data_5UH6
# 
_entry.id   5UH6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5UH6         
WWPDB D_1000225864 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5UH7 unspecified 
PDB . 5UH8 unspecified 
PDB . 5UHA unspecified 
PDB . 5UHB unspecified 
PDB . 5UHC unspecified 
PDB . 5UHD unspecified 
PDB . 5UHE unspecified 
PDB . 5UHF unspecified 
PDB . 5UHG unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5UH6 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lin, W.'       1 ? 
'Das, K.'       2 ? 
'Feng, Y.'      3 ? 
'Ebright, R.H.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            66 
_citation.language                  ? 
_citation.page_first                169 
_citation.page_last                 179.e8 
_citation.title                     'Structural Basis of Mycobacterium tuberculosis Transcription and Transcription Inhibition.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2017.03.001 
_citation.pdbx_database_id_PubMed   28392175 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lin, W.'       1  
primary 'Mandal, S.'    2  
primary 'Degen, D.'     3  
primary 'Liu, Y.'       4  
primary 'Ebright, Y.W.' 5  
primary 'Li, S.'        6  
primary 'Feng, Y.'      7  
primary 'Zhang, Y.'     8  
primary 'Mandal, S.'    9  
primary 'Jiang, Y.'     10 
primary 'Liu, S.'       11 
primary 'Gigliotti, M.' 12 
primary 'Talaue, M.'    13 
primary 'Connell, N.'   14 
primary 'Das, K.'       15 
primary 'Arnold, E.'    16 
primary 'Ebright, R.H.' 17 
# 
_cell.length_a           153.236 
_cell.length_b           164.889 
_cell.length_c           199.969 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5UH6 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         5UH6 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed RNA polymerase subunit alpha'                                           37745.328  2 2.7.7.6 ? ? 
? 
2  polymer     man 'DNA-directed RNA polymerase subunit beta'                                            130018.828 1 2.7.7.6 ? ? 
? 
3  polymer     man 
;DNA-directed RNA polymerase subunit beta'
;
146968.969 1 2.7.7.6 ? ? ? 
4  polymer     man 'DNA-directed RNA polymerase subunit omega'                                           11851.140  1 2.7.7.6 ? ? 
? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                                    57877.160  1 ?       ? ? 
? 
6  polymer     syn 
;DNA (5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*G)-3')
;
7160.632   1 ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*CP*AP*GP*G)-3')
;
4899.180   1 ?       ? ? ? 
8  polymer     syn 
;RNA (5'-R(*GP*A)-3')
;
629.454    1 ?       ? ? ? 
9  non-polymer syn RIFAMPICIN                                                                            822.940    1 ?       ? ? 
? 
10 non-polymer syn 'ZINC ION'                                                                            65.409     2 ?       ? ? 
? 
11 non-polymer syn 'MAGNESIUM ION'                                                                       24.305     1 ?       ? ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
5 Sigma-A                                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
A,B ? 
2 'polypeptide(L)'        no no 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
C   ? 
3 'polypeptide(L)'        no no 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
D   ? 
4 'polypeptide(L)'        no no 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
E   ? 
5 'polypeptide(L)'        no no 
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
F   ? 
6 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)
;
TATAATGGGAGCTGTCACGGATG H   ? 
7 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DC)(DA)(DG)(DG)' CATCCGTGAGTCCAGG G   ? 
8 polyribonucleotide      no no GA GA I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ILE n 
1 4    SER n 
1 5    GLN n 
1 6    ARG n 
1 7    PRO n 
1 8    THR n 
1 9    LEU n 
1 10   SER n 
1 11   GLU n 
1 12   ASP n 
1 13   VAL n 
1 14   LEU n 
1 15   THR n 
1 16   ASP n 
1 17   ASN n 
1 18   ARG n 
1 19   SER n 
1 20   GLN n 
1 21   PHE n 
1 22   VAL n 
1 23   ILE n 
1 24   GLU n 
1 25   PRO n 
1 26   LEU n 
1 27   GLU n 
1 28   PRO n 
1 29   GLY n 
1 30   PHE n 
1 31   GLY n 
1 32   TYR n 
1 33   THR n 
1 34   LEU n 
1 35   GLY n 
1 36   ASN n 
1 37   SER n 
1 38   LEU n 
1 39   ARG n 
1 40   ARG n 
1 41   THR n 
1 42   LEU n 
1 43   LEU n 
1 44   SER n 
1 45   SER n 
1 46   ILE n 
1 47   PRO n 
1 48   GLY n 
1 49   ALA n 
1 50   ALA n 
1 51   VAL n 
1 52   THR n 
1 53   SER n 
1 54   ILE n 
1 55   ARG n 
1 56   ILE n 
1 57   ASP n 
1 58   GLY n 
1 59   VAL n 
1 60   LEU n 
1 61   HIS n 
1 62   GLU n 
1 63   PHE n 
1 64   THR n 
1 65   THR n 
1 66   VAL n 
1 67   PRO n 
1 68   GLY n 
1 69   VAL n 
1 70   LYS n 
1 71   GLU n 
1 72   ASP n 
1 73   VAL n 
1 74   THR n 
1 75   GLU n 
1 76   ILE n 
1 77   ILE n 
1 78   LEU n 
1 79   ASN n 
1 80   LEU n 
1 81   LYS n 
1 82   SER n 
1 83   LEU n 
1 84   VAL n 
1 85   VAL n 
1 86   SER n 
1 87   SER n 
1 88   GLU n 
1 89   GLU n 
1 90   ASP n 
1 91   GLU n 
1 92   PRO n 
1 93   VAL n 
1 94   THR n 
1 95   MET n 
1 96   TYR n 
1 97   LEU n 
1 98   ARG n 
1 99   LYS n 
1 100  GLN n 
1 101  GLY n 
1 102  PRO n 
1 103  GLY n 
1 104  GLU n 
1 105  VAL n 
1 106  THR n 
1 107  ALA n 
1 108  GLY n 
1 109  ASP n 
1 110  ILE n 
1 111  VAL n 
1 112  PRO n 
1 113  PRO n 
1 114  ALA n 
1 115  GLY n 
1 116  VAL n 
1 117  THR n 
1 118  VAL n 
1 119  HIS n 
1 120  ASN n 
1 121  PRO n 
1 122  GLY n 
1 123  MET n 
1 124  HIS n 
1 125  ILE n 
1 126  ALA n 
1 127  THR n 
1 128  LEU n 
1 129  ASN n 
1 130  ASP n 
1 131  LYS n 
1 132  GLY n 
1 133  LYS n 
1 134  LEU n 
1 135  GLU n 
1 136  VAL n 
1 137  GLU n 
1 138  LEU n 
1 139  VAL n 
1 140  VAL n 
1 141  GLU n 
1 142  ARG n 
1 143  GLY n 
1 144  ARG n 
1 145  GLY n 
1 146  TYR n 
1 147  VAL n 
1 148  PRO n 
1 149  ALA n 
1 150  VAL n 
1 151  GLN n 
1 152  ASN n 
1 153  ARG n 
1 154  ALA n 
1 155  SER n 
1 156  GLY n 
1 157  ALA n 
1 158  GLU n 
1 159  ILE n 
1 160  GLY n 
1 161  ARG n 
1 162  ILE n 
1 163  PRO n 
1 164  VAL n 
1 165  ASP n 
1 166  SER n 
1 167  ILE n 
1 168  TYR n 
1 169  SER n 
1 170  PRO n 
1 171  VAL n 
1 172  LEU n 
1 173  LYS n 
1 174  VAL n 
1 175  THR n 
1 176  TYR n 
1 177  LYS n 
1 178  VAL n 
1 179  ASP n 
1 180  ALA n 
1 181  THR n 
1 182  ARG n 
1 183  VAL n 
1 184  GLU n 
1 185  GLN n 
1 186  ARG n 
1 187  THR n 
1 188  ASP n 
1 189  PHE n 
1 190  ASP n 
1 191  LYS n 
1 192  LEU n 
1 193  ILE n 
1 194  LEU n 
1 195  ASP n 
1 196  VAL n 
1 197  GLU n 
1 198  THR n 
1 199  LYS n 
1 200  ASN n 
1 201  SER n 
1 202  ILE n 
1 203  SER n 
1 204  PRO n 
1 205  ARG n 
1 206  ASP n 
1 207  ALA n 
1 208  LEU n 
1 209  ALA n 
1 210  SER n 
1 211  ALA n 
1 212  GLY n 
1 213  LYS n 
1 214  THR n 
1 215  LEU n 
1 216  VAL n 
1 217  GLU n 
1 218  LEU n 
1 219  PHE n 
1 220  GLY n 
1 221  LEU n 
1 222  ALA n 
1 223  ARG n 
1 224  GLU n 
1 225  LEU n 
1 226  ASN n 
1 227  VAL n 
1 228  GLU n 
1 229  ALA n 
1 230  GLU n 
1 231  GLY n 
1 232  ILE n 
1 233  GLU n 
1 234  ILE n 
1 235  GLY n 
1 236  PRO n 
1 237  SER n 
1 238  PRO n 
1 239  ALA n 
1 240  GLU n 
1 241  ALA n 
1 242  ASP n 
1 243  HIS n 
1 244  ILE n 
1 245  ALA n 
1 246  SER n 
1 247  PHE n 
1 248  ALA n 
1 249  LEU n 
1 250  PRO n 
1 251  ILE n 
1 252  ASP n 
1 253  ASP n 
1 254  LEU n 
1 255  ASP n 
1 256  LEU n 
1 257  THR n 
1 258  VAL n 
1 259  ARG n 
1 260  SER n 
1 261  TYR n 
1 262  ASN n 
1 263  CYS n 
1 264  LEU n 
1 265  LYS n 
1 266  ARG n 
1 267  GLU n 
1 268  GLY n 
1 269  VAL n 
1 270  HIS n 
1 271  THR n 
1 272  VAL n 
1 273  GLY n 
1 274  GLU n 
1 275  LEU n 
1 276  VAL n 
1 277  ALA n 
1 278  ARG n 
1 279  THR n 
1 280  GLU n 
1 281  SER n 
1 282  ASP n 
1 283  LEU n 
1 284  LEU n 
1 285  ASP n 
1 286  ILE n 
1 287  ARG n 
1 288  ASN n 
1 289  PHE n 
1 290  GLY n 
1 291  GLN n 
1 292  LYS n 
1 293  SER n 
1 294  ILE n 
1 295  ASP n 
1 296  GLU n 
1 297  VAL n 
1 298  LYS n 
1 299  ILE n 
1 300  LYS n 
1 301  LEU n 
1 302  HIS n 
1 303  GLN n 
1 304  LEU n 
1 305  GLY n 
1 306  LEU n 
1 307  SER n 
1 308  LEU n 
1 309  LYS n 
1 310  ASP n 
1 311  SER n 
1 312  PRO n 
1 313  PRO n 
1 314  SER n 
1 315  PHE n 
1 316  ASP n 
1 317  PRO n 
1 318  SER n 
1 319  GLU n 
1 320  VAL n 
1 321  ALA n 
1 322  GLY n 
1 323  TYR n 
1 324  ASP n 
1 325  VAL n 
1 326  ALA n 
1 327  THR n 
1 328  GLY n 
1 329  THR n 
1 330  TRP n 
1 331  SER n 
1 332  THR n 
1 333  GLU n 
1 334  GLY n 
1 335  ALA n 
1 336  TYR n 
1 337  ASP n 
1 338  GLU n 
1 339  GLN n 
1 340  ASP n 
1 341  TYR n 
1 342  ALA n 
1 343  GLU n 
1 344  THR n 
1 345  GLU n 
1 346  GLN n 
1 347  LEU n 
2 1    MET n 
2 2    LEU n 
2 3    GLU n 
2 4    GLY n 
2 5    CYS n 
2 6    ILE n 
2 7    LEU n 
2 8    ALA n 
2 9    ASP n 
2 10   SER n 
2 11   ARG n 
2 12   GLN n 
2 13   SER n 
2 14   LYS n 
2 15   THR n 
2 16   ALA n 
2 17   ALA n 
2 18   SER n 
2 19   PRO n 
2 20   SER n 
2 21   PRO n 
2 22   SER n 
2 23   ARG n 
2 24   PRO n 
2 25   GLN n 
2 26   SER n 
2 27   SER n 
2 28   SER n 
2 29   ASN n 
2 30   ASN n 
2 31   SER n 
2 32   VAL n 
2 33   PRO n 
2 34   GLY n 
2 35   ALA n 
2 36   PRO n 
2 37   ASN n 
2 38   ARG n 
2 39   VAL n 
2 40   SER n 
2 41   PHE n 
2 42   ALA n 
2 43   LYS n 
2 44   LEU n 
2 45   ARG n 
2 46   GLU n 
2 47   PRO n 
2 48   LEU n 
2 49   GLU n 
2 50   VAL n 
2 51   PRO n 
2 52   GLY n 
2 53   LEU n 
2 54   LEU n 
2 55   ASP n 
2 56   VAL n 
2 57   GLN n 
2 58   THR n 
2 59   ASP n 
2 60   SER n 
2 61   PHE n 
2 62   GLU n 
2 63   TRP n 
2 64   LEU n 
2 65   ILE n 
2 66   GLY n 
2 67   SER n 
2 68   PRO n 
2 69   ARG n 
2 70   TRP n 
2 71   ARG n 
2 72   GLU n 
2 73   SER n 
2 74   ALA n 
2 75   ALA n 
2 76   GLU n 
2 77   ARG n 
2 78   GLY n 
2 79   ASP n 
2 80   VAL n 
2 81   ASN n 
2 82   PRO n 
2 83   VAL n 
2 84   GLY n 
2 85   GLY n 
2 86   LEU n 
2 87   GLU n 
2 88   GLU n 
2 89   VAL n 
2 90   LEU n 
2 91   TYR n 
2 92   GLU n 
2 93   LEU n 
2 94   SER n 
2 95   PRO n 
2 96   ILE n 
2 97   GLU n 
2 98   ASP n 
2 99   PHE n 
2 100  SER n 
2 101  GLY n 
2 102  SER n 
2 103  MET n 
2 104  SER n 
2 105  LEU n 
2 106  SER n 
2 107  PHE n 
2 108  SER n 
2 109  ASP n 
2 110  PRO n 
2 111  ARG n 
2 112  PHE n 
2 113  ASP n 
2 114  ASP n 
2 115  VAL n 
2 116  LYS n 
2 117  ALA n 
2 118  PRO n 
2 119  VAL n 
2 120  ASP n 
2 121  GLU n 
2 122  CYS n 
2 123  LYS n 
2 124  ASP n 
2 125  LYS n 
2 126  ASP n 
2 127  MET n 
2 128  THR n 
2 129  TYR n 
2 130  ALA n 
2 131  ALA n 
2 132  PRO n 
2 133  LEU n 
2 134  PHE n 
2 135  VAL n 
2 136  THR n 
2 137  ALA n 
2 138  GLU n 
2 139  PHE n 
2 140  ILE n 
2 141  ASN n 
2 142  ASN n 
2 143  ASN n 
2 144  THR n 
2 145  GLY n 
2 146  GLU n 
2 147  ILE n 
2 148  LYS n 
2 149  SER n 
2 150  GLN n 
2 151  THR n 
2 152  VAL n 
2 153  PHE n 
2 154  MET n 
2 155  GLY n 
2 156  ASP n 
2 157  PHE n 
2 158  PRO n 
2 159  MET n 
2 160  MET n 
2 161  THR n 
2 162  GLU n 
2 163  LYS n 
2 164  GLY n 
2 165  THR n 
2 166  PHE n 
2 167  ILE n 
2 168  ILE n 
2 169  ASN n 
2 170  GLY n 
2 171  THR n 
2 172  GLU n 
2 173  ARG n 
2 174  VAL n 
2 175  VAL n 
2 176  VAL n 
2 177  SER n 
2 178  GLN n 
2 179  LEU n 
2 180  VAL n 
2 181  ARG n 
2 182  SER n 
2 183  PRO n 
2 184  GLY n 
2 185  VAL n 
2 186  TYR n 
2 187  PHE n 
2 188  ASP n 
2 189  GLU n 
2 190  THR n 
2 191  ILE n 
2 192  ASP n 
2 193  LYS n 
2 194  SER n 
2 195  THR n 
2 196  ASP n 
2 197  LYS n 
2 198  THR n 
2 199  LEU n 
2 200  HIS n 
2 201  SER n 
2 202  VAL n 
2 203  LYS n 
2 204  VAL n 
2 205  ILE n 
2 206  PRO n 
2 207  SER n 
2 208  ARG n 
2 209  GLY n 
2 210  ALA n 
2 211  TRP n 
2 212  LEU n 
2 213  GLU n 
2 214  PHE n 
2 215  ASP n 
2 216  VAL n 
2 217  ASP n 
2 218  LYS n 
2 219  ARG n 
2 220  ASP n 
2 221  THR n 
2 222  VAL n 
2 223  GLY n 
2 224  VAL n 
2 225  ARG n 
2 226  ILE n 
2 227  ASP n 
2 228  ARG n 
2 229  LYS n 
2 230  ARG n 
2 231  ARG n 
2 232  GLN n 
2 233  PRO n 
2 234  VAL n 
2 235  THR n 
2 236  VAL n 
2 237  LEU n 
2 238  LEU n 
2 239  LYS n 
2 240  ALA n 
2 241  LEU n 
2 242  GLY n 
2 243  TRP n 
2 244  THR n 
2 245  SER n 
2 246  GLU n 
2 247  GLN n 
2 248  ILE n 
2 249  VAL n 
2 250  GLU n 
2 251  ARG n 
2 252  PHE n 
2 253  GLY n 
2 254  PHE n 
2 255  SER n 
2 256  GLU n 
2 257  ILE n 
2 258  MET n 
2 259  ARG n 
2 260  SER n 
2 261  THR n 
2 262  LEU n 
2 263  GLU n 
2 264  LYS n 
2 265  ASP n 
2 266  ASN n 
2 267  THR n 
2 268  VAL n 
2 269  GLY n 
2 270  THR n 
2 271  ASP n 
2 272  GLU n 
2 273  ALA n 
2 274  LEU n 
2 275  LEU n 
2 276  ASP n 
2 277  ILE n 
2 278  TYR n 
2 279  ARG n 
2 280  LYS n 
2 281  LEU n 
2 282  ARG n 
2 283  PRO n 
2 284  GLY n 
2 285  GLU n 
2 286  PRO n 
2 287  PRO n 
2 288  THR n 
2 289  LYS n 
2 290  GLU n 
2 291  SER n 
2 292  ALA n 
2 293  GLN n 
2 294  THR n 
2 295  LEU n 
2 296  LEU n 
2 297  GLU n 
2 298  ASN n 
2 299  LEU n 
2 300  PHE n 
2 301  PHE n 
2 302  LYS n 
2 303  GLU n 
2 304  LYS n 
2 305  ARG n 
2 306  TYR n 
2 307  ASP n 
2 308  LEU n 
2 309  ALA n 
2 310  ARG n 
2 311  VAL n 
2 312  GLY n 
2 313  ARG n 
2 314  TYR n 
2 315  LYS n 
2 316  VAL n 
2 317  ASN n 
2 318  LYS n 
2 319  LYS n 
2 320  LEU n 
2 321  GLY n 
2 322  LEU n 
2 323  HIS n 
2 324  VAL n 
2 325  GLY n 
2 326  GLU n 
2 327  PRO n 
2 328  ILE n 
2 329  THR n 
2 330  SER n 
2 331  SER n 
2 332  THR n 
2 333  LEU n 
2 334  THR n 
2 335  GLU n 
2 336  GLU n 
2 337  ASP n 
2 338  VAL n 
2 339  VAL n 
2 340  ALA n 
2 341  THR n 
2 342  ILE n 
2 343  GLU n 
2 344  TYR n 
2 345  LEU n 
2 346  VAL n 
2 347  ARG n 
2 348  LEU n 
2 349  HIS n 
2 350  GLU n 
2 351  GLY n 
2 352  GLN n 
2 353  THR n 
2 354  THR n 
2 355  MET n 
2 356  THR n 
2 357  VAL n 
2 358  PRO n 
2 359  GLY n 
2 360  GLY n 
2 361  VAL n 
2 362  GLU n 
2 363  VAL n 
2 364  PRO n 
2 365  VAL n 
2 366  GLU n 
2 367  THR n 
2 368  ASP n 
2 369  ASP n 
2 370  ILE n 
2 371  ASP n 
2 372  HIS n 
2 373  PHE n 
2 374  GLY n 
2 375  ASN n 
2 376  ARG n 
2 377  ARG n 
2 378  LEU n 
2 379  ARG n 
2 380  THR n 
2 381  VAL n 
2 382  GLY n 
2 383  GLU n 
2 384  LEU n 
2 385  ILE n 
2 386  GLN n 
2 387  ASN n 
2 388  GLN n 
2 389  ILE n 
2 390  ARG n 
2 391  VAL n 
2 392  GLY n 
2 393  MET n 
2 394  SER n 
2 395  ARG n 
2 396  MET n 
2 397  GLU n 
2 398  ARG n 
2 399  VAL n 
2 400  VAL n 
2 401  ARG n 
2 402  GLU n 
2 403  ARG n 
2 404  MET n 
2 405  THR n 
2 406  THR n 
2 407  GLN n 
2 408  ASP n 
2 409  VAL n 
2 410  GLU n 
2 411  ALA n 
2 412  ILE n 
2 413  THR n 
2 414  PRO n 
2 415  GLN n 
2 416  THR n 
2 417  LEU n 
2 418  ILE n 
2 419  ASN n 
2 420  ILE n 
2 421  ARG n 
2 422  PRO n 
2 423  VAL n 
2 424  VAL n 
2 425  ALA n 
2 426  ALA n 
2 427  ILE n 
2 428  LYS n 
2 429  GLU n 
2 430  PHE n 
2 431  PHE n 
2 432  GLY n 
2 433  THR n 
2 434  SER n 
2 435  GLN n 
2 436  LEU n 
2 437  SER n 
2 438  GLN n 
2 439  PHE n 
2 440  MET n 
2 441  ASP n 
2 442  GLN n 
2 443  ASN n 
2 444  ASN n 
2 445  PRO n 
2 446  LEU n 
2 447  SER n 
2 448  GLY n 
2 449  LEU n 
2 450  THR n 
2 451  HIS n 
2 452  LYS n 
2 453  ARG n 
2 454  ARG n 
2 455  LEU n 
2 456  SER n 
2 457  ALA n 
2 458  LEU n 
2 459  GLY n 
2 460  PRO n 
2 461  GLY n 
2 462  GLY n 
2 463  LEU n 
2 464  SER n 
2 465  ARG n 
2 466  GLU n 
2 467  ARG n 
2 468  ALA n 
2 469  GLY n 
2 470  LEU n 
2 471  GLU n 
2 472  VAL n 
2 473  ARG n 
2 474  ASP n 
2 475  VAL n 
2 476  HIS n 
2 477  PRO n 
2 478  SER n 
2 479  HIS n 
2 480  TYR n 
2 481  GLY n 
2 482  ARG n 
2 483  MET n 
2 484  CYS n 
2 485  PRO n 
2 486  ILE n 
2 487  GLU n 
2 488  THR n 
2 489  PRO n 
2 490  GLU n 
2 491  GLY n 
2 492  PRO n 
2 493  ASN n 
2 494  ILE n 
2 495  GLY n 
2 496  LEU n 
2 497  ILE n 
2 498  GLY n 
2 499  SER n 
2 500  LEU n 
2 501  SER n 
2 502  VAL n 
2 503  TYR n 
2 504  ALA n 
2 505  ARG n 
2 506  VAL n 
2 507  ASN n 
2 508  PRO n 
2 509  PHE n 
2 510  GLY n 
2 511  PHE n 
2 512  ILE n 
2 513  GLU n 
2 514  THR n 
2 515  PRO n 
2 516  TYR n 
2 517  ARG n 
2 518  LYS n 
2 519  VAL n 
2 520  VAL n 
2 521  ASP n 
2 522  GLY n 
2 523  VAL n 
2 524  VAL n 
2 525  SER n 
2 526  ASP n 
2 527  GLU n 
2 528  ILE n 
2 529  VAL n 
2 530  TYR n 
2 531  LEU n 
2 532  THR n 
2 533  ALA n 
2 534  ASP n 
2 535  GLU n 
2 536  GLU n 
2 537  ASP n 
2 538  ARG n 
2 539  HIS n 
2 540  VAL n 
2 541  VAL n 
2 542  ALA n 
2 543  GLN n 
2 544  ALA n 
2 545  ASN n 
2 546  SER n 
2 547  PRO n 
2 548  ILE n 
2 549  ASP n 
2 550  ALA n 
2 551  ASP n 
2 552  GLY n 
2 553  ARG n 
2 554  PHE n 
2 555  VAL n 
2 556  GLU n 
2 557  PRO n 
2 558  ARG n 
2 559  VAL n 
2 560  LEU n 
2 561  VAL n 
2 562  ARG n 
2 563  ARG n 
2 564  LYS n 
2 565  ALA n 
2 566  GLY n 
2 567  GLU n 
2 568  VAL n 
2 569  GLU n 
2 570  TYR n 
2 571  VAL n 
2 572  PRO n 
2 573  SER n 
2 574  SER n 
2 575  GLU n 
2 576  VAL n 
2 577  ASP n 
2 578  TYR n 
2 579  MET n 
2 580  ASP n 
2 581  VAL n 
2 582  SER n 
2 583  PRO n 
2 584  ARG n 
2 585  GLN n 
2 586  MET n 
2 587  VAL n 
2 588  SER n 
2 589  VAL n 
2 590  ALA n 
2 591  THR n 
2 592  ALA n 
2 593  MET n 
2 594  ILE n 
2 595  PRO n 
2 596  PHE n 
2 597  LEU n 
2 598  GLU n 
2 599  HIS n 
2 600  ASP n 
2 601  ASP n 
2 602  ALA n 
2 603  ASN n 
2 604  ARG n 
2 605  ALA n 
2 606  LEU n 
2 607  MET n 
2 608  GLY n 
2 609  ALA n 
2 610  ASN n 
2 611  MET n 
2 612  GLN n 
2 613  ARG n 
2 614  GLN n 
2 615  ALA n 
2 616  VAL n 
2 617  PRO n 
2 618  LEU n 
2 619  VAL n 
2 620  ARG n 
2 621  SER n 
2 622  GLU n 
2 623  ALA n 
2 624  PRO n 
2 625  LEU n 
2 626  VAL n 
2 627  GLY n 
2 628  THR n 
2 629  GLY n 
2 630  MET n 
2 631  GLU n 
2 632  LEU n 
2 633  ARG n 
2 634  ALA n 
2 635  ALA n 
2 636  ILE n 
2 637  ASP n 
2 638  ALA n 
2 639  GLY n 
2 640  ASP n 
2 641  VAL n 
2 642  VAL n 
2 643  VAL n 
2 644  ALA n 
2 645  GLU n 
2 646  GLU n 
2 647  SER n 
2 648  GLY n 
2 649  VAL n 
2 650  ILE n 
2 651  GLU n 
2 652  GLU n 
2 653  VAL n 
2 654  SER n 
2 655  ALA n 
2 656  ASP n 
2 657  TYR n 
2 658  ILE n 
2 659  THR n 
2 660  VAL n 
2 661  MET n 
2 662  HIS n 
2 663  ASP n 
2 664  ASN n 
2 665  GLY n 
2 666  THR n 
2 667  ARG n 
2 668  ARG n 
2 669  THR n 
2 670  TYR n 
2 671  ARG n 
2 672  MET n 
2 673  ARG n 
2 674  LYS n 
2 675  PHE n 
2 676  ALA n 
2 677  ARG n 
2 678  SER n 
2 679  ASN n 
2 680  HIS n 
2 681  GLY n 
2 682  THR n 
2 683  CYS n 
2 684  ALA n 
2 685  ASN n 
2 686  GLN n 
2 687  CYS n 
2 688  PRO n 
2 689  ILE n 
2 690  VAL n 
2 691  ASP n 
2 692  ALA n 
2 693  GLY n 
2 694  ASP n 
2 695  ARG n 
2 696  VAL n 
2 697  GLU n 
2 698  ALA n 
2 699  GLY n 
2 700  GLN n 
2 701  VAL n 
2 702  ILE n 
2 703  ALA n 
2 704  ASP n 
2 705  GLY n 
2 706  PRO n 
2 707  CYS n 
2 708  THR n 
2 709  ASP n 
2 710  ASP n 
2 711  GLY n 
2 712  GLU n 
2 713  MET n 
2 714  ALA n 
2 715  LEU n 
2 716  GLY n 
2 717  LYS n 
2 718  ASN n 
2 719  LEU n 
2 720  LEU n 
2 721  VAL n 
2 722  ALA n 
2 723  ILE n 
2 724  MET n 
2 725  PRO n 
2 726  TRP n 
2 727  GLU n 
2 728  GLY n 
2 729  HIS n 
2 730  ASN n 
2 731  TYR n 
2 732  GLU n 
2 733  ASP n 
2 734  ALA n 
2 735  ILE n 
2 736  ILE n 
2 737  LEU n 
2 738  SER n 
2 739  ASN n 
2 740  ARG n 
2 741  LEU n 
2 742  VAL n 
2 743  GLU n 
2 744  GLU n 
2 745  ASP n 
2 746  VAL n 
2 747  LEU n 
2 748  THR n 
2 749  SER n 
2 750  ILE n 
2 751  HIS n 
2 752  ILE n 
2 753  GLU n 
2 754  GLU n 
2 755  HIS n 
2 756  GLU n 
2 757  ILE n 
2 758  ASP n 
2 759  ALA n 
2 760  ARG n 
2 761  ASP n 
2 762  THR n 
2 763  LYS n 
2 764  LEU n 
2 765  GLY n 
2 766  ALA n 
2 767  GLU n 
2 768  GLU n 
2 769  ILE n 
2 770  THR n 
2 771  ARG n 
2 772  ASP n 
2 773  ILE n 
2 774  PRO n 
2 775  ASN n 
2 776  ILE n 
2 777  SER n 
2 778  ASP n 
2 779  GLU n 
2 780  VAL n 
2 781  LEU n 
2 782  ALA n 
2 783  ASP n 
2 784  LEU n 
2 785  ASP n 
2 786  GLU n 
2 787  ARG n 
2 788  GLY n 
2 789  ILE n 
2 790  VAL n 
2 791  ARG n 
2 792  ILE n 
2 793  GLY n 
2 794  ALA n 
2 795  GLU n 
2 796  VAL n 
2 797  ARG n 
2 798  ASP n 
2 799  GLY n 
2 800  ASP n 
2 801  ILE n 
2 802  LEU n 
2 803  VAL n 
2 804  GLY n 
2 805  LYS n 
2 806  VAL n 
2 807  THR n 
2 808  PRO n 
2 809  LYS n 
2 810  GLY n 
2 811  GLU n 
2 812  THR n 
2 813  GLU n 
2 814  LEU n 
2 815  THR n 
2 816  PRO n 
2 817  GLU n 
2 818  GLU n 
2 819  ARG n 
2 820  LEU n 
2 821  LEU n 
2 822  ARG n 
2 823  ALA n 
2 824  ILE n 
2 825  PHE n 
2 826  GLY n 
2 827  GLU n 
2 828  LYS n 
2 829  ALA n 
2 830  ARG n 
2 831  GLU n 
2 832  VAL n 
2 833  ARG n 
2 834  ASP n 
2 835  THR n 
2 836  SER n 
2 837  LEU n 
2 838  LYS n 
2 839  VAL n 
2 840  PRO n 
2 841  HIS n 
2 842  GLY n 
2 843  GLU n 
2 844  SER n 
2 845  GLY n 
2 846  LYS n 
2 847  VAL n 
2 848  ILE n 
2 849  GLY n 
2 850  ILE n 
2 851  ARG n 
2 852  VAL n 
2 853  PHE n 
2 854  SER n 
2 855  ARG n 
2 856  GLU n 
2 857  ASP n 
2 858  GLU n 
2 859  ASP n 
2 860  GLU n 
2 861  LEU n 
2 862  PRO n 
2 863  ALA n 
2 864  GLY n 
2 865  VAL n 
2 866  ASN n 
2 867  GLU n 
2 868  LEU n 
2 869  VAL n 
2 870  ARG n 
2 871  VAL n 
2 872  TYR n 
2 873  VAL n 
2 874  ALA n 
2 875  GLN n 
2 876  LYS n 
2 877  ARG n 
2 878  LYS n 
2 879  ILE n 
2 880  SER n 
2 881  ASP n 
2 882  GLY n 
2 883  ASP n 
2 884  LYS n 
2 885  LEU n 
2 886  ALA n 
2 887  GLY n 
2 888  ARG n 
2 889  HIS n 
2 890  GLY n 
2 891  ASN n 
2 892  LYS n 
2 893  GLY n 
2 894  VAL n 
2 895  ILE n 
2 896  GLY n 
2 897  LYS n 
2 898  ILE n 
2 899  LEU n 
2 900  PRO n 
2 901  VAL n 
2 902  GLU n 
2 903  ASP n 
2 904  MET n 
2 905  PRO n 
2 906  PHE n 
2 907  LEU n 
2 908  ALA n 
2 909  ASP n 
2 910  GLY n 
2 911  THR n 
2 912  PRO n 
2 913  VAL n 
2 914  ASP n 
2 915  ILE n 
2 916  ILE n 
2 917  LEU n 
2 918  ASN n 
2 919  THR n 
2 920  HIS n 
2 921  GLY n 
2 922  VAL n 
2 923  PRO n 
2 924  ARG n 
2 925  ARG n 
2 926  MET n 
2 927  ASN n 
2 928  ILE n 
2 929  GLY n 
2 930  GLN n 
2 931  ILE n 
2 932  LEU n 
2 933  GLU n 
2 934  THR n 
2 935  HIS n 
2 936  LEU n 
2 937  GLY n 
2 938  TRP n 
2 939  CYS n 
2 940  ALA n 
2 941  HIS n 
2 942  SER n 
2 943  GLY n 
2 944  TRP n 
2 945  LYS n 
2 946  VAL n 
2 947  ASP n 
2 948  ALA n 
2 949  ALA n 
2 950  LYS n 
2 951  GLY n 
2 952  VAL n 
2 953  PRO n 
2 954  ASP n 
2 955  TRP n 
2 956  ALA n 
2 957  ALA n 
2 958  ARG n 
2 959  LEU n 
2 960  PRO n 
2 961  ASP n 
2 962  GLU n 
2 963  LEU n 
2 964  LEU n 
2 965  GLU n 
2 966  ALA n 
2 967  GLN n 
2 968  PRO n 
2 969  ASN n 
2 970  ALA n 
2 971  ILE n 
2 972  VAL n 
2 973  SER n 
2 974  THR n 
2 975  PRO n 
2 976  VAL n 
2 977  PHE n 
2 978  ASP n 
2 979  GLY n 
2 980  ALA n 
2 981  GLN n 
2 982  GLU n 
2 983  ALA n 
2 984  GLU n 
2 985  LEU n 
2 986  GLN n 
2 987  GLY n 
2 988  LEU n 
2 989  LEU n 
2 990  SER n 
2 991  CYS n 
2 992  THR n 
2 993  LEU n 
2 994  PRO n 
2 995  ASN n 
2 996  ARG n 
2 997  ASP n 
2 998  GLY n 
2 999  ASP n 
2 1000 VAL n 
2 1001 LEU n 
2 1002 VAL n 
2 1003 ASP n 
2 1004 ALA n 
2 1005 ASP n 
2 1006 GLY n 
2 1007 LYS n 
2 1008 ALA n 
2 1009 MET n 
2 1010 LEU n 
2 1011 PHE n 
2 1012 ASP n 
2 1013 GLY n 
2 1014 ARG n 
2 1015 SER n 
2 1016 GLY n 
2 1017 GLU n 
2 1018 PRO n 
2 1019 PHE n 
2 1020 PRO n 
2 1021 TYR n 
2 1022 PRO n 
2 1023 VAL n 
2 1024 THR n 
2 1025 VAL n 
2 1026 GLY n 
2 1027 TYR n 
2 1028 MET n 
2 1029 TYR n 
2 1030 ILE n 
2 1031 MET n 
2 1032 LYS n 
2 1033 LEU n 
2 1034 HIS n 
2 1035 HIS n 
2 1036 LEU n 
2 1037 VAL n 
2 1038 ASP n 
2 1039 ASP n 
2 1040 LYS n 
2 1041 ILE n 
2 1042 HIS n 
2 1043 ALA n 
2 1044 ARG n 
2 1045 SER n 
2 1046 THR n 
2 1047 GLY n 
2 1048 PRO n 
2 1049 TYR n 
2 1050 SER n 
2 1051 MET n 
2 1052 ILE n 
2 1053 THR n 
2 1054 GLN n 
2 1055 GLN n 
2 1056 PRO n 
2 1057 LEU n 
2 1058 GLY n 
2 1059 GLY n 
2 1060 LYS n 
2 1061 ALA n 
2 1062 GLN n 
2 1063 PHE n 
2 1064 GLY n 
2 1065 GLY n 
2 1066 GLN n 
2 1067 ARG n 
2 1068 PHE n 
2 1069 GLY n 
2 1070 GLU n 
2 1071 MET n 
2 1072 GLU n 
2 1073 CYS n 
2 1074 TRP n 
2 1075 ALA n 
2 1076 MET n 
2 1077 GLN n 
2 1078 ALA n 
2 1079 TYR n 
2 1080 GLY n 
2 1081 ALA n 
2 1082 ALA n 
2 1083 TYR n 
2 1084 THR n 
2 1085 LEU n 
2 1086 GLN n 
2 1087 GLU n 
2 1088 LEU n 
2 1089 LEU n 
2 1090 THR n 
2 1091 ILE n 
2 1092 LYS n 
2 1093 SER n 
2 1094 ASP n 
2 1095 ASP n 
2 1096 THR n 
2 1097 VAL n 
2 1098 GLY n 
2 1099 ARG n 
2 1100 VAL n 
2 1101 LYS n 
2 1102 VAL n 
2 1103 TYR n 
2 1104 GLU n 
2 1105 ALA n 
2 1106 ILE n 
2 1107 VAL n 
2 1108 LYS n 
2 1109 GLY n 
2 1110 GLU n 
2 1111 ASN n 
2 1112 ILE n 
2 1113 PRO n 
2 1114 GLU n 
2 1115 PRO n 
2 1116 GLY n 
2 1117 ILE n 
2 1118 PRO n 
2 1119 GLU n 
2 1120 SER n 
2 1121 PHE n 
2 1122 LYS n 
2 1123 VAL n 
2 1124 LEU n 
2 1125 LEU n 
2 1126 LYS n 
2 1127 GLU n 
2 1128 LEU n 
2 1129 GLN n 
2 1130 SER n 
2 1131 LEU n 
2 1132 CYS n 
2 1133 LEU n 
2 1134 ASN n 
2 1135 VAL n 
2 1136 GLU n 
2 1137 VAL n 
2 1138 LEU n 
2 1139 SER n 
2 1140 SER n 
2 1141 ASP n 
2 1142 GLY n 
2 1143 ALA n 
2 1144 ALA n 
2 1145 ILE n 
2 1146 GLU n 
2 1147 LEU n 
2 1148 ARG n 
2 1149 GLU n 
2 1150 GLY n 
2 1151 GLU n 
2 1152 ASP n 
2 1153 GLU n 
2 1154 ASP n 
2 1155 LEU n 
2 1156 GLU n 
2 1157 ARG n 
2 1158 ALA n 
2 1159 ALA n 
2 1160 ALA n 
2 1161 ASN n 
2 1162 LEU n 
2 1163 GLY n 
2 1164 ILE n 
2 1165 ASN n 
2 1166 LEU n 
2 1167 SER n 
2 1168 ARG n 
2 1169 ASN n 
2 1170 GLU n 
2 1171 SER n 
2 1172 ALA n 
2 1173 SER n 
2 1174 VAL n 
2 1175 GLU n 
2 1176 ASP n 
2 1177 LEU n 
2 1178 ALA n 
3 1    MET n 
3 2    LEU n 
3 3    ASP n 
3 4    VAL n 
3 5    ASN n 
3 6    PHE n 
3 7    PHE n 
3 8    ASP n 
3 9    GLU n 
3 10   LEU n 
3 11   ARG n 
3 12   ILE n 
3 13   GLY n 
3 14   LEU n 
3 15   ALA n 
3 16   THR n 
3 17   ALA n 
3 18   GLU n 
3 19   ASP n 
3 20   ILE n 
3 21   ARG n 
3 22   GLN n 
3 23   TRP n 
3 24   SER n 
3 25   TYR n 
3 26   GLY n 
3 27   GLU n 
3 28   VAL n 
3 29   LYS n 
3 30   LYS n 
3 31   PRO n 
3 32   GLU n 
3 33   THR n 
3 34   ILE n 
3 35   ASN n 
3 36   TYR n 
3 37   ARG n 
3 38   THR n 
3 39   LEU n 
3 40   LYS n 
3 41   PRO n 
3 42   GLU n 
3 43   LYS n 
3 44   ASP n 
3 45   GLY n 
3 46   LEU n 
3 47   PHE n 
3 48   CYS n 
3 49   GLU n 
3 50   LYS n 
3 51   ILE n 
3 52   PHE n 
3 53   GLY n 
3 54   PRO n 
3 55   THR n 
3 56   ARG n 
3 57   ASP n 
3 58   TRP n 
3 59   GLU n 
3 60   CYS n 
3 61   TYR n 
3 62   CYS n 
3 63   GLY n 
3 64   LYS n 
3 65   TYR n 
3 66   LYS n 
3 67   ARG n 
3 68   VAL n 
3 69   ARG n 
3 70   PHE n 
3 71   LYS n 
3 72   GLY n 
3 73   ILE n 
3 74   ILE n 
3 75   CYS n 
3 76   GLU n 
3 77   ARG n 
3 78   CYS n 
3 79   GLY n 
3 80   VAL n 
3 81   GLU n 
3 82   VAL n 
3 83   THR n 
3 84   ARG n 
3 85   ALA n 
3 86   LYS n 
3 87   VAL n 
3 88   ARG n 
3 89   ARG n 
3 90   GLU n 
3 91   ARG n 
3 92   MET n 
3 93   GLY n 
3 94   HIS n 
3 95   ILE n 
3 96   GLU n 
3 97   LEU n 
3 98   ALA n 
3 99   ALA n 
3 100  PRO n 
3 101  VAL n 
3 102  THR n 
3 103  HIS n 
3 104  ILE n 
3 105  TRP n 
3 106  TYR n 
3 107  PHE n 
3 108  LYS n 
3 109  GLY n 
3 110  VAL n 
3 111  PRO n 
3 112  SER n 
3 113  ARG n 
3 114  LEU n 
3 115  GLY n 
3 116  TYR n 
3 117  LEU n 
3 118  LEU n 
3 119  ASP n 
3 120  LEU n 
3 121  ALA n 
3 122  PRO n 
3 123  LYS n 
3 124  ASP n 
3 125  LEU n 
3 126  GLU n 
3 127  LYS n 
3 128  ILE n 
3 129  ILE n 
3 130  TYR n 
3 131  PHE n 
3 132  ALA n 
3 133  ALA n 
3 134  TYR n 
3 135  VAL n 
3 136  ILE n 
3 137  THR n 
3 138  SER n 
3 139  VAL n 
3 140  ASP n 
3 141  GLU n 
3 142  GLU n 
3 143  MET n 
3 144  ARG n 
3 145  HIS n 
3 146  ASN n 
3 147  GLU n 
3 148  LEU n 
3 149  SER n 
3 150  THR n 
3 151  LEU n 
3 152  GLU n 
3 153  ALA n 
3 154  GLU n 
3 155  MET n 
3 156  ALA n 
3 157  VAL n 
3 158  GLU n 
3 159  ARG n 
3 160  LYS n 
3 161  ALA n 
3 162  VAL n 
3 163  GLU n 
3 164  ASP n 
3 165  GLN n 
3 166  ARG n 
3 167  ASP n 
3 168  GLY n 
3 169  GLU n 
3 170  LEU n 
3 171  GLU n 
3 172  ALA n 
3 173  ARG n 
3 174  ALA n 
3 175  GLN n 
3 176  LYS n 
3 177  LEU n 
3 178  GLU n 
3 179  ALA n 
3 180  ASP n 
3 181  LEU n 
3 182  ALA n 
3 183  GLU n 
3 184  LEU n 
3 185  GLU n 
3 186  ALA n 
3 187  GLU n 
3 188  GLY n 
3 189  ALA n 
3 190  LYS n 
3 191  ALA n 
3 192  ASP n 
3 193  ALA n 
3 194  ARG n 
3 195  ARG n 
3 196  LYS n 
3 197  VAL n 
3 198  ARG n 
3 199  ASP n 
3 200  GLY n 
3 201  GLY n 
3 202  GLU n 
3 203  ARG n 
3 204  GLU n 
3 205  MET n 
3 206  ARG n 
3 207  GLN n 
3 208  ILE n 
3 209  ARG n 
3 210  ASP n 
3 211  ARG n 
3 212  ALA n 
3 213  GLN n 
3 214  ARG n 
3 215  GLU n 
3 216  LEU n 
3 217  ASP n 
3 218  ARG n 
3 219  LEU n 
3 220  GLU n 
3 221  ASP n 
3 222  ILE n 
3 223  TRP n 
3 224  SER n 
3 225  THR n 
3 226  PHE n 
3 227  THR n 
3 228  LYS n 
3 229  LEU n 
3 230  ALA n 
3 231  PRO n 
3 232  LYS n 
3 233  GLN n 
3 234  LEU n 
3 235  ILE n 
3 236  VAL n 
3 237  ASP n 
3 238  GLU n 
3 239  ASN n 
3 240  LEU n 
3 241  TYR n 
3 242  ARG n 
3 243  GLU n 
3 244  LEU n 
3 245  VAL n 
3 246  ASP n 
3 247  ARG n 
3 248  TYR n 
3 249  GLY n 
3 250  GLU n 
3 251  TYR n 
3 252  PHE n 
3 253  THR n 
3 254  GLY n 
3 255  ALA n 
3 256  MET n 
3 257  GLY n 
3 258  ALA n 
3 259  GLU n 
3 260  SER n 
3 261  ILE n 
3 262  GLN n 
3 263  LYS n 
3 264  LEU n 
3 265  ILE n 
3 266  GLU n 
3 267  ASN n 
3 268  PHE n 
3 269  ASP n 
3 270  ILE n 
3 271  ASP n 
3 272  ALA n 
3 273  GLU n 
3 274  ALA n 
3 275  GLU n 
3 276  SER n 
3 277  LEU n 
3 278  ARG n 
3 279  ASP n 
3 280  VAL n 
3 281  ILE n 
3 282  ARG n 
3 283  ASN n 
3 284  GLY n 
3 285  LYS n 
3 286  GLY n 
3 287  GLN n 
3 288  LYS n 
3 289  LYS n 
3 290  LEU n 
3 291  ARG n 
3 292  ALA n 
3 293  LEU n 
3 294  LYS n 
3 295  ARG n 
3 296  LEU n 
3 297  LYS n 
3 298  VAL n 
3 299  VAL n 
3 300  ALA n 
3 301  ALA n 
3 302  PHE n 
3 303  GLN n 
3 304  GLN n 
3 305  SER n 
3 306  GLY n 
3 307  ASN n 
3 308  SER n 
3 309  PRO n 
3 310  MET n 
3 311  GLY n 
3 312  MET n 
3 313  VAL n 
3 314  LEU n 
3 315  ASP n 
3 316  ALA n 
3 317  VAL n 
3 318  PRO n 
3 319  VAL n 
3 320  ILE n 
3 321  PRO n 
3 322  PRO n 
3 323  GLU n 
3 324  LEU n 
3 325  ARG n 
3 326  PRO n 
3 327  MET n 
3 328  VAL n 
3 329  GLN n 
3 330  LEU n 
3 331  ASP n 
3 332  GLY n 
3 333  GLY n 
3 334  ARG n 
3 335  PHE n 
3 336  ALA n 
3 337  THR n 
3 338  SER n 
3 339  ASP n 
3 340  LEU n 
3 341  ASN n 
3 342  ASP n 
3 343  LEU n 
3 344  TYR n 
3 345  ARG n 
3 346  ARG n 
3 347  VAL n 
3 348  ILE n 
3 349  ASN n 
3 350  ARG n 
3 351  ASN n 
3 352  ASN n 
3 353  ARG n 
3 354  LEU n 
3 355  LYS n 
3 356  ARG n 
3 357  LEU n 
3 358  ILE n 
3 359  ASP n 
3 360  LEU n 
3 361  GLY n 
3 362  ALA n 
3 363  PRO n 
3 364  GLU n 
3 365  ILE n 
3 366  ILE n 
3 367  VAL n 
3 368  ASN n 
3 369  ASN n 
3 370  GLU n 
3 371  LYS n 
3 372  ARG n 
3 373  MET n 
3 374  LEU n 
3 375  GLN n 
3 376  GLU n 
3 377  SER n 
3 378  VAL n 
3 379  ASP n 
3 380  ALA n 
3 381  LEU n 
3 382  PHE n 
3 383  ASP n 
3 384  ASN n 
3 385  GLY n 
3 386  ARG n 
3 387  ARG n 
3 388  GLY n 
3 389  ARG n 
3 390  PRO n 
3 391  VAL n 
3 392  THR n 
3 393  GLY n 
3 394  PRO n 
3 395  GLY n 
3 396  ASN n 
3 397  ARG n 
3 398  PRO n 
3 399  LEU n 
3 400  LYS n 
3 401  SER n 
3 402  LEU n 
3 403  SER n 
3 404  ASP n 
3 405  LEU n 
3 406  LEU n 
3 407  LYS n 
3 408  GLY n 
3 409  LYS n 
3 410  GLN n 
3 411  GLY n 
3 412  ARG n 
3 413  PHE n 
3 414  ARG n 
3 415  GLN n 
3 416  ASN n 
3 417  LEU n 
3 418  LEU n 
3 419  GLY n 
3 420  LYS n 
3 421  ARG n 
3 422  VAL n 
3 423  ASP n 
3 424  TYR n 
3 425  SER n 
3 426  GLY n 
3 427  ARG n 
3 428  SER n 
3 429  VAL n 
3 430  ILE n 
3 431  VAL n 
3 432  VAL n 
3 433  GLY n 
3 434  PRO n 
3 435  GLN n 
3 436  LEU n 
3 437  LYS n 
3 438  LEU n 
3 439  HIS n 
3 440  GLN n 
3 441  CYS n 
3 442  GLY n 
3 443  LEU n 
3 444  PRO n 
3 445  LYS n 
3 446  LEU n 
3 447  MET n 
3 448  ALA n 
3 449  LEU n 
3 450  GLU n 
3 451  LEU n 
3 452  PHE n 
3 453  LYS n 
3 454  PRO n 
3 455  PHE n 
3 456  VAL n 
3 457  MET n 
3 458  LYS n 
3 459  ARG n 
3 460  LEU n 
3 461  VAL n 
3 462  ASP n 
3 463  LEU n 
3 464  ASN n 
3 465  HIS n 
3 466  ALA n 
3 467  GLN n 
3 468  ASN n 
3 469  ILE n 
3 470  LYS n 
3 471  SER n 
3 472  ALA n 
3 473  LYS n 
3 474  ARG n 
3 475  MET n 
3 476  VAL n 
3 477  GLU n 
3 478  ARG n 
3 479  GLN n 
3 480  ARG n 
3 481  PRO n 
3 482  GLN n 
3 483  VAL n 
3 484  TRP n 
3 485  ASP n 
3 486  VAL n 
3 487  LEU n 
3 488  GLU n 
3 489  GLU n 
3 490  VAL n 
3 491  ILE n 
3 492  ALA n 
3 493  GLU n 
3 494  HIS n 
3 495  PRO n 
3 496  VAL n 
3 497  LEU n 
3 498  LEU n 
3 499  ASN n 
3 500  ARG n 
3 501  ALA n 
3 502  PRO n 
3 503  THR n 
3 504  LEU n 
3 505  HIS n 
3 506  ARG n 
3 507  LEU n 
3 508  GLY n 
3 509  ILE n 
3 510  GLN n 
3 511  ALA n 
3 512  PHE n 
3 513  GLU n 
3 514  PRO n 
3 515  MET n 
3 516  LEU n 
3 517  VAL n 
3 518  GLU n 
3 519  GLY n 
3 520  LYS n 
3 521  ALA n 
3 522  ILE n 
3 523  GLN n 
3 524  LEU n 
3 525  HIS n 
3 526  PRO n 
3 527  LEU n 
3 528  VAL n 
3 529  CYS n 
3 530  GLU n 
3 531  ALA n 
3 532  PHE n 
3 533  ASN n 
3 534  ALA n 
3 535  ASP n 
3 536  PHE n 
3 537  ASP n 
3 538  GLY n 
3 539  ASP n 
3 540  GLN n 
3 541  MET n 
3 542  ALA n 
3 543  VAL n 
3 544  HIS n 
3 545  LEU n 
3 546  PRO n 
3 547  LEU n 
3 548  SER n 
3 549  ALA n 
3 550  GLU n 
3 551  ALA n 
3 552  GLN n 
3 553  ALA n 
3 554  GLU n 
3 555  ALA n 
3 556  ARG n 
3 557  ILE n 
3 558  LEU n 
3 559  MET n 
3 560  LEU n 
3 561  SER n 
3 562  SER n 
3 563  ASN n 
3 564  ASN n 
3 565  ILE n 
3 566  LEU n 
3 567  SER n 
3 568  PRO n 
3 569  ALA n 
3 570  SER n 
3 571  GLY n 
3 572  ARG n 
3 573  PRO n 
3 574  LEU n 
3 575  ALA n 
3 576  MET n 
3 577  PRO n 
3 578  ARG n 
3 579  LEU n 
3 580  ASP n 
3 581  MET n 
3 582  VAL n 
3 583  THR n 
3 584  GLY n 
3 585  LEU n 
3 586  TYR n 
3 587  TYR n 
3 588  LEU n 
3 589  THR n 
3 590  THR n 
3 591  GLU n 
3 592  VAL n 
3 593  PRO n 
3 594  GLY n 
3 595  ASP n 
3 596  THR n 
3 597  GLY n 
3 598  GLU n 
3 599  TYR n 
3 600  GLN n 
3 601  PRO n 
3 602  ALA n 
3 603  SER n 
3 604  GLY n 
3 605  ASP n 
3 606  HIS n 
3 607  PRO n 
3 608  GLU n 
3 609  THR n 
3 610  GLY n 
3 611  VAL n 
3 612  TYR n 
3 613  SER n 
3 614  SER n 
3 615  PRO n 
3 616  ALA n 
3 617  GLU n 
3 618  ALA n 
3 619  ILE n 
3 620  MET n 
3 621  ALA n 
3 622  ALA n 
3 623  ASP n 
3 624  ARG n 
3 625  GLY n 
3 626  VAL n 
3 627  LEU n 
3 628  SER n 
3 629  VAL n 
3 630  ARG n 
3 631  ALA n 
3 632  LYS n 
3 633  ILE n 
3 634  LYS n 
3 635  VAL n 
3 636  ARG n 
3 637  LEU n 
3 638  THR n 
3 639  GLN n 
3 640  LEU n 
3 641  ARG n 
3 642  PRO n 
3 643  PRO n 
3 644  VAL n 
3 645  GLU n 
3 646  ILE n 
3 647  GLU n 
3 648  ALA n 
3 649  GLU n 
3 650  LEU n 
3 651  PHE n 
3 652  GLY n 
3 653  HIS n 
3 654  SER n 
3 655  GLY n 
3 656  TRP n 
3 657  GLN n 
3 658  PRO n 
3 659  GLY n 
3 660  ASP n 
3 661  ALA n 
3 662  TRP n 
3 663  MET n 
3 664  ALA n 
3 665  GLU n 
3 666  THR n 
3 667  THR n 
3 668  LEU n 
3 669  GLY n 
3 670  ARG n 
3 671  VAL n 
3 672  MET n 
3 673  PHE n 
3 674  ASN n 
3 675  GLU n 
3 676  LEU n 
3 677  LEU n 
3 678  PRO n 
3 679  LEU n 
3 680  GLY n 
3 681  TYR n 
3 682  PRO n 
3 683  PHE n 
3 684  VAL n 
3 685  ASN n 
3 686  LYS n 
3 687  GLN n 
3 688  MET n 
3 689  HIS n 
3 690  LYS n 
3 691  LYS n 
3 692  VAL n 
3 693  GLN n 
3 694  ALA n 
3 695  ALA n 
3 696  ILE n 
3 697  ILE n 
3 698  ASN n 
3 699  ASP n 
3 700  LEU n 
3 701  ALA n 
3 702  GLU n 
3 703  ARG n 
3 704  TYR n 
3 705  PRO n 
3 706  MET n 
3 707  ILE n 
3 708  VAL n 
3 709  VAL n 
3 710  ALA n 
3 711  GLN n 
3 712  THR n 
3 713  VAL n 
3 714  ASP n 
3 715  LYS n 
3 716  LEU n 
3 717  LYS n 
3 718  ASP n 
3 719  ALA n 
3 720  GLY n 
3 721  PHE n 
3 722  TYR n 
3 723  TRP n 
3 724  ALA n 
3 725  THR n 
3 726  ARG n 
3 727  SER n 
3 728  GLY n 
3 729  VAL n 
3 730  THR n 
3 731  VAL n 
3 732  SER n 
3 733  MET n 
3 734  ALA n 
3 735  ASP n 
3 736  VAL n 
3 737  LEU n 
3 738  VAL n 
3 739  PRO n 
3 740  PRO n 
3 741  ARG n 
3 742  LYS n 
3 743  LYS n 
3 744  GLU n 
3 745  ILE n 
3 746  LEU n 
3 747  ASP n 
3 748  HIS n 
3 749  TYR n 
3 750  GLU n 
3 751  GLU n 
3 752  ARG n 
3 753  ALA n 
3 754  ASP n 
3 755  LYS n 
3 756  VAL n 
3 757  GLU n 
3 758  LYS n 
3 759  GLN n 
3 760  PHE n 
3 761  GLN n 
3 762  ARG n 
3 763  GLY n 
3 764  ALA n 
3 765  LEU n 
3 766  ASN n 
3 767  HIS n 
3 768  ASP n 
3 769  GLU n 
3 770  ARG n 
3 771  ASN n 
3 772  GLU n 
3 773  ALA n 
3 774  LEU n 
3 775  VAL n 
3 776  GLU n 
3 777  ILE n 
3 778  TRP n 
3 779  LYS n 
3 780  GLU n 
3 781  ALA n 
3 782  THR n 
3 783  ASP n 
3 784  GLU n 
3 785  VAL n 
3 786  GLY n 
3 787  GLN n 
3 788  ALA n 
3 789  LEU n 
3 790  ARG n 
3 791  GLU n 
3 792  HIS n 
3 793  TYR n 
3 794  PRO n 
3 795  ASP n 
3 796  ASP n 
3 797  ASN n 
3 798  PRO n 
3 799  ILE n 
3 800  ILE n 
3 801  THR n 
3 802  ILE n 
3 803  VAL n 
3 804  ASP n 
3 805  SER n 
3 806  GLY n 
3 807  ALA n 
3 808  THR n 
3 809  GLY n 
3 810  ASN n 
3 811  PHE n 
3 812  THR n 
3 813  GLN n 
3 814  THR n 
3 815  ARG n 
3 816  THR n 
3 817  LEU n 
3 818  ALA n 
3 819  GLY n 
3 820  MET n 
3 821  LYS n 
3 822  GLY n 
3 823  LEU n 
3 824  VAL n 
3 825  THR n 
3 826  ASN n 
3 827  PRO n 
3 828  LYS n 
3 829  GLY n 
3 830  GLU n 
3 831  PHE n 
3 832  ILE n 
3 833  PRO n 
3 834  ARG n 
3 835  PRO n 
3 836  VAL n 
3 837  LYS n 
3 838  SER n 
3 839  SER n 
3 840  PHE n 
3 841  ARG n 
3 842  GLU n 
3 843  GLY n 
3 844  LEU n 
3 845  THR n 
3 846  VAL n 
3 847  LEU n 
3 848  GLU n 
3 849  TYR n 
3 850  PHE n 
3 851  ILE n 
3 852  ASN n 
3 853  THR n 
3 854  HIS n 
3 855  GLY n 
3 856  ALA n 
3 857  ARG n 
3 858  LYS n 
3 859  GLY n 
3 860  LEU n 
3 861  ALA n 
3 862  ASP n 
3 863  THR n 
3 864  ALA n 
3 865  LEU n 
3 866  ARG n 
3 867  THR n 
3 868  ALA n 
3 869  ASP n 
3 870  SER n 
3 871  GLY n 
3 872  TYR n 
3 873  LEU n 
3 874  THR n 
3 875  ARG n 
3 876  ARG n 
3 877  LEU n 
3 878  VAL n 
3 879  ASP n 
3 880  VAL n 
3 881  SER n 
3 882  GLN n 
3 883  ASP n 
3 884  VAL n 
3 885  ILE n 
3 886  VAL n 
3 887  ARG n 
3 888  GLU n 
3 889  HIS n 
3 890  ASP n 
3 891  CYS n 
3 892  GLN n 
3 893  THR n 
3 894  GLU n 
3 895  ARG n 
3 896  GLY n 
3 897  ILE n 
3 898  VAL n 
3 899  VAL n 
3 900  GLU n 
3 901  LEU n 
3 902  ALA n 
3 903  GLU n 
3 904  ARG n 
3 905  ALA n 
3 906  PRO n 
3 907  ASP n 
3 908  GLY n 
3 909  THR n 
3 910  LEU n 
3 911  ILE n 
3 912  ARG n 
3 913  ASP n 
3 914  PRO n 
3 915  TYR n 
3 916  ILE n 
3 917  GLU n 
3 918  THR n 
3 919  SER n 
3 920  ALA n 
3 921  TYR n 
3 922  ALA n 
3 923  ARG n 
3 924  THR n 
3 925  LEU n 
3 926  GLY n 
3 927  THR n 
3 928  ASP n 
3 929  ALA n 
3 930  VAL n 
3 931  ASP n 
3 932  GLU n 
3 933  ALA n 
3 934  GLY n 
3 935  ASN n 
3 936  VAL n 
3 937  ILE n 
3 938  VAL n 
3 939  GLU n 
3 940  ARG n 
3 941  GLY n 
3 942  GLN n 
3 943  ASP n 
3 944  LEU n 
3 945  GLY n 
3 946  ASP n 
3 947  PRO n 
3 948  GLU n 
3 949  ILE n 
3 950  ASP n 
3 951  ALA n 
3 952  LEU n 
3 953  LEU n 
3 954  ALA n 
3 955  ALA n 
3 956  GLY n 
3 957  ILE n 
3 958  THR n 
3 959  GLN n 
3 960  VAL n 
3 961  LYS n 
3 962  VAL n 
3 963  ARG n 
3 964  SER n 
3 965  VAL n 
3 966  LEU n 
3 967  THR n 
3 968  CYS n 
3 969  ALA n 
3 970  THR n 
3 971  SER n 
3 972  THR n 
3 973  GLY n 
3 974  VAL n 
3 975  CYS n 
3 976  ALA n 
3 977  THR n 
3 978  CYS n 
3 979  TYR n 
3 980  GLY n 
3 981  ARG n 
3 982  SER n 
3 983  MET n 
3 984  ALA n 
3 985  THR n 
3 986  GLY n 
3 987  LYS n 
3 988  LEU n 
3 989  VAL n 
3 990  ASP n 
3 991  ILE n 
3 992  GLY n 
3 993  GLU n 
3 994  ALA n 
3 995  VAL n 
3 996  GLY n 
3 997  ILE n 
3 998  VAL n 
3 999  ALA n 
3 1000 ALA n 
3 1001 GLN n 
3 1002 SER n 
3 1003 ILE n 
3 1004 GLY n 
3 1005 GLU n 
3 1006 PRO n 
3 1007 GLY n 
3 1008 THR n 
3 1009 GLN n 
3 1010 LEU n 
3 1011 THR n 
3 1012 MET n 
3 1013 ARG n 
3 1014 THR n 
3 1015 PHE n 
3 1016 HIS n 
3 1017 GLN n 
3 1018 GLY n 
3 1019 GLY n 
3 1020 VAL n 
3 1021 GLY n 
3 1022 GLU n 
3 1023 ASP n 
3 1024 ILE n 
3 1025 THR n 
3 1026 GLY n 
3 1027 GLY n 
3 1028 LEU n 
3 1029 PRO n 
3 1030 ARG n 
3 1031 VAL n 
3 1032 GLN n 
3 1033 GLU n 
3 1034 LEU n 
3 1035 PHE n 
3 1036 GLU n 
3 1037 ALA n 
3 1038 ARG n 
3 1039 VAL n 
3 1040 PRO n 
3 1041 ARG n 
3 1042 GLY n 
3 1043 LYS n 
3 1044 ALA n 
3 1045 PRO n 
3 1046 ILE n 
3 1047 ALA n 
3 1048 ASP n 
3 1049 VAL n 
3 1050 THR n 
3 1051 GLY n 
3 1052 ARG n 
3 1053 VAL n 
3 1054 ARG n 
3 1055 LEU n 
3 1056 GLU n 
3 1057 ASP n 
3 1058 GLY n 
3 1059 GLU n 
3 1060 ARG n 
3 1061 PHE n 
3 1062 TYR n 
3 1063 LYS n 
3 1064 ILE n 
3 1065 THR n 
3 1066 ILE n 
3 1067 VAL n 
3 1068 PRO n 
3 1069 ASP n 
3 1070 ASP n 
3 1071 GLY n 
3 1072 GLY n 
3 1073 GLU n 
3 1074 GLU n 
3 1075 VAL n 
3 1076 VAL n 
3 1077 TYR n 
3 1078 ASP n 
3 1079 LYS n 
3 1080 ILE n 
3 1081 SER n 
3 1082 LYS n 
3 1083 ARG n 
3 1084 GLN n 
3 1085 ARG n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 VAL n 
3 1089 PHE n 
3 1090 LYS n 
3 1091 HIS n 
3 1092 GLU n 
3 1093 ASP n 
3 1094 GLY n 
3 1095 SER n 
3 1096 GLU n 
3 1097 ARG n 
3 1098 VAL n 
3 1099 LEU n 
3 1100 SER n 
3 1101 ASP n 
3 1102 GLY n 
3 1103 ASP n 
3 1104 HIS n 
3 1105 VAL n 
3 1106 GLU n 
3 1107 VAL n 
3 1108 GLY n 
3 1109 GLN n 
3 1110 GLN n 
3 1111 LEU n 
3 1112 MET n 
3 1113 GLU n 
3 1114 GLY n 
3 1115 SER n 
3 1116 ALA n 
3 1117 ASP n 
3 1118 PRO n 
3 1119 HIS n 
3 1120 GLU n 
3 1121 VAL n 
3 1122 LEU n 
3 1123 ARG n 
3 1124 VAL n 
3 1125 GLN n 
3 1126 GLY n 
3 1127 PRO n 
3 1128 ARG n 
3 1129 GLU n 
3 1130 VAL n 
3 1131 GLN n 
3 1132 ILE n 
3 1133 HIS n 
3 1134 LEU n 
3 1135 VAL n 
3 1136 ARG n 
3 1137 GLU n 
3 1138 VAL n 
3 1139 GLN n 
3 1140 GLU n 
3 1141 VAL n 
3 1142 TYR n 
3 1143 ARG n 
3 1144 ALA n 
3 1145 GLN n 
3 1146 GLY n 
3 1147 VAL n 
3 1148 SER n 
3 1149 ILE n 
3 1150 HIS n 
3 1151 ASP n 
3 1152 LYS n 
3 1153 HIS n 
3 1154 ILE n 
3 1155 GLU n 
3 1156 VAL n 
3 1157 ILE n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 GLN n 
3 1161 MET n 
3 1162 LEU n 
3 1163 ARG n 
3 1164 ARG n 
3 1165 VAL n 
3 1166 THR n 
3 1167 ILE n 
3 1168 ILE n 
3 1169 ASP n 
3 1170 SER n 
3 1171 GLY n 
3 1172 SER n 
3 1173 THR n 
3 1174 GLU n 
3 1175 PHE n 
3 1176 LEU n 
3 1177 PRO n 
3 1178 GLY n 
3 1179 SER n 
3 1180 LEU n 
3 1181 ILE n 
3 1182 ASP n 
3 1183 ARG n 
3 1184 ALA n 
3 1185 GLU n 
3 1186 PHE n 
3 1187 GLU n 
3 1188 ALA n 
3 1189 GLU n 
3 1190 ASN n 
3 1191 ARG n 
3 1192 ARG n 
3 1193 VAL n 
3 1194 VAL n 
3 1195 ALA n 
3 1196 GLU n 
3 1197 GLY n 
3 1198 GLY n 
3 1199 GLU n 
3 1200 PRO n 
3 1201 ALA n 
3 1202 ALA n 
3 1203 GLY n 
3 1204 ARG n 
3 1205 PRO n 
3 1206 VAL n 
3 1207 LEU n 
3 1208 MET n 
3 1209 GLY n 
3 1210 ILE n 
3 1211 THR n 
3 1212 LYS n 
3 1213 ALA n 
3 1214 SER n 
3 1215 LEU n 
3 1216 ALA n 
3 1217 THR n 
3 1218 ASP n 
3 1219 SER n 
3 1220 TRP n 
3 1221 LEU n 
3 1222 SER n 
3 1223 ALA n 
3 1224 ALA n 
3 1225 SER n 
3 1226 PHE n 
3 1227 GLN n 
3 1228 GLU n 
3 1229 THR n 
3 1230 THR n 
3 1231 ARG n 
3 1232 VAL n 
3 1233 LEU n 
3 1234 THR n 
3 1235 ASP n 
3 1236 ALA n 
3 1237 ALA n 
3 1238 ILE n 
3 1239 ASN n 
3 1240 CYS n 
3 1241 ARG n 
3 1242 SER n 
3 1243 ASP n 
3 1244 LYS n 
3 1245 LEU n 
3 1246 ASN n 
3 1247 GLY n 
3 1248 LEU n 
3 1249 LYS n 
3 1250 GLU n 
3 1251 ASN n 
3 1252 VAL n 
3 1253 ILE n 
3 1254 ILE n 
3 1255 GLY n 
3 1256 LYS n 
3 1257 LEU n 
3 1258 ILE n 
3 1259 PRO n 
3 1260 ALA n 
3 1261 GLY n 
3 1262 THR n 
3 1263 GLY n 
3 1264 ILE n 
3 1265 ASN n 
3 1266 ARG n 
3 1267 TYR n 
3 1268 ARG n 
3 1269 ASN n 
3 1270 ILE n 
3 1271 ALA n 
3 1272 VAL n 
3 1273 GLN n 
3 1274 PRO n 
3 1275 THR n 
3 1276 GLU n 
3 1277 GLU n 
3 1278 ALA n 
3 1279 ARG n 
3 1280 ALA n 
3 1281 ALA n 
3 1282 ALA n 
3 1283 TYR n 
3 1284 THR n 
3 1285 ILE n 
3 1286 PRO n 
3 1287 SER n 
3 1288 TYR n 
3 1289 GLU n 
3 1290 ASP n 
3 1291 GLN n 
3 1292 TYR n 
3 1293 TYR n 
3 1294 SER n 
3 1295 PRO n 
3 1296 ASP n 
3 1297 PHE n 
3 1298 GLY n 
3 1299 ALA n 
3 1300 ALA n 
3 1301 THR n 
3 1302 GLY n 
3 1303 ALA n 
3 1304 ALA n 
3 1305 VAL n 
3 1306 PRO n 
3 1307 LEU n 
3 1308 ASP n 
3 1309 ASP n 
3 1310 TYR n 
3 1311 GLY n 
3 1312 TYR n 
3 1313 SER n 
3 1314 ASP n 
3 1315 TYR n 
3 1316 ARG n 
4 1    MET n 
4 2    SER n 
4 3    ILE n 
4 4    SER n 
4 5    GLN n 
4 6    SER n 
4 7    ASP n 
4 8    ALA n 
4 9    SER n 
4 10   LEU n 
4 11   ALA n 
4 12   ALA n 
4 13   VAL n 
4 14   PRO n 
4 15   ALA n 
4 16   VAL n 
4 17   ASP n 
4 18   GLN n 
4 19   PHE n 
4 20   ASP n 
4 21   PRO n 
4 22   SER n 
4 23   SER n 
4 24   GLY n 
4 25   ALA n 
4 26   SER n 
4 27   GLY n 
4 28   GLY n 
4 29   TYR n 
4 30   ASP n 
4 31   THR n 
4 32   PRO n 
4 33   LEU n 
4 34   GLY n 
4 35   ILE n 
4 36   THR n 
4 37   ASN n 
4 38   PRO n 
4 39   PRO n 
4 40   ILE n 
4 41   ASP n 
4 42   GLU n 
4 43   LEU n 
4 44   LEU n 
4 45   ASP n 
4 46   ARG n 
4 47   VAL n 
4 48   SER n 
4 49   SER n 
4 50   LYS n 
4 51   TYR n 
4 52   ALA n 
4 53   LEU n 
4 54   VAL n 
4 55   ILE n 
4 56   TYR n 
4 57   ALA n 
4 58   ALA n 
4 59   LYS n 
4 60   ARG n 
4 61   ALA n 
4 62   ARG n 
4 63   GLN n 
4 64   ILE n 
4 65   ASN n 
4 66   ASP n 
4 67   TYR n 
4 68   TYR n 
4 69   ASN n 
4 70   GLN n 
4 71   LEU n 
4 72   GLY n 
4 73   GLU n 
4 74   GLY n 
4 75   ILE n 
4 76   LEU n 
4 77   GLU n 
4 78   TYR n 
4 79   VAL n 
4 80   GLY n 
4 81   PRO n 
4 82   LEU n 
4 83   VAL n 
4 84   GLU n 
4 85   PRO n 
4 86   GLY n 
4 87   LEU n 
4 88   GLN n 
4 89   GLU n 
4 90   LYS n 
4 91   PRO n 
4 92   LEU n 
4 93   SER n 
4 94   ILE n 
4 95   ALA n 
4 96   LEU n 
4 97   ARG n 
4 98   GLU n 
4 99   ILE n 
4 100  HIS n 
4 101  ALA n 
4 102  ASP n 
4 103  LEU n 
4 104  LEU n 
4 105  GLU n 
4 106  HIS n 
4 107  THR n 
4 108  GLU n 
4 109  GLY n 
4 110  GLU n 
5 1    MET n 
5 2    ALA n 
5 3    ALA n 
5 4    THR n 
5 5    LYS n 
5 6    ALA n 
5 7    SER n 
5 8    THR n 
5 9    ALA n 
5 10   THR n 
5 11   ASP n 
5 12   GLU n 
5 13   PRO n 
5 14   VAL n 
5 15   LYS n 
5 16   ARG n 
5 17   THR n 
5 18   ALA n 
5 19   THR n 
5 20   LYS n 
5 21   SER n 
5 22   PRO n 
5 23   ALA n 
5 24   ALA n 
5 25   SER n 
5 26   ALA n 
5 27   SER n 
5 28   GLY n 
5 29   ALA n 
5 30   LYS n 
5 31   THR n 
5 32   GLY n 
5 33   ALA n 
5 34   LYS n 
5 35   ARG n 
5 36   THR n 
5 37   ALA n 
5 38   ALA n 
5 39   LYS n 
5 40   SER n 
5 41   ALA n 
5 42   SER n 
5 43   GLY n 
5 44   SER n 
5 45   PRO n 
5 46   PRO n 
5 47   ALA n 
5 48   LYS n 
5 49   ARG n 
5 50   ALA n 
5 51   THR n 
5 52   LYS n 
5 53   PRO n 
5 54   ALA n 
5 55   ALA n 
5 56   ARG n 
5 57   SER n 
5 58   VAL n 
5 59   LYS n 
5 60   PRO n 
5 61   ALA n 
5 62   SER n 
5 63   ALA n 
5 64   PRO n 
5 65   GLN n 
5 66   ASP n 
5 67   THR n 
5 68   THR n 
5 69   THR n 
5 70   SER n 
5 71   THR n 
5 72   ILE n 
5 73   PRO n 
5 74   LYS n 
5 75   ARG n 
5 76   LYS n 
5 77   THR n 
5 78   ARG n 
5 79   ALA n 
5 80   ALA n 
5 81   ALA n 
5 82   LYS n 
5 83   SER n 
5 84   ALA n 
5 85   ALA n 
5 86   ALA n 
5 87   LYS n 
5 88   ALA n 
5 89   PRO n 
5 90   SER n 
5 91   ALA n 
5 92   ARG n 
5 93   GLY n 
5 94   HIS n 
5 95   ALA n 
5 96   THR n 
5 97   LYS n 
5 98   PRO n 
5 99   ARG n 
5 100  ALA n 
5 101  PRO n 
5 102  LYS n 
5 103  ASP n 
5 104  ALA n 
5 105  GLN n 
5 106  HIS n 
5 107  GLU n 
5 108  ALA n 
5 109  ALA n 
5 110  THR n 
5 111  ASP n 
5 112  PRO n 
5 113  GLU n 
5 114  ASP n 
5 115  ALA n 
5 116  LEU n 
5 117  ASP n 
5 118  SER n 
5 119  VAL n 
5 120  GLU n 
5 121  GLU n 
5 122  LEU n 
5 123  ASP n 
5 124  ALA n 
5 125  GLU n 
5 126  PRO n 
5 127  ASP n 
5 128  LEU n 
5 129  ASP n 
5 130  VAL n 
5 131  GLU n 
5 132  PRO n 
5 133  GLY n 
5 134  GLU n 
5 135  ASP n 
5 136  LEU n 
5 137  ASP n 
5 138  LEU n 
5 139  ASP n 
5 140  ALA n 
5 141  ALA n 
5 142  ASP n 
5 143  LEU n 
5 144  ASN n 
5 145  LEU n 
5 146  ASP n 
5 147  ASP n 
5 148  LEU n 
5 149  GLU n 
5 150  ASP n 
5 151  ASP n 
5 152  VAL n 
5 153  ALA n 
5 154  PRO n 
5 155  ASP n 
5 156  ALA n 
5 157  ASP n 
5 158  ASP n 
5 159  ASP n 
5 160  LEU n 
5 161  ASP n 
5 162  SER n 
5 163  GLY n 
5 164  ASP n 
5 165  ASP n 
5 166  GLU n 
5 167  ASP n 
5 168  HIS n 
5 169  GLU n 
5 170  ASP n 
5 171  LEU n 
5 172  GLU n 
5 173  ALA n 
5 174  GLU n 
5 175  ALA n 
5 176  ALA n 
5 177  VAL n 
5 178  ALA n 
5 179  PRO n 
5 180  GLY n 
5 181  GLN n 
5 182  THR n 
5 183  ALA n 
5 184  ASP n 
5 185  ASP n 
5 186  ASP n 
5 187  GLU n 
5 188  GLU n 
5 189  ILE n 
5 190  ALA n 
5 191  GLU n 
5 192  PRO n 
5 193  THR n 
5 194  GLU n 
5 195  LYS n 
5 196  ASP n 
5 197  LYS n 
5 198  ALA n 
5 199  SER n 
5 200  GLY n 
5 201  ASP n 
5 202  PHE n 
5 203  VAL n 
5 204  TRP n 
5 205  ASP n 
5 206  GLU n 
5 207  ASP n 
5 208  GLU n 
5 209  SER n 
5 210  GLU n 
5 211  ALA n 
5 212  LEU n 
5 213  ARG n 
5 214  GLN n 
5 215  ALA n 
5 216  ARG n 
5 217  LYS n 
5 218  ASP n 
5 219  ALA n 
5 220  GLU n 
5 221  LEU n 
5 222  THR n 
5 223  ALA n 
5 224  SER n 
5 225  ALA n 
5 226  ASP n 
5 227  SER n 
5 228  VAL n 
5 229  ARG n 
5 230  ALA n 
5 231  TYR n 
5 232  LEU n 
5 233  LYS n 
5 234  GLN n 
5 235  ILE n 
5 236  GLY n 
5 237  LYS n 
5 238  VAL n 
5 239  ALA n 
5 240  LEU n 
5 241  LEU n 
5 242  ASN n 
5 243  ALA n 
5 244  GLU n 
5 245  GLU n 
5 246  GLU n 
5 247  VAL n 
5 248  GLU n 
5 249  LEU n 
5 250  ALA n 
5 251  LYS n 
5 252  ARG n 
5 253  ILE n 
5 254  GLU n 
5 255  ALA n 
5 256  GLY n 
5 257  LEU n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  GLN n 
5 262  LEU n 
5 263  MET n 
5 264  THR n 
5 265  GLU n 
5 266  LEU n 
5 267  SER n 
5 268  GLU n 
5 269  ARG n 
5 270  GLY n 
5 271  GLU n 
5 272  LYS n 
5 273  LEU n 
5 274  PRO n 
5 275  ALA n 
5 276  ALA n 
5 277  GLN n 
5 278  ARG n 
5 279  ARG n 
5 280  ASP n 
5 281  MET n 
5 282  MET n 
5 283  TRP n 
5 284  ILE n 
5 285  CYS n 
5 286  ARG n 
5 287  ASP n 
5 288  GLY n 
5 289  ASP n 
5 290  ARG n 
5 291  ALA n 
5 292  LYS n 
5 293  ASN n 
5 294  HIS n 
5 295  LEU n 
5 296  LEU n 
5 297  GLU n 
5 298  ALA n 
5 299  ASN n 
5 300  LEU n 
5 301  ARG n 
5 302  LEU n 
5 303  VAL n 
5 304  VAL n 
5 305  SER n 
5 306  LEU n 
5 307  ALA n 
5 308  LYS n 
5 309  ARG n 
5 310  TYR n 
5 311  THR n 
5 312  GLY n 
5 313  ARG n 
5 314  GLY n 
5 315  MET n 
5 316  ALA n 
5 317  PHE n 
5 318  LEU n 
5 319  ASP n 
5 320  LEU n 
5 321  ILE n 
5 322  GLN n 
5 323  GLU n 
5 324  GLY n 
5 325  ASN n 
5 326  LEU n 
5 327  GLY n 
5 328  LEU n 
5 329  ILE n 
5 330  ARG n 
5 331  ALA n 
5 332  VAL n 
5 333  GLU n 
5 334  LYS n 
5 335  PHE n 
5 336  ASP n 
5 337  TYR n 
5 338  THR n 
5 339  LYS n 
5 340  GLY n 
5 341  TYR n 
5 342  LYS n 
5 343  PHE n 
5 344  SER n 
5 345  THR n 
5 346  TYR n 
5 347  ALA n 
5 348  THR n 
5 349  TRP n 
5 350  TRP n 
5 351  ILE n 
5 352  ARG n 
5 353  GLN n 
5 354  ALA n 
5 355  ILE n 
5 356  THR n 
5 357  ARG n 
5 358  ALA n 
5 359  MET n 
5 360  ALA n 
5 361  ASP n 
5 362  GLN n 
5 363  ALA n 
5 364  ARG n 
5 365  THR n 
5 366  ILE n 
5 367  ARG n 
5 368  ILE n 
5 369  PRO n 
5 370  VAL n 
5 371  HIS n 
5 372  MET n 
5 373  VAL n 
5 374  GLU n 
5 375  VAL n 
5 376  ILE n 
5 377  ASN n 
5 378  LYS n 
5 379  LEU n 
5 380  GLY n 
5 381  ARG n 
5 382  ILE n 
5 383  GLN n 
5 384  ARG n 
5 385  GLU n 
5 386  LEU n 
5 387  LEU n 
5 388  GLN n 
5 389  ASP n 
5 390  LEU n 
5 391  GLY n 
5 392  ARG n 
5 393  GLU n 
5 394  PRO n 
5 395  THR n 
5 396  PRO n 
5 397  GLU n 
5 398  GLU n 
5 399  LEU n 
5 400  ALA n 
5 401  LYS n 
5 402  GLU n 
5 403  MET n 
5 404  ASP n 
5 405  ILE n 
5 406  THR n 
5 407  PRO n 
5 408  GLU n 
5 409  LYS n 
5 410  VAL n 
5 411  LEU n 
5 412  GLU n 
5 413  ILE n 
5 414  GLN n 
5 415  GLN n 
5 416  TYR n 
5 417  ALA n 
5 418  ARG n 
5 419  GLU n 
5 420  PRO n 
5 421  ILE n 
5 422  SER n 
5 423  LEU n 
5 424  ASP n 
5 425  GLN n 
5 426  THR n 
5 427  ILE n 
5 428  GLY n 
5 429  ASP n 
5 430  GLU n 
5 431  GLY n 
5 432  ASP n 
5 433  SER n 
5 434  GLN n 
5 435  LEU n 
5 436  GLY n 
5 437  ASP n 
5 438  PHE n 
5 439  ILE n 
5 440  GLU n 
5 441  ASP n 
5 442  SER n 
5 443  GLU n 
5 444  ALA n 
5 445  VAL n 
5 446  VAL n 
5 447  ALA n 
5 448  VAL n 
5 449  ASP n 
5 450  ALA n 
5 451  VAL n 
5 452  SER n 
5 453  PHE n 
5 454  THR n 
5 455  LEU n 
5 456  LEU n 
5 457  GLN n 
5 458  ASP n 
5 459  GLN n 
5 460  LEU n 
5 461  GLN n 
5 462  SER n 
5 463  VAL n 
5 464  LEU n 
5 465  ASP n 
5 466  THR n 
5 467  LEU n 
5 468  SER n 
5 469  GLU n 
5 470  ARG n 
5 471  GLU n 
5 472  ALA n 
5 473  GLY n 
5 474  VAL n 
5 475  VAL n 
5 476  ARG n 
5 477  LEU n 
5 478  ARG n 
5 479  PHE n 
5 480  GLY n 
5 481  LEU n 
5 482  THR n 
5 483  ASP n 
5 484  GLY n 
5 485  GLN n 
5 486  PRO n 
5 487  ARG n 
5 488  THR n 
5 489  LEU n 
5 490  ASP n 
5 491  GLU n 
5 492  ILE n 
5 493  GLY n 
5 494  GLN n 
5 495  VAL n 
5 496  TYR n 
5 497  GLY n 
5 498  VAL n 
5 499  THR n 
5 500  ARG n 
5 501  GLU n 
5 502  ARG n 
5 503  ILE n 
5 504  ARG n 
5 505  GLN n 
5 506  ILE n 
5 507  GLU n 
5 508  SER n 
5 509  LYS n 
5 510  THR n 
5 511  MET n 
5 512  SER n 
5 513  LYS n 
5 514  LEU n 
5 515  ARG n 
5 516  HIS n 
5 517  PRO n 
5 518  SER n 
5 519  ARG n 
5 520  SER n 
5 521  GLN n 
5 522  VAL n 
5 523  LEU n 
5 524  ARG n 
5 525  ASP n 
5 526  TYR n 
5 527  LEU n 
5 528  ASP n 
6 1    DT  n 
6 2    DA  n 
6 3    DT  n 
6 4    DA  n 
6 5    DA  n 
6 6    DT  n 
6 7    DG  n 
6 8    DG  n 
6 9    DG  n 
6 10   DA  n 
6 11   DG  n 
6 12   DC  n 
6 13   DT  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DA  n 
6 18   DC  n 
6 19   DG  n 
6 20   DG  n 
6 21   DA  n 
6 22   DT  n 
6 23   DG  n 
7 1    DC  n 
7 2    DA  n 
7 3    DT  n 
7 4    DC  n 
7 5    DC  n 
7 6    DG  n 
7 7    DT  n 
7 8    DG  n 
7 9    DA  n 
7 10   DG  n 
7 11   DT  n 
7 12   DC  n 
7 13   DC  n 
7 14   DA  n 
7 15   DG  n 
7 16   DG  n 
8 1    G   n 
8 2    A   n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 347  ? ? 'rpoA, Rv3457c, MTCY13E12.10c'                ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1178 ? ? 'rpoB, Rv0667, MTCI376.08c'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 1316 ? ? 'rpoC, Rv0668, MTCI376.07c'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 110  ? ? 'rpoZ, Rv1390, MTCY21B4.07'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 528  ? ? 'sigA, mysA, rpoD, rpoV, Rv2703, MTCY05A6.24' ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 23 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' ? 83332 ? 
7 1 sample 1 16 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' ? 83332 ? 
8 1 sample 1 2  'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' ? 83332 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_MYCTU P9WGZ1 ? 1 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
1 
2 UNP RPOB_MYCTU P9WGY9 ? 2 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
1 
3 UNP RPOC_MYCTU P9WGY7 ? 3 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
1 
4 UNP RPOZ_MYCTU P9WGY5 ? 4 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
1 
5 UNP SIGA_MYCTU P9WGI1 ? 5 
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
1 
6 PDB 5UH6       5UH6   ? 6 ? 1 
7 PDB 5UH6       5UH6   ? 7 ? 1 
8 PDB 5UH6       5UH6   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5UH6 A 1 ? 347  ? P9WGZ1 1 ? 347  ? 1 347  
2 1 5UH6 B 1 ? 347  ? P9WGZ1 1 ? 347  ? 1 347  
3 2 5UH6 C 1 ? 1178 ? P9WGY9 1 ? 1178 ? 1 1178 
4 3 5UH6 D 1 ? 1316 ? P9WGY7 1 ? 1316 ? 1 1316 
5 4 5UH6 E 1 ? 110  ? P9WGY5 1 ? 110  ? 1 110  
6 5 5UH6 F 1 ? 528  ? P9WGI1 1 ? 528  ? 1 528  
7 6 5UH6 H 1 ? 23   ? 5UH6   1 ? 23   ? 1 23   
8 7 5UH6 G 1 ? 16   ? 5UH6   5 ? 20   ? 5 20   
9 8 5UH6 I 1 ? 2    ? 5UH6   1 ? 2    ? 1 2    
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
RFP non-polymer         . RIFAMPICIN                           ? 'C43 H58 N4 O12'  822.940 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5UH6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.91 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.68 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM Tris-HCl, pH 8.2, 200 mM KCl, 50 mM MgCl2, and 10% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-04-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.929 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.929 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.entry_id                     5UH6 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.800 
_reflns.number_obs                   47440 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.700 
_reflns.pdbx_Rmerge_I_obs            0.134 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.800 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.500 
_reflns.pdbx_Rrim_I_all              0.142 
_reflns.pdbx_Rpim_I_all              0.046 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_netI_over_av_sigmaI     ? 
_reflns.pdbx_number_measured_all     355801 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_chi_squared             1.110 
_reflns.Rmerge_F_all                 ? 
_reflns.Rmerge_F_obs                 ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.observed_criterion_I_max     ? 
_reflns.observed_criterion_I_min     ? 
_reflns.pdbx_d_res_high_opt          ? 
_reflns.pdbx_d_res_low_opt           ? 
_reflns.details                      ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  3.800 3.940  ? ? ? ? 0.800 ? ? 0.844 4.300  ? ? ? 4404 ? ? ? ? 92.600  0.901 0.401 0.432 
1 2  3.940 4.090  ? ? ? ? 0.722 ? ? 0.821 4.900  ? ? ? 4531 ? ? ? ? 94.400  0.800 0.335 0.529 
1 3  4.090 4.280  ? ? ? ? 0.619 ? ? 0.885 5.600  ? ? ? 4589 ? ? ? ? 95.800  0.677 0.269 0.710 
1 4  4.280 4.500  ? ? ? ? 0.508 ? ? 0.945 6.200  ? ? ? 4656 ? ? ? ? 96.800  0.551 0.209 0.828 
1 5  4.500 4.790  ? ? ? ? 0.423 ? ? 0.985 6.900  ? ? ? 4732 ? ? ? ? 98.400  0.455 0.165 0.846 
1 6  4.790 5.160  ? ? ? ? 0.396 ? ? 1.025 7.600  ? ? ? 4794 ? ? ? ? 99.300  0.423 0.147 0.879 
1 7  5.160 5.670  ? ? ? ? 0.366 ? ? 1.037 8.500  ? ? ? 4825 ? ? ? ? 99.600  0.388 0.128 0.916 
1 8  5.670 6.490  ? ? ? ? 0.308 ? ? 1.101 9.400  ? ? ? 4870 ? ? ? ? 99.900  0.324 0.101 0.938 
1 9  6.490 8.180  ? ? ? ? 0.165 ? ? 1.437 10.300 ? ? ? 4925 ? ? ? ? 100.000 0.173 0.052 0.974 
1 10 8.180 50.000 ? ? ? ? 0.078 ? ? 1.350 10.600 ? ? ? 5114 ? ? ? ? 99.700  0.082 0.024 0.959 
# 
_refine.entry_id                                 5UH6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            3.8370 
_refine.ls_d_res_low                             50.0870 
_refine.pdbx_ls_sigma_F                          1.460 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    80.9600 
_refine.ls_number_reflns_obs                     39783 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2143 
_refine.ls_R_factor_R_work                       0.2117 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2638 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0200 
_refine.ls_number_reflns_R_free                  1996 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               60.2698 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.4700 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                244.800 
_refine.B_iso_min                                2.440 
_refine.pdbx_overall_phase_error                 21.1400 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.8370 
_refine_hist.d_res_low                        50.0870 
_refine_hist.pdbx_number_atoms_ligand         104 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               26128 
_refine_hist.pdbx_number_residues_total       3281 
_refine_hist.pdbx_B_iso_mean_ligand           34.41 
_refine_hist.pdbx_number_atoms_protein        25203 
_refine_hist.pdbx_number_atoms_nucleic_acid   821 
# 
_struct.entry_id                     5UH6 
_struct.title                        
'Crystal structure of Mycobacterium tuberculosis transcription initiation complex containing 2ntRNA in complex with Rifampin' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5UH6 
_struct_keywords.text            
'RNA polymerase complex, transcription, DNA, RNA, TRANSCRIPTION-DNA-RNA complex, transcription-dna-rna-antibiotic complex' 
_struct_keywords.pdbx_keywords   transcription/dna/rna/antibiotic 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 10 ? 
L N N 10 ? 
M N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? ILE A 46   ? GLY A 31   ILE A 46   1 ? 16 
HELX_P HELX_P2   AA2 ASP A 72   ? LEU A 80   ? ASP A 72   LEU A 80   1 ? 9  
HELX_P HELX_P3   AA3 LYS A 81   ? LEU A 83   ? LYS A 81   LEU A 83   5 ? 3  
HELX_P HELX_P4   AA4 GLY A 108  ? ILE A 110  ? GLY A 108  ILE A 110  5 ? 3  
HELX_P HELX_P5   AA5 PRO A 148  ? ASN A 152  ? PRO A 148  ASN A 152  5 ? 5  
HELX_P HELX_P6   AA6 SER A 203  ? GLY A 220  ? SER A 203  GLY A 220  1 ? 18 
HELX_P HELX_P7   AA7 LEU A 221  ? ARG A 223  ? LEU A 221  ARG A 223  5 ? 3  
HELX_P HELX_P8   AA8 PHE B 30   ? SER B 45   ? PHE B 30   SER B 45   1 ? 16 
HELX_P HELX_P9   AA9 ASP B 72   ? SER B 82   ? ASP B 72   SER B 82   1 ? 11 
HELX_P HELX_P10  AB1 ALA B 149  ? ARG B 153  ? ALA B 149  ARG B 153  5 ? 5  
HELX_P HELX_P11  AB2 SER B 203  ? GLU B 224  ? SER B 203  GLU B 224  1 ? 22 
HELX_P HELX_P12  AB3 LEU C 54   ? GLY C 66   ? LEU C 54   GLY C 66   1 ? 13 
HELX_P HELX_P13  AB4 SER C 67   ? ARG C 77   ? SER C 67   ARG C 77   1 ? 11 
HELX_P HELX_P14  AB5 GLY C 84   ? SER C 94   ? GLY C 84   SER C 94   1 ? 11 
HELX_P HELX_P15  AB6 PRO C 118  ? LYS C 125  ? PRO C 118  LYS C 125  1 ? 8  
HELX_P HELX_P16  AB7 VAL C 234  ? GLY C 242  ? VAL C 234  GLY C 242  1 ? 9  
HELX_P HELX_P17  AB8 THR C 244  ? PHE C 252  ? THR C 244  PHE C 252  1 ? 9  
HELX_P HELX_P18  AB9 SER C 255  ? LYS C 264  ? SER C 255  LYS C 264  1 ? 10 
HELX_P HELX_P19  AC1 GLY C 269  ? ARG C 282  ? GLY C 269  ARG C 282  1 ? 14 
HELX_P HELX_P20  AC2 SER C 291  ? LYS C 302  ? SER C 291  LYS C 302  1 ? 12 
HELX_P HELX_P21  AC3 ALA C 309  ? GLY C 321  ? ALA C 309  GLY C 321  1 ? 13 
HELX_P HELX_P22  AC4 THR C 334  ? GLU C 350  ? THR C 334  GLU C 350  1 ? 17 
HELX_P HELX_P23  AC5 THR C 380  ? GLN C 407  ? THR C 380  GLN C 407  1 ? 28 
HELX_P HELX_P24  AC6 ASP C 408  ? ILE C 412  ? ASP C 408  ILE C 412  5 ? 5  
HELX_P HELX_P25  AC7 THR C 413  ? ILE C 418  ? THR C 413  ILE C 418  1 ? 6  
HELX_P HELX_P26  AC8 ILE C 420  ? SER C 434  ? ILE C 420  SER C 434  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 444  ? ARG C 453  ? ASN C 444  ARG C 453  1 ? 10 
HELX_P HELX_P28  AD1 HIS C 476  ? TYR C 480  ? HIS C 476  TYR C 480  5 ? 5  
HELX_P HELX_P29  AD2 THR C 532  ? ARG C 538  ? THR C 532  ARG C 538  1 ? 7  
HELX_P HELX_P30  AD3 LYS C 564  ? GLY C 566  ? LYS C 564  GLY C 566  5 ? 3  
HELX_P HELX_P31  AD4 SER C 574  ? VAL C 576  ? SER C 574  VAL C 576  5 ? 3  
HELX_P HELX_P32  AD5 SER C 582  ? MET C 586  ? SER C 582  MET C 586  5 ? 5  
HELX_P HELX_P33  AD6 ALA C 590  ? ILE C 594  ? ALA C 590  ILE C 594  5 ? 5  
HELX_P HELX_P34  AD7 PHE C 596  ? ASP C 600  ? PHE C 596  ASP C 600  5 ? 5  
HELX_P HELX_P35  AD8 ASP C 601  ? ARG C 613  ? ASP C 601  ARG C 613  1 ? 13 
HELX_P HELX_P36  AD9 MET C 630  ? GLY C 639  ? MET C 630  GLY C 639  1 ? 10 
HELX_P HELX_P37  AE1 ASN C 739  ? GLU C 744  ? ASN C 739  GLU C 744  1 ? 6  
HELX_P HELX_P38  AE2 VAL C 780  ? LEU C 784  ? VAL C 780  LEU C 784  5 ? 5  
HELX_P HELX_P39  AE3 THR C 815  ? PHE C 825  ? THR C 815  PHE C 825  1 ? 11 
HELX_P HELX_P40  AE4 PRO C 900  ? MET C 904  ? PRO C 900  MET C 904  5 ? 5  
HELX_P HELX_P41  AE5 ILE C 928  ? GLY C 943  ? ILE C 928  GLY C 943  1 ? 16 
HELX_P HELX_P42  AE6 ASP C 954  ? ARG C 958  ? ASP C 954  ARG C 958  5 ? 5  
HELX_P HELX_P43  AE7 PRO C 960  ? LEU C 963  ? PRO C 960  LEU C 963  5 ? 4  
HELX_P HELX_P44  AE8 GLN C 981  ? CYS C 991  ? GLN C 981  CYS C 991  1 ? 11 
HELX_P HELX_P45  AE9 LEU C 1036 ? ILE C 1041 ? LEU C 1036 ILE C 1041 1 ? 6  
HELX_P HELX_P46  AF1 GLY C 1069 ? GLY C 1080 ? GLY C 1069 GLY C 1080 1 ? 12 
HELX_P HELX_P47  AF2 ALA C 1081 ? THR C 1090 ? ALA C 1081 THR C 1090 1 ? 10 
HELX_P HELX_P48  AF3 VAL C 1097 ? LYS C 1108 ? VAL C 1097 LYS C 1108 1 ? 12 
HELX_P HELX_P49  AF4 PRO C 1118 ? SER C 1130 ? PRO C 1118 SER C 1130 1 ? 13 
HELX_P HELX_P50  AF5 THR D 16   ? TRP D 23   ? THR D 16   TRP D 23   1 ? 8  
HELX_P HELX_P51  AF6 ARG D 84   ? GLU D 90   ? ARG D 84   GLU D 90   5 ? 7  
HELX_P HELX_P52  AF7 ILE D 104  ? PHE D 107  ? ILE D 104  PHE D 107  5 ? 4  
HELX_P HELX_P53  AF8 SER D 112  ? LEU D 118  ? SER D 112  LEU D 118  1 ? 7  
HELX_P HELX_P54  AF9 ALA D 121  ? TYR D 130  ? ALA D 121  TYR D 130  1 ? 10 
HELX_P HELX_P55  AG1 ASP D 140  ? GLU D 187  ? ASP D 140  GLU D 187  1 ? 48 
HELX_P HELX_P56  AG2 LYS D 190  ? LYS D 228  ? LYS D 190  LYS D 228  1 ? 39 
HELX_P HELX_P57  AG3 ASP D 237  ? GLY D 249  ? ASP D 237  GLY D 249  1 ? 13 
HELX_P HELX_P58  AG4 GLY D 257  ? ASN D 267  ? GLY D 257  ASN D 267  1 ? 11 
HELX_P HELX_P59  AG5 ASP D 269  ? ASN D 283  ? ASP D 269  ASN D 283  1 ? 15 
HELX_P HELX_P60  AG6 LYS D 285  ? SER D 305  ? LYS D 285  SER D 305  1 ? 21 
HELX_P HELX_P61  AG7 SER D 308  ? GLY D 311  ? SER D 308  GLY D 311  5 ? 4  
HELX_P HELX_P62  AG8 PRO D 321  ? ARG D 325  ? PRO D 321  ARG D 325  5 ? 5  
HELX_P HELX_P63  AG9 ASP D 339  ? LEU D 360  ? ASP D 339  LEU D 360  1 ? 22 
HELX_P HELX_P64  AH1 PRO D 363  ? ASP D 383  ? PRO D 363  ASP D 383  1 ? 21 
HELX_P HELX_P65  AH2 LEU D 402  ? LEU D 406  ? LEU D 402  LEU D 406  5 ? 5  
HELX_P HELX_P66  AH3 LYS D 445  ? PHE D 452  ? LYS D 445  PHE D 452  1 ? 8  
HELX_P HELX_P67  AH4 PHE D 452  ? LEU D 463  ? PHE D 452  LEU D 463  1 ? 12 
HELX_P HELX_P68  AH5 ASN D 468  ? ARG D 478  ? ASN D 468  ARG D 478  1 ? 11 
HELX_P HELX_P69  AH6 GLN D 482  ? ILE D 491  ? GLN D 482  ILE D 491  1 ? 10 
HELX_P HELX_P70  AH7 HIS D 505  ? LEU D 507  ? HIS D 505  LEU D 507  5 ? 3  
HELX_P HELX_P71  AH8 VAL D 528  ? ASN D 533  ? VAL D 528  ASN D 533  1 ? 6  
HELX_P HELX_P72  AH9 SER D 548  ? MET D 559  ? SER D 548  MET D 559  1 ? 12 
HELX_P HELX_P73  AI1 LEU D 579  ? THR D 589  ? LEU D 579  THR D 589  1 ? 11 
HELX_P HELX_P74  AI2 SER D 614  ? GLY D 625  ? SER D 614  GLY D 625  1 ? 12 
HELX_P HELX_P75  AI3 PRO D 643  ? GLY D 652  ? PRO D 643  GLY D 652  1 ? 10 
HELX_P HELX_P76  AI4 THR D 667  ? GLU D 675  ? THR D 667  GLU D 675  1 ? 9  
HELX_P HELX_P77  AI5 HIS D 689  ? ARG D 703  ? HIS D 689  ARG D 703  1 ? 15 
HELX_P HELX_P78  AI6 PRO D 705  ? ARG D 726  ? PRO D 705  ARG D 726  1 ? 22 
HELX_P HELX_P79  AI7 ARG D 741  ? ARG D 762  ? ARG D 741  ARG D 762  1 ? 22 
HELX_P HELX_P80  AI8 ASN D 766  ? TYR D 793  ? ASN D 766  TYR D 793  1 ? 28 
HELX_P HELX_P81  AI9 ASN D 797  ? SER D 805  ? ASN D 797  SER D 805  1 ? 9  
HELX_P HELX_P82  AJ1 ASN D 810  ? GLY D 819  ? ASN D 810  GLY D 819  1 ? 10 
HELX_P HELX_P83  AJ2 THR D 845  ? SER D 881  ? THR D 845  SER D 881  1 ? 37 
HELX_P HELX_P84  AJ3 TYR D 915  ? ALA D 920  ? TYR D 915  ALA D 920  1 ? 6  
HELX_P HELX_P85  AJ4 GLY D 945  ? ALA D 955  ? GLY D 945  ALA D 955  1 ? 11 
HELX_P HELX_P86  AJ5 ALA D 976  ? GLY D 980  ? ALA D 976  GLY D 980  1 ? 5  
HELX_P HELX_P87  AJ6 ALA D 994  ? GLU D 1005 ? ALA D 994  GLU D 1005 1 ? 12 
HELX_P HELX_P88  AJ7 GLY D 1027 ? GLU D 1036 ? GLY D 1027 GLU D 1036 1 ? 10 
HELX_P HELX_P89  AJ8 ASP D 1117 ? GLY D 1126 ? ASP D 1117 GLY D 1126 1 ? 10 
HELX_P HELX_P90  AJ9 GLY D 1126 ? GLN D 1145 ? GLY D 1126 GLN D 1145 1 ? 20 
HELX_P HELX_P91  AK1 HIS D 1150 ? GLN D 1160 ? HIS D 1150 GLN D 1160 1 ? 11 
HELX_P HELX_P92  AK2 ARG D 1183 ? ALA D 1195 ? ARG D 1183 ALA D 1195 1 ? 13 
HELX_P HELX_P93  AK3 GLY D 1209 ? ALA D 1216 ? GLY D 1209 ALA D 1216 1 ? 8  
HELX_P HELX_P94  AK4 SER D 1219 ? SER D 1225 ? SER D 1219 SER D 1225 1 ? 7  
HELX_P HELX_P95  AK5 GLU D 1228 ? CYS D 1240 ? GLU D 1228 CYS D 1240 1 ? 13 
HELX_P HELX_P96  AK6 GLY D 1247 ? GLY D 1255 ? GLY D 1247 GLY D 1255 1 ? 9  
HELX_P HELX_P97  AK7 ALA D 1260 ? GLY D 1263 ? ALA D 1260 GLY D 1263 5 ? 4  
HELX_P HELX_P98  AK8 ILE D 1264 ? ASN D 1269 ? ILE D 1264 ASN D 1269 1 ? 6  
HELX_P HELX_P99  AK9 LEU E 33   ? ASN E 37   ? LEU E 33   ASN E 37   5 ? 5  
HELX_P HELX_P100 AL1 PRO E 39   ? ASP E 45   ? PRO E 39   ASP E 45   1 ? 7  
HELX_P HELX_P101 AL2 SER E 49   ? GLY E 72   ? SER E 49   GLY E 72   1 ? 24 
HELX_P HELX_P102 AL3 LYS E 90   ? ALA E 101  ? LYS E 90   ALA E 101  1 ? 12 
HELX_P HELX_P103 AL4 SER F 209  ? THR F 222  ? SER F 209  THR F 222  1 ? 14 
HELX_P HELX_P104 AL5 ASP F 226  ? GLY F 236  ? ASP F 226  GLY F 236  1 ? 11 
HELX_P HELX_P105 AL6 ASN F 242  ? GLY F 270  ? ASN F 242  GLY F 270  1 ? 29 
HELX_P HELX_P106 AL7 PRO F 274  ? ASN F 299  ? PRO F 274  ASN F 299  1 ? 26 
HELX_P HELX_P107 AL8 ASN F 299  ? LEU F 306  ? ASN F 299  LEU F 306  1 ? 8  
HELX_P HELX_P108 AL9 ALA F 307  ? THR F 311  ? ALA F 307  THR F 311  5 ? 5  
HELX_P HELX_P109 AM1 ALA F 316  ? LYS F 334  ? ALA F 316  LYS F 334  1 ? 19 
HELX_P HELX_P110 AM2 LYS F 342  ? ALA F 363  ? LYS F 342  ALA F 363  1 ? 22 
HELX_P HELX_P111 AM3 PRO F 369  ? GLN F 388  ? PRO F 369  GLN F 388  1 ? 20 
HELX_P HELX_P112 AM4 THR F 395  ? ASP F 404  ? THR F 395  ASP F 404  1 ? 10 
HELX_P HELX_P113 AM5 THR F 406  ? ALA F 417  ? THR F 406  ALA F 417  1 ? 12 
HELX_P HELX_P114 AM6 GLN F 434  ? PHE F 438  ? GLN F 434  PHE F 438  5 ? 5  
HELX_P HELX_P115 AM7 VAL F 446  ? GLN F 461  ? VAL F 446  GLN F 461  1 ? 16 
HELX_P HELX_P116 AM8 ARG F 470  ? PHE F 479  ? ARG F 470  PHE F 479  1 ? 10 
HELX_P HELX_P117 AM9 THR F 488  ? TYR F 496  ? THR F 488  TYR F 496  1 ? 9  
HELX_P HELX_P118 AN1 GLU F 501  ? SER F 512  ? GLU F 501  SER F 512  1 ? 12 
HELX_P HELX_P119 AN2 LEU F 514  ? SER F 520  ? LEU F 514  SER F 520  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? D CYS 975 SG    ? ? ? 1_555 D CYS 978 SG ? ? D CYS 975 D CYS 978  1_555 ? ? ? ? ? ? ?                       
2.048 ? 
metalc1  metalc ? ? D CYS 60  SG    ? ? ? 1_555 L ZN  .   ZN ? ? D CYS 60  D ZN  1402 1_555 ? ? ? ? ? ? ?                       
2.116 ? 
metalc2  metalc ? ? D CYS 62  SG    ? ? ? 1_555 L ZN  .   ZN ? ? D CYS 62  D ZN  1402 1_555 ? ? ? ? ? ? ?                       
2.187 ? 
metalc3  metalc ? ? D CYS 75  SG    ? ? ? 1_555 L ZN  .   ZN ? ? D CYS 75  D ZN  1402 1_555 ? ? ? ? ? ? ?                       
2.263 ? 
metalc4  metalc ? ? D CYS 78  SG    ? ? ? 1_555 L ZN  .   ZN ? ? D CYS 78  D ZN  1402 1_555 ? ? ? ? ? ? ?                       
2.263 ? 
metalc5  metalc ? ? D ASP 535 OD1   ? ? ? 1_555 M MG  .   MG ? ? D ASP 535 D MG  1403 1_555 ? ? ? ? ? ? ?                       
1.856 ? 
metalc6  metalc ? ? D ASP 535 OD2   ? ? ? 1_555 M MG  .   MG ? ? D ASP 535 D MG  1403 1_555 ? ? ? ? ? ? ?                       
2.714 ? 
metalc7  metalc ? ? D ASP 537 OD1   ? ? ? 1_555 M MG  .   MG ? ? D ASP 537 D MG  1403 1_555 ? ? ? ? ? ? ?                       
2.402 ? 
metalc8  metalc ? ? D ASP 539 OD1   ? ? ? 1_555 M MG  .   MG ? ? D ASP 539 D MG  1403 1_555 ? ? ? ? ? ? ?                       
2.467 ? 
metalc9  metalc ? ? D CYS 891 SG    ? ? ? 1_555 K ZN  .   ZN ? ? D CYS 891 D ZN  1401 1_555 ? ? ? ? ? ? ?                       
2.345 ? 
metalc10 metalc ? ? D CYS 968 SG    ? ? ? 1_555 K ZN  .   ZN ? ? D CYS 968 D ZN  1401 1_555 ? ? ? ? ? ? ?                       
2.256 ? 
metalc11 metalc ? ? D CYS 975 SG    ? ? ? 1_555 K ZN  .   ZN ? ? D CYS 975 D ZN  1401 1_555 ? ? ? ? ? ? ?                       
2.407 ? 
metalc12 metalc ? ? D CYS 978 SG    ? ? ? 1_555 K ZN  .   ZN ? ? D CYS 978 D ZN  1401 1_555 ? ? ? ? ? ? ?                       
2.395 ? 
metalc13 metalc ? ? I A   2   "O3'" ? ? ? 1_555 M MG  .   MG ? ? I A   2   D MG  1403 1_555 ? ? ? ? ? ? ?                       
1.782 ? 
hydrog1  hydrog ? ? H DT  11  N3    ? ? ? 1_555 I A   2   N1 ? ? G DT  15  I A   2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog2  hydrog ? ? H DT  11  O4    ? ? ? 1_555 I A   2   N6 ? ? G DT  15  I A   2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog3  hydrog ? ? H DC  12  N3    ? ? ? 1_555 I G   1   N1 ? ? G DC  16  I G   1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog4  hydrog ? ? H DC  12  N4    ? ? ? 1_555 I G   1   O6 ? ? G DC  16  I G   1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog5  hydrog ? ? H DC  12  O2    ? ? ? 1_555 I G   1   N2 ? ? G DC  16  I G   1    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog6  hydrog ? ? G DT  15  N3    ? ? ? 1_555 H DA  9   N1 ? ? H DT  15  G DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog7  hydrog ? ? G DT  15  O4    ? ? ? 1_555 H DA  9   N6 ? ? H DT  15  G DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog8  hydrog ? ? G DC  16  N3    ? ? ? 1_555 H DG  8   N2 ? ? H DC  16  G DG  12   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog9  hydrog ? ? G DC  16  O2    ? ? ? 1_555 H DG  8   N1 ? ? H DC  16  G DG  12   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog10 hydrog ? ? G DA  17  N1    ? ? ? 1_555 H DT  7   N3 ? ? H DA  17  G DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog11 hydrog ? ? G DA  17  N6    ? ? ? 1_555 H DT  7   O4 ? ? H DA  17  G DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog12 hydrog ? ? G DC  18  N3    ? ? ? 1_555 H DG  6   N1 ? ? H DC  18  G DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog13 hydrog ? ? G DC  18  N4    ? ? ? 1_555 H DG  6   O6 ? ? H DC  18  G DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog14 hydrog ? ? G DC  18  O2    ? ? ? 1_555 H DG  6   N2 ? ? H DC  18  G DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog15 hydrog ? ? G DG  19  N1    ? ? ? 1_555 H DC  5   N3 ? ? H DG  19  G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog16 hydrog ? ? G DG  19  N2    ? ? ? 1_555 H DC  5   O2 ? ? H DG  19  G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog17 hydrog ? ? G DG  19  O6    ? ? ? 1_555 H DC  5   N4 ? ? H DG  19  G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog18 hydrog ? ? G DG  20  N1    ? ? ? 1_555 H DC  4   N3 ? ? H DG  20  G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog19 hydrog ? ? G DG  20  N2    ? ? ? 1_555 H DC  4   O2 ? ? H DG  20  G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog20 hydrog ? ? G DG  20  O6    ? ? ? 1_555 H DC  4   N4 ? ? H DG  20  G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog21 hydrog ? ? G DA  21  N1    ? ? ? 1_555 H DT  3   N3 ? ? H DA  21  G DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog22 hydrog ? ? G DA  21  N6    ? ? ? 1_555 H DT  3   O4 ? ? H DA  21  G DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog23 hydrog ? ? G DT  22  N3    ? ? ? 1_555 H DA  2   N1 ? ? H DT  22  G DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog24 hydrog ? ? G DT  22  O4    ? ? ? 1_555 H DA  2   N6 ? ? H DT  22  G DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog25 hydrog ? ? G DG  23  N1    ? ? ? 1_555 H DC  1   N3 ? ? H DG  23  G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog26 hydrog ? ? G DG  23  N2    ? ? ? 1_555 H DC  1   O2 ? ? H DG  23  G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog27 hydrog ? ? G DG  23  O6    ? ? ? 1_555 H DC  1   N4 ? ? H DG  23  G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 24  A . ? GLU 24  A PRO 25  A ? PRO 25  A 1 -1.86 
2 GLU 24  B . ? GLU 24  B PRO 25  B ? PRO 25  B 1 -2.47 
3 SER 94  C . ? SER 94  C PRO 95  C ? PRO 95  C 1 -4.25 
4 VAL 110 D . ? VAL 110 D PRO 111 D ? PRO 111 D 1 0.53  
5 ALA 501 D . ? ALA 501 D PRO 502 D ? PRO 502 D 1 -2.79 
6 LEU 677 D . ? LEU 677 D PRO 678 D ? PRO 678 D 1 -9.16 
7 ASN 37  E . ? ASN 37  E PRO 38  E ? PRO 38  E 1 1.04  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 6 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 5 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 2 ? 
AD2 ? 8 ? 
AD3 ? 2 ? 
AD4 ? 3 ? 
AD5 ? 3 ? 
AD6 ? 3 ? 
AD7 ? 3 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 3 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 4 ? 
AE6 ? 3 ? 
AE7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC1 4 5 ? anti-parallel 
AC1 5 6 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD2 5 6 ? parallel      
AD2 6 7 ? anti-parallel 
AD2 7 8 ? parallel      
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? parallel      
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? parallel      
AD8 1 2 ? anti-parallel 
AD9 1 2 ? parallel      
AD9 2 3 ? anti-parallel 
AE1 1 2 ? parallel      
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 11   ? LEU A 14   ? GLU A 11   LEU A 14   
AA1 2 ARG A 18   ? LEU A 26   ? ARG A 18   LEU A 26   
AA1 3 PHE A 189  ? THR A 198  ? PHE A 189  THR A 198  
AA1 4 VAL A 171  ? THR A 181  ? VAL A 171  THR A 181  
AA2 1 VAL A 93   ? THR A 94   ? VAL A 93   THR A 94   
AA2 2 LEU A 134  ? ARG A 144  ? LEU A 134  ARG A 144  
AA2 3 LEU A 97   ? LYS A 99   ? LEU A 97   LYS A 99   
AA3 1 VAL A 93   ? THR A 94   ? VAL A 93   THR A 94   
AA3 2 LEU A 134  ? ARG A 144  ? LEU A 134  ARG A 144  
AA3 3 PRO A 47   ? ILE A 56   ? PRO A 47   ILE A 56   
AA3 4 ILE A 162  ? PRO A 163  ? ILE A 162  PRO A 163  
AA4 1 VAL A 85   ? SER A 87   ? VAL A 85   SER A 87   
AA4 2 VAL A 116  ? VAL A 118  ? VAL A 116  VAL A 118  
AA5 1 GLY A 103  ? THR A 106  ? GLY A 103  THR A 106  
AA5 2 HIS A 124  ? LEU A 128  ? HIS A 124  LEU A 128  
AA6 1 TYR A 146  ? VAL A 147  ? TYR A 146  VAL A 147  
AA6 2 SER A 166  ? ILE A 167  ? SER A 166  ILE A 167  
AA7 1 LEU B 9    ? VAL B 13   ? LEU B 9    VAL B 13   
AA7 2 ARG B 18   ? LEU B 26   ? ARG B 18   LEU B 26   
AA7 3 ASP B 190  ? THR B 198  ? ASP B 190  THR B 198  
AA7 4 VAL B 171  ? ALA B 180  ? VAL B 171  ALA B 180  
AA8 1 VAL B 93   ? GLN B 100  ? VAL B 93   GLN B 100  
AA8 2 LYS B 133  ? ARG B 144  ? LYS B 133  ARG B 144  
AA8 3 PRO B 47   ? ILE B 56   ? PRO B 47   ILE B 56   
AA8 4 ARG B 161  ? PRO B 163  ? ARG B 161  PRO B 163  
AA9 1 VAL B 85   ? SER B 87   ? VAL B 85   SER B 87   
AA9 2 VAL B 116  ? VAL B 118  ? VAL B 116  VAL B 118  
AB1 1 GLY B 103  ? THR B 106  ? GLY B 103  THR B 106  
AB1 2 HIS B 124  ? LEU B 128  ? HIS B 124  LEU B 128  
AB2 1 VAL C 39   ? SER C 40   ? VAL C 39   SER C 40   
AB2 2 VAL C 972  ? SER C 973  ? VAL C 972  SER C 973  
AB2 3 VAL C 626  ? GLY C 627  ? VAL C 626  GLY C 627  
AB3 1 ILE C 96   ? GLU C 97   ? ILE C 96   GLU C 97   
AB3 2 MET C 103  ? PHE C 112  ? MET C 103  PHE C 112  
AB3 3 ALA C 130  ? ASN C 141  ? ALA C 130  ASN C 141  
AB3 4 ILE C 147  ? PRO C 158  ? ILE C 147  PRO C 158  
AB4 1 PHE C 166  ? ILE C 168  ? PHE C 166  ILE C 168  
AB4 2 THR C 171  ? VAL C 175  ? THR C 171  VAL C 175  
AB4 3 SER C 437  ? PHE C 439  ? SER C 437  PHE C 439  
AB5 1 ARG C 376  ? ARG C 379  ? ARG C 376  ARG C 379  
AB5 2 SER C 177  ? ARG C 181  ? SER C 177  ARG C 181  
AB5 3 ARG C 454  ? SER C 456  ? ARG C 454  SER C 456  
AB5 4 ILE C 497  ? SER C 499  ? ILE C 497  SER C 499  
AB6 1 GLY C 184  ? ILE C 191  ? GLY C 184  ILE C 191  
AB6 2 THR C 198  ? ILE C 205  ? THR C 198  ILE C 205  
AB7 1 GLU C 213  ? VAL C 216  ? GLU C 213  VAL C 216  
AB7 2 VAL C 222  ? ARG C 225  ? VAL C 222  ARG C 225  
AB7 3 GLN C 232  ? PRO C 233  ? GLN C 232  PRO C 233  
AB8 1 THR C 354  ? THR C 356  ? THR C 354  THR C 356  
AB8 2 GLU C 362  ? PRO C 364  ? GLU C 362  PRO C 364  
AB9 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AB9 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AB9 3 VAL C 524  ? LEU C 531  ? VAL C 524  LEU C 531  
AC1 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AC1 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AC1 3 TYR C 578  ? ASP C 580  ? TYR C 578  ASP C 580  
AC1 4 VAL C 541  ? ALA C 542  ? VAL C 541  ALA C 542  
AC1 5 ARG C 558  ? ARG C 563  ? ARG C 558  ARG C 563  
AC1 6 GLU C 567  ? PRO C 572  ? GLU C 567  PRO C 572  
AC2 1 VAL C 642  ? VAL C 643  ? VAL C 642  VAL C 643  
AC2 2 VAL C 701  ? ASP C 704  ? VAL C 701  ASP C 704  
AC2 3 CYS C 687  ? PRO C 688  ? CYS C 687  PRO C 688  
AC3 1 ARG C 667  ? ARG C 671  ? ARG C 667  ARG C 671  
AC3 2 TYR C 657  ? HIS C 662  ? TYR C 657  HIS C 662  
AC3 3 GLY C 648  ? VAL C 653  ? GLY C 648  VAL C 653  
AC3 4 ARG C 695  ? VAL C 696  ? ARG C 695  VAL C 696  
AC4 1 ALA C 676  ? ARG C 677  ? ALA C 676  ARG C 677  
AC4 2 CYS C 683  ? ALA C 684  ? CYS C 683  ALA C 684  
AC5 1 THR C 708  ? ASP C 709  ? THR C 708  ASP C 709  
AC5 2 GLU C 712  ? MET C 713  ? GLU C 712  MET C 713  
AC6 1 LYS C 1007 ? ALA C 1008 ? LYS C 1007 ALA C 1008 
AC6 2 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC6 3 LYS C 884  ? ALA C 886  ? LYS C 884  ALA C 886  
AC6 4 LYS C 892  ? LEU C 899  ? LYS C 892  LEU C 899  
AC6 5 ILE C 735  ? SER C 738  ? ILE C 735  SER C 738  
AC6 6 ILE C 915  ? ILE C 916  ? ILE C 915  ILE C 916  
AC6 7 GLY C 716  ? ALA C 722  ? GLY C 716  ALA C 722  
AC6 8 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC7 1 GLY C 765  ? ALA C 766  ? GLY C 765  ALA C 766  
AC7 2 SER C 749  ? THR C 762  ? SER C 749  THR C 762  
AC7 3 VAL C 865  ? ARG C 877  ? VAL C 865  ARG C 877  
AC7 4 GLY C 845  ? SER C 854  ? GLY C 845  SER C 854  
AC7 5 GLU C 795  ? VAL C 796  ? GLU C 795  VAL C 796  
AC8 1 GLU C 768  ? ILE C 769  ? GLU C 768  ILE C 769  
AC8 2 LYS C 805  ? PRO C 808  ? LYS C 805  PRO C 808  
AC8 3 VAL C 832  ? ASP C 834  ? VAL C 832  ASP C 834  
AC9 1 ILE C 801  ? VAL C 803  ? ILE C 801  VAL C 803  
AC9 2 LEU C 837  ? LYS C 838  ? LEU C 837  LYS C 838  
AD1 1 TRP C 944  ? LYS C 945  ? TRP C 944  LYS C 945  
AD1 2 GLU C 965  ? ALA C 966  ? GLU C 965  ALA C 966  
AD2 1 HIS C 1042 ? ARG C 1044 ? HIS C 1042 ARG C 1044 
AD2 2 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD2 3 GLN D 540  ? HIS D 544  ? GLN D 540  HIS D 544  
AD2 4 VAL D 496  ? ASN D 499  ? VAL D 496  ASN D 499  
AD2 5 ILE D 509  ? VAL D 517  ? ILE D 509  VAL D 517  
AD2 6 GLN D 440  ? PRO D 444  ? GLN D 440  PRO D 444  
AD2 7 ILE D 522  ? LEU D 524  ? ILE D 522  LEU D 524  
AD2 8 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD3 1 ARG C 1067 ? PHE C 1068 ? ARG C 1067 PHE C 1068 
AD3 2 LYS D 420  ? ARG D 421  ? LYS D 420  ARG D 421  
AD4 1 LEU C 1133 ? LEU C 1138 ? LEU C 1133 LEU C 1138 
AD4 2 GLU D 9    ? LEU D 14   ? GLU D 9    LEU D 14   
AD4 3 SER D 1242 ? LYS D 1244 ? SER D 1242 LYS D 1244 
AD5 1 SER D 24   ? GLU D 27   ? SER D 24   GLU D 27   
AD5 2 MET D 92   ? THR D 102  ? MET D 92   THR D 102  
AD5 3 VAL D 313  ? VAL D 319  ? VAL D 313  VAL D 319  
AD6 1 LEU D 234  ? ILE D 235  ? LEU D 234  ILE D 235  
AD6 2 TYR D 134  ? VAL D 139  ? TYR D 134  VAL D 139  
AD6 3 PHE D 252  ? ALA D 255  ? PHE D 252  ALA D 255  
AD7 1 MET D 327  ? GLN D 329  ? MET D 327  GLN D 329  
AD7 2 PHE D 335  ? THR D 337  ? PHE D 335  THR D 337  
AD7 3 ILE F 421  ? SER F 422  ? ILE F 421  SER F 422  
AD8 1 THR D 392  ? GLY D 393  ? THR D 392  GLY D 393  
AD8 2 ARG D 397  ? PRO D 398  ? ARG D 397  PRO D 398  
AD9 1 VAL D 611  ? TYR D 612  ? VAL D 611  TYR D 612  
AD9 2 LYS D 634  ? LEU D 637  ? LYS D 634  LEU D 637  
AD9 3 TRP D 662  ? ALA D 664  ? TRP D 662  ALA D 664  
AE1 1 VAL D 886  ? GLU D 888  ? VAL D 886  GLU D 888  
AE1 2 VAL D 974  ? CYS D 975  ? VAL D 974  CYS D 975  
AE2 1 ILE D 897  ? GLU D 900  ? ILE D 897  GLU D 900  
AE2 2 GLN D 959  ? ARG D 963  ? GLN D 959  ARG D 963  
AE2 3 THR D 924  ? LEU D 925  ? THR D 924  LEU D 925  
AE3 1 ALA D 902  ? ARG D 904  ? ALA D 902  ARG D 904  
AE3 2 LEU D 910  ? ARG D 912  ? LEU D 910  ARG D 912  
AE4 1 ALA D 929  ? VAL D 930  ? ALA D 929  VAL D 930  
AE4 2 VAL D 936  ? VAL D 938  ? VAL D 936  VAL D 938  
AE5 1 VAL D 1075 ? LYS D 1079 ? VAL D 1075 LYS D 1079 
AE5 2 TYR D 1062 ? PRO D 1068 ? TYR D 1062 PRO D 1068 
AE5 3 GLY D 1051 ? LEU D 1055 ? GLY D 1051 LEU D 1055 
AE5 4 HIS D 1104 ? VAL D 1105 ? HIS D 1104 VAL D 1105 
AE6 1 ILE D 1181 ? ASP D 1182 ? ILE D 1181 ASP D 1182 
AE6 2 ARG D 1164 ? ASP D 1169 ? ARG D 1164 ASP D 1169 
AE6 3 ALA D 1202 ? PRO D 1205 ? ALA D 1202 PRO D 1205 
AE7 1 ALA D 1271 ? PRO D 1274 ? ALA D 1271 PRO D 1274 
AE7 2 LEU E 104  ? THR E 107  ? LEU E 104  THR E 107  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 13   ? N VAL A 13   O GLN A 20   ? O GLN A 20   
AA1 2 3 N ILE A 23   ? N ILE A 23   O LEU A 192  ? O LEU A 192  
AA1 3 4 O ASP A 195  ? O ASP A 195  N THR A 175  ? N THR A 175  
AA2 1 2 N VAL A 93   ? N VAL A 93   O VAL A 140  ? O VAL A 140  
AA2 2 3 O VAL A 136  ? O VAL A 136  N LEU A 97   ? N LEU A 97   
AA3 1 2 N VAL A 93   ? N VAL A 93   O VAL A 140  ? O VAL A 140  
AA3 2 3 O GLY A 143  ? O GLY A 143  N GLY A 48   ? N GLY A 48   
AA3 3 4 N ILE A 54   ? N ILE A 54   O ILE A 162  ? O ILE A 162  
AA4 1 2 N SER A 86   ? N SER A 86   O THR A 117  ? O THR A 117  
AA5 1 2 N VAL A 105  ? N VAL A 105  O ALA A 126  ? O ALA A 126  
AA6 1 2 N VAL A 147  ? N VAL A 147  O SER A 166  ? O SER A 166  
AA7 1 2 N LEU B 9    ? N LEU B 9    O GLU B 24   ? O GLU B 24   
AA7 2 3 N ILE B 23   ? N ILE B 23   O LEU B 192  ? O LEU B 192  
AA7 3 4 O LYS B 191  ? O LYS B 191  N ASP B 179  ? N ASP B 179  
AA8 1 2 N MET B 95   ? N MET B 95   O LEU B 138  ? O LEU B 138  
AA8 2 3 O VAL B 139  ? O VAL B 139  N THR B 52   ? N THR B 52   
AA8 3 4 N ILE B 54   ? N ILE B 54   O ILE B 162  ? O ILE B 162  
AA9 1 2 N SER B 86   ? N SER B 86   O THR B 117  ? O THR B 117  
AB1 1 2 N GLY B 103  ? N GLY B 103  O LEU B 128  ? O LEU B 128  
AB2 1 2 N VAL C 39   ? N VAL C 39   O SER C 973  ? O SER C 973  
AB2 2 3 O VAL C 972  ? O VAL C 972  N GLY C 627  ? N GLY C 627  
AB3 1 2 N ILE C 96   ? N ILE C 96   O LEU C 105  ? O LEU C 105  
AB3 2 3 N SER C 104  ? N SER C 104  O ILE C 140  ? O ILE C 140  
AB3 3 4 N ALA C 137  ? N ALA C 137  O GLN C 150  ? O GLN C 150  
AB4 1 2 N PHE C 166  ? N PHE C 166  O ARG C 173  ? O ARG C 173  
AB4 2 3 N VAL C 174  ? N VAL C 174  O GLN C 438  ? O GLN C 438  
AB5 1 2 O ARG C 377  ? O ARG C 377  N VAL C 180  ? N VAL C 180  
AB5 2 3 N LEU C 179  ? N LEU C 179  O SER C 456  ? O SER C 456  
AB5 3 4 N LEU C 455  ? N LEU C 455  O GLY C 498  ? O GLY C 498  
AB6 1 2 N ASP C 188  ? N ASP C 188  O SER C 201  ? O SER C 201  
AB7 1 2 N GLU C 213  ? N GLU C 213  O ARG C 225  ? O ARG C 225  
AB7 2 3 N VAL C 224  ? N VAL C 224  O GLN C 232  ? O GLN C 232  
AB8 1 2 N MET C 355  ? N MET C 355  O VAL C 363  ? O VAL C 363  
AB9 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AB9 2 3 N LYS C 518  ? N LYS C 518  O SER C 525  ? O SER C 525  
AC1 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AC1 2 3 N ARG C 517  ? N ARG C 517  O MET C 579  ? O MET C 579  
AC1 3 4 O TYR C 578  ? O TYR C 578  N ALA C 542  ? N ALA C 542  
AC1 4 5 N VAL C 541  ? N VAL C 541  O ARG C 562  ? O ARG C 562  
AC1 5 6 N VAL C 559  ? N VAL C 559  O VAL C 571  ? O VAL C 571  
AC2 1 2 N VAL C 642  ? N VAL C 642  O ALA C 703  ? O ALA C 703  
AC2 2 3 O ASP C 704  ? O ASP C 704  N CYS C 687  ? N CYS C 687  
AC3 1 2 O TYR C 670  ? O TYR C 670  N ILE C 658  ? N ILE C 658  
AC3 2 3 O THR C 659  ? O THR C 659  N GLU C 652  ? N GLU C 652  
AC3 3 4 N GLY C 648  ? N GLY C 648  O VAL C 696  ? O VAL C 696  
AC4 1 2 N ALA C 676  ? N ALA C 676  O ALA C 684  ? O ALA C 684  
AC5 1 2 N ASP C 709  ? N ASP C 709  O GLU C 712  ? O GLU C 712  
AC6 1 2 N ALA C 1008 ? N ALA C 1008 O VAL C 1023 ? O VAL C 1023 
AC6 2 3 O MET C 1031 ? O MET C 1031 N ALA C 886  ? N ALA C 886  
AC6 3 4 N LEU C 885  ? N LEU C 885  O GLY C 893  ? O GLY C 893  
AC6 4 5 O GLY C 896  ? O GLY C 896  N ILE C 735  ? N ILE C 735  
AC6 5 6 N ILE C 736  ? N ILE C 736  O ILE C 916  ? O ILE C 916  
AC6 6 7 N ILE C 915  ? N ILE C 915  O LEU C 720  ? O LEU C 720  
AC6 7 8 N VAL C 721  ? N VAL C 721  O GLY C 1026 ? O GLY C 1026 
AC7 1 2 O GLY C 765  ? O GLY C 765  N THR C 762  ? N THR C 762  
AC7 2 3 N GLU C 753  ? N GLU C 753  O VAL C 873  ? O VAL C 873  
AC7 3 4 O TYR C 872  ? O TYR C 872  N GLY C 849  ? N GLY C 849  
AC7 4 5 O GLY C 845  ? O GLY C 845  N VAL C 796  ? N VAL C 796  
AC8 1 2 N GLU C 768  ? N GLU C 768  O VAL C 806  ? O VAL C 806  
AC8 2 3 N THR C 807  ? N THR C 807  O ARG C 833  ? O ARG C 833  
AC9 1 2 N LEU C 802  ? N LEU C 802  O LEU C 837  ? O LEU C 837  
AD1 1 2 N TRP C 944  ? N TRP C 944  O ALA C 966  ? O ALA C 966  
AD2 1 2 N HIS C 1042 ? N HIS C 1042 O ARG D 427  ? O ARG D 427  
AD2 2 3 N GLY D 426  ? N GLY D 426  O VAL D 543  ? O VAL D 543  
AD2 3 4 O ALA D 542  ? O ALA D 542  N ASN D 499  ? N ASN D 499  
AD2 4 5 N LEU D 498  ? N LEU D 498  O GLN D 510  ? O GLN D 510  
AD2 5 6 O MET D 515  ? O MET D 515  N LEU D 443  ? N LEU D 443  
AD2 6 7 N GLY D 442  ? N GLY D 442  O GLN D 523  ? O GLN D 523  
AD2 7 8 O ILE D 522  ? O ILE D 522  N VAL D 429  ? N VAL D 429  
AD3 1 2 N PHE C 1068 ? N PHE C 1068 O LYS D 420  ? O LYS D 420  
AD4 1 2 N ASN C 1134 ? N ASN C 1134 O GLY D 13   ? O GLY D 13   
AD4 2 3 N LEU D 10   ? N LEU D 10   O ASP D 1243 ? O ASP D 1243 
AD5 1 2 N TYR D 25   ? N TYR D 25   O MET D 92   ? O MET D 92   
AD5 2 3 N VAL D 101  ? N VAL D 101  O LEU D 314  ? O LEU D 314  
AD6 1 2 O ILE D 235  ? O ILE D 235  N TYR D 134  ? N TYR D 134  
AD6 2 3 N SER D 138  ? N SER D 138  O THR D 253  ? O THR D 253  
AD7 1 2 N VAL D 328  ? N VAL D 328  O ALA D 336  ? O ALA D 336  
AD7 2 3 N THR D 337  ? N THR D 337  O ILE F 421  ? O ILE F 421  
AD8 1 2 N GLY D 393  ? N GLY D 393  O ARG D 397  ? O ARG D 397  
AD9 1 2 N TYR D 612  ? N TYR D 612  O LYS D 634  ? O LYS D 634  
AD9 2 3 N LEU D 637  ? N LEU D 637  O TRP D 662  ? O TRP D 662  
AE1 1 2 N ARG D 887  ? N ARG D 887  O VAL D 974  ? O VAL D 974  
AE2 1 2 N ILE D 897  ? N ILE D 897  O VAL D 962  ? O VAL D 962  
AE2 2 3 O ARG D 963  ? O ARG D 963  N THR D 924  ? N THR D 924  
AE3 1 2 N GLU D 903  ? N GLU D 903  O ILE D 911  ? O ILE D 911  
AE4 1 2 N ALA D 929  ? N ALA D 929  O ILE D 937  ? O ILE D 937  
AE5 1 2 O TYR D 1077 ? O TYR D 1077 N ILE D 1064 ? N ILE D 1064 
AE5 2 3 O THR D 1065 ? O THR D 1065 N ARG D 1054 ? N ARG D 1054 
AE5 3 4 N GLY D 1051 ? N GLY D 1051 O VAL D 1105 ? O VAL D 1105 
AE6 1 2 O ILE D 1181 ? O ILE D 1181 N VAL D 1165 ? N VAL D 1165 
AE6 2 3 N THR D 1166 ? N THR D 1166 O ARG D 1204 ? O ARG D 1204 
AE7 1 2 N GLN D 1273 ? N GLN D 1273 O GLU E 105  ? O GLU E 105  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software C RFP 1201 ? 15 'binding site for residue RFP C 1201' 
AC2 Software D ZN  1401 ? 4  'binding site for residue ZN D 1401'  
AC3 Software D ZN  1402 ? 4  'binding site for residue ZN D 1402'  
AC4 Software D MG  1403 ? 4  'binding site for residue MG D 1403'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 ARG C 173 ? ARG C 173 . ? 1_555 ? 
