  C CA   . ARG A 1 76  ? 2.709   0.826   5.729   1.00 0.00 ? 76  ARG A CA   5  
ATOM   9478  C C    . ARG A 1 76  ? 1.525   1.768   5.927   1.00 0.00 ? 76  ARG A C    5  
ATOM   9479  O O    . ARG A 1 76  ? 0.438   1.332   6.301   1.00 0.00 ? 76  ARG A O    5  
ATOM   9480  C CB   . ARG A 1 76  ? 3.436   0.556   7.054   1.00 0.00 ? 76  ARG A CB   5  
ATOM   9481  C CG   . ARG A 1 76  ? 3.347   1.689   8.062   1.00 0.00 ? 76  ARG A CG   5  
ATOM   9482  C CD   . ARG A 1 76  ? 4.043   1.341   9.370   1.00 0.00 ? 76  ARG A CD   5  
ATOM   9483  N NE   . ARG A 1 76  ? 4.028   2.461   10.308  1.00 0.00 ? 76  ARG A NE   5  
ATOM   9484  C CZ   . ARG A 1 76  ? 3.996   2.330   11.633  1.00 0.00 ? 76  ARG A CZ   5  
ATOM   9485  N NH1  . ARG A 1 76  ? 3.988   1.125   12.192  1.00 0.00 ? 76  ARG A NH1  5  
ATOM   9486  N NH2  . ARG A 1 76  ? 3.987   3.410   12.399  1.00 0.00 ? 76  ARG A NH2  5  
ATOM   9487  H H    . ARG A 1 76  ? 4.476   1.742   4.968   1.00 0.00 ? 76  ARG A H    5  
ATOM   9488  H HA   . ARG A 1 76  ? 2.328   -0.111  5.348   1.00 0.00 ? 76  ARG A HA   5  
ATOM   9489  H HB2  . ARG A 1 76  ? 3.012   -0.329  7.506   1.00 0.00 ? 76  ARG A HB2  5  
ATOM   9490  H HB3  . ARG A 1 76  ? 4.478   0.373   6.841   1.00 0.00 ? 76  ARG A HB3  5  
ATOM   9491  H HG2  . ARG A 1 76  ? 3.803   2.564   7.641   1.00 0.00 ? 76  ARG A HG2  5  
ATOM   9492  H HG3  . ARG A 1 76  ? 2.305   1.892   8.265   1.00 0.00 ? 76  ARG A HG3  5  
ATOM   9493  H HD2  . ARG A 1 76  ? 3.534   0.501   9.819   1.00 0.00 ? 76  ARG A HD2  5  
ATOM   9494  H HD3  . ARG A 1 76  ? 5.068   1.071   9.166   1.00 0.00 ? 76  ARG A HD3  5  
ATOM   9495  H HE   . ARG A 1 76  ? 4.050   3.368   9.926   1.00 0.00 ? 76  ARG A HE   5  
ATOM   9496  H HH11 . ARG A 1 76  ? 4.007   0.301   11.618  1.00 0.00 ? 76  ARG A HH11 5  
ATOM   9497  H HH12 . ARG A 1 76  ? 3.965   1.031   13.190  1.00 0.00 ? 76  ARG A HH12 5  
ATOM   9498  H HH21 . ARG A 1 76  ? 4.005   4.323   11.981  1.00 0.00 ? 76  ARG A HH21 5  
ATOM   9499  H HH22 . ARG A 1 76  ? 3.960   3.323   13.398  1.00 0.00 ? 76  ARG A HH22 5  
ATOM   9500  N N    . LEU A 1 77  ? 1.735   3.058   5.656   1.00 0.00 ? 77  LEU A N    5  
ATOM   9501  C CA   . LEU A 1 77  ? 0.648   4.029   5.660   1.00 0.00 ? 77  LEU A CA   5  
ATOM   9502  C C    . LEU A 1 77  ? -0.372  3.675   4.585   1.00 0.00 ? 77  LEU A C    5  
ATOM   9503  O O    . LEU A 1 77  ? -1.575  3.877   4.763   1.00 0.00 ? 77  LEU A O    5  
ATOM   9504  C CB   . LEU A 1 77  ? 1.191   5.434   5.418   1.00 0.00 ? 77  LEU A CB   5  
ATOM   9505  C CG   . LEU A 1 77  ? 0.900   6.445   6.525   1.00 0.00 ? 77  LEU A CG   5  
ATOM   9506  C CD1  . LEU A 1 77  ? 1.422   7.808   6.130   1.00 0.00 ? 77  LEU A CD1  5  
ATOM   9507  C CD2  . LEU A 1 77  ? -0.591  6.498   6.819   1.00 0.00 ? 77  LEU A CD2  5  
ATOM   9508  H H    . LEU A 1 77  ? 2.649   3.371   5.464   1.00 0.00 ? 77  LEU A H    5  
ATOM   9509  H HA   . LEU A 1 77  ? 0.166   3.994   6.625   1.00 0.00 ? 77  LEU A HA   5  
ATOM   9510  H HB2  . LEU A 1 77  ? 2.262   5.368   5.294   1.00 0.00 ? 77  LEU A HB2  5  
ATOM   9511  H HB3  . LEU A 1 77  ? 0.763   5.809   4.501   1.00 0.00 ? 77  LEU A HB3  5  
ATOM   9512  H HG   . LEU A 1 77  ? 1.412   6.144   7.424   1.00 0.00 ? 77  LEU A HG   5  
ATOM   9513  H HD11 . LEU A 1 77  ? 1.085   8.037   5.134   1.00 0.00 ? 77  LEU A HD11 5  
ATOM   9514  H HD12 . LEU A 1 77  ? 2.501   7.803   6.154   1.00 0.00 ? 77  LEU A HD12 5  
ATOM   9515  H HD13 . LEU A 1 77  ? 1.048   8.551   6.818   1.00 0.00 ? 77  LEU A HD13 5  
ATOM   9516  H HD21 . LEU A 1 77  ? -1.139  6.510   5.889   1.00 0.00 ? 77  LEU A HD21 5  
ATOM   9517  H HD22 . LEU A 1 77  ? -0.814  7.394   7.380   1.00 0.00 ? 77  LEU A HD22 5  
ATOM   9518  H HD23 . LEU A 1 77  ? -0.877  5.632   7.396   1.00 0.00 ? 77  LEU A HD23 5  
ATOM   9519  N N    . MET A 1 78  ? 0.120   3.144   3.472   1.00 0.00 ? 78  MET A N    5  
ATOM   9520  C CA   . MET A 1 78  ? -0.744  2.657   2.400   1.00 0.00 ? 78  MET A CA   5  
ATOM   9521  C C    . MET A 1 78  ? -1.657  1.551   2.930   1.00 0.00 ? 78  MET A C    5  
ATOM   9522  O O    . MET A 1 78  ? -2.874  1.597   2.754   1.00 0.00 ? 78  MET A O    5  
ATOM   9523  C CB   . MET A 1 78  ? 0.103   2.138   1.235   1.00 0.00 ? 78  MET A CB   5  
ATOM   9524  C CG   . MET A 1 78  ? -0.680  1.673   0.008   1.00 0.00 ? 78  MET A CG   5  
ATOM   9525  S SD   . MET A 1 78  ? 0.401   0.892   -1.201  1.00 0.00 ? 78  MET A SD   5  
ATOM   9526  C CE   . MET A 1 78  ? 1.090   -0.440  -0.217  1.00 0.00 ? 78  MET A CE   5  
ATOM   9527  H H    . MET A 1 78  ? 1.096   3.086   3.366   1.00 0.00 ? 78  MET A H    5  
ATOM   9528  H HA   . MET A 1 78  ? -1.351  3.486   2.063   1.00 0.00 ? 78  MET A HA   5  
ATOM   9529  H HB2  . MET A 1 78  ? 0.770   2.928   0.920   1.00 0.00 ? 78  MET A HB2  5  
ATOM   9530  H HB3  . MET A 1 78  ? 0.698   1.306   1.587   1.00 0.00 ? 78  MET A HB3  5  
ATOM   9531  H HG2  . MET A 1 78  ? -1.442  0.959   0.302   1.00 0.00 ? 78  MET A HG2  5  
ATOM   9532  H HG3  . MET A 1 78  ? -1.148  2.535   -0.452  1.00 0.00 ? 78  MET A HG3  5  
ATOM   9533  H HE1  . MET A 1 78  ? 1.754   -0.031  0.531   1.00 0.00 ? 78  MET A HE1  5  
ATOM   9534  H HE2  . MET A 1 78  ? 1.640   -1.115  -0.855  1.00 0.00 ? 78  MET A HE2  5  
ATOM   9535  H HE3  . MET A 1 78  ? 0.290   -0.977  0.270   1.00 0.00 ? 78  MET A HE3  5  
ATOM   9536  N N    . PHE A 1 79  ? -1.068  0.572   3.610   1.00 0.00 ? 79  PHE A N    5  
ATOM   9537  C CA   . PHE A 1 79  ? -1.854  -0.507  4.202   1.00 0.00 ? 79  PHE A CA   5  
ATOM   9538  C C    . PHE A 1 79  ? -2.763  0.026   5.319   1.00 0.00 ? 79  PHE A C    5  
ATOM   9539  O O    . PHE A 1 79  ? -3.878  -0.464  5.515   1.00 0.00 ? 79  PHE A O    5  
ATOM   9540  C CB   . PHE A 1 79  ? -0.946  -1.621  4.743   1.00 0.00 ? 79  PHE A CB   5  
ATOM   9541  C CG   . PHE A 1 79  ? -0.091  -2.275  3.690   1.00 0.00 ? 79  PHE A CG   5  
ATOM   9542  C CD1  . PHE A 1 79  ? -0.664  -2.869  2.577   1.00 0.00 ? 79  PHE A CD1  5  
ATOM   9543  C CD2  . PHE A 1 79  ? 1.288   -2.299  3.821   1.00 0.00 ? 79  PHE A CD2  5  
ATOM   9544  C CE1  . PHE A 1 79  ? 0.123   -3.469  1.611   1.00 0.00 ? 79  PHE A CE1  5  
ATOM   9545  C CE2  . PHE A 1 79  ? 2.080   -2.898  2.861   1.00 0.00 ? 79  PHE A CE2  5  
ATOM   9546  C CZ   . PHE A 1 79  ? 1.501   -3.484  1.753   1.00 0.00 ? 79  PHE A CZ   5  
ATOM   9547  H H    . PHE A 1 79  ? -0.084  0.570   3.708   1.00 0.00 ? 79  PHE A H    5  
ATOM   9548  H HA   . PHE A 1 79  ? -2.479  -0.917  3.422   1.00 0.00 ? 79  PHE A HA   5  
ATOM   9549  H HB2  . PHE A 1 79  ? -0.286  -1.207  5.491   1.00 0.00 ? 79  PHE A HB2  5  
ATOM   9550  H HB3  . PHE A 1 79  ? -1.561  -2.387  5.194   1.00 0.00 ? 79  PHE A HB3  5  
ATOM   9551  H HD1  . PHE A 1 79  ? -1.738  -2.856  2.464   1.00 0.00 ? 79  PHE A HD1  5  
ATOM   9552  H HD2  . PHE A 1 79  ? 1.744   -1.844  4.686   1.00 0.00 ? 79  PHE A HD2  5  
ATOM   9553  H HE1  . PHE A 1 79  ? -0.339  -3.929  0.750   1.00 0.00 ? 79  PHE A HE1  5  
ATOM   9554  H HE2  . PHE A 1 79  ? 3.153   -2.909  2.978   1.00 0.00 ? 79  PHE A HE2  5  
ATOM   9555  H HZ   . PHE A 1 79  ? 2.126   -3.948  0.998   1.00 0.00 ? 79  PHE A HZ   5  
ATOM   9556  N N    . SER A 1 80  ? -2.293  1.049   6.029   1.00 0.00 ? 80  SER A N    5  
ATOM   9557  C CA   . SER A 1 80  ? -3.043  1.627   7.134   1.00 0.00 ? 80  SER A CA   5  
ATOM   9558  C C    . SER A 1 80  ? -4.303  2.346   6.650   1.00 0.00 ? 80  SER A C    5  
ATOM   9559  O O    . SER A 1 80  ? -5.369  2.197   7.251   1.00 0.00 ? 80  SER A O    5  
ATOM   9560  C CB   . SER A 1 80  ? -2.158  2.588   7.932   1.00 0.00 ? 80  SER A CB   5  
ATOM   9561  O OG   . SER A 1 80  ? -1.019  1.917   8.454   1.00 0.00 ? 80  SER A OG   5  
ATOM   9562  H H    . SER A 1 80  ? -1.415  1.420   5.809   1.00 0.00 ? 80  SER A H    5  
ATOM   9563  H HA   . SER A 1 80  ? -3.340  0.816   7.782   1.00 0.00 ? 80  SER A HA   5  
ATOM   9564  H HB2  . SER A 1 80  ? -1.825  3.386   7.287   1.00 0.00 ? 80  SER A HB2  5  
ATOM   9565  H HB3  . SER A 1 80  ? -2.726  3.000   8.753   1.00 0.00 ? 80  SER A HB3  5  
ATOM   9566  H HG   . SER A 1 80  ? -0.526  1.509   7.727   1.00 0.00 ? 80  SER A HG   5  
ATOM   9567  N N    . ASN A 1 81  ? -4.197  3.118   5.561   1.00 0.00 ? 81  ASN A N    5  
ATOM   9568  C CA   . ASN A 1 81  ? -5.366  3.828   5.044   1.00 0.00 ? 81  ASN A CA   5  
ATOM   9569  C C    . ASN A 1 81  ? -6.402  2.828   4.530   1.00 0.00 ? 81  ASN A C    5  
ATOM   9570  O O    . ASN A 1 81  ? -7.606  3.062   4.635   1.00 0.00 ? 81  ASN A O    5  
ATOM   9571  C CB   . ASN A 1 81  ? -5.010  4.872   3.955   1.00 0.00 ? 81  ASN A CB   5  
ATOM   9572  C CG   . ASN A 1 81  ? -4.578  4.278   2.625   1.00 0.00 ? 81  ASN A CG   5  
ATOM   9573  O OD1  . ASN A 1 81  ? -5.400  3.805   1.845   1.00 0.00 ? 81  ASN A OD1  5  
ATOM   9574  N ND2  . ASN A 1 81  ? -3.294  4.364   2.330   1.00 0.00 ? 81  ASN A ND2  5  
ATOM   9575  H H    . ASN A 1 81  ? -3.326  3.217   5.114   1.00 0.00 ? 81  ASN A H    5  
ATOM   9576  H HA   . ASN A 1 81  ? -5.801  4.352   5.882   1.00 0.00 ? 81  ASN A HA   5  
ATOM   9577  H HB2  . ASN A 1 81  ? -5.870  5.500   3.771   1.00 0.00 ? 81  ASN A HB2  5  
ATOM   9578  H HB3  . ASN A 1 81  ? -4.203  5.489   4.324   1.00 0.00 ? 81  ASN A HB3  5  
ATOM   9579  H HD21 . ASN A 1 81  ? -2.697  4.800   2.974   1.00 0.00 ? 81  ASN A HD21 5  
ATOM   9580  H HD22 . ASN A 1 81  ? -2.992  3.985   1.479   1.00 0.00 ? 81  ASN A HD22 5  
ATOM   9581  N N    . CYS A 1 82  ? -5.930  1.693   4.014   1.00 0.00 ? 82  CYS A N    5  
ATOM   9582  C CA   . CYS A 1 82  ? -6.825  0.621   3.583   1.00 0.00 ? 82  CYS A CA   5  
ATOM   9583  C C    . CYS A 1 82  ? -7.675  0.116   4.748   1.00 0.00 ? 82  CYS A C    5  
ATOM   9584  O O    . CYS A 1 82  ? -8.876  -0.118  4.587   1.00 0.00 ? 82  CYS A O    5  
ATOM   9585  C CB   . CYS A 1 82  ? -6.032  -0.546  2.987   1.00 0.00 ? 82  CYS A CB   5  
ATOM   9586  S SG   . CYS A 1 82  ? -4.971  -0.097  1.595   1.00 0.00 ? 82  CYS A SG   5  
ATOM   9587  H H    . CYS A 1 82  ? -4.959  1.586   3.897   1.00 0.00 ? 82  CYS A H    5  
ATOM   9588  H HA   . CYS A 1 82  ? -7.487  1.024   2.826   1.00 0.00 ? 82  CYS A HA   5  
ATOM   9589  H HB2  . CYS A 1 82  ? -5.403  -0.974  3.754   1.00 0.00 ? 82  CYS A HB2  5  
ATOM   9590  H HB3  . CYS A 1 82  ? -6.726  -1.299  2.641   1.00 0.00 ? 82  CYS A HB3  5  
ATOM   9591  H HG   . CYS A 1 82  ? -4.205  0.920   1.974   1.00 0.00 ? 82  CYS A HG   5  
ATOM   9592  N N    . TYR A 1 83  ? -7.054  -0.050  5.922   1.00 0.00 ? 83  TYR A N    5  
ATOM   9593  C CA   . TYR A 1 83  ? -7.780  -0.530  7.098   1.00 0.00 ? 83  TYR A CA   5  
ATOM   9594  C C    . TYR A 1 83  ? -8.738  0.528   7.627   1.00 0.00 ? 83  TYR A C    5  
ATOM   9595  O O    . TYR A 1 83  ? -9.711  0.203   8.307   1.00 0.00 ? 83  TYR A O    5  
ATOM   9596  C CB   . TYR A 1 83  ? -6.836  -0.942  8.235   1.00 0.00 ? 83  TYR A CB   5  
ATOM   9597  C CG   . TYR A 1 83  ? -5.907  -2.102  7.917   1.00 0.00 ? 83  TYR A CG   5  
ATOM   9598  C CD1  . TYR A 1 83  ? -6.317  -3.137  7.082   1.00 0.00 ? 83  TYR A CD1  5  
ATOM   9599  C CD2  . TYR A 1 83  ? -4.622  -2.177  8.467   1.00 0.00 ? 83  TYR A CD2  5  
ATOM   9600  C CE1  . TYR A 1 83  ? -5.486  -4.205  6.807   1.00 0.00 ? 83  TYR A CE1  5  
ATOM   9601  C CE2  . TYR A 1 83  ? -3.791  -3.242  8.190   1.00 0.00 ? 83  TYR A CE2  5  
ATOM   9602  C CZ   . TYR A 1 83  ? -4.225  -4.251  7.364   1.00 0.00 ? 83  TYR A CZ   5  
ATOM   9603  O OH   . TYR A 1 83  ? -3.392  -5.314  7.094   1.00 0.00 ? 83  TYR A OH   5  
ATOM   9604  H H    . TYR A 1 83  ? -6.093  0.149   5.993   1.00 0.00 ? 83  TYR A H    5  
ATOM   9605  H HA   . TYR A 1 83  ? -8.356  -1.393  6.795   1.00 0.00 ? 83  TYR A HA   5  
ATOM   9606  H HB2  . TYR A 1 83  ? -6.226  -0.094  8.508   1.00 0.00 ? 83  TYR A HB2  5  
ATOM   9607  H HB3  . TYR A 1 83  ? -7.449  -1.228  9.086   1.00 0.00 ? 83  TYR A HB3  5  
ATOM   9608  H HD1  . TYR A 1 83  ? -7.304  -3.101  6.647   1.00 0.00 ? 83  TYR A HD1  5  
ATOM   9609  H HD2  . TYR A 1 83  ? -4.266  -1.383  9.114   1.00 0.00 ? 83  TYR A HD2  5  
ATOM   9610  H HE1  . TYR A 1 83  ? -5.823  -4.996  6.154   1.00 0.00 ? 83  TYR A HE1  5  
ATOM   9611  H HE2  . TYR A 1 83  ? -2.808  -3.286  8.632   1.00 0.00 ? 83  TYR A HE2  5  
ATOM   9612  H HH   . TYR A 1 83  ? -3.318  -5.429  6.142   1.00 0.00 ? 83  TYR A HH   5  
ATOM   9613  N N    . LYS A 1 84  ? -8.455  1.792   7.334   1.00 0.00 ? 84  LYS A N    5  
ATOM   9614  C CA   . LYS A 1 84  ? -9.338  2.874   7.749   1.00 0.00 ? 84  LYS A CA   5  
ATOM   9615  C C    . LYS A 1 84  ? -10.644 2.810   6.986   1.00 0.00 ? 84  LYS A C    5  
ATOM   9616  O O    . LYS A 1 84  ? -11.725 2.841   7.573   1.00 0.00 ? 84  LYS A O    5  
ATOM   9617  C CB   . LYS A 1 84  ? -8.711  4.246   7.505   1.00 0.00 ? 84  LYS A CB   5  
ATOM   9618  C CG   . LYS A 1 84  ? -7.538  4.579   8.404   1.00 0.00 ? 84  LYS A CG   5  
ATOM   9619  C CD   . LYS A 1 84  ? -7.019  5.982   8.122   1.00 0.00 ? 84  LYS A CD   5  
ATOM   9620  C CE   . LYS A 1 84  ? -8.128  7.027   8.229   1.00 0.00 ? 84  LYS A CE   5  
ATOM   9621  N NZ   . LYS A 1 84  ? -8.767  7.028   9.573   1.00 0.00 ? 84  LYS A NZ   5  
ATOM   9622  H H    . LYS A 1 84  ? -7.637  1.998   6.833   1.00 0.00 ? 84  LYS A H    5  
ATOM   9623  H HA   . LYS A 1 84  ? -9.539  2.758   8.802   1.00 0.00 ? 84  LYS A HA   5  
ATOM   9624  H HB2  . LYS A 1 84  ? -8.376  4.298   6.481   1.00 0.00 ? 84  LYS A HB2  5  
ATOM   9625  H HB3  . LYS A 1 84  ? -9.472  4.996   7.656   1.00 0.00 ? 84  LYS A HB3  5  
ATOM   9626  H HG2  . LYS A 1 84  ? -7.857  4.521   9.434   1.00 0.00 ? 84  LYS A HG2  5  
ATOM   9627  H HG3  . LYS A 1 84  ? -6.744  3.867   8.227   1.00 0.00 ? 84  LYS A HG3  5  
ATOM   9628  H HD2  . LYS A 1 84  ? -6.247  6.220   8.837   1.00 0.00 ? 84  LYS A HD2  5  
ATOM   9629  H HD3  . LYS A 1 84  ? -6.608  6.009   7.124   1.00 0.00 ? 84  LYS A HD3  5  
ATOM   9630  H HE2  . LYS A 1 84  ? -7.702  8.002   8.046   1.00 0.00 ? 84  LYS A HE2  5  
ATOM   9631  H HE3  . LYS A 1 84  ? -8.882  6.818   7.476   1.00 0.00 ? 84  LYS A HE3  5  
ATOM   9632  H HZ1  . LYS A 1 84  ? -9.519  7.748   9.610   1.00 0.00 ? 84  LYS A HZ1  5  
ATOM   9633  H HZ2  . LYS A 1 84  ? -8.063  7.245   10.306  1.00 0.00 ? 84  LYS A HZ2  5  
ATOM   9634  H HZ3  . LYS A 1 84  ? -9.186  6.099   9.773   1.00 0.00 ? 84  LYS A HZ3  5  
ATOM   9635  N N    . TYR A 1 85  ? -10.531 2.710   5.672   1.00 0.00 ? 85  TYR A N    5  
ATOM   9636  C CA   . TYR A 1 85  ? -11.686 2.807   4.809   1.00 0.00 ? 85  TYR A CA   5  
ATOM   9637  C C    . TYR A 1 85  ? -12.534 1.550   4.877   1.00 0.00 ? 85  TYR A C    5  
ATOM   9638  O O    . TYR A 1 85  ? -13.701 1.588   5.270   1.00 0.00 ? 85  TYR A O    5  
ATOM   9639  C CB   . TYR A 1 85  ? -11.262 3.046   3.364   1.00 0.00 ? 85  TYR A CB   5  
ATOM   9640  C CG   . TYR A 1 85  ? -12.448 3.336   2.475   1.00 0.00 ? 85  TYR A CG   5  
ATOM   9641  C CD1  . TYR A 1 85  ? -13.081 4.554   2.591   1.00 0.00 ? 85  TYR A CD1  5  
ATOM   9642  C CD2  . TYR A 1 85  ? -12.951 2.417   1.555   1.00 0.00 ? 85  TYR A CD2  5  
ATOM   9643  C CE1  . TYR A 1 85  ? -14.181 4.872   1.825   1.00 0.00 ? 85  TYR A CE1  5  
ATOM   9644  C CE2  . TYR A 1 85  ? -14.053 2.728   0.781   1.00 0.00 ? 85  TYR A CE2  5  
ATOM   9645  C CZ   . TYR A 1 85  ? -14.664 3.957   0.922   1.00 0.00 ? 85  TYR A CZ   5  
ATOM   9646  O OH   . TYR A 1 85  ? -15.756 4.277   0.153   1.00 0.00 ? 85  TYR A OH   5  
ATOM   9647  H H    . TYR A 1 85  ? -9.646  2.557   5.275   1.00 0.00 ? 85  TYR A H    5  
ATOM   9648  H HA   . TYR A 1 85  ? -12.273 3.652   5.140   1.00 0.00 ? 85  TYR A HA   5  
ATOM   9649  H HB2  . TYR A 1 85  ? -10.606 3.900   3.331   1.00 0.00 ? 85  TYR A HB2  5  
ATOM   9650  H HB3  . TYR A 1 85  ? -10.737 2.177   2.987   1.00 0.00 ? 85  TYR A HB3  5  
ATOM   9651  H HD1  . TYR A 1 85  ? -12.694 5.261   3.304   1.00 0.00 ? 85  TYR A HD1  5  
ATOM   9652  H HD2  . TYR A 1 85  ? -12.475 1.453   1.445   1.00 0.00 ? 85  TYR A HD2  5  
ATOM   9653  H HE1  . TYR A 1 85  ? -14.661 5.829   1.937   1.00 0.00 ? 85  TYR A HE1  5  
ATOM   9654  H HE2  . TYR A 1 85  ? -14.438 2.006   0.076   1.00 0.00 ? 85  TYR A HE2  5  
ATOM   9655  H HH   . TYR A 1 85  ? -15.830 5.238   0.090   1.00 0.00 ? 85  TYR A HH   5  
ATOM   9656  N N    . ASN A 1 86  ? -11.928 0.444   4.504   1.00 0.00 ? 86  ASN A N    5  
ATOM   9657  C CA   . ASN A 1 86  ? -12.640 -0.809  4.357   1.00 0.00 ? 86  ASN A CA   5  
ATOM   9658  C C    . ASN A 1 86  ? -12.817 -1.479  5.708   1.00 0.00 ? 86  ASN A C    5  
ATOM   9659  O O    . ASN A 1 86  ? -11.859 -1.604  6.476   1.00 0.00 ? 86  ASN A O    5  
ATOM   9660  C CB   . ASN A 1 86  ? -11.871 -1.738  3.413   1.00 0.00 ? 86  ASN A CB   5  
ATOM   9661  C CG   . ASN A 1 86  ? -11.568 -1.096  2.076   1.00 0.00 ? 86  ASN A CG   5  
ATOM   9662  O OD1  . ASN A 1 86  ? -12.348 -1.200  1.132   1.00 0.00 ? 86  ASN A OD1  5  
ATOM   9663  N ND2  . ASN A 1 86  ? -10.419 -0.443  1.980   1.00 0.00 ? 86  ASN A ND2  5  
ATOM   9664  H H    . ASN A 1 86  ? -10.962 0.466   4.336   1.00 0.00 ? 86  ASN A H    5  
ATOM   9665  H HA   . ASN A 1 86  ? -13.609 -0.596  3.935   1.00 0.00 ? 86  ASN A HA   5  
ATOM   9666  H HB2  . ASN A 1 86  ? -10.935 -2.013  3.877   1.00 0.00 ? 86  ASN A HB2  5  
ATOM   9667  H HB3  . ASN A 1 86  ? -12.463 -2.628  3.237   1.00 0.00 ? 86  ASN A HB3  5  
ATOM   9668  H HD21 . ASN A 1 86  ? -9.833  -0.414  2.769   1.00 0.00 ? 86  ASN A HD21 5  
ATOM   9669  H HD22 . ASN A 1 86  ? -10.207 0.000   1.132   1.00 0.00 ? 86  ASN A HD22 5  
ATOM   9670  N N    . PRO A 1 87  ? -14.050 -1.895  6.031   1.00 0.00 ? 87  PRO A N    5  
ATOM   9671  C CA   . PRO A 1 87  ? -14.330 -2.643  7.253   1.00 0.00 ? 87  PRO A CA   5  
ATOM   9672  C C    . PRO A 1 87  ? -13.533 -3.945  7.293   1.00 0.00 ? 87  PRO A C    5  
ATOM   9673  O O    . PRO A 1 87  ? -13.159 -4.485  6.249   1.00 0.00 ? 87  PRO A O    5  
ATOM   9674  C CB   . PRO A 1 87  ? -15.838 -2.928  7.188   1.00 0.00 ? 87  PRO A CB   5  
ATOM   9675  C CG   . PRO A 1 87  ? -16.242 -2.659  5.779   1.00 0.00 ? 87  PRO A CG   5  
ATOM   9676  C CD   . PRO A 1 87  ? -15.265 -1.655  5.238   1.00 0.00 ? 87  PRO A CD   5  
ATOM   9677  H HA   . PRO A 1 87  ? -14.105 -2.058  8.133   1.00 0.00 ? 87  PRO A HA   5  
ATOM   9678  H HB2  . PRO A 1 87  ? -16.019 -3.959  7.456   1.00 0.00 ? 87  PRO A HB2  5  
ATOM   9679  H HB3  . PRO A 1 87  ? -16.356 -2.278  7.876   1.00 0.00 ? 87  PRO A HB3  5  
ATOM   9680  H HG2  . PRO A 1 87  ? -16.197 -3.571  5.204   1.00 0.00 ? 87  PRO A HG2  5  
ATOM   9681  H HG3  . PRO A 1 87  ? -17.244 -2.251  5.760   1.00 0.00 ? 87  PRO A HG3  5  
ATOM   9682  H HD2  . PRO A 1 87  ? -15.083 -1.838  4.189   1.00 0.00 ? 87  PRO A HD2  5  
ATOM   9683  H HD3  . PRO A 1 87  ? -15.631 -0.650  5.389   1.00 0.00 ? 87  PRO A HD3  5  
ATOM   9684  N N    . PRO A 1 88  ? -13.265 -4.449  8.514   1.00 0.00 ? 88  PRO A N    5  
ATOM   9685  C CA   . PRO A 1 88  ? -12.382 -5.607  8.762   1.00 0.00 ? 88  PRO A CA   5  
ATOM   9686  C C    . PRO A 1 88  ? -12.734 -6.847  7.945   1.00 0.00 ? 88  PRO A C    5  
ATOM   9687  O O    . PRO A 1 88  ? -11.919 -7.760  7.815   1.00 0.00 ? 88  PRO A O    5  
ATOM   9688  C CB   . PRO A 1 88  ? -12.570 -5.897  10.256  1.00 0.00 ? 88  PRO A CB   5  
ATOM   9689  C CG   . PRO A 1 88  ? -13.768 -5.111  10.671  1.00 0.00 ? 88  PRO A CG   5  
ATOM   9690  C CD   . PRO A 1 88  ? -13.804 -3.916  9.773   1.00 0.00 ? 88  PRO A CD   5  
ATOM   9691  H HA   . PRO A 1 88  ? -11.350 -5.352  8.579   1.00 0.00 ? 88  PRO A HA   5  
ATOM   9692  H HB2  . PRO A 1 88  ? -12.727 -6.954  10.397  1.00 0.00 ? 88  PRO A HB2  5  
ATOM   9693  H HB3  . PRO A 1 88  ? -11.690 -5.584  10.796  1.00 0.00 ? 88  PRO A HB3  5  
ATOM   9694  H HG2  . PRO A 1 88  ? -14.659 -5.706  10.540  1.00 0.00 ? 88  PRO A HG2  5  
ATOM   9695  H HG3  . PRO A 1 88  ? -13.669 -4.803  11.701  1.00 0.00 ? 88  PRO A HG3  5  
ATOM   9696  H HD2  . PRO A 1 88  ? -14.819 -3.568  9.645   1.00 0.00 ? 88  PRO A HD2  5  
ATOM   9697  H HD3  . PRO A 1 88  ? -13.175 -3.130  10.161  1.00 0.00 ? 88  PRO A HD3  5  
ATOM   9698  N N    . ASP A 1 89  ? -13.951 -6.888  7.429   1.00 0.00 ? 89  ASP A N    5  
ATOM   9699  C CA   . ASP A 1 89  ? -14.366 -7.963  6.533   1.00 0.00 ? 89  ASP A CA   5  
ATOM   9700  C C    . ASP A 1 89  ? -14.593 -7.415  5.125   1.00 0.00 ? 89  ASP A C    5  
ATOM   9701  O O    . ASP A 1 89  ? -15.709 -7.039  4.763   1.00 0.00 ? 89  ASP A O    5  
ATOM   9702  C CB   . ASP A 1 89  ? -15.640 -8.647  7.050   1.00 0.00 ? 89  ASP A CB   5  