2  AC1 15 GLN C 435 ? GLN C 435 . ? 1_555 ? 
3  AC1 15 SER C 437 ? SER C 437 . ? 1_555 ? 
4  AC1 15 GLN C 438 ? GLN C 438 . ? 1_555 ? 
5  AC1 15 PHE C 439 ? PHE C 439 . ? 1_555 ? 
6  AC1 15 HIS C 451 ? HIS C 451 . ? 1_555 ? 
7  AC1 15 ARG C 454 ? ARG C 454 . ? 1_555 ? 
8  AC1 15 SER C 456 ? SER C 456 . ? 1_555 ? 
9  AC1 15 LEU C 458 ? LEU C 458 . ? 1_555 ? 
10 AC1 15 ASN C 493 ? ASN C 493 . ? 1_555 ? 
11 AC1 15 ILE C 497 ? ILE C 497 . ? 1_555 ? 
12 AC1 15 ARG C 613 ? ARG C 613 . ? 1_555 ? 
13 AC1 15 HIS C 680 ? HIS C 680 . ? 1_555 ? 
14 AC1 15 ASP F 429 ? ASP F 429 . ? 1_555 ? 
15 AC1 15 G   I 1   ? G   I 1   . ? 1_555 ? 
16 AC2 4  CYS D 891 ? CYS D 891 . ? 1_555 ? 
17 AC2 4  CYS D 968 ? CYS D 968 . ? 1_555 ? 
18 AC2 4  CYS D 975 ? CYS D 975 . ? 1_555 ? 
19 AC2 4  CYS D 978 ? CYS D 978 . ? 1_555 ? 
20 AC3 4  CYS D 60  ? CYS D 60  . ? 1_555 ? 
21 AC3 4  CYS D 62  ? CYS D 62  . ? 1_555 ? 
22 AC3 4  CYS D 75  ? CYS D 75  . ? 1_555 ? 
23 AC3 4  CYS D 78  ? CYS D 78  . ? 1_555 ? 
24 AC4 4  ASP D 535 ? ASP D 535 . ? 1_555 ? 
25 AC4 4  ASP D 537 ? ASP D 537 . ? 1_555 ? 
26 AC4 4  ASP D 539 ? ASP D 539 . ? 1_555 ? 
27 AC4 4  A   I 2   ? A   I 2   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5UH6 
_atom_sites.fract_transf_matrix[1][1]   0.006526 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006065 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005001 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ILE A 1  3    ? -17.701 0.927   -55.052 1.00 147.01 ? 3    ILE A N     1 
ATOM   2     C  CA    . ILE A 1  3    ? -17.257 1.175   -56.419 1.00 156.86 ? 3    ILE A CA    1 
ATOM   3     C  C     . ILE A 1  3    ? -17.753 2.538   -56.903 1.00 161.56 ? 3    ILE A C     1 
ATOM   4     O  O     . ILE A 1  3    ? -18.475 2.632   -57.897 1.00 163.71 ? 3    ILE A O     1 
ATOM   5     C  CB    . ILE A 1  3    ? -17.748 0.073   -57.383 1.00 155.58 ? 3    ILE A CB    1 
ATOM   6     C  CG1   . ILE A 1  3    ? -17.787 -1.284  -56.673 1.00 146.45 ? 3    ILE A CG1   1 
ATOM   7     C  CG2   . ILE A 1  3    ? -16.865 0.010   -58.625 1.00 143.02 ? 3    ILE A CG2   1 
ATOM   8     C  CD1   . ILE A 1  3    ? -18.308 -2.414  -57.539 1.00 131.41 ? 3    ILE A CD1   1 
ATOM   9     N  N     . SER A 1  4    ? -17.364 3.589   -56.187 1.00 161.48 ? 4    SER A N     1 
ATOM   10    C  CA    . SER A 1  4    ? -17.756 4.954   -56.528 1.00 153.78 ? 4    SER A CA    1 
ATOM   11    C  C     . SER A 1  4    ? -16.789 5.964   -55.916 1.00 149.00 ? 4    SER A C     1 
ATOM   12    O  O     . SER A 1  4    ? -16.189 5.702   -54.874 1.00 158.14 ? 4    SER A O     1 
ATOM   13    C  CB    . SER A 1  4    ? -19.185 5.239   -56.057 1.00 148.29 ? 4    SER A CB    1 
ATOM   14    O  OG    . SER A 1  4    ? -19.313 5.041   -54.660 1.00 147.80 ? 4    SER A OG    1 
ATOM   15    N  N     . GLN A 1  5    ? -16.637 7.116   -56.563 1.00 134.28 ? 5    GLN A N     1 
ATOM   16    C  CA    . GLN A 1  5    ? -15.745 8.154   -56.055 1.00 130.94 ? 5    GLN A CA    1 
ATOM   17    C  C     . GLN A 1  5    ? -16.424 9.519   -55.969 1.00 140.70 ? 5    GLN A C     1 
ATOM   18    O  O     . GLN A 1  5    ? -16.896 10.055  -56.972 1.00 145.44 ? 5    GLN A O     1 
ATOM   19    C  CB    . GLN A 1  5    ? -14.491 8.255   -56.928 1.00 122.82 ? 5    GLN A CB    1 
ATOM   20    C  CG    . GLN A 1  5    ? -13.527 7.091   -56.765 1.00 113.98 ? 5    GLN A CG    1 
ATOM   21    C  CD    . GLN A 1  5    ? -12.253 7.272   -57.566 1.00 104.77 ? 5    GLN A CD    1 
ATOM   22    O  OE1   . GLN A 1  5    ? -11.205 6.725   -57.222 1.00 106.13 ? 5    GLN A OE1   1 
ATOM   23    N  NE2   . GLN A 1  5    ? -12.336 8.042   -58.644 1.00 103.65 ? 5    GLN A NE2   1 
ATOM   24    N  N     . ARG A 1  6    ? -16.467 10.073  -54.760 1.00 141.27 ? 6    ARG A N     1 
ATOM   25    C  CA    . ARG A 1  6    ? -17.000 11.414  -54.532 1.00 130.85 ? 6    ARG A CA    1 
ATOM   26    C  C     . ARG A 1  6    ? -16.268 12.122  -53.397 1.00 129.49 ? 6    ARG A C     1 
ATOM   27    O  O     . ARG A 1  6    ? -16.219 11.614  -52.276 1.00 131.82 ? 6    ARG A O     1 
ATOM   28    C  CB    . ARG A 1  6    ? -18.497 11.362  -54.213 1.00 121.79 ? 6    ARG A CB    1 
ATOM   29    C  CG    . ARG A 1  6    ? -19.402 11.244  -55.424 1.00 132.50 ? 6    ARG A CG    1 
ATOM   30    C  CD    . ARG A 1  6    ? -20.863 11.321  -55.017 1.00 130.30 ? 6    ARG A CD    1 
ATOM   31    N  NE    . ARG A 1  6    ? -21.188 10.354  -53.973 1.00 128.22 ? 6    ARG A NE    1 
ATOM   32    C  CZ    . ARG A 1  6    ? -21.542 9.094   -54.204 1.00 138.03 ? 6    ARG A CZ    1 
ATOM   33    N  NH1   . ARG A 1  6    ? -21.615 8.641   -55.448 1.00 139.04 ? 6    ARG A NH1   1 
ATOM   34    N  NH2   . ARG A 1  6    ? -21.821 8.285   -53.191 1.00 143.47 ? 6    ARG A NH2   1 
ATOM   35    N  N     . PRO A 1  7    ? -15.689 13.297  -53.689 1.00 129.40 ? 7    PRO A N     1 
ATOM   36    C  CA    . PRO A 1  7    ? -15.146 14.162  -52.638 1.00 129.98 ? 7    PRO A CA    1 
ATOM   37    C  C     . PRO A 1  7    ? -16.219 14.488  -51.602 1.00 125.38 ? 7    PRO A C     1 
ATOM   38    O  O     . PRO A 1  7    ? -17.384 14.669  -51.960 1.00 120.76 ? 7    PRO A O     1 
ATOM   39    C  CB    . PRO A 1  7    ? -14.706 15.412  -53.403 1.00 126.94 ? 7    PRO A CB    1 
ATOM   40    C  CG    . PRO A 1  7    ? -14.419 14.915  -54.783 1.00 124.09 ? 7    PRO A CG    1 
ATOM   41    C  CD    . PRO A 1  7    ? -15.427 13.831  -55.037 1.00 123.89 ? 7    PRO A CD    1 
ATOM   42    N  N     . THR A 1  8    ? -15.828 14.555  -50.335 1.00 116.42 ? 8    THR A N     1 
ATOM   43    C  CA    . THR A 1  8    ? -16.788 14.664  -49.244 1.00 103.10 ? 8    THR A CA    1 
ATOM   44    C  C     . THR A 1  8    ? -17.120 16.107  -48.874 1.00 101.23 ? 8    THR A C     1 
ATOM   45    O  O     . THR A 1  8    ? -16.381 17.035  -49.204 1.00 98.16  ? 8    THR A O     1 
ATOM   46    C  CB    . THR A 1  8    ? -16.270 13.944  -47.996 1.00 100.19 ? 8    THR A CB    1 
ATOM   47    O  OG1   . THR A 1  8    ? -15.085 14.599  -47.531 1.00 120.09 ? 8    THR A OG1   1 
ATOM   48    C  CG2   . THR A 1  8    ? -15.940 12.501  -48.323 1.00 89.43  ? 8    THR A CG2   1 
ATOM   49    N  N     . LEU A 1  9    ? -18.238 16.278  -48.174 1.00 97.62  ? 9    LEU A N     1 
ATOM   50    C  CA    . LEU A 1  9    ? -18.716 17.596  -47.776 1.00 91.63  ? 9    LEU A CA    1 
ATOM   51    C  C     . LEU A 1  9    ? -18.603 17.797  -46.270 1.00 93.61  ? 9    LEU A C     1 
ATOM   52    O  O     . LEU A 1  9    ? -18.103 16.929  -45.554 1.00 97.80  ? 9    LEU A O     1 
ATOM   53    C  CB    . LEU A 1  9    ? -20.168 17.791  -48.215 1.00 86.43  ? 9    LEU A CB    1 
ATOM   54    C  CG    . LEU A 1  9    ? -20.470 17.495  -49.683 1.00 88.22  ? 9    LEU A CG    1 
ATOM   55    C  CD1   . LEU A 1  9    ? -21.931 17.778  -49.991 1.00 92.85  ? 9    LEU A CD1   1 
ATOM   56    C  CD2   . LEU A 1  9    ? -19.558 18.305  -50.587 1.00 98.88  ? 9    LEU A CD2   1 
ATOM   57    N  N     . SER A 1  10   ? -19.079 18.946  -45.798 1.00 95.06  ? 10   SER A N     1 
ATOM   58    C  CA    . SER A 1  10   ? -19.074 19.262  -44.372 1.00 87.00  ? 10   SER A CA    1 
ATOM   59    C  C     . SER A 1  10   ? -20.181 20.255  -44.026 1.00 80.99  ? 10   SER A C     1 
ATOM   60    O  O     . SER A 1  10   ? -19.922 21.437  -43.801 1.00 80.70  ? 10   SER A O     1 
ATOM   61    C  CB    . SER A 1  10   ? -17.715 19.824  -43.951 1.00 78.27  ? 10   SER A CB    1 
ATOM   62    O  OG    . SER A 1  10   ? -17.700 20.120  -42.568 1.00 70.01  ? 10   SER A OG    1 
ATOM   63    N  N     . GLU A 1  11   ? -21.415 19.764  -43.978 1.00 78.61  ? 11   GLU A N     1 
ATOM   64    C  CA    . GLU A 1  11   ? -22.574 20.620  -43.753 1.00 80.57  ? 11   GLU A CA    1 
ATOM   65    C  C     . GLU A 1  11   ? -22.697 21.018  -42.284 1.00 78.59  ? 11   GLU A C     1 
ATOM   66    O  O     . GLU A 1  11   ? -21.886 20.607  -41.455 1.00 83.22  ? 11   GLU A O     1 
ATOM   67    C  CB    . GLU A 1  11   ? -23.845 19.916  -44.228 1.00 93.29  ? 11   GLU A CB    1 
ATOM   68    C  CG    . GLU A 1  11   ? -23.730 19.354  -45.640 1.00 102.48 ? 11   GLU A CG    1 
ATOM   69    C  CD    . GLU A 1  11   ? -24.968 18.597  -46.082 1.00 119.12 ? 11   GLU A CD    1 
ATOM   70    O  OE1   . GLU A 1  11   ? -26.025 18.750  -45.434 1.00 128.60 ? 11   GLU A OE1   1 
ATOM   71    O  OE2   . GLU A 1  11   ? -24.882 17.846  -47.078 1.00 112.33 ? 11   GLU A OE2   1 
ATOM   72    N  N     . ASP A 1  12   ? -23.713 21.819  -41.969 1.00 78.16  ? 12   ASP A N     1 
ATOM   73    C  CA    . ASP A 1  12   ? -23.895 22.340  -40.615 1.00 77.02  ? 12   ASP A CA    1 
ATOM   74    C  C     . ASP A 1  12   ? -25.362 22.677  -40.325 1.00 77.64  ? 12   ASP A C     1 
ATOM   75    O  O     . ASP A 1  12   ? -26.041 23.302  -41.141 1.00 80.56  ? 12   ASP A O     1 
ATOM   76    C  CB    . ASP A 1  12   ? -23.017 23.583  -40.408 1.00 71.42  ? 12   ASP A CB    1 
ATOM   77    C  CG    . ASP A 1  12   ? -22.874 23.975  -38.943 1.00 68.10  ? 12   ASP A CG    1 
ATOM   78    O  OD1   . ASP A 1  12   ? -23.642 23.471  -38.099 1.00 63.78  ? 12   ASP A OD1   1 
ATOM   79    O  OD2   . ASP A 1  12   ? -21.988 24.801  -38.636 1.00 71.54  ? 12   ASP A OD2   1 
ATOM   80    N  N     . VAL A 1  13   ? -25.841 22.249  -39.160 1.00 75.68  ? 13   VAL A N     1 
ATOM   81    C  CA    . VAL A 1  13   ? -27.162 22.632  -38.665 1.00 69.32  ? 13   VAL A CA    1 
ATOM   82    C  C     . VAL A 1  13   ? -26.988 23.243  -37.271 1.00 72.59  ? 13   VAL A C     1 
ATOM   83    O  O     . VAL A 1  13   ? -26.525 22.571  -36.348 1.00 79.66  ? 13   VAL A O     1 
ATOM   84    C  CB    . VAL A 1  13   ? -28.133 21.433  -38.612 1.00 61.46  ? 13   VAL A CB    1 
ATOM   85    C  CG1   . VAL A 1  13   ? -29.550 21.912  -38.346 1.00 58.84  ? 13   VAL A CG1   1 
ATOM   86    C  CG2   . VAL A 1  13   ? -28.079 20.642  -39.914 1.00 62.98  ? 13   VAL A CG2   1 
ATOM   87    N  N     . LEU A 1  14   ? -27.362 24.512  -37.121 1.00 68.58  ? 14   LEU A N     1 
ATOM   88    C  CA    . LEU A 1  14   ? -26.922 25.314  -35.976 1.00 64.86  ? 14   LEU A CA    1 
ATOM   89    C  C     . LEU A 1  14   ? -27.901 25.452  -34.804 1.00 71.67  ? 14   LEU A C     1 
ATOM   90    O  O     . LEU A 1  14   ? -29.105 25.233  -34.935 1.00 81.85  ? 14   LEU A O     1 
ATOM   91    C  CB    . LEU A 1  14   ? -26.547 26.723  -36.457 1.00 63.29  ? 14   LEU A CB    1 
ATOM   92    C  CG    . LEU A 1  14   ? -25.194 26.919  -37.148 1.00 67.36  ? 14   LEU A CG    1 
ATOM   93    C  CD1   . LEU A 1  14   ? -25.115 28.288  -37.803 1.00 77.27  ? 14   LEU A CD1   1 
ATOM   94    C  CD2   . LEU A 1  14   ? -24.048 26.747  -36.166 1.00 65.90  ? 14   LEU A CD2   1 
ATOM   95    N  N     . THR A 1  15   ? -27.331 25.806  -33.653 1.00 76.88  ? 15   THR A N     1 
ATOM   96    C  CA    . THR A 1  15   ? -28.048 26.303  -32.480 1.00 75.65  ? 15   THR A CA    1 
ATOM   97    C  C     . THR A 1  15   ? -27.073 27.275  -31.814 1.00 71.58  ? 15   THR A C     1 
ATOM   98    O  O     . THR A 1  15   ? -25.871 27.207  -32.071 1.00 72.91  ? 15   THR A O     1 
ATOM   99    C  CB    . THR A 1  15   ? -28.472 25.178  -31.500 1.00 71.55  ? 15   THR A CB    1 
ATOM   100   O  OG1   . THR A 1  15   ? -29.081 24.103  -32.226 1.00 73.03  ? 15   THR A OG1   1 
ATOM   101   C  CG2   . THR A 1  15   ? -29.456 25.702  -30.458 1.00 63.25  ? 15   THR A CG2   1 
ATOM   102   N  N     . ASP A 1  16   ? -27.578 28.180  -30.981 1.00 66.83  ? 16   ASP A N     1 
ATOM   103   C  CA    . ASP A 1  16   ? -26.759 29.255  -30.416 1.00 74.92  ? 16   ASP A CA    1 
ATOM   104   C  C     . ASP A 1  16   ? -25.481 28.759  -29.742 1.00 72.82  ? 16   ASP A C     1 
ATOM   105   O  O     . ASP A 1  16   ? -24.390 29.269  -29.999 1.00 68.98  ? 16   ASP A O     1 
ATOM   106   C  CB    . ASP A 1  16   ? -27.581 30.064  -29.409 1.00 83.60  ? 16   ASP A CB    1 
ATOM   107   C  CG    . ASP A 1  16   ? -26.991 31.441  -29.139 1.00 91.33  ? 16   ASP A CG    1 
ATOM   108   O  OD1   . ASP A 1  16   ? -25.753 31.598  -29.205 1.00 93.39  ? 16   ASP A OD1   1 
ATOM   109   O  OD2   . ASP A 1  16   ? -27.775 32.373  -28.860 1.00 87.90  ? 16   ASP A OD2   1 
ATOM   110   N  N     . ASN A 1  17   ? -25.621 27.761  -28.882 1.00 74.55  ? 17   ASN A N     1 
ATOM   111   C  CA    . ASN A 1  17   ? -24.500 27.306  -28.078 1.00 72.40  ? 17   ASN A CA    1 
ATOM   112   C  C     . ASN A 1  17   ? -23.870 26.034  -28.626 1.00 70.62  ? 17   ASN A C     1 
ATOM   113   O  O     . ASN A 1  17   ? -22.691 25.767  -28.400 1.00 72.71  ? 17   ASN A O     1 
ATOM   114   C  CB    . ASN A 1  17   ? -24.951 27.085  -26.636 1.00 73.35  ? 17   ASN A CB    1 
ATOM   115   C  CG    . ASN A 1  17   ? -23.794 26.830  -25.702 1.00 73.92  ? 17   ASN A CG    1 
ATOM   116   O  OD1   . ASN A 1  17   ? -22.651 27.166  -26.009 1.00 74.67  ? 17   ASN A OD1   1 
ATOM   117   N  ND2   . ASN A 1  17   ? -24.083 26.235  -24.552 1.00 77.39  ? 17   ASN A ND2   1 
ATOM   118   N  N     . ARG A 1  18   ? -24.659 25.252  -29.351 1.00 65.98  ? 18   ARG A N     1 
ATOM   119   C  CA    . ARG A 1  18   ? -24.179 23.987  -29.892 1.00 70.01  ? 18   ARG A CA    1 
ATOM   120   C  C     . ARG A 1  18   ? -24.497 23.867  -31.376 1.00 69.00  ? 18   ARG A C     1 
ATOM   121   O  O     . ARG A 1  18   ? -25.436 24.484  -31.864 1.00 74.35  ? 18   ARG A O     1 
ATOM   122   C  CB    . ARG A 1  18   ? -24.788 22.815  -29.121 1.00 74.94  ? 18   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1  18   ? -26.302 22.871  -29.013 1.00 76.24  ? 18   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1  18   ? -26.844 21.737  -28.156 1.00 64.61  ? 18   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1  18   ? -26.557 20.431  -28.737 1.00 52.93  ? 18   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1  18   ? -27.074 19.291  -28.293 1.00 59.96  ? 18   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1  18   ? -27.910 19.299  -27.263 1.00 61.10  ? 18   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1  18   ? -26.761 18.144  -28.881 1.00 69.27  ? 18   ARG A NH2   1 
ATOM   129   N  N     . SER A 1  19   ? -23.715 23.069  -32.094 1.00 69.02  ? 19   SER A N     1 
ATOM   130   C  CA    . SER A 1  19   ? -23.906 22.937  -33.534 1.00 67.40  ? 19   SER A CA    1 
ATOM   131   C  C     . SER A 1  19   ? -23.615 21.532  -34.043 1.00 64.13  ? 19   SER A C     1 
ATOM   132   O  O     . SER A 1  19   ? -22.604 20.927  -33.688 1.00 65.47  ? 19   SER A O     1 
ATOM   133   C  CB    . SER A 1  19   ? -23.024 23.937  -34.279 1.00 70.31  ? 19   SER A CB    1 
ATOM   134   O  OG    . SER A 1  19   ? -21.667 23.537  -34.248 1.00 63.32  ? 19   SER A OG    1 
ATOM   135   N  N     . GLN A 1  20   ? -24.509 21.025  -34.885 1.00 63.12  ? 20   GLN A N     1 
ATOM   136   C  CA    . GLN A 1  20   ? -24.310 19.735  -35.530 1.00 60.26  ? 20   GLN A CA    1 
ATOM   137   C  C     . GLN A 1  20   ? -23.583 19.887  -36.860 1.00 65.55  ? 20   GLN A C     1 
ATOM   138   O  O     . GLN A 1  20   ? -24.017 20.637  -37.733 1.00 73.00  ? 20   GLN A O     1 
ATOM   139   C  CB    . GLN A 1  20   ? -25.646 19.029  -35.755 1.00 53.26  ? 20   GLN A CB    1 
ATOM   140   C  CG    . GLN A 1  20   ? -26.310 18.526  -34.493 1.00 59.19  ? 20   GLN A CG    1 
ATOM   141   C  CD    . GLN A 1  20   ? -27.397 17.514  -34.790 1.00 67.67  ? 20   GLN A CD    1 
ATOM   142   O  OE1   . GLN A 1  20   ? -27.607 17.138  -35.943 1.00 71.66  ? 20   GLN A OE1   1 
ATOM   143   N  NE2   . GLN A 1  20   ? -28.091 17.064  -33.751 1.00 68.72  ? 20   GLN A NE2   1 
ATOM   144   N  N     . PHE A 1  21   ? -22.473 19.174  -37.009 1.00 61.62  ? 21   PHE A N     1 
ATOM   145   C  CA    . PHE A 1  21   ? -21.758 19.136  -38.277 1.00 61.11  ? 21   PHE A CA    1 
ATOM   146   C  C     . PHE A 1  21   ? -22.058 17.828  -39.002 1.00 69.69  ? 21   PHE A C     1 
ATOM   147   O  O     . PHE A 1  21   ? -21.921 16.751  -38.426 1.00 73.96  ? 21   PHE A O     1 
ATOM   148   C  CB    . PHE A 1  21   ? -20.253 19.288  -38.057 1.00 59.87  ? 21   PHE A CB    1 
ATOM   149   C  CG    . PHE A 1  21   ? -19.851 20.622  -37.496 1.00 60.03  ? 21   PHE A CG    1 
ATOM   150   C  CD1   . PHE A 1  21   ? -19.604 21.696  -38.335 1.00 63.96  ? 21   PHE A CD1   1 
ATOM   151   C  CD2   . PHE A 1  21   ? -19.710 20.799  -36.131 1.00 62.93  ? 21   PHE A CD2   1 
ATOM   152   C  CE1   . PHE A 1  21   ? -19.229 22.923  -37.822 1.00 63.47  ? 21   PHE A CE1   1 
ATOM   153   C  CE2   . PHE A 1  21   ? -19.334 22.025  -35.612 1.00 63.92  ? 21   PHE A CE2   1 
ATOM   154   C  CZ    . PHE A 1  21   ? -19.094 23.088  -36.458 1.00 59.83  ? 21   PHE A CZ    1 
ATOM   155   N  N     . VAL A 1  22   ? -22.475 17.922  -40.260 1.00 75.84  ? 22   VAL A N     1 
ATOM   156   C  CA    . VAL A 1  22   ? -22.757 16.731  -41.055 1.00 77.99  ? 22   VAL A CA    1 
ATOM   157   C  C     . VAL A 1  22   ? -21.662 16.510  -42.092 1.00 81.86  ? 22   VAL A C     1 
ATOM   158   O  O     . VAL A 1  22   ? -21.326 17.422  -42.847 1.00 85.04  ? 22   VAL A O     1 
ATOM   159   C  CB    . VAL A 1  22   ? -24.118 16.828  -41.767 1.00 74.15  ? 22   VAL A CB    1 
ATOM   160   C  CG1   . VAL A 1  22   ? -24.428 15.526  -42.489 1.00 78.89  ? 22   VAL A CG1   1 
ATOM   161   C  CG2   . VAL A 1  22   ? -25.215 17.167  -40.770 1.00 77.55  ? 22   VAL A CG2   1 
ATOM   162   N  N     . ILE A 1  23   ? -21.099 15.304  -42.120 1.00 79.74  ? 23   ILE A N     1 
ATOM   163   C  CA    . ILE A 1  23   ? -20.044 14.980  -43.077 1.00 80.21  ? 23   ILE A CA    1 
ATOM   164   C  C     . ILE A 1  23   ? -20.323 13.663  -43.809 1.00 87.07  ? 23   ILE A C     1 
ATOM   165   O  O     . ILE A 1  23   ? -20.524 12.618  -43.185 1.00 84.04  ? 23   ILE A O     1 
ATOM   166   C  CB    . ILE A 1  23   ? -18.663 14.907  -42.392 1.00 66.68  ? 23   ILE A CB    1 
ATOM   167   C  CG1   . ILE A 1  23   ? -18.264 16.283  -41.855 1.00 61.18  ? 23   ILE A CG1   1 
ATOM   168   C  CG2   . ILE A 1  23   ? -17.609 14.415  -43.368 1.00 74.91  ? 23   ILE A CG2   1 
ATOM   169   C  CD1   . ILE A 1  23   ? -16.858 16.343  -41.320 1.00 52.80  ? 23   ILE A CD1   1 
ATOM   170   N  N     . GLU A 1  24   ? -20.334 13.736  -45.139 1.00 97.58  ? 24   GLU A N     1 
ATOM   171   C  CA    . GLU A 1  24   ? -20.659 12.603  -46.003 1.00 99.52  ? 24   GLU A CA    1 
ATOM   172   C  C     . GLU A 1  24   ? -20.240 12.911  -47.446 1.00 94.35  ? 24   GLU A C     1 
ATOM   173   O  O     . GLU A 1  24   ? -20.083 14.079  -47.807 1.00 95.92  ? 24   GLU A O     1 
ATOM   174   C  CB    . GLU A 1  24   ? -22.160 12.290  -45.929 1.00 99.93  ? 24   GLU A CB    1 
ATOM   175   C  CG    . GLU A 1  24   ? -23.057 13.444  -46.349 1.00 99.16  ? 24   GLU A CG    1 
ATOM   176   C  CD    . GLU A 1  24   ? -24.530 13.092  -46.289 1.00 94.93  ? 24   GLU A CD    1 
ATOM   177   O  OE1   . GLU A 1  24   ? -24.861 11.888  -46.341 1.00 94.92  ? 24   GLU A OE1   1 
ATOM   178   O  OE2   . GLU A 1  24   ? -25.359 14.021  -46.187 1.00 96.43  ? 24   GLU A OE2   1 
ATOM   179   N  N     . PRO A 1  25   ? -20.051 11.874  -48.281 1.00 89.24  ? 25   PRO A N     1 
ATOM   180   C  CA    . PRO A 1  25   ? -20.153 10.438  -48.006 1.00 93.47  ? 25   PRO A CA    1 
ATOM   181   C  C     . PRO A 1  25   ? -18.808 9.813   -47.643 1.00 99.22  ? 25   PRO A C     1 
ATOM   182   O  O     . PRO A 1  25   ? -17.819 10.020  -48.344 1.00 98.63  ? 25   PRO A O     1 
ATOM   183   C  CB    . PRO A 1  25   ? -20.681 9.879   -49.325 1.00 98.37  ? 25   PRO A CB    1 
ATOM   184   C  CG    . PRO A 1  25   ? -20.082 10.780  -50.362 1.00 108.99 ? 25   PRO A CG    1 
ATOM   185   C  CD    . PRO A 1  25   ? -19.855 12.134  -49.719 1.00 100.57 ? 25   PRO A CD    1 
ATOM   186   N  N     . LEU A 1  26   ? -18.781 9.046   -46.559 1.00 102.14 ? 26   LEU A N     1 
ATOM   187   C  CA    . LEU A 1  26   ? -17.540 8.453   -46.075 1.00 99.18  ? 26   LEU A CA    1 
ATOM   188   C  C     . LEU A 1  26   ? -17.485 6.947   -46.321 1.00 95.10  ? 26   LEU A C     1 
ATOM   189   O  O     . LEU A 1  26   ? -18.507 6.313   -46.590 1.00 92.71  ? 26   LEU A O     1 
ATOM   190   C  CB    . LEU A 1  26   ? -17.363 8.750   -44.585 1.00 96.45  ? 26   LEU A CB    1 
ATOM   191   C  CG    . LEU A 1  26   ? -17.153 10.225  -44.236 1.00 86.35  ? 26   LEU A CG    1 
ATOM   192   C  CD1   . LEU A 1  26   ? -17.509 10.496  -42.784 1.00 85.93  ? 26   LEU A CD1   1 
ATOM   193   C  CD2   . LEU A 1  26   ? -15.717 10.643  -44.525 1.00 77.19  ? 26   LEU A CD2   1 
ATOM   194   N  N     . GLU A 1  27   ? -16.278 6.392   -46.232 1.00 95.27  ? 27   GLU A N     1 
ATOM   195   C  CA    . GLU A 1  27   ? -16.044 4.958   -46.391 1.00 95.42  ? 27   GLU A CA    1 
ATOM   196   C  C     . GLU A 1  27   ? -16.909 4.140   -45.433 1.00 97.04  ? 27   GLU A C     1 
ATOM   197   O  O     . GLU A 1  27   ? -17.272 4.620   -44.361 1.00 105.08 ? 27   GLU A O     1 
ATOM   198   C  CB    . GLU A 1  27   ? -14.562 4.642   -46.164 1.00 94.00  ? 27   GLU A CB    1 
ATOM   199   C  CG    . GLU A 1  27   ? -13.613 5.375   -47.099 1.00 96.19  ? 27   GLU A CG    1 
ATOM   200   C  CD    . GLU A 1  27   ? -13.642 4.825   -48.511 1.00 108.64 ? 27   GLU A CD    1 
ATOM   201   O  OE1   . GLU A 1  27   ? -13.974 3.632   -48.681 1.00 111.57 ? 27   GLU A OE1   1 
ATOM   202   O  OE2   . GLU A 1  27   ? -13.333 5.587   -49.453 1.00 112.18 ? 27   GLU A OE2   1 
ATOM   203   N  N     . PRO A 1  28   ? -17.248 2.900   -45.820 1.00 94.13  ? 28   PRO A N     1 
ATOM   204   C  CA    . PRO A 1  28   ? -18.080 2.043   -44.967 1.00 95.99  ? 28   PRO A CA    1 
ATOM   205   C  C     . PRO A 1  28   ? -17.389 1.672   -43.654 1.00 100.21 ? 28   PRO A C     1 
ATOM   206   O  O     . PRO A 1  28   ? -16.272 1.155   -43.672 1.00 108.51 ? 28   PRO A O     1 
ATOM   207   C  CB    . PRO A 1  28   ? -18.312 0.804   -45.837 1.00 106.98 ? 28   PRO A CB    1 
ATOM   208   C  CG    . PRO A 1  28   ? -17.173 0.795   -46.797 1.00 113.11 ? 28   PRO A CG    1 
ATOM   209   C  CD    . PRO A 1  28   ? -16.890 2.235   -47.085 1.00 103.55 ? 28   PRO A CD    1 
ATOM   210   N  N     . GLY A 1  29   ? -18.055 1.939   -42.533 1.00 99.38  ? 29   GLY A N     1 
ATOM   211   C  CA    . GLY A 1  29   ? -17.493 1.681   -41.219 1.00 91.34  ? 29   GLY A CA    1 
ATOM   212   C  C     . GLY A 1  29   ? -16.284 2.550   -40.926 1.00 80.80  ? 29   GLY A C     1 
ATOM   213   O  O     . GLY A 1  29   ? -15.320 2.100   -40.307 1.00 80.76  ? 29   GLY A O     1 
ATOM   214   N  N     . PHE A 1  30   ? -16.338 3.800   -41.375 1.00 78.08  ? 30   PHE A N     1 
ATOM   215   C  CA    . PHE A 1  30   ? -15.229 4.734   -41.210 1.00 76.14  ? 30   PHE A CA    1 
ATOM   216   C  C     . PHE A 1  30   ? -15.657 5.921   -40.354 1.00 76.42  ? 30   PHE A C     1 
ATOM   217   O  O     . PHE A 1  30   ? -14.828 6.570   -39.716 1.00 76.64  ? 30   PHE A O     1 
ATOM   218   C  CB    . PHE A 1  30   ? -14.728 5.212   -42.578 1.00 84.57  ? 30   PHE A CB    1 
ATOM   219   C  CG    . PHE A 1  30   ? -13.387 5.905   -42.543 1.00 80.14  ? 30   PHE A CG    1 
ATOM   220   C  CD1   . PHE A 1  30   ? -13.294 7.263   -42.278 1.00 74.73  ? 30   PHE A CD1   1 
ATOM   221   C  CD2   . PHE A 1  30   ? -12.222 5.200   -42.805 1.00 80.26  ? 30   PHE A CD2   1 
ATOM   222   C  CE1   . PHE A 1  30   ? -12.063 7.900   -42.255 1.00 66.12  ? 30   PHE A CE1   1 
ATOM   223   C  CE2   . PHE A 1  30   ? -10.987 5.833   -42.786 1.00 76.60  ? 30   PHE A CE2   1 
ATOM   224   C  CZ    . PHE A 1  30   ? -10.910 7.184   -42.510 1.00 70.46  ? 30   PHE A CZ    1 
ATOM   225   N  N     . GLY A 1  31   ? -16.957 6.195   -40.337 1.00 78.91  ? 31   GLY A N     1 
ATOM   226   C  CA    . GLY A 1  31   ? -17.494 7.329   -39.604 1.00 81.36  ? 31   GLY A CA    1 
ATOM   227   C  C     . GLY A 1  31   ? -17.226 7.313   -38.110 1.00 72.07  ? 31   GLY A C     1 
ATOM   228   O  O     . GLY A 1  31   ? -16.862 8.339   -37.533 1.00 68.18  ? 31   GLY A O     1 
ATOM   229   N  N     . TYR A 1  32   ? -17.411 6.154   -37.484 1.00 66.79  ? 32   TYR A N     1 
ATOM   230   C  CA    . TYR A 1  32   ? -17.218 6.015   -36.045 1.00 54.93  ? 32   TYR A CA    1 
ATOM   231   C  C     . TYR A 1  32   ? -15.820 6.448   -35.613 1.00 60.32  ? 32   TYR A C     1 
ATOM   232   O  O     . TYR A 1  32   ? -15.667 7.315   -34.752 1.00 62.76  ? 32   TYR A O     1 
ATOM   233   C  CB    . TYR A 1  32   ? -17.481 4.571   -35.609 1.00 46.43  ? 32   TYR A CB    1 
ATOM   234   C  CG    . TYR A 1  32   ? -18.949 4.241   -35.464 1.00 46.79  ? 32   TYR A CG    1 
ATOM   235   C  CD1   . TYR A 1  32   ? -19.882 5.242   -35.227 1.00 56.81  ? 32   TYR A CD1   1 
ATOM   236   C  CD2   . TYR A 1  32   ? -19.405 2.932   -35.563 1.00 47.33  ? 32   TYR A CD2   1 
ATOM   237   C  CE1   . TYR A 1  32   ? -21.229 4.953   -35.093 1.00 59.06  ? 32   TYR A CE1   1 
ATOM   238   C  CE2   . TYR A 1  32   ? -20.753 2.631   -35.431 1.00 59.99  ? 32   TYR A CE2   1 
ATOM   239   C  CZ    . TYR A 1  32   ? -21.660 3.647   -35.196 1.00 59.71  ? 32   TYR A CZ    1 
ATOM   240   O  OH    . TYR A 1  32   ? -23.002 3.364   -35.063 1.00 46.57  ? 32   TYR A OH    1 
ATOM   241   N  N     . THR A 1  33   ? -14.805 5.859   -36.233 1.00 57.61  ? 33   THR A N     1 
ATOM   242   C  CA    . THR A 1  33   ? -13.423 6.106   -35.841 1.00 60.26  ? 33   THR A CA    1 
ATOM   243   C  C     . THR A 1  33   ? -12.879 7.411   -36.419 1.00 57.11  ? 33   THR A C     1 
ATOM   244   O  O     . THR A 1  33   ? -11.686 7.698   -36.315 1.00 55.96  ? 33   THR A O     1 
ATOM   245   C  CB    . THR A 1  33   ? -12.516 4.934   -36.267 1.00 61.94  ? 33   THR A CB    1 
ATOM   246   O  OG1   . THR A 1  33   ? -11.141 5.323   -36.164 1.00 68.22  ? 33   THR A OG1   1 
ATOM   247   C  CG2   . THR A 1  33   ? -12.821 4.516   -37.697 1.00 69.01  ? 33   THR A CG2   1 
ATOM   248   N  N     . LEU A 1  34   ? -13.765 8.199   -37.022 1.00 63.00  ? 34   LEU A N     1 
ATOM   249   C  CA    . LEU A 1  34   ? -13.401 9.506   -37.556 1.00 72.48  ? 34   LEU A CA    1 
ATOM   250   C  C     . LEU A 1  34   ? -13.888 10.626  -36.640 1.00 77.64  ? 34   LEU A C     1 
ATOM   251   O  O     . LEU A 1  34   ? -13.129 11.534  -36.291 1.00 76.63  ? 34   LEU A O     1 
ATOM   252   C  CB    . LEU A 1  34   ? -13.975 9.693   -38.960 1.00 70.77  ? 34   LEU A CB    1 
ATOM   253   C  CG    . LEU A 1  34   ? -13.797 11.090  -39.561 1.00 70.59  ? 34   LEU A CG    1 
ATOM   254   C  CD1   . LEU A 1  34   ? -12.329 11.496  -39.565 1.00 64.32  ? 34   LEU A CD1   1 
ATOM   255   C  CD2   . LEU A 1  34   ? -14.376 11.140  -40.964 1.00 84.96  ? 34   LEU A CD2   1 
ATOM   256   N  N     . GLY A 1  35   ? -15.161 10.556  -36.262 1.00 77.64  ? 35   GLY A N     1 
ATOM   257   C  CA    . GLY A 1  35   ? -15.747 11.531  -35.362 1.00 67.09  ? 35   GLY A CA    1 
ATOM   258   C  C     . GLY A 1  35   ? -15.084 11.493  -34.001 1.00 57.81  ? 35   GLY A C     1 
ATOM   259   O  O     . GLY A 1  35   ? -14.912 12.526  -33.358 1.00 53.31  ? 35   GLY A O     1 
ATOM   260   N  N     . ASN A 1  36   ? -14.708 10.296  -33.565 1.00 56.94  ? 36   ASN A N     1 
ATOM   261   C  CA    . ASN A 1  36   ? -14.016 10.133  -32.294 1.00 59.52  ? 36   ASN A CA    1 
ATOM   262   C  C     . ASN A 1  36   ? -12.644 10.799  -32.320 1.00 65.08  ? 36   ASN A C     1 
ATOM   263   O  O     . ASN A 1  36   ? -12.187 11.339  -31.312 1.00 61.57  ? 36   ASN A O     1 
ATOM   264   C  CB    . ASN A 1  36   ? -13.881 8.650   -31.944 1.00 54.31  ? 36   ASN A CB    1 
ATOM   265   C  CG    . ASN A 1  36   ? -13.369 8.431   -30.534 1.00 57.40  ? 36   ASN A CG    1 
ATOM   266   O  OD1   . ASN A 1  36   ? -12.289 7.874   -30.332 1.00 58.57  ? 36   ASN A OD1   1 
ATOM   267   N  ND2   . ASN A 1  36   ? -14.140 8.878   -29.548 1.00 56.49  ? 36   ASN A ND2   1 
ATOM   268   N  N     . SER A 1  37   ? -11.999 10.768  -33.483 1.00 63.00  ? 37   SER A N     1 
ATOM   269   C  CA    . SER A 1  37   ? -10.693 11.394  -33.652 1.00 54.03  ? 37   SER A CA    1 
ATOM   270   C  C     . SER A 1  37   ? -10.808 12.902  -33.490 1.00 53.54  ? 37   SER A C     1 
ATOM   271   O  O     . SER A 1  37   ? -9.822  13.591  -33.232 1.00 54.60  ? 37   SER A O     1 
ATOM   272   C  CB    . SER A 1  37   ? -10.100 11.047  -35.019 1.00 57.86  ? 37   SER A CB    1 
ATOM   273   O  OG    . SER A 1  37   ? -10.008 9.644   -35.191 1.00 55.31  ? 37   SER A OG    1 
ATOM   274   N  N     . LEU A 1  38   ? -12.027 13.406  -33.639 1.00 53.60  ? 38   LEU A N     1 
ATOM   275   C  CA    . LEU A 1  38   ? -12.308 14.817  -33.431 1.00 64.86  ? 38   LEU A CA    1 
ATOM   276   C  C     . LEU A 1  38   ? -12.691 15.095  -31.979 1.00 56.97  ? 38   LEU A C     1 
ATOM   277   O  O     . LEU A 1  38   ? -12.223 16.062  -31.378 1.00 54.72  ? 38   LEU A O     1 
ATOM   278   C  CB    . LEU A 1  38   ? -13.424 15.277  -34.370 1.00 68.08  ? 38   LEU A CB    1 
ATOM   279   C  CG    . LEU A 1  38   ? -13.079 15.324  -35.859 1.00 60.61  ? 38   LEU A CG    1 
ATOM   280   C  CD1   . LEU A 1  38   ? -14.341 15.424  -36.699 1.00 57.27  ? 38   LEU A CD1   1 
ATOM   281   C  CD2   . LEU A 1  38   ? -12.150 16.495  -36.147 1.00 59.20  ? 38   LEU A CD2   1 
ATOM   282   N  N     . ARG A 1  39   ? -13.546 14.243  -31.423 1.00 54.65  ? 39   ARG A N     1 
ATOM   283   C  CA    . ARG A 1  39   ? -14.027 14.422  -30.059 1.00 49.12  ? 39   ARG A CA    1 
ATOM   284   C  C     . ARG A 1  39   ? -12.875 14.425  -29.070 1.00 49.95  ? 39   ARG A C     1 
ATOM   285   O  O     . ARG A 1  39   ? -12.864 15.200  -28.116 1.00 65.52  ? 39   ARG A O     1 
ATOM   286   C  CB    . ARG A 1  39   ? -15.024 13.324  -29.690 1.00 51.15  ? 39   ARG A CB    1 
ATOM   287   C  CG    . ARG A 1  39   ? -15.389 13.296  -28.218 1.00 46.53  ? 39   ARG A CG    1 
ATOM   288   C  CD    . ARG A 1  39   ? -16.316 12.137  -27.915 1.00 44.60  ? 39   ARG A CD    1 
ATOM   289   N  NE    . ARG A 1  39   ? -16.613 12.038  -26.491 1.00 45.41  ? 39   ARG A NE    1 
ATOM   290   C  CZ    . ARG A 1  39   ? -15.906 11.313  -25.632 1.00 49.97  ? 39   ARG A CZ    1 
ATOM   291   N  NH1   . ARG A 1  39   ? -14.859 10.618  -26.057 1.00 50.89  ? 39   ARG A NH1   1 
ATOM   292   N  NH2   . ARG A 1  39   ? -16.247 11.278  -24.351 1.00 48.54  ? 39   ARG A NH2   1 
ATOM   293   N  N     . ARG A 1  40   ? -11.902 13.557  -29.312 1.00 46.10  ? 40   ARG A N     1 
ATOM   294   C  CA    . ARG A 1  40   ? -10.746 13.447  -28.437 1.00 51.96  ? 40   ARG A CA    1 
ATOM   295   C  C     . ARG A 1  40   ? -9.787  14.625  -28.604 1.00 57.34  ? 40   ARG A C     1 
ATOM   296   O  O     . ARG A 1  40   ? -8.938  14.867  -27.748 1.00 59.86  ? 40   ARG A O     1 
ATOM   297   C  CB    . ARG A 1  40   ? -10.018 12.133  -28.698 1.00 50.26  ? 40   ARG A CB    1 
ATOM   298   C  CG    . ARG A 1  40   ? -10.890 10.906  -28.499 1.00 48.59  ? 40   ARG A CG    1 
ATOM   299   C  CD    . ARG A 1  40   ? -10.108 9.632   -28.747 1.00 52.29  ? 40   ARG A CD    1 
ATOM   300   N  NE    . ARG A 1  40   ? -8.863  9.611   -27.987 1.00 56.87  ? 40   ARG A NE    1 
ATOM   301   C  CZ    . ARG A 1  40   ? -8.769  9.268   -26.707 1.00 54.87  ? 40   ARG A CZ    1 
ATOM   302   N  NH1   . ARG A 1  40   ? -9.852  8.911   -26.029 1.00 51.08  ? 40   ARG A NH1   1 
ATOM   303   N  NH2   . ARG A 1  40   ? -7.588  9.284   -26.104 1.00 56.78  ? 40   ARG A NH2   1 
ATOM   304   N  N     . THR A 1  41   ? -9.923  15.356  -29.704 1.00 55.26  ? 41   THR A N     1 
ATOM   305   C  CA    . THR A 1  41   ? -9.078  16.520  -29.943 1.00 54.79  ? 41   THR A CA    1 
ATOM   306   C  C     . THR A 1  41   ? -9.668  17.748  -29.258 1.00 52.19  ? 41   THR A C     1 
ATOM   307   O  O     . THR A 1  41   ? -8.950  18.550  -28.657 1.00 51.78  ? 41   THR A O     1 
ATOM   308   C  CB    . THR A 1  41   ? -8.915  16.800  -31.449 1.00 63.85  ? 41   THR A CB    1 
ATOM   309   O  OG1   . THR A 1  41   ? -8.619  15.578  -32.136 1.00 70.40  ? 41   THR A OG1   1 
ATOM   310   C  CG2   . THR A 1  41   ? -7.796  17.803  -31.692 1.00 64.51  ? 41   THR A CG2   1 
ATOM   311   N  N     . LEU A 1  42   ? -10.988 17.870  -29.356 1.00 58.55  ? 42   LEU A N     1 
ATOM   312   C  CA    . LEU A 1  42   ? -11.732 18.994  -28.796 1.00 56.20  ? 42   LEU A CA    1 
ATOM   313   C  C     . LEU A 1  42   ? -11.624 19.071  -27.275 1.00 54.23  ? 42   LEU A C     1 
ATOM   314   O  O     . LEU A 1  42   ? -11.198 20.084  -26.723 1.00 53.13  ? 42   LEU A O     1 
ATOM   315   C  CB    . LEU A 1  42   ? -13.206 18.895  -29.203 1.00 60.60  ? 42   LEU A CB    1 
ATOM   316   C  CG    . LEU A 1  42   ? -13.528 19.043  -30.692 1.00 58.73  ? 42   LEU A CG    1 
ATOM   317   C  CD1   . LEU A 1  42   ? -14.894 18.456  -31.014 1.00 58.99  ? 42   LEU A CD1   1 
ATOM   318   C  CD2   . LEU A 1  42   ? -13.471 20.507  -31.087 1.00 63.48  ? 42   LEU A CD2   1 
ATOM   319   N  N     . LEU A 1  43   ? -12.013 17.988  -26.611 1.00 50.00  ? 43   LEU A N     1 
ATOM   320   C  CA    . LEU A 1  43   ? -12.038 17.922  -25.153 1.00 47.15  ? 43   LEU A CA    1 
ATOM   321   C  C     . LEU A 1  43   ? -10.675 18.183  -24.511 1.00 49.45  ? 43   LEU A C     1 
ATOM   322   O  O     . LEU A 1  43   ? -10.601 18.657  -23.377 1.00 52.51  ? 43   LEU A O     1 
ATOM   323   C  CB    . LEU A 1  43   ? -12.558 16.553  -24.702 1.00 41.41  ? 43   LEU A CB    1 
ATOM   324   C  CG    . LEU A 1  43   ? -13.950 16.128  -25.171 1.00 40.17  ? 43   LEU A CG    1 
ATOM   325   C  CD1   . LEU A 1  43   ? -14.189 14.656  -24.880 1.00 35.98  ? 43   LEU A CD1   1 
ATOM   326   C  CD2   . LEU A 1  43   ? -15.017 16.978  -24.507 1.00 58.17  ? 43   LEU A CD2   1 
ATOM   327   N  N     . SER A 1  44   ? -9.600  17.883  -25.236 1.00 52.18  ? 44   SER A N     1 
ATOM   328   C  CA    . SER A 1  44   ? -8.265  17.882  -24.643 1.00 50.19  ? 44   SER A CA    1 
ATOM   329   C  C     . SER A 1  44   ? -7.372  19.055  -25.048 1.00 54.66  ? 44   SER A C     1 
ATOM   330   O  O     . SER A 1  44   ? -6.693  19.633  -24.200 1.00 59.60  ? 44   SER A O     1 
ATOM   331   C  CB    . SER A 1  44   ? -7.548  16.577  -24.991 1.00 47.86  ? 44   SER A CB    1 
ATOM   332   O  OG    . SER A 1  44   ? -7.416  16.435  -26.394 1.00 50.16  ? 44   SER A OG    1 
ATOM   333   N  N     . SER A 1  45   ? -7.362  19.406  -26.331 1.00 54.42  ? 45   SER A N     1 
ATOM   334   C  CA    . SER A 1  45   ? -6.335  20.315  -26.839 1.00 56.62  ? 45   SER A CA    1 
ATOM   335   C  C     . SER A 1  45   ? -6.856  21.593  -27.502 1.00 51.81  ? 45   SER A C     1 
ATOM   336   O  O     . SER A 1  45   ? -6.167  22.187  -28.326 1.00 53.04  ? 45   SER A O     1 
ATOM   337   C  CB    . SER A 1  45   ? -5.440  19.566  -27.826 1.00 60.60  ? 45   SER A CB    1 
ATOM   338   O  OG    . SER A 1  45   ? -4.785  18.486  -27.188 1.00 65.08  ? 45   SER A OG    1 
ATOM   339   N  N     . ILE A 1  46   ? -8.057  22.027  -27.137 1.00 55.07  ? 46   ILE A N     1 
ATOM   340   C  CA    . ILE A 1  46   ? -8.572  23.297  -27.639 1.00 54.91  ? 46   ILE A CA    1 
ATOM   341   C  C     . ILE A 1  46   ? -8.163  24.431  -26.706 1.00 53.97  ? 46   ILE A C     1 
ATOM   342   O  O     . ILE A 1  46   ? -8.380  24.358  -25.499 1.00 55.70  ? 46   ILE A O     1 
ATOM   343   C  CB    . ILE A 1  46   ? -10.102 23.274  -27.795 1.00 54.47  ? 46   ILE A CB    1 
ATOM   344   C  CG1   . ILE A 1  46   ? -10.506 22.304  -28.905 1.00 48.26  ? 46   ILE A CG1   1 
ATOM   345   C  CG2   . ILE A 1  46   ? -10.633 24.663  -28.108 1.00 52.09  ? 46   ILE A CG2   1 
ATOM   346   C  CD1   . ILE A 1  46   ? -9.961  22.670  -30.266 1.00 57.81  ? 46   ILE A CD1   1 
ATOM   347   N  N     . PRO A 1  47   ? -7.553  25.486  -27.266 1.00 49.89  ? 47   PRO A N     1 
ATOM   348   C  CA    . PRO A 1  47   ? -7.054  26.603  -26.457 1.00 51.17  ? 47   PRO A CA    1 
ATOM   349   C  C     . PRO A 1  47   ? -8.166  27.512  -25.928 1.00 49.05  ? 47   PRO A C     1 
ATOM   350   O  O     . PRO A 1  47   ? -9.246  27.583  -26.515 1.00 42.74  ? 47   PRO A O     1 
ATOM   351   C  CB    . PRO A 1  47   ? -6.154  27.367  -27.437 1.00 50.53  ? 47   PRO A CB    1 
ATOM   352   C  CG    . PRO A 1  47   ? -6.732  27.058  -28.781 1.00 54.05  ? 47   PRO A CG    1 
ATOM   353   C  CD    . PRO A 1  47   ? -7.212  25.644  -28.692 1.00 52.09  ? 47   PRO A CD    1 
ATOM   354   N  N     . GLY A 1  48   ? -7.891  28.194  -24.820 1.00 52.37  ? 48   GLY A N     1 
ATOM   355   C  CA    . GLY A 1  48   ? -8.826  29.130  -24.226 1.00 47.42  ? 48   GLY A CA    1 
ATOM   356   C  C     . GLY A 1  48   ? -8.141  30.037  -23.226 1.00 46.25  ? 48   GLY A C     1 
ATOM   357   O  O     . GLY A 1  48   ? -6.994  30.441  -23.426 1.00 49.56  ? 48   GLY A O     1 
ATOM   358   N  N     . ALA A 1  49   ? -8.843  30.355  -22.144 1.00 49.20  ? 49   ALA A N     1 
ATOM   359   C  CA    . ALA A 1  49   ? -8.290  31.208  -21.100 1.00 44.22  ? 49   ALA A CA    1 
ATOM   360   C  C     . ALA A 1  49   ? -9.104  31.094  -19.821 1.00 46.49  ? 49   ALA A C     1 
ATOM   361   O  O     . ALA A 1  49   ? -10.325 30.932  -19.858 1.00 45.07  ? 49   ALA A O     1 
ATOM   362   C  CB    . ALA A 1  49   ? -8.233  32.654  -21.558 1.00 50.11  ? 49   ALA A CB    1 
ATOM   363   N  N     . ALA A 1  50   ? -8.409  31.196  -18.693 1.00 45.16  ? 50   ALA A N     1 
ATOM   364   C  CA    . ALA A 1  50   ? -9.029  31.103  -17.380 1.00 48.96  ? 50   ALA A CA    1 
ATOM   365   C  C     . ALA A 1  50   ? -8.109  31.668  -16.302 1.00 42.79  ? 50   ALA A C     1 
ATOM   366   O  O     . ALA A 1  50   ? -6.990  32.096  -16.586 1.00 39.34  ? 50   ALA A O     1 
ATOM   367   C  CB    . ALA A 1  50   ? -9.389  29.660  -17.068 1.00 53.88  ? 50   ALA A CB    1 
ATOM   368   N  N     . VAL A 1  51   ? -8.594  31.653  -15.064 1.00 37.79  ? 51   VAL A N     1 
ATOM   369   C  CA    . VAL A 1  51   ? -7.876  32.218  -13.927 1.00 36.32  ? 51   VAL A CA    1 
ATOM   370   C  C     . VAL A 1  51   ? -6.762  31.303  -13.437 1.00 32.18  ? 51   VAL A C     1 
ATOM   371   O  O     . VAL A 1  51   ? -6.936  30.091  -13.369 1.00 41.15  ? 51   VAL A O     1 
ATOM   372   C  CB    . VAL A 1  51   ? -8.825  32.484  -12.750 1.00 35.75  ? 51   VAL A CB    1 
ATOM   373   C  CG1   . VAL A 1  51   ? -8.172  33.417  -11.743 1.00 36.67  ? 51   VAL A CG1   1 
ATOM   374   C  CG2   . VAL A 1  51   ? -10.144 33.053  -13.250 1.00 37.57  ? 51   VAL A CG2   1 
ATOM   375   N  N     . THR A 1  52   ? -5.623  31.877  -13.074 1.00 28.58  ? 52   THR A N     1 
ATOM   376   C  CA    . THR A 1  52   ? -4.529  31.064  -12.565 1.00 32.70  ? 52   THR A CA    1 
ATOM   377   C  C     . THR A 1  52   ? -4.308  31.299  -11.077 1.00 37.89  ? 52   THR A C     1 
ATOM   378   O  O     . THR A 1  52   ? -4.154  30.352  -10.310 1.00 45.10  ? 52   THR A O     1 
ATOM   379   C  CB    . THR A 1  52   ? -3.228  31.335  -13.328 1.00 39.36  ? 52   THR A CB    1 
ATOM   380   O  OG1   . THR A 1  52   ? -2.921  32.733  -13.277 1.00 43.19  ? 52   THR A OG1   1 
ATOM   381   C  CG2   . THR A 1  52   ? -3.379  30.909  -14.776 1.00 44.65  ? 52   THR A CG2   1 
ATOM   382   N  N     . SER A 1  53   ? -4.302  32.562  -10.668 1.00 35.96  ? 53   SER A N     1 
ATOM   383   C  CA    . SER A 1  53   ? -4.079  32.901  -9.268  1.00 36.02  ? 53   SER A CA    1 
ATOM   384   C  C     . SER A 1  53   ? -4.879  34.139  -8.892  1.00 33.38  ? 53   SER A C     1 
ATOM   385   O  O     . SER A 1  53   ? -5.255  34.919  -9.760  1.00 42.63  ? 53   SER A O     1 
ATOM   386   C  CB    . SER A 1  53   ? -2.593  33.137  -9.005  1.00 41.71  ? 53   SER A CB    1 
ATOM   387   O  OG    . SER A 1  53   ? -2.178  34.362  -9.582  1.00 49.43  ? 53   SER A OG    1 
ATOM   388   N  N     . ILE A 1  54   ? -5.141  34.316  -7.599  1.00 30.80  ? 54   ILE A N     1 
ATOM   389   C  CA    . ILE A 1  54   ? -5.863  35.490  -7.110  1.00 32.16  ? 54   ILE A CA    1 
ATOM   390   C  C     . ILE A 1  54   ? -5.170  36.095  -5.884  1.00 30.85  ? 54   ILE A C     1 
ATOM   391   O  O     . ILE A 1  54   ? -4.151  35.585  -5.434  1.00 40.27  ? 54   ILE A O     1 
ATOM   392   C  CB    . ILE A 1  54   ? -7.321  35.146  -6.743  1.00 35.06  ? 54   ILE A CB    1 
ATOM   393   C  CG1   . ILE A 1  54   ? -7.362  34.282  -5.482  1.00 32.85  ? 54   ILE A CG1   1 
ATOM   394   C  CG2   . ILE A 1  54   ? -8.021  34.439  -7.899  1.00 34.18  ? 54   ILE A CG2   1 
ATOM   395   C  CD1   . ILE A 1  54   ? -8.751  34.081  -4.922  1.00 31.12  ? 54   ILE A CD1   1 
ATOM   396   N  N     . ARG A 1  55   ? -5.719  37.187  -5.358  1.00 27.98  ? 55   ARG A N     1 
ATOM   397   C  CA    . ARG A 1  55   ? -5.234  37.783  -4.111  1.00 29.72  ? 55   ARG A CA    1 
ATOM   398   C  C     . ARG A 1  55   ? -6.357  38.541  -3.424  1.00 35.59  ? 55   ARG A C     1 
ATOM   399   O  O     . ARG A 1  55   ? -7.075  39.302  -4.066  1.00 49.58  ? 55   ARG A O     1 
ATOM   400   C  CB    . ARG A 1  55   ? -4.052  38.723  -4.360  1.00 37.93  ? 55   ARG A CB    1 
ATOM   401   C  CG    . ARG A 1  55   ? -2.694  38.055  -4.253  1.00 43.92  ? 55   ARG A CG    1 
ATOM   402   C  CD    . ARG A 1  55   ? -1.568  39.065  -4.275  1.00 42.68  ? 55   ARG A CD    1 
ATOM   403   N  NE    . ARG A 1  55   ? -1.650  39.985  -3.146  1.00 53.97  ? 55   ARG A NE    1 
ATOM   404   C  CZ    . ARG A 1  55   ? -0.761  40.939  -2.901  1.00 65.55  ? 55   ARG A CZ    1 
ATOM   405   N  NH1   . ARG A 1  55   ? 0.279   41.095  -3.708  1.00 69.90  ? 55   ARG A NH1   1 
ATOM   406   N  NH2   . ARG A 1  55   ? -0.911  41.736  -1.852  1.00 74.09  ? 55   ARG A NH2   1 
ATOM   407   N  N     . ILE A 1  56   ? -6.513  38.337  -2.121  1.00 30.02  ? 56   ILE A N     1 
ATOM   408   C  CA    . ILE A 1  56   ? -7.593  38.994  -1.396  1.00 31.52  ? 56   ILE A CA    1 
ATOM   409   C  C     . ILE A 1  56   ? -7.073  39.832  -0.232  1.00 35.16  ? 56   ILE A C     1 
ATOM   410   O  O     . ILE A 1  56   ? -6.118  39.454  0.442   1.00 38.94  ? 56   ILE A O     1 
ATOM   411   C  CB    . ILE A 1  56   ? -8.615  37.968  -0.879  1.00 29.71  ? 56   ILE A CB    1 
ATOM   412   C  CG1   . ILE A 1  56   ? -9.096  37.084  -2.030  1.00 30.68  ? 56   ILE A CG1   1 
ATOM   413   C  CG2   . ILE A 1  56   ? -9.800  38.666  -0.245  1.00 36.23  ? 56   ILE A CG2   1 
ATOM   414   C  CD1   . ILE A 1  56   ? -10.217 36.139  -1.665  1.00 28.81  ? 56   ILE A CD1   1 
ATOM   415   N  N     . ASP A 1  57   ? -7.707  40.980  -0.014  1.00 39.17  ? 57   ASP A N     1 
ATOM   416   C  CA    . ASP A 1  57   ? -7.329  41.883  1.063   1.00 49.67  ? 57   ASP A CA    1 
ATOM   417   C  C     . ASP A 1  57   ? -7.580  41.244  2.429   1.00 52.11  ? 57   ASP A C     1 
ATOM   418   O  O     . ASP A 1  57   ? -8.703  40.847  2.742   1.00 52.96  ? 57   ASP A O     1 
ATOM   419   C  CB    . ASP A 1  57   ? -8.101  43.200  0.945   1.00 56.13  ? 57   ASP A CB    1 
ATOM   420   C  CG    . ASP A 1  57   ? -7.384  44.363  1.609   1.00 64.52  ? 57   ASP A CG    1 
ATOM   421   O  OD1   . ASP A 1  57   ? -6.340  44.138  2.259   1.00 65.70  ? 57   ASP A OD1   1 
ATOM   422   O  OD2   . ASP A 1  57   ? -7.872  45.507  1.487   1.00 64.96  ? 57   ASP A OD2   1 
ATOM   423   N  N     . GLY A 1  58   ? -6.525  41.139  3.233   1.00 48.54  ? 58   GLY A N     1 
ATOM   424   C  CA    . GLY A 1  58   ? -6.636  40.619  4.586   1.00 37.53  ? 58   GLY A CA    1 
ATOM   425   C  C     . GLY A 1  58   ? -6.542  39.108  4.670   1.00 35.47  ? 58   GLY A C     1 
ATOM   426   O  O     . GLY A 1  58   ? -6.670  38.524  5.747   1.00 32.68  ? 58   GLY A O     1 
ATOM   427   N  N     . VAL A 1  59   ? -6.316  38.475  3.524   1.00 41.12  ? 59   VAL A N     1 
ATOM   428   C  CA    . VAL A 1  59   ? -6.215  37.023  3.440   1.00 37.21  ? 59   VAL A CA    1 
ATOM   429   C  C     . VAL A 1  59   ? -4.791  36.600  3.090   1.00 32.31  ? 59   VAL A C     1 
ATOM   430   O  O     . VAL A 1  59   ? -4.164  37.178  2.201   1.00 35.14  ? 59   VAL A O     1 
ATOM   431   C  CB    . VAL A 1  59   ? -7.197  36.459  2.391   1.00 36.04  ? 59   VAL A CB    1 
ATOM   432   C  CG1   . VAL A 1  59   ? -7.056  34.953  2.271   1.00 34.68  ? 59   VAL A CG1   1 
ATOM   433   C  CG2   . VAL A 1  59   ? -8.623  36.834  2.751   1.00 34.87  ? 59   VAL A CG2   1 
ATOM   434   N  N     . LEU A 1  60   ? -4.278  35.595  3.791   1.00 21.79  ? 60   LEU A N     1 
ATOM   435   C  CA    . LEU A 1  60   ? -2.923  35.126  3.539   1.00 17.03  ? 60   LEU A CA    1 
ATOM   436   C  C     . LEU A 1  60   ? -2.908  33.744  2.910   1.00 18.69  ? 60   LEU A C     1 
ATOM   437   O  O     . LEU A 1  60   ? -1.949  33.370  2.240   1.00 22.06  ? 60   LEU A O     1 
ATOM   438   C  CB    . LEU A 1  60   ? -2.111  35.114  4.829   1.00 14.18  ? 60   LEU A CB    1 
ATOM   439   C  CG    . LEU A 1  60   ? -1.733  36.491  5.365   1.00 12.69  ? 60   LEU A CG    1 
ATOM   440   C  CD1   . LEU A 1  60   ? -2.845  37.071  6.221   1.00 16.43  ? 60   LEU A CD1   1 
ATOM   441   C  CD2   . LEU A 1  60   ? -0.442  36.399  6.147   1.00 20.97  ? 60   LEU A CD2   1 
ATOM   442   N  N     . HIS A 1  61   ? -3.968  32.980  3.129   1.00 18.55  ? 61   HIS A N     1 
ATOM   443   C  CA    . HIS A 1  61   ? -4.038  31.652  2.546   1.00 19.08  ? 61   HIS A CA    1 
ATOM   444   C  C     . HIS A 1  61   ? -5.469  31.216  2.274   1.00 23.14  ? 61   HIS A C     1 
ATOM   445   O  O     . HIS A 1  61   ? -6.424  31.826  2.754   1.00 23.11  ? 61   HIS A O     1 
ATOM   446   C  CB    . HIS A 1  61   ? -3.327  30.634  3.445   1.00 22.14  ? 61   HIS A CB    1 
ATOM   447   C  CG    . HIS A 1  61   ? -3.841  30.580  4.852   1.00 20.06  ? 61   HIS A CG    1 
ATOM   448   N  ND1   . HIS A 1  61   ? -5.121  30.177  5.167   1.00 18.52  ? 61   HIS A ND1   1 
ATOM   449   C  CD2   . HIS A 1  61   ? -3.230  30.843  6.032   1.00 17.25  ? 61   HIS A CD2   1 
ATOM   450   C  CE1   . HIS A 1  61   ? -5.281  30.211  6.477   1.00 16.07  ? 61   HIS A CE1   1 
ATOM   451   N  NE2   . HIS A 1  61   ? -4.149  30.610  7.026   1.00 13.21  ? 61   HIS A NE2   1 
ATOM   452   N  N     . GLU A 1  62   ? -5.596  30.147  1.497   1.00 24.99  ? 62   GLU A N     1 
ATOM   453   C  CA    . GLU A 1  62   ? -6.881  29.673  0.998   1.00 23.74  ? 62   GLU A CA    1 
ATOM   454   C  C     . GLU A 1  62   ? -7.882  29.315  2.105   1.00 28.76  ? 62   GLU A C     1 
ATOM   455   O  O     . GLU A 1  62   ? -9.091  29.318  1.875   1.00 33.26  ? 62   GLU A O     1 
ATOM   456   C  CB    . GLU A 1  62   ? -6.654  28.459  0.086   1.00 22.76  ? 62   GLU A CB    1 
ATOM   457   C  CG    . GLU A 1  62   ? -7.911  27.907  -0.579  1.00 34.29  ? 62   GLU A CG    1 
ATOM   458   C  CD    . GLU A 1  62   ? -7.673  26.577  -1.278  1.00 41.35  ? 62   GLU A CD    1 
ATOM   459   O  OE1   . GLU A 1  62   ? -6.500  26.261  -1.575  1.00 45.07  ? 62   GLU A OE1   1 
ATOM   460   O  OE2   . GLU A 1  62   ? -8.657  25.844  -1.524  1.00 39.28  ? 62   GLU A OE2   1 
ATOM   461   N  N     . PHE A 1  63   ? -7.388  29.031  3.307   1.00 26.90  ? 63   PHE A N     1 
ATOM   462   C  CA    . PHE A 1  63   ? -8.240  28.472  4.359   1.00 25.20  ? 63   PHE A CA    1 
ATOM   463   C  C     . PHE A 1  63   ? -8.602  29.462  5.468   1.00 26.40  ? 63   PHE A C     1 
ATOM   464   O  O     . PHE A 1  63   ? -8.112  29.340  6.589   1.00 25.86  ? 63   PHE A O     1 
ATOM   465   C  CB    . PHE A 1  63   ? -7.561  27.250  4.989   1.00 23.92  ? 63   PHE A CB    1 
ATOM   466   C  CG    . PHE A 1  63   ? -7.019  26.267  3.985   1.00 26.20  ? 63   PHE A CG    1 
ATOM   467   C  CD1   . PHE A 1  63   ? -7.803  25.224  3.520   1.00 27.18  ? 63   PHE A CD1   1 
ATOM   468   C  CD2   . PHE A 1  63   ? -5.723  26.384  3.511   1.00 26.41  ? 63   PHE A CD2   1 
ATOM   469   C  CE1   . PHE A 1  63   ? -7.302  24.320  2.596   1.00 27.91  ? 63   PHE A CE1   1 
ATOM   470   C  CE2   . PHE A 1  63   ? -5.220  25.485  2.588   1.00 30.71  ? 63   PHE A CE2   1 
ATOM   471   C  CZ    . PHE A 1  63   ? -6.010  24.452  2.132   1.00 31.02  ? 63   PHE A CZ    1 
ATOM   472   N  N     . THR A 1  64   ? -9.474  30.422  5.167   1.00 30.56  ? 64   THR A N     1 
ATOM   473   C  CA    . THR A 1  64   ? -9.916  31.391  6.174   1.00 30.39  ? 64   THR A CA    1 
ATOM   474   C  C     . THR A 1  64   ? -11.229 32.081  5.803   1.00 28.56  ? 64   THR A C     1 
ATOM   475   O  O     . THR A 1  64   ? -11.894 31.700  4.840   1.00 26.42  ? 64   THR A O     1 
ATOM   476   C  CB    . THR A 1  64   ? -8.851  32.475  6.418   1.00 33.56  ? 64   THR A CB    1 
ATOM   477   O  OG1   . THR A 1  64   ? -9.355  33.437  7.353   1.00 33.51  ? 64   THR A OG1   1 
ATOM   478   C  CG2   . THR A 1  64   ? -8.502  33.180  5.123   1.00 32.69  ? 64   THR A CG2   1 
ATOM   479   N  N     . THR A 1  65   ? -11.600 33.097  6.578   1.00 27.60  ? 65   THR A N     1 
ATOM   480   C  CA    . THR A 1  65   ? -12.851 33.815  6.351   1.00 33.44  ? 65   THR A CA    1 
ATOM   481   C  C     . THR A 1  65   ? -12.685 35.327  6.394   1.00 33.18  ? 65   THR A C     1 
ATOM   482   O  O     . THR A 1  65   ? -12.013 35.867  7.271   1.00 42.92  ? 65   THR A O     1 
ATOM   483   C  CB    . THR A 1  65   ? -13.921 33.430  7.390   1.00 38.32  ? 65   THR A CB    1 
ATOM   484   O  OG1   . THR A 1  65   ? -13.401 33.624  8.712   1.00 42.29  ? 65   THR A OG1   1 
ATOM   485   C  CG2   . THR A 1  65   ? -14.335 31.980  7.216   1.00 39.56  ? 65   THR A CG2   1 
ATOM   486   N  N     . VAL A 1  66   ? -13.308 36.012  5.445   1.00 29.53  ? 66   VAL A N     1 
ATOM   487   C  CA    . VAL A 1  66   ? -13.328 37.464  5.467   1.00 31.91  ? 66   VAL A CA    1 
ATOM   488   C  C     . VAL A 1  66   ? -14.479 37.913  6.361   1.00 32.74  ? 66   VAL A C     1 
ATOM   489   O  O     . VAL A 1  66   ? -15.568 37.342  6.306   1.00 37.63  ? 66   VAL A O     1 
ATOM   490   C  CB    . VAL A 1  66   ? -13.463 38.046  4.048   1.00 26.63  ? 66   VAL A CB    1 
ATOM   491   C  CG1   . VAL A 1  66   ? -13.558 39.559  4.083   1.00 30.99  ? 66   VAL A CG1   1 
ATOM   492   C  CG2   . VAL A 1  66   ? -12.278 37.620  3.209   1.00 25.46  ? 66   VAL A CG2   1 
ATOM   493   N  N     . PRO A 1  67   ? -14.225 38.908  7.222   1.00 30.10  ? 67   PRO A N     1 
ATOM   494   C  CA    . PRO A 1  67   ? -15.278 39.416  8.103   1.00 29.61  ? 67   PRO A CA    1 
ATOM   495   C  C     . PRO A 1  67   ? -16.490 39.898  7.316   1.00 31.20  ? 67   PRO A C     1 
ATOM   496   O  O     . PRO A 1  67   ? -16.337 40.597  6.317   1.00 31.99  ? 67   PRO A O     1 
ATOM   497   C  CB    . PRO A 1  67   ? -14.596 40.578  8.828   1.00 33.76  ? 67   PRO A CB    1 
ATOM   498   C  CG    . PRO A 1  67   ? -13.144 40.237  8.795   1.00 32.11  ? 67   PRO A CG    1 
ATOM   499   C  CD    . PRO A 1  67   ? -12.925 39.552  7.485   1.00 33.75  ? 67   PRO A CD    1 
ATOM   500   N  N     . GLY A 1  68   ? -17.680 39.500  7.750   1.00 32.29  ? 68   GLY A N     1 
ATOM   501   C  CA    . GLY A 1  68   ? -18.907 40.016  7.174   1.00 43.00  ? 68   GLY A CA    1 
ATOM   502   C  C     . GLY A 1  68   ? -19.299 39.419  5.837   1.00 39.36  ? 68   GLY A C     1 
ATOM   503   O  O     . GLY A 1  68   ? -20.201 39.923  5.170   1.00 50.66  ? 68   GLY A O     1 
ATOM   504   N  N     . VAL A 1  69   ? -18.625 38.345  5.441   1.00 32.59  ? 69   VAL A N     1 
ATOM   505   C  CA    . VAL A 1  69   ? -18.962 37.645  4.208   1.00 31.29  ? 69   VAL A CA    1 
ATOM   506   C  C     . VAL A 1  69   ? -19.498 36.258  4.535   1.00 33.61  ? 69   VAL A C     1 
ATOM   507   O  O     . VAL A 1  69   ? -18.903 35.538  5.326   1.00 38.60  ? 69   VAL A O     1 
ATOM   508   C  CB    . VAL A 1  69   ? -17.747 37.525  3.277   1.00 31.43  ? 69   VAL A CB    1 
ATOM   509   C  CG1   . VAL A 1  69   ? -18.123 36.787  2.004   1.00 36.02  ? 69   VAL A CG1   1 
ATOM   510   C  CG2   . VAL A 1  69   ? -17.191 38.903  2.956   1.00 36.97  ? 69   VAL A CG2   1 
ATOM   511   N  N     . LYS A 1  70   ? -20.622 35.888  3.931   1.00 33.73  ? 70   LYS A N     1 
ATOM   512   C  CA    . LYS A 1  70   ? -21.276 34.617  4.239   1.00 33.81  ? 70   LYS A CA    1 
ATOM   513   C  C     . LYS A 1  70   ? -20.413 33.402  3.895   1.00 38.28  ? 70   LYS A C     1 
ATOM   514   O  O     . LYS A 1  70   ? -20.439 32.397  4.606   1.00 38.65  ? 70   LYS A O     1 
ATOM   515   C  CB    . LYS A 1  70   ? -22.617 34.518  3.506   1.00 35.61  ? 70   LYS A CB    1 
ATOM   516   C  CG    . LYS A 1  70   ? -23.448 33.299  3.888   1.00 34.38  ? 70   LYS A CG    1 
ATOM   517   C  CD    . LYS A 1  70   ? -24.764 33.245  3.122   1.00 30.63  ? 70   LYS A CD    1 
ATOM   518   C  CE    . LYS A 1  70   ? -25.579 32.026  3.525   1.00 26.22  ? 70   LYS A CE    1 
ATOM   519   N  NZ    . LYS A 1  70   ? -26.840 31.898  2.749   1.00 29.65  ? 70   LYS A NZ    1 
ATOM   520   N  N     . GLU A 1  71   ? -19.650 33.494  2.809   1.00 42.46  ? 71   GLU A N     1 
ATOM   521   C  CA    . GLU A 1  71   ? -18.829 32.372  2.355   1.00 41.11  ? 71   GLU A CA    1 
ATOM   522   C  C     . GLU A 1  71   ? -17.372 32.482  2.798   1.00 36.31  ? 71   GLU A C     1 
ATOM   523   O  O     . GLU A 1  71   ? -16.867 33.579  3.045   1.00 33.49  ? 71   GLU A O     1 
ATOM   524   C  CB    . GLU A 1  71   ? -18.883 32.250  0.829   1.00 44.70  ? 71   GLU A CB    1 
ATOM   525   C  CG    . GLU A 1  71   ? -20.228 31.800  0.269   1.00 54.63  ? 71   GLU A CG    1 
ATOM   526   C  CD    . GLU A 1  71   ? -21.062 32.953  -0.265  1.00 49.07  ? 71   GLU A CD    1 
ATOM   527   O  OE1   . GLU A 1  71   ? -20.846 34.101  0.177   1.00 52.92  ? 71   GLU A OE1   1 
ATOM   528   O  OE2   . GLU A 1  71   ? -21.930 32.713  -1.133  1.00 45.93  ? 71   GLU A OE2   1 
ATOM   529   N  N     . ASP A 1  72   ? -16.704 31.335  2.894   1.00 37.18  ? 72   ASP A N     1 
ATOM   530   C  CA    . ASP A 1  72   ? -15.278 31.287  3.201   1.00 33.42  ? 72   ASP A CA    1 
ATOM   531   C  C     . ASP A 1  72   ? -14.478 31.274  1.905   1.00 29.32  ? 72   ASP A C     1 
ATOM   532   O  O     . ASP A 1  72   ? -15.037 31.048  0.832   1.00 29.60  ? 72   ASP A O     1 
ATOM   533   C  CB    . ASP A 1  72   ? -14.944 30.063  4.057   1.00 35.96  ? 72   ASP A CB    1 
ATOM   534   C  CG    . ASP A 1  72   ? -15.505 28.775  3.481   1.00 39.89  ? 72   ASP A CG    1 
ATOM   535   O  OD1   . ASP A 1  72   ? -14.854 28.187  2.593   1.00 40.55  ? 72   ASP A OD1   1 
ATOM   536   O  OD2   . ASP A 1  72   ? -16.594 28.349  3.922   1.00 43.22  ? 72   ASP A OD2   1 
ATOM   537   N  N     . VAL A 1  73   ? -13.174 31.514  2.008   1.00 25.22  ? 73   VAL A N     1 
ATOM   538   C  CA    . VAL A 1  73   ? -12.332 31.689  0.828   1.00 24.19  ? 73   VAL A CA    1 
ATOM   539   C  C     . VAL A 1  73   ? -12.354 30.457  -0.078  1.00 25.14  ? 73   VAL A C     1 
ATOM   540   O  O     . VAL A 1  73   ? -12.442 30.580  -1.300  1.00 22.55  ? 73   VAL A O     1 
ATOM   541   C  CB    . VAL A 1  73   ? -10.877 32.013  1.228   1.00 24.62  ? 73   VAL A CB    1 
ATOM   542   C  CG1   . VAL A 1  73   ? -10.031 32.292  -0.001  1.00 24.99  ? 73   VAL A CG1   1 
ATOM   543   C  CG2   . VAL A 1  73   ? -10.843 33.207  2.171   1.00 23.57  ? 73   VAL A CG2   1 
ATOM   544   N  N     . THR A 1  74   ? -12.293 29.277  0.532   1.00 27.12  ? 74   THR A N     1 
ATOM   545   C  CA    . THR A 1  74   ? -12.333 28.010  -0.197  1.00 24.97  ? 74   THR A CA    1 
ATOM   546   C  C     . THR A 1  74   ? -13.576 27.879  -1.069  1.00 25.56  ? 74   THR A C     1 
ATOM   547   O  O     . THR A 1  74   ? -13.482 27.535  -2.244  1.00 27.35  ? 74   THR A O     1 
ATOM   548   C  CB    . THR A 1  74   ? -12.289 26.807  0.762   1.00 25.52  ? 74   THR A CB    1 
ATOM   549   O  OG1   . THR A 1  74   ? -11.091 26.861  1.543   1.00 28.61  ? 74   THR A OG1   1 
ATOM   550   C  CG2   . THR A 1  74   ? -12.323 25.502  -0.018  1.00 24.71  ? 74   THR A CG2   1 
ATOM   551   N  N     . GLU A 1  75   ? -14.741 28.145  -0.488  1.00 29.46  ? 75   GLU A N     1 
ATOM   552   C  CA    . GLU A 1  75   ? -15.985 28.087  -1.245  1.00 37.11  ? 75   GLU A CA    1 
ATOM   553   C  C     . GLU A 1  75   ? -16.024 29.208  -2.280  1.00 36.82  ? 75   GLU A C     1 
ATOM   554   O  O     . GLU A 1  75   ? -16.636 29.071  -3.340  1.00 42.51  ? 75   GLU A O     1 
ATOM   555   C  CB    . GLU A 1  75   ? -17.201 28.183  -0.320  1.00 41.82  ? 75   GLU A CB    1 
ATOM   556   C  CG    . GLU A 1  75   ? -18.527 27.929  -1.031  1.00 45.47  ? 75   GLU A CG    1 
ATOM   557   C  CD    . GLU A 1  75   ? -19.733 28.365  -0.217  1.00 53.20  ? 75   GLU A CD    1 
ATOM   558   O  OE1   . GLU A 1  75   ? -19.612 28.490  1.020   1.00 58.17  ? 75   GLU A OE1   1 
ATOM   559   O  OE2   . GLU A 1  75   ? -20.804 28.589  -0.820  1.00 54.88  ? 75   GLU A OE2   1 
ATOM   560   N  N     . ILE A 1  76   ? -15.367 30.319  -1.970  1.00 31.12  ? 76   ILE A N     1 
ATOM   561   C  CA    . ILE A 1  76   ? -15.311 31.432  -2.906  1.00 28.11  ? 76   ILE A CA    1 
ATOM   562   C  C     . ILE A 1  76   ? -14.448 31.061  -4.104  1.00 30.62  ? 76   ILE A C     1 
ATOM   563   O  O     . ILE A 1  76   ? -14.844 31.266  -5.253  1.00 34.33  ? 76   ILE A O     1 
ATOM   564   C  CB    . ILE A 1  76   ? -14.771 32.705  -2.242  1.00 24.09  ? 76   ILE A CB    1 
ATOM   565   C  CG1   . ILE A 1  76   ? -15.841 33.308  -1.334  1.00 26.99  ? 76   ILE A CG1   1 
ATOM   566   C  CG2   . ILE A 1  76   ? -14.362 33.719  -3.291  1.00 28.38  ? 76   ILE A CG2   1 
ATOM   567   C  CD1   . ILE A 1  76   ? -15.470 34.654  -0.770  1.00 35.17  ? 76   ILE A CD1   1 
ATOM   568   N  N     . ILE A 1  77   ? -13.275 30.500  -3.828  1.00 28.53  ? 77   ILE A N     1 
ATOM   569   C  CA    . ILE A 1  77   ? -12.384 30.025  -4.877  1.00 24.66  ? 77   ILE A CA    1 
ATOM   570   C  C     . ILE A 1  77   ? -13.054 28.903  -5.662  1.00 29.63  ? 77   ILE A C     1 
ATOM   571   O  O     . ILE A 1  77   ? -12.829 28.745  -6.862  1.00 34.84  ? 77   ILE A O     1 
ATOM   572   C  CB    . ILE A 1  77   ? -11.046 29.541  -4.294  1.00 21.20  ? 77   ILE A CB    1 
ATOM   573   C  CG1   . ILE A 1  77   ? -10.303 30.715  -3.657  1.00 25.06  ? 77   ILE A CG1   1 
ATOM   574   C  CG2   . ILE A 1  77   ? -10.186 28.904  -5.366  1.00 19.24  ? 77   ILE A CG2   1 
ATOM   575   C  CD1   . ILE A 1  77   ? -8.915  30.379  -3.171  1.00 30.10  ? 77   ILE A CD1   1 
ATOM   576   N  N     . LEU A 1  78   ? -13.901 28.139  -4.980  1.00 30.66  ? 78   LEU A N     1 
ATOM   577   C  CA    . LEU A 1  78   ? -14.625 27.048  -5.621  1.00 33.63  ? 78   LEU A CA    1 
ATOM   578   C  C     . LEU A 1  78   ? -15.778 27.583  -6.471  1.00 32.51  ? 78   LEU A C     1 
ATOM   579   O  O     . LEU A 1  78   ? -16.240 26.916  -7.396  1.00 35.99  ? 78   LEU A O     1 
ATOM   580   C  CB    . LEU A 1  78   ? -15.142 26.058  -4.573  1.00 36.13  ? 78   LEU A CB    1 
ATOM   581   C  CG    . LEU A 1  78   ? -15.526 24.661  -5.063  1.00 37.87  ? 78   LEU A CG    1 
ATOM   582   C  CD1   . LEU A 1  78   ? -14.998 23.612  -4.102  1.00 29.64  ? 78   LEU A CD1   1 
ATOM   583   C  CD2   . LEU A 1  78   ? -17.032 24.535  -5.212  1.00 40.91  ? 78   LEU A CD2   1 
ATOM   584   N  N     . ASN A 1  79   ? -16.238 28.788  -6.158  1.00 27.71  ? 79   ASN A N     1 
ATOM   585   C  CA    . ASN A 1  79   ? -17.269 29.432  -6.958  1.00 29.84  ? 79   ASN A CA    1 
ATOM   586   C  C     . ASN A 1  79   ? -16.665 30.039  -8.215  1.00 34.67  ? 79   ASN A C     1 
ATOM   587   O  O     . ASN A 1  79   ? -17.303 30.092  -9.267  1.00 38.13  ? 79   ASN A O     1 
ATOM   588   C  CB    . ASN A 1  79   ? -17.993 30.500  -6.140  1.00 30.70  ? 79   ASN A CB    1 
ATOM   589   C  CG    . ASN A 1  79   ? -19.011 29.908  -5.187  1.00 36.80  ? 79   ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1  79   ? -19.740 28.982  -5.540  1.00 42.64  ? 79   ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1  79   ? -19.063 30.435  -3.969  1.00 40.22  ? 79   ASN A ND2   1 
ATOM   592   N  N     . LEU A 1  80   ? -15.416 30.476  -8.090  1.00 38.01  ? 80   LEU A N     1 
ATOM   593   C  CA    . LEU A 1  80   ? -14.687 31.124  -9.176  1.00 35.45  ? 80   LEU A CA    1 
ATOM   594   C  C     . LEU A 1  80   ? -14.218 30.159  -10.257 1.00 34.99  ? 80   LEU A C     1 
ATOM   595   O  O     . LEU A 1  80   ? -13.754 30.585  -11.312 1.00 38.98  ? 80   LEU A O     1 
ATOM   596   C  CB    . LEU A 1  80   ? -13.482 31.876  -8.616  1.00 29.19  ? 80   LEU A CB    1 
ATOM   597   C  CG    . LEU A 1  80   ? -13.839 33.156  -7.868  1.00 29.52  ? 80   LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1  80   ? -12.625 33.701  -7.147  1.00 24.54  ? 80   LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1  80   ? -14.387 34.174  -8.849  1.00 34.88  ? 80   LEU A CD2   1 
ATOM   600   N  N     . LYS A 1  81   ? -14.323 28.861  -9.994  1.00 42.73  ? 81   LYS A N     1 
ATOM   601   C  CA    . LYS A 1  81   ? -13.958 27.862  -10.993 1.00 46.17  ? 81   LYS A CA    1 
ATOM   602   C  C     . LYS A 1  81   ? -14.942 27.897  -12.149 1.00 44.09  ? 81   LYS A C     1 
ATOM   603   O  O     . LYS A 1  81   ? -14.605 27.547  -13.277 1.00 57.31  ? 81   LYS A O     1 
ATOM   604   C  CB    . LYS A 1  81   ? -13.928 26.455  -10.393 1.00 47.06  ? 81   LYS A CB    1 
ATOM   605   C  CG    . LYS A 1  81   ? -13.120 26.325  -9.125  1.00 50.39  ? 81   LYS A CG    1 
ATOM   606   C  CD    . LYS A 1  81   ? -11.650 26.078  -9.390  1.00 38.69  ? 81   LYS A CD    1 
ATOM   607   C  CE    . LYS A 1  81   ? -10.944 25.831  -8.072  1.00 40.94  ? 81   LYS A CE    1 
ATOM   608   N  NZ    . LYS A 1  81   ? -9.543  25.380  -8.241  1.00 46.51  ? 81   LYS A NZ    1 
ATOM   609   N  N     . SER A 1  82   ? -16.167 28.317  -11.858 1.00 40.40  ? 82   SER A N     1 
ATOM   610   C  CA    . SER A 1  82   ? -17.226 28.306  -12.857 1.00 45.33  ? 82   SER A CA    1 
ATOM   611   C  C     . SER A 1  82   ? -17.143 29.527  -13.769 1.00 42.69  ? 82   SER A C     1 
ATOM   612   O  O     . SER A 1  82   ? -17.836 29.604  -14.784 1.00 49.15  ? 82   SER A O     1 
ATOM   613   C  CB    . SER A 1  82   ? -18.597 28.234  -12.176 1.00 52.80  ? 82   SER A CB    1 
ATOM   614   O  OG    . SER A 1  82   ? -18.502 28.531  -10.789 1.00 43.63  ? 82   SER A OG    1 
ATOM   615   N  N     . LEU A 1  83   ? -16.276 30.467  -13.407 1.00 40.85  ? 83   LEU A N     1 
ATOM   616   C  CA    . LEU A 1  83   ? -16.129 31.720  -14.141 1.00 46.64  ? 83   LEU A CA    1 
ATOM   617   C  C     . LEU A 1  83   ? -15.670 31.503  -15.579 1.00 52.32  ? 83   LEU A C     1 
ATOM   618   O  O     . LEU A 1  83   ? -14.622 30.908  -15.819 1.00 61.63  ? 83   LEU A O     1 
ATOM   619   C  CB    . LEU A 1  83   ? -15.144 32.634  -13.415 1.00 43.34  ? 83   LEU A CB    1 
ATOM   620   C  CG    . LEU A 1  83   ? -14.818 33.967  -14.079 1.00 38.18  ? 83   LEU A CG    1 
ATOM   621   C  CD1   . LEU A 1  83   ? -16.076 34.797  -14.259 1.00 50.60  ? 83   LEU A CD1   1 
ATOM   622   C  CD2   . LEU A 1  83   ? -13.783 34.721  -13.263 1.00 34.61  ? 83   LEU A CD2   1 
ATOM   623   N  N     . VAL A 1  84   ? -16.453 31.996  -16.533 1.00 55.53  ? 84   VAL A N     1 
ATOM   624   C  CA    . VAL A 1  84   ? -16.117 31.832  -17.945 1.00 53.69  ? 84   VAL A CA    1 
ATOM   625   C  C     . VAL A 1  84   ? -15.405 33.072  -18.491 1.00 59.66  ? 84   VAL A C     1 
ATOM   626   O  O     . VAL A 1  84   ? -15.985 34.156  -18.561 1.00 65.32  ? 84   VAL A O     1 
ATOM   627   C  CB    . VAL A 1  84   ? -17.369 31.539  -18.789 1.00 51.32  ? 84   VAL A CB    1 
ATOM   628   C  CG1   . VAL A 1  84   ? -17.003 31.430  -20.257 1.00 57.25  ? 84   VAL A CG1   1 
ATOM   629   C  CG2   . VAL A 1  84   ? -18.035 30.261  -18.312 1.00 48.12  ? 84   VAL A CG2   1 
ATOM   630   N  N     . VAL A 1  85   ? -14.142 32.905  -18.872 1.00 53.51  ? 85   VAL A N     1 
ATOM   631   C  CA    . VAL A 1  85   ? -13.318 34.032  -19.295 1.00 48.95  ? 85   VAL A CA    1 
ATOM   632   C  C     . VAL A 1  85   ? -12.632 33.773  -20.628 1.00 48.22  ? 85   VAL A C     1 
ATOM   633   O  O     . VAL A 1  85   ? -12.180 32.664  -20.901 1.00 50.82  ? 85   VAL A O     1 
ATOM   634   C  CB    . VAL A 1  85   ? -12.238 34.366  -18.236 1.00 52.30  ? 85   VAL A CB    1 
ATOM   635   C  CG1   . VAL A 1  85   ? -11.327 35.487  -18.716 1.00 53.44  ? 85   VAL A CG1   1 
ATOM   636   C  CG2   . VAL A 1  85   ? -12.883 34.753  -16.928 1.00 56.57  ? 85   VAL A CG2   1 
ATOM   637   N  N     . SER A 1  86   ? -12.572 34.809  -21.458 1.00 52.14  ? 86   SER A N     1 
ATOM   638   C  CA    . SER A 1  86   ? -11.786 34.774  -22.682 1.00 57.11  ? 86   SER A CA    1 
ATOM   639   C  C     . SER A 1  86   ? -10.804 35.945  -22.717 1.00 58.85  ? 86   SER A C     1 
ATOM   640   O  O     . SER A 1  86   ? -11.182 37.096  -22.493 1.00 64.57  ? 86   SER A O     1 
ATOM   641   C  CB    . SER A 1  86   ? -12.698 34.801  -23.911 1.00 68.02  ? 86   SER A CB    1 
ATOM   642   O  OG    . SER A 1  86   ? -13.544 35.938  -23.899 1.00 74.99  ? 86   SER A OG    1 
ATOM   643   N  N     . SER A 1  87   ? -9.540  35.637  -22.988 1.00 60.33  ? 87   SER A N     1 
ATOM   644   C  CA    . SER A 1  87   ? -8.498  36.653  -23.071 1.00 62.36  ? 87   SER A CA    1 
ATOM   645   C  C     . SER A 1  87   ? -7.703  36.523  -24.369 1.00 66.13  ? 87   SER A C     1 
ATOM   646   O  O     . SER A 1  87   ? -7.467  35.418  -24.859 1.00 66.94  ? 87   SER A O     1 
ATOM   647   C  CB    . SER A 1  87   ? -7.560  36.559  -21.865 1.00 59.15  ? 87   SER A CB    1 
ATOM   648   O  OG    . SER A 1  87   ? -6.461  37.443  -22.000 1.00 60.32  ? 87   SER A OG    1 
ATOM   649   N  N     . GLU A 1  88   ? -7.302  37.666  -24.919 1.00 79.98  ? 88   GLU A N     1 
ATOM   650   C  CA    . GLU A 1  88   ? -6.528  37.722  -26.156 1.00 80.39  ? 88   GLU A CA    1 
ATOM   651   C  C     . GLU A 1  88   ? -5.047  37.882  -25.837 1.00 79.22  ? 88   GLU A C     1 
ATOM   652   O  O     . GLU A 1  88   ? -4.183  37.403  -26.574 1.00 76.14  ? 88   GLU A O     1 
ATOM   653   C  CB    . GLU A 1  88   ? -7.006  38.880  -27.042 1.00 85.01  ? 88   GLU A CB    1 
ATOM   654   C  CG    . GLU A 1  88   ? -8.490  38.827  -27.398 1.00 95.12  ? 88   GLU A CG    1 
ATOM   655   C  CD    . GLU A 1  88   ? -9.014  40.132  -27.983 1.00 93.52  ? 88   GLU A CD    1 
ATOM   656   O  OE1   . GLU A 1  88   ? -8.232  41.102  -28.091 1.00 90.71  ? 88   GLU A OE1   1 
ATOM   657   O  OE2   . GLU A 1  88   ? -10.214 40.189  -28.331 1.00 83.18  ? 88   GLU A OE2   1 
ATOM   658   N  N     . GLU A 1  89   ? -4.772  38.566  -24.730 1.00 78.92  ? 89   GLU A N     1 
ATOM   659   C  CA    . GLU A 1  89   ? -3.410  38.786  -24.264 1.00 83.53  ? 89   GLU A CA    1 
ATOM   660   C  C     . GLU A 1  89   ? -2.707  37.458  -24.022 1.00 83.12  ? 89   GLU A C     1 
ATOM   661   O  O     . GLU A 1  89   ? -3.079  36.706  -23.121 1.00 81.65  ? 89   GLU A O     1 
ATOM   662   C  CB    . GLU A 1  89   ? -3.413  39.624  -22.983 1.00 82.77  ? 89   GLU A CB    1 
ATOM   663   C  CG    . GLU A 1  89   ? -4.167  40.942  -23.090 1.00 82.56  ? 89   GLU A CG    1 
ATOM   664   C  CD    . GLU A 1  89   ? -3.316  42.062  -23.658 1.00 93.02  ? 89   GLU A CD    1 
ATOM   665   O  OE1   . GLU A 1  89   ? -2.111  41.833  -23.898 1.00 92.73  ? 89   GLU A OE1   1 
ATOM   666   O  OE2   . GLU A 1  89   ? -3.851  43.173  -23.859 1.00 96.56  ? 89   GLU A OE2   1 
ATOM   667   N  N     . ASP A 1  90   ? -1.696  37.172  -24.837 1.00 84.32  ? 90   ASP A N     1 
ATOM   668   C  CA    . ASP A 1  90   ? -0.945  35.929  -24.714 1.00 89.85  ? 90   ASP A CA    1 
ATOM   669   C  C     . ASP A 1  90   ? -0.180  35.915  -23.395 1.00 89.05  ? 90   ASP A C     1 
ATOM   670   O  O     . ASP A 1  90   ? 0.099   34.857  -22.834 1.00 99.89  ? 90   ASP A O     1 
ATOM   671   C  CB    . ASP A 1  90   ? 0.012   35.756  -25.897 1.00 108.58 ? 90   ASP A CB    1 
ATOM   672   C  CG    . ASP A 1  90   ? 0.247   34.298  -26.252 1.00 116.38 ? 90   ASP A CG    1 
ATOM   673   O  OD1   . ASP A 1  90   ? 0.256   33.454  -25.332 1.00 118.04 ? 90   ASP A OD1   1 
ATOM   674   O  OD2   . ASP A 1  90   ? 0.417   33.994  -27.452 1.00 114.79 ? 90   ASP A OD2   1 
ATOM   675   N  N     . GLU A 1  91   ? 0.147   37.106  -22.906 1.00 86.46  ? 91   GLU A N     1 
ATOM   676   C  CA    . GLU A 1  91   ? 0.806   37.268  -21.617 1.00 87.59  ? 91   GLU A CA    1 
ATOM   677   C  C     . GLU A 1  91   ? -0.231  37.466  -20.507 1.00 78.67  ? 91   GLU A C     1 
ATOM   678   O  O     . GLU A 1  91   ? -1.355  37.889  -20.779 1.00 82.38  ? 91   GLU A O     1 
ATOM   679   C  CB    . GLU A 1  91   ? 1.784   38.447  -21.672 1.00 94.07  ? 91   GLU A CB    1 
ATOM   680   C  CG    . GLU A 1  91   ? 1.200   39.701  -22.298 1.00 104.03 ? 91   GLU A CG    1 
ATOM   681   C  CD    . GLU A 1  91   ? 2.172   40.865  -22.292 1.00 108.93 ? 91   GLU A CD    1 
ATOM   682   O  OE1   . GLU A 1  91   ? 3.131   40.841  -21.491 1.00 107.82 ? 91   GLU A OE1   1 
ATOM   683   O  OE2   . GLU A 1  91   ? 1.978   41.805  -23.092 1.00 111.39 ? 91   GLU A OE2   1 
ATOM   684   N  N     . PRO A 1  92   ? 0.140   37.148  -19.254 1.00 64.46  ? 92   PRO A N     1 
ATOM   685   C  CA    . PRO A 1  92   ? -0.775  37.276  -18.111 1.00 65.75  ? 92   PRO A CA    1 
ATOM   686   C  C     . PRO A 1  92   ? -1.342  38.684  -17.921 1.00 67.53  ? 92   PRO A C     1 
ATOM   687   O  O     . PRO A 1  92   ? -0.641  39.671  -18.141 1.00 70.58  ? 92   PRO A O     1 
ATOM   688   C  CB    . PRO A 1  92   ? 0.107   36.896  -16.918 1.00 73.43  ? 92   PRO A CB    1 
ATOM   689   C  CG    . PRO A 1  92   ? 1.157   36.021  -17.492 1.00 69.05  ? 92   PRO A CG    1 
ATOM   690   C  CD    . PRO A 1  92   ? 1.433   36.563  -18.856 1.00 61.76  ? 92   PRO A CD    1 
ATOM   691   N  N     . VAL A 1  93   ? -2.605  38.762  -17.508 1.00 67.98  ? 93   VAL A N     1 
ATOM   692   C  CA    . VAL A 1  93   ? -3.257  40.038  -17.223 1.00 63.56  ? 93   VAL A CA    1 
ATOM   693   C  C     . VAL A 1  93   ? -3.955  40.001  -15.864 1.00 58.23  ? 93   VAL A C     1 
ATOM   694   O  O     . VAL A 1  93   ? -4.074  38.943  -15.250 1.00 60.81  ? 93   VAL A O     1 
ATOM   695   C  CB    . VAL A 1  93   ? -4.277  40.404  -18.312 1.00 69.41  ? 93   VAL A CB    1 
ATOM   696   C  CG1   . VAL A 1  93   ? -3.563  40.916  -19.553 1.00 75.59  ? 93   VAL A CG1   1 
ATOM   697   C  CG2   . VAL A 1  93   ? -5.159  39.207  -18.640 1.00 64.08  ? 93   VAL A CG2   1 
ATOM   698   N  N     . THR A 1  94   ? -4.421  41.156  -15.399 1.00 54.24  ? 94   THR A N     1 
ATOM   699   C  CA    . THR A 1  94   ? -4.981  41.263  -14.056 1.00 50.82  ? 94   THR A CA    1 
ATOM   700   C  C     . THR A 1  94   ? -6.351  41.940  -14.037 1.00 47.65  ? 94   THR A C     1 
ATOM   701   O  O     . THR A 1  94   ? -6.491  43.079  -14.476 1.00 51.79  ? 94   THR A O     1 
ATOM   702   C  CB    . THR A 1  94   ? -4.022  42.038  -13.126 1.00 54.75  ? 94   THR A CB    1 
ATOM   703   O  OG1   . THR A 1  94   ? -2.795  41.309  -12.987 1.00 48.24  ? 94   THR A OG1   1 
ATOM   704   C  CG2   . THR A 1  94   ? -4.644  42.241  -11.753 1.00 58.69  ? 94   THR A CG2   1 
ATOM   705   N  N     . MET A 1  95   ? -7.357  41.233  -13.527 1.00 50.49  ? 95   MET A N     1 
ATOM   706   C  CA    . MET A 1  95   ? -8.694  41.802  -13.350 1.00 54.31  ? 95   MET A CA    1 
ATOM   707   C  C     . MET A 1  95   ? -8.857  42.362  -11.936 1.00 50.29  ? 95   MET A C     1 
ATOM   708   O  O     . MET A 1  95   ? -7.932  42.292  -11.128 1.00 55.27  ? 95   MET A O     1 
ATOM   709   C  CB    . MET A 1  95   ? -9.775  40.751  -13.633 1.00 51.66  ? 95   MET A CB    1 
ATOM   710   C  CG    . MET A 1  95   ? -9.646  40.068  -14.990 1.00 52.63  ? 95   MET A CG    1 
ATOM   711   S  SD    . MET A 1  95   ? -11.003 38.933  -15.359 1.00 59.36  ? 95   MET A SD    1 
ATOM   712   C  CE    . MET A 1  95   ? -11.031 37.925  -13.882 1.00 49.68  ? 95   MET A CE    1 
ATOM   713   N  N     . TYR A 1  96   ? -10.029 42.917  -11.639 1.00 50.49  ? 96   TYR A N     1 
ATOM   714   C  CA    . TYR A 1  96   ? -10.281 43.510  -10.329 1.00 49.40  ? 96   TYR A CA    1 
ATOM   715   C  C     . TYR A 1  96   ? -11.741 43.389  -9.905  1.00 54.29  ? 96   TYR A C     1 
ATOM   716   O  O     . TYR A 1  96   ? -12.640 43.357  -10.743 1.00 60.92  ? 96   TYR A O     1 
ATOM   717   C  CB    . TYR A 1  96   ? -9.859  44.981  -10.322 1.00 53.46  ? 96   TYR A CB    1 
ATOM   718   C  CG    . TYR A 1  96   ? -8.370  45.170  -10.161 1.00 59.89  ? 96   TYR A CG    1 
ATOM   719   C  CD1   . TYR A 1  96   ? -7.791  45.194  -8.900  1.00 69.41  ? 96   TYR A CD1   1 
ATOM   720   C  CD2   . TYR A 1  96   ? -7.540  45.312  -11.268 1.00 63.12  ? 96   TYR A CD2   1 
ATOM   721   C  CE1   . TYR A 1  96   ? -6.428  45.357  -8.742  1.00 71.70  ? 96   TYR A CE1   1 
ATOM   722   C  CE2   . TYR A 1  96   ? -6.174  45.473  -11.121 1.00 62.98  ? 96   TYR A CE2   1 
ATOM   723   C  CZ    . TYR A 1  96   ? -5.625  45.496  -9.855  1.00 69.38  ? 96   TYR A CZ    1 
ATOM   724   O  OH    . TYR A 1  96   ? -4.268  45.658  -9.694  1.00 74.61  ? 96   TYR A OH    1 
ATOM   725   N  N     . LEU A 1  97   ? -11.967 43.320  -8.596  1.00 54.48  ? 97   LEU A N     1 
ATOM   726   C  CA    . LEU A 1  97   ? -13.316 43.239  -8.040  1.00 53.74  ? 97   LEU A CA    1 
ATOM   727   C  C     . LEU A 1  97   ? -13.356 43.834  -6.635  1.00 54.36  ? 97   LEU A C     1 
ATOM   728   O  O     . LEU A 1  97   ? -12.729 43.317  -5.711  1.00 51.21  ? 97   LEU A O     1 
ATOM   729   C  CB    . LEU A 1  97   ? -13.810 41.789  -8.020  1.00 49.94  ? 97   LEU A CB    1 
ATOM   730   C  CG    . LEU A 1  97   ? -15.194 41.507  -7.422  1.00 49.07  ? 97   LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1  97   ? -15.894 40.405  -8.194  1.00 57.61  ? 97   LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1  97   ? -15.105 41.125  -5.951  1.00 45.01  ? 97   LEU A CD2   1 
ATOM   733   N  N     . ARG A 1  98   ? -14.098 44.924  -6.484  1.00 64.64  ? 98   ARG A N     1 
ATOM   734   C  CA    . ARG A 1  98   ? -14.211 45.612  -5.203  1.00 58.12  ? 98   ARG A CA    1 
ATOM   735   C  C     . ARG A 1  98   ? -15.655 46.039  -4.959  1.00 53.98  ? 98   ARG A C     1 
ATOM   736   O  O     . ARG A 1  98   ? -16.235 46.780  -5.750  1.00 64.47  ? 98   ARG A O     1 
ATOM   737   C  CB    . ARG A 1  98   ? -13.280 46.830  -5.159  1.00 62.12  ? 98   ARG A CB    1 
ATOM   738   C  CG    . ARG A 1  98   ? -11.797 46.502  -5.319  1.00 67.16  ? 98   ARG A CG    1 
ATOM   739   C  CD    . ARG A 1  98   ? -10.927 47.754  -5.249  1.00 74.28  ? 98   ARG A CD    1 
ATOM   740   N  NE    . ARG A 1  98   ? -9.527  47.457  -5.545  1.00 83.94  ? 98   ARG A NE    1 
ATOM   741   C  CZ    . ARG A 1  98   ? -8.539  48.345  -5.478  1.00 87.68  ? 98   ARG A CZ    1 
ATOM   742   N  NH1   . ARG A 1  98   ? -8.787  49.598  -5.117  1.00 82.03  ? 98   ARG A NH1   1 
ATOM   743   N  NH2   . ARG A 1  98   ? -7.297  47.978  -5.769  1.00 93.95  ? 98   ARG A NH2   1 
ATOM   744   N  N     . LYS A 1  99   ? -16.235 45.565  -3.863  1.00 46.17  ? 99   LYS A N     1 
ATOM   745   C  CA    . LYS A 1  99   ? -17.610 45.906  -3.526  1.00 48.79  ? 99   LYS A CA    1 
ATOM   746   C  C     . LYS A 1  99   ? -17.805 45.848  -2.016  1.00 52.16  ? 99   LYS A C     1 
ATOM   747   O  O     . LYS A 1  99   ? -17.269 44.966  -1.349  1.00 59.90  ? 99   LYS A O     1 
ATOM   748   C  CB    . LYS A 1  99   ? -18.584 44.966  -4.238  1.00 43.47  ? 99   LYS A CB    1 
ATOM   749   C  CG    . LYS A 1  99   ? -19.988 45.524  -4.391  1.00 54.97  ? 99   LYS A CG    1 
ATOM   750   C  CD    . LYS A 1  99   ? -20.828 44.648  -5.305  1.00 61.64  ? 99   LYS A CD    1 
ATOM   751   C  CE    . LYS A 1  99   ? -22.169 45.294  -5.622  1.00 58.28  ? 99   LYS A CE    1 
ATOM   752   N  NZ    . LYS A 1  99   ? -23.015 45.455  -4.407  1.00 44.32  ? 99   LYS A NZ    1 
ATOM   753   N  N     . GLN A 1  100  ? -18.564 46.794  -1.475  1.00 43.20  ? 100  GLN A N     1 
ATOM   754   C  CA    . GLN A 1  100  ? -18.730 46.889  -0.031  1.00 43.19  ? 100  GLN A CA    1 
ATOM   755   C  C     . GLN A 1  100  ? -20.205 46.889  0.355   1.00 47.44  ? 100  GLN A C     1 
ATOM   756   O  O     . GLN A 1  100  ? -21.079 46.716  -0.496  1.00 44.65  ? 100  GLN A O     1 
ATOM   757   C  CB    . GLN A 1  100  ? -18.048 48.152  0.501   1.00 51.46  ? 100  GLN A CB    1 
ATOM   758   C  CG    . GLN A 1  100  ? -17.442 48.013  1.891   1.00 57.84  ? 100  GLN A CG    1 
ATOM   759   C  CD    . GLN A 1  100  ? -17.145 49.354  2.536   1.00 60.88  ? 100  GLN A CD    1 
ATOM   760   O  OE1   . GLN A 1  100  ? -17.854 50.335  2.312   1.00 69.75  ? 100  GLN A OE1   1 
ATOM   761   N  NE2   . GLN A 1  100  ? -16.089 49.403  3.339   1.00 58.15  ? 100  GLN A NE2   1 
ATOM   762   N  N     . GLY A 1  101  ? -20.468 47.077  1.645   1.00 50.07  ? 101  GLY A N     1 
ATOM   763   C  CA    . GLY A 1  101  ? -21.819 47.207  2.157   1.00 44.28  ? 101  GLY A CA    1 
ATOM   764   C  C     . GLY A 1  101  ? -22.698 46.006  1.884   1.00 42.05  ? 101  GLY A C     1 
ATOM   765   O  O     . GLY A 1  101  ? -22.216 44.959  1.455   1.00 47.28  ? 101  GLY A O     1 
ATOM   766   N  N     . PRO A 1  102  ? -24.004 46.150  2.139   1.00 40.94  ? 102  PRO A N     1 
ATOM   767   C  CA    . PRO A 1  102  ? -24.969 45.081  1.875   1.00 43.91  ? 102  PRO A CA    1 
ATOM   768   C  C     . PRO A 1  102  ? -25.049 44.757  0.391   1.00 49.94  ? 102  PRO A C     1 
ATOM   769   O  O     . PRO A 1  102  ? -24.661 45.582  -0.437  1.00 44.42  ? 102  PRO A O     1 
ATOM   770   C  CB    . PRO A 1  102  ? -26.294 45.666  2.378   1.00 44.03  ? 102  PRO A CB    1 
ATOM   771   C  CG    . PRO A 1  102  ? -25.906 46.750  3.317   1.00 50.16  ? 102  PRO A CG    1 
ATOM   772   C  CD    . PRO A 1  102  ? -24.634 47.317  2.775   1.00 48.59  ? 102  PRO A CD    1 
ATOM   773   N  N     . GLY A 1  103  ? -25.539 43.566  0.065   1.00 58.88  ? 103  GLY A N     1 
ATOM   774   C  CA    . GLY A 1  103  ? -25.752 43.186  -1.318  1.00 58.95  ? 103  GLY A CA    1 
ATOM   775   C  C     . GLY A 1  103  ? -25.028 41.922  -1.730  1.00 56.86  ? 103  GLY A C     1 
ATOM   776   O  O     . GLY A 1  103  ? -24.365 41.273  -0.923  1.00 54.01  ? 103  GLY A O     1 
ATOM   777   N  N     . GLU A 1  104  ? -25.157 41.578  -3.006  1.00 59.45  ? 104  GLU A N     1 
ATOM   778   C  CA    . GLU A 1  104  ? -24.539 40.379  -3.552  1.00 59.31  ? 104  GLU A CA    1 
ATOM   779   C  C     . GLU A 1  104  ? -23.525 40.739  -4.634  1.00 53.80  ? 104  GLU A C     1 
ATOM   780   O  O     . GLU A 1  104  ? -23.833 41.500  -5.551  1.00 56.78  ? 104  GLU A O     1 
ATOM   781   C  CB    . GLU A 1  104  ? -25.613 39.446  -4.115  1.00 59.92  ? 104  GLU A CB    1 
ATOM   782   C  CG    . GLU A 1  104  ? -25.121 38.068  -4.521  1.00 63.83  ? 104  GLU A CG    1 
ATOM   783   C  CD    . GLU A 1  104  ? -26.181 37.286  -5.278  1.00 82.72  ? 104  GLU A CD    1 
ATOM   784   O  OE1   . GLU A 1  104  ? -26.901 37.904  -6.091  1.00 89.71  ? 104  GLU A OE1   1 
ATOM   785   O  OE2   . GLU A 1  104  ? -26.305 36.061  -5.055  1.00 88.59  ? 104  GLU A OE2   1 
ATOM   786   N  N     . VAL A 1  105  ? -22.314 40.203  -4.518  1.00 50.51  ? 105  VAL A N     1 
ATOM   787   C  CA    . VAL A 1  105  ? -21.299 40.405  -5.544  1.00 52.55  ? 105  VAL A CA    1 
ATOM   788   C  C     . VAL A 1  105  ? -21.422 39.306  -6.598  1.00 60.75  ? 105  VAL A C     1 
ATOM   789   O  O     . VAL A 1  105  ? -21.725 38.156  -6.279  1.00 62.50  ? 105  VAL A O     1 
ATOM   790   C  CB    . VAL A 1  105  ? -19.865 40.429  -4.948  1.00 44.72  ? 105  VAL A CB    1 
ATOM   791   C  CG1   . VAL A 1  105  ? -19.424 39.043  -4.507  1.00 50.41  ? 105  VAL A CG1   1 
ATOM   792   C  CG2   . VAL A 1  105  ? -18.879 40.995  -5.954  1.00 48.53  ? 105  VAL A CG2   1 
ATOM   793   N  N     . THR A 1  106  ? -21.217 39.672  -7.860  1.00 62.42  ? 106  THR A N     1 
ATOM   794   C  CA    . THR A 1  106  ? -21.340 38.728  -8.968  1.00 59.78  ? 106  THR A CA    1 
ATOM   795   C  C     . THR A 1  106  ? -20.154 38.842  -9.917  1.00 58.27  ? 106  THR A C     1 
ATOM   796   O  O     . THR A 1  106  ? -19.251 39.649  -9.699  1.00 60.58  ? 106  THR A O     1 
ATOM   797   C  CB    . THR A 1  106  ? -22.635 38.956  -9.769  1.00 60.79  ? 106  THR A CB    1 
ATOM   798   O  OG1   . THR A 1  106  ? -22.689 40.320  -10.203 1.00 64.15  ? 106  THR A OG1   1 
ATOM   799   C  CG2   . THR A 1  106  ? -23.861 38.647  -8.919  1.00 61.65  ? 106  THR A CG2   1 
ATOM   800   N  N     . ALA A 1  107  ? -20.164 38.039  -10.977 1.00 59.94  ? 107  ALA A N     1 
ATOM   801   C  CA    . ALA A 1  107  ? -19.101 38.084  -11.974 1.00 58.99  ? 107  ALA A CA    1 
ATOM   802   C  C     . ALA A 1  107  ? -19.147 39.392  -12.754 1.00 64.94  ? 107  ALA A C     1 
ATOM   803   O  O     . ALA A 1  107  ? -18.189 39.756  -13.437 1.00 66.78  ? 107  ALA A O     1 
ATOM   804   C  CB    . ALA A 1  107  ? -19.205 36.901  -12.918 1.00 63.44  ? 107  ALA A CB    1 
ATOM   805   N  N     . GLY A 1  108  ? -20.272 40.093  -12.648 1.00 65.72  ? 108  GLY A N     1 
ATOM   806   C  CA    . GLY A 1  108  ? -20.434 41.381  -13.290 1.00 67.51  ? 108  GLY A CA    1 
ATOM   807   C  C     . GLY A 1  108  ? -19.582 42.462  -12.654 1.00 66.87  ? 108  GLY A C     1 
ATOM   808   O  O     . GLY A 1  108  ? -19.074 43.342  -13.345 1.00 80.42  ? 108  GLY A O     1 
ATOM   809   N  N     . ASP A 1  109  ? -19.408 42.395  -11.338 1.00 60.08  ? 109  ASP A N     1 
ATOM   810   C  CA    . ASP A 1  109  ? -18.648 43.420  -10.628 1.00 63.41  ? 109  ASP A CA    1 
ATOM   811   C  C     . ASP A 1  109  ? -17.148 43.317  -10.903 1.00 57.79  ? 109  ASP A C     1 
ATOM   812   O  O     . ASP A 1  109  ? -16.367 44.154  -10.451 1.00 54.65  ? 109  ASP A O     1 
ATOM   813   C  CB    . ASP A 1  109  ? -18.921 43.338  -9.124  1.00 67.64  ? 109  ASP A CB    1 
ATOM   814   C  CG    . ASP A 1  109  ? -20.367 43.651  -8.778  1.00 70.34  ? 109  ASP A CG    1 
ATOM   815   O  OD1   . ASP A 1  109  ? -20.677 44.838  -8.538  1.00 78.76  ? 109  ASP A OD1   1 
ATOM   816   O  OD2   . ASP A 1  109  ? -21.192 42.713  -8.754  1.00 67.78  ? 109  ASP A OD2   1 
ATOM   817   N  N     . ILE A 1  110  ? -16.752 42.288  -11.647 1.00 53.07  ? 110  ILE A N     1 
ATOM   818   C  CA    . ILE A 1  110  ? -15.364 42.131  -12.059 1.00 55.66  ? 110  ILE A CA    1 
ATOM   819   C  C     . ILE A 1  110  ? -15.020 43.209  -13.078 1.00 57.54  ? 110  ILE A C     1 
ATOM   820   O  O     . ILE A 1  110  ? -15.870 43.614  -13.865 1.00 61.07  ? 110  ILE A O     1 
ATOM   821   C  CB    . ILE A 1  110  ? -15.103 40.734  -12.659 1.00 57.15  ? 110  ILE A CB    1 
ATOM   822   C  CG1   . ILE A 1  110  ? -15.621 39.648  -11.720 1.00 52.45  ? 110  ILE A CG1   1 
ATOM   823   C  CG2   . ILE A 1  110  ? -13.618 40.516  -12.916 1.00 61.48  ? 110  ILE A CG2   1 
ATOM   824   C  CD1   . ILE A 1  110  ? -15.446 38.257  -12.264 1.00 52.22  ? 110  ILE A CD1   1 
ATOM   825   N  N     . VAL A 1  111  ? -13.780 43.683  -13.053 1.00 58.88  ? 111  VAL A N     1 
ATOM   826   C  CA    . VAL A 1  111  ? -13.345 44.712  -13.988 1.00 62.05  ? 111  VAL A CA    1 
ATOM   827   C  C     . VAL A 1  111  ? -12.256 44.204  -14.924 1.00 61.31  ? 111  VAL A C     1 
ATOM   828   O  O     . VAL A 1  111  ? -11.069 44.348  -14.634 1.00 59.77  ? 111  VAL A O     1 
ATOM   829   C  CB    . VAL A 1  111  ? -12.832 45.945  -13.243 1.00 65.64  ? 111  VAL A CB    1 
ATOM   830   C  CG1   . VAL A 1  111  ? -12.553 47.072  -14.219 1.00 73.92  ? 111  VAL A CG1   1 
ATOM   831   C  CG2   . VAL A 1  111  ? -13.853 46.371  -12.204 1.00 80.59  ? 111  VAL A CG2   1 
ATOM   832   N  N     . PRO A 1  112  ? -12.661 43.607  -16.057 1.00 63.03  ? 112  PRO A N     1 
ATOM   833   C  CA    . PRO A 1  112  ? -11.713 43.072  -17.037 1.00 59.36  ? 112  PRO A CA    1 
ATOM   834   C  C     . PRO A 1  112  ? -11.024 44.173  -17.831 1.00 63.36  ? 112  PRO A C     1 
ATOM   835   O  O     . PRO A 1  112  ? -11.689 45.073  -18.342 1.00 69.61  ? 112  PRO A O     1 
ATOM   836   C  CB    . PRO A 1  112  ? -12.597 42.217  -17.946 1.00 65.34  ? 112  PRO A CB    1 
ATOM   837   C  CG    . PRO A 1  112  ? -13.920 42.876  -17.889 1.00 66.36  ? 112  PRO A CG    1 
ATOM   838   C  CD    . PRO A 1  112  ? -14.057 43.427  -16.494 1.00 70.19  ? 112  PRO A CD    1 
ATOM   839   N  N     . PRO A 1  113  ? -9.691  44.104  -17.928 1.00 63.75  ? 113  PRO A N     1 
ATOM   840   C  CA    . PRO A 1  113  ? -8.891  45.068  -18.688 1.00 72.14  ? 113  PRO A CA    1 
ATOM   841   C  C     . PRO A 1  113  ? -9.082  44.901  -20.193 1.00 78.02  ? 113  PRO A C     1 
ATOM   842   O  O     . PRO A 1  113  ? -9.963  44.155  -20.622 1.00 77.48  ? 113  PRO A O     1 
ATOM   843   C  CB    . PRO A 1  113  ? -7.456  44.733  -18.274 1.00 69.32  ? 113  PRO A CB    1 
ATOM   844   C  CG    . PRO A 1  113  ? -7.510  43.292  -17.905 1.00 71.21  ? 113  PRO A CG    1 
ATOM   845   C  CD    . PRO A 1  113  ? -8.852  43.087  -17.272 1.00 67.71  ? 113  PRO A CD    1 
ATOM   846   N  N     . ALA A 1  114  ? -8.262  45.588  -20.980 1.00 77.07  ? 114  ALA A N     1 
ATOM   847   C  CA    . ALA A 1  114  ? -8.362  45.524  -22.433 1.00 72.80  ? 114  ALA A CA    1 
ATOM   848   C  C     . ALA A 1  114  ? -8.062  44.122  -22.959 1.00 76.72  ? 114  ALA A C     1 
ATOM   849   O  O     . ALA A 1  114  ? -7.014  43.547  -22.665 1.00 80.68  ? 114  ALA A O     1 
ATOM   850   C  CB    . ALA A 1  114  ? -7.426  46.539  -23.066 1.00 72.60  ? 114  ALA A CB    1 
ATOM   851   N  N     . GLY A 1  115  ? -8.992  43.575  -23.735 1.00 74.14  ? 115  GLY A N     1 
ATOM   852   C  CA    . GLY A 1  115  ? -8.806  42.268  -24.336 1.00 77.64  ? 115  GLY A CA    1 
ATOM   853   C  C     . GLY A 1  115  ? -9.202  41.126  -23.422 1.00 77.85  ? 115  GLY A C     1 
ATOM   854   O  O     . GLY A 1  115  ? -8.709  40.008  -23.565 1.00 87.17  ? 115  GLY A O     1 
ATOM   855   N  N     . VAL A 1  116  ? -10.084 41.411  -22.469 1.00 74.52  ? 116  VAL A N     1 
ATOM   856   C  CA    . VAL A 1  116  ? -10.618 40.384  -21.579 1.00 70.53  ? 116  VAL A CA    1 
ATOM   857   C  C     . VAL A 1  116  ? -12.117 40.577  -21.387 1.00 68.54  ? 116  VAL A C     1 
ATOM   858   O  O     . VAL A 1  116  ? -12.571 41.672  -21.056 1.00 71.51  ? 116  VAL A O     1 
ATOM   859   C  CB    . VAL A 1  116  ? -9.934  40.399  -20.202 1.00 72.65  ? 116  VAL A CB    1 
ATOM   860   C  CG1   . VAL A 1  116  ? -10.590 39.382  -19.283 1.00 79.79  ? 116  VAL A CG1   1 
ATOM   861   C  CG2   . VAL A 1  116  ? -8.447  40.115  -20.336 1.00 73.33  ? 116  VAL A CG2   1 
ATOM   862   N  N     . THR A 1  117  ? -12.886 39.514  -21.598 1.00 64.89  ? 117  THR A N     1 
ATOM   863   C  CA    . THR A 1  117  ? -14.338 39.612  -21.531 1.00 67.93  ? 117  THR A CA    1 
ATOM   864   C  C     . THR A 1  117  ? -14.955 38.498  -20.685 1.00 67.64  ? 117  THR A C     1 
ATOM   865   O  O     . THR A 1  117  ? -14.632 37.323  -20.854 1.00 70.61  ? 117  THR A O     1 
ATOM   866   C  CB    . THR A 1  117  ? -14.960 39.580  -22.943 1.00 75.80  ? 117  THR A CB    1 
ATOM   867   O  OG1   . THR A 1  117  ? -14.543 38.391  -23.626 1.00 79.61  ? 117  THR A OG1   1 
ATOM   868   C  CG2   . THR A 1  117  ? -14.528 40.799  -23.753 1.00 80.67  ? 117  THR A CG2   1 
ATOM   869   N  N     . VAL A 1  118  ? -15.844 38.878  -19.772 1.00 65.05  ? 118  VAL A N     1 
ATOM   870   C  CA    . VAL A 1  118  ? -16.553 37.918  -18.932 1.00 59.57  ? 118  VAL A CA    1 
ATOM   871   C  C     . VAL A 1  118  ? -17.887 37.546  -19.575 1.00 56.49  ? 118  VAL A C     1 
ATOM   872   O  O     . VAL A 1  118  ? -18.694 38.417  -19.892 1.00 57.08  ? 118  VAL A O     1 
ATOM   873   C  CB    . VAL A 1  118  ? -16.798 38.477  -17.514 1.00 63.95  ? 118  VAL A CB    1 
ATOM   874   C  CG1   . VAL A 1  118  ? -17.481 37.435  -16.642 1.00 69.76  ? 118  VAL A CG1   1 
ATOM   875   C  CG2   . VAL A 1  118  ? -15.488 38.937  -16.882 1.00 55.79  ? 118  VAL A CG2   1 
ATOM   876   N  N     . HIS A 1  119  ? -18.119 36.252  -19.762 1.00 56.44  ? 119  HIS A N     1 
ATOM   877   C  CA    . HIS A 1  119  ? -19.279 35.789  -20.521 1.00 63.01  ? 119  HIS A CA    1 
ATOM   878   C  C     . HIS A 1  119  ? -20.444 35.317  -19.653 1.00 70.92  ? 119  HIS A C     1 
ATOM   879   O  O     . HIS A 1  119  ? -21.413 34.759  -20.166 1.00 76.60  ? 119  HIS A O     1 
ATOM   880   C  CB    . HIS A 1  119  ? -18.871 34.653  -21.462 1.00 69.05  ? 119  HIS A CB    1 
ATOM   881   C  CG    . HIS A 1  119  ? -17.825 35.039  -22.462 1.00 68.52  ? 119  HIS A CG    1 
ATOM   882   N  ND1   . HIS A 1  119  ? -18.098 35.827  -23.559 1.00 68.73  ? 119  HIS A ND1   1 
ATOM   883   C  CD2   . HIS A 1  119  ? -16.507 34.734  -22.536 1.00 70.45  ? 119  HIS A CD2   1 
ATOM   884   C  CE1   . HIS A 1  119  ? -16.993 35.996  -24.263 1.00 72.88  ? 119  HIS A CE1   1 
ATOM   885   N  NE2   . HIS A 1  119  ? -16.013 35.343  -23.664 1.00 69.94  ? 119  HIS A NE2   1 
ATOM   886   N  N     . ASN A 1  120  ? -20.352 35.534  -18.346 1.00 72.60  ? 120  ASN A N     1 
ATOM   887   C  CA    . ASN A 1  120  ? -21.413 35.112  -17.432 1.00 74.30  ? 120  ASN A CA    1 
ATOM   888   C  C     . ASN A 1  120  ? -21.465 35.967  -16.172 1.00 68.00  ? 120  ASN A C     1 
ATOM   889   O  O     . ASN A 1  120  ? -21.087 35.518  -15.093 1.00 70.34  ? 120  ASN A O     1 
ATOM   890   C  CB    . ASN A 1  120  ? -21.238 33.636  -17.060 1.00 77.66  ? 120  ASN A CB    1 
ATOM   891   C  CG    . ASN A 1  120  ? -19.808 33.296  -16.678 1.00 76.23  ? 120  ASN A CG    1 
ATOM   892   O  OD1   . ASN A 1  120  ? -18.868 33.993  -17.062 1.00 79.56  ? 120  ASN A OD1   1 
ATOM   893   N  ND2   . ASN A 1  120  ? -19.636 32.216  -15.924 1.00 72.98  ? 120  ASN A ND2   1 
ATOM   894   N  N     . PRO A 1  121  ? -21.952 37.208  -16.310 1.00 69.47  ? 121  PRO A N     1 
ATOM   895   C  CA    . PRO A 1  121  ? -21.986 38.188  -15.219 1.00 72.56  ? 121  PRO A CA    1 
ATOM   896   C  C     . PRO A 1  121  ? -22.932 37.794  -14.091 1.00 79.19  ? 121  PRO A C     1 
ATOM   897   O  O     . PRO A 1  121  ? -22.745 38.236  -12.958 1.00 81.77  ? 121  PRO A O     1 
ATOM   898   C  CB    . PRO A 1  121  ? -22.482 39.468  -15.905 1.00 75.91  ? 121  PRO A CB    1 
ATOM   899   C  CG    . PRO A 1  121  ? -22.318 39.223  -17.373 1.00 87.15  ? 121  PRO A CG    1 
ATOM   900   C  CD    . PRO A 1  121  ? -22.510 37.760  -17.554 1.00 77.73  ? 121  PRO A CD    1 
ATOM   901   N  N     . GLY A 1  122  ? -23.933 36.976  -14.397 1.00 78.44  ? 122  GLY A N     1 
ATOM   902   C  CA    . GLY A 1  122  ? -24.932 36.608  -13.411 1.00 79.96  ? 122  GLY A CA    1 
ATOM   903   C  C     . GLY A 1  122  ? -24.445 35.569  -12.420 1.00 77.81  ? 122  GLY A C     1 
ATOM   904   O  O     . GLY A 1  122  ? -25.198 35.131  -11.550 1.00 74.65  ? 122  GLY A O     1 
ATOM   905   N  N     . MET A 1  123  ? -23.182 35.178  -12.548 1.00 80.84  ? 123  MET A N     1 
ATOM   906   C  CA    . MET A 1  123  ? -22.622 34.124  -11.712 1.00 70.29  ? 123  MET A CA    1 
ATOM   907   C  C     . MET A 1  123  ? -22.404 34.591  -10.281 1.00 60.79  ? 123  MET A C     1 
ATOM   908   O  O     . MET A 1  123  ? -21.676 35.551  -10.030 1.00 58.01  ? 123  MET A O     1 
ATOM   909   C  CB    . MET A 1  123  ? -21.307 33.623  -12.294 1.00 70.31  ? 123  MET A CB    1 
ATOM   910   C  CG    . MET A 1  123  ? -20.689 32.490  -11.506 1.00 63.09  ? 123  MET A CG    1 
ATOM   911   S  SD    . MET A 1  123  ? -18.989 32.193  -12.011 1.00 73.52  ? 123  MET A SD    1 
ATOM   912   C  CE    . MET A 1  123  ? -18.212 33.697  -11.430 1.00 59.39  ? 123  MET A CE    1 
ATOM   913   N  N     . HIS A 1  124  ? -23.037 33.892  -9.347  1.00 58.60  ? 124  HIS A N     1 
ATOM   914   C  CA    . HIS A 1  124  ? -22.961 34.252  -7.941  1.00 54.93  ? 124  HIS A CA    1 
ATOM   915   C  C     . HIS A 1  124  ? -21.585 33.939  -7.377  1.00 46.64  ? 124  HIS A C     1 
ATOM   916   O  O     . HIS A 1  124  ? -21.094 32.825  -7.520  1.00 51.51  ? 124  HIS A O     1 
ATOM   917   C  CB    . HIS A 1  124  ? -24.039 33.516  -7.141  1.00 55.23  ? 124  HIS A CB    1 
ATOM   918   C  CG    . HIS A 1  124  ? -23.906 33.687  -5.662  1.00 52.87  ? 124  HIS A CG    1 
ATOM   919   N  ND1   . HIS A 1  124  ? -23.263 34.763  -5.094  1.00 56.96  ? 124  HIS A ND1   1 
ATOM   920   C  CD2   . HIS A 1  124  ? -24.325 32.912  -4.633  1.00 62.02  ? 124  HIS A CD2   1 
ATOM   921   C  CE1   . HIS A 1  124  ? -23.295 34.650  -3.779  1.00 56.02  ? 124  HIS A CE1   1 
ATOM   922   N  NE2   . HIS A 1  124  ? -23.934 33.535  -3.474  1.00 61.22  ? 124  HIS A NE2   1 
ATOM   923   N  N     . ILE A 1  125  ? -20.961 34.918  -6.733  1.00 43.02  ? 125  ILE A N     1 
ATOM   924   C  CA    . ILE A 1  125  ? -19.692 34.657  -6.073  1.00 41.57  ? 125  ILE A CA    1 
ATOM   925   C  C     . ILE A 1  125  ? -19.851 34.613  -4.563  1.00 43.16  ? 125  ILE A C     1 
ATOM   926   O  O     . ILE A 1  125  ? -19.728 33.554  -3.956  1.00 55.67  ? 125  ILE A O     1 
ATOM   927   C  CB    . ILE A 1  125  ? -18.633 35.696  -6.435  1.00 38.73  ? 125  ILE A CB    1 
ATOM   928   C  CG1   . ILE A 1  125  ? -18.332 35.621  -7.929  1.00 42.56  ? 125  ILE A CG1   1 
ATOM   929   C  CG2   . ILE A 1  125  ? -17.364 35.444  -5.640  1.00 36.71  ? 125  ILE A CG2   1 
ATOM   930   C  CD1   . ILE A 1  125  ? -17.231 36.543  -8.374  1.00 50.52  ? 125  ILE A CD1   1 
ATOM   931   N  N     . ALA A 1  126  ? -20.130 35.757  -3.955  1.00 42.41  ? 126  ALA A N     1 
ATOM   932   C  CA    . ALA A 1  126  ? -20.194 35.824  -2.504  1.00 41.84  ? 126  ALA A CA    1 
ATOM   933   C  C     . ALA A 1  126  ? -21.365 36.675  -2.040  1.00 50.82  ? 126  ALA A C     1 
ATOM   934   O  O     . ALA A 1  126  ? -21.669 37.705  -2.637  1.00 66.91  ? 126  ALA A O     1 
ATOM   935   C  CB    . ALA A 1  126  ? -18.887 36.367  -1.944  1.00 37.14  ? 126  ALA A CB    1 
ATOM   936   N  N     . THR A 1  127  ? -22.022 36.241  -0.972  1.00 43.82  ? 127  THR A N     1 
ATOM   937   C  CA    . THR A 1  127  ? -23.138 36.993  -0.417  1.00 44.44  ? 127  THR A CA    1 
ATOM   938   C  C     . THR A 1  127  ? -22.652 37.918  0.698   1.00 44.38  ? 127  THR A C     1 
ATOM   939   O  O     . THR A 1  127  ? -22.569 37.513  1.856   1.00 48.77  ? 127  THR A O     1 
ATOM   940   C  CB    . THR A 1  127  ? -24.234 36.054  0.125   1.00 42.72  ? 127  THR A CB    1 
ATOM   941   O  OG1   . THR A 1  127  ? -24.572 35.085  -0.873  1.00 46.95  ? 127  THR A OG1   1 
ATOM   942   C  CG2   . THR A 1  127  ? -25.480 36.839  0.489   1.00 48.74  ? 127  THR A CG2   1 
ATOM   943   N  N     . LEU A 1  128  ? -22.329 39.160  0.351   1.00 41.95  ? 128  LEU A N     1 
ATOM   944   C  CA    . LEU A 1  128  ? -21.765 40.087  1.329   1.00 41.71  ? 128  LEU A CA    1 
ATOM   945   C  C     . LEU A 1  128  ? -22.824 40.729  2.219   1.00 46.23  ? 128  LEU A C     1 
ATOM   946   O  O     . LEU A 1  128  ? -23.615 41.547  1.760   1.00 47.58  ? 128  LEU A O     1 
ATOM   947   C  CB    . LEU A 1  128  ? -20.956 41.179  0.631   1.00 40.80  ? 128  LEU A CB    1 
ATOM   948   C  CG    . LEU A 1  128  ? -19.500 40.819  0.334   1.00 43.42  ? 128  LEU A CG    1 
ATOM   949   C  CD1   . LEU A 1  128  ? -19.384 40.093  -0.993  1.00 48.86  ? 128  LEU A CD1   1 
ATOM   950   C  CD2   . LEU A 1  128  ? -18.616 42.055  0.364   1.00 44.31  ? 128  LEU A CD2   1 
ATOM   951   N  N     . ASN A 1  129  ? -22.824 40.363  3.497   1.00 51.39  ? 129  ASN A N     1 
ATOM   952   C  CA    . ASN A 1  129  ? -23.742 40.962  4.458   1.00 48.05  ? 129  ASN A CA    1 
ATOM   953   C  C     . ASN A 1  129  ? -23.298 42.374  4.828   1.00 50.21  ? 129  ASN A C     1 
ATOM   954   O  O     . ASN A 1  129  ? -22.272 42.850  4.342   1.00 52.23  ? 129  ASN A O     1 
ATOM   955   C  CB    . ASN A 1  129  ? -23.851 40.093  5.712   1.00 51.66  ? 129  ASN A CB    1 
ATOM   956   C  CG    . ASN A 1  129  ? -25.009 40.498  6.600   1.00 64.25  ? 129  ASN A CG    1 
ATOM   957   O  OD1   . ASN A 1  129  ? -25.929 41.185  6.157   1.00 75.09  ? 129  ASN A OD1   1 
ATOM   958   N  ND2   . ASN A 1  129  ? -24.961 40.093  7.860   1.00 59.99  ? 129  ASN A ND2   1 
ATOM   959   N  N     . ASP A 1  130  ? -24.074 43.042  5.681   1.00 56.25  ? 130  ASP A N     1 
ATOM   960   C  CA    . ASP A 1  130  ? -23.741 44.385  6.142   1.00 60.32  ? 130  ASP A CA    1 
ATOM   961   C  C     . ASP A 1  130  ? -22.347 44.371  6.746   1.00 57.98  ? 130  ASP A C     1 
ATOM   962   O  O     . ASP A 1  130  ? -21.882 43.329  7.207   1.00 53.40  ? 130  ASP A O     1 
ATOM   963   C  CB    . ASP A 1  130  ? -24.767 44.894  7.163   1.00 60.04  ? 130  ASP A CB    1 
ATOM   964   C  CG    . ASP A 1  130  ? -24.775 46.411  7.278   1.00 62.37  ? 130  ASP A CG    1 
ATOM   965   O  OD1   . ASP A 1  130  ? -23.741 47.040  6.971   1.00 65.37  ? 130  ASP A OD1   1 
ATOM   966   O  OD2   . ASP A 1  130  ? -25.818 46.976  7.672   1.00 64.15  ? 130  ASP A OD2   1 
ATOM   967   N  N     . LYS A 1  131  ? -21.678 45.520  6.690   1.00 51.90  ? 131  LYS A N     1 
ATOM   968   C  CA    . LYS A 1  131  ? -20.320 45.698  7.210   1.00 51.44  ? 131  LYS A CA    1 
ATOM   969   C  C     . LYS A 1  131  ? -19.286 44.778  6.537   1.00 50.99  ? 131  LYS A C     1 
ATOM   970   O  O     . LYS A 1  131  ? -18.110 44.779  6.903   1.00 52.79  ? 131  LYS A O     1 
ATOM   971   C  CB    . LYS A 1  131  ? -20.306 45.505  8.737   1.00 54.84  ? 131  LYS A CB    1 
ATOM   972   C  CG    . LYS A 1  131  ? -19.877 44.126  9.233   1.00 59.67  ? 131  LYS A CG    1 
ATOM   973   C  CD    . LYS A 1  131  ? -20.184 43.937  10.706  1.00 60.97  ? 131  LYS A CD    1 
ATOM   974   C  CE    . LYS A 1  131  ? -21.681 43.977  10.966  1.00 57.55  ? 131  LYS A CE    1 
ATOM   975   N  NZ    . LYS A 1  131  ? -21.991 43.758  12.405  1.00 53.68  ? 131  LYS A NZ    1 
ATOM   976   N  N     . GLY A 1  132  ? -19.711 44.023  5.529   1.00 48.18  ? 132  GLY A N     1 
ATOM   977   C  CA    . GLY A 1  132  ? -18.809 43.131  4.823   1.00 43.22  ? 132  GLY A CA    1 
ATOM   978   C  C     . GLY A 1  132  ? -18.154 43.777  3.615   1.00 48.60  ? 132  GLY A C     1 
ATOM   979   O  O     . GLY A 1  132  ? -18.835 44.305  2.737   1.00 54.91  ? 132  GLY A O     1 
ATOM   980   N  N     . LYS A 1  133  ? -16.826 43.735  3.571   1.00 44.34  ? 133  LYS A N     1 
ATOM   981   C  CA    . LYS A 1  133  ? -16.074 44.284  2.447   1.00 42.44  ? 133  LYS A CA    1 
ATOM   982   C  C     . LYS A 1  133  ? -15.263 43.197  1.751   1.00 48.03  ? 133  LYS A C     1 
ATOM   983   O  O     . LYS A 1  133  ? -14.701 42.322  2.406   1.00 62.18  ? 133  LYS A O     1 
ATOM   984   C  CB    . LYS A 1  133  ? -15.149 45.406  2.920   1.00 48.76  ? 133  LYS A CB    1 
ATOM   985   C  CG    . LYS A 1  133  ? -14.139 45.858  1.881   1.00 49.53  ? 133  LYS A CG    1 
ATOM   986   C  CD    . LYS A 1  133  ? -13.150 46.843  2.469   1.00 64.01  ? 133  LYS A CD    1 
ATOM   987   C  CE    . LYS A 1  133  ? -11.916 46.975  1.591   1.00 74.18  ? 133  LYS A CE    1 
ATOM   988   N  NZ    . LYS A 1  133  ? -12.237 47.504  0.237   1.00 80.39  ? 133  LYS A NZ    1 
ATOM   989   N  N     . LEU A 1  134  ? -15.196 43.247  0.425   1.00 45.58  ? 134  LEU A N     1 
ATOM   990   C  CA    . LEU A 1  134  ? -14.446 42.243  -0.319  1.00 44.19  ? 134  LEU A CA    1 
ATOM   991   C  C     . LEU A 1  134  ? -13.619 42.854  -1.447  1.00 44.85  ? 134  LEU A C     1 
ATOM   992   O  O     . LEU A 1  134  ? -14.159 43.391  -2.414  1.00 51.31  ? 134  LEU A O     1 
ATOM   993   C  CB    . LEU A 1  134  ? -15.397 41.185  -0.878  1.00 38.00  ? 134  LEU A CB    1 
ATOM   994   C  CG    . LEU A 1  134  ? -14.777 39.940  -1.510  1.00 39.07  ? 134  LEU A CG    1 
ATOM   995   C  CD1   . LEU A 1  134  ? -13.891 39.208  -0.516  1.00 39.74  ? 134  LEU A CD1   1 
ATOM   996   C  CD2   . LEU A 1  134  ? -15.874 39.029  -2.021  1.00 40.62  ? 134  LEU A CD2   1 
ATOM   997   N  N     . GLU A 1  135  ? -12.302 42.772  -1.316  1.00 41.29  ? 135  GLU A N     1 
ATOM   998   C  CA    . GLU A 1  135  ? -11.411 43.266  -2.353  1.00 48.71  ? 135  GLU A CA    1 
ATOM   999   C  C     . GLU A 1  135  ? -10.550 42.139  -2.898  1.00 48.82  ? 135  GLU A C     1 
ATOM   1000  O  O     . GLU A 1  135  ? -9.743  41.561  -2.170  1.00 53.56  ? 135  GLU A O     1 
ATOM   1001  C  CB    . GLU A 1  135  ? -10.531 44.388  -1.814  1.00 58.07  ? 135  GLU A CB    1 
ATOM   1002  C  CG    . GLU A 1  135  ? -9.456  44.834  -2.778  1.00 61.11  ? 135  GLU A CG    1 
ATOM   1003  C  CD    . GLU A 1  135  ? -8.628  45.963  -2.216  1.00 64.41  ? 135  GLU A CD    1 
ATOM   1004  O  OE1   . GLU A 1  135  ? -7.418  46.023  -2.518  1.00 66.81  ? 135  GLU A OE1   1 
ATOM   1005  O  OE2   . GLU A 1  135  ? -9.190  46.788  -1.466  1.00 63.94  ? 135  GLU A OE2   1 
ATOM   1006  N  N     . VAL A 1  136  ? -10.727 41.826  -4.178  1.00 47.94  ? 136  VAL A N     1 
ATOM   1007  C  CA    . VAL A 1  136  ? -10.000 40.725  -4.802  1.00 41.75  ? 136  VAL A CA    1 
ATOM   1008  C  C     . VAL A 1  136  ? -9.143  41.219  -5.966  1.00 40.19  ? 136  VAL A C     1 
ATOM   1009  O  O     . VAL A 1  136  ? -9.199  42.390  -6.338  1.00 48.95  ? 136  VAL A O     1 
ATOM   1010  C  CB    . VAL A 1  136  ? -10.962 39.626  -5.303  1.00 41.53  ? 136  VAL A CB    1 
ATOM   1011  C  CG1   . VAL A 1  136  ? -10.279 38.265  -5.283  1.00 39.30  ? 136  VAL A CG1   1 
ATOM   1012  C  CG2   . VAL A 1  136  ? -12.205 39.581  -4.436  1.00 47.76  ? 136  VAL A CG2   1 
ATOM   1013  N  N     . GLU A 1  137  ? -8.350  40.314  -6.531  1.00 35.87  ? 137  GLU A N     1 
ATOM   1014  C  CA    . GLU A 1  137  ? -7.418  40.636  -7.601  1.00 41.13  ? 137  GLU A CA    1 
ATOM   1015  C  C     . GLU A 1  137  ? -7.076  39.385  -8.400  1.00 37.08  ? 137  GLU A C     1 
ATOM   1016  O  O     . GLU A 1  137  ? -6.309  38.544  -7.940  1.00 41.15  ? 137  GLU A O     1 
ATOM   1017  C  CB    . GLU A 1  137  ? -6.146  41.255  -7.029  1.00 43.67  ? 137  GLU A CB    1 
ATOM   1018  C  CG    . GLU A 1  137  ? -5.042  41.417  -8.050  1.00 48.51  ? 137  GLU A CG    1 
ATOM   1019  C  CD    . GLU A 1  137  ? -3.788  42.007  -7.451  1.00 65.19  ? 137  GLU A CD    1 
ATOM   1020  O  OE1   . GLU A 1  137  ? -3.910  42.877  -6.564  1.00 74.56  ? 137  GLU A OE1   1 
ATOM   1021  O  OE2   . GLU A 1  137  ? -2.682  41.595  -7.861  1.00 73.47  ? 137  GLU A OE2   1 
ATOM   1022  N  N     . LEU A 1  138  ? -7.630  39.269  -9.603  1.00 36.81  ? 138  LEU A N     1 
ATOM   1023  C  CA    . LEU A 1  138  ? -7.549  38.021  -10.362 1.00 34.06  ? 138  LEU A CA    1 
ATOM   1024  C  C     . LEU A 1  138  ? -6.603  38.081  -11.561 1.00 40.79  ? 138  LEU A C     1 
ATOM   1025  O  O     . LEU A 1  138  ? -6.633  39.029  -12.343 1.00 52.04  ? 138  LEU A O     1 
ATOM   1026  C  CB    . LEU A 1  138  ? -8.940  37.609  -10.848 1.00 34.90  ? 138  LEU A CB    1 
ATOM   1027  C  CG    . LEU A 1  138  ? -10.009 37.214  -9.827  1.00 35.39  ? 138  LEU A CG    1 
ATOM   1028  C  CD1   . LEU A 1  138  ? -10.594 38.421  -9.100  1.00 37.23  ? 138  LEU A CD1   1 
ATOM   1029  C  CD2   . LEU A 1  138  ? -11.106 36.429  -10.522 1.00 38.32  ? 138  LEU A CD2   1 
ATOM   1030  N  N     . VAL A 1  139  ? -5.782  37.046  -11.709 1.00 42.07  ? 139  VAL A N     1 
ATOM   1031  C  CA    . VAL A 1  139  ? -4.839  36.955  -12.819 1.00 39.71  ? 139  VAL A CA    1 
ATOM   1032  C  C     . VAL A 1  139  ? -5.303  35.928  -13.836 1.00 40.82  ? 139  VAL A C     1 
ATOM   1033  O  O     . VAL A 1  139  ? -5.549  34.771  -13.497 1.00 45.69  ? 139  VAL A O     1 
ATOM   1034  C  CB    . VAL A 1  139  ? -3.424  36.583  -12.337 1.00 38.51  ? 139  VAL A CB    1 
ATOM   1035  C  CG1   . VAL A 1  139  ? -2.561  36.125  -13.507 1.00 36.91  ? 139  VAL A CG1   1 
ATOM   1036  C  CG2   . VAL A 1  139  ? -2.787  37.758  -11.613 1.00 44.29  ? 139  VAL A CG2   1 
ATOM   1037  N  N     . VAL A 1  140  ? -5.422  36.358  -15.087 1.00 46.74  ? 140  VAL A N     1 
ATOM   1038  C  CA    . VAL A 1  140  ? -5.899  35.483  -16.149 1.00 53.16  ? 140  VAL A CA    1 
ATOM   1039  C  C     . VAL A 1  140  ? -4.823  35.237  -17.203 1.00 55.62  ? 140  VAL A C     1 
ATOM   1040  O  O     . VAL A 1  140  ? -4.116  36.160  -17.615 1.00 61.49  ? 140  VAL A O     1 
ATOM   1041  C  CB    . VAL A 1  140  ? -7.151  36.065  -16.834 1.00 49.11  ? 140  VAL A CB    1 
ATOM   1042  C  CG1   . VAL A 1  140  ? -7.760  35.046  -17.781 1.00 51.41  ? 140  VAL A CG1   1 
ATOM   1043  C  CG2   . VAL A 1  140  ? -8.173  36.497  -15.793 1.00 48.28  ? 140  VAL A CG2   1 
ATOM   1044  N  N     . GLU A 1  141  ? -4.702  33.986  -17.634 1.00 52.39  ? 141  GLU A N     1 
ATOM   1045  C  CA    . GLU A 1  141  ? -3.750  33.635  -18.676 1.00 51.42  ? 141  GLU A CA    1 
ATOM   1046  C  C     . GLU A 1  141  ? -4.406  32.837  -19.796 1.00 44.27  ? 141  GLU A C     1 
ATOM   1047  O  O     . GLU A 1  141  ? -5.586  32.491  -19.731 1.00 38.93  ? 141  GLU A O     1 
ATOM   1048  C  CB    . GLU A 1  141  ? -2.583  32.843  -18.086 1.00 52.58  ? 141  GLU A CB    1 
ATOM   1049  C  CG    . GLU A 1  141  ? -1.872  33.542  -16.941 1.00 52.77  ? 141  GLU A CG    1 
ATOM   1050  C  CD    . GLU A 1  141  ? -0.818  32.666  -16.297 1.00 57.49  ? 141  GLU A CD    1 
ATOM   1051  O  OE1   . GLU A 1  141  ? -0.322  31.739  -16.973 1.00 48.75  ? 141  GLU A OE1   1 
ATOM   1052  O  OE2   . GLU A 1  141  ? -0.496  32.898  -15.112 1.00 64.71  ? 141  GLU A OE2   1 
ATOM   1053  N  N     . ARG A 1  142  ? -3.620  32.563  -20.831 1.00 46.53  ? 142  ARG A N     1 
ATOM   1054  C  CA    . ARG A 1  142  ? -4.065  31.754  -21.954 1.00 45.42  ? 142  ARG A CA    1 
ATOM   1055  C  C     . ARG A 1  142  ? -3.367  30.400  -21.928 1.00 50.44  ? 142  ARG A C     1 
ATOM   1056  O  O     . ARG A 1  142  ? -2.170  30.323  -21.650 1.00 51.43  ? 142  ARG A O     1 
ATOM   1057  C  CB    . ARG A 1  142  ? -3.787  32.464  -23.282 1.00 58.20  ? 142  ARG A CB    1 
ATOM   1058  C  CG    . ARG A 1  142  ? -4.680  33.663  -23.568 1.00 68.39  ? 142  ARG A CG    1 
ATOM   1059  C  CD    . ARG A 1  142  ? -4.514  34.144  -25.007 1.00 66.57  ? 142  ARG A CD    1 
ATOM   1060  N  NE    . ARG A 1  142  ? -4.793  33.088  -25.979 1.00 54.76  ? 142  ARG A NE    1 
ATOM   1061  C  CZ    . ARG A 1  142  ? -6.013  32.725  -26.365 1.00 56.49  ? 142  ARG A CZ    1 
ATOM   1062  N  NH1   . ARG A 1  142  ? -7.080  33.330  -25.861 1.00 62.34  ? 142  ARG A NH1   1 
ATOM   1063  N  NH2   . ARG A 1  142  ? -6.168  31.754  -27.255 1.00 57.64  ? 142  ARG A NH2   1 
ATOM   1064  N  N     . GLY A 1  143  ? -4.119  29.341  -22.221 1.00 53.77  ? 143  GLY A N     1 
ATOM   1065  C  CA    . GLY A 1  143  ? -3.590  27.986  -22.245 1.00 55.65  ? 143  GLY A CA    1 
ATOM   1066  C  C     . GLY A 1  143  ? -4.610  26.974  -22.746 1.00 56.64  ? 143  GLY A C     1 
ATOM   1067  O  O     . GLY A 1  143  ? -5.666  27.355  -23.250 1.00 57.67  ? 143  GLY A O     1 
ATOM   1068  N  N     . ARG A 1  144  ? -4.306  25.684  -22.610 1.00 60.68  ? 144  ARG A N     1 
ATOM   1069  C  CA    . ARG A 1  144  ? -5.235  24.634  -23.038 1.00 59.85  ? 144  ARG A CA    1 
ATOM   1070  C  C     . ARG A 1  144  ? -5.310  23.486  -22.029 1.00 56.31  ? 144  ARG A C     1 
ATOM   1071  O  O     . ARG A 1  144  ? -4.385  23.272  -21.245 1.00 59.11  ? 144  ARG A O     1 
ATOM   1072  C  CB    . ARG A 1  144  ? -4.839  24.093  -24.415 1.00 59.06  ? 144  ARG A CB    1 
ATOM   1073  C  CG    . ARG A 1  144  ? -3.534  23.318  -24.421 1.00 65.95  ? 144  ARG A CG    1 
ATOM   1074  C  CD    . ARG A 1  144  ? -3.168  22.817  -25.810 1.00 65.10  ? 144  ARG A CD    1 
ATOM   1075  N  NE    . ARG A 1  144  ? -1.889  22.114  -25.790 1.00 63.39  ? 144  ARG A NE    1 
ATOM   1076  C  CZ    . ARG A 1  144  ? -0.706  22.720  -25.824 1.00 72.83  ? 144  ARG A CZ    1 
ATOM   1077  N  NH1   . ARG A 1  144  ? -0.639  24.043  -25.884 1.00 82.01  ? 144  ARG A NH1   1 
ATOM   1078  N  NH2   . ARG A 1  144  ? 0.411   22.004  -25.797 1.00 75.97  ? 144  ARG A NH2   1 
ATOM   1079  N  N     . GLY A 1  145  ? -6.416  22.750  -22.051 1.00 49.03  ? 145  GLY A N     1 
ATOM   1080  C  CA    . GLY A 1  145  ? -6.601  21.634  -21.140 1.00 57.59  ? 145  GLY A CA    1 
ATOM   1081  C  C     . GLY A 1  145  ? -6.784  22.038  -19.685 1.00 63.95  ? 145  GLY A C     1 
ATOM   1082  O  O     . GLY A 1  145  ? -7.500  22.994  -19.382 1.00 60.83  ? 145  GLY A O     1 
ATOM   1083  N  N     . TYR A 1  146  ? -6.129  21.305  -18.785 1.00 71.68  ? 146  TYR A N     1 
ATOM   1084  C  CA    . TYR A 1  146  ? -6.285  21.497  -17.340 1.00 59.50  ? 146  TYR A CA    1 
ATOM   1085  C  C     . TYR A 1  146  ? -4.943  21.556  -16.618 1.00 48.37  ? 146  TYR A C     1 
ATOM   1086  O  O     . TYR A 1  146  ? -4.159  20.610  -16.670 1.00 54.83  ? 146  TYR A O     1 
ATOM   1087  C  CB    . TYR A 1  146  ? -7.142  20.374  -16.745 1.00 53.91  ? 146  TYR A CB    1 
ATOM   1088  C  CG    . TYR A 1  146  ? -6.990  20.178  -15.249 1.00 44.65  ? 146  TYR A CG    1 
ATOM   1089  C  CD1   . TYR A 1  146  ? -7.645  21.008  -14.346 1.00 47.61  ? 146  TYR A CD1   1 
ATOM   1090  C  CD2   . TYR A 1  146  ? -6.209  19.146  -14.739 1.00 46.28  ? 146  TYR A CD2   1 
ATOM   1091  C  CE1   . TYR A 1  146  ? -7.514  20.825  -12.979 1.00 48.16  ? 146  TYR A CE1   1 
ATOM   1092  C  CE2   . TYR A 1  146  ? -6.074  18.956  -13.374 1.00 46.69  ? 146  TYR A CE2   1 
ATOM   1093  C  CZ    . TYR A 1  146  ? -6.727  19.797  -12.499 1.00 44.85  ? 146  TYR A CZ    1 
ATOM   1094  O  OH    . TYR A 1  146  ? -6.590  19.606  -11.142 1.00 43.53  ? 146  TYR A OH    1 
ATOM   1095  N  N     . VAL A 1  147  ? -4.686  22.664  -15.933 1.00 44.26  ? 147  VAL A N     1 
ATOM   1096  C  CA    . VAL A 1  147  ? -3.427  22.832  -15.218 1.00 48.52  ? 147  VAL A CA    1 
ATOM   1097  C  C     . VAL A 1  147  ? -3.659  23.088  -13.728 1.00 54.23  ? 147  VAL A C     1 
ATOM   1098  O  O     . VAL A 1  147  ? -4.193  24.131  -13.346 1.00 56.84  ? 147  VAL A O     1 
ATOM   1099  C  CB    . VAL A 1  147  ? -2.602  23.980  -15.815 1.00 49.71  ? 147  VAL A CB    1 
ATOM   1100  C  CG1   . VAL A 1  147  ? -1.272  24.106  -15.092 1.00 54.56  ? 147  VAL A CG1   1 
ATOM   1101  C  CG2   . VAL A 1  147  ? -2.387  23.749  -17.305 1.00 55.58  ? 147  VAL A CG2   1 
ATOM   1102  N  N     . PRO A 1  148  ? -3.263  22.123  -12.884 1.00 59.59  ? 148  PRO A N     1 
ATOM   1103  C  CA    . PRO A 1  148  ? -3.429  22.184  -11.428 1.00 51.33  ? 148  PRO A CA    1 
ATOM   1104  C  C     . PRO A 1  148  ? -2.765  23.407  -10.811 1.00 48.78  ? 148  PRO A C     1 
ATOM   1105  O  O     . PRO A 1  148  ? -1.734  23.866  -11.301 1.00 50.66  ? 148  PRO A O     1 
ATOM   1106  C  CB    . PRO A 1  148  ? -2.758  20.895  -10.946 1.00 64.39  ? 148  PRO A CB    1 
ATOM   1107  C  CG    . PRO A 1  148  ? -2.875  19.965  -12.103 1.00 66.93  ? 148  PRO A CG    1 
ATOM   1108  C  CD    . PRO A 1  148  ? -2.690  20.836  -13.314 1.00 70.19  ? 148  PRO A CD    1 
ATOM   1109  N  N     . ALA A 1  149  ? -3.366  23.922  -9.745  1.00 48.36  ? 149  ALA A N     1 
ATOM   1110  C  CA    . ALA A 1  149  ? -2.882  25.125  -9.080  1.00 61.00  ? 149  ALA A CA    1 
ATOM   1111  C  C     . ALA A 1  149  ? -1.454  24.955  -8.600  1.00 67.05  ? 149  ALA A C     1 
ATOM   1112  O  O     . ALA A 1  149  ? -0.640  25.878  -8.678  1.00 64.98  ? 149  ALA A O     1 
ATOM   1113  C  CB    . ALA A 1  149  ? -3.781  25.473  -7.907  1.00 64.10  ? 149  ALA A CB    1 
ATOM   1114  N  N     . VAL A 1  150  ? -1.165  23.746  -8.131  1.00 70.91  ? 150  VAL A N     1 
ATOM   1115  C  CA    . VAL A 1  150  ? 0.041   23.438  -7.370  1.00 83.40  ? 150  VAL A CA    1 
ATOM   1116  C  C     . VAL A 1  150  ? 1.344   23.895  -8.026  1.00 88.47  ? 150  VAL A C     1 
ATOM   1117  O  O     . VAL A 1  150  ? 2.366   24.041  -7.355  1.00 89.33  ? 150  VAL A O     1 
ATOM   1118  C  CB    . VAL A 1  150  ? 0.121   21.922  -7.101  1.00 85.18  ? 150  VAL A CB    1 
ATOM   1119  C  CG1   . VAL A 1  150  ? -1.041  21.486  -6.219  1.00 83.87  ? 150  VAL A CG1   1 
ATOM   1120  C  CG2   . VAL A 1  150  ? 0.111   21.148  -8.412  1.00 87.03  ? 150  VAL A CG2   1 
ATOM   1121  N  N     . GLN A 1  151  ? 1.298   24.140  -9.330  1.00 87.77  ? 151  GLN A N     1 
ATOM   1122  C  CA    . GLN A 1  151  ? 2.490   24.502  -10.083 1.00 89.35  ? 151  GLN A CA    1 
ATOM   1123  C  C     . GLN A 1  151  ? 2.919   25.957  -9.881  1.00 87.48  ? 151  GLN A C     1 
ATOM   1124  O  O     . GLN A 1  151  ? 4.085   26.294  -10.069 1.00 97.27  ? 151  GLN A O     1 
ATOM   1125  C  CB    . GLN A 1  151  ? 2.262   24.231  -11.573 1.00 92.32  ? 151  GLN A CB    1 
ATOM   1126  C  CG    . GLN A 1  151  ? 1.820   22.813  -11.886 1.00 86.85  ? 151  GLN A CG    1 
ATOM   1127  C  CD    . GLN A 1  151  ? 1.767   22.539  -13.376 1.00 89.74  ? 151  GLN A CD    1 
ATOM   1128  O  OE1   . GLN A 1  151  ? 2.281   23.317  -14.180 1.00 91.92  ? 151  GLN A OE1   1 
ATOM   1129  N  NE2   . GLN A 1  151  ? 1.143   21.428  -13.752 1.00 83.86  ? 151  GLN A NE2   1 
ATOM   1130  N  N     . ASN A 1  152  ? 1.977   26.811  -9.495  1.00 69.26  ? 152  ASN A N     1 
ATOM   1131  C  CA    . ASN A 1  152  ? 2.232   28.246  -9.394  1.00 74.58  ? 152  ASN A CA    1 
ATOM   1132  C  C     . ASN A 1  152  ? 3.117   28.651  -8.209  1.00 83.93  ? 152  ASN A C     1 
ATOM   1133  O  O     . ASN A 1  152  ? 3.890   29.607  -8.290  1.00 85.64  ? 152  ASN A O     1 
ATOM   1134  C  CB    . ASN A 1  152  ? 0.892   28.991  -9.319  1.00 86.53  ? 152  ASN A CB    1 
ATOM   1135  C  CG    . ASN A 1  152  ? 1.057   30.500  -9.222  1.00 105.05 ? 152  ASN A CG    1 
ATOM   1136  O  OD1   . ASN A 1  152  ? 1.350   31.039  -8.152  1.00 109.32 ? 152  ASN A OD1   1 
ATOM   1137  N  ND2   . ASN A 1  152  ? 0.843   31.192  -10.337 1.00 98.88  ? 152  ASN A ND2   1 
ATOM   1138  N  N     . ARG A 1  153  ? 3.008   27.898  -7.123  1.00 81.44  ? 153  ARG A N     1 
ATOM   1139  C  CA    . ARG A 1  153  ? 3.560   28.279  -5.823  1.00 83.84  ? 153  ARG A CA    1 
ATOM   1140  C  C     . ARG A 1  153  ? 5.086   28.248  -5.692  1.00 86.11  ? 153  ARG A C     1 
ATOM   1141  O  O     . ARG A 1  153  ? 5.674   29.077  -4.995  1.00 81.33  ? 153  ARG A O     1 
ATOM   1142  C  CB    . ARG A 1  153  ? 2.945   27.366  -4.764  1.00 77.21  ? 153  ARG A CB    1 
ATOM   1143  C  CG    . ARG A 1  153  ? 3.525   27.479  -3.380  1.00 80.69  ? 153  ARG A CG    1 
ATOM   1144  C  CD    . ARG A 1  153  ? 3.034   26.319  -2.535  1.00 85.12  ? 153  ARG A CD    1 
ATOM   1145  N  NE    . ARG A 1  153  ? 1.578   26.297  -2.420  1.00 81.88  ? 153  ARG A NE    1 
ATOM   1146  C  CZ    . ARG A 1  153  ? 0.783   25.503  -3.131  1.00 79.12  ? 153  ARG A CZ    1 
ATOM   1147  N  NH1   . ARG A 1  153  ? 1.305   24.660  -4.013  1.00 78.29  ? 153  ARG A NH1   1 
ATOM   1148  N  NH2   . ARG A 1  153  ? -0.531  25.552  -2.962  1.00 70.01  ? 153  ARG A NH2   1 
ATOM   1149  N  N     . ALA A 1  154  ? 5.720   27.288  -6.357  1.00 95.13  ? 154  ALA A N     1 
ATOM   1150  C  CA    . ALA A 1  154  ? 7.161   27.065  -6.219  1.00 87.25  ? 154  ALA A CA    1 
ATOM   1151  C  C     . ALA A 1  154  ? 7.989   28.029  -7.062  1.00 83.91  ? 154  ALA A C     1 
ATOM   1152  O  O     . ALA A 1  154  ? 9.210   28.112  -6.906  1.00 80.78  ? 154  ALA A O     1 
ATOM   1153  C  CB    . ALA A 1  154  ? 7.507   25.633  -6.590  1.00 89.68  ? 154  ALA A CB    1 
ATOM   1154  N  N     . SER A 1  155  ? 7.319   28.745  -7.958  1.00 87.48  ? 155  SER A N     1 
ATOM   1155  C  CA    . SER A 1  155  ? 7.975   29.673  -8.871  1.00 83.66  ? 155  SER A CA    1 
ATOM   1156  C  C     . SER A 1  155  ? 8.737   30.757  -8.120  1.00 88.86  ? 155  SER A C     1 
ATOM   1157  O  O     . SER A 1  155  ? 9.900   31.037  -8.414  1.00 92.63  ? 155  SER A O     1 
ATOM   1158  C  CB    . SER A 1  155  ? 6.943   30.315  -9.796  1.00 76.46  ? 155  SER A CB    1 
ATOM   1159  O  OG    . SER A 1  155  ? 5.929   29.388  -10.136 1.00 78.30  ? 155  SER A OG    1 
ATOM   1160  N  N     . GLY A 1  156  ? 8.064   31.360  -7.148  1.00 86.39  ? 156  GLY A N     1 
ATOM   1161  C  CA    . GLY A 1  156  ? 8.626   32.452  -6.379  1.00 83.05  ? 156  GLY A CA    1 
ATOM   1162  C  C     . GLY A 1  156  ? 7.528   33.412  -5.976  1.00 79.85  ? 156  GLY A C     1 
ATOM   1163  O  O     . GLY A 1  156  ? 7.797   34.507  -5.480  1.00 78.35  ? 156  GLY A O     1 
ATOM   1164  N  N     . ALA A 1  157  ? 6.284   32.991  -6.197  1.00 78.43  ? 157  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  157  ? 5.112   33.794  -5.867  1.00 74.24  ? 157  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  157  ? 5.114   34.191  -4.396  1.00 70.50  ? 157  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  157  ? 5.427   33.379  -3.527  1.00 81.76  ? 157  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  157  ? 3.839   33.036  -6.208  1.00 72.77  ? 157  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  158  ? 4.764   35.443  -4.125  1.00 60.58  ? 158  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  158  ? 4.775   35.963  -2.763  1.00 55.55  ? 158  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  158  ? 3.756   35.259  -1.872  1.00 55.94  ? 158  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  158  ? 2.955   34.452  -2.340  1.00 62.75  ? 158  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  158  ? 4.508   37.467  -2.766  1.00 57.80  ? 158  GLU A CB    1 
ATOM   1174  N  N     . ILE A 1  159  ? 3.784   35.583  -0.583  1.00 48.44  ? 159  ILE A N     1 
ATOM   1175  C  CA    . ILE A 1  159  ? 2.942   34.911  0.402   1.00 38.57  ? 159  ILE A CA    1 
ATOM   1176  C  C     . ILE A 1  159  ? 1.495   35.396  0.339   1.00 31.74  ? 159  ILE A C     1 
ATOM   1177  O  O     . ILE A 1  159  ? 0.627   34.905  1.057   1.00 28.97  ? 159  ILE A O     1 
ATOM   1178  C  CB    . ILE A 1  159  ? 3.496   35.118  1.822   1.00 36.45  ? 159  ILE A CB    1 
ATOM   1179  C  CG1   . ILE A 1  159  ? 5.028   35.081  1.791   1.00 52.05  ? 159  ILE A CG1   1 
ATOM   1180  C  CG2   . ILE A 1  159  ? 2.933   34.079  2.784   1.00 31.58  ? 159  ILE A CG2   1 
ATOM   1181  C  CD1   . ILE A 1  159  ? 5.666   34.294  2.922   1.00 58.56  ? 159  ILE A CD1   1 
ATOM   1182  N  N     . GLY A 1  160  ? 1.236   36.362  -0.532  1.00 37.66  ? 160  GLY A N     1 
ATOM   1183  C  CA    . GLY A 1  160  ? -0.109  36.875  -0.698  1.00 39.71  ? 160  GLY A CA    1 
ATOM   1184  C  C     . GLY A 1  160  ? -0.953  36.020  -1.622  1.00 37.91  ? 160  GLY A C     1 
ATOM   1185  O  O     . GLY A 1  160  ? -2.131  35.778  -1.358  1.00 31.94  ? 160  GLY A O     1 
ATOM   1186  N  N     . ARG A 1  161  ? -0.342  35.549  -2.704  1.00 40.16  ? 161  ARG A N     1 
ATOM   1187  C  CA    . ARG A 1  161  ? -1.072  34.882  -3.776  1.00 35.74  ? 161  ARG A CA    1 
ATOM   1188  C  C     . ARG A 1  161  ? -1.606  33.508  -3.400  1.00 32.38  ? 161  ARG A C     1 
ATOM   1189  O  O     . ARG A 1  161  ? -0.960  32.745  -2.684  1.00 34.90  ? 161  ARG A O     1 
ATOM   1190  C  CB    . ARG A 1  161  ? -0.185  34.766  -5.014  1.00 40.79  ? 161  ARG A CB    1 
ATOM   1191  C  CG    . ARG A 1  161  ? 0.057   36.095  -5.696  1.00 49.22  ? 161  ARG A CG    1 
ATOM   1192  C  CD    . ARG A 1  161  ? 1.173   36.006  -6.709  1.00 56.46  ? 161  ARG A CD    1 
ATOM   1193  N  NE    . ARG A 1  161  ? 2.234   36.959  -6.409  1.00 65.85  ? 161  ARG A NE    1 
ATOM   1194  C  CZ    . ARG A 1  161  ? 3.296   37.160  -7.180  1.00 74.30  ? 161  ARG A CZ    1 
ATOM   1195  N  NH1   . ARG A 1  161  ? 4.214   38.050  -6.830  1.00 76.39  ? 161  ARG A NH1   1 
ATOM   1196  N  NH2   . ARG A 1  161  ? 3.438   36.471  -8.305  1.00 74.04  ? 161  ARG A NH2   1 
ATOM   1197  N  N     . ILE A 1  162  ? -2.803  33.213  -3.896  1.00 30.29  ? 162  ILE A N     1 
ATOM   1198  C  CA    . ILE A 1  162  ? -3.435  31.917  -3.708  1.00 28.41  ? 162  ILE A CA    1 
ATOM   1199  C  C     . ILE A 1  162  ? -3.678  31.250  -5.048  1.00 28.51  ? 162  ILE A C     1 
ATOM   1200  O  O     . ILE A 1  162  ? -4.702  31.486  -5.682  1.00 32.16  ? 162  ILE A O     1 
ATOM   1201  C  CB    . ILE A 1  162  ? -4.781  32.027  -2.983  1.00 28.91  ? 162  ILE A CB    1 
ATOM   1202  C  CG1   . ILE A 1  162  ? -4.668  32.931  -1.760  1.00 36.33  ? 162  ILE A CG1   1 
ATOM   1203  C  CG2   . ILE A 1  162  ? -5.281  30.645  -2.592  1.00 29.90  ? 162  ILE A CG2   1 
ATOM   1204  C  CD1   . ILE A 1  162  ? -5.985  33.118  -1.044  1.00 37.02  ? 162  ILE A CD1   1 
ATOM   1205  N  N     . PRO A 1  163  ? -2.733  30.412  -5.484  1.00 28.20  ? 163  PRO A N     1 
ATOM   1206  C  CA    . PRO A 1  163  ? -2.823  29.664  -6.742  1.00 33.79  ? 163  PRO A CA    1 
ATOM   1207  C  C     . PRO A 1  163  ? -4.106  28.838  -6.868  1.00 28.61  ? 163  PRO A C     1 
ATOM   1208  O  O     . PRO A 1  163  ? -4.484  28.100  -5.958  1.00 24.68  ? 163  PRO A O     1 
ATOM   1209  C  CB    . PRO A 1  163  ? -1.590  28.758  -6.697  1.00 55.04  ? 163  PRO A CB    1 
ATOM   1210  C  CG    . PRO A 1  163  ? -1.147  28.762  -5.259  1.00 53.91  ? 163  PRO A CG    1 
ATOM   1211  C  CD    . PRO A 1  163  ? -1.495  30.112  -4.751  1.00 33.17  ? 163  PRO A CD    1 
ATOM   1212  N  N     . VAL A 1  164  ? -4.769  28.980  -8.009  1.00 28.93  ? 164  VAL A N     1 
ATOM   1213  C  CA    . VAL A 1  164  ? -6.033  28.307  -8.265  1.00 29.39  ? 164  VAL A CA    1 
ATOM   1214  C  C     . VAL A 1  164  ? -5.941  27.492  -9.544  1.00 34.45  ? 164  VAL A C     1 
ATOM   1215  O  O     . VAL A 1  164  ? -5.317  27.918  -10.512 1.00 39.60  ? 164  VAL A O     1 
ATOM   1216  C  CB    . VAL A 1  164  ? -7.194  29.310  -8.387  1.00 29.95  ? 164  VAL A CB    1 
ATOM   1217  C  CG1   . VAL A 1  164  ? -8.519  28.579  -8.553  1.00 34.05  ? 164  VAL A CG1   1 
ATOM   1218  C  CG2   . VAL A 1  164  ? -7.236  30.232  -7.179  1.00 34.02  ? 164  VAL A CG2   1 
ATOM   1219  N  N     . ASP A 1  165  ? -6.562  26.318  -9.540  1.00 40.72  ? 165  ASP A N     1 
ATOM   1220  C  CA    . ASP A 1  165  ? -6.560  25.434  -10.698 1.00 41.52  ? 165  ASP A CA    1 
ATOM   1221  C  C     . ASP A 1  165  ? -7.080  26.122  -11.952 1.00 40.73  ? 165  ASP A C     1 
ATOM   1222  O  O     . ASP A 1  165  ? -7.872  27.061  -11.881 1.00 46.87  ? 165  ASP A O     1 
ATOM   1223  C  CB    . ASP A 1  165  ? -7.386  24.188  -10.401 1.00 42.59  ? 165  ASP A CB    1 
ATOM   1224  C  CG    . ASP A 1  165  ? -6.803  23.375  -9.272  1.00 47.14  ? 165  ASP A CG    1 
ATOM   1225  O  OD1   . ASP A 1  165  ? -7.565  22.954  -8.377  1.00 50.81  ? 165  ASP A OD1   1 
ATOM   1226  O  OD2   . ASP A 1  165  ? -5.572  23.167  -9.276  1.00 45.35  ? 165  ASP A OD2   1 
ATOM   1227  N  N     . SER A 1  166  ? -6.622  25.647  -13.102 1.00 38.67  ? 166  SER A N     1 
ATOM   1228  C  CA    . SER A 1  166  ? -6.949  26.287  -14.363 1.00 38.15  ? 166  SER A CA    1 
ATOM   1229  C  C     . SER A 1  166  ? -7.553  25.299  -15.352 1.00 46.07  ? 166  SER A C     1 
ATOM   1230  O  O     . SER A 1  166  ? -6.889  24.364  -15.797 1.00 48.25  ? 166  SER A O     1 
ATOM   1231  C  CB    . SER A 1  166  ? -5.699  26.937  -14.953 1.00 39.22  ? 166  SER A CB    1 
ATOM   1232  O  OG    . SER A 1  166  ? -5.067  27.766  -13.990 1.00 39.62  ? 166  SER A OG    1 
ATOM   1233  N  N     . ILE A 1  167  ? -8.823  25.508  -15.684 1.00 49.20  ? 167  ILE A N     1 
ATOM   1234  C  CA    . ILE A 1  167  ? -9.493  24.697  -16.693 1.00 53.76  ? 167  ILE A CA    1 
ATOM   1235  C  C     . ILE A 1  167  ? -9.701  25.509  -17.966 1.00 54.95  ? 167  ILE A C     1 
ATOM   1236  O  O     . ILE A 1  167  ? -10.765 26.096  -18.177 1.00 61.52  ? 167  ILE A O     1 
ATOM   1237  C  CB    . ILE A 1  167  ? -10.848 24.179  -16.205 1.00 53.22  ? 167  ILE A CB    1 
ATOM   1238  C  CG1   . ILE A 1  167  ? -10.771 23.779  -14.732 1.00 49.28  ? 167  ILE A CG1   1 
ATOM   1239  C  CG2   . ILE A 1  167  ? -11.304 23.014  -17.067 1.00 54.62  ? 167  ILE A CG2   1 
ATOM   1240  C  CD1   . ILE A 1  167  ? -12.077 23.236  -14.186 1.00 55.16  ? 167  ILE A CD1   1 
ATOM   1241  N  N     . TYR A 1  168  ? -8.676  25.528  -18.811 1.00 51.85  ? 168  TYR A N     1 
ATOM   1242  C  CA    . TYR A 1  168  ? -8.668  26.363  -20.006 1.00 47.16  ? 168  TYR A CA    1 
ATOM   1243  C  C     . TYR A 1  168  ? -9.641  25.907  -21.090 1.00 49.29  ? 168  TYR A C     1 
ATOM   1244  O  O     . TYR A 1  168  ? -10.134 26.730  -21.862 1.00 52.03  ? 168  TYR A O     1 
ATOM   1245  C  CB    . TYR A 1  168  ? -7.263  26.416  -20.602 1.00 50.15  ? 168  TYR A CB    1 
ATOM   1246  C  CG    . TYR A 1  168  ? -6.211  27.031  -19.703 1.00 51.29  ? 168  TYR A CG    1 
ATOM   1247  C  CD1   . TYR A 1  168  ? -6.223  28.388  -19.418 1.00 52.99  ? 168  TYR A CD1   1 
ATOM   1248  C  CD2   . TYR A 1  168  ? -5.191  26.257  -19.162 1.00 55.33  ? 168  TYR A CD2   1 
ATOM   1249  C  CE1   . TYR A 1  168  ? -5.261  28.957  -18.607 1.00 52.79  ? 168  TYR A CE1   1 
ATOM   1250  C  CE2   . TYR A 1  168  ? -4.221  26.816  -18.350 1.00 49.44  ? 168  TYR A CE2   1 
ATOM   1251  C  CZ    . TYR A 1  168  ? -4.262  28.166  -18.076 1.00 47.89  ? 168  TYR A CZ    1 
ATOM   1252  O  OH    . TYR A 1  168  ? -3.303  28.729  -17.270 1.00 47.95  ? 168  TYR A OH    1 
ATOM   1253  N  N     . SER A 1  169  ? -9.904  24.604  -21.156 1.00 51.07  ? 169  SER A N     1 
ATOM   1254  C  CA    . SER A 1  169  ? -10.720 24.031  -22.229 1.00 50.54  ? 169  SER A CA    1 
ATOM   1255  C  C     . SER A 1  169  ? -12.105 24.673  -22.309 1.00 50.17  ? 169  SER A C     1 
ATOM   1256  O  O     . SER A 1  169  ? -12.895 24.561  -21.372 1.00 55.59  ? 169  SER A O     1 
ATOM   1257  C  CB    . SER A 1  169  ? -10.857 22.516  -22.043 1.00 48.41  ? 169  SER A CB    1 
ATOM   1258  O  OG    . SER A 1  169  ? -11.536 21.928  -23.136 1.00 45.20  ? 169  SER A OG    1 
ATOM   1259  N  N     . PRO A 1  170  ? -12.397 25.354  -23.430 1.00 46.11  ? 170  PRO A N     1 
ATOM   1260  C  CA    . PRO A 1  170  ? -13.680 26.026  -23.651 1.00 45.21  ? 170  PRO A CA    1 
ATOM   1261  C  C     . PRO A 1  170  ? -14.703 25.103  -24.307 1.00 44.14  ? 170  PRO A C     1 
ATOM   1262  O  O     . PRO A 1  170  ? -15.738 25.554  -24.802 1.00 44.31  ? 170  PRO A O     1 
ATOM   1263  C  CB    . PRO A 1  170  ? -13.306 27.183  -24.575 1.00 45.38  ? 170  PRO A CB    1 
ATOM   1264  C  CG    . PRO A 1  170  ? -12.036 26.738  -25.262 1.00 47.08  ? 170  PRO A CG    1 
ATOM   1265  C  CD    . PRO A 1  170  ? -11.493 25.524  -24.578 1.00 48.69  ? 170  PRO A CD    1 
ATOM   1266  N  N     . VAL A 1  171  ? -14.397 23.810  -24.303 1.00 43.21  ? 171  VAL A N     1 
ATOM   1267  C  CA    . VAL A 1  171  ? -15.302 22.789  -24.818 1.00 57.21  ? 171  VAL A CA    1 
ATOM   1268  C  C     . VAL A 1  171  ? -16.176 22.247  -23.697 1.00 59.48  ? 171  VAL A C     1 
ATOM   1269  O  O     . VAL A 1  171  ? -15.717 22.073  -22.570 1.00 62.61  ? 171  VAL A O     1 
ATOM   1270  C  CB    . VAL A 1  171  ? -14.531 21.622  -25.463 1.00 65.67  ? 171  VAL A CB    1 
ATOM   1271  C  CG1   . VAL A 1  171  ? -15.495 20.631  -26.122 1.00 56.33  ? 171  VAL A CG1   1 
ATOM   1272  C  CG2   . VAL A 1  171  ? -13.528 22.150  -26.471 1.00 65.00  ? 171  VAL A CG2   1 
ATOM   1273  N  N     . LEU A 1  172  ? -17.437 21.974  -24.006 1.00 56.03  ? 172  LEU A N     1 
ATOM   1274  C  CA    . LEU A 1  172  ? -18.355 21.495  -22.990 1.00 57.29  ? 172  LEU A CA    1 
ATOM   1275  C  C     . LEU A 1  172  ? -18.657 20.012  -23.169 1.00 57.96  ? 172  LEU A C     1 
ATOM   1276  O  O     . LEU A 1  172  ? -18.202 19.182  -22.383 1.00 57.37  ? 172  LEU A O     1 
ATOM   1277  C  CB    . LEU A 1  172  ? -19.643 22.315  -23.019 1.00 66.17  ? 172  LEU A CB    1 
ATOM   1278  C  CG    . LEU A 1  172  ? -20.467 22.334  -21.734 1.00 73.48  ? 172  LEU A CG    1 
ATOM   1279  C  CD1   . LEU A 1  172  ? -21.190 23.664  -21.626 1.00 75.17  ? 172  LEU A CD1   1 
ATOM   1280  C  CD2   . LEU A 1  172  ? -21.456 21.173  -21.698 1.00 76.54  ? 172  LEU A CD2   1 
ATOM   1281  N  N     . LYS A 1  173  ? -19.421 19.681  -24.203 1.00 59.44  ? 173  LYS A N     1 
ATOM   1282  C  CA    . LYS A 1  173  ? -19.848 18.303  -24.414 1.00 59.18  ? 173  LYS A CA    1 
ATOM   1283  C  C     . LYS A 1  173  ? -19.907 17.952  -25.896 1.00 63.08  ? 173  LYS A C     1 
ATOM   1284  O  O     . LYS A 1  173  ? -20.538 18.655  -26.684 1.00 72.38  ? 173  LYS A O     1 
ATOM   1285  C  CB    . LYS A 1  173  ? -21.210 18.070  -23.762 1.00 58.33  ? 173  LYS A CB    1 
ATOM   1286  C  CG    . LYS A 1  173  ? -21.651 16.616  -23.750 1.00 58.04  ? 173  LYS A CG    1 
ATOM   1287  C  CD    . LYS A 1  173  ? -22.923 16.440  -22.942 1.00 58.83  ? 173  LYS A CD    1 
ATOM   1288  C  CE    . LYS A 1  173  ? -22.749 16.989  -21.537 1.00 55.81  ? 173  LYS A CE    1 
ATOM   1289  N  NZ    . LYS A 1  173  ? -23.986 16.848  -20.726 1.00 59.95  ? 173  LYS A NZ    1 
ATOM   1290  N  N     . VAL A 1  174  ? -19.252 16.855  -26.265 1.00 59.86  ? 174  VAL A N     1 
ATOM   1291  C  CA    . VAL A 1  174  ? -19.129 16.457  -27.662 1.00 56.07  ? 174  VAL A CA    1 
ATOM   1292  C  C     . VAL A 1  174  ? -19.535 15.003  -27.858 1.00 49.72  ? 174  VAL A C     1 
ATOM   1293  O  O     . VAL A 1  174  ? -19.220 14.149  -27.031 1.00 57.93  ? 174  VAL A O     1 
ATOM   1294  C  CB    . VAL A 1  174  ? -17.682 16.652  -28.176 1.00 59.86  ? 174  VAL A CB    1 
ATOM   1295  C  CG1   . VAL A 1  174  ? -17.538 16.160  -29.613 1.00 55.26  ? 174  VAL A CG1   1 
ATOM   1296  C  CG2   . VAL A 1  174  ? -17.263 18.114  -28.060 1.00 62.95  ? 174  VAL A CG2   1 
ATOM   1297  N  N     . THR A 1  175  ? -20.239 14.731  -28.952 1.00 45.27  ? 175  THR A N     1 
ATOM   1298  C  CA    . THR A 1  175  ? -20.615 13.372  -29.317 1.00 45.34  ? 175  THR A CA    1 
ATOM   1299  C  C     . THR A 1  175  ? -20.806 13.243  -30.822 1.00 51.13  ? 175  THR A C     1 
ATOM   1300  O  O     . THR A 1  175  ? -20.574 14.195  -31.566 1.00 58.96  ? 175  THR A O     1 
ATOM   1301  C  CB    . THR A 1  175  ? -21.908 12.936  -28.624 1.00 44.81  ? 175  THR A CB    1 
ATOM   1302  O  OG1   . THR A 1  175  ? -22.320 11.669  -29.149 1.00 45.26  ? 175  THR A OG1   1 
ATOM   1303  C  CG2   . THR A 1  175  ? -23.006 13.955  -28.873 1.00 49.07  ? 175  THR A CG2   1 
ATOM   1304  N  N     . TYR A 1  176  ? -21.240 12.065  -31.264 1.00 53.60  ? 176  TYR A N     1 
ATOM   1305  C  CA    . TYR A 1  176  ? -21.508 11.831  -32.680 1.00 58.15  ? 176  TYR A CA    1 
ATOM   1306  C  C     . TYR A 1  176  ? -22.423 10.633  -32.923 1.00 58.80  ? 176  TYR A C     1 
ATOM   1307  O  O     . TYR A 1  176  ? -22.522 9.730   -32.091 1.00 57.27  ? 176  TYR A O     1 
ATOM   1308  C  CB    . TYR A 1  176  ? -20.197 11.632  -33.449 1.00 62.77  ? 176  TYR A CB    1 
ATOM   1309  C  CG    . TYR A 1  176  ? -19.302 10.540  -32.896 1.00 60.35  ? 176  TYR A CG    1 
ATOM   1310  C  CD1   . TYR A 1  176  ? -19.518 9.202   -33.212 1.00 51.38  ? 176  TYR A CD1   1 
ATOM   1311  C  CD2   . TYR A 1  176  ? -18.230 10.851  -32.068 1.00 58.31  ? 176  TYR A CD2   1 
ATOM   1312  C  CE1   . TYR A 1  176  ? -18.697 8.206   -32.708 1.00 49.88  ? 176  TYR A CE1   1 
ATOM   1313  C  CE2   . TYR A 1  176  ? -17.405 9.863   -31.563 1.00 55.93  ? 176  TYR A CE2   1 
ATOM   1314  C  CZ    . TYR A 1  176  ? -17.641 8.544   -31.886 1.00 50.81  ? 176  TYR A CZ    1 
ATOM   1315  O  OH    . TYR A 1  176  ? -16.819 7.562   -31.380 1.00 45.48  ? 176  TYR A OH    1 
ATOM   1316  N  N     . LYS A 1  177  ? -23.085 10.637  -34.077 1.00 63.53  ? 177  LYS A N     1 
ATOM   1317  C  CA    . LYS A 1  177  ? -23.878 9.498   -34.526 1.00 68.92  ? 177  LYS A CA    1 
ATOM   1318  C  C     . LYS A 1  177  ? -23.676 9.280   -36.025 1.00 76.57  ? 177  LYS A C     1 
ATOM   1319  O  O     . LYS A 1  177  ? -23.410 10.229  -36.766 1.00 75.42  ? 177  LYS A O     1 
ATOM   1320  C  CB    . LYS A 1  177  ? -25.356 9.708   -34.208 1.00 59.65  ? 177  LYS A CB    1 
ATOM   1321  C  CG    . LYS A 1  177  ? -25.892 11.045  -34.662 1.00 67.91  ? 177  LYS A CG    1 
ATOM   1322  C  CD    . LYS A 1  177  ? -27.341 11.209  -34.267 1.00 77.55  ? 177  LYS A CD    1 
ATOM   1323  C  CE    . LYS A 1  177  ? -27.866 12.567  -34.685 1.00 79.27  ? 177  LYS A CE    1 
ATOM   1324  N  NZ    . LYS A 1  177  ? -29.305 12.715  -34.343 1.00 88.69  ? 177  LYS A NZ    1 
ATOM   1325  N  N     . VAL A 1  178  ? -23.803 8.030   -36.467 1.00 79.33  ? 178  VAL A N     1 
ATOM   1326  C  CA    . VAL A 1  178  ? -23.484 7.668   -37.849 1.00 84.33  ? 178  VAL A CA    1 
ATOM   1327  C  C     . VAL A 1  178  ? -24.600 6.906   -38.565 1.00 94.58  ? 178  VAL A C     1 
ATOM   1328  O  O     . VAL A 1  178  ? -25.107 5.905   -38.058 1.00 95.66  ? 178  VAL A O     1 
ATOM   1329  C  CB    . VAL A 1  178  ? -22.200 6.812   -37.909 1.00 77.31  ? 178  VAL A CB    1 
ATOM   1330  C  CG1   . VAL A 1  178  ? -22.030 6.183   -39.288 1.00 90.65  ? 178  VAL A CG1   1 
ATOM   1331  C  CG2   . VAL A 1  178  ? -20.986 7.649   -37.547 1.00 76.31  ? 178  VAL A CG2   1 
ATOM   1332  N  N     . ASP A 1  179  ? -24.965 7.386   -39.754 1.00 96.39  ? 179  ASP A N     1 
ATOM   1333  C  CA    . ASP A 1  179  ? -25.926 6.700   -40.614 1.00 96.22  ? 179  ASP A CA    1 
ATOM   1334  C  C     . ASP A 1  179  ? -25.227 5.972   -41.755 1.00 101.05 ? 179  ASP A C     1 
ATOM   1335  O  O     . ASP A 1  179  ? -24.898 6.574   -42.778 1.00 101.82 ? 179  ASP A O     1 
ATOM   1336  C  CB    . ASP A 1  179  ? -26.946 7.686   -41.182 1.00 93.96  ? 179  ASP A CB    1 
ATOM   1337  C  CG    . ASP A 1  179  ? -27.972 8.115   -40.157 1.00 97.20  ? 179  ASP A CG    1 
ATOM   1338  O  OD1   . ASP A 1  179  ? -28.275 9.325   -40.088 1.00 101.20 ? 179  ASP A OD1   1 
ATOM   1339  O  OD2   . ASP A 1  179  ? -28.477 7.241   -39.420 1.00 91.00  ? 179  ASP A OD2   1 
ATOM   1340  N  N     . ALA A 1  180  ? -25.012 4.673   -41.577 1.00 106.87 ? 180  ALA A N     1 
ATOM   1341  C  CA    . ALA A 1  180  ? -24.334 3.863   -42.580 1.00 111.54 ? 180  ALA A CA    1 
ATOM   1342  C  C     . ALA A 1  180  ? -25.329 3.112   -43.458 1.00 119.37 ? 180  ALA A C     1 
ATOM   1343  O  O     . ALA A 1  180  ? -26.049 2.232   -42.985 1.00 121.59 ? 180  ALA A O     1 
ATOM   1344  C  CB    . ALA A 1  180  ? -23.378 2.887   -41.912 1.00 111.78 ? 180  ALA A CB    1 
ATOM   1345  N  N     . THR A 1  181  ? -25.366 3.465   -44.738 1.00 120.29 ? 181  THR A N     1 
ATOM   1346  C  CA    . THR A 1  181  ? -26.214 2.765   -45.693 1.00 125.40 ? 181  THR A CA    1 
ATOM   1347  C  C     . THR A 1  181  ? -25.583 1.423   -46.043 1.00 129.86 ? 181  THR A C     1 
ATOM   1348  O  O     . THR A 1  181  ? -24.652 1.354   -46.843 1.00 127.49 ? 181  THR A O     1 
ATOM   1349  C  CB    . THR A 1  181  ? -26.434 3.595   -46.971 1.00 118.84 ? 181  THR A CB    1 
ATOM   1350  O  OG1   . THR A 1  181  ? -27.049 4.843   -46.631 1.00 104.84 ? 181  THR A OG1   1 
ATOM   1351  C  CG2   . THR A 1  181  ? -27.329 2.848   -47.949 1.00 125.29 ? 181  THR A CG2   1 
ATOM   1352  N  N     . ARG A 1  182  ? -26.085 0.357   -45.431 1.00 133.06 ? 182  ARG A N     1 
ATOM   1353  C  CA    . ARG A 1  182  ? -25.508 -0.966  -45.626 1.00 129.60 ? 182  ARG A CA    1 
ATOM   1354  C  C     . ARG A 1  182  ? -26.268 -1.764  -46.679 1.00 132.88 ? 182  ARG A C     1 
ATOM   1355  O  O     . ARG A 1  182  ? -26.162 -2.989  -46.733 1.00 136.57 ? 182  ARG A O     1 
ATOM   1356  C  CB    . ARG A 1  182  ? -25.479 -1.735  -44.302 1.00 124.15 ? 182  ARG A CB    1 
ATOM   1357  C  CG    . ARG A 1  182  ? -24.100 -2.258  -43.931 1.00 127.77 ? 182  ARG A CG    1 
ATOM   1358  C  CD    . ARG A 1  182  ? -23.081 -1.128  -43.900 1.00 128.44 ? 182  ARG A CD    1 
ATOM   1359  N  NE    . ARG A 1  182  ? -21.712 -1.616  -43.758 1.00 118.96 ? 182  ARG A NE    1 
ATOM   1360  C  CZ    . ARG A 1  182  ? -20.645 -0.828  -43.680 1.00 111.42 ? 182  ARG A CZ    1 
ATOM   1361  N  NH1   . ARG A 1  182  ? -19.434 -1.355  -43.553 1.00 104.43 ? 182  ARG A NH1   1 
ATOM   1362  N  NH2   . ARG A 1  182  ? -20.790 0.489   -43.727 1.00 112.93 ? 182  ARG A NH2   1 
ATOM   1363  N  N     . VAL A 1  183  ? -27.030 -1.066  -47.516 1.00 133.44 ? 183  VAL A N     1 
ATOM   1364  C  CA    . VAL A 1  183  ? -27.790 -1.719  -48.576 1.00 147.25 ? 183  VAL A CA    1 
ATOM   1365  C  C     . VAL A 1  183  ? -26.842 -2.390  -49.568 1.00 149.08 ? 183  VAL A C     1 
ATOM   1366  O  O     . VAL A 1  183  ? -25.873 -1.778  -50.022 1.00 140.31 ? 183  VAL A O     1 
ATOM   1367  C  CB    . VAL A 1  183  ? -28.706 -0.720  -49.316 1.00 148.14 ? 183  VAL A CB    1 
ATOM   1368  C  CG1   . VAL A 1  183  ? -29.502 -1.426  -50.405 1.00 152.65 ? 183  VAL A CG1   1 
ATOM   1369  C  CG2   . VAL A 1  183  ? -29.645 -0.035  -48.334 1.00 138.88 ? 183  VAL A CG2   1 
ATOM   1370  N  N     . GLU A 1  184  ? -27.119 -3.654  -49.883 1.00 153.92 ? 184  GLU A N     1 
ATOM   1371  C  CA    . GLU A 1  184  ? -26.271 -4.437  -50.778 1.00 146.22 ? 184  GLU A CA    1 
ATOM   1372  C  C     . GLU A 1  184  ? -26.200 -3.827  -52.170 1.00 138.70 ? 184  GLU A C     1 
ATOM   1373  O  O     . GLU A 1  184  ? -27.001 -4.152  -53.048 1.00 139.11 ? 184  GLU A O     1 
ATOM   1374  C  CB    . GLU A 1  184  ? -26.767 -5.884  -50.872 1.00 148.52 ? 184  GLU A CB    1 
ATOM   1375  C  CG    . GLU A 1  184  ? -26.484 -6.728  -49.636 1.00 146.66 ? 184  GLU A CG    1 
ATOM   1376  C  CD    . GLU A 1  184  ? -26.626 -8.219  -49.897 1.00 140.57 ? 184  GLU A CD    1 
ATOM   1377  O  OE1   . GLU A 1  184  ? -26.902 -8.602  -51.053 1.00 138.03 ? 184  GLU A OE1   1 
ATOM   1378  O  OE2   . GLU A 1  184  ? -26.457 -9.009  -48.944 1.00 141.72 ? 184  GLU A OE2   1 
ATOM   1379  N  N     . GLN A 1  185  ? -25.227 -2.943  -52.356 1.00 136.45 ? 185  GLN A N     1 
ATOM   1380  C  CA    . GLN A 1  185  ? -24.995 -2.279  -53.630 1.00 145.96 ? 185  GLN A CA    1 
ATOM   1381  C  C     . GLN A 1  185  ? -23.691 -1.497  -53.521 1.00 151.20 ? 185  GLN A C     1 
ATOM   1382  O  O     . GLN A 1  185  ? -22.960 -1.637  -52.539 1.00 144.28 ? 185  GLN A O     1 
ATOM   1383  C  CB    . GLN A 1  185  ? -26.164 -1.353  -53.986 1.00 146.02 ? 185  GLN A CB    1 
ATOM   1384  C  CG    . GLN A 1  185  ? -26.356 -1.104  -55.476 1.00 145.28 ? 185  GLN A CG    1 
ATOM   1385  C  CD    . GLN A 1  185  ? -27.531 -0.191  -55.760 1.00 145.91 ? 185  GLN A CD    1 
ATOM   1386  O  OE1   . GLN A 1  185  ? -28.506 -0.166  -55.010 1.00 144.37 ? 185  GLN A OE1   1 
ATOM   1387  N  NE2   . GLN A 1  185  ? -27.441 0.571   -56.844 1.00 144.86 ? 185  GLN A NE2   1 
ATOM   1388  N  N     . ARG A 1  186  ? -23.400 -0.679  -54.526 1.00 156.95 ? 186  ARG A N     1 
ATOM   1389  C  CA    . ARG A 1  186  ? -22.264 0.230   -54.467 1.00 152.09 ? 186  ARG A CA    1 
ATOM   1390  C  C     . ARG A 1  186  ? -22.714 1.555   -53.859 1.00 146.57 ? 186  ARG A C     1 
ATOM   1391  O  O     . ARG A 1  186  ? -22.055 2.584   -54.008 1.00 143.42 ? 186  ARG A O     1 
ATOM   1392  C  CB    . ARG A 1  186  ? -21.659 0.432   -55.859 1.00 151.90 ? 186  ARG A CB    1 
ATOM   1393  C  CG    . ARG A 1  186  ? -22.686 0.581   -56.973 1.00 152.91 ? 186  ARG A CG    1 
ATOM   1394  C  CD    . ARG A 1  186  ? -22.137 0.095   -58.312 1.00 151.41 ? 186  ARG A CD    1 
ATOM   1395  N  NE    . ARG A 1  186  ? -21.064 0.942   -58.826 1.00 151.84 ? 186  ARG A NE    1 
ATOM   1396  C  CZ    . ARG A 1  186  ? -20.323 0.647   -59.891 1.00 144.25 ? 186  ARG A CZ    1 
ATOM   1397  N  NH1   . ARG A 1  186  ? -20.533 -0.482  -60.554 1.00 139.93 ? 186  ARG A NH1   1 
ATOM   1398  N  NH2   . ARG A 1  186  ? -19.370 1.477   -60.290 1.00 138.82 ? 186  ARG A NH2   1 
ATOM   1399  N  N     . THR A 1  187  ? -23.852 1.506   -53.171 1.00 145.45 ? 187  THR A N     1 
ATOM   1400  C  CA    . THR A 1  187  ? -24.400 2.653   -52.459 1.00 139.57 ? 187  THR A CA    1 
ATOM   1401  C  C     . THR A 1  187  ? -24.096 2.555   -50.966 1.00 140.26 ? 187  THR A C     1 
ATOM   1402  O  O     . THR A 1  187  ? -24.819 3.111   -50.139 1.00 134.17 ? 187  THR A O     1 
ATOM   1403  C  CB    . THR A 1  187  ? -25.924 2.764   -52.653 1.00 133.93 ? 187  THR A CB    1 
ATOM   1404  O  OG1   . THR A 1  187  ? -26.572 1.651   -52.023 1.00 144.32 ? 187  THR A OG1   1 
ATOM   1405  C  CG2   . THR A 1  187  ? -26.275 2.777   -54.132 1.00 131.26 ? 187  THR A CG2   1 
ATOM   1406  N  N     . ASP A 1  188  ? -23.026 1.840   -50.628 1.00 142.89 ? 188  ASP A N     1 
ATOM   1407  C  CA    . ASP A 1  188  ? -22.634 1.654   -49.234 1.00 135.05 ? 188  ASP A CA    1 
ATOM   1408  C  C     . ASP A 1  188  ? -21.671 2.747   -48.772 1.00 124.25 ? 188  ASP A C     1 
ATOM   1409  O  O     . ASP A 1  188  ? -20.559 2.869   -49.284 1.00 116.35 ? 188  ASP A O     1 
ATOM   1410  C  CB    . ASP A 1  188  ? -22.010 0.268   -49.032 1.00 134.77 ? 188  ASP A CB    1 
ATOM   1411  C  CG    . ASP A 1  188  ? -20.844 0.007   -49.968 1.00 130.59 ? 188  ASP A CG    1 
ATOM   1412  O  OD1   . ASP A 1  188  ? -20.796 0.630   -51.050 1.00 135.23 ? 188  ASP A OD1   1 
ATOM   1413  O  OD2   . ASP A 1  188  ? -19.977 -0.823  -49.620 1.00 126.16 ? 188  ASP A OD2   1 
ATOM   1414  N  N     . PHE A 1  189  ? -22.112 3.542   -47.801 1.00 121.45 ? 189  PHE A N     1 
ATOM   1415  C  CA    . PHE A 1  189  ? -21.320 4.660   -47.300 1.00 111.85 ? 189  PHE A CA    1 
ATOM   1416  C  C     . PHE A 1  189  ? -21.699 4.988   -45.859 1.00 104.80 ? 189  PHE A C     1 
ATOM   1417  O  O     . PHE A 1  189  ? -22.660 4.436   -45.325 1.00 108.27 ? 189  PHE A O     1 
ATOM   1418  C  CB    . PHE A 1  189  ? -21.504 5.893   -48.193 1.00 113.27 ? 189  PHE A CB    1 
ATOM   1419  C  CG    . PHE A 1  189  ? -22.855 6.552   -48.064 1.00 115.30 ? 189  PHE A CG    1 
ATOM   1420  C  CD1   . PHE A 1  189  ? -23.003 7.713   -47.322 1.00 111.16 ? 189  PHE A CD1   1 
ATOM   1421  C  CD2   . PHE A 1  189  ? -23.972 6.017   -48.688 1.00 121.83 ? 189  PHE A CD2   1 
ATOM   1422  C  CE1   . PHE A 1  189  ? -24.238 8.326   -47.201 1.00 102.60 ? 189  PHE A CE1   1 
ATOM   1423  C  CE2   . PHE A 1  189  ? -25.210 6.627   -48.570 1.00 112.28 ? 189  PHE A CE2   1 
ATOM   1424  C  CZ    . PHE A 1  189  ? -25.342 7.782   -47.825 1.00 96.86  ? 189  PHE A CZ    1 
ATOM   1425  N  N     . ASP A 1  190  ? -20.938 5.878   -45.227 1.00 96.68  ? 190  ASP A N     1 
ATOM   1426  C  CA    . ASP A 1  190  ? -21.251 6.312   -43.868 1.00 99.96  ? 190  ASP A CA    1 
ATOM   1427  C  C     . ASP A 1  190  ? -21.416 7.831   -43.791 1.00 105.52 ? 190  ASP A C     1 
ATOM   1428  O  O     . ASP A 1  190  ? -20.559 8.583   -44.255 1.00 103.73 ? 190  ASP A O     1 
ATOM   1429  C  CB    . ASP A 1  190  ? -20.169 5.847   -42.886 1.00 101.24 ? 190  ASP A CB    1 
ATOM   1430  C  CG    . ASP A 1  190  ? -20.259 4.360   -42.576 1.00 103.10 ? 190  ASP A CG    1 
ATOM   1431  O  OD1   . ASP A 1  190  ? -19.992 3.971   -41.418 1.00 91.48  ? 190  ASP A OD1   1 
ATOM   1432  O  OD2   . ASP A 1  190  ? -20.597 3.577   -43.488 1.00 111.04 ? 190  ASP A OD2   1 
ATOM   1433  N  N     . LYS A 1  191  ? -22.530 8.270   -43.208 1.00 106.72 ? 191  LYS A N     1 
ATOM   1434  C  CA    . LYS A 1  191  ? -22.820 9.693   -43.036 1.00 96.49  ? 191  LYS A CA    1 
ATOM   1435  C  C     . LYS A 1  191  ? -22.607 10.114  -41.587 1.00 89.18  ? 191  LYS A C     1 
ATOM   1436  O  O     . LYS A 1  191  ? -23.317 9.664   -40.688 1.00 90.67  ? 191  LYS A O     1 
ATOM   1437  C  CB    . LYS A 1  191  ? -24.254 10.006  -43.469 1.00 97.76  ? 191  LYS A CB    1 
ATOM   1438  C  CG    . LYS A 1  191  ? -24.745 11.394  -43.080 1.00 95.07  ? 191  LYS A CG    1 
ATOM   1439  C  CD    . LYS A 1  191  ? -26.252 11.500  -43.261 1.00 94.10  ? 191  LYS A CD    1 
ATOM   1440  C  CE    . LYS A 1  191  ? -26.824 12.710  -42.545 1.00 80.37  ? 191  LYS A CE    1 
ATOM   1441  N  NZ    . LYS A 1  191  ? -28.310 12.703  -42.601 1.00 65.11  ? 191  LYS A NZ    1 
ATOM   1442  N  N     . LEU A 1  192  ? -21.629 10.982  -41.362 1.00 78.20  ? 192  LEU A N     1 
ATOM   1443  C  CA    . LEU A 1  192  ? -21.275 11.368  -40.006 1.00 73.06  ? 192  LEU A CA    1 
ATOM   1444  C  C     . LEU A 1  192  ? -22.054 12.592  -39.545 1.00 71.18  ? 192  LEU A C     1 
ATOM   1445  O  O     . LEU A 1  192  ? -22.283 13.525  -40.316 1.00 72.03  ? 192  LEU A O     1 
ATOM   1446  C  CB    . LEU A 1  192  ? -19.771 11.628  -39.907 1.00 69.64  ? 192  LEU A CB    1 
ATOM   1447  C  CG    . LEU A 1  192  ? -19.228 12.151  -38.577 1.00 60.38  ? 192  LEU A CG    1 
ATOM   1448  C  CD1   . LEU A 1  192  ? -19.577 11.214  -37.430 1.00 64.36  ? 192  LEU A CD1   1 
ATOM   1449  C  CD2   . LEU A 1  192  ? -17.725 12.349  -38.674 1.00 55.31  ? 192  LEU A CD2   1 
ATOM   1450  N  N     . ILE A 1  193  ? -22.477 12.565  -38.285 1.00 71.97  ? 193  ILE A N     1 
ATOM   1451  C  CA    . ILE A 1  193  ? -23.100 13.719  -37.652 1.00 77.35  ? 193  ILE A CA    1 
ATOM   1452  C  C     . ILE A 1  193  ? -22.402 14.026  -36.329 1.00 68.53  ? 193  ILE A C     1 
ATOM   1453  O  O     . ILE A 1  193  ? -22.676 13.403  -35.304 1.00 65.86  ? 193  ILE A O     1 
ATOM   1454  C  CB    . ILE A 1  193  ? -24.608 13.502  -37.407 1.00 81.62  ? 193  ILE A CB    1 
ATOM   1455  C  CG1   . ILE A 1  193  ? -25.327 13.205  -38.724 1.00 87.48  ? 193  ILE A CG1   1 
ATOM   1456  C  CG2   . ILE A 1  193  ? -25.220 14.727  -36.745 1.00 73.88  ? 193  ILE A CG2   1 
ATOM   1457  C  CD1   . ILE A 1  193  ? -26.831 13.036  -38.584 1.00 87.14  ? 193  ILE A CD1   1 
ATOM   1458  N  N     . LEU A 1  194  ? -21.484 14.986  -36.372 1.00 66.75  ? 194  LEU A N     1 
ATOM   1459  C  CA    . LEU A 1  194  ? -20.739 15.411  -35.194 1.00 61.07  ? 194  LEU A CA    1 
ATOM   1460  C  C     . LEU A 1  194  ? -21.520 16.464  -34.410 1.00 64.71  ? 194  LEU A C     1 
ATOM   1461  O  O     . LEU A 1  194  ? -22.188 17.311  -35.000 1.00 72.94  ? 194  LEU A O     1 
ATOM   1462  C  CB    . LEU A 1  194  ? -19.374 15.964  -35.610 1.00 59.57  ? 194  LEU A CB    1 
ATOM   1463  C  CG    . LEU A 1  194  ? -18.461 16.520  -34.517 1.00 52.81  ? 194  LEU A CG    1 
ATOM   1464  C  CD1   . LEU A 1  194  ? -17.867 15.394  -33.690 1.00 64.53  ? 194  LEU A CD1   1 
ATOM   1465  C  CD2   . LEU A 1  194  ? -17.369 17.385  -35.122 1.00 47.65  ? 194  LEU A CD2   1 
ATOM   1466  N  N     . ASP A 1  195  ? -21.435 16.410  -33.084 1.00 62.99  ? 195  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  195  ? -22.109 17.388  -32.234 1.00 58.83  ? 195  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  195  ? -21.112 18.073  -31.300 1.00 56.25  ? 195  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  195  ? -20.387 17.408  -30.562 1.00 58.38  ? 195  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  195  ? -23.222 16.718  -31.423 1.00 60.77  ? 195  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  195  ? -24.219 17.715  -30.856 1.00 63.64  ? 195  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  195  ? -25.434 17.436  -30.926 1.00 67.92  ? 195  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  195  ? -23.794 18.770  -30.336 1.00 61.11  ? 195  ASP A OD2   1 
ATOM   1474  N  N     . VAL A 1  196  ? -21.084 19.403  -31.336 1.00 57.33  ? 196  VAL A N     1 
ATOM   1475  C  CA    . VAL A 1  196  ? -20.169 20.181  -30.500 1.00 65.80  ? 196  VAL A CA    1 
ATOM   1476  C  C     . VAL A 1  196  ? -20.893 21.274  -29.710 1.00 74.48  ? 196  VAL A C     1 
ATOM   1477  O  O     . VAL A 1  196  ? -21.590 22.109  -30.287 1.00 80.84  ? 196  VAL A O     1 
ATOM   1478  C  CB    . VAL A 1  196  ? -19.053 20.841  -31.344 1.00 61.97  ? 196  VAL A CB    1 
ATOM   1479  C  CG1   . VAL A 1  196  ? -18.185 21.744  -30.477 1.00 56.88  ? 196  VAL A CG1   1 
ATOM   1480  C  CG2   . VAL A 1  196  ? -18.204 19.784  -32.035 1.00 57.75  ? 196  VAL A CG2   1 
ATOM   1481  N  N     . GLU A 1  197  ? -20.720 21.266  -28.389 1.00 75.46  ? 197  GLU A N     1 
ATOM   1482  C  CA    . GLU A 1  197  ? -21.281 22.298  -27.520 1.00 70.42  ? 197  GLU A CA    1 
ATOM   1483  C  C     . GLU A 1  197  ? -20.166 23.018  -26.762 1.00 68.64  ? 197  GLU A C     1 
ATOM   1484  O  O     . GLU A 1  197  ? -19.294 22.379  -26.177 1.00 75.73  ? 197  GLU A O     1 
ATOM   1485  C  CB    . GLU A 1  197  ? -22.288 21.689  -26.540 1.00 68.02  ? 197  GLU A CB    1 
ATOM   1486  C  CG    . GLU A 1  197  ? -23.001 22.709  -25.663 1.00 73.92  ? 197  GLU A CG    1 
ATOM   1487  C  CD    . GLU A 1  197  ? -23.966 22.064  -24.681 1.00 68.58  ? 197  GLU A CD    1 
ATOM   1488  O  OE1   . GLU A 1  197  ? -23.832 20.849  -24.420 1.00 59.89  ? 197  GLU A OE1   1 
ATOM   1489  O  OE2   . GLU A 1  197  ? -24.863 22.773  -24.175 1.00 64.63  ? 197  GLU A OE2   1 
ATOM   1490  N  N     . THR A 1  198  ? -20.189 24.347  -26.774 1.00 60.92  ? 198  THR A N     1 
ATOM   1491  C  CA    . THR A 1  198  ? -19.106 25.116  -26.172 1.00 59.84  ? 198  THR A CA    1 
ATOM   1492  C  C     . THR A 1  198  ? -19.530 25.807  -24.883 1.00 64.73  ? 198  THR A C     1 
ATOM   1493  O  O     . THR A 1  198  ? -20.604 25.538  -24.345 1.00 68.37  ? 198  THR A O     1 
ATOM   1494  C  CB    . THR A 1  198  ? -18.567 26.169  -27.147 1.00 61.32  ? 198  THR A CB    1 
ATOM   1495  O  OG1   . THR A 1  198  ? -19.640 27.011  -27.584 1.00 70.66  ? 198  THR A OG1   1 
ATOM   1496  C  CG2   . THR A 1  198  ? -17.945 25.491  -28.352 1.00 63.87  ? 198  THR A CG2   1 
ATOM   1497  N  N     . LYS A 1  199  ? -18.676 26.701  -24.396 1.00 66.94  ? 199  LYS A N     1 
ATOM   1498  C  CA    . LYS A 1  199  ? -18.920 27.399  -23.140 1.00 69.07  ? 199  LYS A CA    1 
ATOM   1499  C  C     . LYS A 1  199  ? -19.291 28.860  -23.344 1.00 68.12  ? 199  LYS A C     1 
ATOM   1500  O  O     . LYS A 1  199  ? -19.179 29.661  -22.415 1.00 72.69  ? 199  LYS A O     1 
ATOM   1501  C  CB    . LYS A 1  199  ? -17.686 27.326  -22.241 1.00 68.20  ? 199  LYS A CB    1 
ATOM   1502  C  CG    . LYS A 1  199  ? -17.424 25.977  -21.607 1.00 67.55  ? 199  LYS A CG    1 
ATOM   1503  C  CD    . LYS A 1  199  ? -16.213 26.078  -20.698 1.00 63.74  ? 199  LYS A CD    1 
ATOM   1504  C  CE    . LYS A 1  199  ? -15.959 24.799  -19.927 1.00 62.85  ? 199  LYS A CE    1 
ATOM   1505  N  NZ    . LYS A 1  199  ? -14.788 24.968  -19.018 1.00 57.69  ? 199  LYS A NZ    1 
ATOM   1506  N  N     . ASN A 1  200  ? -19.718 29.203  -24.556 1.00 67.34  ? 200  ASN A N     1 
ATOM   1507  C  CA    . ASN A 1  200  ? -19.982 30.591  -24.932 1.00 65.62  ? 200  ASN A CA    1 
ATOM   1508  C  C     . ASN A 1  200  ? -18.743 31.465  -24.786 1.00 59.85  ? 200  ASN A C     1 
ATOM   1509  O  O     . ASN A 1  200  ? -18.846 32.682  -24.646 1.00 59.21  ? 200  ASN A O     1 
ATOM   1510  C  CB    . ASN A 1  200  ? -21.127 31.185  -24.102 1.00 71.54  ? 200  ASN A CB    1 
ATOM   1511  C  CG    . ASN A 1  200  ? -22.463 30.533  -24.396 1.00 80.39  ? 200  ASN A CG    1 
ATOM   1512  O  OD1   . ASN A 1  200  ? -22.691 30.023  -25.494 1.00 89.34  ? 200  ASN A OD1   1 
ATOM   1513  N  ND2   . ASN A 1  200  ? -23.359 30.554  -23.415 1.00 74.18  ? 200  ASN A ND2   1 
ATOM   1514  N  N     . SER A 1  201  ? -17.574 30.836  -24.799 1.00 59.87  ? 201  SER A N     1 
ATOM   1515  C  CA    . SER A 1  201  ? -16.318 31.570  -24.796 1.00 61.08  ? 201  SER A CA    1 
ATOM   1516  C  C     . SER A 1  201  ? -15.829 31.673  -26.229 1.00 65.19  ? 201  SER A C     1 
ATOM   1517  O  O     . SER A 1  201  ? -15.274 32.691  -26.642 1.00 70.79  ? 201  SER A O     1 
ATOM   1518  C  CB    . SER A 1  201  ? -15.276 30.886  -23.911 1.00 63.55  ? 201  SER A CB    1 
ATOM   1519  O  OG    . SER A 1  201  ? -14.063 31.619  -23.904 1.00 60.12  ? 201  SER A OG    1 
ATOM   1520  N  N     . ILE A 1  202  ? -16.036 30.595  -26.979 1.00 61.11  ? 202  ILE A N     1 
ATOM   1521  C  CA    . ILE A 1  202  ? -15.818 30.592  -28.418 1.00 57.06  ? 202  ILE A CA    1 
ATOM   1522  C  C     . ILE A 1  202  ? -16.989 29.892  -29.093 1.00 61.86  ? 202  ILE A C     1 
ATOM   1523  O  O     . ILE A 1  202  ? -17.864 29.344  -28.422 1.00 68.02  ? 202  ILE A O     1 
ATOM   1524  C  CB    . ILE A 1  202  ? -14.505 29.890  -28.819 1.00 57.10  ? 202  ILE A CB    1 
ATOM   1525  C  CG1   . ILE A 1  202  ? -14.581 28.394  -28.523 1.00 59.32  ? 202  ILE A CG1   1 
ATOM   1526  C  CG2   . ILE A 1  202  ? -13.309 30.525  -28.118 1.00 59.74  ? 202  ILE A CG2   1 
ATOM   1527  C  CD1   . ILE A 1  202  ? -13.373 27.626  -29.004 1.00 64.49  ? 202  ILE A CD1   1 
ATOM   1528  N  N     . SER A 1  203  ? -16.999 29.912  -30.420 1.00 63.52  ? 203  SER A N     1 
ATOM   1529  C  CA    . SER A 1  203  ? -18.088 29.330  -31.194 1.00 68.28  ? 203  SER A CA    1 
ATOM   1530  C  C     . SER A 1  203  ? -17.861 27.840  -31.424 1.00 62.71  ? 203  SER A C     1 
ATOM   1531  O  O     . SER A 1  203  ? -16.718 27.393  -31.481 1.00 64.54  ? 203  SER A O     1 
ATOM   1532  C  CB    . SER A 1  203  ? -18.231 30.062  -32.532 1.00 72.52  ? 203  SER A CB    1 
ATOM   1533  O  OG    . SER A 1  203  ? -19.257 29.495  -33.325 1.00 79.66  ? 203  SER A OG    1 
ATOM   1534  N  N     . PRO A 1  204  ? -18.952 27.065  -31.545 1.00 61.67  ? 204  PRO A N     1 
ATOM   1535  C  CA    . PRO A 1  204  ? -18.837 25.644  -31.892 1.00 62.72  ? 204  PRO A CA    1 
ATOM   1536  C  C     . PRO A 1  204  ? -18.065 25.413  -33.195 1.00 67.03  ? 204  PRO A C     1 
ATOM   1537  O  O     . PRO A 1  204  ? -17.397 24.389  -33.338 1.00 70.38  ? 204  PRO A O     1 
ATOM   1538  C  CB    . PRO A 1  204  ? -20.294 25.203  -32.035 1.00 62.57  ? 204  PRO A CB    1 
ATOM   1539  C  CG    . PRO A 1  204  ? -21.050 26.127  -31.159 1.00 63.16  ? 204  PRO A CG    1 
ATOM   1540  C  CD    . PRO A 1  204  ? -20.343 27.445  -31.239 1.00 59.37  ? 204  PRO A CD    1 
ATOM   1541  N  N     . ARG A 1  205  ? -18.159 26.360  -34.125 1.00 72.59  ? 205  ARG A N     1 
ATOM   1542  C  CA    . ARG A 1  205  ? -17.421 26.293  -35.386 1.00 67.34  ? 205  ARG A CA    1 
ATOM   1543  C  C     . ARG A 1  205  ? -15.937 26.577  -35.187 1.00 63.59  ? 205  ARG A C     1 
ATOM   1544  O  O     . ARG A 1  205  ? -15.081 25.842  -35.679 1.00 61.35  ? 205  ARG A O     1 
ATOM   1545  C  CB    . ARG A 1  205  ? -17.998 27.284  -36.401 1.00 74.88  ? 205  ARG A CB    1 
ATOM   1546  C  CG    . ARG A 1  205  ? -19.325 26.867  -37.007 1.00 85.88  ? 205  ARG A CG    1 
ATOM   1547  C  CD    . ARG A 1  205  ? -19.839 27.917  -37.981 1.00 98.25  ? 205  ARG A CD    1 
ATOM   1548  N  NE    . ARG A 1  205  ? -20.746 27.336  -38.967 1.00 105.85 ? 205  ARG A NE    1 
ATOM   1549  C  CZ    . ARG A 1  205  ? -20.806 27.713  -40.241 1.00 111.81 ? 205  ARG A CZ    1 
ATOM   1550  N  NH1   . ARG A 1  205  ? -20.014 28.679  -40.691 1.00 118.25 ? 205  ARG A NH1   1 
ATOM   1551  N  NH2   . ARG A 1  205  ? -21.660 27.123  -41.068 1.00 101.55 ? 205  ARG A NH2   1 
ATOM   1552  N  N     . ASP A 1  206  ? -15.643 27.653  -34.465 1.00 69.19  ? 206  ASP A N     1 
ATOM   1553  C  CA    . ASP A 1  206  ? -14.266 28.058  -34.207 1.00 72.44  ? 206  ASP A CA    1 
ATOM   1554  C  C     . ASP A 1  206  ? -13.516 27.000  -33.397 1.00 72.33  ? 206  ASP A C     1 
ATOM   1555  O  O     . ASP A 1  206  ? -12.286 26.946  -33.425 1.00 73.92  ? 206  ASP A O     1 
ATOM   1556  C  CB    . ASP A 1  206  ? -14.229 29.406  -33.478 1.00 80.26  ? 206  ASP A CB    1 
ATOM   1557  C  CG    . ASP A 1  206  ? -14.866 30.533  -34.285 1.00 74.99  ? 206  ASP A CG    1 
ATOM   1558  O  OD1   . ASP A 1  206  ? -14.737 30.536  -35.529 1.00 75.86  ? 206  ASP A OD1   1 
ATOM   1559  O  OD2   . ASP A 1  206  ? -15.496 31.420  -33.671 1.00 74.18  ? 206  ASP A OD2   1 
ATOM   1560  N  N     . ALA A 1  207  ? -14.258 26.165  -32.673 1.00 69.64  ? 207  ALA A N     1 
ATOM   1561  C  CA    . ALA A 1  207  ? -13.659 25.069  -31.918 1.00 68.35  ? 207  ALA A CA    1 
ATOM   1562  C  C     . ALA A 1  207  ? -13.216 23.965  -32.868 1.00 66.90  ? 207  ALA A C     1 
ATOM   1563  O  O     . ALA A 1  207  ? -12.110 23.433  -32.753 1.00 70.38  ? 207  ALA A O     1 
ATOM   1564  C  CB    . ALA A 1  207  ? -14.639 24.527  -30.885 1.00 68.37  ? 207  ALA A CB    1 
ATOM   1565  N  N     . LEU A 1  208  ? -14.090 23.634  -33.814 1.00 64.89  ? 208  LEU A N     1 
ATOM   1566  C  CA    . LEU A 1  208  ? -13.793 22.619  -34.814 1.00 59.58  ? 208  LEU A CA    1 
ATOM   1567  C  C     . LEU A 1  208  ? -12.689 23.092  -35.754 1.00 61.49  ? 208  LEU A C     1 
ATOM   1568  O  O     . LEU A 1  208  ? -11.995 22.285  -36.367 1.00 62.99  ? 208  LEU A O     1 
ATOM   1569  C  CB    . LEU A 1  208  ? -15.057 22.264  -35.603 1.00 55.72  ? 208  LEU A CB    1 
ATOM   1570  C  CG    . LEU A 1  208  ? -15.015 21.010  -36.477 1.00 51.32  ? 208  LEU A CG    1 
ATOM   1571  C  CD1   . LEU A 1  208  ? -14.633 19.802  -35.646 1.00 61.75  ? 208  LEU A CD1   1 
ATOM   1572  C  CD2   . LEU A 1  208  ? -16.353 20.784  -37.151 1.00 48.89  ? 208  LEU A CD2   1 
ATOM   1573  N  N     . ALA A 1  209  ? -12.523 24.405  -35.860 1.00 65.02  ? 209  ALA A N     1 
ATOM   1574  C  CA    . ALA A 1  209  ? -11.467 24.963  -36.696 1.00 76.51  ? 209  ALA A CA    1 
ATOM   1575  C  C     . ALA A 1  209  ? -10.091 24.776  -36.056 1.00 84.64  ? 209  ALA A C     1 
ATOM   1576  O  O     . ALA A 1  209  ? -9.124  24.443  -36.741 1.00 92.46  ? 209  ALA A O     1 
ATOM   1577  C  CB    . ALA A 1  209  ? -11.725 26.435  -36.974 1.00 86.42  ? 209  ALA A CB    1 
ATOM   1578  N  N     . SER A 1  210  ? -10.003 24.989  -34.746 1.00 84.31  ? 210  SER A N     1 
ATOM   1579  C  CA    . SER A 1  210  ? -8.733  24.844  -34.040 1.00 75.38  ? 210  SER A CA    1 
ATOM   1580  C  C     . SER A 1  210  ? -8.395  23.376  -33.835 1.00 68.70  ? 210  SER A C     1 
ATOM   1581  O  O     . SER A 1  210  ? -7.235  23.016  -33.634 1.00 73.95  ? 210  SER A O     1 
ATOM   1582  C  CB    . SER A 1  210  ? -8.769  25.565  -32.693 1.00 74.89  ? 210  SER A CB    1 
ATOM   1583  O  OG    . SER A 1  210  ? -7.537  25.406  -32.010 1.00 64.88  ? 210  SER A OG    1 
ATOM   1584  N  N     . ALA A 1  211  ? -9.421  22.535  -33.881 1.00 65.26  ? 211  ALA A N     1 
ATOM   1585  C  CA    . ALA A 1  211  ? -9.234  21.094  -33.810 1.00 74.98  ? 211  ALA A CA    1 
ATOM   1586  C  C     . ALA A 1  211  ? -8.610  20.588  -35.102 1.00 82.37  ? 211  ALA A C     1 
ATOM   1587  O  O     . ALA A 1  211  ? -7.681  19.781  -35.081 1.00 84.01  ? 211  ALA A O     1 
ATOM   1588  C  CB    . ALA A 1  211  ? -10.557 20.396  -33.547 1.00 74.24  ? 211  ALA A CB    1 
ATOM   1589  N  N     . GLY A 1  212  ? -9.124  21.079  -36.226 1.00 83.71  ? 212  GLY A N     1 
ATOM   1590  C  CA    . GLY A 1  212  ? -8.635  20.686  -37.535 1.00 84.18  ? 212  GLY A CA    1 
ATOM   1591  C  C     . GLY A 1  212  ? -7.231  21.182  -37.823 1.00 83.77  ? 212  GLY A C     1 
ATOM   1592  O  O     . GLY A 1  212  ? -6.403  20.439  -38.352 1.00 87.29  ? 212  GLY A O     1 
ATOM   1593  N  N     . LYS A 1  213  ? -6.967  22.441  -37.481 1.00 81.67  ? 213  LYS A N     1 
ATOM   1594  C  CA    . LYS A 1  213  ? -5.642  23.032  -37.648 1.00 80.96  ? 213  LYS A CA    1 
ATOM   1595  C  C     . LYS A 1  213  ? -4.592  22.214  -36.908 1.00 80.56  ? 213  LYS A C     1 
ATOM   1596  O  O     . LYS A 1  213  ? -3.465  22.049  -37.376 1.00 76.69  ? 213  LYS A O     1 
ATOM   1597  C  CB    . LYS A 1  213  ? -5.637  24.480  -37.151 1.00 89.20  ? 213  LYS A CB    1 
ATOM   1598  C  CG    . LYS A 1  213  ? -4.252  25.090  -36.979 1.00 94.18  ? 213  LYS A CG    1 
ATOM   1599  C  CD    . LYS A 1  213  ? -3.506  25.182  -38.299 1.00 89.78  ? 213  LYS A CD    1 
ATOM   1600  C  CE    . LYS A 1  213  ? -2.164  25.872  -38.121 1.00 88.03  ? 213  LYS A CE    1 
ATOM   1601  N  NZ    . LYS A 1  213  ? -2.316  27.213  -37.488 1.00 84.82  ? 213  LYS A NZ    1 
ATOM   1602  N  N     . THR A 1  214  ? -4.982  21.696  -35.750 1.00 78.52  ? 214  THR A N     1 
ATOM   1603  C  CA    . THR A 1  214  ? -4.110  20.849  -34.954 1.00 80.87  ? 214  THR A CA    1 
ATOM   1604  C  C     . THR A 1  214  ? -3.847  19.520  -35.651 1.00 81.52  ? 214  THR A C     1 
ATOM   1605  O  O     . THR A 1  214  ? -2.698  19.149  -35.883 1.00 82.70  ? 214  THR A O     1 
ATOM   1606  C  CB    . THR A 1  214  ? -4.711  20.585  -33.564 1.00 77.39  ? 214  THR A CB    1 
ATOM   1607  O  OG1   . THR A 1  214  ? -4.831  21.825  -32.854 1.00 75.04  ? 214  THR A OG1   1 
ATOM   1608  C  CG2   . THR A 1  214  ? -3.828  19.635  -32.774 1.00 85.08  ? 214  THR A CG2   1 
ATOM   1609  N  N     . LEU A 1  215  ? -4.921  18.817  -35.994 1.00 78.57  ? 215  LEU A N     1 
ATOM   1610  C  CA    . LEU A 1  215  ? -4.826  17.486  -36.586 1.00 78.09  ? 215  LEU A CA    1 
ATOM   1611  C  C     . LEU A 1  215  ? -4.055  17.471  -37.899 1.00 81.93  ? 215  LEU A C     1 
ATOM   1612  O  O     . LEU A 1  215  ? -3.255  16.568  -38.142 1.00 83.97  ? 215  LEU A O     1 
ATOM   1613  C  CB    . LEU A 1  215  ? -6.223  16.911  -36.808 1.00 77.02  ? 215  LEU A CB    1 
ATOM   1614  C  CG    . LEU A 1  215  ? -7.040  16.716  -35.533 1.00 78.18  ? 215  LEU A CG    1 
ATOM   1615  C  CD1   . LEU A 1  215  ? -8.485  16.394  -35.865 1.00 75.51  ? 215  LEU A CD1   1 
ATOM   1616  C  CD2   . LEU A 1  215  ? -6.426  15.625  -34.672 1.00 82.74  ? 215  LEU A CD2   1 
ATOM   1617  N  N     . VAL A 1  216  ? -4.305  18.466  -38.745 1.00 85.48  ? 216  VAL A N     1 
ATOM   1618  C  CA    . VAL A 1  216  ? -3.622  18.563  -40.030 1.00 85.47  ? 216  VAL A CA    1 
ATOM   1619  C  C     . VAL A 1  216  ? -2.108  18.595  -39.826 1.00 84.66  ? 216  VAL A C     1 
ATOM   1620  O  O     . VAL A 1  216  ? -1.366  17.885  -40.506 1.00 85.12  ? 216  VAL A O     1 
ATOM   1621  C  CB    . VAL A 1  216  ? -4.075  19.814  -40.822 1.00 88.87  ? 216  VAL A CB    1 
ATOM   1622  C  CG1   . VAL A 1  216  ? -3.060  20.172  -41.897 1.00 90.82  ? 216  VAL A CG1   1 
ATOM   1623  C  CG2   . VAL A 1  216  ? -5.450  19.588  -41.438 1.00 87.22  ? 216  VAL A CG2   1 
ATOM   1624  N  N     . GLU A 1  217  ? -1.663  19.393  -38.860 1.00 87.27  ? 217  GLU A N     1 
ATOM   1625  C  CA    . GLU A 1  217  ? -0.240  19.543  -38.570 1.00 94.79  ? 217  GLU A CA    1 
ATOM   1626  C  C     . GLU A 1  217  ? 0.367   18.260  -37.999 1.00 96.07  ? 217  GLU A C     1 
ATOM   1627  O  O     . GLU A 1  217  ? 1.589   18.104  -37.951 1.00 97.17  ? 217  GLU A O     1 
ATOM   1628  C  CB    . GLU A 1  217  ? -0.022  20.707  -37.599 1.00 94.34  ? 217  GLU A CB    1 
ATOM   1629  C  CG    . GLU A 1  217  ? 1.355   21.340  -37.683 1.00 96.32  ? 217  GLU A CG    1 
ATOM   1630  C  CD    . GLU A 1  217  ? 1.449   22.638  -36.907 1.00 102.94 ? 217  GLU A CD    1 
ATOM   1631  O  OE1   . GLU A 1  217  ? 2.485   23.326  -37.022 1.00 114.11 ? 217  GLU A OE1   1 
ATOM   1632  O  OE2   . GLU A 1  217  ? 0.490   22.970  -36.179 1.00 100.83 ? 217  GLU A OE2   1 
ATOM   1633  N  N     . LEU A 1  218  ? -0.496  17.344  -37.570 1.00 93.10  ? 218  LEU A N     1 
ATOM   1634  C  CA    . LEU A 1  218  ? -0.060  16.065  -37.023 1.00 88.67  ? 218  LEU A CA    1 
ATOM   1635  C  C     . LEU A 1  218  ? 0.054   15.008  -38.116 1.00 87.63  ? 218  LEU A C     1 
ATOM   1636  O  O     . LEU A 1  218  ? 1.026   14.255  -38.166 1.00 86.35  ? 218  LEU A O     1 
ATOM   1637  C  CB    . LEU A 1  218  ? -1.025  15.595  -35.931 1.00 87.38  ? 218  LEU A CB    1 
ATOM   1638  C  CG    . LEU A 1  218  ? -0.655  15.933  -34.483 1.00 94.14  ? 218  LEU A CG    1 
ATOM   1639  C  CD1   . LEU A 1  218  ? 0.673   15.285  -34.123 1.00 97.93  ? 218  LEU A CD1   1 
ATOM   1640  C  CD2   . LEU A 1  218  ? -0.603  17.437  -34.234 1.00 92.36  ? 218  LEU A CD2   1 
ATOM   1641  N  N     . PHE A 1  219  ? -0.944  14.965  -38.993 1.00 89.20  ? 219  PHE A N     1 
ATOM   1642  C  CA    . PHE A 1  219  ? -0.979  13.999  -40.088 1.00 94.19  ? 219  PHE A CA    1 
ATOM   1643  C  C     . PHE A 1  219  ? -0.049  14.391  -41.237 1.00 105.76 ? 219  PHE A C     1 
ATOM   1644  O  O     . PHE A 1  219  ? 0.234   13.577  -42.119 1.00 106.27 ? 219  PHE A O     1 
ATOM   1645  C  CB    . PHE A 1  219  ? -2.410  13.841  -40.612 1.00 83.13  ? 219  PHE A CB    1 
ATOM   1646  C  CG    . PHE A 1  219  ? -3.309  13.046  -39.706 1.00 64.47  ? 219  PHE A CG    1 
ATOM   1647  C  CD1   . PHE A 1  219  ? -3.740  11.786  -40.076 1.00 63.97  ? 219  PHE A CD1   1 
ATOM   1648  C  CD2   . PHE A 1  219  ? -3.725  13.559  -38.491 1.00 65.18  ? 219  PHE A CD2   1 
ATOM   1649  C  CE1   . PHE A 1  219  ? -4.567  11.053  -39.252 1.00 58.13  ? 219  PHE A CE1   1 
ATOM   1650  C  CE2   . PHE A 1  219  ? -4.549  12.830  -37.663 1.00 61.40  ? 219  PHE A CE2   1 
ATOM   1651  C  CZ    . PHE A 1  219  ? -4.975  11.577  -38.046 1.00 56.18  ? 219  PHE A CZ    1 
ATOM   1652  N  N     . GLY A 1  220  ? 0.424   15.635  -41.225 1.00 108.06 ? 220  GLY A N     1 
ATOM   1653  C  CA    . GLY A 1  220  ? 1.312   16.125  -42.265 1.00 107.50 ? 220  GLY A CA    1 
ATOM   1654  C  C     . GLY A 1  220  ? 2.685   15.480  -42.221 1.00 114.36 ? 220  GLY A C     1 
ATOM   1655  O  O     . GLY A 1  220  ? 3.413   15.485  -43.214 1.00 114.46 ? 220  GLY A O     1 
ATOM   1656  N  N     . LEU A 1  221  ? 3.035   14.921  -41.065 1.00 120.35 ? 221  LEU A N     1 
ATOM   1657  C  CA    . LEU A 1  221  ? 4.330   14.274  -40.871 1.00 121.27 ? 221  LEU A CA    1 
ATOM   1658  C  C     . LEU A 1  221  ? 4.305   12.845  -41.407 1.00 113.33 ? 221  LEU A C     1 
ATOM   1659  O  O     . LEU A 1  221  ? 5.338   12.177  -41.484 1.00 102.79 ? 221  LEU A O     1 
ATOM   1660  C  CB    . LEU A 1  221  ? 4.716   14.291  -39.388 1.00 118.53 ? 221  LEU A CB    1 
ATOM   1661  C  CG    . LEU A 1  221  ? 4.932   15.680  -38.775 1.00 116.11 ? 221  LEU A CG    1 
ATOM   1662  C  CD1   . LEU A 1  221  ? 4.563   15.689  -37.301 1.00 110.41 ? 221  LEU A CD1   1 
ATOM   1663  C  CD2   . LEU A 1  221  ? 6.370   16.148  -38.969 1.00 108.08 ? 221  LEU A CD2   1 
ATOM   1664  N  N     . ALA A 1  222  ? 3.111   12.392  -41.779 1.00 114.32 ? 222  ALA A N     1 
ATOM   1665  C  CA    . ALA A 1  222  ? 2.917   11.075  -42.373 1.00 119.94 ? 222  ALA A CA    1 
ATOM   1666  C  C     . ALA A 1  222  ? 3.088   11.135  -43.888 1.00 122.49 ? 222  ALA A C     1 
ATOM   1667  O  O     . ALA A 1  222  ? 3.016   10.115  -44.574 1.00 123.05 ? 222  ALA A O     1 
ATOM   1668  C  CB    . ALA A 1  222  ? 1.541   10.528  -42.016 1.00 106.21 ? 222  ALA A CB    1 
ATOM   1669  N  N     . ARG A 1  223  ? 3.315   12.340  -44.401 1.00 121.62 ? 223  ARG A N     1 
ATOM   1670  C  CA    . ARG A 1  223  ? 3.456   12.548  -45.836 1.00 117.22 ? 223  ARG A CA    1 
ATOM   1671  C  C     . ARG A 1  223  ? 4.892   12.926  -46.202 1.00 119.08 ? 223  ARG A C     1 
ATOM   1672  O  O     . ARG A 1  223  ? 5.327   12.712  -47.335 1.00 127.92 ? 223  ARG A O     1 
ATOM   1673  C  CB    . ARG A 1  223  ? 2.472   13.622  -46.311 1.00 119.21 ? 223  ARG A CB    1 
ATOM   1674  C  CG    . ARG A 1  223  ? 2.477   13.877  -47.811 1.00 114.10 ? 223  ARG A CG    1 
ATOM   1675  C  CD    . ARG A 1  223  ? 1.214   14.603  -48.251 1.00 103.50 ? 223  ARG A CD    1 
ATOM   1676  N  NE    . ARG A 1  223  ? 0.859   15.693  -47.346 1.00 108.52 ? 223  ARG A NE    1 
ATOM   1677  C  CZ    . ARG A 1  223  ? 1.269   16.950  -47.486 1.00 108.89 ? 223  ARG A CZ    1 
ATOM   1678  N  NH1   . ARG A 1  223  ? 2.054   17.286  -48.500 1.00 105.57 ? 223  ARG A NH1   1 
ATOM   1679  N  NH2   . ARG A 1  223  ? 0.892   17.872  -46.610 1.00 107.96 ? 223  ARG A NH2   1 
ATOM   1680  N  N     . GLU A 1  224  ? 5.630   13.476  -45.242 1.00 120.55 ? 224  GLU A N     1 
ATOM   1681  C  CA    . GLU A 1  224  ? 7.018   13.858  -45.487 1.00 128.47 ? 224  GLU A CA    1 
ATOM   1682  C  C     . GLU A 1  224  ? 7.884   12.626  -45.746 1.00 135.44 ? 224  GLU A C     1 
ATOM   1683  O  O     . GLU A 1  224  ? 7.683   11.572  -45.141 1.00 134.56 ? 224  GLU A O     1 
ATOM   1684  C  CB    . GLU A 1  224  ? 7.580   14.673  -44.316 1.00 130.75 ? 224  GLU A CB    1 
ATOM   1685  C  CG    . GLU A 1  224  ? 7.662   13.934  -42.988 1.00 121.48 ? 224  GLU A CG    1 
ATOM   1686  C  CD    . GLU A 1  224  ? 8.328   14.763  -41.902 1.00 125.01 ? 224  GLU A CD    1 
ATOM   1687  O  OE1   . GLU A 1  224  ? 8.704   15.923  -42.180 1.00 129.26 ? 224  GLU A OE1   1 
ATOM   1688  O  OE2   . GLU A 1  224  ? 8.475   14.257  -40.769 1.00 125.61 ? 224  GLU A OE2   1 
ATOM   1689  N  N     . LEU A 1  225  ? 8.841   12.768  -46.656 1.00 143.10 ? 225  LEU A N     1 
ATOM   1690  C  CA    . LEU A 1  225  ? 9.683   11.652  -47.073 1.00 144.75 ? 225  LEU A CA    1 
ATOM   1691  C  C     . LEU A 1  225  ? 10.892  11.477  -46.157 1.00 145.48 ? 225  LEU A C     1 
ATOM   1692  O  O     . LEU A 1  225  ? 11.282  12.398  -45.438 1.00 140.89 ? 225  LEU A O     1 
ATOM   1693  C  CB    . LEU A 1  225  ? 10.135  11.828  -48.536 1.00 140.40 ? 225  LEU A CB    1 
ATOM   1694  C  CG    . LEU A 1  225  ? 10.982  12.991  -49.100 1.00 133.81 ? 225  LEU A CG    1 
ATOM   1695  C  CD1   . LEU A 1  225  ? 10.374  14.370  -48.833 1.00 137.73 ? 225  LEU A CD1   1 
ATOM   1696  C  CD2   . LEU A 1  225  ? 12.443  12.949  -48.649 1.00 127.09 ? 225  LEU A CD2   1 
ATOM   1697  N  N     . ASN A 1  226  ? 11.477  10.283  -46.189 1.00 143.80 ? 226  ASN A N     1 
ATOM   1698  C  CA    . ASN A 1  226  ? 12.668  9.988   -45.402 1.00 136.06 ? 226  ASN A CA    1 
ATOM   1699  C  C     . ASN A 1  226  ? 13.929  10.501  -46.085 1.00 133.69 ? 226  ASN A C     1 
ATOM   1700  O  O     . ASN A 1  226  ? 14.176  11.706  -46.129 1.00 140.95 ? 226  ASN A O     1 
ATOM   1701  C  CB    . ASN A 1  226  ? 12.785  8.484   -45.152 1.00 132.61 ? 226  ASN A CB    1 
ATOM   1702  C  CG    . ASN A 1  226  ? 14.028  8.119   -44.363 1.00 138.12 ? 226  ASN A CG    1 
ATOM   1703  O  OD1   . ASN A 1  226  ? 14.535  8.919   -43.575 1.00 140.03 ? 226  ASN A OD1   1 
ATOM   1704  N  ND2   . ASN A 1  226  ? 14.526  6.907   -44.573 1.00 137.03 ? 226  ASN A ND2   1 
ATOM   1705  N  N     . ARG B 1  6    ? 8.520   19.180  -27.955 1.00 80.75  ? 6    ARG B N     1 
ATOM   1706  C  CA    . ARG B 1  6    ? 9.432   18.866  -29.049 1.00 92.07  ? 6    ARG B CA    1 
ATOM   1707  C  C     . ARG B 1  6    ? 8.677   18.282  -30.240 1.00 96.67  ? 6    ARG B C     1 
ATOM   1708  O  O     . ARG B 1  6    ? 7.723   17.523  -30.060 1.00 89.59  ? 6    ARG B O     1 
ATOM   1709  C  CB    . ARG B 1  6    ? 10.516  17.892  -28.581 1.00 89.32  ? 6    ARG B CB    1 
ATOM   1710  N  N     . PRO B 1  7    ? 9.097   18.648  -31.465 1.00 104.28 ? 7    PRO B N     1 
ATOM   1711  C  CA    . PRO B 1  7    ? 8.510   18.106  -32.696 1.00 96.40  ? 7    PRO B CA    1 
ATOM   1712  C  C     . PRO B 1  7    ? 8.635   16.592  -32.753 1.00 87.90  ? 7    PRO B C     1 
ATOM   1713  O  O     . PRO B 1  7    ? 9.631   16.036  -32.290 1.00 92.81  ? 7    PRO B O     1 
ATOM   1714  C  CB    . PRO B 1  7    ? 9.336   18.766  -33.804 1.00 93.08  ? 7    PRO B CB    1 
ATOM   1715  C  CG    . PRO B 1  7    ? 9.851   20.015  -33.191 1.00 104.42 ? 7    PRO B CG    1 
ATOM   1716  C  CD    . PRO B 1  7    ? 10.117  19.671  -31.754 1.00 106.89 ? 7    PRO B CD    1 
ATOM   1717  N  N     . THR B 1  8    ? 7.630   15.937  -33.320 1.00 84.08  ? 8    THR B N     1 
ATOM   1718  C  CA    . THR B 1  8    ? 7.583   14.483  -33.332 1.00 88.44  ? 8    THR B CA    1 
ATOM   1719  C  C     . THR B 1  8    ? 8.421   13.892  -34.463 1.00 89.13  ? 8    THR B C     1 
ATOM   1720  O  O     . THR B 1  8    ? 8.580   14.502  -35.523 1.00 86.75  ? 8    THR B O     1 
ATOM   1721  C  CB    . THR B 1  8    ? 6.139   13.983  -33.454 1.00 93.08  ? 8    THR B CB    1 
ATOM   1722  O  OG1   . THR B 1  8    ? 5.665   14.198  -34.788 1.00 88.18  ? 8    THR B OG1   1 
ATOM   1723  C  CG2   . THR B 1  8    ? 5.243   14.727  -32.472 1.00 92.27  ? 8    THR B CG2   1 
ATOM   1724  N  N     . LEU B 1  9    ? 8.948   12.695  -34.222 1.00 86.96  ? 9    LEU B N     1 
ATOM   1725  C  CA    . LEU B 1  9    ? 9.836   12.023  -35.165 1.00 77.70  ? 9    LEU B CA    1 
ATOM   1726  C  C     . LEU B 1  9    ? 9.139   10.874  -35.884 1.00 76.34  ? 9    LEU B C     1 
ATOM   1727  O  O     . LEU B 1  9    ? 8.110   10.374  -35.429 1.00 75.65  ? 9    LEU B O     1 
ATOM   1728  C  CB    . LEU B 1  9    ? 11.074  11.495  -34.439 1.00 75.51  ? 9    LEU B CB    1 
ATOM   1729  C  CG    . LEU B 1  9    ? 11.693  12.428  -33.398 1.00 77.47  ? 9    LEU B CG    1 
ATOM   1730  C  CD1   . LEU B 1  9    ? 12.877  11.756  -32.727 1.00 77.21  ? 9    LEU B CD1   1 
ATOM   1731  C  CD2   . LEU B 1  9    ? 12.104  13.753  -34.026 1.00 81.51  ? 9    LEU B CD2   1 
ATOM   1732  N  N     . SER B 1  10   ? 9.717   10.451  -37.003 1.00 78.40  ? 10   SER B N     1 
ATOM   1733  C  CA    . SER B 1  10   ? 9.186   9.324   -37.760 1.00 81.85  ? 10   SER B CA    1 
ATOM   1734  C  C     . SER B 1  10   ? 10.290  8.318   -38.086 1.00 80.72  ? 10   SER B C     1 
ATOM   1735  O  O     . SER B 1  10   ? 11.342  8.686   -38.610 1.00 88.02  ? 10   SER B O     1 
ATOM   1736  C  CB    . SER B 1  10   ? 8.514   9.814   -39.042 1.00 94.31  ? 10   SER B CB    1 
ATOM   1737  O  OG    . SER B 1  10   ? 7.924   8.735   -39.747 1.00 98.56  ? 10   SER B OG    1 
ATOM   1738  N  N     . GLU B 1  11   ? 10.045  7.048   -37.773 1.00 71.82  ? 11   GLU B N     1 
ATOM   1739  C  CA    . GLU B 1  11   ? 11.066  6.011   -37.901 1.00 75.02  ? 11   GLU B CA    1 
ATOM   1740  C  C     . GLU B 1  11   ? 10.553  4.795   -38.674 1.00 79.05  ? 11   GLU B C     1 
ATOM   1741  O  O     . GLU B 1  11   ? 9.367   4.712   -38.996 1.00 78.26  ? 11   GLU B O     1 
ATOM   1742  C  CB    . GLU B 1  11   ? 11.556  5.587   -36.515 1.00 85.24  ? 11   GLU B CB    1 
ATOM   1743  C  CG    . GLU B 1  11   ? 11.990  6.751   -35.631 1.00 94.34  ? 11   GLU B CG    1 
ATOM   1744  C  CD    . GLU B 1  11   ? 12.359  6.320   -34.222 1.00 94.77  ? 11   GLU B CD    1 
ATOM   1745  O  OE1   . GLU B 1  11   ? 12.562  5.107   -33.999 1.00 99.90  ? 11   GLU B OE1   1 
ATOM   1746  O  OE2   . GLU B 1  11   ? 12.443  7.198   -33.337 1.00 86.28  ? 11   GLU B OE2   1 
ATOM   1747  N  N     . ASP B 1  12   ? 11.448  3.854   -38.967 1.00 85.30  ? 12   ASP B N     1 
ATOM   1748  C  CA    . ASP B 1  12   ? 11.098  2.695   -39.786 1.00 81.58  ? 12   ASP B CA    1 
ATOM   1749  C  C     . ASP B 1  12   ? 12.030  1.500   -39.563 1.00 87.92  ? 12   ASP B C     1 
ATOM   1750  O  O     . ASP B 1  12   ? 13.246  1.600   -39.736 1.00 92.40  ? 12   ASP B O     1 
ATOM   1751  C  CB    . ASP B 1  12   ? 11.109  3.083   -41.269 1.00 81.35  ? 12   ASP B CB    1 
ATOM   1752  C  CG    . ASP B 1  12   ? 10.433  2.050   -42.160 1.00 79.08  ? 12   ASP B CG    1 
ATOM   1753  O  OD1   . ASP B 1  12   ? 10.205  0.907   -41.710 1.00 81.55  ? 12   ASP B OD1   1 
ATOM   1754  O  OD2   . ASP B 1  12   ? 10.132  2.385   -43.325 1.00 83.21  ? 12   ASP B OD2   1 
ATOM   1755  N  N     . VAL B 1  13   ? 11.443  0.369   -39.186 1.00 91.97  ? 13   VAL B N     1 
ATOM   1756  C  CA    . VAL B 1  13   ? 12.158  -0.903  -39.157 1.00 94.97  ? 13   VAL B CA    1 
ATOM   1757  C  C     . VAL B 1  13   ? 11.592  -1.775  -40.280 1.00 89.10  ? 13   VAL B C     1 
ATOM   1758  O  O     . VAL B 1  13   ? 10.377  -1.863  -40.451 1.00 88.09  ? 13   VAL B O     1 
ATOM   1759  C  CB    . VAL B 1  13   ? 12.031  -1.607  -37.793 1.00 94.53  ? 13   VAL B CB    1 
ATOM   1760  C  CG1   . VAL B 1  13   ? 13.050  -2.731  -37.683 1.00 94.34  ? 13   VAL B CG1   1 
ATOM   1761  C  CG2   . VAL B 1  13   ? 12.224  -0.604  -36.661 1.00 84.78  ? 13   VAL B CG2   1 
ATOM   1762  N  N     . LEU B 1  14   ? 12.468  -2.416  -41.047 1.00 85.33  ? 14   LEU B N     1 
ATOM   1763  C  CA    . LEU B 1  14   ? 12.073  -2.916  -42.362 1.00 83.38  ? 14   LEU B CA    1 
ATOM   1764  C  C     . LEU B 1  14   ? 11.847  -4.417  -42.509 1.00 81.27  ? 14   LEU B C     1 
ATOM   1765  O  O     . LEU B 1  14   ? 12.246  -5.223  -41.668 1.00 80.13  ? 14   LEU B O     1 
ATOM   1766  C  CB    . LEU B 1  14   ? 13.121  -2.500  -43.397 1.00 86.69  ? 14   LEU B CB    1 
ATOM   1767  C  CG    . LEU B 1  14   ? 13.103  -1.051  -43.878 1.00 87.37  ? 14   LEU B CG    1 
ATOM   1768  C  CD1   . LEU B 1  14   ? 14.185  -0.835  -44.926 1.00 75.03  ? 14   LEU B CD1   1 
ATOM   1769  C  CD2   . LEU B 1  14   ? 11.731  -0.687  -44.429 1.00 90.87  ? 14   LEU B CD2   1 
ATOM   1770  N  N     . THR B 1  15   ? 11.168  -4.749  -43.604 1.00 86.45  ? 15   THR B N     1 
ATOM   1771  C  CA    . THR B 1  15   ? 11.108  -6.087  -44.186 1.00 88.25  ? 15   THR B CA    1 
ATOM   1772  C  C     . THR B 1  15   ? 10.645  -5.860  -45.629 1.00 89.98  ? 15   THR B C     1 
ATOM   1773  O  O     . THR B 1  15   ? 10.087  -4.807  -45.936 1.00 93.73  ? 15   THR B O     1 
ATOM   1774  C  CB    . THR B 1  15   ? 10.155  -7.041  -43.429 1.00 81.22  ? 15   THR B CB    1 
ATOM   1775  O  OG1   . THR B 1  15   ? 10.355  -6.907  -42.017 1.00 78.02  ? 15   THR B OG1   1 
ATOM   1776  C  CG2   . THR B 1  15   ? 10.403  -8.491  -43.835 1.00 77.56  ? 15   THR B CG2   1 
ATOM   1777  N  N     . ASP B 1  16   ? 10.889  -6.821  -46.515 1.00 90.67  ? 16   ASP B N     1 
ATOM   1778  C  CA    . ASP B 1  16   ? 10.624  -6.634  -47.943 1.00 95.69  ? 16   ASP B CA    1 
ATOM   1779  C  C     . ASP B 1  16   ? 9.166   -6.309  -48.271 1.00 86.30  ? 16   ASP B C     1 
ATOM   1780  O  O     . ASP B 1  16   ? 8.886   -5.445  -49.104 1.00 74.24  ? 16   ASP B O     1 
ATOM   1781  C  CB    . ASP B 1  16   ? 11.050  -7.881  -48.720 1.00 110.90 ? 16   ASP B CB    1 
ATOM   1782  C  CG    . ASP B 1  16   ? 12.544  -8.131  -48.648 1.00 105.79 ? 16   ASP B CG    1 
ATOM   1783  O  OD1   . ASP B 1  16   ? 13.294  -7.166  -48.395 1.00 105.71 ? 16   ASP B OD1   1 
ATOM   1784  O  OD2   . ASP B 1  16   ? 12.966  -9.290  -48.849 1.00 93.29  ? 16   ASP B OD2   1 
ATOM   1785  N  N     . ASN B 1  17   ? 8.243   -7.004  -47.615 1.00 92.49  ? 17   ASN B N     1 
ATOM   1786  C  CA    . ASN B 1  17   ? 6.822   -6.843  -47.899 1.00 95.47  ? 17   ASN B CA    1 
ATOM   1787  C  C     . ASN B 1  17   ? 6.101   -5.969  -46.873 1.00 97.12  ? 17   ASN B C     1 
ATOM   1788  O  O     . ASN B 1  17   ? 5.099   -5.327  -47.191 1.00 93.07  ? 17   ASN B O     1 
ATOM   1789  C  CB    . ASN B 1  17   ? 6.144   -8.212  -47.978 1.00 98.96  ? 17   ASN B CB    1 
ATOM   1790  C  CG    . ASN B 1  17   ? 5.371   -8.406  -49.267 1.00 98.50  ? 17   ASN B CG    1 
ATOM   1791  O  OD1   . ASN B 1  17   ? 5.660   -7.766  -50.278 1.00 104.71 ? 17   ASN B OD1   1 
ATOM   1792  N  ND2   . ASN B 1  17   ? 4.381   -9.291  -49.238 1.00 91.18  ? 17   ASN B ND2   1 
ATOM   1793  N  N     . ARG B 1  18   ? 6.612   -5.946  -45.645 1.00 97.05  ? 18   ARG B N     1 
ATOM   1794  C  CA    . ARG B 1  18   ? 6.003   -5.147  -44.586 1.00 93.44  ? 18   ARG B CA    1 
ATOM   1795  C  C     . ARG B 1  18   ? 7.050   -4.432  -43.738 1.00 89.86  ? 18   ARG B C     1 
ATOM   1796  O  O     . ARG B 1  18   ? 8.243   -4.679  -43.876 1.00 89.94  ? 18   ARG B O     1 
ATOM   1797  C  CB    . ARG B 1  18   ? 5.122   -6.024  -43.698 1.00 90.52  ? 18   ARG B CB    1 
ATOM   1798  C  CG    . ARG B 1  18   ? 5.861   -6.987  -42.790 1.00 85.39  ? 18   ARG B CG    1 
ATOM   1799  C  CD    . ARG B 1  18   ? 4.866   -7.745  -41.925 1.00 85.50  ? 18   ARG B CD    1 
ATOM   1800  N  NE    . ARG B 1  18   ? 5.511   -8.484  -40.844 1.00 79.32  ? 18   ARG B NE    1 
ATOM   1801  C  CZ    . ARG B 1  18   ? 4.854   -9.100  -39.867 1.00 79.38  ? 18   ARG B CZ    1 
ATOM   1802  N  NH1   . ARG B 1  18   ? 3.530   -9.066  -39.831 1.00 83.24  ? 18   ARG B NH1   1 
ATOM   1803  N  NH2   . ARG B 1  18   ? 5.522   -9.747  -38.924 1.00 82.41  ? 18   ARG B NH2   1 
ATOM   1804  N  N     . SER B 1  19   ? 6.598   -3.542  -42.861 1.00 87.28  ? 19   SER B N     1 
ATOM   1805  C  CA    . SER B 1  19   ? 7.514   -2.778  -42.020 1.00 87.25  ? 19   SER B CA    1 
ATOM   1806  C  C     . SER B 1  19   ? 6.796   -2.134  -40.838 1.00 87.04  ? 19   SER B C     1 
ATOM   1807  O  O     . SER B 1  19   ? 5.576   -1.973  -40.854 1.00 81.65  ? 19   SER B O     1 
ATOM   1808  C  CB    . SER B 1  19   ? 8.226   -1.707  -42.850 1.00 83.67  ? 19   SER B CB    1 
ATOM   1809  O  OG    . SER B 1  19   ? 7.306   -0.996  -43.659 1.00 81.17  ? 19   SER B OG    1 
ATOM   1810  N  N     . GLN B 1  20   ? 7.562   -1.768  -39.814 1.00 87.18  ? 20   GLN B N     1 
ATOM   1811  C  CA    . GLN B 1  20   ? 7.006   -1.126  -38.628 1.00 74.67  ? 20   GLN B CA    1 
ATOM   1812  C  C     . GLN B 1  20   ? 7.352   0.356   -38.562 1.00 75.10  ? 20   GLN B C     1 
ATOM   1813  O  O     . GLN B 1  20   ? 8.482   0.756   -38.842 1.00 76.95  ? 20   GLN B O     1 
ATOM   1814  C  CB    . GLN B 1  20   ? 7.500   -1.820  -37.362 1.00 69.66  ? 20   GLN B CB    1 
ATOM   1815  C  CG    . GLN B 1  20   ? 6.866   -3.165  -37.095 1.00 66.02  ? 20   GLN B CG    1 
ATOM   1816  C  CD    . GLN B 1  20   ? 7.226   -3.689  -35.724 1.00 73.25  ? 20   GLN B CD    1 
ATOM   1817  O  OE1   . GLN B 1  20   ? 8.102   -3.142  -35.055 1.00 71.76  ? 20   GLN B OE1   1 
ATOM   1818  N  NE2   . GLN B 1  20   ? 6.548   -4.745  -35.292 1.00 84.09  ? 20   GLN B NE2   1 
ATOM   1819  N  N     . PHE B 1  21   ? 6.370   1.166   -38.180 1.00 74.28  ? 21   PHE B N     1 
ATOM   1820  C  CA    . PHE B 1  21   ? 6.557   2.607   -38.074 1.00 72.80  ? 21   PHE B CA    1 
ATOM   1821  C  C     . PHE B 1  21   ? 6.397   3.063   -36.625 1.00 65.04  ? 21   PHE B C     1 
ATOM   1822  O  O     . PHE B 1  21   ? 5.520   2.584   -35.907 1.00 62.78  ? 21   PHE B O     1 
ATOM   1823  C  CB    . PHE B 1  21   ? 5.569   3.343   -38.983 1.00 75.76  ? 21   PHE B CB    1 
ATOM   1824  C  CG    . PHE B 1  21   ? 5.665   2.950   -40.435 1.00 78.27  ? 21   PHE B CG    1 
ATOM   1825  C  CD1   . PHE B 1  21   ? 6.588   3.554   -41.272 1.00 79.96  ? 21   PHE B CD1   1 
ATOM   1826  C  CD2   . PHE B 1  21   ? 4.825   1.982   -40.964 1.00 78.34  ? 21   PHE B CD2   1 
ATOM   1827  C  CE1   . PHE B 1  21   ? 6.676   3.198   -42.608 1.00 81.04  ? 21   PHE B CE1   1 
ATOM   1828  C  CE2   . PHE B 1  21   ? 4.908   1.622   -42.299 1.00 78.59  ? 21   PHE B CE2   1 
ATOM   1829  C  CZ    . PHE B 1  21   ? 5.835   2.231   -43.121 1.00 81.52  ? 21   PHE B CZ    1 
ATOM   1830  N  N     . VAL B 1  22   ? 7.251   3.986   -36.199 1.00 62.93  ? 22   VAL B N     1 
ATOM   1831  C  CA    . VAL B 1  22   ? 7.268   4.424   -34.809 1.00 60.49  ? 22   VAL B CA    1 
ATOM   1832  C  C     . VAL B 1  22   ? 7.092   5.935   -34.697 1.00 68.38  ? 22   VAL B C     1 
ATOM   1833  O  O     . VAL B 1  22   ? 7.902   6.697   -35.221 1.00 78.43  ? 22   VAL B O     1 
ATOM   1834  C  CB    . VAL B 1  22   ? 8.583   4.013   -34.118 1.00 68.52  ? 22   VAL B CB    1 
ATOM   1835  C  CG1   . VAL B 1  22   ? 8.604   4.495   -32.679 1.00 77.89  ? 22   VAL B CG1   1 
ATOM   1836  C  CG2   . VAL B 1  22   ? 8.770   2.504   -34.185 1.00 73.00  ? 22   VAL B CG2   1 
ATOM   1837  N  N     . ILE B 1  23   ? 6.035   6.363   -34.013 1.00 70.46  ? 23   ILE B N     1 
ATOM   1838  C  CA    . ILE B 1  23   ? 5.754   7.787   -33.846 1.00 63.71  ? 23   ILE B CA    1 
ATOM   1839  C  C     . ILE B 1  23   ? 5.909   8.229   -32.394 1.00 64.21  ? 23   ILE B C     1 
ATOM   1840  O  O     . ILE B 1  23   ? 5.326   7.630   -31.490 1.00 67.72  ? 23   ILE B O     1 
ATOM   1841  C  CB    . ILE B 1  23   ? 4.332   8.142   -34.314 1.00 62.34  ? 23   ILE B CB    1 
ATOM   1842  C  CG1   . ILE B 1  23   ? 4.059   7.561   -35.701 1.00 66.98  ? 23   ILE B CG1   1 
ATOM   1843  C  CG2   . ILE B 1  23   ? 4.136   9.647   -34.317 1.00 66.02  ? 23   ILE B CG2   1 
ATOM   1844  C  CD1   . ILE B 1  23   ? 2.655   7.825   -36.200 1.00 62.30  ? 23   ILE B CD1   1 
ATOM   1845  N  N     . GLU B 1  24   ? 6.690   9.285   -32.183 1.00 65.77  ? 24   GLU B N     1 
ATOM   1846  C  CA    . GLU B 1  24   ? 6.941   9.827   -30.849 1.00 81.24  ? 24   GLU B CA    1 
ATOM   1847  C  C     . GLU B 1  24   ? 7.673   11.166  -30.955 1.00 86.75  ? 24   GLU B C     1 
ATOM   1848  O  O     . GLU B 1  24   ? 8.413   11.390  -31.913 1.00 89.20  ? 24   GLU B O     1 
ATOM   1849  C  CB    . GLU B 1  24   ? 7.752   8.834   -30.004 1.00 82.50  ? 24   GLU B CB    1 
ATOM   1850  C  CG    . GLU B 1  24   ? 9.018   8.310   -30.676 1.00 86.60  ? 24   GLU B CG    1 
ATOM   1851  C  CD    . GLU B 1  24   ? 9.760   7.294   -29.819 1.00 83.13  ? 24   GLU B CD    1 
ATOM   1852  O  OE1   . GLU B 1  24   ? 9.470   7.210   -28.607 1.00 93.84  ? 24   GLU B OE1   1 
ATOM   1853  O  OE2   . GLU B 1  24   ? 10.632  6.578   -30.358 1.00 72.22  ? 24   GLU B OE2   1 
ATOM   1854  N  N     . PRO B 1  25   ? 7.469   12.067  -29.976 1.00 84.54  ? 25   PRO B N     1 
ATOM   1855  C  CA    . PRO B 1  25   ? 6.571   11.926  -28.826 1.00 84.17  ? 25   PRO B CA    1 
ATOM   1856  C  C     . PRO B 1  25   ? 5.227   12.635  -29.001 1.00 77.92  ? 25   PRO B C     1 
ATOM   1857  O  O     . PRO B 1  25   ? 5.177   13.856  -29.161 1.00 72.38  ? 25   PRO B O     1 
ATOM   1858  C  CB    . PRO B 1  25   ? 7.372   12.567  -27.696 1.00 87.06  ? 25   PRO B CB    1 
ATOM   1859  C  CG    . PRO B 1  25   ? 8.143   13.661  -28.380 1.00 78.74  ? 25   PRO B CG    1 
ATOM   1860  C  CD    . PRO B 1  25   ? 8.360   13.232  -29.820 1.00 79.81  ? 25   PRO B CD    1 
ATOM   1861  N  N     . LEU B 1  26   ? 4.143   11.868  -28.963 1.00 76.70  ? 26   LEU B N     1 
ATOM   1862  C  CA    . LEU B 1  26   ? 2.807   12.439  -29.067 1.00 74.39  ? 26   LEU B CA    1 
ATOM   1863  C  C     . LEU B 1  26   ? 2.379   13.075  -27.754 1.00 79.07  ? 26   LEU B C     1 
ATOM   1864  O  O     . LEU B 1  26   ? 2.724   12.588  -26.678 1.00 82.29  ? 26   LEU B O     1 
ATOM   1865  C  CB    . LEU B 1  26   ? 1.788   11.373  -29.477 1.00 78.28  ? 26   LEU B CB    1 
ATOM   1866  C  CG    . LEU B 1  26   ? 1.932   10.750  -30.866 1.00 77.04  ? 26   LEU B CG    1 
ATOM   1867  C  CD1   . LEU B 1  26   ? 0.673   9.974   -31.232 1.00 77.13  ? 26   LEU B CD1   1 
ATOM   1868  C  CD2   . LEU B 1  26   ? 2.237   11.816  -31.907 1.00 82.38  ? 26   LEU B CD2   1 
ATOM   1869  N  N     . GLU B 1  27   ? 1.630   14.168  -27.851 1.00 79.41  ? 27   GLU B N     1 
ATOM   1870  C  CA    . GLU B 1  27   ? 1.017   14.786  -26.683 1.00 80.64  ? 27   GLU B CA    1 
ATOM   1871  C  C     . GLU B 1  27   ? 0.097   13.765  -26.015 1.00 78.45  ? 27   GLU B C     1 
ATOM   1872  O  O     . GLU B 1  27   ? -0.677  13.097  -26.700 1.00 74.54  ? 27   GLU B O     1 
ATOM   1873  C  CB    . GLU B 1  27   ? 0.254   16.049  -27.092 1.00 80.67  ? 27   GLU B CB    1 
ATOM   1874  C  CG    . GLU B 1  27   ? -0.374  16.823  -25.948 1.00 78.79  ? 27   GLU B CG    1 
ATOM   1875  C  CD    . GLU B 1  27   ? -0.481  18.302  -26.249 1.00 77.71  ? 27   GLU B CD    1 
ATOM   1876  O  OE1   . GLU B 1  27   ? 0.477   18.853  -26.831 1.00 78.29  ? 27   GLU B OE1   1 
ATOM   1877  O  OE2   . GLU B 1  27   ? -1.519  18.910  -25.913 1.00 72.75  ? 27   GLU B OE2   1 
ATOM   1878  N  N     . PRO B 1  28   ? 0.201   13.626  -24.681 1.00 75.35  ? 28   PRO B N     1 
ATOM   1879  C  CA    . PRO B 1  28   ? -0.514  12.609  -23.898 1.00 73.34  ? 28   PRO B CA    1 
ATOM   1880  C  C     . PRO B 1  28   ? -1.967  12.394  -24.319 1.00 63.11  ? 28   PRO B C     1 
ATOM   1881  O  O     . PRO B 1  28   ? -2.757  13.336  -24.341 1.00 58.87  ? 28   PRO B O     1 
ATOM   1882  C  CB    . PRO B 1  28   ? -0.445  13.159  -22.462 1.00 76.77  ? 28   PRO B CB    1 
ATOM   1883  C  CG    . PRO B 1  28   ? 0.147   14.550  -22.578 1.00 81.11  ? 28   PRO B CG    1 
ATOM   1884  C  CD    . PRO B 1  28   ? 0.986   14.509  -23.806 1.00 75.79  ? 28   PRO B CD    1 
ATOM   1885  N  N     . GLY B 1  29   ? -2.295  11.153  -24.665 1.00 66.54  ? 29   GLY B N     1 
ATOM   1886  C  CA    . GLY B 1  29   ? -3.652  10.786  -25.017 1.00 65.03  ? 29   GLY B CA    1 
ATOM   1887  C  C     . GLY B 1  29   ? -3.923  10.802  -26.509 1.00 69.74  ? 29   GLY B C     1 
ATOM   1888  O  O     . GLY B 1  29   ? -5.045  10.534  -26.937 1.00 69.29  ? 29   GLY B O     1 
ATOM   1889  N  N     . PHE B 1  30   ? -2.900  11.112  -27.303 1.00 73.82  ? 30   PHE B N     1 
ATOM   1890  C  CA    . PHE B 1  30   ? -3.074  11.236  -28.750 1.00 73.12  ? 30   PHE B CA    1 
ATOM   1891  C  C     . PHE B 1  30   ? -2.651  9.977   -29.502 1.00 60.70  ? 30   PHE B C     1 
ATOM   1892  O  O     . PHE B 1  30   ? -2.922  9.841   -30.695 1.00 55.65  ? 30   PHE B O     1 
ATOM   1893  C  CB    . PHE B 1  30   ? -2.301  12.445  -29.287 1.00 73.25  ? 30   PHE B CB    1 
ATOM   1894  C  CG    . PHE B 1  30   ? -3.093  13.727  -29.279 1.00 62.20  ? 30   PHE B CG    1 
ATOM   1895  C  CD1   . PHE B 1  30   ? -4.216  13.865  -30.075 1.00 54.36  ? 30   PHE B CD1   1 
ATOM   1896  C  CD2   . PHE B 1  30   ? -2.704  14.794  -28.490 1.00 61.36  ? 30   PHE B CD2   1 
ATOM   1897  C  CE1   . PHE B 1  30   ? -4.942  15.037  -30.076 1.00 51.59  ? 30   PHE B CE1   1 
ATOM   1898  C  CE2   . PHE B 1  30   ? -3.425  15.970  -28.488 1.00 56.09  ? 30   PHE B CE2   1 
ATOM   1899  C  CZ    . PHE B 1  30   ? -4.545  16.091  -29.282 1.00 56.33  ? 30   PHE B CZ    1 
ATOM   1900  N  N     . GLY B 1  31   ? -1.989  9.060   -28.806 1.00 59.35  ? 31   GLY B N     1 
ATOM   1901  C  CA    . GLY B 1  31   ? -1.648  7.780   -29.395 1.00 57.84  ? 31   GLY B CA    1 
ATOM   1902  C  C     . GLY B 1  31   ? -2.899  7.053   -29.850 1.00 59.73  ? 31   GLY B C     1 
ATOM   1903  O  O     . GLY B 1  31   ? -2.941  6.497   -30.947 1.00 66.48  ? 31   GLY B O     1 
ATOM   1904  N  N     . TYR B 1  32   ? -3.929  7.072   -29.008 1.00 57.22  ? 32   TYR B N     1 
ATOM   1905  C  CA    . TYR B 1  32   ? -5.187  6.397   -29.310 1.00 51.89  ? 32   TYR B CA    1 
ATOM   1906  C  C     . TYR B 1  32   ? -6.065  7.257   -30.213 1.00 55.35  ? 32   TYR B C     1 
ATOM   1907  O  O     . TYR B 1  32   ? -6.977  6.757   -30.872 1.00 51.76  ? 32   TYR B O     1 
ATOM   1908  C  CB    . TYR B 1  32   ? -5.935  6.050   -28.019 1.00 54.58  ? 32   TYR B CB    1 
ATOM   1909  C  CG    . TYR B 1  32   ? -5.310  4.925   -27.220 1.00 54.79  ? 32   TYR B CG    1 
ATOM   1910  C  CD1   . TYR B 1  32   ? -5.824  3.637   -27.283 1.00 56.42  ? 32   TYR B CD1   1 
ATOM   1911  C  CD2   . TYR B 1  32   ? -4.207  5.150   -26.404 1.00 58.22  ? 32   TYR B CD2   1 
ATOM   1912  C  CE1   . TYR B 1  32   ? -5.261  2.603   -26.556 1.00 62.73  ? 32   TYR B CE1   1 
ATOM   1913  C  CE2   . TYR B 1  32   ? -3.635  4.121   -25.673 1.00 61.98  ? 32   TYR B CE2   1 
ATOM   1914  C  CZ    . TYR B 1  32   ? -4.166  2.849   -25.753 1.00 62.21  ? 32   TYR B CZ    1 
ATOM   1915  O  OH    . TYR B 1  32   ? -3.607  1.818   -25.032 1.00 57.13  ? 32   TYR B OH    1 
ATOM   1916  N  N     . THR B 1  33   ? -5.775  8.554   -30.234 1.00 61.86  ? 33   THR B N     1 
ATOM   1917  C  CA    . THR B 1  33   ? -6.492  9.511   -31.071 1.00 64.50  ? 33   THR B CA    1 
ATOM   1918  C  C     . THR B 1  33   ? -6.077  9.342   -32.532 1.00 62.24  ? 33   THR B C     1 
ATOM   1919  O  O     . THR B 1  33   ? -6.829  9.657   -33.455 1.00 61.10  ? 33   THR B O     1 
ATOM   1920  C  CB    . THR B 1  33   ? -6.223  10.967  -30.611 1.00 63.39  ? 33   THR B CB    1 
ATOM   1921  O  OG1   . THR B 1  33   ? -6.491  11.088  -29.207 1.00 59.86  ? 33   THR B OG1   1 
ATOM   1922  C  CG2   . THR B 1  33   ? -7.086  11.963  -31.376 1.00 57.72  ? 33   THR B CG2   1 
ATOM   1923  N  N     . LEU B 1  34   ? -4.872  8.820   -32.726 1.00 62.54  ? 34   LEU B N     1 
ATOM   1924  C  CA    . LEU B 1  34   ? -4.304  8.650   -34.056 1.00 63.19  ? 34   LEU B CA    1 
ATOM   1925  C  C     . LEU B 1  34   ? -4.296  7.179   -34.495 1.00 62.09  ? 34   LEU B C     1 
ATOM   1926  O  O     . LEU B 1  34   ? -4.349  6.878   -35.688 1.00 58.82  ? 34   LEU B O     1 
ATOM   1927  C  CB    . LEU B 1  34   ? -2.886  9.232   -34.082 1.00 64.39  ? 34   LEU B CB    1 
ATOM   1928  C  CG    . LEU B 1  34   ? -2.001  8.969   -35.301 1.00 72.02  ? 34   LEU B CG    1 
ATOM   1929  C  CD1   . LEU B 1  34   ? -2.656  9.492   -36.566 1.00 82.52  ? 34   LEU B CD1   1 
ATOM   1930  C  CD2   . LEU B 1  34   ? -0.621  9.583   -35.111 1.00 63.45  ? 34   LEU B CD2   1 
ATOM   1931  N  N     . GLY B 1  35   ? -4.248  6.274   -33.520 1.00 62.94  ? 35   GLY B N     1 
ATOM   1932  C  CA    . GLY B 1  35   ? -4.169  4.843   -33.773 1.00 57.34  ? 35   GLY B CA    1 
ATOM   1933  C  C     . GLY B 1  35   ? -5.193  4.243   -34.725 1.00 65.93  ? 35   GLY B C     1 
ATOM   1934  O  O     . GLY B 1  35   ? -4.921  4.105   -35.919 1.00 71.61  ? 35   GLY B O     1 
ATOM   1935  N  N     . ASN B 1  36   ? -6.365  3.881   -34.201 1.00 69.29  ? 36   ASN B N     1 
ATOM   1936  C  CA    . ASN B 1  36   ? -7.382  3.164   -34.980 1.00 65.06  ? 36   ASN B CA    1 
ATOM   1937  C  C     . ASN B 1  36   ? -7.839  3.927   -36.213 1.00 64.94  ? 36   ASN B C     1 
ATOM   1938  O  O     . ASN B 1  36   ? -8.238  3.332   -37.216 1.00 70.21  ? 36   ASN B O     1 
ATOM   1939  C  CB    . ASN B 1  36   ? -8.605  2.844   -34.118 1.00 63.19  ? 36   ASN B CB    1 
ATOM   1940  C  CG    . ASN B 1  36   ? -9.618  1.970   -34.847 1.00 62.38  ? 36   ASN B CG    1 
ATOM   1941  O  OD1   . ASN B 1  36   ? -9.252  1.004   -35.517 1.00 59.01  ? 36   ASN B OD1   1 
ATOM   1942  N  ND2   . ASN B 1  36   ? -10.896 2.316   -34.729 1.00 62.20  ? 36   ASN B ND2   1 
ATOM   1943  N  N     . SER B 1  37   ? -7.789  5.249   -36.123 1.00 64.49  ? 37   SER B N     1 
ATOM   1944  C  CA    . SER B 1  37   ? -8.153  6.109   -37.236 1.00 66.44  ? 37   SER B CA    1 
ATOM   1945  C  C     . SER B 1  37   ? -7.252  5.877   -38.450 1.00 71.18  ? 37   SER B C     1 
ATOM   1946  O  O     . SER B 1  37   ? -7.723  5.852   -39.589 1.00 74.29  ? 37   SER B O     1 
ATOM   1947  C  CB    . SER B 1  37   ? -8.097  7.572   -36.798 1.00 67.14  ? 37   SER B CB    1 
ATOM   1948  O  OG    . SER B 1  37   ? -7.036  7.785   -35.880 1.00 67.75  ? 37   SER B OG    1 
ATOM   1949  N  N     . LEU B 1  38   ? -5.958  5.695   -38.208 1.00 68.98  ? 38   LEU B N     1 
ATOM   1950  C  CA    . LEU B 1  38   ? -5.010  5.516   -39.301 1.00 64.68  ? 38   LEU B CA    1 
ATOM   1951  C  C     . LEU B 1  38   ? -5.099  4.111   -39.890 1.00 63.04  ? 38   LEU B C     1 
ATOM   1952  O  O     . LEU B 1  38   ? -4.919  3.926   -41.093 1.00 71.46  ? 38   LEU B O     1 
ATOM   1953  C  CB    . LEU B 1  38   ? -3.586  5.809   -38.826 1.00 63.97  ? 38   LEU B CB    1 
ATOM   1954  C  CG    . LEU B 1  38   ? -2.491  5.829   -39.894 1.00 62.92  ? 38   LEU B CG    1 
ATOM   1955  C  CD1   . LEU B 1  38   ? -2.889  6.706   -41.072 1.00 66.33  ? 38   LEU B CD1   1 
ATOM   1956  C  CD2   . LEU B 1  38   ? -1.176  6.306   -39.298 1.00 67.16  ? 38   LEU B CD2   1 
ATOM   1957  N  N     . ARG B 1  39   ? -5.387  3.129   -39.041 1.00 63.15  ? 39   ARG B N     1 
ATOM   1958  C  CA    . ARG B 1  39   ? -5.490  1.739   -39.478 1.00 73.62  ? 39   ARG B CA    1 
ATOM   1959  C  C     . ARG B 1  39   ? -6.610  1.529   -40.499 1.00 82.01  ? 39   ARG B C     1 
ATOM   1960  O  O     . ARG B 1  39   ? -6.374  0.992   -41.582 1.00 89.33  ? 39   ARG B O     1 
ATOM   1961  C  CB    . ARG B 1  39   ? -5.708  0.813   -38.277 1.00 73.50  ? 39   ARG B CB    1 
ATOM   1962  C  CG    . ARG B 1  39   ? -6.025  -0.628  -38.659 1.00 70.87  ? 39   ARG B CG    1 
ATOM   1963  C  CD    . ARG B 1  39   ? -6.262  -1.507  -37.439 1.00 70.97  ? 39   ARG B CD    1 
ATOM   1964  N  NE    . ARG B 1  39   ? -6.665  -2.860  -37.820 1.00 71.73  ? 39   ARG B NE    1 
ATOM   1965  C  CZ    . ARG B 1  39   ? -7.927  -3.273  -37.898 1.00 70.40  ? 39   ARG B CZ    1 
ATOM   1966  N  NH1   . ARG B 1  39   ? -8.919  -2.440  -37.613 1.00 67.84  ? 39   ARG B NH1   1 
ATOM   1967  N  NH2   . ARG B 1  39   ? -8.198  -4.521  -38.257 1.00 69.03  ? 39   ARG B NH2   1 
ATOM   1968  N  N     . ARG B 1  40   ? -7.823  1.958   -40.158 1.00 77.58  ? 40   ARG B N     1 
ATOM   1969  C  CA    . ARG B 1  40   ? -8.981  1.758   -41.029 1.00 75.95  ? 40   ARG B CA    1 
ATOM   1970  C  C     . ARG B 1  40   ? -8.817  2.524   -42.339 1.00 80.41  ? 40   ARG B C     1 
ATOM   1971  O  O     . ARG B 1  40   ? -9.466  2.213   -43.338 1.00 81.25  ? 40   ARG B O     1 
ATOM   1972  C  CB    . ARG B 1  40   ? -10.269 2.187   -40.319 1.00 76.27  ? 40   ARG B CB    1 
ATOM   1973  C  CG    . ARG B 1  40   ? -11.542 1.582   -40.899 1.00 72.15  ? 40   ARG B CG    1 
ATOM   1974  C  CD    . ARG B 1  40   ? -11.526 0.063   -40.805 1.00 73.61  ? 40   ARG B CD    1 
ATOM   1975  N  NE    . ARG B 1  40   ? -11.404 -0.406  -39.426 1.00 78.23  ? 40   ARG B NE    1 
ATOM   1976  C  CZ    . ARG B 1  40   ? -12.436 -0.677  -38.635 1.00 81.01  ? 40   ARG B CZ    1 
ATOM   1977  N  NH1   . ARG B 1  40   ? -13.675 -0.526  -39.086 1.00 80.43  ? 40   ARG B NH1   1 
ATOM   1978  N  NH2   . ARG B 1  40   ? -12.232 -1.100  -37.393 1.00 82.09  ? 40   ARG B NH2   1 
ATOM   1979  N  N     . THR B 1  41   ? -7.942  3.524   -42.329 1.00 76.93  ? 41   THR B N     1 
ATOM   1980  C  CA    . THR B 1  41   ? -7.662  4.297   -43.528 1.00 71.34  ? 41   THR B CA    1 
ATOM   1981  C  C     . THR B 1  41   ? -6.866  3.460   -44.531 1.00 77.41  ? 41   THR B C     1 
ATOM   1982  O  O     . THR B 1  41   ? -7.237  3.370   -45.699 1.00 89.54  ? 41   THR B O     1 
ATOM   1983  C  CB    . THR B 1  41   ? -6.902  5.590   -43.191 1.00 66.59  ? 41   THR B CB    1 
ATOM   1984  O  OG1   . THR B 1  41   ? -7.695  6.385   -42.301 1.00 58.31  ? 41   THR B OG1   1 
ATOM   1985  C  CG2   . THR B 1  41   ? -6.618  6.390   -44.453 1.00 76.77  ? 41   THR B CG2   1 
ATOM   1986  N  N     . LEU B 1  42   ? -5.790  2.832   -44.067 1.00 72.69  ? 42   LEU B N     1 
ATOM   1987  C  CA    . LEU B 1  42   ? -4.966  1.984   -44.927 1.00 69.10  ? 42   LEU B CA    1 
ATOM   1988  C  C     . LEU B 1  42   ? -5.736  0.777   -45.460 1.00 83.30  ? 42   LEU B C     1 
ATOM   1989  O  O     . LEU B 1  42   ? -5.511  0.335   -46.586 1.00 89.56  ? 42   LEU B O     1 
ATOM   1990  C  CB    . LEU B 1  42   ? -3.726  1.509   -44.171 1.00 67.57  ? 42   LEU B CB    1 
ATOM   1991  C  CG    . LEU B 1  42   ? -2.850  2.623   -43.603 1.00 68.10  ? 42   LEU B CG    1 
ATOM   1992  C  CD1   . LEU B 1  42   ? -2.273  2.218   -42.258 1.00 74.21  ? 42   LEU B CD1   1 
ATOM   1993  C  CD2   . LEU B 1  42   ? -1.744  2.985   -44.580 1.00 71.40  ? 42   LEU B CD2   1 
ATOM   1994  N  N     . LEU B 1  43   ? -6.653  0.256   -44.650 1.00 89.19  ? 43   LEU B N     1 
ATOM   1995  C  CA    . LEU B 1  43   ? -7.390  -0.955  -44.999 1.00 92.78  ? 43   LEU B CA    1 
ATOM   1996  C  C     . LEU B 1  43   ? -8.596  -0.697  -45.901 1.00 93.60  ? 43   LEU B C     1 
ATOM   1997  O  O     . LEU B 1  43   ? -9.164  -1.636  -46.459 1.00 100.26 ? 43   LEU B O     1 
ATOM   1998  C  CB    . LEU B 1  43   ? -7.855  -1.672  -43.729 1.00 82.68  ? 43   LEU B CB    1 
ATOM   1999  C  CG    . LEU B 1  43   ? -6.761  -2.143  -42.771 1.00 79.85  ? 43   LEU B CG    1 
ATOM   2000  C  CD1   . LEU B 1  43   ? -7.369  -2.864  -41.582 1.00 83.85  ? 43   LEU B CD1   1 
ATOM   2001  C  CD2   . LEU B 1  43   ? -5.775  -3.040  -43.492 1.00 80.34  ? 43   LEU B CD2   1 
ATOM   2002  N  N     . SER B 1  44   ? -8.996  0.563   -46.050 1.00 87.95  ? 44   SER B N     1 
ATOM   2003  C  CA    . SER B 1  44   ? -10.221 0.852   -46.790 1.00 87.56  ? 44   SER B CA    1 
ATOM   2004  C  C     . SER B 1  44   ? -10.141 2.067   -47.715 1.00 89.38  ? 44   SER B C     1 
ATOM   2005  O  O     . SER B 1  44   ? -10.881 2.146   -48.694 1.00 92.07  ? 44   SER B O     1 
ATOM   2006  C  CB    . SER B 1  44   ? -11.380 1.038   -45.808 1.00 87.53  ? 44   SER B CB    1 
ATOM   2007  O  OG    . SER B 1  44   ? -11.535 -0.107  -44.987 1.00 85.01  ? 44   SER B OG    1 
ATOM   2008  N  N     . SER B 1  45   ? -9.251  3.008   -47.417 1.00 87.04  ? 45   SER B N     1 
ATOM   2009  C  CA    . SER B 1  45   ? -9.218  4.267   -48.162 1.00 85.96  ? 45   SER B CA    1 
ATOM   2010  C  C     . SER B 1  45   ? -8.113  4.347   -49.220 1.00 90.94  ? 45   SER B C     1 
ATOM   2011  O  O     . SER B 1  45   ? -7.701  5.441   -49.606 1.00 89.15  ? 45   SER B O     1 
ATOM   2012  C  CB    . SER B 1  45   ? -9.078  5.442   -47.192 1.00 84.44  ? 45   SER B CB    1 
ATOM   2013  O  OG    . SER B 1  45   ? -8.881  6.657   -47.892 1.00 85.05  ? 45   SER B OG    1 
ATOM   2014  N  N     . ILE B 1  46   ? -7.640  3.196   -49.690 1.00 93.10  ? 46   ILE B N     1 
ATOM   2015  C  CA    . ILE B 1  46   ? -6.651  3.158   -50.767 1.00 87.62  ? 46   ILE B CA    1 
ATOM   2016  C  C     . ILE B 1  46   ? -7.142  2.272   -51.911 1.00 91.77  ? 46   ILE B C     1 
ATOM   2017  O  O     . ILE B 1  46   ? -7.423  1.093   -51.704 1.00 95.79  ? 46   ILE B O     1 
ATOM   2018  C  CB    . ILE B 1  46   ? -5.285  2.641   -50.276 1.00 83.46  ? 46   ILE B CB    1 
ATOM   2019  C  CG1   . ILE B 1  46   ? -4.837  3.404   -49.029 1.00 88.98  ? 46   ILE B CG1   1 
ATOM   2020  C  CG2   . ILE B 1  46   ? -4.241  2.776   -51.370 1.00 85.67  ? 46   ILE B CG2   1 
ATOM   2021  C  CD1   . ILE B 1  46   ? -4.542  4.864   -49.281 1.00 90.00  ? 46   ILE B CD1   1 
ATOM   2022  N  N     . PRO B 1  47   ? -7.247  2.842   -53.122 1.00 92.75  ? 47   PRO B N     1 
ATOM   2023  C  CA    . PRO B 1  47   ? -7.823  2.165   -54.289 1.00 91.29  ? 47   PRO B CA    1 
ATOM   2024  C  C     . PRO B 1  47   ? -6.852  1.214   -54.985 1.00 93.40  ? 47   PRO B C     1 
ATOM   2025  O  O     . PRO B 1  47   ? -5.637  1.414   -54.942 1.00 92.51  ? 47   PRO B O     1 
ATOM   2026  C  CB    . PRO B 1  47   ? -8.191  3.327   -55.210 1.00 90.87  ? 47   PRO B CB    1 
ATOM   2027  C  CG    . PRO B 1  47   ? -7.179  4.373   -54.892 1.00 95.92  ? 47   PRO B CG    1 
ATOM   2028  C  CD    . PRO B 1  47   ? -6.871  4.235   -53.424 1.00 96.38  ? 47   PRO B CD    1 
ATOM   2029  N  N     . GLY B 1  48   ? -7.402  0.194   -55.637 1.00 97.49  ? 48   GLY B N     1 
ATOM   2030  C  CA    . GLY B 1  48   ? -6.606  -0.779  -56.359 1.00 104.25 ? 48   GLY B CA    1 
ATOM   2031  C  C     . GLY B 1  48   ? -7.427  -1.485  -57.419 1.00 99.99  ? 48   GLY B C     1 
ATOM   2032  O  O     . GLY B 1  48   ? -8.365  -0.912  -57.971 1.00 104.54 ? 48   GLY B O     1 
ATOM   2033  N  N     . ALA B 1  49   ? -7.074  -2.734  -57.705 1.00 92.45  ? 49   ALA B N     1 
ATOM   2034  C  CA    . ALA B 1  49   ? -7.803  -3.526  -58.687 1.00 91.04  ? 49   ALA B CA    1 
ATOM   2035  C  C     . ALA B 1  49   ? -7.817  -4.994  -58.284 1.00 85.84  ? 49   ALA B C     1 
ATOM   2036  O  O     . ALA B 1  49   ? -6.793  -5.543  -57.882 1.00 87.68  ? 49   ALA B O     1 
ATOM   2037  C  CB    . ALA B 1  49   ? -7.192  -3.356  -60.067 1.00 100.45 ? 49   ALA B CB    1 
ATOM   2038  N  N     . ALA B 1  50   ? -8.979  -5.628  -58.399 1.00 85.12  ? 50   ALA B N     1 
ATOM   2039  C  CA    . ALA B 1  50   ? -9.132  -7.016  -57.983 1.00 89.25  ? 50   ALA B CA    1 
ATOM   2040  C  C     . ALA B 1  50   ? -10.166 -7.762  -58.824 1.00 95.25  ? 50   ALA B C     1 
ATOM   2041  O  O     . ALA B 1  50   ? -10.811 -7.179  -59.696 1.00 96.97  ? 50   ALA B O     1 
ATOM   2042  C  CB    . ALA B 1  50   ? -9.507  -7.082  -56.512 1.00 98.24  ? 50   ALA B CB    1 
ATOM   2043  N  N     . VAL B 1  51   ? -10.316 -9.054  -58.545 1.00 99.80  ? 51   VAL B N     1 
ATOM   2044  C  CA    . VAL B 1  51   ? -11.231 -9.921  -59.284 1.00 100.18 ? 51   VAL B CA    1 
ATOM   2045  C  C     . VAL B 1  51   ? -12.639 -9.929  -58.696 1.00 105.43 ? 51   VAL B C     1 
ATOM   2046  O  O     . VAL B 1  51   ? -12.841 -10.335 -57.551 1.00 111.99 ? 51   VAL B O     1 
ATOM   2047  C  CB    . VAL B 1  51   ? -10.720 -11.376 -59.318 1.00 97.51  ? 51   VAL B CB    1 
ATOM   2048  C  CG1   . VAL B 1  51   ? -11.736 -12.283 -60.001 1.00 101.93 ? 51   VAL B CG1   1 
ATOM   2049  C  CG2   . VAL B 1  51   ? -9.368  -11.454 -60.010 1.00 109.81 ? 51   VAL B CG2   1 
ATOM   2050  N  N     . THR B 1  52   ? -13.611 -9.495  -59.493 1.00 112.68 ? 52   THR B N     1 
ATOM   2051  C  CA    . THR B 1  52   ? -15.009 -9.488  -59.076 1.00 108.47 ? 52   THR B CA    1 
ATOM   2052  C  C     . THR B 1  52   ? -15.660 -10.859 -59.252 1.00 109.73 ? 52   THR B C     1 
ATOM   2053  O  O     . THR B 1  52   ? -16.289 -11.381 -58.331 1.00 109.27 ? 52   THR B O     1 
ATOM   2054  C  CB    . THR B 1  52   ? -15.821 -8.440  -59.863 1.00 104.55 ? 52   THR B CB    1 
ATOM   2055  O  OG1   . THR B 1  52   ? -15.387 -7.125  -59.497 1.00 97.36  ? 52   THR B OG1   1 
ATOM   2056  C  CG2   . THR B 1  52   ? -17.303 -8.576  -59.565 1.00 113.20 ? 52   THR B CG2   1 
ATOM   2057  N  N     . SER B 1  53   ? -15.503 -11.440 -60.437 1.00 113.47 ? 53   SER B N     1 
ATOM   2058  C  CA    . SER B 1  53   ? -16.101 -12.737 -60.738 1.00 118.38 ? 53   SER B CA    1 
ATOM   2059  C  C     . SER B 1  53   ? -15.263 -13.533 -61.735 1.00 122.64 ? 53   SER B C     1 
ATOM   2060  O  O     . SER B 1  53   ? -14.408 -12.977 -62.424 1.00 124.56 ? 53   SER B O     1 
ATOM   2061  C  CB    . SER B 1  53   ? -17.517 -12.556 -61.284 1.00 126.96 ? 53   SER B CB    1 
ATOM   2062  O  OG    . SER B 1  53   ? -17.499 -11.864 -62.521 1.00 135.83 ? 53   SER B OG    1 
ATOM   2063  N  N     . ILE B 1  54   ? -15.512 -14.838 -61.804 1.00 121.83 ? 54   ILE B N     1 
ATOM   2064  C  CA    . ILE B 1  54   ? -14.807 -15.706 -62.743 1.00 121.89 ? 54   ILE B CA    1 
ATOM   2065  C  C     . ILE B 1  54   ? -15.773 -16.630 -63.482 1.00 131.40 ? 54   ILE B C     1 
ATOM   2066  O  O     . ILE B 1  54   ? -16.961 -16.682 -63.162 1.00 134.31 ? 54   ILE B O     1 
ATOM   2067  C  CB    . ILE B 1  54   ? -13.742 -16.570 -62.036 1.00 117.06 ? 54   ILE B CB    1 
ATOM   2068  C  CG1   . ILE B 1  54   ? -14.407 -17.556 -61.074 1.00 116.50 ? 54   ILE B CG1   1 
ATOM   2069  C  CG2   . ILE B 1  54   ? -12.734 -15.697 -61.304 1.00 122.31 ? 54   ILE B CG2   1 
ATOM   2070  C  CD1   . ILE B 1  54   ? -13.439 -18.516 -60.421 1.00 113.32 ? 54   ILE B CD1   1 
ATOM   2071  N  N     . ARG B 1  55   ? -15.252 -17.354 -64.471 1.00 131.01 ? 55   ARG B N     1 
ATOM   2072  C  CA    . ARG B 1  55   ? -16.030 -18.351 -65.207 1.00 129.72 ? 55   ARG B CA    1 
ATOM   2073  C  C     . ARG B 1  55   ? -15.158 -19.530 -65.631 1.00 126.92 ? 55   ARG B C     1 
ATOM   2074  O  O     . ARG B 1  55   ? -14.088 -19.346 -66.211 1.00 124.89 ? 55   ARG B O     1 
ATOM   2075  C  CB    . ARG B 1  55   ? -16.690 -17.727 -66.438 1.00 126.28 ? 55   ARG B CB    1 
ATOM   2076  C  CG    . ARG B 1  55   ? -17.971 -16.964 -66.154 1.00 129.89 ? 55   ARG B CG    1 
ATOM   2077  C  CD    . ARG B 1  55   ? -18.447 -16.238 -67.397 1.00 132.03 ? 55   ARG B CD    1 
ATOM   2078  N  NE    . ARG B 1  55   ? -18.702 -17.157 -68.502 1.00 121.39 ? 55   ARG B NE    1 
ATOM   2079  C  CZ    . ARG B 1  55   ? -18.998 -16.771 -69.738 1.00 116.04 ? 55   ARG B CZ    1 
ATOM   2080  N  NH1   . ARG B 1  55   ? -19.071 -15.480 -70.027 1.00 127.07 ? 55   ARG B NH1   1 
ATOM   2081  N  NH2   . ARG B 1  55   ? -19.217 -17.672 -70.684 1.00 113.98 ? 55   ARG B NH2   1 
ATOM   2082  N  N     . ILE B 1  56   ? -15.625 -20.741 -65.342 1.00 123.69 ? 56   ILE B N     1 
ATOM   2083  C  CA    . ILE B 1  56   ? -14.892 -21.949 -65.700 1.00 123.58 ? 56   ILE B CA    1 
ATOM   2084  C  C     . ILE B 1  56   ? -15.662 -22.751 -66.741 1.00 134.90 ? 56   ILE B C     1 
ATOM   2085  O  O     . ILE B 1  56   ? -16.885 -22.863 -66.668 1.00 134.89 ? 56   ILE B O     1 
ATOM   2086  C  CB    . ILE B 1  56   ? -14.628 -22.833 -64.474 1.00 122.10 ? 56   ILE B CB    1 
ATOM   2087  C  CG1   . ILE B 1  56   ? -14.105 -21.987 -63.315 1.00 122.94 ? 56   ILE B CG1   1 
ATOM   2088  C  CG2   . ILE B 1  56   ? -13.646 -23.944 -64.816 1.00 127.00 ? 56   ILE B CG2   1 
ATOM   2089  C  CD1   . ILE B 1  56   ? -13.855 -22.776 -62.054 1.00 137.05 ? 56   ILE B CD1   1 
ATOM   2090  N  N     . ASP B 1  57   ? -14.937 -23.314 -67.703 1.00 138.83 ? 57   ASP B N     1 
ATOM   2091  C  CA    . ASP B 1  57   ? -15.555 -24.002 -68.831 1.00 141.39 ? 57   ASP B CA    1 
ATOM   2092  C  C     . ASP B 1  57   ? -16.252 -25.302 -68.426 1.00 150.08 ? 57   ASP B C     1 
ATOM   2093  O  O     . ASP B 1  57   ? -17.439 -25.484 -68.696 1.00 151.16 ? 57   ASP B O     1 
ATOM   2094  C  CB    . ASP B 1  57   ? -14.508 -24.290 -69.908 1.00 130.42 ? 57   ASP B CB    1 
ATOM   2095  C  CG    . ASP B 1  57   ? -15.130 -24.555 -71.265 1.00 139.37 ? 57   ASP B CG    1 
ATOM   2096  O  OD1   . ASP B 1  57   ? -16.375 -24.578 -71.356 1.00 140.55 ? 57   ASP B OD1   1 
ATOM   2097  O  OD2   . ASP B 1  57   ? -14.375 -24.745 -72.240 1.00 145.46 ? 57   ASP B OD2   1 
ATOM   2098  N  N     . GLY B 1  58   ? -15.516 -26.205 -67.787 1.00 148.96 ? 58   GLY B N     1 
ATOM   2099  C  CA    . GLY B 1  58   ? -16.062 -27.499 -67.417 1.00 147.92 ? 58   GLY B CA    1 
ATOM   2100  C  C     . GLY B 1  58   ? -16.740 -27.529 -66.059 1.00 151.33 ? 58   GLY B C     1 
ATOM   2101  O  O     . GLY B 1  58   ? -16.503 -28.435 -65.261 1.00 155.28 ? 58   GLY B O     1 
ATOM   2102  N  N     . VAL B 1  59   ? -17.589 -26.540 -65.794 1.00 147.45 ? 59   VAL B N     1 
ATOM   2103  C  CA    . VAL B 1  59   ? -18.306 -26.466 -64.523 1.00 149.61 ? 59   VAL B CA    1 
ATOM   2104  C  C     . VAL B 1  59   ? -19.766 -26.062 -64.720 1.00 155.36 ? 59   VAL B C     1 
ATOM   2105  O  O     . VAL B 1  59   ? -20.058 -25.022 -65.311 1.00 162.42 ? 59   VAL B O     1 
ATOM   2106  C  CB    . VAL B 1  59   ? -17.631 -25.467 -63.551 1.00 151.90 ? 59   VAL B CB    1 
ATOM   2107  C  CG1   . VAL B 1  59   ? -18.557 -25.129 -62.391 1.00 158.13 ? 59   VAL B CG1   1 
ATOM   2108  C  CG2   . VAL B 1  59   ? -16.308 -26.023 -63.039 1.00 147.86 ? 59   VAL B CG2   1 
ATOM   2109  N  N     . LEU B 1  60   ? -20.681 -26.896 -64.233 1.00 155.81 ? 60   LEU B N     1 
ATOM   2110  C  CA    . LEU B 1  60   ? -22.102 -26.559 -64.228 1.00 158.07 ? 60   LEU B CA    1 
ATOM   2111  C  C     . LEU B 1  60   ? -22.596 -26.422 -62.789 1.00 165.42 ? 60   LEU B C     1 
ATOM   2112  O  O     . LEU B 1  60   ? -23.658 -25.851 -62.537 1.00 161.59 ? 60   LEU B O     1 
ATOM   2113  C  CB    . LEU B 1  60   ? -22.923 -27.608 -64.987 1.00 153.79 ? 60   LEU B CB    1 
ATOM   2114  C  CG    . LEU B 1  60   ? -22.923 -27.508 -66.519 1.00 156.95 ? 60   LEU B CG    1 
ATOM   2115  C  CD1   . LEU B 1  60   ? -21.628 -28.042 -67.120 1.00 155.66 ? 60   LEU B CD1   1 
ATOM   2116  C  CD2   . LEU B 1  60   ? -24.132 -28.216 -67.118 1.00 146.87 ? 60   LEU B CD2   1 
ATOM   2117  N  N     . HIS B 1  61   ? -21.813 -26.957 -61.854 1.00 172.45 ? 61   HIS B N     1 
ATOM   2118  C  CA    . HIS B 1  61   ? -22.045 -26.761 -60.423 1.00 171.33 ? 61   HIS B CA    1 
ATOM   2119  C  C     . HIS B 1  61   ? -20.713 -26.839 -59.667 1.00 167.58 ? 61   HIS B C     1 
ATOM   2120  O  O     . HIS B 1  61   ? -19.706 -27.279 -60.221 1.00 167.29 ? 61   HIS B O     1 
ATOM   2121  C  CB    . HIS B 1  61   ? -23.056 -27.779 -59.881 1.00 171.03 ? 61   HIS B CB    1 
ATOM   2122  C  CG    . HIS B 1  61   ? -22.673 -29.209 -60.108 1.00 163.02 ? 61   HIS B CG    1 
ATOM   2123  N  ND1   . HIS B 1  61   ? -22.640 -29.784 -61.361 1.00 158.91 ? 61   HIS B ND1   1 
ATOM   2124  C  CD2   . HIS B 1  61   ? -22.332 -30.188 -59.237 1.00 156.03 ? 61   HIS B CD2   1 
ATOM   2125  C  CE1   . HIS B 1  61   ? -22.281 -31.050 -61.252 1.00 154.80 ? 61   HIS B CE1   1 
ATOM   2126  N  NE2   . HIS B 1  61   ? -22.090 -31.321 -59.974 1.00 154.48 ? 61   HIS B NE2   1 
ATOM   2127  N  N     . GLU B 1  62   ? -20.710 -26.412 -58.406 1.00 168.81 ? 62   GLU B N     1 
ATOM   2128  C  CA    . GLU B 1  62   ? -19.459 -26.154 -57.686 1.00 171.44 ? 62   GLU B CA    1 
ATOM   2129  C  C     . GLU B 1  62   ? -18.797 -27.359 -57.004 1.00 173.19 ? 62   GLU B C     1 
ATOM   2130  O  O     . GLU B 1  62   ? -17.570 -27.405 -56.900 1.00 164.70 ? 62   GLU B O     1 
ATOM   2131  C  CB    . GLU B 1  62   ? -19.688 -25.063 -56.631 1.00 170.67 ? 62   GLU B CB    1 
ATOM   2132  C  CG    . GLU B 1  62   ? -19.409 -23.647 -57.121 1.00 167.03 ? 62   GLU B CG    1 
ATOM   2133  C  CD    . GLU B 1  62   ? -20.303 -23.241 -58.276 1.00 174.79 ? 62   GLU B CD    1 
ATOM   2134  O  OE1   . GLU B 1  62   ? -19.815 -22.544 -59.191 1.00 167.40 ? 62   GLU B OE1   1 
ATOM   2135  O  OE2   . GLU B 1  62   ? -21.495 -23.616 -58.266 1.00 183.53 ? 62   GLU B OE2   1 
ATOM   2136  N  N     . PHE B 1  63   ? -19.587 -28.323 -56.536 1.00 174.47 ? 63   PHE B N     1 
ATOM   2137  C  CA    . PHE B 1  63   ? -19.040 -29.397 -55.701 1.00 167.01 ? 63   PHE B CA    1 
ATOM   2138  C  C     . PHE B 1  63   ? -18.051 -30.297 -56.443 1.00 160.98 ? 63   PHE B C     1 
ATOM   2139  O  O     . PHE B 1  63   ? -17.059 -30.745 -55.866 1.00 156.11 ? 63   PHE B O     1 
ATOM   2140  C  CB    . PHE B 1  63   ? -20.163 -30.252 -55.114 1.00 162.89 ? 63   PHE B CB    1 
ATOM   2141  C  CG    . PHE B 1  63   ? -19.758 -31.004 -53.877 1.00 159.27 ? 63   PHE B CG    1 
ATOM   2142  C  CD1   . PHE B 1  63   ? -19.598 -30.337 -52.674 1.00 156.48 ? 63   PHE B CD1   1 
ATOM   2143  C  CD2   . PHE B 1  63   ? -19.530 -32.370 -53.916 1.00 158.49 ? 63   PHE B CD2   1 
ATOM   2144  C  CE1   . PHE B 1  63   ? -19.222 -31.016 -51.532 1.00 152.89 ? 63   PHE B CE1   1 
ATOM   2145  C  CE2   . PHE B 1  63   ? -19.154 -33.056 -52.775 1.00 156.07 ? 63   PHE B CE2   1 
ATOM   2146  C  CZ    . PHE B 1  63   ? -19.000 -32.377 -51.582 1.00 154.48 ? 63   PHE B CZ    1 
ATOM   2147  N  N     . THR B 1  64   ? -18.322 -30.564 -57.716 1.00 159.30 ? 64   THR B N     1 
ATOM   2148  C  CA    . THR B 1  64   ? -17.403 -31.349 -58.532 1.00 151.34 ? 64   THR B CA    1 
ATOM   2149  C  C     . THR B 1  64   ? -16.208 -30.504 -58.954 1.00 157.51 ? 64   THR B C     1 
ATOM   2150  O  O     . THR B 1  64   ? -16.365 -29.354 -59.364 1.00 159.74 ? 64   THR B O     1 
ATOM   2151  C  CB    . THR B 1  64   ? -18.086 -31.911 -59.790 1.00 150.11 ? 64   THR B CB    1 
ATOM   2152  O  OG1   . THR B 1  64   ? -18.572 -30.831 -60.597 1.00 158.09 ? 64   THR B OG1   1 
ATOM   2153  C  CG2   . THR B 1  64   ? -19.242 -32.818 -59.409 1.00 152.99 ? 64   THR B CG2   1 
ATOM   2154  N  N     . THR B 1  65   ? -15.016 -31.080 -58.850 1.00 161.40 ? 65   THR B N     1 
ATOM   2155  C  CA    . THR B 1  65   ? -13.796 -30.388 -59.246 1.00 162.53 ? 65   THR B CA    1 
ATOM   2156  C  C     . THR B 1  65   ? -13.687 -30.300 -60.764 1.00 157.37 ? 65   THR B C     1 
ATOM   2157  O  O     . THR B 1  65   ? -14.304 -31.084 -61.486 1.00 157.92 ? 65   THR B O     1 
ATOM   2158  C  CB    . THR B 1  65   ? -12.542 -31.090 -58.694 1.00 154.91 ? 65   THR B CB    1 
ATOM   2159  O  OG1   . THR B 1  65   ? -12.334 -32.323 -59.394 1.00 151.16 ? 65   THR B OG1   1 
ATOM   2160  C  CG2   . THR B 1  65   ? -12.700 -31.369 -57.206 1.00 146.82 ? 65   THR B CG2   1 
ATOM   2161  N  N     . VAL B 1  66   ? -12.899 -29.342 -61.242 1.00 147.48 ? 66   VAL B N     1 
ATOM   2162  C  CA    . VAL B 1  66   ? -12.691 -29.168 -62.673 1.00 142.79 ? 66   VAL B CA    1 
ATOM   2163  C  C     . VAL B 1  66   ? -11.937 -30.364 -63.247 1.00 144.04 ? 66   VAL B C     1 
ATOM   2164  O  O     . VAL B 1  66   ? -10.880 -30.734 -62.734 1.00 139.45 ? 66   VAL B O     1 
ATOM   2165  C  CB    . VAL B 1  66   ? -11.919 -27.869 -62.975 1.00 132.89 ? 66   VAL B CB    1 
ATOM   2166  C  CG1   . VAL B 1  66   ? -11.735 -27.692 -64.473 1.00 141.30 ? 66   VAL B CG1   1 
ATOM   2167  C  CG2   . VAL B 1  66   ? -12.646 -26.674 -62.383 1.00 134.99 ? 66   VAL B CG2   1 
ATOM   2168  N  N     . PRO B 1  67   ? -12.493 -30.984 -64.303 1.00 149.23 ? 67   PRO B N     1 
ATOM   2169  C  CA    . PRO B 1  67   ? -11.911 -32.166 -64.949 1.00 140.79 ? 67   PRO B CA    1 
ATOM   2170  C  C     . PRO B 1  67   ? -10.448 -31.978 -65.343 1.00 139.50 ? 67   PRO B C     1 
ATOM   2171  O  O     . PRO B 1  67   ? -10.136 -31.143 -66.192 1.00 138.47 ? 67   PRO B O     1 
ATOM   2172  C  CB    . PRO B 1  67   ? -12.786 -32.348 -66.192 1.00 133.34 ? 67   PRO B CB    1 
ATOM   2173  C  CG    . PRO B 1  67   ? -14.100 -31.780 -65.800 1.00 139.07 ? 67   PRO B CG    1 
ATOM   2174  C  CD    . PRO B 1  67   ? -13.784 -30.610 -64.909 1.00 150.61 ? 67   PRO B CD    1 
ATOM   2175  N  N     . GLY B 1  68   ? -9.564  -32.749 -64.717 1.00 145.09 ? 68   GLY B N     1 
ATOM   2176  C  CA    . GLY B 1  68   ? -8.150  -32.716 -65.042 1.00 144.06 ? 68   GLY B CA    1 
ATOM   2177  C  C     . GLY B 1  68   ? -7.322  -31.833 -64.128 1.00 137.93 ? 68   GLY B C     1 
ATOM   2178  O  O     . GLY B 1  68   ? -6.141  -31.600 -64.384 1.00 130.58 ? 68   GLY B O     1 
ATOM   2179  N  N     . VAL B 1  69   ? -7.936  -31.340 -63.058 1.00 141.95 ? 69   VAL B N     1 