ATOM   9703  C CG   . ASP A 1 89  ? -16.019 -9.865  6.231   1.00 0.00 ? 89  ASP A CG   5  
ATOM   9704  O OD1  . ASP A 1 89  ? -15.337 -10.906 6.353   1.00 0.00 ? 89  ASP A OD1  5  
ATOM   9705  O OD2  . ASP A 1 89  ? -17.014 -9.795  5.478   1.00 0.00 ? 89  ASP A OD2  5  
ATOM   9706  H H    . ASP A 1 89  ? -14.581 -6.173  7.653   1.00 0.00 ? 89  ASP A H    5  
ATOM   9707  H HA   . ASP A 1 89  ? -13.565 -8.688  6.498   1.00 0.00 ? 89  ASP A HA   5  
ATOM   9708  H HB2  . ASP A 1 89  ? -15.487 -8.958  8.071   1.00 0.00 ? 89  ASP A HB2  5  
ATOM   9709  H HB3  . ASP A 1 89  ? -16.464 -7.946  7.011   1.00 0.00 ? 89  ASP A HB3  5  
ATOM   9710  N N    . HIS A 1 90  ? -13.522 -7.345  4.344   1.00 0.00 ? 90  HIS A N    5  
ATOM   9711  C CA   . HIS A 1 90  ? -13.601 -6.877  2.964   1.00 0.00 ? 90  HIS A CA   5  
ATOM   9712  C C    . HIS A 1 90  ? -12.361 -7.341  2.202   1.00 0.00 ? 90  HIS A C    5  
ATOM   9713  O O    . HIS A 1 90  ? -11.305 -7.503  2.805   1.00 0.00 ? 90  HIS A O    5  
ATOM   9714  C CB   . HIS A 1 90  ? -13.695 -5.344  2.906   1.00 0.00 ? 90  HIS A CB   5  
ATOM   9715  C CG   . HIS A 1 90  ? -14.450 -4.814  1.708   1.00 0.00 ? 90  HIS A CG   5  
ATOM   9716  N ND1  . HIS A 1 90  ? -13.823 -4.408  0.549   1.00 0.00 ? 90  HIS A ND1  5  
ATOM   9717  C CD2  . HIS A 1 90  ? -15.780 -4.619  1.489   1.00 0.00 ? 90  HIS A CD2  5  
ATOM   9718  C CE1  . HIS A 1 90  ? -14.724 -3.991  -0.320  1.00 0.00 ? 90  HIS A CE1  5  
ATOM   9719  N NE2  . HIS A 1 90  ? -15.914 -4.111  0.224   1.00 0.00 ? 90  HIS A NE2  5  
ATOM   9720  H H    . HIS A 1 90  ? -12.650 -7.629  4.703   1.00 0.00 ? 90  HIS A H    5  
ATOM   9721  H HA   . HIS A 1 90  ? -14.482 -7.312  2.514   1.00 0.00 ? 90  HIS A HA   5  
ATOM   9722  H HB2  . HIS A 1 90  ? -14.169 -4.982  3.803   1.00 0.00 ? 90  HIS A HB2  5  
ATOM   9723  H HB3  . HIS A 1 90  ? -12.692 -4.942  2.862   1.00 0.00 ? 90  HIS A HB3  5  
ATOM   9724  H HD1  . HIS A 1 90  ? -12.866 -4.413  0.391   1.00 0.00 ? 90  HIS A HD1  5  
ATOM   9725  H HD2  . HIS A 1 90  ? -16.582 -4.815  2.176   1.00 0.00 ? 90  HIS A HD2  5  
ATOM   9726  H HE1  . HIS A 1 90  ? -14.518 -3.617  -1.312  1.00 0.00 ? 90  HIS A HE1  5  
ATOM   9727  H HE2  . HIS A 1 90  ? -16.757 -3.800  -0.182  1.00 0.00 ? 90  HIS A HE2  5  
ATOM   9728  N N    . ASP A 1 91  ? -12.469 -7.551  0.896   1.00 0.00 ? 91  ASP A N    5  
ATOM   9729  C CA   . ASP A 1 91  ? -11.346 -8.096  0.121   1.00 0.00 ? 91  ASP A CA   5  
ATOM   9730  C C    . ASP A 1 91  ? -10.059 -7.292  0.312   1.00 0.00 ? 91  ASP A C    5  
ATOM   9731  O O    . ASP A 1 91  ? -8.984  -7.865  0.493   1.00 0.00 ? 91  ASP A O    5  
ATOM   9732  C CB   . ASP A 1 91  ? -11.683 -8.162  -1.371  1.00 0.00 ? 91  ASP A CB   5  
ATOM   9733  C CG   . ASP A 1 91  ? -12.637 -9.292  -1.711  1.00 0.00 ? 91  ASP A CG   5  
ATOM   9734  O OD1  . ASP A 1 91  ? -13.798 -9.014  -2.073  1.00 0.00 ? 91  ASP A OD1  5  
ATOM   9735  O OD2  . ASP A 1 91  ? -12.230 -10.471 -1.615  1.00 0.00 ? 91  ASP A OD2  5  
ATOM   9736  H H    . ASP A 1 91  ? -13.318 -7.354  0.444   1.00 0.00 ? 91  ASP A H    5  
ATOM   9737  H HA   . ASP A 1 91  ? -11.171 -9.100  0.476   1.00 0.00 ? 91  ASP A HA   5  
ATOM   9738  H HB2  . ASP A 1 91  ? -12.133 -7.228  -1.673  1.00 0.00 ? 91  ASP A HB2  5  
ATOM   9739  H HB3  . ASP A 1 91  ? -10.770 -8.308  -1.928  1.00 0.00 ? 91  ASP A HB3  5  
ATOM   9740  N N    . VAL A 1 92  ? -10.173 -5.967  0.312   1.00 0.00 ? 92  VAL A N    5  
ATOM   9741  C CA   . VAL A 1 92  ? -8.992  -5.103  0.322   1.00 0.00 ? 92  VAL A CA   5  
ATOM   9742  C C    . VAL A 1 92  ? -8.226  -5.206  1.634   1.00 0.00 ? 92  VAL A C    5  
ATOM   9743  O O    . VAL A 1 92  ? -7.014  -5.029  1.655   1.00 0.00 ? 92  VAL A O    5  
ATOM   9744  C CB   . VAL A 1 92  ? -9.330  -3.622  0.052   1.00 0.00 ? 92  VAL A CB   5  
ATOM   9745  C CG1  . VAL A 1 92  ? -8.358  -3.036  -0.949  1.00 0.00 ? 92  VAL A CG1  5  
ATOM   9746  C CG2  . VAL A 1 92  ? -10.750 -3.464  -0.444  1.00 0.00 ? 92  VAL A CG2  5  
ATOM   9747  H H    . VAL A 1 92  ? -11.061 -5.567  0.314   1.00 0.00 ? 92  VAL A H    5  
ATOM   9748  H HA   . VAL A 1 92  ? -8.342  -5.436  -0.466  1.00 0.00 ? 92  VAL A HA   5  
ATOM   9749  H HB   . VAL A 1 92  ? -9.225  -3.076  0.976   1.00 0.00 ? 92  VAL A HB   5  
ATOM   9750  H HG11 . VAL A 1 92  ? -7.365  -3.361  -0.708  1.00 0.00 ? 92  VAL A HG11 5  
ATOM   9751  H HG12 . VAL A 1 92  ? -8.405  -1.958  -0.910  1.00 0.00 ? 92  VAL A HG12 5  
ATOM   9752  H HG13 . VAL A 1 92  ? -8.618  -3.372  -1.942  1.00 0.00 ? 92  VAL A HG13 5  
ATOM   9753  H HG21 . VAL A 1 92  ? -11.422 -3.844  0.298   1.00 0.00 ? 92  VAL A HG21 5  
ATOM   9754  H HG22 . VAL A 1 92  ? -10.876 -4.016  -1.362  1.00 0.00 ? 92  VAL A HG22 5  
ATOM   9755  H HG23 . VAL A 1 92  ? -10.957 -2.420  -0.617  1.00 0.00 ? 92  VAL A HG23 5  
ATOM   9756  N N    . VAL A 1 93  ? -8.918  -5.507  2.728   1.00 0.00 ? 93  VAL A N    5  
ATOM   9757  C CA   . VAL A 1 93  ? -8.241  -5.633  4.011   1.00 0.00 ? 93  VAL A CA   5  
ATOM   9758  C C    . VAL A 1 93  ? -7.561  -6.992  4.105   1.00 0.00 ? 93  VAL A C    5  
ATOM   9759  O O    . VAL A 1 93  ? -6.470  -7.111  4.654   1.00 0.00 ? 93  VAL A O    5  
ATOM   9760  C CB   . VAL A 1 93  ? -9.187  -5.424  5.222   1.00 0.00 ? 93  VAL A CB   5  
ATOM   9761  C CG1  . VAL A 1 93  ? -9.928  -4.107  5.094   1.00 0.00 ? 93  VAL A CG1  5  
ATOM   9762  C CG2  . VAL A 1 93  ? -10.173 -6.565  5.374   1.00 0.00 ? 93  VAL A CG2  5  
ATOM   9763  H H    . VAL A 1 93  ? -9.884  -5.660  2.669   1.00 0.00 ? 93  VAL A H    5  
ATOM   9764  H HA   . VAL A 1 93  ? -7.476  -4.869  4.044   1.00 0.00 ? 93  VAL A HA   5  
ATOM   9765  H HB   . VAL A 1 93  ? -8.585  -5.383  6.116   1.00 0.00 ? 93  VAL A HB   5  
ATOM   9766  H HG11 . VAL A 1 93  ? -10.633 -4.176  4.276   1.00 0.00 ? 93  VAL A HG11 5  
ATOM   9767  H HG12 . VAL A 1 93  ? -9.223  -3.313  4.899   1.00 0.00 ? 93  VAL A HG12 5  
ATOM   9768  H HG13 . VAL A 1 93  ? -10.459 -3.901  6.012   1.00 0.00 ? 93  VAL A HG13 5  
ATOM   9769  H HG21 . VAL A 1 93  ? -10.811 -6.608  4.503   1.00 0.00 ? 93  VAL A HG21 5  
ATOM   9770  H HG22 . VAL A 1 93  ? -10.777 -6.406  6.255   1.00 0.00 ? 93  VAL A HG22 5  
ATOM   9771  H HG23 . VAL A 1 93  ? -9.634  -7.495  5.470   1.00 0.00 ? 93  VAL A HG23 5  
ATOM   9772  N N    . ALA A 1 94  ? -8.199  -8.006  3.532   1.00 0.00 ? 94  ALA A N    5  
ATOM   9773  C CA   . ALA A 1 94  ? -7.626  -9.344  3.484   1.00 0.00 ? 94  ALA A CA   5  
ATOM   9774  C C    . ALA A 1 94  ? -6.375  -9.351  2.615   1.00 0.00 ? 94  ALA A C    5  
ATOM   9775  O O    . ALA A 1 94  ? -5.368  -9.973  2.960   1.00 0.00 ? 94  ALA A O    5  
ATOM   9776  C CB   . ALA A 1 94  ? -8.648  -10.345 2.965   1.00 0.00 ? 94  ALA A CB   5  
ATOM   9777  H H    . ALA A 1 94  ? -9.085  -7.851  3.142   1.00 0.00 ? 94  ALA A H    5  
ATOM   9778  H HA   . ALA A 1 94  ? -7.354  -9.627  4.491   1.00 0.00 ? 94  ALA A HA   5  
ATOM   9779  H HB1  . ALA A 1 94  ? -8.965  -10.059 1.974   1.00 0.00 ? 94  ALA A HB1  5  
ATOM   9780  H HB2  . ALA A 1 94  ? -9.503  -10.360 3.625   1.00 0.00 ? 94  ALA A HB2  5  
ATOM   9781  H HB3  . ALA A 1 94  ? -8.204  -11.328 2.931   1.00 0.00 ? 94  ALA A HB3  5  
ATOM   9782  N N    . MET A 1 95  ? -6.438  -8.644  1.493   1.00 0.00 ? 95  MET A N    5  
ATOM   9783  C CA   . MET A 1 95  ? -5.286  -8.501  0.612   1.00 0.00 ? 95  MET A CA   5  
ATOM   9784  C C    . MET A 1 95  ? -4.205  -7.656  1.287   1.00 0.00 ? 95  MET A C    5  
ATOM   9785  O O    . MET A 1 95  ? -3.013  -7.929  1.142   1.00 0.00 ? 95  MET A O    5  
ATOM   9786  C CB   . MET A 1 95  ? -5.698  -7.882  -0.734  1.00 0.00 ? 95  MET A CB   5  
ATOM   9787  C CG   . MET A 1 95  ? -6.593  -8.783  -1.585  1.00 0.00 ? 95  MET A CG   5  
ATOM   9788  S SD   . MET A 1 95  ? -6.846  -8.143  -3.257  1.00 0.00 ? 95  MET A SD   5  
ATOM   9789  C CE   . MET A 1 95  ? -8.349  -7.192  -3.054  1.00 0.00 ? 95  MET A CE   5  
ATOM   9790  H H    . MET A 1 95  ? -7.289  -8.217  1.244   1.00 0.00 ? 95  MET A H    5  
ATOM   9791  H HA   . MET A 1 95  ? -4.883  -9.488  0.434   1.00 0.00 ? 95  MET A HA   5  
ATOM   9792  H HB2  . MET A 1 95  ? -6.230  -6.961  -0.544  1.00 0.00 ? 95  MET A HB2  5  
ATOM   9793  H HB3  . MET A 1 95  ? -4.804  -7.660  -1.300  1.00 0.00 ? 95  MET A HB3  5  
ATOM   9794  H HG2  . MET A 1 95  ? -6.142  -9.761  -1.657  1.00 0.00 ? 95  MET A HG2  5  
ATOM   9795  H HG3  . MET A 1 95  ? -7.556  -8.869  -1.099  1.00 0.00 ? 95  MET A HG3  5  
ATOM   9796  H HE1  . MET A 1 95  ? -8.240  -6.509  -2.229  1.00 0.00 ? 95  MET A HE1  5  
ATOM   9797  H HE2  . MET A 1 95  ? -9.171  -7.862  -2.862  1.00 0.00 ? 95  MET A HE2  5  
ATOM   9798  H HE3  . MET A 1 95  ? -8.544  -6.635  -3.959  1.00 0.00 ? 95  MET A HE3  5  
ATOM   9799  N N    . ALA A 1 96  ? -4.630  -6.653  2.057   1.00 0.00 ? 96  ALA A N    5  
ATOM   9800  C CA   . ALA A 1 96  ? -3.695  -5.791  2.776   1.00 0.00 ? 96  ALA A CA   5  
ATOM   9801  C C    . ALA A 1 96  ? -2.987  -6.566  3.878   1.00 0.00 ? 96  ALA A C    5  
ATOM   9802  O O    . ALA A 1 96  ? -1.815  -6.334  4.150   1.00 0.00 ? 96  ALA A O    5  
ATOM   9803  C CB   . ALA A 1 96  ? -4.410  -4.584  3.364   1.00 0.00 ? 96  ALA A CB   5  
ATOM   9804  H H    . ALA A 1 96  ? -5.596  -6.491  2.143   1.00 0.00 ? 96  ALA A H    5  
ATOM   9805  H HA   . ALA A 1 96  ? -2.960  -5.429  2.069   1.00 0.00 ? 96  ALA A HA   5  
ATOM   9806  H HB1  . ALA A 1 96  ? -4.726  -3.929  2.567   1.00 0.00 ? 96  ALA A HB1  5  
ATOM   9807  H HB2  . ALA A 1 96  ? -3.737  -4.053  4.021   1.00 0.00 ? 96  ALA A HB2  5  
ATOM   9808  H HB3  . ALA A 1 96  ? -5.272  -4.915  3.924   1.00 0.00 ? 96  ALA A HB3  5  
ATOM   9809  N N    . ARG A 1 97  ? -3.711  -7.481  4.514   1.00 0.00 ? 97  ARG A N    5  
ATOM   9810  C CA   . ARG A 1 97  ? -3.158  -8.286  5.602   1.00 0.00 ? 97  ARG A CA   5  
ATOM   9811  C C    . ARG A 1 97  ? -2.107  -9.263  5.092   1.00 0.00 ? 97  ARG A C    5  
ATOM   9812  O O    . ARG A 1 97  ? -1.055  -9.442  5.706   1.00 0.00 ? 97  ARG A O    5  
ATOM   9813  C CB   . ARG A 1 97  ? -4.267  -9.055  6.319   1.00 0.00 ? 97  ARG A CB   5  
ATOM   9814  C CG   . ARG A 1 97  ? -5.186  -8.169  7.144   1.00 0.00 ? 97  ARG A CG   5  
ATOM   9815  C CD   . ARG A 1 97  ? -6.315  -8.966  7.772   1.00 0.00 ? 97  ARG A CD   5  
ATOM   9816  N NE   . ARG A 1 97  ? -5.818  -9.996  8.680   1.00 0.00 ? 97  ARG A NE   5  
ATOM   9817  C CZ   . ARG A 1 97  ? -6.488  -11.108 8.980   1.00 0.00 ? 97  ARG A CZ   5  
ATOM   9818  N NH1  . ARG A 1 97  ? -7.702  -11.314 8.477   1.00 0.00 ? 97  ARG A NH1  5  
ATOM   9819  N NH2  . ARG A 1 97  ? -5.952  -12.008 9.795   1.00 0.00 ? 97  ARG A NH2  5  
ATOM   9820  H H    . ARG A 1 97  ? -4.648  -7.612  4.250   1.00 0.00 ? 97  ARG A H    5  
ATOM   9821  H HA   . ARG A 1 97  ? -2.694  -7.612  6.304   1.00 0.00 ? 97  ARG A HA   5  
ATOM   9822  H HB2  . ARG A 1 97  ? -4.861  -9.576  5.583   1.00 0.00 ? 97  ARG A HB2  5  
ATOM   9823  H HB3  . ARG A 1 97  ? -3.815  -9.780  6.981   1.00 0.00 ? 97  ARG A HB3  5  
ATOM   9824  H HG2  . ARG A 1 97  ? -4.609  -7.705  7.930   1.00 0.00 ? 97  ARG A HG2  5  
ATOM   9825  H HG3  . ARG A 1 97  ? -5.606  -7.406  6.504   1.00 0.00 ? 97  ARG A HG3  5  
ATOM   9826  H HD2  . ARG A 1 97  ? -6.953  -8.292  8.323   1.00 0.00 ? 97  ARG A HD2  5  
ATOM   9827  H HD3  . ARG A 1 97  ? -6.886  -9.439  6.985   1.00 0.00 ? 97  ARG A HD3  5  
ATOM   9828  H HE   . ARG A 1 97  ? -4.932  -9.850  9.084   1.00 0.00 ? 97  ARG A HE   5  
ATOM   9829  H HH11 . ARG A 1 97  ? -8.123  -10.632 7.872   1.00 0.00 ? 97  ARG A HH11 5  
ATOM   9830  H HH12 . ARG A 1 97  ? -8.201  -12.156 8.695   1.00 0.00 ? 97  ARG A HH12 5  
ATOM   9831  H HH21 . ARG A 1 97  ? -5.042  -11.855 10.187  1.00 0.00 ? 97  ARG A HH21 5  
ATOM   9832  H HH22 . ARG A 1 97  ? -6.454  -12.846 10.022  1.00 0.00 ? 97  ARG A HH22 5  
ATOM   9833  N N    . LYS A 1 98  ? -2.398  -9.907  3.975   1.00 0.00 ? 98  LYS A N    5  
ATOM   9834  C CA   . LYS A 1 98  ? -1.473  -10.874 3.405   1.00 0.00 ? 98  LYS A CA   5  
ATOM   9835  C C    . LYS A 1 98  ? -0.223  -10.179 2.853   1.00 0.00 ? 98  LYS A C    5  
ATOM   9836  O O    . LYS A 1 98  ? 0.907   -10.621 3.098   1.00 0.00 ? 98  LYS A O    5  
ATOM   9837  C CB   . LYS A 1 98  ? -2.163  -11.691 2.315   1.00 0.00 ? 98  LYS A CB   5  
ATOM   9838  C CG   . LYS A 1 98  ? -1.281  -12.789 1.752   1.00 0.00 ? 98  LYS A CG   5  
ATOM   9839  C CD   . LYS A 1 98  ? -1.981  -13.584 0.669   1.00 0.00 ? 98  LYS A CD   5  
ATOM   9840  C CE   . LYS A 1 98  ? -1.037  -14.594 0.047   1.00 0.00 ? 98  LYS A CE   5  
ATOM   9841  N NZ   . LYS A 1 98  ? -0.359  -15.429 1.074   1.00 0.00 ? 98  LYS A NZ   5  
ATOM   9842  H H    . LYS A 1 98  ? -3.261  -9.739  3.534   1.00 0.00 ? 98  LYS A H    5  
ATOM   9843  H HA   . LYS A 1 98  ? -1.172  -11.540 4.200   1.00 0.00 ? 98  LYS A HA   5  
ATOM   9844  H HB2  . LYS A 1 98  ? -3.051  -12.147 2.730   1.00 0.00 ? 98  LYS A HB2  5  
ATOM   9845  H HB3  . LYS A 1 98  ? -2.449  -11.032 1.511   1.00 0.00 ? 98  LYS A HB3  5  
ATOM   9846  H HG2  . LYS A 1 98  ? -0.390  -12.349 1.342   1.00 0.00 ? 98  LYS A HG2  5  
ATOM   9847  H HG3  . LYS A 1 98  ? -1.010  -13.459 2.555   1.00 0.00 ? 98  LYS A HG3  5  
ATOM   9848  H HD2  . LYS A 1 98  ? -2.823  -14.103 1.097   1.00 0.00 ? 98  LYS A HD2  5  
ATOM   9849  H HD3  . LYS A 1 98  ? -2.323  -12.906 -0.099  1.00 0.00 ? 98  LYS A HD3  5  
ATOM   9850  H HE2  . LYS A 1 98  ? -1.598  -15.236 -0.615  1.00 0.00 ? 98  LYS A HE2  5  
ATOM   9851  H HE3  . LYS A 1 98  ? -0.291  -14.057 -0.520  1.00 0.00 ? 98  LYS A HE3  5  
ATOM   9852  H HZ1  . LYS A 1 98  ? -1.062  -15.944 1.641   1.00 0.00 ? 98  LYS A HZ1  5  
ATOM   9853  H HZ2  . LYS A 1 98  ? 0.208   -14.830 1.706   1.00 0.00 ? 98  LYS A HZ2  5  
ATOM   9854  H HZ3  . LYS A 1 98  ? 0.272   -16.117 0.614   1.00 0.00 ? 98  LYS A HZ3  5  
ATOM   9855  N N    . LEU A 1 99  ? -0.426  -9.097  2.106   1.00 0.00 ? 99  LEU A N    5  
ATOM   9856  C CA   . LEU A 1 99  ? 0.683   -8.269  1.640   1.00 0.00 ? 99  LEU A CA   5  
ATOM   9857  C C    . LEU A 1 99  ? 1.441   -7.650  2.812   1.00 0.00 ? 99  LEU A C    5  
ATOM   9858  O O    . LEU A 1 99  ? 2.631   -7.352  2.703   1.00 0.00 ? 99  LEU A O    5  
ATOM   9859  C CB   . LEU A 1 99  ? 0.205   -7.157  0.702   1.00 0.00 ? 99  LEU A CB   5  
ATOM   9860  C CG   . LEU A 1 99  ? 0.281   -7.431  -0.812  1.00 0.00 ? 99  LEU A CG   5  
ATOM   9861  C CD1  . LEU A 1 99  ? 0.839   -6.213  -1.509  1.00 0.00 ? 99  LEU A CD1  5  
ATOM   9862  C CD2  . LEU A 1 99  ? 1.155   -8.627  -1.145  1.00 0.00 ? 99  LEU A CD2  5  
ATOM   9863  H H    . LEU A 1 99  ? -1.338  -8.863  1.845   1.00 0.00 ? 99  LEU A H    5  
ATOM   9864  H HA   . LEU A 1 99  ? 1.361   -8.908  1.104   1.00 0.00 ? 99  LEU A HA   5  
ATOM   9865  H HB2  . LEU A 1 99  ? -0.823  -6.934  0.946   1.00 0.00 ? 99  LEU A HB2  5  
ATOM   9866  H HB3  . LEU A 1 99  ? 0.792   -6.283  0.909   1.00 0.00 ? 99  LEU A HB3  5  
ATOM   9867  H HG   . LEU A 1 99  ? -0.711  -7.612  -1.197  1.00 0.00 ? 99  LEU A HG   5  
ATOM   9868  H HD11 . LEU A 1 99  ? 1.902   -6.170  -1.338  1.00 0.00 ? 99  LEU A HD11 5  
ATOM   9869  H HD12 . LEU A 1 99  ? 0.372   -5.323  -1.113  1.00 0.00 ? 99  LEU A HD12 5  
ATOM   9870  H HD13 . LEU A 1 99  ? 0.646   -6.282  -2.568  1.00 0.00 ? 99  LEU A HD13 5  
ATOM   9871  H HD21 . LEU A 1 99  ? 2.193   -8.364  -0.985  1.00 0.00 ? 99  LEU A HD21 5  
ATOM   9872  H HD22 . LEU A 1 99  ? 1.011   -8.896  -2.181  1.00 0.00 ? 99  LEU A HD22 5  
ATOM   9873  H HD23 . LEU A 1 99  ? 0.888   -9.463  -0.520  1.00 0.00 ? 99  LEU A HD23 5  
ATOM   9874  N N    . GLN A 1 100 ? 0.752   -7.445  3.927   1.00 0.00 ? 100 GLN A N    5  
ATOM   9875  C CA   . GLN A 1 100 ? 1.403   -6.970  5.139   1.00 0.00 ? 100 GLN A CA   5  
ATOM   9876  C C    . GLN A 1 100 ? 2.441   -7.988  5.590   1.00 0.00 ? 100 GLN A C    5  
ATOM   9877  O O    . GLN A 1 100 ? 3.535   -7.623  6.002   1.00 0.00 ? 100 GLN A O    5  
ATOM   9878  C CB   . GLN A 1 100 ? 0.376   -6.736  6.254   1.00 0.00 ? 100 GLN A CB   5  
ATOM   9879  C CG   . GLN A 1 100 ? 0.969   -6.217  7.557   1.00 0.00 ? 100 GLN A CG   5  
ATOM   9880  C CD   . GLN A 1 100 ? 1.656   -4.874  7.406   1.00 0.00 ? 100 GLN A CD   5  
ATOM   9881  O OE1  . GLN A 1 100 ? 1.033   -3.824  7.549   1.00 0.00 ? 100 GLN A OE1  5  
ATOM   9882  N NE2  . GLN A 1 100 ? 2.948   -4.899  7.126   1.00 0.00 ? 100 GLN A NE2  5  
ATOM   9883  H H    . GLN A 1 100 ? -0.216  -7.607  3.933   1.00 0.00 ? 100 GLN A H    5  
ATOM   9884  H HA   . GLN A 1 100 ? 1.905   -6.038  4.908   1.00 0.00 ? 100 GLN A HA   5  
ATOM   9885  H HB2  . GLN A 1 100 ? -0.357  -6.020  5.911   1.00 0.00 ? 100 GLN A HB2  5  
ATOM   9886  H HB3  . GLN A 1 100 ? -0.123  -7.672  6.465   1.00 0.00 ? 100 GLN A HB3  5  
ATOM   9887  H HG2  . GLN A 1 100 ? 0.177   -6.116  8.283   1.00 0.00 ? 100 GLN A HG2  5  
ATOM   9888  H HG3  . GLN A 1 100 ? 1.693   -6.935  7.916   1.00 0.00 ? 100 GLN A HG3  5  
ATOM   9889  H HE21 . GLN A 1 100 ? 3.386   -5.775  7.031   1.00 0.00 ? 100 GLN A HE21 5  
ATOM   9890  H HE22 . GLN A 1 100 ? 3.418   -4.045  7.032   1.00 0.00 ? 100 GLN A HE22 5  
ATOM   9891  N N    . ASP A 1 101 ? 2.091   -9.267  5.478   1.00 0.00 ? 101 ASP A N    5  
ATOM   9892  C CA   . ASP A 1 101 ? 2.981   -10.350 5.886   1.00 0.00 ? 101 ASP A CA   5  
ATOM   9893  C C    . ASP A 1 101 ? 4.264   -10.361 5.058   1.00 0.00 ? 101 ASP A C    5  
ATOM   9894  O O    . ASP A 1 101 ? 5.360   -10.444 5.611   1.00 0.00 ? 101 ASP A O    5  
ATOM   9895  C CB   . ASP A 1 101 ? 2.279   -11.705 5.777   1.00 0.00 ? 101 ASP A CB   5  
ATOM   9896  C CG   . ASP A 1 101 ? 3.178   -12.852 6.198   1.00 0.00 ? 101 ASP A CG   5  
ATOM   9897  O OD1  . ASP A 1 101 ? 3.786   -13.493 5.316   1.00 0.00 ? 101 ASP A OD1  5  
ATOM   9898  O OD2  . ASP A 1 101 ? 3.289   -13.114 7.414   1.00 0.00 ? 101 ASP A OD2  5  
ATOM   9899  H H    . ASP A 1 101 ? 1.202   -9.487  5.120   1.00 0.00 ? 101 ASP A H    5  
ATOM   9900  H HA   . ASP A 1 101 ? 3.244   -10.180 6.919   1.00 0.00 ? 101 ASP A HA   5  
ATOM   9901  H HB2  . ASP A 1 101 ? 1.406   -11.704 6.413   1.00 0.00 ? 101 ASP A HB2  5  
ATOM   9902  H HB3  . ASP A 1 101 ? 1.976   -11.864 4.753   1.00 0.00 ? 101 ASP A HB3  5  
ATOM   9903  N N    . VAL A 1 102 ? 4.135   -10.274 3.735   1.00 0.00 ? 102 VAL A N    5  
ATOM   9904  C CA   . VAL A 1 102 ? 5.319   -10.252 2.877   1.00 0.00 ? 102 VAL A CA   5  
ATOM   9905  C C    . VAL A 1 102 ? 6.156   -9.005  3.142   1.00 0.00 ? 102 VAL A C    5  
ATOM   9906  O O    . VAL A 1 102 ? 7.336   -9.107  3.467   1.00 0.00 ? 102 VAL A O    5  
ATOM   9907  C CB   . VAL A 1 102 ? 4.979   -10.372 1.365   1.00 0.00 ? 102 VAL A CB   5  
ATOM   9908  C CG1  . VAL A 1 102 ? 3.821   -9.499  0.978   1.00 0.00 ? 102 VAL A CG1  5  
ATOM   9909  C CG2  . VAL A 1 102 ? 6.175   -10.036 0.488   1.00 0.00 ? 102 VAL A CG2  5  
ATOM   9910  H H    . VAL A 1 102 ? 3.236   -10.228 3.335   1.00 0.00 ? 102 VAL A H    5  
ATOM   9911  H HA   . VAL A 1 102 ? 5.916   -11.113 3.148   1.00 0.00 ? 102 VAL A HA   5  
ATOM   9912  H HB   . VAL A 1 102 ? 4.697   -11.387 1.166   1.00 0.00 ? 102 VAL A HB   5  
ATOM   9913  H HG11 . VAL A 1 102 ? 3.799   -9.417  -0.095  1.00 0.00 ? 102 VAL A HG11 5  
ATOM   9914  H HG12 . VAL A 1 102 ? 3.940   -8.519  1.414   1.00 0.00 ? 102 VAL A HG12 5  
ATOM   9915  H HG13 . VAL A 1 102 ? 2.903   -9.944  1.325   1.00 0.00 ? 102 VAL A HG13 5  
ATOM   9916  H HG21 . VAL A 1 102 ? 6.168   -8.979  0.252   1.00 0.00 ? 102 VAL A HG21 5  
ATOM   9917  H HG22 . VAL A 1 102 ? 6.122   -10.609 -0.427  1.00 0.00 ? 102 VAL A HG22 5  
ATOM   9918  H HG23 . VAL A 1 102 ? 7.086   -10.282 1.012   1.00 0.00 ? 102 VAL A HG23 5  
ATOM   9919  N N    . PHE A 1 103 ? 5.536   -7.835  3.044   1.00 0.00 ? 103 PHE A N    5  
ATOM   9920  C CA   . PHE A 1 103 ? 6.237   -6.579  3.288   1.00 0.00 ? 103 PHE A CA   5  
ATOM   9921  C C    . PHE A 1 103 ? 6.884   -6.559  4.681   1.00 0.00 ? 103 PHE A C    5  
ATOM   9922  O O    . PHE A 1 103 ? 8.025   -6.116  4.827   1.00 0.00 ? 103 PHE A O    5  
ATOM   9923  C CB   . PHE A 1 103 ? 5.293   -5.379  3.087   1.00 0.00 ? 103 PHE A CB   5  
ATOM   9924  C CG   . PHE A 1 103 ? 5.701   -4.142  3.857   1.00 0.00 ? 103 PHE A CG   5  
ATOM   9925  C CD1  . PHE A 1 103 ? 6.920   -3.529  3.599   1.00 0.00 ? 103 PHE A CD1  5  
ATOM   9926  C CD2  . PHE A 1 103 ? 4.883   -3.603  4.849   1.00 0.00 ? 103 PHE A CD2  5  
ATOM   9927  C CE1  . PHE A 1 103 ? 7.316   -2.414  4.309   1.00 0.00 ? 103 PHE A CE1  5  
ATOM   9928  C CE2  . PHE A 1 103 ? 5.278   -2.485  5.556   1.00 0.00 ? 103 PHE A CE2  5  
ATOM   9929  C CZ   . PHE A 1 103 ? 6.494   -1.893  5.288   1.00 0.00 ? 103 PHE A CZ   5  
ATOM   9930  H H    . PHE A 1 103 ? 4.584   -7.818  2.798   1.00 0.00 ? 103 PHE A H    5  
ATOM   9931  H HA   . PHE A 1 103 ? 7.027   -6.506  2.554   1.00 0.00 ? 103 PHE A HA   5  
ATOM   9932  H HB2  . PHE A 1 103 ? 5.289   -5.124  2.032   1.00 0.00 ? 103 PHE A HB2  5  
ATOM   9933  H HB3  . PHE A 1 103 ? 4.294   -5.655  3.383   1.00 0.00 ? 103 PHE A HB3  5  
ATOM   9934  H HD1  . PHE A 1 103 ? 7.565   -3.933  2.833   1.00 0.00 ? 103 PHE A HD1  5  
ATOM   9935  H HD2  . PHE A 1 103 ? 3.925   -4.056  5.065   1.00 0.00 ? 103 PHE A HD2  5  
ATOM   9936  H HE1  . PHE A 1 103 ? 8.267   -1.949  4.098   1.00 0.00 ? 103 PHE A HE1  5  
ATOM   9937  H HE2  . PHE A 1 103 ? 4.636   -2.076  6.321   1.00 0.00 ? 103 PHE A HE2  5  
ATOM   9938  H HZ   . PHE A 1 103 ? 6.804   -1.020  5.844   1.00 0.00 ? 103 PHE A HZ   5  
ATOM   9939  N N    . GLU A 1 104 ? 6.187   -7.077  5.690   1.00 0.00 ? 104 GLU A N    5  
ATOM   9940  C CA   . GLU A 1 104 ? 6.716   -7.047  7.054   1.00 0.00 ? 104 GLU A CA   5  
ATOM   9941  C C    . GLU A 1 104 ? 7.921   -7.974  7.179   1.00 0.00 ? 104 GLU A C    5  
ATOM   9942  O O    . GLU A 1 104 ? 8.895   -7.640  7.846   1.00 0.00 ? 104 GLU A O    5  
ATOM   9943  C CB   . GLU A 1 104 ? 5.650   -7.407  8.108   1.00 0.00 ? 104 GLU A CB   5  
ATOM   9944  C CG   . GLU A 1 104 ? 5.461   -8.900  8.354   1.00 0.00 ? 104 GLU A CG   5  
ATOM   9945  C CD   . GLU A 1 104 ? 4.522   -9.189  9.505   1.00 0.00 ? 104 GLU A CD   5  
ATOM   9946  O OE1  . GLU A 1 104 ? 3.309   -9.356  9.265   1.00 0.00 ? 104 GLU A OE1  5  
ATOM   9947  O OE2  . GLU A 1 104 ? 4.998   -9.261  10.660  1.00 0.00 ? 104 GLU A OE2  5  
ATOM   9948  H H    . GLU A 1 104 ? 5.308   -7.482  5.515   1.00 0.00 ? 104 GLU A H    5  
ATOM   9949  H HA   . GLU A 1 104 ? 7.053   -6.036  7.240   1.00 0.00 ? 104 GLU A HA   5  
ATOM   9950  H HB2  . GLU A 1 104 ? 5.925   -6.948  9.044   1.00 0.00 ? 104 GLU A HB2  5  
ATOM   9951  H HB3  . GLU A 1 104 ? 4.702   -6.999  7.789   1.00 0.00 ? 104 GLU A HB3  5  
ATOM   9952  H HG2  . GLU A 1 104 ? 5.062   -9.358  7.464   1.00 0.00 ? 104 GLU A HG2  5  
ATOM   9953  H HG3  . GLU A 1 104 ? 6.425   -9.338  8.580   1.00 0.00 ? 104 GLU A HG3  5  
ATOM   9954  N N    . PHE A 1 105 ? 7.859   -9.130  6.519   1.00 0.00 ? 105 PHE A N    5  
ATOM   9955  C CA   . PHE A 1 105 ? 8.967   -10.077 6.539   1.00 0.00 ? 105 PHE A CA   5  
ATOM   9956  C C    . PHE A 1 105 ? 10.165  -9.481  5.822   1.00 0.00 ? 105 PHE A C    5  
ATOM   9957  O O    . PHE A 1 105 ? 11.293  -9.573  6.294   1.00 0.00 ? 105 PHE A O    5  
ATOM   9958  C CB   . PHE A 1 105 ? 8.574   -11.397 5.869   1.00 0.00 ? 105 PHE A CB   5  
ATOM   9959  C CG   . PHE A 1 105 ? 9.628   -12.472 5.963   1.00 0.00 ? 105 PHE A CG   5  
ATOM   9960  C CD1  . PHE A 1 105 ? 9.573   -13.422 6.968   1.00 0.00 ? 105 PHE A CD1  5  
ATOM   9961  C CD2  . PHE A 1 105 ? 10.672  -12.537 5.043   1.00 0.00 ? 105 PHE A CD2  5  
ATOM   9962  C CE1  . PHE A 1 105 ? 10.532  -14.413 7.058   1.00 0.00 ? 105 PHE A CE1  5  
ATOM   9963  C CE2  . PHE A 1 105 ? 11.631  -13.526 5.132   1.00 0.00 ? 105 PHE A CE2  5  
ATOM   9964  C CZ   . PHE A 1 105 ? 11.561  -14.466 6.140   1.00 0.00 ? 105 PHE A CZ   5  
ATOM   9965  H H    . PHE A 1 105 ? 7.047   -9.352  6.013   1.00 0.00 ? 105 PHE A H    5  
ATOM   9966  H HA   . PHE A 1 105 ? 9.231   -10.266 7.569   1.00 0.00 ? 105 PHE A HA   5  
ATOM   9967  H HB2  . PHE A 1 105 ? 7.676   -11.774 6.336   1.00 0.00 ? 105 PHE A HB2  5  
ATOM   9968  H HB3  . PHE A 1 105 ? 8.377   -11.215 4.822   1.00 0.00 ? 105 PHE A HB3  5  
ATOM   9969  H HD1  . PHE A 1 105 ? 8.770   -13.385 7.689   1.00 0.00 ? 105 PHE A HD1  5  
ATOM   9970  H HD2  . PHE A 1 105 ? 10.733  -11.802 4.254   1.00 0.00 ? 105 PHE A HD2  5  
ATOM   9971  H HE1  . PHE A 1 105 ? 10.477  -15.148 7.847   1.00 0.00 ? 105 PHE A HE1  5  
ATOM   9972  H HE2  . PHE A 1 105 ? 12.434  -13.564 4.412   1.00 0.00 ? 105 PHE A HE2  5  
ATOM   9973  H HZ   . PHE A 1 105 ? 12.310  -15.241 6.209   1.00 0.00 ? 105 PHE A HZ   5  
ATOM   9974  N N    . ARG A 1 106 ? 9.901   -8.863  4.679   1.00 0.00 ? 106 ARG A N    5  
ATOM   9975  C CA   . ARG A 1 106 ? 10.937  -8.247  3.874   1.00 0.00 ? 106 ARG A CA   5  
ATOM   9976  C C    . ARG A 1 106 ? 11.646  -7.159  4.670   1.00 0.00 ? 106 ARG A C    5  
ATOM   9977  O O    . ARG A 1 106 ? 12.870  -7.039  4.629   1.00 0.00 ? 106 ARG A O    5  
ATOM   9978  C CB   . ARG A 1 106 ? 10.324  -7.646  2.606   1.00 0.00 ? 106 ARG A CB   5  
ATOM   9979  C CG   . ARG A 1 106 ? 9.859   -8.635  1.536   1.00 0.00 ? 106 ARG A CG   5  
ATOM   9980  C CD   . ARG A 1 106 ? 9.714   -10.047 2.047   1.00 0.00 ? 106 ARG A CD   5  
ATOM   9981  N NE   . ARG A 1 106 ? 9.187   -10.938 1.019   1.00 0.00 ? 106 ARG A NE   5  
ATOM   9982  C CZ   . ARG A 1 106 ? 8.725   -12.169 1.244   1.00 0.00 ? 106 ARG A CZ   5  
ATOM   9983  N NH1  . ARG A 1 106 ? 8.778   -12.699 2.460   1.00 0.00 ? 106 ARG A NH1  5  
ATOM   9984  N NH2  . ARG A 1 106 ? 8.202   -12.863 0.245   1.00 0.00 ? 106 ARG A NH2  5  
ATOM   9985  H H    . ARG A 1 106 ? 8.972   -8.813  4.361   1.00 0.00 ? 106 ARG A H    5  
ATOM   9986  H HA   . ARG A 1 106 ? 11.656  -9.005  3.600   1.00 0.00 ? 106 ARG A HA   5  
ATOM   9987  H HB2  . ARG A 1 106 ? 9.477   -7.037  2.885   1.00 0.00 ? 106 ARG A HB2  5  
ATOM   9988  H HB3  . ARG A 1 106 ? 11.058  -7.020  2.161   1.00 0.00 ? 106 ARG A HB3  5  
ATOM   9989  H HG2  . ARG A 1 106 ? 8.905   -8.306  1.154   1.00 0.00 ? 106 ARG A HG2  5  
ATOM   9990  H HG3  . ARG A 1 106 ? 10.570  -8.641  0.739   1.00 0.00 ? 106 ARG A HG3  5  
ATOM   9991  H HD2  . ARG A 1 106 ? 10.685  -10.395 2.358   1.00 0.00 ? 106 ARG A HD2  5  
ATOM   9992  H HD3  . ARG A 1 106 ? 9.046   -10.035 2.889   1.00 0.00 ? 106 ARG A HD3  5  
ATOM   9993  H HE   . ARG A 1 106 ? 9.152   -10.580 0.094   1.00 0.00 ? 106 ARG A HE   5  
ATOM   9994  H HH11 . ARG A 1 106 ? 9.166   -12.178 3.219   1.00 0.00 ? 106 ARG A HH11 5  
ATOM   9995  H HH12 . ARG A 1 106 ? 8.420   -13.625 2.625   1.00 0.00 ? 106 ARG A HH12 5  
ATOM   9996  H HH21 . ARG A 1 106 ? 8.150   -12.453 -0.675  1.00 0.00 ? 106 ARG A HH21 5  
ATOM   9997  H HH22 . ARG A 1 106 ? 7.861   -13.796 0.398   1.00 0.00 ? 106 ARG A HH22 5  
ATOM   9998  N N    . TYR A 1 107 ? 10.867  -6.373  5.403   1.00 0.00 ? 107 TYR A N    5  
ATOM   9999  C CA   . TYR A 1 107 ? 11.423  -5.287  6.205   1.00 0.00 ? 107 TYR A CA   5  
ATOM   10000 C C    . TYR A 1 107 ? 12.085  -5.825  7.474   1.00 0.00 ? 107 TYR A C    5  
ATOM   10001 O O    . TYR A 1 107 ? 13.101  -5.297  7.920   1.00 0.00 ? 107 TYR A O    5  
ATOM   10002 C CB   . TYR A 1 107 ? 10.342  -4.254  6.562   1.00 0.00 ? 107 TYR A CB   5  
ATOM   10003 C CG   . TYR A 1 107 ? 10.904  -2.974  7.150   1.00 0.00 ? 107 TYR A CG   5  
ATOM   10004 C CD1  . TYR A 1 107 ? 11.317  -1.923  6.336   1.00 0.00 ? 107 TYR A CD1  5  
ATOM   10005 C CD2  . TYR A 1 107 ? 11.039  -2.827  8.524   1.00 0.00 ? 107 TYR A CD2  5  
ATOM   10006 C CE1  . TYR A 1 107 ? 11.847  -0.771  6.878   1.00 0.00 ? 107 TYR A CE1  5  
ATOM   10007 C CE2  . TYR A 1 107 ? 11.563  -1.675  9.071   1.00 0.00 ? 107 TYR A CE2  5  
ATOM   10008 C CZ   . TYR A 1 107 ? 11.966  -0.650  8.244   1.00 0.00 ? 107 TYR A CZ   5  
ATOM   10009 O OH   . TYR A 1 107 ? 12.492  0.497   8.782   1.00 0.00 ? 107 TYR A OH   5  
ATOM   10010 H H    . TYR A 1 107 ? 9.894   -6.519  5.391   1.00 0.00 ? 107 TYR A H    5  
ATOM   10011 H HA   . TYR A 1 107 ? 12.182  -4.807  5.607   1.00 0.00 ? 107 TYR A HA   5  
ATOM   10012 H HB2  . TYR A 1 107 ? 9.787   -4.001  5.672   1.00 0.00 ? 107 TYR A HB2  5  
ATOM   10013 H HB3  . TYR A 1 107 ? 9.669   -4.682  7.292   1.00 0.00 ? 107 TYR A HB3  5  
ATOM   10014 H HD1  . TYR A 1 107 ? 11.214  -2.009  5.265   1.00 0.00 ? 107 TYR A HD1  5  
ATOM   10015 H HD2  . TYR A 1 107 ? 10.723  -3.632  9.168   1.00 0.00 ? 107 TYR A HD2  5  
ATOM   10016 H HE1  . TYR A 1 107 ? 12.164  0.032   6.232   1.00 0.00 ? 107 TYR A HE1  5  
ATOM   10017 H HE2  . TYR A 1 107 ? 11.656  -1.580  10.142  1.00 0.00 ? 107 TYR A HE2  5  
ATOM   10018 H HH   . TYR A 1 107 ? 13.107  0.265   9.487   1.00 0.00 ? 107 TYR A HH   5  
ATOM   10019 N N    . ALA A 1 108 ? 11.510  -6.873  8.054   1.00 0.00 ? 108 ALA A N    5  
ATOM   10020 C CA   . ALA A 1 108 ? 12.087  -7.505  9.237   1.00 0.00 ? 108 ALA A CA   5  
ATOM   10021 C C    . ALA A 1 108 ? 13.420  -8.160  8.900   1.00 0.00 ? 108 ALA A C    5  
ATOM   10022 O O    . ALA A 1 108 ? 14.367  -8.136  9.690   1.00 0.00 ? 108 ALA A O    5  
ATOM   10023 C CB   . ALA A 1 108 ? 11.124  -8.533  9.810   1.00 0.00 ? 108 ALA A CB   5  
ATOM   10024 H H    . ALA A 1 108 ? 10.668  -7.223  7.687   1.00 0.00 ? 108 ALA A H    5  
ATOM   10025 H HA   . ALA A 1 108 ? 12.248  -6.741  9.983   1.00 0.00 ? 108 ALA A HA   5  
ATOM   10026 H HB1  . ALA A 1 108 ? 10.164  -8.068  9.983   1.00 0.00 ? 108 ALA A HB1  5  
ATOM   10027 H HB2  . ALA A 1 108 ? 11.514  -8.911  10.741  1.00 0.00 ? 108 ALA A HB2  5  
ATOM   10028 H HB3  . ALA A 1 108 ? 11.009  -9.347  9.110   1.00 0.00 ? 108 ALA A HB3  5  
ATOM   10029 N N    . LYS A 1 109 ? 13.477  -8.745  7.714   1.00 0.00 ? 109 LYS A N    5  
ATOM   10030 C CA   . LYS A 1 109 ? 14.689  -9.358  7.199   1.00 0.00 ? 109 LYS A CA   5  
ATOM   10031 C C    . LYS A 1 109 ? 15.709  -8.280  6.836   1.00 0.00 ? 109 LYS A C    5  
ATOM   10032 O O    . LYS A 1 109 ? 16.920  -8.509  6.858   1.00 0.00 ? 109 LYS A O    5  
ATOM   10033 C CB   . LYS A 1 109 ? 14.333  -10.207 5.978   1.00 0.00 ? 109 LYS A CB   5  
ATOM   10034 C CG   . LYS A 1 109 ? 15.524  -10.888 5.323   1.00 0.00 ? 109 LYS A CG   5  
ATOM   10035 C CD   . LYS A 1 109 ? 15.110  -11.721 4.115   1.00 0.00 ? 109 LYS A CD   5  
ATOM   10036 C CE   . LYS A 1 109 ? 16.301  -12.070 3.244   1.00 0.00 ? 109 LYS A CE   5  
ATOM   10037 N NZ   . LYS A 1 109 ? 17.383  -12.739 4.017   1.00 0.00 ? 109 LYS A NZ   5  
ATOM   10038 H H    . LYS A 1 109 ? 12.662  -8.775  7.164   1.00 0.00 ? 109 LYS A H    5  
ATOM   10039 H HA   . LYS A 1 109 ? 15.103  -9.995  7.965   1.00 0.00 ? 109 LYS A HA   5  
ATOM   10040 H HB2  . LYS A 1 109 ? 13.630  -10.965 6.289   1.00 0.00 ? 109 LYS A HB2  5  
ATOM   10041 H HB3  . LYS A 1 109 ? 13.859  -9.574  5.243   1.00 0.00 ? 109 LYS A HB3  5  
ATOM   10042 H HG2  . LYS A 1 109 ? 16.221  -10.130 5.001   1.00 0.00 ? 109 LYS A HG2  5  
ATOM   10043 H HG3  . LYS A 1 109 ? 15.998  -11.530 6.051   1.00 0.00 ? 109 LYS A HG3  5  
ATOM   10044 H HD2  . LYS A 1 109 ? 14.656  -12.643 4.452   1.00 0.00 ? 109 LYS A HD2  5  
ATOM   10045 H HD3  . LYS A 1 109 ? 14.398  -11.160 3.528   1.00 0.00 ? 109 LYS A HD3  5  
ATOM   10046 H HE2  . LYS A 1 109 ? 15.968  -12.734 2.460   1.00 0.00 ? 109 LYS A HE2  5  
ATOM   10047 H HE3  . LYS A 1 109 ? 16.690  -11.164 2.805   1.00 0.00 ? 109 LYS A HE3  5  
ATOM   10048 H HZ1  . LYS A 1 109 ? 18.146  -13.036 3.377   1.00 0.00 ? 109 LYS A HZ1  5  
ATOM   10049 H HZ2  . LYS A 1 109 ? 17.010  -13.577 4.507   1.00 0.00 ? 109 LYS A HZ2  5  
ATOM   10050 H HZ3  . LYS A 1 109 ? 17.776  -12.082 4.722   1.00 0.00 ? 109 LYS A HZ3  5  
ATOM   10051 N N    . MET A 1 110 ? 15.198  -7.101  6.515   1.00 0.00 ? 110 MET A N    5  
ATOM   10052 C CA   . MET A 1 110 ? 16.032  -5.951  6.189   1.00 0.00 ? 110 MET A CA   5  
ATOM   10053 C C    . MET A 1 110 ? 16.719  -5.400  7.440   1.00 0.00 ? 110 MET A C    5  
ATOM   10054 O O    . MET A 1 110 ? 16.056  -5.044  8.413   1.00 0.00 ? 110 MET A O    5  
ATOM   10055 C CB   . MET A 1 110 ? 15.182  -4.860  5.512   1.00 0.00 ? 110 MET A CB   5  
ATOM   10056 C CG   . MET A 1 110 ? 15.857  -3.502  5.418   1.00 0.00 ? 110 MET A CG   5  
ATOM   10057 S SD   . MET A 1 110 ? 15.558  -2.485  6.876   1.00 0.00 ? 110 MET A SD   5  
ATOM   10058 C CE   . MET A 1 110 ? 16.423  -0.999  6.407   1.00 0.00 ? 110 MET A CE   5  
ATOM   10059 H H    . MET A 1 110 ? 14.224  -7.002  6.498   1.00 0.00 ? 110 MET A H    5  
ATOM   10060 H HA   . MET A 1 110 ? 16.789  -6.284  5.496   1.00 0.00 ? 110 MET A HA   5  
ATOM   10061 H HB2  . MET A 1 110 ? 14.935  -5.181  4.511   1.00 0.00 ? 110 MET A HB2  5  
ATOM   10062 H HB3  . MET A 1 110 ? 14.266  -4.735  6.072   1.00 0.00 ? 110 MET A HB3  5  
ATOM   10063 H HG2  . MET A 1 110 ? 16.920  -3.651  5.314   1.00 0.00 ? 110 MET A HG2  5  
ATOM   10064 H HG3  . MET A 1 110 ? 15.482  -2.981  4.549   1.00 0.00 ? 110 MET A HG3  5  
ATOM   10065 H HE1  . MET A 1 110 ? 16.026  -0.642  5.467   1.00 0.00 ? 110 MET A HE1  5  
ATOM   10066 H HE2  . MET A 1 110 ? 17.476  -1.214  6.297   1.00 0.00 ? 110 MET A HE2  5  
ATOM   10067 H HE3  . MET A 1 110 ? 16.284  -0.245  7.168   1.00 0.00 ? 110 MET A HE3  5  
ATOM   10068 N N    . PRO A 1 111 ? 18.061  -5.358  7.448   1.00 0.00 ? 111 PRO A N    5  
ATOM   10069 C CA   . PRO A 1 111 ? 18.822  -4.752  8.530   1.00 0.00 ? 111 PRO A CA   5  
ATOM   10070 C C    . PRO A 1 111 ? 19.108  -3.267  8.288   1.00 0.00 ? 111 PRO A C    5  
ATOM   10071 O O    . PRO A 1 111 ? 19.160  -2.809  7.140   1.00 0.00 ? 111 PRO A O    5  
ATOM   10072 C CB   . PRO A 1 111 ? 20.113  -5.559  8.514   1.00 0.00 ? 111 PRO A CB   5  
ATOM   10073 C CG   . PRO A 1 111 ? 20.313  -5.944  7.083   1.00 0.00 ? 111 PRO A CG   5  
ATOM   10074 C CD   . PRO A 1 111 ? 18.951  -5.937  6.423   1.00 0.00 ? 111 PRO A CD   5  
ATOM   10075 H HA   . PRO A 1 111 ? 18.328  -4.875  9.481   1.00 0.00 ? 111 PRO A HA   5  
ATOM   10076 H HB2  . PRO A 1 111 ? 20.926  -4.948  8.877   1.00 0.00 ? 111 PRO A HB2  5  
ATOM   10077 H HB3  . PRO A 1 111 ? 20.003  -6.428  9.143   1.00 0.00 ? 111 PRO A HB3  5  
ATOM   10078 H HG2  . PRO A 1 111 ? 20.961  -5.228  6.601   1.00 0.00 ? 111 PRO A HG2  5  
ATOM   10079 H HG3  . PRO A 1 111 ? 20.746  -6.931  7.031   1.00 0.00 ? 111 PRO A HG3  5  
ATOM   10080 H HD2  . PRO A 1 111 ? 18.971  -5.316  5.535   1.00 0.00 ? 111 PRO A HD2  5  
ATOM   10081 H HD3  . PRO A 1 111 ? 18.649  -6.949  6.177   1.00 0.00 ? 111 PRO A HD3  5  
ATOM   10082 N N    . ASP A 1 112 ? 19.289  -2.524  9.371   1.00 0.00 ? 112 ASP A N    5  
ATOM   10083 C CA   . ASP A 1 112 ? 19.609  -1.103  9.287   1.00 0.00 ? 112 ASP A CA   5  
ATOM   10084 C C    . ASP A 1 112 ? 21.111  -0.897  9.360   1.00 0.00 ? 112 ASP A C    5  
ATOM   10085 O O    . ASP A 1 112 ? 21.731  -1.385  10.330  1.00 0.00 ? 112 ASP A O    5  
ATOM   10086 C CB   . ASP A 1 112 ? 18.933  -0.313  10.408  1.00 0.00 ? 112 ASP A CB   5  
ATOM   10087 C CG   . ASP A 1 112 ? 17.458  -0.082  10.166  1.00 0.00 ? 112 ASP A CG   5  
ATOM   10088 O OD1  . ASP A 1 112 ? 16.638  -0.873  10.673  1.00 0.00 ? 112 ASP A OD1  5  
ATOM   10089 O OD2  . ASP A 1 112 ? 17.111  0.907   9.483   1.00 0.00 ? 112 ASP A OD2  5  
ATOM   10090 O OXT  . ASP A 1 112 ? 21.669  -0.237  8.461   1.00 0.00 ? 112 ASP A OXT  5  
ATOM   10091 H H    . ASP A 1 112 ? 19.216  -2.945  10.254  1.00 0.00 ? 112 ASP A H    5  
ATOM   10092 H HA   . ASP A 1 112 ? 19.254  -0.739  8.335   1.00 0.00 ? 112 ASP A HA   5  
ATOM   10093 H HB2  . ASP A 1 112 ? 19.041  -0.856  11.336  1.00 0.00 ? 112 ASP A HB2  5  
ATOM   10094 H HB3  . ASP A 1 112 ? 19.417  0.649   10.504  1.00 0.00 ? 112 ASP A HB3  5  
ATOM   10095 N N    . HIS B 2 1   ? -26.201 8.388   10.026  1.00 0.00 ? 281 HIS B N    5  
ATOM   10096 C CA   . HIS B 2 1   ? -25.344 7.555   10.900  1.00 0.00 ? 281 HIS B CA   5  
ATOM   10097 C C    . HIS B 2 1   ? -24.223 6.930   10.086  1.00 0.00 ? 281 HIS B C    5  
ATOM   10098 O O    . HIS B 2 1   ? -24.361 5.811   9.586   1.00 0.00 ? 281 HIS B O    5  
ATOM   10099 C CB   . HIS B 2 1   ? -26.162 6.450   11.582  1.00 0.00 ? 281 HIS B CB   5  
ATOM   10100 C CG   . HIS B 2 1   ? -27.209 6.954   12.529  1.00 0.00 ? 281 HIS B CG   5  
ATOM   10101 N ND1  . HIS B 2 1   ? -26.920 7.475   13.773  1.00 0.00 ? 281 HIS B ND1  5  
ATOM   10102 C CD2  . HIS B 2 1   ? -28.557 7.010   12.408  1.00 0.00 ? 281 HIS B CD2  5  
ATOM   10103 C CE1  . HIS B 2 1   ? -28.044 7.824   14.371  1.00 0.00 ? 281 HIS B CE1  5  
ATOM   10104 N NE2  . HIS B 2 1   ? -29.050 7.554   13.566  1.00 0.00 ? 281 HIS B NE2  5  
ATOM   10105 H H1   . HIS B 2 1   ? -26.944 8.853   10.584  1.00 0.00 ? 281 HIS B H1   5  
ATOM   10106 H H2   . HIS B 2 1   ? -26.649 7.799   9.296   1.00 0.00 ? 281 HIS B H2   5  
ATOM   10107 H H3   . HIS B 2 1   ? -25.629 9.120   9.557   1.00 0.00 ? 281 HIS B H3   5  
ATOM   10108 H HA   . HIS B 2 1   ? -24.910 8.193   11.655  1.00 0.00 ? 281 HIS B HA   5  
ATOM   10109 H HB2  . HIS B 2 1   ? -26.658 5.864   10.824  1.00 0.00 ? 281 HIS B HB2  5  
ATOM   10110 H HB3  . HIS B 2 1   ? -25.491 5.810   12.137  1.00 0.00 ? 281 HIS B HB3  5  
ATOM   10111 H HD1  . HIS B 2 1   ? -26.018 7.577   14.163  1.00 0.00 ? 281 HIS B HD1  5  
ATOM   10112 H HD2  . HIS B 2 1   ? -29.135 6.684   11.557  1.00 0.00 ? 281 HIS B HD2  5  
ATOM   10113 H HE1  . HIS B 2 1   ? -28.123 8.262   15.356  1.00 0.00 ? 281 HIS B HE1  5  
ATOM   10114 H HE2  . HIS B 2 1   ? -29.964 7.909   13.675  1.00 0.00 ? 281 HIS B HE2  5  
ATOM   10115 N N    . ASN B 2 2   ? -23.118 7.667   9.957   1.00 0.00 ? 282 ASN B N    5  
ATOM   10116 C CA   . ASN B 2 2   ? -21.971 7.252   9.147   1.00 0.00 ? 282 ASN B CA   5  
ATOM   10117 C C    . ASN B 2 2   ? -22.330 7.279   7.664   1.00 0.00 ? 282 ASN B C    5  
ATOM   10118 O O    . ASN B 2 2   ? -21.944 8.207   6.950   1.00 0.00 ? 282 ASN B O    5  
ATOM   10119 C CB   . ASN B 2 2   ? -21.462 5.857   9.548   1.00 0.00 ? 282 ASN B CB   5  
ATOM   10120 C CG   . ASN B 2 2   ? -20.823 5.837   10.923  1.00 0.00 ? 282 ASN B CG   5  
ATOM   10121 O OD1  . ASN B 2 2   ? -20.183 6.803   11.341  1.00 0.00 ? 282 ASN B OD1  5  
ATOM   10122 N ND2  . ASN B 2 2   ? -20.999 4.738   11.639  1.00 0.00 ? 282 ASN B ND2  5  
ATOM   10123 H H    . ASN B 2 2   ? -23.076 8.533   10.420  1.00 0.00 ? 282 ASN B H    5  
ATOM   10124 H HA   . ASN B 2 2   ? -21.182 7.969   9.316   1.00 0.00 ? 282 ASN B HA   5  
ATOM   10125 H HB2  . ASN B 2 2   ? -22.292 5.167   9.550   1.00 0.00 ? 282 ASN B HB2  5  
ATOM   10126 H HB3  . ASN B 2 2   ? -20.730 5.529   8.826   1.00 0.00 ? 282 ASN B HB3  5  
ATOM   10127 H HD21 . ASN B 2 2   ? -21.526 4.007   11.245  1.00 0.00 ? 282 ASN B HD21 5  
ATOM   10128 H HD22 . ASN B 2 2   ? -20.605 4.699   12.536  1.00 0.00 ? 282 ASN B HD22 5  
ATOM   10129 N N    . LEU B 2 3   ? -23.086 6.270   7.224   1.00 0.00 ? 283 LEU B N    5  
ATOM   10130 C CA   . LEU B 2 3   ? -23.536 6.160   5.837   1.00 0.00 ? 283 LEU B CA   5  
ATOM   10131 C C    . LEU B 2 3   ? -22.353 6.277   4.877   1.00 0.00 ? 283 LEU B C    5  
ATOM   10132 O O    . LEU B 2 3   ? -22.390 7.019   3.895   1.00 0.00 ? 283 LEU B O    5  
ATOM   10133 C CB   . LEU B 2 3   ? -24.596 7.231   5.539   1.00 0.00 ? 283 LEU B CB   5  
ATOM   10134 C CG   . LEU B 2 3   ? -25.340 7.077   4.209   1.00 0.00 ? 283 LEU B CG   5  
ATOM   10135 C CD1  . LEU B 2 3   ? -26.073 5.743   4.148   1.00 0.00 ? 283 LEU B CD1  5  
ATOM   10136 C CD2  . LEU B 2 3   ? -26.313 8.227   4.019   1.00 0.00 ? 283 LEU B CD2  5  
ATOM   10137 H H    . LEU B 2 3   ? -23.357 5.576   7.863   1.00 0.00 ? 283 LEU B H    5  
ATOM   10138 H HA   . LEU B 2 3   ? -23.982 5.185   5.717   1.00 0.00 ? 283 LEU B HA   5  
ATOM   10139 H HB2  . LEU B 2 3   ? -25.324 7.216   6.337   1.00 0.00 ? 283 LEU B HB2  5  
ATOM   10140 H HB3  . LEU B 2 3   ? -24.109 8.195   5.541   1.00 0.00 ? 283 LEU B HB3  5  
ATOM   10141 H HG   . LEU B 2 3   ? -24.627 7.103   3.398   1.00 0.00 ? 283 LEU B HG   5  
ATOM   10142 H HD11 . LEU B 2 3   ? -26.592 5.661   3.205   1.00 0.00 ? 283 LEU B HD11 5  
ATOM   10143 H HD12 . LEU B 2 3   ? -26.787 5.688   4.956   1.00 0.00 ? 283 LEU B HD12 5  
ATOM   10144 H HD13 . LEU B 2 3   ? -25.362 4.937   4.240   1.00 0.00 ? 283 LEU B HD13 5  
ATOM   10145 H HD21 . LEU B 2 3   ? -25.768 9.158   3.992   1.00 0.00 ? 283 LEU B HD21 5  
ATOM   10146 H HD22 . LEU B 2 3   ? -27.015 8.244   4.840   1.00 0.00 ? 283 LEU B HD22 5  
ATOM   10147 H HD23 . LEU B 2 3   ? -26.848 8.095   3.091   1.00 0.00 ? 283 LEU B HD23 5  
ATOM   10148 N N    . LEU B 2 4   ? -21.299 5.543   5.184   1.00 0.00 ? 284 LEU B N    5  
ATOM   10149 C CA   . LEU B 2 4   ? -20.085 5.572   4.389   1.00 0.00 ? 284 LEU B CA   5  
ATOM   10150 C C    . LEU B 2 4   ? -20.038 4.365   3.464   1.00 0.00 ? 284 LEU B C    5  
ATOM   10151 O O    . LEU B 2 4   ? -20.705 3.359   3.706   1.00 0.00 ? 284 LEU B O    5  
ATOM   10152 C CB   . LEU B 2 4   ? -18.859 5.578   5.304   1.00 0.00 ? 284 LEU B CB   5  
ATOM   10153 C CG   . LEU B 2 4   ? -18.766 6.764   6.267   1.00 0.00 ? 284 LEU B CG   5  
ATOM   10154 C CD1  . LEU B 2 4   ? -17.546 6.630   7.165   1.00 0.00 ? 284 LEU B CD1  5  