ATOM   2180  C  CA    . VAL B 1  69   ? -7.242  -30.458 -62.127 1.00 138.34 ? 69   VAL B CA    1 
ATOM   2181  C  C     . VAL B 1  69   ? -7.143  -31.092 -60.742 1.00 133.27 ? 69   VAL B C     1 
ATOM   2182  O  O     . VAL B 1  69   ? -8.065  -31.774 -60.294 1.00 135.83 ? 69   VAL B O     1 
ATOM   2183  C  CB    . VAL B 1  69   ? -7.948  -29.093 -62.013 1.00 139.78 ? 69   VAL B CB    1 
ATOM   2184  C  CG1   . VAL B 1  69   ? -7.042  -28.079 -61.325 1.00 129.41 ? 69   VAL B CG1   1 
ATOM   2185  C  CG2   . VAL B 1  69   ? -8.353  -28.595 -63.390 1.00 131.94 ? 69   VAL B CG2   1 
ATOM   2186  N  N     . LYS B 1  70   ? -6.016  -30.866 -60.073 1.00 122.73 ? 70   LYS B N     1 
ATOM   2187  C  CA    . LYS B 1  70   ? -5.794  -31.411 -58.740 1.00 124.53 ? 70   LYS B CA    1 
ATOM   2188  C  C     . LYS B 1  70   ? -6.690  -30.737 -57.708 1.00 128.26 ? 70   LYS B C     1 
ATOM   2189  O  O     . LYS B 1  70   ? -7.426  -31.404 -56.979 1.00 127.39 ? 70   LYS B O     1 
ATOM   2190  C  CB    . LYS B 1  70   ? -4.326  -31.256 -58.335 1.00 123.05 ? 70   LYS B CB    1 
ATOM   2191  C  CG    . LYS B 1  70   ? -4.028  -31.725 -56.919 1.00 124.88 ? 70   LYS B CG    1 
ATOM   2192  C  CD    . LYS B 1  70   ? -2.580  -31.474 -56.533 1.00 116.69 ? 70   LYS B CD    1 
ATOM   2193  C  CE    . LYS B 1  70   ? -2.309  -31.934 -55.110 1.00 102.56 ? 70   LYS B CE    1 
ATOM   2194  N  NZ    . LYS B 1  70   ? -0.899  -31.680 -54.713 1.00 110.75 ? 70   LYS B NZ    1 
ATOM   2195  N  N     . GLU B 1  71   ? -6.625  -29.412 -57.655 1.00 129.30 ? 71   GLU B N     1 
ATOM   2196  C  CA    . GLU B 1  71   ? -7.346  -28.649 -56.644 1.00 132.69 ? 71   GLU B CA    1 
ATOM   2197  C  C     . GLU B 1  71   ? -8.858  -28.674 -56.870 1.00 128.15 ? 71   GLU B C     1 
ATOM   2198  O  O     . GLU B 1  71   ? -9.332  -28.879 -57.988 1.00 129.40 ? 71   GLU B O     1 
ATOM   2199  C  CB    . GLU B 1  71   ? -6.847  -27.199 -56.612 1.00 130.10 ? 71   GLU B CB    1 
ATOM   2200  C  CG    . GLU B 1  71   ? -5.371  -27.036 -56.249 1.00 120.78 ? 71   GLU B CG    1 
ATOM   2201  C  CD    . GLU B 1  71   ? -4.437  -27.288 -57.421 1.00 118.42 ? 71   GLU B CD    1 
ATOM   2202  O  OE1   . GLU B 1  71   ? -4.931  -27.597 -58.527 1.00 116.88 ? 71   GLU B OE1   1 
ATOM   2203  O  OE2   . GLU B 1  71   ? -3.207  -27.175 -57.235 1.00 116.92 ? 71   GLU B OE2   1 
ATOM   2204  N  N     . ASP B 1  72   ? -9.606  -28.473 -55.790 1.00 125.71 ? 72   ASP B N     1 
ATOM   2205  C  CA    . ASP B 1  72   ? -11.054 -28.342 -55.866 1.00 128.68 ? 72   ASP B CA    1 
ATOM   2206  C  C     . ASP B 1  72   ? -11.401 -26.966 -56.427 1.00 125.28 ? 72   ASP B C     1 
ATOM   2207  O  O     . ASP B 1  72   ? -10.515 -26.140 -56.650 1.00 120.77 ? 72   ASP B O     1 
ATOM   2208  C  CB    . ASP B 1  72   ? -11.685 -28.541 -54.483 1.00 131.73 ? 72   ASP B CB    1 
ATOM   2209  C  CG    . ASP B 1  72   ? -13.164 -28.889 -54.551 1.00 134.42 ? 72   ASP B CG    1 
ATOM   2210  O  OD1   . ASP B 1  72   ? -13.838 -28.489 -55.524 1.00 131.82 ? 72   ASP B OD1   1 
ATOM   2211  O  OD2   . ASP B 1  72   ? -13.655 -29.562 -53.620 1.00 140.80 ? 72   ASP B OD2   1 
ATOM   2212  N  N     . VAL B 1  73   ? -12.687 -26.724 -56.654 1.00 125.40 ? 73   VAL B N     1 
ATOM   2213  C  CA    . VAL B 1  73   ? -13.156 -25.420 -57.106 1.00 123.47 ? 73   VAL B CA    1 
ATOM   2214  C  C     . VAL B 1  73   ? -12.858 -24.349 -56.054 1.00 117.37 ? 73   VAL B C     1 
ATOM   2215  O  O     . VAL B 1  73   ? -12.571 -23.198 -56.384 1.00 111.87 ? 73   VAL B O     1 
ATOM   2216  C  CB    . VAL B 1  73   ? -14.668 -25.450 -57.414 1.00 125.68 ? 73   VAL B CB    1 
ATOM   2217  C  CG1   . VAL B 1  73   ? -15.163 -24.077 -57.847 1.00 129.84 ? 73   VAL B CG1   1 
ATOM   2218  C  CG2   . VAL B 1  73   ? -14.965 -26.491 -58.483 1.00 125.82 ? 73   VAL B CG2   1 
ATOM   2219  N  N     . THR B 1  74   ? -12.903 -24.749 -54.787 1.00 115.55 ? 74   THR B N     1 
ATOM   2220  C  CA    . THR B 1  74   ? -12.687 -23.834 -53.670 1.00 107.12 ? 74   THR B CA    1 
ATOM   2221  C  C     . THR B 1  74   ? -11.281 -23.233 -53.644 1.00 101.90 ? 74   THR B C     1 
ATOM   2222  O  O     . THR B 1  74   ? -11.120 -22.012 -53.622 1.00 95.12  ? 74   THR B O     1 
ATOM   2223  C  CB    . THR B 1  74   ? -12.942 -24.541 -52.323 1.00 103.63 ? 74   THR B CB    1 
ATOM   2224  O  OG1   . THR B 1  74   ? -12.033 -25.640 -52.176 1.00 101.83 ? 74   THR B OG1   1 
ATOM   2225  C  CG2   . THR B 1  74   ? -14.367 -25.064 -52.259 1.00 99.61  ? 74   THR B CG2   1 
ATOM   2226  N  N     . GLU B 1  75   ? -10.270 -24.096 -53.652 1.00 107.30 ? 75   GLU B N     1 
ATOM   2227  C  CA    . GLU B 1  75   ? -8.882  -23.675 -53.466 1.00 103.96 ? 75   GLU B CA    1 
ATOM   2228  C  C     . GLU B 1  75   ? -8.346  -22.797 -54.593 1.00 99.55  ? 75   GLU B C     1 
ATOM   2229  O  O     . GLU B 1  75   ? -7.424  -22.007 -54.385 1.00 95.09  ? 75   GLU B O     1 
ATOM   2230  C  CB    . GLU B 1  75   ? -7.985  -24.900 -53.305 1.00 108.05 ? 75   GLU B CB    1 
ATOM   2231  C  CG    . GLU B 1  75   ? -8.149  -25.602 -51.973 1.00 110.92 ? 75   GLU B CG    1 
ATOM   2232  C  CD    . GLU B 1  75   ? -7.209  -26.776 -51.817 1.00 115.07 ? 75   GLU B CD    1 
ATOM   2233  O  OE1   . GLU B 1  75   ? -6.839  -27.383 -52.845 1.00 115.08 ? 75   GLU B OE1   1 
ATOM   2234  O  OE2   . GLU B 1  75   ? -6.833  -27.088 -50.668 1.00 115.84 ? 75   GLU B OE2   1 
ATOM   2235  N  N     . ILE B 1  76   ? -8.918  -22.936 -55.783 1.00 104.27 ? 76   ILE B N     1 
ATOM   2236  C  CA    . ILE B 1  76   ? -8.490  -22.132 -56.921 1.00 108.57 ? 76   ILE B CA    1 
ATOM   2237  C  C     . ILE B 1  76   ? -8.967  -20.690 -56.764 1.00 103.70 ? 76   ILE B C     1 
ATOM   2238  O  O     . ILE B 1  76   ? -8.232  -19.749 -57.066 1.00 102.99 ? 76   ILE B O     1 
ATOM   2239  C  CB    . ILE B 1  76   ? -9.009  -22.708 -58.252 1.00 112.18 ? 76   ILE B CB    1 
ATOM   2240  C  CG1   . ILE B 1  76   ? -8.612  -24.180 -58.382 1.00 114.89 ? 76   ILE B CG1   1 
ATOM   2241  C  CG2   . ILE B 1  76   ? -8.469  -21.906 -59.427 1.00 99.92  ? 76   ILE B CG2   1 
ATOM   2242  C  CD1   . ILE B 1  76   ? -9.108  -24.841 -59.650 1.00 111.52 ? 76   ILE B CD1   1 
ATOM   2243  N  N     . ILE B 1  77   ? -10.198 -20.528 -56.287 1.00 99.19  ? 77   ILE B N     1 
ATOM   2244  C  CA    . ILE B 1  77   ? -10.757 -19.207 -56.020 1.00 93.35  ? 77   ILE B CA    1 
ATOM   2245  C  C     . ILE B 1  77   ? -9.884  -18.461 -55.023 1.00 92.82  ? 77   ILE B C     1 
ATOM   2246  O  O     . ILE B 1  77   ? -9.553  -17.291 -55.213 1.00 82.12  ? 77   ILE B O     1 
ATOM   2247  C  CB    . ILE B 1  77   ? -12.187 -19.300 -55.462 1.00 97.82  ? 77   ILE B CB    1 
ATOM   2248  C  CG1   . ILE B 1  77   ? -13.090 -20.083 -56.417 1.00 101.31 ? 77   ILE B CG1   1 
ATOM   2249  C  CG2   . ILE B 1  77   ? -12.748 -17.912 -55.207 1.00 104.84 ? 77   ILE B CG2   1 
ATOM   2250  C  CD1   . ILE B 1  77   ? -14.442 -20.438 -55.825 1.00 107.60 ? 77   ILE B CD1   1 
ATOM   2251  N  N     . LEU B 1  78   ? -9.516  -19.170 -53.961 1.00 99.56  ? 78   LEU B N     1 
ATOM   2252  C  CA    . LEU B 1  78   ? -8.657  -18.647 -52.907 1.00 98.03  ? 78   LEU B CA    1 
ATOM   2253  C  C     . LEU B 1  78   ? -7.302  -18.236 -53.467 1.00 92.09  ? 78   LEU B C     1 
ATOM   2254  O  O     . LEU B 1  78   ? -6.784  -17.166 -53.145 1.00 84.19  ? 78   LEU B O     1 
ATOM   2255  C  CB    . LEU B 1  78   ? -8.482  -19.691 -51.798 1.00 97.23  ? 78   LEU B CB    1 
ATOM   2256  C  CG    . LEU B 1  78   ? -9.546  -19.801 -50.697 1.00 93.07  ? 78   LEU B CG    1 
ATOM   2257  C  CD1   . LEU B 1  78   ? -10.969 -19.779 -51.247 1.00 91.11  ? 78   LEU B CD1   1 
ATOM   2258  C  CD2   . LEU B 1  78   ? -9.319  -21.062 -49.873 1.00 89.31  ? 78   LEU B CD2   1 
ATOM   2259  N  N     . ASN B 1  79   ? -6.735  -19.099 -54.307 1.00 90.55  ? 79   ASN B N     1 
ATOM   2260  C  CA    . ASN B 1  79   ? -5.492  -18.798 -55.006 1.00 90.40  ? 79   ASN B CA    1 
ATOM   2261  C  C     . ASN B 1  79   ? -5.612  -17.535 -55.842 1.00 96.58  ? 79   ASN B C     1 
ATOM   2262  O  O     . ASN B 1  79   ? -4.680  -16.734 -55.917 1.00 98.78  ? 79   ASN B O     1 
ATOM   2263  C  CB    . ASN B 1  79   ? -5.082  -19.965 -55.906 1.00 89.33  ? 79   ASN B CB    1 
ATOM   2264  C  CG    . ASN B 1  79   ? -4.424  -21.093 -55.141 1.00 91.54  ? 79   ASN B CG    1 
ATOM   2265  O  OD1   . ASN B 1  79   ? -3.219  -21.066 -54.890 1.00 103.26 ? 79   ASN B OD1   1 
ATOM   2266  N  ND2   . ASN B 1  79   ? -5.208  -22.100 -54.779 1.00 85.36  ? 79   ASN B ND2   1 
ATOM   2267  N  N     . LEU B 1  80   ? -6.769  -17.365 -56.473 1.00 99.78  ? 80   LEU B N     1 
ATOM   2268  C  CA    . LEU B 1  80   ? -6.998  -16.220 -57.342 1.00 107.86 ? 80   LEU B CA    1 
ATOM   2269  C  C     . LEU B 1  80   ? -7.209  -14.937 -56.542 1.00 108.17 ? 80   LEU B C     1 
ATOM   2270  O  O     . LEU B 1  80   ? -6.911  -13.845 -57.026 1.00 108.51 ? 80   LEU B O     1 
ATOM   2271  C  CB    . LEU B 1  80   ? -8.195  -16.476 -58.264 1.00 107.62 ? 80   LEU B CB    1 
ATOM   2272  C  CG    . LEU B 1  80   ? -7.930  -17.392 -59.464 1.00 105.76 ? 80   LEU B CG    1 
ATOM   2273  C  CD1   . LEU B 1  80   ? -9.185  -17.562 -60.312 1.00 102.43 ? 80   LEU B CD1   1 
ATOM   2274  C  CD2   . LEU B 1  80   ? -6.773  -16.866 -60.310 1.00 107.52 ? 80   LEU B CD2   1 
ATOM   2275  N  N     . LYS B 1  81   ? -7.716  -15.066 -55.319 1.00 99.72  ? 81   LYS B N     1 
ATOM   2276  C  CA    . LYS B 1  81   ? -7.931  -13.898 -54.472 1.00 96.07  ? 81   LYS B CA    1 
ATOM   2277  C  C     . LYS B 1  81   ? -6.608  -13.221 -54.131 1.00 95.89  ? 81   LYS B C     1 
ATOM   2278  O  O     . LYS B 1  81   ? -6.544  -12.002 -53.970 1.00 95.21  ? 81   LYS B O     1 
ATOM   2279  C  CB    . LYS B 1  81   ? -8.663  -14.285 -53.189 1.00 96.88  ? 81   LYS B CB    1 
ATOM   2280  C  CG    . LYS B 1  81   ? -10.096 -14.727 -53.399 1.00 96.86  ? 81   LYS B CG    1 
ATOM   2281  C  CD    . LYS B 1  81   ? -10.753 -15.050 -52.075 1.00 88.59  ? 81   LYS B CD    1 
ATOM   2282  C  CE    . LYS B 1  81   ? -12.173 -15.535 -52.267 1.00 86.88  ? 81   LYS B CE    1 
ATOM   2283  N  NZ    . LYS B 1  81   ? -12.789 -15.882 -50.961 1.00 80.59  ? 81   LYS B NZ    1 
ATOM   2284  N  N     . SER B 1  82   ? -5.554  -14.025 -54.035 1.00 97.48  ? 82   SER B N     1 
ATOM   2285  C  CA    . SER B 1  82   ? -4.232  -13.534 -53.668 1.00 97.16  ? 82   SER B CA    1 
ATOM   2286  C  C     . SER B 1  82   ? -3.457  -13.009 -54.876 1.00 102.64 ? 82   SER B C     1 
ATOM   2287  O  O     . SER B 1  82   ? -2.280  -12.663 -54.766 1.00 103.94 ? 82   SER B O     1 
ATOM   2288  C  CB    . SER B 1  82   ? -3.433  -14.638 -52.977 1.00 91.53  ? 82   SER B CB    1 
ATOM   2289  O  OG    . SER B 1  82   ? -2.173  -14.158 -52.545 1.00 90.99  ? 82   SER B OG    1 
ATOM   2290  N  N     . LEU B 1  83   ? -4.120  -12.954 -56.026 1.00 102.59 ? 83   LEU B N     1 
ATOM   2291  C  CA    . LEU B 1  83   ? -3.509  -12.417 -57.235 1.00 100.18 ? 83   LEU B CA    1 
ATOM   2292  C  C     . LEU B 1  83   ? -3.524  -10.890 -57.220 1.00 103.60 ? 83   LEU B C     1 
ATOM   2293  O  O     . LEU B 1  83   ? -4.583  -10.276 -57.081 1.00 105.82 ? 83   LEU B O     1 
ATOM   2294  C  CB    . LEU B 1  83   ? -4.234  -12.941 -58.475 1.00 96.82  ? 83   LEU B CB    1 
ATOM   2295  C  CG    . LEU B 1  83   ? -3.803  -12.355 -59.818 1.00 110.56 ? 83   LEU B CG    1 
ATOM   2296  C  CD1   . LEU B 1  83   ? -2.361  -12.729 -60.136 1.00 113.36 ? 83   LEU B CD1   1 
ATOM   2297  C  CD2   . LEU B 1  83   ? -4.745  -12.814 -60.921 1.00 114.43 ? 83   LEU B CD2   1 
ATOM   2298  N  N     . VAL B 1  84   ? -2.349  -10.283 -57.360 1.00 99.68  ? 84   VAL B N     1 
ATOM   2299  C  CA    . VAL B 1  84   ? -2.235  -8.826  -57.346 1.00 101.89 ? 84   VAL B CA    1 
ATOM   2300  C  C     . VAL B 1  84   ? -2.230  -8.255  -58.768 1.00 98.03  ? 84   VAL B C     1 
ATOM   2301  O  O     . VAL B 1  84   ? -1.469  -8.697  -59.629 1.00 99.10  ? 84   VAL B O     1 
ATOM   2302  C  CB    . VAL B 1  84   ? -0.969  -8.368  -56.584 1.00 106.52 ? 84   VAL B CB    1 
ATOM   2303  C  CG1   . VAL B 1  84   ? -1.129  -8.617  -55.094 1.00 99.23  ? 84   VAL B CG1   1 
ATOM   2304  C  CG2   . VAL B 1  84   ? 0.263   -9.084  -57.098 1.00 113.87 ? 84   VAL B CG2   1 
ATOM   2305  N  N     . VAL B 1  85   ? -3.099  -7.275  -59.005 1.00 96.89  ? 85   VAL B N     1 
ATOM   2306  C  CA    . VAL B 1  85   ? -3.331  -6.738  -60.345 1.00 98.62  ? 85   VAL B CA    1 
ATOM   2307  C  C     . VAL B 1  85   ? -3.551  -5.221  -60.316 1.00 106.12 ? 85   VAL B C     1 
ATOM   2308  O  O     . VAL B 1  85   ? -4.241  -4.711  -59.434 1.00 114.74 ? 85   VAL B O     1 
ATOM   2309  C  CB    . VAL B 1  85   ? -4.559  -7.425  -61.007 1.00 103.27 ? 85   VAL B CB    1 
ATOM   2310  C  CG1   . VAL B 1  85   ? -5.035  -6.657  -62.231 1.00 111.80 ? 85   VAL B CG1   1 
ATOM   2311  C  CG2   . VAL B 1  85   ? -4.241  -8.868  -61.369 1.00 109.63 ? 85   VAL B CG2   1 
ATOM   2312  N  N     . SER B 1  86   ? -2.957  -4.504  -61.270 1.00 105.54 ? 86   SER B N     1 
ATOM   2313  C  CA    . SER B 1  86   ? -3.204  -3.068  -61.416 1.00 113.44 ? 86   SER B CA    1 
ATOM   2314  C  C     . SER B 1  86   ? -3.821  -2.730  -62.775 1.00 117.99 ? 86   SER B C     1 
ATOM   2315  O  O     . SER B 1  86   ? -3.146  -2.787  -63.804 1.00 120.69 ? 86   SER B O     1 
ATOM   2316  C  CB    . SER B 1  86   ? -1.910  -2.271  -61.230 1.00 112.12 ? 86   SER B CB    1 
ATOM   2317  O  OG    . SER B 1  86   ? -1.379  -2.444  -59.928 1.00 114.81 ? 86   SER B OG    1 
ATOM   2318  N  N     . SER B 1  87   ? -5.103  -2.377  -62.773 1.00 118.93 ? 87   SER B N     1 
ATOM   2319  C  CA    . SER B 1  87   ? -5.790  -1.958  -63.991 1.00 114.95 ? 87   SER B CA    1 
ATOM   2320  C  C     . SER B 1  87   ? -5.731  -0.442  -64.112 1.00 122.47 ? 87   SER B C     1 
ATOM   2321  O  O     . SER B 1  87   ? -5.762  0.264   -63.106 1.00 132.91 ? 87   SER B O     1 
ATOM   2322  C  CB    . SER B 1  87   ? -7.242  -2.443  -63.989 1.00 112.08 ? 87   SER B CB    1 
ATOM   2323  O  OG    . SER B 1  87   ? -7.933  -2.016  -65.150 1.00 104.23 ? 87   SER B OG    1 
ATOM   2324  N  N     . GLU B 1  88   ? -5.639  0.063   -65.337 1.00 116.84 ? 88   GLU B N     1 
ATOM   2325  C  CA    . GLU B 1  88   ? -5.481  1.499   -65.535 1.00 115.61 ? 88   GLU B CA    1 
ATOM   2326  C  C     . GLU B 1  88   ? -6.820  2.206   -65.694 1.00 111.07 ? 88   GLU B C     1 
ATOM   2327  O  O     . GLU B 1  88   ? -6.947  3.388   -65.377 1.00 108.91 ? 88   GLU B O     1 
ATOM   2328  C  CB    . GLU B 1  88   ? -4.595  1.775   -66.749 1.00 124.46 ? 88   GLU B CB    1 
ATOM   2329  C  CG    . GLU B 1  88   ? -4.139  3.217   -66.852 1.00 129.12 ? 88   GLU B CG    1 
ATOM   2330  C  CD    . GLU B 1  88   ? -2.902  3.366   -67.707 1.00 136.00 ? 88   GLU B CD    1 
ATOM   2331  O  OE1   . GLU B 1  88   ? -2.549  2.395   -68.411 1.00 137.39 ? 88   GLU B OE1   1 
ATOM   2332  O  OE2   . GLU B 1  88   ? -2.277  4.446   -67.670 1.00 135.50 ? 88   GLU B OE2   1 
ATOM   2333  N  N     . GLU B 1  89   ? -7.815  1.473   -66.183 1.00 115.59 ? 89   GLU B N     1 
ATOM   2334  C  CA    . GLU B 1  89   ? -9.149  2.025   -66.385 1.00 123.48 ? 89   GLU B CA    1 
ATOM   2335  C  C     . GLU B 1  89   ? -10.141 1.532   -65.338 1.00 126.84 ? 89   GLU B C     1 
ATOM   2336  O  O     . GLU B 1  89   ? -10.136 0.356   -64.968 1.00 126.35 ? 89   GLU B O     1 
ATOM   2337  C  CB    . GLU B 1  89   ? -9.667  1.687   -67.787 1.00 124.33 ? 89   GLU B CB    1 
ATOM   2338  C  CG    . GLU B 1  89   ? -9.171  2.624   -68.878 1.00 131.86 ? 89   GLU B CG    1 
ATOM   2339  C  CD    . GLU B 1  89   ? -9.642  4.055   -68.682 1.00 126.04 ? 89   GLU B CD    1 
ATOM   2340  O  OE1   . GLU B 1  89   ? -10.640 4.268   -67.958 1.00 117.57 ? 89   GLU B OE1   1 
ATOM   2341  O  OE2   . GLU B 1  89   ? -9.012  4.972   -69.250 1.00 125.05 ? 89   GLU B OE2   1 
ATOM   2342  N  N     . ASP B 1  90   ? -10.993 2.446   -64.880 1.00 130.90 ? 90   ASP B N     1 
ATOM   2343  C  CA    . ASP B 1  90   ? -11.986 2.167   -63.845 1.00 133.49 ? 90   ASP B CA    1 
ATOM   2344  C  C     . ASP B 1  90   ? -12.979 1.102   -64.292 1.00 132.39 ? 90   ASP B C     1 
ATOM   2345  O  O     . ASP B 1  90   ? -13.363 0.228   -63.514 1.00 130.44 ? 90   ASP B O     1 
ATOM   2346  C  CB    . ASP B 1  90   ? -12.734 3.450   -63.476 1.00 136.16 ? 90   ASP B CB    1 
ATOM   2347  C  CG    . ASP B 1  90   ? -13.422 3.368   -62.122 1.00 140.08 ? 90   ASP B CG    1 
ATOM   2348  O  OD1   . ASP B 1  90   ? -13.955 2.294   -61.768 1.00 135.80 ? 90   ASP B OD1   1 
ATOM   2349  O  OD2   . ASP B 1  90   ? -13.430 4.391   -61.404 1.00 143.84 ? 90   ASP B OD2   1 
ATOM   2350  N  N     . GLU B 1  91   ? -13.392 1.187   -65.552 1.00 125.58 ? 91   GLU B N     1 
ATOM   2351  C  CA    . GLU B 1  91   ? -14.379 0.275   -66.113 1.00 122.34 ? 91   GLU B CA    1 
ATOM   2352  C  C     . GLU B 1  91   ? -13.865 -1.167  -66.142 1.00 123.86 ? 91   GLU B C     1 
ATOM   2353  O  O     . GLU B 1  91   ? -12.670 -1.399  -66.327 1.00 120.86 ? 91   GLU B O     1 
ATOM   2354  C  CB    . GLU B 1  91   ? -14.774 0.750   -67.515 1.00 122.23 ? 91   GLU B CB    1 
ATOM   2355  C  CG    . GLU B 1  91   ? -15.891 1.796   -67.529 1.00 121.56 ? 91   GLU B CG    1 
ATOM   2356  C  CD    . GLU B 1  91   ? -15.584 3.015   -66.673 1.00 126.41 ? 91   GLU B CD    1 
ATOM   2357  O  OE1   . GLU B 1  91   ? -14.405 3.426   -66.613 1.00 120.94 ? 91   GLU B OE1   1 
ATOM   2358  O  OE2   . GLU B 1  91   ? -16.525 3.561   -66.055 1.00 135.34 ? 91   GLU B OE2   1 
ATOM   2359  N  N     . PRO B 1  92   ? -14.773 -2.144  -65.950 1.00 119.76 ? 92   PRO B N     1 
ATOM   2360  C  CA    . PRO B 1  92   ? -14.417 -3.567  -65.845 1.00 111.12 ? 92   PRO B CA    1 
ATOM   2361  C  C     . PRO B 1  92   ? -13.781 -4.132  -67.108 1.00 108.98 ? 92   PRO B C     1 
ATOM   2362  O  O     . PRO B 1  92   ? -14.377 -4.053  -68.179 1.00 118.46 ? 92   PRO B O     1 
ATOM   2363  C  CB    . PRO B 1  92   ? -15.767 -4.252  -65.580 1.00 112.37 ? 92   PRO B CB    1 
ATOM   2364  C  CG    . PRO B 1  92   ? -16.784 -3.295  -66.093 1.00 117.10 ? 92   PRO B CG    1 
ATOM   2365  C  CD    . PRO B 1  92   ? -16.228 -1.938  -65.833 1.00 118.72 ? 92   PRO B CD    1 
ATOM   2366  N  N     . VAL B 1  93   ? -12.584 -4.694  -66.979 1.00 111.06 ? 93   VAL B N     1 
ATOM   2367  C  CA    . VAL B 1  93   ? -11.912 -5.326  -68.109 1.00 117.87 ? 93   VAL B CA    1 
ATOM   2368  C  C     . VAL B 1  93   ? -12.054 -6.847  -68.005 1.00 115.94 ? 93   VAL B C     1 
ATOM   2369  O  O     . VAL B 1  93   ? -12.667 -7.350  -67.064 1.00 118.70 ? 93   VAL B O     1 
ATOM   2370  C  CB    . VAL B 1  93   ? -10.419 -4.924  -68.179 1.00 115.76 ? 93   VAL B CB    1 
ATOM   2371  C  CG1   . VAL B 1  93   ? -10.281 -3.405  -68.234 1.00 116.53 ? 93   VAL B CG1   1 
ATOM   2372  C  CG2   . VAL B 1  93   ? -9.650  -5.486  -66.992 1.00 119.80 ? 93   VAL B CG2   1 
ATOM   2373  N  N     . THR B 1  94   ? -11.510 -7.578  -68.974 1.00 110.34 ? 94   THR B N     1 
ATOM   2374  C  CA    . THR B 1  94   ? -11.565 -9.039  -68.935 1.00 112.71 ? 94   THR B CA    1 
ATOM   2375  C  C     . THR B 1  94   ? -10.285 -9.657  -69.489 1.00 116.44 ? 94   THR B C     1 
ATOM   2376  O  O     . THR B 1  94   ? -9.850  -9.329  -70.593 1.00 119.27 ? 94   THR B O     1 
ATOM   2377  C  CB    . THR B 1  94   ? -12.780 -9.587  -69.718 1.00 101.85 ? 94   THR B CB    1 
ATOM   2378  O  OG1   . THR B 1  94   ? -13.989 -9.063  -69.157 1.00 101.70 ? 94   THR B OG1   1 
ATOM   2379  C  CG2   . THR B 1  94   ? -12.824 -11.108 -69.650 1.00 100.68 ? 94   THR B CG2   1 
ATOM   2380  N  N     . MET B 1  95   ? -9.680  -10.547 -68.709 1.00 112.93 ? 95   MET B N     1 
ATOM   2381  C  CA    . MET B 1  95   ? -8.462  -11.230 -69.121 1.00 110.97 ? 95   MET B CA    1 
ATOM   2382  C  C     . MET B 1  95   ? -8.727  -12.722 -69.250 1.00 116.59 ? 95   MET B C     1 
ATOM   2383  O  O     . MET B 1  95   ? -9.608  -13.259 -68.581 1.00 119.21 ? 95   MET B O     1 
ATOM   2384  C  CB    . MET B 1  95   ? -7.330  -10.970 -68.123 1.00 117.95 ? 95   MET B CB    1 
ATOM   2385  C  CG    . MET B 1  95   ? -7.641  -11.405 -66.700 1.00 119.69 ? 95   MET B CG    1 
ATOM   2386  S  SD    . MET B 1  95   ? -6.300  -11.045 -65.550 1.00 118.27 ? 95   MET B SD    1 
ATOM   2387  C  CE    . MET B 1  95   ? -6.163  -9.271  -65.734 1.00 107.61 ? 95   MET B CE    1 
ATOM   2388  N  N     . TYR B 1  96   ? -7.972  -13.391 -70.114 1.00 119.83 ? 96   TYR B N     1 
ATOM   2389  C  CA    . TYR B 1  96   ? -8.165  -14.822 -70.316 1.00 124.37 ? 96   TYR B CA    1 
ATOM   2390  C  C     . TYR B 1  96   ? -6.942  -15.630 -69.889 1.00 119.88 ? 96   TYR B C     1 
ATOM   2391  O  O     . TYR B 1  96   ? -5.800  -15.201 -70.063 1.00 118.98 ? 96   TYR B O     1 
ATOM   2392  C  CB    . TYR B 1  96   ? -8.506  -15.119 -71.780 1.00 127.14 ? 96   TYR B CB    1 
ATOM   2393  C  CG    . TYR B 1  96   ? -9.918  -14.737 -72.185 1.00 127.02 ? 96   TYR B CG    1 
ATOM   2394  C  CD1   . TYR B 1  96   ? -10.995 -15.575 -71.910 1.00 122.33 ? 96   TYR B CD1   1 
ATOM   2395  C  CD2   . TYR B 1  96   ? -10.173 -13.545 -72.853 1.00 124.82 ? 96   TYR B CD2   1 
ATOM   2396  C  CE1   . TYR B 1  96   ? -12.287 -15.231 -72.282 1.00 116.96 ? 96   TYR B CE1   1 
ATOM   2397  C  CE2   . TYR B 1  96   ? -11.461 -13.193 -73.228 1.00 123.84 ? 96   TYR B CE2   1 
ATOM   2398  C  CZ    . TYR B 1  96   ? -12.513 -14.039 -72.941 1.00 118.01 ? 96   TYR B CZ    1 
ATOM   2399  O  OH    . TYR B 1  96   ? -13.794 -13.693 -73.312 1.00 109.06 ? 96   TYR B OH    1 
ATOM   2400  N  N     . LEU B 1  97   ? -7.196  -16.802 -69.318 1.00 114.95 ? 97   LEU B N     1 
ATOM   2401  C  CA    . LEU B 1  97   ? -6.129  -17.709 -68.927 1.00 111.18 ? 97   LEU B CA    1 
ATOM   2402  C  C     . LEU B 1  97   ? -6.461  -19.129 -69.364 1.00 113.48 ? 97   LEU B C     1 
ATOM   2403  O  O     . LEU B 1  97   ? -7.337  -19.780 -68.794 1.00 112.60 ? 97   LEU B O     1 
ATOM   2404  C  CB    . LEU B 1  97   ? -5.895  -17.655 -67.418 1.00 108.39 ? 97   LEU B CB    1 
ATOM   2405  C  CG    . LEU B 1  97   ? -4.857  -18.640 -66.881 1.00 109.85 ? 97   LEU B CG    1 
ATOM   2406  C  CD1   . LEU B 1  97   ? -3.560  -18.515 -67.655 1.00 110.94 ? 97   LEU B CD1   1 
ATOM   2407  C  CD2   . LEU B 1  97   ? -4.619  -18.412 -65.398 1.00 118.65 ? 97   LEU B CD2   1 
ATOM   2408  N  N     . ARG B 1  98   ? -5.757  -19.599 -70.387 1.00 117.02 ? 98   ARG B N     1 
ATOM   2409  C  CA    . ARG B 1  98   ? -5.976  -20.935 -70.922 1.00 116.20 ? 98   ARG B CA    1 
ATOM   2410  C  C     . ARG B 1  98   ? -4.676  -21.730 -70.934 1.00 111.92 ? 98   ARG B C     1 
ATOM   2411  O  O     . ARG B 1  98   ? -3.627  -21.209 -71.314 1.00 108.23 ? 98   ARG B O     1 
ATOM   2412  C  CB    . ARG B 1  98   ? -6.551  -20.862 -72.337 1.00 121.81 ? 98   ARG B CB    1 
ATOM   2413  C  CG    . ARG B 1  98   ? -7.717  -19.902 -72.500 1.00 119.34 ? 98   ARG B CG    1 
ATOM   2414  C  CD    . ARG B 1  98   ? -8.167  -19.860 -73.950 1.00 115.59 ? 98   ARG B CD    1 
ATOM   2415  N  NE    . ARG B 1  98   ? -9.214  -18.870 -74.181 1.00 111.99 ? 98   ARG B NE    1 
ATOM   2416  C  CZ    . ARG B 1  98   ? -8.989  -17.633 -74.610 1.00 115.41 ? 98   ARG B CZ    1 
ATOM   2417  N  NH1   . ARG B 1  98   ? -7.750  -17.229 -74.857 1.00 106.82 ? 98   ARG B NH1   1 
ATOM   2418  N  NH2   . ARG B 1  98   ? -10.003 -16.799 -74.796 1.00 121.75 ? 98   ARG B NH2   1 
ATOM   2419  N  N     . LYS B 1  99   ? -4.746  -22.989 -70.514 1.00 109.16 ? 99   LYS B N     1 
ATOM   2420  C  CA    . LYS B 1  99   ? -3.586  -23.870 -70.556 1.00 107.55 ? 99   LYS B CA    1 
ATOM   2421  C  C     . LYS B 1  99   ? -4.021  -25.328 -70.480 1.00 107.64 ? 99   LYS B C     1 
ATOM   2422  O  O     . LYS B 1  99   ? -5.013  -25.655 -69.830 1.00 105.55 ? 99   LYS B O     1 
ATOM   2423  C  CB    . LYS B 1  99   ? -2.608  -23.545 -69.424 1.00 109.87 ? 99   LYS B CB    1 
ATOM   2424  C  CG    . LYS B 1  99   ? -1.184  -24.010 -69.695 1.00 109.61 ? 99   LYS B CG    1 
ATOM   2425  C  CD    . LYS B 1  99   ? -0.218  -23.523 -68.628 1.00 115.52 ? 99   LYS B CD    1 
ATOM   2426  C  CE    . LYS B 1  99   ? 1.223   -23.833 -69.008 1.00 114.50 ? 99   LYS B CE    1 
ATOM   2427  N  NZ    . LYS B 1  99   ? 1.433   -25.279 -69.297 1.00 95.27  ? 99   LYS B NZ    1 
ATOM   2428  N  N     . GLN B 1  100  ? -3.270  -26.197 -71.148 1.00 116.31 ? 100  GLN B N     1 
ATOM   2429  C  CA    . GLN B 1  100  ? -3.622  -27.609 -71.244 1.00 129.56 ? 100  GLN B CA    1 
ATOM   2430  C  C     . GLN B 1  100  ? -2.377  -28.495 -71.137 1.00 131.62 ? 100  GLN B C     1 
ATOM   2431  O  O     . GLN B 1  100  ? -1.248  -28.007 -71.220 1.00 121.13 ? 100  GLN B O     1 
ATOM   2432  C  CB    . GLN B 1  100  ? -4.366  -27.874 -72.559 1.00 132.29 ? 100  GLN B CB    1 
ATOM   2433  C  CG    . GLN B 1  100  ? -5.204  -29.148 -72.579 1.00 135.57 ? 100  GLN B CG    1 
ATOM   2434  C  CD    . GLN B 1  100  ? -5.977  -29.324 -73.873 1.00 136.89 ? 100  GLN B CD    1 
ATOM   2435  O  OE1   . GLN B 1  100  ? -6.238  -28.359 -74.593 1.00 122.02 ? 100  GLN B OE1   1 
ATOM   2436  N  NE2   . GLN B 1  100  ? -6.345  -30.565 -74.176 1.00 145.99 ? 100  GLN B NE2   1 
ATOM   2437  N  N     . GLY B 1  101  ? -2.586  -29.795 -70.946 1.00 129.79 ? 101  GLY B N     1 
ATOM   2438  C  CA    . GLY B 1  101  ? -1.489  -30.736 -70.819 1.00 124.62 ? 101  GLY B CA    1 
ATOM   2439  C  C     . GLY B 1  101  ? -1.043  -30.879 -69.378 1.00 132.03 ? 101  GLY B C     1 
ATOM   2440  O  O     . GLY B 1  101  ? -1.666  -30.317 -68.478 1.00 143.49 ? 101  GLY B O     1 
ATOM   2441  N  N     . PRO B 1  102  ? 0.035   -31.642 -69.149 1.00 128.85 ? 102  PRO B N     1 
ATOM   2442  C  CA    . PRO B 1  102  ? 0.597   -31.819 -67.807 1.00 133.18 ? 102  PRO B CA    1 
ATOM   2443  C  C     . PRO B 1  102  ? 1.522   -30.670 -67.411 1.00 131.26 ? 102  PRO B C     1 
ATOM   2444  O  O     . PRO B 1  102  ? 2.275   -30.170 -68.247 1.00 135.97 ? 102  PRO B O     1 
ATOM   2445  C  CB    . PRO B 1  102  ? 1.374   -33.128 -67.932 1.00 134.47 ? 102  PRO B CB    1 
ATOM   2446  C  CG    . PRO B 1  102  ? 1.824   -33.138 -69.352 1.00 145.51 ? 102  PRO B CG    1 
ATOM   2447  C  CD    . PRO B 1  102  ? 0.721   -32.480 -70.148 1.00 133.81 ? 102  PRO B CD    1 
ATOM   2448  N  N     . GLY B 1  103  ? 1.460   -30.261 -66.148 1.00 125.20 ? 103  GLY B N     1 
ATOM   2449  C  CA    . GLY B 1  103  ? 2.283   -29.171 -65.658 1.00 124.39 ? 103  GLY B CA    1 
ATOM   2450  C  C     . GLY B 1  103  ? 1.556   -28.312 -64.644 1.00 122.34 ? 103  GLY B C     1 
ATOM   2451  O  O     . GLY B 1  103  ? 0.545   -28.727 -64.078 1.00 123.91 ? 103  GLY B O     1 
ATOM   2452  N  N     . GLU B 1  104  ? 2.071   -27.108 -64.416 1.00 117.05 ? 104  GLU B N     1 
ATOM   2453  C  CA    . GLU B 1  104  ? 1.487   -26.192 -63.442 1.00 116.73 ? 104  GLU B CA    1 
ATOM   2454  C  C     . GLU B 1  104  ? 1.201   -24.827 -64.063 1.00 119.46 ? 104  GLU B C     1 
ATOM   2455  O  O     . GLU B 1  104  ? 2.057   -24.246 -64.731 1.00 118.42 ? 104  GLU B O     1 
ATOM   2456  C  CB    . GLU B 1  104  ? 2.411   -26.035 -62.230 1.00 114.44 ? 104  GLU B CB    1 
ATOM   2457  C  CG    . GLU B 1  104  ? 2.612   -27.310 -61.419 1.00 116.14 ? 104  GLU B CG    1 
ATOM   2458  C  CD    . GLU B 1  104  ? 3.430   -27.080 -60.160 1.00 111.28 ? 104  GLU B CD    1 
ATOM   2459  O  OE1   . GLU B 1  104  ? 3.769   -25.912 -59.875 1.00 110.89 ? 104  GLU B OE1   1 
ATOM   2460  O  OE2   . GLU B 1  104  ? 3.733   -28.065 -59.455 1.00 107.72 ? 104  GLU B OE2   1 
ATOM   2461  N  N     . VAL B 1  105  ? -0.008  -24.321 -63.840 1.00 124.23 ? 105  VAL B N     1 
ATOM   2462  C  CA    . VAL B 1  105  ? -0.403  -23.014 -64.354 1.00 119.13 ? 105  VAL B CA    1 
ATOM   2463  C  C     . VAL B 1  105  ? -0.102  -21.926 -63.332 1.00 119.90 ? 105  VAL B C     1 
ATOM   2464  O  O     . VAL B 1  105  ? -0.430  -22.065 -62.155 1.00 126.45 ? 105  VAL B O     1 
ATOM   2465  C  CB    . VAL B 1  105  ? -1.901  -22.969 -64.710 1.00 113.28 ? 105  VAL B CB    1 
ATOM   2466  C  CG1   . VAL B 1  105  ? -2.248  -21.648 -65.379 1.00 109.78 ? 105  VAL B CG1   1 
ATOM   2467  C  CG2   . VAL B 1  105  ? -2.266  -24.132 -65.611 1.00 120.36 ? 105  VAL B CG2   1 
ATOM   2468  N  N     . THR B 1  106  ? 0.522   -20.843 -63.780 1.00 116.26 ? 106  THR B N     1 
ATOM   2469  C  CA    . THR B 1  106  ? 0.894   -19.765 -62.875 1.00 118.20 ? 106  THR B CA    1 
ATOM   2470  C  C     . THR B 1  106  ? 0.255   -18.441 -63.277 1.00 116.17 ? 106  THR B C     1 
ATOM   2471  O  O     . THR B 1  106  ? -0.591  -18.392 -64.169 1.00 118.75 ? 106  THR B O     1 
ATOM   2472  C  CB    . THR B 1  106  ? 2.422   -19.592 -62.812 1.00 124.52 ? 106  THR B CB    1 
ATOM   2473  O  OG1   . THR B 1  106  ? 2.943   -19.434 -64.138 1.00 127.42 ? 106  THR B OG1   1 
ATOM   2474  C  CG2   . THR B 1  106  ? 3.065   -20.809 -62.164 1.00 123.83 ? 106  THR B CG2   1 
ATOM   2475  N  N     . ALA B 1  107  ? 0.663   -17.370 -62.605 1.00 112.32 ? 107  ALA B N     1 
ATOM   2476  C  CA    . ALA B 1  107  ? 0.134   -16.043 -62.890 1.00 111.48 ? 107  ALA B CA    1 
ATOM   2477  C  C     . ALA B 1  107  ? 0.857   -15.416 -64.077 1.00 120.09 ? 107  ALA B C     1 
ATOM   2478  O  O     . ALA B 1  107  ? 0.454   -14.364 -64.576 1.00 122.69 ? 107  ALA B O     1 
ATOM   2479  C  CB    . ALA B 1  107  ? 0.248   -15.154 -61.665 1.00 109.03 ? 107  ALA B CB    1 
ATOM   2480  N  N     . GLY B 1  108  ? 1.928   -16.067 -64.522 1.00 123.57 ? 108  GLY B N     1 
ATOM   2481  C  CA    . GLY B 1  108  ? 2.679   -15.608 -65.677 1.00 125.76 ? 108  GLY B CA    1 
ATOM   2482  C  C     . GLY B 1  108  ? 2.054   -16.094 -66.970 1.00 126.89 ? 108  GLY B C     1 
ATOM   2483  O  O     . GLY B 1  108  ? 2.353   -15.585 -68.051 1.00 125.03 ? 108  GLY B O     1 
ATOM   2484  N  N     . ASP B 1  109  ? 1.180   -17.088 -66.851 1.00 127.67 ? 109  ASP B N     1 
ATOM   2485  C  CA    . ASP B 1  109  ? 0.474   -17.641 -68.000 1.00 123.60 ? 109  ASP B CA    1 
ATOM   2486  C  C     . ASP B 1  109  ? -0.724  -16.775 -68.369 1.00 120.19 ? 109  ASP B C     1 
ATOM   2487  O  O     . ASP B 1  109  ? -1.303  -16.923 -69.445 1.00 122.99 ? 109  ASP B O     1 
ATOM   2488  C  CB    . ASP B 1  109  ? 0.014   -19.071 -67.712 1.00 127.76 ? 109  ASP B CB    1 
ATOM   2489  C  CG    . ASP B 1  109  ? 1.151   -19.973 -67.277 1.00 135.57 ? 109  ASP B CG    1 
ATOM   2490  O  OD1   . ASP B 1  109  ? 0.910   -20.875 -66.446 1.00 133.22 ? 109  ASP B OD1   1 
ATOM   2491  O  OD2   . ASP B 1  109  ? 2.286   -19.781 -67.763 1.00 139.62 ? 109  ASP B OD2   1 
ATOM   2492  N  N     . ILE B 1  110  ? -1.094  -15.880 -67.460 1.00 123.50 ? 110  ILE B N     1 
ATOM   2493  C  CA    . ILE B 1  110  ? -2.230  -14.988 -67.660 1.00 125.86 ? 110  ILE B CA    1 
ATOM   2494  C  C     . ILE B 1  110  ? -2.016  -14.068 -68.858 1.00 124.13 ? 110  ILE B C     1 
ATOM   2495  O  O     . ILE B 1  110  ? -0.931  -13.516 -69.036 1.00 118.77 ? 110  ILE B O     1 
ATOM   2496  C  CB    . ILE B 1  110  ? -2.489  -14.126 -66.406 1.00 129.86 ? 110  ILE B CB    1 
ATOM   2497  C  CG1   . ILE B 1  110  ? -2.718  -15.013 -65.182 1.00 130.74 ? 110  ILE B CG1   1 
ATOM   2498  C  CG2   . ILE B 1  110  ? -3.676  -13.201 -66.621 1.00 122.23 ? 110  ILE B CG2   1 
ATOM   2499  C  CD1   . ILE B 1  110  ? -2.972  -14.234 -63.907 1.00 118.93 ? 110  ILE B CD1   1 
ATOM   2500  N  N     . VAL B 1  111  ? -3.051  -13.920 -69.679 1.00 123.80 ? 111  VAL B N     1 
ATOM   2501  C  CA    . VAL B 1  111  ? -3.022  -12.985 -70.798 1.00 124.35 ? 111  VAL B CA    1 
ATOM   2502  C  C     . VAL B 1  111  ? -3.727  -11.686 -70.408 1.00 118.24 ? 111  VAL B C     1 
ATOM   2503  O  O     . VAL B 1  111  ? -4.956  -11.626 -70.391 1.00 117.29 ? 111  VAL B O     1 
ATOM   2504  C  CB    . VAL B 1  111  ? -3.691  -13.582 -72.054 1.00 128.00 ? 111  VAL B CB    1 
ATOM   2505  C  CG1   . VAL B 1  111  ? -3.598  -12.610 -73.221 1.00 124.69 ? 111  VAL B CG1   1 
ATOM   2506  C  CG2   . VAL B 1  111  ? -3.055  -14.918 -72.415 1.00 126.42 ? 111  VAL B CG2   1 
ATOM   2507  N  N     . PRO B 1  112  ? -2.946  -10.641 -70.082 1.00 116.97 ? 112  PRO B N     1 
ATOM   2508  C  CA    . PRO B 1  112  ? -3.501  -9.373  -69.599 1.00 120.74 ? 112  PRO B CA    1 
ATOM   2509  C  C     . PRO B 1  112  ? -3.813  -8.370  -70.711 1.00 120.43 ? 112  PRO B C     1 
ATOM   2510  O  O     . PRO B 1  112  ? -3.063  -8.285  -71.684 1.00 121.65 ? 112  PRO B O     1 
ATOM   2511  C  CB    . PRO B 1  112  ? -2.384  -8.840  -68.703 1.00 120.24 ? 112  PRO B CB    1 
ATOM   2512  C  CG    . PRO B 1  112  ? -1.135  -9.309  -69.385 1.00 106.74 ? 112  PRO B CG    1 
ATOM   2513  C  CD    . PRO B 1  112  ? -1.471  -10.642 -70.030 1.00 111.83 ? 112  PRO B CD    1 
ATOM   2514  N  N     . PRO B 1  113  ? -4.912  -7.612  -70.565 1.00 118.00 ? 113  PRO B N     1 
ATOM   2515  C  CA    . PRO B 1  113  ? -5.251  -6.526  -71.493 1.00 111.06 ? 113  PRO B CA    1 
ATOM   2516  C  C     . PRO B 1  113  ? -4.254  -5.368  -71.413 1.00 112.33 ? 113  PRO B C     1 
ATOM   2517  O  O     . PRO B 1  113  ? -3.282  -5.442  -70.659 1.00 112.38 ? 113  PRO B O     1 
ATOM   2518  C  CB    . PRO B 1  113  ? -6.644  -6.083  -71.025 1.00 103.21 ? 113  PRO B CB    1 
ATOM   2519  C  CG    . PRO B 1  113  ? -7.178  -7.242  -70.247 1.00 110.47 ? 113  PRO B CG    1 
ATOM   2520  C  CD    . PRO B 1  113  ? -5.981  -7.842  -69.579 1.00 120.50 ? 113  PRO B CD    1 
ATOM   2521  N  N     . ALA B 1  114  ? -4.492  -4.312  -72.183 1.00 111.40 ? 114  ALA B N     1 
ATOM   2522  C  CA    . ALA B 1  114  ? -3.605  -3.153  -72.179 1.00 107.18 ? 114  ALA B CA    1 
ATOM   2523  C  C     . ALA B 1  114  ? -3.862  -2.276  -70.960 1.00 107.07 ? 114  ALA B C     1 
ATOM   2524  O  O     . ALA B 1  114  ? -5.009  -1.975  -70.633 1.00 109.06 ? 114  ALA B O     1 
ATOM   2525  C  CB    . ALA B 1  114  ? -3.772  -2.347  -73.458 1.00 107.07 ? 114  ALA B CB    1 
ATOM   2526  N  N     . GLY B 1  115  ? -2.790  -1.869  -70.290 1.00 111.41 ? 115  GLY B N     1 
ATOM   2527  C  CA    . GLY B 1  115  ? -2.904  -1.054  -69.094 1.00 121.46 ? 115  GLY B CA    1 
ATOM   2528  C  C     . GLY B 1  115  ? -3.225  -1.879  -67.861 1.00 124.62 ? 115  GLY B C     1 
ATOM   2529  O  O     . GLY B 1  115  ? -3.601  -1.341  -66.818 1.00 121.27 ? 115  GLY B O     1 
ATOM   2530  N  N     . VAL B 1  116  ? -3.080  -3.195  -67.984 1.00 123.50 ? 116  VAL B N     1 
ATOM   2531  C  CA    . VAL B 1  116  ? -3.335  -4.106  -66.874 1.00 114.42 ? 116  VAL B CA    1 
ATOM   2532  C  C     . VAL B 1  116  ? -2.112  -4.992  -66.637 1.00 107.33 ? 116  VAL B C     1 
ATOM   2533  O  O     . VAL B 1  116  ? -1.686  -5.728  -67.528 1.00 103.09 ? 116  VAL B O     1 
ATOM   2534  C  CB    . VAL B 1  116  ? -4.583  -4.978  -67.137 1.00 110.88 ? 116  VAL B CB    1 
ATOM   2535  C  CG1   . VAL B 1  116  ? -4.793  -5.961  -66.003 1.00 112.23 ? 116  VAL B CG1   1 
ATOM   2536  C  CG2   . VAL B 1  116  ? -5.817  -4.103  -67.315 1.00 108.15 ? 116  VAL B CG2   1 
ATOM   2537  N  N     . THR B 1  117  ? -1.550  -4.913  -65.434 1.00 107.27 ? 117  THR B N     1 
ATOM   2538  C  CA    . THR B 1  117  ? -0.302  -5.605  -65.124 1.00 104.84 ? 117  THR B CA    1 
ATOM   2539  C  C     . THR B 1  117  ? -0.428  -6.561  -63.936 1.00 110.22 ? 117  THR B C     1 
ATOM   2540  O  O     . THR B 1  117  ? -0.985  -6.209  -62.895 1.00 113.14 ? 117  THR B O     1 
ATOM   2541  C  CB    . THR B 1  117  ? 0.830   -4.600  -64.822 1.00 103.12 ? 117  THR B CB    1 
ATOM   2542  O  OG1   . THR B 1  117  ? 0.766   -3.506  -65.746 1.00 88.51  ? 117  THR B OG1   1 
ATOM   2543  C  CG2   . THR B 1  117  ? 2.191   -5.276  -64.922 1.00 102.39 ? 117  THR B CG2   1 
ATOM   2544  N  N     . VAL B 1  118  ? 0.100   -7.771  -64.105 1.00 111.34 ? 118  VAL B N     1 
ATOM   2545  C  CA    . VAL B 1  118  ? 0.166   -8.756  -63.027 1.00 115.05 ? 118  VAL B CA    1 
ATOM   2546  C  C     . VAL B 1  118  ? 1.527   -8.655  -62.331 1.00 118.04 ? 118  VAL B C     1 
ATOM   2547  O  O     . VAL B 1  118  ? 2.568   -8.674  -62.990 1.00 117.08 ? 118  VAL B O     1 
ATOM   2548  C  CB    . VAL B 1  118  ? -0.060  -10.189 -63.559 1.00 110.22 ? 118  VAL B CB    1 
ATOM   2549  C  CG1   . VAL B 1  118  ? 0.093   -11.209 -62.444 1.00 114.17 ? 118  VAL B CG1   1 
ATOM   2550  C  CG2   . VAL B 1  118  ? -1.434  -10.305 -64.207 1.00 104.06 ? 118  VAL B CG2   1 
ATOM   2551  N  N     . HIS B 1  119  ? 1.519   -8.544  -61.004 1.00 118.35 ? 119  HIS B N     1 
ATOM   2552  C  CA    . HIS B 1  119  ? 2.739   -8.228  -60.261 1.00 112.10 ? 119  HIS B CA    1 
ATOM   2553  C  C     . HIS B 1  119  ? 3.407   -9.439  -59.593 1.00 109.04 ? 119  HIS B C     1 
ATOM   2554  O  O     . HIS B 1  119  ? 4.510   -9.319  -59.055 1.00 104.27 ? 119  HIS B O     1 
ATOM   2555  C  CB    . HIS B 1  119  ? 2.441   -7.160  -59.203 1.00 101.48 ? 119  HIS B CB    1 
ATOM   2556  C  CG    . HIS B 1  119  ? 1.820   -5.914  -59.757 1.00 101.07 ? 119  HIS B CG    1 
ATOM   2557  N  ND1   . HIS B 1  119  ? 2.566   -4.839  -60.193 1.00 103.32 ? 119  HIS B ND1   1 
ATOM   2558  C  CD2   . HIS B 1  119  ? 0.524   -5.571  -59.943 1.00 99.81  ? 119  HIS B CD2   1 
ATOM   2559  C  CE1   . HIS B 1  119  ? 1.756   -3.889  -60.624 1.00 99.17  ? 119  HIS B CE1   1 
ATOM   2560  N  NE2   . HIS B 1  119  ? 0.512   -4.308  -60.484 1.00 100.35 ? 119  HIS B NE2   1 
ATOM   2561  N  N     . ASN B 1  120  ? 2.751   -10.597 -59.624 1.00 104.05 ? 120  ASN B N     1 
ATOM   2562  C  CA    . ASN B 1  120  ? 3.338   -11.816 -59.066 1.00 99.21  ? 120  ASN B CA    1 
ATOM   2563  C  C     . ASN B 1  120  ? 3.199   -13.029 -59.991 1.00 106.71 ? 120  ASN B C     1 
ATOM   2564  O  O     . ASN B 1  120  ? 2.497   -13.987 -59.666 1.00 109.15 ? 120  ASN B O     1 
ATOM   2565  C  CB    . ASN B 1  120  ? 2.713   -12.126 -57.702 1.00 101.38 ? 120  ASN B CB    1 
ATOM   2566  C  CG    . ASN B 1  120  ? 1.202   -12.269 -57.767 1.00 99.82  ? 120  ASN B CG    1 
ATOM   2567  O  OD1   . ASN B 1  120  ? 0.570   -11.865 -58.742 1.00 96.60  ? 120  ASN B OD1   1 
ATOM   2568  N  ND2   . ASN B 1  120  ? 0.617   -12.846 -56.724 1.00 110.19 ? 120  ASN B ND2   1 
ATOM   2569  N  N     . PRO B 1  121  ? 3.894   -13.006 -61.140 1.00 112.63 ? 121  PRO B N     1 
ATOM   2570  C  CA    . PRO B 1  121  ? 3.761   -14.055 -62.161 1.00 113.64 ? 121  PRO B CA    1 
ATOM   2571  C  C     . PRO B 1  121  ? 4.257   -15.430 -61.709 1.00 112.68 ? 121  PRO B C     1 
ATOM   2572  O  O     . PRO B 1  121  ? 4.168   -16.387 -62.478 1.00 116.77 ? 121  PRO B O     1 
ATOM   2573  C  CB    . PRO B 1  121  ? 4.624   -13.532 -63.319 1.00 113.49 ? 121  PRO B CB    1 
ATOM   2574  C  CG    . PRO B 1  121  ? 4.821   -12.073 -63.041 1.00 115.22 ? 121  PRO B CG    1 
ATOM   2575  C  CD    . PRO B 1  121  ? 4.845   -11.962 -61.555 1.00 116.92 ? 121  PRO B CD    1 
ATOM   2576  N  N     . GLY B 1  122  ? 4.771   -15.526 -60.487 1.00 108.05 ? 122  GLY B N     1 
ATOM   2577  C  CA    . GLY B 1  122  ? 5.277   -16.784 -59.970 1.00 110.35 ? 122  GLY B CA    1 
ATOM   2578  C  C     . GLY B 1  122  ? 4.310   -17.493 -59.039 1.00 110.86 ? 122  GLY B C     1 
ATOM   2579  O  O     . GLY B 1  122  ? 4.600   -18.586 -58.550 1.00 106.95 ? 122  GLY B O     1 
ATOM   2580  N  N     . MET B 1  123  ? 3.158   -16.874 -58.794 1.00 108.20 ? 123  MET B N     1 
ATOM   2581  C  CA    . MET B 1  123  ? 2.159   -17.439 -57.890 1.00 105.52 ? 123  MET B CA    1 
ATOM   2582  C  C     . MET B 1  123  ? 1.580   -18.747 -58.422 1.00 110.29 ? 123  MET B C     1 
ATOM   2583  O  O     . MET B 1  123  ? 1.143   -18.821 -59.571 1.00 114.80 ? 123  MET B O     1 
ATOM   2584  C  CB    . MET B 1  123  ? 1.023   -16.440 -57.646 1.00 105.63 ? 123  MET B CB    1 
ATOM   2585  C  CG    . MET B 1  123  ? -0.022  -16.933 -56.648 1.00 106.32 ? 123  MET B CG    1 
ATOM   2586  S  SD    . MET B 1  123  ? -1.516  -15.922 -56.567 1.00 98.04  ? 123  MET B SD    1 
ATOM   2587  C  CE    . MET B 1  123  ? -2.172  -16.165 -58.216 1.00 109.77 ? 123  MET B CE    1 
ATOM   2588  N  N     . HIS B 1  124  ? 1.578   -19.774 -57.578 1.00 110.78 ? 124  HIS B N     1 
ATOM   2589  C  CA    . HIS B 1  124  ? 0.960   -21.052 -57.918 1.00 114.53 ? 124  HIS B CA    1 
ATOM   2590  C  C     . HIS B 1  124  ? -0.557  -20.902 -58.000 1.00 112.95 ? 124  HIS B C     1 
ATOM   2591  O  O     . HIS B 1  124  ? -1.156  -20.174 -57.208 1.00 110.88 ? 124  HIS B O     1 
ATOM   2592  C  CB    . HIS B 1  124  ? 1.334   -22.123 -56.889 1.00 115.80 ? 124  HIS B CB    1 
ATOM   2593  C  CG    . HIS B 1  124  ? 0.704   -23.457 -57.144 1.00 111.69 ? 124  HIS B CG    1 
ATOM   2594  N  ND1   . HIS B 1  124  ? 1.261   -24.395 -57.987 1.00 111.78 ? 124  HIS B ND1   1 
ATOM   2595  C  CD2   . HIS B 1  124  ? -0.436  -24.010 -56.668 1.00 110.17 ? 124  HIS B CD2   1 
ATOM   2596  C  CE1   . HIS B 1  124  ? 0.492   -25.468 -58.018 1.00 114.80 ? 124  HIS B CE1   1 
ATOM   2597  N  NE2   . HIS B 1  124  ? -0.545  -25.261 -57.227 1.00 112.68 ? 124  HIS B NE2   1 
ATOM   2598  N  N     . ILE B 1  125  ? -1.174  -21.589 -58.958 1.00 114.30 ? 125  ILE B N     1 
ATOM   2599  C  CA    . ILE B 1  125  ? -2.621  -21.508 -59.145 1.00 114.36 ? 125  ILE B CA    1 
ATOM   2600  C  C     . ILE B 1  125  ? -3.283  -22.884 -59.104 1.00 113.24 ? 125  ILE B C     1 
ATOM   2601  O  O     . ILE B 1  125  ? -4.073  -23.172 -58.204 1.00 112.94 ? 125  ILE B O     1 
ATOM   2602  C  CB    . ILE B 1  125  ? -2.982  -20.818 -60.481 1.00 114.00 ? 125  ILE B CB    1 
ATOM   2603  C  CG1   . ILE B 1  125  ? -2.461  -19.377 -60.500 1.00 112.31 ? 125  ILE B CG1   1 
ATOM   2604  C  CG2   . ILE B 1  125  ? -4.488  -20.841 -60.705 1.00 110.81 ? 125  ILE B CG2   1 
ATOM   2605  C  CD1   . ILE B 1  125  ? -2.876  -18.587 -61.727 1.00 106.75 ? 125  ILE B CD1   1 
ATOM   2606  N  N     . ALA B 1  126  ? -2.958  -23.731 -60.077 1.00 119.99 ? 126  ALA B N     1 
ATOM   2607  C  CA    . ALA B 1  126  ? -3.560  -25.058 -60.170 1.00 128.76 ? 126  ALA B CA    1 
ATOM   2608  C  C     . ALA B 1  126  ? -2.631  -26.053 -60.863 1.00 129.38 ? 126  ALA B C     1 
ATOM   2609  O  O     . ALA B 1  126  ? -1.901  -25.696 -61.787 1.00 126.46 ? 126  ALA B O     1 
ATOM   2610  C  CB    . ALA B 1  126  ? -4.893  -24.983 -60.905 1.00 128.99 ? 126  ALA B CB    1 
ATOM   2611  N  N     . THR B 1  127  ? -2.669  -27.304 -60.413 1.00 129.18 ? 127  THR B N     1 
ATOM   2612  C  CA    . THR B 1  127  ? -1.829  -28.352 -60.983 1.00 126.94 ? 127  THR B CA    1 
ATOM   2613  C  C     . THR B 1  127  ? -2.612  -29.201 -61.984 1.00 132.69 ? 127  THR B C     1 
ATOM   2614  O  O     . THR B 1  127  ? -3.483  -29.982 -61.601 1.00 139.27 ? 127  THR B O     1 
ATOM   2615  C  CB    . THR B 1  127  ? -1.246  -29.264 -59.882 1.00 123.39 ? 127  THR B CB    1 
ATOM   2616  O  OG1   . THR B 1  127  ? -0.504  -28.471 -58.946 1.00 122.52 ? 127  THR B OG1   1 
ATOM   2617  C  CG2   . THR B 1  127  ? -0.328  -30.317 -60.486 1.00 121.42 ? 127  THR B CG2   1 
ATOM   2618  N  N     . LEU B 1  128  ? -2.301  -29.038 -63.267 1.00 125.38 ? 128  LEU B N     1 
ATOM   2619  C  CA    . LEU B 1  128  ? -2.972  -29.789 -64.324 1.00 121.51 ? 128  LEU B CA    1 
ATOM   2620  C  C     . LEU B 1  128  ? -2.239  -31.089 -64.638 1.00 125.41 ? 128  LEU B C     1 
ATOM   2621  O  O     . LEU B 1  128  ? -1.010  -31.113 -64.712 1.00 124.89 ? 128  LEU B O     1 
ATOM   2622  C  CB    . LEU B 1  128  ? -3.091  -28.941 -65.595 1.00 117.78 ? 128  LEU B CB    1 
ATOM   2623  C  CG    . LEU B 1  128  ? -4.248  -27.943 -65.689 1.00 123.93 ? 128  LEU B CG    1 
ATOM   2624  C  CD1   . LEU B 1  128  ? -4.105  -27.058 -66.918 1.00 118.77 ? 128  LEU B CD1   1 
ATOM   2625  C  CD2   . LEU B 1  128  ? -5.579  -28.673 -65.719 1.00 134.22 ? 128  LEU B CD2   1 
ATOM   2626  N  N     . ASN B 1  129  ? -2.996  -32.167 -64.818 1.00 130.98 ? 129  ASN B N     1 
ATOM   2627  C  CA    . ASN B 1  129  ? -2.418  -33.440 -65.239 1.00 143.19 ? 129  ASN B CA    1 
ATOM   2628  C  C     . ASN B 1  129  ? -2.608  -33.643 -66.740 1.00 145.32 ? 129  ASN B C     1 
ATOM   2629  O  O     . ASN B 1  129  ? -3.113  -32.756 -67.429 1.00 147.17 ? 129  ASN B O     1 
ATOM   2630  C  CB    . ASN B 1  129  ? -3.037  -34.605 -64.461 1.00 138.73 ? 129  ASN B CB    1 
ATOM   2631  C  CG    . ASN B 1  129  ? -4.443  -34.937 -64.921 1.00 135.09 ? 129  ASN B CG    1 
ATOM   2632  O  OD1   . ASN B 1  129  ? -5.235  -34.048 -65.228 1.00 124.90 ? 129  ASN B OD1   1 
ATOM   2633  N  ND2   . ASN B 1  129  ? -4.757  -36.226 -64.977 1.00 141.95 ? 129  ASN B ND2   1 
ATOM   2634  N  N     . ASP B 1  130  ? -2.204  -34.804 -67.248 1.00 143.53 ? 130  ASP B N     1 
ATOM   2635  C  CA    . ASP B 1  130  ? -2.353  -35.095 -68.671 1.00 140.09 ? 130  ASP B CA    1 
ATOM   2636  C  C     . ASP B 1  130  ? -3.828  -35.153 -69.057 1.00 143.44 ? 130  ASP B C     1 
ATOM   2637  O  O     . ASP B 1  130  ? -4.677  -35.505 -68.235 1.00 140.90 ? 130  ASP B O     1 
ATOM   2638  C  CB    . ASP B 1  130  ? -1.661  -36.410 -69.034 1.00 144.83 ? 130  ASP B CB    1 
ATOM   2639  C  CG    . ASP B 1  130  ? -2.434  -37.626 -68.563 1.00 143.11 ? 130  ASP B CG    1 
ATOM   2640  O  OD1   . ASP B 1  130  ? -2.956  -37.601 -67.429 1.00 143.52 ? 130  ASP B OD1   1 
ATOM   2641  O  OD2   . ASP B 1  130  ? -2.523  -38.605 -69.334 1.00 140.23 ? 130  ASP B OD2   1 
ATOM   2642  N  N     . LYS B 1  131  ? -4.118  -34.800 -70.308 1.00 147.53 ? 131  LYS B N     1 
ATOM   2643  C  CA    . LYS B 1  131  ? -5.489  -34.718 -70.811 1.00 145.26 ? 131  LYS B CA    1 
ATOM   2644  C  C     . LYS B 1  131  ? -6.315  -33.746 -69.975 1.00 141.80 ? 131  LYS B C     1 
ATOM   2645  O  O     . LYS B 1  131  ? -7.530  -33.896 -69.845 1.00 136.59 ? 131  LYS B O     1 
ATOM   2646  C  CB    . LYS B 1  131  ? -6.152  -36.098 -70.826 1.00 141.81 ? 131  LYS B CB    1 
ATOM   2647  C  CG    . LYS B 1  131  ? -5.412  -37.131 -71.656 1.00 141.91 ? 131  LYS B CG    1 
ATOM   2648  C  CD    . LYS B 1  131  ? -6.184  -38.437 -71.722 1.00 142.55 ? 131  LYS B CD    1 
ATOM   2649  C  CE    . LYS B 1  131  ? -6.382  -39.033 -70.339 1.00 137.65 ? 131  LYS B CE    1 
ATOM   2650  N  NZ    . LYS B 1  131  ? -7.109  -40.329 -70.406 1.00 128.49 ? 131  LYS B NZ    1 
ATOM   2651  N  N     . GLY B 1  132  ? -5.640  -32.748 -69.413 1.00 142.15 ? 132  GLY B N     1 
ATOM   2652  C  CA    . GLY B 1  132  ? -6.276  -31.793 -68.527 1.00 138.62 ? 132  GLY B CA    1 
ATOM   2653  C  C     . GLY B 1  132  ? -6.445  -30.433 -69.170 1.00 129.69 ? 132  GLY B C     1 
ATOM   2654  O  O     . GLY B 1  132  ? -5.472  -29.717 -69.407 1.00 124.81 ? 132  GLY B O     1 
ATOM   2655  N  N     . LYS B 1  133  ? -7.694  -30.077 -69.447 1.00 129.07 ? 133  LYS B N     1 
ATOM   2656  C  CA    . LYS B 1  133  ? -8.011  -28.826 -70.119 1.00 127.24 ? 133  LYS B CA    1 
ATOM   2657  C  C     . LYS B 1  133  ? -8.473  -27.769 -69.123 1.00 124.15 ? 133  LYS B C     1 
ATOM   2658  O  O     . LYS B 1  133  ? -9.186  -28.077 -68.169 1.00 125.47 ? 133  LYS B O     1 
ATOM   2659  C  CB    . LYS B 1  133  ? -9.085  -29.060 -71.183 1.00 123.18 ? 133  LYS B CB    1 
ATOM   2660  C  CG    . LYS B 1  133  ? -9.483  -27.820 -71.958 1.00 127.83 ? 133  LYS B CG    1 
ATOM   2661  C  CD    . LYS B 1  133  ? -10.451 -28.161 -73.078 1.00 126.27 ? 133  LYS B CD    1 
ATOM   2662  C  CE    . LYS B 1  133  ? -10.928 -26.908 -73.795 1.00 125.62 ? 133  LYS B CE    1 
ATOM   2663  N  NZ    . LYS B 1  133  ? -9.801  -26.132 -74.388 1.00 123.49 ? 133  LYS B NZ    1 
ATOM   2664  N  N     . LEU B 1  134  ? -8.066  -26.523 -69.344 1.00 123.49 ? 134  LEU B N     1 
ATOM   2665  C  CA    . LEU B 1  134  ? -8.459  -25.441 -68.451 1.00 123.63 ? 134  LEU B CA    1 
ATOM   2666  C  C     . LEU B 1  134  ? -8.628  -24.113 -69.190 1.00 124.75 ? 134  LEU B C     1 
ATOM   2667  O  O     . LEU B 1  134  ? -7.701  -23.622 -69.837 1.00 114.68 ? 134  LEU B O     1 
ATOM   2668  C  CB    . LEU B 1  134  ? -7.437  -25.293 -67.323 1.00 124.32 ? 134  LEU B CB    1 
ATOM   2669  C  CG    . LEU B 1  134  ? -7.900  -24.543 -66.072 1.00 124.08 ? 134  LEU B CG    1 
ATOM   2670  C  CD1   . LEU B 1  134  ? -9.118  -25.215 -65.454 1.00 124.48 ? 134  LEU B CD1   1 
ATOM   2671  C  CD2   . LEU B 1  134  ? -6.766  -24.453 -65.064 1.00 123.65 ? 134  LEU B CD2   1 
ATOM   2672  N  N     . GLU B 1  135  ? -9.828  -23.546 -69.088 1.00 132.62 ? 135  GLU B N     1 
ATOM   2673  C  CA    . GLU B 1  135  ? -10.142 -22.246 -69.676 1.00 131.24 ? 135  GLU B CA    1 
ATOM   2674  C  C     . GLU B 1  135  ? -10.946 -21.394 -68.697 1.00 133.81 ? 135  GLU B C     1 
ATOM   2675  O  O     . GLU B 1  135  ? -12.070 -21.746 -68.335 1.00 130.81 ? 135  GLU B O     1 
ATOM   2676  C  CB    . GLU B 1  135  ? -10.922 -22.414 -70.979 1.00 131.07 ? 135  GLU B CB    1 
ATOM   2677  C  CG    . GLU B 1  135  ? -10.162 -23.132 -72.080 1.00 130.19 ? 135  GLU B CG    1 
ATOM   2678  C  CD    . GLU B 1  135  ? -11.006 -23.335 -73.322 1.00 130.60 ? 135  GLU B CD    1 
ATOM   2679  O  OE1   . GLU B 1  135  ? -12.225 -23.070 -73.257 1.00 140.96 ? 135  GLU B OE1   1 
ATOM   2680  O  OE2   . GLU B 1  135  ? -10.455 -23.755 -74.361 1.00 120.19 ? 135  GLU B OE2   1 
ATOM   2681  N  N     . VAL B 1  136  ? -10.370 -20.272 -68.272 1.00 132.39 ? 136  VAL B N     1 
ATOM   2682  C  CA    . VAL B 1  136  ? -10.998 -19.426 -67.261 1.00 124.31 ? 136  VAL B CA    1 
ATOM   2683  C  C     . VAL B 1  136  ? -11.151 -17.973 -67.711 1.00 119.39 ? 136  VAL B C     1 
ATOM   2684  O  O     . VAL B 1  136  ? -10.223 -17.377 -68.257 1.00 119.08 ? 136  VAL B O     1 
ATOM   2685  C  CB    . VAL B 1  136  ? -10.198 -19.446 -65.943 1.00 116.19 ? 136  VAL B CB    1 
ATOM   2686  C  CG1   . VAL B 1  136  ? -10.969 -18.733 -64.844 1.00 119.35 ? 136  VAL B CG1   1 
ATOM   2687  C  CG2   . VAL B 1  136  ? -9.883  -20.875 -65.530 1.00 113.62 ? 136  VAL B CG2   1 
ATOM   2688  N  N     . GLU B 1  137  ? -12.331 -17.410 -67.471 1.00 113.64 ? 137  GLU B N     1 
ATOM   2689  C  CA    . GLU B 1  137  ? -12.591 -16.002 -67.748 1.00 117.30 ? 137  GLU B CA    1 
ATOM   2690  C  C     . GLU B 1  137  ? -12.594 -15.195 -66.451 1.00 120.68 ? 137  GLU B C     1 
ATOM   2691  O  O     . GLU B 1  137  ? -13.353 -15.491 -65.530 1.00 117.20 ? 137  GLU B O     1 
ATOM   2692  C  CB    . GLU B 1  137  ? -13.923 -15.839 -68.483 1.00 124.56 ? 137  GLU B CB    1 
ATOM   2693  C  CG    . GLU B 1  137  ? -14.411 -14.404 -68.599 1.00 124.35 ? 137  GLU B CG    1 
ATOM   2694  C  CD    . GLU B 1  137  ? -15.793 -14.310 -69.218 1.00 119.19 ? 137  GLU B CD    1 
ATOM   2695  O  OE1   . GLU B 1  137  ? -16.161 -15.215 -69.998 1.00 117.69 ? 137  GLU B OE1   1 
ATOM   2696  O  OE2   . GLU B 1  137  ? -16.516 -13.337 -68.918 1.00 116.43 ? 137  GLU B OE2   1 
ATOM   2697  N  N     . LEU B 1  138  ? -11.742 -14.176 -66.388 1.00 123.22 ? 138  LEU B N     1 
ATOM   2698  C  CA    . LEU B 1  138  ? -11.601 -13.350 -65.191 1.00 117.17 ? 138  LEU B CA    1 
ATOM   2699  C  C     . LEU B 1  138  ? -12.189 -11.954 -65.388 1.00 118.68 ? 138  LEU B C     1 
ATOM   2700  O  O     . LEU B 1  138  ? -12.023 -11.348 -66.445 1.00 127.68 ? 138  LEU B O     1 
ATOM   2701  C  CB    . LEU B 1  138  ? -10.127 -13.238 -64.799 1.00 113.23 ? 138  LEU B CB    1 
ATOM   2702  C  CG    . LEU B 1  138  ? -9.361  -14.558 -64.708 1.00 111.65 ? 138  LEU B CG    1 
ATOM   2703  C  CD1   . LEU B 1  138  ? -7.886  -14.309 -64.437 1.00 111.87 ? 138  LEU B CD1   1 
ATOM   2704  C  CD2   . LEU B 1  138  ? -9.964  -15.445 -63.634 1.00 113.98 ? 138  LEU B CD2   1 
ATOM   2705  N  N     . VAL B 1  139  ? -12.868 -11.445 -64.364 1.00 108.80 ? 139  VAL B N     1 
ATOM   2706  C  CA    . VAL B 1  139  ? -13.449 -10.107 -64.417 1.00 107.16 ? 139  VAL B CA    1 
ATOM   2707  C  C     . VAL B 1  139  ? -12.763 -9.186  -63.410 1.00 103.32 ? 139  VAL B C     1 
ATOM   2708  O  O     . VAL B 1  139  ? -12.867 -9.391  -62.202 1.00 111.48 ? 139  VAL B O     1 
ATOM   2709  C  CB    . VAL B 1  139  ? -14.967 -10.140 -64.140 1.00 107.34 ? 139  VAL B CB    1 
ATOM   2710  C  CG1   . VAL B 1  139  ? -15.548 -8.737  -64.175 1.00 112.00 ? 139  VAL B CG1   1 
ATOM   2711  C  CG2   . VAL B 1  139  ? -15.672 -11.036 -65.148 1.00 108.38 ? 139  VAL B CG2   1 
ATOM   2712  N  N     . VAL B 1  140  ? -12.063 -8.174  -63.914 1.00 102.58 ? 140  VAL B N     1 
ATOM   2713  C  CA    . VAL B 1  140  ? -11.289 -7.269  -63.063 1.00 108.00 ? 140  VAL B CA    1 
ATOM   2714  C  C     . VAL B 1  140  ? -11.888 -5.866  -62.989 1.00 114.82 ? 140  VAL B C     1 
ATOM   2715  O  O     . VAL B 1  140  ? -12.012 -5.181  -64.004 1.00 126.35 ? 140  VAL B O     1 
ATOM   2716  C  CB    . VAL B 1  140  ? -9.835  -7.144  -63.560 1.00 106.66 ? 140  VAL B CB    1 
ATOM   2717  C  CG1   . VAL B 1  140  ? -9.059  -6.160  -62.694 1.00 111.16 ? 140  VAL B CG1   1 
ATOM   2718  C  CG2   . VAL B 1  140  ? -9.158  -8.503  -63.578 1.00 103.45 ? 140  VAL B CG2   1 
ATOM   2719  N  N     . GLU B 1  141  ? -12.246 -5.435  -61.784 1.00 102.50 ? 141  GLU B N     1 
ATOM   2720  C  CA    . GLU B 1  141  ? -12.755 -4.082  -61.588 1.00 99.23  ? 141  GLU B CA    1 
ATOM   2721  C  C     . GLU B 1  141  ? -11.837 -3.277  -60.679 1.00 100.09 ? 141  GLU B C     1 
ATOM   2722  O  O     . GLU B 1  141  ? -10.787 -3.759  -60.259 1.00 106.10 ? 141  GLU B O     1 
ATOM   2723  C  CB    . GLU B 1  141  ? -14.166 -4.114  -61.002 1.00 100.01 ? 141  GLU B CB    1 
ATOM   2724  C  CG    . GLU B 1  141  ? -15.182 -4.833  -61.862 1.00 96.76  ? 141  GLU B CG    1 
ATOM   2725  C  CD    . GLU B 1  141  ? -16.593 -4.662  -61.345 1.00 101.72 ? 141  GLU B CD    1 
ATOM   2726  O  OE1   . GLU B 1  141  ? -16.851 -3.663  -60.641 1.00 113.41 ? 141  GLU B OE1   1 
ATOM   2727  O  OE2   . GLU B 1  141  ? -17.443 -5.528  -61.639 1.00 103.99 ? 141  GLU B OE2   1 
ATOM   2728  N  N     . ARG B 1  142  ? -12.240 -2.048  -60.378 1.00 98.84  ? 142  ARG B N     1 
ATOM   2729  C  CA    . ARG B 1  142  ? -11.495 -1.219  -59.440 1.00 104.95 ? 142  ARG B CA    1 
ATOM   2730  C  C     . ARG B 1  142  ? -12.366 -0.805  -58.258 1.00 107.12 ? 142  ARG B C     1 
ATOM   2731  O  O     . ARG B 1  142  ? -13.592 -0.752  -58.365 1.00 112.73 ? 142  ARG B O     1 
ATOM   2732  C  CB    . ARG B 1  142  ? -10.928 0.017   -60.146 1.00 111.71 ? 142  ARG B CB    1 
ATOM   2733  C  CG    . ARG B 1  142  ? -9.793  -0.296  -61.111 1.00 112.62 ? 142  ARG B CG    1 
ATOM   2734  C  CD    . ARG B 1  142  ? -9.253  0.958   -61.784 1.00 111.21 ? 142  ARG B CD    1 
ATOM   2735  N  NE    . ARG B 1  142  ? -8.799  1.961   -60.824 1.00 101.15 ? 142  ARG B NE    1 
ATOM   2736  C  CZ    . ARG B 1  142  ? -7.575  2.007   -60.308 1.00 103.41 ? 142  ARG B CZ    1 
ATOM   2737  N  NH1   . ARG B 1  142  ? -6.671  1.100   -60.654 1.00 110.31 ? 142  ARG B NH1   1 
ATOM   2738  N  NH2   . ARG B 1  142  ? -7.253  2.959   -59.442 1.00 99.51  ? 142  ARG B NH2   1 
ATOM   2739  N  N     . GLY B 1  143  ? -11.724 -0.522  -57.129 1.00 107.97 ? 143  GLY B N     1 
ATOM   2740  C  CA    . GLY B 1  143  ? -12.431 -0.080  -55.941 1.00 115.62 ? 143  GLY B CA    1 
ATOM   2741  C  C     . GLY B 1  143  ? -11.535 0.089   -54.728 1.00 111.45 ? 143  GLY B C     1 
ATOM   2742  O  O     . GLY B 1  143  ? -10.313 0.197   -54.854 1.00 101.02 ? 143  GLY B O     1 
ATOM   2743  N  N     . ARG B 1  144  ? -12.151 0.105   -53.548 1.00 114.87 ? 144  ARG B N     1 
ATOM   2744  C  CA    . ARG B 1  144  ? -11.432 0.292   -52.290 1.00 100.56 ? 144  ARG B CA    1 
ATOM   2745  C  C     . ARG B 1  144  ? -11.832 -0.746  -51.243 1.00 96.82  ? 144  ARG B C     1 
ATOM   2746  O  O     . ARG B 1  144  ? -12.987 -1.171  -51.185 1.00 104.79 ? 144  ARG B O     1 
ATOM   2747  C  CB    . ARG B 1  144  ? -11.688 1.693   -51.730 1.00 100.21 ? 144  ARG B CB    1 
ATOM   2748  C  CG    . ARG B 1  144  ? -11.531 2.823   -52.729 1.00 101.99 ? 144  ARG B CG    1 
ATOM   2749  C  CD    . ARG B 1  144  ? -11.954 4.149   -52.121 1.00 97.75  ? 144  ARG B CD    1 
ATOM   2750  N  NE    . ARG B 1  144  ? -11.952 5.224   -53.107 1.00 99.25  ? 144  ARG B NE    1 
ATOM   2751  C  CZ    . ARG B 1  144  ? -10.921 6.031   -53.332 1.00 93.60  ? 144  ARG B CZ    1 
ATOM   2752  N  NH1   . ARG B 1  144  ? -9.801  5.893   -52.635 1.00 89.50  ? 144  ARG B NH1   1 
ATOM   2753  N  NH2   . ARG B 1  144  ? -11.010 6.980   -54.253 1.00 95.93  ? 144  ARG B NH2   1 
ATOM   2754  N  N     . GLY B 1  145  ? -10.873 -1.144  -50.414 1.00 90.00  ? 145  GLY B N     1 
ATOM   2755  C  CA    . GLY B 1  145  ? -11.149 -2.004  -49.277 1.00 92.25  ? 145  GLY B CA    1 
ATOM   2756  C  C     . GLY B 1  145  ? -11.556 -3.430  -49.601 1.00 92.02  ? 145  GLY B C     1 
ATOM   2757  O  O     . GLY B 1  145  ? -10.823 -4.166  -50.263 1.00 88.67  ? 145  GLY B O     1 
ATOM   2758  N  N     . TYR B 1  146  ? -12.735 -3.817  -49.125 1.00 91.92  ? 146  TYR B N     1 
ATOM   2759  C  CA    . TYR B 1  146  ? -13.196 -5.198  -49.214 1.00 89.85  ? 146  TYR B CA    1 
ATOM   2760  C  C     . TYR B 1  146  ? -14.692 -5.255  -49.514 1.00 91.95  ? 146  TYR B C     1 
ATOM   2761  O  O     . TYR B 1  146  ? -15.490 -4.602  -48.842 1.00 93.22  ? 146  TYR B O     1 
ATOM   2762  C  CB    . TYR B 1  146  ? -12.879 -5.939  -47.908 1.00 88.49  ? 146  TYR B CB    1 
ATOM   2763  C  CG    . TYR B 1  146  ? -13.234 -7.412  -47.900 1.00 90.17  ? 146  TYR B CG    1 
ATOM   2764  C  CD1   . TYR B 1  146  ? -14.473 -7.848  -47.443 1.00 90.92  ? 146  TYR B CD1   1 
ATOM   2765  C  CD2   . TYR B 1  146  ? -12.322 -8.369  -48.330 1.00 88.60  ? 146  TYR B CD2   1 
ATOM   2766  C  CE1   . TYR B 1  146  ? -14.799 -9.193  -47.428 1.00 85.32  ? 146  TYR B CE1   1 
ATOM   2767  C  CE2   . TYR B 1  146  ? -12.640 -9.717  -48.318 1.00 85.13  ? 146  TYR B CE2   1 
ATOM   2768  C  CZ    . TYR B 1  146  ? -13.879 -10.123 -47.866 1.00 81.15  ? 146  TYR B CZ    1 
ATOM   2769  O  OH    . TYR B 1  146  ? -14.199 -11.462 -47.851 1.00 78.82  ? 146  TYR B OH    1 
ATOM   2770  N  N     . VAL B 1  147  ? -15.064 -6.034  -50.526 1.00 93.15  ? 147  VAL B N     1 
ATOM   2771  C  CA    . VAL B 1  147  ? -16.465 -6.188  -50.913 1.00 95.42  ? 147  VAL B CA    1 
ATOM   2772  C  C     . VAL B 1  147  ? -16.851 -7.663  -51.035 1.00 94.47  ? 147  VAL B C     1 
ATOM   2773  O  O     . VAL B 1  147  ? -16.205 -8.416  -51.763 1.00 94.83  ? 147  VAL B O     1 
ATOM   2774  C  CB    . VAL B 1  147  ? -16.764 -5.478  -52.249 1.00 101.71 ? 147  VAL B CB    1 
ATOM   2775  C  CG1   . VAL B 1  147  ? -18.196 -5.750  -52.695 1.00 115.66 ? 147  VAL B CG1   1 
ATOM   2776  C  CG2   . VAL B 1  147  ? -16.515 -3.983  -52.124 1.00 104.04 ? 147  VAL B CG2   1 
ATOM   2777  N  N     . PRO B 1  148  ? -17.914 -8.073  -50.321 1.00 96.07  ? 148  PRO B N     1 
ATOM   2778  C  CA    . PRO B 1  148  ? -18.419 -9.452  -50.275 1.00 100.10 ? 148  PRO B CA    1 
ATOM   2779  C  C     . PRO B 1  148  ? -18.769 -10.038 -51.642 1.00 105.30 ? 148  PRO B C     1 
ATOM   2780  O  O     . PRO B 1  148  ? -18.702 -9.349  -52.659 1.00 108.43 ? 148  PRO B O     1 
ATOM   2781  C  CB    . PRO B 1  148  ? -19.677 -9.331  -49.411 1.00 101.75 ? 148  PRO B CB    1 
ATOM   2782  C  CG    . PRO B 1  148  ? -19.421 -8.155  -48.550 1.00 107.48 ? 148  PRO B CG    1 
ATOM   2783  C  CD    . PRO B 1  148  ? -18.663 -7.190  -49.411 1.00 106.74 ? 148  PRO B CD    1 
ATOM   2784  N  N     . ALA B 1  149  ? -19.153 -11.310 -51.648 1.00 111.69 ? 149  ALA B N     1 
ATOM   2785  C  CA    . ALA B 1  149  ? -19.414 -12.032 -52.887 1.00 122.58 ? 149  ALA B CA    1 
ATOM   2786  C  C     . ALA B 1  149  ? -20.882 -11.972 -53.300 1.00 138.50 ? 149  ALA B C     1 
ATOM   2787  O  O     . ALA B 1  149  ? -21.198 -12.042 -54.488 1.00 146.19 ? 149  ALA B O     1 
ATOM   2788  C  CB    . ALA B 1  149  ? -18.967 -13.480 -52.750 1.00 126.75 ? 149  ALA B CB    1 
ATOM   2789  N  N     . VAL B 1  150  ? -21.776 -11.844 -52.324 1.00 138.63 ? 150  VAL B N     1 
ATOM   2790  C  CA    . VAL B 1  150  ? -23.208 -11.800 -52.606 1.00 141.97 ? 150  VAL B CA    1 
ATOM   2791  C  C     . VAL B 1  150  ? -23.563 -10.546 -53.405 1.00 147.27 ? 150  VAL B C     1 
ATOM   2792  O  O     . VAL B 1  150  ? -24.533 -10.537 -54.165 1.00 146.79 ? 150  VAL B O     1 
ATOM   2793  C  CB    . VAL B 1  150  ? -24.045 -11.841 -51.309 1.00 138.16 ? 150  VAL B CB    1 
ATOM   2794  C  CG1   . VAL B 1  150  ? -25.510 -12.121 -51.624 1.00 130.05 ? 150  VAL B CG1   1 
ATOM   2795  C  CG2   . VAL B 1  150  ? -23.496 -12.896 -50.360 1.00 139.60 ? 150  VAL B CG2   1 
ATOM   2796  N  N     . GLN B 1  151  ? -22.762 -9.495  -53.240 1.00 147.92 ? 151  GLN B N     1 
ATOM   2797  C  CA    . GLN B 1  151  ? -22.975 -8.242  -53.960 1.00 146.77 ? 151  GLN B CA    1 
ATOM   2798  C  C     . GLN B 1  151  ? -22.444 -8.312  -55.391 1.00 141.16 ? 151  GLN B C     1 
ATOM   2799  O  O     . GLN B 1  151  ? -22.629 -7.381  -56.175 1.00 143.15 ? 151  GLN B O     1 
ATOM   2800  C  CB    . GLN B 1  151  ? -22.316 -7.073  -53.221 1.00 141.69 ? 151  GLN B CB    1 
ATOM   2801  C  CG    . GLN B 1  151  ? -22.893 -6.793  -51.840 1.00 137.81 ? 151  GLN B CG    1 
ATOM   2802  C  CD    . GLN B 1  151  ? -22.392 -5.487  -51.247 1.00 143.55 ? 151  GLN B CD    1 
ATOM   2803  O  OE1   . GLN B 1  151  ? -21.747 -4.687  -51.928 1.00 135.51 ? 151  GLN B OE1   1 
ATOM   2804  N  NE2   . GLN B 1  151  ? -22.689 -5.264  -49.972 1.00 150.10 ? 151  GLN B NE2   1 
ATOM   2805  N  N     . ASN B 1  152  ? -21.781 -9.415  -55.726 1.00 133.81 ? 152  ASN B N     1 
ATOM   2806  C  CA    . ASN B 1  152  ? -21.289 -9.629  -57.082 1.00 134.64 ? 152  ASN B CA    1 
ATOM   2807  C  C     . ASN B 1  152  ? -21.893 -10.887 -57.700 1.00 146.82 ? 152  ASN B C     1 
ATOM   2808  O  O     . ASN B 1  152  ? -21.235 -11.594 -58.464 1.00 149.56 ? 152  ASN B O     1 
ATOM   2809  C  CB    . ASN B 1  152  ? -19.762 -9.721  -57.093 1.00 129.24 ? 152  ASN B CB    1 
ATOM   2810  C  CG    . ASN B 1  152  ? -19.101 -8.535  -56.418 1.00 128.37 ? 152  ASN B CG    1 
ATOM   2811  O  OD1   . ASN B 1  152  ? -19.023 -7.445  -56.985 1.00 126.09 ? 152  ASN B OD1   1 
ATOM   2812  N  ND2   . ASN B 1  152  ? -18.614 -8.745  -55.200 1.00 127.07 ? 152  ASN B ND2   1 
ATOM   2813  N  N     . ARG B 1  153  ? -23.154 -11.154 -57.368 1.00 147.41 ? 153  ARG B N     1 
ATOM   2814  C  CA    . ARG B 1  153  ? -23.835 -12.366 -57.814 1.00 148.05 ? 153  ARG B CA    1 
ATOM   2815  C  C     . ARG B 1  153  ? -24.476 -12.215 -59.193 1.00 157.59 ? 153  ARG B C     1 
ATOM   2816  O  O     . ARG B 1  153  ? -25.122 -13.139 -59.688 1.00 159.93 ? 153  ARG B O     1 
ATOM   2817  C  CB    . ARG B 1  153  ? -24.905 -12.768 -56.803 1.00 136.52 ? 153  ARG B CB    1 
ATOM   2818  C  CG    . ARG B 1  153  ? -26.106 -11.846 -56.809 1.00 136.86 ? 153  ARG B CG    1 
ATOM   2819  C  CD    . ARG B 1  153  ? -27.158 -12.313 -55.830 1.00 146.29 ? 153  ARG B CD    1 
ATOM   2820  N  NE    . ARG B 1  153  ? -28.414 -11.591 -56.004 1.00 150.90 ? 153  ARG B NE    1 
ATOM   2821  C  CZ    . ARG B 1  153  ? -29.507 -11.820 -55.286 1.00 151.01 ? 153  ARG B CZ    1 
ATOM   2822  N  NH1   . ARG B 1  153  ? -30.610 -11.118 -55.511 1.00 143.51 ? 153  ARG B NH1   1 
ATOM   2823  N  NH2   . ARG B 1  153  ? -29.498 -12.752 -54.343 1.00 150.05 ? 153  ARG B NH2   1 
ATOM   2824  N  N     . ALA B 1  154  ? -24.306 -11.048 -59.807 1.00 159.04 ? 154  ALA B N     1 
ATOM   2825  C  CA    . ALA B 1  154  ? -24.849 -10.803 -61.139 1.00 148.33 ? 154  ALA B CA    1 
ATOM   2826  C  C     . ALA B 1  154  ? -23.876 -9.991  -61.990 1.00 150.92 ? 154  ALA B C     1 
ATOM   2827  O  O     . ALA B 1  154  ? -24.200 -8.892  -62.438 1.00 151.09 ? 154  ALA B O     1 
ATOM   2828  C  CB    . ALA B 1  154  ? -26.192 -10.093 -61.041 1.00 134.14 ? 154  ALA B CB    1 
ATOM   2829  N  N     . ALA B 1  157  ? -21.962 -14.165 -67.153 1.00 153.15 ? 157  ALA B N     1 
ATOM   2830  C  CA    . ALA B 1  157  ? -22.949 -14.937 -67.901 1.00 148.71 ? 157  ALA B CA    1 
ATOM   2831  C  C     . ALA B 1  157  ? -23.431 -16.117 -67.070 1.00 147.15 ? 157  ALA B C     1 
ATOM   2832  O  O     . ALA B 1  157  ? -22.626 -16.909 -66.581 1.00 145.70 ? 157  ALA B O     1 
ATOM   2833  C  CB    . ALA B 1  157  ? -22.366 -15.415 -69.221 1.00 141.92 ? 157  ALA B CB    1 
ATOM   2834  N  N     . GLU B 1  158  ? -24.747 -16.243 -66.927 1.00 145.97 ? 158  GLU B N     1 
ATOM   2835  C  CA    . GLU B 1  158  ? -25.336 -17.245 -66.041 1.00 145.12 ? 158  GLU B CA    1 
ATOM   2836  C  C     . GLU B 1  158  ? -25.181 -18.672 -66.573 1.00 146.50 ? 158  GLU B C     1 
ATOM   2837  O  O     . GLU B 1  158  ? -26.027 -19.533 -66.330 1.00 143.81 ? 158  GLU B O     1 
ATOM   2838  C  CB    . GLU B 1  158  ? -26.815 -16.929 -65.805 1.00 137.01 ? 158  GLU B CB    1 
ATOM   2839  C  CG    . GLU B 1  158  ? -27.342 -17.398 -64.459 1.00 135.59 ? 158  GLU B CG    1 
ATOM   2840  C  CD    . GLU B 1  158  ? -28.656 -16.740 -64.093 1.00 136.43 ? 158  GLU B CD    1 
ATOM   2841  O  OE1   . GLU B 1  158  ? -28.985 -15.696 -64.695 1.00 135.68 ? 158  GLU B OE1   1 
ATOM   2842  O  OE2   . GLU B 1  158  ? -29.359 -17.265 -63.204 1.00 139.28 ? 158  GLU B OE2   1 
ATOM   2843  N  N     . ILE B 1  159  ? -24.094 -18.913 -67.298 1.00 147.44 ? 159  ILE B N     1 
ATOM   2844  C  CA    . ILE B 1  159  ? -23.748 -20.251 -67.750 1.00 153.94 ? 159  ILE B CA    1 
ATOM   2845  C  C     . ILE B 1  159  ? -22.469 -20.693 -67.042 1.00 158.03 ? 159  ILE B C     1 
ATOM   2846  O  O     . ILE B 1  159  ? -21.569 -21.273 -67.650 1.00 161.10 ? 159  ILE B O     1 
ATOM   2847  C  CB    . ILE B 1  159  ? -23.557 -20.307 -69.279 1.00 156.92 ? 159  ILE B CB    1 
ATOM   2848  C  CG1   . ILE B 1  159  ? -24.472 -19.293 -69.968 1.00 153.02 ? 159  ILE B CG1   1 
ATOM   2849  C  CG2   . ILE B 1  159  ? -23.815 -21.716 -69.803 1.00 154.60 ? 159  ILE B CG2   1 
ATOM   2850  C  CD1   . ILE B 1  159  ? -24.342 -19.276 -71.476 1.00 151.95 ? 159  ILE B CD1   1 
ATOM   2851  N  N     . GLY B 1  160  ? -22.394 -20.399 -65.748 1.00 157.34 ? 160  GLY B N     1 
ATOM   2852  C  CA    . GLY B 1  160  ? -21.233 -20.746 -64.950 1.00 149.51 ? 160  GLY B CA    1 
ATOM   2853  C  C     . GLY B 1  160  ? -20.517 -19.524 -64.409 1.00 145.49 ? 160  GLY B C     1 
ATOM   2854  O  O     . GLY B 1  160  ? -19.288 -19.491 -64.353 1.00 140.25 ? 160  GLY B O     1 
ATOM   2855  N  N     . ARG B 1  161  ? -21.289 -18.515 -64.017 1.00 146.24 ? 161  ARG B N     1 
ATOM   2856  C  CA    . ARG B 1  161  ? -20.730 -17.302 -63.430 1.00 141.52 ? 161  ARG B CA    1 
ATOM   2857  C  C     . ARG B 1  161  ? -20.526 -17.478 -61.931 1.00 142.37 ? 161  ARG B C     1 
ATOM   2858  O  O     . ARG B 1  161  ? -21.445 -17.876 -61.213 1.00 145.10 ? 161  ARG B O     1 
ATOM   2859  C  CB    . ARG B 1  161  ? -21.639 -16.101 -63.698 1.00 147.52 ? 161  ARG B CB    1 
ATOM   2860  N  N     . ILE B 1  162  ? -19.320 -17.175 -61.462 1.00 137.78 ? 162  ILE B N     1 
ATOM   2861  C  CA    . ILE B 1  162  ? -18.976 -17.366 -60.059 1.00 137.75 ? 162  ILE B CA    1 
ATOM   2862  C  C     . ILE B 1  162  ? -18.568 -16.056 -59.388 1.00 133.34 ? 162  ILE B C     1 
ATOM   2863  O  O     . ILE B 1  162  ? -17.592 -15.425 -59.792 1.00 126.63 ? 162  ILE B O     1 
ATOM   2864  C  CB    . ILE B 1  162  ? -17.834 -18.389 -59.899 1.00 139.03 ? 162  ILE B CB    1 
ATOM   2865  C  CG1   . ILE B 1  162  ? -18.231 -19.733 -60.516 1.00 140.45 ? 162  ILE B CG1   1 
ATOM   2866  C  CG2   . ILE B 1  162  ? -17.471 -18.557 -58.433 1.00 147.32 ? 162  ILE B CG2   1 
ATOM   2867  C  CD1   . ILE B 1  162  ? -17.155 -20.795 -60.422 1.00 141.19 ? 162  ILE B CD1   1 
ATOM   2868  N  N     . PRO B 1  163  ? -19.325 -15.644 -58.358 1.00 130.92 ? 163  PRO B N     1 
ATOM   2869  C  CA    . PRO B 1  163  ? -19.025 -14.436 -57.581 1.00 127.08 ? 163  PRO B CA    1 
ATOM   2870  C  C     . PRO B 1  163  ? -17.840 -14.633 -56.638 1.00 123.07 ? 163  PRO B C     1 
ATOM   2871  O  O     . PRO B 1  163  ? -17.797 -15.614 -55.895 1.00 120.33 ? 163  PRO B O     1 
ATOM   2872  C  CB    . PRO B 1  163  ? -20.316 -14.199 -56.795 1.00 132.69 ? 163  PRO B CB    1 
ATOM   2873  C  CG    . PRO B 1  163  ? -20.921 -15.544 -56.661 1.00 123.65 ? 163  PRO B CG    1 
ATOM   2874  C  CD    . PRO B 1  163  ? -20.580 -16.282 -57.923 1.00 130.42 ? 163  PRO B CD    1 
ATOM   2875  N  N     . VAL B 1  164  ? -16.890 -13.705 -56.669 1.00 116.64 ? 164  VAL B N     1 
ATOM   2876  C  CA    . VAL B 1  164  ? -15.677 -13.831 -55.871 1.00 110.67 ? 164  VAL B CA    1 
ATOM   2877  C  C     . VAL B 1  164  ? -15.530 -12.658 -54.901 1.00 113.28 ? 164  VAL B C     1 
ATOM   2878  O  O     . VAL B 1  164  ? -15.967 -11.544 -55.192 1.00 112.73 ? 164  VAL B O     1 
ATOM   2879  C  CB    . VAL B 1  164  ? -14.430 -13.919 -56.774 1.00 104.94 ? 164  VAL B CB    1 
ATOM   2880  C  CG1   . VAL B 1  164  ? -13.220 -14.381 -55.980 1.00 101.80 ? 164  VAL B CG1   1 
ATOM   2881  C  CG2   . VAL B 1  164  ? -14.686 -14.865 -57.936 1.00 116.12 ? 164  VAL B CG2   1 
ATOM   2882  N  N     . ASP B 1  165  ? -14.927 -12.922 -53.744 1.00 110.64 ? 165  ASP B N     1 
ATOM   2883  C  CA    . ASP B 1  165  ? -14.651 -11.885 -52.754 1.00 102.13 ? 165  ASP B CA    1 
ATOM   2884  C  C     . ASP B 1  165  ? -13.640 -10.882 -53.299 1.00 90.24  ? 165  ASP B C     1 
ATOM   2885  O  O     . ASP B 1  165  ? -12.503 -11.242 -53.604 1.00 84.63  ? 165  ASP B O     1 
ATOM   2886  C  CB    . ASP B 1  165  ? -14.130 -12.508 -51.455 1.00 100.24 ? 165  ASP B CB    1 
ATOM   2887  C  CG    . ASP B 1  165  ? -15.116 -13.483 -50.835 1.00 96.15  ? 165  ASP B CG    1 
ATOM   2888  O  OD1   . ASP B 1  165  ? -16.332 -13.206 -50.871 1.00 99.72  ? 165  ASP B OD1   1 
ATOM   2889  O  OD2   . ASP B 1  165  ? -14.674 -14.528 -50.311 1.00 87.24  ? 165  ASP B OD2   1 
ATOM   2890  N  N     . SER B 1  166  ? -14.052 -9.624  -53.418 1.00 87.07  ? 166  SER B N     1 
ATOM   2891  C  CA    . SER B 1  166  ? -13.211 -8.604  -54.037 1.00 89.78  ? 166  SER B CA    1 
ATOM   2892  C  C     . SER B 1  166  ? -12.292 -7.921  -53.030 1.00 87.28  ? 166  SER B C     1 
ATOM   2893  O  O     . SER B 1  166  ? -12.750 -7.181  -52.160 1.00 93.48  ? 166  SER B O     1 
ATOM   2894  C  CB    . SER B 1  166  ? -14.077 -7.556  -54.739 1.00 98.64  ? 166  SER B CB    1 
ATOM   2895  O  OG    . SER B 1  166  ? -14.934 -8.153  -55.698 1.00 106.74 ? 166  SER B OG    1 
ATOM   2896  N  N     . ILE B 1  167  ? -10.992 -8.169  -53.155 1.00 76.68  ? 167  ILE B N     1 
ATOM   2897  C  CA    . ILE B 1  167  ? -10.013 -7.528  -52.287 1.00 81.11  ? 167  ILE B CA    1 
ATOM   2898  C  C     . ILE B 1  167  ? -9.301  -6.415  -53.038 1.00 85.50  ? 167  ILE B C     1 
ATOM   2899  O  O     . ILE B 1  167  ? -8.149  -6.566  -53.451 1.00 82.60  ? 167  ILE B O     1 
ATOM   2900  C  CB    . ILE B 1  167  ? -8.972  -8.526  -51.754 1.00 81.38  ? 167  ILE B CB    1 
ATOM   2901  C  CG1   . ILE B 1  167  ? -9.651  -9.820  -51.304 1.00 83.55  ? 167  ILE B CG1   1 
ATOM   2902  C  CG2   . ILE B 1  167  ? -8.171  -7.905  -50.613 1.00 95.65  ? 167  ILE B CG2   1 
ATOM   2903  C  CD1   . ILE B 1  167  ? -8.692  -10.841 -50.745 1.00 85.71  ? 167  ILE B CD1   1 
ATOM   2904  N  N     . TYR B 1  168  ? -10.001 -5.299  -53.216 1.00 92.18  ? 168  TYR B N     1 
ATOM   2905  C  CA    . TYR B 1  168  ? -9.457  -4.149  -53.930 1.00 95.25  ? 168  TYR B CA    1 
ATOM   2906  C  C     . TYR B 1  168  ? -8.225  -3.578  -53.226 1.00 87.11  ? 168  TYR B C     1 
ATOM   2907  O  O     . TYR B 1  168  ? -7.225  -3.264  -53.873 1.00 84.34  ? 168  TYR B O     1 
ATOM   2908  C  CB    . TYR B 1  168  ? -10.514 -3.047  -54.078 1.00 100.18 ? 168  TYR B CB    1 
ATOM   2909  C  CG    . TYR B 1  168  ? -11.793 -3.457  -54.789 1.00 106.19 ? 168  TYR B CG    1 
ATOM   2910  C  CD1   . TYR B 1  168  ? -11.827 -3.623  -56.170 1.00 102.46 ? 168  TYR B CD1   1 
ATOM   2911  C  CD2   . TYR B 1  168  ? -12.972 -3.648  -54.079 1.00 108.80 ? 168  TYR B CD2   1 
ATOM   2912  C  CE1   . TYR B 1  168  ? -12.998 -3.988  -56.819 1.00 104.15 ? 168  TYR B CE1   1 
ATOM   2913  C  CE2   . TYR B 1  168  ? -14.145 -4.010  -54.720 1.00 105.60 ? 168  TYR B CE2   1 
ATOM   2914  C  CZ    . TYR B 1  168  ? -14.154 -4.179  -56.087 1.00 101.48 ? 168  TYR B CZ    1 
ATOM   2915  O  OH    . TYR B 1  168  ? -15.323 -4.541  -56.718 1.00 95.11  ? 168  TYR B OH    1 
ATOM   2916  N  N     . SER B 1  169  ? -8.303  -3.454  -51.903 1.00 85.94  ? 169  SER B N     1 
ATOM   2917  C  CA    . SER B 1  169  ? -7.264  -2.779  -51.129 1.00 85.10  ? 169  SER B CA    1 
ATOM   2918  C  C     . SER B 1  169  ? -5.891  -3.417  -51.292 1.00 78.16  ? 169  SER B C     1 
ATOM   2919  O  O     . SER B 1  169  ? -5.759  -4.636  -51.261 1.00 87.57  ? 169  SER B O     1 
ATOM   2920  C  CB    . SER B 1  169  ? -7.632  -2.749  -49.645 1.00 86.60  ? 169  SER B CB    1 
ATOM   2921  O  OG    . SER B 1  169  ? -6.639  -2.068  -48.896 1.00 81.12  ? 169  SER B OG    1 
ATOM   2922  N  N     . PRO B 1  170  ? -4.860  -2.581  -51.469 1.00 76.07  ? 170  PRO B N     1 
ATOM   2923  C  CA    . PRO B 1  170  ? -3.474  -3.035  -51.599 1.00 84.19  ? 170  PRO B CA    1 
ATOM   2924  C  C     . PRO B 1  170  ? -2.808  -3.266  -50.247 1.00 83.69  ? 170  PRO B C     1 
ATOM   2925  O  O     . PRO B 1  170  ? -1.686  -3.768  -50.190 1.00 83.60  ? 170  PRO B O     1 
ATOM   2926  C  CB    . PRO B 1  170  ? -2.803  -1.882  -52.347 1.00 89.58  ? 170  PRO B CB    1 
ATOM   2927  C  CG    . PRO B 1  170  ? -3.545  -0.678  -51.881 1.00 89.34  ? 170  PRO B CG    1 
ATOM   2928  C  CD    . PRO B 1  170  ? -4.981  -1.126  -51.670 1.00 82.66  ? 170  PRO B CD    1 
ATOM   2929  N  N     . VAL B 1  171  ? -3.496  -2.894  -49.173 1.00 80.74  ? 171  VAL B N     1 
ATOM   2930  C  CA    . VAL B 1  171  ? -2.985  -3.118  -47.828 1.00 80.38  ? 171  VAL B CA    1 
ATOM   2931  C  C     . VAL B 1  171  ? -3.623  -4.373  -47.241 1.00 81.65  ? 171  VAL B C     1 
ATOM   2932  O  O     . VAL B 1  171  ? -4.846  -4.520  -47.251 1.00 85.88  ? 171  VAL B O     1 
ATOM   2933  C  CB    . VAL B 1  171  ? -3.250  -1.911  -46.911 1.00 79.33  ? 171  VAL B CB    1 
ATOM   2934  C  CG1   . VAL B 1  171  ? -2.800  -2.213  -45.495 1.00 81.71  ? 171  VAL B CG1   1 
ATOM   2935  C  CG2   . VAL B 1  171  ? -2.542  -0.670  -47.444 1.00 81.69  ? 171  VAL B CG2   1 
ATOM   2936  N  N     . LEU B 1  172  ? -2.789  -5.274  -46.731 1.00 81.24  ? 172  LEU B N     1 
ATOM   2937  C  CA    . LEU B 1  172  ? -3.245  -6.598  -46.316 1.00 80.04  ? 172  LEU B CA    1 
ATOM   2938  C  C     . LEU B 1  172  ? -3.694  -6.658  -44.858 1.00 77.76  ? 172  LEU B C     1 
ATOM   2939  O  O     . LEU B 1  172  ? -4.817  -7.073  -44.565 1.00 79.30  ? 172  LEU B O     1 
ATOM   2940  C  CB    . LEU B 1  172  ? -2.140  -7.627  -46.562 1.00 82.46  ? 172  LEU B CB    1 
ATOM   2941  C  CG    . LEU B 1  172  ? -1.790  -7.822  -48.039 1.00 84.03  ? 172  LEU B CG    1 
ATOM   2942  C  CD1   . LEU B 1  172  ? -0.584  -8.734  -48.210 1.00 87.17  ? 172  LEU B CD1   1 
ATOM   2943  C  CD2   . LEU B 1  172  ? -2.993  -8.366  -48.799 1.00 84.92  ? 172  LEU B CD2   1 
ATOM   2944  N  N     . LYS B 1  173  ? -2.817  -6.250  -43.945 1.00 80.35  ? 173  LYS B N     1 
ATOM   2945  C  CA    . LYS B 1  173  ? -3.120  -6.335  -42.520 1.00 81.64  ? 173  LYS B CA    1 
ATOM   2946  C  C     . LYS B 1  173  ? -2.315  -5.324  -41.692 1.00 75.32  ? 173  LYS B C     1 
ATOM   2947  O  O     . LYS B 1  173  ? -1.112  -5.149  -41.897 1.00 74.45  ? 173  LYS B O     1 
ATOM   2948  C  CB    . LYS B 1  173  ? -2.870  -7.762  -42.020 1.00 78.71  ? 173  LYS B CB    1 
ATOM   2949  C  CG    . LYS B 1  173  ? -3.129  -7.966  -40.537 1.00 81.23  ? 173  LYS B CG    1 
ATOM   2950  C  CD    . LYS B 1  173  ? -4.515  -7.473  -40.151 1.00 93.55  ? 173  LYS B CD    1 
ATOM   2951  C  CE    . LYS B 1  173  ? -4.594  -7.154  -38.664 1.00 97.11  ? 173  LYS B CE    1 
ATOM   2952  N  NZ    . LYS B 1  173  ? -5.737  -6.254  -38.334 1.00 84.80  ? 173  LYS B NZ    1 
ATOM   2953  N  N     . VAL B 1  174  ? -2.994  -4.662  -40.758 1.00 70.49  ? 174  VAL B N     1 
ATOM   2954  C  CA    . VAL B 1  174  ? -2.389  -3.608  -39.949 1.00 70.71  ? 174  VAL B CA    1 
ATOM   2955  C  C     . VAL B 1  174  ? -2.730  -3.752  -38.464 1.00 67.06  ? 174  VAL B C     1 
ATOM   2956  O  O     . VAL B 1  174  ? -3.897  -3.884  -38.101 1.00 68.25  ? 174  VAL B O     1 
ATOM   2957  C  CB    . VAL B 1  174  ? -2.843  -2.205  -40.432 1.00 78.04  ? 174  VAL B CB    1 
ATOM   2958  C  CG1   . VAL B 1  174  ? -2.333  -1.118  -39.500 1.00 75.21  ? 174  VAL B CG1   1 
ATOM   2959  C  CG2   . VAL B 1  174  ? -2.384  -1.944  -41.861 1.00 81.87  ? 174  VAL B CG2   1 
ATOM   2960  N  N     . THR B 1  175  ? -1.708  -3.733  -37.611 1.00 64.61  ? 175  THR B N     1 
ATOM   2961  C  CA    . THR B 1  175  ? -1.908  -3.697  -36.161 1.00 65.89  ? 175  THR B CA    1 
ATOM   2962  C  C     . THR B 1  175  ? -1.115  -2.542  -35.546 1.00 69.35  ? 175  THR B C     1 
ATOM   2963  O  O     . THR B 1  175  ? -0.127  -2.089  -36.123 1.00 69.35  ? 175  THR B O     1 
ATOM   2964  C  CB    . THR B 1  175  ? -1.487  -5.017  -35.485 1.00 65.42  ? 175  THR B CB    1 
ATOM   2965  O  OG1   . THR B 1  175  ? -0.098  -5.263  -35.732 1.00 72.52  ? 175  THR B OG1   1 
ATOM   2966  C  CG2   . THR B 1  175  ? -2.308  -6.182  -36.018 1.00 68.97  ? 175  THR B CG2   1 
ATOM   2967  N  N     . TYR B 1  176  ? -1.544  -2.071  -34.377 1.00 67.73  ? 176  TYR B N     1 
ATOM   2968  C  CA    . TYR B 1  176  ? -0.893  -0.932  -33.728 1.00 60.66  ? 176  TYR B CA    1 
ATOM   2969  C  C     . TYR B 1  176  ? -0.918  -1.028  -32.207 1.00 59.65  ? 176  TYR B C     1 
ATOM   2970  O  O     . TYR B 1  176  ? -1.905  -1.465  -31.619 1.00 66.90  ? 176  TYR B O     1 
ATOM   2971  C  CB    . TYR B 1  176  ? -1.552  0.380   -34.160 1.00 61.75  ? 176  TYR B CB    1 
ATOM   2972  C  CG    . TYR B 1  176  ? -2.947  0.578   -33.608 1.00 58.43  ? 176  TYR B CG    1 
ATOM   2973  C  CD1   . TYR B 1  176  ? -3.198  1.514   -32.613 1.00 57.48  ? 176  TYR B CD1   1 
ATOM   2974  C  CD2   . TYR B 1  176  ? -4.012  -0.180  -34.078 1.00 67.63  ? 176  TYR B CD2   1 
ATOM   2975  C  CE1   . TYR B 1  176  ? -4.473  1.693   -32.105 1.00 66.34  ? 176  TYR B CE1   1 
ATOM   2976  C  CE2   . TYR B 1  176  ? -5.286  -0.011  -33.577 1.00 71.52  ? 176  TYR B CE2   1 
ATOM   2977  C  CZ    . TYR B 1  176  ? -5.513  0.926   -32.591 1.00 70.99  ? 176  TYR B CZ    1 
ATOM   2978  O  OH    . TYR B 1  176  ? -6.785  1.093   -32.094 1.00 74.12  ? 176  TYR B OH    1 
ATOM   2979  N  N     . LYS B 1  177  ? 0.172   -0.609  -31.573 1.00 60.47  ? 177  LYS B N     1 
ATOM   2980  C  CA    . LYS B 1  177  ? 0.220   -0.538  -30.118 1.00 65.31  ? 177  LYS B CA    1 
ATOM   2981  C  C     . LYS B 1  177  ? 0.632   0.858   -29.666 1.00 69.72  ? 177  LYS B C     1 
ATOM   2982  O  O     . LYS B 1  177  ? 1.416   1.531   -30.339 1.00 67.99  ? 177  LYS B O     1 
ATOM   2983  C  CB    . LYS B 1  177  ? 1.183   -1.585  -29.550 1.00 69.90  ? 177  LYS B CB    1 
ATOM   2984  C  CG    . LYS B 1  177  ? 1.166   -1.679  -28.029 1.00 69.52  ? 177  LYS B CG    1 
ATOM   2985  C  CD    . LYS B 1  177  ? 2.034   -2.817  -27.519 1.00 73.02  ? 177  LYS B CD    1 
ATOM   2986  C  CE    . LYS B 1  177  ? 1.901   -2.968  -26.011 1.00 78.43  ? 177  LYS B CE    1 
ATOM   2987  N  NZ    . LYS B 1  177  ? 2.691   -4.118  -25.490 1.00 90.68  ? 177  LYS B NZ    1 
ATOM   2988  N  N     . VAL B 1  178  ? 0.094   1.287   -28.528 1.00 72.40  ? 178  VAL B N     1 
ATOM   2989  C  CA    . VAL B 1  178  ? 0.423   2.587   -27.960 1.00 66.04  ? 178  VAL B CA    1 
ATOM   2990  C  C     . VAL B 1  178  ? 1.091   2.442   -26.597 1.00 68.25  ? 178  VAL B C     1 
ATOM   2991  O  O     . VAL B 1  178  ? 0.447   2.056   -25.621 1.00 73.54  ? 178  VAL B O     1 
ATOM   2992  C  CB    . VAL B 1  178  ? -0.827  3.471   -27.806 1.00 56.85  ? 178  VAL B CB    1 
ATOM   2993  C  CG1   . VAL B 1  178  ? -0.436  4.852   -27.308 1.00 63.30  ? 178  VAL B CG1   1 
ATOM   2994  C  CG2   . VAL B 1  178  ? -1.575  3.572   -29.122 1.00 67.07  ? 178  VAL B CG2   1 
ATOM   2995  N  N     . ASP B 1  179  ? 2.385   2.744   -26.539 1.00 69.01  ? 179  ASP B N     1 
ATOM   2996  C  CA    . ASP B 1  179  ? 3.117   2.765   -25.277 1.00 66.76  ? 179  ASP B CA    1 
ATOM   2997  C  C     . ASP B 1  179  ? 3.413   4.205   -24.866 1.00 68.20  ? 179  ASP B C     1 
ATOM   2998  O  O     . ASP B 1  179  ? 3.045   5.146   -25.568 1.00 71.26  ? 179  ASP B O     1 
ATOM   2999  C  CB    . ASP B 1  179  ? 4.417   1.963   -25.386 1.00 80.17  ? 179  ASP B CB    1 
ATOM   3000  C  CG    . ASP B 1  179  ? 4.172   0.478   -25.597 1.00 90.95  ? 179  ASP B CG    1 
ATOM   3001  O  OD1   . ASP B 1  179  ? 3.098   -0.013  -25.190 1.00 85.58  ? 179  ASP B OD1   1 
ATOM   3002  O  OD2   . ASP B 1  179  ? 5.057   -0.199  -26.165 1.00 99.56  ? 179  ASP B OD2   1 
ATOM   3003  N  N     . ALA B 1  180  ? 4.077   4.378   -23.730 1.00 70.23  ? 180  ALA B N     1 
ATOM   3004  C  CA    . ALA B 1  180  ? 4.338   5.716   -23.216 1.00 81.13  ? 180  ALA B CA    1 
ATOM   3005  C  C     . ALA B 1  180  ? 5.822   6.057   -23.230 1.00 84.94  ? 180  ALA B C     1 
ATOM   3006  O  O     . ALA B 1  180  ? 6.654   5.277   -22.770 1.00 88.57  ? 180  ALA B O     1 
ATOM   3007  C  CB    . ALA B 1  180  ? 3.779   5.860   -21.807 1.00 87.37  ? 180  ALA B CB    1 
ATOM   3008  N  N     . THR B 1  181  ? 6.146   7.230   -23.763 1.00 87.59  ? 181  THR B N     1 
ATOM   3009  C  CA    . THR B 1  181  ? 7.514   7.727   -23.738 1.00 91.85  ? 181  THR B CA    1 
ATOM   3010  C  C     . THR B 1  181  ? 7.669   8.772   -22.635 1.00 94.41  ? 181  THR B C     1 
ATOM   3011  O  O     . THR B 1  181  ? 6.772   9.584   -22.402 1.00 91.99  ? 181  THR B O     1 
ATOM   3012  C  CB    . THR B 1  181  ? 7.930   8.328   -25.098 1.00 93.02  ? 181  THR B CB    1 
ATOM   3013  O  OG1   . THR B 1  181  ? 9.213   8.953   -24.974 1.00 100.14 ? 181  THR B OG1   1 
ATOM   3014  C  CG2   . THR B 1  181  ? 6.909   9.353   -25.575 1.00 85.20  ? 181  THR B CG2   1 
ATOM   3015  N  N     . ARG B 1  182  ? 8.807   8.737   -21.949 1.00 96.85  ? 182  ARG B N     1 
ATOM   3016  C  CA    . ARG B 1  182  ? 9.045   9.628   -20.820 1.00 100.20 ? 182  ARG B CA    1 
ATOM   3017  C  C     . ARG B 1  182  ? 9.806   10.881  -21.242 1.00 105.33 ? 182  ARG B C     1 
ATOM   3018  O  O     . ARG B 1  182  ? 11.032  10.936  -21.143 1.00 107.08 ? 182  ARG B O     1 
ATOM   3019  C  CB    . ARG B 1  182  ? 9.814   8.900   -19.717 1.00 99.93  ? 182  ARG B CB    1 
ATOM   3020  C  CG    . ARG B 1  182  ? 9.261   7.529   -19.370 1.00 97.14  ? 182  ARG B CG    1 
ATOM   3021  C  CD    . ARG B 1  182  ? 10.047  6.905   -18.230 1.00 98.97  ? 182  ARG B CD    1 
ATOM   3022  N  NE    . ARG B 1  182  ? 11.486  7.095   -18.393 1.00 107.11 ? 182  ARG B NE    1 
ATOM   3023  C  CZ    . ARG B 1  182  ? 12.268  6.305   -19.121 1.00 106.40 ? 182  ARG B CZ    1 
ATOM   3024  N  NH1   . ARG B 1  182  ? 11.751  5.265   -19.761 1.00 108.66 ? 182  ARG B NH1   1 
ATOM   3025  N  NH2   . ARG B 1  182  ? 13.569  6.557   -19.212 1.00 99.21  ? 182  ARG B NH2   1 
ATOM   3026  N  N     . VAL B 1  183  ? 9.069   11.883  -21.710 1.00 109.78 ? 183  VAL B N     1 
ATOM   3027  C  CA    . VAL B 1  183  ? 9.654   13.157  -22.114 1.00 110.57 ? 183  VAL B CA    1 
ATOM   3028  C  C     . VAL B 1  183  ? 9.780   14.093  -20.914 1.00 112.87 ? 183  VAL B C     1 
ATOM   3029  O  O     . VAL B 1  183  ? 8.831   14.249  -20.143 1.00 111.32 ? 183  VAL B O     1 
ATOM   3030  C  CB    . VAL B 1  183  ? 8.814   13.837  -23.215 1.00 102.62 ? 183  VAL B CB    1 
ATOM   3031  C  CG1   . VAL B 1  183  ? 9.422   15.173  -23.608 1.00 108.97 ? 183  VAL B CG1   1 
ATOM   3032  C  CG2   . VAL B 1  183  ? 8.698   12.928  -24.424 1.00 95.37  ? 183  VAL B CG2   1 
ATOM   3033  N  N     . GLU B 1  184  ? 10.954  14.705  -20.767 1.00 112.38 ? 184  GLU B N     1 
ATOM   3034  C  CA    . GLU B 1  184  ? 11.254  15.581  -19.635 1.00 113.33 ? 184  GLU B CA    1 
ATOM   3035  C  C     . GLU B 1  184  ? 11.087  14.830  -18.318 1.00 110.65 ? 184  GLU B C     1 
ATOM   3036  O  O     . GLU B 1  184  ? 11.809  13.873  -18.036 1.00 105.16 ? 184  GLU B O     1 
ATOM   3037  C  CB    . GLU B 1  184  ? 10.357  16.827  -19.650 1.00 114.43 ? 184  GLU B CB    1 
ATOM   3038  C  CG    . GLU B 1  184  ? 10.448  17.663  -20.917 1.00 111.11 ? 184  GLU B CG    1 
ATOM   3039  C  CD    . GLU B 1  184  ? 11.678  18.548  -20.949 1.00 107.57 ? 184  GLU B CD    1 
ATOM   3040  O  OE1   . GLU B 1  184  ? 12.406  18.596  -19.935 1.00 103.29 ? 184  GLU B OE1   1 
ATOM   3041  O  OE2   . GLU B 1  184  ? 11.913  19.198  -21.989 1.00 115.32 ? 184  GLU B OE2   1 
ATOM   3042  N  N     . GLN B 1  185  ? 10.126  15.273  -17.516 1.00 107.15 ? 185  GLN B N     1 
ATOM   3043  C  CA    . GLN B 1  185  ? 9.780   14.586  -16.283 1.00 104.92 ? 185  GLN B CA    1 
ATOM   3044  C  C     . GLN B 1  185  ? 8.454   13.862  -16.476 1.00 103.55 ? 185  GLN B C     1 
ATOM   3045  O  O     . GLN B 1  185  ? 8.069   13.009  -15.678 1.00 96.63  ? 185  GLN B O     1 
ATOM   3046  C  CB    . GLN B 1  185  ? 9.695   15.574  -15.119 1.00 107.22 ? 185  GLN B CB    1 
ATOM   3047  C  CG    . GLN B 1  185  ? 9.546   14.925  -13.755 1.00 105.20 ? 185  GLN B CG    1 
ATOM   3048  C  CD    . GLN B 1  185  ? 9.363   15.937  -12.645 1.00 120.20 ? 185  GLN B CD    1 
ATOM   3049  O  OE1   . GLN B 1  185  ? 9.638   17.126  -12.818 1.00 126.65 ? 185  GLN B OE1   1 
ATOM   3050  N  NE2   . GLN B 1  185  ? 8.893   15.471  -11.494 1.00 115.39 ? 185  GLN B NE2   1 
ATOM   3051  N  N     . ARG B 1  186  ? 7.764   14.208  -17.556 1.00 103.88 ? 186  ARG B N     1 
ATOM   3052  C  CA    . ARG B 1  186  ? 6.450   13.650  -17.843 1.00 98.24  ? 186  ARG B CA    1 
ATOM   3053  C  C     . ARG B 1  186  ? 6.555   12.269  -18.473 1.00 95.82  ? 186  ARG B C     1 
ATOM   3054  O  O     . ARG B 1  186  ? 7.158   12.105  -19.530 1.00 104.87 ? 186  ARG B O     1 
ATOM   3055  C  CB    . ARG B 1  186  ? 5.664   14.580  -18.768 1.00 99.44  ? 186  ARG B CB    1 
ATOM   3056  C  CG    . ARG B 1  186  ? 5.634   16.031  -18.319 1.00 101.88 ? 186  ARG B CG    1 
ATOM   3057  C  CD    . ARG B 1  186  ? 4.568   16.806  -19.070 1.00 85.84  ? 186  ARG B CD    1 
ATOM   3058  N  NE    . ARG B 1  186  ? 3.245   16.229  -18.853 1.00 83.38  ? 186  ARG B NE    1 
ATOM   3059  C  CZ    . ARG B 1  186  ? 2.132   16.667  -19.431 1.00 82.49  ? 186  ARG B CZ    1 
ATOM   3060  N  NH1   . ARG B 1  186  ? 0.974   16.077  -19.171 1.00 90.93  ? 186  ARG B NH1   1 
ATOM   3061  N  NH2   . ARG B 1  186  ? 2.176   17.691  -20.271 1.00 84.21  ? 186  ARG B NH2   1 
ATOM   3062  N  N     . THR B 1  187  ? 5.962   11.276  -17.824 1.00 88.83  ? 187  THR B N     1 
ATOM   3063  C  CA    . THR B 1  187  ? 5.947   9.929   -18.374 1.00 89.00  ? 187  THR B CA    1 
ATOM   3064  C  C     . THR B 1  187  ? 4.595   9.648   -19.018 1.00 92.47  ? 187  THR B C     1 
ATOM   3065  O  O     . THR B 1  187  ? 4.203   8.495   -19.187 1.00 95.82  ? 187  THR B O     1 
ATOM   3066  C  CB    . THR B 1  187  ? 6.236   8.872   -17.293 1.00 88.87  ? 187  THR B CB    1 
ATOM   3067  O  OG1   . THR B 1  187  ? 5.174   8.866   -16.332 1.00 96.39  ? 187  THR B OG1   1 
ATOM   3068  C  CG2   . THR B 1  187  ? 7.549   9.177   -16.587 1.00 86.90  ? 187  THR B CG2   1 
ATOM   3069  N  N     . ASP B 1  188  ? 3.893   10.716  -19.386 1.00 94.23  ? 188  ASP B N     1 
ATOM   3070  C  CA    . ASP B 1  188  ? 2.519   10.612  -19.867 1.00 97.18  ? 188  ASP B CA    1 
ATOM   3071  C  C     . ASP B 1  188  ? 2.427   10.508  -21.385 1.00 89.73  ? 188  ASP B C     1 
ATOM   3072  O  O     . ASP B 1  188  ? 1.503   9.886   -21.915 1.00 85.37  ? 188  ASP B O     1 
ATOM   3073  C  CB    . ASP B 1  188  ? 1.709   11.816  -19.389 1.00 99.38  ? 188  ASP B CB    1 
ATOM   3074  C  CG    . ASP B 1  188  ? 1.882   12.081  -17.910 1.00 103.24 ? 188  ASP B CG    1 
ATOM   3075  O  OD1   . ASP B 1  188  ? 1.923   11.105  -17.132 1.00 106.82 ? 188  ASP B OD1   1 
ATOM   3076  O  OD2   . ASP B 1  188  ? 1.989   13.265  -17.526 1.00 100.10 ? 188  ASP B OD2   1 
ATOM   3077  N  N     . PHE B 1  189  ? 3.386   11.128  -22.069 1.00 90.42  ? 189  PHE B N     1 
ATOM   3078  C  CA    . PHE B 1  189  ? 3.415   11.178  -23.529 1.00 86.61  ? 189  PHE B CA    1 
ATOM   3079  C  C     . PHE B 1  189  ? 3.268   9.800   -24.160 1.00 86.87  ? 189  PHE B C     1 
ATOM   3080  O  O     . PHE B 1  189  ? 3.699   8.798   -23.592 1.00 90.16  ? 189  PHE B O     1 
ATOM   3081  C  CB    . PHE B 1  189  ? 4.711   11.832  -24.009 1.00 86.28  ? 189  PHE B CB    1 
ATOM   3082  C  CG    . PHE B 1  189  ? 4.784   13.302  -23.726 1.00 84.48  ? 189  PHE B CG    1 
ATOM   3083  C  CD1   . PHE B 1  189  ? 5.219   13.763  -22.497 1.00 94.14  ? 189  PHE B CD1   1 
ATOM   3084  C  CD2   . PHE B 1  189  ? 4.415   14.224  -24.690 1.00 82.17  ? 189  PHE B CD2   1 
ATOM   3085  C  CE1   . PHE B 1  189  ? 5.286   15.117  -22.235 1.00 95.18  ? 189  PHE B CE1   1 
ATOM   3086  C  CE2   . PHE B 1  189  ? 4.478   15.577  -24.433 1.00 88.04  ? 189  PHE B CE2   1 
ATOM   3087  C  CZ    . PHE B 1  189  ? 4.915   16.025  -23.204 1.00 95.42  ? 189  PHE B CZ    1 
ATOM   3088  N  N     . ASP B 1  190  ? 2.656   9.758   -25.339 1.00 87.35  ? 190  ASP B N     1 
ATOM   3089  C  CA    . ASP B 1  190  ? 2.367   8.495   -26.005 1.00 82.63  ? 190  ASP B CA    1 
ATOM   3090  C  C     . ASP B 1  190  ? 3.310   8.222   -27.180 1.00 79.61  ? 190  ASP B C     1 
ATOM   3091  O  O     . ASP B 1  190  ? 3.723   9.138   -27.889 1.00 80.60  ? 190  ASP B O     1 
ATOM   3092  C  CB    . ASP B 1  190  ? 0.909   8.476   -26.480 1.00 78.24  ? 190  ASP B CB    1 
ATOM   3093  C  CG    . ASP B 1  190  ? -0.080  8.480   -25.325 1.00 71.58  ? 190  ASP B CG    1 
ATOM   3094  O  OD1   . ASP B 1  190  ? 0.326   8.140   -24.194 1.00 68.69  ? 190  ASP B OD1   1 
ATOM   3095  O  OD2   . ASP B 1  190  ? -1.262  8.814   -25.547 1.00 69.90  ? 190  ASP B OD2   1 
ATOM   3096  N  N     . LYS B 1  191  ? 3.654   6.950   -27.361 1.00 74.27  ? 191  LYS B N     1 
ATOM   3097  C  CA    . LYS B 1  191  ? 4.461   6.501   -28.492 1.00 61.32  ? 191  LYS B CA    1 
ATOM   3098  C  C     . LYS B 1  191  ? 3.652   5.526   -29.328 1.00 59.19  ? 191  LYS B C     1 
ATOM   3099  O  O     . LYS B 1  191  ? 3.147   4.533   -28.812 1.00 67.13  ? 191  LYS B O     1 
ATOM   3100  C  CB    . LYS B 1  191  ? 5.758   5.842   -28.016 1.00 73.12  ? 191  LYS B CB    1 
ATOM   3101  C  CG    . LYS B 1  191  ? 6.390   4.877   -29.022 1.00 67.89  ? 191  LYS B CG    1 
ATOM   3102  C  CD    . LYS B 1  191  ? 7.617   4.191   -28.428 1.00 63.48  ? 191  LYS B CD    1 
ATOM   3103  C  CE    . LYS B 1  191  ? 8.167   3.101   -29.336 1.00 52.51  ? 191  LYS B CE    1 
ATOM   3104  N  NZ    . LYS B 1  191  ? 9.416   2.515   -28.776 1.00 48.93  ? 191  LYS B NZ    1 
ATOM   3105  N  N     . LEU B 1  192  ? 3.527   5.803   -30.618 1.00 59.14  ? 192  LEU B N     1 
ATOM   3106  C  CA    . LEU B 1  192  ? 2.676   4.984   -31.470 1.00 64.05  ? 192  LEU B CA    1 
ATOM   3107  C  C     . LEU B 1  192  ? 3.470   4.041   -32.367 1.00 69.13  ? 192  LEU B C     1 
ATOM   3108  O  O     . LEU B 1  192  ? 4.210   4.481   -33.247 1.00 74.59  ? 192  LEU B O     1 
ATOM   3109  C  CB    . LEU B 1  192  ? 1.775   5.873   -32.324 1.00 59.91  ? 192  LEU B CB    1 
ATOM   3110  C  CG    . LEU B 1  192  ? 0.882   5.134   -33.318 1.00 58.37  ? 192  LEU B CG    1 
ATOM   3111  C  CD1   . LEU B 1  192  ? 0.019   4.096   -32.616 1.00 62.02  ? 192  LEU B CD1   1 
ATOM   3112  C  CD2   . LEU B 1  192  ? 0.022   6.127   -34.067 1.00 58.59  ? 192  LEU B CD2   1 
ATOM   3113  N  N     . ILE B 1  193  ? 3.305   2.742   -32.137 1.00 65.44  ? 193  ILE B N     1 
ATOM   3114  C  CA    . ILE B 1  193  ? 3.912   1.727   -32.989 1.00 63.05  ? 193  ILE B CA    1 
ATOM   3115  C  C     . ILE B 1  193  ? 2.861   1.171   -33.940 1.00 62.95  ? 193  ILE B C     1 
ATOM   3116  O  O     . ILE B 1  193  ? 1.744   0.858   -33.529 1.00 61.28  ? 193  ILE B O     1 
ATOM   3117  C  CB    . ILE B 1  193  ? 4.532   0.586   -32.164 1.00 62.09  ? 193  ILE B CB    1 
ATOM   3118  C  CG1   . ILE B 1  193  ? 5.621   1.136   -31.242 1.00 73.81  ? 193  ILE B CG1   1 
ATOM   3119  C  CG2   . ILE B 1  193  ? 5.115   -0.483  -33.075 1.00 59.28  ? 193  ILE B CG2   1 
ATOM   3120  C  CD1   . ILE B 1  193  ? 6.337   0.071   -30.439 1.00 93.95  ? 193  ILE B CD1   1 
ATOM   3121  N  N     . LEU B 1  194  ? 3.224   1.055   -35.213 1.00 66.74  ? 194  LEU B N     1 
ATOM   3122  C  CA    . LEU B 1  194  ? 2.274   0.671   -36.247 1.00 60.24  ? 194  LEU B CA    1 
ATOM   3123  C  C     . LEU B 1  194  ? 2.868   -0.332  -37.234 1.00 62.55  ? 194  LEU B C     1 
ATOM   3124  O  O     . LEU B 1  194  ? 3.839   -0.033  -37.927 1.00 66.42  ? 194  LEU B O     1 
ATOM   3125  C  CB    . LEU B 1  194  ? 1.793   1.915   -36.992 1.00 58.26  ? 194  LEU B CB    1 
ATOM   3126  C  CG    . LEU B 1  194  ? 0.723   1.725   -38.064 1.00 69.08  ? 194  LEU B CG    1 
ATOM   3127  C  CD1   . LEU B 1  194  ? -0.530  1.145   -37.450 1.00 72.57  ? 194  LEU B CD1   1 
ATOM   3128  C  CD2   . LEU B 1  194  ? 0.419   3.047   -38.751 1.00 63.75  ? 194  LEU B CD2   1 
ATOM   3129  N  N     . ASP B 1  195  ? 2.278   -1.521  -37.295 1.00 64.12  ? 195  ASP B N     1 
ATOM   3130  C  CA    . ASP B 1  195  ? 2.730   -2.552  -38.223 1.00 69.14  ? 195  ASP B CA    1 
ATOM   3131  C  C     . ASP B 1  195  ? 1.828   -2.601  -39.452 1.00 79.00  ? 195  ASP B C     1 
ATOM   3132  O  O     . ASP B 1  195  ? 0.608   -2.699  -39.331 1.00 81.35  ? 195  ASP B O     1 
ATOM   3133  C  CB    . ASP B 1  195  ? 2.763   -3.919  -37.540 1.00 76.17  ? 195  ASP B CB    1 
ATOM   3134  C  CG    . ASP B 1  195  ? 3.373   -4.995  -38.419 1.00 83.23  ? 195  ASP B CG    1 
ATOM   3135  O  OD1   . ASP B 1  195  ? 2.653   -5.536  -39.286 1.00 87.23  ? 195  ASP B OD1   1 
ATOM   3136  O  OD2   . ASP B 1  195  ? 4.571   -5.300  -38.242 1.00 86.18  ? 195  ASP B OD2   1 
ATOM   3137  N  N     . VAL B 1  196  ? 2.435   -2.533  -40.633 1.00 86.86  ? 196  VAL B N     1 
ATOM   3138  C  CA    . VAL B 1  196  ? 1.686   -2.489  -41.885 1.00 81.19  ? 196  VAL B CA    1 
ATOM   3139  C  C     . VAL B 1  196  ? 2.227   -3.474  -42.912 1.00 80.81  ? 196  VAL B C     1 
ATOM   3140  O  O     . VAL B 1  196  ? 3.396   -3.404  -43.290 1.00 88.11  ? 196  VAL B O     1 
ATOM   3141  C  CB    . VAL B 1  196  ? 1.713   -1.080  -42.512 1.00 74.58  ? 196  VAL B CB    1 
ATOM   3142  C  CG1   . VAL B 1  196  ? 1.058   -1.098  -43.884 1.00 84.50  ? 196  VAL B CG1   1 
ATOM   3143  C  CG2   . VAL B 1  196  ? 1.032   -0.073  -41.602 1.00 70.03  ? 196  VAL B CG2   1 
ATOM   3144  N  N     . GLU B 1  197  ? 1.374   -4.384  -43.371 1.00 76.73  ? 197  GLU B N     1 
ATOM   3145  C  CA    . GLU B 1  197  ? 1.764   -5.306  -44.429 1.00 85.81  ? 197  GLU B CA    1 
ATOM   3146  C  C     . GLU B 1  197  ? 0.974   -5.063  -45.707 1.00 89.15  ? 197  GLU B C     1 
ATOM   3147  O  O     . GLU B 1  197  ? -0.256  -5.091  -45.705 1.00 90.30  ? 197  GLU B O     1 
ATOM   3148  C  CB    . GLU B 1  197  ? 1.591   -6.753  -43.979 1.00 90.38  ? 197  GLU B CB    1 
ATOM   3149  C  CG    . GLU B 1  197  ? 2.096   -7.758  -44.995 1.00 93.67  ? 197  GLU B CG    1 
ATOM   3150  C  CD    . GLU B 1  197  ? 2.337   -9.121  -44.387 1.00 96.07  ? 197  GLU B CD    1 
ATOM   3151  O  OE1   . GLU B 1  197  ? 1.841   -9.367  -43.268 1.00 95.61  ? 197  GLU B OE1   1 
ATOM   3152  O  OE2   . GLU B 1  197  ? 3.030   -9.942  -45.024 1.00 103.34 ? 197  GLU B OE2   1 
ATOM   3153  N  N     . THR B 1  198  ? 1.694   -4.829  -46.798 1.00 92.45  ? 198  THR B N     1 
ATOM   3154  C  CA    . THR B 1  198  ? 1.066   -4.536  -48.078 1.00 93.59  ? 198  THR B CA    1 
ATOM   3155  C  C     . THR B 1  198  ? 1.271   -5.667  -49.074 1.00 90.58  ? 198  THR B C     1 
ATOM   3156  O  O     . THR B 1  198  ? 2.062   -6.581  -48.839 1.00 92.52  ? 198  THR B O     1 
ATOM   3157  C  CB    . THR B 1  198  ? 1.616   -3.235  -48.688 1.00 94.42  ? 198  THR B CB    1 
ATOM   3158  O  OG1   . THR B 1  198  ? 3.028   -3.363  -48.897 1.00 90.30  ? 198  THR B OG1   1 
ATOM   3159  C  CG2   . THR B 1  198  ? 1.345   -2.061  -47.764 1.00 95.04  ? 198  THR B CG2   1 
ATOM   3160  N  N     . LYS B 1  199  ? 0.555   -5.591  -50.190 1.00 90.37  ? 199  LYS B N     1 
ATOM   3161  C  CA    . LYS B 1  199  ? 0.711   -6.551  -51.275 1.00 98.04  ? 199  LYS B CA    1 
ATOM   3162  C  C     . LYS B 1  199  ? 2.062   -6.380  -51.965 1.00 106.55 ? 199  LYS B C     1 
ATOM   3163  O  O     . LYS B 1  199  ? 2.936   -5.652  -51.487 1.00 105.00 ? 199  LYS B O     1 
ATOM   3164  C  CB    . LYS B 1  199  ? -0.418  -6.396  -52.299 1.00 91.10  ? 199  LYS B CB    1 
ATOM   3165  C  CG    . LYS B 1  199  ? -1.791  -6.824  -51.806 1.00 90.81  ? 199  LYS B CG    1 
ATOM   3166  C  CD    . LYS B 1  199  ? -2.876  -6.491  -52.825 1.00 99.18  ? 199  LYS B CD    1 
ATOM   3167  C  CE    . LYS B 1  199  ? -4.216  -7.107  -52.439 1.00 95.06  ? 199  LYS B CE    1 
ATOM   3168  N  NZ    . LYS B 1  199  ? -5.325  -6.683  -53.345 1.00 81.79  ? 199  LYS B NZ    1 
ATOM   3169  N  N     . ASN B 1  200  ? 2.220   -7.055  -53.098 1.00 109.58 ? 200  ASN B N     1 
ATOM   3170  C  CA    . ASN B 1  200  ? 3.409   -6.904  -53.924 1.00 102.18 ? 200  ASN B CA    1 
ATOM   3171  C  C     . ASN B 1  200  ? 3.233   -5.723  -54.871 1.00 101.88 ? 200  ASN B C     1 
ATOM   3172  O  O     . ASN B 1  200  ? 4.126   -5.388  -55.650 1.00 103.91 ? 200  ASN B O     1 
ATOM   3173  C  CB    . ASN B 1  200  ? 3.679   -8.188  -54.708 1.00 93.83  ? 200  ASN B CB    1 
ATOM   3174  C  CG    . ASN B 1  200  ? 5.132   -8.340  -55.095 1.00 91.12  ? 200  ASN B CG    1 
ATOM   3175  O  OD1   . ASN B 1  200  ? 5.537   -7.966  -56.195 1.00 95.86  ? 200  ASN B OD1   1 
ATOM   3176  N  ND2   . ASN B 1  200  ? 5.930   -8.893  -54.188 1.00 95.73  ? 200  ASN B ND2   1 
ATOM   3177  N  N     . SER B 1  201  ? 2.066   -5.095  -54.784 1.00 98.76  ? 201  SER B N     1 
ATOM   3178  C  CA    . SER B 1  201  ? 1.720   -3.974  -55.642 1.00 90.23  ? 201  SER B CA    1 
ATOM   3179  C  C     . SER B 1  201  ? 2.409   -2.681  -55.197 1.00 95.48  ? 201  SER B C     1 
ATOM   3180  O  O     . SER B 1  201  ? 3.071   -2.022  -55.999 1.00 89.19  ? 201  SER B O     1 
ATOM   3181  C  CB    . SER B 1  201  ? 0.201   -3.791  -55.668 1.00 84.04  ? 201  SER B CB    1 
ATOM   3182  O  OG    . SER B 1  201  ? -0.173  -2.733  -56.530 1.00 99.16  ? 201  SER B OG    1 
ATOM   3183  N  N     . ILE B 1  202  ? 2.265   -2.327  -53.920 1.00 107.96 ? 202  ILE B N     1 
ATOM   3184  C  CA    . ILE B 1  202  ? 2.824   -1.076  -53.399 1.00 102.12 ? 202  ILE B CA    1 
ATOM   3185  C  C     . ILE B 1  202  ? 3.658   -1.284  -52.124 1.00 95.26  ? 202  ILE B C     1 
ATOM   3186  O  O     . ILE B 1  202  ? 3.380   -2.179  -51.325 1.00 92.50  ? 202  ILE B O     1 
ATOM   3187  C  CB    . ILE B 1  202  ? 1.699   -0.037  -53.117 1.00 88.07  ? 202  ILE B CB    1 
ATOM   3188  C  CG1   . ILE B 1  202  ? 2.285   1.355   -52.873 1.00 95.06  ? 202  ILE B CG1   1 
ATOM   3189  C  CG2   . ILE B 1  202  ? 0.820   -0.476  -51.952 1.00 79.19  ? 202  ILE B CG2   1 
ATOM   3190  C  CD1   . ILE B 1  202  ? 3.133   1.867   -54.019 1.00 105.21 ? 202  ILE B CD1   1 
ATOM   3191  N  N     . SER B 1  203  ? 4.690   -0.461  -51.949 1.00 98.34  ? 203  SER B N     1 
ATOM   3192  C  CA    . SER B 1  203  ? 5.511   -0.496  -50.742 1.00 107.56 ? 203  SER B CA    1 
ATOM   3193  C  C     . SER B 1  203  ? 4.750   0.082   -49.549 1.00 101.80 ? 203  SER B C     1 
ATOM   3194  O  O     . SER B 1  203  ? 3.981   1.031   -49.705 1.00 101.60 ? 203  SER B O     1 
ATOM   3195  C  CB    . SER B 1  203  ? 6.819   0.274   -50.959 1.00 108.77 ? 203  SER B CB    1 
ATOM   3196  O  OG    . SER B 1  203  ? 7.611   0.296   -49.781 1.00 105.26 ? 203  SER B OG    1 
ATOM   3197  N  N     . PRO B 1  204  ? 4.956   -0.498  -48.352 1.00 99.52  ? 204  PRO B N     1 
ATOM   3198  C  CA    . PRO B 1  204  ? 4.319   -0.005  -47.125 1.00 89.31  ? 204  PRO B CA    1 
ATOM   3199  C  C     . PRO B 1  204  ? 4.637   1.460   -46.846 1.00 89.41  ? 204  PRO B C     1 
ATOM   3200  O  O     . PRO B 1  204  ? 3.754   2.215   -46.441 1.00 93.91  ? 204  PRO B O     1 
ATOM   3201  C  CB    . PRO B 1  204  ? 4.916   -0.899  -46.034 1.00 94.30  ? 204  PRO B CB    1 
ATOM   3202  C  CG    . PRO B 1  204  ? 5.328   -2.137  -46.739 1.00 96.70  ? 204  PRO B CG    1 
ATOM   3203  C  CD    . PRO B 1  204  ? 5.771   -1.700  -48.103 1.00 102.51 ? 204  PRO B CD    1 
ATOM   3204  N  N     . ARG B 1  205  ? 5.893   1.845   -47.061 1.00 92.63  ? 205  ARG B N     1 
ATOM   3205  C  CA    . ARG B 1  205  ? 6.342   3.214   -46.827 1.00 91.93  ? 205  ARG B CA    1 
ATOM   3206  C  C     . ARG B 1  205  ? 5.556   4.199   -47.683 1.00 91.75  ? 205  ARG B C     1 
ATOM   3207  O  O     . ARG B 1  205  ? 5.315   5.338   -47.281 1.00 78.69  ? 205  ARG B O     1 
ATOM   3208  C  CB    . ARG B 1  205  ? 7.837   3.343   -47.120 1.00 95.67  ? 205  ARG B CB    1 
ATOM   3209  C  CG    . ARG B 1  205  ? 8.709   2.336   -46.389 1.00 96.62  ? 205  ARG B CG    1 
ATOM   3210  C  CD    . ARG B 1  205  ? 10.151  2.413   -46.870 1.00 104.09 ? 205  ARG B CD    1 
ATOM   3211  N  NE    . ARG B 1  205  ? 10.685  3.769   -46.771 1.00 108.25 ? 205  ARG B NE    1 
ATOM   3212  C  CZ    . ARG B 1  205  ? 11.909  4.122   -47.153 1.00 112.55 ? 205  ARG B CZ    1 
ATOM   3213  N  NH1   . ARG B 1  205  ? 12.308  5.381   -47.024 1.00 109.90 ? 205  ARG B NH1   1 
ATOM   3214  N  NH2   . ARG B 1  205  ? 12.734  3.218   -47.665 1.00 113.41 ? 205  ARG B NH2   1 
ATOM   3215  N  N     . ASP B 1  206  ? 5.163   3.744   -48.869 1.00 100.33 ? 206  ASP B N     1 
ATOM   3216  C  CA    . ASP B 1  206  ? 4.365   4.548   -49.786 1.00 100.24 ? 206  ASP B CA    1 
ATOM   3217  C  C     . ASP B 1  206  ? 2.888   4.514   -49.412 1.00 95.94  ? 206  ASP B C     1 
ATOM   3218  O  O     . ASP B 1  206  ? 2.190   5.524   -49.517 1.00 96.21  ? 206  ASP B O     1 
ATOM   3219  C  CB    . ASP B 1  206  ? 4.546   4.058   -51.226 1.00 97.87  ? 206  ASP B CB    1 
ATOM   3220  C  CG    . ASP B 1  206  ? 5.940   4.320   -51.763 1.00 100.21 ? 206  ASP B CG    1 
ATOM   3221  O  OD1   . ASP B 1  206  ? 6.164   5.410   -52.332 1.00 113.32 ? 206  ASP B OD1   1 
ATOM   3222  O  OD2   . ASP B 1  206  ? 6.809   3.435   -51.623 1.00 91.55  ? 206  ASP B OD2   1 
ATOM   3223  N  N     . ALA B 1  207  ? 2.418   3.346   -48.981 1.00 101.12 ? 207  ALA B N     1 
ATOM   3224  C  CA    . ALA B 1  207  ? 1.014   3.159   -48.626 1.00 98.58  ? 207  ALA B CA    1 
ATOM   3225  C  C     . ALA B 1  207  ? 0.613   4.073   -47.479 1.00 95.30  ? 207  ALA B C     1 
ATOM   3226  O  O     . ALA B 1  207  ? -0.533  4.514   -47.392 1.00 100.04 ? 207  ALA B O     1 
ATOM   3227  C  CB    . ALA B 1  207  ? 0.748   1.704   -48.261 1.00 103.07 ? 207  ALA B CB    1 
ATOM   3228  N  N     . LEU B 1  208  ? 1.570   4.358   -46.603 1.00 95.39  ? 208  LEU B N     1 
ATOM   3229  C  CA    . LEU B 1  208  ? 1.322   5.204   -45.446 1.00 94.69  ? 208  LEU B CA    1 
ATOM   3230  C  C     . LEU B 1  208  ? 1.178   6.664   -45.851 1.00 94.57  ? 208  LEU B C     1 
ATOM   3231  O  O     . LEU B 1  208  ? 0.301   7.372   -45.355 1.00 95.02  ? 208  LEU B O     1 
ATOM   3232  C  CB    . LEU B 1  208  ? 2.450   5.053   -44.427 1.00 89.47  ? 208  LEU B CB    1 
ATOM   3233  C  CG    . LEU B 1  208  ? 2.232   5.799   -43.113 1.00 87.05  ? 208  LEU B CG    1 
ATOM   3234  C  CD1   . LEU B 1  208  ? 0.936   5.345   -42.458 1.00 91.70  ? 208  LEU B CD1   1 
ATOM   3235  C  CD2   . LEU B 1  208  ? 3.412   5.589   -42.182 1.00 82.17  ? 208  LEU B CD2   1 
ATOM   3236  N  N     . ALA B 1  209  ? 2.049   7.105   -46.755 1.00 96.72  ? 209  ALA B N     1 
ATOM   3237  C  CA    . ALA B 1  209  ? 2.047   8.484   -47.229 1.00 101.01 ? 209  ALA B CA    1 
ATOM   3238  C  C     . ALA B 1  209  ? 0.724   8.830   -47.902 1.00 97.93  ? 209  ALA B C     1 
ATOM   3239  O  O     . ALA B 1  209  ? 0.170   9.908   -47.681 1.00 95.67  ? 209  ALA B O     1 
ATOM   3240  C  CB    . ALA B 1  209  ? 3.207   8.716   -48.186 1.00 105.08 ? 209  ALA B CB    1 
ATOM   3241  N  N     . SER B 1  210  ? 0.223   7.908   -48.719 1.00 99.13  ? 210  SER B N     1 
ATOM   3242  C  CA    . SER B 1  210  ? -1.063  8.088   -49.380 1.00 99.04  ? 210  SER B CA    1 
ATOM   3243  C  C     . SER B 1  210  ? -2.179  8.068   -48.346 1.00 95.71  ? 210  SER B C     1 
ATOM   3244  O  O     . SER B 1  210  ? -3.104  8.879   -48.398 1.00 96.83  ? 210  SER B O     1 
ATOM   3245  C  CB    . SER B 1  210  ? -1.293  7.004   -50.435 1.00 102.92 ? 210  SER B CB    1 
ATOM   3246  O  OG    . SER B 1  210  ? -2.517  7.213   -51.122 1.00 101.81 ? 210  SER B OG    1 
ATOM   3247  N  N     . ALA B 1  211  ? -2.081  7.139   -47.401 1.00 91.53  ? 211  ALA B N     1 
ATOM   3248  C  CA    . ALA B 1  211  ? -3.021  7.073   -46.299 1.00 86.78  ? 211  ALA B CA    1 
ATOM   3249  C  C     . ALA B 1  211  ? -2.875  8.290   -45.409 1.00 86.59  ? 211  ALA B C     1 
ATOM   3250  O  O     . ALA B 1  211  ? -3.828  8.709   -44.753 1.00 80.54  ? 211  ALA B O     1 
ATOM   3251  C  CB    . ALA B 1  211  ? -2.820  5.795   -45.499 1.00 20.00  ? 211  ALA B CB    1 
ATOM   3252  N  N     . GLY B 1  212  ? -1.673  8.858   -45.395 1.00 91.58  ? 212  GLY B N     1 
ATOM   3253  C  CA    . GLY B 1  212  ? -1.396  10.056  -44.626 1.00 92.66  ? 212  GLY B CA    1 
ATOM   3254  C  C     . GLY B 1  212  ? -1.891  11.301  -45.334 1.00 84.33  ? 212  GLY B C     1 
ATOM   3255  O  O     . GLY B 1  212  ? -2.437  12.205  -44.705 1.00 80.65  ? 212  GLY B O     1 
ATOM   3256  N  N     . LYS B 1  213  ? -1.697  11.343  -46.648 1.00 84.53  ? 213  LYS B N     1 
ATOM   3257  C  CA    . LYS B 1  213  ? -2.173  12.454  -47.463 1.00 84.32  ? 213  LYS B CA    1 
ATOM   3258  C  C     . LYS B 1  213  ? -3.698  12.480  -47.514 1.00 81.35  ? 213  LYS B C     1 
ATOM   3259  O  O     . LYS B 1  213  ? -4.308  13.548  -47.463 1.00 84.64  ? 213  LYS B O     1 
ATOM   3260  C  CB    . LYS B 1  213  ? -1.595  12.370  -48.881 1.00 88.43  ? 213  LYS B CB    1 
ATOM   3261  C  CG    . LYS B 1  213  ? -2.150  13.408  -49.851 1.00 90.49  ? 213  LYS B CG    1 
ATOM   3262  C  CD    . LYS B 1  213  ? -1.487  13.317  -51.220 1.00 85.64  ? 213  LYS B CD    1 
ATOM   3263  C  CE    . LYS B 1  213  ? -2.097  14.316  -52.195 1.00 86.96  ? 213  LYS B CE    1 
ATOM   3264  N  NZ    . LYS B 1  213  ? -1.400  14.311  -53.513 1.00 84.60  ? 213  LYS B NZ    1 
ATOM   3265  N  N     . THR B 1  214  ? -4.307  11.301  -47.611 1.00 81.41  ? 214  THR B N     1 
ATOM   3266  C  CA    . THR B 1  214  ? -5.761  11.192  -47.703 1.00 78.85  ? 214  THR B CA    1 
ATOM   3267  C  C     . THR B 1  214  ? -6.448  11.859  -46.514 1.00 80.21  ? 214  THR B C     1 
ATOM   3268  O  O     . THR B 1  214  ? -7.406  12.613  -46.683 1.00 83.94  ? 214  THR B O     1 
ATOM   3269  C  CB    . THR B 1  214  ? -6.221  9.717   -47.783 1.00 80.59  ? 214  THR B CB    1 
ATOM   3270  O  OG1   . THR B 1  214  ? -5.668  9.099   -48.952 1.00 88.09  ? 214  THR B OG1   1 
ATOM   3271  C  CG2   . THR B 1  214  ? -7.737  9.635   -47.850 1.00 73.28  ? 214  THR B CG2   1 
ATOM   3272  N  N     . LEU B 1  215  ? -5.935  11.595  -45.316 1.00 80.98  ? 215  LEU B N     1 
ATOM   3273  C  CA    . LEU B 1  215  ? -6.555  12.069  -44.081 1.00 77.25  ? 215  LEU B CA    1 
ATOM   3274  C  C     . LEU B 1  215  ? -6.345  13.561  -43.843 1.00 76.27  ? 215  LEU B C     1 
ATOM   3275  O  O     . LEU B 1  215  ? -7.147  14.207  -43.170 1.00 79.21  ? 215  LEU B O     1 
ATOM   3276  C  CB    . LEU B 1  215  ? -6.021  11.270  -42.893 1.00 73.14  ? 215  LEU B CB    1 
ATOM   3277  C  CG    . LEU B 1  215  ? -6.344  9.778   -42.963 1.00 69.03  ? 215  LEU B CG    1 