ATOM   10155 C CD2  . LEU B 2 4   ? -18.719 8.075   5.500   1.00 0.00 ? 284 LEU B CD2  5  
ATOM   10156 H H    . LEU B 2 4   ? -21.339 4.952   5.965   1.00 0.00 ? 284 LEU B H    5  
ATOM   10157 H HA   . LEU B 2 4   ? -20.092 6.473   3.794   1.00 0.00 ? 284 LEU B HA   5  
ATOM   10158 H HB2  . LEU B 2 4   ? -18.868 4.669   5.887   1.00 0.00 ? 284 LEU B HB2  5  
ATOM   10159 H HB3  . LEU B 2 4   ? -17.975 5.578   4.684   1.00 0.00 ? 284 LEU B HB3  5  
ATOM   10160 H HG   . LEU B 2 4   ? -19.642 6.776   6.898   1.00 0.00 ? 284 LEU B HG   5  
ATOM   10161 H HD11 . LEU B 2 4   ? -16.654 6.590   6.556   1.00 0.00 ? 284 LEU B HD11 5  
ATOM   10162 H HD12 . LEU B 2 4   ? -17.626 5.726   7.748   1.00 0.00 ? 284 LEU B HD12 5  
ATOM   10163 H HD13 . LEU B 2 4   ? -17.492 7.482   7.826   1.00 0.00 ? 284 LEU B HD13 5  
ATOM   10164 H HD21 . LEU B 2 4   ? -19.650 8.216   4.972   1.00 0.00 ? 284 LEU B HD21 5  
ATOM   10165 H HD22 . LEU B 2 4   ? -17.906 8.050   4.791   1.00 0.00 ? 284 LEU B HD22 5  
ATOM   10166 H HD23 . LEU B 2 4   ? -18.570 8.891   6.191   1.00 0.00 ? 284 LEU B HD23 5  
ATOM   10167 N N    . ARG B 2 5   ? -19.260 4.474   2.401   1.00 0.00 ? 285 ARG B N    5  
ATOM   10168 C CA   . ARG B 2 5   ? -19.106 3.379   1.453   1.00 0.00 ? 285 ARG B CA   5  
ATOM   10169 C C    . ARG B 2 5   ? -18.024 2.419   1.930   1.00 0.00 ? 285 ARG B C    5  
ATOM   10170 O O    . ARG B 2 5   ? -17.275 2.730   2.860   1.00 0.00 ? 285 ARG B O    5  
ATOM   10171 C CB   . ARG B 2 5   ? -18.760 3.910   0.061   1.00 0.00 ? 285 ARG B CB   5  
ATOM   10172 C CG   . ARG B 2 5   ? -19.927 4.537   -0.688  1.00 0.00 ? 285 ARG B CG   5  
ATOM   10173 C CD   . ARG B 2 5   ? -20.356 5.844   -0.053  1.00 0.00 ? 285 ARG B CD   5  
ATOM   10174 N NE   . ARG B 2 5   ? -21.404 6.514   -0.812  1.00 0.00 ? 285 ARG B NE   5  
ATOM   10175 C CZ   . ARG B 2 5   ? -21.660 7.814   -0.721  1.00 0.00 ? 285 ARG B CZ   5  
ATOM   10176 N NH1  . ARG B 2 5   ? -20.942 8.573   0.095   1.00 0.00 ? 285 ARG B NH1  5  
ATOM   10177 N NH2  . ARG B 2 5   ? -22.636 8.353   -1.439  1.00 0.00 ? 285 ARG B NH2  5  
ATOM   10178 H H    . ARG B 2 5   ? -18.768 5.312   2.251   1.00 0.00 ? 285 ARG B H    5  
ATOM   10179 H HA   . ARG B 2 5   ? -20.047 2.848   1.404   1.00 0.00 ? 285 ARG B HA   5  
ATOM   10180 H HB2  . ARG B 2 5   ? -17.994 4.664   0.169   1.00 0.00 ? 285 ARG B HB2  5  
ATOM   10181 H HB3  . ARG B 2 5   ? -18.371 3.097   -0.536  1.00 0.00 ? 285 ARG B HB3  5  
ATOM   10182 H HG2  . ARG B 2 5   ? -19.627 4.729   -1.706  1.00 0.00 ? 285 ARG B HG2  5  
ATOM   10183 H HG3  . ARG B 2 5   ? -20.761 3.851   -0.679  1.00 0.00 ? 285 ARG B HG3  5  
ATOM   10184 H HD2  . ARG B 2 5   ? -20.720 5.642   0.944   1.00 0.00 ? 285 ARG B HD2  5  
ATOM   10185 H HD3  . ARG B 2 5   ? -19.496 6.493   0.006   1.00 0.00 ? 285 ARG B HD3  5  
ATOM   10186 H HE   . ARG B 2 5   ? -21.950 5.959   -1.416  1.00 0.00 ? 285 ARG B HE   5  
ATOM   10187 H HH11 . ARG B 2 5   ? -20.200 8.165   0.651   1.00 0.00 ? 285 ARG B HH11 5  
ATOM   10188 H HH12 . ARG B 2 5   ? -21.132 9.556   0.172   1.00 0.00 ? 285 ARG B HH12 5  
ATOM   10189 H HH21 . ARG B 2 5   ? -23.184 7.781   -2.057  1.00 0.00 ? 285 ARG B HH21 5  
ATOM   10190 H HH22 . ARG B 2 5   ? -22.835 9.333   -1.366  1.00 0.00 ? 285 ARG B HH22 5  
ATOM   10191 N N    . ILE B 2 6   ? -17.944 1.253   1.302   1.00 0.00 ? 286 ILE B N    5  
ATOM   10192 C CA   . ILE B 2 6   ? -16.984 0.233   1.708   1.00 0.00 ? 286 ILE B CA   5  
ATOM   10193 C C    . ILE B 2 6   ? -16.119 -0.217  0.536   1.00 0.00 ? 286 ILE B C    5  
ATOM   10194 O O    . ILE B 2 6   ? -15.449 -1.244  0.624   1.00 0.00 ? 286 ILE B O    5  
ATOM   10195 C CB   . ILE B 2 6   ? -17.688 -1.001  2.311   1.00 0.00 ? 286 ILE B CB   5  
ATOM   10196 C CG1  . ILE B 2 6   ? -18.635 -1.627  1.285   1.00 0.00 ? 286 ILE B CG1  5  
ATOM   10197 C CG2  . ILE B 2 6   ? -18.441 -0.619  3.578   1.00 0.00 ? 286 ILE B CG2  5  
ATOM   10198 C CD1  . ILE B 2 6   ? -19.298 -2.899  1.761   1.00 0.00 ? 286 ILE B CD1  5  
ATOM   10199 H H    . ILE B 2 6   ? -18.547 1.070   0.549   1.00 0.00 ? 286 ILE B H    5  
ATOM   10200 H HA   . ILE B 2 6   ? -16.345 0.663   2.468   1.00 0.00 ? 286 ILE B HA   5  
ATOM   10201 H HB   . ILE B 2 6   ? -16.930 -1.724  2.578   1.00 0.00 ? 286 ILE B HB   5  
ATOM   10202 H HG12 . ILE B 2 6   ? -19.413 -0.919  1.046   1.00 0.00 ? 286 ILE B HG12 5  
ATOM   10203 H HG13 . ILE B 2 6   ? -18.079 -1.858  0.387   1.00 0.00 ? 286 ILE B HG13 5  
ATOM   10204 H HG21 . ILE B 2 6   ? -18.927 -1.493  3.985   1.00 0.00 ? 286 ILE B HG21 5  
ATOM   10205 H HG22 . ILE B 2 6   ? -19.181 0.131   3.342   1.00 0.00 ? 286 ILE B HG22 5  
ATOM   10206 H HG23 . ILE B 2 6   ? -17.745 -0.223  4.304   1.00 0.00 ? 286 ILE B HG23 5  
ATOM   10207 H HD11 . ILE B 2 6   ? -18.541 -3.624  2.021   1.00 0.00 ? 286 ILE B HD11 5  
ATOM   10208 H HD12 . ILE B 2 6   ? -19.921 -3.296  0.975   1.00 0.00 ? 286 ILE B HD12 5  
ATOM   10209 H HD13 . ILE B 2 6   ? -19.905 -2.686  2.629   1.00 0.00 ? 286 ILE B HD13 5  
HETATM 10210 O OH   . ALY B 2 7   ? -9.616  2.245   0.511   1.00 0.00 ? 287 ALY B OH   5  
HETATM 10211 C CH   . ALY B 2 7   ? -9.027  1.519   -0.287  1.00 0.00 ? 287 ALY B CH   5  
HETATM 10212 C CH3  . ALY B 2 7   ? -7.501  1.418   -0.225  1.00 0.00 ? 287 ALY B CH3  5  
HETATM 10213 N NZ   . ALY B 2 7   ? -9.677  0.818   -1.206  1.00 0.00 ? 287 ALY B NZ   5  
HETATM 10214 C CE   . ALY B 2 7   ? -11.125 0.837   -1.367  1.00 0.00 ? 287 ALY B CE   5  
HETATM 10215 C CD   . ALY B 2 7   ? -11.590 -0.174  -2.401  1.00 0.00 ? 287 ALY B CD   5  
HETATM 10216 C CG   . ALY B 2 7   ? -13.066 -0.023  -2.725  1.00 0.00 ? 287 ALY B CG   5  
HETATM 10217 C CB   . ALY B 2 7   ? -13.940 -0.069  -1.484  1.00 0.00 ? 287 ALY B CB   5  
HETATM 10218 C CA   . ALY B 2 7   ? -15.399 0.272   -1.775  1.00 0.00 ? 287 ALY B CA   5  
HETATM 10219 N N    . ALY B 2 7   ? -16.151 0.562   -0.548  1.00 0.00 ? 287 ALY B N    5  
HETATM 10220 C C    . ALY B 2 7   ? -16.045 -0.856  -2.573  1.00 0.00 ? 287 ALY B C    5  
HETATM 10221 O O    . ALY B 2 7   ? -16.309 -1.939  -2.049  1.00 0.00 ? 287 ALY B O    5  
HETATM 10222 H HH31 . ALY B 2 7   ? -7.115  1.197   -1.213  1.00 0.00 ? 287 ALY B HH31 5  
HETATM 10223 H HH32 . ALY B 2 7   ? -7.091  2.355   0.121   1.00 0.00 ? 287 ALY B HH32 5  
HETATM 10224 H HH33 . ALY B 2 7   ? -7.221  0.628   0.456   1.00 0.00 ? 287 ALY B HH33 5  
HETATM 10225 H HZ   . ALY B 2 7   ? -9.160  0.256   -1.818  1.00 0.00 ? 287 ALY B HZ   5  
HETATM 10226 H HE3  . ALY B 2 7   ? -11.431 1.825   -1.682  1.00 0.00 ? 287 ALY B HE3  5  
HETATM 10227 H HE2  . ALY B 2 7   ? -11.586 0.603   -0.419  1.00 0.00 ? 287 ALY B HE2  5  
HETATM 10228 H HD3  . ALY B 2 7   ? -11.414 -1.168  -2.022  1.00 0.00 ? 287 ALY B HD3  5  
HETATM 10229 H HD2  . ALY B 2 7   ? -11.023 -0.028  -3.310  1.00 0.00 ? 287 ALY B HD2  5  
HETATM 10230 H HG3  . ALY B 2 7   ? -13.359 -0.826  -3.385  1.00 0.00 ? 287 ALY B HG3  5  
HETATM 10231 H HG2  . ALY B 2 7   ? -13.219 0.923   -3.222  1.00 0.00 ? 287 ALY B HG2  5  
HETATM 10232 H HB3  . ALY B 2 7   ? -13.550 0.630   -0.762  1.00 0.00 ? 287 ALY B HB3  5  
HETATM 10233 H HB2  . ALY B 2 7   ? -13.900 -1.066  -1.071  1.00 0.00 ? 287 ALY B HB2  5  
HETATM 10234 H HCA  . ALY B 2 7   ? -15.418 1.163   -2.382  1.00 0.00 ? 287 ALY B HCA  5  
HETATM 10235 H H    . ALY B 2 7   ? -16.710 1.367   -0.523  1.00 0.00 ? 287 ALY B H    5  
ATOM   10236 N N    . GLN B 2 8   ? -16.279 -0.605  -3.853  1.00 0.00 ? 288 GLN B N    5  
ATOM   10237 C CA   . GLN B 2 8   ? -16.912 -1.586  -4.720  1.00 0.00 ? 288 GLN B CA   5  
ATOM   10238 C C    . GLN B 2 8   ? -15.859 -2.499  -5.353  1.00 0.00 ? 288 GLN B C    5  
ATOM   10239 O O    . GLN B 2 8   ? -15.701 -2.545  -6.573  1.00 0.00 ? 288 GLN B O    5  
ATOM   10240 C CB   . GLN B 2 8   ? -17.734 -0.878  -5.801  1.00 0.00 ? 288 GLN B CB   5  
ATOM   10241 C CG   . GLN B 2 8   ? -18.657 -1.804  -6.579  1.00 0.00 ? 288 GLN B CG   5  
ATOM   10242 C CD   . GLN B 2 8   ? -19.422 -1.082  -7.669  1.00 0.00 ? 288 GLN B CD   5  
ATOM   10243 O OE1  . GLN B 2 8   ? -18.960 -0.984  -8.806  1.00 0.00 ? 288 GLN B OE1  5  
ATOM   10244 N NE2  . GLN B 2 8   ? -20.593 -0.567  -7.335  1.00 0.00 ? 288 GLN B NE2  5  
ATOM   10245 H H    . GLN B 2 8   ? -16.019 0.261   -4.225  1.00 0.00 ? 288 GLN B H    5  
ATOM   10246 H HA   . GLN B 2 8   ? -17.571 -2.188  -4.114  1.00 0.00 ? 288 GLN B HA   5  
ATOM   10247 H HB2  . GLN B 2 8   ? -18.337 -0.114  -5.335  1.00 0.00 ? 288 GLN B HB2  5  
ATOM   10248 H HB3  . GLN B 2 8   ? -17.057 -0.410  -6.502  1.00 0.00 ? 288 GLN B HB3  5  
ATOM   10249 H HG2  . GLN B 2 8   ? -18.066 -2.584  -7.032  1.00 0.00 ? 288 GLN B HG2  5  
ATOM   10250 H HG3  . GLN B 2 8   ? -19.367 -2.243  -5.892  1.00 0.00 ? 288 GLN B HG3  5  
ATOM   10251 H HE21 . GLN B 2 8   ? -20.903 -0.679  -6.409  1.00 0.00 ? 288 GLN B HE21 5  
ATOM   10252 H HE22 . GLN B 2 8   ? -21.106 -0.097  -8.024  1.00 0.00 ? 288 GLN B HE22 5  
ATOM   10253 N N    . PHE B 2 9   ? -15.127 -3.209  -4.510  1.00 0.00 ? 289 PHE B N    5  
ATOM   10254 C CA   . PHE B 2 9   ? -14.133 -4.168  -4.975  1.00 0.00 ? 289 PHE B CA   5  
ATOM   10255 C C    . PHE B 2 9   ? -14.727 -5.568  -4.996  1.00 0.00 ? 289 PHE B C    5  
ATOM   10256 O O    . PHE B 2 9   ? -14.349 -6.430  -4.201  1.00 0.00 ? 289 PHE B O    5  
ATOM   10257 C CB   . PHE B 2 9   ? -12.880 -4.137  -4.087  1.00 0.00 ? 289 PHE B CB   5  
ATOM   10258 C CG   . PHE B 2 9   ? -11.815 -3.176  -4.549  1.00 0.00 ? 289 PHE B CG   5  
ATOM   10259 C CD1  . PHE B 2 9   ? -12.103 -2.188  -5.478  1.00 0.00 ? 289 PHE B CD1  5  
ATOM   10260 C CD2  . PHE B 2 9   ? -10.521 -3.264  -4.054  1.00 0.00 ? 289 PHE B CD2  5  
ATOM   10261 C CE1  . PHE B 2 9   ? -11.126 -1.311  -5.903  1.00 0.00 ? 289 PHE B CE1  5  
ATOM   10262 C CE2  . PHE B 2 9   ? -9.541  -2.386  -4.478  1.00 0.00 ? 289 PHE B CE2  5  
ATOM   10263 C CZ   . PHE B 2 9   ? -9.844  -1.408  -5.403  1.00 0.00 ? 289 PHE B CZ   5  
ATOM   10264 H H    . PHE B 2 9   ? -15.270 -3.096  -3.546  1.00 0.00 ? 289 PHE B H    5  
ATOM   10265 H HA   . PHE B 2 9   ? -13.857 -3.895  -5.982  1.00 0.00 ? 289 PHE B HA   5  
ATOM   10266 H HB2  . PHE B 2 9   ? -13.168 -3.849  -3.087  1.00 0.00 ? 289 PHE B HB2  5  
ATOM   10267 H HB3  . PHE B 2 9   ? -12.447 -5.126  -4.057  1.00 0.00 ? 289 PHE B HB3  5  
ATOM   10268 H HD1  . PHE B 2 9   ? -13.105 -2.105  -5.869  1.00 0.00 ? 289 PHE B HD1  5  
ATOM   10269 H HD2  . PHE B 2 9   ? -10.278 -4.028  -3.329  1.00 0.00 ? 289 PHE B HD2  5  
ATOM   10270 H HE1  . PHE B 2 9   ? -11.364 -0.547  -6.628  1.00 0.00 ? 289 PHE B HE1  5  
ATOM   10271 H HE2  . PHE B 2 9   ? -8.539  -2.464  -4.086  1.00 0.00 ? 289 PHE B HE2  5  
ATOM   10272 H HZ   . PHE B 2 9   ? -9.079  -0.722  -5.735  1.00 0.00 ? 289 PHE B HZ   5  
ATOM   10273 N N    . LEU B 2 10  ? -15.666 -5.785  -5.902  1.00 0.00 ? 290 LEU B N    5  
ATOM   10274 C CA   . LEU B 2 10  ? -16.339 -7.068  -6.009  1.00 0.00 ? 290 LEU B CA   5  
ATOM   10275 C C    . LEU B 2 10  ? -15.895 -7.786  -7.280  1.00 0.00 ? 290 LEU B C    5  
ATOM   10276 O O    . LEU B 2 10  ? -16.579 -7.749  -8.306  1.00 0.00 ? 290 LEU B O    5  
ATOM   10277 C CB   . LEU B 2 10  ? -17.858 -6.869  -6.003  1.00 0.00 ? 290 LEU B CB   5  
ATOM   10278 C CG   . LEU B 2 10  ? -18.686 -8.148  -5.864  1.00 0.00 ? 290 LEU B CG   5  
ATOM   10279 C CD1  . LEU B 2 10  ? -18.419 -8.816  -4.523  1.00 0.00 ? 290 LEU B CD1  5  
ATOM   10280 C CD2  . LEU B 2 10  ? -20.167 -7.839  -6.022  1.00 0.00 ? 290 LEU B CD2  5  
ATOM   10281 H H    . LEU B 2 10  ? -15.906 -5.065  -6.525  1.00 0.00 ? 290 LEU B H    5  
ATOM   10282 H HA   . LEU B 2 10  ? -16.057 -7.665  -5.154  1.00 0.00 ? 290 LEU B HA   5  
ATOM   10283 H HB2  . LEU B 2 10  ? -18.109 -6.212  -5.183  1.00 0.00 ? 290 LEU B HB2  5  
ATOM   10284 H HB3  . LEU B 2 10  ? -18.139 -6.386  -6.926  1.00 0.00 ? 290 LEU B HB3  5  
ATOM   10285 H HG   . LEU B 2 10  ? -18.402 -8.839  -6.643  1.00 0.00 ? 290 LEU B HG   5  
ATOM   10286 H HD11 . LEU B 2 10  ? -17.379 -9.102  -4.464  1.00 0.00 ? 290 LEU B HD11 5  
ATOM   10287 H HD12 . LEU B 2 10  ? -19.039 -9.694  -4.429  1.00 0.00 ? 290 LEU B HD12 5  
ATOM   10288 H HD13 . LEU B 2 10  ? -18.648 -8.125  -3.725  1.00 0.00 ? 290 LEU B HD13 5  
ATOM   10289 H HD21 . LEU B 2 10  ? -20.739 -8.748  -5.903  1.00 0.00 ? 290 LEU B HD21 5  
ATOM   10290 H HD22 . LEU B 2 10  ? -20.346 -7.429  -7.006  1.00 0.00 ? 290 LEU B HD22 5  
ATOM   10291 H HD23 . LEU B 2 10  ? -20.468 -7.123  -5.272  1.00 0.00 ? 290 LEU B HD23 5  
ATOM   10292 N N    . GLN B 2 11  ? -14.745 -8.436  -7.202  1.00 0.00 ? 291 GLN B N    5  
ATOM   10293 C CA   . GLN B 2 11  ? -14.160 -9.109  -8.354  1.00 0.00 ? 291 GLN B CA   5  
ATOM   10294 C C    . GLN B 2 11  ? -14.720 -10.519 -8.496  1.00 0.00 ? 291 GLN B C    5  
ATOM   10295 O O    . GLN B 2 11  ? -14.003 -11.504 -8.304  1.00 0.00 ? 291 GLN B O    5  
ATOM   10296 C CB   . GLN B 2 11  ? -12.627 -9.162  -8.246  1.00 0.00 ? 291 GLN B CB   5  
ATOM   10297 C CG   . GLN B 2 11  ? -11.952 -7.796  -8.280  1.00 0.00 ? 291 GLN B CG   5  
ATOM   10298 C CD   . GLN B 2 11  ? -12.171 -6.985  -7.012  1.00 0.00 ? 291 GLN B CD   5  
ATOM   10299 O OE1  . GLN B 2 11  ? -12.259 -5.758  -7.055  1.00 0.00 ? 291 GLN B OE1  5  
ATOM   10300 N NE2  . GLN B 2 11  ? -12.231 -7.659  -5.872  1.00 0.00 ? 291 GLN B NE2  5  
ATOM   10301 H H    . GLN B 2 11  ? -14.274 -8.471  -6.340  1.00 0.00 ? 291 GLN B H    5  
ATOM   10302 H HA   . GLN B 2 11  ? -14.427 -8.542  -9.233  1.00 0.00 ? 291 GLN B HA   5  
ATOM   10303 H HB2  . GLN B 2 11  ? -12.360 -9.645  -7.319  1.00 0.00 ? 291 GLN B HB2  5  
ATOM   10304 H HB3  . GLN B 2 11  ? -12.241 -9.747  -9.067  1.00 0.00 ? 291 GLN B HB3  5  
ATOM   10305 H HG2  . GLN B 2 11  ? -10.890 -7.938  -8.413  1.00 0.00 ? 291 GLN B HG2  5  
ATOM   10306 H HG3  . GLN B 2 11  ? -12.345 -7.238  -9.118  1.00 0.00 ? 291 GLN B HG3  5  
ATOM   10307 H HE21 . GLN B 2 11  ? -12.128 -8.634  -5.901  1.00 0.00 ? 291 GLN B HE21 5  
ATOM   10308 H HE22 . GLN B 2 11  ? -12.391 -7.157  -5.045  1.00 0.00 ? 291 GLN B HE22 5  
ATOM   10309 N N    . SER B 2 12  ? -16.008 -10.592 -8.824  1.00 0.00 ? 292 SER B N    5  
ATOM   10310 C CA   . SER B 2 12  ? -16.699 -11.859 -9.035  1.00 0.00 ? 292 SER B CA   5  
ATOM   10311 C C    . SER B 2 12  ? -16.612 -12.747 -7.794  1.00 0.00 ? 292 SER B C    5  
ATOM   10312 O O    . SER B 2 12  ? -17.316 -12.446 -6.805  1.00 0.00 ? 292 SER B O    5  
ATOM   10313 C CB   . SER B 2 12  ? -16.126 -12.572 -10.263 1.00 0.00 ? 292 SER B CB   5  
ATOM   10314 O OG   . SER B 2 12  ? -16.183 -11.729 -11.407 1.00 0.00 ? 292 SER B OG   5  
ATOM   10315 O OXT  . SER B 2 12  ? -15.847 -13.736 -7.805  1.00 0.00 ? 292 SER B OXT  5  
ATOM   10316 H H    . SER B 2 12  ? -16.514 -9.758  -8.920  1.00 0.00 ? 292 SER B H    5  
ATOM   10317 H HA   . SER B 2 12  ? -17.737 -11.634 -9.221  1.00 0.00 ? 292 SER B HA   5  
ATOM   10318 H HB2  . SER B 2 12  ? -15.095 -12.837 -10.077 1.00 0.00 ? 292 SER B HB2  5  
ATOM   10319 H HB3  . SER B 2 12  ? -16.698 -13.466 -10.461 1.00 0.00 ? 292 SER B HB3  5  
ATOM   10320 H HG   . SER B 2 12  ? -16.307 -12.272 -12.198 1.00 0.00 ? 292 SER B HG   5  
ATOM   10321 N N    . GLY A 1 1   ? 20.060  12.308  -2.074  1.00 0.00 ? 1   GLY A N    6  
ATOM   10322 C CA   . GLY A 1 1   ? 20.052  11.601  -3.378  1.00 0.00 ? 1   GLY A CA   6  
ATOM   10323 C C    . GLY A 1 1   ? 20.732  10.254  -3.289  1.00 0.00 ? 1   GLY A C    6  
ATOM   10324 O O    . GLY A 1 1   ? 21.233  9.887   -2.224  1.00 0.00 ? 1   GLY A O    6  
ATOM   10325 H H1   . GLY A 1 1   ? 21.037  12.503  -1.777  1.00 0.00 ? 1   GLY A H1   6  
ATOM   10326 H H2   . GLY A 1 1   ? 19.604  11.721  -1.346  1.00 0.00 ? 1   GLY A H2   6  
ATOM   10327 H H3   . GLY A 1 1   ? 19.545  13.206  -2.148  1.00 0.00 ? 1   GLY A H3   6  
ATOM   10328 H HA2  . GLY A 1 1   ? 19.029  11.458  -3.693  1.00 0.00 ? 1   GLY A HA2  6  
ATOM   10329 H HA3  . GLY A 1 1   ? 20.564  12.207  -4.111  1.00 0.00 ? 1   GLY A HA3  6  
ATOM   10330 N N    . LYS A 1 2   ? 20.755  9.523   -4.406  1.00 0.00 ? 2   LYS A N    6  
ATOM   10331 C CA   . LYS A 1 2   ? 21.343  8.180   -4.465  1.00 0.00 ? 2   LYS A CA   6  
ATOM   10332 C C    . LYS A 1 2   ? 20.546  7.183   -3.631  1.00 0.00 ? 2   LYS A C    6  
ATOM   10333 O O    . LYS A 1 2   ? 19.825  7.552   -2.704  1.00 0.00 ? 2   LYS A O    6  
ATOM   10334 C CB   . LYS A 1 2   ? 22.804  8.192   -4.009  1.00 0.00 ? 2   LYS A CB   6  
ATOM   10335 C CG   . LYS A 1 2   ? 23.744  8.892   -4.976  1.00 0.00 ? 2   LYS A CG   6  
ATOM   10336 C CD   . LYS A 1 2   ? 23.915  8.094   -6.260  1.00 0.00 ? 2   LYS A CD   6  
ATOM   10337 C CE   . LYS A 1 2   ? 24.824  8.810   -7.244  1.00 0.00 ? 2   LYS A CE   6  
ATOM   10338 N NZ   . LYS A 1 2   ? 26.162  9.095   -6.664  1.00 0.00 ? 2   LYS A NZ   6  
ATOM   10339 H H    . LYS A 1 2   ? 20.364  9.901   -5.225  1.00 0.00 ? 2   LYS A H    6  
ATOM   10340 H HA   . LYS A 1 2   ? 21.310  7.859   -5.493  1.00 0.00 ? 2   LYS A HA   6  
ATOM   10341 H HB2  . LYS A 1 2   ? 22.869  8.688   -3.054  1.00 0.00 ? 2   LYS A HB2  6  
ATOM   10342 H HB3  . LYS A 1 2   ? 23.135  7.170   -3.898  1.00 0.00 ? 2   LYS A HB3  6  
ATOM   10343 H HG2  . LYS A 1 2   ? 23.338  9.862   -5.219  1.00 0.00 ? 2   LYS A HG2  6  
ATOM   10344 H HG3  . LYS A 1 2   ? 24.709  9.010   -4.504  1.00 0.00 ? 2   LYS A HG3  6  
ATOM   10345 H HD2  . LYS A 1 2   ? 24.346  7.134   -6.021  1.00 0.00 ? 2   LYS A HD2  6  
ATOM   10346 H HD3  . LYS A 1 2   ? 22.945  7.953   -6.716  1.00 0.00 ? 2   LYS A HD3  6  
ATOM   10347 H HE2  . LYS A 1 2   ? 24.947  8.187   -8.117  1.00 0.00 ? 2   LYS A HE2  6  
ATOM   10348 H HE3  . LYS A 1 2   ? 24.359  9.742   -7.532  1.00 0.00 ? 2   LYS A HE3  6  
ATOM   10349 H HZ1  . LYS A 1 2   ? 26.636  8.208   -6.399  1.00 0.00 ? 2   LYS A HZ1  6  
ATOM   10350 H HZ2  . LYS A 1 2   ? 26.066  9.688   -5.815  1.00 0.00 ? 2   LYS A HZ2  6  
ATOM   10351 H HZ3  . LYS A 1 2   ? 26.753  9.597   -7.357  1.00 0.00 ? 2   LYS A HZ3  6  
ATOM   10352 N N    . LEU A 1 3   ? 20.659  5.918   -3.986  1.00 0.00 ? 3   LEU A N    6  
ATOM   10353 C CA   . LEU A 1 3   ? 20.025  4.862   -3.222  1.00 0.00 ? 3   LEU A CA   6  
ATOM   10354 C C    . LEU A 1 3   ? 21.066  4.132   -2.389  1.00 0.00 ? 3   LEU A C    6  
ATOM   10355 O O    . LEU A 1 3   ? 21.828  3.317   -2.911  1.00 0.00 ? 3   LEU A O    6  
ATOM   10356 C CB   . LEU A 1 3   ? 19.316  3.861   -4.139  1.00 0.00 ? 3   LEU A CB   6  
ATOM   10357 C CG   . LEU A 1 3   ? 18.170  4.414   -4.985  1.00 0.00 ? 3   LEU A CG   6  
ATOM   10358 C CD1  . LEU A 1 3   ? 17.662  3.337   -5.931  1.00 0.00 ? 3   LEU A CD1  6  
ATOM   10359 C CD2  . LEU A 1 3   ? 17.037  4.915   -4.100  1.00 0.00 ? 3   LEU A CD2  6  
ATOM   10360 H H    . LEU A 1 3   ? 21.187  5.685   -4.782  1.00 0.00 ? 3   LEU A H    6  
ATOM   10361 H HA   . LEU A 1 3   ? 19.300  5.314   -2.562  1.00 0.00 ? 3   LEU A HA   6  
ATOM   10362 H HB2  . LEU A 1 3   ? 20.054  3.425   -4.805  1.00 0.00 ? 3   LEU A HB2  6  
ATOM   10363 H HB3  . LEU A 1 3   ? 18.914  3.083   -3.515  1.00 0.00 ? 3   LEU A HB3  6  
ATOM   10364 H HG   . LEU A 1 3   ? 18.530  5.241   -5.579  1.00 0.00 ? 3   LEU A HG   6  
ATOM   10365 H HD11 . LEU A 1 3   ? 17.433  2.441   -5.368  1.00 0.00 ? 3   LEU A HD11 6  
ATOM   10366 H HD12 . LEU A 1 3   ? 18.422  3.116   -6.665  1.00 0.00 ? 3   LEU A HD12 6  
ATOM   10367 H HD13 . LEU A 1 3   ? 16.771  3.687   -6.430  1.00 0.00 ? 3   LEU A HD13 6  
ATOM   10368 H HD21 . LEU A 1 3   ? 17.410  5.671   -3.426  1.00 0.00 ? 3   LEU A HD21 6  
ATOM   10369 H HD22 . LEU A 1 3   ? 16.635  4.091   -3.530  1.00 0.00 ? 3   LEU A HD22 6  
ATOM   10370 H HD23 . LEU A 1 3   ? 16.257  5.336   -4.719  1.00 0.00 ? 3   LEU A HD23 6  
ATOM   10371 N N    . SER A 1 4   ? 21.108  4.429   -1.103  1.00 0.00 ? 4   SER A N    6  
ATOM   10372 C CA   . SER A 1 4   ? 22.046  3.769   -0.209  1.00 0.00 ? 4   SER A CA   6  
ATOM   10373 C C    . SER A 1 4   ? 21.499  2.386   0.154   1.00 0.00 ? 4   SER A C    6  
ATOM   10374 O O    . SER A 1 4   ? 20.494  1.957   -0.411  1.00 0.00 ? 4   SER A O    6  
ATOM   10375 C CB   . SER A 1 4   ? 22.307  4.625   1.046   1.00 0.00 ? 4   SER A CB   6  
ATOM   10376 O OG   . SER A 1 4   ? 23.250  4.013   1.912   1.00 0.00 ? 4   SER A OG   6  
ATOM   10377 H H    . SER A 1 4   ? 20.483  5.089   -0.745  1.00 0.00 ? 4   SER A H    6  
ATOM   10378 H HA   . SER A 1 4   ? 22.971  3.644   -0.749  1.00 0.00 ? 4   SER A HA   6  
ATOM   10379 H HB2  . SER A 1 4   ? 22.698  5.590   0.751   1.00 0.00 ? 4   SER A HB2  6  
ATOM   10380 H HB3  . SER A 1 4   ? 21.381  4.761   1.581   1.00 0.00 ? 4   SER A HB3  6  
ATOM   10381 H HG   . SER A 1 4   ? 23.121  4.346   2.813   1.00 0.00 ? 4   SER A HG   6  
ATOM   10382 N N    . GLU A 1 5   ? 22.152  1.700   1.084   1.00 0.00 ? 5   GLU A N    6  
ATOM   10383 C CA   . GLU A 1 5   ? 21.772  0.338   1.462   1.00 0.00 ? 5   GLU A CA   6  
ATOM   10384 C C    . GLU A 1 5   ? 20.280  0.253   1.780   1.00 0.00 ? 5   GLU A C    6  
ATOM   10385 O O    . GLU A 1 5   ? 19.573  -0.623  1.273   1.00 0.00 ? 5   GLU A O    6  
ATOM   10386 C CB   . GLU A 1 5   ? 22.591  -0.105  2.675   1.00 0.00 ? 5   GLU A CB   6  
ATOM   10387 C CG   . GLU A 1 5   ? 22.496  -1.592  2.975   1.00 0.00 ? 5   GLU A CG   6  
ATOM   10388 C CD   . GLU A 1 5   ? 23.113  -2.443  1.885   1.00 0.00 ? 5   GLU A CD   6  
ATOM   10389 O OE1  . GLU A 1 5   ? 24.343  -2.355  1.680   1.00 0.00 ? 5   GLU A OE1  6  
ATOM   10390 O OE2  . GLU A 1 5   ? 22.378  -3.220  1.240   1.00 0.00 ? 5   GLU A OE2  6  
ATOM   10391 H H    . GLU A 1 5   ? 22.911  2.126   1.539   1.00 0.00 ? 5   GLU A H    6  
ATOM   10392 H HA   . GLU A 1 5   ? 21.992  -0.313  0.628   1.00 0.00 ? 5   GLU A HA   6  
ATOM   10393 H HB2  . GLU A 1 5   ? 23.627  0.138   2.502   1.00 0.00 ? 5   GLU A HB2  6  
ATOM   10394 H HB3  . GLU A 1 5   ? 22.244  0.436   3.544   1.00 0.00 ? 5   GLU A HB3  6  
ATOM   10395 H HG2  . GLU A 1 5   ? 23.010  -1.795  3.902   1.00 0.00 ? 5   GLU A HG2  6  
ATOM   10396 H HG3  . GLU A 1 5   ? 21.456  -1.860  3.075   1.00 0.00 ? 5   GLU A HG3  6  
ATOM   10397 N N    . GLN A 1 6   ? 19.810  1.186   2.597   1.00 0.00 ? 6   GLN A N    6  
ATOM   10398 C CA   . GLN A 1 6   ? 18.415  1.232   3.013   1.00 0.00 ? 6   GLN A CA   6  
ATOM   10399 C C    . GLN A 1 6   ? 17.493  1.469   1.817   1.00 0.00 ? 6   GLN A C    6  
ATOM   10400 O O    . GLN A 1 6   ? 16.544  0.719   1.604   1.00 0.00 ? 6   GLN A O    6  
ATOM   10401 C CB   . GLN A 1 6   ? 18.190  2.339   4.058   1.00 0.00 ? 6   GLN A CB   6  
ATOM   10402 C CG   . GLN A 1 6   ? 18.800  2.075   5.434   1.00 0.00 ? 6   GLN A CG   6  
ATOM   10403 C CD   . GLN A 1 6   ? 20.283  1.732   5.400   1.00 0.00 ? 6   GLN A CD   6  
ATOM   10404 O OE1  . GLN A 1 6   ? 21.051  2.331   4.642   1.00 0.00 ? 6   GLN A OE1  6  
ATOM   10405 N NE2  . GLN A 1 6   ? 20.685  0.710   6.150   1.00 0.00 ? 6   GLN A NE2  6  
ATOM   10406 H H    . GLN A 1 6   ? 20.432  1.863   2.948   1.00 0.00 ? 6   GLN A H    6  
ATOM   10407 H HA   . GLN A 1 6   ? 18.169  0.277   3.458   1.00 0.00 ? 6   GLN A HA   6  
ATOM   10408 H HB2  . GLN A 1 6   ? 18.599  3.262   3.682   1.00 0.00 ? 6   GLN A HB2  6  
ATOM   10409 H HB3  . GLN A 1 6   ? 17.122  2.457   4.193   1.00 0.00 ? 6   GLN A HB3  6  
ATOM   10410 H HG2  . GLN A 1 6   ? 18.682  2.984   6.024   1.00 0.00 ? 6   GLN A HG2  6  
ATOM   10411 H HG3  . GLN A 1 6   ? 18.259  1.266   5.905   1.00 0.00 ? 6   GLN A HG3  6  
ATOM   10412 H HE21 . GLN A 1 6   ? 20.018  0.218   6.686   1.00 0.00 ? 6   GLN A HE21 6  
ATOM   10413 H HE22 . GLN A 1 6   ? 21.639  0.487   6.149   1.00 0.00 ? 6   GLN A HE22 6  
ATOM   10414 N N    . LEU A 1 7   ? 17.784  2.499   1.025   1.00 0.00 ? 7   LEU A N    6  
ATOM   10415 C CA   . LEU A 1 7   ? 16.911  2.867   -0.088  1.00 0.00 ? 7   LEU A CA   6  
ATOM   10416 C C    . LEU A 1 7   ? 17.013  1.871   -1.246  1.00 0.00 ? 7   LEU A C    6  
ATOM   10417 O O    . LEU A 1 7   ? 16.090  1.735   -2.045  1.00 0.00 ? 7   LEU A O    6  
ATOM   10418 C CB   . LEU A 1 7   ? 17.200  4.292   -0.573  1.00 0.00 ? 7   LEU A CB   6  
ATOM   10419 C CG   . LEU A 1 7   ? 16.861  5.389   0.430   1.00 0.00 ? 7   LEU A CG   6  
ATOM   10420 C CD1  . LEU A 1 7   ? 17.305  6.743   -0.096  1.00 0.00 ? 7   LEU A CD1  6  
ATOM   10421 C CD2  . LEU A 1 7   ? 15.372  5.402   0.732   1.00 0.00 ? 7   LEU A CD2  6  
ATOM   10422 H H    . LEU A 1 7   ? 18.595  3.024   1.196   1.00 0.00 ? 7   LEU A H    6  
ATOM   10423 H HA   . LEU A 1 7   ? 15.901  2.839   0.290   1.00 0.00 ? 7   LEU A HA   6  
ATOM   10424 H HB2  . LEU A 1 7   ? 18.248  4.364   -0.822  1.00 0.00 ? 7   LEU A HB2  6  
ATOM   10425 H HB3  . LEU A 1 7   ? 16.622  4.474   -1.468  1.00 0.00 ? 7   LEU A HB3  6  
ATOM   10426 H HG   . LEU A 1 7   ? 17.384  5.195   1.350   1.00 0.00 ? 7   LEU A HG   6  
ATOM   10427 H HD11 . LEU A 1 7   ? 18.371  6.735   -0.249  1.00 0.00 ? 7   LEU A HD11 6  
ATOM   10428 H HD12 . LEU A 1 7   ? 17.049  7.509   0.622   1.00 0.00 ? 7   LEU A HD12 6  
ATOM   10429 H HD13 . LEU A 1 7   ? 16.807  6.946   -1.032  1.00 0.00 ? 7   LEU A HD13 6  
ATOM   10430 H HD21 . LEU A 1 7   ? 15.134  4.605   1.424   1.00 0.00 ? 7   LEU A HD21 6  
ATOM   10431 H HD22 . LEU A 1 7   ? 14.818  5.260   -0.185  1.00 0.00 ? 7   LEU A HD22 6  
ATOM   10432 H HD23 . LEU A 1 7   ? 15.103  6.351   1.170   1.00 0.00 ? 7   LEU A HD23 6  
ATOM   10433 N N    . LYS A 1 8   ? 18.127  1.166   -1.338  1.00 0.00 ? 8   LYS A N    6  
ATOM   10434 C CA   . LYS A 1 8   ? 18.246  0.093   -2.311  1.00 0.00 ? 8   LYS A CA   6  
ATOM   10435 C C    . LYS A 1 8   ? 17.427  -1.099  -1.848  1.00 0.00 ? 8   LYS A C    6  
ATOM   10436 O O    . LYS A 1 8   ? 16.800  -1.793  -2.652  1.00 0.00 ? 8   LYS A O    6  
ATOM   10437 C CB   . LYS A 1 8   ? 19.712  -0.304  -2.510  1.00 0.00 ? 8   LYS A CB   6  
ATOM   10438 C CG   . LYS A 1 8   ? 19.917  -1.483  -3.452  1.00 0.00 ? 8   LYS A CG   6  
ATOM   10439 C CD   . LYS A 1 8   ? 19.410  -1.197  -4.860  1.00 0.00 ? 8   LYS A CD   6  
ATOM   10440 C CE   . LYS A 1 8   ? 20.127  -0.012  -5.487  1.00 0.00 ? 8   LYS A CE   6  
ATOM   10441 N NZ   . LYS A 1 8   ? 19.826  0.117   -6.940  1.00 0.00 ? 8   LYS A NZ   6  
ATOM   10442 H H    . LYS A 1 8   ? 18.887  1.377   -0.750  1.00 0.00 ? 8   LYS A H    6  
ATOM   10443 H HA   . LYS A 1 8   ? 17.842  0.444   -3.245  1.00 0.00 ? 8   LYS A HA   6  
ATOM   10444 H HB2  . LYS A 1 8   ? 20.251  0.544   -2.906  1.00 0.00 ? 8   LYS A HB2  6  
ATOM   10445 H HB3  . LYS A 1 8   ? 20.127  -0.565  -1.552  1.00 0.00 ? 8   LYS A HB3  6  
ATOM   10446 H HG2  . LYS A 1 8   ? 20.972  -1.710  -3.503  1.00 0.00 ? 8   LYS A HG2  6  
ATOM   10447 H HG3  . LYS A 1 8   ? 19.384  -2.335  -3.058  1.00 0.00 ? 8   LYS A HG3  6  
ATOM   10448 H HD2  . LYS A 1 8   ? 19.575  -2.069  -5.474  1.00 0.00 ? 8   LYS A HD2  6  
ATOM   10449 H HD3  . LYS A 1 8   ? 18.350  -0.984  -4.812  1.00 0.00 ? 8   LYS A HD3  6  
ATOM   10450 H HE2  . LYS A 1 8   ? 19.808  0.889   -4.979  1.00 0.00 ? 8   LYS A HE2  6  
ATOM   10451 H HE3  . LYS A 1 8   ? 21.191  -0.140  -5.357  1.00 0.00 ? 8   LYS A HE3  6  
ATOM   10452 H HZ1  . LYS A 1 8   ? 20.120  -0.746  -7.445  1.00 0.00 ? 8   LYS A HZ1  6  
ATOM   10453 H HZ2  . LYS A 1 8   ? 20.337  0.925   -7.343  1.00 0.00 ? 8   LYS A HZ2  6  
ATOM   10454 H HZ3  . LYS A 1 8   ? 18.806  0.257   -7.087  1.00 0.00 ? 8   LYS A HZ3  6  
ATOM   10455 N N    . HIS A 1 9   ? 17.414  -1.313  -0.542  1.00 0.00 ? 9   HIS A N    6  
ATOM   10456 C CA   . HIS A 1 9   ? 16.639  -2.389  0.036   1.00 0.00 ? 9   HIS A CA   6  
ATOM   10457 C C    . HIS A 1 9   ? 15.154  -2.071  -0.077  1.00 0.00 ? 9   HIS A C    6  
ATOM   10458 O O    . HIS A 1 9   ? 14.342  -2.955  -0.345  1.00 0.00 ? 9   HIS A O    6  
ATOM   10459 C CB   . HIS A 1 9   ? 17.024  -2.615  1.499   1.00 0.00 ? 9   HIS A CB   6  
ATOM   10460 C CG   . HIS A 1 9   ? 17.060  -4.060  1.876   1.00 0.00 ? 9   HIS A CG   6  
ATOM   10461 N ND1  . HIS A 1 9   ? 18.224  -4.720  2.194   1.00 0.00 ? 9   HIS A ND1  6  
ATOM   10462 C CD2  . HIS A 1 9   ? 16.072  -4.975  1.972   1.00 0.00 ? 9   HIS A CD2  6  
ATOM   10463 C CE1  . HIS A 1 9   ? 17.954  -5.979  2.465   1.00 0.00 ? 9   HIS A CE1  6  
ATOM   10464 N NE2  . HIS A 1 9   ? 16.655  -6.161  2.341   1.00 0.00 ? 9   HIS A NE2  6  
ATOM   10465 H H    . HIS A 1 9   ? 17.947  -0.734  0.046   1.00 0.00 ? 9   HIS A H    6  
ATOM   10466 H HA   . HIS A 1 9   ? 16.847  -3.286  -0.528  1.00 0.00 ? 9   HIS A HA   6  
ATOM   10467 H HB2  . HIS A 1 9   ? 18.004  -2.200  1.681   1.00 0.00 ? 9   HIS A HB2  6  
ATOM   10468 H HB3  . HIS A 1 9   ? 16.304  -2.123  2.135   1.00 0.00 ? 9   HIS A HB3  6  
ATOM   10469 H HD1  . HIS A 1 9   ? 19.123  -4.321  2.219   1.00 0.00 ? 9   HIS A HD1  6  
ATOM   10470 H HD2  . HIS A 1 9   ? 15.019  -4.804  1.782   1.00 0.00 ? 9   HIS A HD2  6  
ATOM   10471 H HE1  . HIS A 1 9   ? 18.674  -6.736  2.732   1.00 0.00 ? 9   HIS A HE1  6  
ATOM   10472 H HE2  . HIS A 1 9   ? 16.219  -7.042  2.297   1.00 0.00 ? 9   HIS A HE2  6  
ATOM   10473 N N    . CYS A 1 10  ? 14.806  -0.798  0.110   1.00 0.00 ? 10  CYS A N    6  
ATOM   10474 C CA   . CYS A 1 10  ? 13.418  -0.376  0.001   1.00 0.00 ? 10  CYS A CA   6  
ATOM   10475 C C    . CYS A 1 10  ? 12.948  -0.483  -1.444  1.00 0.00 ? 10  CYS A C    6  
ATOM   10476 O O    . CYS A 1 10  ? 11.778  -0.765  -1.708  1.00 0.00 ? 10  CYS A O    6  
ATOM   10477 C CB   . CYS A 1 10  ? 13.221  1.054   0.533   1.00 0.00 ? 10  CYS A CB   6  
ATOM   10478 S SG   . CYS A 1 10  ? 13.790  2.380   -0.549  1.00 0.00 ? 10  CYS A SG   6  
ATOM   10479 H H    . CYS A 1 10  ? 15.496  -0.135  0.340   1.00 0.00 ? 10  CYS A H    6  
ATOM   10480 H HA   . CYS A 1 10  ? 12.830  -1.053  0.600   1.00 0.00 ? 10  CYS A HA   6  
ATOM   10481 H HB2  . CYS A 1 10  ? 12.164  1.217   0.705   1.00 0.00 ? 10  CYS A HB2  6  
ATOM   10482 H HB3  . CYS A 1 10  ? 13.753  1.155   1.470   1.00 0.00 ? 10  CYS A HB3  6  
ATOM   10483 H HG   . CYS A 1 10  ? 14.539  1.844   -1.506  1.00 0.00 ? 10  CYS A HG   6  
ATOM   10484 N N    . ASN A 1 11  ? 13.875  -0.286  -2.380  1.00 0.00 ? 11  ASN A N    6  
ATOM   10485 C CA   . ASN A 1 11  ? 13.560  -0.387  -3.798  1.00 0.00 ? 11  ASN A CA   6  
ATOM   10486 C C    . ASN A 1 11  ? 13.247  -1.833  -4.161  1.00 0.00 ? 11  ASN A C    6  
ATOM   10487 O O    . ASN A 1 11  ? 12.347  -2.109  -4.956  1.00 0.00 ? 11  ASN A O    6  
ATOM   10488 C CB   . ASN A 1 11  ? 14.732  0.119   -4.644  1.00 0.00 ? 11  ASN A CB   6  
ATOM   10489 C CG   . ASN A 1 11  ? 14.368  0.275   -6.109  1.00 0.00 ? 11  ASN A CG   6  
ATOM   10490 O OD1  . ASN A 1 11  ? 14.480  -0.666  -6.897  1.00 0.00 ? 11  ASN A OD1  6  
ATOM   10491 N ND2  . ASN A 1 11  ? 13.931  1.465   -6.486  1.00 0.00 ? 11  ASN A ND2  6  
ATOM   10492 H H    . ASN A 1 11  ? 14.794  -0.067  -2.110  1.00 0.00 ? 11  ASN A H    6  
ATOM   10493 H HA   . ASN A 1 11  ? 12.691  0.225   -3.992  1.00 0.00 ? 11  ASN A HA   6  
ATOM   10494 H HB2  . ASN A 1 11  ? 15.056  1.081   -4.269  1.00 0.00 ? 11  ASN A HB2  6  
ATOM   10495 H HB3  . ASN A 1 11  ? 15.551  -0.582  -4.569  1.00 0.00 ? 11  ASN A HB3  6  
ATOM   10496 H HD21 . ASN A 1 11  ? 13.863  2.172   -5.804  1.00 0.00 ? 11  ASN A HD21 6  
ATOM   10497 H HD22 . ASN A 1 11  ? 13.706  1.599   -7.430  1.00 0.00 ? 11  ASN A HD22 6  
ATOM   10498 N N    . GLY A 1 12  ? 13.986  -2.751  -3.547  1.00 0.00 ? 12  GLY A N    6  
ATOM   10499 C CA   . GLY A 1 12  ? 13.814  -4.166  -3.822  1.00 0.00 ? 12  GLY A CA   6  
ATOM   10500 C C    . GLY A 1 12  ? 12.546  -4.723  -3.206  1.00 0.00 ? 12  GLY A C    6  
ATOM   10501 O O    . GLY A 1 12  ? 11.843  -5.523  -3.827  1.00 0.00 ? 12  GLY A O    6  
ATOM   10502 H H    . GLY A 1 12  ? 14.659  -2.462  -2.892  1.00 0.00 ? 12  GLY A H    6  
ATOM   10503 H HA2  . GLY A 1 12  ? 13.775  -4.311  -4.893  1.00 0.00 ? 12  GLY A HA2  6  
ATOM   10504 H HA3  . GLY A 1 12  ? 14.661  -4.706  -3.425  1.00 0.00 ? 12  GLY A HA3  6  
ATOM   10505 N N    . ILE A 1 13  ? 12.256  -4.301  -1.981  1.00 0.00 ? 13  ILE A N    6  
ATOM   10506 C CA   . ILE A 1 13  ? 11.044  -4.726  -1.288  1.00 0.00 ? 13  ILE A CA   6  
ATOM   10507 C C    . ILE A 1 13  ? 9.806   -4.267  -2.057  1.00 0.00 ? 13  ILE A C    6  
ATOM   10508 O O    . ILE A 1 13  ? 8.896   -5.055  -2.322  1.00 0.00 ? 13  ILE A O    6  
ATOM   10509 C CB   . ILE A 1 13  ? 10.995  -4.161  0.149   1.00 0.00 ? 13  ILE A CB   6  
ATOM   10510 C CG1  . ILE A 1 13  ? 12.176  -4.687  0.975   1.00 0.00 ? 13  ILE A CG1  6  
ATOM   10511 C CG2  . ILE A 1 13  ? 9.681   -4.527  0.830   1.00 0.00 ? 13  ILE A CG2  6  
ATOM   10512 C CD1  . ILE A 1 13  ? 12.272  -4.083  2.355   1.00 0.00 ? 13  ILE A CD1  6  
ATOM   10513 H H    . ILE A 1 13  ? 12.876  -3.687  -1.528  1.00 0.00 ? 13  ILE A H    6  
ATOM   10514 H HA   . ILE A 1 13  ? 11.047  -5.804  -1.233  1.00 0.00 ? 13  ILE A HA   6  
ATOM   10515 H HB   . ILE A 1 13  ? 11.057  -3.087  0.086   1.00 0.00 ? 13  ILE A HB   6  
ATOM   10516 H HG12 . ILE A 1 13  ? 12.062  -5.749  1.102   1.00 0.00 ? 13  ILE A HG12 6  
ATOM   10517 H HG13 . ILE A 1 13  ? 13.102  -4.490  0.453   1.00 0.00 ? 13  ILE A HG13 6  
ATOM   10518 H HG21 . ILE A 1 13  ? 8.941   -4.760  0.082   1.00 0.00 ? 13  ILE A HG21 6  
ATOM   10519 H HG22 . ILE A 1 13  ? 9.341   -3.692  1.425   1.00 0.00 ? 13  ILE A HG22 6  
ATOM   10520 H HG23 . ILE A 1 13  ? 9.831   -5.385  1.467   1.00 0.00 ? 13  ILE A HG23 6  
ATOM   10521 H HD11 . ILE A 1 13  ? 11.465  -4.464  2.960   1.00 0.00 ? 13  ILE A HD11 6  
ATOM   10522 H HD12 . ILE A 1 13  ? 12.193  -3.007  2.284   1.00 0.00 ? 13  ILE A HD12 6  
ATOM   10523 H HD13 . ILE A 1 13  ? 13.216  -4.348  2.803   1.00 0.00 ? 13  ILE A HD13 6  
ATOM   10524 N N    . LEU A 1 14  ? 9.794   -2.985  -2.420  1.00 0.00 ? 14  LEU A N    6  
ATOM   10525 C CA   . LEU A 1 14  ? 8.712   -2.406  -3.200  1.00 0.00 ? 14  LEU A CA   6  
ATOM   10526 C C    . LEU A 1 14  ? 8.521   -3.170  -4.504  1.00 0.00 ? 14  LEU A C    6  
ATOM   10527 O O    . LEU A 1 14  ? 7.401   -3.493  -4.894  1.00 0.00 ? 14  LEU A O    6  
ATOM   10528 C CB   . LEU A 1 14  ? 9.035   -0.946  -3.507  1.00 0.00 ? 14  LEU A CB   6  
ATOM   10529 C CG   . LEU A 1 14  ? 7.843   -0.008  -3.516  1.00 0.00 ? 14  LEU A CG   6  
ATOM   10530 C CD1  . LEU A 1 14  ? 8.335   1.421   -3.493  1.00 0.00 ? 14  LEU A CD1  6  
ATOM   10531 C CD2  . LEU A 1 14  ? 6.966   -0.239  -4.735  1.00 0.00 ? 14  LEU A CD2  6  
ATOM   10532 H H    . LEU A 1 14  ? 10.530  -2.403  -2.139  1.00 0.00 ? 14  LEU A H    6  
ATOM   10533 H HA   . LEU A 1 14  ? 7.805   -2.458  -2.618  1.00 0.00 ? 14  LEU A HA   6  
ATOM   10534 H HB2  . LEU A 1 14  ? 9.741   -0.583  -2.776  1.00 0.00 ? 14  LEU A HB2  6  
ATOM   10535 H HB3  . LEU A 1 14  ? 9.501   -0.903  -4.480  1.00 0.00 ? 14  LEU A HB3  6  
ATOM   10536 H HG   . LEU A 1 14  ? 7.255   -0.183  -2.626  1.00 0.00 ? 14  LEU A HG   6  
ATOM   10537 H HD11 . LEU A 1 14  ? 9.145   1.531   -4.203  1.00 0.00 ? 14  LEU A HD11 6  
ATOM   10538 H HD12 . LEU A 1 14  ? 8.689   1.668   -2.503  1.00 0.00 ? 14  LEU A HD12 6  
ATOM   10539 H HD13 . LEU A 1 14  ? 7.528   2.086   -3.765  1.00 0.00 ? 14  LEU A HD13 6  
ATOM   10540 H HD21 . LEU A 1 14  ? 6.753   -1.299  -4.849  1.00 0.00 ? 14  LEU A HD21 6  
ATOM   10541 H HD22 . LEU A 1 14  ? 7.478   0.119   -5.615  1.00 0.00 ? 14  LEU A HD22 6  
ATOM   10542 H HD23 . LEU A 1 14  ? 6.041   0.302   -4.615  1.00 0.00 ? 14  LEU A HD23 6  
ATOM   10543 N N    . LYS A 1 15  ? 9.636   -3.466  -5.158  1.00 0.00 ? 15  LYS A N    6  
ATOM   10544 C CA   . LYS A 1 15  ? 9.644   -4.167  -6.418  1.00 0.00 ? 15  LYS A CA   6  
ATOM   10545 C C    . LYS A 1 15  ? 8.947   -5.518  -6.303  1.00 0.00 ? 15  LYS A C    6  
ATOM   10546 O O    . LYS A 1 15  ? 8.234   -5.944  -7.211  1.00 0.00 ? 15  LYS A O    6  
ATOM   10547 C CB   . LYS A 1 15  ? 11.095  -4.346  -6.855  1.00 0.00 ? 15  LYS A CB   6  
ATOM   10548 C CG   . LYS A 1 15  ? 11.319  -5.577  -7.691  1.00 0.00 ? 15  LYS A CG   6  
ATOM   10549 C CD   . LYS A 1 15  ? 10.872  -5.383  -9.125  1.00 0.00 ? 15  LYS A CD   6  
ATOM   10550 C CE   . LYS A 1 15  ? 11.374  -6.515  -9.993  1.00 0.00 ? 15  LYS A CE   6  
ATOM   10551 N NZ   . LYS A 1 15  ? 10.701  -6.538  -11.318 1.00 0.00 ? 15  LYS A NZ   6  
ATOM   10552 H H    . LYS A 1 15  ? 10.494  -3.217  -4.772  1.00 0.00 ? 15  LYS A H    6  
ATOM   10553 H HA   . LYS A 1 15  ? 9.129   -3.566  -7.143  1.00 0.00 ? 15  LYS A HA   6  
ATOM   10554 H HB2  . LYS A 1 15  ? 11.396  -3.484  -7.430  1.00 0.00 ? 15  LYS A HB2  6  
ATOM   10555 H HB3  . LYS A 1 15  ? 11.718  -4.416  -5.974  1.00 0.00 ? 15  LYS A HB3  6  
ATOM   10556 H HG2  . LYS A 1 15  ? 12.356  -5.843  -7.676  1.00 0.00 ? 15  LYS A HG2  6  
ATOM   10557 H HG3  . LYS A 1 15  ? 10.741  -6.369  -7.250  1.00 0.00 ? 15  LYS A HG3  6  
ATOM   10558 H HD2  . LYS A 1 15  ? 9.793   -5.363  -9.159  1.00 0.00 ? 15  LYS A HD2  6  
ATOM   10559 H HD3  . LYS A 1 15  ? 11.267  -4.451  -9.496  1.00 0.00 ? 15  LYS A HD3  6  
ATOM   10560 H HE2  . LYS A 1 15  ? 12.437  -6.389  -10.143 1.00 0.00 ? 15  LYS A HE2  6  
ATOM   10561 H HE3  . LYS A 1 15  ? 11.193  -7.443  -9.478  1.00 0.00 ? 15  LYS A HE3  6  
ATOM   10562 H HZ1  . LYS A 1 15  ? 9.670   -6.598  -11.195 1.00 0.00 ? 15  LYS A HZ1  6  
ATOM   10563 H HZ2  . LYS A 1 15  ? 11.020  -7.358  -11.869 1.00 0.00 ? 15  LYS A HZ2  6  
ATOM   10564 H HZ3  . LYS A 1 15  ? 10.924  -5.671  -11.848 1.00 0.00 ? 15  LYS A HZ3  6  
ATOM   10565 N N    . GLU A 1 16  ? 9.150   -6.177  -5.181  1.00 0.00 ? 16  GLU A N    6  
ATOM   10566 C CA   . GLU A 1 16  ? 8.597   -7.513  -4.985  1.00 0.00 ? 16  GLU A CA   6  
ATOM   10567 C C    . GLU A 1 16  ? 7.086   -7.443  -4.793  1.00 0.00 ? 16  GLU A C    6  
ATOM   10568 O O    . GLU A 1 16  ? 6.345   -8.251  -5.351  1.00 0.00 ? 16  GLU A O    6  
ATOM   10569 C CB   . GLU A 1 16  ? 9.250   -8.241  -3.794  1.00 0.00 ? 16  GLU A CB   6  
ATOM   10570 C CG   . GLU A 1 16  ? 8.698   -9.650  -3.550  1.00 0.00 ? 16  GLU A CG   6  
ATOM   10571 C CD   . GLU A 1 16  ? 9.073   -10.223 -2.206  1.00 0.00 ? 16  GLU A CD   6  
ATOM   10572 O OE1  . GLU A 1 16  ? 10.266  -10.203 -1.860  1.00 0.00 ? 16  GLU A OE1  6  
ATOM   10573 O OE2  . GLU A 1 16  ? 8.181   -10.756 -1.519  1.00 0.00 ? 16  GLU A OE2  6  
ATOM   10574 H H    . GLU A 1 16  ? 9.680   -5.754  -4.475  1.00 0.00 ? 16  GLU A H    6  
ATOM   10575 H HA   . GLU A 1 16  ? 8.794   -8.056  -5.893  1.00 0.00 ? 16  GLU A HA   6  
ATOM   10576 H HB2  . GLU A 1 16  ? 10.313  -8.323  -3.977  1.00 0.00 ? 16  GLU A HB2  6  
ATOM   10577 H HB3  . GLU A 1 16  ? 9.090   -7.657  -2.899  1.00 0.00 ? 16  GLU A HB3  6  
ATOM   10578 H HG2  . GLU A 1 16  ? 7.625   -9.616  -3.619  1.00 0.00 ? 16  GLU A HG2  6  
ATOM   10579 H HG3  . GLU A 1 16  ? 9.077   -10.320 -4.301  1.00 0.00 ? 16  GLU A HG3  6  
ATOM   10580 N N    . LEU A 1 17  ? 6.636   -6.469  -4.016  1.00 0.00 ? 17  LEU A N    6  
ATOM   10581 C CA   . LEU A 1 17  ? 5.202   -6.244  -3.820  1.00 0.00 ? 17  LEU A CA   6  
ATOM   10582 C C    . LEU A 1 17  ? 4.548   -5.864  -5.150  1.00 0.00 ? 17  LEU A C    6  
ATOM   10583 O O    . LEU A 1 17  ? 3.348   -6.036  -5.340  1.00 0.00 ? 17  LEU A O    6  
ATOM   10584 C CB   . LEU A 1 17  ? 4.975   -5.139  -2.779  1.00 0.00 ? 17  LEU A CB   6  
ATOM   10585 C CG   . LEU A 1 17  ? 5.573   -5.396  -1.390  1.00 0.00 ? 17  LEU A CG   6  
ATOM   10586 C CD1  . LEU A 1 17  ? 5.666   -4.090  -0.620  1.00 0.00 ? 17  LEU A CD1  6  
ATOM   10587 C CD2  . LEU A 1 17  ? 4.728   -6.395  -0.606  1.00 0.00 ? 17  LEU A CD2  6  
ATOM   10588 H H    . LEU A 1 17  ? 7.282   -5.882  -3.561  1.00 0.00 ? 17  LEU A H    6  
ATOM   10589 H HA   . LEU A 1 17  ? 4.760   -7.165  -3.466  1.00 0.00 ? 17  LEU A HA   6  
ATOM   10590 H HB2  . LEU A 1 17  ? 5.398   -4.222  -3.160  1.00 0.00 ? 17  LEU A HB2  6  
ATOM   10591 H HB3  . LEU A 1 17  ? 3.912   -4.998  -2.662  1.00 0.00 ? 17  LEU A HB3  6  
ATOM   10592 H HG   . LEU A 1 17  ? 6.569   -5.799  -1.495  1.00 0.00 ? 17  LEU A HG   6  
ATOM   10593 H HD11 . LEU A 1 17  ? 6.152   -3.348  -1.234  1.00 0.00 ? 17  LEU A HD11 6  
ATOM   10594 H HD12 . LEU A 1 17  ? 6.240   -4.243  0.282   1.00 0.00 ? 17  LEU A HD12 6  
ATOM   10595 H HD13 . LEU A 1 17  ? 4.674   -3.750  -0.362  1.00 0.00 ? 17  LEU A HD13 6  
ATOM   10596 H HD21 . LEU A 1 17  ? 4.631   -7.313  -1.162  1.00 0.00 ? 17  LEU A HD21 6  
ATOM   10597 H HD22 . LEU A 1 17  ? 3.749   -5.977  -0.430  1.00 0.00 ? 17  LEU A HD22 6  
ATOM   10598 H HD23 . LEU A 1 17  ? 5.205   -6.600  0.342   1.00 0.00 ? 17  LEU A HD23 6  
ATOM   10599 N N    . LEU A 1 18  ? 5.364   -5.361  -6.070  1.00 0.00 ? 18  LEU A N    6  
ATOM   10600 C CA   . LEU A 1 18  ? 4.897   -4.974  -7.396  1.00 0.00 ? 18  LEU A CA   6  
ATOM   10601 C C    . LEU A 1 18  ? 5.038   -6.114  -8.403  1.00 0.00 ? 18  LEU A C    6  
ATOM   10602 O O    . LEU A 1 18  ? 4.475   -6.061  -9.501  1.00 0.00 ? 18  LEU A O    6  
ATOM   10603 C CB   . LEU A 1 18  ? 5.689   -3.774  -7.889  1.00 0.00 ? 18  LEU A CB   6  
ATOM   10604 C CG   . LEU A 1 18  ? 5.410   -2.473  -7.152  1.00 0.00 ? 18  LEU A CG   6  
ATOM   10605 C CD1  . LEU A 1 18  ? 6.304   -1.382  -7.694  1.00 0.00 ? 18  LEU A CD1  6  
ATOM   10606 C CD2  . LEU A 1 18  ? 3.951   -2.076  -7.274  1.00 0.00 ? 18  LEU A CD2  6  