ATOM   3278  C  CD1   . LEU B 1  215  ? -5.730  9.021   -41.800 1.00 67.98  ? 215  LEU B CD1   1 
ATOM   3279  C  CD2   . LEU B 1  215  ? -7.849  9.573   -43.005 1.00 71.08  ? 215  LEU B CD2   1 
ATOM   3280  N  N     . VAL B 1  216  ? -5.263  14.102  -44.391 1.00 76.86  ? 216  VAL B N     1 
ATOM   3281  C  CA    . VAL B 1  216  ? -5.010  15.534  -44.317 1.00 79.10  ? 216  VAL B CA    1 
ATOM   3282  C  C     . VAL B 1  216  ? -6.143  16.305  -45.011 1.00 76.71  ? 216  VAL B C     1 
ATOM   3283  O  O     . VAL B 1  216  ? -6.555  17.368  -44.540 1.00 77.19  ? 216  VAL B O     1 
ATOM   3284  C  CB    . VAL B 1  216  ? -3.638  15.894  -44.947 1.00 85.13  ? 216  VAL B CB    1 
ATOM   3285  C  CG1   . VAL B 1  216  ? -3.452  17.400  -45.031 1.00 92.09  ? 216  VAL B CG1   1 
ATOM   3286  C  CG2   . VAL B 1  216  ? -2.502  15.264  -44.149 1.00 84.62  ? 216  VAL B CG2   1 
ATOM   3287  N  N     . GLU B 1  217  ? -6.659  15.748  -46.109 1.00 81.01  ? 217  GLU B N     1 
ATOM   3288  C  CA    . GLU B 1  217  ? -7.755  16.361  -46.872 1.00 87.23  ? 217  GLU B CA    1 
ATOM   3289  C  C     . GLU B 1  217  ? -9.032  16.503  -46.040 1.00 82.63  ? 217  GLU B C     1 
ATOM   3290  O  O     . GLU B 1  217  ? -9.744  17.504  -46.140 1.00 81.14  ? 217  GLU B O     1 
ATOM   3291  C  CB    . GLU B 1  217  ? -8.068  15.547  -48.146 1.00 102.86 ? 217  GLU B CB    1 
ATOM   3292  C  CG    . GLU B 1  217  ? -6.997  15.591  -49.249 1.00 107.34 ? 217  GLU B CG    1 
ATOM   3293  C  CD    . GLU B 1  217  ? -7.492  15.075  -50.609 1.00 97.15  ? 217  GLU B CD    1 
ATOM   3294  O  OE1   . GLU B 1  217  ? -8.672  14.676  -50.724 1.00 91.40  ? 217  GLU B OE1   1 
ATOM   3295  O  OE2   . GLU B 1  217  ? -6.691  15.076  -51.570 1.00 92.04  ? 217  GLU B OE2   1 
ATOM   3296  N  N     . LEU B 1  218  ? -9.318  15.488  -45.230 1.00 79.64  ? 218  LEU B N     1 
ATOM   3297  C  CA    . LEU B 1  218  ? -10.510 15.482  -44.388 1.00 77.14  ? 218  LEU B CA    1 
ATOM   3298  C  C     . LEU B 1  218  ? -10.456 16.580  -43.331 1.00 81.21  ? 218  LEU B C     1 
ATOM   3299  O  O     . LEU B 1  218  ? -11.402 17.355  -43.177 1.00 81.66  ? 218  LEU B O     1 
ATOM   3300  C  CB    . LEU B 1  218  ? -10.680 14.117  -43.718 1.00 65.69  ? 218  LEU B CB    1 
ATOM   3301  C  CG    . LEU B 1  218  ? -11.120 12.986  -44.646 1.00 59.71  ? 218  LEU B CG    1 
ATOM   3302  C  CD1   . LEU B 1  218  ? -11.286 11.679  -43.888 1.00 63.45  ? 218  LEU B CD1   1 
ATOM   3303  C  CD2   . LEU B 1  218  ? -12.413 13.372  -45.333 1.00 70.84  ? 218  LEU B CD2   1 
ATOM   3304  N  N     . PHE B 1  219  ? -9.340  16.649  -42.613 1.00 79.65  ? 219  PHE B N     1 
ATOM   3305  C  CA    . PHE B 1  219  ? -9.173  17.633  -41.549 1.00 78.76  ? 219  PHE B CA    1 
ATOM   3306  C  C     . PHE B 1  219  ? -8.957  19.038  -42.104 1.00 83.87  ? 219  PHE B C     1 
ATOM   3307  O  O     . PHE B 1  219  ? -8.843  20.001  -41.347 1.00 90.13  ? 219  PHE B O     1 
ATOM   3308  C  CB    . PHE B 1  219  ? -8.008  17.242  -40.638 1.00 82.03  ? 219  PHE B CB    1 
ATOM   3309  C  CG    . PHE B 1  219  ? -8.240  15.973  -39.869 1.00 77.88  ? 219  PHE B CG    1 
ATOM   3310  C  CD1   . PHE B 1  219  ? -9.484  15.689  -39.330 1.00 76.74  ? 219  PHE B CD1   1 
ATOM   3311  C  CD2   . PHE B 1  219  ? -7.216  15.056  -39.696 1.00 81.36  ? 219  PHE B CD2   1 
ATOM   3312  C  CE1   . PHE B 1  219  ? -9.702  14.516  -38.627 1.00 74.83  ? 219  PHE B CE1   1 
ATOM   3313  C  CE2   . PHE B 1  219  ? -7.428  13.884  -38.995 1.00 78.53  ? 219  PHE B CE2   1 
ATOM   3314  C  CZ    . PHE B 1  219  ? -8.671  13.613  -38.459 1.00 75.41  ? 219  PHE B CZ    1 
ATOM   3315  N  N     . GLY B 1  220  ? -8.902  19.154  -43.427 1.00 86.54  ? 220  GLY B N     1 
ATOM   3316  C  CA    . GLY B 1  220  ? -8.827  20.453  -44.067 1.00 88.34  ? 220  GLY B CA    1 
ATOM   3317  C  C     . GLY B 1  220  ? -10.143 21.196  -43.939 1.00 87.38  ? 220  GLY B C     1 
ATOM   3318  O  O     . GLY B 1  220  ? -10.158 22.385  -43.622 1.00 87.04  ? 220  GLY B O     1 
ATOM   3319  N  N     . LEU B 1  221  ? -11.243 20.481  -44.177 1.00 82.60  ? 221  LEU B N     1 
ATOM   3320  C  CA    . LEU B 1  221  ? -12.598 21.034  -44.103 1.00 78.67  ? 221  LEU B CA    1 
ATOM   3321  C  C     . LEU B 1  221  ? -12.839 21.824  -42.826 1.00 76.35  ? 221  LEU B C     1 
ATOM   3322  O  O     . LEU B 1  221  ? -13.389 22.925  -42.851 1.00 81.62  ? 221  LEU B O     1 
ATOM   3323  C  CB    . LEU B 1  221  ? -13.639 19.915  -44.198 1.00 76.32  ? 221  LEU B CB    1 
ATOM   3324  C  CG    . LEU B 1  221  ? -14.142 19.451  -45.567 1.00 85.04  ? 221  LEU B CG    1 
ATOM   3325  C  CD1   . LEU B 1  221  ? -14.812 20.595  -46.321 1.00 89.35  ? 221  LEU B CD1   1 
ATOM   3326  C  CD2   . LEU B 1  221  ? -13.021 18.830  -46.392 1.00 86.02  ? 221  LEU B CD2   1 
ATOM   3327  N  N     . ALA B 1  222  ? -12.432 21.241  -41.707 1.00 70.87  ? 222  ALA B N     1 
ATOM   3328  C  CA    . ALA B 1  222  ? -12.562 21.900  -40.421 1.00 76.03  ? 222  ALA B CA    1 
ATOM   3329  C  C     . ALA B 1  222  ? -11.617 23.092  -40.328 1.00 84.22  ? 222  ALA B C     1 
ATOM   3330  O  O     . ALA B 1  222  ? -11.995 24.149  -39.825 1.00 93.06  ? 222  ALA B O     1 
ATOM   3331  C  CB    . ALA B 1  222  ? -12.293 20.920  -39.295 1.00 79.50  ? 222  ALA B CB    1 
ATOM   3332  N  N     . ARG B 1  223  ? -10.394 22.921  -40.824 1.00 86.76  ? 223  ARG B N     1 
ATOM   3333  C  CA    . ARG B 1  223  ? -9.357  23.944  -40.685 1.00 90.16  ? 223  ARG B CA    1 
ATOM   3334  C  C     . ARG B 1  223  ? -9.641  25.193  -41.516 1.00 95.25  ? 223  ARG B C     1 
ATOM   3335  O  O     . ARG B 1  223  ? -9.235  26.298  -41.150 1.00 101.40 ? 223  ARG B O     1 
ATOM   3336  C  CB    . ARG B 1  223  ? -7.988  23.382  -41.077 1.00 87.51  ? 223  ARG B CB    1 
ATOM   3337  C  CG    . ARG B 1  223  ? -6.852  24.374  -40.860 1.00 92.76  ? 223  ARG B CG    1 
ATOM   3338  C  CD    . ARG B 1  223  ? -5.665  24.116  -41.777 1.00 101.09 ? 223  ARG B CD    1 
ATOM   3339  N  NE    . ARG B 1  223  ? -4.616  25.114  -41.576 1.00 100.15 ? 223  ARG B NE    1 
ATOM   3340  C  CZ    . ARG B 1  223  ? -3.453  25.126  -42.220 1.00 95.63  ? 223  ARG B CZ    1 
ATOM   3341  N  NH1   . ARG B 1  223  ? -2.564  26.077  -41.963 1.00 94.19  ? 223  ARG B NH1   1 
ATOM   3342  N  NH2   . ARG B 1  223  ? -3.176  24.190  -43.119 1.00 90.90  ? 223  ARG B NH2   1 
ATOM   3343  N  N     . GLU B 1  224  ? -10.343 25.006  -42.630 1.00 93.27  ? 224  GLU B N     1 
ATOM   3344  C  CA    . GLU B 1  224  ? -10.629 26.084  -43.575 1.00 93.81  ? 224  GLU B CA    1 
ATOM   3345  C  C     . GLU B 1  224  ? -11.314 27.293  -42.940 1.00 91.96  ? 224  GLU B C     1 
ATOM   3346  O  O     . GLU B 1  224  ? -11.142 28.425  -43.393 1.00 100.54 ? 224  GLU B O     1 
ATOM   3347  C  CB    . GLU B 1  224  ? -11.504 25.560  -44.720 1.00 86.75  ? 224  GLU B CB    1 
ATOM   3348  C  CG    . GLU B 1  224  ? -10.827 24.549  -45.629 1.00 87.42  ? 224  GLU B CG    1 
ATOM   3349  C  CD    . GLU B 1  224  ? -11.769 23.970  -46.667 1.00 78.94  ? 224  GLU B CD    1 
ATOM   3350  O  OE1   . GLU B 1  224  ? -12.958 24.351  -46.665 1.00 75.06  ? 224  GLU B OE1   1 
ATOM   3351  O  OE2   . GLU B 1  224  ? -11.324 23.136  -47.484 1.00 80.25  ? 224  GLU B OE2   1 
ATOM   3352  N  N     . LEU B 1  225  ? -12.082 27.049  -41.886 1.00 80.20  ? 225  LEU B N     1 
ATOM   3353  C  CA    . LEU B 1  225  ? -12.967 28.069  -41.339 1.00 79.32  ? 225  LEU B CA    1 
ATOM   3354  C  C     . LEU B 1  225  ? -12.250 29.247  -40.666 1.00 80.83  ? 225  LEU B C     1 
ATOM   3355  O  O     . LEU B 1  225  ? -12.652 30.394  -40.851 1.00 80.67  ? 225  LEU B O     1 
ATOM   3356  C  CB    . LEU B 1  225  ? -13.947 27.418  -40.359 1.00 76.73  ? 225  LEU B CB    1 
ATOM   3357  C  CG    . LEU B 1  225  ? -15.094 26.654  -41.031 1.00 75.01  ? 225  LEU B CG    1 
ATOM   3358  C  CD1   . LEU B 1  225  ? -15.755 25.679  -40.071 1.00 73.43  ? 225  LEU B CD1   1 
ATOM   3359  C  CD2   . LEU B 1  225  ? -16.119 27.632  -41.583 1.00 76.78  ? 225  LEU B CD2   1 
ATOM   3360  N  N     . ASN B 1  226  ? -11.194 28.982  -39.902 1.00 83.42  ? 226  ASN B N     1 
ATOM   3361  C  CA    . ASN B 1  226  ? -10.557 30.052  -39.132 1.00 94.04  ? 226  ASN B CA    1 
ATOM   3362  C  C     . ASN B 1  226  ? -9.034  29.973  -39.046 1.00 101.61 ? 226  ASN B C     1 
ATOM   3363  O  O     . ASN B 1  226  ? -8.379  31.006  -38.890 1.00 95.96  ? 226  ASN B O     1 
ATOM   3364  C  CB    . ASN B 1  226  ? -11.131 30.077  -37.711 1.00 100.51 ? 226  ASN B CB    1 
ATOM   3365  C  CG    . ASN B 1  226  ? -10.884 31.401  -36.995 1.00 103.81 ? 226  ASN B CG    1 
ATOM   3366  O  OD1   . ASN B 1  226  ? -11.414 31.635  -35.909 1.00 102.76 ? 226  ASN B OD1   1 
ATOM   3367  N  ND2   . ASN B 1  226  ? -10.090 32.276  -37.605 1.00 102.89 ? 226  ASN B ND2   1 
ATOM   3368  N  N     . VAL B 1  227  ? -8.494  28.757  -39.156 1.00 106.18 ? 227  VAL B N     1 
ATOM   3369  C  CA    . VAL B 1  227  ? -7.081  28.450  -38.893 1.00 110.03 ? 227  VAL B CA    1 
ATOM   3370  C  C     . VAL B 1  227  ? -6.568  29.299  -37.709 1.00 118.19 ? 227  VAL B C     1 
ATOM   3371  O  O     . VAL B 1  227  ? -5.599  30.054  -37.817 1.00 124.55 ? 227  VAL B O     1 
ATOM   3372  C  CB    . VAL B 1  227  ? -6.192  28.625  -40.189 1.00 102.19 ? 227  VAL B CB    1 
ATOM   3373  C  CG1   . VAL B 1  227  ? -6.178  30.061  -40.730 1.00 86.52  ? 227  VAL B CG1   1 
ATOM   3374  C  CG2   . VAL B 1  227  ? -4.770  28.099  -39.977 1.00 99.24  ? 227  VAL B CG2   1 
ATOM   3375  N  N     . GLU B 1  228  ? -7.246  29.162  -36.568 1.00 116.92 ? 228  GLU B N     1 
ATOM   3376  C  CA    . GLU B 1  228  ? -6.986  30.000  -35.393 1.00 114.87 ? 228  GLU B CA    1 
ATOM   3377  C  C     . GLU B 1  228  ? -5.660  29.710  -34.697 1.00 114.55 ? 228  GLU B C     1 
ATOM   3378  O  O     . GLU B 1  228  ? -4.725  30.509  -34.771 1.00 112.36 ? 228  GLU B O     1 
ATOM   3379  C  CB    . GLU B 1  228  ? -8.127  29.861  -34.367 1.00 112.73 ? 228  GLU B CB    1 
ATOM   3380  C  CG    . GLU B 1  228  ? -7.934  30.725  -33.105 1.00 112.76 ? 228  GLU B CG    1 
ATOM   3381  C  CD    . GLU B 1  228  ? -8.937  30.411  -31.999 1.00 101.44 ? 228  GLU B CD    1 
ATOM   3382  O  OE1   . GLU B 1  228  ? -9.767  29.495  -32.186 1.00 96.47  ? 228  GLU B OE1   1 
ATOM   3383  O  OE2   . GLU B 1  228  ? -8.895  31.076  -30.940 1.00 86.19  ? 228  GLU B OE2   1 
ATOM   3384  N  N     . ALA B 1  229  ? -5.586  28.577  -34.007 1.00 103.74 ? 229  ALA B N     1 
ATOM   3385  C  CA    . ALA B 1  229  ? -4.456  28.327  -33.115 1.00 98.95  ? 229  ALA B CA    1 
ATOM   3386  C  C     . ALA B 1  229  ? -3.985  26.871  -33.061 1.00 96.99  ? 229  ALA B C     1 
ATOM   3387  O  O     . ALA B 1  229  ? -4.791  25.941  -33.019 1.00 93.18  ? 229  ALA B O     1 
ATOM   3388  C  CB    . ALA B 1  229  ? -4.801  28.799  -31.711 1.00 95.75  ? 229  ALA B CB    1 
ATOM   3389  N  N     . GLU B 1  230  ? -2.662  26.710  -33.073 1.00 98.36  ? 230  GLU B N     1 
ATOM   3390  C  CA    . GLU B 1  230  ? -1.977  25.439  -32.841 1.00 96.69  ? 230  GLU B CA    1 
ATOM   3391  C  C     . GLU B 1  230  ? -0.472  25.695  -32.804 1.00 105.99 ? 230  GLU B C     1 
ATOM   3392  O  O     . GLU B 1  230  ? 0.013   26.616  -33.459 1.00 111.39 ? 230  GLU B O     1 
ATOM   3393  C  CB    . GLU B 1  230  ? -2.312  24.407  -33.920 1.00 92.90  ? 230  GLU B CB    1 
ATOM   3394  C  CG    . GLU B 1  230  ? -1.630  23.062  -33.715 1.00 88.35  ? 230  GLU B CG    1 
ATOM   3395  C  CD    . GLU B 1  230  ? -1.815  22.530  -32.307 1.00 80.80  ? 230  GLU B CD    1 
ATOM   3396  O  OE1   . GLU B 1  230  ? -2.937  22.646  -31.770 1.00 75.35  ? 230  GLU B OE1   1 
ATOM   3397  O  OE2   . GLU B 1  230  ? -0.838  22.005  -31.734 1.00 81.80  ? 230  GLU B OE2   1 
ATOM   3398  N  N     . GLY B 1  231  ? 0.266   24.885  -32.046 1.00 108.99 ? 231  GLY B N     1 
ATOM   3399  C  CA    . GLY B 1  231  ? 1.707   25.053  -31.944 1.00 119.43 ? 231  GLY B CA    1 
ATOM   3400  C  C     . GLY B 1  231  ? 2.549   23.796  -32.113 1.00 115.16 ? 231  GLY B C     1 
ATOM   3401  O  O     . GLY B 1  231  ? 2.412   22.838  -31.353 1.00 111.82 ? 231  GLY B O     1 
ATOM   3402  N  N     . ILE B 1  232  ? 3.430   23.805  -33.110 1.00 115.60 ? 232  ILE B N     1 
ATOM   3403  C  CA    . ILE B 1  232  ? 4.388   22.719  -33.314 1.00 107.92 ? 232  ILE B CA    1 
ATOM   3404  C  C     . ILE B 1  232  ? 5.804   23.266  -33.457 1.00 101.89 ? 232  ILE B C     1 
ATOM   3405  O  O     . ILE B 1  232  ? 6.058   24.135  -34.293 1.00 97.74  ? 232  ILE B O     1 
ATOM   3406  C  CB    . ILE B 1  232  ? 4.050   21.881  -34.563 1.00 100.90 ? 232  ILE B CB    1 
ATOM   3407  C  CG1   . ILE B 1  232  ? 2.827   21.000  -34.304 1.00 103.28 ? 232  ILE B CG1   1 
ATOM   3408  C  CG2   . ILE B 1  232  ? 5.238   21.018  -34.970 1.00 90.08  ? 232  ILE B CG2   1 
ATOM   3409  C  CD1   . ILE B 1  232  ? 3.103   19.809  -33.411 1.00 107.76 ? 232  ILE B CD1   1 
ATOM   3410  N  N     . SER C 2  28   ? -43.386 11.567  2.469   1.00 82.83  ? 28   SER C N     1 
ATOM   3411  C  CA    . SER C 2  28   ? -42.220 12.012  3.223   1.00 78.03  ? 28   SER C CA    1 
ATOM   3412  C  C     . SER C 2  28   ? -41.891 11.029  4.339   1.00 82.37  ? 28   SER C C     1 
ATOM   3413  O  O     . SER C 2  28   ? -42.751 10.270  4.787   1.00 77.05  ? 28   SER C O     1 
ATOM   3414  C  CB    . SER C 2  28   ? -42.454 13.409  3.801   1.00 72.71  ? 28   SER C CB    1 
ATOM   3415  N  N     . ASN C 2  29   ? -40.639 11.048  4.783   1.00 89.39  ? 29   ASN C N     1 
ATOM   3416  C  CA    . ASN C 2  29   ? -40.192 10.162  5.849   1.00 93.89  ? 29   ASN C CA    1 
ATOM   3417  C  C     . ASN C 2  29   ? -40.258 10.849  7.208   1.00 98.44  ? 29   ASN C C     1 
ATOM   3418  O  O     . ASN C 2  29   ? -41.155 10.582  8.008   1.00 99.86  ? 29   ASN C O     1 
ATOM   3419  C  CB    . ASN C 2  29   ? -38.768 9.673   5.575   1.00 87.92  ? 29   ASN C CB    1 
ATOM   3420  N  N     . ASN C 2  30   ? -39.304 11.740  7.459   1.00 99.84  ? 30   ASN C N     1 
ATOM   3421  C  CA    . ASN C 2  30   ? -39.251 12.468  8.720   1.00 97.74  ? 30   ASN C CA    1 
ATOM   3422  C  C     . ASN C 2  30   ? -39.689 13.922  8.554   1.00 94.90  ? 30   ASN C C     1 
ATOM   3423  O  O     . ASN C 2  30   ? -38.858 14.810  8.356   1.00 88.95  ? 30   ASN C O     1 
ATOM   3424  C  CB    . ASN C 2  30   ? -37.838 12.408  9.308   1.00 93.99  ? 30   ASN C CB    1 
ATOM   3425  C  CG    . ASN C 2  30   ? -37.347 10.984  9.508   1.00 94.06  ? 30   ASN C CG    1 
ATOM   3426  O  OD1   . ASN C 2  30   ? -36.841 10.354  8.579   1.00 100.95 ? 30   ASN C OD1   1 
ATOM   3427  N  ND2   . ASN C 2  30   ? -37.491 10.473  10.726  1.00 88.77  ? 30   ASN C ND2   1 
ATOM   3428  N  N     . SER C 2  31   ? -40.998 14.156  8.632   1.00 101.83 ? 31   SER C N     1 
ATOM   3429  C  CA    . SER C 2  31   ? -41.561 15.503  8.524   1.00 94.84  ? 31   SER C CA    1 
ATOM   3430  C  C     . SER C 2  31   ? -41.630 16.171  9.894   1.00 80.86  ? 31   SER C C     1 
ATOM   3431  O  O     . SER C 2  31   ? -42.689 16.640  10.315  1.00 77.01  ? 31   SER C O     1 
ATOM   3432  C  CB    . SER C 2  31   ? -42.959 15.460  7.899   1.00 79.38  ? 31   SER C CB    1 
ATOM   3433  O  OG    . SER C 2  31   ? -42.969 14.713  6.696   1.00 78.80  ? 31   SER C OG    1 
ATOM   3434  N  N     . VAL C 2  32   ? -40.496 16.212  10.585  1.00 67.09  ? 32   VAL C N     1 
ATOM   3435  C  CA    . VAL C 2  32   ? -40.464 16.675  11.967  1.00 54.97  ? 32   VAL C CA    1 
ATOM   3436  C  C     . VAL C 2  32   ? -39.640 17.953  12.196  1.00 49.32  ? 32   VAL C C     1 
ATOM   3437  O  O     . VAL C 2  32   ? -40.096 18.856  12.895  1.00 59.61  ? 32   VAL C O     1 
ATOM   3438  C  CB    . VAL C 2  32   ? -39.930 15.567  12.899  1.00 59.44  ? 32   VAL C CB    1 
ATOM   3439  C  CG1   . VAL C 2  32   ? -40.024 16.007  14.353  1.00 63.49  ? 32   VAL C CG1   1 
ATOM   3440  C  CG2   . VAL C 2  32   ? -40.698 14.275  12.672  1.00 55.75  ? 32   VAL C CG2   1 
ATOM   3441  N  N     . PRO C 2  33   ? -38.431 18.047  11.616  1.00 39.68  ? 33   PRO C N     1 
ATOM   3442  C  CA    . PRO C 2  33   ? -37.661 19.245  11.969  1.00 36.95  ? 33   PRO C CA    1 
ATOM   3443  C  C     . PRO C 2  33   ? -37.951 20.463  11.084  1.00 24.91  ? 33   PRO C C     1 
ATOM   3444  O  O     . PRO C 2  33   ? -38.418 21.501  11.554  1.00 14.41  ? 33   PRO C O     1 
ATOM   3445  C  CB    . PRO C 2  33   ? -36.205 18.788  11.780  1.00 42.84  ? 33   PRO C CB    1 
ATOM   3446  C  CG    . PRO C 2  33   ? -36.273 17.298  11.442  1.00 38.88  ? 33   PRO C CG    1 
ATOM   3447  C  CD    . PRO C 2  33   ? -37.614 17.094  10.849  1.00 38.94  ? 33   PRO C CD    1 
ATOM   3448  N  N     . GLY C 2  34   ? -37.664 20.307  9.798   1.00 28.76  ? 34   GLY C N     1 
ATOM   3449  C  CA    . GLY C 2  34   ? -37.682 21.385  8.827   1.00 23.77  ? 34   GLY C CA    1 
ATOM   3450  C  C     . GLY C 2  34   ? -36.706 20.964  7.744   1.00 29.10  ? 34   GLY C C     1 
ATOM   3451  O  O     . GLY C 2  34   ? -35.976 21.778  7.178   1.00 23.29  ? 34   GLY C O     1 
ATOM   3452  N  N     . ALA C 2  35   ? -36.714 19.662  7.467   1.00 36.09  ? 35   ALA C N     1 
ATOM   3453  C  CA    . ALA C 2  35   ? -35.702 18.997  6.649   1.00 32.82  ? 35   ALA C CA    1 
ATOM   3454  C  C     . ALA C 2  35   ? -36.058 18.945  5.168   1.00 31.70  ? 35   ALA C C     1 
ATOM   3455  O  O     . ALA C 2  35   ? -37.220 19.105  4.802   1.00 44.71  ? 35   ALA C O     1 
ATOM   3456  C  CB    . ALA C 2  35   ? -35.480 17.583  7.172   1.00 29.68  ? 35   ALA C CB    1 
ATOM   3457  N  N     . PRO C 2  36   ? -35.052 18.713  4.308   1.00 27.78  ? 36   PRO C N     1 
ATOM   3458  C  CA    . PRO C 2  36   ? -35.343 18.492  2.890   1.00 30.59  ? 36   PRO C CA    1 
ATOM   3459  C  C     . PRO C 2  36   ? -36.197 17.245  2.684   1.00 33.78  ? 36   PRO C C     1 
ATOM   3460  O  O     . PRO C 2  36   ? -35.955 16.216  3.316   1.00 34.40  ? 36   PRO C O     1 
ATOM   3461  C  CB    . PRO C 2  36   ? -33.954 18.318  2.273   1.00 26.52  ? 36   PRO C CB    1 
ATOM   3462  C  CG    . PRO C 2  36   ? -33.092 17.880  3.413   1.00 27.90  ? 36   PRO C CG    1 
ATOM   3463  C  CD    . PRO C 2  36   ? -33.606 18.655  4.579   1.00 24.25  ? 36   PRO C CD    1 
ATOM   3464  N  N     . ASN C 2  37   ? -37.187 17.343  1.807   1.00 31.64  ? 37   ASN C N     1 
ATOM   3465  C  CA    . ASN C 2  37   ? -38.131 16.255  1.598   1.00 37.93  ? 37   ASN C CA    1 
ATOM   3466  C  C     . ASN C 2  37   ? -37.535 15.090  0.814   1.00 37.59  ? 37   ASN C C     1 
ATOM   3467  O  O     . ASN C 2  37   ? -37.202 15.227  -0.363  1.00 31.92  ? 37   ASN C O     1 
ATOM   3468  C  CB    . ASN C 2  37   ? -39.373 16.778  0.881   1.00 48.52  ? 37   ASN C CB    1 
ATOM   3469  C  CG    . ASN C 2  37   ? -40.446 15.720  0.726   1.00 64.50  ? 37   ASN C CG    1 
ATOM   3470  O  OD1   . ASN C 2  37   ? -40.662 14.898  1.618   1.00 61.68  ? 37   ASN C OD1   1 
ATOM   3471  N  ND2   . ASN C 2  37   ? -41.123 15.731  -0.417  1.00 72.98  ? 37   ASN C ND2   1 
ATOM   3472  N  N     . ARG C 2  38   ? -37.403 13.946  1.478   1.00 36.74  ? 38   ARG C N     1 
ATOM   3473  C  CA    . ARG C 2  38   ? -36.934 12.723  0.834   1.00 30.00  ? 38   ARG C CA    1 
ATOM   3474  C  C     . ARG C 2  38   ? -38.078 11.718  0.767   1.00 30.15  ? 38   ARG C C     1 
ATOM   3475  O  O     . ARG C 2  38   ? -38.482 11.146  1.779   1.00 35.14  ? 38   ARG C O     1 
ATOM   3476  C  CB    . ARG C 2  38   ? -35.732 12.135  1.580   1.00 33.10  ? 38   ARG C CB    1 
ATOM   3477  C  CG    . ARG C 2  38   ? -34.919 11.128  0.774   1.00 24.22  ? 38   ARG C CG    1 
ATOM   3478  C  CD    . ARG C 2  38   ? -33.685 10.654  1.537   1.00 24.22  ? 38   ARG C CD    1 
ATOM   3479  N  NE    . ARG C 2  38   ? -32.683 11.705  1.674   1.00 23.13  ? 38   ARG C NE    1 
ATOM   3480  C  CZ    . ARG C 2  38   ? -31.625 11.836  0.880   1.00 20.20  ? 38   ARG C CZ    1 
ATOM   3481  N  NH1   . ARG C 2  38   ? -30.766 12.825  1.077   1.00 19.03  ? 38   ARG C NH1   1 
ATOM   3482  N  NH2   . ARG C 2  38   ? -31.424 10.975  -0.107  1.00 21.38  ? 38   ARG C NH2   1 
ATOM   3483  N  N     . VAL C 2  39   ? -38.597 11.522  -0.438  1.00 29.40  ? 39   VAL C N     1 
ATOM   3484  C  CA    . VAL C 2  39   ? -39.769 10.685  -0.663  1.00 32.72  ? 39   VAL C CA    1 
ATOM   3485  C  C     . VAL C 2  39   ? -39.461 9.207   -0.428  1.00 32.18  ? 39   VAL C C     1 
ATOM   3486  O  O     . VAL C 2  39   ? -38.491 8.673   -0.958  1.00 36.58  ? 39   VAL C O     1 
ATOM   3487  C  CB    . VAL C 2  39   ? -40.302 10.881  -2.090  1.00 34.11  ? 39   VAL C CB    1 
ATOM   3488  C  CG1   . VAL C 2  39   ? -41.771 10.544  -2.151  1.00 47.60  ? 39   VAL C CG1   1 
ATOM   3489  C  CG2   . VAL C 2  39   ? -40.074 12.315  -2.542  1.00 29.19  ? 39   VAL C CG2   1 
ATOM   3490  N  N     . SER C 2  40   ? -40.294 8.539   0.358   1.00 30.37  ? 40   SER C N     1 
ATOM   3491  C  CA    . SER C 2  40   ? -39.976 7.183   0.781   1.00 30.15  ? 40   SER C CA    1 
ATOM   3492  C  C     . SER C 2  40   ? -40.967 6.135   0.296   1.00 30.77  ? 40   SER C C     1 
ATOM   3493  O  O     . SER C 2  40   ? -42.166 6.253   0.534   1.00 35.56  ? 40   SER C O     1 
ATOM   3494  C  CB    . SER C 2  40   ? -39.894 7.127   2.305   1.00 38.62  ? 40   SER C CB    1 
ATOM   3495  O  OG    . SER C 2  40   ? -39.884 5.789   2.765   1.00 39.99  ? 40   SER C OG    1 
ATOM   3496  N  N     . PHE C 2  41   ? -40.461 5.112   -0.385  1.00 29.62  ? 41   PHE C N     1 
ATOM   3497  C  CA    . PHE C 2  41   ? -41.221 3.881   -0.559  1.00 33.15  ? 41   PHE C CA    1 
ATOM   3498  C  C     . PHE C 2  41   ? -41.446 3.328   0.844   1.00 32.62  ? 41   PHE C C     1 
ATOM   3499  O  O     . PHE C 2  41   ? -40.479 3.018   1.538   1.00 42.00  ? 41   PHE C O     1 
ATOM   3500  C  CB    . PHE C 2  41   ? -40.478 2.839   -1.412  1.00 34.23  ? 41   PHE C CB    1 
ATOM   3501  C  CG    . PHE C 2  41   ? -39.884 3.368   -2.695  1.00 34.09  ? 41   PHE C CG    1 
ATOM   3502  C  CD1   . PHE C 2  41   ? -40.446 3.043   -3.918  1.00 42.21  ? 41   PHE C CD1   1 
ATOM   3503  C  CD2   . PHE C 2  41   ? -38.732 4.135   -2.682  1.00 35.71  ? 41   PHE C CD2   1 
ATOM   3504  C  CE1   . PHE C 2  41   ? -39.893 3.504   -5.099  1.00 45.21  ? 41   PHE C CE1   1 
ATOM   3505  C  CE2   . PHE C 2  41   ? -38.176 4.601   -3.860  1.00 33.27  ? 41   PHE C CE2   1 
ATOM   3506  C  CZ    . PHE C 2  41   ? -38.755 4.283   -5.069  1.00 35.63  ? 41   PHE C CZ    1 
ATOM   3507  N  N     . ALA C 2  42   ? -42.694 3.202   1.283   1.00 28.21  ? 42   ALA C N     1 
ATOM   3508  C  CA    . ALA C 2  42   ? -42.911 2.750   2.653   1.00 33.20  ? 42   ALA C CA    1 
ATOM   3509  C  C     . ALA C 2  42   ? -44.310 2.232   2.954   1.00 45.16  ? 42   ALA C C     1 
ATOM   3510  O  O     . ALA C 2  42   ? -45.279 2.584   2.283   1.00 47.18  ? 42   ALA C O     1 
ATOM   3511  C  CB    . ALA C 2  42   ? -42.583 3.883   3.619   1.00 38.34  ? 42   ALA C CB    1 
ATOM   3512  N  N     . LYS C 2  43   ? -44.392 1.375   3.968   1.00 48.78  ? 43   LYS C N     1 
ATOM   3513  C  CA    . LYS C 2  43   ? -45.624 1.202   4.718   1.00 47.53  ? 43   LYS C CA    1 
ATOM   3514  C  C     . LYS C 2  43   ? -45.572 2.268   5.808   1.00 56.74  ? 43   LYS C C     1 
ATOM   3515  O  O     . LYS C 2  43   ? -44.490 2.595   6.301   1.00 55.71  ? 43   LYS C O     1 
ATOM   3516  C  CB    . LYS C 2  43   ? -45.752 -0.204  5.307   1.00 41.24  ? 43   LYS C CB    1 
ATOM   3517  C  CG    . LYS C 2  43   ? -44.961 -0.435  6.585   1.00 42.39  ? 43   LYS C CG    1 
ATOM   3518  C  CD    . LYS C 2  43   ? -45.509 -1.627  7.356   1.00 56.18  ? 43   LYS C CD    1 
ATOM   3519  C  CE    . LYS C 2  43   ? -44.893 -1.743  8.746   1.00 58.58  ? 43   LYS C CE    1 
ATOM   3520  N  NZ    . LYS C 2  43   ? -45.494 -2.854  9.546   1.00 54.24  ? 43   LYS C NZ    1 
ATOM   3521  N  N     . LEU C 2  44   ? -46.719 2.832   6.168   1.00 65.25  ? 44   LEU C N     1 
ATOM   3522  C  CA    . LEU C 2  44   ? -46.733 3.988   7.061   1.00 71.13  ? 44   LEU C CA    1 
ATOM   3523  C  C     . LEU C 2  44   ? -46.146 3.647   8.429   1.00 64.29  ? 44   LEU C C     1 
ATOM   3524  O  O     . LEU C 2  44   ? -46.630 2.760   9.131   1.00 60.18  ? 44   LEU C O     1 
ATOM   3525  C  CB    . LEU C 2  44   ? -48.153 4.539   7.211   1.00 85.42  ? 44   LEU C CB    1 
ATOM   3526  C  CG    . LEU C 2  44   ? -48.280 6.053   7.435   1.00 93.57  ? 44   LEU C CG    1 
ATOM   3527  C  CD1   . LEU C 2  44   ? -49.625 6.557   6.929   1.00 97.50  ? 44   LEU C CD1   1 
ATOM   3528  C  CD2   . LEU C 2  44   ? -48.085 6.436   8.900   1.00 83.21  ? 44   LEU C CD2   1 
ATOM   3529  N  N     . ARG C 2  45   ? -45.088 4.365   8.787   1.00 66.73  ? 45   ARG C N     1 
ATOM   3530  C  CA    . ARG C 2  45   ? -44.383 4.138   10.039  1.00 65.47  ? 45   ARG C CA    1 
ATOM   3531  C  C     . ARG C 2  45   ? -44.670 5.246   11.042  1.00 63.04  ? 45   ARG C C     1 
ATOM   3532  O  O     . ARG C 2  45   ? -43.960 6.247   11.090  1.00 66.12  ? 45   ARG C O     1 
ATOM   3533  C  CB    . ARG C 2  45   ? -42.876 4.037   9.790   1.00 75.71  ? 45   ARG C CB    1 
ATOM   3534  C  CG    . ARG C 2  45   ? -42.044 3.812   11.045  1.00 79.23  ? 45   ARG C CG    1 
ATOM   3535  C  CD    . ARG C 2  45   ? -40.553 3.898   10.745  1.00 78.75  ? 45   ARG C CD    1 
ATOM   3536  N  NE    . ARG C 2  45   ? -40.174 5.198   10.194  1.00 79.61  ? 45   ARG C NE    1 
ATOM   3537  C  CZ    . ARG C 2  45   ? -39.721 6.218   10.919  1.00 71.67  ? 45   ARG C CZ    1 
ATOM   3538  N  NH1   . ARG C 2  45   ? -39.401 7.362   10.328  1.00 68.56  ? 45   ARG C NH1   1 
ATOM   3539  N  NH2   . ARG C 2  45   ? -39.585 6.094   12.232  1.00 58.88  ? 45   ARG C NH2   1 
ATOM   3540  N  N     . GLU C 2  46   ? -45.715 5.070   11.842  1.00 68.23  ? 46   GLU C N     1 
ATOM   3541  C  CA    . GLU C 2  46   ? -45.990 6.021   12.914  1.00 77.72  ? 46   GLU C CA    1 
ATOM   3542  C  C     . GLU C 2  46   ? -45.917 5.467   14.349  1.00 67.12  ? 46   GLU C C     1 
ATOM   3543  O  O     . GLU C 2  46   ? -46.623 5.969   15.224  1.00 72.44  ? 46   GLU C O     1 
ATOM   3544  C  CB    . GLU C 2  46   ? -47.374 6.645   12.701  1.00 94.76  ? 46   GLU C CB    1 
ATOM   3545  C  CG    . GLU C 2  46   ? -48.531 5.657   12.780  1.00 97.80  ? 46   GLU C CG    1 
ATOM   3546  C  CD    . GLU C 2  46   ? -49.884 6.344   12.776  1.00 92.25  ? 46   GLU C CD    1 
ATOM   3547  O  OE1   . GLU C 2  46   ? -50.728 6.005   13.633  1.00 82.41  ? 46   GLU C OE1   1 
ATOM   3548  O  OE2   . GLU C 2  46   ? -50.104 7.222   11.915  1.00 90.73  ? 46   GLU C OE2   1 
ATOM   3549  N  N     . PRO C 2  47   ? -45.073 4.450   14.617  1.00 60.14  ? 47   PRO C N     1 
ATOM   3550  C  CA    . PRO C 2  47   ? -45.081 4.074   16.034  1.00 56.00  ? 47   PRO C CA    1 
ATOM   3551  C  C     . PRO C 2  47   ? -44.402 5.117   16.915  1.00 44.85  ? 47   PRO C C     1 
ATOM   3552  O  O     . PRO C 2  47   ? -45.068 5.727   17.750  1.00 39.28  ? 47   PRO C O     1 
ATOM   3553  C  CB    . PRO C 2  47   ? -44.310 2.749   16.047  1.00 58.91  ? 47   PRO C CB    1 
ATOM   3554  C  CG    . PRO C 2  47   ? -44.427 2.243   14.644  1.00 56.06  ? 47   PRO C CG    1 
ATOM   3555  C  CD    . PRO C 2  47   ? -44.321 3.468   13.818  1.00 58.72  ? 47   PRO C CD    1 
ATOM   3556  N  N     . LEU C 2  48   ? -43.102 5.319   16.728  1.00 45.13  ? 48   LEU C N     1 
ATOM   3557  C  CA    . LEU C 2  48   ? -42.387 6.370   17.447  1.00 46.62  ? 48   LEU C CA    1 
ATOM   3558  C  C     . LEU C 2  48   ? -41.111 6.785   16.722  1.00 43.04  ? 48   LEU C C     1 
ATOM   3559  O  O     . LEU C 2  48   ? -40.448 5.964   16.086  1.00 37.70  ? 48   LEU C O     1 
ATOM   3560  C  CB    . LEU C 2  48   ? -42.062 5.941   18.890  1.00 41.65  ? 48   LEU C CB    1 
ATOM   3561  C  CG    . LEU C 2  48   ? -41.168 4.764   19.315  1.00 31.10  ? 48   LEU C CG    1 
ATOM   3562  C  CD1   . LEU C 2  48   ? -41.672 3.446   18.772  1.00 38.46  ? 48   LEU C CD1   1 
ATOM   3563  C  CD2   . LEU C 2  48   ? -39.691 4.946   18.981  1.00 28.27  ? 48   LEU C CD2   1 
ATOM   3564  N  N     . GLU C 2  49   ? -40.782 8.069   16.832  1.00 47.82  ? 49   GLU C N     1 
ATOM   3565  C  CA    . GLU C 2  49   ? -39.566 8.618   16.248  1.00 43.50  ? 49   GLU C CA    1 
ATOM   3566  C  C     . GLU C 2  49   ? -38.340 7.969   16.869  1.00 33.05  ? 49   GLU C C     1 
ATOM   3567  O  O     . GLU C 2  49   ? -38.371 7.572   18.032  1.00 29.67  ? 49   GLU C O     1 
ATOM   3568  C  CB    . GLU C 2  49   ? -39.502 10.135  16.451  1.00 50.66  ? 49   GLU C CB    1 
ATOM   3569  C  CG    . GLU C 2  49   ? -40.729 10.902  15.973  1.00 61.31  ? 49   GLU C CG    1 
ATOM   3570  C  CD    . GLU C 2  49   ? -40.677 12.379  16.345  1.00 81.03  ? 49   GLU C CD    1 
ATOM   3571  O  OE1   . GLU C 2  49   ? -39.860 12.746  17.218  1.00 78.44  ? 49   GLU C OE1   1 
ATOM   3572  O  OE2   . GLU C 2  49   ? -41.452 13.172  15.766  1.00 90.61  ? 49   GLU C OE2   1 
ATOM   3573  N  N     . VAL C 2  50   ? -37.269 7.864   16.090  1.00 29.25  ? 50   VAL C N     1 
ATOM   3574  C  CA    . VAL C 2  50   ? -35.990 7.384   16.602  1.00 24.92  ? 50   VAL C CA    1 
ATOM   3575  C  C     . VAL C 2  50   ? -35.591 8.189   17.831  1.00 23.48  ? 50   VAL C C     1 
ATOM   3576  O  O     . VAL C 2  50   ? -35.323 9.386   17.731  1.00 23.34  ? 50   VAL C O     1 
ATOM   3577  C  CB    . VAL C 2  50   ? -34.880 7.485   15.543  1.00 24.23  ? 50   VAL C CB    1 
ATOM   3578  C  CG1   . VAL C 2  50   ? -33.529 7.152   16.155  1.00 25.92  ? 50   VAL C CG1   1 
ATOM   3579  C  CG2   . VAL C 2  50   ? -35.188 6.580   14.356  1.00 32.51  ? 50   VAL C CG2   1 
ATOM   3580  N  N     . PRO C 2  51   ? -35.558 7.532   19.002  1.00 23.06  ? 51   PRO C N     1 
ATOM   3581  C  CA    . PRO C 2  51   ? -35.287 8.235   20.261  1.00 21.17  ? 51   PRO C CA    1 
ATOM   3582  C  C     . PRO C 2  51   ? -33.916 8.903   20.230  1.00 17.33  ? 51   PRO C C     1 
ATOM   3583  O  O     . PRO C 2  51   ? -33.135 8.625   19.319  1.00 15.23  ? 51   PRO C O     1 
ATOM   3584  C  CB    . PRO C 2  51   ? -35.352 7.121   21.316  1.00 23.04  ? 51   PRO C CB    1 
ATOM   3585  C  CG    . PRO C 2  51   ? -35.112 5.849   20.552  1.00 22.20  ? 51   PRO C CG    1 
ATOM   3586  C  CD    . PRO C 2  51   ? -35.677 6.074   19.187  1.00 23.27  ? 51   PRO C CD    1 
ATOM   3587  N  N     . GLY C 2  52   ? -33.643 9.792   21.179  1.00 17.20  ? 52   GLY C N     1 
ATOM   3588  C  CA    . GLY C 2  52   ? -32.368 10.482  21.215  1.00 20.66  ? 52   GLY C CA    1 
ATOM   3589  C  C     . GLY C 2  52   ? -31.241 9.473   21.215  1.00 22.67  ? 52   GLY C C     1 
ATOM   3590  O  O     . GLY C 2  52   ? -31.102 8.699   22.158  1.00 30.35  ? 52   GLY C O     1 
ATOM   3591  N  N     . LEU C 2  53   ? -30.451 9.464   20.148  1.00 17.21  ? 53   LEU C N     1 
ATOM   3592  C  CA    . LEU C 2  53   ? -29.382 8.484   20.006  1.00 18.59  ? 53   LEU C CA    1 
ATOM   3593  C  C     . LEU C 2  53   ? -28.333 8.586   21.109  1.00 19.73  ? 53   LEU C C     1 
ATOM   3594  O  O     . LEU C 2  53   ? -27.826 7.571   21.588  1.00 22.29  ? 53   LEU C O     1 
ATOM   3595  C  CB    . LEU C 2  53   ? -28.719 8.633   18.642  1.00 18.44  ? 53   LEU C CB    1 
ATOM   3596  C  CG    . LEU C 2  53   ? -29.594 8.135   17.496  1.00 21.93  ? 53   LEU C CG    1 
ATOM   3597  C  CD1   . LEU C 2  53   ? -28.931 8.417   16.160  1.00 23.68  ? 53   LEU C CD1   1 
ATOM   3598  C  CD2   . LEU C 2  53   ? -29.886 6.645   17.669  1.00 22.41  ? 53   LEU C CD2   1 
ATOM   3599  N  N     . LEU C 2  54   ? -28.024 9.813   21.517  1.00 19.43  ? 54   LEU C N     1 
ATOM   3600  C  CA    . LEU C 2  54   ? -26.998 10.053  22.524  1.00 17.62  ? 54   LEU C CA    1 
ATOM   3601  C  C     . LEU C 2  54   ? -27.521 9.841   23.939  1.00 16.93  ? 54   LEU C C     1 
ATOM   3602  O  O     . LEU C 2  54   ? -26.834 10.142  24.912  1.00 17.22  ? 54   LEU C O     1 
ATOM   3603  C  CB    . LEU C 2  54   ? -26.438 11.468  22.382  1.00 17.74  ? 54   LEU C CB    1 
ATOM   3604  C  CG    . LEU C 2  54   ? -25.652 11.756  21.103  1.00 18.43  ? 54   LEU C CG    1 
ATOM   3605  C  CD1   . LEU C 2  54   ? -25.047 13.145  21.183  1.00 23.61  ? 54   LEU C CD1   1 
ATOM   3606  C  CD2   . LEU C 2  54   ? -24.576 10.703  20.863  1.00 11.78  ? 54   LEU C CD2   1 
ATOM   3607  N  N     . ASP C 2  55   ? -28.736 9.314   24.052  1.00 18.56  ? 55   ASP C N     1 
ATOM   3608  C  CA    . ASP C 2  55   ? -29.346 9.094   25.358  1.00 23.42  ? 55   ASP C CA    1 
ATOM   3609  C  C     . ASP C 2  55   ? -28.627 8.005   26.145  1.00 26.02  ? 55   ASP C C     1 
ATOM   3610  O  O     . ASP C 2  55   ? -28.767 7.923   27.363  1.00 34.67  ? 55   ASP C O     1 
ATOM   3611  C  CB    . ASP C 2  55   ? -30.829 8.737   25.220  1.00 28.09  ? 55   ASP C CB    1 
ATOM   3612  C  CG    . ASP C 2  55   ? -31.716 9.963   25.088  1.00 34.87  ? 55   ASP C CG    1 
ATOM   3613  O  OD1   . ASP C 2  55   ? -31.263 10.963  24.489  1.00 39.78  ? 55   ASP C OD1   1 
ATOM   3614  O  OD2   . ASP C 2  55   ? -32.862 9.928   25.591  1.00 31.02  ? 55   ASP C OD2   1 
ATOM   3615  N  N     . VAL C 2  56   ? -27.858 7.172   25.453  1.00 24.14  ? 56   VAL C N     1 
ATOM   3616  C  CA    . VAL C 2  56   ? -27.130 6.087   26.108  1.00 30.19  ? 56   VAL C CA    1 
ATOM   3617  C  C     . VAL C 2  56   ? -26.077 6.643   27.055  1.00 23.19  ? 56   VAL C C     1 
ATOM   3618  O  O     . VAL C 2  56   ? -25.880 6.139   28.160  1.00 22.99  ? 56   VAL C O     1 
ATOM   3619  C  CB    . VAL C 2  56   ? -26.444 5.166   25.085  1.00 34.39  ? 56   VAL C CB    1 
ATOM   3620  C  CG1   . VAL C 2  56   ? -25.872 3.922   25.772  1.00 27.86  ? 56   VAL C CG1   1 
ATOM   3621  C  CG2   . VAL C 2  56   ? -27.423 4.790   23.980  1.00 39.64  ? 56   VAL C CG2   1 
ATOM   3622  N  N     . GLN C 2  57   ? -25.398 7.687   26.597  1.00 18.36  ? 57   GLN C N     1 
ATOM   3623  C  CA    . GLN C 2  57   ? -24.394 8.368   27.399  1.00 20.48  ? 57   GLN C CA    1 
ATOM   3624  C  C     . GLN C 2  57   ? -25.052 9.370   28.341  1.00 22.53  ? 57   GLN C C     1 
ATOM   3625  O  O     . GLN C 2  57   ? -24.780 9.382   29.543  1.00 23.80  ? 57   GLN C O     1 
ATOM   3626  C  CB    . GLN C 2  57   ? -23.385 9.081   26.496  1.00 21.54  ? 57   GLN C CB    1 
ATOM   3627  C  CG    . GLN C 2  57   ? -22.620 8.162   25.558  1.00 19.19  ? 57   GLN C CG    1 
ATOM   3628  C  CD    . GLN C 2  57   ? -21.356 7.612   26.189  1.00 20.10  ? 57   GLN C CD    1 
ATOM   3629  O  OE1   . GLN C 2  57   ? -20.642 8.323   26.900  1.00 19.24  ? 57   GLN C OE1   1 
ATOM   3630  N  NE2   . GLN C 2  57   ? -21.073 6.339   25.935  1.00 19.19  ? 57   GLN C NE2   1 
ATOM   3631  N  N     . THR C 2  58   ? -25.927 10.198  27.776  1.00 23.18  ? 58   THR C N     1 
ATOM   3632  C  CA    . THR C 2  58   ? -26.562 11.301  28.493  1.00 22.52  ? 58   THR C CA    1 
ATOM   3633  C  C     . THR C 2  58   ? -27.252 10.876  29.788  1.00 24.86  ? 58   THR C C     1 
ATOM   3634  O  O     . THR C 2  58   ? -26.829 11.273  30.872  1.00 29.85  ? 58   THR C O     1 
ATOM   3635  C  CB    . THR C 2  58   ? -27.597 12.012  27.601  1.00 23.64  ? 58   THR C CB    1 
ATOM   3636  O  OG1   . THR C 2  58   ? -26.976 12.412  26.374  1.00 24.80  ? 58   THR C OG1   1 
ATOM   3637  C  CG2   . THR C 2  58   ? -28.152 13.239  28.303  1.00 32.62  ? 58   THR C CG2   1 
ATOM   3638  N  N     . ASP C 2  59   ? -28.302 10.066  29.671  1.00 24.98  ? 59   ASP C N     1 
ATOM   3639  C  CA    . ASP C 2  59   ? -29.114 9.661   30.822  1.00 28.67  ? 59   ASP C CA    1 
ATOM   3640  C  C     . ASP C 2  59   ? -28.297 9.009   31.933  1.00 25.17  ? 59   ASP C C     1 
ATOM   3641  O  O     . ASP C 2  59   ? -28.648 9.095   33.109  1.00 22.41  ? 59   ASP C O     1 
ATOM   3642  C  CB    . ASP C 2  59   ? -30.222 8.706   30.375  1.00 36.04  ? 59   ASP C CB    1 
ATOM   3643  C  CG    . ASP C 2  59   ? -31.227 9.371   29.453  1.00 41.65  ? 59   ASP C CG    1 
ATOM   3644  O  OD1   . ASP C 2  59   ? -30.910 10.454  28.914  1.00 41.46  ? 59   ASP C OD1   1 
ATOM   3645  O  OD2   . ASP C 2  59   ? -32.328 8.808   29.264  1.00 45.22  ? 59   ASP C OD2   1 
ATOM   3646  N  N     . SER C 2  60   ? -27.203 8.362   31.552  1.00 23.54  ? 60   SER C N     1 
ATOM   3647  C  CA    . SER C 2  60   ? -26.322 7.714   32.513  1.00 28.25  ? 60   SER C CA    1 
ATOM   3648  C  C     . SER C 2  60   ? -25.626 8.742   33.401  1.00 29.91  ? 60   SER C C     1 
ATOM   3649  O  O     . SER C 2  60   ? -25.733 8.685   34.627  1.00 31.67  ? 60   SER C O     1 
ATOM   3650  C  CB    . SER C 2  60   ? -25.284 6.853   31.790  1.00 24.56  ? 60   SER C CB    1 
ATOM   3651  O  OG    . SER C 2  60   ? -24.456 6.164   32.708  1.00 21.89  ? 60   SER C OG    1 
ATOM   3652  N  N     . PHE C 2  61   ? -24.917 9.681   32.778  1.00 28.76  ? 61   PHE C N     1 
ATOM   3653  C  CA    . PHE C 2  61   ? -24.173 10.702  33.514  1.00 24.58  ? 61   PHE C CA    1 
ATOM   3654  C  C     . PHE C 2  61   ? -25.102 11.606  34.320  1.00 27.01  ? 61   PHE C C     1 
ATOM   3655  O  O     . PHE C 2  61   ? -24.710 12.147  35.354  1.00 26.49  ? 61   PHE C O     1 
ATOM   3656  C  CB    . PHE C 2  61   ? -23.327 11.548  32.561  1.00 18.55  ? 61   PHE C CB    1 
ATOM   3657  C  CG    . PHE C 2  61   ? -22.254 12.345  33.249  1.00 18.45  ? 61   PHE C CG    1 
ATOM   3658  C  CD1   . PHE C 2  61   ? -22.430 13.692  33.521  1.00 23.66  ? 61   PHE C CD1   1 
ATOM   3659  C  CD2   . PHE C 2  61   ? -21.070 11.743  33.629  1.00 18.66  ? 61   PHE C CD2   1 
ATOM   3660  C  CE1   . PHE C 2  61   ? -21.439 14.422  34.154  1.00 20.97  ? 61   PHE C CE1   1 
ATOM   3661  C  CE2   . PHE C 2  61   ? -20.078 12.465  34.262  1.00 21.64  ? 61   PHE C CE2   1 
ATOM   3662  C  CZ    . PHE C 2  61   ? -20.263 13.807  34.525  1.00 21.20  ? 61   PHE C CZ    1 
ATOM   3663  N  N     . GLU C 2  62   ? -26.330 11.768  33.837  1.00 29.75  ? 62   GLU C N     1 
ATOM   3664  C  CA    . GLU C 2  62   ? -27.340 12.528  34.563  1.00 33.44  ? 62   GLU C CA    1 
ATOM   3665  C  C     . GLU C 2  62   ? -27.697 11.831  35.868  1.00 33.64  ? 62   GLU C C     1 
ATOM   3666  O  O     . GLU C 2  62   ? -27.991 12.482  36.871  1.00 37.88  ? 62   GLU C O     1 
ATOM   3667  C  CB    . GLU C 2  62   ? -28.594 12.717  33.714  1.00 38.06  ? 62   GLU C CB    1 
ATOM   3668  C  CG    . GLU C 2  62   ? -28.376 13.525  32.451  1.00 44.33  ? 62   GLU C CG    1 
ATOM   3669  C  CD    . GLU C 2  62   ? -29.682 14.003  31.847  1.00 62.32  ? 62   GLU C CD    1 
ATOM   3670  O  OE1   . GLU C 2  62   ? -30.177 15.059  32.291  1.00 80.24  ? 62   GLU C OE1   1 
ATOM   3671  O  OE2   . GLU C 2  62   ? -30.216 13.327  30.939  1.00 53.45  ? 62   GLU C OE2   1 
ATOM   3672  N  N     . TRP C 2  63   ? -27.674 10.502  35.848  1.00 32.47  ? 63   TRP C N     1 
ATOM   3673  C  CA    . TRP C 2  63   ? -27.944 9.721   37.049  1.00 37.59  ? 63   TRP C CA    1 
ATOM   3674  C  C     . TRP C 2  63   ? -26.768 9.786   38.017  1.00 34.08  ? 63   TRP C C     1 
ATOM   3675  O  O     . TRP C 2  63   ? -26.944 9.701   39.233  1.00 38.21  ? 63   TRP C O     1 
ATOM   3676  C  CB    . TRP C 2  63   ? -28.256 8.263   36.691  1.00 36.88  ? 63   TRP C CB    1 
ATOM   3677  C  CG    . TRP C 2  63   ? -28.119 7.312   37.853  1.00 33.96  ? 63   TRP C CG    1 
ATOM   3678  C  CD1   . TRP C 2  63   ? -29.023 7.093   38.852  1.00 38.38  ? 63   TRP C CD1   1 
ATOM   3679  C  CD2   . TRP C 2  63   ? -27.007 6.454   38.124  1.00 31.99  ? 63   TRP C CD2   1 
ATOM   3680  N  NE1   . TRP C 2  63   ? -28.540 6.154   39.730  1.00 39.71  ? 63   TRP C NE1   1 
ATOM   3681  C  CE2   . TRP C 2  63   ? -27.304 5.746   39.305  1.00 34.52  ? 63   TRP C CE2   1 
ATOM   3682  C  CE3   . TRP C 2  63   ? -25.789 6.217   37.484  1.00 35.54  ? 63   TRP C CE3   1 
ATOM   3683  C  CZ2   . TRP C 2  63   ? -26.426 4.818   39.858  1.00 39.83  ? 63   TRP C CZ2   1 
ATOM   3684  C  CZ3   . TRP C 2  63   ? -24.919 5.297   38.032  1.00 37.85  ? 63   TRP C CZ3   1 
ATOM   3685  C  CH2   . TRP C 2  63   ? -25.242 4.608   39.208  1.00 39.95  ? 63   TRP C CH2   1 
ATOM   3686  N  N     . LEU C 2  64   ? -25.567 9.940   37.474  1.00 28.38  ? 64   LEU C N     1 
ATOM   3687  C  CA    . LEU C 2  64   ? -24.378 9.970   38.309  1.00 28.45  ? 64   LEU C CA    1 
ATOM   3688  C  C     . LEU C 2  64   ? -24.414 11.182  39.227  1.00 29.75  ? 64   LEU C C     1 
ATOM   3689  O  O     . LEU C 2  64   ? -24.345 11.051  40.449  1.00 32.95  ? 64   LEU C O     1 
ATOM   3690  C  CB    . LEU C 2  64   ? -23.112 9.988   37.453  1.00 25.82  ? 64   LEU C CB    1 
ATOM   3691  C  CG    . LEU C 2  64   ? -21.785 9.905   38.213  1.00 24.87  ? 64   LEU C CG    1 
ATOM   3692  C  CD1   . LEU C 2  64   ? -21.590 8.526   38.831  1.00 29.40  ? 64   LEU C CD1   1 
ATOM   3693  C  CD2   . LEU C 2  64   ? -20.622 10.262  37.301  1.00 22.94  ? 64   LEU C CD2   1 
ATOM   3694  N  N     . ILE C 2  65   ? -24.544 12.359  38.627  1.00 30.79  ? 65   ILE C N     1 
ATOM   3695  C  CA    . ILE C 2  65   ? -24.502 13.611  39.371  1.00 35.23  ? 65   ILE C CA    1 
ATOM   3696  C  C     . ILE C 2  65   ? -25.845 13.943  40.011  1.00 34.74  ? 65   ILE C C     1 
ATOM   3697  O  O     . ILE C 2  65   ? -25.925 14.783  40.907  1.00 34.71  ? 65   ILE C O     1 
ATOM   3698  C  CB    . ILE C 2  65   ? -24.068 14.781  38.464  1.00 38.40  ? 65   ILE C CB    1 
ATOM   3699  C  CG1   . ILE C 2  65   ? -25.127 15.061  37.396  1.00 42.09  ? 65   ILE C CG1   1 
ATOM   3700  C  CG2   . ILE C 2  65   ? -22.730 14.476  37.808  1.00 34.79  ? 65   ILE C CG2   1 
ATOM   3701  C  CD1   . ILE C 2  65   ? -24.753 16.192  36.458  1.00 36.53  ? 65   ILE C CD1   1 
ATOM   3702  N  N     . GLY C 2  66   ? -26.897 13.274  39.552  1.00 34.64  ? 66   GLY C N     1 
ATOM   3703  C  CA    . GLY C 2  66   ? -28.230 13.505  40.074  1.00 45.18  ? 66   GLY C CA    1 
ATOM   3704  C  C     . GLY C 2  66   ? -28.791 14.836  39.622  1.00 44.00  ? 66   GLY C C     1 
ATOM   3705  O  O     . GLY C 2  66   ? -29.304 15.611  40.428  1.00 48.05  ? 66   GLY C O     1 
ATOM   3706  N  N     . SER C 2  67   ? -28.696 15.097  38.323  1.00 42.14  ? 67   SER C N     1 
ATOM   3707  C  CA    . SER C 2  67   ? -29.155 16.359  37.754  1.00 51.56  ? 67   SER C CA    1 
ATOM   3708  C  C     . SER C 2  67   ? -30.664 16.526  37.938  1.00 56.70  ? 67   SER C C     1 
ATOM   3709  O  O     . SER C 2  67   ? -31.366 15.559  38.238  1.00 57.33  ? 67   SER C O     1 
ATOM   3710  C  CB    . SER C 2  67   ? -28.782 16.437  36.270  1.00 52.26  ? 67   SER C CB    1 
ATOM   3711  O  OG    . SER C 2  67   ? -29.585 15.564  35.496  1.00 65.95  ? 67   SER C OG    1 
ATOM   3712  N  N     . PRO C 2  68   ? -31.165 17.763  37.789  1.00 61.44  ? 68   PRO C N     1 
ATOM   3713  C  CA    . PRO C 2  68   ? -32.612 17.984  37.854  1.00 60.56  ? 68   PRO C CA    1 
ATOM   3714  C  C     . PRO C 2  68   ? -33.369 17.152  36.830  1.00 66.07  ? 68   PRO C C     1 
ATOM   3715  O  O     . PRO C 2  68   ? -34.381 16.544  37.178  1.00 74.63  ? 68   PRO C O     1 
ATOM   3716  C  CB    . PRO C 2  68   ? -32.754 19.475  37.547  1.00 71.07  ? 68   PRO C CB    1 
ATOM   3717  C  CG    . PRO C 2  68   ? -31.471 20.066  38.002  1.00 74.74  ? 68   PRO C CG    1 
ATOM   3718  C  CD    . PRO C 2  68   ? -30.418 19.033  37.728  1.00 71.14  ? 68   PRO C CD    1 
ATOM   3719  N  N     . ARG C 2  69   ? -32.875 17.117  35.595  1.00 63.04  ? 69   ARG C N     1 
ATOM   3720  C  CA    . ARG C 2  69   ? -33.574 16.430  34.513  1.00 69.65  ? 69   ARG C CA    1 
ATOM   3721  C  C     . ARG C 2  69   ? -33.754 14.952  34.818  1.00 65.69  ? 69   ARG C C     1 
ATOM   3722  O  O     . ARG C 2  69   ? -34.705 14.326  34.356  1.00 77.64  ? 69   ARG C O     1 
ATOM   3723  C  CB    . ARG C 2  69   ? -32.831 16.599  33.185  1.00 78.16  ? 69   ARG C CB    1 
ATOM   3724  C  CG    . ARG C 2  69   ? -32.828 18.021  32.643  1.00 85.21  ? 69   ARG C CG    1 
ATOM   3725  C  CD    . ARG C 2  69   ? -32.409 18.061  31.177  1.00 90.80  ? 69   ARG C CD    1 
ATOM   3726  N  NE    . ARG C 2  69   ? -31.047 17.573  30.970  1.00 98.43  ? 69   ARG C NE    1 
ATOM   3727  C  CZ    . ARG C 2  69   ? -29.974 18.355  30.889  1.00 93.17  ? 69   ARG C CZ    1 
ATOM   3728  N  NH1   . ARG C 2  69   ? -30.101 19.671  30.995  1.00 94.00  ? 69   ARG C NH1   1 
ATOM   3729  N  NH2   . ARG C 2  69   ? -28.774 17.823  30.697  1.00 81.76  ? 69   ARG C NH2   1 
ATOM   3730  N  N     . TRP C 2  70   ? -32.842 14.399  35.607  1.00 60.49  ? 70   TRP C N     1 
ATOM   3731  C  CA    . TRP C 2  70   ? -32.921 12.996  35.979  1.00 63.97  ? 70   TRP C CA    1 
ATOM   3732  C  C     . TRP C 2  70   ? -34.011 12.742  37.012  1.00 68.95  ? 70   TRP C C     1 
ATOM   3733  O  O     . TRP C 2  70   ? -34.756 11.767  36.913  1.00 72.69  ? 70   TRP C O     1 
ATOM   3734  C  CB    . TRP C 2  70   ? -31.581 12.509  36.520  1.00 54.57  ? 70   TRP C CB    1 
ATOM   3735  C  CG    . TRP C 2  70   ? -31.705 11.228  37.266  1.00 48.36  ? 70   TRP C CG    1 
ATOM   3736  C  CD1   . TRP C 2  70   ? -31.923 9.994   36.736  1.00 50.63  ? 70   TRP C CD1   1 
ATOM   3737  C  CD2   . TRP C 2  70   ? -31.628 11.051  38.683  1.00 49.03  ? 70   TRP C CD2   1 
ATOM   3738  N  NE1   . TRP C 2  70   ? -31.984 9.054   37.735  1.00 45.38  ? 70   TRP C NE1   1 
ATOM   3739  C  CE2   . TRP C 2  70   ? -31.804 9.679   38.941  1.00 48.40  ? 70   TRP C CE2   1 
ATOM   3740  C  CE3   . TRP C 2  70   ? -31.423 11.918  39.760  1.00 61.83  ? 70   TRP C CE3   1 
ATOM   3741  C  CZ2   . TRP C 2  70   ? -31.782 9.153   40.229  1.00 56.43  ? 70   TRP C CZ2   1 
ATOM   3742  C  CZ3   . TRP C 2  70   ? -31.401 11.394  41.040  1.00 63.99  ? 70   TRP C CZ3   1 
ATOM   3743  C  CH2   . TRP C 2  70   ? -31.580 10.025  41.263  1.00 60.24  ? 70   TRP C CH2   1 
ATOM   3744  N  N     . ARG C 2  71   ? -34.097 13.620  38.007  1.00 69.43  ? 71   ARG C N     1 
ATOM   3745  C  CA    . ARG C 2  71   ? -35.064 13.458  39.085  1.00 70.30  ? 71   ARG C CA    1 
ATOM   3746  C  C     . ARG C 2  71   ? -36.484 13.599  38.547  1.00 83.26  ? 71   ARG C C     1 
ATOM   3747  O  O     . ARG C 2  71   ? -37.409 12.939  39.024  1.00 85.81  ? 71   ARG C O     1 
ATOM   3748  C  CB    . ARG C 2  71   ? -34.806 14.473  40.199  1.00 66.15  ? 71   ARG C CB    1 
ATOM   3749  C  CG    . ARG C 2  71   ? -35.053 13.925  41.597  1.00 65.37  ? 71   ARG C CG    1 
ATOM   3750  C  CD    . ARG C 2  71   ? -34.600 14.902  42.672  1.00 70.08  ? 71   ARG C CD    1 
ATOM   3751  N  NE    . ARG C 2  71   ? -33.203 15.299  42.507  1.00 79.05  ? 71   ARG C NE    1 
ATOM   3752  C  CZ    . ARG C 2  71   ? -32.175 14.722  43.123  1.00 74.27  ? 71   ARG C CZ    1 
ATOM   3753  N  NH1   . ARG C 2  71   ? -32.374 13.709  43.956  1.00 71.23  ? 71   ARG C NH1   1 
ATOM   3754  N  NH2   . ARG C 2  71   ? -30.942 15.160  42.904  1.00 67.66  ? 71   ARG C NH2   1 
ATOM   3755  N  N     . GLU C 2  72   ? -36.646 14.464  37.550  1.00 89.72  ? 72   GLU C N     1 
ATOM   3756  C  CA    . GLU C 2  72   ? -37.910 14.586  36.836  1.00 88.51  ? 72   GLU C CA    1 
ATOM   3757  C  C     . GLU C 2  72   ? -38.127 13.347  35.973  1.00 89.90  ? 72   GLU C C     1 
ATOM   3758  O  O     . GLU C 2  72   ? -39.252 12.874  35.822  1.00 93.26  ? 72   GLU C O     1 
ATOM   3759  C  CB    . GLU C 2  72   ? -37.935 15.854  35.974  1.00 90.51  ? 72   GLU C CB    1 
ATOM   3760  C  CG    . GLU C 2  72   ? -37.802 17.159  36.754  1.00 92.36  ? 72   GLU C CG    1 
ATOM   3761  C  CD    . GLU C 2  72   ? -37.837 18.389  35.858  1.00 98.75  ? 72   GLU C CD    1 
ATOM   3762  O  OE1   . GLU C 2  72   ? -38.241 18.261  34.682  1.00 106.69 ? 72   GLU C OE1   1 
ATOM   3763  O  OE2   . GLU C 2  72   ? -37.458 19.484  36.328  1.00 89.52  ? 72   GLU C OE2   1 
ATOM   3764  N  N     . SER C 2  73   ? -37.040 12.825  35.411  1.00 81.31  ? 73   SER C N     1 
ATOM   3765  C  CA    . SER C 2  73   ? -37.101 11.598  34.625  1.00 83.71  ? 73   SER C CA    1 
ATOM   3766  C  C     . SER C 2  73   ? -37.396 10.414  35.533  1.00 82.40  ? 73   SER C C     1 
ATOM   3767  O  O     . SER C 2  73   ? -37.973 9.419   35.105  1.00 83.89  ? 73   SER C O     1 
ATOM   3768  C  CB    . SER C 2  73   ? -35.794 11.368  33.861  1.00 91.70  ? 73   SER C CB    1 
ATOM   3769  O  OG    . SER C 2  73   ? -35.890 10.241  33.005  1.00 97.88  ? 73   SER C OG    1 
ATOM   3770  N  N     . ALA C 2  74   ? -36.990 10.528  36.792  1.00 81.40  ? 74   ALA C N     1 
ATOM   3771  C  CA    . ALA C 2  74   ? -37.292 9.506   37.784  1.00 92.23  ? 74   ALA C CA    1 
ATOM   3772  C  C     . ALA C 2  74   ? -38.753 9.609   38.198  1.00 100.70 ? 74   ALA C C     1 
ATOM   3773  O  O     . ALA C 2  74   ? -39.396 8.609   38.514  1.00 105.75 ? 74   ALA C O     1 
ATOM   3774  C  CB    . ALA C 2  74   ? -36.384 9.646   38.990  1.00 94.35  ? 74   ALA C CB    1 
ATOM   3775  N  N     . ALA C 2  75   ? -39.269 10.833  38.188  1.00 99.42  ? 75   ALA C N     1 
ATOM   3776  C  CA    . ALA C 2  75   ? -40.661 11.085  38.534  1.00 104.94 ? 75   ALA C CA    1 
ATOM   3777  C  C     . ALA C 2  75   ? -41.598 10.610  37.425  1.00 112.04 ? 75   ALA C C     1 
ATOM   3778  O  O     . ALA C 2  75   ? -42.591 9.931   37.691  1.00 108.00 ? 75   ALA C O     1 
ATOM   3779  C  CB    . ALA C 2  75   ? -40.876 12.565  38.814  1.00 101.68 ? 75   ALA C CB    1 
ATOM   3780  N  N     . GLU C 2  76   ? -41.273 10.970  36.185  1.00 116.30 ? 76   GLU C N     1 
ATOM   3781  C  CA    . GLU C 2  76   ? -42.088 10.594  35.030  1.00 115.59 ? 76   GLU C CA    1 
ATOM   3782  C  C     . GLU C 2  76   ? -42.112 9.077   34.844  1.00 105.52 ? 76   GLU C C     1 
ATOM   3783  O  O     . GLU C 2  76   ? -43.134 8.509   34.458  1.00 103.76 ? 76   GLU C O     1 
ATOM   3784  C  CB    . GLU C 2  76   ? -41.576 11.280  33.753  1.00 126.17 ? 76   GLU C CB    1 
ATOM   3785  C  CG    . GLU C 2  76   ? -41.799 12.798  33.702  1.00 135.35 ? 76   GLU C CG    1 
ATOM   3786  C  CD    . GLU C 2  76   ? -41.492 13.400  32.334  1.00 138.18 ? 76   GLU C CD    1 
ATOM   3787  O  OE1   . GLU C 2  76   ? -41.607 14.637  32.181  1.00 139.02 ? 76   GLU C OE1   1 
ATOM   3788  O  OE2   . GLU C 2  76   ? -41.138 12.638  31.410  1.00 137.41 ? 76   GLU C OE2   1 
ATOM   3789  N  N     . ARG C 2  77   ? -40.986 8.427   35.125  1.00 109.28 ? 77   ARG C N     1 
ATOM   3790  C  CA    . ARG C 2  77   ? -40.906 6.970   35.064  1.00 112.87 ? 77   ARG C CA    1 
ATOM   3791  C  C     . ARG C 2  77   ? -41.561 6.355   36.298  1.00 109.17 ? 77   ARG C C     1 
ATOM   3792  O  O     . ARG C 2  77   ? -41.763 5.142   36.370  1.00 110.99 ? 77   ARG C O     1 
ATOM   3793  C  CB    . ARG C 2  77   ? -39.449 6.501   34.941  1.00 106.56 ? 77   ARG C CB    1 
ATOM   3794  C  CG    . ARG C 2  77   ? -38.787 6.807   33.598  1.00 93.64  ? 77   ARG C CG    1 
ATOM   3795  C  CD    . ARG C 2  77   ? -37.368 6.240   33.527  1.00 87.41  ? 77   ARG C CD    1 
ATOM   3796  N  NE    . ARG C 2  77   ? -36.661 6.662   32.318  1.00 92.30  ? 77   ARG C NE    1 
ATOM   3797  C  CZ    . ARG C 2  77   ? -35.427 6.283   31.995  1.00 87.52  ? 77   ARG C CZ    1 
ATOM   3798  N  NH1   . ARG C 2  77   ? -34.868 6.722   30.875  1.00 73.11  ? 77   ARG C NH1   1 
ATOM   3799  N  NH2   . ARG C 2  77   ? -34.750 5.465   32.791  1.00 80.74  ? 77   ARG C NH2   1 
ATOM   3800  N  N     . GLY C 2  78   ? -41.890 7.203   37.268  1.00 101.56 ? 78   GLY C N     1 
ATOM   3801  C  CA    . GLY C 2  78   ? -42.574 6.761   38.468  1.00 105.67 ? 78   GLY C CA    1 
ATOM   3802  C  C     . GLY C 2  78   ? -41.661 6.028   39.427  1.00 112.06 ? 78   GLY C C     1 
ATOM   3803  O  O     . GLY C 2  78   ? -42.085 5.101   40.118  1.00 109.65 ? 78   GLY C O     1 
ATOM   3804  N  N     . ASP C 2  79   ? -40.399 6.441   39.470  1.00 117.95 ? 79   ASP C N     1 
ATOM   3805  C  CA    . ASP C 2  79   ? -39.435 5.824   40.371  1.00 124.69 ? 79   ASP C CA    1 
ATOM   3806  C  C     . ASP C 2  79   ? -39.649 6.316   41.800  1.00 113.65 ? 79   ASP C C     1 
ATOM   3807  O  O     . ASP C 2  79   ? -39.604 7.518   42.071  1.00 102.47 ? 79   ASP C O     1 
ATOM   3808  C  CB    . ASP C 2  79   ? -38.001 6.110   39.910  1.00 129.85 ? 79   ASP C CB    1 
ATOM   3809  C  CG    . ASP C 2  79   ? -37.659 5.420   38.596  1.00 131.12 ? 79   ASP C CG    1 
ATOM   3810  O  OD1   . ASP C 2  79   ? -36.474 5.080   38.387  1.00 124.14 ? 79   ASP C OD1   1 
ATOM   3811  O  OD2   . ASP C 2  79   ? -38.576 5.215   37.773  1.00 132.46 ? 79   ASP C OD2   1 
ATOM   3812  N  N     . VAL C 2  80   ? -39.896 5.377   42.707  1.00 111.02 ? 80   VAL C N     1 
ATOM   3813  C  CA    . VAL C 2  80   ? -40.094 5.706   44.112  1.00 110.23 ? 80   VAL C CA    1 
ATOM   3814  C  C     . VAL C 2  80   ? -38.757 5.922   44.812  1.00 111.88 ? 80   VAL C C     1 
ATOM   3815  O  O     . VAL C 2  80   ? -37.913 5.025   44.850  1.00 113.12 ? 80   VAL C O     1 
ATOM   3816  C  CB    . VAL C 2  80   ? -40.889 4.603   44.847  1.00 113.00 ? 80   VAL C CB    1 
ATOM   3817  C  CG1   . VAL C 2  80   ? -40.448 3.216   44.387  1.00 113.21 ? 80   VAL C CG1   1 
ATOM   3818  C  CG2   . VAL C 2  80   ? -40.747 4.758   46.358  1.00 111.92 ? 80   VAL C CG2   1 
ATOM   3819  N  N     . ASN C 2  81   ? -38.575 7.123   45.356  1.00 106.88 ? 81   ASN C N     1 
ATOM   3820  C  CA    . ASN C 2  81   ? -37.356 7.482   46.077  1.00 106.36 ? 81   ASN C CA    1 
ATOM   3821  C  C     . ASN C 2  81   ? -36.087 7.241   45.265  1.00 103.26 ? 81   ASN C C     1 
ATOM   3822  O  O     . ASN C 2  81   ? -35.375 6.262   45.492  1.00 99.21  ? 81   ASN C O     1 
ATOM   3823  C  CB    . ASN C 2  81   ? -37.279 6.714   47.397  1.00 113.72 ? 81   ASN C CB    1 
ATOM   3824  C  CG    . ASN C 2  81   ? -38.251 7.241   48.431  1.00 116.49 ? 81   ASN C CG    1 
ATOM   3825  O  OD1   . ASN C 2  81   ? -38.353 8.450   48.642  1.00 121.53 ? 81   ASN C OD1   1 
ATOM   3826  N  ND2   . ASN C 2  81   ? -38.978 6.336   49.078  1.00 106.08 ? 81   ASN C ND2   1 
ATOM   3827  N  N     . PRO C 2  82   ? -35.802 8.139   44.312  1.00 98.21  ? 82   PRO C N     1 
ATOM   3828  C  CA    . PRO C 2  82   ? -34.615 8.015   43.464  1.00 87.36  ? 82   PRO C CA    1 
ATOM   3829  C  C     . PRO C 2  82   ? -33.336 8.441   44.184  1.00 80.26  ? 82   PRO C C     1 
ATOM   3830  O  O     . PRO C 2  82   ? -33.312 9.470   44.860  1.00 77.18  ? 82   PRO C O     1 
ATOM   3831  C  CB    . PRO C 2  82   ? -34.926 8.953   42.298  1.00 87.66  ? 82   PRO C CB    1 
ATOM   3832  C  CG    . PRO C 2  82   ? -35.791 10.006  42.900  1.00 85.60  ? 82   PRO C CG    1 
ATOM   3833  C  CD    . PRO C 2  82   ? -36.615 9.317   43.958  1.00 93.80  ? 82   PRO C CD    1 
ATOM   3834  N  N     . VAL C 2  83   ? -32.284 7.643   44.036  1.00 71.95  ? 83   VAL C N     1 
ATOM   3835  C  CA    . VAL C 2  83   ? -30.995 7.949   44.641  1.00 63.09  ? 83   VAL C CA    1 
ATOM   3836  C  C     . VAL C 2  83   ? -29.927 8.104   43.568  1.00 59.57  ? 83   VAL C C     1 
ATOM   3837  O  O     . VAL C 2  83   ? -29.693 7.187   42.782  1.00 61.12  ? 83   VAL C O     1 
ATOM   3838  C  CB    . VAL C 2  83   ? -30.559 6.856   45.633  1.00 65.46  ? 83   VAL C CB    1 
ATOM   3839  C  CG1   . VAL C 2  83   ? -29.176 7.163   46.182  1.00 66.05  ? 83   VAL C CG1   1 
ATOM   3840  C  CG2   . VAL C 2  83   ? -31.571 6.727   46.760  1.00 76.35  ? 83   VAL C CG2   1 
ATOM   3841  N  N     . GLY C 2  84   ? -29.285 9.268   43.539  1.00 58.86  ? 84   GLY C N     1 
ATOM   3842  C  CA    . GLY C 2  84   ? -28.243 9.547   42.565  1.00 56.54  ? 84   GLY C CA    1 
ATOM   3843  C  C     . GLY C 2  84   ? -27.026 8.654   42.721  1.00 55.33  ? 84   GLY C C     1 
ATOM   3844  O  O     . GLY C 2  84   ? -26.863 7.992   43.746  1.00 63.98  ? 84   GLY C O     1 
ATOM   3845  N  N     . GLY C 2  85   ? -26.171 8.631   41.704  1.00 43.01  ? 85   GLY C N     1 
ATOM   3846  C  CA    . GLY C 2  85   ? -24.986 7.793   41.731  1.00 41.69  ? 85   GLY C CA    1 
ATOM   3847  C  C     . GLY C 2  85   ? -24.062 8.159   42.875  1.00 44.41  ? 85   GLY C C     1 
ATOM   3848  O  O     . GLY C 2  85   ? -23.527 7.287   43.563  1.00 47.92  ? 85   GLY C O     1 
ATOM   3849  N  N     . LEU C 2  86   ? -23.887 9.460   43.084  1.00 42.71  ? 86   LEU C N     1 
ATOM   3850  C  CA    . LEU C 2  86   ? -23.026 9.966   44.145  1.00 41.74  ? 86   LEU C CA    1 
ATOM   3851  C  C     . LEU C 2  86   ? -23.672 9.847   45.518  1.00 53.31  ? 86   LEU C C     1 
ATOM   3852  O  O     . LEU C 2  86   ? -22.992 9.569   46.507  1.00 63.87  ? 86   LEU C O     1 
ATOM   3853  C  CB    . LEU C 2  86   ? -22.653 11.421  43.877  1.00 38.08  ? 86   LEU C CB    1 
ATOM   3854  C  CG    . LEU C 2  86   ? -21.499 11.622  42.901  1.00 36.85  ? 86   LEU C CG    1 
ATOM   3855  C  CD1   . LEU C 2  86   ? -21.132 13.092  42.817  1.00 41.07  ? 86   LEU C CD1   1 
ATOM   3856  C  CD2   . LEU C 2  86   ? -20.307 10.793  43.337  1.00 33.85  ? 86   LEU C CD2   1 
ATOM   3857  N  N     . GLU C 2  87   ? -24.982 10.072  45.574  1.00 51.58  ? 87   GLU C N     1 
ATOM   3858  C  CA    . GLU C 2  87   ? -25.746 9.909   46.807  1.00 51.65  ? 87   GLU C CA    1 
ATOM   3859  C  C     . GLU C 2  87   ? -25.588 8.492   47.348  1.00 55.32  ? 87   GLU C C     1 
ATOM   3860  O  O     . GLU C 2  87   ? -25.474 8.281   48.556  1.00 58.24  ? 87   GLU C O     1 
ATOM   3861  C  CB    . GLU C 2  87   ? -27.232 10.206  46.575  1.00 53.69  ? 87   GLU C CB    1 
ATOM   3862  C  CG    . GLU C 2  87   ? -27.557 11.617  46.097  1.00 65.21  ? 87   GLU C CG    1 
ATOM   3863  C  CD    . GLU C 2  87   ? -29.045 11.812  45.826  1.00 68.15  ? 87   GLU C CD    1 
ATOM   3864  O  OE1   . GLU C 2  87   ? -29.790 10.807  45.831  1.00 62.53  ? 87   GLU C OE1   1 
ATOM   3865  O  OE2   . GLU C 2  87   ? -29.471 12.967  45.609  1.00 66.79  ? 87   GLU C OE2   1 
ATOM   3866  N  N     . GLU C 2  88   ? -25.579 7.530   46.430  1.00 55.59  ? 88   GLU C N     1 
ATOM   3867  C  CA    . GLU C 2  88   ? -25.521 6.111   46.764  1.00 57.87  ? 88   GLU C CA    1 
ATOM   3868  C  C     . GLU C 2  88   ? -24.218 5.745   47.454  1.00 58.47  ? 88   GLU C C     1 
ATOM   3869  O  O     . GLU C 2  88   ? -24.216 5.080   48.490  1.00 64.66  ? 88   GLU C O     1 
ATOM   3870  C  CB    . GLU C 2  88   ? -25.695 5.265   45.500  1.00 62.92  ? 88   GLU C CB    1 
ATOM   3871  C  CG    . GLU C 2  88   ? -25.435 3.777   45.691  1.00 73.49  ? 88   GLU C CG    1 
ATOM   3872  C  CD    . GLU C 2  88   ? -25.629 2.978   44.412  1.00 74.15  ? 88   GLU C CD    1 
ATOM   3873  O  OE1   . GLU C 2  88   ? -26.261 3.499   43.468  1.00 66.47  ? 88   GLU C OE1   1 
ATOM   3874  O  OE2   . GLU C 2  88   ? -25.151 1.824   44.354  1.00 80.47  ? 88   GLU C OE2   1 
ATOM   3875  N  N     . VAL C 2  89   ? -23.114 6.183   46.862  1.00 55.16  ? 89   VAL C N     1 
ATOM   3876  C  CA    . VAL C 2  89   ? -21.785 5.913   47.389  1.00 61.23  ? 89   VAL C CA    1 
ATOM   3877  C  C     . VAL C 2  89   ? -21.636 6.442   48.812  1.00 64.64  ? 89   VAL C C     1 
ATOM   3878  O  O     . VAL C 2  89   ? -21.021 5.801   49.664  1.00 70.68  ? 89   VAL C O     1 
ATOM   3879  C  CB    . VAL C 2  89   ? -20.703 6.537   46.488  1.00 56.46  ? 89   VAL C CB    1 
ATOM   3880  C  CG1   . VAL C 2  89   ? -19.316 6.292   47.060  1.00 60.10  ? 89   VAL C CG1   1 
ATOM   3881  C  CG2   . VAL C 2  89   ? -20.812 5.978   45.079  1.00 49.31  ? 89   VAL C CG2   1 
ATOM   3882  N  N     . LEU C 2  90   ? -22.221 7.604   49.072  1.00 57.99  ? 90   LEU C N     1 
ATOM   3883  C  CA    . LEU C 2  90   ? -22.104 8.223   50.384  1.00 63.68  ? 90   LEU C CA    1 
ATOM   3884  C  C     . LEU C 2  90   ? -22.915 7.495   51.453  1.00 72.96  ? 90   LEU C C     1 
ATOM   3885  O  O     . LEU C 2  90   ? -22.516 7.462   52.615  1.00 77.94  ? 90   LEU C O     1 
ATOM   3886  C  CB    . LEU C 2  90   ? -22.529 9.689   50.319  1.00 55.55  ? 90   LEU C CB    1 
ATOM   3887  C  CG    . LEU C 2  90   ? -21.676 10.568  49.405  1.00 50.26  ? 90   LEU C CG    1 
ATOM   3888  C  CD1   . LEU C 2  90   ? -21.987 12.035  49.640  1.00 55.79  ? 90   LEU C CD1   1 
ATOM   3889  C  CD2   . LEU C 2  90   ? -20.197 10.288  49.610  1.00 44.86  ? 90   LEU C CD2   1 
ATOM   3890  N  N     . TYR C 2  91   ? -24.045 6.909   51.071  1.00 75.34  ? 91   TYR C N     1 
ATOM   3891  C  CA    . TYR C 2  91   ? -24.895 6.231   52.048  1.00 75.03  ? 91   TYR C CA    1 
ATOM   3892  C  C     . TYR C 2  91   ? -24.342 4.861   52.426  1.00 72.54  ? 91   TYR C C     1 
ATOM   3893  O  O     . TYR C 2  91   ? -24.415 4.459   53.587  1.00 73.27  ? 91   TYR C O     1 
ATOM   3894  C  CB    . TYR C 2  91   ? -26.327 6.098   51.525  1.00 78.27  ? 91   TYR C CB    1 
ATOM   3895  C  CG    . TYR C 2  91   ? -27.126 7.376   51.634  1.00 82.33  ? 91   TYR C CG    1 
ATOM   3896  C  CD1   . TYR C 2  91   ? -26.523 8.561   52.039  1.00 79.04  ? 91   TYR C CD1   1 
ATOM   3897  C  CD2   . TYR C 2  91   ? -28.485 7.397   51.348  1.00 93.13  ? 91   TYR C CD2   1 
ATOM   3898  C  CE1   . TYR C 2  91   ? -27.246 9.733   52.144  1.00 88.31  ? 91   TYR C CE1   1 
ATOM   3899  C  CE2   . TYR C 2  91   ? -29.218 8.566   51.451  1.00 100.66 ? 91   TYR C CE2   1 
ATOM   3900  C  CZ    . TYR C 2  91   ? -28.594 9.730   51.849  1.00 100.59 ? 91   TYR C CZ    1 
ATOM   3901  O  OH    . TYR C 2  91   ? -29.323 10.893  51.952  1.00 97.98  ? 91   TYR C OH    1 
ATOM   3902  N  N     . GLU C 2  92   ? -23.795 4.147   51.445  1.00 70.72  ? 92   GLU C N     1 
ATOM   3903  C  CA    . GLU C 2  92   ? -23.136 2.873   51.710  1.00 68.18  ? 92   GLU C CA    1 
ATOM   3904  C  C     . GLU C 2  92   ? -21.964 3.101   52.651  1.00 70.93  ? 92   GLU C C     1 
ATOM   3905  O  O     . GLU C 2  92   ? -21.737 2.336   53.589  1.00 68.05  ? 92   GLU C O     1 
ATOM   3906  C  CB    . GLU C 2  92   ? -22.645 2.223   50.415  1.00 73.72  ? 92   GLU C CB    1 
ATOM   3907  C  CG    . GLU C 2  92   ? -23.726 1.950   49.384  1.00 80.85  ? 92   GLU C CG    1 
ATOM   3908  C  CD    . GLU C 2  92   ? -23.180 1.271   48.138  1.00 82.15  ? 92   GLU C CD    1 
ATOM   3909  O  OE1   . GLU C 2  92   ? -22.017 0.810   48.170  1.00 84.75  ? 92   GLU C OE1   1 
ATOM   3910  O  OE2   . GLU C 2  92   ? -23.911 1.200   47.128  1.00 71.14  ? 92   GLU C OE2   1 
ATOM   3911  N  N     . LEU C 2  93   ? -21.234 4.177   52.381  1.00 73.71  ? 93   LEU C N     1 
ATOM   3912  C  CA    . LEU C 2  93   ? -20.063 4.565   53.155  1.00 70.22  ? 93   LEU C CA    1 
ATOM   3913  C  C     . LEU C 2  93   ? -20.421 4.989   54.574  1.00 69.58  ? 93   LEU C C     1 
ATOM   3914  O  O     . LEU C 2  93   ? -19.935 4.413   55.547  1.00 75.59  ? 93   LEU C O     1 
ATOM   3915  C  CB    . LEU C 2  93   ? -19.336 5.705   52.447  1.00 66.70  ? 93   LEU C CB    1 
ATOM   3916  C  CG    . LEU C 2  93   ? -18.129 6.287   53.171  1.00 65.15  ? 93   LEU C CG    1 
ATOM   3917  C  CD1   . LEU C 2  93   ? -17.039 5.238   53.279  1.00 79.83  ? 93   LEU C CD1   1 
ATOM   3918  C  CD2   . LEU C 2  93   ? -17.628 7.510   52.435  1.00 59.32  ? 93   LEU C CD2   1 
ATOM   3919  N  N     . SER C 2  94   ? -21.268 6.010   54.673  1.00 70.52  ? 94   SER C N     1 
ATOM   3920  C  CA    . SER C 2  94   ? -21.698 6.563   55.956  1.00 73.41  ? 94   SER C CA    1 
ATOM   3921  C  C     . SER C 2  94   ? -22.503 5.578   56.802  1.00 78.88  ? 94   SER C C     1 
ATOM   3922  O  O     . SER C 2  94   ? -23.323 4.822   56.279  1.00 72.78  ? 94   SER C O     1 
ATOM   3923  C  CB    . SER C 2  94   ? -22.533 7.828   55.732  1.00 76.63  ? 94   SER C CB    1 
ATOM   3924  O  OG    . SER C 2  94   ? -21.739 8.891   55.241  1.00 72.04  ? 94   SER C OG    1 
ATOM   3925  N  N     . PRO C 2  95   ? -22.276 5.598   58.125  1.00 83.20  ? 95   PRO C N     1 
ATOM   3926  C  CA    . PRO C 2  95   ? -21.248 6.443   58.737  1.00 84.76  ? 95   PRO C CA    1 
ATOM   3927  C  C     . PRO C 2  95   ? -19.953 5.676   58.988  1.00 85.49  ? 95   PRO C C     1 
ATOM   3928  O  O     . PRO C 2  95   ? -19.975 4.448   59.074  1.00 85.92  ? 95   PRO C O     1 
ATOM   3929  C  CB    . PRO C 2  95   ? -21.899 6.870   60.050  1.00 91.11  ? 95   PRO C CB    1 
ATOM   3930  C  CG    . PRO C 2  95   ? -22.736 5.686   60.428  1.00 92.16  ? 95   PRO C CG    1 
ATOM   3931  C  CD    . PRO C 2  95   ? -23.173 5.014   59.138  1.00 80.47  ? 95   PRO C CD    1 
ATOM   3932  N  N     . ILE C 2  96   ? -18.838 6.392   59.094  1.00 88.66  ? 96   ILE C N     1 
ATOM   3933  C  CA    . ILE C 2  96   ? -17.558 5.757   59.389  1.00 91.03  ? 96   ILE C CA    1 
ATOM   3934  C  C     . ILE C 2  96   ? -17.259 5.836   60.883  1.00 92.09  ? 96   ILE C C     1 
ATOM   3935  O  O     . ILE C 2  96   ? -17.011 6.916   61.418  1.00 83.62  ? 96   ILE C O     1 
ATOM   3936  C  CB    . ILE C 2  96   ? -16.394 6.405   58.604  1.00 88.18  ? 96   ILE C CB    1 
ATOM   3937  C  CG1   . ILE C 2  96   ? -16.781 6.636   57.142  1.00 89.96  ? 96   ILE C CG1   1 
ATOM   3938  C  CG2   . ILE C 2  96   ? -15.143 5.538   58.686  1.00 83.00  ? 96   ILE C CG2   1 
ATOM   3939  C  CD1   . ILE C 2  96   ? -15.669 7.258   56.313  1.00 78.17  ? 96   ILE C CD1   1 
ATOM   3940  N  N     . GLU C 2  97   ? -17.292 4.689   61.552  1.00 92.71  ? 97   GLU C N     1 
ATOM   3941  C  CA    . GLU C 2  97   ? -16.947 4.614   62.967  1.00 89.28  ? 97   GLU C CA    1 
ATOM   3942  C  C     . GLU C 2  97   ? -15.743 3.699   63.180  1.00 96.77  ? 97   GLU C C     1 
ATOM   3943  O  O     . GLU C 2  97   ? -15.485 2.804   62.375  1.00 101.76 ? 97   GLU C O     1 
ATOM   3944  C  CB    . GLU C 2  97   ? -18.141 4.114   63.786  1.00 91.40  ? 97   GLU C CB    1 
ATOM   3945  C  CG    . GLU C 2  97   ? -19.418 4.917   63.576  1.00 96.90  ? 97   GLU C CG    1 
ATOM   3946  C  CD    . GLU C 2  97   ? -20.632 4.289   64.244  1.00 103.12 ? 97   GLU C CD    1 
ATOM   3947  O  OE1   . GLU C 2  97   ? -20.509 3.172   64.790  1.00 92.80  ? 97   GLU C OE1   1 
ATOM   3948  O  OE2   . GLU C 2  97   ? -21.713 4.917   64.221  1.00 102.49 ? 97   GLU C OE2   1 
ATOM   3949  N  N     . ASP C 2  98   ? -15.002 3.932   64.259  1.00 92.86  ? 98   ASP C N     1 
ATOM   3950  C  CA    . ASP C 2  98   ? -13.905 3.046   64.632  1.00 94.83  ? 98   ASP C CA    1 
ATOM   3951  C  C     . ASP C 2  98   ? -14.451 1.828   65.378  1.00 103.75 ? 98   ASP C C     1 
ATOM   3952  O  O     . ASP C 2  98   ? -15.666 1.662   65.495  1.00 106.08 ? 98   ASP C O     1 
ATOM   3953  C  CB    . ASP C 2  98   ? -12.879 3.787   65.490  1.00 95.70  ? 98   ASP C CB    1 
ATOM   3954  C  CG    . ASP C 2  98   ? -13.491 4.389   66.740  1.00 101.60 ? 98   ASP C CG    1 
ATOM   3955  O  OD1   . ASP C 2  98   ? -14.666 4.808   66.686  1.00 102.58 ? 98   ASP C OD1   1 
ATOM   3956  O  OD2   . ASP C 2  98   ? -12.799 4.444   67.778  1.00 100.58 ? 98   ASP C OD2   1 
ATOM   3957  N  N     . PHE C 2  99   ? -13.558 0.980   65.881  1.00 107.64 ? 99   PHE C N     1 
ATOM   3958  C  CA    . PHE C 2  99   ? -13.964 -0.237  66.584  1.00 107.60 ? 99   PHE C CA    1 
ATOM   3959  C  C     . PHE C 2  99   ? -14.690 0.095   67.884  1.00 102.14 ? 99   PHE C C     1 
ATOM   3960  O  O     . PHE C 2  99   ? -15.570 -0.645  68.327  1.00 96.42  ? 99   PHE C O     1 
ATOM   3961  C  CB    . PHE C 2  99   ? -12.748 -1.126  66.867  1.00 113.57 ? 99   PHE C CB    1 
ATOM   3962  C  CG    . PHE C 2  99   ? -13.081 -2.405  67.587  1.00 118.09 ? 99   PHE C CG    1 
ATOM   3963  C  CD1   . PHE C 2  99   ? -13.772 -3.420  66.943  1.00 119.69 ? 99   PHE C CD1   1 
ATOM   3964  C  CD2   . PHE C 2  99   ? -12.693 -2.598  68.903  1.00 114.82 ? 99   PHE C CD2   1 
ATOM   3965  C  CE1   . PHE C 2  99   ? -14.077 -4.599  67.601  1.00 111.48 ? 99   PHE C CE1   1 
ATOM   3966  C  CE2   . PHE C 2  99   ? -12.994 -3.775  69.566  1.00 110.22 ? 99   PHE C CE2   1 
ATOM   3967  C  CZ    . PHE C 2  99   ? -13.687 -4.776  68.914  1.00 109.18 ? 99   PHE C CZ    1 
ATOM   3968  N  N     . SER C 2  100  ? -14.316 1.221   68.482  1.00 100.97 ? 100  SER C N     1 
ATOM   3969  C  CA    . SER C 2  100  ? -14.936 1.694   69.711  1.00 98.29  ? 100  SER C CA    1 
ATOM   3970  C  C     . SER C 2  100  ? -16.397 2.072   69.489  1.00 100.54 ? 100  SER C C     1 
ATOM   3971  O  O     . SER C 2  100  ? -17.277 1.682   70.256  1.00 103.35 ? 100  SER C O     1 
ATOM   3972  C  CB    . SER C 2  100  ? -14.171 2.899   70.262  1.00 98.58  ? 100  SER C CB    1 
ATOM   3973  O  OG    . SER C 2  100  ? -12.771 2.692   70.193  1.00 99.61  ? 100  SER C OG    1 
ATOM   3974  N  N     . GLY C 2  101  ? -16.645 2.827   68.425  1.00 105.83 ? 101  GLY C N     1 
ATOM   3975  C  CA    . GLY C 2  101  ? -17.952 3.411   68.190  1.00 104.74 ? 101  GLY C CA    1 
ATOM   3976  C  C     . GLY C 2  101  ? -17.946 4.816   68.753  1.00 102.67 ? 101  GLY C C     1 
ATOM   3977  O  O     . GLY C 2  101  ? -18.941 5.535   68.689  1.00 97.87  ? 101  GLY C O     1 
ATOM   3978  N  N     . SER C 2  102  ? -16.798 5.194   69.310  1.00 104.16 ? 102  SER C N     1 
ATOM   3979  C  CA    . SER C 2  102  ? -16.597 6.506   69.910  1.00 105.95 ? 102  SER C CA    1 
ATOM   3980  C  C     . SER C 2  102  ? -16.743 7.620   68.880  1.00 102.41 ? 102  SER C C     1 
ATOM   3981  O  O     . SER C 2  102  ? -17.465 8.592   69.099  1.00 106.26 ? 102  SER C O     1 
ATOM   3982  C  CB    . SER C 2  102  ? -15.216 6.576   70.569  1.00 102.93 ? 102  SER C CB    1 
ATOM   3983  O  OG    . SER C 2  102  ? -14.902 7.898   70.972  1.00 108.86 ? 102  SER C OG    1 
ATOM   3984  N  N     . MET C 2  103  ? -16.060 7.468   67.753  1.00 96.20  ? 103  MET C N     1 
ATOM   3985  C  CA    . MET C 2  103  ? -16.094 8.475   66.704  1.00 96.75  ? 103  MET C CA    1 
ATOM   3986  C  C     . MET C 2  103  ? -16.973 8.043   65.533  1.00 102.03 ? 103  MET C C     1 
ATOM   3987  O  O     . MET C 2  103  ? -17.128 6.851   65.267  1.00 101.51 ? 103  MET C O     1 
ATOM   3988  C  CB    . MET C 2  103  ? -14.675 8.769   66.225  1.00 91.75  ? 103  MET C CB    1 
ATOM   3989  C  CG    . MET C 2  103  ? -13.750 9.242   67.329  1.00 83.13  ? 103  MET C CG    1 
ATOM   3990  S  SD    . MET C 2  103  ? -12.020 9.174   66.846  1.00 83.47  ? 103  MET C SD    1 
ATOM   3991  C  CE    . MET C 2  103  ? -11.748 7.406   66.814  1.00 89.21  ? 103  MET C CE    1 
ATOM   3992  N  N     . SER C 2  104  ? -17.548 9.021   64.838  1.00 102.91 ? 104  SER C N     1 
ATOM   3993  C  CA    . SER C 2  104  ? -18.396 8.742   63.683  1.00 103.71 ? 104  SER C CA    1 
ATOM   3994  C  C     . SER C 2  104  ? -18.334 9.869   62.652  1.00 101.93 ? 104  SER C C     1 
ATOM   3995  O  O     . SER C 2  104  ? -18.693 11.012  62.941  1.00 99.18  ? 104  SER C O     1 
ATOM   3996  C  CB    . SER C 2  104  ? -19.844 8.512   64.127  1.00 108.68 ? 104  SER C CB    1 
ATOM   3997  O  OG    . SER C 2  104  ? -20.672 8.151   63.033  1.00 106.67 ? 104  SER C OG    1 
ATOM   3998  N  N     . LEU C 2  105  ? -17.871 9.537   61.450  1.00 95.36  ? 105  LEU C N     1 
ATOM   3999  C  CA    . LEU C 2  105  ? -17.825 10.494  60.350  1.00 88.12  ? 105  LEU C CA    1 
ATOM   4000  C  C     . LEU C 2  105  ? -18.842 10.109  59.277  1.00 87.35  ? 105  LEU C C     1 
ATOM   4001  O  O     . LEU C 2  105  ? -18.907 8.954   58.854  1.00 84.69  ? 105  LEU C O     1 
ATOM   4002  C  CB    . LEU C 2  105  ? -16.414 10.568  59.758  1.00 82.05  ? 105  LEU C CB    1 
ATOM   4003  C  CG    . LEU C 2  105  ? -16.157 11.656  58.709  1.00 79.30  ? 105  LEU C CG    1 
ATOM   4004  C  CD1   . LEU C 2  105  ? -16.425 13.046  59.274  1.00 77.69  ? 105  LEU C CD1   1 
ATOM   4005  C  CD2   . LEU C 2  105  ? -14.737 11.559  58.164  1.00 74.52  ? 105  LEU C CD2   1 
ATOM   4006  N  N     . SER C 2  106  ? -19.640 11.081  58.845  1.00 82.35  ? 106  SER C N     1 
ATOM   4007  C  CA    . SER C 2  106  ? -20.697 10.822  57.873  1.00 76.79  ? 106  SER C CA    1 
ATOM   4008  C  C     . SER C 2  106  ? -20.798 11.930  56.829  1.00 69.89  ? 106  SER C C     1 
ATOM   4009  O  O     . SER C 2  106  ? -20.539 13.099  57.120  1.00 76.20  ? 106  SER C O     1 
ATOM   4010  C  CB    . SER C 2  106  ? -22.037 10.651  58.589  1.00 79.88  ? 106  SER C CB    1 
ATOM   4011  O  OG    . SER C 2  106  ? -22.230 11.675  59.549  1.00 86.45  ? 106  SER C OG    1 
ATOM   4012  N  N     . PHE C 2  107  ? -21.185 11.552  55.615  1.00 63.87  ? 107  PHE C N     1 
ATOM   4013  C  CA    . PHE C 2  107  ? -21.256 12.488  54.499  1.00 59.58  ? 107  PHE C CA    1 
ATOM   4014  C  C     . PHE C 2  107  ? -22.667 12.601  53.946  1.00 60.38  ? 107  PHE C C     1 
ATOM   4015  O  O     . PHE C 2  107  ? -23.437 11.643  53.992  1.00 68.57  ? 107  PHE C O     1 
ATOM   4016  C  CB    . PHE C 2  107  ? -20.306 12.058  53.383  1.00 58.10  ? 107  PHE C CB    1 
ATOM   4017  C  CG    . PHE C 2  107  ? -18.905 11.809  53.848  1.00 58.51  ? 107  PHE C CG    1 
ATOM   4018  C  CD1   . PHE C 2  107  ? -18.009 12.855  53.969  1.00 64.22  ? 107  PHE C CD1   1 
ATOM   4019  C  CD2   . PHE C 2  107  ? -18.483 10.530  54.165  1.00 56.30  ? 107  PHE C CD2   1 
ATOM   4020  C  CE1   . PHE C 2  107  ? -16.719 12.632  54.399  1.00 64.03  ? 107  PHE C CE1   1 
ATOM   4021  C  CE2   . PHE C 2  107  ? -17.193 10.301  54.595  1.00 55.64  ? 107  PHE C CE2   1 
ATOM   4022  C  CZ    . PHE C 2  107  ? -16.309 11.353  54.712  1.00 59.81  ? 107  PHE C CZ    1 
ATOM   4023  N  N     . SER C 2  108  ? -22.996 13.772  53.412  1.00 56.49  ? 108  SER C N     1 
ATOM   4024  C  CA    . SER C 2  108  ? -24.295 13.989  52.789  1.00 58.37  ? 108  SER C CA    1 
ATOM   4025  C  C     . SER C 2  108  ? -24.308 15.268  51.962  1.00 54.96  ? 108  SER C C     1 
ATOM   4026  O  O     . SER C 2  108  ? -23.426 16.115  52.099  1.00 54.58  ? 108  SER C O     1 
ATOM   4027  C  CB    . SER C 2  108  ? -25.398 14.042  53.848  1.00 70.36  ? 108  SER C CB    1 
ATOM   4028  O  OG    . SER C 2  108  ? -25.114 15.027  54.827  1.00 80.66  ? 108  SER C OG    1 
ATOM   4029  N  N     . ASP C 2  109  ? -25.316 15.384  51.102  1.00 54.11  ? 109  ASP C N     1 
ATOM   4030  C  CA    . ASP C 2  109  ? -25.527 16.561  50.262  1.00 58.03  ? 109  ASP C CA    1 
ATOM   4031  C  C     . ASP C 2  109  ? -24.325 16.903  49.384  1.00 52.89  ? 109  ASP C C     1 
ATOM   4032  O  O     . ASP C 2  109  ? -23.578 17.833  49.687  1.00 57.79  ? 109  ASP C O     1 
ATOM   4033  C  CB    . ASP C 2  109  ? -25.884 17.776  51.125  1.00 68.81  ? 109  ASP C CB    1 
ATOM   4034  C  CG    . ASP C 2  109  ? -26.455 18.924  50.309  1.00 72.75  ? 109  ASP C CG    1 
ATOM   4035  O  OD1   . ASP C 2  109  ? -26.017 20.078  50.507  1.00 75.79  ? 109  ASP C OD1   1 
ATOM   4036  O  OD2   . ASP C 2  109  ? -27.349 18.672  49.473  1.00 67.68  ? 109  ASP C OD2   1 
ATOM   4037  N  N     . PRO C 2  110  ? -24.136 16.152  48.288  1.00 48.85  ? 110  PRO C N     1 
ATOM   4038  C  CA    . PRO C 2  110  ? -23.096 16.503  47.320  1.00 42.46  ? 110  PRO C CA    1 
ATOM   4039  C  C     . PRO C 2  110  ? -23.576 17.607  46.383  1.00 41.23  ? 110  PRO C C     1 
ATOM   4040  O  O     . PRO C 2  110  ? -24.762 17.650  46.065  1.00 46.50  ? 110  PRO C O     1 
ATOM   4041  C  CB    . PRO C 2  110  ? -22.875 15.194  46.567  1.00 37.01  ? 110  PRO C CB    1 
ATOM   4042  C  CG    . PRO C 2  110  ? -24.217 14.546  46.586  1.00 41.09  ? 110  PRO C CG    1 
ATOM   4043  C  CD    . PRO C 2  110  ? -24.843 14.915  47.910  1.00 46.34  ? 110  PRO C CD    1 
ATOM   4044  N  N     . ARG C 2  111  ? -22.679 18.486  45.950  1.00 38.72  ? 111  ARG C N     1 
ATOM   4045  C  CA    . ARG C 2  111  ? -23.066 19.586  45.071  1.00 36.13  ? 111  ARG C CA    1 
ATOM   4046  C  C     . ARG C 2  111  ? -21.887 20.112  44.257  1.00 36.04  ? 111  ARG C C     1 
ATOM   4047  O  O     . ARG C 2  111  ? -20.735 19.984  44.665  1.00 41.60  ? 111  ARG C O     1 
ATOM   4048  C  CB    . ARG C 2  111  ? -23.688 20.716  45.889  1.00 45.16  ? 111  ARG C CB    1 
ATOM   4049  C  CG    . ARG C 2  111  ? -22.865 21.124  47.096  1.00 52.64  ? 111  ARG C CG    1 
ATOM   4050  C  CD    . ARG C 2  111  ? -23.662 22.011  48.037  1.00 62.64  ? 111  ARG C CD    1 
ATOM   4051  N  NE    . ARG C 2  111  ? -22.871 22.416  49.196  1.00 71.73  ? 111  ARG C NE    1 
ATOM   4052  C  CZ    . ARG C 2  111  ? -22.742 21.692  50.303  1.00 67.42  ? 111  ARG C CZ    1 
ATOM   4053  N  NH1   . ARG C 2  111  ? -23.352 20.519  50.408  1.00 69.55  ? 111  ARG C NH1   1 
ATOM   4054  N  NH2   . ARG C 2  111  ? -22.002 22.140  51.308  1.00 71.90  ? 111  ARG C NH2   1 
ATOM   4055  N  N     . PHE C 2  112  ? -22.184 20.710  43.107  1.00 34.75  ? 112  PHE C N     1 
ATOM   4056  C  CA    . PHE C 2  112  ? -21.145 21.195  42.204  1.00 31.48  ? 112  PHE C CA    1 
ATOM   4057  C  C     . PHE C 2  112  ? -21.161 22.710  42.053  1.00 35.21  ? 112  PHE C C     1 
ATOM   4058  O  O     . PHE C 2  112  ? -22.202 23.346  42.198  1.00 37.46  ? 112  PHE C O     1 
ATOM   4059  C  CB    . PHE C 2  112  ? -21.300 20.555  40.823  1.00 32.00  ? 112  PHE C CB    1 
ATOM   4060  C  CG    . PHE C 2  112  ? -21.201 19.060  40.830  1.00 32.25  ? 112  PHE C CG    1 
ATOM   4061  C  CD1   . PHE C 2  112  ? -19.970 18.435  40.733  1.00 36.07  ? 112  PHE C CD1   1 
ATOM   4062  C  CD2   . PHE C 2  112  ? -22.338 18.277  40.925  1.00 33.87  ? 112  PHE C CD2   1 
ATOM   4063  C  CE1   . PHE C 2  112  ? -19.875 17.055  40.737  1.00 38.98  ? 112  PHE C CE1   1 
ATOM   4064  C  CE2   . PHE C 2  112  ? -22.250 16.899  40.929  1.00 32.19  ? 112  PHE C CE2   1 
ATOM   4065  C  CZ    . PHE C 2  112  ? -21.018 16.287  40.836  1.00 35.23  ? 112  PHE C CZ    1 
ATOM   4066  N  N     . ASP C 2  113  ? -20.001 23.284  41.757  1.00 36.53  ? 113  ASP C N     1 
ATOM   4067  C  CA    . ASP C 2  113  ? -19.934 24.679  41.345  1.00 40.88  ? 113  ASP C CA    1 
ATOM   4068  C  C     . ASP C 2  113  ? -20.027 24.762  39.830  1.00 41.95  ? 113  ASP C C     1 
ATOM   4069  O  O     . ASP C 2  113  ? -20.251 23.756  39.160  1.00 45.23  ? 113  ASP C O     1 
ATOM   4070  C  CB    . ASP C 2  113  ? -18.647 25.342  41.828  1.00 43.49  ? 113  ASP C CB    1 
ATOM   4071  C  CG    . ASP C 2  113  ? -18.813 26.024  43.166  1.00 54.04  ? 113  ASP C CG    1 
ATOM   4072  O  OD1   . ASP C 2  113  ? -19.969 26.242  43.586  1.00 64.92  ? 113  ASP C OD1   1 
ATOM   4073  O  OD2   . ASP C 2  113  ? -17.785 26.354  43.794  1.00 60.21  ? 113  ASP C OD2   1 
ATOM   4074  N  N     . ASP C 2  114  ? -19.863 25.959  39.285  1.00 43.04  ? 114  ASP C N     1 
ATOM   4075  C  CA    . ASP C 2  114  ? -19.811 26.105  37.840  1.00 48.00  ? 114  ASP C CA    1 
ATOM   4076  C  C     . ASP C 2  114  ? -18.521 25.497  37.323  1.00 38.98  ? 114  ASP C C     1 
ATOM   4077  O  O     . ASP C 2  114  ? -17.548 25.368  38.062  1.00 35.88  ? 114  ASP C O     1 
ATOM   4078  C  CB    . ASP C 2  114  ? -19.911 27.573  37.429  1.00 57.86  ? 114  ASP C CB    1 
ATOM   4079  C  CG    . ASP C 2  114  ? -21.247 28.186  37.782  1.00 63.04  ? 114  ASP C CG    1 
ATOM   4080  O  OD1   . ASP C 2  114  ? -22.251 27.444  37.807  1.00 68.64  ? 114  ASP C OD1   1 
ATOM   4081  O  OD2   . ASP C 2  114  ? -21.293 29.408  38.034  1.00 71.26  ? 114  ASP C OD2   1 
ATOM   4082  N  N     . VAL C 2  115  ? -18.520 25.120  36.051  1.00 32.36  ? 115  VAL C N     1 
ATOM   4083  C  CA    . VAL C 2  115  ? -17.330 24.571  35.422  1.00 32.05  ? 115  VAL C CA    1 
ATOM   4084  C  C     . VAL C 2  115  ? -16.211 25.610  35.392  1.00 37.59  ? 115  VAL C C     1 
ATOM   4085  O  O     . VAL C 2  115  ? -16.437 26.776  35.060  1.00 39.19  ? 115  VAL C O     1 
ATOM   4086  C  CB    . VAL C 2  115  ? -17.630 24.086  33.999  1.00 33.64  ? 115  VAL C CB    1 
ATOM   4087  C  CG1   . VAL C 2  115  ? -16.403 23.436  33.389  1.00 34.86  ? 115  VAL C CG1   1 
ATOM   4088  C  CG2   . VAL C 2  115  ? -18.792 23.111  34.018  1.00 35.11  ? 115  VAL C CG2   1 
ATOM   4089  N  N     . LYS C 2  116  ? -15.005 25.172  35.744  1.00 40.17  ? 116  LYS C N     1 
ATOM   4090  C  CA    . LYS C 2  116  ? -13.852 26.055  35.879  1.00 37.46  ? 116  LYS C CA    1 
ATOM   4091  C  C     . LYS C 2  116  ? -13.477 26.739  34.568  1.00 37.55  ? 116  LYS C C     1 
ATOM   4092  O  O     . LYS C 2  116  ? -12.860 27.803  34.575  1.00 45.08  ? 116  LYS C O     1 
ATOM   4093  C  CB    . LYS C 2  116  ? -12.653 25.269  36.423  1.00 34.37  ? 116  LYS C CB    1 
ATOM   4094  C  CG    . LYS C 2  116  ? -12.936 24.568  37.746  1.00 34.95  ? 116  LYS C CG    1 
ATOM   4095  C  CD    . LYS C 2  116  ? -11.722 23.826  38.276  1.00 38.77  ? 116  LYS C CD    1 
ATOM   4096  C  CE    . LYS C 2  116  ? -10.641 24.789  38.736  1.00 45.41  ? 116  LYS C CE    1 
ATOM   4097  N  NZ    . LYS C 2  116  ? -9.471  24.069  39.314  1.00 56.33  ? 116  LYS C NZ    1 
ATOM   4098  N  N     . ALA C 2  117  ? -13.855 26.134  33.448  1.00 31.34  ? 117  ALA C N     1 
ATOM   4099  C  CA    . ALA C 2  117  ? -13.552 26.710  32.144  1.00 34.41  ? 117  ALA C CA    1 
ATOM   4100  C  C     . ALA C 2  117  ? -14.401 26.076  31.048  1.00 34.93  ? 117  ALA C C     1 
ATOM   4101  O  O     . ALA C 2  117  ? -14.657 24.873  31.078  1.00 35.94  ? 117  ALA C O     1 
ATOM   4102  C  CB    . ALA C 2  117  ? -12.071 26.550  31.827  1.00 41.29  ? 117  ALA C CB    1 
ATOM   4103  N  N     . PRO C 2  118  ? -14.842 26.891  30.074  1.00 36.37  ? 118  PRO C N     1 
ATOM   4104  C  CA    . PRO C 2  118  ? -15.658 26.419  28.953  1.00 30.88  ? 118  PRO C CA    1 
ATOM   4105  C  C     . PRO C 2  118  ? -14.987 25.304  28.164  1.00 35.90  ? 118  PRO C C     1 
ATOM   4106  O  O     . PRO C 2  118  ? -13.776 25.105  28.265  1.00 40.96  ? 118  PRO C O     1 
ATOM   4107  C  CB    . PRO C 2  118  ? -15.817 27.668  28.082  1.00 34.62  ? 118  PRO C CB    1 
ATOM   4108  C  CG    . PRO C 2  118  ? -15.655 28.794  29.017  1.00 40.67  ? 118  PRO C CG    1 
ATOM   4109  C  CD    . PRO C 2  118  ? -14.630 28.347  30.012  1.00 41.71  ? 118  PRO C CD    1 
ATOM   4110  N  N     . VAL C 2  119  ? -15.792 24.591  27.385  1.00 38.48  ? 119  VAL C N     1 
ATOM   4111  C  CA    . VAL C 2  119  ? -15.340 23.478  26.557  1.00 36.92  ? 119  VAL C CA    1 
ATOM   4112  C  C     . VAL C 2  119  ? -14.211 23.842  25.592  1.00 35.35  ? 119  VAL C C     1 
ATOM   4113  O  O     . VAL C 2  119  ? -13.159 23.205  25.588  1.00 33.39  ? 119  VAL C O     1 
ATOM   4114  C  CB    . VAL C 2  119  ? -16.514 22.911  25.742  1.00 39.48  ? 119  VAL C CB    1 
ATOM   4115  C  CG1   . VAL C 2  119  ? -16.017 21.951  24.673  1.00 40.75  ? 119  VAL C CG1   1 
ATOM   4116  C  CG2   . VAL C 2  119  ? -17.525 22.245  26.666  1.00 34.28  ? 119  VAL C CG2   1 
ATOM   4117  N  N     . ASP C 2  120  ? -14.437 24.862  24.771  1.00 33.62  ? 120  ASP C N     1 
ATOM   4118  C  CA    . ASP C 2  120  ? -13.456 25.274  23.772  1.00 33.63  ? 120  ASP C CA    1 
ATOM   4119  C  C     . ASP C 2  120  ? -12.136 25.691  24.402  1.00 34.87  ? 120  ASP C C     1 
ATOM   4120  O  O     . ASP C 2  120  ? -11.081 25.573  23.785  1.00 38.78  ? 120  ASP C O     1 
ATOM   4121  C  CB    . ASP C 2  120  ? -14.000 26.427  22.930  1.00 37.97  ? 120  ASP C CB    1 
ATOM   4122  C  CG    . ASP C 2  120  ? -14.431 27.608  23.775  1.00 51.58  ? 120  ASP C CG    1 
ATOM   4123  O  OD1   . ASP C 2  120  ? -14.915 27.384  24.904  1.00 54.91  ? 120  ASP C OD1   1 
ATOM   4124  O  OD2   . ASP C 2  120  ? -14.285 28.760  23.314  1.00 58.13  ? 120  ASP C OD2   1 
ATOM   4125  N  N     . GLU C 2  121  ? -12.195 26.188  25.630  1.00 39.99  ? 121  GLU C N     1 
ATOM   4126  C  CA    . GLU C 2  121  ? -10.990 26.661  26.289  1.00 39.34  ? 121  GLU C CA    1 
ATOM   4127  C  C     . GLU C 2  121  ? -10.162 25.483  26.764  1.00 31.01  ? 121  GLU C C     1 
ATOM   4128  O  O     . GLU C 2  121  ? -8.934  25.522  26.729  1.00 33.44  ? 121  GLU C O     1 
ATOM   4129  C  CB    . GLU C 2  121  ? -11.333 27.585  27.456  1.00 44.51  ? 121  GLU C CB    1 
ATOM   4130  C  CG    . GLU C 2  121  ? -10.134 28.316  28.021  1.00 52.86  ? 121  GLU C CG    1 
ATOM   4131  C  CD    . GLU C 2  121  ? -10.524 29.348  29.053  1.00 57.75  ? 121  GLU C CD    1 
ATOM   4132  O  OE1   . GLU C 2  121  ? -11.739 29.529  29.280  1.00 49.77  ? 121  GLU C OE1   1 
ATOM   4133  O  OE2   . GLU C 2  121  ? -9.620  29.980  29.638  1.00 71.64  ? 121  GLU C OE2   1 
ATOM   4134  N  N     . CYS C 2  122  ? -10.846 24.430  27.196  1.00 27.83  ? 122  CYS C N     1 
ATOM   4135  C  CA    . CYS C 2  122  ? -10.181 23.211  27.639  1.00 30.98  ? 122  CYS C CA    1 
ATOM   4136  C  C     . CYS C 2  122  ? -9.428  22.520  26.506  1.00 31.44  ? 122  CYS C C     1 
ATOM   4137  O  O     . CYS C 2  122  ? -8.281  22.112  26.683  1.00 33.06  ? 122  CYS C O     1 
ATOM   4138  C  CB    . CYS C 2  122  ? -11.192 22.242  28.253  1.00 33.81  ? 122  CYS C CB    1 
ATOM   4139  S  SG    . CYS C 2  122  ? -11.870 22.781  29.837  1.00 40.48  ? 122  CYS C SG    1 
ATOM   4140  N  N     . LYS C 2  123  ? -10.070 22.375  25.350  1.00 30.86  ? 123  LYS C N     1 
ATOM   4141  C  CA    . LYS C 2  123  ? -9.405  21.760  24.204  1.00 28.32  ? 123  LYS C CA    1 
ATOM   4142  C  C     . LYS C 2  123  ? -8.160  22.555  23.848  1.00 28.96  ? 123  LYS C C     1 
ATOM   4143  O  O     . LYS C 2  123  ? -7.119  21.990  23.519  1.00 33.03  ? 123  LYS C O     1 
ATOM   4144  C  CB    . LYS C 2  123  ? -10.332 21.681  22.990  1.00 30.31  ? 123  LYS C CB    1 
ATOM   4145  C  CG    . LYS C 2  123  ? -11.458 20.667  23.094  1.00 26.87  ? 123  LYS C CG    1 
ATOM   4146  C  CD    . LYS C 2  123  ? -12.321 20.715  21.839  1.00 33.34  ? 123  LYS C CD    1 
ATOM   4147  C  CE    . LYS C 2  123  ? -13.452 19.700  21.876  1.00 33.90  ? 123  LYS C CE    1 
ATOM   4148  N  NZ    . LYS C 2  123  ? -14.294 19.765  20.645  1.00 35.06  ? 123  LYS C NZ    1 
ATOM   4149  N  N     . ASP C 2  124  ? -8.273  23.874  23.932  1.00 31.27  ? 124  ASP C N     1 
ATOM   4150  C  CA    . ASP C 2  124  ? -7.177  24.749  23.556  1.00 33.66  ? 124  ASP C CA    1 
ATOM   4151  C  C     . ASP C 2  124  ? -6.045  24.716  24.573  1.00 34.97  ? 124  ASP C C     1 
ATOM   4152  O  O     . ASP C 2  124  ? -4.874  24.658  24.202  1.00 34.70  ? 124  ASP C O     1 
ATOM   4153  C  CB    . ASP C 2  124  ? -7.672  26.182  23.386  1.00 34.29  ? 124  ASP C CB    1 
ATOM   4154  C  CG    . ASP C 2  124  ? -6.555  27.137  23.031  1.00 40.49  ? 124  ASP C CG    1 
ATOM   4155  O  OD1   . ASP C 2  124  ? -6.291  27.320  21.824  1.00 45.29  ? 124  ASP C OD1   1 
ATOM   4156  O  OD2   . ASP C 2  124  ? -5.936  27.699  23.959  1.00 39.19  ? 124  ASP C OD2   1 
ATOM   4157  N  N     . LYS C 2  125  ? -6.392  24.756  25.854  1.00 35.65  ? 125  LYS C N     1 
ATOM   4158  C  CA    . LYS C 2  125  ? -5.377  24.849  26.897  1.00 37.11  ? 125  LYS C CA    1 
ATOM   4159  C  C     . LYS C 2  125  ? -5.080  23.505  27.566  1.00 37.37  ? 125  LYS C C     1 
ATOM   4160  O  O     . LYS C 2  125  ? -4.627  23.465  28.714  1.00 34.69  ? 125  LYS C O     1 
ATOM   4161  C  CB    . LYS C 2  125  ? -5.798  25.876  27.947  1.00 41.11  ? 125  LYS C CB    1 
ATOM   4162  C  CG    . LYS C 2  125  ? -5.932  27.294  27.397  1.00 45.11  ? 125  LYS C CG    1 
ATOM   4163  C  CD    . LYS C 2  125  ? -6.149  28.297  28.520  1.00 49.02  ? 125  LYS C CD    1 
ATOM   4164  C  CE    . LYS C 2  125  ? -6.178  29.728  28.006  1.00 48.26  ? 125  LYS C CE    1 
ATOM   4165  N  NZ    . LYS C 2  125  ? -6.373  30.707  29.112  1.00 47.52  ? 125  LYS C NZ    1 
ATOM   4166  N  N     . ASP C 2  126  ? -5.330  22.421  26.829  1.00 35.19  ? 126  ASP C N     1 
ATOM   4167  C  CA    . ASP C 2  126  ? -5.007  21.051  27.246  1.00 31.00  ? 126  ASP C CA    1 
ATOM   4168  C  C     . ASP C 2  126  ? -5.319  20.764  28.716  1.00 28.55  ? 126  ASP C C     1 
ATOM   4169  O  O     . ASP C 2  126  ? -4.539  20.113  29.408  1.00 26.63  ? 126  ASP C O     1 
ATOM   4170  C  CB    . ASP C 2  126  ? -3.530  20.747  26.955  1.00 32.37  ? 126  ASP C CB    1 
ATOM   4171  C  CG    . ASP C 2  126  ? -3.308  20.176  25.555  1.00 36.07  ? 126  ASP C CG    1 
ATOM   4172  O  OD1   . ASP C 2  126  ? -4.150  20.420  24.667  1.00 37.16  ? 126  ASP C OD1   1 
ATOM   4173  O  OD2   . ASP C 2  126  ? -2.292  19.478  25.344  1.00 37.37  ? 126  ASP C OD2   1 
ATOM   4174  N  N     . MET C 2  127  ? -6.461  21.261  29.186  1.00 30.75  ? 127  MET C N     1 
ATOM   4175  C  CA    . MET C 2  127  ? -6.912  21.005  30.552  1.00 30.00  ? 127  MET C CA    1 
ATOM   4176  C  C     . MET C 2  127  ? -8.193  20.177  30.543  1.00 27.17  ? 127  MET C C     1 
ATOM   4177  O  O     . MET C 2  127  ? -8.820  20.002  29.498  1.00 27.49  ? 127  MET C O     1 
ATOM   4178  C  CB    . MET C 2  127  ? -7.127  22.318  31.314  1.00 36.24  ? 127  MET C CB    1 
ATOM   4179  C  CG    . MET C 2  127  ? -8.269  23.182  30.797  1.00 38.28  ? 127  MET C CG    1 
ATOM   4180  S  SD    . MET C 2  127  ? -8.366  24.781  31.633  1.00 36.66  ? 127  MET C SD    1 
ATOM   4181  C  CE    . MET C 2  127  ? -8.506  24.267  33.344  1.00 41.05  ? 127  MET C CE    1 
ATOM   4182  N  N     . THR C 2  128  ? -8.574  19.669  31.710  1.00 23.70  ? 128  THR C N     1 
ATOM   4183  C  CA    . THR C 2  128  ? -9.709  18.759  31.810  1.00 23.64  ? 128  THR C CA    1 
ATOM   4184  C  C     . THR C 2  128  ? -11.000 19.476  32.175  1.00 24.93  ? 128  THR C C     1 
ATOM   4185  O  O     . THR C 2  128  ? -11.106 20.106  33.227  1.00 23.83  ? 128  THR C O     1 
ATOM   4186  C  CB    . THR C 2  128  ? -9.451  17.650  32.842  1.00 25.29  ? 128  THR C CB    1 
ATOM   4187  O  OG1   . THR C 2  128  ? -8.387  16.808  32.380  1.00 25.79  ? 128  THR C OG1   1 
ATOM   4188  C  CG2   . THR C 2  128  ? -10.700 16.809  33.037  1.00 23.63  ? 128  THR C CG2   1 
ATOM   4189  N  N     . TYR C 2  129  ? -11.976 19.369  31.282  1.00 29.16  ? 129  TYR C N     1 
ATOM   4190  C  CA    . TYR C 2  129  ? -13.293 19.945  31.488  1.00 29.98  ? 129  TYR C CA    1 
ATOM   4191  C  C     . TYR C 2  129  ? -13.918 19.359  32.743  1.00 26.87  ? 129  TYR C C     1 
ATOM   4192  O  O     . TYR C 2  129  ? -14.332 18.199  32.761  1.00 24.14  ? 129  TYR C O     1 
ATOM   4193  C  CB    . TYR C 2  129  ? -14.169 19.690  30.259  1.00 30.52  ? 129  TYR C CB    1 
ATOM   4194  C  CG    . TYR C 2  129  ? -15.547 20.303  30.306  1.00 31.52  ? 129  TYR C CG    1 
ATOM   4195  C  CD1   . TYR C 2  129  ? -15.734 21.660  30.074  1.00 30.18  ? 129  TYR C CD1   1 
ATOM   4196  C  CD2   . TYR C 2  129  ? -16.668 19.517  30.550  1.00 29.24  ? 129  TYR C CD2   1 
ATOM   4197  C  CE1   . TYR C 2  129  ? -16.996 22.218  30.106  1.00 31.97  ? 129  TYR C CE1   1 
ATOM   4198  C  CE2   . TYR C 2  129  ? -17.932 20.067  30.581  1.00 25.08  ? 129  TYR C CE2   1 
ATOM   4199  C  CZ    . TYR C 2  129  ? -18.090 21.416  30.358  1.00 27.30  ? 129  TYR C CZ    1 
ATOM   4200  O  OH    . TYR C 2  129  ? -19.349 21.962  30.390  1.00 25.74  ? 129  TYR C OH    1 
ATOM   4201  N  N     . ALA C 2  130  ? -13.967 20.164  33.799  1.00 24.02  ? 130  ALA C N     1 
ATOM   4202  C  CA    . ALA C 2  130  ? -14.455 19.676  35.077  1.00 25.08  ? 130  ALA C CA    1 
ATOM   4203  C  C     . ALA C 2  130  ? -15.118 20.762  35.908  1.00 26.74  ? 130  ALA C C     1 
ATOM   4204  O  O     . ALA C 2  130  ? -14.868 21.951  35.720  1.00 28.32  ? 130  ALA C O     1 
ATOM   4205  C  CB    . ALA C 2  130  ? -13.318 19.047  35.857  1.00 26.99  ? 130  ALA C CB    1 
ATOM   4206  N  N     . ALA C 2  131  ? -15.968 20.326  36.831  1.00 28.37  ? 131  ALA C N     1 
ATOM   4207  C  CA    . ALA C 2  131  ? -16.639 21.208  37.774  1.00 34.83  ? 131  ALA C CA    1 
ATOM   4208  C  C     . ALA C 2  131  ? -16.413 20.701  39.197  1.00 37.37  ? 131  ALA C C     1 
ATOM   4209  O  O     . ALA C 2  131  ? -16.700 19.543  39.499  1.00 36.33  ? 131  ALA C O     1 
ATOM   4210  C  CB    . ALA C 2  131  ? -18.121 21.292  37.460  1.00 38.04  ? 131  ALA C CB    1 
ATOM   4211  N  N     . PRO C 2  132  ? -15.900 21.571  40.078  1.00 33.84  ? 132  PRO C N     1 
ATOM   4212  C  CA    . PRO C 2  132  ? -15.505 21.198  41.442  1.00 34.86  ? 132  PRO C CA    1 
ATOM   4213  C  C     . PRO C 2  132  ? -16.660 20.670  42.294  1.00 35.38  ? 132  PRO C C     1 
ATOM   4214  O  O     . PRO C 2  132  ? -17.751 21.241  42.286  1.00 33.10  ? 132  PRO C O     1 
ATOM   4215  C  CB    . PRO C 2  132  ? -14.967 22.510  42.013  1.00 36.87  ? 132  PRO C CB    1 
ATOM   4216  C  CG    . PRO C 2  132  ? -15.664 23.558  41.235  1.00 36.55  ? 132  PRO C CG    1 
ATOM   4217  C  CD    . PRO C 2  132  ? -15.751 23.017  39.848  1.00 33.28  ? 132  PRO C CD    1 
ATOM   4218  N  N     . LEU C 2  133  ? -16.395 19.593  43.030  1.00 34.35  ? 133  LEU C N     1 
ATOM   4219  C  CA    . LEU C 2  133  ? -17.402 18.892  43.828  1.00 39.51  ? 133  LEU C CA    1 
ATOM   4220  C  C     . LEU C 2  133  ? -17.303 19.202  45.326  1.00 43.53  ? 133  LEU C C     1 
ATOM   4221  O  O     . LEU C 2  133  ? -16.214 19.194  45.894  1.00 49.40  ? 133  LEU C O     1 
ATOM   4222  C  CB    . LEU C 2  133  ? -17.268 17.380  43.605  1.00 35.71  ? 133  LEU C CB    1 
ATOM   4223  C  CG    . LEU C 2  133  ? -18.000 16.425  44.552  1.00 34.89  ? 133  LEU C CG    1 
ATOM   4224  C  CD1   . LEU C 2  133  ? -19.505 16.546  44.385  1.00 40.58  ? 133  LEU C CD1   1 
ATOM   4225  C  CD2   . LEU C 2  133  ? -17.547 14.990  44.330  1.00 24.99  ? 133  LEU C CD2   1 
ATOM   4226  N  N     . PHE C 2  134  ? -18.441 19.463  45.965  1.00 43.48  ? 134  PHE C N     1 
ATOM   4227  C  CA    . PHE C 2  134  ? -18.475 19.712  47.408  1.00 42.50  ? 134  PHE C CA    1 
ATOM   4228  C  C     . PHE C 2  134  ? -19.383 18.728  48.139  1.00 45.25  ? 134  PHE C C     1 
ATOM   4229  O  O     . PHE C 2  134  ? -20.363 18.246  47.577  1.00 49.49  ? 134  PHE C O     1 
ATOM   4230  C  CB    . PHE C 2  134  ? -18.952 21.135  47.701  1.00 49.12  ? 134  PHE C CB    1 
ATOM   4231  C  CG    . PHE C 2  134  ? -18.018 22.204  47.220  1.00 48.80  ? 134  PHE C CG    1 
ATOM   4232  C  CD1   . PHE C 2  134  ? -16.657 21.976  47.153  1.00 43.08  ? 134  PHE C CD1   1 
ATOM   4233  C  CD2   . PHE C 2  134  ? -18.506 23.442  46.836  1.00 55.00  ? 134  PHE C CD2   1 
ATOM   4234  C  CE1   . PHE C 2  134  ? -15.799 22.963  46.711  1.00 44.39  ? 134  PHE C CE1   1 
ATOM   4235  C  CE2   . PHE C 2  134  ? -17.652 24.433  46.393  1.00 55.31  ? 134  PHE C CE2   1 
ATOM   4236  C  CZ    . PHE C 2  134  ? -16.297 24.192  46.330  1.00 48.52  ? 134  PHE C CZ    1 
ATOM   4237  N  N     . VAL C 2  135  ? -19.061 18.436  49.396  1.00 46.65  ? 135  VAL C N     1 
ATOM   4238  C  CA    . VAL C 2  135  ? -19.950 17.645  50.246  1.00 50.28  ? 135  VAL C CA    1 
ATOM   4239  C  C     . VAL C 2  135  ? -20.002 18.216  51.657  1.00 62.31  ? 135  VAL C C     1 
ATOM   4240  O  O     . VAL C 2  135  ? -19.190 19.068  52.022  1.00 63.43  ? 135  VAL C O     1 
ATOM   4241  C  CB    . VAL C 2  135  ? -19.521 16.167  50.330  1.00 45.42  ? 135  VAL C CB    1 
ATOM   4242  C  CG1   . VAL C 2  135  ? -19.712 15.471  48.990  1.00 47.92  ? 135  VAL C CG1   1 
ATOM   4243  C  CG2   . VAL C 2  135  ? -18.086 16.053  50.810  1.00 48.23  ? 135  VAL C CG2   1 
ATOM   4244  N  N     . THR C 2  136  ? -20.964 17.747  52.447  1.00 67.51  ? 136  THR C N     1 
ATOM   4245  C  CA    . THR C 2  136  ? -21.102 18.186  53.831  1.00 68.55  ? 136  THR C CA    1 
ATOM   4246  C  C     . THR C 2  136  ? -20.789 17.039  54.782  1.00 63.71  ? 136  THR C C     1 
ATOM   4247  O  O     . THR C 2  136  ? -21.525 16.052  54.850  1.00 60.43  ? 136  THR C O     1 
ATOM   4248  C  CB    . THR C 2  136  ? -22.516 18.725  54.133  1.00 69.71  ? 136  THR C CB    1 
ATOM   4249  O  OG1   . THR C 2  136  ? -22.830 19.799  53.237  1.00 63.18  ? 136  THR C OG1   1 
ATOM   4250  C  CG2   . THR C 2  136  ? -22.592 19.233  55.564  1.00 73.09  ? 136  THR C CG2   1 
ATOM   4251  N  N     . ALA C 2  137  ? -19.691 17.176  55.515  1.00 65.37  ? 137  ALA C N     1 
ATOM   4252  C  CA    . ALA C 2  137  ? -19.236 16.120  56.408  1.00 74.38  ? 137  ALA C CA    1 
ATOM   4253  C  C     . ALA C 2  137  ? -19.298 16.555  57.867  1.00 84.09  ? 137  ALA C C     1 
ATOM   4254  O  O     . ALA C 2  137  ? -18.961 17.694  58.199  1.00 83.08  ? 137  ALA C O     1 
ATOM   4255  C  CB    . ALA C 2  137  ? -17.824 15.698  56.044  1.00 71.91  ? 137  ALA C CB    1 
ATOM   4256  N  N     . GLU C 2  138  ? -19.728 15.643  58.735  1.00 85.98  ? 138  GLU C N     1 
ATOM   4257  C  CA    . GLU C 2  138  ? -19.795 15.925  60.164  1.00 83.78  ? 138  GLU C CA    1 
ATOM   4258  C  C     . GLU C 2  138  ? -19.126 14.833  60.996  1.00 83.48  ? 138  GLU C C     1 
ATOM   4259  O  O     . GLU C 2  138  ? -19.279 13.642  60.720  1.00 81.71  ? 138  GLU C O     1 
ATOM   4260  C  CB    . GLU C 2  138  ? -21.249 16.109  60.610  1.00 85.17  ? 138  GLU C CB    1 
ATOM   4261  C  CG    . GLU C 2  138  ? -22.149 14.901  60.419  1.00 92.55  ? 138  GLU C CG    1 
ATOM   4262  C  CD    . GLU C 2  138  ? -23.585 15.181  60.834  1.00 98.40  ? 138  GLU C CD    1 
ATOM   4263  O  OE1   . GLU C 2  138  ? -23.968 16.370  60.892  1.00 99.04  ? 138  GLU C OE1   1 
ATOM   4264  O  OE2   . GLU C 2  138  ? -24.328 14.214  61.107  1.00 96.15  ? 138  GLU C OE2   1 
ATOM   4265  N  N     . PHE C 2  139  ? -18.377 15.256  62.013  1.00 85.85  ? 139  PHE C N     1 
ATOM   4266  C  CA    . PHE C 2  139  ? -17.697 14.336  62.920  1.00 88.26  ? 139  PHE C CA    1 
ATOM   4267  C  C     . PHE C 2  139  ? -18.512 14.106  64.186  1.00 87.74  ? 139  PHE C C     1 
ATOM   4268  O  O     . PHE C 2  139  ? -18.470 14.909  65.118  1.00 84.16  ? 139  PHE C O     1 
ATOM   4269  C  CB    . PHE C 2  139  ? -16.307 14.862  63.288  1.00 90.01  ? 139  PHE C CB    1 
ATOM   4270  C  CG    . PHE C 2  139  ? -15.607 14.045  64.342  1.00 90.86  ? 139  PHE C CG    1 
ATOM   4271  C  CD1   . PHE C 2  139  ? -15.436 14.539  65.625  1.00 86.83  ? 139  PHE C CD1   1 
ATOM   4272  C  CD2   . PHE C 2  139  ? -15.128 12.780  64.049  1.00 95.29  ? 139  PHE C CD2   1 
ATOM   4273  C  CE1   . PHE C 2  139  ? -14.796 13.789  66.592  1.00 84.01  ? 139  PHE C CE1   1 
ATOM   4274  C  CE2   . PHE C 2  139  ? -14.487 12.026  65.013  1.00 87.77  ? 139  PHE C CE2   1 
ATOM   4275  C  CZ    . PHE C 2  139  ? -14.321 12.532  66.285  1.00 82.14  ? 139  PHE C CZ    1 
ATOM   4276  N  N     . ILE C 2  140  ? -19.252 13.005  64.216  1.00 92.73  ? 140  ILE C N     1 
ATOM   4277  C  CA    . ILE C 2  140  ? -20.084 12.677  65.364  1.00 92.49  ? 140  ILE C CA    1 
ATOM   4278  C  C     . ILE C 2  140  ? -19.268 11.947  66.423  1.00 91.29  ? 140  ILE C C     1 
ATOM   4279  O  O     . ILE C 2  140  ? -18.567 10.984  66.118  1.00 92.35  ? 140  ILE C O     1 
ATOM   4280  C  CB    . ILE C 2  140  ? -21.287 11.807  64.953  1.00 95.82  ? 140  ILE C CB    1 
ATOM   4281  C  CG1   . ILE C 2  140  ? -21.940 12.367  63.686  1.00 93.96  ? 140  ILE C CG1   1 
ATOM   4282  C  CG2   . ILE C 2  140  ? -22.289 11.705  66.095  1.00 94.30  ? 140  ILE C CG2   1 
ATOM   4283  C  CD1   . ILE C 2  140  ? -22.991 11.460  63.082  1.00 92.77  ? 140  ILE C CD1   1 
ATOM   4284  N  N     . ASN C 2  141  ? -19.350 12.413  67.664  1.00 92.74  ? 141  ASN C N     1 
ATOM   4285  C  CA    . ASN C 2  141  ? -18.680 11.739  68.769  1.00 100.87 ? 141  ASN C CA    1 
ATOM   4286  C  C     . ASN C 2  141  ? -19.674 11.351  69.856  1.00 100.52 ? 141  ASN C C     1 
ATOM   4287  O  O     . ASN C 2  141  ? -20.416 12.191  70.358  1.00 104.20 ? 141  ASN C O     1 
ATOM   4288  C  CB    . ASN C 2  141  ? -17.574 12.619  69.352  1.00 99.44  ? 141  ASN C CB    1 
ATOM   4289  C  CG    . ASN C 2  141  ? -16.726 11.885  70.374  1.00 103.49 ? 141  ASN C CG    1 
ATOM   4290  O  OD1   . ASN C 2  141  ? -16.410 12.419  71.436  1.00 105.91 ? 141  ASN C OD1   1 
ATOM   4291  N  ND2   . ASN C 2  141  ? -16.364 10.648  70.060  1.00 108.65 ? 141  ASN C ND2   1 
ATOM   4292  N  N     . ASN C 2  142  ? -19.688 10.072  70.214  1.00 102.76 ? 142  ASN C N     1 
ATOM   4293  C  CA    . ASN C 2  142  ? -20.659 9.566   71.174  1.00 112.31 ? 142  ASN C CA    1 
ATOM   4294  C  C     . ASN C 2  142  ? -20.286 9.886   72.618  1.00 113.51 ? 142  ASN C C     1 
ATOM   4295  O  O     . ASN C 2  142  ? -21.158 10.066  73.467  1.00 116.63 ? 142  ASN C O     1 
ATOM   4296  C  CB    . ASN C 2  142  ? -20.830 8.055   71.006  1.00 108.32 ? 142  ASN C CB    1 
ATOM   4297  C  CG    . ASN C 2  142  ? -21.280 7.671   69.609  1.00 105.85 ? 142  ASN C CG    1 
ATOM   4298  O  OD1   . ASN C 2  142  ? -21.945 8.446   68.922  1.00 108.37 ? 142  ASN C OD1   1 
ATOM   4299  N  ND2   . ASN C 2  142  ? -20.920 6.467   69.182  1.00 104.49 ? 142  ASN C ND2   1 
ATOM   4300  N  N     . ASN C 2  143  ? -18.989 9.959   72.895  1.00 107.27 ? 143  ASN C N     1 
ATOM   4301  C  CA    . ASN C 2  143  ? -18.527 10.191  74.256  1.00 102.37 ? 143  ASN C CA    1 
ATOM   4302  C  C     . ASN C 2  143  ? -18.699 11.640  74.684  1.00 104.75 ? 143  ASN C C     1 
ATOM   4303  O  O     . ASN C 2  143  ? -19.215 11.919  75.766  1.00 104.55 ? 143  ASN C O     1 
ATOM   4304  C  CB    . ASN C 2  143  ? -17.066 9.773   74.398  1.00 105.71 ? 143  ASN C CB    1 
ATOM   4305  C  CG    . ASN C 2  143  ? -16.860 8.299   74.129  1.00 119.41 ? 143  ASN C CG    1 
ATOM   4306  O  OD1   . ASN C 2  143  ? -15.880 7.899   73.502  1.00 126.72 ? 143  ASN C OD1   1 
ATOM   4307  N  ND2   . ASN C 2  143  ? -17.798 7.479   74.592  1.00 115.01 ? 143  ASN C ND2   1 
ATOM   4308  N  N     . THR C 2  144  ? -18.270 12.561  73.829  1.00 112.04 ? 144  THR C N     1 
ATOM   4309  C  CA    . THR C 2  144  ? -18.378 13.985  74.123  1.00 115.96 ? 144  THR C CA    1 
ATOM   4310  C  C     . THR C 2  144  ? -19.742 14.538  73.715  1.00 112.85 ? 144  THR C C     1 
ATOM   4311  O  O     . THR C 2  144  ? -20.146 15.609  74.168  1.00 113.11 ? 144  THR C O     1 
ATOM   4312  C  CB    . THR C 2  144  ? -17.269 14.791  73.420  1.00 118.20 ? 144  THR C CB    1 
ATOM   4313  O  OG1   . THR C 2  144  ? -17.301 14.528  72.012  1.00 120.37 ? 144  THR C OG1   1 
ATOM   4314  C  CG2   . THR C 2  144  ? -15.905 14.403  73.968  1.00 117.46 ? 144  THR C CG2   1 
ATOM   4315  N  N     . GLY C 2  145  ? -20.443 13.808  72.852  1.00 109.01 ? 145  GLY C N     1 
ATOM   4316  C  CA    . GLY C 2  145  ? -21.780 14.190  72.433  1.00 104.60 ? 145  GLY C CA    1 
ATOM   4317  C  C     . GLY C 2  145  ? -21.841 15.396  71.511  1.00 104.22 ? 145  GLY C C     1 
ATOM   4318  O  O     . GLY C 2  145  ? -22.928 15.822  71.116  1.00 97.84  ? 145  GLY C O     1 
ATOM   4319  N  N     . GLU C 2  146  ? -20.680 15.946  71.164  1.00 104.14 ? 146  GLU C N     1 
ATOM   4320  C  CA    . GLU C 2  146  ? -20.614 17.118  70.294  1.00 99.39  ? 146  GLU C CA    1 
ATOM   4321  C  C     . GLU C 2  146  ? -20.465 16.732  68.824  1.00 98.03  ? 146  GLU C C     1 
ATOM   4322  O  O     . GLU C 2  146  ? -19.912 15.681  68.497  1.00 99.59  ? 146  GLU C O     1 
ATOM   4323  C  CB    . GLU C 2  146  ? -19.458 18.028  70.709  1.00 99.34  ? 146  GLU C CB    1 
ATOM   4324  C  CG    . GLU C 2  146  ? -18.093 17.371  70.608  1.00 108.33 ? 146  GLU C CG    1 
ATOM   4325  C  CD    . GLU C 2  146  ? -16.958 18.319  70.940  1.00 115.06 ? 146  GLU C CD    1 
ATOM   4326  O  OE1   . GLU C 2  146  ? -17.210 19.539  71.045  1.00 118.71 ? 146  GLU C OE1   1 
ATOM   4327  O  OE2   . GLU C 2  146  ? -15.813 17.841  71.097  1.00 114.10 ? 146  GLU C OE2   1 
ATOM   4328  N  N     . ILE C 2  147  ? -20.963 17.596  67.945  1.00 93.60  ? 147  ILE C N     1 
ATOM   4329  C  CA    . ILE C 2  147  ? -20.911 17.353  66.508  1.00 93.93  ? 147  ILE C CA    1 
ATOM   4330  C  C     . ILE C 2  147  ? -20.320 18.544  65.766  1.00 85.14  ? 147  ILE C C     1 
ATOM   4331  O  O     . ILE C 2  147  ? -20.832 19.660  65.856  1.00 78.78  ? 147  ILE C O     1 
ATOM   4332  C  CB    . ILE C 2  147  ? -22.311 17.045  65.933  1.00 92.27  ? 147  ILE C CB    1 
ATOM   4333  C  CG1   . ILE C 2  147  ? -22.805 15.682  66.426  1.00 93.10  ? 147  ILE C CG1   1 
ATOM   4334  C  CG2   . ILE C 2  147  ? -22.289 17.076  64.411  1.00 93.19  ? 147  ILE C CG2   1 
ATOM   4335  C  CD1   . ILE C 2  147  ? -24.102 15.226  65.784  1.00 85.35  ? 147  ILE C CD1   1 
ATOM   4336  N  N     . LYS C 2  148  ? -19.239 18.300  65.033  1.00 86.56  ? 148  LYS C N     1 
ATOM   4337  C  CA    . LYS C 2  148  ? -18.627 19.330  64.205  1.00 79.88  ? 148  LYS C CA    1 
ATOM   4338  C  C     . LYS C 2  148  ? -18.884 19.045  62.727  1.00 80.31  ? 148  LYS C C     1 
ATOM   4339  O  O     . LYS C 2  148  ? -18.395 18.056  62.180  1.00 79.73  ? 148  LYS C O     1 
ATOM   4340  C  CB    . LYS C 2  148  ? -17.129 19.419  64.487  1.00 77.35  ? 148  LYS C CB    1 
ATOM   4341  C  CG    . LYS C 2  148  ? -16.801 19.645  65.953  1.00 80.54  ? 148  LYS C CG    1 
ATOM   4342  C  CD    . LYS C 2  148  ? -15.309 19.826  66.165  1.00 86.50  ? 148  LYS C CD    1 
ATOM   4343  C  CE    . LYS C 2  148  ? -14.989 20.084  67.628  1.00 92.05  ? 148  LYS C CE    1 
ATOM   4344  N  NZ    . LYS C 2  148  ? -13.544 20.374  67.845  1.00 102.86 ? 148  LYS C NZ    1 
ATOM   4345  N  N     . SER C 2  149  ? -19.657 19.918  62.088  1.00 76.65  ? 149  SER C N     1 
ATOM   4346  C  CA    . SER C 2  149  ? -20.092 19.700  60.714  1.00 74.05  ? 149  SER C CA    1 
ATOM   4347  C  C     . SER C 2  149  ? -19.634 20.829  59.795  1.00 74.14  ? 149  SER C C     1 
ATOM   4348  O  O     . SER C 2  149  ? -19.876 22.004  60.073  1.00 66.83  ? 149  SER C O     1 
ATOM   4349  C  CB    . SER C 2  149  ? -21.616 19.565  60.659  1.00 79.96  ? 149  SER C CB    1 
ATOM   4350  O  OG    . SER C 2  149  ? -22.044 19.015  59.424  1.00 81.67  ? 149  SER C OG    1 
ATOM   4351  N  N     . GLN C 2  150  ? -18.977 20.468  58.697  1.00 76.85  ? 150  GLN C N     1 
ATOM   4352  C  CA    . GLN C 2  150  ? -18.504 21.461  57.739  1.00 75.34  ? 150  GLN C CA    1 
ATOM   4353  C  C     . GLN C 2  150  ? -18.444 20.921  56.311  1.00 72.42  ? 150  GLN C C     1 
ATOM   4354  O  O     . GLN C 2  150  ? -18.587 19.719  56.075  1.00 75.44  ? 150  GLN C O     1 
ATOM   4355  C  CB    . GLN C 2  150  ? -17.128 21.974  58.152  1.00 73.24  ? 150  GLN C CB    1 
ATOM   4356  C  CG    . GLN C 2  150  ? -16.056 20.910  58.110  1.00 69.77  ? 150  GLN C CG    1 
ATOM   4357  C  CD    . GLN C 2  150  ? -14.804 21.320  58.852  1.00 74.62  ? 150  GLN C CD    1 
ATOM   4358  O  OE1   . GLN C 2  150  ? -14.034 20.476  59.306  1.00 72.22  ? 150  GLN C OE1   1 
ATOM   4359  N  NE2   . GLN C 2  150  ? -14.594 22.624  58.979  1.00 77.44  ? 150  GLN C NE2   1 
ATOM   4360  N  N     . THR C 2  151  ? -18.224 21.828  55.366  1.00 64.73  ? 151  THR C N     1 
ATOM   4361  C  CA    . THR C 2  151  ? -18.172 21.490  53.949  1.00 63.32  ? 151  THR C CA    1 
ATOM   4362  C  C     . THR C 2  151  ? -16.738 21.232  53.500  1.00 70.04  ? 151  THR C C     1 
ATOM   4363  O  O     . THR C 2  151  ? -15.835 22.007  53.816  1.00 73.95  ? 151  THR C O     1 
ATOM   4364  C  CB    . THR C 2  151  ? -18.784 22.613  53.090  1.00 64.01  ? 151  THR C CB    1 
ATOM   4365  O  OG1   . THR C 2  151  ? -20.174 22.756  53.408  1.00 69.49  ? 151  THR C OG1   1 
ATOM   4366  C  CG2   . THR C 2  151  ? -18.639 22.301  51.612  1.00 69.32  ? 151  THR C CG2   1 
ATOM   4367  N  N     . VAL C 2  152  ? -16.529 20.143  52.763  1.00 65.52  ? 152  VAL C N     1 
ATOM   4368  C  CA    . VAL C 2  152  ? -15.189 19.773  52.321  1.00 58.80  ? 152  VAL C CA    1 
ATOM   4369  C  C     . VAL C 2  152  ? -15.066 19.779  50.796  1.00 50.67  ? 152  VAL C C     1 
ATOM   4370  O  O     . VAL C 2  152  ? -16.003 19.417  50.084  1.00 48.91  ? 152  VAL C O     1 
ATOM   4371  C  CB    . VAL C 2  152  ? -14.793 18.381  52.854  1.00 52.23  ? 152  VAL C CB    1 
ATOM   4372  C  CG1   . VAL C 2  152  ? -13.283 18.217  52.834  1.00 53.09  ? 152  VAL C CG1   1 
ATOM   4373  C  CG2   . VAL C 2  152  ? -15.322 18.186  54.265  1.00 59.30  ? 152  VAL C CG2   1 
ATOM   4374  N  N     . PHE C 2  153  ? -13.907 20.203  50.301  1.00 43.71  ? 153  PHE C N     1 
ATOM   4375  C  CA    . PHE C 2  153  ? -13.620 20.154  48.872  1.00 44.98  ? 153  PHE C CA    1 