ATOM   10607 H H    . LEU A 1 18  ? 6.309   -5.234  -5.845  1.00 0.00 ? 18  LEU A H    6  
ATOM   10608 H HA   . LEU A 1 18  ? 3.856   -4.695  -7.314  1.00 0.00 ? 18  LEU A HA   6  
ATOM   10609 H HB2  . LEU A 1 18  ? 6.739   -4.001  -7.789  1.00 0.00 ? 18  LEU A HB2  6  
ATOM   10610 H HB3  . LEU A 1 18  ? 5.470   -3.627  -8.930  1.00 0.00 ? 18  LEU A HB3  6  
ATOM   10611 H HG   . LEU A 1 18  ? 5.639   -2.604  -6.105  1.00 0.00 ? 18  LEU A HG   6  
ATOM   10612 H HD11 . LEU A 1 18  ? 7.318   -1.562  -7.366  1.00 0.00 ? 18  LEU A HD11 6  
ATOM   10613 H HD12 . LEU A 1 18  ? 5.968   -0.424  -7.325  1.00 0.00 ? 18  LEU A HD12 6  
ATOM   10614 H HD13 . LEU A 1 18  ? 6.268   -1.387  -8.773  1.00 0.00 ? 18  LEU A HD13 6  
ATOM   10615 H HD21 . LEU A 1 18  ? 3.701   -1.410  -6.468  1.00 0.00 ? 18  LEU A HD21 6  
ATOM   10616 H HD22 . LEU A 1 18  ? 3.326   -2.953  -7.221  1.00 0.00 ? 18  LEU A HD22 6  
ATOM   10617 H HD23 . LEU A 1 18  ? 3.790   -1.574  -8.218  1.00 0.00 ? 18  LEU A HD23 6  
ATOM   10618 N N    . SER A 1 19  ? 5.808   -7.124  -8.040  1.00 0.00 ? 19  SER A N    6  
ATOM   10619 C CA   . SER A 1 19  ? 6.040   -8.265  -8.915  1.00 0.00 ? 19  SER A CA   6  
ATOM   10620 C C    . SER A 1 19  ? 4.765   -9.086  -9.092  1.00 0.00 ? 19  SER A C    6  
ATOM   10621 O O    . SER A 1 19  ? 3.938   -9.188  -8.183  1.00 0.00 ? 19  SER A O    6  
ATOM   10622 C CB   . SER A 1 19  ? 7.159   -9.138  -8.353  1.00 0.00 ? 19  SER A CB   6  
ATOM   10623 O OG   . SER A 1 19  ? 8.395   -8.438  -8.355  1.00 0.00 ? 19  SER A OG   6  
ATOM   10624 H H    . SER A 1 19  ? 6.233   -7.102  -7.159  1.00 0.00 ? 19  SER A H    6  
ATOM   10625 H HA   . SER A 1 19  ? 6.342   -7.884  -9.878  1.00 0.00 ? 19  SER A HA   6  
ATOM   10626 H HB2  . SER A 1 19  ? 6.919   -9.420  -7.338  1.00 0.00 ? 19  SER A HB2  6  
ATOM   10627 H HB3  . SER A 1 19  ? 7.259   -10.027 -8.962  1.00 0.00 ? 19  SER A HB3  6  
ATOM   10628 H HG   . SER A 1 19  ? 8.248   -7.525  -8.063  1.00 0.00 ? 19  SER A HG   6  
ATOM   10629 N N    . LYS A 1 20  ? 4.638   -9.686  -10.275 1.00 0.00 ? 20  LYS A N    6  
ATOM   10630 C CA   . LYS A 1 20  ? 3.420   -10.380 -10.681 1.00 0.00 ? 20  LYS A CA   6  
ATOM   10631 C C    . LYS A 1 20  ? 3.100   -11.561 -9.772  1.00 0.00 ? 20  LYS A C    6  
ATOM   10632 O O    . LYS A 1 20  ? 1.975   -12.058 -9.766  1.00 0.00 ? 20  LYS A O    6  
ATOM   10633 C CB   . LYS A 1 20  ? 3.537   -10.834 -12.130 1.00 0.00 ? 20  LYS A CB   6  
ATOM   10634 C CG   . LYS A 1 20  ? 3.598   -9.667  -13.095 1.00 0.00 ? 20  LYS A CG   6  
ATOM   10635 C CD   . LYS A 1 20  ? 2.245   -8.985  -13.249 1.00 0.00 ? 20  LYS A CD   6  
ATOM   10636 C CE   . LYS A 1 20  ? 2.323   -7.804  -14.204 1.00 0.00 ? 20  LYS A CE   6  
ATOM   10637 N NZ   . LYS A 1 20  ? 0.999   -7.160  -14.405 1.00 0.00 ? 20  LYS A NZ   6  
ATOM   10638 H H    . LYS A 1 20  ? 5.395   -9.662  -10.899 1.00 0.00 ? 20  LYS A H    6  
ATOM   10639 H HA   . LYS A 1 20  ? 2.617   -9.667  -10.619 1.00 0.00 ? 20  LYS A HA   6  
ATOM   10640 H HB2  . LYS A 1 20  ? 4.436   -11.427 -12.246 1.00 0.00 ? 20  LYS A HB2  6  
ATOM   10641 H HB3  . LYS A 1 20  ? 2.678   -11.439 -12.379 1.00 0.00 ? 20  LYS A HB3  6  
ATOM   10642 H HG2  . LYS A 1 20  ? 4.298   -8.946  -12.705 1.00 0.00 ? 20  LYS A HG2  6  
ATOM   10643 H HG3  . LYS A 1 20  ? 3.933   -10.019 -14.061 1.00 0.00 ? 20  LYS A HG3  6  
ATOM   10644 H HD2  . LYS A 1 20  ? 1.535   -9.701  -13.635 1.00 0.00 ? 20  LYS A HD2  6  
ATOM   10645 H HD3  . LYS A 1 20  ? 1.917   -8.634  -12.281 1.00 0.00 ? 20  LYS A HD3  6  
ATOM   10646 H HE2  . LYS A 1 20  ? 3.008   -7.073  -13.801 1.00 0.00 ? 20  LYS A HE2  6  
ATOM   10647 H HE3  . LYS A 1 20  ? 2.691   -8.152  -15.158 1.00 0.00 ? 20  LYS A HE3  6  
ATOM   10648 H HZ1  . LYS A 1 20  ? 0.622   -6.819  -13.497 1.00 0.00 ? 20  LYS A HZ1  6  
ATOM   10649 H HZ2  . LYS A 1 20  ? 0.326   -7.840  -14.814 1.00 0.00 ? 20  LYS A HZ2  6  
ATOM   10650 H HZ3  . LYS A 1 20  ? 1.090   -6.352  -15.052 1.00 0.00 ? 20  LYS A HZ3  6  
ATOM   10651 N N    . LYS A 1 21  ? 4.090   -12.003 -9.007  1.00 0.00 ? 21  LYS A N    6  
ATOM   10652 C CA   . LYS A 1 21  ? 3.879   -13.031 -8.000  1.00 0.00 ? 21  LYS A CA   6  
ATOM   10653 C C    . LYS A 1 21  ? 2.848   -12.572 -6.975  1.00 0.00 ? 21  LYS A C    6  
ATOM   10654 O O    . LYS A 1 21  ? 2.002   -13.348 -6.534  1.00 0.00 ? 21  LYS A O    6  
ATOM   10655 C CB   . LYS A 1 21  ? 5.194   -13.365 -7.290  1.00 0.00 ? 21  LYS A CB   6  
ATOM   10656 C CG   . LYS A 1 21  ? 5.015   -14.247 -6.062  1.00 0.00 ? 21  LYS A CG   6  
ATOM   10657 C CD   . LYS A 1 21  ? 6.324   -14.502 -5.350  1.00 0.00 ? 21  LYS A CD   6  
ATOM   10658 C CE   . LYS A 1 21  ? 6.164   -15.635 -4.356  1.00 0.00 ? 21  LYS A CE   6  
ATOM   10659 N NZ   . LYS A 1 21  ? 7.304   -15.726 -3.404  1.00 0.00 ? 21  LYS A NZ   6  
ATOM   10660 H H    . LYS A 1 21  ? 4.988   -11.633 -9.132  1.00 0.00 ? 21  LYS A H    6  
ATOM   10661 H HA   . LYS A 1 21  ? 3.510   -13.915 -8.496  1.00 0.00 ? 21  LYS A HA   6  
ATOM   10662 H HB2  . LYS A 1 21  ? 5.843   -13.876 -7.981  1.00 0.00 ? 21  LYS A HB2  6  
ATOM   10663 H HB3  . LYS A 1 21  ? 5.666   -12.447 -6.982  1.00 0.00 ? 21  LYS A HB3  6  
ATOM   10664 H HG2  . LYS A 1 21  ? 4.343   -13.749 -5.378  1.00 0.00 ? 21  LYS A HG2  6  
ATOM   10665 H HG3  . LYS A 1 21  ? 4.589   -15.193 -6.353  1.00 0.00 ? 21  LYS A HG3  6  
ATOM   10666 H HD2  . LYS A 1 21  ? 7.076   -14.769 -6.077  1.00 0.00 ? 21  LYS A HD2  6  
ATOM   10667 H HD3  . LYS A 1 21  ? 6.621   -13.606 -4.823  1.00 0.00 ? 21  LYS A HD3  6  
ATOM   10668 H HE2  . LYS A 1 21  ? 5.250   -15.477 -3.810  1.00 0.00 ? 21  LYS A HE2  6  
ATOM   10669 H HE3  . LYS A 1 21  ? 6.093   -16.563 -4.905  1.00 0.00 ? 21  LYS A HE3  6  
ATOM   10670 H HZ1  . LYS A 1 21  ? 8.201   -15.823 -3.923  1.00 0.00 ? 21  LYS A HZ1  6  
ATOM   10671 H HZ2  . LYS A 1 21  ? 7.187   -16.551 -2.782  1.00 0.00 ? 21  LYS A HZ2  6  
ATOM   10672 H HZ3  . LYS A 1 21  ? 7.349   -14.872 -2.815  1.00 0.00 ? 21  LYS A HZ3  6  
ATOM   10673 N N    . HIS A 1 22  ? 2.902   -11.298 -6.618  1.00 0.00 ? 22  HIS A N    6  
ATOM   10674 C CA   . HIS A 1 22  ? 2.036   -10.777 -5.575  1.00 0.00 ? 22  HIS A CA   6  
ATOM   10675 C C    . HIS A 1 22  ? 0.895   -9.983  -6.182  1.00 0.00 ? 22  HIS A C    6  
ATOM   10676 O O    . HIS A 1 22  ? -0.108  -9.748  -5.522  1.00 0.00 ? 22  HIS A O    6  
ATOM   10677 C CB   . HIS A 1 22  ? 2.823   -9.903  -4.584  1.00 0.00 ? 22  HIS A CB   6  
ATOM   10678 C CG   . HIS A 1 22  ? 3.954   -10.636 -3.920  1.00 0.00 ? 22  HIS A CG   6  
ATOM   10679 N ND1  . HIS A 1 22  ? 3.821   -11.322 -2.728  1.00 0.00 ? 22  HIS A ND1  6  
ATOM   10680 C CD2  . HIS A 1 22  ? 5.242   -10.796 -4.300  1.00 0.00 ? 22  HIS A CD2  6  
ATOM   10681 C CE1  . HIS A 1 22  ? 4.980   -11.870 -2.403  1.00 0.00 ? 22  HIS A CE1  6  
ATOM   10682 N NE2  . HIS A 1 22  ? 5.863   -11.567 -3.341  1.00 0.00 ? 22  HIS A NE2  6  
ATOM   10683 H H    . HIS A 1 22  ? 3.517   -10.688 -7.087  1.00 0.00 ? 22  HIS A H    6  
ATOM   10684 H HA   . HIS A 1 22  ? 1.624   -11.626 -5.048  1.00 0.00 ? 22  HIS A HA   6  
ATOM   10685 H HB2  . HIS A 1 22  ? 3.234   -9.048  -5.114  1.00 0.00 ? 22  HIS A HB2  6  
ATOM   10686 H HB3  . HIS A 1 22  ? 2.153   -9.551  -3.805  1.00 0.00 ? 22  HIS A HB3  6  
ATOM   10687 H HD1  . HIS A 1 22  ? 3.000   -11.397 -2.193  1.00 0.00 ? 22  HIS A HD1  6  
ATOM   10688 H HD2  . HIS A 1 22  ? 5.693   -10.401 -5.207  1.00 0.00 ? 22  HIS A HD2  6  
ATOM   10689 H HE1  . HIS A 1 22  ? 5.169   -12.478 -1.522  1.00 0.00 ? 22  HIS A HE1  6  
ATOM   10690 H HE2  . HIS A 1 22  ? 6.840   -11.642 -3.226  1.00 0.00 ? 22  HIS A HE2  6  
ATOM   10691 N N    . ALA A 1 23  ? 1.054   -9.608  -7.451  1.00 0.00 ? 23  ALA A N    6  
ATOM   10692 C CA   . ALA A 1 23  ? 0.080   -8.783  -8.170  1.00 0.00 ? 23  ALA A CA   6  
ATOM   10693 C C    . ALA A 1 23  ? -1.347  -9.293  -8.014  1.00 0.00 ? 23  ALA A C    6  
ATOM   10694 O O    . ALA A 1 23  ? -2.291  -8.504  -7.953  1.00 0.00 ? 23  ALA A O    6  
ATOM   10695 C CB   . ALA A 1 23  ? 0.451   -8.726  -9.640  1.00 0.00 ? 23  ALA A CB   6  
ATOM   10696 H H    . ALA A 1 23  ? 1.869   -9.882  -7.922  1.00 0.00 ? 23  ALA A H    6  
ATOM   10697 H HA   . ALA A 1 23  ? 0.135   -7.780  -7.776  1.00 0.00 ? 23  ALA A HA   6  
ATOM   10698 H HB1  . ALA A 1 23  ? 1.482   -8.421  -9.730  1.00 0.00 ? 23  ALA A HB1  6  
ATOM   10699 H HB2  . ALA A 1 23  ? -0.183  -8.011  -10.144 1.00 0.00 ? 23  ALA A HB2  6  
ATOM   10700 H HB3  . ALA A 1 23  ? 0.321   -9.701  -10.084 1.00 0.00 ? 23  ALA A HB3  6  
ATOM   10701 N N    . ALA A 1 24  ? -1.487  -10.611 -7.930  1.00 0.00 ? 24  ALA A N    6  
ATOM   10702 C CA   . ALA A 1 24  ? -2.785  -11.258 -7.775  1.00 0.00 ? 24  ALA A CA   6  
ATOM   10703 C C    . ALA A 1 24  ? -3.526  -10.766 -6.526  1.00 0.00 ? 24  ALA A C    6  
ATOM   10704 O O    . ALA A 1 24  ? -4.750  -10.881 -6.433  1.00 0.00 ? 24  ALA A O    6  
ATOM   10705 C CB   . ALA A 1 24  ? -2.589  -12.763 -7.716  1.00 0.00 ? 24  ALA A CB   6  
ATOM   10706 H H    . ALA A 1 24  ? -0.685  -11.170 -7.979  1.00 0.00 ? 24  ALA A H    6  
ATOM   10707 H HA   . ALA A 1 24  ? -3.378  -11.031 -8.648  1.00 0.00 ? 24  ALA A HA   6  
ATOM   10708 H HB1  . ALA A 1 24  ? -1.822  -12.995 -6.991  1.00 0.00 ? 24  ALA A HB1  6  
ATOM   10709 H HB2  . ALA A 1 24  ? -2.290  -13.126 -8.687  1.00 0.00 ? 24  ALA A HB2  6  
ATOM   10710 H HB3  . ALA A 1 24  ? -3.515  -13.236 -7.424  1.00 0.00 ? 24  ALA A HB3  6  
ATOM   10711 N N    . TYR A 1 25  ? -2.783  -10.225 -5.570  1.00 0.00 ? 25  TYR A N    6  
ATOM   10712 C CA   . TYR A 1 25  ? -3.370  -9.679  -4.354  1.00 0.00 ? 25  TYR A CA   6  
ATOM   10713 C C    . TYR A 1 25  ? -2.643  -8.402  -3.924  1.00 0.00 ? 25  TYR A C    6  
ATOM   10714 O O    . TYR A 1 25  ? -2.740  -7.975  -2.775  1.00 0.00 ? 25  TYR A O    6  
ATOM   10715 C CB   . TYR A 1 25  ? -3.362  -10.734 -3.232  1.00 0.00 ? 25  TYR A CB   6  
ATOM   10716 C CG   . TYR A 1 25  ? -2.078  -11.530 -3.120  1.00 0.00 ? 25  TYR A CG   6  
ATOM   10717 C CD1  . TYR A 1 25  ? -0.936  -10.987 -2.547  1.00 0.00 ? 25  TYR A CD1  6  
ATOM   10718 C CD2  . TYR A 1 25  ? -2.019  -12.840 -3.580  1.00 0.00 ? 25  TYR A CD2  6  
ATOM   10719 C CE1  . TYR A 1 25  ? 0.227   -11.728 -2.444  1.00 0.00 ? 25  TYR A CE1  6  
ATOM   10720 C CE2  . TYR A 1 25  ? -0.861  -13.583 -3.480  1.00 0.00 ? 25  TYR A CE2  6  
ATOM   10721 C CZ   . TYR A 1 25  ? 0.260   -13.021 -2.912  1.00 0.00 ? 25  TYR A CZ   6  
ATOM   10722 O OH   . TYR A 1 25  ? 1.419   -13.756 -2.812  1.00 0.00 ? 25  TYR A OH   6  
ATOM   10723 H H    . TYR A 1 25  ? -1.805  -10.192 -5.683  1.00 0.00 ? 25  TYR A H    6  
ATOM   10724 H HA   . TYR A 1 25  ? -4.396  -9.424  -4.579  1.00 0.00 ? 25  TYR A HA   6  
ATOM   10725 H HB2  . TYR A 1 25  ? -3.527  -10.246 -2.283  1.00 0.00 ? 25  TYR A HB2  6  
ATOM   10726 H HB3  . TYR A 1 25  ? -4.162  -11.437 -3.414  1.00 0.00 ? 25  TYR A HB3  6  
ATOM   10727 H HD1  . TYR A 1 25  ? -0.963  -9.967  -2.185  1.00 0.00 ? 25  TYR A HD1  6  
ATOM   10728 H HD2  . TYR A 1 25  ? -2.898  -13.280 -4.019  1.00 0.00 ? 25  TYR A HD2  6  
ATOM   10729 H HE1  . TYR A 1 25  ? 1.103   -11.295 -1.994  1.00 0.00 ? 25  TYR A HE1  6  
ATOM   10730 H HE2  . TYR A 1 25  ? -0.836  -14.597 -3.848  1.00 0.00 ? 25  TYR A HE2  6  
ATOM   10731 H HH   . TYR A 1 25  ? 1.746   -13.720 -1.903  1.00 0.00 ? 25  TYR A HH   6  
ATOM   10732 N N    . ALA A 1 26  ? -1.923  -7.796  -4.867  1.00 0.00 ? 26  ALA A N    6  
ATOM   10733 C CA   . ALA A 1 26  ? -1.190  -6.559  -4.603  1.00 0.00 ? 26  ALA A CA   6  
ATOM   10734 C C    . ALA A 1 26  ? -1.726  -5.403  -5.449  1.00 0.00 ? 26  ALA A C    6  
ATOM   10735 O O    . ALA A 1 26  ? -1.436  -4.231  -5.178  1.00 0.00 ? 26  ALA A O    6  
ATOM   10736 C CB   . ALA A 1 26  ? 0.301   -6.749  -4.872  1.00 0.00 ? 26  ALA A CB   6  
ATOM   10737 H H    . ALA A 1 26  ? -1.871  -8.202  -5.756  1.00 0.00 ? 26  ALA A H    6  
ATOM   10738 H HA   . ALA A 1 26  ? -1.313  -6.315  -3.559  1.00 0.00 ? 26  ALA A HA   6  
ATOM   10739 H HB1  . ALA A 1 26  ? 0.691   -7.568  -4.277  1.00 0.00 ? 26  ALA A HB1  6  
ATOM   10740 H HB2  . ALA A 1 26  ? 0.829   -5.843  -4.617  1.00 0.00 ? 26  ALA A HB2  6  
ATOM   10741 H HB3  . ALA A 1 26  ? 0.450   -6.966  -5.919  1.00 0.00 ? 26  ALA A HB3  6  
ATOM   10742 N N    . TRP A 1 27  ? -2.526  -5.725  -6.467  1.00 0.00 ? 27  TRP A N    6  
ATOM   10743 C CA   . TRP A 1 27  ? -3.040  -4.706  -7.383  1.00 0.00 ? 27  TRP A CA   6  
ATOM   10744 C C    . TRP A 1 27  ? -3.800  -3.556  -6.680  1.00 0.00 ? 27  TRP A C    6  
ATOM   10745 O O    . TRP A 1 27  ? -3.726  -2.424  -7.158  1.00 0.00 ? 27  TRP A O    6  
ATOM   10746 C CB   . TRP A 1 27  ? -3.907  -5.321  -8.500  1.00 0.00 ? 27  TRP A CB   6  
ATOM   10747 C CG   . TRP A 1 27  ? -5.100  -6.107  -8.030  1.00 0.00 ? 27  TRP A CG   6  
ATOM   10748 C CD1  . TRP A 1 27  ? -5.147  -7.450  -7.798  1.00 0.00 ? 27  TRP A CD1  6  
ATOM   10749 C CD2  . TRP A 1 27  ? -6.420  -5.608  -7.756  1.00 0.00 ? 27  TRP A CD2  6  
ATOM   10750 N NE1  . TRP A 1 27  ? -6.404  -7.817  -7.391  1.00 0.00 ? 27  TRP A NE1  6  
ATOM   10751 C CE2  . TRP A 1 27  ? -7.204  -6.707  -7.357  1.00 0.00 ? 27  TRP A CE2  6  
ATOM   10752 C CE3  . TRP A 1 27  ? -7.016  -4.341  -7.802  1.00 0.00 ? 27  TRP A CE3  6  
ATOM   10753 C CZ2  . TRP A 1 27  ? -8.547  -6.581  -7.013  1.00 0.00 ? 27  TRP A CZ2  6  
ATOM   10754 C CZ3  . TRP A 1 27  ? -8.349  -4.218  -7.459  1.00 0.00 ? 27  TRP A CZ3  6  
ATOM   10755 C CH2  . TRP A 1 27  ? -9.101  -5.332  -7.068  1.00 0.00 ? 27  TRP A CH2  6  
ATOM   10756 H H    . TRP A 1 27  ? -2.766  -6.664  -6.612  1.00 0.00 ? 27  TRP A H    6  
ATOM   10757 H HA   . TRP A 1 27  ? -2.166  -4.269  -7.854  1.00 0.00 ? 27  TRP A HA   6  
ATOM   10758 H HB2  . TRP A 1 27  ? -4.273  -4.526  -9.130  1.00 0.00 ? 27  TRP A HB2  6  
ATOM   10759 H HB3  . TRP A 1 27  ? -3.289  -5.980  -9.092  1.00 0.00 ? 27  TRP A HB3  6  
ATOM   10760 H HD1  . TRP A 1 27  ? -4.307  -8.118  -7.918  1.00 0.00 ? 27  TRP A HD1  6  
ATOM   10761 H HE1  . TRP A 1 27  ? -6.684  -8.731  -7.164  1.00 0.00 ? 27  TRP A HE1  6  
ATOM   10762 H HE3  . TRP A 1 27  ? -6.453  -3.466  -8.093  1.00 0.00 ? 27  TRP A HE3  6  
ATOM   10763 H HZ2  . TRP A 1 27  ? -9.142  -7.429  -6.710  1.00 0.00 ? 27  TRP A HZ2  6  
ATOM   10764 H HZ3  . TRP A 1 27  ? -8.824  -3.249  -7.489  1.00 0.00 ? 27  TRP A HZ3  6  
ATOM   10765 H HH2  . TRP A 1 27  ? -10.140 -5.189  -6.809  1.00 0.00 ? 27  TRP A HH2  6  
ATOM   10766 N N    . PRO A 1 28  ? -4.545  -3.790  -5.558  1.00 0.00 ? 28  PRO A N    6  
ATOM   10767 C CA   . PRO A 1 28  ? -5.224  -2.701  -4.839  1.00 0.00 ? 28  PRO A CA   6  
ATOM   10768 C C    . PRO A 1 28  ? -4.287  -1.555  -4.459  1.00 0.00 ? 28  PRO A C    6  
ATOM   10769 O O    . PRO A 1 28  ? -4.726  -0.422  -4.266  1.00 0.00 ? 28  PRO A O    6  
ATOM   10770 C CB   . PRO A 1 28  ? -5.759  -3.346  -3.549  1.00 0.00 ? 28  PRO A CB   6  
ATOM   10771 C CG   . PRO A 1 28  ? -5.290  -4.765  -3.547  1.00 0.00 ? 28  PRO A CG   6  
ATOM   10772 C CD   . PRO A 1 28  ? -4.836  -5.100  -4.942  1.00 0.00 ? 28  PRO A CD   6  
ATOM   10773 H HA   . PRO A 1 28  ? -6.050  -2.307  -5.413  1.00 0.00 ? 28  PRO A HA   6  
ATOM   10774 H HB2  . PRO A 1 28  ? -5.358  -2.809  -2.699  1.00 0.00 ? 28  PRO A HB2  6  
ATOM   10775 H HB3  . PRO A 1 28  ? -6.840  -3.285  -3.524  1.00 0.00 ? 28  PRO A HB3  6  
ATOM   10776 H HG2  . PRO A 1 28  ? -4.468  -4.873  -2.852  1.00 0.00 ? 28  PRO A HG2  6  
ATOM   10777 H HG3  . PRO A 1 28  ? -6.106  -5.413  -3.257  1.00 0.00 ? 28  PRO A HG3  6  
ATOM   10778 H HD2  . PRO A 1 28  ? -3.947  -5.712  -4.913  1.00 0.00 ? 28  PRO A HD2  6  
ATOM   10779 H HD3  . PRO A 1 28  ? -5.619  -5.613  -5.485  1.00 0.00 ? 28  PRO A HD3  6  
ATOM   10780 N N    . PHE A 1 29  ? -2.998  -1.854  -4.358  1.00 0.00 ? 29  PHE A N    6  
ATOM   10781 C CA   . PHE A 1 29  ? -2.037  -0.886  -3.835  1.00 0.00 ? 29  PHE A CA   6  
ATOM   10782 C C    . PHE A 1 29  ? -1.092  -0.384  -4.914  1.00 0.00 ? 29  PHE A C    6  
ATOM   10783 O O    . PHE A 1 29  ? -0.302  0.530   -4.670  1.00 0.00 ? 29  PHE A O    6  
ATOM   10784 C CB   . PHE A 1 29  ? -1.220  -1.505  -2.702  1.00 0.00 ? 29  PHE A CB   6  
ATOM   10785 C CG   . PHE A 1 29  ? -1.969  -2.548  -1.930  1.00 0.00 ? 29  PHE A CG   6  
ATOM   10786 C CD1  . PHE A 1 29  ? -1.613  -3.883  -2.028  1.00 0.00 ? 29  PHE A CD1  6  
ATOM   10787 C CD2  . PHE A 1 29  ? -3.038  -2.201  -1.123  1.00 0.00 ? 29  PHE A CD2  6  
ATOM   10788 C CE1  . PHE A 1 29  ? -2.308  -4.847  -1.339  1.00 0.00 ? 29  PHE A CE1  6  
ATOM   10789 C CE2  . PHE A 1 29  ? -3.736  -3.166  -0.429  1.00 0.00 ? 29  PHE A CE2  6  
ATOM   10790 C CZ   . PHE A 1 29  ? -3.369  -4.490  -0.540  1.00 0.00 ? 29  PHE A CZ   6  
ATOM   10791 H H    . PHE A 1 29  ? -2.690  -2.744  -4.640  1.00 0.00 ? 29  PHE A H    6  
ATOM   10792 H HA   . PHE A 1 29  ? -2.593  -0.047  -3.445  1.00 0.00 ? 29  PHE A HA   6  
ATOM   10793 H HB2  . PHE A 1 29  ? -0.334  -1.965  -3.114  1.00 0.00 ? 29  PHE A HB2  6  
ATOM   10794 H HB3  . PHE A 1 29  ? -0.928  -0.721  -2.013  1.00 0.00 ? 29  PHE A HB3  6  
ATOM   10795 H HD1  . PHE A 1 29  ? -0.780  -4.171  -2.653  1.00 0.00 ? 29  PHE A HD1  6  
ATOM   10796 H HD2  . PHE A 1 29  ? -3.324  -1.163  -1.036  1.00 0.00 ? 29  PHE A HD2  6  
ATOM   10797 H HE1  . PHE A 1 29  ? -2.020  -5.885  -1.422  1.00 0.00 ? 29  PHE A HE1  6  
ATOM   10798 H HE2  . PHE A 1 29  ? -4.568  -2.888  0.196   1.00 0.00 ? 29  PHE A HE2  6  
ATOM   10799 H HZ   . PHE A 1 29  ? -3.912  -5.245  -0.003  1.00 0.00 ? 29  PHE A HZ   6  
ATOM   10800 N N    . TYR A 1 30  ? -1.138  -1.004  -6.090  1.00 0.00 ? 30  TYR A N    6  
ATOM   10801 C CA   . TYR A 1 30  ? -0.330  -0.547  -7.218  1.00 0.00 ? 30  TYR A CA   6  
ATOM   10802 C C    . TYR A 1 30  ? -0.595  0.924   -7.515  1.00 0.00 ? 30  TYR A C    6  
ATOM   10803 O O    . TYR A 1 30  ? 0.320   1.744   -7.488  1.00 0.00 ? 30  TYR A O    6  
ATOM   10804 C CB   . TYR A 1 30  ? -0.609  -1.381  -8.475  1.00 0.00 ? 30  TYR A CB   6  
ATOM   10805 C CG   . TYR A 1 30  ? 0.087   -2.723  -8.489  1.00 0.00 ? 30  TYR A CG   6  
ATOM   10806 C CD1  . TYR A 1 30  ? 0.473   -3.328  -7.307  1.00 0.00 ? 30  TYR A CD1  6  
ATOM   10807 C CD2  . TYR A 1 30  ? 0.365   -3.380  -9.680  1.00 0.00 ? 30  TYR A CD2  6  
ATOM   10808 C CE1  . TYR A 1 30  ? 1.115   -4.544  -7.304  1.00 0.00 ? 30  TYR A CE1  6  
ATOM   10809 C CE2  . TYR A 1 30  ? 1.006   -4.603  -9.687  1.00 0.00 ? 30  TYR A CE2  6  
ATOM   10810 C CZ   . TYR A 1 30  ? 1.378   -5.178  -8.491  1.00 0.00 ? 30  TYR A CZ   6  
ATOM   10811 O OH   . TYR A 1 30  ? 2.019   -6.391  -8.484  1.00 0.00 ? 30  TYR A OH   6  
ATOM   10812 H H    . TYR A 1 30  ? -1.713  -1.795  -6.194  1.00 0.00 ? 30  TYR A H    6  
ATOM   10813 H HA   . TYR A 1 30  ? 0.712   -0.665  -6.946  1.00 0.00 ? 30  TYR A HA   6  
ATOM   10814 H HB2  . TYR A 1 30  ? -1.668  -1.558  -8.549  1.00 0.00 ? 30  TYR A HB2  6  
ATOM   10815 H HB3  . TYR A 1 30  ? -0.281  -0.828  -9.344  1.00 0.00 ? 30  TYR A HB3  6  
ATOM   10816 H HD1  . TYR A 1 30  ? 0.260   -2.831  -6.376  1.00 0.00 ? 30  TYR A HD1  6  
ATOM   10817 H HD2  . TYR A 1 30  ? 0.069   -2.924  -10.613 1.00 0.00 ? 30  TYR A HD2  6  
ATOM   10818 H HE1  . TYR A 1 30  ? 1.408   -4.996  -6.368  1.00 0.00 ? 30  TYR A HE1  6  
ATOM   10819 H HE2  . TYR A 1 30  ? 1.213   -5.102  -10.622 1.00 0.00 ? 30  TYR A HE2  6  
ATOM   10820 H HH   . TYR A 1 30  ? 2.782   -6.354  -9.073  1.00 0.00 ? 30  TYR A HH   6  
ATOM   10821 N N    . LYS A 1 31  ? -1.850  1.253   -7.778  1.00 0.00 ? 31  LYS A N    6  
ATOM   10822 C CA   . LYS A 1 31  ? -2.223  2.591   -8.190  1.00 0.00 ? 31  LYS A CA   6  
ATOM   10823 C C    . LYS A 1 31  ? -3.353  3.111   -7.302  1.00 0.00 ? 31  LYS A C    6  
ATOM   10824 O O    . LYS A 1 31  ? -4.101  2.311   -6.735  1.00 0.00 ? 31  LYS A O    6  
ATOM   10825 C CB   . LYS A 1 31  ? -2.685  2.552   -9.646  1.00 0.00 ? 31  LYS A CB   6  
ATOM   10826 C CG   . LYS A 1 31  ? -1.735  1.814   -10.591 1.00 0.00 ? 31  LYS A CG   6  
ATOM   10827 C CD   . LYS A 1 31  ? -2.080  2.065   -12.041 1.00 0.00 ? 31  LYS A CD   6  
ATOM   10828 C CE   . LYS A 1 31  ? -3.423  1.470   -12.408 1.00 0.00 ? 31  LYS A CE   6  
ATOM   10829 N NZ   . LYS A 1 31  ? -3.462  0.002   -12.179 1.00 0.00 ? 31  LYS A NZ   6  
ATOM   10830 H H    . LYS A 1 31  ? -2.552  0.581   -7.681  1.00 0.00 ? 31  LYS A H    6  
ATOM   10831 H HA   . LYS A 1 31  ? -1.361  3.235   -8.099  1.00 0.00 ? 31  LYS A HA   6  