ATOM   4376  C  C     . PHE C 2  153  ? -13.174 18.745  48.489  1.00 46.43  ? 153  PHE C C     1 
ATOM   4377  O  O     . PHE C 2  153  ? -12.315 18.160  49.144  1.00 50.10  ? 153  PHE C O     1 
ATOM   4378  C  CB    . PHE C 2  153  ? -12.553 21.188  48.499  1.00 48.36  ? 153  PHE C CB    1 
ATOM   4379  C  CG    . PHE C 2  153  ? -12.158 21.166  47.046  1.00 49.13  ? 153  PHE C CG    1 
ATOM   4380  C  CD1   . PHE C 2  153  ? -13.117 21.128  46.051  1.00 46.29  ? 153  PHE C CD1   1 
ATOM   4381  C  CD2   . PHE C 2  153  ? -10.823 21.207  46.678  1.00 57.47  ? 153  PHE C CD2   1 
ATOM   4382  C  CE1   . PHE C 2  153  ? -12.754 21.114  44.717  1.00 45.89  ? 153  PHE C CE1   1 
ATOM   4383  C  CE2   . PHE C 2  153  ? -10.454 21.194  45.346  1.00 52.20  ? 153  PHE C CE2   1 
ATOM   4384  C  CZ    . PHE C 2  153  ? -11.422 21.151  44.365  1.00 43.71  ? 153  PHE C CZ    1 
ATOM   4385  N  N     . MET C 2  154  ? -13.766 18.201  47.432  1.00 45.40  ? 154  MET C N     1 
ATOM   4386  C  CA    . MET C 2  154  ? -13.511 16.814  47.051  1.00 41.95  ? 154  MET C CA    1 
ATOM   4387  C  C     . MET C 2  154  ? -12.722 16.674  45.755  1.00 44.41  ? 154  MET C C     1 
ATOM   4388  O  O     . MET C 2  154  ? -12.387 15.563  45.349  1.00 47.09  ? 154  MET C O     1 
ATOM   4389  C  CB    . MET C 2  154  ? -14.830 16.055  46.921  1.00 45.16  ? 154  MET C CB    1 
ATOM   4390  C  CG    . MET C 2  154  ? -15.619 15.984  48.208  1.00 45.98  ? 154  MET C CG    1 
ATOM   4391  S  SD    . MET C 2  154  ? -14.710 15.169  49.535  1.00 65.10  ? 154  MET C SD    1 
ATOM   4392  C  CE    . MET C 2  154  ? -14.511 13.514  48.872  1.00 44.98  ? 154  MET C CE    1 
ATOM   4393  N  N     . GLY C 2  155  ? -12.437 17.794  45.101  1.00 47.20  ? 155  GLY C N     1 
ATOM   4394  C  CA    . GLY C 2  155  ? -11.657 17.770  43.877  1.00 44.95  ? 155  GLY C CA    1 
ATOM   4395  C  C     . GLY C 2  155  ? -12.452 18.144  42.641  1.00 42.78  ? 155  GLY C C     1 
ATOM   4396  O  O     . GLY C 2  155  ? -13.682 18.184  42.668  1.00 43.27  ? 155  GLY C O     1 
ATOM   4397  N  N     . ASP C 2  156  ? -11.744 18.418  41.550  1.00 41.38  ? 156  ASP C N     1 
ATOM   4398  C  CA    . ASP C 2  156  ? -12.390 18.775  40.291  1.00 40.61  ? 156  ASP C CA    1 
ATOM   4399  C  C     . ASP C 2  156  ? -12.932 17.542  39.580  1.00 38.62  ? 156  ASP C C     1 
ATOM   4400  O  O     . ASP C 2  156  ? -12.221 16.557  39.375  1.00 36.56  ? 156  ASP C O     1 
ATOM   4401  C  CB    . ASP C 2  156  ? -11.420 19.529  39.387  1.00 40.18  ? 156  ASP C CB    1 
ATOM   4402  C  CG    . ASP C 2  156  ? -10.998 20.857  39.978  1.00 47.88  ? 156  ASP C CG    1 
ATOM   4403  O  OD1   . ASP C 2  156  ? -11.810 21.471  40.706  1.00 45.86  ? 156  ASP C OD1   1 
ATOM   4404  O  OD2   . ASP C 2  156  ? -9.855  21.285  39.720  1.00 59.64  ? 156  ASP C OD2   1 
ATOM   4405  N  N     . PHE C 2  157  ? -14.202 17.621  39.200  1.00 36.23  ? 157  PHE C N     1 
ATOM   4406  C  CA    . PHE C 2  157  ? -14.949 16.471  38.711  1.00 27.52  ? 157  PHE C CA    1 
ATOM   4407  C  C     . PHE C 2  157  ? -15.256 16.577  37.223  1.00 23.23  ? 157  PHE C C     1 
ATOM   4408  O  O     . PHE C 2  157  ? -16.002 17.462  36.806  1.00 21.59  ? 157  PHE C O     1 
ATOM   4409  C  CB    . PHE C 2  157  ? -16.248 16.335  39.501  1.00 24.27  ? 157  PHE C CB    1 
ATOM   4410  C  CG    . PHE C 2  157  ? -16.997 15.075  39.224  1.00 18.35  ? 157  PHE C CG    1 
ATOM   4411  C  CD1   . PHE C 2  157  ? -17.834 14.975  38.129  1.00 20.76  ? 157  PHE C CD1   1 
ATOM   4412  C  CD2   . PHE C 2  157  ? -16.875 13.993  40.071  1.00 19.55  ? 157  PHE C CD2   1 
ATOM   4413  C  CE1   . PHE C 2  157  ? -18.526 13.815  37.878  1.00 22.89  ? 157  PHE C CE1   1 
ATOM   4414  C  CE2   . PHE C 2  157  ? -17.566 12.833  39.828  1.00 23.39  ? 157  PHE C CE2   1 
ATOM   4415  C  CZ    . PHE C 2  157  ? -18.393 12.742  38.730  1.00 21.32  ? 157  PHE C CZ    1 
ATOM   4416  N  N     . PRO C 2  158  ? -14.694 15.661  36.422  1.00 21.70  ? 158  PRO C N     1 
ATOM   4417  C  CA    . PRO C 2  158  ? -14.900 15.618  34.971  1.00 19.83  ? 158  PRO C CA    1 
ATOM   4418  C  C     . PRO C 2  158  ? -16.372 15.576  34.583  1.00 20.17  ? 158  PRO C C     1 
ATOM   4419  O  O     . PRO C 2  158  ? -17.064 14.610  34.899  1.00 22.00  ? 158  PRO C O     1 
ATOM   4420  C  CB    . PRO C 2  158  ? -14.200 14.322  34.559  1.00 18.32  ? 158  PRO C CB    1 
ATOM   4421  C  CG    . PRO C 2  158  ? -13.159 14.124  35.589  1.00 18.89  ? 158  PRO C CG    1 
ATOM   4422  C  CD    . PRO C 2  158  ? -13.777 14.601  36.872  1.00 22.92  ? 158  PRO C CD    1 
ATOM   4423  N  N     . MET C 2  159  ? -16.840 16.618  33.904  1.00 20.93  ? 159  MET C N     1 
ATOM   4424  C  CA    . MET C 2  159  ? -18.226 16.680  33.457  1.00 24.29  ? 159  MET C CA    1 
ATOM   4425  C  C     . MET C 2  159  ? -18.360 16.237  32.005  1.00 23.60  ? 159  MET C C     1 
ATOM   4426  O  O     . MET C 2  159  ? -17.435 16.408  31.206  1.00 22.53  ? 159  MET C O     1 
ATOM   4427  C  CB    . MET C 2  159  ? -18.782 18.097  33.631  1.00 29.55  ? 159  MET C CB    1 
ATOM   4428  C  CG    . MET C 2  159  ? -18.837 18.566  35.078  1.00 28.78  ? 159  MET C CG    1 
ATOM   4429  S  SD    . MET C 2  159  ? -20.208 17.834  35.983  1.00 25.22  ? 159  MET C SD    1 
ATOM   4430  C  CE    . MET C 2  159  ? -21.585 18.530  35.083  1.00 26.61  ? 159  MET C CE    1 
ATOM   4431  N  N     . MET C 2  160  ? -19.516 15.665  31.679  1.00 21.90  ? 160  MET C N     1 
ATOM   4432  C  CA    . MET C 2  160  ? -19.804 15.209  30.325  1.00 18.62  ? 160  MET C CA    1 
ATOM   4433  C  C     . MET C 2  160  ? -20.455 16.307  29.498  1.00 19.49  ? 160  MET C C     1 
ATOM   4434  O  O     . MET C 2  160  ? -21.417 16.942  29.934  1.00 20.10  ? 160  MET C O     1 
ATOM   4435  C  CB    . MET C 2  160  ? -20.713 13.983  30.341  1.00 15.93  ? 160  MET C CB    1 
ATOM   4436  C  CG    . MET C 2  160  ? -21.229 13.619  28.962  1.00 15.75  ? 160  MET C CG    1 
ATOM   4437  S  SD    . MET C 2  160  ? -22.382 12.239  28.946  1.00 20.52  ? 160  MET C SD    1 
ATOM   4438  C  CE    . MET C 2  160  ? -21.327 10.908  29.512  1.00 26.16  ? 160  MET C CE    1 
ATOM   4439  N  N     . THR C 2  161  ? -19.931 16.514  28.296  1.00 17.96  ? 161  THR C N     1 
ATOM   4440  C  CA    . THR C 2  161  ? -20.406 17.565  27.410  1.00 19.97  ? 161  THR C CA    1 
ATOM   4441  C  C     . THR C 2  161  ? -21.846 17.350  26.965  1.00 24.38  ? 161  THR C C     1 
ATOM   4442  O  O     . THR C 2  161  ? -22.473 16.347  27.306  1.00 24.99  ? 161  THR C O     1 
ATOM   4443  C  CB    . THR C 2  161  ? -19.529 17.662  26.158  1.00 17.61  ? 161  THR C CB    1 
ATOM   4444  O  OG1   . THR C 2  161  ? -19.662 16.458  25.395  1.00 17.68  ? 161  THR C OG1   1 
ATOM   4445  C  CG2   . THR C 2  161  ? -18.078 17.849  26.546  1.00 17.11  ? 161  THR C CG2   1 
ATOM   4446  N  N     . GLU C 2  162  ? -22.367 18.303  26.199  1.00 28.46  ? 162  GLU C N     1 
ATOM   4447  C  CA    . GLU C 2  162  ? -23.667 18.136  25.567  1.00 35.44  ? 162  GLU C CA    1 
ATOM   4448  C  C     . GLU C 2  162  ? -23.573 17.050  24.509  1.00 30.82  ? 162  GLU C C     1 
ATOM   4449  O  O     . GLU C 2  162  ? -24.519 16.295  24.287  1.00 30.85  ? 162  GLU C O     1 
ATOM   4450  C  CB    . GLU C 2  162  ? -24.148 19.440  24.935  1.00 43.23  ? 162  GLU C CB    1 
ATOM   4451  C  CG    . GLU C 2  162  ? -24.526 20.516  25.926  1.00 57.29  ? 162  GLU C CG    1 
ATOM   4452  C  CD    . GLU C 2  162  ? -25.132 21.724  25.245  1.00 85.04  ? 162  GLU C CD    1 
ATOM   4453  O  OE1   . GLU C 2  162  ? -25.317 21.671  24.011  1.00 92.92  ? 162  GLU C OE1   1 
ATOM   4454  O  OE2   . GLU C 2  162  ? -25.424 22.721  25.939  1.00 93.65  ? 162  GLU C OE2   1 
ATOM   4455  N  N     . LYS C 2  163  ? -22.411 16.972  23.870  1.00 23.47  ? 163  LYS C N     1 
ATOM   4456  C  CA    . LYS C 2  163  ? -22.185 16.016  22.800  1.00 22.68  ? 163  LYS C CA    1 
ATOM   4457  C  C     . LYS C 2  163  ? -21.883 14.623  23.339  1.00 17.89  ? 163  LYS C C     1 
ATOM   4458  O  O     . LYS C 2  163  ? -21.480 13.735  22.592  1.00 15.37  ? 163  LYS C O     1 
ATOM   4459  C  CB    . LYS C 2  163  ? -21.047 16.497  21.903  1.00 21.16  ? 163  LYS C CB    1 
ATOM   4460  C  CG    . LYS C 2  163  ? -21.317 17.830  21.241  1.00 22.58  ? 163  LYS C CG    1 
ATOM   4461  C  CD    . LYS C 2  163  ? -20.154 18.242  20.365  1.00 29.54  ? 163  LYS C CD    1 
ATOM   4462  C  CE    . LYS C 2  163  ? -18.895 18.448  21.192  1.00 34.76  ? 163  LYS C CE    1 
ATOM   4463  N  NZ    . LYS C 2  163  ? -17.728 18.791  20.335  1.00 36.64  ? 163  LYS C NZ    1 
ATOM   4464  N  N     . GLY C 2  164  ? -22.077 14.442  24.641  1.00 19.25  ? 164  GLY C N     1 
ATOM   4465  C  CA    . GLY C 2  164  ? -21.927 13.140  25.266  1.00 24.61  ? 164  GLY C CA    1 
ATOM   4466  C  C     . GLY C 2  164  ? -20.490 12.672  25.408  1.00 23.53  ? 164  GLY C C     1 
ATOM   4467  O  O     . GLY C 2  164  ? -20.228 11.492  25.647  1.00 21.91  ? 164  GLY C O     1 
ATOM   4468  N  N     . THR C 2  165  ? -19.550 13.597  25.261  1.00 20.32  ? 165  THR C N     1 
ATOM   4469  C  CA    . THR C 2  165  ? -18.143 13.259  25.396  1.00 16.21  ? 165  THR C CA    1 
ATOM   4470  C  C     . THR C 2  165  ? -17.547 13.895  26.643  1.00 16.39  ? 165  THR C C     1 
ATOM   4471  O  O     . THR C 2  165  ? -18.186 14.714  27.307  1.00 15.69  ? 165  THR C O     1 
ATOM   4472  C  CB    . THR C 2  165  ? -17.328 13.712  24.175  1.00 14.20  ? 165  THR C CB    1 
ATOM   4473  O  OG1   . THR C 2  165  ? -16.929 15.078  24.340  1.00 12.87  ? 165  THR C OG1   1 
ATOM   4474  C  CG2   . THR C 2  165  ? -18.151 13.574  22.906  1.00 15.93  ? 165  THR C CG2   1 
ATOM   4475  N  N     . PHE C 2  166  ? -16.320 13.493  26.957  1.00 16.69  ? 166  PHE C N     1 
ATOM   4476  C  CA    . PHE C 2  166  ? -15.534 14.122  28.009  1.00 14.72  ? 166  PHE C CA    1 
ATOM   4477  C  C     . PHE C 2  166  ? -14.367 14.863  27.391  1.00 11.90  ? 166  PHE C C     1 
ATOM   4478  O  O     . PHE C 2  166  ? -13.989 14.606  26.250  1.00 12.84  ? 166  PHE C O     1 
ATOM   4479  C  CB    . PHE C 2  166  ? -15.006 13.092  29.009  1.00 12.76  ? 166  PHE C CB    1 
ATOM   4480  C  CG    . PHE C 2  166  ? -16.052 12.528  29.917  1.00 12.11  ? 166  PHE C CG    1 
ATOM   4481  C  CD1   . PHE C 2  166  ? -16.481 11.224  29.768  1.00 11.66  ? 166  PHE C CD1   1 
ATOM   4482  C  CD2   . PHE C 2  166  ? -16.596 13.298  30.926  1.00 15.82  ? 166  PHE C CD2   1 
ATOM   4483  C  CE1   . PHE C 2  166  ? -17.436 10.699  30.604  1.00 14.79  ? 166  PHE C CE1   1 
ATOM   4484  C  CE2   . PHE C 2  166  ? -17.550 12.779  31.765  1.00 18.59  ? 166  PHE C CE2   1 
ATOM   4485  C  CZ    . PHE C 2  166  ? -17.972 11.477  31.604  1.00 18.08  ? 166  PHE C CZ    1 
ATOM   4486  N  N     . ILE C 2  167  ? -13.785 15.775  28.152  1.00 11.39  ? 167  ILE C N     1 
ATOM   4487  C  CA    . ILE C 2  167  ? -12.552 16.398  27.723  1.00 15.05  ? 167  ILE C CA    1 
ATOM   4488  C  C     . ILE C 2  167  ? -11.467 16.150  28.750  1.00 22.75  ? 167  ILE C C     1 
ATOM   4489  O  O     . ILE C 2  167  ? -11.465 16.735  29.830  1.00 26.11  ? 167  ILE C O     1 
ATOM   4490  C  CB    . ILE C 2  167  ? -12.715 17.897  27.500  1.00 16.44  ? 167  ILE C CB    1 
ATOM   4491  C  CG1   . ILE C 2  167  ? -13.632 18.145  26.307  1.00 15.23  ? 167  ILE C CG1   1 
ATOM   4492  C  CG2   . ILE C 2  167  ? -11.366 18.538  27.251  1.00 23.68  ? 167  ILE C CG2   1 
ATOM   4493  C  CD1   . ILE C 2  167  ? -13.598 19.564  25.809  1.00 25.64  ? 167  ILE C CD1   1 
ATOM   4494  N  N     . ILE C 2  168  ? -10.550 15.255  28.415  1.00 22.18  ? 168  ILE C N     1 
ATOM   4495  C  CA    . ILE C 2  168  ? -9.423  14.990  29.285  1.00 21.36  ? 168  ILE C CA    1 
ATOM   4496  C  C     . ILE C 2  168  ? -8.168  15.533  28.627  1.00 18.64  ? 168  ILE C C     1 
ATOM   4497  O  O     . ILE C 2  168  ? -7.800  15.122  27.526  1.00 20.87  ? 168  ILE C O     1 
ATOM   4498  C  CB    . ILE C 2  168  ? -9.275  13.486  29.599  1.00 20.71  ? 168  ILE C CB    1 
ATOM   4499  C  CG1   . ILE C 2  168  ? -10.205 13.088  30.749  1.00 16.20  ? 168  ILE C CG1   1 
ATOM   4500  C  CG2   . ILE C 2  168  ? -7.846  13.157  29.992  1.00 21.81  ? 168  ILE C CG2   1 
ATOM   4501  C  CD1   . ILE C 2  168  ? -11.665 13.002  30.378  1.00 15.11  ? 168  ILE C CD1   1 
ATOM   4502  N  N     . ASN C 2  169  ? -7.549  16.495  29.303  1.00 19.78  ? 169  ASN C N     1 
ATOM   4503  C  CA    . ASN C 2  169  ? -6.287  17.081  28.877  1.00 21.90  ? 169  ASN C CA    1 
ATOM   4504  C  C     . ASN C 2  169  ? -6.262  17.512  27.419  1.00 23.49  ? 169  ASN C C     1 
ATOM   4505  O  O     . ASN C 2  169  ? -5.284  17.280  26.714  1.00 27.08  ? 169  ASN C O     1 
ATOM   4506  C  CB    . ASN C 2  169  ? -5.152  16.099  29.135  1.00 22.16  ? 169  ASN C CB    1 
ATOM   4507  C  CG    . ASN C 2  169  ? -5.096  15.654  30.573  1.00 21.51  ? 169  ASN C CG    1 
ATOM   4508  O  OD1   . ASN C 2  169  ? -5.715  16.262  31.448  1.00 20.65  ? 169  ASN C OD1   1 
ATOM   4509  N  ND2   . ASN C 2  169  ? -4.347  14.592  30.832  1.00 26.43  ? 169  ASN C ND2   1 
ATOM   4510  N  N     . GLY C 2  170  ? -7.347  18.128  26.967  1.00 22.85  ? 170  GLY C N     1 
ATOM   4511  C  CA    . GLY C 2  170  ? -7.375  18.720  25.643  1.00 29.92  ? 170  GLY C CA    1 
ATOM   4512  C  C     . GLY C 2  170  ? -7.621  17.732  24.520  1.00 25.95  ? 170  GLY C C     1 
ATOM   4513  O  O     . GLY C 2  170  ? -7.549  18.083  23.340  1.00 32.10  ? 170  GLY C O     1 
ATOM   4514  N  N     . THR C 2  171  ? -7.902  16.487  24.881  1.00 24.27  ? 171  THR C N     1 
ATOM   4515  C  CA    . THR C 2  171  ? -8.292  15.496  23.891  1.00 23.15  ? 171  THR C CA    1 
ATOM   4516  C  C     . THR C 2  171  ? -9.710  15.032  24.187  1.00 20.01  ? 171  THR C C     1 
ATOM   4517  O  O     . THR C 2  171  ? -10.040 14.725  25.331  1.00 20.14  ? 171  THR C O     1 
ATOM   4518  C  CB    . THR C 2  171  ? -7.333  14.290  23.869  1.00 20.30  ? 171  THR C CB    1 
ATOM   4519  O  OG1   . THR C 2  171  ? -7.113  13.821  25.204  1.00 24.17  ? 171  THR C OG1   1 
ATOM   4520  C  CG2   . THR C 2  171  ? -6.000  14.682  23.256  1.00 20.93  ? 171  THR C CG2   1 
ATOM   4521  N  N     . GLU C 2  172  ? -10.553 15.004  23.162  1.00 16.57  ? 172  GLU C N     1 
ATOM   4522  C  CA    . GLU C 2  172  ? -11.936 14.591  23.345  1.00 15.47  ? 172  GLU C CA    1 
ATOM   4523  C  C     . GLU C 2  172  ? -12.001 13.077  23.531  1.00 13.67  ? 172  GLU C C     1 
ATOM   4524  O  O     . GLU C 2  172  ? -11.545 12.323  22.677  1.00 17.59  ? 172  GLU C O     1 
ATOM   4525  C  CB    . GLU C 2  172  ? -12.795 15.041  22.155  1.00 16.20  ? 172  GLU C CB    1 
ATOM   4526  C  CG    . GLU C 2  172  ? -14.297 15.077  22.443  1.00 18.73  ? 172  GLU C CG    1 
ATOM   4527  C  CD    . GLU C 2  172  ? -15.097 15.861  21.409  1.00 17.98  ? 172  GLU C CD    1 
ATOM   4528  O  OE1   . GLU C 2  172  ? -14.502 16.363  20.431  1.00 22.81  ? 172  GLU C OE1   1 
ATOM   4529  O  OE2   . GLU C 2  172  ? -16.329 15.979  21.580  1.00 14.67  ? 172  GLU C OE2   1 
ATOM   4530  N  N     . ARG C 2  173  ? -12.549 12.627  24.655  1.00 12.04  ? 173  ARG C N     1 
ATOM   4531  C  CA    . ARG C 2  173  ? -12.650 11.192  24.899  1.00 12.40  ? 173  ARG C CA    1 
ATOM   4532  C  C     . ARG C 2  173  ? -14.085 10.730  25.138  1.00 14.21  ? 173  ARG C C     1 
ATOM   4533  O  O     . ARG C 2  173  ? -14.979 11.536  25.392  1.00 16.57  ? 173  ARG C O     1 
ATOM   4534  C  CB    . ARG C 2  173  ? -11.773 10.783  26.081  1.00 15.55  ? 173  ARG C CB    1 
ATOM   4535  C  CG    . ARG C 2  173  ? -10.282 10.769  25.775  1.00 17.92  ? 173  ARG C CG    1 
ATOM   4536  C  CD    . ARG C 2  173  ? -9.510  10.213  26.961  1.00 19.47  ? 173  ARG C CD    1 
ATOM   4537  N  NE    . ARG C 2  173  ? -8.088  10.062  26.675  1.00 25.00  ? 173  ARG C NE    1 
ATOM   4538  C  CZ    . ARG C 2  173  ? -7.562  8.999   26.079  1.00 28.82  ? 173  ARG C CZ    1 
ATOM   4539  N  NH1   . ARG C 2  173  ? -8.345  7.998   25.703  1.00 24.83  ? 173  ARG C NH1   1 
ATOM   4540  N  NH2   . ARG C 2  173  ? -6.257  8.938   25.854  1.00 38.34  ? 173  ARG C NH2   1 
ATOM   4541  N  N     . VAL C 2  174  ? -14.288 9.418   25.054  1.00 14.04  ? 174  VAL C N     1 
ATOM   4542  C  CA    . VAL C 2  174  ? -15.612 8.815   25.142  1.00 9.64   ? 174  VAL C CA    1 
ATOM   4543  C  C     . VAL C 2  174  ? -15.579 7.535   25.971  1.00 10.70  ? 174  VAL C C     1 
ATOM   4544  O  O     . VAL C 2  174  ? -14.706 6.689   25.780  1.00 10.97  ? 174  VAL C O     1 
ATOM   4545  C  CB    . VAL C 2  174  ? -16.170 8.500   23.742  1.00 8.41   ? 174  VAL C CB    1 
ATOM   4546  C  CG1   . VAL C 2  174  ? -17.318 7.526   23.829  1.00 13.99  ? 174  VAL C CG1   1 
ATOM   4547  C  CG2   . VAL C 2  174  ? -16.614 9.773   23.053  1.00 11.80  ? 174  VAL C CG2   1 
ATOM   4548  N  N     . VAL C 2  175  ? -16.526 7.403   26.895  1.00 11.54  ? 175  VAL C N     1 
ATOM   4549  C  CA    . VAL C 2  175  ? -16.643 6.204   27.716  1.00 12.68  ? 175  VAL C CA    1 
ATOM   4550  C  C     . VAL C 2  175  ? -17.615 5.204   27.113  1.00 12.03  ? 175  VAL C C     1 
ATOM   4551  O  O     . VAL C 2  175  ? -18.815 5.458   27.032  1.00 10.98  ? 175  VAL C O     1 
ATOM   4552  C  CB    . VAL C 2  175  ? -17.106 6.531   29.139  1.00 14.28  ? 175  VAL C CB    1 
ATOM   4553  C  CG1   . VAL C 2  175  ? -17.394 5.249   29.901  1.00 16.58  ? 175  VAL C CG1   1 
ATOM   4554  C  CG2   . VAL C 2  175  ? -16.054 7.347   29.856  1.00 21.27  ? 175  VAL C CG2   1 
ATOM   4555  N  N     . VAL C 2  176  ? -17.083 4.061   26.702  1.00 12.07  ? 176  VAL C N     1 
ATOM   4556  C  CA    . VAL C 2  176  ? -17.877 3.003   26.096  1.00 12.72  ? 176  VAL C CA    1 
ATOM   4557  C  C     . VAL C 2  176  ? -18.628 2.210   27.162  1.00 13.21  ? 176  VAL C C     1 
ATOM   4558  O  O     . VAL C 2  176  ? -18.141 2.039   28.277  1.00 15.23  ? 176  VAL C O     1 
ATOM   4559  C  CB    . VAL C 2  176  ? -16.980 2.061   25.265  1.00 19.17  ? 176  VAL C CB    1 
ATOM   4560  C  CG1   . VAL C 2  176  ? -17.782 0.925   24.654  1.00 19.57  ? 176  VAL C CG1   1 
ATOM   4561  C  CG2   . VAL C 2  176  ? -16.268 2.843   24.178  1.00 21.21  ? 176  VAL C CG2   1 
ATOM   4562  N  N     . SER C 2  177  ? -19.823 1.741   26.824  1.00 12.20  ? 177  SER C N     1 
ATOM   4563  C  CA    . SER C 2  177  ? -20.592 0.913   27.737  1.00 14.04  ? 177  SER C CA    1 
ATOM   4564  C  C     . SER C 2  177  ? -20.083 -0.527  27.726  1.00 15.56  ? 177  SER C C     1 
ATOM   4565  O  O     . SER C 2  177  ? -19.935 -1.126  26.662  1.00 13.95  ? 177  SER C O     1 
ATOM   4566  C  CB    . SER C 2  177  ? -22.069 0.965   27.365  1.00 16.75  ? 177  SER C CB    1 
ATOM   4567  O  OG    . SER C 2  177  ? -22.516 2.307   27.323  1.00 21.30  ? 177  SER C OG    1 
ATOM   4568  N  N     . GLN C 2  178  ? -19.818 -1.072  28.912  1.00 16.38  ? 178  GLN C N     1 
ATOM   4569  C  CA    . GLN C 2  178  ? -19.253 -2.413  29.051  1.00 17.31  ? 178  GLN C CA    1 
ATOM   4570  C  C     . GLN C 2  178  ? -20.321 -3.486  29.263  1.00 20.07  ? 178  GLN C C     1 
ATOM   4571  O  O     . GLN C 2  178  ? -21.213 -3.333  30.097  1.00 20.69  ? 178  GLN C O     1 
ATOM   4572  C  CB    . GLN C 2  178  ? -18.249 -2.443  30.209  1.00 17.79  ? 178  GLN C CB    1 
ATOM   4573  C  CG    . GLN C 2  178  ? -17.568 -3.790  30.404  1.00 19.43  ? 178  GLN C CG    1 
ATOM   4574  C  CD    . GLN C 2  178  ? -16.523 -3.779  31.508  1.00 25.62  ? 178  GLN C CD    1 
ATOM   4575  O  OE1   . GLN C 2  178  ? -16.851 -3.757  32.696  1.00 25.50  ? 178  GLN C OE1   1 
ATOM   4576  N  NE2   . GLN C 2  178  ? -15.254 -3.805  31.118  1.00 28.01  ? 178  GLN C NE2   1 
ATOM   4577  N  N     . LEU C 2  179  ? -20.218 -4.572  28.503  1.00 17.44  ? 179  LEU C N     1 
ATOM   4578  C  CA    . LEU C 2  179  ? -21.137 -5.697  28.633  1.00 14.89  ? 179  LEU C CA    1 
ATOM   4579  C  C     . LEU C 2  179  ? -20.585 -6.752  29.578  1.00 17.15  ? 179  LEU C C     1 
ATOM   4580  O  O     . LEU C 2  179  ? -19.667 -7.491  29.228  1.00 21.18  ? 179  LEU C O     1 
ATOM   4581  C  CB    . LEU C 2  179  ? -21.417 -6.324  27.268  1.00 15.50  ? 179  LEU C CB    1 
ATOM   4582  C  CG    . LEU C 2  179  ? -22.686 -5.870  26.551  1.00 20.03  ? 179  LEU C CG    1 
ATOM   4583  C  CD1   . LEU C 2  179  ? -22.792 -6.542  25.199  1.00 19.21  ? 179  LEU C CD1   1 
ATOM   4584  C  CD2   . LEU C 2  179  ? -23.905 -6.190  27.389  1.00 25.07  ? 179  LEU C CD2   1 
ATOM   4585  N  N     . VAL C 2  180  ? -21.153 -6.831  30.774  1.00 17.26  ? 180  VAL C N     1 
ATOM   4586  C  CA    . VAL C 2  180  ? -20.648 -7.764  31.766  1.00 17.96  ? 180  VAL C CA    1 
ATOM   4587  C  C     . VAL C 2  180  ? -21.644 -8.847  32.149  1.00 24.02  ? 180  VAL C C     1 
ATOM   4588  O  O     . VAL C 2  180  ? -22.825 -8.789  31.815  1.00 24.72  ? 180  VAL C O     1 
ATOM   4589  C  CB    . VAL C 2  180  ? -20.216 -7.033  33.044  1.00 21.83  ? 180  VAL C CB    1 
ATOM   4590  C  CG1   . VAL C 2  180  ? -18.847 -6.408  32.851  1.00 27.30  ? 180  VAL C CG1   1 
ATOM   4591  C  CG2   . VAL C 2  180  ? -21.246 -5.983  33.430  1.00 27.04  ? 180  VAL C CG2   1 
ATOM   4592  N  N     . ARG C 2  181  ? -21.132 -9.843  32.857  1.00 30.56  ? 181  ARG C N     1 
ATOM   4593  C  CA    . ARG C 2  181  ? -21.926 -10.946 33.364  1.00 35.33  ? 181  ARG C CA    1 
ATOM   4594  C  C     . ARG C 2  181  ? -22.584 -10.532 34.672  1.00 34.85  ? 181  ARG C C     1 
ATOM   4595  O  O     . ARG C 2  181  ? -21.907 -10.275 35.661  1.00 40.61  ? 181  ARG C O     1 
ATOM   4596  C  CB    . ARG C 2  181  ? -21.034 -12.172 33.553  1.00 46.68  ? 181  ARG C CB    1 
ATOM   4597  C  CG    . ARG C 2  181  ? -21.679 -13.396 34.169  1.00 47.43  ? 181  ARG C CG    1 
ATOM   4598  C  CD    . ARG C 2  181  ? -20.572 -14.338 34.626  1.00 58.97  ? 181  ARG C CD    1 
ATOM   4599  N  NE    . ARG C 2  181  ? -20.987 -15.733 34.715  1.00 73.12  ? 181  ARG C NE    1 
ATOM   4600  C  CZ    . ARG C 2  181  ? -20.165 -16.730 35.029  1.00 84.53  ? 181  ARG C CZ    1 
ATOM   4601  N  NH1   . ARG C 2  181  ? -18.887 -16.481 35.287  1.00 90.72  ? 181  ARG C NH1   1 
ATOM   4602  N  NH2   . ARG C 2  181  ? -20.618 -17.974 35.089  1.00 86.50  ? 181  ARG C NH2   1 
ATOM   4603  N  N     . SER C 2  182  ? -23.909 -10.451 34.662  1.00 37.08  ? 182  SER C N     1 
ATOM   4604  C  CA    . SER C 2  182  ? -24.671 -10.016 35.827  1.00 43.46  ? 182  SER C CA    1 
ATOM   4605  C  C     . SER C 2  182  ? -24.421 -10.901 37.041  1.00 46.56  ? 182  SER C C     1 
ATOM   4606  O  O     . SER C 2  182  ? -24.298 -12.117 36.909  1.00 54.70  ? 182  SER C O     1 
ATOM   4607  C  CB    . SER C 2  182  ? -26.166 -9.998  35.493  1.00 48.78  ? 182  SER C CB    1 
ATOM   4608  O  OG    . SER C 2  182  ? -26.965 -9.913  36.659  1.00 52.78  ? 182  SER C OG    1 
ATOM   4609  N  N     . PRO C 2  183  ? -24.328 -10.285 38.229  1.00 46.86  ? 183  PRO C N     1 
ATOM   4610  C  CA    . PRO C 2  183  ? -24.253 -11.037 39.484  1.00 49.65  ? 183  PRO C CA    1 
ATOM   4611  C  C     . PRO C 2  183  ? -25.513 -11.856 39.689  1.00 54.34  ? 183  PRO C C     1 
ATOM   4612  O  O     . PRO C 2  183  ? -26.569 -11.482 39.183  1.00 56.31  ? 183  PRO C O     1 
ATOM   4613  C  CB    . PRO C 2  183  ? -24.137 -9.945  40.551  1.00 48.56  ? 183  PRO C CB    1 
ATOM   4614  C  CG    . PRO C 2  183  ? -23.663 -8.749  39.832  1.00 51.21  ? 183  PRO C CG    1 
ATOM   4615  C  CD    . PRO C 2  183  ? -24.217 -8.835  38.447  1.00 47.68  ? 183  PRO C CD    1 
ATOM   4616  N  N     . GLY C 2  184  ? -25.405 -12.958 40.419  1.00 55.09  ? 184  GLY C N     1 
ATOM   4617  C  CA    . GLY C 2  184  ? -26.566 -13.773 40.710  1.00 63.23  ? 184  GLY C CA    1 
ATOM   4618  C  C     . GLY C 2  184  ? -26.251 -15.252 40.755  1.00 65.56  ? 184  GLY C C     1 
ATOM   4619  O  O     . GLY C 2  184  ? -25.087 -15.651 40.797  1.00 65.79  ? 184  GLY C O     1 
ATOM   4620  N  N     . VAL C 2  185  ? -27.299 -16.066 40.745  1.00 65.69  ? 185  VAL C N     1 
ATOM   4621  C  CA    . VAL C 2  185  ? -27.150 -17.511 40.805  1.00 57.56  ? 185  VAL C CA    1 
ATOM   4622  C  C     . VAL C 2  185  ? -27.511 -18.143 39.460  1.00 56.25  ? 185  VAL C C     1 
ATOM   4623  O  O     . VAL C 2  185  ? -28.612 -17.950 38.945  1.00 58.58  ? 185  VAL C O     1 
ATOM   4624  C  CB    . VAL C 2  185  ? -28.020 -18.107 41.930  1.00 54.04  ? 185  VAL C CB    1 
ATOM   4625  C  CG1   . VAL C 2  185  ? -29.388 -17.435 41.968  1.00 63.53  ? 185  VAL C CG1   1 
ATOM   4626  C  CG2   . VAL C 2  185  ? -28.151 -19.608 41.769  1.00 69.13  ? 185  VAL C CG2   1 
ATOM   4627  N  N     . TYR C 2  186  ? -26.572 -18.890 38.887  1.00 56.18  ? 186  TYR C N     1 
ATOM   4628  C  CA    . TYR C 2  186  ? -26.777 -19.488 37.572  1.00 60.65  ? 186  TYR C CA    1 
ATOM   4629  C  C     . TYR C 2  186  ? -26.663 -21.006 37.595  1.00 74.58  ? 186  TYR C C     1 
ATOM   4630  O  O     . TYR C 2  186  ? -25.815 -21.567 38.288  1.00 79.33  ? 186  TYR C O     1 
ATOM   4631  C  CB    . TYR C 2  186  ? -25.784 -18.903 36.568  1.00 58.49  ? 186  TYR C CB    1 
ATOM   4632  C  CG    . TYR C 2  186  ? -25.977 -17.424 36.374  1.00 53.39  ? 186  TYR C CG    1 
ATOM   4633  C  CD1   . TYR C 2  186  ? -26.972 -16.944 35.538  1.00 56.89  ? 186  TYR C CD1   1 
ATOM   4634  C  CD2   . TYR C 2  186  ? -25.184 -16.506 37.046  1.00 59.92  ? 186  TYR C CD2   1 
ATOM   4635  C  CE1   . TYR C 2  186  ? -27.167 -15.592 35.366  1.00 62.05  ? 186  TYR C CE1   1 
ATOM   4636  C  CE2   . TYR C 2  186  ? -25.369 -15.149 36.880  1.00 67.58  ? 186  TYR C CE2   1 
ATOM   4637  C  CZ    . TYR C 2  186  ? -26.365 -14.697 36.037  1.00 66.82  ? 186  TYR C CZ    1 
ATOM   4638  O  OH    . TYR C 2  186  ? -26.564 -13.346 35.861  1.00 66.34  ? 186  TYR C OH    1 
ATOM   4639  N  N     . PHE C 2  187  ? -27.526 -21.661 36.826  1.00 80.90  ? 187  PHE C N     1 
ATOM   4640  C  CA    . PHE C 2  187  ? -27.579 -23.118 36.783  1.00 84.53  ? 187  PHE C CA    1 
ATOM   4641  C  C     . PHE C 2  187  ? -27.134 -23.642 35.420  1.00 83.63  ? 187  PHE C C     1 
ATOM   4642  O  O     . PHE C 2  187  ? -27.565 -23.142 34.381  1.00 81.04  ? 187  PHE C O     1 
ATOM   4643  C  CB    . PHE C 2  187  ? -28.994 -23.608 37.110  1.00 87.17  ? 187  PHE C CB    1 
ATOM   4644  C  CG    . PHE C 2  187  ? -29.487 -23.177 38.466  1.00 83.80  ? 187  PHE C CG    1 
ATOM   4645  C  CD1   . PHE C 2  187  ? -30.057 -21.928 38.649  1.00 83.14  ? 187  PHE C CD1   1 
ATOM   4646  C  CD2   . PHE C 2  187  ? -29.382 -24.023 39.555  1.00 85.25  ? 187  PHE C CD2   1 
ATOM   4647  C  CE1   . PHE C 2  187  ? -30.507 -21.531 39.892  1.00 81.74  ? 187  PHE C CE1   1 
ATOM   4648  C  CE2   . PHE C 2  187  ? -29.831 -23.631 40.803  1.00 84.80  ? 187  PHE C CE2   1 
ATOM   4649  C  CZ    . PHE C 2  187  ? -30.391 -22.381 40.971  1.00 80.50  ? 187  PHE C CZ    1 
ATOM   4650  N  N     . ASP C 2  188  ? -26.271 -24.653 35.433  1.00 85.01  ? 188  ASP C N     1 
ATOM   4651  C  CA    . ASP C 2  188  ? -25.692 -25.184 34.204  1.00 92.91  ? 188  ASP C CA    1 
ATOM   4652  C  C     . ASP C 2  188  ? -25.806 -26.703 34.143  1.00 99.02  ? 188  ASP C C     1 
ATOM   4653  O  O     . ASP C 2  188  ? -25.615 -27.389 35.147  1.00 103.23 ? 188  ASP C O     1 
ATOM   4654  C  CB    . ASP C 2  188  ? -24.225 -24.764 34.087  1.00 98.51  ? 188  ASP C CB    1 
ATOM   4655  C  CG    . ASP C 2  188  ? -23.574 -25.257 32.808  1.00 105.47 ? 188  ASP C CG    1 
ATOM   4656  O  OD1   . ASP C 2  188  ? -24.175 -25.090 31.726  1.00 102.19 ? 188  ASP C OD1   1 
ATOM   4657  O  OD2   . ASP C 2  188  ? -22.459 -25.816 32.886  1.00 116.64 ? 188  ASP C OD2   1 
ATOM   4658  N  N     . GLU C 2  189  ? -26.113 -27.221 32.958  1.00 104.45 ? 189  GLU C N     1 
ATOM   4659  C  CA    . GLU C 2  189  ? -26.241 -28.659 32.754  1.00 106.66 ? 189  GLU C CA    1 
ATOM   4660  C  C     . GLU C 2  189  ? -25.074 -29.216 31.953  1.00 103.81 ? 189  GLU C C     1 
ATOM   4661  O  O     . GLU C 2  189  ? -24.995 -29.027 30.740  1.00 103.56 ? 189  GLU C O     1 
ATOM   4662  C  CB    . GLU C 2  189  ? -27.555 -28.985 32.043  1.00 109.03 ? 189  GLU C CB    1 
ATOM   4663  C  CG    . GLU C 2  189  ? -27.750 -30.462 31.743  1.00 116.33 ? 189  GLU C CG    1 
ATOM   4664  C  CD    . GLU C 2  189  ? -29.005 -30.728 30.934  1.00 115.72 ? 189  GLU C CD    1 
ATOM   4665  O  OE1   . GLU C 2  189  ? -29.339 -31.914 30.724  1.00 123.74 ? 189  GLU C OE1   1 
ATOM   4666  O  OE2   . GLU C 2  189  ? -29.656 -29.751 30.506  1.00 102.84 ? 189  GLU C OE2   1 
ATOM   4667  N  N     . THR C 2  190  ? -24.168 -29.907 32.631  1.00 107.27 ? 190  THR C N     1 
ATOM   4668  C  CA    . THR C 2  190  ? -23.027 -30.498 31.952  1.00 115.65 ? 190  THR C CA    1 
ATOM   4669  C  C     . THR C 2  190  ? -23.213 -32.010 31.824  1.00 123.03 ? 190  THR C C     1 
ATOM   4670  O  O     . THR C 2  190  ? -23.740 -32.664 32.725  1.00 121.17 ? 190  THR C O     1 
ATOM   4671  C  CB    . THR C 2  190  ? -21.706 -30.171 32.686  1.00 114.28 ? 190  THR C CB    1 
ATOM   4672  O  OG1   . THR C 2  190  ? -20.625 -30.899 32.089  1.00 115.78 ? 190  THR C OG1   1 
ATOM   4673  C  CG2   . THR C 2  190  ? -21.804 -30.519 34.165  1.00 118.94 ? 190  THR C CG2   1 
ATOM   4674  N  N     . ILE C 2  191  ? -22.801 -32.554 30.683  1.00 124.48 ? 191  ILE C N     1 
ATOM   4675  C  CA    . ILE C 2  191  ? -22.929 -33.983 30.422  1.00 120.01 ? 191  ILE C CA    1 
ATOM   4676  C  C     . ILE C 2  191  ? -21.615 -34.701 30.709  1.00 124.80 ? 191  ILE C C     1 
ATOM   4677  O  O     . ILE C 2  191  ? -20.554 -34.278 30.251  1.00 125.09 ? 191  ILE C O     1 
ATOM   4678  C  CB    . ILE C 2  191  ? -23.358 -34.255 28.966  1.00 115.03 ? 191  ILE C CB    1 
ATOM   4679  C  CG1   . ILE C 2  191  ? -24.723 -33.624 28.685  1.00 118.00 ? 191  ILE C CG1   1 
ATOM   4680  C  CG2   . ILE C 2  191  ? -23.407 -35.748 28.692  1.00 121.64 ? 191  ILE C CG2   1 
ATOM   4681  C  CD1   . ILE C 2  191  ? -25.833 -34.158 29.565  1.00 116.66 ? 191  ILE C CD1   1 
ATOM   4682  N  N     . ASP C 2  192  ? -21.694 -35.786 31.474  1.00 128.36 ? 192  ASP C N     1 
ATOM   4683  C  CA    . ASP C 2  192  ? -20.509 -36.545 31.858  1.00 130.32 ? 192  ASP C CA    1 
ATOM   4684  C  C     . ASP C 2  192  ? -19.981 -37.379 30.691  1.00 130.02 ? 192  ASP C C     1 
ATOM   4685  O  O     . ASP C 2  192  ? -20.754 -37.976 29.943  1.00 131.04 ? 192  ASP C O     1 
ATOM   4686  C  CB    . ASP C 2  192  ? -20.822 -37.444 33.058  1.00 132.46 ? 192  ASP C CB    1 
ATOM   4687  C  CG    . ASP C 2  192  ? -19.574 -38.029 33.692  1.00 135.76 ? 192  ASP C CG    1 
ATOM   4688  O  OD1   . ASP C 2  192  ? -19.686 -39.067 34.378  1.00 137.06 ? 192  ASP C OD1   1 
ATOM   4689  O  OD2   . ASP C 2  192  ? -18.482 -37.451 33.507  1.00 135.52 ? 192  ASP C OD2   1 
ATOM   4690  N  N     . LYS C 2  193  ? -18.661 -37.414 30.544  1.00 132.02 ? 193  LYS C N     1 
ATOM   4691  C  CA    . LYS C 2  193  ? -18.024 -38.135 29.446  1.00 139.13 ? 193  LYS C CA    1 
ATOM   4692  C  C     . LYS C 2  193  ? -18.108 -39.647 29.638  1.00 139.40 ? 193  LYS C C     1 
ATOM   4693  O  O     . LYS C 2  193  ? -18.372 -40.393 28.694  1.00 131.39 ? 193  LYS C O     1 
ATOM   4694  C  CB    . LYS C 2  193  ? -16.558 -37.713 29.312  1.00 146.51 ? 193  LYS C CB    1 
ATOM   4695  C  CG    . LYS C 2  193  ? -16.329 -36.209 29.345  1.00 144.40 ? 193  LYS C CG    1 
ATOM   4696  C  CD    . LYS C 2  193  ? -14.843 -35.878 29.332  1.00 139.18 ? 193  LYS C CD    1 
ATOM   4697  C  CE    . LYS C 2  193  ? -14.605 -34.386 29.507  1.00 144.76 ? 193  LYS C CE    1 
ATOM   4698  N  NZ    . LYS C 2  193  ? -15.217 -33.582 28.411  1.00 141.69 ? 193  LYS C NZ    1 
ATOM   4699  N  N     . SER C 2  194  ? -17.881 -40.088 30.871  1.00 139.92 ? 194  SER C N     1 
ATOM   4700  C  CA    . SER C 2  194  ? -17.824 -41.510 31.189  1.00 128.44 ? 194  SER C CA    1 
ATOM   4701  C  C     . SER C 2  194  ? -19.207 -42.120 31.404  1.00 131.97 ? 194  SER C C     1 
ATOM   4702  O  O     . SER C 2  194  ? -19.608 -43.034 30.684  1.00 137.69 ? 194  SER C O     1 
ATOM   4703  C  CB    . SER C 2  194  ? -16.965 -41.735 32.434  1.00 127.21 ? 194  SER C CB    1 
ATOM   4704  O  OG    . SER C 2  194  ? -17.488 -41.024 33.543  1.00 127.58 ? 194  SER C OG    1 
ATOM   4705  N  N     . THR C 2  195  ? -19.928 -41.612 32.399  1.00 131.82 ? 195  THR C N     1 
ATOM   4706  C  CA    . THR C 2  195  ? -21.227 -42.169 32.772  1.00 133.18 ? 195  THR C CA    1 
ATOM   4707  C  C     . THR C 2  195  ? -22.349 -41.748 31.826  1.00 131.44 ? 195  THR C C     1 
ATOM   4708  O  O     . THR C 2  195  ? -23.417 -42.361 31.821  1.00 130.31 ? 195  THR C O     1 
ATOM   4709  C  CB    . THR C 2  195  ? -21.621 -41.760 34.205  1.00 134.54 ? 195  THR C CB    1 
ATOM   4710  O  OG1   . THR C 2  195  ? -21.711 -40.333 34.290  1.00 136.86 ? 195  THR C OG1   1 
ATOM   4711  C  CG2   . THR C 2  195  ? -20.592 -42.259 35.206  1.00 137.78 ? 195  THR C CG2   1 
ATOM   4712  N  N     . ASP C 2  196  ? -22.106 -40.700 31.041  1.00 130.08 ? 196  ASP C N     1 
ATOM   4713  C  CA    . ASP C 2  196  ? -23.087 -40.187 30.083  1.00 126.58 ? 196  ASP C CA    1 
ATOM   4714  C  C     . ASP C 2  196  ? -24.404 -39.788 30.745  1.00 125.42 ? 196  ASP C C     1 
ATOM   4715  O  O     . ASP C 2  196  ? -25.456 -39.790 30.104  1.00 127.19 ? 196  ASP C O     1 
ATOM   4716  C  CB    . ASP C 2  196  ? -23.353 -41.217 28.980  1.00 130.29 ? 196  ASP C CB    1 
ATOM   4717  C  CG    . ASP C 2  196  ? -22.193 -41.348 28.013  1.00 139.17 ? 196  ASP C CG    1 
ATOM   4718  O  OD1   . ASP C 2  196  ? -21.507 -40.334 27.766  1.00 141.09 ? 196  ASP C OD1   1 
ATOM   4719  O  OD2   . ASP C 2  196  ? -21.970 -42.464 27.496  1.00 142.20 ? 196  ASP C OD2   1 
ATOM   4720  N  N     . LYS C 2  197  ? -24.342 -39.448 32.029  1.00 123.39 ? 197  LYS C N     1 
ATOM   4721  C  CA    . LYS C 2  197  ? -25.527 -39.016 32.760  1.00 120.23 ? 197  LYS C CA    1 
ATOM   4722  C  C     . LYS C 2  197  ? -25.547 -37.500 32.871  1.00 118.11 ? 197  LYS C C     1 
ATOM   4723  O  O     . LYS C 2  197  ? -24.506 -36.850 32.776  1.00 120.14 ? 197  LYS C O     1 
ATOM   4724  C  CB    . LYS C 2  197  ? -25.571 -39.649 34.153  1.00 120.83 ? 197  LYS C CB    1 
ATOM   4725  C  CG    . LYS C 2  197  ? -24.527 -39.105 35.117  1.00 119.74 ? 197  LYS C CG    1 
ATOM   4726  C  CD    . LYS C 2  197  ? -24.690 -39.694 36.510  1.00 121.81 ? 197  LYS C CD    1 
ATOM   4727  C  CE    . LYS C 2  197  ? -24.532 -41.207 36.497  1.00 115.08 ? 197  LYS C CE    1 
ATOM   4728  N  NZ    . LYS C 2  197  ? -24.698 -41.796 37.855  1.00 113.02 ? 197  LYS C NZ    1 
ATOM   4729  N  N     . THR C 2  198  ? -26.734 -36.941 33.071  1.00 118.49 ? 198  THR C N     1 
ATOM   4730  C  CA    . THR C 2  198  ? -26.880 -35.497 33.197  1.00 120.45 ? 198  THR C CA    1 
ATOM   4731  C  C     . THR C 2  198  ? -26.429 -35.017 34.570  1.00 122.01 ? 198  THR C C     1 
ATOM   4732  O  O     . THR C 2  198  ? -26.971 -35.433 35.594  1.00 116.17 ? 198  THR C O     1 
ATOM   4733  C  CB    . THR C 2  198  ? -28.333 -35.055 32.963  1.00 117.24 ? 198  THR C CB    1 
ATOM   4734  O  OG1   . THR C 2  198  ? -29.191 -35.725 33.895  1.00 120.08 ? 198  THR C OG1   1 
ATOM   4735  C  CG2   . THR C 2  198  ? -28.768 -35.390 31.543  1.00 108.93 ? 198  THR C CG2   1 
ATOM   4736  N  N     . LEU C 2  199  ? -25.427 -34.143 34.583  1.00 123.23 ? 199  LEU C N     1 
ATOM   4737  C  CA    . LEU C 2  199  ? -24.935 -33.563 35.824  1.00 117.36 ? 199  LEU C CA    1 
ATOM   4738  C  C     . LEU C 2  199  ? -25.243 -32.071 35.871  1.00 109.56 ? 199  LEU C C     1 
ATOM   4739  O  O     . LEU C 2  199  ? -25.085 -31.361 34.877  1.00 104.08 ? 199  LEU C O     1 
ATOM   4740  C  CB    . LEU C 2  199  ? -23.433 -33.805 35.975  1.00 116.61 ? 199  LEU C CB    1 
ATOM   4741  C  CG    . LEU C 2  199  ? -22.992 -35.270 35.999  1.00 115.45 ? 199  LEU C CG    1 
ATOM   4742  C  CD1   . LEU C 2  199  ? -21.499 -35.369 36.252  1.00 117.40 ? 199  LEU C CD1   1 
ATOM   4743  C  CD2   . LEU C 2  199  ? -23.769 -36.050 37.047  1.00 118.77 ? 199  LEU C CD2   1 
ATOM   4744  N  N     . HIS C 2  200  ? -25.686 -31.603 37.032  1.00 109.17 ? 200  HIS C N     1 
ATOM   4745  C  CA    . HIS C 2  200  ? -26.098 -30.215 37.191  1.00 104.91 ? 200  HIS C CA    1 
ATOM   4746  C  C     . HIS C 2  200  ? -25.161 -29.443 38.118  1.00 106.93 ? 200  HIS C C     1 
ATOM   4747  O  O     . HIS C 2  200  ? -24.823 -29.912 39.205  1.00 106.84 ? 200  HIS C O     1 
ATOM   4748  C  CB    . HIS C 2  200  ? -27.534 -30.148 37.716  1.00 101.48 ? 200  HIS C CB    1 
ATOM   4749  C  CG    . HIS C 2  200  ? -28.567 -30.538 36.703  1.00 102.36 ? 200  HIS C CG    1 
ATOM   4750  N  ND1   . HIS C 2  200  ? -28.581 -31.770 36.086  1.00 108.65 ? 200  HIS C ND1   1 
ATOM   4751  C  CD2   . HIS C 2  200  ? -29.621 -29.853 36.200  1.00 103.23 ? 200  HIS C CD2   1 
ATOM   4752  C  CE1   . HIS C 2  200  ? -29.600 -31.828 35.247  1.00 108.12 ? 200  HIS C CE1   1 
ATOM   4753  N  NE2   . HIS C 2  200  ? -30.247 -30.678 35.297  1.00 102.17 ? 200  HIS C NE2   1 
ATOM   4754  N  N     . SER C 2  201  ? -24.751 -28.257 37.676  1.00 106.08 ? 201  SER C N     1 
ATOM   4755  C  CA    . SER C 2  201  ? -23.854 -27.405 38.453  1.00 95.65  ? 201  SER C CA    1 
ATOM   4756  C  C     . SER C 2  201  ? -24.449 -26.018 38.674  1.00 83.39  ? 201  SER C C     1 
ATOM   4757  O  O     . SER C 2  201  ? -25.129 -25.476 37.803  1.00 78.76  ? 201  SER C O     1 
ATOM   4758  C  CB    . SER C 2  201  ? -22.498 -27.279 37.757  1.00 96.09  ? 201  SER C CB    1 
ATOM   4759  O  OG    . SER C 2  201  ? -22.604 -26.498 36.580  1.00 90.75  ? 201  SER C OG    1 
ATOM   4760  N  N     . VAL C 2  202  ? -24.186 -25.450 39.846  1.00 83.41  ? 202  VAL C N     1 
ATOM   4761  C  CA    . VAL C 2  202  ? -24.640 -24.102 40.173  1.00 80.54  ? 202  VAL C CA    1 
ATOM   4762  C  C     . VAL C 2  202  ? -23.447 -23.235 40.554  1.00 91.75  ? 202  VAL C C     1 
ATOM   4763  O  O     . VAL C 2  202  ? -22.462 -23.737 41.093  1.00 99.96  ? 202  VAL C O     1 
ATOM   4764  C  CB    . VAL C 2  202  ? -25.651 -24.104 41.333  1.00 78.22  ? 202  VAL C CB    1 
ATOM   4765  C  CG1   . VAL C 2  202  ? -26.431 -22.802 41.359  1.00 75.14  ? 202  VAL C CG1   1 
ATOM   4766  C  CG2   . VAL C 2  202  ? -26.596 -25.278 41.208  1.00 95.56  ? 202  VAL C CG2   1 
ATOM   4767  N  N     . LYS C 2  203  ? -23.532 -21.938 40.271  1.00 85.17  ? 203  LYS C N     1 
ATOM   4768  C  CA    . LYS C 2  203  ? -22.459 -21.010 40.613  1.00 78.35  ? 203  LYS C CA    1 
ATOM   4769  C  C     . LYS C 2  203  ? -23.014 -19.660 41.070  1.00 70.92  ? 203  LYS C C     1 
ATOM   4770  O  O     . LYS C 2  203  ? -23.726 -18.985 40.329  1.00 67.74  ? 203  LYS C O     1 
ATOM   4771  C  CB    . LYS C 2  203  ? -21.511 -20.831 39.422  1.00 76.76  ? 203  LYS C CB    1 
ATOM   4772  C  CG    . LYS C 2  203  ? -20.630 -22.048 39.144  1.00 81.57  ? 203  LYS C CG    1 
ATOM   4773  C  CD    . LYS C 2  203  ? -19.960 -21.980 37.782  1.00 79.26  ? 203  LYS C CD    1 
ATOM   4774  C  CE    . LYS C 2  203  ? -19.195 -23.262 37.485  1.00 82.34  ? 203  LYS C CE    1 
ATOM   4775  N  NZ    . LYS C 2  203  ? -18.562 -23.237 36.138  1.00 86.68  ? 203  LYS C NZ    1 
ATOM   4776  N  N     . VAL C 2  204  ? -22.685 -19.282 42.302  1.00 70.51  ? 204  VAL C N     1 
ATOM   4777  C  CA    . VAL C 2  204  ? -23.117 -18.009 42.872  1.00 64.00  ? 204  VAL C CA    1 
ATOM   4778  C  C     . VAL C 2  204  ? -22.052 -16.937 42.678  1.00 71.16  ? 204  VAL C C     1 
ATOM   4779  O  O     . VAL C 2  204  ? -20.923 -17.080 43.143  1.00 83.59  ? 204  VAL C O     1 
ATOM   4780  C  CB    . VAL C 2  204  ? -23.433 -18.145 44.370  1.00 63.74  ? 204  VAL C CB    1 
ATOM   4781  C  CG1   . VAL C 2  204  ? -23.611 -16.779 45.008  1.00 62.56  ? 204  VAL C CG1   1 
ATOM   4782  C  CG2   . VAL C 2  204  ? -24.670 -18.995 44.566  1.00 64.33  ? 204  VAL C CG2   1 
ATOM   4783  N  N     . ILE C 2  205  ? -22.419 -15.860 41.990  1.00 67.77  ? 205  ILE C N     1 
ATOM   4784  C  CA    . ILE C 2  205  ? -21.467 -14.808 41.660  1.00 66.19  ? 205  ILE C CA    1 
ATOM   4785  C  C     . ILE C 2  205  ? -21.830 -13.479 42.307  1.00 65.59  ? 205  ILE C C     1 
ATOM   4786  O  O     . ILE C 2  205  ? -22.824 -12.854 41.937  1.00 66.84  ? 205  ILE C O     1 
ATOM   4787  C  CB    . ILE C 2  205  ? -21.375 -14.599 40.146  1.00 65.15  ? 205  ILE C CB    1 
ATOM   4788  C  CG1   . ILE C 2  205  ? -21.370 -15.946 39.424  1.00 60.97  ? 205  ILE C CG1   1 
ATOM   4789  C  CG2   . ILE C 2  205  ? -20.144 -13.775 39.801  1.00 69.29  ? 205  ILE C CG2   1 
ATOM   4790  C  CD1   . ILE C 2  205  ? -21.698 -15.842 37.959  1.00 58.66  ? 205  ILE C CD1   1 
ATOM   4791  N  N     . PRO C 2  206  ? -21.019 -13.040 43.277  1.00 65.30  ? 206  PRO C N     1 
ATOM   4792  C  CA    . PRO C 2  206  ? -21.245 -11.754 43.937  1.00 74.41  ? 206  PRO C CA    1 
ATOM   4793  C  C     . PRO C 2  206  ? -20.813 -10.586 43.067  1.00 72.32  ? 206  PRO C C     1 
ATOM   4794  O  O     . PRO C 2  206  ? -20.044 -10.776 42.125  1.00 73.10  ? 206  PRO C O     1 
ATOM   4795  C  CB    . PRO C 2  206  ? -20.374 -11.850 45.189  1.00 83.38  ? 206  PRO C CB    1 
ATOM   4796  C  CG    . PRO C 2  206  ? -19.254 -12.735 44.775  1.00 82.62  ? 206  PRO C CG    1 
ATOM   4797  C  CD    . PRO C 2  206  ? -19.852 -13.747 43.833  1.00 71.98  ? 206  PRO C CD    1 
ATOM   4798  N  N     . SER C 2  207  ? -21.312 -9.394  43.376  1.00 72.68  ? 207  SER C N     1 
ATOM   4799  C  CA    . SER C 2  207  ? -20.835 -8.183  42.728  1.00 76.49  ? 207  SER C CA    1 
ATOM   4800  C  C     . SER C 2  207  ? -19.367 -7.991  43.087  1.00 80.94  ? 207  SER C C     1 
ATOM   4801  O  O     . SER C 2  207  ? -18.574 -7.490  42.290  1.00 88.73  ? 207  SER C O     1 
ATOM   4802  C  CB    . SER C 2  207  ? -21.666 -6.972  43.156  1.00 78.91  ? 207  SER C CB    1 
ATOM   4803  O  OG    . SER C 2  207  ? -21.160 -5.775  42.593  1.00 85.01  ? 207  SER C OG    1 
ATOM   4804  N  N     . ARG C 2  208  ? -19.022 -8.409  44.300  1.00 77.13  ? 208  ARG C N     1 
ATOM   4805  C  CA    . ARG C 2  208  ? -17.651 -8.372  44.788  1.00 80.74  ? 208  ARG C CA    1 
ATOM   4806  C  C     . ARG C 2  208  ? -17.525 -9.220  46.048  1.00 83.86  ? 208  ARG C C     1 
ATOM   4807  O  O     . ARG C 2  208  ? -18.223 -8.989  47.036  1.00 87.10  ? 208  ARG C O     1 
ATOM   4808  C  CB    . ARG C 2  208  ? -17.208 -6.933  45.068  1.00 97.25  ? 208  ARG C CB    1 
ATOM   4809  C  CG    . ARG C 2  208  ? -18.186 -6.120  45.906  1.00 105.49 ? 208  ARG C CG    1 
ATOM   4810  C  CD    . ARG C 2  208  ? -17.559 -4.814  46.372  1.00 111.23 ? 208  ARG C CD    1 
ATOM   4811  N  NE    . ARG C 2  208  ? -18.440 -4.056  47.257  1.00 96.85  ? 208  ARG C NE    1 
ATOM   4812  C  CZ    . ARG C 2  208  ? -18.533 -4.255  48.568  1.00 90.17  ? 208  ARG C CZ    1 
ATOM   4813  N  NH1   . ARG C 2  208  ? -17.804 -5.195  49.152  1.00 81.96  ? 208  ARG C NH1   1 
ATOM   4814  N  NH2   . ARG C 2  208  ? -19.360 -3.515  49.296  1.00 95.21  ? 208  ARG C NH2   1 
ATOM   4815  N  N     . GLY C 2  209  ? -16.646 -10.213 46.011  1.00 94.59  ? 209  GLY C N     1 
ATOM   4816  C  CA    . GLY C 2  209  ? -16.422 -11.037 47.181  1.00 97.01  ? 209  GLY C CA    1 
ATOM   4817  C  C     . GLY C 2  209  ? -16.036 -12.473 46.894  1.00 94.45  ? 209  GLY C C     1 
ATOM   4818  O  O     . GLY C 2  209  ? -15.531 -12.799 45.818  1.00 95.81  ? 209  GLY C O     1 
ATOM   4819  N  N     . ALA C 2  210  ? -16.280 -13.334 47.876  1.00 92.82  ? 210  ALA C N     1 
ATOM   4820  C  CA    . ALA C 2  210  ? -15.876 -14.728 47.796  1.00 89.76  ? 210  ALA C CA    1 
ATOM   4821  C  C     . ALA C 2  210  ? -16.824 -15.539 46.931  1.00 88.96  ? 210  ALA C C     1 
ATOM   4822  O  O     . ALA C 2  210  ? -17.978 -15.167 46.719  1.00 88.34  ? 210  ALA C O     1 
ATOM   4823  C  CB    . ALA C 2  210  ? -15.788 -15.332 49.183  1.00 93.96  ? 210  ALA C CB    1 
ATOM   4824  N  N     . TRP C 2  211  ? -16.317 -16.665 46.446  1.00 92.11  ? 211  TRP C N     1 
ATOM   4825  C  CA    . TRP C 2  211  ? -17.058 -17.518 45.530  1.00 99.27  ? 211  TRP C CA    1 
ATOM   4826  C  C     . TRP C 2  211  ? -17.870 -18.581 46.252  1.00 99.10  ? 211  TRP C C     1 
ATOM   4827  O  O     . TRP C 2  211  ? -17.676 -18.823 47.444  1.00 109.09 ? 211  TRP C O     1 
ATOM   4828  C  CB    . TRP C 2  211  ? -16.101 -18.177 44.545  1.00 109.43 ? 211  TRP C CB    1 
ATOM   4829  C  CG    . TRP C 2  211  ? -16.018 -17.445 43.257  1.00 108.79 ? 211  TRP C CG    1 
ATOM   4830  C  CD1   . TRP C 2  211  ? -15.909 -16.098 43.077  1.00 109.39 ? 211  TRP C CD1   1 
ATOM   4831  C  CD2   . TRP C 2  211  ? -16.072 -18.029 41.960  1.00 111.01 ? 211  TRP C CD2   1 
ATOM   4832  N  NE1   . TRP C 2  211  ? -15.878 -15.814 41.742  1.00 116.11 ? 211  TRP C NE1   1 
ATOM   4833  C  CE2   . TRP C 2  211  ? -15.977 -16.979 41.031  1.00 113.74 ? 211  TRP C CE2   1 
ATOM   4834  C  CE3   . TRP C 2  211  ? -16.184 -19.338 41.491  1.00 115.35 ? 211  TRP C CE3   1 
ATOM   4835  C  CZ2   . TRP C 2  211  ? -15.993 -17.195 39.661  1.00 113.93 ? 211  TRP C CZ2   1 
ATOM   4836  C  CZ3   . TRP C 2  211  ? -16.199 -19.556 40.143  1.00 118.38 ? 211  TRP C CZ3   1 
ATOM   4837  C  CH2   . TRP C 2  211  ? -16.098 -18.486 39.234  1.00 112.09 ? 211  TRP C CH2   1 
ATOM   4838  N  N     . LEU C 2  212  ? -18.775 -19.217 45.516  1.00 91.43  ? 212  LEU C N     1 
ATOM   4839  C  CA    . LEU C 2  212  ? -19.627 -20.256 46.081  1.00 88.26  ? 212  LEU C CA    1 
ATOM   4840  C  C     . LEU C 2  212  ? -20.351 -21.031 44.982  1.00 85.50  ? 212  LEU C C     1 
ATOM   4841  O  O     . LEU C 2  212  ? -21.184 -20.474 44.268  1.00 85.65  ? 212  LEU C O     1 
ATOM   4842  C  CB    . LEU C 2  212  ? -20.639 -19.639 47.050  1.00 90.82  ? 212  LEU C CB    1 
ATOM   4843  C  CG    . LEU C 2  212  ? -21.470 -20.559 47.944  1.00 90.08  ? 212  LEU C CG    1 
ATOM   4844  C  CD1   . LEU C 2  212  ? -20.574 -21.442 48.796  1.00 91.65  ? 212  LEU C CD1   1 
ATOM   4845  C  CD2   . LEU C 2  212  ? -22.405 -19.738 48.821  1.00 90.55  ? 212  LEU C CD2   1 
ATOM   4846  N  N     . GLU C 2  213  ? -20.035 -22.315 44.845  1.00 91.40  ? 213  GLU C N     1 
ATOM   4847  C  CA    . GLU C 2  213  ? -20.653 -23.128 43.803  1.00 96.91  ? 213  GLU C CA    1 
ATOM   4848  C  C     . GLU C 2  213  ? -21.007 -24.539 44.275  1.00 105.29 ? 213  GLU C C     1 
ATOM   4849  O  O     . GLU C 2  213  ? -20.147 -25.296 44.727  1.00 110.77 ? 213  GLU C O     1 
ATOM   4850  C  CB    . GLU C 2  213  ? -19.737 -23.200 42.577  1.00 94.17  ? 213  GLU C CB    1 
ATOM   4851  C  CG    . GLU C 2  213  ? -18.281 -23.505 42.878  1.00 102.38 ? 213  GLU C CG    1 
ATOM   4852  C  CD    . GLU C 2  213  ? -17.445 -23.625 41.620  1.00 105.55 ? 213  GLU C CD    1 
ATOM   4853  O  OE1   . GLU C 2  213  ? -16.206 -23.493 41.712  1.00 108.50 ? 213  GLU C OE1   1 
ATOM   4854  O  OE2   . GLU C 2  213  ? -18.029 -23.853 40.539  1.00 104.14 ? 213  GLU C OE2   1 
ATOM   4855  N  N     . PHE C 2  214  ? -22.288 -24.879 44.171  1.00 102.48 ? 214  PHE C N     1 
ATOM   4856  C  CA    . PHE C 2  214  ? -22.757 -26.228 44.459  1.00 98.93  ? 214  PHE C CA    1 
ATOM   4857  C  C     . PHE C 2  214  ? -22.827 -27.038 43.175  1.00 102.46 ? 214  PHE C C     1 
ATOM   4858  O  O     . PHE C 2  214  ? -23.406 -26.592 42.184  1.00 101.97 ? 214  PHE C O     1 
ATOM   4859  C  CB    . PHE C 2  214  ? -24.133 -26.204 45.129  1.00 100.25 ? 214  PHE C CB    1 
ATOM   4860  C  CG    . PHE C 2  214  ? -24.164 -25.461 46.429  1.00 97.33  ? 214  PHE C CG    1 
ATOM   4861  C  CD1   . PHE C 2  214  ? -23.749 -26.070 47.599  1.00 101.87 ? 214  PHE C CD1   1 
ATOM   4862  C  CD2   . PHE C 2  214  ? -24.622 -24.158 46.483  1.00 100.89 ? 214  PHE C CD2   1 
ATOM   4863  C  CE1   . PHE C 2  214  ? -23.780 -25.389 48.798  1.00 108.14 ? 214  PHE C CE1   1 
ATOM   4864  C  CE2   . PHE C 2  214  ? -24.657 -23.471 47.678  1.00 106.30 ? 214  PHE C CE2   1 
ATOM   4865  C  CZ    . PHE C 2  214  ? -24.235 -24.088 48.838  1.00 112.26 ? 214  PHE C CZ    1 
ATOM   4866  N  N     . ASP C 2  215  ? -22.238 -28.228 43.192  1.00 106.80 ? 215  ASP C N     1 
ATOM   4867  C  CA    . ASP C 2  215  ? -22.279 -29.106 42.030  1.00 114.06 ? 215  ASP C CA    1 
ATOM   4868  C  C     . ASP C 2  215  ? -22.794 -30.491 42.419  1.00 113.57 ? 215  ASP C C     1 
ATOM   4869  O  O     . ASP C 2  215  ? -22.826 -30.839 43.599  1.00 112.98 ? 215  ASP C O     1 
ATOM   4870  C  CB    . ASP C 2  215  ? -20.894 -29.210 41.388  1.00 116.49 ? 215  ASP C CB    1 
ATOM   4871  C  CG    . ASP C 2  215  ? -20.307 -27.853 41.037  1.00 117.33 ? 215  ASP C CG    1 
ATOM   4872  O  OD1   . ASP C 2  215  ? -21.078 -26.938 40.675  1.00 110.88 ? 215  ASP C OD1   1 
ATOM   4873  O  OD2   . ASP C 2  215  ? -19.070 -27.703 41.123  1.00 119.64 ? 215  ASP C OD2   1 
ATOM   4874  N  N     . VAL C 2  216  ? -23.205 -31.272 41.423  1.00 115.58 ? 216  VAL C N     1 
ATOM   4875  C  CA    . VAL C 2  216  ? -23.690 -32.630 41.661  1.00 117.23 ? 216  VAL C CA    1 
ATOM   4876  C  C     . VAL C 2  216  ? -22.812 -33.666 40.962  1.00 123.62 ? 216  VAL C C     1 
ATOM   4877  O  O     . VAL C 2  216  ? -22.660 -33.644 39.741  1.00 123.42 ? 216  VAL C O     1 
ATOM   4878  C  CB    . VAL C 2  216  ? -25.147 -32.807 41.186  1.00 108.18 ? 216  VAL C CB    1 
ATOM   4879  C  CG1   . VAL C 2  216  ? -25.556 -34.270 41.256  1.00 112.73 ? 216  VAL C CG1   1 
ATOM   4880  C  CG2   . VAL C 2  216  ? -26.083 -31.955 42.021  1.00 109.99 ? 216  VAL C CG2   1 
ATOM   4881  N  N     . ASP C 2  217  ? -22.239 -34.574 41.747  1.00 128.70 ? 217  ASP C N     1 
ATOM   4882  C  CA    . ASP C 2  217  ? -21.393 -35.635 41.211  1.00 130.59 ? 217  ASP C CA    1 
ATOM   4883  C  C     . ASP C 2  217  ? -22.190 -36.666 40.418  1.00 137.90 ? 217  ASP C C     1 
ATOM   4884  O  O     . ASP C 2  217  ? -23.421 -36.638 40.392  1.00 144.41 ? 217  ASP C O     1 
ATOM   4885  C  CB    . ASP C 2  217  ? -20.636 -36.341 42.341  1.00 129.17 ? 217  ASP C CB    1 
ATOM   4886  C  CG    . ASP C 2  217  ? -19.321 -35.665 42.677  1.00 132.23 ? 217  ASP C CG    1 
ATOM   4887  O  OD1   . ASP C 2  217  ? -18.751 -34.996 41.790  1.00 130.66 ? 217  ASP C OD1   1 
ATOM   4888  O  OD2   . ASP C 2  217  ? -18.853 -35.808 43.827  1.00 130.17 ? 217  ASP C OD2   1 
ATOM   4889  N  N     . LYS C 2  218  ? -21.471 -37.578 39.772  1.00 138.97 ? 218  LYS C N     1 
ATOM   4890  C  CA    . LYS C 2  218  ? -22.085 -38.726 39.121  1.00 130.52 ? 218  LYS C CA    1 
ATOM   4891  C  C     . LYS C 2  218  ? -22.379 -39.788 40.172  1.00 130.69 ? 218  LYS C C     1 
ATOM   4892  O  O     . LYS C 2  218  ? -23.007 -40.808 39.890  1.00 132.71 ? 218  LYS C O     1 
ATOM   4893  C  CB    . LYS C 2  218  ? -21.168 -39.280 38.031  1.00 119.64 ? 218  LYS C CB    1 
ATOM   4894  C  CG    . LYS C 2  218  ? -19.781 -39.629 38.540  1.00 118.35 ? 218  LYS C CG    1 
ATOM   4895  C  CD    . LYS C 2  218  ? -18.781 -39.763 37.407  1.00 116.36 ? 218  LYS C CD    1 
ATOM   4896  C  CE    . LYS C 2  218  ? -17.372 -39.939 37.948  1.00 122.01 ? 218  LYS C CE    1 
ATOM   4897  N  NZ    . LYS C 2  218  ? -16.347 -39.902 36.869  1.00 126.08 ? 218  LYS C NZ    1 
ATOM   4898  N  N     . ARG C 2  219  ? -21.915 -39.527 41.392  1.00 128.31 ? 219  ARG C N     1 
ATOM   4899  C  CA    . ARG C 2  219  ? -22.088 -40.443 42.510  1.00 126.62 ? 219  ARG C CA    1 
ATOM   4900  C  C     . ARG C 2  219  ? -23.374 -40.156 43.281  1.00 127.70 ? 219  ARG C C     1 
ATOM   4901  O  O     . ARG C 2  219  ? -23.611 -40.746 44.335  1.00 136.79 ? 219  ARG C O     1 
ATOM   4902  C  CB    . ARG C 2  219  ? -20.889 -40.356 43.460  1.00 123.55 ? 219  ARG C CB    1 
ATOM   4903  C  CG    . ARG C 2  219  ? -19.527 -40.406 42.779  1.00 118.31 ? 219  ARG C CG    1 
ATOM   4904  C  CD    . ARG C 2  219  ? -19.352 -41.678 41.963  1.00 129.26 ? 219  ARG C CD    1 
ATOM   4905  N  NE    . ARG C 2  219  ? -18.002 -41.802 41.416  1.00 131.73 ? 219  ARG C NE    1 
ATOM   4906  C  CZ    . ARG C 2  219  ? -17.608 -42.788 40.616  1.00 139.54 ? 219  ARG C CZ    1 
ATOM   4907  N  NH1   . ARG C 2  219  ? -18.463 -43.740 40.263  1.00 150.51 ? 219  ARG C NH1   1 
ATOM   4908  N  NH2   . ARG C 2  219  ? -16.361 -42.824 40.165  1.00 133.60 ? 219  ARG C NH2   1 
ATOM   4909  N  N     . ASP C 2  220  ? -24.192 -39.248 42.752  1.00 121.78 ? 220  ASP C N     1 
ATOM   4910  C  CA    . ASP C 2  220  ? -25.431 -38.826 43.407  1.00 122.45 ? 220  ASP C CA    1 
ATOM   4911  C  C     . ASP C 2  220  ? -25.155 -38.257 44.799  1.00 123.64 ? 220  ASP C C     1 
ATOM   4912  O  O     . ASP C 2  220  ? -25.931 -38.463 45.734  1.00 118.66 ? 220  ASP C O     1 
ATOM   4913  C  CB    . ASP C 2  220  ? -26.424 -39.989 43.493  1.00 122.50 ? 220  ASP C CB    1 
ATOM   4914  C  CG    . ASP C 2  220  ? -26.839 -40.501 42.128  1.00 134.74 ? 220  ASP C CG    1 
ATOM   4915  O  OD1   . ASP C 2  220  ? -27.814 -41.279 42.054  1.00 142.16 ? 220  ASP C OD1   1 
ATOM   4916  O  OD2   . ASP C 2  220  ? -26.193 -40.122 41.127  1.00 132.39 ? 220  ASP C OD2   1 
ATOM   4917  N  N     . THR C 2  221  ? -24.035 -37.548 44.920  1.00 124.88 ? 221  THR C N     1 
ATOM   4918  C  CA    . THR C 2  221  ? -23.658 -36.867 46.155  1.00 125.17 ? 221  THR C CA    1 
ATOM   4919  C  C     . THR C 2  221  ? -23.370 -35.393 45.883  1.00 121.79 ? 221  THR C C     1 
ATOM   4920  O  O     . THR C 2  221  ? -22.552 -35.061 45.025  1.00 116.24 ? 221  THR C O     1 
ATOM   4921  C  CB    . THR C 2  221  ? -22.419 -37.504 46.811  1.00 123.63 ? 221  THR C CB    1 
ATOM   4922  O  OG1   . THR C 2  221  ? -21.296 -37.392 45.927  1.00 119.11 ? 221  THR C OG1   1 
ATOM   4923  C  CG2   . THR C 2  221  ? -22.671 -38.968 47.123  1.00 128.33 ? 221  THR C CG2   1 
ATOM   4924  N  N     . VAL C 2  222  ? -24.038 -34.515 46.625  1.00 125.88 ? 222  VAL C N     1 
ATOM   4925  C  CA    . VAL C 2  222  ? -23.933 -33.076 46.403  1.00 121.07 ? 222  VAL C CA    1 
ATOM   4926  C  C     . VAL C 2  222  ? -22.747 -32.455 47.136  1.00 114.22 ? 222  VAL C C     1 
ATOM   4927  O  O     . VAL C 2  222  ? -22.600 -32.611 48.349  1.00 114.16 ? 222  VAL C O     1 
ATOM   4928  C  CB    . VAL C 2  222  ? -25.216 -32.352 46.842  1.00 121.81 ? 222  VAL C CB    1 
ATOM   4929  C  CG1   . VAL C 2  222  ? -25.138 -30.877 46.489  1.00 117.16 ? 222  VAL C CG1   1 
ATOM   4930  C  CG2   . VAL C 2  222  ? -26.433 -32.998 46.199  1.00 124.33 ? 222  VAL C CG2   1 
ATOM   4931  N  N     . GLY C 2  223  ? -21.911 -31.741 46.389  1.00 117.16 ? 223  GLY C N     1 
ATOM   4932  C  CA    . GLY C 2  223  ? -20.728 -31.112 46.945  1.00 118.50 ? 223  GLY C CA    1 
ATOM   4933  C  C     . GLY C 2  223  ? -20.655 -29.624 46.664  1.00 119.11 ? 223  GLY C C     1 
ATOM   4934  O  O     . GLY C 2  223  ? -21.359 -29.106 45.796  1.00 120.36 ? 223  GLY C O     1 
ATOM   4935  N  N     . VAL C 2  224  ? -19.787 -28.934 47.396  1.00 108.69 ? 224  VAL C N     1 
ATOM   4936  C  CA    . VAL C 2  224  ? -19.691 -27.485 47.302  1.00 99.37  ? 224  VAL C CA    1 
ATOM   4937  C  C     . VAL C 2  224  ? -18.234 -27.025 47.268  1.00 104.89 ? 224  VAL C C     1 
ATOM   4938  O  O     . VAL C 2  224  ? -17.407 -27.498 48.047  1.00 109.23 ? 224  VAL C O     1 
ATOM   4939  C  CB    . VAL C 2  224  ? -20.429 -26.813 48.481  1.00 102.14 ? 224  VAL C CB    1 
ATOM   4940  C  CG1   . VAL C 2  224  ? -20.026 -27.458 49.801  1.00 108.25 ? 224  VAL C CG1   1 
ATOM   4941  C  CG2   . VAL C 2  224  ? -20.181 -25.312 48.500  1.00 103.85 ? 224  VAL C CG2   1 
ATOM   4942  N  N     . ARG C 2  225  ? -17.925 -26.115 46.348  1.00 111.07 ? 225  ARG C N     1 
ATOM   4943  C  CA    . ARG C 2  225  ? -16.589 -25.534 46.250  1.00 108.66 ? 225  ARG C CA    1 
ATOM   4944  C  C     . ARG C 2  225  ? -16.589 -24.049 46.606  1.00 111.53 ? 225  ARG C C     1 
ATOM   4945  O  O     . ARG C 2  225  ? -17.160 -23.229 45.886  1.00 112.02 ? 225  ARG C O     1 
ATOM   4946  C  CB    . ARG C 2  225  ? -16.021 -25.721 44.844  1.00 99.78  ? 225  ARG C CB    1 
ATOM   4947  C  CG    . ARG C 2  225  ? -15.489 -27.108 44.557  1.00 101.56 ? 225  ARG C CG    1 
ATOM   4948  C  CD    . ARG C 2  225  ? -14.429 -27.027 43.478  1.00 113.30 ? 225  ARG C CD    1 
ATOM   4949  N  NE    . ARG C 2  225  ? -13.485 -28.137 43.539  1.00 120.20 ? 225  ARG C NE    1 
ATOM   4950  C  CZ    . ARG C 2  225  ? -12.291 -28.123 42.956  1.00 125.56 ? 225  ARG C CZ    1 
ATOM   4951  N  NH1   . ARG C 2  225  ? -11.899 -27.052 42.277  1.00 123.74 ? 225  ARG C NH1   1 
ATOM   4952  N  NH2   . ARG C 2  225  ? -11.487 -29.173 43.053  1.00 127.51 ? 225  ARG C NH2   1 
ATOM   4953  N  N     . ILE C 2  226  ? -15.937 -23.709 47.714  1.00 105.24 ? 226  ILE C N     1 
ATOM   4954  C  CA    . ILE C 2  226  ? -15.848 -22.327 48.173  1.00 90.75  ? 226  ILE C CA    1 
ATOM   4955  C  C     . ILE C 2  226  ? -14.551 -21.681 47.708  1.00 91.85  ? 226  ILE C C     1 
ATOM   4956  O  O     . ILE C 2  226  ? -13.473 -22.121 48.093  1.00 96.08  ? 226  ILE C O     1 
ATOM   4957  C  CB    . ILE C 2  226  ? -15.923 -22.239 49.709  1.00 83.13  ? 226  ILE C CB    1 
ATOM   4958  C  CG1   . ILE C 2  226  ? -17.165 -22.962 50.229  1.00 76.53  ? 226  ILE C CG1   1 
ATOM   4959  C  CG2   . ILE C 2  226  ? -15.899 -20.786 50.171  1.00 84.20  ? 226  ILE C CG2   1 
ATOM   4960  C  CD1   . ILE C 2  226  ? -17.298 -22.926 51.731  1.00 79.45  ? 226  ILE C CD1   1 
ATOM   4961  N  N     . ASP C 2  227  ? -14.663 -20.640 46.885  1.00 95.56  ? 227  ASP C N     1 
ATOM   4962  C  CA    . ASP C 2  227  ? -13.501 -19.919 46.362  1.00 106.52 ? 227  ASP C CA    1 
ATOM   4963  C  C     . ASP C 2  227  ? -12.499 -20.882 45.727  1.00 106.34 ? 227  ASP C C     1 
ATOM   4964  O  O     . ASP C 2  227  ? -11.288 -20.745 45.912  1.00 106.71 ? 227  ASP C O     1 
ATOM   4965  C  CB    . ASP C 2  227  ? -12.827 -19.103 47.472  1.00 108.37 ? 227  ASP C CB    1 
ATOM   4966  C  CG    . ASP C 2  227  ? -12.210 -17.808 46.962  1.00 112.15 ? 227  ASP C CG    1 
ATOM   4967  O  OD1   . ASP C 2  227  ? -12.129 -17.620 45.730  1.00 124.92 ? 227  ASP C OD1   1 
ATOM   4968  O  OD2   . ASP C 2  227  ? -11.799 -16.977 47.800  1.00 103.63 ? 227  ASP C OD2   1 
ATOM   4969  N  N     . ARG C 2  228  ? -13.027 -21.863 44.999  1.00 102.74 ? 228  ARG C N     1 
ATOM   4970  C  CA    . ARG C 2  228  ? -12.226 -22.873 44.310  1.00 114.81 ? 228  ARG C CA    1 
ATOM   4971  C  C     . ARG C 2  228  ? -11.377 -23.723 45.262  1.00 117.56 ? 228  ARG C C     1 
ATOM   4972  O  O     . ARG C 2  228  ? -10.247 -24.087 44.938  1.00 110.30 ? 228  ARG C O     1 
ATOM   4973  C  CB    . ARG C 2  228  ? -11.330 -22.215 43.254  1.00 114.07 ? 228  ARG C CB    1 
ATOM   4974  N  N     . LYS C 2  229  ? -11.927 -24.035 46.433  1.00 117.83 ? 229  LYS C N     1 
ATOM   4975  C  CA    . LYS C 2  229  ? -11.326 -25.028 47.319  1.00 111.53 ? 229  LYS C CA    1 
ATOM   4976  C  C     . LYS C 2  229  ? -11.908 -26.401 46.998  1.00 112.60 ? 229  LYS C C     1 
ATOM   4977  O  O     . LYS C 2  229  ? -12.862 -26.510 46.228  1.00 113.88 ? 229  LYS C O     1 
ATOM   4978  C  CB    . LYS C 2  229  ? -11.560 -24.684 48.791  1.00 104.37 ? 229  LYS C CB    1 
ATOM   4979  C  CG    . LYS C 2  229  ? -10.883 -23.404 49.249  1.00 109.32 ? 229  LYS C CG    1 
ATOM   4980  C  CD    . LYS C 2  229  ? -9.415  -23.385 48.870  1.00 106.10 ? 229  LYS C CD    1 
ATOM   4981  C  CE    . LYS C 2  229  ? -8.812  -22.009 49.095  1.00 109.00 ? 229  LYS C CE    1 
ATOM   4982  N  NZ    . LYS C 2  229  ? -9.480  -20.977 48.255  1.00 111.58 ? 229  LYS C NZ    1 
ATOM   4983  N  N     . ARG C 2  230  ? -11.336 -27.443 47.596  1.00 113.88 ? 230  ARG C N     1 
ATOM   4984  C  CA    . ARG C 2  230  ? -11.731 -28.820 47.305  1.00 114.07 ? 230  ARG C CA    1 
ATOM   4985  C  C     . ARG C 2  230  ? -13.190 -29.089 47.671  1.00 113.35 ? 230  ARG C C     1 
ATOM   4986  O  O     . ARG C 2  230  ? -13.771 -28.398 48.507  1.00 116.17 ? 230  ARG C O     1 
ATOM   4987  C  CB    . ARG C 2  230  ? -10.819 -29.805 48.044  1.00 114.56 ? 230  ARG C CB    1 
ATOM   4988  C  CG    . ARG C 2  230  ? -9.339  -29.453 47.987  1.00 118.40 ? 230  ARG C CG    1 
ATOM   4989  C  CD    . ARG C 2  230  ? -8.790  -29.507 46.567  1.00 130.82 ? 230  ARG C CD    1 
ATOM   4990  N  NE    . ARG C 2  230  ? -8.224  -30.813 46.235  1.00 130.28 ? 230  ARG C NE    1 
ATOM   4991  C  CZ    . ARG C 2  230  ? -7.588  -31.080 45.098  1.00 133.09 ? 230  ARG C CZ    1 
ATOM   4992  N  NH1   . ARG C 2  230  ? -7.439  -30.131 44.183  1.00 128.98 ? 230  ARG C NH1   1 
ATOM   4993  N  NH2   . ARG C 2  230  ? -7.101  -32.293 44.874  1.00 132.72 ? 230  ARG C NH2   1 
ATOM   4994  N  N     . ARG C 2  231  ? -13.768 -30.104 47.039  1.00 109.40 ? 231  ARG C N     1 
ATOM   4995  C  CA    . ARG C 2  231  ? -15.174 -30.443 47.233  1.00 110.13 ? 231  ARG C CA    1 
ATOM   4996  C  C     . ARG C 2  231  ? -15.439 -31.165 48.549  1.00 106.48 ? 231  ARG C C     1 
ATOM   4997  O  O     . ARG C 2  231  ? -14.714 -32.083 48.928  1.00 110.12 ? 231  ARG C O     1 
ATOM   4998  C  CB    . ARG C 2  231  ? -15.671 -31.304 46.068  1.00 114.62 ? 231  ARG C CB    1 
ATOM   4999  C  CG    . ARG C 2  231  ? -16.924 -32.112 46.372  1.00 111.40 ? 231  ARG C CG    1 
ATOM   5000  C  CD    . ARG C 2  231  ? -17.232 -33.086 45.249  1.00 110.02 ? 231  ARG C CD    1 
ATOM   5001  N  NE    . ARG C 2  231  ? -17.814 -32.418 44.090  1.00 119.50 ? 231  ARG C NE    1 
ATOM   5002  C  CZ    . ARG C 2  231  ? -19.102 -32.474 43.770  1.00 124.82 ? 231  ARG C CZ    1 
ATOM   5003  N  NH1   . ARG C 2  231  ? -19.941 -33.179 44.517  1.00 129.78 ? 231  ARG C NH1   1 
ATOM   5004  N  NH2   . ARG C 2  231  ? -19.550 -31.835 42.699  1.00 119.55 ? 231  ARG C NH2   1 
ATOM   5005  N  N     . GLN C 2  232  ? -16.487 -30.733 49.240  1.00 110.01 ? 232  GLN C N     1 
ATOM   5006  C  CA    . GLN C 2  232  ? -16.984 -31.428 50.420  1.00 118.44 ? 232  GLN C CA    1 
ATOM   5007  C  C     . GLN C 2  232  ? -18.490 -31.615 50.307  1.00 118.50 ? 232  GLN C C     1 
ATOM   5008  O  O     . GLN C 2  232  ? -19.160 -30.821 49.648  1.00 118.28 ? 232  GLN C O     1 
ATOM   5009  C  CB    . GLN C 2  232  ? -16.643 -30.657 51.695  1.00 123.76 ? 232  GLN C CB    1 
ATOM   5010  C  CG    . GLN C 2  232  ? -15.232 -30.875 52.200  1.00 136.95 ? 232  GLN C CG    1 
ATOM   5011  C  CD    . GLN C 2  232  ? -15.086 -30.504 53.661  1.00 142.49 ? 232  GLN C CD    1 
ATOM   5012  O  OE1   . GLN C 2  232  ? -14.020 -30.670 54.253  1.00 143.42 ? 232  GLN C OE1   1 
ATOM   5013  N  NE2   . GLN C 2  232  ? -16.164 -30.003 54.255  1.00 131.35 ? 232  GLN C NE2   1 
ATOM   5014  N  N     . PRO C 2  233  ? -19.026 -32.671 50.942  1.00 115.97 ? 233  PRO C N     1 
ATOM   5015  C  CA    . PRO C 2  233  ? -20.474 -32.901 50.967  1.00 117.21 ? 233  PRO C CA    1 
ATOM   5016  C  C     . PRO C 2  233  ? -21.250 -31.665 51.413  1.00 112.25 ? 233  PRO C C     1 
ATOM   5017  O  O     . PRO C 2  233  ? -20.766 -30.893 52.241  1.00 113.41 ? 233  PRO C O     1 
ATOM   5018  C  CB    . PRO C 2  233  ? -20.626 -34.039 51.976  1.00 117.24 ? 233  PRO C CB    1 
ATOM   5019  C  CG    . PRO C 2  233  ? -19.354 -34.795 51.856  1.00 116.72 ? 233  PRO C CG    1 
ATOM   5020  C  CD    . PRO C 2  233  ? -18.288 -33.763 51.601  1.00 116.84 ? 233  PRO C CD    1 
ATOM   5021  N  N     . VAL C 2  234  ? -22.444 -31.487 50.859  1.00 111.69 ? 234  VAL C N     1 
ATOM   5022  C  CA    . VAL C 2  234  ? -23.233 -30.287 51.098  1.00 111.55 ? 234  VAL C CA    1 
ATOM   5023  C  C     . VAL C 2  234  ? -23.902 -30.295 52.477  1.00 116.98 ? 234  VAL C C     1 
ATOM   5024  O  O     . VAL C 2  234  ? -24.271 -29.243 52.998  1.00 115.84 ? 234  VAL C O     1 
ATOM   5025  C  CB    . VAL C 2  234  ? -24.307 -30.110 50.001  1.00 112.06 ? 234  VAL C CB    1 
ATOM   5026  C  CG1   . VAL C 2  234  ? -25.484 -31.042 50.243  1.00 123.88 ? 234  VAL C CG1   1 
ATOM   5027  C  CG2   . VAL C 2  234  ? -24.773 -28.664 49.932  1.00 114.85 ? 234  VAL C CG2   1 
ATOM   5028  N  N     . THR C 2  235  ? -24.049 -31.476 53.072  1.00 125.33 ? 235  THR C N     1 
ATOM   5029  C  CA    . THR C 2  235  ? -24.669 -31.585 54.392  1.00 128.78 ? 235  THR C CA    1 
ATOM   5030  C  C     . THR C 2  235  ? -23.753 -31.012 55.467  1.00 126.14 ? 235  THR C C     1 
ATOM   5031  O  O     . THR C 2  235  ? -24.217 -30.541 56.507  1.00 127.04 ? 235  THR C O     1 
ATOM   5032  C  CB    . THR C 2  235  ? -25.015 -33.046 54.752  1.00 137.35 ? 235  THR C CB    1 
ATOM   5033  O  OG1   . THR C 2  235  ? -23.853 -33.872 54.601  1.00 136.18 ? 235  THR C OG1   1 
ATOM   5034  C  CG2   . THR C 2  235  ? -26.127 -33.571 53.856  1.00 140.57 ? 235  THR C CG2   1 
ATOM   5035  N  N     . VAL C 2  236  ? -22.451 -31.062 55.202  1.00 124.64 ? 236  VAL C N     1 
ATOM   5036  C  CA    . VAL C 2  236  ? -21.444 -30.492 56.091  1.00 121.93 ? 236  VAL C CA    1 
ATOM   5037  C  C     . VAL C 2  236  ? -21.721 -29.014 56.326  1.00 119.94 ? 236  VAL C C     1 
ATOM   5038  O  O     . VAL C 2  236  ? -21.498 -28.487 57.416  1.00 117.62 ? 236  VAL C O     1 
ATOM   5039  C  CB    . VAL C 2  236  ? -20.024 -30.658 55.508  1.00 123.04 ? 236  VAL C CB    1 
ATOM   5040  C  CG1   . VAL C 2  236  ? -18.978 -30.119 56.473  1.00 122.22 ? 236  VAL C CG1   1 
ATOM   5041  C  CG2   . VAL C 2  236  ? -19.752 -32.116 55.181  1.00 127.28 ? 236  VAL C CG2   1 
ATOM   5042  N  N     . LEU C 2  237  ? -22.223 -28.355 55.288  1.00 124.73 ? 237  LEU C N     1 
ATOM   5043  C  CA    . LEU C 2  237  ? -22.513 -26.930 55.337  1.00 131.96 ? 237  LEU C CA    1 
ATOM   5044  C  C     . LEU C 2  237  ? -23.772 -26.642 56.149  1.00 131.22 ? 237  LEU C C     1 
ATOM   5045  O  O     . LEU C 2  237  ? -23.847 -25.640 56.860  1.00 130.52 ? 237  LEU C O     1 
ATOM   5046  C  CB    . LEU C 2  237  ? -22.658 -26.377 53.917  1.00 134.67 ? 237  LEU C CB    1 
ATOM   5047  C  CG    . LEU C 2  237  ? -22.897 -24.875 53.756  1.00 125.99 ? 237  LEU C CG    1 
ATOM   5048  C  CD1   . LEU C 2  237  ? -21.830 -24.080 54.491  1.00 127.18 ? 237  LEU C CD1   1 
ATOM   5049  C  CD2   . LEU C 2  237  ? -22.927 -24.504 52.280  1.00 110.96 ? 237  LEU C CD2   1 
ATOM   5050  N  N     . LEU C 2  238  ? -24.758 -27.527 56.043  1.00 129.99 ? 238  LEU C N     1 
ATOM   5051  C  CA    . LEU C 2  238  ? -26.030 -27.335 56.729  1.00 133.26 ? 238  LEU C CA    1 
ATOM   5052  C  C     . LEU C 2  238  ? -25.891 -27.518 58.237  1.00 134.35 ? 238  LEU C C     1 
ATOM   5053  O  O     . LEU C 2  238  ? -26.475 -26.764 59.016  1.00 131.41 ? 238  LEU C O     1 
ATOM   5054  C  CB    . LEU C 2  238  ? -27.084 -28.293 56.174  1.00 136.49 ? 238  LEU C CB    1 
ATOM   5055  C  CG    . LEU C 2  238  ? -27.583 -27.976 54.762  1.00 129.41 ? 238  LEU C CG    1 
ATOM   5056  C  CD1   . LEU C 2  238  ? -28.523 -29.061 54.263  1.00 132.75 ? 238  LEU C CD1   1 
ATOM   5057  C  CD2   . LEU C 2  238  ? -28.266 -26.615 54.728  1.00 124.67 ? 238  LEU C CD2   1 
ATOM   5058  N  N     . LYS C 2  239  ? -25.112 -28.517 58.645  1.00 134.32 ? 239  LYS C N     1 
ATOM   5059  C  CA    . LYS C 2  239  ? -24.864 -28.763 60.062  1.00 133.69 ? 239  LYS C CA    1 
ATOM   5060  C  C     . LYS C 2  239  ? -23.937 -27.692 60.630  1.00 131.22 ? 239  LYS C C     1 
ATOM   5061  O  O     . LYS C 2  239  ? -23.813 -27.541 61.845  1.00 130.21 ? 239  LYS C O     1 
ATOM   5062  C  CB    . LYS C 2  239  ? -24.269 -30.159 60.276  1.00 130.87 ? 239  LYS C CB    1 
ATOM   5063  C  CG    . LYS C 2  239  ? -25.196 -31.306 59.885  1.00 127.82 ? 239  LYS C CG    1 
ATOM   5064  C  CD    . LYS C 2  239  ? -24.533 -32.659 60.116  1.00 136.52 ? 239  LYS C CD    1 
ATOM   5065  C  CE    . LYS C 2  239  ? -25.429 -33.805 59.670  1.00 136.87 ? 239  LYS C CE    1 
ATOM   5066  N  NZ    . LYS C 2  239  ? -24.731 -35.121 59.740  1.00 137.05 ? 239  LYS C NZ    1 
ATOM   5067  N  N     . ALA C 2  240  ? -23.289 -26.950 59.737  1.00 129.81 ? 240  ALA C N     1 
ATOM   5068  C  CA    . ALA C 2  240  ? -22.440 -25.834 60.132  1.00 130.22 ? 240  ALA C CA    1 
ATOM   5069  C  C     . ALA C 2  240  ? -23.278 -24.585 60.385  1.00 130.48 ? 240  ALA C C     1 
ATOM   5070  O  O     . ALA C 2  240  ? -22.960 -23.777 61.258  1.00 127.69 ? 240  ALA C O     1 
ATOM   5071  C  CB    . ALA C 2  240  ? -21.391 -25.564 59.068  1.00 129.62 ? 240  ALA C CB    1 
ATOM   5072  N  N     . LEU C 2  241  ? -24.352 -24.434 59.614  1.00 132.20 ? 241  LEU C N     1 
ATOM   5073  C  CA    . LEU C 2  241  ? -25.258 -23.302 59.771  1.00 135.13 ? 241  LEU C CA    1 
ATOM   5074  C  C     . LEU C 2  241  ? -26.041 -23.400 61.074  1.00 135.32 ? 241  LEU C C     1 
ATOM   5075  O  O     . LEU C 2  241  ? -26.501 -22.391 61.612  1.00 133.10 ? 241  LEU C O     1 
ATOM   5076  C  CB    . LEU C 2  241  ? -26.226 -23.219 58.590  1.00 135.42 ? 241  LEU C CB    1 
ATOM   5077  C  CG    . LEU C 2  241  ? -25.677 -22.729 57.250  1.00 134.18 ? 241  LEU C CG    1 
ATOM   5078  C  CD1   . LEU C 2  241  ? -26.763 -22.785 56.188  1.00 138.32 ? 241  LEU C CD1   1 
ATOM   5079  C  CD2   . LEU C 2  241  ? -25.129 -21.318 57.384  1.00 122.40 ? 241  LEU C CD2   1 
ATOM   5080  N  N     . GLY C 2  242  ? -26.188 -24.622 61.575  1.00 133.80 ? 242  GLY C N     1 
ATOM   5081  C  CA    . GLY C 2  242  ? -26.931 -24.866 62.797  1.00 136.44 ? 242  GLY C CA    1 
ATOM   5082  C  C     . GLY C 2  242  ? -28.172 -25.698 62.541  1.00 134.12 ? 242  GLY C C     1 
ATOM   5083  O  O     . GLY C 2  242  ? -28.895 -26.056 63.473  1.00 128.56 ? 242  GLY C O     1 
ATOM   5084  N  N     . TRP C 2  243  ? -28.421 -26.002 61.271  1.00 136.92 ? 243  TRP C N     1 
ATOM   5085  C  CA    . TRP C 2  243  ? -29.558 -26.832 60.894  1.00 140.46 ? 243  TRP C CA    1 
ATOM   5086  C  C     . TRP C 2  243  ? -29.376 -28.250 61.419  1.00 136.81 ? 243  TRP C C     1 
ATOM   5087  O  O     . TRP C 2  243  ? -28.335 -28.870 61.208  1.00 139.88 ? 243  TRP C O     1 
ATOM   5088  C  CB    . TRP C 2  243  ? -29.742 -26.848 59.374  1.00 137.85 ? 243  TRP C CB    1 
ATOM   5089  C  CG    . TRP C 2  243  ? -30.119 -25.514 58.806  1.00 137.70 ? 243  TRP C CG    1 
ATOM   5090  C  CD1   . TRP C 2  243  ? -29.292 -24.622 58.189  1.00 139.83 ? 243  TRP C CD1   1 
ATOM   5091  C  CD2   . TRP C 2  243  ? -31.420 -24.916 58.812  1.00 136.65 ? 243  TRP C CD2   1 
ATOM   5092  N  NE1   . TRP C 2  243  ? -29.998 -23.507 57.807  1.00 141.45 ? 243  TRP C NE1   1 
ATOM   5093  C  CE2   . TRP C 2  243  ? -31.307 -23.662 58.178  1.00 139.37 ? 243  TRP C CE2   1 
ATOM   5094  C  CE3   . TRP C 2  243  ? -32.671 -25.319 59.291  1.00 136.16 ? 243  TRP C CE3   1 
ATOM   5095  C  CZ2   . TRP C 2  243  ? -32.397 -22.810 58.010  1.00 137.11 ? 243  TRP C CZ2   1 
ATOM   5096  C  CZ3   . TRP C 2  243  ? -33.751 -24.471 59.123  1.00 133.60 ? 243  TRP C CZ3   1 
ATOM   5097  C  CH2   . TRP C 2  243  ? -33.607 -23.231 58.489  1.00 133.07 ? 243  TRP C CH2   1 
ATOM   5098  N  N     . THR C 2  244  ? -30.394 -28.753 62.110  1.00 131.89 ? 244  THR C N     1 
ATOM   5099  C  CA    . THR C 2  244  ? -30.341 -30.086 62.698  1.00 133.28 ? 244  THR C CA    1 
ATOM   5100  C  C     . THR C 2  244  ? -30.214 -31.161 61.623  1.00 136.12 ? 244  THR C C     1 
ATOM   5101  O  O     . THR C 2  244  ? -30.534 -30.927 60.459  1.00 137.12 ? 244  THR C O     1 
ATOM   5102  C  CB    . THR C 2  244  ? -31.590 -30.374 63.551  1.00 135.17 ? 244  THR C CB    1 
ATOM   5103  O  OG1   . THR C 2  244  ? -32.727 -30.555 62.697  1.00 131.82 ? 244  THR C OG1   1 
ATOM   5104  C  CG2   . THR C 2  244  ? -31.857 -29.223 64.510  1.00 136.64 ? 244  THR C CG2   1 
ATOM   5105  N  N     . SER C 2  245  ? -29.746 -32.341 62.021  1.00 135.93 ? 245  SER C N     1 
ATOM   5106  C  CA    . SER C 2  245  ? -29.605 -33.460 61.095  1.00 134.24 ? 245  SER C CA    1 
ATOM   5107  C  C     . SER C 2  245  ? -30.965 -34.055 60.759  1.00 132.79 ? 245  SER C C     1 
ATOM   5108  O  O     . SER C 2  245  ? -31.077 -34.918 59.890  1.00 131.98 ? 245  SER C O     1 
ATOM   5109  C  CB    . SER C 2  245  ? -28.692 -34.537 61.680  1.00 139.16 ? 245  SER C CB    1 
ATOM   5110  O  OG    . SER C 2  245  ? -27.432 -33.998 62.034  1.00 144.49 ? 245  SER C OG    1 
ATOM   5111  N  N     . GLU C 2  246  ? -31.993 -33.588 61.463  1.00 136.14 ? 246  GLU C N     1 
ATOM   5112  C  CA    . GLU C 2  246  ? -33.366 -34.010 61.217  1.00 143.92 ? 246  GLU C CA    1 
ATOM   5113  C  C     . GLU C 2  246  ? -34.064 -33.084 60.221  1.00 142.17 ? 246  GLU C C     1 
ATOM   5114  O  O     . GLU C 2  246  ? -34.940 -33.515 59.471  1.00 137.39 ? 246  GLU C O     1 
ATOM   5115  C  CB    . GLU C 2  246  ? -34.155 -34.062 62.529  1.00 142.58 ? 246  GLU C CB    1 
ATOM   5116  C  CG    . GLU C 2  246  ? -34.236 -35.444 63.170  1.00 135.81 ? 246  GLU C CG    1 
ATOM   5117  C  CD    . GLU C 2  246  ? -32.884 -35.989 63.592  1.00 142.01 ? 246  GLU C CD    1 
ATOM   5118  O  OE1   . GLU C 2  246  ? -31.949 -35.187 63.804  1.00 141.17 ? 246  GLU C OE1   1 
ATOM   5119  O  OE2   . GLU C 2  246  ? -32.756 -37.226 63.712  1.00 147.40 ? 246  GLU C OE2   1 
ATOM   5120  N  N     . GLN C 2  247  ? -33.676 -31.812 60.220  1.00 141.82 ? 247  GLN C N     1 
ATOM   5121  C  CA    . GLN C 2  247  ? -34.232 -30.851 59.272  1.00 141.92 ? 247  GLN C CA    1 
ATOM   5122  C  C     . GLN C 2  247  ? -33.667 -31.091 57.874  1.00 143.05 ? 247  GLN C C     1 
ATOM   5123  O  O     . GLN C 2  247  ? -34.296 -30.746 56.872  1.00 139.02 ? 247  GLN C O     1 
ATOM   5124  C  CB    . GLN C 2  247  ? -33.951 -29.413 59.722  1.00 142.12 ? 247  GLN C CB    1 
ATOM   5125  C  CG    . GLN C 2  247  ? -34.841 -28.926 60.860  1.00 134.49 ? 247  GLN C CG    1 
ATOM   5126  C  CD    . GLN C 2  247  ? -34.577 -27.477 61.230  1.00 130.80 ? 247  GLN C CD    1 
ATOM   5127  O  OE1   . GLN C 2  247  ? -33.516 -27.141 61.757  1.00 137.55 ? 247  GLN C OE1   1 
ATOM   5128  N  NE2   . GLN C 2  247  ? -35.544 -26.609 60.952  1.00 123.94 ? 247  GLN C NE2   1 
ATOM   5129  N  N     . ILE C 2  248  ? -32.477 -31.683 57.821  1.00 147.93 ? 248  ILE C N     1 
ATOM   5130  C  CA    . ILE C 2  248  ? -31.854 -32.067 56.557  1.00 143.34 ? 248  ILE C CA    1 
ATOM   5131  C  C     . ILE C 2  248  ? -32.683 -33.146 55.869  1.00 144.00 ? 248  ILE C C     1 
ATOM   5132  O  O     . ILE C 2  248  ? -32.901 -33.102 54.659  1.00 143.03 ? 248  ILE C O     1 
ATOM   5133  C  CB    . ILE C 2  248  ? -30.414 -32.585 56.762  1.00 139.14 ? 248  ILE C CB    1 
ATOM   5134  C  CG1   . ILE C 2  248  ? -29.566 -31.548 57.499  1.00 141.11 ? 248  ILE C CG1   1 
ATOM   5135  C  CG2   . ILE C 2  248  ? -29.776 -32.941 55.427  1.00 134.53 ? 248  ILE C CG2   1 
ATOM   5136  C  CD1   . ILE C 2  248  ? -28.152 -32.008 57.783  1.00 135.04 ? 248  ILE C CD1   1 
ATOM   5137  N  N     . VAL C 2  249  ? -33.145 -34.114 56.655  1.00 146.66 ? 249  VAL C N     1 
ATOM   5138  C  CA    . VAL C 2  249  ? -33.984 -35.187 56.138  1.00 143.94 ? 249  VAL C CA    1 
ATOM   5139  C  C     . VAL C 2  249  ? -35.346 -34.642 55.708  1.00 137.18 ? 249  VAL C C     1 
ATOM   5140  O  O     . VAL C 2  249  ? -35.965 -35.154 54.777  1.00 138.06 ? 249  VAL C O     1 
ATOM   5141  C  CB    . VAL C 2  249  ? -34.181 -36.307 57.189  1.00 145.22 ? 249  VAL C CB    1 
ATOM   5142  C  CG1   . VAL C 2  249  ? -34.931 -37.485 56.587  1.00 140.16 ? 249  VAL C CG1   1 
ATOM   5143  C  CG2   . VAL C 2  249  ? -32.841 -36.764 57.741  1.00 138.89 ? 249  VAL C CG2   1 
ATOM   5144  N  N     . GLU C 2  250  ? -35.801 -33.590 56.379  1.00 130.61 ? 250  GLU C N     1 
ATOM   5145  C  CA    . GLU C 2  250  ? -37.121 -33.025 56.115  1.00 131.85 ? 250  GLU C CA    1 
ATOM   5146  C  C     . GLU C 2  250  ? -37.196 -32.267 54.790  1.00 137.86 ? 250  GLU C C     1 
ATOM   5147  O  O     . GLU C 2  250  ? -38.026 -32.573 53.933  1.00 139.45 ? 250  GLU C O     1 
ATOM   5148  C  CB    . GLU C 2  250  ? -37.530 -32.091 57.254  1.00 127.73 ? 250  GLU C CB    1 
ATOM   5149  C  CG    . GLU C 2  250  ? -38.878 -31.424 57.044  1.00 138.17 ? 250  GLU C CG    1 
ATOM   5150  C  CD    . GLU C 2  250  ? -39.116 -30.286 58.013  1.00 141.66 ? 250  GLU C CD    1 
ATOM   5151  O  OE1   . GLU C 2  250  ? -40.271 -29.824 58.123  1.00 145.90 ? 250  GLU C OE1   1 
ATOM   5152  O  OE2   . GLU C 2  250  ? -38.143 -29.850 58.663  1.00 142.28 ? 250  GLU C OE2   1 
ATOM   5153  N  N     . ARG C 2  251  ? -36.323 -31.278 54.635  1.00 140.37 ? 251  ARG C N     1 
ATOM   5154  C  CA    . ARG C 2  251  ? -36.373 -30.363 53.499  1.00 140.12 ? 251  ARG C CA    1 
ATOM   5155  C  C     . ARG C 2  251  ? -35.954 -31.006 52.176  1.00 141.24 ? 251  ARG C C     1 
ATOM   5156  O  O     . ARG C 2  251  ? -36.527 -30.711 51.129  1.00 137.94 ? 251  ARG C O     1 
ATOM   5157  C  CB    . ARG C 2  251  ? -35.491 -29.143 53.780  1.00 130.41 ? 251  ARG C CB    1 
ATOM   5158  C  CG    . ARG C 2  251  ? -35.519 -28.079 52.695  1.00 118.49 ? 251  ARG C CG    1 
ATOM   5159  C  CD    . ARG C 2  251  ? -36.902 -27.466 52.558  1.00 111.47 ? 251  ARG C CD    1 
ATOM   5160  N  NE    . ARG C 2  251  ? -36.913 -26.369 51.595  1.00 107.35 ? 251  ARG C NE    1 
ATOM   5161  C  CZ    . ARG C 2  251  ? -36.629 -25.107 51.900  1.00 108.01 ? 251  ARG C CZ    1 
ATOM   5162  N  NH1   . ARG C 2  251  ? -36.310 -24.780 53.145  1.00 112.55 ? 251  ARG C NH1   1 
ATOM   5163  N  NH2   . ARG C 2  251  ? -36.662 -24.172 50.961  1.00 105.88 ? 251  ARG C NH2   1 
ATOM   5164  N  N     . PHE C 2  252  ? -34.956 -31.884 52.228  1.00 144.90 ? 252  PHE C N     1 
ATOM   5165  C  CA    . PHE C 2  252  ? -34.384 -32.459 51.014  1.00 144.28 ? 252  PHE C CA    1 
ATOM   5166  C  C     . PHE C 2  252  ? -34.604 -33.971 50.927  1.00 146.55 ? 252  PHE C C     1 
ATOM   5167  O  O     . PHE C 2  252  ? -33.921 -34.664 50.170  1.00 143.88 ? 252  PHE C O     1 
ATOM   5168  C  CB    . PHE C 2  252  ? -32.883 -32.153 50.938  1.00 144.16 ? 252  PHE C CB    1 
ATOM   5169  C  CG    . PHE C 2  252  ? -32.539 -30.697 51.137  1.00 146.53 ? 252  PHE C CG    1 
ATOM   5170  C  CD1   . PHE C 2  252  ? -32.516 -29.820 50.063  1.00 141.34 ? 252  PHE C CD1   1 
ATOM   5171  C  CD2   . PHE C 2  252  ? -32.221 -30.210 52.396  1.00 147.81 ? 252  PHE C CD2   1 
ATOM   5172  C  CE1   . PHE C 2  252  ? -32.193 -28.484 50.244  1.00 136.31 ? 252  PHE C CE1   1 
ATOM   5173  C  CE2   . PHE C 2  252  ? -31.898 -28.876 52.583  1.00 142.41 ? 252  PHE C CE2   1 
ATOM   5174  C  CZ    . PHE C 2  252  ? -31.884 -28.013 51.505  1.00 135.22 ? 252  PHE C CZ    1 
ATOM   5175  N  N     . GLY C 2  253  ? -35.562 -34.478 51.696  1.00 148.70 ? 253  GLY C N     1 
ATOM   5176  C  CA    . GLY C 2  253  ? -35.808 -35.908 51.762  1.00 145.85 ? 253  GLY C CA    1 
ATOM   5177  C  C     . GLY C 2  253  ? -36.518 -36.479 50.552  1.00 139.45 ? 253  GLY C C     1 
ATOM   5178  O  O     . GLY C 2  253  ? -36.467 -37.686 50.307  1.00 139.06 ? 253  GLY C O     1 
ATOM   5179  N  N     . PHE C 2  254  ? -37.173 -35.611 49.786  1.00 135.39 ? 254  PHE C N     1 
ATOM   5180  C  CA    . PHE C 2  254  ? -37.936 -36.041 48.617  1.00 134.40 ? 254  PHE C CA    1 
ATOM   5181  C  C     . PHE C 2  254  ? -37.034 -36.600 47.520  1.00 128.00 ? 254  PHE C C     1 
ATOM   5182  O  O     . PHE C 2  254  ? -37.515 -37.168 46.540  1.00 131.66 ? 254  PHE C O     1 
ATOM   5183  C  CB    . PHE C 2  254  ? -38.781 -34.884 48.070  1.00 130.49 ? 254  PHE C CB    1 
ATOM   5184  C  CG    . PHE C 2  254  ? -37.981 -33.675 47.666  1.00 127.23 ? 254  PHE C CG    1 
ATOM   5185  C  CD1   . PHE C 2  254  ? -37.676 -32.689 48.589  1.00 127.72 ? 254  PHE C CD1   1 
ATOM   5186  C  CD2   . PHE C 2  254  ? -37.550 -33.517 46.359  1.00 125.39 ? 254  PHE C CD2   1 
ATOM   5187  C  CE1   . PHE C 2  254  ? -36.946 -31.575 48.218  1.00 127.57 ? 254  PHE C CE1   1 
ATOM   5188  C  CE2   . PHE C 2  254  ? -36.819 -32.404 45.984  1.00 126.44 ? 254  PHE C CE2   1 
ATOM   5189  C  CZ    . PHE C 2  254  ? -36.517 -31.433 46.915  1.00 125.19 ? 254  PHE C CZ    1 
ATOM   5190  N  N     . SER C 2  255  ? -35.726 -36.441 47.686  1.00 123.25 ? 255  SER C N     1 
ATOM   5191  C  CA    . SER C 2  255  ? -34.773 -36.989 46.733  1.00 128.74 ? 255  SER C CA    1 
ATOM   5192  C  C     . SER C 2  255  ? -33.946 -38.097 47.366  1.00 133.31 ? 255  SER C C     1 
ATOM   5193  O  O     . SER C 2  255  ? -33.775 -38.142 48.583  1.00 136.01 ? 255  SER C O     1 
ATOM   5194  C  CB    . SER C 2  255  ? -33.852 -35.895 46.201  1.00 133.29 ? 255  SER C CB    1 
ATOM   5195  O  OG    . SER C 2  255  ? -33.022 -35.384 47.227  1.00 136.31 ? 255  SER C OG    1 
ATOM   5196  N  N     . GLU C 2  256  ? -33.433 -38.989 46.528  1.00 133.97 ? 256  GLU C N     1 
ATOM   5197  C  CA    . GLU C 2  256  ? -32.605 -40.088 46.999  1.00 144.32 ? 256  GLU C CA    1 
ATOM   5198  C  C     . GLU C 2  256  ? -31.133 -39.686 46.967  1.00 140.87 ? 256  GLU C C     1 
ATOM   5199  O  O     . GLU C 2  256  ? -30.284 -40.338 47.575  1.00 143.06 ? 256  GLU C O     1 
ATOM   5200  C  CB    . GLU C 2  256  ? -32.846 -41.340 46.150  1.00 151.30 ? 256  GLU C CB    1 
ATOM   5201  C  CG    . GLU C 2  256  ? -32.275 -42.626 46.733  1.00 152.57 ? 256  GLU C CG    1 
ATOM   5202  C  CD    . GLU C 2  256  ? -32.951 -43.041 48.027  1.00 151.81 ? 256  GLU C CD    1 
ATOM   5203  O  OE1   . GLU C 2  256  ? -34.106 -42.625 48.264  1.00 142.59 ? 256  GLU C OE1   1 
ATOM   5204  O  OE2   . GLU C 2  256  ? -32.324 -43.785 48.810  1.00 154.16 ? 256  GLU C OE2   1 
ATOM   5205  N  N     . ILE C 2  257  ? -30.839 -38.598 46.263  1.00 134.89 ? 257  ILE C N     1 
ATOM   5206  C  CA    . ILE C 2  257  ? -29.466 -38.132 46.117  1.00 132.14 ? 257  ILE C CA    1 
ATOM   5207  C  C     . ILE C 2  257  ? -29.017 -37.314 47.328  1.00 134.54 ? 257  ILE C C     1 
ATOM   5208  O  O     . ILE C 2  257  ? -27.821 -37.202 47.599  1.00 135.64 ? 257  ILE C O     1 
ATOM   5209  C  CB    . ILE C 2  257  ? -29.296 -37.295 44.833  1.00 131.52 ? 257  ILE C CB    1 
ATOM   5210  C  CG1   . ILE C 2  257  ? -30.222 -36.077 44.852  1.00 133.61 ? 257  ILE C CG1   1 
ATOM   5211  C  CG2   . ILE C 2  257  ? -29.575 -38.146 43.605  1.00 126.69 ? 257  ILE C CG2   1 
ATOM   5212  C  CD1   . ILE C 2  257  ? -29.505 -34.771 45.111  1.00 132.40 ? 257  ILE C CD1   1 
ATOM   5213  N  N     . MET C 2  258  ? -29.977 -36.748 48.054  1.00 132.42 ? 258  MET C N     1 
ATOM   5214  C  CA    . MET C 2  258  ? -29.676 -36.000 49.271  1.00 135.20 ? 258  MET C CA    1 
ATOM   5215  C  C     . MET C 2  258  ? -29.614 -36.931 50.473  1.00 139.03 ? 258  MET C C     1 
ATOM   5216  O  O     . MET C 2  258  ? -28.819 -36.728 51.392  1.00 138.81 ? 258  MET C O     1 
ATOM   5217  C  CB    . MET C 2  258  ? -30.716 -34.905 49.507  1.00 134.11 ? 258  MET C CB    1 
ATOM   5218  C  CG    . MET C 2  258  ? -30.573 -33.708 48.584  1.00 134.15 ? 258  MET C CG    1 
ATOM   5219  S  SD    . MET C 2  258  ? -29.026 -32.815 48.832  1.00 124.40 ? 258  MET C SD    1 
ATOM   5220  C  CE    . MET C 2  258  ? -29.212 -32.263 50.526  1.00 129.58 ? 258  MET C CE    1 
ATOM   5221  N  N     . ARG C 2  259  ? -30.469 -37.948 50.460  1.00 139.32 ? 259  ARG C N     1 
ATOM   5222  C  CA    . ARG C 2  259  ? -30.437 -38.988 51.479  1.00 141.34 ? 259  ARG C CA    1 
ATOM   5223  C  C     . ARG C 2  259  ? -29.119 -39.747 51.393  1.00 132.52 ? 259  ARG C C     1 
ATOM   5224  O  O     . ARG C 2  259  ? -28.537 -40.126 52.408  1.00 127.84 ? 259  ARG C O     1 
ATOM   5225  C  CB    . ARG C 2  259  ? -31.621 -39.941 51.312  1.00 145.90 ? 259  ARG C CB    1 
ATOM   5226  C  CG    . ARG C 2  259  ? -32.974 -39.299 51.567  1.00 136.99 ? 259  ARG C CG    1 
ATOM   5227  C  CD    . ARG C 2  259  ? -33.115 -38.894 53.023  1.00 140.64 ? 259  ARG C CD    1 
ATOM   5228  N  NE    . ARG C 2  259  ? -34.456 -38.407 53.328  1.00 140.89 ? 259  ARG C NE    1 
ATOM   5229  C  CZ    . ARG C 2  259  ? -35.489 -39.193 53.614  1.00 151.26 ? 259  ARG C CZ    1 
ATOM   5230  N  NH1   . ARG C 2  259  ? -35.336 -40.511 53.632  1.00 156.30 ? 259  ARG C NH1   1 
ATOM   5231  N  NH2   . ARG C 2  259  ? -36.675 -38.663 53.880  1.00 149.21 ? 259  ARG C NH2   1 
ATOM   5232  N  N     . SER C 2  260  ? -28.650 -39.954 50.167  1.00 129.11 ? 260  SER C N     1 
ATOM   5233  C  CA    . SER C 2  260  ? -27.372 -40.612 49.929  1.00 127.90 ? 260  SER C CA    1 
ATOM   5234  C  C     . SER C 2  260  ? -26.214 -39.726 50.362  1.00 130.65 ? 260  SER C C     1 
ATOM   5235  O  O     . SER C 2  260  ? -25.108 -40.205 50.606  1.00 129.30 ? 260  SER C O     1 
ATOM   5236  C  CB    . SER C 2  260  ? -27.225 -40.975 48.451  1.00 129.59 ? 260  SER C CB    1 
ATOM   5237  O  OG    . SER C 2  260  ? -25.921 -41.455 48.174  1.00 130.66 ? 260  SER C OG    1 
ATOM   5238  N  N     . THR C 2  261  ? -26.476 -38.428 50.451  1.00 132.58 ? 261  THR C N     1 
ATOM   5239  C  CA    . THR C 2  261  ? -25.450 -37.466 50.823  1.00 131.65 ? 261  THR C CA    1 
ATOM   5240  C  C     . THR C 2  261  ? -25.311 -37.378 52.337  1.00 135.04 ? 261  THR C C     1 
ATOM   5241  O  O     . THR C 2  261  ? -24.200 -37.381 52.868  1.00 141.83 ? 261  THR C O     1 
ATOM   5242  C  CB    . THR C 2  261  ? -25.758 -36.070 50.256  1.00 128.30 ? 261  THR C CB    1 
ATOM   5243  O  OG1   . THR C 2  261  ? -26.019 -36.171 48.850  1.00 127.00 ? 261  THR C OG1   1 
ATOM   5244  C  CG2   . THR C 2  261  ? -24.586 -35.131 50.485  1.00 126.67 ? 261  THR C CG2   1 
ATOM   5245  N  N     . LEU C 2  262  ? -26.444 -37.306 53.029  1.00 129.50 ? 262  LEU C N     1 
ATOM   5246  C  CA    . LEU C 2  262  ? -26.444 -37.220 54.485  1.00 125.22 ? 262  LEU C CA    1 
ATOM   5247  C  C     . LEU C 2  262  ? -25.966 -38.528 55.104  1.00 131.39 ? 262  LEU C C     1 
ATOM   5248  O  O     . LEU C 2  262  ? -25.482 -38.554 56.237  1.00 129.48 ? 262  LEU C O     1 
ATOM   5249  C  CB    . LEU C 2  262  ? -27.840 -36.866 55.003  1.00 124.72 ? 262  LEU C CB    1 
ATOM   5250  C  CG    . LEU C 2  262  ? -27.942 -36.622 56.509  1.00 128.08 ? 262  LEU C CG    1 
ATOM   5251  C  CD1   . LEU C 2  262  ? -26.993 -35.516 56.929  1.00 128.08 ? 262  LEU C CD1   1 
ATOM   5252  C  CD2   . LEU C 2  262  ? -29.366 -36.290 56.911  1.00 134.88 ? 262  LEU C CD2   1 
ATOM   5253  N  N     . GLU C 2  263  ? -26.098 -39.612 54.346  1.00 138.90 ? 263  GLU C N     1 
ATOM   5254  C  CA    . GLU C 2  263  ? -25.678 -40.935 54.796  1.00 147.06 ? 263  GLU C CA    1 
ATOM   5255  C  C     . GLU C 2  263  ? -24.171 -41.120 54.622  1.00 144.20 ? 263  GLU C C     1 
ATOM   5256  O  O     . GLU C 2  263  ? -23.499 -41.670 55.495  1.00 143.87 ? 263  GLU C O     1 
ATOM   5257  C  CB    . GLU C 2  263  ? -26.442 -42.022 54.034  1.00 148.09 ? 263  GLU C CB    1 
ATOM   5258  C  CG    . GLU C 2  263  ? -26.474 -43.381 54.722  1.00 149.09 ? 263  GLU C CG    1 
ATOM   5259  C  CD    . GLU C 2  263  ? -25.253 -44.227 54.418  1.00 146.76 ? 263  GLU C CD    1 
ATOM   5260  O  OE1   . GLU C 2  263  ? -24.582 -43.963 53.398  1.00 145.83 ? 263  GLU C OE1   1 
ATOM   5261  O  OE2   . GLU C 2  263  ? -24.967 -45.158 55.201  1.00 145.55 ? 263  GLU C OE2   1 
ATOM   5262  N  N     . LYS C 2  264  ? -23.646 -40.654 53.492  1.00 140.93 ? 264  LYS C N     1 
ATOM   5263  C  CA    . LYS C 2  264  ? -22.212 -40.711 53.227  1.00 137.83 ? 264  LYS C CA    1 
ATOM   5264  C  C     . LYS C 2  264  ? -21.481 -39.567 53.920  1.00 137.47 ? 264  LYS C C     1 
ATOM   5265  O  O     . LYS C 2  264  ? -20.265 -39.423 53.789  1.00 141.52 ? 264  LYS C O     1 
ATOM   5266  C  CB    . LYS C 2  264  ? -21.940 -40.671 51.725  1.00 131.72 ? 264  LYS C CB    1 
ATOM   5267  C  CG    . LYS C 2  264  ? -22.465 -41.874 50.975  1.00 125.33 ? 264  LYS C CG    1 
ATOM   5268  C  CD    . LYS C 2  264  ? -22.344 -41.669 49.480  1.00 125.66 ? 264  LYS C CD    1 
ATOM   5269  C  CE    . LYS C 2  264  ? -23.057 -42.770 48.718  1.00 135.53 ? 264  LYS C CE    1 
ATOM   5270  N  NZ    . LYS C 2  264  ? -23.121 -42.480 47.258  1.00 138.38 ? 264  LYS C NZ    1 
ATOM   5271  N  N     . ASP C 2  265  ? -22.239 -38.751 54.645  1.00 133.85 ? 265  ASP C N     1 
ATOM   5272  C  CA    . ASP C 2  265  ? -21.678 -37.662 55.431  1.00 128.82 ? 265  ASP C CA    1 
ATOM   5273  C  C     . ASP C 2  265  ? -20.663 -38.187 56.436  1.00 126.26 ? 265  ASP C C     1 
ATOM   5274  O  O     . ASP C 2  265  ? -20.950 -39.110 57.197  1.00 125.84 ? 265  ASP C O     1 
ATOM   5275  C  CB    . ASP C 2  265  ? -22.787 -36.899 56.151  1.00 128.10 ? 265  ASP C CB    1 
ATOM   5276  C  CG    . ASP C 2  265  ? -22.266 -36.052 57.289  1.00 125.78 ? 265  ASP C CG    1 
ATOM   5277  O  OD1   . ASP C 2  265  ? -21.267 -35.329 57.089  1.00 117.50 ? 265  ASP C OD1   1 
ATOM   5278  O  OD2   . ASP C 2  265  ? -22.854 -36.116 58.389  1.00 131.68 ? 265  ASP C OD2   1 
ATOM   5279  N  N     . ASN C 2  266  ? -19.478 -37.586 56.434  1.00 125.90 ? 266  ASN C N     1 
ATOM   5280  C  CA    . ASN C 2  266  ? -18.380 -38.049 57.272  1.00 128.93 ? 266  ASN C CA    1 
ATOM   5281  C  C     . ASN C 2  266  ? -18.659 -37.868 58.763  1.00 132.25 ? 266  ASN C C     1 
ATOM   5282  O  O     . ASN C 2  266  ? -18.802 -38.846 59.495  1.00 138.93 ? 266  ASN C O     1 
ATOM   5283  C  CB    . ASN C 2  266  ? -17.089 -37.325 56.887  1.00 124.33 ? 266  ASN C CB    1 
ATOM   5284  C  CG    . ASN C 2  266  ? -15.848 -38.116 57.246  1.00 116.09 ? 266  ASN C CG    1 
ATOM   5285  O  OD1   . ASN C 2  266  ? -15.806 -38.801 58.268  1.00 117.67 ? 266  ASN C OD1   1 
ATOM   5286  N  ND2   . ASN C 2  266  ? -14.829 -38.031 56.400  1.00 106.40 ? 266  ASN C ND2   1 
ATOM   5287  N  N     . THR C 2  267  ? -18.738 -36.619 59.211  1.00 132.75 ? 267  THR C N     1 
ATOM   5288  C  CA    . THR C 2  267  ? -18.941 -36.340 60.629  1.00 128.25 ? 267  THR C CA    1 
ATOM   5289  C  C     . THR C 2  267  ? -20.268 -35.635 60.891  1.00 123.94 ? 267  THR C C     1 
ATOM   5290  O  O     . THR C 2  267  ? -20.871 -35.065 59.984  1.00 121.57 ? 267  THR C O     1 
ATOM   5291  C  CB    . THR C 2  267  ? -17.796 -35.479 61.204  1.00 129.77 ? 267  THR C CB    1 
ATOM   5292  O  OG1   . THR C 2  267  ? -17.780 -34.200 60.558  1.00 137.61 ? 267  THR C OG1   1 
ATOM   5293  C  CG2   . THR C 2  267  ? -16.456 -36.166 60.991  1.00 126.40 ? 267  THR C CG2   1 
ATOM   5294  N  N     . VAL C 2  268  ? -20.718 -35.686 62.141  1.00 124.38 ? 268  VAL C N     1 
ATOM   5295  C  CA    . VAL C 2  268  ? -21.931 -34.991 62.554  1.00 133.35 ? 268  VAL C CA    1 
ATOM   5296  C  C     . VAL C 2  268  ? -21.620 -34.108 63.766  1.00 140.64 ? 268  VAL C C     1 
ATOM   5297  O  O     . VAL C 2  268  ? -20.676 -34.375 64.513  1.00 132.37 ? 268  VAL C O     1 
ATOM   5298  C  CB    . VAL C 2  268  ? -23.070 -35.987 62.882  1.00 127.15 ? 268  VAL C CB    1 
ATOM   5299  C  CG1   . VAL C 2  268  ? -22.766 -36.746 64.163  1.00 139.94 ? 268  VAL C CG1   1 
ATOM   5300  C  CG2   . VAL C 2  268  ? -24.416 -35.274 62.979  1.00 114.05 ? 268  VAL C CG2   1 
ATOM   5301  N  N     . GLY C 2  269  ? -22.399 -33.045 63.943  1.00 142.88 ? 269  GLY C N     1 
ATOM   5302  C  CA    . GLY C 2  269  ? -22.176 -32.102 65.025  1.00 137.61 ? 269  GLY C CA    1 
ATOM   5303  C  C     . GLY C 2  269  ? -21.936 -30.698 64.504  1.00 137.98 ? 269  GLY C C     1 
ATOM   5304  O  O     . GLY C 2  269  ? -21.193 -30.505 63.542  1.00 141.14 ? 269  GLY C O     1 
ATOM   5305  N  N     . THR C 2  270  ? -22.568 -29.716 65.141  1.00 137.48 ? 270  THR C N     1 
ATOM   5306  C  CA    . THR C 2  270  ? -22.437 -28.321 64.731  1.00 137.21 ? 270  THR C CA    1 
ATOM   5307  C  C     . THR C 2  270  ? -20.997 -27.833 64.894  1.00 144.12 ? 270  THR C C     1 
ATOM   5308  O  O     . THR C 2  270  ? -20.484 -27.098 64.049  1.00 142.72 ? 270  THR C O     1 
ATOM   5309  C  CB    . THR C 2  270  ? -23.384 -27.405 65.534  1.00 132.19 ? 270  THR C CB    1 
ATOM   5310  O  OG1   . THR C 2  270  ? -24.719 -27.920 65.465  1.00 131.23 ? 270  THR C OG1   1 
ATOM   5311  C  CG2   . THR C 2  270  ? -23.366 -25.989 64.976  1.00 129.60 ? 270  THR C CG2   1 
ATOM   5312  N  N     . ASP C 2  271  ? -20.350 -28.249 65.980  1.00 148.91 ? 271  ASP C N     1 
ATOM   5313  C  CA    . ASP C 2  271  ? -18.943 -27.929 66.205  1.00 143.36 ? 271  ASP C CA    1 
ATOM   5314  C  C     . ASP C 2  271  ? -18.056 -28.574 65.146  1.00 140.90 ? 271  ASP C C     1 
ATOM   5315  O  O     . ASP C 2  271  ? -17.224 -27.909 64.530  1.00 137.50 ? 271  ASP C O     1 
ATOM   5316  C  CB    . ASP C 2  271  ? -18.494 -28.383 67.599  1.00 140.62 ? 271  ASP C CB    1 
ATOM   5317  C  CG    . ASP C 2  271  ? -18.648 -27.298 68.649  1.00 140.04 ? 271  ASP C CG    1 
ATOM   5318  O  OD1   . ASP C 2  271  ? -18.692 -27.635 69.851  1.00 144.09 ? 271  ASP C OD1   1 
ATOM   5319  O  OD2   . ASP C 2  271  ? -18.724 -26.110 68.274  1.00 143.66 ? 271  ASP C OD2   1 
ATOM   5320  N  N     . GLU C 2  272  ? -18.251 -29.872 64.935  1.00 141.14 ? 272  GLU C N     1 
ATOM   5321  C  CA    . GLU C 2  272  ? -17.387 -30.657 64.058  1.00 142.57 ? 272  GLU C CA    1 
ATOM   5322  C  C     . GLU C 2  272  ? -17.472 -30.228 62.593  1.00 137.57 ? 272  GLU C C     1 
ATOM   5323  O  O     . GLU C 2  272  ? -16.532 -30.431 61.825  1.00 130.45 ? 272  GLU C O     1 
ATOM   5324  C  CB    . GLU C 2  272  ? -17.729 -32.143 64.188  1.00 137.59 ? 272  GLU C CB    1 
ATOM   5325  C  CG    . GLU C 2  272  ? -17.868 -32.615 65.629  1.00 138.72 ? 272  GLU C CG    1 
ATOM   5326  C  CD    . GLU C 2  272  ? -16.640 -32.308 66.467  1.00 144.17 ? 272  GLU C CD    1 
ATOM   5327  O  OE1   . GLU C 2  272  ? -15.512 -32.506 65.969  1.00 148.74 ? 272  GLU C OE1   1 
ATOM   5328  O  OE2   . GLU C 2  272  ? -16.804 -31.864 67.624  1.00 139.07 ? 272  GLU C OE2   1 
ATOM   5329  N  N     . ALA C 2  273  ? -18.599 -29.636 62.210  1.00 139.75 ? 273  ALA C N     1 
ATOM   5330  C  CA    . ALA C 2  273  ? -18.782 -29.164 60.842  1.00 137.07 ? 273  ALA C CA    1 
ATOM   5331  C  C     . ALA C 2  273  ? -17.991 -27.885 60.602  1.00 130.60 ? 273  ALA C C     1 
ATOM   5332  O  O     . ALA C 2  273  ? -17.239 -27.781 59.633  1.00 130.37 ? 273  ALA C O     1 
ATOM   5333  C  CB    . ALA C 2  273  ? -20.257 -28.938 60.549  1.00 137.38 ? 273  ALA C CB    1 
ATOM   5334  N  N     . LEU C 2  274  ? -18.170 -26.916 61.494  1.00 128.56 ? 274  LEU C N     1 
ATOM   5335  C  CA    . LEU C 2  274  ? -17.458 -25.647 61.412  1.00 131.18 ? 274  LEU C CA    1 
ATOM   5336  C  C     . LEU C 2  274  ? -15.948 -25.871 61.430  1.00 132.02 ? 274  LEU C C     1 
ATOM   5337  O  O     . LEU C 2  274  ? -15.211 -25.249 60.664  1.00 130.29 ? 274  LEU C O     1 
ATOM   5338  C  CB    . LEU C 2  274  ? -17.874 -24.725 62.562  1.00 132.60 ? 274  LEU C CB    1 
ATOM   5339  C  CG    . LEU C 2  274  ? -19.350 -24.321 62.627  1.00 125.98 ? 274  LEU C CG    1 
ATOM   5340  C  CD1   . LEU C 2  274  ? -19.668 -23.651 63.954  1.00 126.97 ? 274  LEU C CD1   1 
ATOM   5341  C  CD2   . LEU C 2  274  ? -19.712 -23.403 61.473  1.00 122.78 ? 274  LEU C CD2   1 
ATOM   5342  N  N     . LEU C 2  275  ? -15.498 -26.769 62.301  1.00 132.34 ? 275  LEU C N     1 
ATOM   5343  C  CA    . LEU C 2  275  ? -14.083 -27.108 62.395  1.00 131.27 ? 275  LEU C CA    1 
ATOM   5344  C  C     . LEU C 2  275  ? -13.593 -27.725 61.093  1.00 129.15 ? 275  LEU C C     1 
ATOM   5345  O  O     . LEU C 2  275  ? -12.477 -27.458 60.648  1.00 132.19 ? 275  LEU C O     1 
ATOM   5346  C  CB    . LEU C 2  275  ? -13.832 -28.068 63.560  1.00 128.93 ? 275  LEU C CB    1 
ATOM   5347  C  CG    . LEU C 2  275  ? -14.076 -27.513 64.965  1.00 126.07 ? 275  LEU C CG    1 
ATOM   5348  C  CD1   . LEU C 2  275  ? -14.001 -28.620 66.004  1.00 127.51 ? 275  LEU C CD1   1 
ATOM   5349  C  CD2   . LEU C 2  275  ? -13.083 -26.409 65.286  1.00 132.17 ? 275  LEU C CD2   1 
ATOM   5350  N  N     . ASP C 2  276  ? -14.442 -28.546 60.485  1.00 127.90 ? 276  ASP C N     1 
ATOM   5351  C  CA    . ASP C 2  276  ? -14.103 -29.221 59.240  1.00 136.42 ? 276  ASP C CA    1 
ATOM   5352  C  C     . ASP C 2  276  ? -13.962 -28.237 58.084  1.00 140.97 ? 276  ASP C C     1 
ATOM   5353  O  O     . ASP C 2  276  ? -13.031 -28.336 57.285  1.00 143.27 ? 276  ASP C O     1 
ATOM   5354  C  CB    . ASP C 2  276  ? -15.157 -30.273 58.900  1.00 135.21 ? 276  ASP C CB    1 
ATOM   5355  C  CG    . ASP C 2  276  ? -14.823 -31.039 57.639  1.00 139.67 ? 276  ASP C CG    1 
ATOM   5356  O  OD1   . ASP C 2  276  ? -13.625 -31.310 57.411  1.00 138.58 ? 276  ASP C OD1   1 
ATOM   5357  O  OD2   . ASP C 2  276  ? -15.755 -31.365 56.874  1.00 140.22 ? 276  ASP C OD2   1 
ATOM   5358  N  N     . ILE C 2  277  ? -14.895 -27.294 57.997  1.00 137.08 ? 277  ILE C N     1 
ATOM   5359  C  CA    . ILE C 2  277  ? -14.869 -26.285 56.944  1.00 131.45 ? 277  ILE C CA    1 
ATOM   5360  C  C     . ILE C 2  277  ? -13.675 -25.350 57.119  1.00 130.91 ? 277  ILE C C     1 
ATOM   5361  O  O     . ILE C 2  277  ? -13.011 -24.983 56.146  1.00 127.30 ? 277  ILE C O     1 
ATOM   5362  C  CB    . ILE C 2  277  ? -16.171 -25.461 56.925  1.00 126.73 ? 277  ILE C CB    1 
ATOM   5363  C  CG1   . ILE C 2  277  ? -17.375 -26.371 56.674  1.00 127.61 ? 277  ILE C CG1   1 
ATOM   5364  C  CG2   . ILE C 2  277  ? -16.105 -24.373 55.865  1.00 126.21 ? 277  ILE C CG2   1 
ATOM   5365  C  CD1   . ILE C 2  277  ? -18.688 -25.629 56.560  1.00 122.00 ? 277  ILE C CD1   1 
ATOM   5366  N  N     . TYR C 2  278  ? -13.405 -24.977 58.366  1.00 131.29 ? 278  TYR C N     1 
ATOM   5367  C  CA    . TYR C 2  278  ? -12.291 -24.093 58.691  1.00 127.83 ? 278  TYR C CA    1 
ATOM   5368  C  C     . TYR C 2  278  ? -10.959 -24.711 58.279  1.00 128.65 ? 278  TYR C C     1 
ATOM   5369  O  O     . TYR C 2  278  ? -10.092 -24.033 57.726  1.00 126.27 ? 278  TYR C O     1 
ATOM   5370  C  CB    . TYR C 2  278  ? -12.282 -23.776 60.191  1.00 123.04 ? 278  TYR C CB    1 
ATOM   5371  C  CG    . TYR C 2  278  ? -11.228 -22.775 60.614  1.00 123.25 ? 278  TYR C CG    1 
ATOM   5372  C  CD1   . TYR C 2  278  ? -11.537 -21.428 60.745  1.00 122.95 ? 278  TYR C CD1   1 
ATOM   5373  C  CD2   . TYR C 2  278  ? -9.926  -23.176 60.891  1.00 133.96 ? 278  TYR C CD2   1 
ATOM   5374  C  CE1   . TYR C 2  278  ? -10.580 -20.510 61.134  1.00 125.20 ? 278  TYR C CE1   1 
ATOM   5375  C  CE2   . TYR C 2  278  ? -8.962  -22.264 61.277  1.00 131.50 ? 278  TYR C CE2   1 
ATOM   5376  C  CZ    . TYR C 2  278  ? -9.295  -20.933 61.397  1.00 127.77 ? 278  TYR C CZ    1 
ATOM   5377  O  OH    . TYR C 2  278  ? -8.342  -20.019 61.783  1.00 130.06 ? 278  TYR C OH    1 
ATOM   5378  N  N     . ARG C 2  279  ? -10.809 -26.004 58.552  1.00 131.21 ? 279  ARG C N     1 
ATOM   5379  C  CA    . ARG C 2  279  ? -9.557  -26.714 58.308  1.00 130.65 ? 279  ARG C CA    1 
ATOM   5380  C  C     . ARG C 2  279  ? -9.218  -26.829 56.826  1.00 127.85 ? 279  ARG C C     1 
ATOM   5381  O  O     . ARG C 2  279  ? -8.057  -27.014 56.462  1.00 133.84 ? 279  ARG C O     1 
ATOM   5382  C  CB    . ARG C 2  279  ? -9.615  -28.109 58.934  1.00 132.12 ? 279  ARG C CB    1 
ATOM   5383  C  CG    . ARG C 2  279  ? -9.330  -28.132 60.425  1.00 132.72 ? 279  ARG C CG    1 
ATOM   5384  C  CD    . ARG C 2  279  ? -9.583  -29.508 61.014  1.00 137.49 ? 279  ARG C CD    1 
ATOM   5385  N  NE    . ARG C 2  279  ? -11.008 -29.819 61.086  1.00 136.75 ? 279  ARG C NE    1 
ATOM   5386  C  CZ    . ARG C 2  279  ? -11.501 -30.951 61.579  1.00 135.46 ? 279  ARG C CZ    1 
ATOM   5387  N  NH1   . ARG C 2  279  ? -10.683 -31.886 62.042  1.00 141.51 ? 279  ARG C NH1   1 
ATOM   5388  N  NH2   . ARG C 2  279  ? -12.812 -31.149 61.609  1.00 136.31 ? 279  ARG C NH2   1 
ATOM   5389  N  N     . LYS C 2  280  ? -10.231 -26.717 55.975  1.00 125.24 ? 280  LYS C N     1 
ATOM   5390  C  CA    . LYS C 2  280  ? -10.037 -26.853 54.536  1.00 128.54 ? 280  LYS C CA    1 
ATOM   5391  C  C     . LYS C 2  280  ? -9.928  -25.495 53.849  1.00 126.45 ? 280  LYS C C     1 
ATOM   5392  O  O     . LYS C 2  280  ? -9.384  -25.386 52.750  1.00 116.15 ? 280  LYS C O     1 
ATOM   5393  C  CB    . LYS C 2  280  ? -11.182 -27.659 53.922  1.00 130.22 ? 280  LYS C CB    1 
ATOM   5394  C  CG    . LYS C 2  280  ? -11.355 -29.047 54.515  1.00 117.38 ? 280  LYS C CG    1 
ATOM   5395  C  CD    . LYS C 2  280  ? -10.267 -29.993 54.050  1.00 110.14 ? 280  LYS C CD    1 
ATOM   5396  C  CE    . LYS C 2  280  ? -10.519 -31.400 54.555  1.00 109.10 ? 280  LYS C CE    1 
ATOM   5397  N  NZ    . LYS C 2  280  ? -9.541  -32.362 53.984  1.00 124.03 ? 280  LYS C NZ    1 
ATOM   5398  N  N     . LEU C 2  281  ? -10.448 -24.461 54.500  1.00 129.22 ? 281  LEU C N     1 
ATOM   5399  C  CA    . LEU C 2  281  ? -10.439 -23.121 53.926  1.00 127.30 ? 281  LEU C CA    1 
ATOM   5400  C  C     . LEU C 2  281  ? -9.105  -22.429 54.185  1.00 135.34 ? 281  LEU C C     1 
ATOM   5401  O  O     . LEU C 2  281  ? -8.439  -21.977 53.253  1.00 133.40 ? 281  LEU C O     1 
ATOM   5402  C  CB    . LEU C 2  281  ? -11.590 -22.288 54.497  1.00 122.28 ? 281  LEU C CB    1 
ATOM   5403  C  CG    . LEU C 2  281  ? -12.222 -21.215 53.604  1.00 121.33 ? 281  LEU C CG    1 
ATOM   5404  C  CD1   . LEU C 2  281  ? -13.524 -20.730 54.221  1.00 125.91 ? 281  LEU C CD1   1 
ATOM   5405  C  CD2   . LEU C 2  281  ? -11.280 -20.041 53.360  1.00 125.33 ? 281  LEU C CD2   1 
ATOM   5406  N  N     . ARG C 2  282  ? -8.724  -22.350 55.456  1.00 136.47 ? 282  ARG C N     1 
ATOM   5407  C  CA    . ARG C 2  282  ? -7.500  -21.661 55.848  1.00 130.39 ? 282  ARG C CA    1 
ATOM   5408  C  C     . ARG C 2  282  ? -6.596  -22.519 56.727  1.00 126.97 ? 282  ARG C C     1 
ATOM   5409  O  O     . ARG C 2  282  ? -6.563  -22.341 57.945  1.00 121.85 ? 282  ARG C O     1 
ATOM   5410  C  CB    . ARG C 2  282  ? -7.836  -20.366 56.586  1.00 126.75 ? 282  ARG C CB    1 
ATOM   5411  C  CG    . ARG C 2  282  ? -8.573  -19.339 55.755  1.00 127.85 ? 282  ARG C CG    1 
ATOM   5412  C  CD    . ARG C 2  282  ? -8.979  -18.155 56.612  1.00 126.82 ? 282  ARG C CD    1 
ATOM   5413  N  NE    . ARG C 2  282  ? -9.633  -17.113 55.829  1.00 126.32 ? 282  ARG C NE    1 
ATOM   5414  C  CZ    . ARG C 2  282  ? -9.009  -16.051 55.333  1.00 137.73 ? 282  ARG C CZ    1 
ATOM   5415  N  NH1   . ARG C 2  282  ? -7.709  -15.885 55.540  1.00 138.74 ? 282  ARG C NH1   1 
ATOM   5416  N  NH2   . ARG C 2  282  ? -9.685  -15.151 54.631  1.00 143.50 ? 282  ARG C NH2   1 
ATOM   5417  N  N     . PRO C 2  283  ? -5.857  -23.455 56.112  1.00 133.11 ? 283  PRO C N     1 
ATOM   5418  C  CA    . PRO C 2  283  ? -4.874  -24.254 56.852  1.00 140.78 ? 283  PRO C CA    1 
ATOM   5419  C  C     . PRO C 2  283  ? -3.688  -23.404 57.306  1.00 141.86 ? 283  PRO C C     1 
ATOM   5420  O  O     . PRO C 2  283  ? -3.305  -22.464 56.609  1.00 139.87 ? 283  PRO C O     1 
ATOM   5421  C  CB    . PRO C 2  283  ? -4.435  -25.312 55.829  1.00 141.23 ? 283  PRO C CB    1 
ATOM   5422  C  CG    . PRO C 2  283  ? -5.510  -25.314 54.781  1.00 133.62 ? 283  PRO C CG    1 
ATOM   5423  C  CD    . PRO C 2  283  ? -5.981  -23.899 54.715  1.00 135.67 ? 283  PRO C CD    1 
ATOM   5424  N  N     . GLY C 2  284  ? -3.119  -23.728 58.463  1.00 138.75 ? 284  GLY C N     1 
ATOM   5425  C  CA    . GLY C 2  284  ? -1.989  -22.982 58.989  1.00 133.26 ? 284  GLY C CA    1 
ATOM   5426  C  C     . GLY C 2  284  ? -2.377  -22.057 60.126  1.00 126.94 ? 284  GLY C C     1 
ATOM   5427  O  O     . GLY C 2  284  ? -1.541  -21.333 60.669  1.00 115.84 ? 284  GLY C O     1 
ATOM   5428  N  N     . GLU C 2  285  ? -3.655  -22.084 60.490  1.00 125.75 ? 285  GLU C N     1 
ATOM   5429  C  CA    . GLU C 2  285  ? -4.183  -21.191 61.513  1.00 117.57 ? 285  GLU C CA    1 
ATOM   5430  C  C     . GLU C 2  285  ? -4.965  -21.964 62.571  1.00 115.66 ? 285  GLU C C     1 
ATOM   5431  O  O     . GLU C 2  285  ? -5.750  -22.851 62.239  1.00 122.93 ? 285  GLU C O     1 
ATOM   5432  C  CB    . GLU C 2  285  ? -5.073  -20.127 60.870  1.00 123.62 ? 285  GLU C CB    1 
ATOM   5433  C  CG    . GLU C 2  285  ? -4.435  -19.443 59.671  1.00 128.46 ? 285  GLU C CG    1 
ATOM   5434  C  CD    . GLU C 2  285  ? -5.458  -18.900 58.698  1.00 131.06 ? 285  GLU C CD    1 
ATOM   5435  O  OE1   . GLU C 2  285  ? -6.627  -18.726 59.100  1.00 141.38 ? 285  GLU C OE1   1 
ATOM   5436  O  OE2   . GLU C 2  285  ? -5.096  -18.655 57.528  1.00 126.86 ? 285  GLU C OE2   1 
ATOM   5437  N  N     . PRO C 2  286  ? -4.758  -21.618 63.851  1.00 111.36 ? 286  PRO C N     1 
ATOM   5438  C  CA    . PRO C 2  286  ? -5.402  -22.291 64.986  1.00 112.89 ? 286  PRO C CA    1 
ATOM   5439  C  C     . PRO C 2  286  ? -6.928  -22.227 64.934  1.00 112.54 ? 286  PRO C C     1 
ATOM   5440  O  O     . PRO C 2  286  ? -7.497  -21.135 64.932  1.00 111.53 ? 286  PRO C O     1 
ATOM   5441  C  CB    . PRO C 2  286  ? -4.865  -21.523 66.199  1.00 117.77 ? 286  PRO C CB    1 
ATOM   5442  C  CG    . PRO C 2  286  ? -4.440  -20.198 65.655  1.00 121.71 ? 286  PRO C CG    1 
ATOM   5443  C  CD    . PRO C 2  286  ? -3.916  -20.492 64.287  1.00 117.06 ? 286  PRO C CD    1 
ATOM   5444  N  N     . PRO C 2  287  ? -7.584  -23.396 64.884  1.00 115.33 ? 287  PRO C N     1 
ATOM   5445  C  CA    . PRO C 2  287  ? -9.044  -23.511 64.810  1.00 116.27 ? 287  PRO C CA    1 
ATOM   5446  C  C     . PRO C 2  287  ? -9.739  -23.431 66.169  1.00 119.88 ? 287  PRO C C     1 
ATOM   5447  O  O     . PRO C 2  287  ? -9.802  -24.419 66.902  1.00 125.08 ? 287  PRO C O     1 
ATOM   5448  C  CB    . PRO C 2  287  ? -9.246  -24.891 64.182  1.00 117.19 ? 287  PRO C CB    1 
ATOM   5449  C  CG    . PRO C 2  287  ? -8.071  -25.675 64.643  1.00 124.66 ? 287  PRO C CG    1 
ATOM   5450  C  CD    . PRO C 2  287  ? -6.922  -24.704 64.735  1.00 129.24 ? 287  PRO C CD    1 
ATOM   5451  N  N     . THR C 2  288  ? -10.256 -22.252 66.495  1.00 123.37 ? 288  THR C N     1 
ATOM   5452  C  CA    . THR C 2  288  ? -11.095 -22.078 67.673  1.00 123.15 ? 288  THR C CA    1 
ATOM   5453  C  C     . THR C 2  288  ? -12.551 -22.288 67.266  1.00 128.39 ? 288  THR C C     1 
ATOM   5454  O  O     . THR C 2  288  ? -12.904 -22.096 66.101  1.00 132.04 ? 288  THR C O     1 
ATOM   5455  C  CB    . THR C 2  288  ? -10.912 -20.676 68.298  1.00 122.04 ? 288  THR C CB    1 
ATOM   5456  O  OG1   . THR C 2  288  ? -9.516  -20.366 68.386  1.00 120.33 ? 288  THR C OG1   1 
ATOM   5457  C  CG2   . THR C 2  288  ? -11.529 -20.608 69.690  1.00 120.33 ? 288  THR C CG2   1 
ATOM   5458  N  N     . LYS C 2  289  ? -13.397 -22.690 68.211  1.00 124.96 ? 289  LYS C N     1 
ATOM   5459  C  CA    . LYS C 2  289  ? -14.827 -22.804 67.941  1.00 122.03 ? 289  LYS C CA    1 
ATOM   5460  C  C     . LYS C 2  289  ? -15.418 -21.430 67.640  1.00 119.65 ? 289  LYS C C     1 
ATOM   5461  O  O     . LYS C 2  289  ? -16.509 -21.320 67.082  1.00 123.96 ? 289  LYS C O     1 
ATOM   5462  C  CB    . LYS C 2  289  ? -15.564 -23.441 69.122  1.00 124.16 ? 289  LYS C CB    1 
ATOM   5463  C  CG    . LYS C 2  289  ? -15.069 -24.821 69.521  1.00 125.01 ? 289  LYS C CG    1 
ATOM   5464  C  CD    . LYS C 2  289  ? -16.047 -25.485 70.478  1.00 122.42 ? 289  LYS C CD    1 
ATOM   5465  C  CE    . LYS C 2  289  ? -15.465 -26.745 71.095  1.00 121.61 ? 289  LYS C CE    1 
ATOM   5466  N  NZ    . LYS C 2  289  ? -14.380 -26.433 72.066  1.00 123.20 ? 289  LYS C NZ    1 
ATOM   5467  N  N     . GLU C 2  290  ? -14.686 -20.385 68.014  1.00 116.51 ? 290  GLU C N     1 
ATOM   5468  C  CA    . GLU C 2  290  ? -15.150 -19.014 67.845  1.00 122.83 ? 290  GLU C CA    1 
ATOM   5469  C  C     . GLU C 2  290  ? -14.524 -18.322 66.634  1.00 122.85 ? 290  GLU C C     1 
ATOM   5470  O  O     . GLU C 2  290  ? -14.944 -17.231 66.253  1.00 123.38 ? 290  GLU C O     1 
ATOM   5471  C  CB    . GLU C 2  290  ? -14.862 -18.206 69.112  1.00 133.48 ? 290  GLU C CB    1 
ATOM   5472  C  CG    . GLU C 2  290  ? -15.646 -18.675 70.328  1.00 138.02 ? 290  GLU C CG    1 
ATOM   5473  C  CD    . GLU C 2  290  ? -17.144 -18.534 70.138  1.00 139.93 ? 290  GLU C CD    1 