ATOM   10832 H HB2  . LYS A 1 31  ? -3.640  2.049   -9.679  1.00 0.00 ? 31  LYS A HB2  6  
ATOM   10833 H HB3  . LYS A 1 31  ? -2.803  3.566   -10.002 1.00 0.00 ? 31  LYS A HB3  6  
ATOM   10834 H HG2  . LYS A 1 31  ? -0.728  2.135   -10.423 1.00 0.00 ? 31  LYS A HG2  6  
ATOM   10835 H HG3  . LYS A 1 31  ? -1.809  0.754   -10.397 1.00 0.00 ? 31  LYS A HG3  6  
ATOM   10836 H HD2  . LYS A 1 31  ? -2.110  3.131   -12.209 1.00 0.00 ? 31  LYS A HD2  6  
ATOM   10837 H HD3  . LYS A 1 31  ? -1.316  1.622   -12.663 1.00 0.00 ? 31  LYS A HD3  6  
ATOM   10838 H HE2  . LYS A 1 31  ? -4.190  1.941   -11.813 1.00 0.00 ? 31  LYS A HE2  6  
ATOM   10839 H HE3  . LYS A 1 31  ? -3.602  1.668   -13.446 1.00 0.00 ? 31  LYS A HE3  6  
ATOM   10840 H HZ1  . LYS A 1 31  ? -3.351  -0.205  -11.168 1.00 0.00 ? 31  LYS A HZ1  6  
ATOM   10841 H HZ2  . LYS A 1 31  ? -2.693  -0.463  -12.701 1.00 0.00 ? 31  LYS A HZ2  6  
ATOM   10842 H HZ3  . LYS A 1 31  ? -4.372  -0.386  -12.503 1.00 0.00 ? 31  LYS A HZ3  6  
ATOM   10843 N N    . PRO A 1 32  ? -3.496  4.447   -7.164  1.00 0.00 ? 32  PRO A N    6  
ATOM   10844 C CA   . PRO A 1 32  ? -4.567  5.066   -6.366  1.00 0.00 ? 32  PRO A CA   6  
ATOM   10845 C C    . PRO A 1 32  ? -5.946  4.573   -6.771  1.00 0.00 ? 32  PRO A C    6  
ATOM   10846 O O    . PRO A 1 32  ? -6.219  4.363   -7.958  1.00 0.00 ? 32  PRO A O    6  
ATOM   10847 C CB   . PRO A 1 32  ? -4.436  6.568   -6.682  1.00 0.00 ? 32  PRO A CB   6  
ATOM   10848 C CG   . PRO A 1 32  ? -3.572  6.628   -7.893  1.00 0.00 ? 32  PRO A CG   6  
ATOM   10849 C CD   . PRO A 1 32  ? -2.629  5.476   -7.755  1.00 0.00 ? 32  PRO A CD   6  
ATOM   10850 H HA   . PRO A 1 32  ? -4.422  4.900   -5.308  1.00 0.00 ? 32  PRO A HA   6  
ATOM   10851 H HB2  . PRO A 1 32  ? -5.415  6.984   -6.874  1.00 0.00 ? 32  PRO A HB2  6  
ATOM   10852 H HB3  . PRO A 1 32  ? -3.980  7.079   -5.847  1.00 0.00 ? 32  PRO A HB3  6  
ATOM   10853 H HG2  . PRO A 1 32  ? -4.174  6.519   -8.783  1.00 0.00 ? 32  PRO A HG2  6  
ATOM   10854 H HG3  . PRO A 1 32  ? -3.028  7.561   -7.916  1.00 0.00 ? 32  PRO A HG3  6  
ATOM   10855 H HD2  . PRO A 1 32  ? -2.252  5.174   -8.719  1.00 0.00 ? 32  PRO A HD2  6  
ATOM   10856 H HD3  . PRO A 1 32  ? -1.822  5.733   -7.084  1.00 0.00 ? 32  PRO A HD3  6  
ATOM   10857 N N    . VAL A 1 33  ? -6.813  4.381   -5.784  1.00 0.00 ? 33  VAL A N    6  
ATOM   10858 C CA   . VAL A 1 33  ? -8.170  3.938   -6.055  1.00 0.00 ? 33  VAL A CA   6  
ATOM   10859 C C    . VAL A 1 33  ? -8.920  5.029   -6.801  1.00 0.00 ? 33  VAL A C    6  
ATOM   10860 O O    . VAL A 1 33  ? -8.742  6.224   -6.534  1.00 0.00 ? 33  VAL A O    6  
ATOM   10861 C CB   . VAL A 1 33  ? -8.943  3.533   -4.766  1.00 0.00 ? 33  VAL A CB   6  
ATOM   10862 C CG1  . VAL A 1 33  ? -7.985  3.057   -3.695  1.00 0.00 ? 33  VAL A CG1  6  
ATOM   10863 C CG2  . VAL A 1 33  ? -9.841  4.645   -4.236  1.00 0.00 ? 33  VAL A CG2  6  
ATOM   10864 H H    . VAL A 1 33  ? -6.529  4.536   -4.860  1.00 0.00 ? 33  VAL A H    6  
ATOM   10865 H HA   . VAL A 1 33  ? -8.105  3.068   -6.694  1.00 0.00 ? 33  VAL A HA   6  
ATOM   10866 H HB   . VAL A 1 33  ? -9.578  2.697   -5.017  1.00 0.00 ? 33  VAL A HB   6  
ATOM   10867 H HG11 . VAL A 1 33  ? -7.448  2.197   -4.058  1.00 0.00 ? 33  VAL A HG11 6  
ATOM   10868 H HG12 . VAL A 1 33  ? -8.542  2.789   -2.809  1.00 0.00 ? 33  VAL A HG12 6  
ATOM   10869 H HG13 . VAL A 1 33  ? -7.290  3.846   -3.457  1.00 0.00 ? 33  VAL A HG13 6  
ATOM   10870 H HG21 . VAL A 1 33  ? -10.848 4.511   -4.620  1.00 0.00 ? 33  VAL A HG21 6  
ATOM   10871 H HG22 . VAL A 1 33  ? -9.457  5.602   -4.559  1.00 0.00 ? 33  VAL A HG22 6  
ATOM   10872 H HG23 . VAL A 1 33  ? -9.860  4.610   -3.157  1.00 0.00 ? 33  VAL A HG23 6  
ATOM   10873 N N    . ASP A 1 34  ? -9.741  4.617   -7.741  1.00 0.00 ? 34  ASP A N    6  
ATOM   10874 C CA   . ASP A 1 34  ? -10.502 5.557   -8.550  1.00 0.00 ? 34  ASP A CA   6  
ATOM   10875 C C    . ASP A 1 34  ? -11.792 5.885   -7.829  1.00 0.00 ? 34  ASP A C    6  
ATOM   10876 O O    . ASP A 1 34  ? -12.872 5.501   -8.267  1.00 0.00 ? 34  ASP A O    6  
ATOM   10877 C CB   . ASP A 1 34  ? -10.798 4.975   -9.939  1.00 0.00 ? 34  ASP A CB   6  
ATOM   10878 C CG   . ASP A 1 34  ? -9.540  4.647   -10.719 1.00 0.00 ? 34  ASP A CG   6  
ATOM   10879 O OD1  . ASP A 1 34  ? -9.153  5.449   -11.593 1.00 0.00 ? 34  ASP A OD1  6  
ATOM   10880 O OD2  . ASP A 1 34  ? -8.929  3.586   -10.466 1.00 0.00 ? 34  ASP A OD2  6  
ATOM   10881 H H    . ASP A 1 34  ? -9.854  3.650   -7.883  1.00 0.00 ? 34  ASP A H    6  
ATOM   10882 H HA   . ASP A 1 34  ? -9.918  6.459   -8.655  1.00 0.00 ? 34  ASP A HA   6  
ATOM   10883 H HB2  . ASP A 1 34  ? -11.380 4.072   -9.833  1.00 0.00 ? 34  ASP A HB2  6  
ATOM   10884 H HB3  . ASP A 1 34  ? -11.369 5.697   -10.505 1.00 0.00 ? 34  ASP A HB3  6  
ATOM   10885 N N    . ALA A 1 35  ? -11.658 6.583   -6.708  1.00 0.00 ? 35  ALA A N    6  
ATOM   10886 C CA   . ALA A 1 35  ? -12.764 6.807   -5.784  1.00 0.00 ? 35  ALA A CA   6  
ATOM   10887 C C    . ALA A 1 35  ? -13.999 7.358   -6.483  1.00 0.00 ? 35  ALA A C    6  
ATOM   10888 O O    . ALA A 1 35  ? -15.111 6.895   -6.236  1.00 0.00 ? 35  ALA A O    6  
ATOM   10889 C CB   . ALA A 1 35  ? -12.327 7.724   -4.658  1.00 0.00 ? 35  ALA A CB   6  
ATOM   10890 H H    . ALA A 1 35  ? -10.780 6.971   -6.498  1.00 0.00 ? 35  ALA A H    6  
ATOM   10891 H HA   . ALA A 1 35  ? -13.018 5.854   -5.348  1.00 0.00 ? 35  ALA A HA   6  
ATOM   10892 H HB1  . ALA A 1 35  ? -12.710 7.344   -3.719  1.00 0.00 ? 35  ALA A HB1  6  
ATOM   10893 H HB2  . ALA A 1 35  ? -12.715 8.717   -4.831  1.00 0.00 ? 35  ALA A HB2  6  
ATOM   10894 H HB3  . ALA A 1 35  ? -11.249 7.759   -4.620  1.00 0.00 ? 35  ALA A HB3  6  
ATOM   10895 N N    . SER A 1 36  ? -13.802 8.321   -7.369  1.00 0.00 ? 36  SER A N    6  
ATOM   10896 C CA   . SER A 1 36  ? -14.907 8.896   -8.122  1.00 0.00 ? 36  SER A CA   6  
ATOM   10897 C C    . SER A 1 36  ? -15.598 7.823   -8.966  1.00 0.00 ? 36  SER A C    6  
ATOM   10898 O O    . SER A 1 36  ? -16.824 7.792   -9.069  1.00 0.00 ? 36  SER A O    6  
ATOM   10899 C CB   . SER A 1 36  ? -14.396 10.021  -9.019  1.00 0.00 ? 36  SER A CB   6  
ATOM   10900 O OG   . SER A 1 36  ? -13.644 10.963  -8.269  1.00 0.00 ? 36  SER A OG   6  
ATOM   10901 H H    . SER A 1 36  ? -12.891 8.655   -7.521  1.00 0.00 ? 36  SER A H    6  
ATOM   10902 H HA   . SER A 1 36  ? -15.618 9.299   -7.417  1.00 0.00 ? 36  SER A HA   6  
ATOM   10903 H HB2  . SER A 1 36  ? -13.766 9.603   -9.788  1.00 0.00 ? 36  SER A HB2  6  
ATOM   10904 H HB3  . SER A 1 36  ? -15.235 10.526  -9.473  1.00 0.00 ? 36  SER A HB3  6  
ATOM   10905 H HG   . SER A 1 36  ? -12.780 11.080  -8.683  1.00 0.00 ? 36  SER A HG   6  
ATOM   10906 N N    . ALA A 1 37  ? -14.801 6.928   -9.535  1.00 0.00 ? 37  ALA A N    6  
ATOM   10907 C CA   . ALA A 1 37  ? -15.317 5.859   -10.377 1.00 0.00 ? 37  ALA A CA   6  
ATOM   10908 C C    . ALA A 1 37  ? -15.979 4.756   -9.552  1.00 0.00 ? 37  ALA A C    6  
ATOM   10909 O O    . ALA A 1 37  ? -16.924 4.119   -10.015 1.00 0.00 ? 37  ALA A O    6  
ATOM   10910 C CB   . ALA A 1 37  ? -14.203 5.279   -11.231 1.00 0.00 ? 37  ALA A CB   6  
ATOM   10911 H H    . ALA A 1 37  ? -13.832 6.987   -9.384  1.00 0.00 ? 37  ALA A H    6  
ATOM   10912 H HA   . ALA A 1 37  ? -16.055 6.289   -11.039 1.00 0.00 ? 37  ALA A HA   6  
ATOM   10913 H HB1  . ALA A 1 37  ? -13.422 4.899   -10.590 1.00 0.00 ? 37  ALA A HB1  6  
ATOM   10914 H HB2  . ALA A 1 37  ? -13.800 6.051   -11.869 1.00 0.00 ? 37  ALA A HB2  6  
ATOM   10915 H HB3  . ALA A 1 37  ? -14.595 4.477   -11.839 1.00 0.00 ? 37  ALA A HB3  6  
ATOM   10916 N N    . LEU A 1 38  ? -15.501 4.527   -8.330  1.00 0.00 ? 38  LEU A N    6  
ATOM   10917 C CA   . LEU A 1 38  ? -16.115 3.484   -7.489  1.00 0.00 ? 38  LEU A CA   6  
ATOM   10918 C C    . LEU A 1 38  ? -17.261 4.057   -6.664  1.00 0.00 ? 38  LEU A C    6  
ATOM   10919 O O    . LEU A 1 38  ? -17.846 3.362   -5.840  1.00 0.00 ? 38  LEU A O    6  
ATOM   10920 C CB   . LEU A 1 38  ? -15.136 2.738   -6.563  1.00 0.00 ? 38  LEU A CB   6  
ATOM   10921 C CG   . LEU A 1 38  ? -13.758 2.400   -7.121  1.00 0.00 ? 38  LEU A CG   6  
ATOM   10922 C CD1  . LEU A 1 38  ? -12.657 3.147   -6.374  1.00 0.00 ? 38  LEU A CD1  6  
ATOM   10923 C CD2  . LEU A 1 38  ? -13.544 0.921   -6.990  1.00 0.00 ? 38  LEU A CD2  6  
ATOM   10924 H H    . LEU A 1 38  ? -14.749 5.073   -7.998  1.00 0.00 ? 38  LEU A H    6  
ATOM   10925 H HA   . LEU A 1 38  ? -16.533 2.763   -8.152  1.00 0.00 ? 38  LEU A HA   6  
ATOM   10926 H HB2  . LEU A 1 38  ? -15.016 3.281   -5.668  1.00 0.00 ? 38  LEU A HB2  6  
ATOM   10927 H HB3  . LEU A 1 38  ? -15.607 1.802   -6.305  1.00 0.00 ? 38  LEU A HB3  6  
ATOM   10928 H HG   . LEU A 1 38  ? -13.707 2.660   -8.166  1.00 0.00 ? 38  LEU A HG   6  
ATOM   10929 H HD11 . LEU A 1 38  ? -12.564 2.767   -5.363  1.00 0.00 ? 38  LEU A HD11 6  
ATOM   10930 H HD12 . LEU A 1 38  ? -12.900 4.198   -6.342  1.00 0.00 ? 38  LEU A HD12 6  
ATOM   10931 H HD13 . LEU A 1 38  ? -11.720 3.014   -6.894  1.00 0.00 ? 38  LEU A HD13 6  
ATOM   10932 H HD21 . LEU A 1 38  ? -13.796 0.633   -5.982  1.00 0.00 ? 38  LEU A HD21 6  
ATOM   10933 H HD22 . LEU A 1 38  ? -12.511 0.684   -7.191  1.00 0.00 ? 38  LEU A HD22 6  
ATOM   10934 H HD23 . LEU A 1 38  ? -14.180 0.397   -7.687  1.00 0.00 ? 38  LEU A HD23 6  
ATOM   10935 N N    . GLY A 1 39  ? -17.577 5.329   -6.894  1.00 0.00 ? 39  GLY A N    6  
ATOM   10936 C CA   . GLY A 1 39  ? -18.703 5.959   -6.220  1.00 0.00 ? 39  GLY A CA   6  
ATOM   10937 C C    . GLY A 1 39  ? -18.376 6.381   -4.801  1.00 0.00 ? 39  GLY A C    6  
ATOM   10938 O O    . GLY A 1 39  ? -19.271 6.650   -3.997  1.00 0.00 ? 39  GLY A O    6  
ATOM   10939 H H    . GLY A 1 39  ? -17.041 5.846   -7.532  1.00 0.00 ? 39  GLY A H    6  
ATOM   10940 H HA2  . GLY A 1 39  ? -19.002 6.830   -6.782  1.00 0.00 ? 39  GLY A HA2  6  
ATOM   10941 H HA3  . GLY A 1 39  ? -19.526 5.262   -6.195  1.00 0.00 ? 39  GLY A HA3  6  
ATOM   10942 N N    . LEU A 1 40  ? -17.092 6.443   -4.496  1.00 0.00 ? 40  LEU A N    6  
ATOM   10943 C CA   . LEU A 1 40  ? -16.627 6.803   -3.168  1.00 0.00 ? 40  LEU A CA   6  
ATOM   10944 C C    . LEU A 1 40  ? -16.379 8.304   -3.096  1.00 0.00 ? 40  LEU A C    6  
ATOM   10945 O O    . LEU A 1 40  ? -15.297 8.787   -3.435  1.00 0.00 ? 40  LEU A O    6  
ATOM   10946 C CB   . LEU A 1 40  ? -15.341 6.040   -2.854  1.00 0.00 ? 40  LEU A CB   6  
ATOM   10947 C CG   . LEU A 1 40  ? -15.324 4.581   -3.318  1.00 0.00 ? 40  LEU A CG   6  
ATOM   10948 C CD1  . LEU A 1 40  ? -14.077 3.872   -2.827  1.00 0.00 ? 40  LEU A CD1  6  
ATOM   10949 C CD2  . LEU A 1 40  ? -16.584 3.840   -2.878  1.00 0.00 ? 40  LEU A CD2  6  
ATOM   10950 H H    . LEU A 1 40  ? -16.429 6.232   -5.186  1.00 0.00 ? 40  LEU A H    6  
ATOM   10951 H HA   . LEU A 1 40  ? -17.389 6.532   -2.455  1.00 0.00 ? 40  LEU A HA   6  
ATOM   10952 H HB2  . LEU A 1 40  ? -14.518 6.556   -3.330  1.00 0.00 ? 40  LEU A HB2  6  
ATOM   10953 H HB3  . LEU A 1 40  ? -15.187 6.058   -1.786  1.00 0.00 ? 40  LEU A HB3  6  
ATOM   10954 H HG   . LEU A 1 40  ? -15.296 4.569   -4.395  1.00 0.00 ? 40  LEU A HG   6  
ATOM   10955 H HD11 . LEU A 1 40  ? -13.223 4.234   -3.366  1.00 0.00 ? 40  LEU A HD11 6  
ATOM   10956 H HD12 . LEU A 1 40  ? -14.178 2.816   -2.995  1.00 0.00 ? 40  LEU A HD12 6  
ATOM   10957 H HD13 . LEU A 1 40  ? -13.946 4.060   -1.771  1.00 0.00 ? 40  LEU A HD13 6  
ATOM   10958 H HD21 . LEU A 1 40  ? -16.762 4.021   -1.835  1.00 0.00 ? 40  LEU A HD21 6  
ATOM   10959 H HD22 . LEU A 1 40  ? -16.455 2.781   -3.043  1.00 0.00 ? 40  LEU A HD22 6  
ATOM   10960 H HD23 . LEU A 1 40  ? -17.426 4.193   -3.454  1.00 0.00 ? 40  LEU A HD23 6  
ATOM   10961 N N    . HIS A 1 41  ? -17.388 9.041   -2.659  1.00 0.00 ? 41  HIS A N    6  
ATOM   10962 C CA   . HIS A 1 41  ? -17.322 10.500  -2.648  1.00 0.00 ? 41  HIS A CA   6  
ATOM   10963 C C    . HIS A 1 41  ? -16.650 11.013  -1.378  1.00 0.00 ? 41  HIS A C    6  
ATOM   10964 O O    . HIS A 1 41  ? -16.362 12.205  -1.253  1.00 0.00 ? 41  HIS A O    6  
ATOM   10965 C CB   . HIS A 1 41  ? -18.730 11.102  -2.765  1.00 0.00 ? 41  HIS A CB   6  
ATOM   10966 C CG   . HIS A 1 41  ? -19.492 10.664  -3.991  1.00 0.00 ? 41  HIS A CG   6  
ATOM   10967 N ND1  . HIS A 1 41  ? -19.341 11.277  -5.215  1.00 0.00 ? 41  HIS A ND1  6  
ATOM   10968 C CD2  . HIS A 1 41  ? -20.416 9.676   -4.185  1.00 0.00 ? 41  HIS A CD2  6  
ATOM   10969 C CE1  . HIS A 1 41  ? -20.130 10.697  -6.100  1.00 0.00 ? 41  HIS A CE1  6  
ATOM   10970 N NE2  . HIS A 1 41  ? -20.792 9.725   -5.505  1.00 0.00 ? 41  HIS A NE2  6  
ATOM   10971 H H    . HIS A 1 41  ? -18.195 8.593   -2.328  1.00 0.00 ? 41  HIS A H    6  
ATOM   10972 H HA   . HIS A 1 41  ? -16.734 10.812  -3.499  1.00 0.00 ? 41  HIS A HA   6  
ATOM   10973 H HB2  . HIS A 1 41  ? -19.302 10.828  -1.892  1.00 0.00 ? 41  HIS A HB2  6  
ATOM   10974 H HB3  . HIS A 1 41  ? -18.640 12.179  -2.799  1.00 0.00 ? 41  HIS A HB3  6  
ATOM   10975 H HD1  . HIS A 1 41  ? -18.741 12.033  -5.408  1.00 0.00 ? 41  HIS A HD1  6  
ATOM   10976 H HD2  . HIS A 1 41  ? -20.792 8.978   -3.443  1.00 0.00 ? 41  HIS A HD2  6  
ATOM   10977 H HE1  . HIS A 1 41  ? -20.215 10.972  -7.141  1.00 0.00 ? 41  HIS A HE1  6  
ATOM   10978 H HE2  . HIS A 1 41  ? -21.593 9.289   -5.876  1.00 0.00 ? 41  HIS A HE2  6  
ATOM   10979 N N    . ASP A 1 42  ? -16.393 10.108  -0.448  1.00 0.00 ? 42  ASP A N    6  
ATOM   10980 C CA   . ASP A 1 42  ? -15.846 10.467  0.858   1.00 0.00 ? 42  ASP A CA   6  
ATOM   10981 C C    . ASP A 1 42  ? -14.424 9.943   1.051   1.00 0.00 ? 42  ASP A C    6  
ATOM   10982 O O    . ASP A 1 42  ? -13.887 9.978   2.157   1.00 0.00 ? 42  ASP A O    6  
ATOM   10983 C CB   . ASP A 1 42  ? -16.750 9.920   1.966   1.00 0.00 ? 42  ASP A CB   6  
ATOM   10984 C CG   . ASP A 1 42  ? -17.109 8.452   1.773   1.00 0.00 ? 42  ASP A CG   6  
ATOM   10985 O OD1  . ASP A 1 42  ? -16.468 7.768   0.943   1.00 0.00 ? 42  ASP A OD1  6  
ATOM   10986 O OD2  . ASP A 1 42  ? -18.057 7.987   2.440   1.00 0.00 ? 42  ASP A OD2  6  
ATOM   10987 H H    . ASP A 1 42  ? -16.586 9.161   -0.633  1.00 0.00 ? 42  ASP A H    6  
ATOM   10988 H HA   . ASP A 1 42  ? -15.832 11.545  0.924   1.00 0.00 ? 42  ASP A HA   6  
ATOM   10989 H HB2  . ASP A 1 42  ? -16.246 10.023  2.915   1.00 0.00 ? 42  ASP A HB2  6  
ATOM   10990 H HB3  . ASP A 1 42  ? -17.665 10.492  1.988   1.00 0.00 ? 42  ASP A HB3  6  
ATOM   10991 N N    . TYR A 1 43  ? -13.800 9.503   -0.031  1.00 0.00 ? 43  TYR A N    6  
ATOM   10992 C CA   . TYR A 1 43  ? -12.497 8.851   0.050   1.00 0.00 ? 43  TYR A CA   6  
ATOM   10993 C C    . TYR A 1 43  ? -11.424 9.788   0.597   1.00 0.00 ? 43  TYR A C    6  
ATOM   10994 O O    . TYR A 1 43  ? -10.600 9.387   1.416   1.00 0.00 ? 43  TYR A O    6  
ATOM   10995 C CB   . TYR A 1 43  ? -12.097 8.316   -1.330  1.00 0.00 ? 43  TYR A CB   6  
ATOM   10996 C CG   . TYR A 1 43  ? -10.699 7.739   -1.415  1.00 0.00 ? 43  TYR A CG   6  
ATOM   10997 C CD1  . TYR A 1 43  ? -10.450 6.432   -1.035  1.00 0.00 ? 43  TYR A CD1  6  
ATOM   10998 C CD2  . TYR A 1 43  ? -9.635  8.494   -1.898  1.00 0.00 ? 43  TYR A CD2  6  
ATOM   10999 C CE1  . TYR A 1 43  ? -9.182  5.888   -1.126  1.00 0.00 ? 43  TYR A CE1  6  
ATOM   11000 C CE2  . TYR A 1 43  ? -8.366  7.959   -1.993  1.00 0.00 ? 43  TYR A CE2  6  
ATOM   11001 C CZ   . TYR A 1 43  ? -8.142  6.657   -1.607  1.00 0.00 ? 43  TYR A CZ   6  
ATOM   11002 O OH   . TYR A 1 43  ? -6.874  6.127   -1.699  1.00 0.00 ? 43  TYR A OH   6  
ATOM   11003 H H    . TYR A 1 43  ? -14.218 9.624   -0.907  1.00 0.00 ? 43  TYR A H    6  
ATOM   11004 H HA   . TYR A 1 43  ? -12.600 8.021   0.732   1.00 0.00 ? 43  TYR A HA   6  
ATOM   11005 H HB2  . TYR A 1 43  ? -12.784 7.533   -1.608  1.00 0.00 ? 43  TYR A HB2  6  
ATOM   11006 H HB3  . TYR A 1 43  ? -12.168 9.113   -2.054  1.00 0.00 ? 43  TYR A HB3  6  
ATOM   11007 H HD1  . TYR A 1 43  ? -11.263 5.836   -0.662  1.00 0.00 ? 43  TYR A HD1  6  
ATOM   11008 H HD2  . TYR A 1 43  ? -9.807  9.519   -2.197  1.00 0.00 ? 43  TYR A HD2  6  
ATOM   11009 H HE1  . TYR A 1 43  ? -9.015  4.866   -0.828  1.00 0.00 ? 43  TYR A HE1  6  
ATOM   11010 H HE2  . TYR A 1 43  ? -7.558  8.558   -2.375  1.00 0.00 ? 43  TYR A HE2  6  
ATOM   11011 H HH   . TYR A 1 43  ? -6.926  5.208   -1.976  1.00 0.00 ? 43  TYR A HH   6  
ATOM   11012 N N    . HIS A 1 44  ? -11.454 11.040  0.171   1.00 0.00 ? 44  HIS A N    6  
ATOM   11013 C CA   . HIS A 1 44  ? -10.424 11.992  0.568   1.00 0.00 ? 44  HIS A CA   6  
ATOM   11014 C C    . HIS A 1 44  ? -10.735 12.595  1.931   1.00 0.00 ? 44  HIS A C    6  
ATOM   11015 O O    . HIS A 1 44  ? -9.951  13.375  2.471   1.00 0.00 ? 44  HIS A O    6  
ATOM   11016 C CB   . HIS A 1 44  ? -10.269 13.094  -0.481  1.00 0.00 ? 44  HIS A CB   6  
ATOM   11017 C CG   . HIS A 1 44  ? -9.621  12.627  -1.750  1.00 0.00 ? 44  HIS A CG   6  
ATOM   11018 N ND1  . HIS A 1 44  ? -8.340  12.980  -2.113  1.00 0.00 ? 44  HIS A ND1  6  
ATOM   11019 C CD2  . HIS A 1 44  ? -10.081 11.830  -2.743  1.00 0.00 ? 44  HIS A CD2  6  
ATOM   11020 C CE1  . HIS A 1 44  ? -8.041  12.424  -3.270  1.00 0.00 ? 44  HIS A CE1  6  
ATOM   11021 N NE2  . HIS A 1 44  ? -9.079  11.720  -3.673  1.00 0.00 ? 44  HIS A NE2  6  
ATOM   11022 H H    . HIS A 1 44  ? -12.195 11.339  -0.401  1.00 0.00 ? 44  HIS A H    6  
ATOM   11023 H HA   . HIS A 1 44  ? -9.493  11.450  0.640   1.00 0.00 ? 44  HIS A HA   6  
ATOM   11024 H HB2  . HIS A 1 44  ? -11.244 13.484  -0.731  1.00 0.00 ? 44  HIS A HB2  6  
ATOM   11025 H HB3  . HIS A 1 44  ? -9.664  13.888  -0.070  1.00 0.00 ? 44  HIS A HB3  6  
ATOM   11026 H HD1  . HIS A 1 44  ? -7.732  13.553  -1.592  1.00 0.00 ? 44  HIS A HD1  6  
ATOM   11027 H HD2  . HIS A 1 44  ? -11.055 11.365  -2.793  1.00 0.00 ? 44  HIS A HD2  6  
ATOM   11028 H HE1  . HIS A 1 44  ? -7.105  12.528  -3.798  1.00 0.00 ? 44  HIS A HE1  6  
ATOM   11029 H HE2  . HIS A 1 44  ? -9.083  11.111  -4.448  1.00 0.00 ? 44  HIS A HE2  6  
ATOM   11030 N N    . ASP A 1 45  ? -11.884 12.230  2.484   1.00 0.00 ? 45  ASP A N    6  
ATOM   11031 C CA   . ASP A 1 45  ? -12.274 12.688  3.811   1.00 0.00 ? 45  ASP A CA   6  
ATOM   11032 C C    . ASP A 1 45  ? -11.808 11.697  4.868   1.00 0.00 ? 45  ASP A C    6  
ATOM   11033 O O    . ASP A 1 45  ? -11.337 12.086  5.937   1.00 0.00 ? 45  ASP A O    6  
ATOM   11034 C CB   . ASP A 1 45  ? -13.791 12.863  3.906   1.00 0.00 ? 45  ASP A CB   6  
ATOM   11035 C CG   . ASP A 1 45  ? -14.318 13.931  2.972   1.00 0.00 ? 45  ASP A CG   6  
ATOM   11036 O OD1  . ASP A 1 45  ? -14.176 15.129  3.290   1.00 0.00 ? 45  ASP A OD1  6  
ATOM   11037 O OD2  . ASP A 1 45  ? -14.882 13.577  1.918   1.00 0.00 ? 45  ASP A OD2  6  
ATOM   11038 H H    . ASP A 1 45  ? -12.489 11.640  1.984   1.00 0.00 ? 45  ASP A H    6  
ATOM   11039 H HA   . ASP A 1 45  ? -11.796 13.639  3.990   1.00 0.00 ? 45  ASP A HA   6  
ATOM   11040 H HB2  . ASP A 1 45  ? -14.271 11.928  3.659   1.00 0.00 ? 45  ASP A HB2  6  
ATOM   11041 H HB3  . ASP A 1 45  ? -14.051 13.138  4.918   1.00 0.00 ? 45  ASP A HB3  6  
ATOM   11042 N N    . ILE A 1 46  ? -11.940 10.415  4.558   1.00 0.00 ? 46  ILE A N    6  
ATOM   11043 C CA   . ILE A 1 46  ? -11.533 9.356   5.474   1.00 0.00 ? 46  ILE A CA   6  
ATOM   11044 C C    . ILE A 1 46  ? -10.031 9.128   5.371   1.00 0.00 ? 46  ILE A C    6  
ATOM   11045 O O    . ILE A 1 46  ? -9.324  9.062   6.380   1.00 0.00 ? 46  ILE A O    6  
ATOM   11046 C CB   . ILE A 1 46  ? -12.289 8.023   5.199   1.00 0.00 ? 46  ILE A CB   6  
ATOM   11047 C CG1  . ILE A 1 46  ? -13.736 8.086   5.696   1.00 0.00 ? 46  ILE A CG1  6  
ATOM   11048 C CG2  . ILE A 1 46  ? -11.587 6.835   5.857   1.00 0.00 ? 46  ILE A CG2  6  
ATOM   11049 C CD1  . ILE A 1 46  ? -14.618 9.088   4.979   1.00 0.00 ? 46  ILE A CD1  6  
ATOM   11050 H H    . ILE A 1 46  ? -12.322 10.173  3.688   1.00 0.00 ? 46  ILE A H    6  
ATOM   11051 H HA   . ILE A 1 46  ? -11.767 9.678   6.479   1.00 0.00 ? 46  ILE A HA   6  
ATOM   11052 H HB   . ILE A 1 46  ? -12.294 7.856   4.129   1.00 0.00 ? 46  ILE A HB   6  
ATOM   11053 H HG12 . ILE A 1 46  ? -14.178 7.112   5.570   1.00 0.00 ? 46  ILE A HG12 6  
ATOM   11054 H HG13 . ILE A 1 46  ? -13.734 8.340   6.748   1.00 0.00 ? 46  ILE A HG13 6  
ATOM   11055 H HG21 . ILE A 1 46  ? -10.907 6.376   5.158   1.00 0.00 ? 46  ILE A HG21 6  
ATOM   11056 H HG22 . ILE A 1 46  ? -12.325 6.110   6.167   1.00 0.00 ? 46  ILE A HG22 6  
ATOM   11057 H HG23 . ILE A 1 46  ? -11.036 7.179   6.721   1.00 0.00 ? 46  ILE A HG23 6  
ATOM   11058 H HD11 . ILE A 1 46  ? -14.652 8.852   3.923   1.00 0.00 ? 46  ILE A HD11 6  
ATOM   11059 H HD12 . ILE A 1 46  ? -14.213 10.081  5.111   1.00 0.00 ? 46  ILE A HD12 6  
ATOM   11060 H HD13 . ILE A 1 46  ? -15.616 9.049   5.390   1.00 0.00 ? 46  ILE A HD13 6  
ATOM   11061 N N    . ILE A 1 47  ? -9.547  9.030   4.146   1.00 0.00 ? 47  ILE A N    6  
ATOM   11062 C CA   . ILE A 1 47  ? -8.139  8.791   3.907   1.00 0.00 ? 47  ILE A CA   6  
ATOM   11063 C C    . ILE A 1 47  ? -7.367  10.104  3.917   1.00 0.00 ? 47  ILE A C    6  
ATOM   11064 O O    . ILE A 1 47  ? -7.496  10.920  3.003   1.00 0.00 ? 47  ILE A O    6  
ATOM   11065 C CB   . ILE A 1 47  ? -7.908  8.081   2.562   1.00 0.00 ? 47  ILE A CB   6  
ATOM   11066 C CG1  . ILE A 1 47  ? -8.778  6.825   2.452   1.00 0.00 ? 47  ILE A CG1  6  
ATOM   11067 C CG2  . ILE A 1 47  ? -6.439  7.726   2.414   1.00 0.00 ? 47  ILE A CG2  6  
ATOM   11068 C CD1  . ILE A 1 47  ? -8.362  5.711   3.376   1.00 0.00 ? 47  ILE A CD1  6  
ATOM   11069 H H    . ILE A 1 47  ? -10.153 9.127   3.378   1.00 0.00 ? 47  ILE A H    6  
ATOM   11070 H HA   . ILE A 1 47  ? -7.768  8.155   4.696   1.00 0.00 ? 47  ILE A HA   6  
ATOM   11071 H HB   . ILE A 1 47  ? -8.172  8.762   1.770   1.00 0.00 ? 47  ILE A HB   6  
ATOM   11072 H HG12 . ILE A 1 47  ? -9.797  7.082   2.696   1.00 0.00 ? 47  ILE A HG12 6  
ATOM   11073 H HG13 . ILE A 1 47  ? -8.738  6.452   1.439   1.00 0.00 ? 47  ILE A HG13 6  
ATOM   11074 H HG21 . ILE A 1 47  ? -6.325  6.983   1.645   1.00 0.00 ? 47  ILE A HG21 6  
ATOM   11075 H HG22 . ILE A 1 47  ? -6.066  7.337   3.349   1.00 0.00 ? 47  ILE A HG22 6  
ATOM   11076 H HG23 . ILE A 1 47  ? -5.880  8.610   2.145   1.00 0.00 ? 47  ILE A HG23 6  
ATOM   11077 H HD11 . ILE A 1 47  ? -8.402  6.058   4.396   1.00 0.00 ? 47  ILE A HD11 6  
ATOM   11078 H HD12 . ILE A 1 47  ? -7.357  5.406   3.136   1.00 0.00 ? 47  ILE A HD12 6  
ATOM   11079 H HD13 . ILE A 1 47  ? -9.026  4.875   3.253   1.00 0.00 ? 47  ILE A HD13 6  
ATOM   11080 N N    . LYS A 1 48  ? -6.587  10.317  4.964   1.00 0.00 ? 48  LYS A N    6  
ATOM   11081 C CA   . LYS A 1 48  ? -5.775  11.520  5.079   1.00 0.00 ? 48  LYS A CA   6  
ATOM   11082 C C    . LYS A 1 48  ? -4.357  11.295  4.563   1.00 0.00 ? 48  LYS A C    6  
ATOM   11083 O O    . LYS A 1 48  ? -3.643  12.247  4.248   1.00 0.00 ? 48  LYS A O    6  
ATOM   11084 C CB   . LYS A 1 48  ? -5.747  12.001  6.522   1.00 0.00 ? 48  LYS A CB   6  
ATOM   11085 C CG   . LYS A 1 48  ? -7.038  12.684  6.942   1.00 0.00 ? 48  LYS A CG   6  
ATOM   11086 C CD   . LYS A 1 48  ? -7.276  13.960  6.147   1.00 0.00 ? 48  LYS A CD   6  
ATOM   11087 C CE   . LYS A 1 48  ? -8.716  14.417  6.223   1.00 0.00 ? 48  LYS A CE   6  
ATOM   11088 N NZ   . LYS A 1 48  ? -9.168  14.668  7.617   1.00 0.00 ? 48  LYS A NZ   6  
ATOM   11089 H H    . LYS A 1 48  ? -6.568  9.656   5.687   1.00 0.00 ? 48  LYS A H    6  
ATOM   11090 H HA   . LYS A 1 48  ? -6.243  12.282  4.477   1.00 0.00 ? 48  LYS A HA   6  
ATOM   11091 H HB2  . LYS A 1 48  ? -5.580  11.153  7.171   1.00 0.00 ? 48  LYS A HB2  6  
ATOM   11092 H HB3  . LYS A 1 48  ? -4.935  12.696  6.636   1.00 0.00 ? 48  LYS A HB3  6  
ATOM   11093 H HG2  . LYS A 1 48  ? -7.863  12.008  6.774   1.00 0.00 ? 48  LYS A HG2  6  
ATOM   11094 H HG3  . LYS A 1 48  ? -6.979  12.928  7.991   1.00 0.00 ? 48  LYS A HG3  6  
ATOM   11095 H HD2  . LYS A 1 48  ? -6.641  14.739  6.535   1.00 0.00 ? 48  LYS A HD2  6  
ATOM   11096 H HD3  . LYS A 1 48  ? -7.035  13.779  5.116   1.00 0.00 ? 48  LYS A HD3  6  
ATOM   11097 H HE2  . LYS A 1 48  ? -8.820  15.329  5.654   1.00 0.00 ? 48  LYS A HE2  6  
ATOM   11098 H HE3  . LYS A 1 48  ? -9.329  13.650  5.782   1.00 0.00 ? 48  LYS A HE3  6  
ATOM   11099 H HZ1  . LYS A 1 48  ? -9.066  13.806  8.191   1.00 0.00 ? 48  LYS A HZ1  6  
ATOM   11100 H HZ2  . LYS A 1 48  ? -10.168 14.953  7.621   1.00 0.00 ? 48  LYS A HZ2  6  
ATOM   11101 H HZ3  . LYS A 1 48  ? -8.603  15.427  8.046   1.00 0.00 ? 48  LYS A HZ3  6  
ATOM   11102 N N    . HIS A 1 49  ? -3.948  10.037  4.488   1.00 0.00 ? 49  HIS A N    6  
ATOM   11103 C CA   . HIS A 1 49  ? -2.649  9.679   3.918   1.00 0.00 ? 49  HIS A CA   6  
ATOM   11104 C C    . HIS A 1 49  ? -2.808  8.683   2.763   1.00 0.00 ? 49  HIS A C    6  
ATOM   11105 O O    . HIS A 1 49  ? -2.416  7.521   2.885   1.00 0.00 ? 49  HIS A O    6  
ATOM   11106 C CB   . HIS A 1 49  ? -1.735  9.081   4.993   1.00 0.00 ? 49  HIS A CB   6  
ATOM   11107 C CG   . HIS A 1 49  ? -1.329  10.055  6.056   1.00 0.00 ? 49  HIS A CG   6  
ATOM   11108 N ND1  . HIS A 1 49  ? -0.145  10.757  6.025   1.00 0.00 ? 49  HIS A ND1  6  
ATOM   11109 C CD2  . HIS A 1 49  ? -1.959  10.438  7.191   1.00 0.00 ? 49  HIS A CD2  6  
ATOM   11110 C CE1  . HIS A 1 49  ? -0.065  11.528  7.092   1.00 0.00 ? 49  HIS A CE1  6  
ATOM   11111 N NE2  . HIS A 1 49  ? -1.153  11.354  7.816   1.00 0.00 ? 49  HIS A NE2  6  
ATOM   11112 H H    . HIS A 1 49  ? -4.528  9.330   4.831   1.00 0.00 ? 49  HIS A H    6  
ATOM   11113 H HA   . HIS A 1 49  ? -2.193  10.581  3.540   1.00 0.00 ? 49  HIS A HA   6  
ATOM   11114 H HB2  . HIS A 1 49  ? -2.247  8.262   5.475   1.00 0.00 ? 49  HIS A HB2  6  
ATOM   11115 H HB3  . HIS A 1 49  ? -0.836  8.708   4.523   1.00 0.00 ? 49  HIS A HB3  6  
ATOM   11116 H HD1  . HIS A 1 49  ? 0.543   10.696  5.325   1.00 0.00 ? 49  HIS A HD1  6  
ATOM   11117 H HD2  . HIS A 1 49  ? -2.919  10.089  7.537   1.00 0.00 ? 49  HIS A HD2  6  
ATOM   11118 H HE1  . HIS A 1 49  ? 0.751   12.193  7.331   1.00 0.00 ? 49  HIS A HE1  6  
ATOM   11119 H HE2  . HIS A 1 49  ? -1.433  11.941  8.553   1.00 0.00 ? 49  HIS A HE2  6  
ATOM   11120 N N    . PRO A 1 50  ? -3.411  9.111   1.634   1.00 0.00 ? 50  PRO A N    6  
ATOM   11121 C CA   . PRO A 1 50  ? -3.575  8.255   0.450   1.00 0.00 ? 50  PRO A CA   6  
ATOM   11122 C C    . PRO A 1 50  ? -2.249  7.977   -0.251  1.00 0.00 ? 50  PRO A C    6  
ATOM   11123 O O    . PRO A 1 50  ? -1.698  8.841   -0.940  1.00 0.00 ? 50  PRO A O    6  
ATOM   11124 C CB   . PRO A 1 50  ? -4.495  9.076   -0.459  1.00 0.00 ? 50  PRO A CB   6  
ATOM   11125 C CG   . PRO A 1 50  ? -4.256  10.487  -0.056  1.00 0.00 ? 50  PRO A CG   6  
ATOM   11126 C CD   . PRO A 1 50  ? -4.002  10.447  1.425   1.00 0.00 ? 50  PRO A CD   6  
ATOM   11127 H HA   . PRO A 1 50  ? -4.052  7.319   0.701   1.00 0.00 ? 50  PRO A HA   6  
ATOM   11128 H HB2  . PRO A 1 50  ? -4.228  8.908   -1.492  1.00 0.00 ? 50  PRO A HB2  6  
ATOM   11129 H HB3  . PRO A 1 50  ? -5.522  8.785   -0.294  1.00 0.00 ? 50  PRO A HB3  6  
ATOM   11130 H HG2  . PRO A 1 50  ? -3.394  10.880  -0.577  1.00 0.00 ? 50  PRO A HG2  6  
ATOM   11131 H HG3  . PRO A 1 50  ? -5.131  11.081  -0.270  1.00 0.00 ? 50  PRO A HG3  6  
ATOM   11132 H HD2  . PRO A 1 50  ? -3.313  11.226  1.717   1.00 0.00 ? 50  PRO A HD2  6  
ATOM   11133 H HD3  . PRO A 1 50  ? -4.933  10.540  1.966   1.00 0.00 ? 50  PRO A HD3  6  
ATOM   11134 N N    . MET A 1 51  ? -1.736  6.773   -0.078  1.00 0.00 ? 51  MET A N    6  
ATOM   11135 C CA   . MET A 1 51  ? -0.463  6.405   -0.668  1.00 0.00 ? 51  MET A CA   6  
ATOM   11136 C C    . MET A 1 51  ? -0.571  5.080   -1.411  1.00 0.00 ? 51  MET A C    6  
ATOM   11137 O O    . MET A 1 51  ? -1.376  4.221   -1.054  1.00 0.00 ? 51  MET A O    6  
ATOM   11138 C CB   . MET A 1 51  ? 0.628   6.347   0.414   1.00 0.00 ? 51  MET A CB   6  
ATOM   11139 C CG   . MET A 1 51  ? 1.978   5.838   -0.088  1.00 0.00 ? 51  MET A CG   6  
ATOM   11140 S SD   . MET A 1 51  ? 2.532   6.698   -1.579  1.00 0.00 ? 51  MET A SD   6  
ATOM   11141 C CE   . MET A 1 51  ? 2.509   8.396   -1.028  1.00 0.00 ? 51  MET A CE   6  
ATOM   11142 H H    . MET A 1 51  ? -2.230  6.111   0.450   1.00 0.00 ? 51  MET A H    6  
ATOM   11143 H HA   . MET A 1 51  ? -0.208  7.178   -1.385  1.00 0.00 ? 51  MET A HA   6  
ATOM   11144 H HB2  . MET A 1 51  ? 0.772   7.342   0.809   1.00 0.00 ? 51  MET A HB2  6  
ATOM   11145 H HB3  . MET A 1 51  ? 0.292   5.700   1.218   1.00 0.00 ? 51  MET A HB3  6  
ATOM   11146 H HG2  . MET A 1 51  ? 2.720   5.978   0.690   1.00 0.00 ? 51  MET A HG2  6  
ATOM   11147 H HG3  . MET A 1 51  ? 1.892   4.783   -0.315  1.00 0.00 ? 51  MET A HG3  6  
ATOM   11148 H HE1  . MET A 1 51  ? 3.052   8.474   -0.105  1.00 0.00 ? 51  MET A HE1  6  
ATOM   11149 H HE2  . MET A 1 51  ? 1.488   8.712   -0.875  1.00 0.00 ? 51  MET A HE2  6  
ATOM   11150 H HE3  . MET A 1 51  ? 2.974   9.025   -1.775  1.00 0.00 ? 51  MET A HE3  6  
ATOM   11151 N N    . ASP A 1 52  ? 0.251   4.936   -2.445  1.00 0.00 ? 52  ASP A N    6  
ATOM   11152 C CA   . ASP A 1 52  ? 0.222   3.777   -3.327  1.00 0.00 ? 52  ASP A CA   6  
ATOM   11153 C C    . ASP A 1 52  ? 1.655   3.321   -3.581  1.00 0.00 ? 52  ASP A C    6  
ATOM   11154 O O    . ASP A 1 52  ? 2.558   4.154   -3.577  1.00 0.00 ? 52  ASP A O    6  
ATOM   11155 C CB   . ASP A 1 52  ? -0.448  4.144   -4.663  1.00 0.00 ? 52  ASP A CB   6  
ATOM   11156 C CG   . ASP A 1 52  ? -1.512  5.214   -4.505  1.00 0.00 ? 52  ASP A CG   6  
ATOM   11157 O OD1  . ASP A 1 52  ? -1.217  6.393   -4.818  1.00 0.00 ? 52  ASP A OD1  6  
ATOM   11158 O OD2  . ASP A 1 52  ? -2.629  4.895   -4.053  1.00 0.00 ? 52  ASP A OD2  6  
ATOM   11159 H H    . ASP A 1 52  ? 0.920   5.634   -2.611  1.00 0.00 ? 52  ASP A H    6  
ATOM   11160 H HA   . ASP A 1 52  ? -0.331  2.986   -2.841  1.00 0.00 ? 52  ASP A HA   6  
ATOM   11161 H HB2  . ASP A 1 52  ? 0.302   4.522   -5.347  1.00 0.00 ? 52  ASP A HB2  6  
ATOM   11162 H HB3  . ASP A 1 52  ? -0.910  3.262   -5.091  1.00 0.00 ? 52  ASP A HB3  6  
ATOM   11163 N N    . LEU A 1 53  ? 1.883   2.030   -3.791  1.00 0.00 ? 53  LEU A N    6  
ATOM   11164 C CA   . LEU A 1 53  ? 3.247   1.531   -4.003  1.00 0.00 ? 53  LEU A CA   6  
ATOM   11165 C C    . LEU A 1 53  ? 3.940   2.233   -5.169  1.00 0.00 ? 53  LEU A C    6  
ATOM   11166 O O    . LEU A 1 53  ? 5.111   2.607   -5.064  1.00 0.00 ? 53  LEU A O    6  
ATOM   11167 C CB   . LEU A 1 53  ? 3.243   0.022   -4.209  1.00 0.00 ? 53  LEU A CB   6  
ATOM   11168 C CG   . LEU A 1 53  ? 3.115   -0.787  -2.924  1.00 0.00 ? 53  LEU A CG   6  
ATOM   11169 C CD1  . LEU A 1 53  ? 2.840   -2.236  -3.248  1.00 0.00 ? 53  LEU A CD1  6  
ATOM   11170 C CD2  . LEU A 1 53  ? 4.373   -0.662  -2.085  1.00 0.00 ? 53  LEU A CD2  6  
ATOM   11171 H H    . LEU A 1 53  ? 1.128   1.395   -3.804  1.00 0.00 ? 53  LEU A H    6  
ATOM   11172 H HA   . LEU A 1 53  ? 3.805   1.745   -3.107  1.00 0.00 ? 53  LEU A HA   6  
ATOM   11173 H HB2  . LEU A 1 53  ? 2.415   -0.236  -4.857  1.00 0.00 ? 53  LEU A HB2  6  
ATOM   11174 H HB3  . LEU A 1 53  ? 4.164   -0.260  -4.698  1.00 0.00 ? 53  LEU A HB3  6  
ATOM   11175 H HG   . LEU A 1 53  ? 2.292   -0.401  -2.345  1.00 0.00 ? 53  LEU A HG   6  
ATOM   11176 H HD11 . LEU A 1 53  ? 2.050   -2.280  -3.973  1.00 0.00 ? 53  LEU A HD11 6  
ATOM   11177 H HD12 . LEU A 1 53  ? 2.539   -2.758  -2.352  1.00 0.00 ? 53  LEU A HD12 6  
ATOM   11178 H HD13 . LEU A 1 53  ? 3.729   -2.693  -3.655  1.00 0.00 ? 53  LEU A HD13 6  
ATOM   11179 H HD21 . LEU A 1 53  ? 4.478   0.358   -1.762  1.00 0.00 ? 53  LEU A HD21 6  
ATOM   11180 H HD22 . LEU A 1 53  ? 5.231   -0.945  -2.677  1.00 0.00 ? 53  LEU A HD22 6  
ATOM   11181 H HD23 . LEU A 1 53  ? 4.298   -1.308  -1.223  1.00 0.00 ? 53  LEU A HD23 6  
ATOM   11182 N N    . SER A 1 54  ? 3.215   2.437   -6.263  1.00 0.00 ? 54  SER A N    6  
ATOM   11183 C CA   . SER A 1 54  ? 3.769   3.135   -7.420  1.00 0.00 ? 54  SER A CA   6  
ATOM   11184 C C    . SER A 1 54  ? 4.157   4.572   -7.064  1.00 0.00 ? 54  SER A C    6  
ATOM   11185 O O    . SER A 1 54  ? 5.078   5.138   -7.653  1.00 0.00 ? 54  SER A O    6  
ATOM   11186 C CB   . SER A 1 54  ? 2.774   3.130   -8.580  1.00 0.00 ? 54  SER A CB   6  
ATOM   11187 O OG   . SER A 1 54  ? 2.485   1.804   -8.990  1.00 0.00 ? 54  SER A OG   6  
ATOM   11188 H H    . SER A 1 54  ? 2.292   2.107   -6.297  1.00 0.00 ? 54  SER A H    6  
ATOM   11189 H HA   . SER A 1 54  ? 4.658   2.603   -7.728  1.00 0.00 ? 54  SER A HA   6  
ATOM   11190 H HB2  . SER A 1 54  ? 1.855   3.607   -8.271  1.00 0.00 ? 54  SER A HB2  6  
ATOM   11191 H HB3  . SER A 1 54  ? 3.195   3.667   -9.414  1.00 0.00 ? 54  SER A HB3  6  
ATOM   11192 H HG   . SER A 1 54  ? 1.634   1.538   -8.616  1.00 0.00 ? 54  SER A HG   6  
ATOM   11193 N N    . THR A 1 55  ? 3.462   5.153   -6.092  1.00 0.00 ? 55  THR A N    6  
ATOM   11194 C CA   . THR A 1 55  ? 3.747   6.510   -5.654  1.00 0.00 ? 55  THR A CA   6  
ATOM   11195 C C    . THR A 1 55  ? 4.927   6.521   -4.688  1.00 0.00 ? 55  THR A C    6  
ATOM   11196 O O    . THR A 1 55  ? 5.740   7.446   -4.699  1.00 0.00 ? 55  THR A O    6  
ATOM   11197 C CB   . THR A 1 55  ? 2.521   7.147   -4.984  1.00 0.00 ? 55  THR A CB   6  
ATOM   11198 O OG1  . THR A 1 55  ? 1.335   6.751   -5.690  1.00 0.00 ? 55  THR A OG1  6  
ATOM   11199 C CG2  . THR A 1 55  ? 2.640   8.659   -5.006  1.00 0.00 ? 55  THR A CG2  6  
ATOM   11200 H H    . THR A 1 55  ? 2.740   4.657   -5.656  1.00 0.00 ? 55  THR A H    6  
ATOM   11201 H HA   . THR A 1 55  ? 4.002   7.099   -6.522  1.00 0.00 ? 55  THR A HA   6  
ATOM   11202 H HB   . THR A 1 55  ? 2.466   6.818   -3.956  1.00 0.00 ? 55  THR A HB   6  
ATOM   11203 H HG1  . THR A 1 55  ? 0.588   6.697   -5.073  1.00 0.00 ? 55  THR A HG1  6  
ATOM   11204 H HG21 . THR A 1 55  ? 3.616   8.937   -4.642  1.00 0.00 ? 55  THR A HG21 6  
ATOM   11205 H HG22 . THR A 1 55  ? 1.880   9.092   -4.370  1.00 0.00 ? 55  THR A HG22 6  
ATOM   11206 H HG23 . THR A 1 55  ? 2.516   9.018   -6.016  1.00 0.00 ? 55  THR A HG23 6  
ATOM   11207 N N    . VAL A 1 56  ? 5.025   5.478   -3.867  1.00 0.00 ? 56  VAL A N    6  
ATOM   11208 C CA   . VAL A 1 56  ? 6.171   5.310   -2.982  1.00 0.00 ? 56  VAL A CA   6  
ATOM   11209 C C    . VAL A 1 56  ? 7.436   5.190   -3.815  1.00 0.00 ? 56  VAL A C    6  
ATOM   11210 O O    . VAL A 1 56  ? 8.438   5.861   -3.563  1.00 0.00 ? 56  VAL A O    6  
ATOM   11211 C CB   . VAL A 1 56  ? 6.037   4.057   -2.088  1.00 0.00 ? 56  VAL A CB   6  
ATOM   11212 C CG1  . VAL A 1 56  ? 7.289   3.860   -1.247  1.00 0.00 ? 56  VAL A CG1  6  
ATOM   11213 C CG2  . VAL A 1 56  ? 4.818   4.165   -1.194  1.00 0.00 ? 56  VAL A CG2  6  
ATOM   11214 H H    . VAL A 1 56  ? 4.306   4.807   -3.855  1.00 0.00 ? 56  VAL A H    6  
ATOM   11215 H HA   . VAL A 1 56  ? 6.239   6.182   -2.349  1.00 0.00 ? 56  VAL A HA   6  
ATOM   11216 H HB   . VAL A 1 56  ? 5.914   3.191   -2.724  1.00 0.00 ? 56  VAL A HB   6  
ATOM   11217 H HG11 . VAL A 1 56  ? 8.150   3.776   -1.898  1.00 0.00 ? 56  VAL A HG11 6  
ATOM   11218 H HG12 . VAL A 1 56  ? 7.192   2.958   -0.661  1.00 0.00 ? 56  VAL A HG12 6  
ATOM   11219 H HG13 . VAL A 1 56  ? 7.417   4.706   -0.588  1.00 0.00 ? 56  VAL A HG13 6  
ATOM   11220 H HG21 . VAL A 1 56  ? 3.948   4.359   -1.801  1.00 0.00 ? 56  VAL A HG21 6  
ATOM   11221 H HG22 . VAL A 1 56  ? 4.956   4.975   -0.492  1.00 0.00 ? 56  VAL A HG22 6  
ATOM   11222 H HG23 . VAL A 1 56  ? 4.682   3.239   -0.654  1.00 0.00 ? 56  VAL A HG23 6  
ATOM   11223 N N    . LYS A 1 57  ? 7.362   4.345   -4.831  1.00 0.00 ? 57  LYS A N    6  
ATOM   11224 C CA   . LYS A 1 57  ? 8.473   4.130   -5.736  1.00 0.00 ? 57  LYS A CA   6  
ATOM   11225 C C    . LYS A 1 57  ? 8.789   5.414   -6.477  1.00 0.00 ? 57  LYS A C    6  
ATOM   11226 O O    . LYS A 1 57  ? 9.946   5.764   -6.659  1.00 0.00 ? 57  LYS A O    6  
ATOM   11227 C CB   . LYS A 1 57  ? 8.138   3.029   -6.737  1.00 0.00 ? 57  LYS A CB   6  
ATOM   11228 C CG   . LYS A 1 57  ? 9.247   2.005   -6.904  1.00 0.00 ? 57  LYS A CG   6  
ATOM   11229 C CD   . LYS A 1 57  ? 8.889   0.957   -7.941  1.00 0.00 ? 57  LYS A CD   6  
ATOM   11230 C CE   . LYS A 1 57  ? 9.904   -0.172  -7.955  1.00 0.00 ? 57  LYS A CE   6  
ATOM   11231 N NZ   . LYS A 1 57  ? 11.187  0.237   -8.584  1.00 0.00 ? 57  LYS A NZ   6  
ATOM   11232 H H    . LYS A 1 57  ? 6.528   3.849   -4.972  1.00 0.00 ? 57  LYS A H    6  
ATOM   11233 H HA   . LYS A 1 57  ? 9.330   3.832   -5.151  1.00 0.00 ? 57  LYS A HA   6  
ATOM   11234 H HB2  . LYS A 1 57  ? 7.249   2.517   -6.402  1.00 0.00 ? 57  LYS A HB2  6  
ATOM   11235 H HB3  . LYS A 1 57  ? 7.944   3.479   -7.698  1.00 0.00 ? 57  LYS A HB3  6  
ATOM   11236 H HG2  . LYS A 1 57  ? 10.148  2.509   -7.204  1.00 0.00 ? 57  LYS A HG2  6  
ATOM   11237 H HG3  . LYS A 1 57  ? 9.413   1.514   -5.961  1.00 0.00 ? 57  LYS A HG3  6  
ATOM   11238 H HD2  . LYS A 1 57  ? 7.915   0.553   -7.709  1.00 0.00 ? 57  LYS A HD2  6  
ATOM   11239 H HD3  . LYS A 1 57  ? 8.866   1.422   -8.916  1.00 0.00 ? 57  LYS A HD3  6  
ATOM   11240 H HE2  . LYS A 1 57  ? 10.094  -0.474  -6.934  1.00 0.00 ? 57  LYS A HE2  6  
ATOM   11241 H HE3  . LYS A 1 57  ? 9.490   -1.004  -8.504  1.00 0.00 ? 57  LYS A HE3  6  
ATOM   11242 H HZ1  . LYS A 1 57  ? 11.896  -0.515  -8.473  1.00 0.00 ? 57  LYS A HZ1  6  
ATOM   11243 H HZ2  . LYS A 1 57  ? 11.548  1.107   -8.146  1.00 0.00 ? 57  LYS A HZ2  6  
ATOM   11244 H HZ3  . LYS A 1 57  ? 11.044  0.409   -9.602  1.00 0.00 ? 57  LYS A HZ3  6  
ATOM   11245 N N    . ARG A 1 58  ? 7.737   6.107   -6.885  1.00 0.00 ? 58  ARG A N    6  
ATOM   11246 C CA   . ARG A 1 58  ? 7.860   7.387   -7.571  1.00 0.00 ? 58  ARG A CA   6  
ATOM   11247 C C    . ARG A 1 58  ? 8.669   8.380   -6.744  1.00 0.00 ? 58  ARG A C    6  
ATOM   11248 O O    . ARG A 1 58  ? 9.637   8.969   -7.226  1.00 0.00 ? 58  ARG A O    6  
ATOM   11249 C CB   . ARG A 1 58  ? 6.469   7.952   -7.831  1.00 0.00 ? 58  ARG A CB   6  
ATOM   11250 C CG   . ARG A 1 58  ? 6.472   9.253   -8.611  1.00 0.00 ? 58  ARG A CG   6  
ATOM   11251 C CD   . ARG A 1 58  ? 5.065   9.777   -8.821  1.00 0.00 ? 58  ARG A CD   6  
ATOM   11252 N NE   . ARG A 1 58  ? 5.060   11.015  -9.594  1.00 0.00 ? 58  ARG A NE   6  
ATOM   11253 C CZ   . ARG A 1 58  ? 4.116   11.343  -10.472 1.00 0.00 ? 58  ARG A CZ   6  
ATOM   11254 N NH1  . ARG A 1 58  ? 3.084   10.532  -10.686 1.00 0.00 ? 58  ARG A NH1  6  
ATOM   11255 N NH2  . ARG A 1 58  ? 4.201   12.491  -11.132 1.00 0.00 ? 58  ARG A NH2  6  
ATOM   11256 H H    . ARG A 1 58  ? 6.839   5.736   -6.731  1.00 0.00 ? 58  ARG A H    6  
ATOM   11257 H HA   . ARG A 1 58  ? 8.358   7.220   -8.513  1.00 0.00 ? 58  ARG A HA   6  
ATOM   11258 H HB2  . ARG A 1 58  ? 5.899   7.221   -8.380  1.00 0.00 ? 58  ARG A HB2  6  
ATOM   11259 H HB3  . ARG A 1 58  ? 5.984   8.128   -6.882  1.00 0.00 ? 58  ARG A HB3  6  
ATOM   11260 H HG2  . ARG A 1 58  ? 7.034   9.987   -8.062  1.00 0.00 ? 58  ARG A HG2  6  
ATOM   11261 H HG3  . ARG A 1 58  ? 6.933   9.089   -9.571  1.00 0.00 ? 58  ARG A HG3  6  
ATOM   11262 H HD2  . ARG A 1 58  ? 4.489   9.031   -9.347  1.00 0.00 ? 58  ARG A HD2  6  
ATOM   11263 H HD3  . ARG A 1 58  ? 4.620   9.964   -7.857  1.00 0.00 ? 58  ARG A HD3  6  
ATOM   11264 H HE   . ARG A 1 58  ? 5.808   11.639  -9.448  1.00 0.00 ? 58  ARG A HE   6  
ATOM   11265 H HH11 . ARG A 1 58  ? 3.010   9.668   -10.186 1.00 0.00 ? 58  ARG A HH11 6  
ATOM   11266 H HH12 . ARG A 1 58  ? 2.378   10.781  -11.352 1.00 0.00 ? 58  ARG A HH12 6  
ATOM   11267 H HH21 . ARG A 1 58  ? 4.974   13.110  -10.970 1.00 0.00 ? 58  ARG A HH21 6  
ATOM   11268 H HH22 . ARG A 1 58  ? 3.492   12.746  -11.795 1.00 0.00 ? 58  ARG A HH22 6  
ATOM   11269 N N    . LYS A 1 59  ? 8.271   8.550   -5.496  1.00 0.00 ? 59  LYS A N    6  
ATOM   11270 C CA   . LYS A 1 59  ? 8.929   9.490   -4.603  1.00 0.00 ? 59  LYS A CA   6  
ATOM   11271 C C    . LYS A 1 59  ? 10.317  8.975   -4.210  1.00 0.00 ? 59  LYS A C    6  
ATOM   11272 O O    . LYS A 1 59  ? 11.228  9.758   -3.932  1.00 0.00 ? 59  LYS A O    6  
ATOM   11273 C CB   . LYS A 1 59  ? 8.047   9.739   -3.376  1.00 0.00 ? 59  LYS A CB   6  
ATOM   11274 C CG   . LYS A 1 59  ? 6.717   10.401  -3.718  1.00 0.00 ? 59  LYS A CG   6  
ATOM   11275 C CD   . LYS A 1 59  ? 5.681   10.272  -2.600  1.00 0.00 ? 59  LYS A CD   6  
ATOM   11276 C CE   . LYS A 1 59  ? 6.188   10.797  -1.263  1.00 0.00 ? 59  LYS A CE   6  
ATOM   11277 N NZ   . LYS A 1 59  ? 6.672   9.700   -0.383  1.00 0.00 ? 59  LYS A NZ   6  
ATOM   11278 H H    . LYS A 1 59  ? 7.506   8.025   -5.162  1.00 0.00 ? 59  LYS A H    6  
ATOM   11279 H HA   . LYS A 1 59  ? 9.050   10.418  -5.140  1.00 0.00 ? 59  LYS A HA   6  
ATOM   11280 H HB2  . LYS A 1 59  ? 7.845   8.796   -2.890  1.00 0.00 ? 59  LYS A HB2  6  
ATOM   11281 H HB3  . LYS A 1 59  ? 8.577   10.385  -2.694  1.00 0.00 ? 59  LYS A HB3  6  
ATOM   11282 H HG2  . LYS A 1 59  ? 6.889   11.450  -3.908  1.00 0.00 ? 59  LYS A HG2  6  
ATOM   11283 H HG3  . LYS A 1 59  ? 6.322   9.938   -4.612  1.00 0.00 ? 59  LYS A HG3  6  
ATOM   11284 H HD2