ATOM   5474  O  OE1   . GLU C 2  290  ? -17.578 -17.506 69.578  1.00 139.41 ? 290  GLU C OE1   1 
ATOM   5475  O  OE2   . GLU C 2  290  ? -17.886 -19.454 70.543  1.00 143.18 ? 290  GLU C OE2   1 
ATOM   5476  N  N     . SER C 2  291  ? -13.522 -18.956 66.033  1.00 126.18 ? 291  SER C N     1 
ATOM   5477  C  CA    . SER C 2  291  ? -12.861 -18.386 64.863  1.00 121.75 ? 291  SER C CA    1 
ATOM   5478  C  C     . SER C 2  291  ? -13.396 -19.014 63.580  1.00 120.01 ? 291  SER C C     1 
ATOM   5479  O  O     . SER C 2  291  ? -13.157 -18.510 62.483  1.00 113.82 ? 291  SER C O     1 
ATOM   5480  C  CB    . SER C 2  291  ? -11.347 -18.577 64.951  1.00 119.28 ? 291  SER C CB    1 
ATOM   5481  O  OG    . SER C 2  291  ? -11.000 -19.945 64.839  1.00 132.37 ? 291  SER C OG    1 
ATOM   5482  N  N     . ALA C 2  292  ? -14.117 -20.120 63.730  1.00 123.21 ? 292  ALA C N     1 
ATOM   5483  C  CA    . ALA C 2  292  ? -14.734 -20.798 62.597  1.00 121.50 ? 292  ALA C CA    1 
ATOM   5484  C  C     . ALA C 2  292  ? -16.202 -20.410 62.494  1.00 113.93 ? 292  ALA C C     1 
ATOM   5485  O  O     . ALA C 2  292  ? -16.839 -20.601 61.459  1.00 112.34 ? 292  ALA C O     1 
ATOM   5486  C  CB    . ALA C 2  292  ? -14.588 -22.301 62.732  1.00 126.85 ? 292  ALA C CB    1 
ATOM   5487  N  N     . GLN C 2  293  ? -16.735 -19.872 63.585  1.00 110.89 ? 293  GLN C N     1 
ATOM   5488  C  CA    . GLN C 2  293  ? -18.096 -19.361 63.602  1.00 110.55 ? 293  GLN C CA    1 
ATOM   5489  C  C     . GLN C 2  293  ? -18.117 -17.954 63.024  1.00 110.71 ? 293  GLN C C     1 
ATOM   5490  O  O     . GLN C 2  293  ? -19.126 -17.504 62.483  1.00 110.94 ? 293  GLN C O     1 
ATOM   5491  C  CB    . GLN C 2  293  ? -18.652 -19.359 65.029  1.00 117.74 ? 293  GLN C CB    1 
ATOM   5492  C  CG    . GLN C 2  293  ? -20.063 -18.806 65.160  1.00 126.45 ? 293  GLN C CG    1 
ATOM   5493  C  CD    . GLN C 2  293  ? -21.128 -19.839 64.857  1.00 123.80 ? 293  GLN C CD    1 
ATOM   5494  O  OE1   . GLN C 2  293  ? -21.015 -20.997 65.258  1.00 119.72 ? 293  GLN C OE1   1 
ATOM   5495  N  NE2   . GLN C 2  293  ? -22.170 -19.426 64.145  1.00 121.74 ? 293  GLN C NE2   1 
ATOM   5496  N  N     . THR C 2  294  ? -16.984 -17.270 63.131  1.00 114.02 ? 294  THR C N     1 
ATOM   5497  C  CA    . THR C 2  294  ? -16.899 -15.864 62.758  1.00 115.24 ? 294  THR C CA    1 
ATOM   5498  C  C     . THR C 2  294  ? -16.756 -15.645 61.253  1.00 113.35 ? 294  THR C C     1 
ATOM   5499  O  O     . THR C 2  294  ? -17.456 -14.813 60.675  1.00 110.71 ? 294  THR C O     1 
ATOM   5500  C  CB    . THR C 2  294  ? -15.718 -15.173 63.467  1.00 122.20 ? 294  THR C CB    1 
ATOM   5501  O  OG1   . THR C 2  294  ? -15.858 -15.320 64.886  1.00 121.48 ? 294  THR C OG1   1 
ATOM   5502  C  CG2   . THR C 2  294  ? -15.678 -13.693 63.121  1.00 114.63 ? 294  THR C CG2   1 
ATOM   5503  N  N     . LEU C 2  295  ? -15.853 -16.385 60.616  1.00 114.56 ? 295  LEU C N     1 
ATOM   5504  C  CA    . LEU C 2  295  ? -15.559 -16.142 59.207  1.00 116.38 ? 295  LEU C CA    1 
ATOM   5505  C  C     . LEU C 2  295  ? -16.659 -16.669 58.289  1.00 114.80 ? 295  LEU C C     1 
ATOM   5506  O  O     . LEU C 2  295  ? -16.874 -16.132 57.201  1.00 115.58 ? 295  LEU C O     1 
ATOM   5507  C  CB    . LEU C 2  295  ? -14.205 -16.748 58.822  1.00 113.45 ? 295  LEU C CB    1 
ATOM   5508  C  CG    . LEU C 2  295  ? -13.924 -18.248 58.922  1.00 107.42 ? 295  LEU C CG    1 
ATOM   5509  C  CD1   . LEU C 2  295  ? -14.450 -19.010 57.716  1.00 103.51 ? 295  LEU C CD1   1 
ATOM   5510  C  CD2   . LEU C 2  295  ? -12.431 -18.456 59.056  1.00 124.01 ? 295  LEU C CD2   1 
ATOM   5511  N  N     . LEU C 2  296  ? -17.347 -17.721 58.720  1.00 114.44 ? 296  LEU C N     1 
ATOM   5512  C  CA    . LEU C 2  296  ? -18.483 -18.231 57.962  1.00 104.02 ? 296  LEU C CA    1 
ATOM   5513  C  C     . LEU C 2  296  ? -19.564 -17.162 57.874  1.00 97.04  ? 296  LEU C C     1 
ATOM   5514  O  O     . LEU C 2  296  ? -20.279 -17.066 56.878  1.00 90.18  ? 296  LEU C O     1 
ATOM   5515  C  CB    . LEU C 2  296  ? -19.041 -19.507 58.592  1.00 104.75 ? 296  LEU C CB    1 
ATOM   5516  C  CG    . LEU C 2  296  ? -18.614 -20.802 57.896  1.00 118.17 ? 296  LEU C CG    1 
ATOM   5517  C  CD1   . LEU C 2  296  ? -17.217 -21.234 58.324  1.00 118.61 ? 296  LEU C CD1   1 
ATOM   5518  C  CD2   . LEU C 2  296  ? -19.628 -21.910 58.133  1.00 132.66 ? 296  LEU C CD2   1 
ATOM   5519  N  N     . GLU C 2  297  ? -19.670 -16.355 58.925  1.00 98.37  ? 297  GLU C N     1 
ATOM   5520  C  CA    . GLU C 2  297  ? -20.553 -15.199 58.911  1.00 99.44  ? 297  GLU C CA    1 
ATOM   5521  C  C     . GLU C 2  297  ? -20.007 -14.136 57.967  1.00 98.70  ? 297  GLU C C     1 
ATOM   5522  O  O     . GLU C 2  297  ? -20.749 -13.530 57.196  1.00 102.77 ? 297  GLU C O     1 
ATOM   5523  C  CB    . GLU C 2  297  ? -20.712 -14.611 60.318  1.00 102.82 ? 297  GLU C CB    1 
ATOM   5524  C  CG    . GLU C 2  297  ? -21.386 -15.523 61.331  1.00 100.61 ? 297  GLU C CG    1 
ATOM   5525  C  CD    . GLU C 2  297  ? -21.583 -14.847 62.678  1.00 100.08 ? 297  GLU C CD    1 
ATOM   5526  O  OE1   . GLU C 2  297  ? -21.399 -13.615 62.759  1.00 95.23  ? 297  GLU C OE1   1 
ATOM   5527  O  OE2   . GLU C 2  297  ? -21.920 -15.547 63.656  1.00 100.45 ? 297  GLU C OE2   1 
ATOM   5528  N  N     . ASN C 2  298  ? -18.698 -13.921 58.030  1.00 92.68  ? 298  ASN C N     1 
ATOM   5529  C  CA    . ASN C 2  298  ? -18.073 -12.811 57.323  1.00 97.45  ? 298  ASN C CA    1 
ATOM   5530  C  C     . ASN C 2  298  ? -17.954 -13.014 55.815  1.00 100.84 ? 298  ASN C C     1 
ATOM   5531  O  O     . ASN C 2  298  ? -18.075 -12.060 55.048  1.00 106.06 ? 298  ASN C O     1 
ATOM   5532  C  CB    . ASN C 2  298  ? -16.689 -12.534 57.916  1.00 105.03 ? 298  ASN C CB    1 
ATOM   5533  C  CG    . ASN C 2  298  ? -16.763 -11.927 59.304  1.00 111.07 ? 298  ASN C CG    1 
ATOM   5534  O  OD1   . ASN C 2  298  ? -17.702 -11.196 59.624  1.00 109.00 ? 298  ASN C OD1   1 
ATOM   5535  N  ND2   . ASN C 2  298  ? -15.772 -12.226 60.137  1.00 113.08 ? 298  ASN C ND2   1 
ATOM   5536  N  N     . LEU C 2  299  ? -17.729 -14.252 55.389  1.00 98.68  ? 299  LEU C N     1 
ATOM   5537  C  CA    . LEU C 2  299  ? -17.459 -14.526 53.981  1.00 90.98  ? 299  LEU C CA    1 
ATOM   5538  C  C     . LEU C 2  299  ? -18.685 -14.424 53.078  1.00 85.37  ? 299  LEU C C     1 
ATOM   5539  O  O     . LEU C 2  299  ? -18.545 -14.295 51.863  1.00 84.57  ? 299  LEU C O     1 
ATOM   5540  C  CB    . LEU C 2  299  ? -16.836 -15.913 53.818  1.00 85.38  ? 299  LEU C CB    1 
ATOM   5541  C  CG    . LEU C 2  299  ? -15.326 -16.011 54.022  1.00 87.52  ? 299  LEU C CG    1 
ATOM   5542  C  CD1   . LEU C 2  299  ? -14.816 -17.356 53.536  1.00 84.76  ? 299  LEU C CD1   1 
ATOM   5543  C  CD2   . LEU C 2  299  ? -14.613 -14.870 53.312  1.00 90.11  ? 299  LEU C CD2   1 
ATOM   5544  N  N     . PHE C 2  300  ? -19.881 -14.483 53.656  1.00 88.20  ? 300  PHE C N     1 
ATOM   5545  C  CA    . PHE C 2  300  ? -21.089 -14.573 52.839  1.00 94.18  ? 300  PHE C CA    1 
ATOM   5546  C  C     . PHE C 2  300  ? -22.290 -13.766 53.349  1.00 95.33  ? 300  PHE C C     1 
ATOM   5547  O  O     . PHE C 2  300  ? -23.300 -13.662 52.651  1.00 92.93  ? 300  PHE C O     1 
ATOM   5548  C  CB    . PHE C 2  300  ? -21.507 -16.042 52.696  1.00 94.14  ? 300  PHE C CB    1 
ATOM   5549  C  CG    . PHE C 2  300  ? -20.507 -16.900 51.965  1.00 86.30  ? 300  PHE C CG    1 
ATOM   5550  C  CD1   . PHE C 2  300  ? -20.503 -16.961 50.581  1.00 89.09  ? 300  PHE C CD1   1 
ATOM   5551  C  CD2   . PHE C 2  300  ? -19.586 -17.662 52.664  1.00 81.01  ? 300  PHE C CD2   1 
ATOM   5552  C  CE1   . PHE C 2  300  ? -19.591 -17.754 49.910  1.00 89.30  ? 300  PHE C CE1   1 
ATOM   5553  C  CE2   . PHE C 2  300  ? -18.670 -18.455 51.997  1.00 79.11  ? 300  PHE C CE2   1 
ATOM   5554  C  CZ    . PHE C 2  300  ? -18.674 -18.502 50.619  1.00 85.98  ? 300  PHE C CZ    1 
ATOM   5555  N  N     . PHE C 2  301  ? -22.199 -13.199 54.549  1.00 91.97  ? 301  PHE C N     1 
ATOM   5556  C  CA    . PHE C 2  301  ? -23.367 -12.548 55.140  1.00 85.90  ? 301  PHE C CA    1 
ATOM   5557  C  C     . PHE C 2  301  ? -23.074 -11.172 55.727  1.00 83.49  ? 301  PHE C C     1 
ATOM   5558  O  O     . PHE C 2  301  ? -23.889 -10.619 56.467  1.00 81.51  ? 301  PHE C O     1 
ATOM   5559  C  CB    . PHE C 2  301  ? -23.971 -13.447 56.218  1.00 89.98  ? 301  PHE C CB    1 
ATOM   5560  C  CG    . PHE C 2  301  ? -24.253 -14.841 55.746  1.00 89.59  ? 301  PHE C CG    1 
ATOM   5561  C  CD1   . PHE C 2  301  ? -25.399 -15.123 55.026  1.00 89.88  ? 301  PHE C CD1   1 
ATOM   5562  C  CD2   . PHE C 2  301  ? -23.364 -15.868 56.010  1.00 92.09  ? 301  PHE C CD2   1 
ATOM   5563  C  CE1   . PHE C 2  301  ? -25.659 -16.402 54.584  1.00 89.84  ? 301  PHE C CE1   1 
ATOM   5564  C  CE2   . PHE C 2  301  ? -23.618 -17.150 55.571  1.00 89.10  ? 301  PHE C CE2   1 
ATOM   5565  C  CZ    . PHE C 2  301  ? -24.768 -17.417 54.857  1.00 89.29  ? 301  PHE C CZ    1 
ATOM   5566  N  N     . LYS C 2  302  ? -21.915 -10.617 55.389  1.00 90.70  ? 302  LYS C N     1 
ATOM   5567  C  CA    . LYS C 2  302  ? -21.538 -9.290  55.866  1.00 95.79  ? 302  LYS C CA    1 
ATOM   5568  C  C     . LYS C 2  302  ? -21.309 -8.317  54.714  1.00 90.63  ? 302  LYS C C     1 
ATOM   5569  O  O     . LYS C 2  302  ? -20.727 -8.678  53.692  1.00 88.26  ? 302  LYS C O     1 
ATOM   5570  C  CB    . LYS C 2  302  ? -20.284 -9.372  56.740  1.00 97.55  ? 302  LYS C CB    1 
ATOM   5571  C  CG    . LYS C 2  302  ? -20.565 -9.594  58.219  1.00 93.66  ? 302  LYS C CG    1 
ATOM   5572  C  CD    . LYS C 2  302  ? -21.289 -8.398  58.818  1.00 104.95 ? 302  LYS C CD    1 
ATOM   5573  C  CE    . LYS C 2  302  ? -20.472 -7.120  58.666  1.00 100.97 ? 302  LYS C CE    1 
ATOM   5574  N  NZ    . LYS C 2  302  ? -21.216 -5.909  59.118  1.00 89.21  ? 302  LYS C NZ    1 
ATOM   5575  N  N     . GLU C 2  303  ? -21.757 -7.077  54.898  1.00 91.36  ? 303  GLU C N     1 
ATOM   5576  C  CA    . GLU C 2  303  ? -21.645 -6.041  53.873  1.00 96.08  ? 303  GLU C CA    1 
ATOM   5577  C  C     . GLU C 2  303  ? -20.200 -5.639  53.591  1.00 91.59  ? 303  GLU C C     1 
ATOM   5578  O  O     . GLU C 2  303  ? -19.927 -4.912  52.636  1.00 91.05  ? 303  GLU C O     1 
ATOM   5579  C  CB    . GLU C 2  303  ? -22.445 -4.797  54.281  1.00 107.61 ? 303  GLU C CB    1 
ATOM   5580  C  CG    . GLU C 2  303  ? -23.960 -4.977  54.279  1.00 116.48 ? 303  GLU C CG    1 
ATOM   5581  C  CD    . GLU C 2  303  ? -24.709 -3.685  54.592  1.00 121.24 ? 303  GLU C CD    1 
ATOM   5582  O  OE1   . GLU C 2  303  ? -24.086 -2.743  55.128  1.00 122.32 ? 303  GLU C OE1   1 
ATOM   5583  O  OE2   . GLU C 2  303  ? -25.922 -3.611  54.298  1.00 113.34 ? 303  GLU C OE2   1 
ATOM   5584  N  N     . LYS C 2  304  ? -19.277 -6.105  54.424  1.00 93.24  ? 304  LYS C N     1 
ATOM   5585  C  CA    . LYS C 2  304  ? -17.874 -5.741  54.278  1.00 97.86  ? 304  LYS C CA    1 
ATOM   5586  C  C     . LYS C 2  304  ? -17.160 -6.637  53.271  1.00 97.44  ? 304  LYS C C     1 
ATOM   5587  O  O     . LYS C 2  304  ? -16.510 -6.150  52.346  1.00 112.40 ? 304  LYS C O     1 
ATOM   5588  C  CB    . LYS C 2  304  ? -17.163 -5.804  55.632  1.00 106.21 ? 304  LYS C CB    1 
ATOM   5589  C  CG    . LYS C 2  304  ? -17.815 -4.953  56.713  1.00 111.64 ? 304  LYS C CG    1 
ATOM   5590  C  CD    . LYS C 2  304  ? -17.161 -5.176  58.068  1.00 110.79 ? 304  LYS C CD    1 
ATOM   5591  C  CE    . LYS C 2  304  ? -17.861 -4.377  59.158  1.00 114.02 ? 304  LYS C CE    1 
ATOM   5592  N  NZ    . LYS C 2  304  ? -17.322 -4.690  60.511  1.00 116.05 ? 304  LYS C NZ    1 
ATOM   5593  N  N     . ARG C 2  305  ? -17.285 -7.946  53.448  1.00 90.15  ? 305  ARG C N     1 
ATOM   5594  C  CA    . ARG C 2  305  ? -16.544 -8.886  52.617  1.00 94.17  ? 305  ARG C CA    1 
ATOM   5595  C  C     . ARG C 2  305  ? -17.389 -9.427  51.466  1.00 96.17  ? 305  ARG C C     1 
ATOM   5596  O  O     . ARG C 2  305  ? -16.850 -9.898  50.464  1.00 95.28  ? 305  ARG C O     1 
ATOM   5597  C  CB    . ARG C 2  305  ? -16.016 -10.036 53.475  1.00 100.06 ? 305  ARG C CB    1 
ATOM   5598  C  CG    . ARG C 2  305  ? -15.111 -9.583  54.613  1.00 102.18 ? 305  ARG C CG    1 
ATOM   5599  C  CD    . ARG C 2  305  ? -13.640 -9.636  54.225  1.00 111.89 ? 305  ARG C CD    1 
ATOM   5600  N  NE    . ARG C 2  305  ? -13.123 -11.003 54.257  1.00 120.34 ? 305  ARG C NE    1 
ATOM   5601  C  CZ    . ARG C 2  305  ? -11.858 -11.336 54.018  1.00 119.60 ? 305  ARG C CZ    1 
ATOM   5602  N  NH1   . ARG C 2  305  ? -10.964 -10.401 53.723  1.00 117.06 ? 305  ARG C NH1   1 
ATOM   5603  N  NH2   . ARG C 2  305  ? -11.486 -12.607 54.073  1.00 122.69 ? 305  ARG C NH2   1 
ATOM   5604  N  N     . TYR C 2  306  ? -18.709 -9.346  51.603  1.00 96.55  ? 306  TYR C N     1 
ATOM   5605  C  CA    . TYR C 2  306  ? -19.615 -9.897  50.599  1.00 93.09  ? 306  TYR C CA    1 
ATOM   5606  C  C     . TYR C 2  306  ? -20.699 -8.903  50.216  1.00 92.40  ? 306  TYR C C     1 
ATOM   5607  O  O     . TYR C 2  306  ? -21.228 -8.195  51.070  1.00 95.59  ? 306  TYR C O     1 
ATOM   5608  C  CB    . TYR C 2  306  ? -20.259 -11.180 51.114  1.00 89.96  ? 306  TYR C CB    1 
ATOM   5609  C  CG    . TYR C 2  306  ? -20.803 -12.079 50.029  1.00 87.66  ? 306  TYR C CG    1 
ATOM   5610  C  CD1   . TYR C 2  306  ? -22.140 -12.022 49.649  1.00 86.16  ? 306  TYR C CD1   1 
ATOM   5611  C  CD2   . TYR C 2  306  ? -19.978 -12.993 49.391  1.00 88.85  ? 306  TYR C CD2   1 
ATOM   5612  C  CE1   . TYR C 2  306  ? -22.633 -12.854 48.658  1.00 85.92  ? 306  TYR C CE1   1 
ATOM   5613  C  CE2   . TYR C 2  306  ? -20.460 -13.824 48.405  1.00 88.09  ? 306  TYR C CE2   1 
ATOM   5614  C  CZ    . TYR C 2  306  ? -21.785 -13.754 48.041  1.00 86.98  ? 306  TYR C CZ    1 
ATOM   5615  O  OH    . TYR C 2  306  ? -22.253 -14.591 47.054  1.00 84.16  ? 306  TYR C OH    1 
ATOM   5616  N  N     . ASP C 2  307  ? -21.046 -8.862  48.935  1.00 88.78  ? 307  ASP C N     1 
ATOM   5617  C  CA    . ASP C 2  307  ? -22.042 -7.906  48.477  1.00 84.03  ? 307  ASP C CA    1 
ATOM   5618  C  C     . ASP C 2  307  ? -22.596 -8.226  47.097  1.00 81.74  ? 307  ASP C C     1 
ATOM   5619  O  O     . ASP C 2  307  ? -21.885 -8.147  46.097  1.00 80.40  ? 307  ASP C O     1 
ATOM   5620  C  CB    . ASP C 2  307  ? -21.447 -6.496  48.471  1.00 87.25  ? 307  ASP C CB    1 
ATOM   5621  C  CG    . ASP C 2  307  ? -22.457 -5.441  48.087  1.00 79.06  ? 307  ASP C CG    1 
ATOM   5622  O  OD1   . ASP C 2  307  ? -23.609 -5.516  48.560  1.00 76.37  ? 307  ASP C OD1   1 
ATOM   5623  O  OD2   . ASP C 2  307  ? -22.099 -4.535  47.308  1.00 83.90  ? 307  ASP C OD2   1 
ATOM   5624  N  N     . LEU C 2  308  ? -23.870 -8.597  47.056  1.00 86.14  ? 308  LEU C N     1 
ATOM   5625  C  CA    . LEU C 2  308  ? -24.612 -8.620  45.807  1.00 83.11  ? 308  LEU C CA    1 
ATOM   5626  C  C     . LEU C 2  308  ? -25.161 -7.223  45.597  1.00 89.12  ? 308  LEU C C     1 
ATOM   5627  O  O     . LEU C 2  308  ? -25.759 -6.652  46.509  1.00 96.45  ? 308  LEU C O     1 
ATOM   5628  C  CB    . LEU C 2  308  ? -25.755 -9.634  45.840  1.00 75.65  ? 308  LEU C CB    1 
ATOM   5629  C  CG    . LEU C 2  308  ? -25.482 -11.068 46.289  1.00 75.34  ? 308  LEU C CG    1 
ATOM   5630  C  CD1   . LEU C 2  308  ? -26.784 -11.847 46.323  1.00 78.38  ? 308  LEU C CD1   1 
ATOM   5631  C  CD2   . LEU C 2  308  ? -24.494 -11.739 45.366  1.00 73.68  ? 308  LEU C CD2   1 
ATOM   5632  N  N     . ALA C 2  309  ? -24.964 -6.667  44.409  1.00 91.91  ? 309  ALA C N     1 
ATOM   5633  C  CA    . ALA C 2  309  ? -25.475 -5.332  44.125  1.00 96.54  ? 309  ALA C CA    1 
ATOM   5634  C  C     . ALA C 2  309  ? -26.998 -5.345  44.087  1.00 86.51  ? 309  ALA C C     1 
ATOM   5635  O  O     . ALA C 2  309  ? -27.626 -6.377  44.339  1.00 82.48  ? 309  ALA C O     1 
ATOM   5636  C  CB    . ALA C 2  309  ? -24.912 -4.811  42.813  1.00 92.66  ? 309  ALA C CB    1 
ATOM   5637  N  N     . ARG C 2  310  ? -27.590 -4.194  43.781  1.00 81.54  ? 310  ARG C N     1 
ATOM   5638  C  CA    . ARG C 2  310  ? -29.034 -4.115  43.617  1.00 83.61  ? 310  ARG C CA    1 
ATOM   5639  C  C     . ARG C 2  310  ? -29.482 -5.092  42.542  1.00 83.47  ? 310  ARG C C     1 
ATOM   5640  O  O     . ARG C 2  310  ? -30.540 -5.706  42.653  1.00 87.82  ? 310  ARG C O     1 
ATOM   5641  C  CB    . ARG C 2  310  ? -29.473 -2.693  43.266  1.00 86.21  ? 310  ARG C CB    1 
ATOM   5642  C  CG    . ARG C 2  310  ? -29.584 -1.765  44.462  1.00 92.22  ? 310  ARG C CG    1 
ATOM   5643  C  CD    . ARG C 2  310  ? -30.213 -0.441  44.066  1.00 89.75  ? 310  ARG C CD    1 
ATOM   5644  N  NE    . ARG C 2  310  ? -30.145 0.542   45.143  1.00 97.70  ? 310  ARG C NE    1 
ATOM   5645  C  CZ    . ARG C 2  310  ? -29.071 1.276   45.408  1.00 102.95 ? 310  ARG C CZ    1 
ATOM   5646  N  NH1   . ARG C 2  310  ? -27.975 1.130   44.677  1.00 94.38  ? 310  ARG C NH1   1 
ATOM   5647  N  NH2   . ARG C 2  310  ? -29.088 2.151   46.406  1.00 114.20 ? 310  ARG C NH2   1 
ATOM   5648  N  N     . VAL C 2  311  ? -28.660 -5.242  41.509  1.00 73.98  ? 311  VAL C N     1 
ATOM   5649  C  CA    . VAL C 2  311  ? -28.905 -6.237  40.477  1.00 67.43  ? 311  VAL C CA    1 
ATOM   5650  C  C     . VAL C 2  311  ? -28.635 -7.637  41.029  1.00 71.82  ? 311  VAL C C     1 
ATOM   5651  O  O     . VAL C 2  311  ? -29.357 -8.585  40.721  1.00 68.37  ? 311  VAL C O     1 
ATOM   5652  C  CB    . VAL C 2  311  ? -28.032 -5.975  39.229  1.00 61.81  ? 311  VAL C CB    1 
ATOM   5653  C  CG1   . VAL C 2  311  ? -26.588 -5.707  39.626  1.00 72.24  ? 311  VAL C CG1   1 
ATOM   5654  C  CG2   . VAL C 2  311  ? -28.125 -7.133  38.245  1.00 63.95  ? 311  VAL C CG2   1 
ATOM   5655  N  N     . GLY C 2  312  ? -27.608 -7.751  41.868  1.00 74.91  ? 312  GLY C N     1 
ATOM   5656  C  CA    . GLY C 2  312  ? -27.228 -9.023  42.458  1.00 81.40  ? 312  GLY C CA    1 
ATOM   5657  C  C     . GLY C 2  312  ? -28.321 -9.615  43.326  1.00 83.76  ? 312  GLY C C     1 
ATOM   5658  O  O     . GLY C 2  312  ? -28.617 -10.806 43.247  1.00 86.36  ? 312  GLY C O     1 
ATOM   5659  N  N     . ARG C 2  313  ? -28.925 -8.778  44.158  1.00 79.66  ? 313  ARG C N     1 
ATOM   5660  C  CA    . ARG C 2  313  ? -30.036 -9.209  44.992  1.00 73.77  ? 313  ARG C CA    1 
ATOM   5661  C  C     . ARG C 2  313  ? -31.272 -9.502  44.150  1.00 73.18  ? 313  ARG C C     1 
ATOM   5662  O  O     . ARG C 2  313  ? -31.922 -10.531 44.320  1.00 73.45  ? 313  ARG C O     1 
ATOM   5663  C  CB    . ARG C 2  313  ? -30.360 -8.147  46.038  1.00 82.37  ? 313  ARG C CB    1 
ATOM   5664  C  CG    . ARG C 2  313  ? -31.493 -8.521  46.976  1.00 87.74  ? 313  ARG C CG    1 
ATOM   5665  C  CD    . ARG C 2  313  ? -31.036 -9.513  48.032  1.00 82.43  ? 313  ARG C CD    1 
ATOM   5666  N  NE    . ARG C 2  313  ? -31.065 -10.890 47.552  1.00 77.10  ? 313  ARG C NE    1 
ATOM   5667  C  CZ    . ARG C 2  313  ? -30.649 -11.932 48.261  1.00 76.55  ? 313  ARG C CZ    1 
ATOM   5668  N  NH1   . ARG C 2  313  ? -30.166 -11.752 49.483  1.00 73.92  ? 313  ARG C NH1   1 
ATOM   5669  N  NH2   . ARG C 2  313  ? -30.712 -13.153 47.749  1.00 81.22  ? 313  ARG C NH2   1 
ATOM   5670  N  N     . TYR C 2  314  ? -31.580 -8.585  43.239  1.00 75.70  ? 314  TYR C N     1 
ATOM   5671  C  CA    . TYR C 2  314  ? -32.775 -8.669  42.406  1.00 76.19  ? 314  TYR C CA    1 
ATOM   5672  C  C     . TYR C 2  314  ? -32.743 -9.865  41.462  1.00 77.38  ? 314  TYR C C     1 
ATOM   5673  O  O     . TYR C 2  314  ? -33.775 -10.486 41.206  1.00 76.50  ? 314  TYR C O     1 
ATOM   5674  C  CB    . TYR C 2  314  ? -32.943 -7.367  41.615  1.00 77.39  ? 314  TYR C CB    1 
ATOM   5675  C  CG    . TYR C 2  314  ? -33.968 -7.403  40.503  1.00 82.77  ? 314  TYR C CG    1 
ATOM   5676  C  CD1   . TYR C 2  314  ? -35.290 -7.746  40.755  1.00 92.49  ? 314  TYR C CD1   1 
ATOM   5677  C  CD2   . TYR C 2  314  ? -33.616 -7.059  39.203  1.00 81.83  ? 314  TYR C CD2   1 
ATOM   5678  C  CE1   . TYR C 2  314  ? -36.228 -7.767  39.737  1.00 101.28 ? 314  TYR C CE1   1 
ATOM   5679  C  CE2   . TYR C 2  314  ? -34.546 -7.075  38.180  1.00 83.29  ? 314  TYR C CE2   1 
ATOM   5680  C  CZ    . TYR C 2  314  ? -35.851 -7.430  38.451  1.00 98.60  ? 314  TYR C CZ    1 
ATOM   5681  O  OH    . TYR C 2  314  ? -36.781 -7.449  37.435  1.00 98.55  ? 314  TYR C OH    1 
ATOM   5682  N  N     . LYS C 2  315  ? -31.559 -10.196 40.956  1.00 78.15  ? 315  LYS C N     1 
ATOM   5683  C  CA    . LYS C 2  315  ? -31.431 -11.297 40.008  1.00 82.72  ? 315  LYS C CA    1 
ATOM   5684  C  C     . LYS C 2  315  ? -31.511 -12.654 40.708  1.00 84.14  ? 315  LYS C C     1 
ATOM   5685  O  O     . LYS C 2  315  ? -32.024 -13.620 40.143  1.00 83.26  ? 315  LYS C O     1 
ATOM   5686  C  CB    . LYS C 2  315  ? -30.124 -11.185 39.222  1.00 80.23  ? 315  LYS C CB    1 
ATOM   5687  C  CG    . LYS C 2  315  ? -30.136 -11.973 37.927  1.00 76.57  ? 315  LYS C CG    1 
ATOM   5688  C  CD    . LYS C 2  315  ? -31.348 -11.601 37.089  1.00 62.89  ? 315  LYS C CD    1 
ATOM   5689  C  CE    . LYS C 2  315  ? -31.523 -12.550 35.922  1.00 57.15  ? 315  LYS C CE    1 
ATOM   5690  N  NZ    . LYS C 2  315  ? -32.704 -12.191 35.092  1.00 58.02  ? 315  LYS C NZ    1 
ATOM   5691  N  N     . VAL C 2  316  ? -31.005 -12.724 41.935  1.00 81.73  ? 316  VAL C N     1 
ATOM   5692  C  CA    . VAL C 2  316  ? -31.108 -13.943 42.730  1.00 79.12  ? 316  VAL C CA    1 
ATOM   5693  C  C     . VAL C 2  316  ? -32.560 -14.196 43.118  1.00 82.75  ? 316  VAL C C     1 
ATOM   5694  O  O     . VAL C 2  316  ? -33.043 -15.330 43.071  1.00 82.69  ? 316  VAL C O     1 
ATOM   5695  C  CB    . VAL C 2  316  ? -30.239 -13.870 44.005  1.00 80.56  ? 316  VAL C CB    1 
ATOM   5696  C  CG1   . VAL C 2  316  ? -30.599 -14.994 44.968  1.00 85.80  ? 316  VAL C CG1   1 
ATOM   5697  C  CG2   . VAL C 2  316  ? -28.765 -13.926 43.649  1.00 80.12  ? 316  VAL C CG2   1 
ATOM   5698  N  N     . ASN C 2  317  ? -33.252 -13.121 43.487  1.00 87.81  ? 317  ASN C N     1 
ATOM   5699  C  CA    . ASN C 2  317  ? -34.634 -13.203 43.942  1.00 87.08  ? 317  ASN C CA    1 
ATOM   5700  C  C     . ASN C 2  317  ? -35.580 -13.707 42.864  1.00 87.90  ? 317  ASN C C     1 
ATOM   5701  O  O     . ASN C 2  317  ? -36.391 -14.591 43.119  1.00 92.08  ? 317  ASN C O     1 
ATOM   5702  C  CB    . ASN C 2  317  ? -35.110 -11.840 44.443  1.00 84.61  ? 317  ASN C CB    1 
ATOM   5703  C  CG    . ASN C 2  317  ? -34.481 -11.457 45.764  1.00 80.66  ? 317  ASN C CG    1 
ATOM   5704  O  OD1   . ASN C 2  317  ? -33.470 -12.028 46.174  1.00 84.16  ? 317  ASN C OD1   1 
ATOM   5705  N  ND2   . ASN C 2  317  ? -35.078 -10.485 46.442  1.00 85.52  ? 317  ASN C ND2   1 
ATOM   5706  N  N     . LYS C 2  318  ? -35.476 -13.142 41.666  1.00 82.35  ? 318  LYS C N     1 
ATOM   5707  C  CA    . LYS C 2  318  ? -36.305 -13.579 40.547  1.00 84.54  ? 318  LYS C CA    1 
ATOM   5708  C  C     . LYS C 2  318  ? -36.092 -15.060 40.245  1.00 82.60  ? 318  LYS C C     1 
ATOM   5709  O  O     . LYS C 2  318  ? -37.032 -15.778 39.909  1.00 74.71  ? 318  LYS C O     1 
ATOM   5710  C  CB    . LYS C 2  318  ? -36.011 -12.750 39.295  1.00 86.08  ? 318  LYS C CB    1 
ATOM   5711  C  CG    . LYS C 2  318  ? -36.482 -11.307 39.354  1.00 81.33  ? 318  LYS C CG    1 
ATOM   5712  C  CD    . LYS C 2  318  ? -36.674 -10.748 37.947  1.00 89.05  ? 318  LYS C CD    1 
ATOM   5713  C  CE    . LYS C 2  318  ? -35.453 -10.995 37.069  1.00 90.74  ? 318  LYS C CE    1 
ATOM   5714  N  NZ    . LYS C 2  318  ? -35.669 -10.552 35.660  1.00 84.01  ? 318  LYS C NZ    1 
ATOM   5715  N  N     . LYS C 2  319  ? -34.848 -15.509 40.372  1.00 89.00  ? 319  LYS C N     1 
ATOM   5716  C  CA    . LYS C 2  319  ? -34.498 -16.893 40.080  1.00 82.97  ? 319  LYS C CA    1 
ATOM   5717  C  C     . LYS C 2  319  ? -35.050 -17.841 41.142  1.00 91.15  ? 319  LYS C C     1 
ATOM   5718  O  O     . LYS C 2  319  ? -35.353 -18.997 40.856  1.00 92.11  ? 319  LYS C O     1 
ATOM   5719  C  CB    . LYS C 2  319  ? -32.978 -17.043 39.973  1.00 81.04  ? 319  LYS C CB    1 
ATOM   5720  C  CG    . LYS C 2  319  ? -32.521 -18.368 39.393  1.00 77.75  ? 319  LYS C CG    1 
ATOM   5721  C  CD    . LYS C 2  319  ? -33.166 -18.623 38.042  1.00 79.15  ? 319  LYS C CD    1 
ATOM   5722  C  CE    . LYS C 2  319  ? -32.812 -20.005 37.518  1.00 87.82  ? 319  LYS C CE    1 
ATOM   5723  N  NZ    . LYS C 2  319  ? -33.529 -20.345 36.257  1.00 90.87  ? 319  LYS C NZ    1 
ATOM   5724  N  N     . LEU C 2  320  ? -35.184 -17.339 42.366  1.00 97.76  ? 320  LEU C N     1 
ATOM   5725  C  CA    . LEU C 2  320  ? -35.661 -18.151 43.482  1.00 103.77 ? 320  LEU C CA    1 
ATOM   5726  C  C     . LEU C 2  320  ? -37.097 -17.805 43.870  1.00 104.34 ? 320  LEU C C     1 
ATOM   5727  O  O     . LEU C 2  320  ? -37.786 -18.602 44.509  1.00 106.71 ? 320  LEU C O     1 
ATOM   5728  C  CB    . LEU C 2  320  ? -34.736 -17.987 44.690  1.00 100.16 ? 320  LEU C CB    1 
ATOM   5729  C  CG    . LEU C 2  320  ? -33.349 -18.616 44.549  1.00 91.59  ? 320  LEU C CG    1 
ATOM   5730  C  CD1   . LEU C 2  320  ? -32.544 -18.430 45.825  1.00 93.69  ? 320  LEU C CD1   1 
ATOM   5731  C  CD2   . LEU C 2  320  ? -33.463 -20.093 44.188  1.00 92.03  ? 320  LEU C CD2   1 
ATOM   5732  N  N     . GLY C 2  321  ? -37.538 -16.612 43.484  1.00 102.13 ? 321  GLY C N     1 
ATOM   5733  C  CA    . GLY C 2  321  ? -38.911 -16.194 43.702  1.00 110.05 ? 321  GLY C CA    1 
ATOM   5734  C  C     . GLY C 2  321  ? -39.289 -16.040 45.159  1.00 111.03 ? 321  GLY C C     1 
ATOM   5735  O  O     . GLY C 2  321  ? -40.274 -16.614 45.612  1.00 112.27 ? 321  GLY C O     1 
ATOM   5736  N  N     . LEU C 2  322  ? -38.499 -15.267 45.895  1.00 106.89 ? 322  LEU C N     1 
ATOM   5737  C  CA    . LEU C 2  322  ? -38.817 -14.945 47.279  1.00 103.65 ? 322  LEU C CA    1 
ATOM   5738  C  C     . LEU C 2  322  ? -38.539 -13.465 47.522  1.00 101.81 ? 322  LEU C C     1 
ATOM   5739  O  O     . LEU C 2  322  ? -37.594 -12.910 46.957  1.00 102.50 ? 322  LEU C O     1 
ATOM   5740  C  CB    . LEU C 2  322  ? -38.020 -15.834 48.240  1.00 100.97 ? 322  LEU C CB    1 
ATOM   5741  C  CG    . LEU C 2  322  ? -36.528 -16.028 47.951  1.00 103.20 ? 322  LEU C CG    1 
ATOM   5742  C  CD1   . LEU C 2  322  ? -35.687 -14.971 48.655  1.00 102.78 ? 322  LEU C CD1   1 
ATOM   5743  C  CD2   . LEU C 2  322  ? -36.077 -17.428 48.341  1.00 100.27 ? 322  LEU C CD2   1 
ATOM   5744  N  N     . HIS C 2  323  ? -39.374 -12.834 48.347  1.00 100.18 ? 323  HIS C N     1 
ATOM   5745  C  CA    . HIS C 2  323  ? -39.343 -11.385 48.561  1.00 99.66  ? 323  HIS C CA    1 
ATOM   5746  C  C     . HIS C 2  323  ? -39.500 -10.637 47.242  1.00 103.75 ? 323  HIS C C     1 
ATOM   5747  O  O     . HIS C 2  323  ? -38.969 -9.540  47.071  1.00 108.07 ? 323  HIS C O     1 
ATOM   5748  C  CB    . HIS C 2  323  ? -38.046 -10.955 49.250  1.00 110.02 ? 323  HIS C CB    1 
ATOM   5749  C  CG    . HIS C 2  323  ? -37.843 -11.566 50.600  1.00 114.66 ? 323  HIS C CG    1 
ATOM   5750  N  ND1   . HIS C 2  323  ? -37.888 -10.831 51.765  1.00 118.25 ? 323  HIS C ND1   1 
ATOM   5751  C  CD2   . HIS C 2  323  ? -37.592 -12.844 50.971  1.00 116.85 ? 323  HIS C CD2   1 
ATOM   5752  C  CE1   . HIS C 2  323  ? -37.673 -11.628 52.795  1.00 120.59 ? 323  HIS C CE1   1 
ATOM   5753  N  NE2   . HIS C 2  323  ? -37.491 -12.856 52.341  1.00 121.60 ? 323  HIS C NE2   1 
ATOM   5754  N  N     . VAL C 2  324  ? -40.239 -11.241 46.318  1.00 103.43 ? 324  VAL C N     1 
ATOM   5755  C  CA    . VAL C 2  324  ? -40.384 -10.718 44.966  1.00 110.05 ? 324  VAL C CA    1 
ATOM   5756  C  C     . VAL C 2  324  ? -41.046 -9.336  44.945  1.00 112.19 ? 324  VAL C C     1 
ATOM   5757  O  O     . VAL C 2  324  ? -40.686 -8.477  44.138  1.00 106.45 ? 324  VAL C O     1 
ATOM   5758  C  CB    . VAL C 2  324  ? -41.188 -11.708 44.085  1.00 108.34 ? 324  VAL C CB    1 
ATOM   5759  C  CG1   . VAL C 2  324  ? -42.508 -12.083 44.749  1.00 103.45 ? 324  VAL C CG1   1 
ATOM   5760  C  CG2   . VAL C 2  324  ? -41.412 -11.144 42.690  1.00 119.93 ? 324  VAL C CG2   1 
ATOM   5761  N  N     . GLY C 2  325  ? -41.996 -9.116  45.848  1.00 116.45 ? 325  GLY C N     1 
ATOM   5762  C  CA    . GLY C 2  325  ? -42.702 -7.849  45.913  1.00 119.64 ? 325  GLY C CA    1 
ATOM   5763  C  C     . GLY C 2  325  ? -42.006 -6.831  46.795  1.00 118.67 ? 325  GLY C C     1 
ATOM   5764  O  O     . GLY C 2  325  ? -42.080 -5.628  46.548  1.00 119.04 ? 325  GLY C O     1 
ATOM   5765  N  N     . GLU C 2  326  ? -41.328 -7.320  47.829  1.00 119.26 ? 326  GLU C N     1 
ATOM   5766  C  CA    . GLU C 2  326  ? -40.622 -6.463  48.776  1.00 117.00 ? 326  GLU C CA    1 
ATOM   5767  C  C     . GLU C 2  326  ? -39.521 -5.654  48.086  1.00 122.08 ? 326  GLU C C     1 
ATOM   5768  O  O     . GLU C 2  326  ? -38.753 -6.199  47.292  1.00 128.41 ? 326  GLU C O     1 
ATOM   5769  C  CB    . GLU C 2  326  ? -40.036 -7.314  49.907  1.00 117.97 ? 326  GLU C CB    1 
ATOM   5770  C  CG    . GLU C 2  326  ? -39.403 -6.526  51.040  1.00 118.73 ? 326  GLU C CG    1 
ATOM   5771  C  CD    . GLU C 2  326  ? -38.935 -7.417  52.174  1.00 126.25 ? 326  GLU C CD    1 
ATOM   5772  O  OE1   . GLU C 2  326  ? -39.267 -8.621  52.163  1.00 120.86 ? 326  GLU C OE1   1 
ATOM   5773  O  OE2   . GLU C 2  326  ? -38.233 -6.913  53.076  1.00 137.73 ? 326  GLU C OE2   1 
ATOM   5774  N  N     . PRO C 2  327  ? -39.448 -4.345  48.384  1.00 121.64 ? 327  PRO C N     1 
ATOM   5775  C  CA    . PRO C 2  327  ? -38.455 -3.447  47.780  1.00 121.87 ? 327  PRO C CA    1 
ATOM   5776  C  C     . PRO C 2  327  ? -37.010 -3.851  48.073  1.00 122.31 ? 327  PRO C C     1 
ATOM   5777  O  O     . PRO C 2  327  ? -36.744 -4.604  49.012  1.00 121.06 ? 327  PRO C O     1 
ATOM   5778  C  CB    . PRO C 2  327  ? -38.778 -2.088  48.415  1.00 122.48 ? 327  PRO C CB    1 
ATOM   5779  C  CG    . PRO C 2  327  ? -39.540 -2.411  49.657  1.00 123.71 ? 327  PRO C CG    1 
ATOM   5780  C  CD    . PRO C 2  327  ? -40.337 -3.628  49.314  1.00 122.07 ? 327  PRO C CD    1 
ATOM   5781  N  N     . ILE C 2  328  ? -36.087 -3.336  47.267  1.00 120.33 ? 328  ILE C N     1 
ATOM   5782  C  CA    . ILE C 2  328  ? -34.678 -3.706  47.356  1.00 116.23 ? 328  ILE C CA    1 
ATOM   5783  C  C     . ILE C 2  328  ? -33.970 -3.014  48.519  1.00 117.97 ? 328  ILE C C     1 
ATOM   5784  O  O     . ILE C 2  328  ? -33.563 -1.857  48.407  1.00 116.38 ? 328  ILE C O     1 
ATOM   5785  C  CB    . ILE C 2  328  ? -33.925 -3.368  46.049  1.00 113.03 ? 328  ILE C CB    1 
ATOM   5786  C  CG1   . ILE C 2  328  ? -34.685 -3.894  44.827  1.00 117.08 ? 328  ILE C CG1   1 
ATOM   5787  C  CG2   . ILE C 2  328  ? -32.508 -3.922  46.087  1.00 103.06 ? 328  ILE C CG2   1 
ATOM   5788  C  CD1   . ILE C 2  328  ? -35.549 -2.852  44.133  1.00 119.56 ? 328  ILE C CD1   1 
ATOM   5789  N  N     . THR C 2  329  ? -33.818 -3.727  49.632  1.00 115.17 ? 329  THR C N     1 
ATOM   5790  C  CA    . THR C 2  329  ? -33.103 -3.188  50.785  1.00 114.83 ? 329  THR C CA    1 
ATOM   5791  C  C     . THR C 2  329  ? -31.897 -4.051  51.153  1.00 109.35 ? 329  THR C C     1 
ATOM   5792  O  O     . THR C 2  329  ? -30.880 -3.545  51.631  1.00 104.11 ? 329  THR C O     1 
ATOM   5793  C  CB    . THR C 2  329  ? -34.024 -3.055  52.017  1.00 114.85 ? 329  THR C CB    1 
ATOM   5794  O  OG1   . THR C 2  329  ? -33.235 -2.765  53.177  1.00 110.23 ? 329  THR C OG1   1 
ATOM   5795  C  CG2   . THR C 2  329  ? -34.810 -4.341  52.250  1.00 107.18 ? 329  THR C CG2   1 
ATOM   5796  N  N     . SER C 2  330  ? -32.022 -5.354  50.924  1.00 105.43 ? 330  SER C N     1 
ATOM   5797  C  CA    . SER C 2  330  ? -30.958 -6.305  51.225  1.00 96.52  ? 330  SER C CA    1 
ATOM   5798  C  C     . SER C 2  330  ? -29.845 -6.240  50.189  1.00 91.31  ? 330  SER C C     1 
ATOM   5799  O  O     . SER C 2  330  ? -30.093 -6.380  48.995  1.00 103.11 ? 330  SER C O     1 
ATOM   5800  C  CB    . SER C 2  330  ? -31.525 -7.725  51.295  1.00 91.47  ? 330  SER C CB    1 
ATOM   5801  O  OG    . SER C 2  330  ? -30.496 -8.686  51.452  1.00 95.86  ? 330  SER C OG    1 
ATOM   5802  N  N     . SER C 2  331  ? -28.616 -6.029  50.640  1.00 82.35  ? 331  SER C N     1 
ATOM   5803  C  CA    . SER C 2  331  ? -27.486 -6.013  49.723  1.00 85.00  ? 331  SER C CA    1 
ATOM   5804  C  C     . SER C 2  331  ? -26.608 -7.235  49.962  1.00 82.39  ? 331  SER C C     1 
ATOM   5805  O  O     . SER C 2  331  ? -25.472 -7.299  49.496  1.00 86.18  ? 331  SER C O     1 
ATOM   5806  C  CB    . SER C 2  331  ? -26.680 -4.722  49.883  1.00 92.26  ? 331  SER C CB    1 
ATOM   5807  O  OG    . SER C 2  331  ? -27.521 -3.585  49.781  1.00 87.62  ? 331  SER C OG    1 
ATOM   5808  N  N     . THR C 2  332  ? -27.151 -8.215  50.675  1.00 79.45  ? 332  THR C N     1 
ATOM   5809  C  CA    . THR C 2  332  ? -26.350 -9.339  51.137  1.00 77.86  ? 332  THR C CA    1 
ATOM   5810  C  C     . THR C 2  332  ? -27.044 -10.687 50.968  1.00 79.89  ? 332  THR C C     1 
ATOM   5811  O  O     . THR C 2  332  ? -28.272 -10.772 50.933  1.00 79.17  ? 332  THR C O     1 
ATOM   5812  C  CB    . THR C 2  332  ? -25.977 -9.163  52.618  1.00 89.33  ? 332  THR C CB    1 
ATOM   5813  O  OG1   . THR C 2  332  ? -25.841 -7.768  52.914  1.00 98.12  ? 332  THR C OG1   1 
ATOM   5814  C  CG2   . THR C 2  332  ? -24.673 -9.879  52.934  1.00 95.38  ? 332  THR C CG2   1 
ATOM   5815  N  N     . LEU C 2  333  ? -26.233 -11.735 50.864  1.00 82.83  ? 333  LEU C N     1 
ATOM   5816  C  CA    . LEU C 2  333  ? -26.712 -13.110 50.800  1.00 91.31  ? 333  LEU C CA    1 
ATOM   5817  C  C     . LEU C 2  333  ? -27.241 -13.552 52.162  1.00 95.94  ? 333  LEU C C     1 
ATOM   5818  O  O     . LEU C 2  333  ? -26.771 -13.076 53.194  1.00 101.81 ? 333  LEU C O     1 
ATOM   5819  C  CB    . LEU C 2  333  ? -25.582 -14.035 50.341  1.00 88.69  ? 333  LEU C CB    1 
ATOM   5820  C  CG    . LEU C 2  333  ? -25.925 -15.463 49.921  1.00 86.44  ? 333  LEU C CG    1 
ATOM   5821  C  CD1   . LEU C 2  333  ? -26.799 -15.448 48.682  1.00 91.95  ? 333  LEU C CD1   1 
ATOM   5822  C  CD2   . LEU C 2  333  ? -24.655 -16.262 49.673  1.00 84.33  ? 333  LEU C CD2   1 
ATOM   5823  N  N     . THR C 2  334  ? -28.220 -14.454 52.165  1.00 95.13  ? 334  THR C N     1 
ATOM   5824  C  CA    . THR C 2  334  ? -28.794 -14.957 53.414  1.00 93.71  ? 334  THR C CA    1 
ATOM   5825  C  C     . THR C 2  334  ? -28.818 -16.482 53.449  1.00 92.27  ? 334  THR C C     1 
ATOM   5826  O  O     . THR C 2  334  ? -28.605 -17.136 52.429  1.00 92.56  ? 334  THR C O     1 
ATOM   5827  C  CB    . THR C 2  334  ? -30.232 -14.449 53.631  1.00 92.03  ? 334  THR C CB    1 
ATOM   5828  O  OG1   . THR C 2  334  ? -31.122 -15.146 52.751  1.00 97.59  ? 334  THR C OG1   1 
ATOM   5829  C  CG2   . THR C 2  334  ? -30.327 -12.950 53.376  1.00 92.05  ? 334  THR C CG2   1 
ATOM   5830  N  N     . GLU C 2  335  ? -29.088 -17.043 54.626  1.00 97.11  ? 335  GLU C N     1 
ATOM   5831  C  CA    . GLU C 2  335  ? -29.182 -18.494 54.780  1.00 107.38 ? 335  GLU C CA    1 
ATOM   5832  C  C     . GLU C 2  335  ? -30.333 -19.066 53.954  1.00 105.28 ? 335  GLU C C     1 
ATOM   5833  O  O     . GLU C 2  335  ? -30.211 -20.147 53.376  1.00 101.18 ? 335  GLU C O     1 
ATOM   5834  C  CB    . GLU C 2  335  ? -29.362 -18.880 56.252  1.00 121.23 ? 335  GLU C CB    1 
ATOM   5835  C  CG    . GLU C 2  335  ? -28.145 -18.641 57.135  1.00 124.21 ? 335  GLU C CG    1 
ATOM   5836  C  CD    . GLU C 2  335  ? -28.286 -19.283 58.507  1.00 126.36 ? 335  GLU C CD    1 
ATOM   5837  O  OE1   . GLU C 2  335  ? -28.701 -20.460 58.576  1.00 119.37 ? 335  GLU C OE1   1 
ATOM   5838  O  OE2   . GLU C 2  335  ? -27.989 -18.610 59.517  1.00 127.13 ? 335  GLU C OE2   1 
ATOM   5839  N  N     . GLU C 2  336  ? -31.447 -18.339 53.911  1.00 102.13 ? 336  GLU C N     1 
ATOM   5840  C  CA    . GLU C 2  336  ? -32.611 -18.747 53.129  1.00 95.98  ? 336  GLU C CA    1 
ATOM   5841  C  C     . GLU C 2  336  ? -32.227 -18.913 51.666  1.00 97.27  ? 336  GLU C C     1 
ATOM   5842  O  O     . GLU C 2  336  ? -32.659 -19.854 51.000  1.00 97.98  ? 336  GLU C O     1 
ATOM   5843  C  CB    . GLU C 2  336  ? -33.743 -17.725 53.265  1.00 95.81  ? 336  GLU C CB    1 
ATOM   5844  C  CG    . GLU C 2  336  ? -34.980 -18.038 52.429  1.00 96.48  ? 336  GLU C CG    1 
ATOM   5845  C  CD    . GLU C 2  336  ? -35.942 -16.864 52.344  1.00 108.54 ? 336  GLU C CD    1 
ATOM   5846  O  OE1   . GLU C 2  336  ? -36.967 -16.981 51.638  1.00 108.74 ? 336  GLU C OE1   1 
ATOM   5847  O  OE2   . GLU C 2  336  ? -35.672 -15.822 52.980  1.00 115.05 ? 336  GLU C OE2   1 
ATOM   5848  N  N     . ASP C 2  337  ? -31.405 -17.990 51.178  1.00 93.01  ? 337  ASP C N     1 
ATOM   5849  C  CA    . ASP C 2  337  ? -30.908 -18.050 49.812  1.00 88.06  ? 337  ASP C CA    1 
ATOM   5850  C  C     . ASP C 2  337  ? -30.077 -19.306 49.601  1.00 91.68  ? 337  ASP C C     1 
ATOM   5851  O  O     . ASP C 2  337  ? -30.175 -19.956 48.561  1.00 92.93  ? 337  ASP C O     1 
ATOM   5852  C  CB    . ASP C 2  337  ? -30.079 -16.809 49.491  1.00 88.14  ? 337  ASP C CB    1 
ATOM   5853  C  CG    . ASP C 2  337  ? -30.869 -15.530 49.644  1.00 85.86  ? 337  ASP C CG    1 
ATOM   5854  O  OD1   . ASP C 2  337  ? -32.092 -15.558 49.394  1.00 86.16  ? 337  ASP C OD1   1 
ATOM   5855  O  OD2   . ASP C 2  337  ? -30.270 -14.497 50.013  1.00 84.55  ? 337  ASP C OD2   1 
ATOM   5856  N  N     . VAL C 2  338  ? -29.265 -19.643 50.599  1.00 91.95  ? 338  VAL C N     1 
ATOM   5857  C  CA    . VAL C 2  338  ? -28.403 -20.815 50.530  1.00 91.55  ? 338  VAL C CA    1 
ATOM   5858  C  C     . VAL C 2  338  ? -29.225 -22.084 50.379  1.00 100.34 ? 338  VAL C C     1 
ATOM   5859  O  O     . VAL C 2  338  ? -28.974 -22.897 49.490  1.00 102.53 ? 338  VAL C O     1 
ATOM   5860  C  CB    . VAL C 2  338  ? -27.517 -20.940 51.779  1.00 87.53  ? 338  VAL C CB    1 
ATOM   5861  C  CG1   . VAL C 2  338  ? -26.652 -22.184 51.688  1.00 96.34  ? 338  VAL C CG1   1 
ATOM   5862  C  CG2   . VAL C 2  338  ? -26.658 -19.701 51.942  1.00 89.37  ? 338  VAL C CG2   1 
ATOM   5863  N  N     . VAL C 2  339  ? -30.216 -22.238 51.249  1.00 101.39 ? 339  VAL C N     1 
ATOM   5864  C  CA    . VAL C 2  339  ? -31.062 -23.422 51.249  1.00 107.15 ? 339  VAL C CA    1 
ATOM   5865  C  C     . VAL C 2  339  ? -31.892 -23.527 49.968  1.00 108.04 ? 339  VAL C C     1 
ATOM   5866  O  O     . VAL C 2  339  ? -31.936 -24.584 49.337  1.00 112.71 ? 339  VAL C O     1 
ATOM   5867  C  CB    . VAL C 2  339  ? -32.000 -23.428 52.472  1.00 113.54 ? 339  VAL C CB    1 
ATOM   5868  C  CG1   . VAL C 2  339  ? -32.811 -24.713 52.516  1.00 117.75 ? 339  VAL C CG1   1 
ATOM   5869  C  CG2   . VAL C 2  339  ? -31.195 -23.260 53.754  1.00 115.38 ? 339  VAL C CG2   1 
ATOM   5870  N  N     . ALA C 2  340  ? -32.530 -22.426 49.577  1.00 103.42 ? 340  ALA C N     1 
ATOM   5871  C  CA    . ALA C 2  340  ? -33.408 -22.416 48.406  1.00 102.09 ? 340  ALA C CA    1 
ATOM   5872  C  C     . ALA C 2  340  ? -32.634 -22.626 47.110  1.00 95.48  ? 340  ALA C C     1 
ATOM   5873  O  O     . ALA C 2  340  ? -33.215 -22.934 46.068  1.00 95.08  ? 340  ALA C O     1 
ATOM   5874  C  CB    . ALA C 2  340  ? -34.190 -21.114 48.345  1.00 108.47 ? 340  ALA C CB    1 
ATOM   5875  N  N     . THR C 2  341  ? -31.320 -22.448 47.182  1.00 95.08  ? 341  THR C N     1 
ATOM   5876  C  CA    . THR C 2  341  ? -30.450 -22.697 46.042  1.00 97.04  ? 341  THR C CA    1 
ATOM   5877  C  C     . THR C 2  341  ? -30.206 -24.190 45.887  1.00 105.65 ? 341  THR C C     1 
ATOM   5878  O  O     . THR C 2  341  ? -30.312 -24.735 44.788  1.00 110.28 ? 341  THR C O     1 
ATOM   5879  C  CB    . THR C 2  341  ? -29.103 -21.978 46.191  1.00 94.73  ? 341  THR C CB    1 
ATOM   5880  O  OG1   . THR C 2  341  ? -29.331 -20.590 46.459  1.00 98.66  ? 341  THR C OG1   1 
ATOM   5881  C  CG2   . THR C 2  341  ? -28.281 -22.123 44.920  1.00 87.08  ? 341  THR C CG2   1 
ATOM   5882  N  N     . ILE C 2  342  ? -29.878 -24.843 46.998  1.00 105.69 ? 342  ILE C N     1 
ATOM   5883  C  CA    . ILE C 2  342  ? -29.650 -26.282 47.005  1.00 106.23 ? 342  ILE C CA    1 
ATOM   5884  C  C     . ILE C 2  342  ? -30.919 -27.013 46.579  1.00 108.57 ? 342  ILE C C     1 
ATOM   5885  O  O     . ILE C 2  342  ? -30.861 -28.021 45.875  1.00 107.83 ? 342  ILE C O     1 
ATOM   5886  C  CB    . ILE C 2  342  ? -29.210 -26.782 48.394  1.00 104.15 ? 342  ILE C CB    1 
ATOM   5887  C  CG1   . ILE C 2  342  ? -28.109 -25.883 48.961  1.00 99.89  ? 342  ILE C CG1   1 
ATOM   5888  C  CG2   . ILE C 2  342  ? -28.736 -28.224 48.315  1.00 111.48 ? 342  ILE C CG2   1 
ATOM   5889  C  CD1   . ILE C 2  342  ? -27.883 -26.059 50.446  1.00 105.46 ? 342  ILE C CD1   1 
ATOM   5890  N  N     . GLU C 2  343  ? -32.064 -26.485 47.006  1.00 108.30 ? 343  GLU C N     1 
ATOM   5891  C  CA    . GLU C 2  343  ? -33.363 -27.042 46.644  1.00 105.12 ? 343  GLU C CA    1 
ATOM   5892  C  C     . GLU C 2  343  ? -33.612 -26.893 45.146  1.00 103.72 ? 343  GLU C C     1 
ATOM   5893  O  O     . GLU C 2  343  ? -34.181 -27.776 44.507  1.00 106.02 ? 343  GLU C O     1 
ATOM   5894  C  CB    . GLU C 2  343  ? -34.479 -26.360 47.442  1.00 113.44 ? 343  GLU C CB    1 
ATOM   5895  C  CG    . GLU C 2  343  ? -35.867 -26.953 47.226  1.00 125.00 ? 343  GLU C CG    1 
ATOM   5896  C  CD    . GLU C 2  343  ? -36.938 -26.267 48.061  1.00 128.91 ? 343  GLU C CD    1 
ATOM   5897  O  OE1   . GLU C 2  343  ? -36.593 -25.358 48.846  1.00 127.97 ? 343  GLU C OE1   1 
ATOM   5898  O  OE2   . GLU C 2  343  ? -38.125 -26.636 47.932  1.00 123.64 ? 343  GLU C OE2   1 
ATOM   5899  N  N     . TYR C 2  344  ? -33.180 -25.765 44.594  1.00 98.03  ? 344  TYR C N     1 
ATOM   5900  C  CA    . TYR C 2  344  ? -33.308 -25.510 43.167  1.00 93.60  ? 344  TYR C CA    1 
ATOM   5901  C  C     . TYR C 2  344  ? -32.423 -26.477 42.391  1.00 92.14  ? 344  TYR C C     1 
ATOM   5902  O  O     . TYR C 2  344  ? -32.767 -26.912 41.292  1.00 90.70  ? 344  TYR C O     1 
ATOM   5903  C  CB    . TYR C 2  344  ? -32.930 -24.062 42.852  1.00 96.26  ? 344  TYR C CB    1 
ATOM   5904  C  CG    . TYR C 2  344  ? -33.564 -23.505 41.599  1.00 93.84  ? 344  TYR C CG    1 
ATOM   5905  C  CD1   . TYR C 2  344  ? -34.550 -22.532 41.674  1.00 88.50  ? 344  TYR C CD1   1 
ATOM   5906  C  CD2   . TYR C 2  344  ? -33.178 -23.950 40.341  1.00 90.53  ? 344  TYR C CD2   1 
ATOM   5907  C  CE1   . TYR C 2  344  ? -35.130 -22.018 40.534  1.00 87.27  ? 344  TYR C CE1   1 
ATOM   5908  C  CE2   . TYR C 2  344  ? -33.747 -23.437 39.198  1.00 85.81  ? 344  TYR C CE2   1 
ATOM   5909  C  CZ    . TYR C 2  344  ? -34.724 -22.474 39.300  1.00 87.44  ? 344  TYR C CZ    1 
ATOM   5910  O  OH    . TYR C 2  344  ? -35.296 -21.963 38.162  1.00 88.31  ? 344  TYR C OH    1 
ATOM   5911  N  N     . LEU C 2  345  ? -31.282 -26.812 42.984  1.00 95.46  ? 345  LEU C N     1 
ATOM   5912  C  CA    . LEU C 2  345  ? -30.315 -27.712 42.370  1.00 97.50  ? 345  LEU C CA    1 
ATOM   5913  C  C     . LEU C 2  345  ? -30.829 -29.142 42.276  1.00 106.81 ? 345  LEU C C     1 
ATOM   5914  O  O     . LEU C 2  345  ? -30.800 -29.752 41.207  1.00 114.90 ? 345  LEU C O     1 
ATOM   5915  C  CB    . LEU C 2  345  ? -29.003 -27.696 43.156  1.00 96.31  ? 345  LEU C CB    1 
ATOM   5916  C  CG    . LEU C 2  345  ? -28.003 -28.803 42.811  1.00 105.60 ? 345  LEU C CG    1 
ATOM   5917  C  CD1   . LEU C 2  345  ? -27.595 -28.739 41.343  1.00 106.51 ? 345  LEU C CD1   1 
ATOM   5918  C  CD2   . LEU C 2  345  ? -26.782 -28.724 43.715  1.00 118.56 ? 345  LEU C CD2   1 
ATOM   5919  N  N     . VAL C 2  346  ? -31.290 -29.674 43.402  1.00 107.86 ? 346  VAL C N     1 
ATOM   5920  C  CA    . VAL C 2  346  ? -31.698 -31.071 43.475  1.00 117.23 ? 346  VAL C CA    1 
ATOM   5921  C  C     . VAL C 2  346  ? -32.916 -31.367 42.597  1.00 118.79 ? 346  VAL C C     1 
ATOM   5922  O  O     . VAL C 2  346  ? -32.949 -32.383 41.898  1.00 116.23 ? 346  VAL C O     1 
ATOM   5923  C  CB    . VAL C 2  346  ? -31.992 -31.488 44.937  1.00 124.52 ? 346  VAL C CB    1 
ATOM   5924  C  CG1   . VAL C 2  346  ? -32.895 -30.478 45.628  1.00 115.52 ? 346  VAL C CG1   1 
ATOM   5925  C  CG2   . VAL C 2  346  ? -32.599 -32.874 44.985  1.00 126.46 ? 346  VAL C CG2   1 
ATOM   5926  N  N     . ARG C 2  347  ? -33.904 -30.475 42.619  1.00 119.69 ? 347  ARG C N     1 
ATOM   5927  C  CA    . ARG C 2  347  ? -35.126 -30.667 41.844  1.00 120.09 ? 347  ARG C CA    1 
ATOM   5928  C  C     . ARG C 2  347  ? -34.830 -30.652 40.349  1.00 114.25 ? 347  ARG C C     1 
ATOM   5929  O  O     . ARG C 2  347  ? -35.419 -31.411 39.580  1.00 114.61 ? 347  ARG C O     1 
ATOM   5930  C  CB    . ARG C 2  347  ? -36.163 -29.594 42.191  1.00 120.18 ? 347  ARG C CB    1 
ATOM   5931  C  CG    . ARG C 2  347  ? -36.657 -29.647 43.631  1.00 123.08 ? 347  ARG C CG    1 
ATOM   5932  C  CD    . ARG C 2  347  ? -37.800 -28.670 43.872  1.00 117.53 ? 347  ARG C CD    1 
ATOM   5933  N  NE    . ARG C 2  347  ? -38.191 -28.619 45.279  1.00 115.46 ? 347  ARG C NE    1 
ATOM   5934  C  CZ    . ARG C 2  347  ? -39.047 -29.460 45.850  1.00 114.10 ? 347  ARG C CZ    1 
ATOM   5935  N  NH1   . ARG C 2  347  ? -39.608 -30.426 45.135  1.00 115.99 ? 347  ARG C NH1   1 
ATOM   5936  N  NH2   . ARG C 2  347  ? -39.341 -29.338 47.137  1.00 116.72 ? 347  ARG C NH2   1 
ATOM   5937  N  N     . LEU C 2  348  ? -33.901 -29.791 39.947  1.00 113.06 ? 348  LEU C N     1 
ATOM   5938  C  CA    . LEU C 2  348  ? -33.511 -29.684 38.547  1.00 116.61 ? 348  LEU C CA    1 
ATOM   5939  C  C     . LEU C 2  348  ? -32.689 -30.897 38.117  1.00 116.74 ? 348  LEU C C     1 
ATOM   5940  O  O     . LEU C 2  348  ? -32.541 -31.175 36.926  1.00 120.27 ? 348  LEU C O     1 
ATOM   5941  C  CB    . LEU C 2  348  ? -32.723 -28.392 38.312  1.00 108.48 ? 348  LEU C CB    1 
ATOM   5942  C  CG    . LEU C 2  348  ? -32.410 -28.024 36.861  1.00 101.99 ? 348  LEU C CG    1 
ATOM   5943  C  CD1   . LEU C 2  348  ? -33.676 -28.004 36.017  1.00 104.23 ? 348  LEU C CD1   1 
ATOM   5944  C  CD2   . LEU C 2  348  ? -31.693 -26.687 36.793  1.00 102.66 ? 348  LEU C CD2   1 
ATOM   5945  N  N     . HIS C 2  349  ? -32.162 -31.625 39.095  1.00 113.50 ? 349  HIS C N     1 
ATOM   5946  C  CA    . HIS C 2  349  ? -31.343 -32.794 38.810  1.00 114.80 ? 349  HIS C CA    1 
ATOM   5947  C  C     . HIS C 2  349  ? -32.194 -34.031 38.534  1.00 115.15 ? 349  HIS C C     1 
ATOM   5948  O  O     . HIS C 2  349  ? -31.812 -34.894 37.741  1.00 114.30 ? 349  HIS C O     1 
ATOM   5949  C  CB    . HIS C 2  349  ? -30.385 -33.066 39.968  1.00 113.18 ? 349  HIS C CB    1 
ATOM   5950  C  CG    . HIS C 2  349  ? -29.508 -34.258 39.752  1.00 112.82 ? 349  HIS C CG    1 
ATOM   5951  N  ND1   . HIS C 2  349  ? -29.833 -35.514 40.216  1.00 114.36 ? 349  HIS C ND1   1 
ATOM   5952  C  CD2   . HIS C 2  349  ? -28.323 -34.387 39.111  1.00 112.59 ? 349  HIS C CD2   1 
ATOM   5953  C  CE1   . HIS C 2  349  ? -28.882 -36.366 39.875  1.00 114.03 ? 349  HIS C CE1   1 
ATOM   5954  N  NE2   . HIS C 2  349  ? -27.955 -35.708 39.204  1.00 113.13 ? 349  HIS C NE2   1 
ATOM   5955  N  N     . GLU C 2  350  ? -33.349 -34.112 39.185  1.00 115.49 ? 350  GLU C N     1 
ATOM   5956  C  CA    . GLU C 2  350  ? -34.201 -35.289 39.066  1.00 117.71 ? 350  GLU C CA    1 
ATOM   5957  C  C     . GLU C 2  350  ? -35.427 -35.051 38.184  1.00 115.94 ? 350  GLU C C     1 
ATOM   5958  O  O     . GLU C 2  350  ? -36.409 -35.788 38.268  1.00 125.25 ? 350  GLU C O     1 
ATOM   5959  C  CB    . GLU C 2  350  ? -34.634 -35.768 40.454  1.00 121.46 ? 350  GLU C CB    1 
ATOM   5960  C  CG    . GLU C 2  350  ? -35.218 -34.682 41.341  1.00 120.95 ? 350  GLU C CG    1 
ATOM   5961  C  CD    . GLU C 2  350  ? -35.365 -35.126 42.784  1.00 125.55 ? 350  GLU C CD    1 
ATOM   5962  O  OE1   . GLU C 2  350  ? -34.824 -36.197 43.135  1.00 128.54 ? 350  GLU C OE1   1 
ATOM   5963  O  OE2   . GLU C 2  350  ? -36.020 -34.405 43.566  1.00 126.98 ? 350  GLU C OE2   1 
ATOM   5964  N  N     . GLY C 2  351  ? -35.372 -34.023 37.342  1.00 110.16 ? 351  GLY C N     1 
ATOM   5965  C  CA    . GLY C 2  351  ? -36.376 -33.841 36.307  1.00 114.41 ? 351  GLY C CA    1 
ATOM   5966  C  C     . GLY C 2  351  ? -37.529 -32.893 36.586  1.00 109.76 ? 351  GLY C C     1 
ATOM   5967  O  O     . GLY C 2  351  ? -38.376 -32.683 35.715  1.00 100.53 ? 351  GLY C O     1 
ATOM   5968  N  N     . GLN C 2  352  ? -37.578 -32.322 37.787  1.00 113.12 ? 352  GLN C N     1 
ATOM   5969  C  CA    . GLN C 2  352  ? -38.631 -31.365 38.118  1.00 114.28 ? 352  GLN C CA    1 
ATOM   5970  C  C     . GLN C 2  352  ? -38.530 -30.124 37.238  1.00 110.07 ? 352  GLN C C     1 
ATOM   5971  O  O     . GLN C 2  352  ? -37.436 -29.699 36.867  1.00 115.20 ? 352  GLN C O     1 
ATOM   5972  C  CB    . GLN C 2  352  ? -38.571 -30.965 39.593  1.00 118.06 ? 352  GLN C CB    1 
ATOM   5973  C  CG    . GLN C 2  352  ? -38.840 -32.102 40.562  1.00 122.33 ? 352  GLN C CG    1 
ATOM   5974  C  CD    . GLN C 2  352  ? -39.168 -31.604 41.956  1.00 121.73 ? 352  GLN C CD    1 
ATOM   5975  O  OE1   . GLN C 2  352  ? -39.716 -30.514 42.123  1.00 117.41 ? 352  GLN C OE1   1 
ATOM   5976  N  NE2   . GLN C 2  352  ? -38.831 -32.399 42.964  1.00 122.63 ? 352  GLN C NE2   1 
ATOM   5977  N  N     . THR C 2  353  ? -39.679 -29.547 36.910  1.00 105.08 ? 353  THR C N     1 
ATOM   5978  C  CA    . THR C 2  353  ? -39.729 -28.427 35.984  1.00 104.32 ? 353  THR C CA    1 
ATOM   5979  C  C     . THR C 2  353  ? -40.126 -27.130 36.678  1.00 108.97 ? 353  THR C C     1 
ATOM   5980  O  O     . THR C 2  353  ? -39.824 -26.041 36.192  1.00 115.71 ? 353  THR C O     1 
ATOM   5981  C  CB    . THR C 2  353  ? -40.715 -28.705 34.839  1.00 99.92  ? 353  THR C CB    1 
ATOM   5982  O  OG1   . THR C 2  353  ? -42.027 -28.900 35.379  1.00 103.28 ? 353  THR C OG1   1 
ATOM   5983  C  CG2   . THR C 2  353  ? -40.300 -29.953 34.076  1.00 99.19  ? 353  THR C CG2   1 
ATOM   5984  N  N     . THR C 2  354  ? -40.801 -27.249 37.817  1.00 105.22 ? 354  THR C N     1 
ATOM   5985  C  CA    . THR C 2  354  ? -41.276 -26.075 38.540  1.00 105.41 ? 354  THR C CA    1 
ATOM   5986  C  C     . THR C 2  354  ? -41.129 -26.263 40.046  1.00 100.57 ? 354  THR C C     1 
ATOM   5987  O  O     . THR C 2  354  ? -41.082 -27.392 40.536  1.00 94.78  ? 354  THR C O     1 
ATOM   5988  C  CB    . THR C 2  354  ? -42.748 -25.766 38.200  1.00 102.25 ? 354  THR C CB    1 
ATOM   5989  O  OG1   . THR C 2  354  ? -43.011 -26.117 36.835  1.00 103.65 ? 354  THR C OG1   1 
ATOM   5990  C  CG2   . THR C 2  354  ? -43.047 -24.291 38.402  1.00 97.63  ? 354  THR C CG2   1 
ATOM   5991  N  N     . MET C 2  355  ? -41.056 -25.153 40.775  1.00 99.08  ? 355  MET C N     1 
ATOM   5992  C  CA    . MET C 2  355  ? -40.871 -25.200 42.221  1.00 104.40 ? 355  MET C CA    1 
ATOM   5993  C  C     . MET C 2  355  ? -41.365 -23.938 42.923  1.00 108.63 ? 355  MET C C     1 
ATOM   5994  O  O     . MET C 2  355  ? -41.156 -22.822 42.447  1.00 113.01 ? 355  MET C O     1 
ATOM   5995  C  CB    . MET C 2  355  ? -39.396 -25.420 42.559  1.00 100.69 ? 355  MET C CB    1 
ATOM   5996  C  CG    . MET C 2  355  ? -39.089 -25.340 44.045  1.00 101.95 ? 355  MET C CG    1 
ATOM   5997  S  SD    . MET C 2  355  ? -37.439 -24.706 44.383  1.00 100.47 ? 355  MET C SD    1 
ATOM   5998  C  CE    . MET C 2  355  ? -37.480 -23.174 43.458  1.00 106.94 ? 355  MET C CE    1 
ATOM   5999  N  N     . THR C 2  356  ? -42.020 -24.127 44.063  1.00 109.98 ? 356  THR C N     1 
ATOM   6000  C  CA    . THR C 2  356  ? -42.389 -23.017 44.928  1.00 103.38 ? 356  THR C CA    1 
ATOM   6001  C  C     . THR C 2  356  ? -41.555 -23.040 46.202  1.00 102.39 ? 356  THR C C     1 
ATOM   6002  O  O     . THR C 2  356  ? -41.687 -23.944 47.027  1.00 101.78 ? 356  THR C O     1 
ATOM   6003  C  CB    . THR C 2  356  ? -43.876 -23.058 45.307  1.00 109.40 ? 356  THR C CB    1 
ATOM   6004  O  OG1   . THR C 2  356  ? -44.149 -24.263 46.032  1.00 122.57 ? 356  THR C OG1   1 
ATOM   6005  C  CG2   . THR C 2  356  ? -44.744 -23.017 44.067  1.00 108.83 ? 356  THR C CG2   1 
ATOM   6006  N  N     . VAL C 2  357  ? -40.686 -22.049 46.353  1.00 104.89 ? 357  VAL C N     1 
ATOM   6007  C  CA    . VAL C 2  357  ? -39.931 -21.890 47.587  1.00 112.09 ? 357  VAL C CA    1 
ATOM   6008  C  C     . VAL C 2  357  ? -40.892 -21.515 48.710  1.00 109.70 ? 357  VAL C C     1 
ATOM   6009  O  O     . VAL C 2  357  ? -41.731 -20.630 48.535  1.00 106.61 ? 357  VAL C O     1 
ATOM   6010  C  CB    . VAL C 2  357  ? -38.828 -20.816 47.443  1.00 121.18 ? 357  VAL C CB    1 
ATOM   6011  C  CG1   . VAL C 2  357  ? -38.267 -20.421 48.802  1.00 122.76 ? 357  VAL C CG1   1 
ATOM   6012  C  CG2   . VAL C 2  357  ? -37.722 -21.312 46.526  1.00 113.78 ? 357  VAL C CG2   1 
ATOM   6013  N  N     . PRO C 2  358  ? -40.793 -22.207 49.859  1.00 110.76 ? 358  PRO C N     1 
ATOM   6014  C  CA    . PRO C 2  358  ? -41.640 -21.903 51.018  1.00 110.92 ? 358  PRO C CA    1 
ATOM   6015  C  C     . PRO C 2  358  ? -41.559 -20.432 51.417  1.00 111.70 ? 358  PRO C C     1 
ATOM   6016  O  O     . PRO C 2  358  ? -40.528 -19.972 51.910  1.00 110.61 ? 358  PRO C O     1 
ATOM   6017  C  CB    . PRO C 2  358  ? -41.075 -22.810 52.122  1.00 101.08 ? 358  PRO C CB    1 
ATOM   6018  C  CG    . PRO C 2  358  ? -39.737 -23.264 51.622  1.00 104.33 ? 358  PRO C CG    1 
ATOM   6019  C  CD    . PRO C 2  358  ? -39.866 -23.316 50.136  1.00 111.54 ? 358  PRO C CD    1 
ATOM   6020  N  N     . GLY C 2  359  ? -42.647 -19.704 51.189  1.00 112.68 ? 359  GLY C N     1 
ATOM   6021  C  CA    . GLY C 2  359  ? -42.686 -18.279 51.458  1.00 114.83 ? 359  GLY C CA    1 
ATOM   6022  C  C     . GLY C 2  359  ? -42.456 -17.471 50.197  1.00 117.56 ? 359  GLY C C     1 
ATOM   6023  O  O     . GLY C 2  359  ? -42.219 -16.263 50.258  1.00 119.07 ? 359  GLY C O     1 
ATOM   6024  N  N     . GLY C 2  360  ? -42.530 -18.137 49.048  1.00 115.16 ? 360  GLY C N     1 
ATOM   6025  C  CA    . GLY C 2  360  ? -42.292 -17.480 47.777  1.00 113.22 ? 360  GLY C CA    1 
ATOM   6026  C  C     . GLY C 2  360  ? -43.126 -17.990 46.615  1.00 112.36 ? 360  GLY C C     1 
ATOM   6027  O  O     . GLY C 2  360  ? -43.522 -19.156 46.578  1.00 115.41 ? 360  GLY C O     1 
ATOM   6028  N  N     . VAL C 2  361  ? -43.376 -17.103 45.656  1.00 110.81 ? 361  VAL C N     1 
ATOM   6029  C  CA    . VAL C 2  361  ? -44.184 -17.405 44.476  1.00 112.71 ? 361  VAL C CA    1 
ATOM   6030  C  C     . VAL C 2  361  ? -43.560 -18.512 43.616  1.00 112.26 ? 361  VAL C C     1 
ATOM   6031  O  O     . VAL C 2  361  ? -42.371 -18.812 43.738  1.00 110.90 ? 361  VAL C O     1 
ATOM   6032  C  CB    . VAL C 2  361  ? -44.386 -16.131 43.616  1.00 116.75 ? 361  VAL C CB    1 
ATOM   6033  C  CG1   . VAL C 2  361  ? -43.122 -15.813 42.824  1.00 120.42 ? 361  VAL C CG1   1 
ATOM   6034  C  CG2   . VAL C 2  361  ? -45.597 -16.265 42.694  1.00 116.98 ? 361  VAL C CG2   1 
ATOM   6035  N  N     . GLU C 2  362  ? -44.374 -19.118 42.755  1.00 110.78 ? 362  GLU C N     1 
ATOM   6036  C  CA    . GLU C 2  362  ? -43.932 -20.195 41.874  1.00 109.29 ? 362  GLU C CA    1 
ATOM   6037  C  C     . GLU C 2  362  ? -42.889 -19.707 40.868  1.00 109.44 ? 362  GLU C C     1 
ATOM   6038  O  O     . GLU C 2  362  ? -43.006 -18.609 40.322  1.00 100.99 ? 362  GLU C O     1 
ATOM   6039  C  CB    . GLU C 2  362  ? -45.132 -20.802 41.143  1.00 113.86 ? 362  GLU C CB    1 
ATOM   6040  C  CG    . GLU C 2  362  ? -44.884 -22.189 40.575  1.00 113.06 ? 362  GLU C CG    1 
ATOM   6041  C  CD    . GLU C 2  362  ? -46.128 -22.804 39.960  1.00 110.34 ? 362  GLU C CD    1 
ATOM   6042  O  OE1   . GLU C 2  362  ? -47.078 -22.052 39.655  1.00 106.17 ? 362  GLU C OE1   1 
ATOM   6043  O  OE2   . GLU C 2  362  ? -46.157 -24.041 39.786  1.00 109.42 ? 362  GLU C OE2   1 
ATOM   6044  N  N     . VAL C 2  363  ? -41.870 -20.532 40.635  1.00 111.67 ? 363  VAL C N     1 
ATOM   6045  C  CA    . VAL C 2  363  ? -40.742 -20.164 39.780  1.00 101.65 ? 363  VAL C CA    1 
ATOM   6046  C  C     . VAL C 2  363  ? -40.418 -21.255 38.757  1.00 98.07  ? 363  VAL C C     1 
ATOM   6047  O  O     . VAL C 2  363  ? -40.352 -22.435 39.105  1.00 98.09  ? 363  VAL C O     1 
ATOM   6048  C  CB    . VAL C 2  363  ? -39.472 -19.884 40.619  1.00 102.96 ? 363  VAL C CB    1 
ATOM   6049  C  CG1   . VAL C 2  363  ? -38.375 -19.278 39.757  1.00 101.53 ? 363  VAL C CG1   1 
ATOM   6050  C  CG2   . VAL C 2  363  ? -39.790 -18.968 41.781  1.00 107.07 ? 363  VAL C CG2   1 
ATOM   6051  N  N     . PRO C 2  364  ? -40.217 -20.862 37.487  1.00 96.99  ? 364  PRO C N     1 
ATOM   6052  C  CA    . PRO C 2  364  ? -39.778 -21.814 36.459  1.00 99.97  ? 364  PRO C CA    1 
ATOM   6053  C  C     . PRO C 2  364  ? -38.381 -22.362 36.741  1.00 100.86 ? 364  PRO C C     1 
ATOM   6054  O  O     . PRO C 2  364  ? -37.450 -21.590 36.972  1.00 105.82 ? 364  PRO C O     1 
ATOM   6055  C  CB    . PRO C 2  364  ? -39.790 -20.976 35.173  1.00 99.89  ? 364  PRO C CB    1 
ATOM   6056  C  CG    . PRO C 2  364  ? -39.715 -19.556 35.635  1.00 95.41  ? 364  PRO C CG    1 
ATOM   6057  C  CD    . PRO C 2  364  ? -40.471 -19.525 36.926  1.00 98.00  ? 364  PRO C CD    1 
ATOM   6058  N  N     . VAL C 2  365  ? -38.240 -23.683 36.718  1.00 101.97 ? 365  VAL C N     1 
ATOM   6059  C  CA    . VAL C 2  365  ? -36.966 -24.315 37.035  1.00 97.42  ? 365  VAL C CA    1 
ATOM   6060  C  C     . VAL C 2  365  ? -36.283 -24.883 35.795  1.00 103.71 ? 365  VAL C C     1 
ATOM   6061  O  O     . VAL C 2  365  ? -36.753 -25.856 35.202  1.00 102.98 ? 365  VAL C O     1 
ATOM   6062  C  CB    . VAL C 2  365  ? -37.145 -25.432 38.075  1.00 98.11  ? 365  VAL C CB    1 
ATOM   6063  C  CG1   . VAL C 2  365  ? -35.825 -26.136 38.332  1.00 97.59  ? 365  VAL C CG1   1 
ATOM   6064  C  CG2   . VAL C 2  365  ? -37.705 -24.855 39.366  1.00 103.02 ? 365  VAL C CG2   1 
ATOM   6065  N  N     . GLU C 2  366  ? -35.170 -24.265 35.410  1.00 108.38 ? 366  GLU C N     1 
ATOM   6066  C  CA    . GLU C 2  366  ? -34.405 -24.699 34.246  1.00 103.42 ? 366  GLU C CA    1 
ATOM   6067  C  C     . GLU C 2  366  ? -32.963 -24.198 34.308  1.00 94.61  ? 366  GLU C C     1 
ATOM   6068  O  O     . GLU C 2  366  ? -32.618 -23.372 35.154  1.00 92.04  ? 366  GLU C O     1 
ATOM   6069  C  CB    . GLU C 2  366  ? -35.071 -24.218 32.954  1.00 98.80  ? 366  GLU C CB    1 
ATOM   6070  C  CG    . GLU C 2  366  ? -35.235 -22.709 32.852  1.00 95.98  ? 366  GLU C CG    1 
ATOM   6071  C  CD    . GLU C 2  366  ? -35.854 -22.281 31.534  1.00 94.97  ? 366  GLU C CD    1 
ATOM   6072  O  OE1   . GLU C 2  366  ? -36.000 -23.139 30.639  1.00 97.96  ? 366  GLU C OE1   1 
ATOM   6073  O  OE2   . GLU C 2  366  ? -36.196 -21.088 31.393  1.00 94.64  ? 366  GLU C OE2   1 
ATOM   6074  N  N     . THR C 2  367  ? -32.127 -24.706 33.408  1.00 90.60  ? 367  THR C N     1 
ATOM   6075  C  CA    . THR C 2  367  ? -30.726 -24.306 33.347  1.00 88.92  ? 367  THR C CA    1 
ATOM   6076  C  C     . THR C 2  367  ? -30.584 -22.956 32.659  1.00 83.60  ? 367  THR C C     1 
ATOM   6077  O  O     . THR C 2  367  ? -31.193 -22.716 31.617  1.00 87.38  ? 367  THR C O     1 
ATOM   6078  C  CB    . THR C 2  367  ? -29.870 -25.343 32.602  1.00 92.84  ? 367  THR C CB    1 
ATOM   6079  O  OG1   . THR C 2  367  ? -30.185 -25.309 31.205  1.00 96.14  ? 367  THR C OG1   1 
ATOM   6080  C  CG2   . THR C 2  367  ? -30.133 -26.736 33.145  1.00 100.96 ? 367  THR C CG2   1 
ATOM   6081  N  N     . ASP C 2  368  ? -29.770 -22.082 33.240  1.00 79.06  ? 368  ASP C N     1 
ATOM   6082  C  CA    . ASP C 2  368  ? -29.635 -20.717 32.743  1.00 74.06  ? 368  ASP C CA    1 
ATOM   6083  C  C     . ASP C 2  368  ? -28.591 -20.588 31.631  1.00 65.14  ? 368  ASP C C     1 
ATOM   6084  O  O     . ASP C 2  368  ? -27.562 -21.263 31.642  1.00 68.71  ? 368  ASP C O     1 
ATOM   6085  C  CB    . ASP C 2  368  ? -29.292 -19.772 33.897  1.00 75.38  ? 368  ASP C CB    1 
ATOM   6086  C  CG    . ASP C 2  368  ? -30.444 -19.601 34.875  1.00 82.75  ? 368  ASP C CG    1 
ATOM   6087  O  OD1   . ASP C 2  368  ? -31.585 -19.969 34.521  1.00 93.76  ? 368  ASP C OD1   1 
ATOM   6088  O  OD2   . ASP C 2  368  ? -30.212 -19.088 35.992  1.00 78.44  ? 368  ASP C OD2   1 
ATOM   6089  N  N     . ASP C 2  369  ? -28.877 -19.719 30.667  1.00 58.50  ? 369  ASP C N     1 
ATOM   6090  C  CA    . ASP C 2  369  ? -27.944 -19.410 29.590  1.00 57.03  ? 369  ASP C CA    1 
ATOM   6091  C  C     . ASP C 2  369  ? -27.233 -18.107 29.924  1.00 60.63  ? 369  ASP C C     1 
ATOM   6092  O  O     . ASP C 2  369  ? -27.872 -17.065 30.066  1.00 61.18  ? 369  ASP C O     1 
ATOM   6093  C  CB    . ASP C 2  369  ? -28.674 -19.307 28.244  1.00 60.41  ? 369  ASP C CB    1 
ATOM   6094  C  CG    . ASP C 2  369  ? -27.725 -19.095 27.071  1.00 59.44  ? 369  ASP C CG    1 
ATOM   6095  O  OD1   . ASP C 2  369  ? -28.166 -18.539 26.042  1.00 48.77  ? 369  ASP C OD1   1 
ATOM   6096  O  OD2   . ASP C 2  369  ? -26.544 -19.489 27.171  1.00 66.73  ? 369  ASP C OD2   1 
ATOM   6097  N  N     . ILE C 2  370  ? -25.911 -18.172 30.054  1.00 59.13  ? 370  ILE C N     1 
ATOM   6098  C  CA    . ILE C 2  370  ? -25.121 -17.030 30.502  1.00 51.96  ? 370  ILE C CA    1 
ATOM   6099  C  C     . ILE C 2  370  ? -25.144 -15.875 29.499  1.00 46.42  ? 370  ILE C C     1 
ATOM   6100  O  O     . ILE C 2  370  ? -25.009 -14.711 29.873  1.00 44.76  ? 370  ILE C O     1 
ATOM   6101  C  CB    . ILE C 2  370  ? -23.656 -17.448 30.773  1.00 48.67  ? 370  ILE C CB    1 
ATOM   6102  C  CG1   . ILE C 2  370  ? -22.858 -16.292 31.380  1.00 55.14  ? 370  ILE C CG1   1 
ATOM   6103  C  CG2   . ILE C 2  370  ? -22.993 -17.962 29.502  1.00 54.62  ? 370  ILE C CG2   1 
ATOM   6104  C  CD1   . ILE C 2  370  ? -21.388 -16.591 31.537  1.00 71.61  ? 370  ILE C CD1   1 
ATOM   6105  N  N     . ASP C 2  371  ? -25.341 -16.195 28.226  1.00 45.85  ? 371  ASP C N     1 
ATOM   6106  C  CA    . ASP C 2  371  ? -25.257 -15.187 27.179  1.00 43.47  ? 371  ASP C CA    1 
ATOM   6107  C  C     . ASP C 2  371  ? -26.611 -14.549 26.863  1.00 44.45  ? 371  ASP C C     1 
ATOM   6108  O  O     . ASP C 2  371  ? -26.694 -13.666 26.010  1.00 44.73  ? 371  ASP C O     1 
ATOM   6109  C  CB    . ASP C 2  371  ? -24.653 -15.795 25.908  1.00 46.93  ? 371  ASP C CB    1 
ATOM   6110  C  CG    . ASP C 2  371  ? -23.251 -16.341 26.131  1.00 52.45  ? 371  ASP C CG    1 
ATOM   6111  O  OD1   . ASP C 2  371  ? -22.520 -15.779 26.973  1.00 56.84  ? 371  ASP C OD1   1 
ATOM   6112  O  OD2   . ASP C 2  371  ? -22.879 -17.333 25.467  1.00 57.01  ? 371  ASP C OD2   1 
ATOM   6113  N  N     . HIS C 2  372  ? -27.665 -14.989 27.549  1.00 42.05  ? 372  HIS C N     1 
ATOM   6114  C  CA    . HIS C 2  372  ? -28.995 -14.400 27.368  1.00 43.81  ? 372  HIS C CA    1 
ATOM   6115  C  C     . HIS C 2  372  ? -29.008 -12.984 27.924  1.00 40.83  ? 372  HIS C C     1 
ATOM   6116  O  O     . HIS C 2  372  ? -28.562 -12.754 29.046  1.00 45.08  ? 372  HIS C O     1 
ATOM   6117  C  CB    . HIS C 2  372  ? -30.076 -15.244 28.053  1.00 50.64  ? 372  HIS C CB    1 
ATOM   6118  C  CG    . HIS C 2  372  ? -31.476 -14.864 27.671  1.00 47.14  ? 372  HIS C CG    1 
ATOM   6119  N  ND1   . HIS C 2  372  ? -32.063 -13.682 28.068  1.00 42.80  ? 372  HIS C ND1   1 
ATOM   6120  C  CD2   . HIS C 2  372  ? -32.404 -15.514 26.930  1.00 45.26  ? 372  HIS C CD2   1 
ATOM   6121  C  CE1   . HIS C 2  372  ? -33.291 -13.618 27.584  1.00 46.37  ? 372  HIS C CE1   1 
ATOM   6122  N  NE2   . HIS C 2  372  ? -33.523 -14.717 26.890  1.00 47.05  ? 372  HIS C NE2   1 
ATOM   6123  N  N     . PHE C 2  373  ? -29.536 -12.037 27.155  1.00 36.16  ? 373  PHE C N     1 
ATOM   6124  C  CA    . PHE C 2  373  ? -29.468 -10.629 27.542  1.00 33.62  ? 373  PHE C CA    1 
ATOM   6125  C  C     . PHE C 2  373  ? -30.310 -10.285 28.773  1.00 38.30  ? 373  PHE C C     1 
ATOM   6126  O  O     . PHE C 2  373  ? -30.472 -9.112  29.113  1.00 42.94  ? 373  PHE C O     1 
ATOM   6127  C  CB    . PHE C 2  373  ? -29.878 -9.739  26.368  1.00 30.41  ? 373  PHE C CB    1 
ATOM   6128  C  CG    . PHE C 2  373  ? -28.713 -9.135  25.640  1.00 31.73  ? 373  PHE C CG    1 
ATOM   6129  C  CD1   . PHE C 2  373  ? -28.911 -8.242  24.602  1.00 29.71  ? 373  PHE C CD1   1 
ATOM   6130  C  CD2   . PHE C 2  373  ? -27.417 -9.461  25.998  1.00 29.63  ? 373  PHE C CD2   1 
ATOM   6131  C  CE1   . PHE C 2  373  ? -27.834 -7.685  23.937  1.00 26.75  ? 373  PHE C CE1   1 
ATOM   6132  C  CE2   . PHE C 2  373  ? -26.339 -8.909  25.337  1.00 26.75  ? 373  PHE C CE2   1 
ATOM   6133  C  CZ    . PHE C 2  373  ? -26.548 -8.020  24.306  1.00 25.05  ? 373  PHE C CZ    1 
ATOM   6134  N  N     . GLY C 2  374  ? -30.843 -11.308 29.434  1.00 40.29  ? 374  GLY C N     1 
ATOM   6135  C  CA    . GLY C 2  374  ? -31.529 -11.132 30.700  1.00 45.73  ? 374  GLY C CA    1 
ATOM   6136  C  C     . GLY C 2  374  ? -30.593 -11.465 31.844  1.00 47.45  ? 374  GLY C C     1 
ATOM   6137  O  O     . GLY C 2  374  ? -30.874 -11.177 33.007  1.00 52.79  ? 374  GLY C O     1 
ATOM   6138  N  N     . ASN C 2  375  ? -29.470 -12.083 31.498  1.00 45.14  ? 375  ASN C N     1 
ATOM   6139  C  CA    . ASN C 2  375  ? -28.440 -12.418 32.467  1.00 42.13  ? 375  ASN C CA    1 
ATOM   6140  C  C     . ASN C 2  375  ? -27.134 -11.725 32.104  1.00 42.04  ? 375  ASN C C     1 
ATOM   6141  O  O     . ASN C 2  375  ? -26.154 -11.794 32.842  1.00 49.93  ? 375  ASN C O     1 
ATOM   6142  C  CB    . ASN C 2  375  ? -28.242 -13.932 32.537  1.00 48.99  ? 375  ASN C CB    1 
ATOM   6143  C  CG    . ASN C 2  375  ? -29.539 -14.678 32.796  1.00 58.76  ? 375  ASN C CG    1 
ATOM   6144  O  OD1   . ASN C 2  375  ? -30.466 -14.138 33.398  1.00 63.93  ? 375  ASN C OD1   1 
ATOM   6145  N  ND2   . ASN C 2  375  ? -29.611 -15.923 32.338  1.00 61.98  ? 375  ASN C ND2   1 
ATOM   6146  N  N     . ARG C 2  376  ? -27.135 -11.057 30.955  1.00 37.24  ? 376  ARG C N     1 
ATOM   6147  C  CA    . ARG C 2  376  ? -25.973 -10.315 30.480  1.00 32.44  ? 376  ARG C CA    1 
ATOM   6148  C  C     . ARG C 2  376  ? -26.199 -8.822  30.686  1.00 29.12  ? 376  ARG C C     1 
ATOM   6149  O  O     . ARG C 2  376  ? -27.097 -8.235  30.088  1.00 30.56  ? 376  ARG C O     1 
ATOM   6150  C  CB    . ARG C 2  376  ? -25.711 -10.618 29.006  1.00 37.14  ? 376  ARG C CB    1 
ATOM   6151  C  CG    . ARG C 2  376  ? -24.369 -10.136 28.494  1.00 38.13  ? 376  ARG C CG    1 
ATOM   6152  C  CD    . ARG C 2  376  ? -23.380 -11.281 28.337  1.00 40.98  ? 376  ARG C CD    1 
ATOM   6153  N  NE    . ARG C 2  376  ? -22.136 -10.828 27.718  1.00 38.28  ? 376  ARG C NE    1 
ATOM   6154  C  CZ    . ARG C 2  376  ? -21.933 -10.775 26.406  1.00 37.41  ? 376  ARG C CZ    1 
ATOM   6155  N  NH1   . ARG C 2  376  ? -22.890 -11.154 25.571  1.00 38.87  ? 376  ARG C NH1   1 
ATOM   6156  N  NH2   . ARG C 2  376  ? -20.772 -10.345 25.928  1.00 36.83  ? 376  ARG C NH2   1 
ATOM   6157  N  N     . ARG C 2  377  ? -25.376 -8.207  31.527  1.00 28.93  ? 377  ARG C N     1 
ATOM   6158  C  CA    . ARG C 2  377  ? -25.630 -6.846  31.986  1.00 27.30  ? 377  ARG C CA    1 
ATOM   6159  C  C     . ARG C 2  377  ? -24.783 -5.790  31.280  1.00 23.17  ? 377  ARG C C     1 
ATOM   6160  O  O     . ARG C 2  377  ? -23.612 -6.007  30.978  1.00 27.02  ? 377  ARG C O     1 
ATOM   6161  C  CB    . ARG C 2  377  ? -25.405 -6.773  33.497  1.00 35.75  ? 377  ARG C CB    1 
ATOM   6162  C  CG    . ARG C 2  377  ? -25.837 -5.478  34.145  1.00 31.46  ? 377  ARG C CG    1 
ATOM   6163  C  CD    . ARG C 2  377  ? -25.851 -5.631  35.654  1.00 33.34  ? 377  ARG C CD    1 
ATOM   6164  N  NE    . ARG C 2  377  ? -25.999 -4.348  36.330  1.00 38.36  ? 377  ARG C NE    1 
ATOM   6165  C  CZ    . ARG C 2  377  ? -24.983 -3.558  36.657  1.00 34.83  ? 377  ARG C CZ    1 
ATOM   6166  N  NH1   . ARG C 2  377  ? -23.740 -3.917  36.366  1.00 32.22  ? 377  ARG C NH1   1 
ATOM   6167  N  NH2   . ARG C 2  377  ? -25.210 -2.407  37.275  1.00 33.84  ? 377  ARG C NH2   1 
ATOM   6168  N  N     . LEU C 2  378  ? -25.394 -4.637  31.033  1.00 19.64  ? 378  LEU C N     1 
ATOM   6169  C  CA    . LEU C 2  378  ? -24.733 -3.534  30.344  1.00 20.35  ? 378  LEU C CA    1 
ATOM   6170  C  C     . LEU C 2  378  ? -24.497 -2.364  31.300  1.00 24.75  ? 378  LEU C C     1 
ATOM   6171  O  O     . LEU C 2  378  ? -25.386 -1.541  31.512  1.00 31.04  ? 378  LEU C O     1 
ATOM   6172  C  CB    . LEU C 2  378  ? -25.576 -3.096  29.144  1.00 19.50  ? 378  LEU C CB    1 
ATOM   6173  C  CG    . LEU C 2  378  ? -25.018 -2.109  28.121  1.00 16.86  ? 378  LEU C CG    1 
ATOM   6174  C  CD1   . LEU C 2  378  ? -25.260 -0.672  28.540  1.00 18.53  ? 378  LEU C CD1   1 
ATOM   6175  C  CD2   . LEU C 2  378  ? -23.539 -2.361  27.847  1.00 18.67  ? 378  LEU C CD2   1 
ATOM   6176  N  N     . ARG C 2  379  ? -23.300 -2.289  31.876  1.00 21.76  ? 379  ARG C N     1 
ATOM   6177  C  CA    . ARG C 2  379  ? -22.988 -1.215  32.818  1.00 20.64  ? 379  ARG C CA    1 
ATOM   6178  C  C     . ARG C 2  379  ? -22.518 0.048   32.089  1.00 19.91  ? 379  ARG C C     1 
ATOM   6179  O  O     . ARG C 2  379  ? -21.455 0.060   31.467  1.00 19.65  ? 379  ARG C O     1 
ATOM   6180  C  CB    . ARG C 2  379  ? -21.935 -1.672  33.836  1.00 25.66  ? 379  ARG C CB    1 
ATOM   6181  C  CG    . ARG C 2  379  ? -20.671 -2.275  33.244  1.00 24.51  ? 379  ARG C CG    1 
ATOM   6182  C  CD    . ARG C 2  379  ? -19.480 -2.083  34.176  1.00 30.76  ? 379  ARG C CD    1 
ATOM   6183  N  NE    . ARG C 2  379  ? -19.088 -3.315  34.855  1.00 30.34  ? 379  ARG C NE    1 
ATOM   6184  C  CZ    . ARG C 2  379  ? -18.023 -3.425  35.642  1.00 28.74  ? 379  ARG C CZ    1 
ATOM   6185  N  NH1   . ARG C 2  379  ? -17.243 -2.374  35.852  1.00 28.39  ? 379  ARG C NH1   1 
ATOM   6186  N  NH2   . ARG C 2  379  ? -17.738 -4.586  36.217  1.00 31.81  ? 379  ARG C NH2   1 
ATOM   6187  N  N     . THR C 2  380  ? -23.313 1.111   32.174  1.00 17.26  ? 380  THR C N     1 
ATOM   6188  C  CA    . THR C 2  380  ? -23.070 2.318   31.383  1.00 16.30  ? 380  THR C CA    1 
ATOM   6189  C  C     . THR C 2  380  ? -21.946 3.188   31.926  1.00 17.33  ? 380  THR C C     1 
ATOM   6190  O  O     . THR C 2  380  ? -21.171 2.758   32.776  1.00 22.44  ? 380  THR C O     1 
ATOM   6191  C  CB    . THR C 2  380  ? -24.330 3.186   31.290  1.00 15.32  ? 380  THR C CB    1 
ATOM   6192  O  OG1   . THR C 2  380  ? -24.872 3.379   32.601  1.00 21.48  ? 380  THR C OG1   1 
ATOM   6193  C  CG2   . THR C 2  380  ? -25.368 2.524   30.412  1.00 21.16  ? 380  THR C CG2   1 
ATOM   6194  N  N     . VAL C 2  381  ? -21.872 4.418   31.426  1.00 15.78  ? 381  VAL C N     1 
ATOM   6195  C  CA    . VAL C 2  381  ? -20.830 5.354   31.830  1.00 14.72  ? 381  VAL C CA    1 
ATOM   6196  C  C     . VAL C 2  381  ? -20.965 5.720   33.299  1.00 15.90  ? 381  VAL C C     1 
ATOM   6197  O  O     . VAL C 2  381  ? -19.970 5.874   34.005  1.00 16.27  ? 381  VAL C O     1 
ATOM   6198  C  CB    . VAL C 2  381  ? -20.869 6.653   31.002  1.00 17.26  ? 381  VAL C CB    1 
ATOM   6199  C  CG1   . VAL C 2  381  ? -19.733 7.582   31.413  1.00 16.01  ? 381  VAL C CG1   1 
ATOM   6200  C  CG2   . VAL C 2  381  ? -20.796 6.347   29.520  1.00 22.51  ? 381  VAL C CG2   1 
ATOM   6201  N  N     . GLY C 2  382  ? -22.206 5.860   33.752  1.00 17.16  ? 382  GLY C N     1 
ATOM   6202  C  CA    . GLY C 2  382  ? -22.480 6.277   35.114  1.00 20.45  ? 382  GLY C CA    1 
ATOM   6203  C  C     . GLY C 2  382  ? -21.948 5.310   36.149  1.00 22.82  ? 382  GLY C C     1 
ATOM   6204  O  O     . GLY C 2  382  ? -21.337 5.719   37.137  1.00 24.21  ? 382  GLY C O     1 
ATOM   6205  N  N     . GLU C 2  383  ? -22.176 4.022   35.918  1.00 24.67  ? 383  GLU C N     1 
ATOM   6206  C  CA    . GLU C 2  383  ? -21.733 2.993   36.850  1.00 25.46  ? 383  GLU C CA    1 
ATOM   6207  C  C     . GLU C 2  383  ? -20.219 2.820   36.815  1.00 27.41  ? 383  GLU C C     1 
ATOM   6208  O  O     . GLU C 2  383  ? -19.582 2.652   37.855  1.00 30.63  ? 383  GLU C O     1 
ATOM   6209  C  CB    . GLU C 2  383  ? -22.412 1.660   36.547  1.00 21.73  ? 383  GLU C CB    1 
ATOM   6210  C  CG    . GLU C 2  383  ? -21.930 0.532   37.441  1.00 28.58  ? 383  GLU C CG    1 
ATOM   6211  C  CD    . GLU C 2  383  ? -22.601 -0.791  37.137  1.00 46.84  ? 383  GLU C CD    1 
ATOM   6212  O  OE1   . GLU C 2  383  ? -23.661 -0.783  36.476  1.00 48.87  ? 383  GLU C OE1   1 
ATOM   6213  O  OE2   . GLU C 2  383  ? -22.063 -1.838  37.557  1.00 53.89  ? 383  GLU C OE2   1 
ATOM   6214  N  N     . LEU C 2  384  ? -19.648 2.865   35.616  1.00 24.98  ? 384  LEU C N     1 
ATOM   6215  C  CA    . LEU C 2  384  ? -18.205 2.726   35.442  1.00 21.85  ? 384  LEU C CA    1 
ATOM   6216  C  C     . LEU C 2  384  ? -17.422 3.805   36.181  1.00 23.62  ? 384  LEU C C     1 
ATOM   6217  O  O     . LEU C 2  384  ? -16.361 3.537   36.748  1.00 23.15  ? 384  LEU C O     1 
ATOM   6218  C  CB    . LEU C 2  384  ? -17.852 2.762   33.961  1.00 19.39  ? 384  LEU C CB    1 
ATOM   6219  C  CG    . LEU C 2  384  ? -18.144 1.452   33.241  1.00 21.44  ? 384  LEU C CG    1 
ATOM   6220  C  CD1   . LEU C 2  384  ? -18.271 1.684   31.749  1.00 22.26  ? 384  LEU C CD1   1 
ATOM   6221  C  CD2   . LEU C 2  384  ? -17.036 0.460   33.548  1.00 27.10  ? 384  LEU C CD2   1 
ATOM   6222  N  N     . ILE C 2  385  ? -17.949 5.024   36.155  1.00 22.44  ? 385  ILE C N     1 
ATOM   6223  C  CA    . ILE C 2  385  ? -17.352 6.140   36.874  1.00 16.90  ? 385  ILE C CA    1 
ATOM   6224  C  C     . ILE C 2  385  ? -17.619 5.986   38.360  1.00 18.22  ? 385  ILE C C     1 
ATOM   6225  O  O     . ILE C 2  385  ? -16.765 6.284   39.196  1.00 19.74  ? 385  ILE C O     1 
ATOM   6226  C  CB    . ILE C 2  385  ? -17.909 7.487   36.398  1.00 14.41  ? 385  ILE C CB    1 
ATOM   6227  C  CG1   . ILE C 2  385  ? -17.623 7.698   34.914  1.00 12.19  ? 385  ILE C CG1   1 
ATOM   6228  C  CG2   . ILE C 2  385  ? -17.311 8.623   37.200  1.00 16.63  ? 385  ILE C CG2   1 
ATOM   6229  C  CD1   . ILE C 2  385  ? -18.059 9.051   34.423  1.00 13.08  ? 385  ILE C CD1   1 
ATOM   6230  N  N     . GLN C 2  386  ? -18.820 5.512   38.675  1.00 17.86  ? 386  GLN C N     1 
ATOM   6231  C  CA    . GLN C 2  386  ? -19.213 5.271   40.054  1.00 20.20  ? 386  GLN C CA    1 
ATOM   6232  C  C     . GLN C 2  386  ? -18.277 4.283   40.718  1.00 23.22  ? 386  GLN C C     1 
ATOM   6233  O  O     . GLN C 2  386  ? -17.713 4.568   41.771  1.00 28.52  ? 386  GLN C O     1 
ATOM   6234  C  CB    . GLN C 2  386  ? -20.644 4.741   40.134  1.00 22.67  ? 386  GLN C CB    1 
ATOM   6235  C  CG    . GLN C 2  386  ? -21.025 4.267   41.527  1.00 28.25  ? 386  GLN C CG    1 
ATOM   6236  C  CD    . GLN C 2  386  ? -22.408 3.657   41.587  1.00 30.06  ? 386  GLN C CD    1 
ATOM   6237  O  OE1   . GLN C 2  386  ? -22.574 2.450   41.416  1.00 28.14  ? 386  GLN C OE1   1 
ATOM   6238  N  NE2   . GLN C 2  386  ? -23.410 4.491   41.834  1.00 31.79  ? 386  GLN C NE2   1 
ATOM   6239  N  N     . ASN C 2  387  ? -18.119 3.119   40.096  1.00 24.73  ? 387  ASN C N     1 
ATOM   6240  C  CA    . ASN C 2  387  ? -17.320 2.048   40.677  1.00 27.81  ? 387  ASN C CA    1 
ATOM   6241  C  C     . ASN C 2  387  ? -15.908 2.504   40.995  1.00 29.07  ? 387  ASN C C     1 
ATOM   6242  O  O     . ASN C 2  387  ? -15.360 2.166   42.043  1.00 38.28  ? 387  ASN C O     1 
ATOM   6243  C  CB    . ASN C 2  387  ? -17.288 0.837   39.747  1.00 35.59  ? 387  ASN C CB    1 
ATOM   6244  C  CG    . ASN C 2  387  ? -18.460 -0.097  39.976  1.00 33.45  ? 387  ASN C CG    1 
ATOM   6245  O  OD1   . ASN C 2  387  ? -19.417 0.255   40.666  1.00 32.89  ? 387  ASN C OD1   1 
ATOM   6246  N  ND2   . ASN C 2  387  ? -18.391 -1.294  39.402  1.00 34.00  ? 387  ASN C ND2   1 
ATOM   6247  N  N     . GLN C 2  388  ? -15.330 3.295   40.100  1.00 26.91  ? 388  GLN C N     1 
ATOM   6248  C  CA    . GLN C 2  388  ? -14.012 3.855   40.342  1.00 26.52  ? 388  GLN C CA    1 
ATOM   6249  C  C     . GLN C 2  388  ? -14.030 4.855   41.486  1.00 26.65  ? 388  GLN C C     1 
ATOM   6250  O  O     . GLN C 2  388  ? -13.087 4.923   42.272  1.00 31.22  ? 388  GLN C O     1 
ATOM   6251  C  CB    . GLN C 2  388  ? -13.477 4.508   39.077  1.00 28.56  ? 388  GLN C CB    1 
ATOM   6252  C  CG    . GLN C 2  388  ? -12.659 3.552   38.256  1.00 32.17  ? 388  GLN C CG    1 
ATOM   6253  C  CD    . GLN C 2  388  ? -11.550 2.930   39.075  1.00 32.95  ? 388  GLN C CD    1 
ATOM   6254  O  OE1   . GLN C 2  388  ? -10.579 3.598   39.431  1.00 37.12  ? 388  GLN C OE1   1 
ATOM   6255  N  NE2   . GLN C 2  388  ? -11.696 1.651   39.397  1.00 32.28  ? 388  GLN C NE2   1 
ATOM   6256  N  N     . ILE C 2  389  ? -15.102 5.634   41.575  1.00 25.00  ? 389  ILE C N     1 
ATOM   6257  C  CA    . ILE C 2  389  ? -15.263 6.555   42.689  1.00 23.39  ? 389  ILE C CA    1 
ATOM   6258  C  C     . ILE C 2  389  ? -15.303 5.770   43.988  1.00 26.34  ? 389  ILE C C     1 
ATOM   6259  O  O     . ILE C 2  389  ? -14.645 6.127   44.962  1.00 34.09  ? 389  ILE C O     1 
ATOM   6260  C  CB    . ILE C 2  389  ? -16.539 7.394   42.564  1.00 23.70  ? 389  ILE C CB    1 
ATOM   6261  C  CG1   . ILE C 2  389  ? -16.382 8.451   41.473  1.00 20.54  ? 389  ILE C CG1   1 
ATOM   6262  C  CG2   . ILE C 2  389  ? -16.861 8.067   43.881  1.00 26.67  ? 389  ILE C CG2   1 
ATOM   6263  C  CD1   . ILE C 2  389  ? -17.579 9.364   41.353  1.00 25.80  ? 389  ILE C CD1   1 
ATOM   6264  N  N     . ARG C 2  390  ? -16.069 4.685   43.980  1.00 25.33  ? 390  ARG C N     1 
ATOM   6265  C  CA    . ARG C 2  390  ? -16.193 3.817   45.142  1.00 31.52  ? 390  ARG C CA    1 
ATOM   6266  C  C     . ARG C 2  390  ? -14.823 3.326   45.606  1.00 34.64  ? 390  ARG C C     1 
ATOM   6267  O  O     . ARG C 2  390  ? -14.573 3.220   46.805  1.00 41.07  ? 390  ARG C O     1 
ATOM   6268  C  CB    . ARG C 2  390  ? -17.114 2.629   44.829  1.00 41.13  ? 390  ARG C CB    1 
ATOM   6269  C  CG    . ARG C 2  390  ? -17.362 1.693   46.008  1.00 54.61  ? 390  ARG C CG    1 
ATOM   6270  C  CD    . ARG C 2  390  ? -18.391 0.606   45.689  1.00 50.28  ? 390  ARG C CD    1 
ATOM   6271  N  NE    . ARG C 2  390  ? -19.751 1.132   45.594  1.00 46.31  ? 390  ARG C NE    1 
ATOM   6272  C  CZ    . ARG C 2  390  ? -20.421 1.275   44.455  1.00 46.13  ? 390  ARG C CZ    1 
ATOM   6273  N  NH1   . ARG C 2  390  ? -19.861 0.922   43.306  1.00 42.34  ? 390  ARG C NH1   1 
ATOM   6274  N  NH2   . ARG C 2  390  ? -21.654 1.764   44.464  1.00 48.42  ? 390  ARG C NH2   1 
ATOM   6275  N  N     . VAL C 2  391  ? -13.930 3.047   44.660  1.00 34.03  ? 391  VAL C N     1 
ATOM   6276  C  CA    . VAL C 2  391  ? -12.585 2.599   45.008  1.00 35.60  ? 391  VAL C CA    1 
ATOM   6277  C  C     . VAL C 2  391  ? -11.840 3.683   45.775  1.00 34.68  ? 391  VAL C C     1 
ATOM   6278  O  O     . VAL C 2  391  ? -11.321 3.440   46.862  1.00 40.33  ? 391  VAL C O     1 
ATOM   6279  C  CB    . VAL C 2  391  ? -11.762 2.204   43.765  1.00 33.85  ? 391  VAL C CB    1 
ATOM   6280  C  CG1   . VAL C 2  391  ? -10.309 1.957   44.148  1.00 36.05  ? 391  VAL C CG1   1 
ATOM   6281  C  CG2   . VAL C 2  391  ? -12.353 0.969   43.105  1.00 42.58  ? 391  VAL C CG2   1 
ATOM   6282  N  N     . GLY C 2  392  ? -11.804 4.883   45.209  1.00 38.18  ? 392  GLY C N     1 
ATOM   6283  C  CA    . GLY C 2  392  ? -11.115 6.000   45.828  1.00 42.92  ? 392  GLY C CA    1 
ATOM   6284  C  C     . GLY C 2  392  ? -11.663 6.391   47.188  1.00 44.51  ? 392  GLY C C     1 
ATOM   6285  O  O     . GLY C 2  392  ? -10.963 7.014   47.985  1.00 46.80  ? 392  GLY C O     1 
ATOM   6286  N  N     . MET C 2  393  ? -12.917 6.032   47.454  1.00 44.68  ? 393  MET C N     1 
ATOM   6287  C  CA    . MET C 2  393  ? -13.550 6.346   48.731  1.00 49.19  ? 393  MET C CA    1 
ATOM   6288  C  C     . MET C 2  393  ? -13.104 5.370   49.807  1.00 51.11  ? 393  MET C C     1 
ATOM   6289  O  O     . MET C 2  393  ? -12.998 5.725   50.983  1.00 59.72  ? 393  MET C O     1 
ATOM   6290  C  CB    . MET C 2  393  ? -15.076 6.320   48.608  1.00 45.28  ? 393  MET C CB    1 
ATOM   6291  C  CG    . MET C 2  393  ? -15.642 7.330   47.627  1.00 39.54  ? 393  MET C CG    1 
ATOM   6292  S  SD    . MET C 2  393  ? -15.170 9.018   48.022  1.00 33.39  ? 393  MET C SD    1 
ATOM   6293  C  CE    . MET C 2  393  ? -16.078 9.254   49.545  1.00 59.18  ? 393  MET C CE    1 
ATOM   6294  N  N     . SER C 2  394  ? -12.848 4.132   49.402  1.00 44.46  ? 394  SER C N     1 
ATOM   6295  C  CA    . SER C 2  394  ? -12.416 3.114   50.346  1.00 47.23  ? 394  SER C CA    1 
ATOM   6296  C  C     . SER C 2  394  ? -10.950 3.315   50.720  1.00 48.65  ? 394  SER C C     1 
ATOM   6297  O  O     . SER C 2  394  ? -10.518 2.908   51.796  1.00 56.52  ? 394  SER C O     1 
ATOM   6298  C  CB    . SER C 2  394  ? -12.638 1.715   49.771  1.00 51.97  ? 394  SER C CB    1 
ATOM   6299  O  OG    . SER C 2  394  ? -11.875 1.522   48.593  1.00 62.74  ? 394  SER C OG    1 
ATOM   6300  N  N     . ARG C 2  395  ? -10.189 3.950   49.833  1.00 44.95  ? 395  ARG C N     1 
ATOM   6301  C  CA    . ARG C 2  395  ? -8.792  4.259   50.128  1.00 47.05  ? 395  ARG C CA    1 
ATOM   6302  C  C     . ARG C 2  395  ? -8.697  5.329   51.207  1.00 59.89  ? 395  ARG C C     1 
ATOM   6303  O  O     . ARG C 2  395  ? -7.898  5.214   52.136  1.00 69.92  ? 395  ARG C O     1 
ATOM   6304  C  CB    . ARG C 2  395  ? -8.044  4.725   48.876  1.00 54.37  ? 395  ARG C CB    1 
ATOM   6305  C  CG    . ARG C 2  395  ? -7.688  3.619   47.892  1.00 63.43  ? 395  ARG C CG    1 
ATOM   6306  C  CD    . ARG C 2  395  ? -6.626  4.079   46.893  1.00 61.75  ? 395  ARG C CD    1 
ATOM   6307  N  NE    . ARG C 2  395  ? -6.246  3.014   45.966  1.00 57.95  ? 395  ARG C NE    1 
ATOM   6308  C  CZ    . ARG C 2  395  ? -6.594  2.972   44.683  1.00 54.92  ? 395  ARG C CZ    1 
ATOM   6309  N  NH1   . ARG C 2  395  ? -7.324  3.945   44.156  1.00 46.19  ? 395  ARG C NH1   1 
ATOM   6310  N  NH2   . ARG C 2  395  ? -6.203  1.958   43.923  1.00 62.20  ? 395  ARG C NH2   1 
ATOM   6311  N  N     . MET C 2  396  ? -9.513  6.372   51.077  1.00 63.95  ? 396  MET C N     1 
ATOM   6312  C  CA    . MET C 2  396  ? -9.485  7.482   52.023  1.00 58.12  ? 396  MET C CA    1 
ATOM   6313  C  C     . MET C 2  396  ? -10.166 7.089   53.324  1.00 54.99  ? 396  MET C C     1 
ATOM   6314  O  O     . MET C 2  396  ? -9.908  7.678   54.370  1.00 59.96  ? 396  MET C O     1 
ATOM   6315  C  CB    . MET C 2  396  ? -10.153 8.724   51.435  1.00 52.20  ? 396  MET C CB    1 
ATOM   6316  C  CG    . MET C 2  396  ? -11.665 8.737   51.564  1.00 50.51  ? 396  MET C CG    1 
ATOM   6317  S  SD    . MET C 2  396  ? -12.305 10.418  51.615  1.00 71.36  ? 396  MET C SD    1 
ATOM   6318  C  CE    . MET C 2  396  ? -11.203 11.140  52.825  1.00 59.65  ? 396  MET C CE    1 
ATOM   6319  N  N     . GLU C 2  397  ? -11.037 6.089   53.253  1.00 53.29  ? 397  GLU C N     1 
ATOM   6320  C  CA    . GLU C 2  397  ? -11.685 5.563   54.445  1.00 59.69  ? 397  GLU C CA    1 
ATOM   6321  C  C     . GLU C 2  397  ? -10.652 4.890   55.341  1.00 61.53  ? 397  GLU C C     1 
ATOM   6322  O  O     . GLU C 2  397  ? -10.716 4.978   56.568  1.00 64.82  ? 397  GLU C O     1 
ATOM   6323  C  CB    . GLU C 2  397  ? -12.786 4.573   54.072  1.00 59.93  ? 397  GLU C CB    1 
ATOM   6324  C  CG    . GLU C 2  397  ? -13.586 4.095   55.264  1.00 66.38  ? 397  GLU C CG    1 
ATOM   6325  C  CD    . GLU C 2  397  ? -14.478 2.916   54.941  1.00 71.46  ? 397  GLU C CD    1 
ATOM   6326  O  OE1   . GLU C 2  397  ? -15.652 2.927   55.369  1.00 86.64  ? 397  GLU C OE1   1 
ATOM   6327  O  OE2   . GLU C 2  397  ? -14.004 1.974   54.272  1.00 59.63  ? 397  GLU C OE2   1 
ATOM   6328  N  N     . ARG C 2  398  ? -9.696  4.218   54.710  1.00 60.04  ? 398  ARG C N     1 
ATOM   6329  C  CA    . ARG C 2  398  ? -8.600  3.577   55.422  1.00 59.11  ? 398  ARG C CA    1 
ATOM   6330  C  C     . ARG C 2  398  ? -7.732  4.633   56.098  1.00 66.00  ? 398  ARG C C     1 
ATOM   6331  O  O     . ARG C 2  398  ? -7.278  4.449   57.226  1.00 72.74  ? 398  ARG C O     1 
ATOM   6332  C  CB    . ARG C 2  398  ? -7.762  2.730   54.462  1.00 70.67  ? 398  ARG C CB    1 
ATOM   6333  C  CG    . ARG C 2  398  ? -7.130  1.491   55.084  1.00 80.37  ? 398  ARG C CG    1 
ATOM   6334  C  CD    . ARG C 2  398  ? -6.125  0.850   54.130  1.00 82.69  ? 398  ARG C CD    1 
ATOM   6335  N  NE    . ARG C 2  398  ? -4.859  1.579   54.109  1.00 78.47  ? 398  ARG C NE    1 
ATOM   6336  C  CZ    . ARG C 2  398  ? -3.719  1.111   54.606  1.00 66.26  ? 398  ARG C CZ    1 
ATOM   6337  N  NH1   . ARG C 2  398  ? -2.616  1.847   54.551  1.00 54.56  ? 398  ARG C NH1   1 
ATOM   6338  N  NH2   . ARG C 2  398  ? -3.679  -0.098  55.151  1.00 62.37  ? 398  ARG C NH2   1 
ATOM   6339  N  N     . VAL C 2  399  ? -7.508  5.740   55.396  1.00 65.08  ? 399  VAL C N     1 
ATOM   6340  C  CA    . VAL C 2  399  ? -6.731  6.856   55.930  1.00 68.87  ? 399  VAL C CA    1 
ATOM   6341  C  C     . VAL C 2  399  ? -7.506  7.572   57.034  1.00 75.21  ? 399  VAL C C     1 
ATOM   6342  O  O     . VAL C 2  399  ? -6.924  8.017   58.028  1.00 83.64  ? 399  VAL C O     1 
ATOM   6343  C  CB    . VAL C 2  399  ? -6.356  7.868   54.821  1.00 73.37  ? 399  VAL C CB    1 
ATOM   6344  C  CG1   . VAL C 2  399  ? -5.758  9.139   55.417  1.00 79.79  ? 399  VAL C CG1   1 
ATOM   6345  C  CG2   . VAL C 2  399  ? -5.390  7.235   53.832  1.00 68.60  ? 399  VAL C CG2   1 
ATOM   6346  N  N     . VAL C 2  400  ? -8.819  7.677   56.857  1.00 68.37  ? 400  VAL C N     1 
ATOM   6347  C  CA    . VAL C 2  400  ? -9.676  8.296   57.859  1.00 62.41  ? 400  VAL C CA    1 
ATOM   6348  C  C     . VAL C 2  400  ? -9.586  7.536   59.177  1.00 65.43  ? 400  VAL C C     1 
ATOM   6349  O  O     . VAL C 2  400  ? -9.337  8.127   60.226  1.00 72.46  ? 400  VAL C O     1 
ATOM   6350  C  CB    . VAL C 2  400  ? -11.143 8.356   57.392  1.00 64.24  ? 400  VAL C CB    1 
ATOM   6351  C  CG1   . VAL C 2  400  ? -12.084 8.441   58.580  1.00 74.24  ? 400  VAL C CG1   1 
ATOM   6352  C  CG2   . VAL C 2  400  ? -11.352 9.540   56.461  1.00 73.99  ? 400  VAL C CG2   1 
ATOM   6353  N  N     . ARG C 2  401  ? -9.759  6.220   59.111  1.00 66.05  ? 401  ARG C N     1 
ATOM   6354  C  CA    . ARG C 2  401  ? -9.713  5.380   60.304  1.00 70.62  ? 401  ARG C CA    1 
ATOM   6355  C  C     . ARG C 2  401  ? -8.315  5.287   60.905  1.00 68.84  ? 401  ARG C C     1 
ATOM   6356  O  O     . ARG C 2  401  ? -8.140  4.781   62.011  1.00 68.11  ? 401  ARG C O     1 
ATOM   6357  C  CB    . ARG C 2  401  ? -10.238 3.980   59.986  1.00 68.63  ? 401  ARG C CB    1 
ATOM   6358  C  CG    . ARG C 2  401  ? -11.749 3.921   59.893  1.00 74.68  ? 401  ARG C CG    1 
ATOM   6359  C  CD    . ARG C 2  401  ? -12.250 2.533   59.550  1.00 73.06  ? 401  ARG C CD    1 
ATOM   6360  N  NE    . ARG C 2  401  ? -13.708 2.487   59.575  1.00 83.21  ? 401  ARG C NE    1 
ATOM   6361  C  CZ    . ARG C 2  401  ? -14.435 1.478   59.109  1.00 99.09  ? 401  ARG C CZ    1 
ATOM   6362  N  NH1   . ARG C 2  401  ? -13.839 0.423   58.570  1.00 109.94 ? 401  ARG C NH1   1 
ATOM   6363  N  NH2   . ARG C 2  401  ? -15.759 1.526   59.176  1.00 103.16 ? 401  ARG C NH2   1 
ATOM   6364  N  N     . GLU C 2  402  ? -7.319  5.771   60.174  1.00 71.92  ? 402  GLU C N     1 
ATOM   6365  C  CA    . GLU C 2  402  ? -5.968  5.834   60.707  1.00 70.90  ? 402  GLU C CA    1 
ATOM   6366  C  C     . GLU C 2  402  ? -5.723  7.198   61.327  1.00 76.57  ? 402  GLU C C     1 
ATOM   6367  O  O     . GLU C 2  402  ? -5.005  7.322   62.317  1.00 90.08  ? 402  GLU C O     1 
ATOM   6368  C  CB    . GLU C 2  402  ? -4.931  5.552   59.619  1.00 79.83  ? 402  GLU C CB    1 
ATOM   6369  C  CG    . GLU C 2  402  ? -3.495  5.589   60.122  1.00 81.98  ? 402  GLU C CG    1 
ATOM   6370  C  CD    . GLU C 2  402  ? -3.273  4.660   61.303  1.00 88.88  ? 402  GLU C CD    1 
ATOM   6371  O  OE1   . GLU C 2  402  ? -3.843  3.547   61.300  1.00 89.55  ? 402  GLU C OE1   1 
ATOM   6372  O  OE2   . GLU C 2  402  ? -2.538  5.047   62.237  1.00 92.28  ? 402  GLU C OE2   1 
ATOM   6373  N  N     . ARG C 2  403  ? -6.330  8.223   60.738  1.00 72.24  ? 403  ARG C N     1 
ATOM   6374  C  CA    . ARG C 2  403  ? -6.194  9.579   61.247  1.00 75.82  ? 403  ARG C CA    1 
ATOM   6375  C  C     . ARG C 2  403  ? -7.092  9.797   62.462  1.00 77.94  ? 403  ARG C C     1 
ATOM   6376  O  O     . ARG C 2  403  ? -6.997  10.823  63.135  1.00 79.97  ? 403  ARG C O     1 
ATOM   6377  C  CB    . ARG C 2  403  ? -6.521  10.601  60.155  1.00 77.61  ? 403  ARG C CB    1 
ATOM   6378  C  CG    . ARG C 2  403  ? -5.431  10.766  59.099  1.00 79.24  ? 403  ARG C CG    1 
ATOM   6379  C  CD    . ARG C 2  403  ? -5.759  11.909  58.143  1.00 86.45  ? 403  ARG C CD    1 
ATOM   6380  N  NE    . ARG C 2  403  ? -4.669  12.196  57.212  1.00 86.39  ? 403  ARG C NE    1 
ATOM   6381  C  CZ    . ARG C 2  403  ? -4.686  13.191  56.328  1.00 82.22  ? 403  ARG C CZ    1 
ATOM   6382  N  NH1   . ARG C 2  403  ? -5.737  13.997  56.253  1.00 83.55  ? 403  ARG C NH1   1 
ATOM   6383  N  NH2   . ARG C 2  403  ? -3.652  13.382  55.518  1.00 75.33  ? 403  ARG C NH2   1 
ATOM   6384  N  N     . MET C 2  404  ? -7.958  8.826   62.740  1.00 76.42  ? 404  MET C N     1 
ATOM   6385  C  CA    . MET C 2  404  ? -8.870  8.918   63.876  1.00 85.19  ? 404  MET C CA    1 
ATOM   6386  C  C     . MET C 2  404  ? -8.215  8.452   65.170  1.00 84.68  ? 404  MET C C     1 
ATOM   6387  O  O     . MET C 2  404  ? -8.279  9.139   66.190  1.00 88.05  ? 404  MET C O     1 
ATOM   6388  C  CB    . MET C 2  404  ? -10.140 8.104   63.617  1.00 86.58  ? 404  MET C CB    1 
ATOM   6389  C  CG    . MET C 2  404  ? -11.163 8.810   62.742  1.00 85.54  ? 404  MET C CG    1 
ATOM   6390  S  SD    . MET C 2  404  ? -12.803 8.072   62.865  1.00 86.95  ? 404  MET C SD    1 
ATOM   6391  C  CE    . MET C 2  404  ? -12.413 6.343   62.613  1.00 86.29  ? 404  MET C CE    1 
ATOM   6392  N  N     . THR C 2  405  ? -7.587  7.282   65.124  1.00 82.83  ? 405  THR C N     1 
ATOM   6393  C  CA    . THR C 2  405  ? -6.935  6.719   66.301  1.00 85.11  ? 405  THR C CA    1 
ATOM   6394  C  C     . THR C 2  405  ? -5.687  7.507   66.687  1.00 87.37  ? 405  THR C C     1 
ATOM   6395  O  O     . THR C 2  405  ? -5.262  7.482   67.840  1.00 95.27  ? 405  THR C O     1 
ATOM   6396  C  CB    . THR C 2  405  ? -6.541  5.250   66.079  1.00 76.64  ? 405  THR C CB    1 
ATOM   6397  O  OG1   . THR C 2  405  ? -5.522  5.174   65.076  1.00 78.54  ? 405  THR C OG1   1 
ATOM   6398  C  CG2   . THR C 2  405  ? -7.747  4.434   65.643  1.00 75.44  ? 405  THR C CG2   1 
ATOM   6399  N  N     . THR C 2  406  ? -5.100  8.203   65.719  1.00 84.84  ? 406  THR C N     1 
ATOM   6400  C  CA    . THR C 2  406  ? -3.910  9.004   65.982  1.00 86.72  ? 406  THR C CA    1 
ATOM   6401  C  C     . THR C 2  406  ? -4.263  10.287  66.721  1.00 89.31  ? 406  THR C C     1 
ATOM   6402  O  O     . THR C 2  406  ? -3.896  10.472  67.883  1.00 92.33  ? 406  THR C O     1 
ATOM   6403  C  CB    . THR C 2  406  ? -3.168  9.368   64.683  1.00 93.92  ? 406  THR C CB    1 
ATOM   6404  O  OG1   . THR C 2  406  ? -2.683  8.175   64.058  1.00 98.47  ? 406  THR C OG1   1 
ATOM   6405  C  CG2   . THR C 2  406  ? -1.992  10.292  64.980  1.00 90.50  ? 406  THR C CG2   1 
ATOM   6406  N  N     . GLN C 2  407  ? -4.984  11.167  66.034  1.00 92.95  ? 407  GLN C N     1 
ATOM   6407  C  CA    . GLN C 2  407  ? -5.332  12.478  66.569  1.00 101.21 ? 407  GLN C CA    1 
ATOM   6408  C  C     . GLN C 2  407  ? -6.186  12.372  67.832  1.00 103.89 ? 407  GLN C C     1 
ATOM   6409  O  O     . GLN C 2  407  ? -6.780  11.328  68.105  1.00 100.70 ? 407  GLN C O     1 
ATOM   6410  C  CB    . GLN C 2  407  ? -6.063  13.296  65.501  1.00 100.26 ? 407  GLN C CB    1 
ATOM   6411  C  CG    . GLN C 2  407  ? -5.316  13.390  64.177  1.00 89.48  ? 407  GLN C CG    1 
ATOM   6412  C  CD    . GLN C 2  407  ? -6.201  13.861  63.038  1.00 88.30  ? 407  GLN C CD    1 
ATOM   6413  O  OE1   . GLN C 2  407  ? -7.337  14.286  63.254  1.00 84.96  ? 407  GLN C OE1   1 
ATOM   6414  N  NE2   . GLN C 2  407  ? -5.685  13.784  61.816  1.00 91.59  ? 407  GLN C NE2   1 
ATOM   6415  N  N     . ASP C 2  408  ? -6.236  13.457  68.601  1.00 105.05 ? 408  ASP C N     1 
ATOM   6416  C  CA    . ASP C 2  408  ? -7.036  13.506  69.822  1.00 106.23 ? 408  ASP C CA    1 
ATOM   6417  C  C     . ASP C 2  408  ? -8.493  13.874  69.529  1.00 99.21  ? 408  ASP C C     1 
ATOM   6418  O  O     . ASP C 2  408  ? -8.777  14.583  68.566  1.00 100.48 ? 408  ASP C O     1 
ATOM   6419  C  CB    . ASP C 2  408  ? -6.426  14.498  70.816  1.00 112.18 ? 408  ASP C CB    1 
ATOM   6420  C  CG    . ASP C 2  408  ? -6.096  15.835  70.178  1.00 110.32 ? 408  ASP C CG    1 
ATOM   6421  O  OD1   . ASP C 2  408  ? -5.630  15.846  69.018  1.00 103.18 ? 408  ASP C OD1   1 
ATOM   6422  O  OD2   . ASP C 2  408  ? -6.303  16.877  70.836  1.00 113.34 ? 408  ASP C OD2   1 
ATOM   6423  N  N     . VAL C 2  409  ? -9.401  13.398  70.379  1.00 94.11  ? 409  VAL C N     1 
ATOM   6424  C  CA    . VAL C 2  409  ? -10.847 13.533  70.171  1.00 98.54  ? 409  VAL C CA    1 
ATOM   6425  C  C     . VAL C 2  409  ? -11.324 14.981  70.031  1.00 104.39 ? 409  VAL C C     1 
ATOM   6426  O  O     . VAL C 2  409  ? -12.240 15.272  69.258  1.00 109.59 ? 409  VAL C O     1 
ATOM   6427  C  CB    . VAL C 2  409  ? -11.630 12.864  71.331  1.00 97.46  ? 409  VAL C CB    1 
ATOM   6428  C  CG1   . VAL C 2  409  ? -13.132 13.100  71.195  1.00 97.87  ? 409  VAL C CG1   1 
ATOM   6429  C  CG2   . VAL C 2  409  ? -11.330 11.376  71.384  1.00 95.47  ? 409  VAL C CG2   1 
ATOM   6430  N  N     . GLU C 2  410  ? -10.697 15.891  70.767  1.00 101.73 ? 410  GLU C N     1 
ATOM   6431  C  CA    . GLU C 2  410  ? -11.186 17.264  70.832  1.00 105.68 ? 410  GLU C CA    1 
ATOM   6432  C  C     . GLU C 2  410  ? -10.784 18.127  69.640  1.00 101.73 ? 410  GLU C C     1 
ATOM   6433  O  O     . GLU C 2  410  ? -11.463 19.104  69.324  1.00 105.36 ? 410  GLU C O     1 
ATOM   6434  C  CB    . GLU C 2  410  ? -10.714 17.926  72.126  1.00 117.91 ? 410  GLU C CB    1 
ATOM   6435  C  CG    . GLU C 2  410  ? -11.610 17.622  73.311  1.00 128.11 ? 410  GLU C CG    1 
ATOM   6436  C  CD    . GLU C 2  410  ? -13.064 17.961  73.032  1.00 123.64 ? 410  GLU C CD    1 
ATOM   6437  O  OE1   . GLU C 2  410  ? -13.941 17.138  73.367  1.00 118.90 ? 410  GLU C OE1   1 
ATOM   6438  O  OE2   . GLU C 2  410  ? -13.328 19.050  72.477  1.00 126.19 ? 410  GLU C OE2   1 
ATOM   6439  N  N     . ALA C 2  411  ? -9.690  17.772  68.977  1.00 96.60  ? 411  ALA C N     1 
ATOM   6440  C  CA    . ALA C 2  411  ? -9.184  18.588  67.878  1.00 96.56  ? 411  ALA C CA    1 
ATOM   6441  C  C     . ALA C 2  411  ? -9.578  18.038  66.513  1.00 91.23  ? 411  ALA C C     1 
ATOM   6442  O  O     . ALA C 2  411  ? -9.158  18.563  65.483  1.00 86.27  ? 411  ALA C O     1 
ATOM   6443  C  CB    . ALA C 2  411  ? -7.672  18.714  67.972  1.00 99.22  ? 411  ALA C CB    1 
ATOM   6444  N  N     . ILE C 2  412  ? -10.386 16.985  66.501  1.00 92.28  ? 412  ILE C N     1 
ATOM   6445  C  CA    . ILE C 2  412  ? -10.748 16.345  65.245  1.00 84.18  ? 412  ILE C CA    1 
ATOM   6446  C  C     . ILE C 2  412  ? -11.782 17.142  64.466  1.00 80.03  ? 412  ILE C C     1 
ATOM   6447  O  O     . ILE C 2  412  ? -12.884 17.398  64.947  1.00 81.55  ? 412  ILE C O     1 
ATOM   6448  C  CB    . ILE C 2  412  ? -11.291 14.922  65.464  1.00 87.65  ? 412  ILE C CB    1 
ATOM   6449  C  CG1   . ILE C 2  412  ? -10.149 13.973  65.822  1.00 90.06  ? 412  ILE C CG1   1 
ATOM   6450  C  CG2   . ILE C 2  412  ? -11.988 14.420  64.212  1.00 82.34  ? 412  ILE C CG2   1 
ATOM   6451  C  CD1   . ILE C 2  412  ? -10.572 12.526  65.943  1.00 85.57  ? 412  ILE C CD1   1 
ATOM   6452  N  N     . THR C 2  413  ? -11.402 17.543  63.261  1.00 79.15  ? 413  THR C N     1 
ATOM   6453  C  CA    . THR C 2  413  ? -12.350 18.074  62.297  1.00 78.53  ? 413  THR C CA    1 
ATOM   6454  C  C     . THR C 2  413  ? -12.362 17.151  61.095  1.00 77.58  ? 413  THR C C     1 
ATOM   6455  O  O     . THR C 2  413  ? -11.403 16.410  60.874  1.00 79.25  ? 413  THR C O     1 
ATOM   6456  C  CB    . THR C 2  413  ? -11.991 19.495  61.838  1.00 71.15  ? 413  THR C CB    1 
ATOM   6457  O  OG1   . THR C 2  413  ? -10.837 19.447  60.989  1.00 74.46  ? 413  THR C OG1   1 
ATOM   6458  C  CG2   . THR C 2  413  ? -11.712 20.384  63.031  1.00 78.86  ? 413  THR C CG2   1 
ATOM   6459  N  N     . PRO C 2  414  ? -13.450 17.177  60.318  1.00 72.76  ? 414  PRO C N     1 
ATOM   6460  C  CA    . PRO C 2  414  ? -13.392 16.402  59.078  1.00 72.57  ? 414  PRO C CA    1 
ATOM   6461  C  C     . PRO C 2  414  ? -12.275 16.898  58.153  1.00 75.37  ? 414  PRO C C     1 
ATOM   6462  O  O     . PRO C 2  414  ? -11.756 16.105  57.375  1.00 79.70  ? 414  PRO C O     1 
ATOM   6463  C  CB    . PRO C 2  414  ? -14.781 16.608  58.456  1.00 79.75  ? 414  PRO C CB    1 
ATOM   6464  C  CG    . PRO C 2  414  ? -15.439 17.689  59.254  1.00 69.75  ? 414  PRO C CG    1 
ATOM   6465  C  CD    . PRO C 2  414  ? -14.800 17.693  60.597  1.00 76.26  ? 414  PRO C CD    1 
ATOM   6466  N  N     . GLN C 2  415  ? -11.889 18.169  58.262  1.00 71.35  ? 415  GLN C N     1 
ATOM   6467  C  CA    . GLN C 2  415  ? -10.799 18.708  57.447  1.00 67.57  ? 415  GLN C CA    1 
ATOM   6468  C  C     . GLN C 2  415  ? -9.452  18.107  57.821  1.00 70.87  ? 415  GLN C C     1 
ATOM   6469  O  O     . GLN C 2  415  ? -8.474  18.244  57.085  1.00 71.47  ? 415  GLN C O     1 
ATOM   6470  C  CB    . GLN C 2  415  ? -10.723 20.230  57.575  1.00 69.71  ? 415  GLN C CB    1 
ATOM   6471  C  CG    . GLN C 2  415  ? -11.916 20.964  57.004  1.00 72.62  ? 415  GLN C CG    1 
ATOM   6472  C  CD    . GLN C 2  415  ? -12.031 20.819  55.501  1.00 72.78  ? 415  GLN C CD    1 
ATOM   6473  O  OE1   . GLN C 2  415  ? -11.074 20.441  54.824  1.00 77.17  ? 415  GLN C OE1   1 
ATOM   6474  N  NE2   . GLN C 2  415  ? -13.208 21.124  54.969  1.00 71.98  ? 415  GLN C NE2   1 
ATOM   6475  N  N     . THR C 2  416  ? -9.401  17.454  58.975  1.00 76.16  ? 416  THR C N     1 
ATOM   6476  C  CA    . THR C 2  416  ? -8.179  16.802  59.419  1.00 78.19  ? 416  THR C CA    1 
ATOM   6477  C  C     . THR C 2  416  ? -8.235  15.298  59.167  1.00 75.13  ? 416  THR C C     1 
ATOM   6478  O  O     . THR C 2  416  ? -7.201  14.649  59.029  1.00 70.48  ? 416  THR C O     1 
ATOM   6479  C  CB    . THR C 2  416  ? -7.912  17.064  60.913  1.00 80.62  ? 416  THR C CB    1 
ATOM   6480  O  OG1   . THR C 2  416  ? -9.082  16.744  61.676  1.00 86.18  ? 416  THR C OG1   1 
ATOM   6481  C  CG2   . THR C 2  416  ? -7.557  18.524  61.138  1.00 73.42  ? 416  THR C CG2   1 
ATOM   6482  N  N     . LEU C 2  417  ? -9.444  14.750  59.099  1.00 71.41  ? 417  LEU C N     1 
ATOM   6483  C  CA    . LEU C 2  417  ? -9.617  13.325  58.840  1.00 72.69  ? 417  LEU C CA    1 
ATOM   6484  C  C     . LEU C 2  417  ? -9.552  13.018  57.350  1.00 79.59  ? 417  LEU C C     1 
ATOM   6485  O  O     . LEU C 2  417  ? -9.176  11.917  56.945  1.00 81.98  ? 417  LEU C O     1 
ATOM   6486  C  CB    . LEU C 2  417  ? -10.952 12.829  59.398  1.00 74.68  ? 417  LEU C CB    1 
ATOM   6487  C  CG    . LEU C 2  417  ? -11.199 12.904  60.904  1.00 80.20  ? 417  LEU C CG    1 
ATOM   6488  C  CD1   . LEU C 2  417  ? -12.573 12.341  61.227  1.00 86.73  ? 417  LEU C CD1   1 
ATOM   6489  C  CD2   . LEU C 2  417  ? -10.119 12.161  61.671  1.00 86.56  ? 417  LEU C CD2   1 
ATOM   6490  N  N     . ILE C 2  418  ? -9.921  14.003  56.539  1.00 79.73  ? 418  ILE C N     1 
ATOM   6491  C  CA    . ILE C 2  418  ? -10.141 13.782  55.118  1.00 67.53  ? 418  ILE C CA    1 
ATOM   6492  C  C     . ILE C 2  418  ? -8.919  14.064  54.256  1.00 62.30  ? 418  ILE C C     1 
ATOM   6493  O  O     . ILE C 2  418  ? -8.339  15.150  54.297  1.00 62.54  ? 418  ILE C O     1 
ATOM   6494  C  CB    . ILE C 2  418  ? -11.318 14.638  54.615  1.00 62.39  ? 418  ILE C CB    1 
ATOM   6495  C  CG1   . ILE C 2  418  ? -12.639 14.045  55.109  1.00 68.15  ? 418  ILE C CG1   1 
ATOM   6496  C  CG2   . ILE C 2  418  ? -11.313 14.736  53.101  1.00 59.06  ? 418  ILE C CG2   1 
ATOM   6497  C  CD1   . ILE C 2  418  ? -13.853 14.830  54.687  1.00 66.44  ? 418  ILE C CD1   1 
ATOM   6498  N  N     . ASN C 2  419  ? -8.532  13.058  53.483  1.00 60.60  ? 419  ASN C N     1 
ATOM   6499  C  CA    . ASN C 2  419  ? -7.515  13.217  52.461  1.00 61.27  ? 419  ASN C CA    1 
ATOM   6500  C  C     . ASN C 2  419  ? -8.106  12.814  51.116  1.00 56.12  ? 419  ASN C C     1 
ATOM   6501  O  O     . ASN C 2  419  ? -8.303  11.631  50.847  1.00 52.35  ? 419  ASN C O     1 
ATOM   6502  C  CB    . ASN C 2  419  ? -6.282  12.379  52.793  1.00 63.10  ? 419  ASN C CB    1 
ATOM   6503  C  CG    . ASN C 2  419  ? -5.153  12.593  51.812  1.00 61.11  ? 419  ASN C CG    1 
ATOM   6504  O  OD1   . ASN C 2  419  ? -5.005  13.673  51.242  1.00 63.27  ? 419  ASN C OD1   1 
ATOM   6505  N  ND2   . ASN C 2  419  ? -4.349  11.557  51.604  1.00 63.10  ? 419  ASN C ND2   1 
ATOM   6506  N  N     . ILE C 2  420  ? -8.413  13.804  50.283  1.00 51.58  ? 420  ILE C N     1 
ATOM   6507  C  CA    . ILE C 2  420  ? -9.090  13.546  49.016  1.00 44.76  ? 420  ILE C CA    1 
ATOM   6508  C  C     . ILE C 2  420  ? -8.119  13.124  47.925  1.00 45.57  ? 420  ILE C C     1 
ATOM   6509  O  O     . ILE C 2  420  ? -8.534  12.791  46.817  1.00 48.13  ? 420  ILE C O     1 
ATOM   6510  C  CB    . ILE C 2  420  ? -9.870  14.781  48.522  1.00 42.16  ? 420  ILE C CB    1 
ATOM   6511  C  CG1   . ILE C 2  420  ? -8.916  15.941  48.237  1.00 42.49  ? 420  ILE C CG1   1 
ATOM   6512  C  CG2   . ILE C 2  420  ? -10.918 15.190  49.535  1.00 46.88  ? 420  ILE C CG2   1 
ATOM   6513  C  CD1   . ILE C 2  420  ? -9.607  17.167  47.685  1.00 46.02  ? 420  ILE C CD1   1 
ATOM   6514  N  N     . ARG C 2  421  ? -6.829  13.141  48.238  1.00 48.49  ? 421  ARG C N     1 
ATOM   6515  C  CA    . ARG C 2  421  ? -5.800  12.777  47.266  1.00 51.18  ? 421  ARG C CA    1 
ATOM   6516  C  C     . ARG C 2  421  ? -5.994  11.388  46.629  1.00 46.59  ? 421  ARG C C     1 
ATOM   6517  O  O     . ARG C 2  421  ? -5.745  11.230  45.434  1.00 41.76  ? 421  ARG C O     1 
ATOM   6518  C  CB    . ARG C 2  421  ? -4.413  12.872  47.915  1.00 66.85  ? 421  ARG C CB    1 
ATOM   6519  C  CG    . ARG C 2  421  ? -3.257  12.509  46.994  1.00 71.70  ? 421  ARG C CG    1 
ATOM   6520  C  CD    . ARG C 2  421  ? -1.947  13.151  47.449  1.00 82.83  ? 421  ARG C CD    1 
ATOM   6521  N  NE    . ARG C 2  421  ? -1.839  13.243  48.904  1.00 84.13  ? 421  ARG C NE    1 
ATOM   6522  C  CZ    . ARG C 2  421  ? -1.765  14.388  49.578  1.00 78.50  ? 421  ARG C CZ    1 
ATOM   6523  N  NH1   . ARG C 2  421  ? -1.778  15.546  48.931  1.00 80.59  ? 421  ARG C NH1   1 
ATOM   6524  N  NH2   . ARG C 2  421  ? -1.671  14.376  50.901  1.00 71.25  ? 421  ARG C NH2   1 
ATOM   6525  N  N     . PRO C 2  422  ? -6.429  10.377  47.411  1.00 51.68  ? 422  PRO C N     1 
ATOM   6526  C  CA    . PRO C 2  422  ? -6.704  9.081   46.772  1.00 51.13  ? 422  PRO C CA    1 
ATOM   6527  C  C     . PRO C 2  422  ? -7.984  9.045   45.931  1.00 47.64  ? 422  PRO C C     1 
ATOM   6528  O  O     . PRO C 2  422  ? -8.168  8.110   45.149  1.00 44.39  ? 422  PRO C O     1 
ATOM   6529  C  CB    . PRO C 2  422  ? -6.821  8.126   47.967  1.00 54.83  ? 422  PRO C CB    1 
ATOM   6530  C  CG    . PRO C 2  422  ? -6.042  8.793   49.054  1.00 55.51  ? 422  PRO C CG    1 
ATOM   6531  C  CD    . PRO C 2  422  ? -6.350  10.238  48.876  1.00 52.87  ? 422  PRO C CD    1 
ATOM   6532  N  N     . VAL C 2  423  ? -8.849  10.043  46.094  1.00 48.45  ? 423  VAL C N     1 
ATOM   6533  C  CA    . VAL C 2  423  ? -10.059 10.163  45.282  1.00 41.42  ? 423  VAL C CA    1 
ATOM   6534  C  C     . VAL C 2  423  ? -9.769  10.834  43.939  1.00 37.60  ? 423  VAL C C     1 
ATOM   6535  O  O     . VAL C 2  423  ? -10.181 10.336  42.891  1.00 38.16  ? 423  VAL C O     1 
ATOM   6536  C  CB    . VAL C 2  423  ? -11.161 10.960  46.015  1.00 40.98  ? 423  VAL C CB    1 
ATOM   6537  C  CG1   . VAL C 2  423  ? -12.214 11.458  45.034  1.00 41.97  ? 423  VAL C CG1   1 
ATOM   6538  C  CG2   . VAL C 2  423  ? -11.800 10.110  47.099  1.00 43.49  ? 423  VAL C CG2   1 
ATOM   6539  N  N     . VAL C 2  424  ? -9.063  11.963  43.971  1.00 40.87  ? 424  VAL C N     1 
ATOM   6540  C  CA    . VAL C 2  424  ? -8.703  12.676  42.747  1.00 38.42  ? 424  VAL C CA    1 
ATOM   6541  C  C     . VAL C 2  424  ? -7.807  11.804  41.878  1.00 36.87  ? 424  VAL C C     1 
ATOM   6542  O  O     . VAL C 2  424  ? -7.850  11.871  40.648  1.00 37.63  ? 424  VAL C O     1 
ATOM   6543  C  CB    . VAL C 2  424  ? -7.973  14.000  43.040  1.00 38.75  ? 424  VAL C CB    1 
ATOM   6544  C  CG1   . VAL C 2  424  ? -7.886  14.846  41.775  1.00 42.89  ? 424  VAL C CG1   1 
ATOM   6545  C  CG2   . VAL C 2  424  ? -8.672  14.766  44.148  1.00 42.00  ? 424  VAL C CG2   1 
ATOM   6546  N  N     . ALA C 2  425  ? -6.990  10.990  42.533  1.00 35.51  ? 425  ALA C N     1 
ATOM   6547  C  CA    . ALA C 2  425  ? -6.099  10.079  41.837  1.00 31.83  ? 425  ALA C CA    1 
ATOM   6548  C  C     . ALA C 2  425  ? -6.907  8.986   41.167  1.00 30.65  ? 425  ALA C C     1 
ATOM   6549  O  O     . ALA C 2  425  ? -6.574  8.530   40.075  1.00 35.87  ? 425  ALA C O     1 
ATOM   6550  C  CB    . ALA C 2  425  ? -5.087  9.479   42.801  1.00 43.25  ? 425  ALA C CB    1 
ATOM   6551  N  N     . ALA C 2  426  ? -7.980  8.576   41.833  1.00 30.18  ? 426  ALA C N     1 
ATOM   6552  C  CA    . ALA C 2  426  ? -8.779  7.444   41.382  1.00 36.03  ? 426  ALA C CA    1 
ATOM   6553  C  C     . ALA C 2  426  ? -9.540  7.773   40.109  1.00 31.67  ? 426  ALA C C     1 
ATOM   6554  O  O     . ALA C 2  426  ? -9.644  6.947   39.200  1.00 27.21  ? 426  ALA C O     1 
ATOM   6555  C  CB    . ALA C 2  426  ? -9.738  7.015   42.472  1.00 41.74  ? 426  ALA C CB    1 
ATOM   6556  N  N     . ILE C 2  427  ? -10.070 8.989   40.051  1.00 31.22  ? 427  ILE C N     1 
ATOM   6557  C  CA    . ILE C 2  427  ? -10.812 9.441   38.885  1.00 27.83  ? 427  ILE C CA    1 
ATOM   6558  C  C     . ILE C 2  427  ? -9.879  9.893   37.767  1.00 32.06  ? 427  ILE C C     1 
ATOM   6559  O  O     . ILE C 2  427  ? -10.190 9.717   36.591  1.00 34.40  ? 427  ILE C O     1 
ATOM   6560  C  CB    . ILE C 2  427  ? -11.777 10.582  39.246  1.00 27.53  ? 427  ILE C CB    1 
ATOM   6561  C  CG1   . ILE C 2  427  ? -11.066 11.653  40.079  1.00 36.14  ? 427  ILE C CG1   1 
ATOM   6562  C  CG2   . ILE C 2  427  ? -12.959 10.036  40.018  1.00 25.22  ? 427  ILE C CG2   1 
ATOM   6563  C  CD1   . ILE C 2  427  ? -10.612 12.868  39.287  1.00 43.27  ? 427  ILE C CD1   1 
ATOM   6564  N  N     . LYS C 2  428  ? -8.735  10.466  38.127  1.00 34.09  ? 428  LYS C N     1 
ATOM   6565  C  CA    . LYS C 2  428  ? -7.772  10.891  37.121  1.00 34.84  ? 428  LYS C CA    1 
ATOM   6566  C  C     . LYS C 2  428  ? -7.234  9.679   36.371  1.00 34.44  ? 428  LYS C C     1 
ATOM   6567  O  O     . LYS C 2  428  ? -7.080  9.708   35.150  1.00 29.30  ? 428  LYS C O     1 
ATOM   6568  C  CB    . LYS C 2  428  ? -6.621  11.672  37.756  1.00 37.03  ? 428  LYS C CB    1 
ATOM   6569  C  CG    . LYS C 2  428  ? -5.566  12.113  36.756  1.00 47.50  ? 428  LYS C CG    1 
ATOM   6570  C  CD    . LYS C 2  428  ? -4.349  12.699  37.443  1.00 54.63  ? 428  LYS C CD    1 
ATOM   6571  C  CE    . LYS C 2  428  ? -3.301  13.123  36.427  1.00 57.05  ? 428  LYS C CE    1 
ATOM   6572  N  NZ    . LYS C 2  428  ? -2.044  13.551  37.097  1.00 63.32  ? 428  LYS C NZ    1 
ATOM   6573  N  N     . GLU C 2  429  ? -6.966  8.613   37.121  1.00 38.30  ? 429  GLU C N     1 
ATOM   6574  C  CA    . GLU C 2  429  ? -6.382  7.392   36.576  1.00 43.04  ? 429  GLU C CA    1 
ATOM   6575  C  C     . GLU C 2  429  ? -7.329  6.700   35.608  1.00 39.71  ? 429  GLU C C     1 
ATOM   6576  O  O     . GLU C 2  429  ? -6.909  6.200   34.564  1.00 47.40  ? 429  GLU C O     1 
ATOM   6577  C  CB    . GLU C 2  429  ? -6.005  6.424   37.702  1.00 46.77  ? 429  GLU C CB    1 
ATOM   6578  C  CG    . GLU C 2  429  ? -5.251  5.188   37.225  1.00 52.23  ? 429  GLU C CG    1 
ATOM   6579  C  CD    . GLU C 2  429  ? -4.954  4.202   38.341  1.00 52.74  ? 429  GLU C CD    1 
ATOM   6580  O  OE1   . GLU C 2  429  ? -5.523  4.350   39.443  1.00 49.09  ? 429  GLU C OE1   1 
ATOM   6581  O  OE2   . GLU C 2  429  ? -4.147  3.276   38.111  1.00 51.97  ? 429  GLU C OE2   1 
ATOM   6582  N  N     . PHE C 2  430  ? -8.608  6.668   35.960  1.00 33.58  ? 430  PHE C N     1 
ATOM   6583  C  CA    . PHE C 2  430  ? -9.588  5.993   35.128  1.00 29.47  ? 430  PHE C CA    1 
ATOM   6584  C  C     . PHE C 2  430  ? -9.632  6.601   33.735  1.00 27.95  ? 430  PHE C C     1 
ATOM   6585  O  O     . PHE C 2  430  ? -9.418  5.907   32.745  1.00 35.00  ? 430  PHE C O     1 
ATOM   6586  C  CB    . PHE C 2  430  ? -10.968 6.050   35.768  1.00 31.12  ? 430  PHE C CB    1 
ATOM   6587  C  CG    . PHE C 2  430  ? -12.059 5.527   34.887  1.00 24.08  ? 430  PHE C CG    1 
ATOM   6588  C  CD1   . PHE C 2  430  ? -12.215 4.168   34.694  1.00 28.62  ? 430  PHE C CD1   1 
ATOM   6589  C  CD2   . PHE C 2  430  ? -12.928 6.396   34.253  1.00 22.21  ? 430  PHE C CD2   1 
ATOM   6590  C  CE1   . PHE C 2  430  ? -13.217 3.683   33.885  1.00 31.77  ? 430  PHE C CE1   1 
ATOM   6591  C  CE2   . PHE C 2  430  ? -13.933 5.918   33.445  1.00 22.75  ? 430  PHE C CE2   1 
ATOM   6592  C  CZ    . PHE C 2  430  ? -14.078 4.560   33.259  1.00 25.67  ? 430  PHE C CZ    1 
ATOM   6593  N  N     . PHE C 2  431  ? -9.888  7.903   33.665  1.00 22.99  ? 431  PHE C N     1 
ATOM   6594  C  CA    . PHE C 2  431  ? -10.011 8.583   32.381  1.00 26.37  ? 431  PHE C CA    1 
ATOM   6595  C  C     . PHE C 2  431  ? -8.724  8.539   31.551  1.00 29.76  ? 431  PHE C C     1 
ATOM   6596  O  O     . PHE C 2  431  ? -8.763  8.653   30.326  1.00 35.31  ? 431  PHE C O     1 
ATOM   6597  C  CB    . PHE C 2  431  ? -10.432 10.037  32.594  1.00 24.45  ? 431  PHE C CB    1 
ATOM   6598  C  CG    . PHE C 2  431  ? -11.867 10.205  33.007  1.00 20.49  ? 431  PHE C CG    1 
ATOM   6599  C  CD1   . PHE C 2  431  ? -12.885 10.124  32.073  1.00 17.78  ? 431  PHE C CD1   1 
ATOM   6600  C  CD2   . PHE C 2  431  ? -12.195 10.468  34.324  1.00 21.48  ? 431  PHE C CD2   1 
ATOM   6601  C  CE1   . PHE C 2  431  ? -14.202 10.291  32.450  1.00 18.48  ? 431  PHE C CE1   1 
ATOM   6602  C  CE2   . PHE C 2  431  ? -13.510 10.636  34.707  1.00 18.46  ? 431  PHE C CE2   1 
ATOM   6603  C  CZ    . PHE C 2  431  ? -14.514 10.547  33.770  1.00 18.41  ? 431  PHE C CZ    1 
ATOM   6604  N  N     . GLY C 2  432  ? -7.587  8.364   32.216  1.00 29.23  ? 432  GLY C N     1 
ATOM   6605  C  CA    . GLY C 2  432  ? -6.308  8.388   31.532  1.00 25.01  ? 432  GLY C CA    1 
ATOM   6606  C  C     . GLY C 2  432  ? -5.688  7.032   31.255  1.00 28.62  ? 432  GLY C C     1 
ATOM   6607  O  O     . GLY C 2  432  ? -4.740  6.935   30.478  1.00 40.66  ? 432  GLY C O     1 
ATOM   6608  N  N     . THR C 2  433  ? -6.214  5.983   31.880  1.00 29.76  ? 433  THR C N     1 
ATOM   6609  C  CA    . THR C 2  433  ? -5.610  4.661   31.745  1.00 33.74  ? 433  THR C CA    1 
ATOM   6610  C  C     . THR C 2  433  ? -6.578  3.597   31.246  1.00 36.97  ? 433  THR C C     1 
ATOM   6611  O  O     . THR C 2  433  ? -6.217  2.781   30.400  1.00 46.93  ? 433  THR C O     1 
ATOM   6612  C  CB    . THR C 2  433  ? -5.023  4.166   33.083  1.00 36.18  ? 433  THR C CB    1 
ATOM   6613  O  OG1   . THR C 2  433  ? -4.354  5.244   33.748  1.00 42.10  ? 433  THR C OG1   1 
ATOM   6614  C  CG2   . THR C 2  433  ? -4.038  3.030   32.846  1.00 40.03  ? 433  THR C CG2   1 
ATOM   6615  N  N     . SER C 2  434  ? -7.798  3.605   31.776  1.00 34.93  ? 434  SER C N     1 
ATOM   6616  C  CA    . SER C 2  434  ? -8.749  2.515   31.556  1.00 37.16  ? 434  SER C CA    1 
ATOM   6617  C  C     . SER C 2  434  ? -9.004  2.232   30.080  1.00 34.12  ? 434  SER C C     1 
ATOM   6618  O  O     . SER C 2  434  ? -8.887  3.123   29.240  1.00 33.22  ? 434  SER C O     1 
ATOM   6619  C  CB    . SER C 2  434  ? -10.073 2.816   32.257  1.00 34.00  ? 434  SER C CB    1 
ATOM   6620  O  OG    . SER C 2  434  ? -10.995 1.755   32.078  1.00 34.94  ? 434  SER C OG    1 
ATOM   6621  N  N     . GLN C 2  435  ? -9.362  0.986   29.779  1.00 34.05  ? 435  GLN C N     1 
ATOM   6622  C  CA    . GLN C 2  435  ? -9.522  0.534   28.400  1.00 33.83  ? 435  GLN C CA    1 
ATOM   6623  C  C     . GLN C 2  435  ? -10.869 0.952   27.818  1.00 29.34  ? 435  GLN C C     1 
ATOM   6624  O  O     . GLN C 2  435  ? -11.232 0.542   26.714  1.00 27.25  ? 435  GLN C O     1 
ATOM   6625  C  CB    . GLN C 2  435  ? -9.370  -0.989  28.316  1.00 41.60  ? 435  GLN C CB    1 
ATOM   6626  C  CG    . GLN C 2  435  ? -8.082  -1.531  28.935  1.00 61.32  ? 435  GLN C CG    1 
ATOM   6627  C  CD    . GLN C 2  435  ? -7.979  -3.050  28.864  1.00 78.39  ? 435  GLN C CD    1 
ATOM   6628  O  OE1   . GLN C 2  435  ? -8.901  -3.771  29.252  1.00 70.33  ? 435  GLN C OE1   1 
ATOM   6629  N  NE2   . GLN C 2  435  ? -6.849  -3.542  28.366  1.00 87.44  ? 435  GLN C NE2   1 
ATOM   6630  N  N     . LEU C 2  436  ? -11.605 1.769   28.566  1.00 32.42  ? 436  LEU C N     1 
ATOM   6631  C  CA    . LEU C 2  436  ? -12.930 2.219   28.154  1.00 25.91  ? 436  LEU C CA    1 
ATOM   6632  C  C     . LEU C 2  436  ? -12.943 3.725   27.890  1.00 24.79  ? 436  LEU C C     1 
ATOM   6633  O  O     . LEU C 2  436  ? -13.865 4.247   27.262  1.00 23.39  ? 436  LEU C O     1 
ATOM   6634  C  CB    . LEU C 2  436  ? -13.968 1.840   29.214  1.00 19.76  ? 436  LEU C CB    1 
ATOM   6635  C  CG    . LEU C 2  436  ? -14.229 0.333   29.309  1.00 19.50  ? 436  LEU C CG    1 
ATOM   6636  C  CD1   . LEU C 2  436  ? -14.995 -0.031  30.570  1.00 22.55  ? 436  LEU C CD1   1 
ATOM   6637  C  CD2   . LEU C 2  436  ? -14.967 -0.161  28.070  1.00 19.12  ? 436  LEU C CD2   1 
ATOM   6638  N  N     . SER C 2  437  ? -11.913 4.415   28.373  1.00 25.19  ? 437  SER C N     1 
ATOM   6639  C  CA    . SER C 2  437  ? -11.712 5.824   28.052  1.00 23.80  ? 437  SER C CA    1 
ATOM   6640  C  C     . SER C 2  437  ? -10.940 5.931   26.741  1.00 26.14  ? 437  SER C C     1 
ATOM   6641  O  O     . SER C 2  437  ? -9.726  5.720   26.702  1.00 28.11  ? 437  SER C O     1 
ATOM   6642  C  CB    . SER C 2  437  ? -10.969 6.543   29.181  1.00 25.58  ? 437  SER C CB    1 
ATOM   6643  O  OG    . SER C 2  437  ? -10.680 7.888   28.838  1.00 18.90  ? 437  SER C OG    1 
ATOM   6644  N  N     . GLN C 2  438  ? -11.652 6.268   25.670  1.00 25.69  ? 438  GLN C N     1 
ATOM   6645  C  CA    . GLN C 2  438  ? -11.105 6.151   24.324  1.00 24.76  ? 438  GLN C CA    1 
ATOM   6646  C  C     . GLN C 2  438  ? -10.931 7.486   23.581  1.00 23.95  ? 438  GLN C C     1 
ATOM   6647  O  O     . GLN C 2  438  ? -11.707 8.424   23.755  1.00 22.99  ? 438  GLN C O     1 
ATOM   6648  C  CB    . GLN C 2  438  ? -11.993 5.208   23.500  1.00 23.37  ? 438  GLN C CB    1 
ATOM   6649  C  CG    . GLN C 2  438  ? -12.174 3.815   24.119  1.00 23.36  ? 438  GLN C CG    1 
ATOM   6650  C  CD    . GLN C 2  438  ? -12.895 2.836   23.193  1.00 22.19  ? 438  GLN C CD    1 
ATOM   6651  O  OE1   . GLN C 2  438  ? -13.710 3.231   22.356  1.00 17.43  ? 438  GLN C OE1   1 
ATOM   6652  N  NE2   . GLN C 2  438  ? -12.587 1.550   23.339  1.00 22.62  ? 438  GLN C NE2   1 
ATOM   6653  N  N     . PHE C 2  439  ? -9.878  7.551   22.771  1.00 23.37  ? 439  PHE C N     1 
ATOM   6654  C  CA    . PHE C 2  439  ? -9.688  8.605   21.785  1.00 20.75  ? 439  PHE C CA    1 
ATOM   6655  C  C     . PHE C 2  439  ? -10.902 8.643   20.884  1.00 21.52  ? 439  PHE C C     1 
ATOM   6656  O  O     . PHE C 2  439  ? -11.161 7.685   20.168  1.00 27.72  ? 439  PHE C O     1 
ATOM   6657  C  CB    . PHE C 2  439  ? -8.437  8.336   20.955  1.00 40.02  ? 439  PHE C CB    1 
ATOM   6658  C  CG    . PHE C 2  439  ? -7.622  9.555   20.671  1.00 46.67  ? 439  PHE C CG    1 
ATOM   6659  C  CD1   . PHE C 2  439  ? -6.905  10.160  21.684  1.00 50.91  ? 439  PHE C CD1   1 
ATOM   6660  C  CD2   . PHE C 2  439  ? -7.549  10.083  19.391  1.00 43.33  ? 439  PHE C CD2   1 
ATOM   6661  C  CE1   . PHE C 2  439  ? -6.142  11.278  21.439  1.00 58.80  ? 439  PHE C CE1   1 
ATOM   6662  C  CE2   . PHE C 2  439  ? -6.785  11.201  19.136  1.00 48.73  ? 439  PHE C CE2   1 
ATOM   6663  C  CZ    . PHE C 2  439  ? -6.080  11.800  20.163  1.00 54.28  ? 439  PHE C CZ    1 
ATOM   6664  N  N     . MET C 2  440  ? -11.651 9.735   20.911  1.00 21.96  ? 440  MET C N     1 
ATOM   6665  C  CA    . MET C 2  440  ? -12.904 9.783   20.166  1.00 17.30  ? 440  MET C CA    1 
ATOM   6666  C  C     . MET C 2  440  ? -12.708 9.630   18.667  1.00 13.76  ? 440  MET C C     1 
ATOM   6667  O  O     . MET C 2  440  ? -11.938 10.363  18.050  1.00 15.41  ? 440  MET C O     1 
ATOM   6668  C  CB    . MET C 2  440  ? -13.644 11.082  20.441  1.00 15.54  ? 440  MET C CB    1 
ATOM   6669  C  CG    . MET C 2  440  ? -14.925 11.208  19.658  1.00 11.10  ? 440  MET C CG    1 
ATOM   6670  S  SD    . MET C 2  440  ? -15.833 12.679  20.133  1.00 8.27   ? 440  MET C SD    1 
ATOM   6671  C  CE    . MET C 2  440  ? -17.204 12.610  18.989  1.00 16.69  ? 440  MET C CE    1 
ATOM   6672  N  N     . ASP C 2  441  ? -13.423 8.673   18.090  1.00 11.40  ? 441  ASP C N     1 
ATOM   6673  C  CA    . ASP C 2  441  ? -13.332 8.401   16.665  1.00 14.75  ? 441  ASP C CA    1 
ATOM   6674  C  C     . ASP C 2  441  ? -13.910 9.568   15.878  1.00 11.93  ? 441  ASP C C     1 
ATOM   6675  O  O     . ASP C 2  441  ? -15.121 9.765   15.847  1.00 13.26  ? 441  ASP C O     1 
ATOM   6676  C  CB    . ASP C 2  441  ? -14.058 7.098   16.320  1.00 18.06  ? 441  ASP C CB    1 
ATOM   6677  C  CG    . ASP C 2  441  ? -13.654 6.545   14.963  1.00 21.67  ? 441  ASP C CG    1 
ATOM   6678  O  OD1   . ASP C 2  441  ? -14.323 5.612   14.471  1.00 20.40  ? 441  ASP C OD1   1 
ATOM   6679  O  OD2   . ASP C 2  441  ? -12.679 7.059   14.378  1.00 25.45  ? 441  ASP C OD2   1 
ATOM   6680  N  N     . GLN C 2  442  ? -13.040 10.340  15.237  1.00 13.43  ? 442  GLN C N     1 
ATOM   6681  C  CA    . GLN C 2  442  ? -13.470 11.576  14.594  1.00 20.43  ? 442  GLN C CA    1 
ATOM   6682  C  C     . GLN C 2  442  ? -13.113 11.721  13.112  1.00 18.61  ? 442  GLN C C     1 
ATOM   6683  O  O     . GLN C 2  442  ? -12.770 12.816  12.662  1.00 23.10  ? 442  GLN C O     1 
ATOM   6684  C  CB    . GLN C 2  442  ? -12.893 12.769  15.350  1.00 17.14  ? 442  GLN C CB    1 
ATOM   6685  C  CG    . GLN C 2  442  ? -13.757 13.279  16.478  1.00 15.89  ? 442  GLN C CG    1 
ATOM   6686  C  CD    . GLN C 2  442  ? -13.268 14.617  16.972  1.00 24.70  ? 442  GLN C CD    1 
ATOM   6687  O  OE1   . GLN C 2  442  ? -12.335 15.185  16.407  1.00 27.68  ? 442  GLN C OE1   1 
ATOM   6688  N  NE2   . GLN C 2  442  ? -13.890 15.132  18.025  1.00 32.82  ? 442  GLN C NE2   1 
ATOM   6689  N  N     . ASN C 2  443  ? -13.200 10.640  12.346  1.00 15.05  ? 443  ASN C N     1 
ATOM   6690  C  CA    . ASN C 2  443  ? -13.026 10.764  10.906  1.00 11.38  ? 443  ASN C CA    1 
ATOM   6691  C  C     . ASN C 2  443  ? -14.170 11.584  10.326  1.00 11.35  ? 443  ASN C C     1 
ATOM   6692  O  O     . ASN C 2  443  ? -13.950 12.555  9.609   1.00 10.44  ? 443  ASN C O     1 
ATOM   6693  C  CB    . ASN C 2  443  ? -12.950 9.392   10.239  1.00 14.21  ? 443  ASN C CB    1 
ATOM   6694  C  CG    . ASN C 2  443  ? -11.677 8.646   10.590  1.00 19.42  ? 443  ASN C CG    1 
ATOM   6695  O  OD1   . ASN C 2  443  ? -10.599 8.964   10.088  1.00 19.79  ? 443  ASN C OD1   1 
ATOM   6696  N  ND2   . ASN C 2  443  ? -11.797 7.644   11.451  1.00 22.85  ? 443  ASN C ND2   1 
ATOM   6697  N  N     . ASN C 2  444  ? -15.392 11.196  10.676  1.00 14.94  ? 444  ASN C N     1 
ATOM   6698  C  CA    . ASN C 2  444  ? -16.609 11.870  10.231  1.00 14.36  ? 444  ASN C CA    1 
ATOM   6699  C  C     . ASN C 2  444  ? -17.609 11.970  11.384  1.00 15.57  ? 444  ASN C C     1 
ATOM   6700  O  O     . ASN C 2  444  ? -17.409 11.335  12.419  1.00 21.57  ? 444  ASN C O     1 
ATOM   6701  C  CB    . ASN C 2  444  ? -17.225 11.109  9.065   1.00 11.46  ? 444  ASN C CB    1 
ATOM   6702  C  CG    . ASN C 2  444  ? -17.550 9.687   9.429   1.00 9.95   ? 444  ASN C CG    1 
ATOM   6703  O  OD1   . ASN C 2  444  ? -18.504 9.426   10.157  1.00 10.42  ? 444  ASN C OD1   1 
ATOM   6704  N  ND2   . ASN C 2  444  ? -16.743 8.754   8.945   1.00 11.75  ? 444  ASN C ND2   1 
ATOM   6705  N  N     . PRO C 2  445  ? -18.688 12.758  11.218  1.00 12.69  ? 445  PRO C N     1 
ATOM   6706  C  CA    . PRO C 2  445  ? -19.690 12.795  12.289  1.00 16.32  ? 445  PRO C CA    1 
ATOM   6707  C  C     . PRO C 2  445  ? -20.209 11.414  12.696  1.00 16.14  ? 445  PRO C C     1 
ATOM   6708  O  O     . PRO C 2  445  ? -20.194 11.099  13.886  1.00 16.30  ? 445  PRO C O     1 
ATOM   6709  C  CB    . PRO C 2  445  ? -20.815 13.631  11.680  1.00 18.13  ? 445  PRO C CB    1 
ATOM   6710  C  CG    . PRO C 2  445  ? -20.128 14.532  10.738  1.00 17.90  ? 445  PRO C CG    1 
ATOM   6711  C  CD    . PRO C 2  445  ? -18.979 13.750  10.165  1.00 15.01  ? 445  PRO C CD    1 
ATOM   6712  N  N     . LEU C 2  446  ? -20.639 10.610  11.724  1.00 14.32  ? 446  LEU C N     1 
ATOM   6713  C  CA    . LEU C 2  446  ? -21.237 9.299   11.998  1.00 15.11  ? 446  LEU C CA    1 
ATOM   6714  C  C     . LEU C 2  446  ? -20.331 8.417   12.845  1.00 14.26  ? 446  LEU C C     1 
ATOM   6715  O  O     . LEU C 2  446  ? -20.791 7.731   13.761  1.00 10.44  ? 446  LEU C O     1 
ATOM   6716  C  CB    . LEU C 2  446  ? -21.571 8.574   10.692  1.00 12.11  ? 446  LEU C CB    1 
ATOM   6717  C  CG    . LEU C 2  446  ? -21.932 7.090   10.821  1.00 11.09  ? 446  LEU C CG    1 
ATOM   6718  C  CD1   . LEU C 2  446  ? -23.231 6.909   11.582  1.00 12.32  ? 446  LEU C CD1   1 
ATOM   6719  C  CD2   . LEU C 2  446  ? -22.008 6.425   9.457   1.00 12.14  ? 446  LEU C CD2   1 
ATOM   6720  N  N     . SER C 2  447  ? -19.042 8.451   12.525  1.00 15.29  ? 447  SER C N     1 
ATOM   6721  C  CA    . SER C 2  447  ? -18.026 7.694   13.241  1.00 16.58  ? 447  SER C CA    1 
ATOM   6722  C  C     . SER C 2  447  ? -18.049 8.001   14.741  1.00 17.88  ? 447  SER C C     1 
ATOM   6723  O  O     . SER C 2  447  ? -17.945 7.093   15.568  1.00 17.56  ? 447  SER C O     1 
ATOM   6724  C  CB    . SER C 2  447  ? -16.649 7.993   12.646  1.00 13.69  ? 447  SER C CB    1 
ATOM   6725  O  OG    . SER C 2  447  ? -15.647 8.018   13.640  1.00 16.18  ? 447  SER C OG    1 
ATOM   6726  N  N     . GLY C 2  448  ? -18.207 9.276   15.087  1.00 16.23  ? 448  GLY C N     1 
ATOM   6727  C  CA    . GLY C 2  448  ? -18.258 9.685   16.480  1.00 12.31  ? 448  GLY C CA    1 
ATOM   6728  C  C     . GLY C 2  448  ? -19.488 9.140   17.170  1.00 10.66  ? 448  GLY C C     1 
ATOM   6729  O  O     . GLY C 2  448  ? -19.424 8.670   18.305  1.00 8.88   ? 448  GLY C O     1 
ATOM   6730  N  N     . LEU C 2  449  ? -20.611 9.205   16.466  1.00 11.08  ? 449  LEU C N     1 
ATOM   6731  C  CA    . LEU C 2  449  ? -21.881 8.710   16.979  1.00 14.17  ? 449  LEU C CA    1 
ATOM   6732  C  C     . LEU C 2  449  ? -21.814 7.220   17.282  1.00 13.12  ? 449  LEU C C     1 
ATOM   6733  O  O     . LEU C 2  449  ? -22.315 6.753   18.308  1.00 11.11  ? 449  LEU C O     1 
ATOM   6734  C  CB    . LEU C 2  449  ? -23.001 8.988   15.977  1.00 12.54  ? 449  LEU C CB    1 
ATOM   6735  C  CG    . LEU C 2  449  ? -24.361 8.405   16.353  1.00 11.26  ? 449  LEU C CG    1 
ATOM   6736  C  CD1   . LEU C 2  449  ? -24.782 8.913   17.719  1.00 13.78  ? 449  LEU C CD1   1 
ATOM   6737  C  CD2   . LEU C 2  449  ? -25.398 8.751   15.298  1.00 16.56  ? 449  LEU C CD2   1 
ATOM   6738  N  N     . THR C 2  450  ? -21.186 6.482   16.376  1.00 14.16  ? 450  THR C N     1 
ATOM   6739  C  CA    . THR C 2  450  ? -21.077 5.039   16.513  1.00 15.41  ? 450  THR C CA    1 
ATOM   6740  C  C     . THR C 2  450  ? -20.237 4.714   17.726  1.00 14.10  ? 450  THR C C     1 
ATOM   6741  O  O     . THR C 2  450  ? -20.449 3.711   18.401  1.00 15.22  ? 450  THR C O     1 
ATOM   6742  C  CB    . THR C 2  450  ? -20.441 4.395   15.277  1.00 16.77  ? 450  THR C CB    1 
ATOM   6743  O  OG1   . THR C 2  450  ? -20.890 5.077   14.100  1.00 17.67  ? 450  THR C OG1   1 
ATOM   6744  C  CG2   . THR C 2  450  ? -20.812 2.923   15.196  1.00 18.68  ? 450  THR C CG2   1 
ATOM   6745  N  N     . HIS C 2  451  ? -19.274 5.583   17.995  1.00 13.40  ? 451  HIS C N     1 
ATOM   6746  C  CA    . HIS C 2  451  ? -18.386 5.382   19.121  1.00 16.46  ? 451  HIS C CA    1 
ATOM   6747  C  C     . HIS C 2  451  ? -19.145 5.502   20.434  1.00 12.51  ? 451  HIS C C     1 
ATOM   6748  O  O     . HIS C 2  451  ? -18.891 4.757   21.378  1.00 15.70  ? 451  HIS C O     1 
ATOM   6749  C  CB    . HIS C 2  451  ? -17.229 6.377   19.081  1.00 18.30  ? 451  HIS C CB    1 
ATOM   6750  C  CG    . HIS C 2  451  ? -16.044 5.946   19.883  1.00 16.09  ? 451  HIS C CG    1 
ATOM   6751  N  ND1   . HIS C 2  451  ? -14.750 6.221   19.499  1.00 17.25  ? 451  HIS C ND1   1 
ATOM   6752  C  CD2   . HIS C 2  451  ? -15.953 5.254   21.043  1.00 12.64  ? 451  HIS C CD2   1 
ATOM   6753  C  CE1   . HIS C 2  451  ? -13.914 5.721   20.389  1.00 17.63  ? 451  HIS C CE1   1 
ATOM   6754  N  NE2   . HIS C 2  451  ? -14.619 5.130   21.338  1.00 13.53  ? 451  HIS C NE2   1 
ATOM   6755  N  N     . LYS C 2  452  ? -20.089 6.430   20.498  1.00 8.27   ? 452  LYS C N     1 
ATOM   6756  C  CA    . LYS C 2  452  ? -20.814 6.631   21.742  1.00 10.25  ? 452  LYS C CA    1 
ATOM   6757  C  C     . LYS C 2  452  ? -21.802 5.498   22.001  1.00 10.39  ? 452  LYS C C     1 
ATOM   6758  O  O     . LYS C 2  452  ? -22.335 5.371   23.101  1.00 9.93   ? 452  LYS C O     1 
ATOM   6759  C  CB    . LYS C 2  452  ? -21.535 7.982   21.733  1.00 11.34  ? 452  LYS C CB    1 
ATOM   6760  C  CG    . LYS C 2  452  ? -20.595 9.168   21.723  1.00 12.08  ? 452  LYS C CG    1 
ATOM   6761  C  CD    . LYS C 2  452  ? -21.015 10.204  20.697  1.00 14.17  ? 452  LYS C CD    1 
ATOM   6762  C  CE    . LYS C 2  452  ? -20.125 11.431  20.770  1.00 15.43  ? 452  LYS C CE    1 
ATOM   6763  N  NZ    . LYS C 2  452  ? -20.452 12.450  19.737  1.00 15.91  ? 452  LYS C NZ    1 
ATOM   6764  N  N     . ARG C 2  453  ? -22.028 4.667   20.990  1.00 12.75  ? 453  ARG C N     1 
ATOM   6765  C  CA    . ARG C 2  453  ? -23.027 3.610   21.094  1.00 12.79  ? 453  ARG C CA    1 
ATOM   6766  C  C     . ARG C 2  453  ? -22.435 2.202   21.040  1.00 14.83  ? 453  ARG C C     1 
ATOM   6767  O  O     . ARG C 2  453  ? -23.176 1.216   20.971  1.00 17.58  ? 453  ARG C O     1 
ATOM   6768  C  CB    . ARG C 2  453  ? -24.062 3.756   19.986  1.00 12.43  ? 453  ARG C CB    1 
ATOM   6769  C  CG    . ARG C 2  453  ? -24.850 5.039   20.065  1.00 10.73  ? 453  ARG C CG    1 
ATOM   6770  C  CD    . ARG C 2  453  ? -25.881 5.099   18.958  1.00 12.84  ? 453  ARG C CD    1 
ATOM   6771  N  NE    . ARG C 2  453  ? -27.237 5.203   19.485  1.00 14.92  ? 453  ARG C NE    1 
ATOM   6772  C  CZ    . ARG C 2  453  ? -28.068 4.176   19.610  1.00 15.45  ? 453  ARG C CZ    1 
ATOM   6773  N  NH1   . ARG C 2  453  ? -27.680 2.962   19.243  1.00 16.26  ? 453  ARG C NH1   1 
ATOM   6774  N  NH2   . ARG C 2  453  ? -29.286 4.363   20.101  1.00 13.27  ? 453  ARG C NH2   1 
ATOM   6775  N  N     . ARG C 2  454  ? -21.112 2.098   21.072  1.00 12.04  ? 454  ARG C N     1 
ATOM   6776  C  CA    . ARG C 2  454  ? -20.468 0.797   20.986  1.00 11.38  ? 454  ARG C CA    1 
ATOM   6777  C  C     . ARG C 2  454  ? -20.631 0.034   22.294  1.00 13.13  ? 454  ARG C C     1 
ATOM   6778  O  O     . ARG C 2  454  ? -20.603 0.613   23.381  1.00 10.51  ? 454  ARG C O     1 
ATOM   6779  C  CB    . ARG C 2  454  ? -18.994 0.956   20.634  1.00 12.65  ? 454  ARG C CB    1 
ATOM   6780  C  CG    . ARG C 2  454  ? -18.548 0.091   19.464  1.00 14.72  ? 454  ARG C CG    1 
ATOM   6781  C  CD    . ARG C 2  454  ? -17.125 0.415   19.041  1.00 16.43  ? 454  ARG C CD    1 
ATOM   6782  N  NE    . ARG C 2  454  ? -17.071 1.483   18.050  1.00 21.01  ? 454  ARG C NE    1 
ATOM   6783  C  CZ    . ARG C 2  454  ? -15.944 2.043   17.627  1.00 30.92  ? 454  ARG C CZ    1 
ATOM   6784  N  NH1   . ARG C 2  454  ? -14.778 1.643   18.120  1.00 31.10  ? 454  ARG C NH1   1 
ATOM   6785  N  NH2   . ARG C 2  454  ? -15.980 3.008   16.720  1.00 30.12  ? 454  ARG C NH2   1 
ATOM   6786  N  N     . LEU C 2  455  ? -20.826 -1.272  22.170  1.00 12.47  ? 455  LEU C N     1 
ATOM   6787  C  CA    . LEU C 2  455  ? -20.994 -2.150  23.317  1.00 13.81  ? 455  LEU C CA    1 
ATOM   6788  C  C     . LEU C 2  455  ? -19.843 -3.146  23.363  1.00 14.46  ? 455  LEU C C     1 
ATOM   6789  O  O     . LEU C 2  455  ? -19.709 -3.989  22.478  1.00 16.36  ? 455  LEU C O     1 
ATOM   6790  C  CB    . LEU C 2  455  ? -22.341 -2.878  23.240  1.00 14.11  ? 455  LEU C CB    1 
ATOM   6791  C  CG    . LEU C 2  455  ? -23.569 -1.978  23.059  1.00 12.91  ? 455  LEU C CG    1 
ATOM   6792  C  CD1   . LEU C 2  455  ? -24.816 -2.792  22.785  1.00 16.32  ? 455  LEU C CD1   1 
ATOM   6793  C  CD2   . LEU C 2  455  ? -23.765 -1.108  24.286  1.00 13.22  ? 455  LEU C CD2   1 
ATOM   6794  N  N     . SER C 2  456  ? -19.009 -3.044  24.392  1.00 13.42  ? 456  SER C N     1 
ATOM   6795  C  CA    . SER C 2  456  ? -17.833 -3.901  24.500  1.00 14.38  ? 456  SER C CA    1 
ATOM   6796  C  C     . SER C 2  456  ? -17.912 -4.914  25.637  1.00 15.59  ? 456  SER C C     1 
ATOM   6797  O  O     . SER C 2  456  ? -18.533 -4.666  26.670  1.00 14.87  ? 456  SER C O     1 
ATOM   6798  C  CB    . SER C 2  456  ? -16.576 -3.051  24.670  1.00 14.69  ? 456  SER C CB    1 
ATOM   6799  O  OG    . SER C 2  456  ? -15.962 -2.811  23.419  1.00 16.25  ? 456  SER C OG    1 
ATOM   6800  N  N     . ALA C 2  457  ? -17.279 -6.063  25.427  1.00 17.96  ? 457  ALA C N     1 
ATOM   6801  C  CA    . ALA C 2  457  ? -17.127 -7.063  26.474  1.00 22.31  ? 457  ALA C CA    1 
ATOM   6802  C  C     . ALA C 2  457  ? -15.714 -6.954  27.020  1.00 24.79  ? 457  ALA C C     1 
ATOM   6803  O  O     . ALA C 2  457  ? -15.400 -7.465  28.095  1.00 33.99  ? 457  ALA C O     1 
ATOM   6804  C  CB    . ALA C 2  457  ? -17.401 -8.465  25.942  1.00 29.51  ? 457  ALA C CB    1 
ATOM   6805  N  N     . LEU C 2  458  ? -14.868 -6.267  26.261  1.00 18.54  ? 458  LEU C N     1 
ATOM   6806  C  CA    . LEU C 2  458  ? -13.480 -6.061  26.643  1.00 23.91  ? 458  LEU C CA    1 
ATOM   6807  C  C     . LEU C 2  458  ? -13.375 -5.012  27.746  1.00 28.58  ? 458  LEU C C     1 
ATOM   6808  O  O     . LEU C 2  458  ? -14.199 -4.105  27.824  1.00 30.31  ? 458  LEU C O     1 
ATOM   6809  C  CB    . LEU C 2  458  ? -12.652 -5.647  25.425  1.00 26.69  ? 458  LEU C CB    1 
ATOM   6810  C  CG    . LEU C 2  458  ? -12.773 -6.572  24.208  1.00 29.34  ? 458  LEU C CG    1 
ATOM   6811  C  CD1   . LEU C 2  458  ? -11.824 -6.154  23.090  1.00 33.35  ? 458  LEU C CD1   1 
ATOM   6812  C  CD2   . LEU C 2  458  ? -12.536 -8.025  24.602  1.00 34.33  ? 458  LEU C CD2   1 
ATOM   6813  N  N     . GLY C 2  459  ? -12.361 -5.140  28.597  1.00 29.65  ? 459  GLY C N     1 
ATOM   6814  C  CA    . GLY C 2  459  ? -12.171 -4.220  29.705  1.00 30.26  ? 459  GLY C CA    1 
ATOM   6815  C  C     . GLY C 2  459  ? -12.202 -4.897  31.063  1.00 30.85  ? 459  GLY C C     1 
ATOM   6816  O  O     . GLY C 2  459  ? -12.745 -5.992  31.199  1.00 36.90  ? 459  GLY C O     1 
ATOM   6817  N  N     . PRO C 2  460  ? -11.613 -4.242  32.077  1.00 29.94  ? 460  PRO C N     1 
ATOM   6818  C  CA    . PRO C 2  460  ? -11.544 -4.724  33.463  1.00 32.65  ? 460  PRO C CA    1 
ATOM   6819  C  C     . PRO C 2  460  ? -12.893 -5.185  33.997  1.00 39.98  ? 460  PRO C C     1 
ATOM   6820  O  O     . PRO C 2  460  ? -13.876 -4.460  33.866  1.00 46.91  ? 460  PRO C O     1 
ATOM   6821  C  CB    . PRO C 2  460  ? -11.064 -3.495  34.234  1.00 30.81  ? 460  PRO C CB    1 
ATOM   6822  C  CG    . PRO C 2  460  ? -10.294 -2.717  33.246  1.00 37.46  ? 460  PRO C CG    1 
ATOM   6823  C  CD    . PRO C 2  460  ? -10.959 -2.933  31.920  1.00 32.11  ? 460  PRO C CD    1 
ATOM   6824  N  N     . GLY C 2  461  ? -12.935 -6.371  34.595  1.00 42.65  ? 461  GLY C N     1 
ATOM   6825  C  CA    . GLY C 2  461  ? -14.182 -6.929  35.084  1.00 50.27  ? 461  GLY C CA    1 
ATOM   6826  C  C     . GLY C 2  461  ? -14.864 -7.754  34.011  1.00 52.75  ? 461  GLY C C     1 
ATOM   6827  O  O     . GLY C 2  461  ? -15.705 -8.606  34.303  1.00 59.71  ? 461  GLY C O     1 
ATOM   6828  N  N     . GLY C 2  462  ? -14.497 -7.493  32.760  1.00 41.62  ? 462  GLY C N     1 
ATOM   6829  C  CA    . GLY C 2  462  ? -15.003 -8.253  31.634  1.00 38.65  ? 462  GLY C CA    1 
ATOM   6830  C  C     . GLY C 2  462  ? -14.086 -9.417  31.320  1.00 43.52  ? 462  GLY C C     1 
ATOM   6831  O  O     . GLY C 2  462  ? -13.419 -9.948  32.207  1.00 52.48  ? 462  GLY C O     1 
ATOM   6832  N  N     . LEU C 2  463  ? -14.045 -9.813  30.053  1.00 41.20  ? 463  LEU C N     1 
ATOM   6833  C  CA    . LEU C 2  463  ? -13.225 -10.944 29.639  1.00 42.87  ? 463  LEU C CA    1 
ATOM   6834  C  C     . LEU C 2  463  ? -12.106 -10.510 28.701  1.00 43.93  ? 463  LEU C C     1 
ATOM   6835  O  O     . LEU C 2  463  ? -12.150 -9.423  28.129  1.00 36.73  ? 463  LEU C O     1 
ATOM   6836  C  CB    . LEU C 2  463  ? -14.095 -12.014 28.971  1.00 46.70  ? 463  LEU C CB    1 
ATOM   6837  C  CG    . LEU C 2  463  ? -15.120 -11.571 27.920  1.00 51.38  ? 463  LEU C CG    1 
ATOM   6838  C  CD1   . LEU C 2  463  ? -14.473 -11.278 26.572  1.00 55.99  ? 463  LEU C CD1   1 
ATOM   6839  C  CD2   . LEU C 2  463  ? -16.216 -12.617 27.768  1.00 63.97  ? 463  LEU C CD2   1 
ATOM   6840  N  N     . SER C 2  464  ? -11.106 -11.370 28.545  1.00 58.11  ? 464  SER C N     1 
ATOM   6841  C  CA    . SER C 2  464  ? -10.005 -11.114 27.623  1.00 63.19  ? 464  SER C CA    1 
ATOM   6842  C  C     . SER C 2  464  ? -10.347 -11.659 26.240  1.00 61.18  ? 464  SER C C     1 
ATOM   6843  O  O     . SER C 2  464  ? -11.371 -12.316 26.065  1.00 64.33  ? 464  SER C O     1 
ATOM   6844  C  CB    . SER C 2  464  ? -8.708  -11.739 28.144  1.00 60.92  ? 464  SER C CB    1 
ATOM   6845  O  OG    . SER C 2  464  ? -7.668  -11.630 27.188  1.00 62.76  ? 464  SER C OG    1 
ATOM   6846  N  N     . ARG C 2  465  ? -9.495  -11.384 25.259  1.00 54.40  ? 465  ARG C N     1 
ATOM   6847  C  CA    . ARG C 2  465  ? -9.759  -11.821 23.892  1.00 49.14  ? 465  ARG C CA    1 
ATOM   6848  C  C     . ARG C 2  465  ? -9.491  -13.315 23.737  1.00 57.09  ? 465  ARG C C     1 
ATOM   6849  O  O     . ARG C 2  465  ? -10.144 -13.995 22.944  1.00 58.33  ? 465  ARG C O     1 
ATOM   6850  C  CB    . ARG C 2  465  ? -8.913  -11.025 22.899  1.00 50.21  ? 465  ARG C CB    1 
ATOM   6851  C  CG    . ARG C 2  465  ? -9.180  -11.366 21.443  1.00 42.22  ? 465  ARG C CG    1 
ATOM   6852  C  CD    . ARG C 2  465  ? -8.417  -10.443 20.504  1.00 45.61  ? 465  ARG C CD    1 
ATOM   6853  N  NE    . ARG C 2  465  ? -8.800  -9.043  20.681  1.00 58.33  ? 465  ARG C NE    1 
ATOM   6854  C  CZ    . ARG C 2  465  ? -7.964  -8.074  21.044  1.00 62.17  ? 465  ARG C CZ    1 
ATOM   6855  N  NH1   . ARG C 2  465  ? -6.683  -8.342  21.264  1.00 70.84  ? 465  ARG C NH1   1 
ATOM   6856  N  NH2   . ARG C 2  465  ? -8.408  -6.830  21.180  1.00 53.66  ? 465  ARG C NH2   1 
ATOM   6857  N  N     . GLU C 2  466  ? -8.532  -13.822 24.504  1.00 63.50  ? 466  GLU C N     1 
ATOM   6858  C  CA    . GLU C 2  466  ? -8.180  -15.236 24.455  1.00 66.27  ? 466  GLU C CA    1 
ATOM   6859  C  C     . GLU C 2  466  ? -9.156  -16.095 25.256  1.00 65.36  ? 466  GLU C C     1 
ATOM   6860  O  O     . GLU C 2  466  ? -9.419  -17.242 24.899  1.00 69.86  ? 466  GLU C O     1 
ATOM   6861  C  CB    . GLU C 2  466  ? -6.757  -15.448 24.972  1.00 72.96  ? 466  GLU C CB    1 
ATOM   6862  C  CG    . GLU C 2  466  ? -5.680  -14.763 24.144  1.00 90.72  ? 466  GLU C CG    1 
ATOM   6863  C  CD    . GLU C 2  466  ? -4.285  -15.010 24.691  1.00 101.01 ? 466  GLU C CD    1 
ATOM   6864  O  OE1   . GLU C 2  466  ? -4.174  -15.526 25.824  1.00 93.95  ? 466  GLU C OE1   1 
ATOM   6865  O  OE2   . GLU C 2  466  ? -3.301  -14.694 23.987  1.00 112.17 ? 466  GLU C OE2   1 
ATOM   6866  N  N     . ARG C 2  467  ? -9.693  -15.536 26.337  1.00 72.53  ? 467  ARG C N     1 
ATOM   6867  C  CA    . ARG C 2  467  ? -10.625 -16.264 27.196  1.00 77.46  ? 467  ARG C CA    1 
ATOM   6868  C  C     . ARG C 2  467  ? -11.994 -16.450 26.533  1.00 75.50  ? 467  ARG C C     1 
ATOM   6869  O  O     . ARG C 2  467  ? -12.743 -17.362 26.885  1.00 79.55  ? 467  ARG C O     1 
ATOM   6870  C  CB    . ARG C 2  467  ? -10.793 -15.541 28.539  1.00 81.27  ? 467  ARG C CB    1 
ATOM   6871  C  CG    . ARG C 2  467  ? -9.483  -15.148 29.221  1.00 81.04  ? 467  ARG C CG    1 
ATOM   6872  C  CD    . ARG C 2  467  ? -9.721  -14.366 30.517  1.00 85.59  ? 467  ARG C CD    1 
ATOM   6873  N  NE    . ARG C 2  467  ? -9.918  -15.230 31.680  1.00 97.63  ? 467  ARG C NE    1 
ATOM   6874  C  CZ    . ARG C 2  467  ? -8.939  -15.640 32.482  1.00 106.84 ? 467  ARG C CZ    1 
ATOM   6875  N  NH1   . ARG C 2  467  ? -7.687  -15.272 32.245  1.00 106.71 ? 467  ARG C NH1   1 
ATOM   6876  N  NH2   . ARG C 2  467  ? -9.208  -16.423 33.518  1.00 109.35 ? 467  ARG C NH2   1 
ATOM   6877  N  N     . ALA C 2  468  ? -12.319 -15.586 25.575  1.00 64.98  ? 468  ALA C N     1 
ATOM   6878  C  CA    . ALA C 2  468  ? -13.616 -15.642 24.905  1.00 52.57  ? 468  ALA C CA    1 
ATOM   6879  C  C     . ALA C 2  468  ? -13.662 -16.751 23.858  1.00 56.18  ? 468  ALA C C     1 
ATOM   6880  O  O     . ALA C 2  468  ? -12.892 -16.741 22.897  1.00 51.52  ? 468  ALA C O     1 
ATOM   6881  C  CB    . ALA C 2  468  ? -13.938 -14.301 24.267  1.00 57.83  ? 468  ALA C CB    1 
ATOM   6882  N  N     . GLY C 2  469  ? -14.574 -17.700 24.054  1.00 58.36  ? 469  GLY C N     1 
ATOM   6883  C  CA    . GLY C 2  469  ? -14.744 -18.820 23.143  1.00 57.36  ? 469  GLY C CA    1 
ATOM   6884  C  C     . GLY C 2  469  ? -15.599 -18.472 21.939  1.00 55.69  ? 469  GLY C C     1 
ATOM   6885  O  O     . GLY C 2  469  ? -15.661 -17.313 21.534  1.00 56.30  ? 469  GLY C O     1 
ATOM   6886  N  N     . LEU C 2  470  ? -16.268 -19.469 21.366  1.00 54.31  ? 470  LEU C N     1 
ATOM   6887  C  CA    . LEU C 2  470  ? -17.050 -19.254 20.150  1.00 53.80  ? 470  LEU C CA    1 
ATOM   6888  C  C     . LEU C 2  470  ? -18.514 -18.954 20.444  1.00 51.47  ? 470  LEU C C     1 
ATOM   6889  O  O     . LEU C 2  470  ? -19.291 -18.665 19.536  1.00 49.58  ? 470  LEU C O     1 
ATOM   6890  C  CB    . LEU C 2  470  ? -16.952 -20.472 19.229  1.00 53.22  ? 470  LEU C CB    1 
ATOM   6891  C  CG    . LEU C 2  470  ? -15.569 -20.793 18.658  1.00 54.06  ? 470  LEU C CG    1 
ATOM   6892  C  CD1   . LEU C 2  470  ? -15.615 -22.084 17.860  1.00 48.03  ? 470  LEU C CD1   1 
ATOM   6893  C  CD2   . LEU C 2  470  ? -15.043 -19.646 17.801  1.00 50.75  ? 470  LEU C CD2   1 
ATOM   6894  N  N     . GLU C 2  471  ? -18.884 -19.021 21.716  1.00 52.43  ? 471  GLU C N     1 
ATOM   6895  C  CA    . GLU C 2  471  ? -20.267 -18.806 22.118  1.00 55.69  ? 471  GLU C CA    1 
ATOM   6896  C  C     . GLU C 2  471  ? -20.545 -17.330 22.385  1.00 55.22  ? 471  GLU C C     1 
ATOM   6897  O  O     . GLU C 2  471  ? -21.632 -16.825 22.097  1.00 59.42  ? 471  GLU C O     1 
ATOM   6898  C  CB    . GLU C 2  471  ? -20.596 -19.628 23.366  1.00 69.46  ? 471  GLU C CB    1 
ATOM   6899  C  CG    . GLU C 2  471  ? -19.990 -21.025 23.386  1.00 80.67  ? 471  GLU C CG    1 
ATOM   6900  C  CD    . GLU C 2  471  ? -18.583 -21.051 23.962  1.00 95.85  ? 471  GLU C CD    1 
ATOM   6901  O  OE1   . GLU C 2  471  ? -17.915 -19.993 23.968  1.00 94.13  ? 471  GLU C OE1   1 
ATOM   6902  O  OE2   . GLU C 2  471  ? -18.150 -22.132 24.415  1.00 107.91 ? 471  GLU C OE2   1 
ATOM   6903  N  N     . VAL C 2  472  ? -19.554 -16.641 22.937  1.00 47.79  ? 472  VAL C N     1 
ATOM   6904  C  CA    . VAL C 2  472  ? -19.726 -15.253 23.333  1.00 38.64  ? 472  VAL C CA    1 
ATOM   6905  C  C     . VAL C 2  472  ? -19.856 -14.345 22.119  1.00 34.02  ? 472  VAL C C     1 
ATOM   6906  O  O     . VAL C 2  472  ? -20.458 -13.277 22.192  1.00 36.95  ? 472  VAL C O     1 
ATOM   6907  C  CB    . VAL C 2  472  ? -18.550 -14.779 24.199  1.00 36.12  ? 472  VAL C CB    1 
ATOM   6908  C  CG1   . VAL C 2  472  ? -18.932 -13.529 24.975  1.00 36.07  ? 472  VAL C CG1   1 
ATOM   6909  C  CG2   . VAL C 2  472  ? -18.123 -15.884 25.148  1.00 47.68  ? 472  VAL C CG2   1 
ATOM   6910  N  N     . ARG C 2  473  ? -19.309 -14.787 20.993  1.00 35.94  ? 473  ARG C N     1 
ATOM   6911  C  CA    . ARG C 2  473  ? -19.171 -13.922 19.828  1.00 33.68  ? 473  ARG C CA    1 
ATOM   6912  C  C     . ARG C 2  473  ? -20.347 -13.959 18.857  1.00 36.86  ? 473  ARG C C     1 
ATOM   6913  O  O     . ARG C 2  473  ? -20.657 -12.950 18.229  1.00 35.94  ? 473  ARG C O     1 
ATOM   6914  C  CB    . ARG C 2  473  ? -17.889 -14.280 19.079  1.00 29.45  ? 473  ARG C CB    1 
ATOM   6915  C  CG    . ARG C 2  473  ? -16.725 -14.547 20.001  1.00 32.01  ? 473  ARG C CG    1 
ATOM   6916  C  CD    . ARG C 2  473  ? -15.536 -15.078 19.239  1.00 31.90  ? 473  ARG C CD    1 
ATOM   6917  N  NE    . ARG C 2  473  ? -14.560 -14.035 18.956  1.00 27.04  ? 473  ARG C NE    1 
ATOM   6918  C  CZ    . ARG C 2  473  ? -13.480 -13.809 19.695  1.00 28.36  ? 473  ARG C CZ    1 
ATOM   6919  N  NH1   . ARG C 2  473  ? -13.236 -14.557 20.762  1.00 32.24  ? 473  ARG C NH1   1 
ATOM   6920  N  NH2   . ARG C 2  473  ? -12.641 -12.839 19.363  1.00 32.90  ? 473  ARG C NH2   1 
ATOM   6921  N  N     . ASP C 2  474  ? -21.000 -15.110 18.728  1.00 42.06  ? 474  ASP C N     1 
ATOM   6922  C  CA    . ASP C 2  474  ? -22.031 -15.276 17.702  1.00 38.18  ? 474  ASP C CA    1 
ATOM   6923  C  C     . ASP C 2  474  ? -23.362 -14.631 18.091  1.00 32.84  ? 474  ASP C C     1 
ATOM   6924  O  O     . ASP C 2  474  ? -23.569 -14.262 19.244  1.00 33.17  ? 474  ASP C O     1 
ATOM   6925  C  CB    . ASP C 2  474  ? -22.237 -16.762 17.379  1.00 43.54  ? 474  ASP C CB    1 
ATOM   6926  C  CG    . ASP C 2  474  ? -22.515 -17.606 18.614  1.00 53.58  ? 474  ASP C CG    1 
ATOM   6927  O  OD1   . ASP C 2  474  ? -22.963 -17.052 19.641  1.00 51.51  ? 474  ASP C OD1   1 
ATOM   6928  O  OD2   . ASP C 2  474  ? -22.290 -18.835 18.555  1.00 53.67  ? 474  ASP C OD2   1 
ATOM   6929  N  N     . VAL C 2  475  ? -24.257 -14.504 17.116  1.00 27.34  ? 475  VAL C N     1 
ATOM   6930  C  CA    . VAL C 2  475  ? -25.502 -13.764 17.291  1.00 25.07  ? 475  VAL C CA    1 
ATOM   6931  C  C     . VAL C 2  475  ? -26.550 -14.515 18.103  1.00 30.48  ? 475  VAL C C     1 
ATOM   6932  O  O     . VAL C 2  475  ? -27.009 -15.581 17.703  1.00 42.55  ? 475  VAL C O     1 
ATOM   6933  C  CB    . VAL C 2  475  ? -26.117 -13.398 15.933  1.00 25.69  ? 475  VAL C CB    1 
ATOM   6934  C  CG1   . VAL C 2  475  ? -27.392 -12.613 16.137  1.00 31.65  ? 475  VAL C CG1   1 
ATOM   6935  C  CG2   . VAL C 2  475  ? -25.128 -12.600 15.103  1.00 28.00  ? 475  VAL C CG2   1 
ATOM   6936  N  N     . HIS C 2  476  ? -26.939 -13.938 19.235  1.00 29.70  ? 476  HIS C N     1 
ATOM   6937  C  CA    . HIS C 2  476  ? -27.907 -14.560 20.138  1.00 34.58  ? 476  HIS C CA    1 
ATOM   6938  C  C     . HIS C 2  476  ? -29.333 -14.124 19.795  1.00 32.95  ? 476  HIS C C     1 
ATOM   6939  O  O     . HIS C 2  476  ? -29.538 -13.008 19.317  1.00 32.37  ? 476  HIS C O     1 
ATOM   6940  C  CB    . HIS C 2  476  ? -27.568 -14.198 21.588  1.00 36.54  ? 476  HIS C CB    1 
ATOM   6941  C  CG    . HIS C 2  476  ? -28.291 -15.018 22.609  1.00 33.76  ? 476  HIS C CG    1 
ATOM   6942  N  ND1   . HIS C 2  476  ? -29.443 -14.586 23.229  1.00 32.01  ? 476  HIS C ND1   1 
ATOM   6943  C  CD2   . HIS C 2  476  ? -28.031 -16.248 23.110  1.00 34.36  ? 476  HIS C CD2   1 
ATOM   6944  C  CE1   . HIS C 2  476  ? -29.859 -15.513 24.073  1.00 40.59  ? 476  HIS C CE1   1 
ATOM   6945  N  NE2   . HIS C 2  476  ? -29.021 -16.532 24.020  1.00 42.81  ? 476  HIS C NE2   1 
ATOM   6946  N  N     . PRO C 2  477  ? -30.323 -15.008 20.022  1.00 35.45  ? 477  PRO C N     1 
ATOM   6947  C  CA    . PRO C 2  477  ? -31.735 -14.672 19.801  1.00 40.01  ? 477  PRO C CA    1 
ATOM   6948  C  C     . PRO C 2  477  ? -32.221 -13.447 20.579  1.00 41.77  ? 477  PRO C C     1 
ATOM   6949  O  O     . PRO C 2  477  ? -33.098 -12.728 20.098  1.00 48.12  ? 477  PRO C O     1 
ATOM   6950  C  CB    . PRO C 2  477  ? -32.473 -15.933 20.279  1.00 39.04  ? 477  PRO C CB    1 
ATOM   6951  C  CG    . PRO C 2  477  ? -31.466 -16.720 21.056  1.00 38.28  ? 477  PRO C CG    1 
ATOM   6952  C  CD    . PRO C 2  477  ? -30.166 -16.423 20.390  1.00 33.95  ? 477  PRO C CD    1 
ATOM   6953  N  N     . SER C 2  478  ? -31.665 -13.209 21.761  1.00 35.04  ? 478  SER C N     1 
ATOM   6954  C  CA    . SER C 2  478  ? -32.115 -12.092 22.583  1.00 36.54  ? 478  SER C CA    1 
ATOM   6955  C  C     . SER C 2  478  ? -31.702 -10.752 21.984  1.00 28.13  ? 478  SER C C     1 
ATOM   6956  O  O     . SER C 2  478  ? -32.280 -9.715  22.308  1.00 25.04  ? 478  SER C O     1 
ATOM   6957  C  CB    . SER C 2  478  ? -31.570 -12.221 24.007  1.00 47.89  ? 478  SER C CB    1 
ATOM   6958  O  OG    . SER C 2  478  ? -30.156 -12.296 24.009  1.00 43.81  ? 478  SER C OG    1 
ATOM   6959  N  N     . HIS C 2  479  ? -30.715 -10.785 21.093  1.00 27.41  ? 479  HIS C N     1 
ATOM   6960  C  CA    . HIS C 2  479  ? -30.130 -9.569  20.531  1.00 27.66  ? 479  HIS C CA    1 
ATOM   6961  C  C     . HIS C 2  479  ? -31.108 -8.759  19.693  1.00 28.64  ? 479  HIS C C     1 
ATOM   6962  O  O     . HIS C 2  479  ? -30.795 -7.649  19.266  1.00 34.79  ? 479  HIS C O     1 
ATOM   6963  C  CB    . HIS C 2  479  ? -28.906 -9.910  19.679  1.00 29.91  ? 479  HIS C CB    1 
ATOM   6964  C  CG    . HIS C 2  479  ? -27.697 -10.289 20.478  1.00 32.33  ? 479  HIS C CG    1 
ATOM   6965  N  ND1   . HIS C 2  479  ? -27.778 -10.799 21.755  1.00 32.99  ? 479  HIS C ND1   1 
ATOM   6966  C  CD2   . HIS C 2  479  ? -26.380 -10.222 20.180  1.00 33.07  ? 479  HIS C CD2   1 
ATOM   6967  C  CE1   . HIS C 2  479  ? -26.559 -11.034 22.209  1.00 32.99  ? 479  HIS C CE1   1 
ATOM   6968  N  NE2   . HIS C 2  479  ? -25.693 -10.694 21.274  1.00 31.55  ? 479  HIS C NE2   1 
ATOM   6969  N  N     . TYR C 2  480  ? -32.290 -9.313  19.458  1.00 25.35  ? 480  TYR C N     1 
ATOM   6970  C  CA    . TYR C 2  480  ? -33.277 -8.658  18.615  1.00 27.33  ? 480  TYR C CA    1 
ATOM   6971  C  C     . TYR C 2  480  ? -33.733 -7.318  19.195  1.00 25.12  ? 480  TYR C C     1 
ATOM   6972  O  O     . TYR C 2  480  ? -34.297 -7.257  20.286  1.00 27.02  ? 480  TYR C O     1 
ATOM   6973  C  CB    . TYR C 2  480  ? -34.477 -9.580  18.406  1.00 36.01  ? 480  TYR C CB    1 
ATOM   6974  C  CG    . TYR C 2  480  ? -35.416 -9.117  17.322  1.00 33.39  ? 480  TYR C CG    1 
ATOM   6975  C  CD1   . TYR C 2  480  ? -36.692 -8.663  17.630  1.00 36.40  ? 480  TYR C CD1   1 
ATOM   6976  C  CD2   . TYR C 2  480  ? -35.022 -9.123  15.991  1.00 27.24  ? 480  TYR C CD2   1 
ATOM   6977  C  CE1   . TYR C 2  480  ? -37.550 -8.235  16.642  1.00 41.58  ? 480  TYR C CE1   1 
ATOM   6978  C  CE2   . TYR C 2  480  ? -35.872 -8.697  14.997  1.00 33.02  ? 480  TYR C CE2   1 
ATOM   6979  C  CZ    . TYR C 2  480  ? -37.135 -8.254  15.327  1.00 46.41  ? 480  TYR C CZ    1 
ATOM   6980  O  OH    . TYR C 2  480  ? -37.984 -7.827  14.332  1.00 57.35  ? 480  TYR C OH    1 
ATOM   6981  N  N     . GLY C 2  481  ? -33.469 -6.243  18.459  1.00 21.18  ? 481  GLY C N     1 
ATOM   6982  C  CA    . GLY C 2  481  ? -33.923 -4.920  18.849  1.00 23.58  ? 481  GLY C CA    1 
ATOM   6983  C  C     . GLY C 2  481  ? -33.124 -4.303  19.979  1.00 25.56  ? 481  GLY C C     1 
ATOM   6984  O  O     . GLY C 2  481  ? -33.449 -3.219  20.461  1.00 29.13  ? 481  GLY C O     1 
ATOM   6985  N  N     . ARG C 2  482  ? -32.070 -4.992  20.399  1.00 26.18  ? 482  ARG C N     1 
ATOM   6986  C  CA    . ARG C 2  482  ? -31.238 -4.517  21.496  1.00 24.92  ? 482  ARG C CA    1 
ATOM   6987  C  C     . ARG C 2  482  ? -29.811 -4.285  21.039  1.00 19.08  ? 482  ARG C C     1 
ATOM   6988  O  O     . ARG C 2  482  ? -29.280 -3.184  21.152  1.00 20.35  ? 482  ARG C O     1 
ATOM   6989  C  CB    . ARG C 2  482  ? -31.264 -5.513  22.652  1.00 30.08  ? 482  ARG C CB    1 
ATOM   6990  C  CG    . ARG C 2  482  ? -32.644 -5.696  23.249  1.00 37.01  ? 482  ARG C CG    1 
ATOM   6991  C  CD    . ARG C 2  482  ? -32.648 -6.719  24.371  1.00 38.78  ? 482  ARG C CD    1 
ATOM   6992  N  NE    . ARG C 2  482  ? -33.976 -6.835  24.967  1.00 38.01  ? 482  ARG C NE    1 
ATOM   6993  C  CZ    . ARG C 2  482  ? -34.941 -7.608  24.482  1.00 42.05  ? 482  ARG C CZ    1 
ATOM   6994  N  NH1   . ARG C 2  482  ? -34.719 -8.338  23.398  1.00 42.41  ? 482  ARG C NH1   1 
ATOM   6995  N  NH2   . ARG C 2  482  ? -36.126 -7.653  25.076  1.00 49.52  ? 482  ARG C NH2   1 
ATOM   6996  N  N     . MET C 2  483  ? -29.192 -5.336  20.520  1.00 17.56  ? 483  MET C N     1 
ATOM   6997  C  CA    . MET C 2  483  ? -27.843 -5.234  19.991  1.00 17.31  ? 483  MET C CA    1 
ATOM   6998  C  C     . MET C 2  483  ? -27.824 -5.626  18.520  1.00 19.05  ? 483  MET C C     1 
ATOM   6999  O  O     . MET C 2  483  ? -28.406 -6.635  18.132  1.00 20.32  ? 483  MET C O     1 
ATOM   7000  C  CB    . MET C 2  483  ? -26.890 -6.110  20.800  1.00 19.65  ? 483  MET C CB    1 
ATOM   7001  C  CG    . MET C 2  483  ? -25.468 -6.127  20.283  1.00 19.97  ? 483  MET C CG    1 
ATOM   7002  S  SD    . MET C 2  483  ? -24.311 -6.701  21.535  1.00 20.02  ? 483  MET C SD    1 
ATOM   7003  C  CE    . MET C 2  483  ? -22.905 -7.109  20.509  1.00 25.15  ? 483  MET C CE    1 
ATOM   7004  N  N     . CYS C 2  484  ? -27.161 -4.824  17.696  1.00 19.50  ? 484  CYS C N     1 
ATOM   7005  C  CA    . CYS C 2  484  ? -27.149 -5.078  16.262  1.00 20.90  ? 484  CYS C CA    1 
ATOM   7006  C  C     . CYS C 2  484  ? -26.392 -6.356  15.932  1.00 17.46  ? 484  CYS C C     1 
ATOM   7007  O  O     . CYS C 2  484  ? -25.311 -6.601  16.464  1.00 16.61  ? 484  CYS C O     1 
ATOM   7008  C  CB    . CYS C 2  484  ? -26.534 -3.900  15.509  1.00 23.35  ? 484  CYS C CB    1 
ATOM   7009  S  SG    . CYS C 2  484  ? -26.629 -4.042  13.711  1.00 18.47  ? 484  CYS C SG    1 
ATOM   7010  N  N     . PRO C 2  485  ? -26.975 -7.186  15.062  1.00 15.86  ? 485  PRO C N     1 
ATOM   7011  C  CA    . PRO C 2  485  ? -26.340 -8.430  14.629  1.00 17.08  ? 485  PRO C CA    1 
ATOM   7012  C  C     . PRO C 2  485  ? -25.433 -8.236  13.424  1.00 17.24  ? 485  PRO C C     1 
ATOM   7013  O  O     . PRO C 2  485  ? -24.750 -9.177  13.034  1.00 21.50  ? 485  PRO C O     1 
ATOM   7014  C  CB    . PRO C 2  485  ? -27.530 -9.310  14.269  1.00 18.61  ? 485  PRO C CB    1 
ATOM   7015  C  CG    . PRO C 2  485  ? -28.526 -8.345  13.767  1.00 16.54  ? 485  PRO C CG    1 
ATOM   7016  C  CD    . PRO C 2  485  ? -28.371 -7.103  14.602  1.00 16.80  ? 485  PRO C CD    1 
ATOM   7017  N  N     . ILE C 2  486  ? -25.418 -7.041  12.845  1.00 13.77  ? 486  ILE C N     1 
ATOM   7018  C  CA    . ILE C 2  486  ? -24.554 -6.793  11.696  1.00 13.80  ? 486  ILE C CA    1 
ATOM   7019  C  C     . ILE C 2  486  ? -23.282 -6.047  12.086  1.00 11.71  ? 486  ILE C C     1 
ATOM   7020  O  O     . ILE C 2  486  ? -22.190 -6.391  11.639  1.00 11.31  ? 486  ILE C O     1 
ATOM   7021  C  CB    . ILE C 2  486  ? -25.283 -5.997  10.599  1.00 15.63  ? 486  ILE C CB    1 
ATOM   7022  C  CG1   . ILE C 2  486  ? -26.418 -6.829  10.009  1.00 17.46  ? 486  ILE C CG1   1 
ATOM   7023  C  CG2   . ILE C 2  486  ? -24.322 -5.614  9.487   1.00 16.44  ? 486  ILE C CG2   1 
ATOM   7024  C  CD1   . ILE C 2  486  ? -25.947 -8.117  9.379   1.00 16.06  ? 486  ILE C CD1   1 
ATOM   7025  N  N     . GLU C 2  487  ? -23.421 -5.027  12.924  1.00 12.64  ? 487  GLU C N     1 
ATOM   7026  C  CA    . GLU C 2  487  ? -22.279 -4.187  13.259  1.00 13.79  ? 487  GLU C CA    1 
ATOM   7027  C  C     . GLU C 2  487  ? -21.343 -4.862  14.246  1.00 13.71  ? 487  GLU C C     1 
ATOM   7028  O  O     . GLU C 2  487  ? -21.707 -5.104  15.396  1.00 15.60  ? 487  GLU C O     1 
ATOM   7029  C  CB    . GLU C 2  487  ? -22.735 -2.842  13.827  1.00 16.00  ? 487  GLU C CB    1 
ATOM   7030  C  CG    . GLU C 2  487  ? -21.576 -1.908  14.136  1.00 14.53  ? 487  GLU C CG    1 
ATOM   7031  C  CD    . GLU C 2  487  ? -21.893 -0.460  13.823  1.00 18.24  ? 487  GLU C CD    1 
ATOM   7032  O  OE1   . GLU C 2  487  ? -23.063 -0.057  13.985  1.00 18.07  ? 487  GLU C OE1   1 
ATOM   7033  O  OE2   . GLU C 2  487  ? -20.972 0.272   13.402  1.00 23.41  ? 487  GLU C OE2   1 
ATOM   7034  N  N     . THR C 2  488  ? -20.131 -5.151  13.781  1.00 12.50  ? 488  THR C N     1 
ATOM   7035  C  CA    . THR C 2  488  ? -19.082 -5.715  14.620  1.00 13.44  ? 488  THR C CA    1 
ATOM   7036  C  C     . THR C 2  488  ? -17.765 -5.727  13.836  1.00 13.67  ? 488  THR C C     1 
ATOM   7037  O  O     . THR C 2  488  ? -17.775 -5.790  12.610  1.00 14.91  ? 488  THR C O     1 
ATOM   7038  C  CB    . THR C 2  488  ? -19.453 -7.143  15.111  1.00 15.06  ? 488  THR C CB    1 
ATOM   7039  O  OG1   . THR C 2  488  ? -18.593 -7.530  16.189  1.00 16.01  ? 488  THR C OG1   1 
ATOM   7040  C  CG2   . THR C 2  488  ? -19.364 -8.161  13.991  1.00 18.80  ? 488  THR C CG2   1 
ATOM   7041  N  N     . PRO C 2  489  ? -16.625 -5.619  14.538  1.00 15.53  ? 489  PRO C N     1 
ATOM   7042  C  CA    . PRO C 2  489  ? -15.327 -5.641  13.852  1.00 18.97  ? 489  PRO C CA    1 
ATOM   7043  C  C     . PRO C 2  489  ? -15.062 -6.947  13.101  1.00 19.46  ? 489  PRO C C     1 
ATOM   7044  O  O     . PRO C 2  489  ? -15.666 -7.975  13.405  1.00 18.58  ? 489  PRO C O     1 
ATOM   7045  C  CB    . PRO C 2  489  ? -14.320 -5.454  14.997  1.00 23.52  ? 489  PRO C CB    1 
ATOM   7046  C  CG    . PRO C 2  489  ? -15.076 -5.766  16.244  1.00 22.13  ? 489  PRO C CG    1 
ATOM   7047  C  CD    . PRO C 2  489  ? -16.474 -5.326  15.970  1.00 17.57  ? 489  PRO C CD    1 
ATOM   7048  N  N     . GLU C 2  490  ? -14.156 -6.895  12.130  1.00 19.77  ? 490  GLU C N     1 
ATOM   7049  C  CA    . GLU C 2  490  ? -13.907 -8.028  11.246  1.00 22.88  ? 490  GLU C CA    1 
ATOM   7050  C  C     . GLU C 2  490  ? -12.715 -8.883  11.679  1.00 22.94  ? 490  GLU C C     1 
ATOM   7051  O  O     . GLU C 2  490  ? -12.539 -9.997  11.185  1.00 24.53  ? 490  GLU C O     1 
ATOM   7052  C  CB    . GLU C 2  490  ? -13.682 -7.538  9.812   1.00 33.69  ? 490  GLU C CB    1 
ATOM   7053  C  CG    . GLU C 2  490  ? -14.670 -8.098  8.794   1.00 42.27  ? 490  GLU C CG    1 
ATOM   7054  C  CD    . GLU C 2  490  ? -14.154 -8.029  7.361   1.00 47.12  ? 490  GLU C CD    1 
ATOM   7055  O  OE1   . GLU C 2  490  ? -13.858 -9.102  6.788   1.00 35.76  ? 490  GLU C OE1   1 
ATOM   7056  O  OE2   . GLU C 2  490  ? -14.048 -6.912  6.807   1.00 46.12  ? 490  GLU C OE2   1 
ATOM   7057  N  N     . GLY C 2  491  ? -11.901 -8.368  12.595  1.00 26.08  ? 491  GLY C N     1 
ATOM   7058  C  CA    . GLY C 2  491  ? -10.670 -9.044  12.974  1.00 27.08  ? 491  GLY C CA    1 
ATOM   7059  C  C     . GLY C 2  491  ? -10.799 -10.039 14.114  1.00 21.65  ? 491  GLY C C     1 
ATOM   7060  O  O     . GLY C 2  491  ? -11.738 -10.831 14.156  1.00 20.24  ? 491  GLY C O     1 
ATOM   7061  N  N     . PRO C 2  492  ? -9.841  -10.007 15.051  1.00 19.95  ? 492  PRO C N     1 
ATOM   7062  C  CA    . PRO C 2  492  ? -9.832  -10.869 16.234  1.00 20.07  ? 492  PRO C CA    1 
ATOM   7063  C  C     . PRO C 2  492  ? -10.772 -10.354 17.308  1.00 22.27  ? 492  PRO C C     1 
ATOM   7064  O  O     . PRO C 2  492  ? -10.943 -10.994 18.345  1.00 28.60  ? 492  PRO C O     1 
ATOM   7065  C  CB    . PRO C 2  492  ? -8.386  -10.782 16.709  1.00 28.46  ? 492  PRO C CB    1 
ATOM   7066  C  CG    . PRO C 2  492  ? -7.990  -9.400  16.343  1.00 26.66  ? 492  PRO C CG    1 
ATOM   7067  C  CD    . PRO C 2  492  ? -8.671  -9.113  15.026  1.00 25.87  ? 492  PRO C CD    1 
ATOM   7068  N  N     . ASN C 2  493  ? -11.362 -9.192  17.067  1.00 22.57  ? 493  ASN C N     1 
ATOM   7069  C  CA    . ASN C 2  493  ? -12.280 -8.602  18.027  1.00 23.97  ? 493  ASN C CA    1 
ATOM   7070  C  C     . ASN C 2  493  ? -13.718 -8.996  17.769  1.00 24.84  ? 493  ASN C C     1 
ATOM   7071  O  O     . ASN C 2  493  ? -14.601 -8.667  18.556  1.00 26.46  ? 493  ASN C O     1 
ATOM   7072  C  CB    . ASN C 2  493  ? -12.167 -7.079  18.010  1.00 24.07  ? 493  ASN C CB    1 
ATOM   7073  C  CG    . ASN C 2  493  ? -11.334 -6.546  19.151  1.00 32.09  ? 493  ASN C CG    1 
ATOM   7074  O  OD1   . ASN C 2  493  ? -10.973 -7.282  20.070  1.00 35.44  ? 493  ASN C OD1   1 
ATOM   7075  N  ND2   . ASN C 2  493  ? -11.048 -5.249  19.116  1.00 36.48  ? 493  ASN C ND2   1 
ATOM   7076  N  N     . ILE C 2  494  ? -13.938 -9.699  16.663  1.00 24.93  ? 494  ILE C N     1 
ATOM   7077  C  CA    . ILE C 2  494  ? -15.280 -9.971  16.155  1.00 26.32  ? 494  ILE C CA    1 
ATOM   7078  C  C     . ILE C 2  494  ? -16.214 -10.581 17.212  1.00 28.96  ? 494  ILE C C     1 
ATOM   7079  O  O     . ILE C 2  494  ? -15.802 -11.409 18.030  1.00 28.11  ? 494  ILE C O     1 
ATOM   7080  C  CB    . ILE C 2  494  ? -15.214 -10.901 14.919  1.00 23.66  ? 494  ILE C CB    1 
ATOM   7081  C  CG1   . ILE C 2  494  ? -16.601 -11.100 14.302  1.00 23.97  ? 494  ILE C CG1   1 
ATOM   7082  C  CG2   . ILE C 2  494  ? -14.574 -12.236 15.283  1.00 24.93  ? 494  ILE C CG2   1 
ATOM   7083  C  CD1   . ILE C 2  494  ? -16.605 -12.043 13.114  1.00 24.38  ? 494  ILE C CD1   1 
ATOM   7084  N  N     . GLY C 2  495  ? -17.465 -10.126 17.212  1.00 25.51  ? 495  GLY C N     1 
ATOM   7085  C  CA    . GLY C 2  495  ? -18.481 -10.638 18.113  1.00 19.24  ? 495  GLY C CA    1 
ATOM   7086  C  C     . GLY C 2  495  ? -18.374 -10.108 19.530  1.00 21.89  ? 495  GLY C C     1 
ATOM   7087  O  O     . GLY C 2  495  ? -19.341 -10.161 20.288  1.00 22.04  ? 495  GLY C O     1 
ATOM   7088  N  N     . LEU C 2  496  ? -17.200 -9.600  19.890  1.00 22.92  ? 496  LEU C N     1 
ATOM   7089  C  CA    . LEU C 2  496  ? -16.969 -9.080  21.234  1.00 21.53  ? 496  LEU C CA    1 
ATOM   7090  C  C     . LEU C 2  496  ? -17.264 -7.589  21.300  1.00 22.85  ? 496  LEU C C     1 
ATOM   7091  O  O     . LEU C 2  496  ? -17.319 -7.003  22.381  1.00 23.80  ? 496  LEU C O     1 
ATOM   7092  C  CB    . LEU C 2  496  ? -15.531 -9.349  21.675  1.00 19.72  ? 496  LEU C CB    1 
ATOM   7093  C  CG    . LEU C 2  496  ? -15.144 -10.826 21.682  1.00 22.94  ? 496  LEU C CG    1 
ATOM   7094  C  CD1   . LEU C 2  496  ? -13.663 -11.003 21.985  1.00 32.64  ? 496  LEU C CD1   1 
ATOM   7095  C  CD2   . LEU C 2  496  ? -16.005 -11.590 22.679  1.00 26.48  ? 496  LEU C CD2   1 
ATOM   7096  N  N     . ILE C 2  497  ? -17.448 -6.979  20.134  1.00 19.18  ? 497  ILE C N     1 
ATOM   7097  C  CA    . ILE C 2  497  ? -17.754 -5.557  20.051  1.00 14.83  ? 497  ILE C CA    1 
ATOM   7098  C  C     . ILE C 2  497  ? -18.920 -5.307  19.115  1.00 16.82  ? 497  ILE C C     1 
ATOM   7099  O  O     . ILE C 2  497  ? -18.890 -5.698  17.951  1.00 17.46  ? 497  ILE C O     1 
ATOM   7100  C  CB    . ILE C 2  497  ? -16.554 -4.744  19.560  1.00 15.63  ? 497  ILE C CB    1 
ATOM   7101  C  CG1   . ILE C 2  497  ? -15.390 -4.871  20.540  1.00 18.36  ? 497  ILE C CG1   1 
ATOM   7102  C  CG2   . ILE C 2  497  ? -16.945 -3.288  19.385  1.00 16.74  ? 497  ILE C CG2   1 
ATOM   7103  C  CD1   . ILE C 2  497  ? -14.106 -4.268  20.031  1.00 26.44  ? 497  ILE C CD1   1 
ATOM   7104  N  N     . GLY C 2  498  ? -19.949 -4.647  19.625  1.00 17.05  ? 498  GLY C N     1 
ATOM   7105  C  CA    . GLY C 2  498  ? -21.119 -4.379  18.820  1.00 19.24  ? 498  GLY C CA    1 
ATOM   7106  C  C     . GLY C 2  498  ? -21.608 -2.955  18.931  1.00 17.08  ? 498  GLY C C     1 
ATOM   7107  O  O     . GLY C 2  498  ? -20.971 -2.100  19.550  1.00 13.58  ? 498  GLY C O     1 
ATOM   7108  N  N     . SER C 2  499  ? -22.756 -2.713  18.312  1.00 19.71  ? 499  SER C N     1 
ATOM   7109  C  CA    . SER C 2  499  ? -23.427 -1.427  18.380  1.00 20.94  ? 499  SER C CA    1 
ATOM   7110  C  C     . SER C 2  499  ? -24.842 -1.604  18.932  1.00 20.30  ? 499  SER C C     1 
ATOM   7111  O  O     . SER C 2  499  ? -25.548 -2.545  18.564  1.00 18.35  ? 499  SER C O     1 
ATOM   7112  C  CB    . SER C 2  499  ? -23.461 -0.774  16.995  1.00 21.44  ? 499  SER C CB    1 
ATOM   7113  O  OG    . SER C 2  499  ? -24.010 0.530   17.043  1.00 27.52  ? 499  SER C OG    1 
ATOM   7114  N  N     . LEU C 2  500  ? -25.243 -0.707  19.827  1.00 17.18  ? 500  LEU C N     1 
ATOM   7115  C  CA    . LEU C 2  500  ? -26.606 -0.695  20.342  1.00 17.69  ? 500  LEU C CA    1 
ATOM   7116  C  C     . LEU C 2  500  ? -27.603 -0.455  19.216  1.00 20.58  ? 500  LEU C C     1 
ATOM   7117  O  O     . LEU C 2  500  ? -27.380 0.403   18.362  1.00 21.02  ? 500  LEU C O     1 
ATOM   7118  C  CB    . LEU C 2  500  ? -26.772 0.382   21.414  1.00 15.92  ? 500  LEU C CB    1 
ATOM   7119  C  CG    . LEU C 2  500  ? -28.165 0.426   22.048  1.00 18.07  ? 500  LEU C CG    1 
ATOM   7120  C  CD1   . LEU C 2  500  ? -28.190 -0.398  23.323  1.00 18.24  ? 500  LEU C CD1   1 
ATOM   7121  C  CD2   . LEU C 2  500  ? -28.637 1.848   22.302  1.00 22.31  ? 500  LEU C CD2   1 
ATOM   7122  N  N     . SER C 2  501  ? -28.698 -1.213  19.220  1.00 22.66  ? 501  SER C N     1 
ATOM   7123  C  CA    . SER C 2  501  ? -29.758 -1.048  18.227  1.00 21.62  ? 501  SER C CA    1 
ATOM   7124  C  C     . SER C 2  501  ? -30.377 0.345   18.296  1.00 22.69  ? 501  SER C C     1 
ATOM   7125  O  O     . SER C 2  501  ? -30.194 1.074   19.275  1.00 25.20  ? 501  SER C O     1 
ATOM   7126  C  CB    . SER C 2  501  ? -30.844 -2.112  18.411  1.00 22.00  ? 501  SER C CB    1 
ATOM   7127  O  OG    . SER C 2  501  ? -30.355 -3.404  18.090  1.00 21.86  ? 501  SER C OG    1 
ATOM   7128  N  N     . VAL C 2  502  ? -31.119 0.701   17.253  1.00 20.46  ? 502  VAL C N     1 
ATOM   7129  C  CA    . VAL C 2  502  ? -31.626 2.057   17.094  1.00 22.82  ? 502  VAL C CA    1 
ATOM   7130  C  C     . VAL C 2  502  ? -32.587 2.466   18.210  1.00 26.33  ? 502  VAL C C     1 
ATOM   7131  O  O     . VAL C 2  502  ? -32.336 3.437   18.925  1.00 24.47  ? 502  VAL C O     1 
ATOM   7132  C  CB    . VAL C 2  502  ? -32.327 2.219   15.730  1.00 21.39  ? 502  VAL C CB    1 
ATOM   7133  C  CG1   . VAL C 2  502  ? -32.965 3.587   15.614  1.00 24.27  ? 502  VAL C CG1   1 
ATOM   7134  C  CG2   . VAL C 2  502  ? -31.337 2.008   14.602  1.00 20.45  ? 502  VAL C CG2   1 
ATOM   7135  N  N     . TYR C 2  503  ? -33.667 1.708   18.371  1.00 28.65  ? 503  TYR C N     1 
ATOM   7136  C  CA    . TYR C 2  503  ? -34.772 2.104   19.244  1.00 27.43  ? 503  TYR C CA    1 
ATOM   7137  C  C     . TYR C 2  503  ? -34.566 1.773   20.723  1.00 26.76  ? 503  TYR C C     1 
ATOM   7138  O  O     . TYR C 2  503  ? -35.304 2.258   21.578  1.00 24.25  ? 503  TYR C O     1 
ATOM   7139  C  CB    . TYR C 2  503  ? -36.073 1.451   18.759  1.00 32.31  ? 503  TYR C CB    1 
ATOM   7140  C  CG    . TYR C 2  503  ? -36.511 1.894   17.379  1.00 31.57  ? 503  TYR C CG    1 
ATOM   7141  C  CD1   . TYR C 2  503  ? -37.229 3.069   17.203  1.00 35.60  ? 503  TYR C CD1   1 
ATOM   7142  C  CD2   . TYR C 2  503  ? -36.210 1.136   16.254  1.00 29.82  ? 503  TYR C CD2   1 
ATOM   7143  C  CE1   . TYR C 2  503  ? -37.634 3.481   15.948  1.00 35.78  ? 503  TYR C CE1   1 
ATOM   7144  C  CE2   . TYR C 2  503  ? -36.610 1.540   14.992  1.00 30.71  ? 503  TYR C CE2   1 
ATOM   7145  C  CZ    . TYR C 2  503  ? -37.322 2.713   14.845  1.00 33.37  ? 503  TYR C CZ    1 
ATOM   7146  O  OH    . TYR C 2  503  ? -37.723 3.119   13.593  1.00 34.70  ? 503  TYR C OH    1 
ATOM   7147  N  N     . ALA C 2  504  ? -33.566 0.954   21.027  1.00 29.86  ? 504  ALA C N     1 
ATOM   7148  C  CA    . ALA C 2  504  ? -33.368 0.467   22.392  1.00 29.56  ? 504  ALA C CA    1 
ATOM   7149  C  C     . ALA C 2  504  ? -32.903 1.549   23.371  1.00 25.49  ? 504  ALA C C     1 
ATOM   7150  O  O     . ALA C 2  504  ? -32.409 2.602   22.973  1.00 24.21  ? 504  ALA C O     1 
ATOM   7151  C  CB    . ALA C 2  504  ? -32.377 -0.686  22.392  1.00 29.30  ? 504  ALA C CB    1 
ATOM   7152  N  N     . ARG C 2  505  ? -33.071 1.271   24.659  1.00 25.98  ? 505  ARG C N     1 
ATOM   7153  C  CA    . ARG C 2  505  ? -32.601 2.158   25.715  1.00 25.65  ? 505  ARG C CA    1 
ATOM   7154  C  C     . ARG C 2  505  ? -32.152 1.334   26.909  1.00 30.40  ? 505  ARG C C     1 
ATOM   7155  O  O     . ARG C 2  505  ? -32.401 0.128   26.967  1.00 33.74  ? 505  ARG C O     1 
ATOM   7156  C  CB    . ARG C 2  505  ? -33.694 3.126   26.145  1.00 31.85  ? 505  ARG C CB    1 
ATOM   7157  C  CG    . ARG C 2  505  ? -34.738 2.467   27.014  1.00 37.66  ? 505  ARG C CG    1 
ATOM   7158  C  CD    . ARG C 2  505  ? -35.772 3.452   27.503  1.00 42.00  ? 505  ARG C CD    1 
ATOM   7159  N  NE    . ARG C 2  505  ? -36.657 2.830   28.480  1.00 43.99  ? 505  ARG C NE    1 
ATOM   7160  C  CZ    . ARG C 2  505  ? -37.709 3.432   29.021  1.00 54.96  ? 505  ARG C CZ    1 
ATOM   7161  N  NH1   . ARG C 2  505  ? -38.012 4.675   28.673  1.00 57.65  ? 505  ARG C NH1   1 
ATOM   7162  N  NH2   . ARG C 2  505  ? -38.462 2.788   29.904  1.00 56.37  ? 505  ARG C NH2   1 
ATOM   7163  N  N     . VAL C 2  506  ? -31.507 1.982   27.870  1.00 29.38  ? 506  VAL C N     1 
ATOM   7164  C  CA    . VAL C 2  506  ? -31.006 1.266   29.030  1.00 25.62  ? 506  VAL C CA    1 
ATOM   7165  C  C     . VAL C 2  506  ? -31.852 1.548   30.254  1.00 33.57  ? 506  VAL C C     1 
ATOM   7166  O  O     . VAL C 2  506  ? -32.181 2.696   30.544  1.00 43.17  ? 506  VAL C O     1 
ATOM   7167  C  CB    . VAL C 2  506  ? -29.558 1.631   29.341  1.00 25.46  ? 506  VAL C CB    1 
ATOM   7168  C  CG1   . VAL C 2  506  ? -28.824 0.406   29.854  1.00 28.45  ? 506  VAL C CG1   1 
ATOM   7169  C  CG2   . VAL C 2  506  ? -28.877 2.198   28.102  1.00 27.13  ? 506  VAL C CG2   1 
ATOM   7170  N  N     . ASN C 2  507  ? -32.194 0.490   30.975  1.00 34.89  ? 507  ASN C N     1 
ATOM   7171  C  CA    . ASN C 2  507  ? -33.032 0.623   32.153  1.00 45.58  ? 507  ASN C CA    1 
ATOM   7172  C  C     . ASN C 2  507  ? -32.184 0.740   33.415  1.00 42.54  ? 507  ASN C C     1 
ATOM   7173  O  O     . ASN C 2  507  ? -31.047 0.268   33.446  1.00 44.53  ? 507  ASN C O     1 
ATOM   7174  C  CB    . ASN C 2  507  ? -34.002 -0.559  32.245  1.00 47.27  ? 507  ASN C CB    1 
ATOM   7175  C  CG    . ASN C 2  507  ? -33.312 -1.856  32.598  1.00 40.50  ? 507  ASN C CG    1 
ATOM   7176  O  OD1   . ASN C 2  507  ? -32.120 -2.033  32.354  1.00 40.20  ? 507  ASN C OD1   1 
ATOM   7177  N  ND2   . ASN C 2  507  ? -34.068 -2.781  33.176  1.00 45.01  ? 507  ASN C ND2   1 
ATOM   7178  N  N     . PRO C 2  508  ? -32.734 1.374   34.463  1.00 53.12  ? 508  PRO C N     1 
ATOM   7179  C  CA    . PRO C 2  508  ? -32.015 1.645   35.716  1.00 54.36  ? 508  PRO C CA    1 
ATOM   7180  C  C     . PRO C 2  508  ? -31.300 0.453   36.359  1.00 47.30  ? 508  PRO C C     1 
ATOM   7181  O  O     . PRO C 2  508  ? -30.677 0.638   37.403  1.00 52.25  ? 508  PRO C O     1 
ATOM   7182  C  CB    . PRO C 2  508  ? -33.127 2.147   36.637  1.00 63.68  ? 508  PRO C CB    1 
ATOM   7183  C  CG    . PRO C 2  508  ? -34.066 2.840   35.712  1.00 70.46  ? 508  PRO C CG    1 
ATOM   7184  C  CD    . PRO C 2  508  ? -34.063 2.016   34.452  1.00 59.34  ? 508  PRO C CD    1 
ATOM   7185  N  N     . PHE C 2  509  ? -31.375 -0.733  35.764  1.00 41.60  ? 509  PHE C N     1 
ATOM   7186  C  CA    . PHE C 2  509  ? -30.680 -1.887  36.321  1.00 41.70  ? 509  PHE C CA    1 
ATOM   7187  C  C     . PHE C 2  509  ? -29.562 -2.392  35.422  1.00 37.48  ? 509  PHE C C     1 
ATOM   7188  O  O     . PHE C 2  509  ? -28.910 -3.387  35.729  1.00 41.74  ? 509  PHE C O     1 
ATOM   7189  C  CB    . PHE C 2  509  ? -31.670 -3.013  36.611  1.00 50.48  ? 509  PHE C CB    1 
ATOM   7190  C  CG    . PHE C 2  509  ? -32.228 -2.968  37.999  1.00 59.32  ? 509  PHE C CG    1 
ATOM   7191  C  CD1   . PHE C 2  509  ? -33.216 -2.057  38.333  1.00 69.40  ? 509  PHE C CD1   1 
ATOM   7192  C  CD2   . PHE C 2  509  ? -31.750 -3.822  38.978  1.00 65.80  ? 509  PHE C CD2   1 
ATOM   7193  C  CE1   . PHE C 2  509  ? -33.727 -2.005  39.619  1.00 71.49  ? 509  PHE C CE1   1 
ATOM   7194  C  CE2   . PHE C 2  509  ? -32.256 -3.776  40.264  1.00 80.21  ? 509  PHE C CE2   1 
ATOM   7195  C  CZ    . PHE C 2  509  ? -33.246 -2.866  40.585  1.00 80.83  ? 509  PHE C CZ    1 
ATOM   7196  N  N     . GLY C 2  510  ? -29.335 -1.699  34.315  1.00 35.91  ? 510  GLY C N     1 
ATOM   7197  C  CA    . GLY C 2  510  ? -28.230 -2.032  33.437  1.00 38.65  ? 510  GLY C CA    1 
ATOM   7198  C  C     . GLY C 2  510  ? -28.525 -3.108  32.408  1.00 38.90  ? 510  GLY C C     1 
ATOM   7199  O  O     . GLY C 2  510  ? -27.601 -3.736  31.890  1.00 37.61  ? 510  GLY C O     1 
ATOM   7200  N  N     . PHE C 2  511  ? -29.802 -3.331  32.107  1.00 38.17  ? 511  PHE C N     1 
ATOM   7201  C  CA    . PHE C 2  511  ? -30.177 -4.257  31.039  1.00 37.33  ? 511  PHE C CA    1 
ATOM   7202  C  C     . PHE C 2  511  ? -30.676 -3.481  29.826  1.00 37.23  ? 511  PHE C C     1 
ATOM   7203  O  O     . PHE C 2  511  ? -30.843 -2.261  29.884  1.00 34.92  ? 511  PHE C O     1 
ATOM   7204  C  CB    . PHE C 2  511  ? -31.245 -5.246  31.514  1.00 34.51  ? 511  PHE C CB    1 
ATOM   7205  C  CG    . PHE C 2  511  ? -30.840 -6.044  32.720  1.00 38.20  ? 511  PHE C CG    1 
ATOM   7206  C  CD1   . PHE C 2  511  ? -30.165 -7.245  32.582  1.00 42.67  ? 511  PHE C CD1   1 
ATOM   7207  C  CD2   . PHE C 2  511  ? -31.133 -5.590  33.993  1.00 41.18  ? 511  PHE C CD2   1 
ATOM   7208  C  CE1   . PHE C 2  511  ? -29.790 -7.976  33.694  1.00 46.59  ? 511  PHE C CE1   1 
ATOM   7209  C  CE2   . PHE C 2  511  ? -30.764 -6.316  35.106  1.00 45.14  ? 511  PHE C CE2   1 
ATOM   7210  C  CZ    . PHE C 2  511  ? -30.091 -7.510  34.957  1.00 48.91  ? 511  PHE C CZ    1 
ATOM   7211  N  N     . ILE C 2  512  ? -30.912 -4.178  28.721  1.00 31.86  ? 512  ILE C N     1 
ATOM   7212  C  CA    . ILE C 2  512  ? -31.324 -3.487  27.508  1.00 30.97  ? 512  ILE C CA    1 
ATOM   7213  C  C     . ILE C 2  512  ? -32.786 -3.735  27.173  1.00 29.51  ? 512  ILE C C     1 
ATOM   7214  O  O     . ILE C 2  512  ? -33.179 -4.841  26.810  1.00 29.73  ? 512  ILE C O     1 
ATOM   7215  C  CB    . ILE C 2  512  ? -30.462 -3.889  26.308  1.00 29.83  ? 512  ILE C CB    1 
ATOM   7216  C  CG1   . ILE C 2  512  ? -28.980 -3.845  26.679  1.00 26.53  ? 512  ILE C CG1   1 
ATOM   7217  C  CG2   . ILE C 2  512  ? -30.740 -2.964  25.135  1.00 27.92  ? 512  ILE C CG2   1 
ATOM   7218  C  CD1   . ILE C 2  512  ? -28.055 -4.010  25.493  1.00 27.45  ? 512  ILE C CD1   1 
ATOM   7219  N  N     . GLU C 2  513  ? -33.589 -2.687  27.303  1.00 29.11  ? 513  GLU C N     1 
ATOM   7220  C  CA    . GLU C 2  513  ? -34.998 -2.765  26.964  1.00 32.35  ? 513  GLU C CA    1 
ATOM   7221  C  C     . GLU C 2  513  ? -35.198 -2.378  25.509  1.00 40.61  ? 513  GLU C C     1 
ATOM   7222  O  O     . GLU C 2  513  ? -34.284 -1.858  24.868  1.00 41.37  ? 513  GLU C O     1 
ATOM   7223  C  CB    . GLU C 2  513  ? -35.828 -1.866  27.882  1.00 36.27  ? 513  GLU C CB    1 
ATOM   7224  C  CG    . GLU C 2  513  ? -35.941 -2.384  29.307  1.00 42.42  ? 513  GLU C CG    1 
ATOM   7225  C  CD    . GLU C 2  513  ? -36.889 -1.561  30.161  1.00 53.20  ? 513  GLU C CD    1 
ATOM   7226  O  OE1   . GLU C 2  513  ? -37.194 -0.413  29.777  1.00 52.34  ? 513  GLU C OE1   1 
ATOM   7227  O  OE2   . GLU C 2  513  ? -37.331 -2.066  31.216  1.00 55.26  ? 513  GLU C OE2   1 
ATOM   7228  N  N     . THR C 2  514  ? -36.390 -2.638  24.988  1.00 46.25  ? 514  THR C N     1 
ATOM   7229  C  CA    . THR C 2  514  ? -36.692 -2.306  23.603  1.00 41.12  ? 514  THR C CA    1 
ATOM   7230  C  C     . THR C 2  514  ? -38.197 -2.121  23.426  1.00 39.05  ? 514  THR C C     1 
ATOM   7231  O  O     . THR C 2  514  ? -38.992 -2.774  24.103  1.00 37.69  ? 514  THR C O     1 
ATOM   7232  C  CB    . THR C 2  514  ? -36.152 -3.390  22.639  1.00 38.47  ? 514  THR C CB    1 
ATOM   7233  O  OG1   . THR C 2  514  ? -36.439 -3.026  21.283  1.00 42.32  ? 514  THR C OG1   1 
ATOM   7234  C  CG2   . THR C 2  514  ? -36.762 -4.750  22.948  1.00 42.65  ? 514  THR C CG2   1 
ATOM   7235  N  N     . PRO C 2  515  ? -38.593 -1.202  22.531  1.00 40.20  ? 515  PRO C N     1 
ATOM   7236  C  CA    . PRO C 2  515  ? -40.015 -0.880  22.385  1.00 42.13  ? 515  PRO C CA    1 
ATOM   7237  C  C     . PRO C 2  515  ? -40.790 -1.887  21.541  1.00 42.04  ? 515  PRO C C     1 
ATOM   7238  O  O     . PRO C 2  515  ? -40.327 -2.316  20.484  1.00 40.77  ? 515  PRO C O     1 
ATOM   7239  C  CB    . PRO C 2  515  ? -39.986 0.487   21.701  1.00 41.25  ? 515  PRO C CB    1 
ATOM   7240  C  CG    . PRO C 2  515  ? -38.744 0.457   20.894  1.00 40.52  ? 515  PRO C CG    1 
ATOM   7241  C  CD    . PRO C 2  515  ? -37.746 -0.325  21.701  1.00 39.51  ? 515  PRO C CD    1 
ATOM   7242  N  N     . TYR C 2  516  ? -41.969 -2.254  22.030  1.00 40.62  ? 516  TYR C N     1 
ATOM   7243  C  CA    . TYR C 2  516  ? -42.888 -3.128  21.312  1.00 45.69  ? 516  TYR C CA    1 
ATOM   7244  C  C     . TYR C 2  516  ? -44.287 -2.520  21.356  1.00 52.76  ? 516  TYR C C     1 
ATOM   7245  O  O     . TYR C 2  516  ? -44.647 -1.856  22.330  1.00 49.77  ? 516  TYR C O     1 
ATOM   7246  C  CB    . TYR C 2  516  ? -42.900 -4.534  21.922  1.00 47.71  ? 516  TYR C CB    1 
ATOM   7247  C  CG    . TYR C 2  516  ? -41.637 -5.339  21.693  1.00 43.00  ? 516  TYR C CG    1 
ATOM   7248  C  CD1   . TYR C 2  516  ? -41.072 -5.439  20.430  1.00 46.49  ? 516  TYR C CD1   1 
ATOM   7249  C  CD2   . TYR C 2  516  ? -41.011 -5.999  22.744  1.00 44.41  ? 516  TYR C CD2   1 
ATOM   7250  C  CE1   . TYR C 2  516  ? -39.919 -6.175  20.218  1.00 47.26  ? 516  TYR C CE1   1 
ATOM   7251  C  CE2   . TYR C 2  516  ? -39.858 -6.736  22.543  1.00 42.51  ? 516  TYR C CE2   1 
ATOM   7252  C  CZ    . TYR C 2  516  ? -39.316 -6.820  21.277  1.00 43.75  ? 516  TYR C CZ    1 
ATOM   7253  O  OH    . TYR C 2  516  ? -38.170 -7.550  21.067  1.00 40.51  ? 516  TYR C OH    1 
ATOM   7254  N  N     . ARG C 2  517  ? -45.073 -2.736  20.304  1.00 56.45  ? 517  ARG C N     1 
ATOM   7255  C  CA    . ARG C 2  517  ? -46.450 -2.253  20.288  1.00 55.84  ? 517  ARG C CA    1 
ATOM   7256  C  C     . ARG C 2  517  ? -47.377 -3.245  20.978  1.00 63.03  ? 517  ARG C C     1 
ATOM   7257  O  O     . ARG C 2  517  ? -47.268 -4.454  20.782  1.00 61.95  ? 517  ARG C O     1 
ATOM   7258  C  CB    . ARG C 2  517  ? -46.925 -1.989  18.859  1.00 53.98  ? 517  ARG C CB    1 
ATOM   7259  C  CG    . ARG C 2  517  ? -46.719 -0.557  18.413  1.00 54.23  ? 517  ARG C CG    1 
ATOM   7260  C  CD    . ARG C 2  517  ? -47.641 -0.190  17.267  1.00 54.94  ? 517  ARG C CD    1 
ATOM   7261  N  NE    . ARG C 2  517  ? -47.163 -0.698  15.987  1.00 62.54  ? 517  ARG C NE    1 
ATOM   7262  C  CZ    . ARG C 2  517  ? -47.715 -0.392  14.819  1.00 72.88  ? 517  ARG C CZ    1 
ATOM   7263  N  NH1   . ARG C 2  517  ? -48.764 0.420   14.778  1.00 75.74  ? 517  ARG C NH1   1 
ATOM   7264  N  NH2   . ARG C 2  517  ? -47.219 -0.892  13.694  1.00 75.69  ? 517  ARG C NH2   1 
ATOM   7265  N  N     . LYS C 2  518  ? -48.291 -2.719  21.786  1.00 64.12  ? 518  LYS C N     1 
ATOM   7266  C  CA    . LYS C 2  518  ? -49.179 -3.548  22.589  1.00 64.70  ? 518  LYS C CA    1 
ATOM   7267  C  C     . LYS C 2  518  ? -50.432 -3.955  21.823  1.00 72.11  ? 518  LYS C C     1 
ATOM   7268  O  O     . LYS C 2  518  ? -51.106 -3.121  21.221  1.00 74.97  ? 518  LYS C O     1 
ATOM   7269  C  CB    . LYS C 2  518  ? -49.568 -2.810  23.870  1.00 64.54  ? 518  LYS C CB    1 
ATOM   7270  C  CG    . LYS C 2  518  ? -50.357 -3.644  24.861  1.00 66.09  ? 518  LYS C CG    1 
ATOM   7271  C  CD    . LYS C 2  518  ? -50.626 -2.851  26.129  1.00 72.93  ? 518  LYS C CD    1 
ATOM   7272  C  CE    . LYS C 2  518  ? -51.332 -3.690  27.183  1.00 84.16  ? 518  LYS C CE    1 
ATOM   7273  N  NZ    . LYS C 2  518  ? -51.551 -2.925  28.448  1.00 78.31  ? 518  LYS C NZ    1 
ATOM   7274  N  N     . VAL C 2  519  ? -50.741 -5.245  21.847  1.00 75.18  ? 519  VAL C N     1 
ATOM   7275  C  CA    . VAL C 2  519  ? -51.953 -5.738  21.210  1.00 78.96  ? 519  VAL C CA    1 
ATOM   7276  C  C     . VAL C 2  519  ? -52.896 -6.310  22.260  1.00 82.71  ? 519  VAL C C     1 
ATOM   7277  O  O     . VAL C 2  519  ? -52.589 -7.311  22.909  1.00 77.90  ? 519  VAL C O     1 
ATOM   7278  C  CB    . VAL C 2  519  ? -51.642 -6.802  20.146  1.00 77.70  ? 519  VAL C CB    1 
ATOM   7279  C  CG1   . VAL C 2  519  ? -52.923 -7.448  19.649  1.00 87.52  ? 519  VAL C CG1   1 
ATOM   7280  C  CG2   . VAL C 2  519  ? -50.871 -6.178  18.992  1.00 74.46  ? 519  VAL C CG2   1 
ATOM   7281  N  N     . VAL C 2  520  ? -54.040 -5.653  22.427  1.00 85.75  ? 520  VAL C N     1 
ATOM   7282  C  CA    . VAL C 2  520  ? -55.022 -6.053  23.424  1.00 92.53  ? 520  VAL C CA    1 
ATOM   7283  C  C     . VAL C 2  520  ? -55.652 -7.391  23.050  1.00 99.04  ? 520  VAL C C     1 
ATOM   7284  O  O     . VAL C 2  520  ? -55.434 -8.398  23.722  1.00 107.44 ? 520  VAL C O     1 
ATOM   7285  C  CB    . VAL C 2  520  ? -56.123 -4.990  23.586  1.00 85.28  ? 520  VAL C CB    1 
ATOM   7286  C  CG1   . VAL C 2  520  ? -57.093 -5.404  24.677  1.00 92.33  ? 520  VAL C CG1   1 
ATOM   7287  C  CG2   . VAL C 2  520  ? -55.508 -3.629  23.895  1.00 80.21  ? 520  VAL C CG2   1 
ATOM   7288  N  N     . ASP C 2  521  ? -56.425 -7.394  21.969  1.00 93.52  ? 521  ASP C N     1 
ATOM   7289  C  CA    . ASP C 2  521  ? -57.042 -8.615  21.463  1.00 88.83  ? 521  ASP C CA    1 
ATOM   7290  C  C     . ASP C 2  521  ? -57.139 -8.580  19.948  1.00 81.94  ? 521  ASP C C     1 
ATOM   7291  O  O     . ASP C 2  521  ? -58.197 -8.297  19.389  1.00 77.30  ? 521  ASP C O     1 
ATOM   7292  C  CB    . ASP C 2  521  ? -58.430 -8.815  22.070  1.00 94.99  ? 521  ASP C CB    1 
ATOM   7293  C  CG    . ASP C 2  521  ? -58.382 -9.519  23.409  1.00 102.29 ? 521  ASP C CG    1 
ATOM   7294  O  OD1   . ASP C 2  521  ? -57.541 -10.427 23.570  1.00 110.65 ? 521  ASP C OD1   1 
ATOM   7295  O  OD2   . ASP C 2  521  ? -59.183 -9.165  24.299  1.00 101.64 ? 521  ASP C OD2   1 
ATOM   7296  N  N     . GLY C 2  522  ? -56.022 -8.862  19.288  1.00 91.16  ? 522  GLY C N     1 
ATOM   7297  C  CA    . GLY C 2  522  ? -55.966 -8.823  17.841  1.00 89.87  ? 522  GLY C CA    1 
ATOM   7298  C  C     . GLY C 2  522  ? -55.881 -7.408  17.307  1.00 91.33  ? 522  GLY C C     1 
ATOM   7299  O  O     . GLY C 2  522  ? -55.719 -7.209  16.107  1.00 93.41  ? 522  GLY C O     1 
ATOM   7300  N  N     . VAL C 2  523  ? -55.979 -6.423  18.196  1.00 89.04  ? 523  VAL C N     1 
ATOM   7301  C  CA    . VAL C 2  523  ? -56.000 -5.024  17.781  1.00 85.00  ? 523  VAL C CA    1 
ATOM   7302  C  C     . VAL C 2  523  ? -54.752 -4.272  18.228  1.00 84.33  ? 523  VAL C C     1 
ATOM   7303  O  O     . VAL C 2  523  ? -54.454 -4.192  19.420  1.00 82.62  ? 523  VAL C O     1 
ATOM   7304  C  CB    . VAL C 2  523  ? -57.231 -4.293  18.331  1.00 87.11  ? 523  VAL C CB    1 
ATOM   7305  C  CG1   . VAL C 2  523  ? -57.440 -2.982  17.584  1.00 82.56  ? 523  VAL C CG1   1 
ATOM   7306  C  CG2   . VAL C 2  523  ? -58.464 -5.182  18.230  1.00 93.25  ? 523  VAL C CG2   1 
ATOM   7307  N  N     . VAL C 2  524  ? -54.029 -3.714  17.263  1.00 81.33  ? 524  VAL C N     1 
ATOM   7308  C  CA    . VAL C 2  524  ? -52.802 -2.992  17.559  1.00 76.05  ? 524  VAL C CA    1 
ATOM   7309  C  C     . VAL C 2  524  ? -53.128 -1.708  18.301  1.00 76.88  ? 524  VAL C C     1 
ATOM   7310  O  O     . VAL C 2  524  ? -54.006 -0.951  17.893  1.00 86.88  ? 524  VAL C O     1 
ATOM   7311  C  CB    . VAL C 2  524  ? -52.010 -2.672  16.278  1.00 78.71  ? 524  VAL C CB    1 
ATOM   7312  C  CG1   . VAL C 2  524  ? -50.781 -1.833  16.601  1.00 72.86  ? 524  VAL C CG1   1 
ATOM   7313  C  CG2   . VAL C 2  524  ? -51.617 -3.959  15.573  1.00 78.81  ? 524  VAL C CG2   1 
ATOM   7314  N  N     . SER C 2  525  ? -52.431 -1.484  19.407  1.00 69.79  ? 525  SER C N     1 
ATOM   7315  C  CA    . SER C 2  525  ? -52.599 -0.267  20.181  1.00 73.46  ? 525  SER C CA    1 
ATOM   7316  C  C     . SER C 2  525  ? -51.342 0.586   20.120  1.00 76.25  ? 525  SER C C     1 
ATOM   7317  O  O     . SER C 2  525  ? -50.229 0.064   20.127  1.00 87.59  ? 525  SER C O     1 
ATOM   7318  C  CB    . SER C 2  525  ? -52.935 -0.596  21.634  1.00 82.31  ? 525  SER C CB    1 
ATOM   7319  O  OG    . SER C 2  525  ? -53.085 0.589   22.396  1.00 99.51  ? 525  SER C OG    1 
ATOM   7320  N  N     . ASP C 2  526  ? -51.525 1.901   20.072  1.00 69.99  ? 526  ASP C N     1 
ATOM   7321  C  CA    . ASP C 2  526  ? -50.401 2.830   20.042  1.00 75.50  ? 526  ASP C CA    1 
ATOM   7322  C  C     . ASP C 2  526  ? -49.657 2.896   21.380  1.00 73.42  ? 526  ASP C C     1 
ATOM   7323  O  O     . ASP C 2  526  ? -48.587 3.498   21.465  1.00 80.76  ? 526  ASP C O     1 
ATOM   7324  C  CB    . ASP C 2  526  ? -50.879 4.229   19.645  1.00 87.57  ? 526  ASP C CB    1 
ATOM   7325  C  CG    . ASP C 2  526  ? -51.066 4.381   18.143  1.00 88.24  ? 526  ASP C CG    1 
ATOM   7326  O  OD1   . ASP C 2  526  ? -51.151 3.351   17.441  1.00 84.49  ? 526  ASP C OD1   1 
ATOM   7327  O  OD2   . ASP C 2  526  ? -51.127 5.534   17.663  1.00 94.55  ? 526  ASP C OD2   1 
ATOM   7328  N  N     . GLU C 2  527  ? -50.221 2.287   22.422  1.00 69.02  ? 527  GLU C N     1 
ATOM   7329  C  CA    . GLU C 2  527  ? -49.562 2.237   23.727  1.00 67.26  ? 527  GLU C CA    1 
ATOM   7330  C  C     . GLU C 2  527  ? -48.307 1.374   23.642  1.00 69.47  ? 527  GLU C C     1 
ATOM   7331  O  O     . GLU C 2  527  ? -48.373 0.221   23.218  1.00 73.13  ? 527  GLU C O     1 
ATOM   7332  C  CB    . GLU C 2  527  ? -50.514 1.695   24.798  1.00 73.54  ? 527  GLU C CB    1 
ATOM   7333  C  CG    . GLU C 2  527  ? -49.842 1.335   26.122  1.00 83.06  ? 527  GLU C CG    1 
ATOM   7334  C  CD    . GLU C 2  527  ? -50.821 0.801   27.159  1.00 86.08  ? 527  GLU C CD    1 
ATOM   7335  O  OE1   . GLU C 2  527  ? -52.025 1.119   27.063  1.00 99.22  ? 527  GLU C OE1   1 
ATOM   7336  O  OE2   . GLU C 2  527  ? -50.388 0.060   28.069  1.00 74.77  ? 527  GLU C OE2   1 
ATOM   7337  N  N     . ILE C 2  528  ? -47.166 1.931   24.043  1.00 69.70  ? 528  ILE C N     1 
ATOM   7338  C  CA    . ILE C 2  528  ? -45.885 1.241   23.904  1.00 61.48  ? 528  ILE C CA    1 
ATOM   7339  C  C     . ILE C 2  528  ? -45.252 0.922   25.257  1.00 51.31  ? 528  ILE C C     1 
ATOM   7340  O  O     . ILE C 2  528  ? -45.203 1.772   26.145  1.00 50.94  ? 528  ILE C O     1 
ATOM   7341  C  CB    . ILE C 2  528  ? -44.891 2.077   23.063  1.00 56.85  ? 528  ILE C CB    1 
ATOM   7342  C  CG1   . ILE C 2  528  ? -45.482 2.373   21.683  1.00 60.11  ? 528  ILE C CG1   1 
ATOM   7343  C  CG2   . ILE C 2  528  ? -43.563 1.352   22.927  1.00 53.64  ? 528  ILE C CG2   1 
ATOM   7344  C  CD1   . ILE C 2  528  ? -44.604 3.230   20.810  1.00 46.52  ? 528  ILE C CD1   1 
ATOM   7345  N  N     . VAL C 2  529  ? -44.778 -0.310  25.416  1.00 46.19  ? 529  VAL C N     1 
ATOM   7346  C  CA    . VAL C 2  529  ? -44.078 -0.699  26.633  1.00 50.11  ? 529  VAL C CA    1 
ATOM   7347  C  C     . VAL C 2  529  ? -42.703 -1.269  26.280  1.00 53.96  ? 529  VAL C C     1 
ATOM   7348  O  O     . VAL C 2  529  ? -42.553 -1.988  25.288  1.00 49.97  ? 529  VAL C O     1 
ATOM   7349  C  CB    . VAL C 2  529  ? -44.898 -1.724  27.457  1.00 51.24  ? 529  VAL C CB    1 
ATOM   7350  C  CG1   . VAL C 2  529  ? -45.281 -2.923  26.604  1.00 49.57  ? 529  VAL C CG1   1 
ATOM   7351  C  CG2   . VAL C 2  529  ? -44.141 -2.159  28.708  1.00 53.79  ? 529  VAL C CG2   1 
ATOM   7352  N  N     . TYR C 2  530  ? -41.695 -0.913  27.072  1.00 53.96  ? 530  TYR C N     1 
ATOM   7353  C  CA    . TYR C 2  530  ? -40.346 -1.426  26.875  1.00 41.34  ? 530  TYR C CA    1 
ATOM   7354  C  C     . TYR C 2  530  ? -40.188 -2.730  27.638  1.00 40.69  ? 530  TYR C C     1 
ATOM   7355  O  O     . TYR C 2  530  ? -40.576 -2.830  28.802  1.00 37.85  ? 530  TYR C O     1 
ATOM   7356  C  CB    . TYR C 2  530  ? -39.294 -0.410  27.330  1.00 45.36  ? 530  TYR C CB    1 
ATOM   7357  C  CG    . TYR C 2  530  ? -39.134 0.794   26.419  1.00 48.86  ? 530  TYR C CG    1 
ATOM   7358  C  CD1   . TYR C 2  530  ? -39.672 2.029   26.762  1.00 47.94  ? 530  TYR C CD1   1 
ATOM   7359  C  CD2   . TYR C 2  530  ? -38.438 0.698   25.220  1.00 44.48  ? 530  TYR C CD2   1 
ATOM   7360  C  CE1   . TYR C 2  530  ? -39.523 3.132   25.936  1.00 41.64  ? 530  TYR C CE1   1 
ATOM   7361  C  CE2   . TYR C 2  530  ? -38.285 1.796   24.388  1.00 36.43  ? 530  TYR C CE2   1 
ATOM   7362  C  CZ    . TYR C 2  530  ? -38.830 3.008   24.750  1.00 33.97  ? 530  TYR C CZ    1 
ATOM   7363  O  OH    . TYR C 2  530  ? -38.680 4.098   23.925  1.00 27.47  ? 530  TYR C OH    1 
ATOM   7364  N  N     . LEU C 2  531  ? -39.627 -3.732  26.973  1.00 39.42  ? 531  LEU C N     1 
ATOM   7365  C  CA    . LEU C 2  531  ? -39.445 -5.040  27.584  1.00 39.53  ? 531  LEU C CA    1 
ATOM   7366  C  C     . LEU C 2  531  ? -37.975 -5.419  27.657  1.00 41.54  ? 531  LEU C C     1 
ATOM   7367  O  O     . LEU C 2  531  ? -37.208 -5.161  26.730  1.00 39.21  ? 531  LEU C O     1 
ATOM   7368  C  CB    . LEU C 2  531  ? -40.211 -6.116  26.810  1.00 39.60  ? 531  LEU C CB    1 
ATOM   7369  C  CG    . LEU C 2  531  ? -41.737 -6.156  26.906  1.00 44.57  ? 531  LEU C CG    1 
ATOM   7370  C  CD1   . LEU C 2  531  ? -42.393 -5.164  25.959  1.00 50.55  ? 531  LEU C CD1   1 
ATOM   7371  C  CD2   . LEU C 2  531  ? -42.229 -7.563  26.630  1.00 55.79  ? 531  LEU C CD2   1 
ATOM   7372  N  N     . THR C 2  532  ? -37.587 -6.037  28.766  1.00 42.00  ? 532  THR C N     1 
ATOM   7373  C  CA    . THR C 2  532  ? -36.242 -6.572  28.888  1.00 42.89  ? 532  THR C CA    1 
ATOM   7374  C  C     . THR C 2  532  ? -36.174 -7.887  28.124  1.00 45.32  ? 532  THR C C     1 
ATOM   7375  O  O     . THR C 2  532  ? -37.177 -8.347  27.577  1.00 52.78  ? 532  THR C O     1 
ATOM   7376  C  CB    . THR C 2  532  ? -35.839 -6.790  30.352  1.00 43.44  ? 532  THR C CB    1 
ATOM   7377  O  OG1   . THR C 2  532  ? -36.400 -8.019  30.828  1.00 41.98  ? 532  THR C OG1   1 
ATOM   7378  C  CG2   . THR C 2  532  ? -36.331 -5.635  31.213  1.00 46.39  ? 532  THR C CG2   1 
ATOM   7379  N  N     . ALA C 2  533  ? -34.993 -8.492  28.085  1.00 47.45  ? 533  ALA C N     1 
ATOM   7380  C  CA    . ALA C 2  533  ? -34.780 -9.692  27.282  1.00 47.12  ? 533  ALA C CA    1 
ATOM   7381  C  C     . ALA C 2  533  ? -35.579 -10.891 27.785  1.00 51.16  ? 533  ALA C C     1 
ATOM   7382  O  O     . ALA C 2  533  ? -36.252 -11.563 27.003  1.00 51.06  ? 533  ALA C O     1 
ATOM   7383  C  CB    . ALA C 2  533  ? -33.308 -10.032 27.238  1.00 52.08  ? 533  ALA C CB    1 
ATOM   7384  N  N     . ASP C 2  534  ? -35.500 -11.159 29.085  1.00 50.70  ? 534  ASP C N     1 
ATOM   7385  C  CA    . ASP C 2  534  ? -36.184 -12.311 29.668  1.00 55.60  ? 534  ASP C CA    1 
ATOM   7386  C  C     . ASP C 2  534  ? -37.687 -12.080 29.772  1.00 55.60  ? 534  ASP C C     1 
ATOM   7387  O  O     . ASP C 2  534  ? -38.472 -13.030 29.755  1.00 55.09  ? 534  ASP C O     1 
ATOM   7388  C  CB    . ASP C 2  534  ? -35.607 -12.643 31.046  1.00 53.04  ? 534  ASP C CB    1 
ATOM   7389  C  CG    . ASP C 2  534  ? -35.392 -11.412 31.901  1.00 53.60  ? 534  ASP C CG    1 
ATOM   7390  O  OD1   . ASP C 2  534  ? -35.934 -10.341 31.555  1.00 48.24  ? 534  ASP C OD1   1 
ATOM   7391  O  OD2   . ASP C 2  534  ? -34.681 -11.520 32.922  1.00 60.12  ? 534  ASP C OD2   1 
ATOM   7392  N  N     . GLU C 2  535  ? -38.085 -10.817 29.884  1.00 53.70  ? 535  GLU C N     1 
ATOM   7393  C  CA    . GLU C 2  535  ? -39.500 -10.472 29.922  1.00 52.40  ? 535  GLU C CA    1 
ATOM   7394  C  C     . GLU C 2  535  ? -40.154 -10.813 28.594  1.00 46.31  ? 535  GLU C C     1 
ATOM   7395  O  O     . GLU C 2  535  ? -41.262 -11.347 28.554  1.00 52.35  ? 535  GLU C O     1 
ATOM   7396  C  CB    . GLU C 2  535  ? -39.692 -8.991  30.241  1.00 50.72  ? 535  GLU C CB    1 
ATOM   7397  C  CG    . GLU C 2  535  ? -39.376 -8.627  31.675  1.00 51.59  ? 535  GLU C CG    1 
ATOM   7398  C  CD    . GLU C 2  535  ? -39.452 -7.136  31.920  1.00 56.53  ? 535  GLU C CD    1 
ATOM   7399  O  OE1   . GLU C 2  535  ? -39.831 -6.398  30.985  1.00 53.23  ? 535  GLU C OE1   1 
ATOM   7400  O  OE2   . GLU C 2  535  ? -39.129 -6.701  33.046  1.00 67.05  ? 535  GLU C OE2   1 
ATOM   7401  N  N     . GLU C 2  536  ? -39.454 -10.507 27.509  1.00 43.41  ? 536  GLU C N     1 
ATOM   7402  C  CA    . GLU C 2  536  ? -39.947 -10.809 26.174  1.00 46.86  ? 536  GLU C CA    1 
ATOM   7403  C  C     . GLU C 2  536  ? -40.158 -12.311 25.989  1.00 54.64  ? 536  GLU C C     1 
ATOM   7404  O  O     . GLU C 2  536  ? -41.084 -12.735 25.297  1.00 60.20  ? 536  GLU C O     1 
ATOM   7405  C  CB    . GLU C 2  536  ? -38.982 -10.272 25.115  1.00 48.45  ? 536  GLU C CB    1 
ATOM   7406  C  CG    . GLU C 2  536  ? -39.377 -10.605 23.685  1.00 52.80  ? 536  GLU C CG    1 
ATOM   7407  C  CD    . GLU C 2  536  ? -38.384 -10.070 22.677  1.00 46.90  ? 536  GLU C CD    1 
ATOM   7408  O  OE1   . GLU C 2  536  ? -37.748 -9.040  22.976  1.00 49.66  ? 536  GLU C OE1   1 
ATOM   7409  O  OE2   . GLU C 2  536  ? -38.231 -10.676 21.594  1.00 39.14  ? 536  GLU C OE2   1 
ATOM   7410  N  N     . ASP C 2  537  ? -39.305 -13.112 26.621  1.00 57.14  ? 537  ASP C N     1 
ATOM   7411  C  CA    . ASP C 2  537  ? -39.394 -14.565 26.501  1.00 58.80  ? 537  ASP C CA    1 
ATOM   7412  C  C     . ASP C 2  537  ? -40.730 -15.099 26.994  1.00 59.99  ? 537  ASP C C     1 
ATOM   7413  O  O     . ASP C 2  537  ? -41.285 -16.032 26.414  1.00 63.67  ? 537  ASP C O     1 
ATOM   7414  C  CB    . ASP C 2  537  ? -38.255 -15.239 27.266  1.00 57.12  ? 537  ASP C CB    1 
ATOM   7415  C  CG    . ASP C 2  537  ? -36.969 -15.282 26.469  1.00 63.86  ? 537  ASP C CG    1 
ATOM   7416  O  OD1   . ASP C 2  537  ? -36.818 -14.453 25.546  1.00 67.73  ? 537  ASP C OD1   1 
ATOM   7417  O  OD2   . ASP C 2  537  ? -36.113 -16.145 26.759  1.00 65.06  ? 537  ASP C OD2   1 
ATOM   7418  N  N     . ARG C 2  538  ? -41.247 -14.499 28.061  1.00 61.46  ? 538  ARG C N     1 
ATOM   7419  C  CA    . ARG C 2  538  ? -42.511 -14.935 28.639  1.00 62.46  ? 538  ARG C CA    1 
ATOM   7420  C  C     . ARG C 2  538  ? -43.692 -14.533 27.770  1.00 63.96  ? 538  ARG C C     1 
ATOM   7421  O  O     . ARG C 2  538  ? -44.811 -14.996 27.982  1.00 75.94  ? 538  ARG C O     1 
ATOM   7422  C  CB    . ARG C 2  538  ? -42.689 -14.367 30.046  1.00 58.49  ? 538  ARG C CB    1 
ATOM   7423  C  CG    . ARG C 2  538  ? -41.799 -15.010 31.086  1.00 59.94  ? 538  ARG C CG    1 
ATOM   7424  C  CD    . ARG C 2  538  ? -42.247 -14.654 32.491  1.00 57.02  ? 538  ARG C CD    1 
ATOM   7425  N  NE    . ARG C 2  538  ? -42.131 -13.225 32.769  1.00 57.19  ? 538  ARG C NE    1 
ATOM   7426  C  CZ    . ARG C 2  538  ? -43.148 -12.370 32.738  1.00 61.91  ? 538  ARG C CZ    1 
ATOM   7427  N  NH1   . ARG C 2  538  ? -42.945 -11.088 33.009  1.00 65.60  ? 538  ARG C NH1   1 
ATOM   7428  N  NH2   . ARG C 2  538  ? -44.368 -12.795 32.438  1.00 64.48  ? 538  ARG C NH2   1 
ATOM   7429  N  N     . HIS C 2  539  ? -43.445 -13.668 26.794  1.00 54.66  ? 539  HIS C N     1 
ATOM   7430  C  CA    . HIS C 2  539  ? -44.512 -13.221 25.913  1.00 57.15  ? 539  HIS C CA    1 
ATOM   7431  C  C     . HIS C 2  539  ? -44.300 -13.684 24.474  1.00 64.59  ? 539  HIS C C     1 
ATOM   7432  O  O     . HIS C 2  539  ? -43.356 -14.413 24.174  1.00 67.46  ? 539  HIS C O     1 
ATOM   7433  C  CB    . HIS C 2  539  ? -44.642 -11.700 25.972  1.00 59.21  ? 539  HIS C CB    1 
ATOM   7434  C  CG    . HIS C 2  539  ? -45.348 -11.206 27.195  1.00 60.50  ? 539  HIS C CG    1 
ATOM   7435  N  ND1   . HIS C 2  539  ? -46.700 -10.939 27.215  1.00 69.58  ? 539  HIS C ND1   1 
ATOM   7436  C  CD2   . HIS C 2  539  ? -44.895 -10.943 28.444  1.00 62.23  ? 539  HIS C CD2   1 
ATOM   7437  C  CE1   . HIS C 2  539  ? -47.048 -10.525 28.420  1.00 72.60  ? 539  HIS C CE1   1 
ATOM   7438  N  NE2   . HIS C 2  539  ? -45.971 -10.518 29.185  1.00 69.32  ? 539  HIS C NE2   1 
ATOM   7439  N  N     . VAL C 2  540  ? -45.194 -13.251 23.591  1.00 62.34  ? 540  VAL C N     1 
ATOM   7440  C  CA    . VAL C 2  540  ? -45.218 -13.708 22.209  1.00 57.89  ? 540  VAL C CA    1 
ATOM   7441  C  C     . VAL C 2  540  ? -45.357 -12.509 21.265  1.00 55.83  ? 540  VAL C C     1 
ATOM   7442  O  O     . VAL C 2  540  ? -46.322 -11.750 21.350  1.00 66.57  ? 540  VAL C O     1 
ATOM   7443  C  CB    . VAL C 2  540  ? -46.370 -14.726 22.002  1.00 58.68  ? 540  VAL C CB    1 
ATOM   7444  C  CG1   . VAL C 2  540  ? -46.890 -14.709 20.576  1.00 63.65  ? 540  VAL C CG1   1 
ATOM   7445  C  CG2   . VAL C 2  540  ? -45.929 -16.124 22.422  1.00 63.47  ? 540  VAL C CG2   1 
ATOM   7446  N  N     . VAL C 2  541  ? -44.379 -12.334 20.379  1.00 49.81  ? 541  VAL C N     1 
ATOM   7447  C  CA    . VAL C 2  541  ? -44.294 -11.129 19.554  1.00 50.41  ? 541  VAL C CA    1 
ATOM   7448  C  C     . VAL C 2  541  ? -44.552 -11.382 18.073  1.00 58.33  ? 541  VAL C C     1 
ATOM   7449  O  O     . VAL C 2  541  ? -43.985 -12.301 17.485  1.00 64.58  ? 541  VAL C O     1 
ATOM   7450  C  CB    . VAL C 2  541  ? -42.913 -10.471 19.678  1.00 50.64  ? 541  VAL C CB    1 
ATOM   7451  C  CG1   . VAL C 2  541  ? -42.894 -9.137  18.947  1.00 50.58  ? 541  VAL C CG1   1 
ATOM   7452  C  CG2   . VAL C 2  541  ? -42.539 -10.298 21.141  1.00 54.32  ? 541  VAL C CG2   1 
ATOM   7453  N  N     . ALA C 2  542  ? -45.397 -10.552 17.471  1.00 56.90  ? 542  ALA C N     1 
ATOM   7454  C  CA    . ALA C 2  542  ? -45.629 -10.616 16.034  1.00 60.16  ? 542  ALA C CA    1 
ATOM   7455  C  C     . ALA C 2  542  ? -44.625 -9.745  15.291  1.00 55.97  ? 542  ALA C C     1 
ATOM   7456  O  O     . ALA C 2  542  ? -44.097 -8.780  15.844  1.00 56.15  ? 542  ALA C O     1 
ATOM   7457  C  CB    . ALA C 2  542  ? -47.048 -10.190 15.702  1.00 74.18  ? 542  ALA C CB    1 
ATOM   7458  N  N     . GLN C 2  543  ? -44.363 -10.090 14.036  1.00 53.38  ? 543  GLN C N     1 
ATOM   7459  C  CA    . GLN C 2  543  ? -43.431 -9.322  13.224  1.00 52.75  ? 543  GLN C CA    1 
ATOM   7460  C  C     . GLN C 2  543  ? -44.065 -7.994  12.826  1.00 56.07  ? 543  GLN C C     1 
ATOM   7461  O  O     . GLN C 2  543  ? -45.287 -7.860  12.817  1.00 56.77  ? 543  GLN C O     1 
ATOM   7462  C  CB    . GLN C 2  543  ? -43.012 -10.118 11.990  1.00 61.21  ? 543  GLN C CB    1 
ATOM   7463  C  CG    . GLN C 2  543  ? -41.739 -9.621  11.322  1.00 70.00  ? 543  GLN C CG    1 
ATOM   7464  C  CD    . GLN C 2  543  ? -41.331 -10.491 10.149  1.00 79.28  ? 543  GLN C CD    1 
ATOM   7465  O  OE1   . GLN C 2  543  ? -41.694 -11.665 10.079  1.00 82.36  ? 543  GLN C OE1   1 
ATOM   7466  N  NE2   . GLN C 2  543  ? -40.578 -9.917  9.217   1.00 82.37  ? 543  GLN C NE2   1 
ATOM   7467  N  N     . ALA C 2  544  ? -43.224 -7.018  12.498  1.00 61.48  ? 544  ALA C N     1 
ATOM   7468  C  CA    . ALA C 2  544  ? -43.669 -5.649  12.257  1.00 58.63  ? 544  ALA C CA    1 
ATOM   7469  C  C     . ALA C 2  544  ? -44.507 -5.506  10.992  1.00 56.76  ? 544  ALA C C     1 
ATOM   7470  O  O     . ALA C 2  544  ? -45.481 -4.754  10.961  1.00 50.57  ? 544  ALA C O     1 
ATOM   7471  C  CB    . ALA C 2  544  ? -42.466 -4.721  12.186  1.00 51.76  ? 544  ALA C CB    1 
ATOM   7472  N  N     . ASN C 2  545  ? -44.120 -6.229  9.949   1.00 61.27  ? 545  ASN C N     1 
ATOM   7473  C  CA    . ASN C 2  545  ? -44.735 -6.055  8.643   1.00 65.18  ? 545  ASN C CA    1 
ATOM   7474  C  C     . ASN C 2  545  ? -46.047 -6.816  8.474   1.00 75.62  ? 545  ASN C C     1 
ATOM   7475  O  O     . ASN C 2  545  ? -46.632 -6.803  7.392   1.00 85.78  ? 545  ASN C O     1 
ATOM   7476  C  CB    . ASN C 2  545  ? -43.754 -6.470  7.543   1.00 71.13  ? 545  ASN C CB    1 
ATOM   7477  C  CG    . ASN C 2  545  ? -43.471 -7.961  7.542   1.00 77.44  ? 545  ASN C CG    1 
ATOM   7478  O  OD1   . ASN C 2  545  ? -43.599 -8.632  8.566   1.00 77.25  ? 545  ASN C OD1   1 
ATOM   7479  N  ND2   . ASN C 2  545  ? -43.083 -8.486  6.386   1.00 79.15  ? 545  ASN C ND2   1 
ATOM   7480  N  N     . SER C 2  546  ? -46.509 -7.479  9.532   1.00 77.19  ? 546  SER C N     1 
ATOM   7481  C  CA    . SER C 2  546  ? -47.789 -8.183  9.476   1.00 72.75  ? 546  SER C CA    1 
ATOM   7482  C  C     . SER C 2  546  ? -48.911 -7.198  9.191   1.00 72.44  ? 546  SER C C     1 
ATOM   7483  O  O     . SER C 2  546  ? -49.046 -6.194  9.885   1.00 80.02  ? 546  SER C O     1 
ATOM   7484  C  CB    . SER C 2  546  ? -48.067 -8.941  10.775  1.00 71.63  ? 546  SER C CB    1 
ATOM   7485  O  OG    . SER C 2  546  ? -47.466 -10.224 10.755  1.00 70.87  ? 546  SER C OG    1 
ATOM   7486  N  N     . PRO C 2  547  ? -49.711 -7.481  8.153   1.00 74.61  ? 547  PRO C N     1 
ATOM   7487  C  CA    . PRO C 2  547  ? -50.786 -6.603  7.676   1.00 84.15  ? 547  PRO C CA    1 
ATOM   7488  C  C     . PRO C 2  547  ? -51.798 -6.252  8.766   1.00 92.41  ? 547  PRO C C     1 
ATOM   7489  O  O     . PRO C 2  547  ? -52.309 -7.134  9.457   1.00 93.57  ? 547  PRO C O     1 
ATOM   7490  C  CB    . PRO C 2  547  ? -51.437 -7.429  6.564   1.00 82.51  ? 547  PRO C CB    1 
ATOM   7491  C  CG    . PRO C 2  547  ? -50.350 -8.326  6.086   1.00 82.34  ? 547  PRO C CG    1 
ATOM   7492  C  CD    . PRO C 2  547  ? -49.576 -8.685  7.317   1.00 78.77  ? 547  PRO C CD    1 
ATOM   7493  N  N     . ILE C 2  548  ? -52.077 -4.961  8.909   1.00 91.92  ? 548  ILE C N     1 
ATOM   7494  C  CA    . ILE C 2  548  ? -52.931 -4.475  9.984   1.00 93.61  ? 548  ILE C CA    1 
ATOM   7495  C  C     . ILE C 2  548  ? -54.135 -3.716  9.444   1.00 94.05  ? 548  ILE C C     1 
ATOM   7496  O  O     . ILE C 2  548  ? -54.011 -2.906  8.526   1.00 89.05  ? 548  ILE C O     1 
ATOM   7497  C  CB    . ILE C 2  548  ? -52.149 -3.554  10.946  1.00 96.55  ? 548  ILE C CB    1 
ATOM   7498  C  CG1   . ILE C 2  548  ? -50.949 -4.293  11.536  1.00 99.03  ? 548  ILE C CG1   1 
ATOM   7499  C  CG2   . ILE C 2  548  ? -53.048 -3.037  12.061  1.00 95.23  ? 548  ILE C CG2   1 
ATOM   7500  C  CD1   . ILE C 2  548  ? -49.991 -3.396  12.282  1.00 99.00  ? 548  ILE C CD1   1 
ATOM   7501  N  N     . ASP C 2  549  ? -55.300 -3.993  10.020  1.00 98.05  ? 549  ASP C N     1 
ATOM   7502  C  CA    . ASP C 2  549  ? -56.522 -3.270  9.697   1.00 92.48  ? 549  ASP C CA    1 
ATOM   7503  C  C     . ASP C 2  549  ? -56.391 -1.786  10.029  1.00 86.17  ? 549  ASP C C     1 
ATOM   7504  O  O     . ASP C 2  549  ? -55.667 -1.404  10.949  1.00 83.78  ? 549  ASP C O     1 
ATOM   7505  C  CB    . ASP C 2  549  ? -57.705 -3.887  10.448  1.00 92.04  ? 549  ASP C CB    1 
ATOM   7506  C  CG    . ASP C 2  549  ? -58.944 -3.023  10.404  1.00 95.84  ? 549  ASP C CG    1 
ATOM   7507  O  OD1   . ASP C 2  549  ? -59.694 -3.026  11.401  1.00 100.25 ? 549  ASP C OD1   1 
ATOM   7508  O  OD2   . ASP C 2  549  ? -59.171 -2.347  9.379   1.00 98.85  ? 549  ASP C OD2   1 
ATOM   7509  N  N     . ALA C 2  550  ? -57.104 -0.961  9.266   1.00 84.08  ? 550  ALA C N     1 
ATOM   7510  C  CA    . ALA C 2  550  ? -57.104 0.485   9.454   1.00 85.64  ? 550  ALA C CA    1 
ATOM   7511  C  C     . ALA C 2  550  ? -57.528 0.874   10.867  1.00 90.29  ? 550  ALA C C     1 
ATOM   7512  O  O     . ALA C 2  550  ? -57.147 1.931   11.367  1.00 99.07  ? 550  ALA C O     1 
ATOM   7513  C  CB    . ALA C 2  550  ? -58.011 1.147   8.428   1.00 85.10  ? 550  ALA C CB    1 
ATOM   7514  N  N     . ASP C 2  551  ? -58.321 0.023   11.510  1.00 86.71  ? 551  ASP C N     1 
ATOM   7515  C  CA    . ASP C 2  551  ? -58.650 0.233   12.912  1.00 94.10  ? 551  ASP C CA    1 
ATOM   7516  C  C     . ASP C 2  551  ? -57.486 -0.242  13.773  1.00 96.66  ? 551  ASP C C     1 
ATOM   7517  O  O     . ASP C 2  551  ? -57.053 0.456   14.691  1.00 97.96  ? 551  ASP C O     1 
ATOM   7518  C  CB    . ASP C 2  551  ? -59.942 -0.494  13.293  1.00 94.75  ? 551  ASP C CB    1 
ATOM   7519  C  CG    . ASP C 2  551  ? -61.162 0.084   12.598  1.00 92.85  ? 551  ASP C CG    1 
ATOM   7520  O  OD1   . ASP C 2  551  ? -61.119 1.270   12.209  1.00 101.64 ? 551  ASP C OD1   1 
ATOM   7521  O  OD2   . ASP C 2  551  ? -62.164 -0.645  12.442  1.00 87.76  ? 551  ASP C OD2   1 
ATOM   7522  N  N     . GLY C 2  552  ? -56.971 -1.426  13.458  1.00 92.65  ? 552  GLY C N     1 
ATOM   7523  C  CA    . GLY C 2  552  ? -55.836 -1.971  14.178  1.00 93.68  ? 552  GLY C CA    1 
ATOM   7524  C  C     . GLY C 2  552  ? -55.817 -3.486  14.261  1.00 97.16  ? 552  GLY C C     1 
ATOM   7525  O  O     . GLY C 2  552  ? -54.956 -4.055  14.928  1.00 99.05  ? 552  GLY C O     1 
ATOM   7526  N  N     . ARG C 2  553  ? -56.753 -4.143  13.580  1.00 94.41  ? 553  ARG C N     1 
ATOM   7527  C  CA    . ARG C 2  553  ? -56.864 -5.601  13.650  1.00 89.39  ? 553  ARG C CA    1 
ATOM   7528  C  C     . ARG C 2  553  ? -55.964 -6.331  12.650  1.00 85.63  ? 553  ARG C C     1 
ATOM   7529  O  O     . ARG C 2  553  ? -55.502 -5.756  11.667  1.00 86.04  ? 553  ARG C O     1 
ATOM   7530  C  CB    . ARG C 2  553  ? -58.322 -6.031  13.448  1.00 80.53  ? 553  ARG C CB    1 
ATOM   7531  C  CG    . ARG C 2  553  ? -59.142 -6.007  14.735  1.00 91.83  ? 553  ARG C CG    1 
ATOM   7532  C  CD    . ARG C 2  553  ? -60.585 -6.446  14.524  1.00 101.30 ? 553  ARG C CD    1 
ATOM   7533  N  NE    . ARG C 2  553  ? -61.403 -5.402  13.912  1.00 111.96 ? 553  ARG C NE    1 
ATOM   7534  C  CZ    . ARG C 2  553  ? -62.072 -4.475  14.593  1.00 105.99 ? 553  ARG C CZ    1 
ATOM   7535  N  NH1   . ARG C 2  553  ? -62.021 -4.454  15.919  1.00 93.20  ? 553  ARG C NH1   1 
ATOM   7536  N  NH2   . ARG C 2  553  ? -62.792 -3.567  13.946  1.00 103.05 ? 553  ARG C NH2   1 
ATOM   7537  N  N     . PHE C 2  554  ? -55.714 -7.608  12.921  1.00 87.27  ? 554  PHE C N     1 
ATOM   7538  C  CA    . PHE C 2  554  ? -54.895 -8.435  12.042  1.00 86.41  ? 554  PHE C CA    1 
ATOM   7539  C  C     . PHE C 2  554  ? -55.698 -8.916  10.843  1.00 88.25  ? 554  PHE C C     1 
ATOM   7540  O  O     . PHE C 2  554  ? -56.925 -8.975  10.893  1.00 97.65  ? 554  PHE C O     1 
ATOM   7541  C  CB    . PHE C 2  554  ? -54.325 -9.637  12.797  1.00 93.20  ? 554  PHE C CB    1 
ATOM   7542  C  CG    . PHE C 2  554  ? -53.115 -9.315  13.625  1.00 94.77  ? 554  PHE C CG    1 
ATOM   7543  C  CD1   . PHE C 2  554  ? -52.261 -10.323 14.045  1.00 96.16  ? 554  PHE C CD1   1 
ATOM   7544  C  CD2   . PHE C 2  554  ? -52.831 -8.010  13.987  1.00 94.70  ? 554  PHE C CD2   1 
ATOM   7545  C  CE1   . PHE C 2  554  ? -51.144 -10.032 14.805  1.00 93.01  ? 554  PHE C CE1   1 
ATOM   7546  C  CE2   . PHE C 2  554  ? -51.718 -7.712  14.749  1.00 99.93  ? 554  PHE C CE2   1 
ATOM   7547  C  CZ    . PHE C 2  554  ? -50.873 -8.725  15.158  1.00 97.07  ? 554  PHE C CZ    1 
ATOM   7548  N  N     . VAL C 2  555  ? -55.000 -9.266  9.770   1.00 87.27  ? 555  VAL C N     1 
ATOM   7549  C  CA    . VAL C 2  555  ? -55.652 -9.717  8.547   1.00 86.58  ? 555  VAL C CA    1 
ATOM   7550  C  C     . VAL C 2  555  ? -55.858 -11.227 8.542   1.00 86.39  ? 555  VAL C C     1 
ATOM   7551  O  O     . VAL C 2  555  ? -56.962 -11.714 8.306   1.00 89.63  ? 555  VAL C O     1 
ATOM   7552  C  CB    . VAL C 2  555  ? -54.845 -9.310  7.304   1.00 84.94  ? 555  VAL C CB    1 
ATOM   7553  C  CG1   . VAL C 2  555  ? -55.343 -10.053 6.072   1.00 84.79  ? 555  VAL C CG1   1 
ATOM   7554  C  CG2   . VAL C 2  555  ? -54.923 -7.807  7.103   1.00 77.63  ? 555  VAL C CG2   1 
ATOM   7555  N  N     . GLU C 2  556  ? -54.789 -11.968 8.802   1.00 85.66  ? 556  GLU C N     1 
ATOM   7556  C  CA    . GLU C 2  556  ? -54.877 -13.417 8.859   1.00 86.86  ? 556  GLU C CA    1 
ATOM   7557  C  C     . GLU C 2  556  ? -54.828 -13.884 10.302  1.00 89.18  ? 556  GLU C C     1 
ATOM   7558  O  O     . GLU C 2  556  ? -54.148 -13.276 11.126  1.00 98.27  ? 556  GLU C O     1 
ATOM   7559  C  CB    . GLU C 2  556  ? -53.749 -14.054 8.056   1.00 87.90  ? 556  GLU C CB    1 
ATOM   7560  C  CG    . GLU C 2  556  ? -53.682 -13.577 6.625   1.00 89.61  ? 556  GLU C CG    1 
ATOM   7561  C  CD    . GLU C 2  556  ? -52.517 -14.182 5.880   1.00 99.05  ? 556  GLU C CD    1 
ATOM   7562  O  OE1   . GLU C 2  556  ? -51.907 -15.134 6.411   1.00 103.83 ? 556  GLU C OE1   1 
ATOM   7563  O  OE2   . GLU C 2  556  ? -52.208 -13.703 4.770   1.00 99.33  ? 556  GLU C OE2   1 
ATOM   7564  N  N     . PRO C 2  557  ? -55.561 -14.960 10.616  1.00 87.01  ? 557  PRO C N     1 
ATOM   7565  C  CA    . PRO C 2  557  ? -55.569 -15.528 11.967  1.00 91.71  ? 557  PRO C CA    1 
ATOM   7566  C  C     . PRO C 2  557  ? -54.168 -15.899 12.435  1.00 89.37  ? 557  PRO C C     1 
ATOM   7567  O  O     . PRO C 2  557  ? -53.699 -15.395 13.455  1.00 83.57  ? 557  PRO C O     1 
ATOM   7568  C  CB    . PRO C 2  557  ? -56.445 -16.773 11.817  1.00 100.12 ? 557  PRO C CB    1 
ATOM   7569  C  CG    . PRO C 2  557  ? -57.333 -16.460 10.663  1.00 98.29  ? 557  PRO C CG    1 
ATOM   7570  C  CD    . PRO C 2  557  ? -56.486 -15.669 9.716   1.00 87.03  ? 557  PRO C CD    1 
ATOM   7571  N  N     . ARG C 2  558  ? -53.509 -16.771 11.681  1.00 93.62  ? 558  ARG C N     1 
ATOM   7572  C  CA    . ARG C 2  558  ? -52.148 -17.177 11.991  1.00 96.11  ? 558  ARG C CA    1 
ATOM   7573  C  C     . ARG C 2  558  ? -51.162 -16.175 11.411  1.00 95.97  ? 558  ARG C C     1 
ATOM   7574  O  O     . ARG C 2  558  ? -51.183 -15.891 10.213  1.00 92.31  ? 558  ARG C O     1 
ATOM   7575  C  CB    . ARG C 2  558  ? -51.868 -18.579 11.449  1.00 98.76  ? 558  ARG C CB    1 
ATOM   7576  C  CG    . ARG C 2  558  ? -52.881 -19.623 11.893  1.00 102.70 ? 558  ARG C CG    1 
ATOM   7577  C  CD    . ARG C 2  558  ? -52.765 -20.894 11.066  1.00 106.15 ? 558  ARG C CD    1 
ATOM   7578  N  NE    . ARG C 2  558  ? -53.805 -21.861 11.405  1.00 114.56 ? 558  ARG C NE    1 
ATOM   7579  C  CZ    . ARG C 2  558  ? -54.042 -22.974 10.718  1.00 114.19 ? 558  ARG C CZ    1 
ATOM   7580  N  NH1   . ARG C 2  558  ? -53.313 -23.261 9.648   1.00 119.30 ? 558  ARG C NH1   1 
ATOM   7581  N  NH2   . ARG C 2  558  ? -55.009 -23.798 11.098  1.00 104.90 ? 558  ARG C NH2   1 
ATOM   7582  N  N     . VAL C 2  559  ? -50.306 -15.632 12.269  1.00 92.23  ? 559  VAL C N     1 
ATOM   7583  C  CA    . VAL C 2  559  ? -49.314 -14.656 11.840  1.00 89.61  ? 559  VAL C CA    1 
ATOM   7584  C  C     . VAL C 2  559  ? -47.910 -15.102 12.224  1.00 92.40  ? 559  VAL C C     1 
ATOM   7585  O  O     . VAL C 2  559  ? -47.739 -16.063 12.974  1.00 92.90  ? 559  VAL C O     1 
ATOM   7586  C  CB    . VAL C 2  559  ? -49.589 -13.270 12.448  1.00 80.06  ? 559  VAL C CB    1 
ATOM   7587  C  CG1   . VAL C 2  559  ? -50.684 -12.561 11.676  1.00 88.96  ? 559  VAL C CG1   1 
ATOM   7588  C  CG2   . VAL C 2  559  ? -49.959 -13.400 13.916  1.00 75.37  ? 559  VAL C CG2   1 
ATOM   7589  N  N     . LEU C 2  560  ? -46.908 -14.403 11.705  1.00 88.49  ? 560  LEU C N     1 
ATOM   7590  C  CA    . LEU C 2  560  ? -45.524 -14.699 12.044  1.00 84.82  ? 560  LEU C CA    1 
ATOM   7591  C  C     . LEU C 2  560  ? -45.218 -14.247 13.464  1.00 77.98  ? 560  LEU C C     1 
ATOM   7592  O  O     . LEU C 2  560  ? -45.515 -13.115 13.843  1.00 76.69  ? 560  LEU C O     1 
ATOM   7593  C  CB    . LEU C 2  560  ? -44.578 -14.034 11.051  1.00 87.06  ? 560  LEU C CB    1 
ATOM   7594  C  CG    . LEU C 2  560  ? -44.593 -14.653 9.655   1.00 95.42  ? 560  LEU C CG    1 
ATOM   7595  C  CD1   . LEU C 2  560  ? -43.577 -13.957 8.778   1.00 101.39 ? 560  LEU C CD1   1 
ATOM   7596  C  CD2   . LEU C 2  560  ? -44.306 -16.146 9.735   1.00 89.38  ? 560  LEU C CD2   1 
ATOM   7597  N  N     . VAL C 2  561  ? -44.612 -15.136 14.243  1.00 75.26  ? 561  VAL C N     1 
ATOM   7598  C  CA    . VAL C 2  561  ? -44.506 -14.942 15.682  1.00 67.69  ? 561  VAL C CA    1 
ATOM   7599  C  C     . VAL C 2  561  ? -43.113 -15.259 16.222  1.00 66.79  ? 561  VAL C C     1 
ATOM   7600  O  O     . VAL C 2  561  ? -42.524 -16.289 15.894  1.00 69.89  ? 561  VAL C O     1 
ATOM   7601  C  CB    . VAL C 2  561  ? -45.549 -15.810 16.414  1.00 74.78  ? 561  VAL C CB    1 
ATOM   7602  C  CG1   . VAL C 2  561  ? -45.129 -16.086 17.848  1.00 73.88  ? 561  VAL C CG1   1 
ATOM   7603  C  CG2   . VAL C 2  561  ? -46.931 -15.160 16.335  1.00 77.52  ? 561  VAL C CG2   1 
ATOM   7604  N  N     . ARG C 2  562  ? -42.597 -14.356 17.049  1.00 61.93  ? 562  ARG C N     1 
ATOM   7605  C  CA    . ARG C 2  562  ? -41.318 -14.548 17.713  1.00 58.35  ? 562  ARG C CA    1 
ATOM   7606  C  C     . ARG C 2  562  ? -41.521 -15.158 19.094  1.00 56.61  ? 562  ARG C C     1 
ATOM   7607  O  O     . ARG C 2  562  ? -42.302 -14.648 19.896  1.00 59.29  ? 562  ARG C O     1 
ATOM   7608  C  CB    . ARG C 2  562  ? -40.573 -13.219 17.828  1.00 60.82  ? 562  ARG C CB    1 
ATOM   7609  C  CG    . ARG C 2  562  ? -40.178 -12.604 16.492  1.00 56.70  ? 562  ARG C CG    1 
ATOM   7610  C  CD    . ARG C 2  562  ? -39.173 -11.477 16.688  1.00 47.50  ? 562  ARG C CD    1 
ATOM   7611  N  NE    . ARG C 2  562  ? -38.194 -11.802 17.722  1.00 53.37  ? 562  ARG C NE    1 
ATOM   7612  C  CZ    . ARG C 2  562  ? -37.206 -12.683 17.574  1.00 55.81  ? 562  ARG C CZ    1 
ATOM   7613  N  NH1   . ARG C 2  562  ? -36.368 -12.909 18.578  1.00 44.14  ? 562  ARG C NH1   1 
ATOM   7614  N  NH2   . ARG C 2  562  ? -37.055 -13.345 16.429  1.00 61.53  ? 562  ARG C NH2   1 
ATOM   7615  N  N     . ARG C 2  563  ? -40.804 -16.245 19.366  1.00 59.34  ? 563  ARG C N     1 
ATOM   7616  C  CA    . ARG C 2  563  ? -40.944 -16.986 20.618  1.00 64.10  ? 563  ARG C CA    1 
ATOM   7617  C  C     . ARG C 2  563  ? -39.594 -17.202 21.303  1.00 62.82  ? 563  ARG C C     1 
ATOM   7618  O  O     . ARG C 2  563  ? -38.550 -17.168 20.652  1.00 71.61  ? 563  ARG C O     1 
ATOM   7619  C  CB    . ARG C 2  563  ? -41.625 -18.335 20.352  1.00 65.97  ? 563  ARG C CB    1 
ATOM   7620  C  CG    . ARG C 2  563  ? -41.861 -19.210 21.578  1.00 71.92  ? 563  ARG C CG    1 
ATOM   7621  C  CD    . ARG C 2  563  ? -42.761 -20.396 21.256  1.00 88.60  ? 563  ARG C CD    1 
ATOM   7622  N  NE    . ARG C 2  563  ? -44.066 -19.979 20.746  1.00 91.57  ? 563  ARG C NE    1 
ATOM   7623  C  CZ    . ARG C 2  563  ? -45.070 -19.558 21.511  1.00 85.74  ? 563  ARG C CZ    1 
ATOM   7624  N  NH1   . ARG C 2  563  ? -44.919 -19.488 22.827  1.00 87.14  ? 563  ARG C NH1   1 
ATOM   7625  N  NH2   . ARG C 2  563  ? -46.223 -19.201 20.960  1.00 74.86  ? 563  ARG C NH2   1 
ATOM   7626  N  N     . LYS C 2  564  ? -39.632 -17.412 22.618  1.00 53.52  ? 564  LYS C N     1 
ATOM   7627  C  CA    . LYS C 2  564  ? -38.460 -17.759 23.420  1.00 57.01  ? 564  LYS C CA    1 
ATOM   7628  C  C     . LYS C 2  564  ? -37.545 -18.776 22.731  1.00 57.38  ? 564  LYS C C     1 
ATOM   7629  O  O     . LYS C 2  564  ? -38.010 -19.616 21.959  1.00 61.77  ? 564  LYS C O     1 
ATOM   7630  C  CB    . LYS C 2  564  ? -38.921 -18.299 24.776  1.00 60.53  ? 564  LYS C CB    1 
ATOM   7631  C  CG    . LYS C 2  564  ? -37.817 -18.798 25.685  1.00 66.28  ? 564  LYS C CG    1 
ATOM   7632  C  CD    . LYS C 2  564  ? -38.387 -19.356 26.975  1.00 69.30  ? 564  LYS C CD    1 
ATOM   7633  C  CE    . LYS C 2  564  ? -37.299 -19.967 27.841  1.00 79.57  ? 564  LYS C CE    1 
ATOM   7634  N  NZ    . LYS C 2  564  ? -37.839 -20.486 29.129  1.00 79.30  ? 564  LYS C NZ    1 
ATOM   7635  N  N     . ALA C 2  565  ? -36.245 -18.669 23.003  1.00 57.83  ? 565  ALA C N     1 
ATOM   7636  C  CA    . ALA C 2  565  ? -35.219 -19.544 22.435  1.00 56.41  ? 565  ALA C CA    1 
ATOM   7637  C  C     . ALA C 2  565  ? -35.110 -19.399 20.917  1.00 55.24  ? 565  ALA C C     1 
ATOM   7638  O  O     . ALA C 2  565  ? -34.600 -20.289 20.236  1.00 65.28  ? 565  ALA C O     1 
ATOM   7639  C  CB    . ALA C 2  565  ? -35.481 -21.005 22.816  1.00 60.33  ? 565  ALA C CB    1 
ATOM   7640  N  N     . GLY C 2  566  ? -35.588 -18.273 20.394  1.00 52.89  ? 566  GLY C N     1 
ATOM   7641  C  CA    . GLY C 2  566  ? -35.385 -17.923 18.997  1.00 66.52  ? 566  GLY C CA    1 
ATOM   7642  C  C     . GLY C 2  566  ? -36.135 -18.804 18.019  1.00 63.70  ? 566  GLY C C     1 
ATOM   7643  O  O     . GLY C 2  566  ? -35.810 -18.859 16.829  1.00 71.74  ? 566  GLY C O     1 
ATOM   7644  N  N     . GLU C 2  567  ? -37.145 -19.492 18.539  1.00 59.22  ? 567  GLU C N     1 
ATOM   7645  C  CA    . GLU C 2  567  ? -37.985 -20.386 17.755  1.00 67.44  ? 567  GLU C CA    1 
ATOM   7646  C  C     . GLU C 2  567  ? -39.151 -19.632 17.132  1.00 64.12  ? 567  GLU C C     1 
ATOM   7647  O  O     . GLU C 2  567  ? -39.711 -18.726 17.746  1.00 68.07  ? 567  GLU C O     1 
ATOM   7648  C  CB    . GLU C 2  567  ? -38.508 -21.521 18.635  1.00 77.11  ? 567  GLU C CB    1 
ATOM   7649  C  CG    . GLU C 2  567  ? -39.531 -22.412 17.956  1.00 83.53  ? 567  GLU C CG    1 
ATOM   7650  C  CD    . GLU C 2  567  ? -40.572 -22.959 18.918  1.00 98.64  ? 567  GLU C CD    1 
ATOM   7651  O  OE1   . GLU C 2  567  ? -40.551 -22.584 20.111  1.00 101.45 ? 567  GLU C OE1   1 
ATOM   7652  O  OE2   . GLU C 2  567  ? -41.416 -23.767 18.475  1.00 102.94 ? 567  GLU C OE2   1 
ATOM   7653  N  N     . VAL C 2  568  ? -39.520 -20.012 15.915  1.00 59.32  ? 568  VAL C N     1 
ATOM   7654  C  CA    . VAL C 2  568  ? -40.581 -19.320 15.198  1.00 64.04  ? 568  VAL C CA    1 
ATOM   7655  C  C     . VAL C 2  568  ? -41.711 -20.277 14.809  1.00 74.48  ? 568  VAL C C     1 
ATOM   7656  O  O     . VAL C 2  568  ? -41.464 -21.437 14.475  1.00 80.04  ? 568  VAL C O     1 
ATOM   7657  C  CB    . VAL C 2  568  ? -40.017 -18.622 13.941  1.00 58.96  ? 568  VAL C CB    1 
ATOM   7658  C  CG1   . VAL C 2  568  ? -41.094 -17.818 13.236  1.00 61.67  ? 568  VAL C CG1   1 
ATOM   7659  C  CG2   . VAL C 2  568  ? -38.848 -17.722 14.322  1.00 72.63  ? 568  VAL C CG2   1 
ATOM   7660  N  N     . GLU C 2  569  ? -42.949 -19.789 14.876  1.00 77.76  ? 569  GLU C N     1 
ATOM   7661  C  CA    . GLU C 2  569  ? -44.113 -20.564 14.452  1.00 82.86  ? 569  GLU C CA    1 
ATOM   7662  C  C     . GLU C 2  569  ? -45.322 -19.671 14.157  1.00 84.11  ? 569  GLU C C     1 
ATOM   7663  O  O     . GLU C 2  569  ? -45.392 -18.529 14.612  1.00 78.14  ? 569  GLU C O     1 
ATOM   7664  C  CB    . GLU C 2  569  ? -44.480 -21.609 15.513  1.00 80.97  ? 569  GLU C CB    1 
ATOM   7665  C  CG    . GLU C 2  569  ? -44.849 -21.031 16.871  1.00 79.75  ? 569  GLU C CG    1 
ATOM   7666  C  CD    . GLU C 2  569  ? -45.217 -22.105 17.880  1.00 86.08  ? 569  GLU C CD    1 
ATOM   7667  O  OE1   . GLU C 2  569  ? -45.241 -23.295 17.502  1.00 91.87  ? 569  GLU C OE1   1 
ATOM   7668  O  OE2   . GLU C 2  569  ? -45.481 -21.758 19.051  1.00 87.76  ? 569  GLU C OE2   1 
ATOM   7669  N  N     . TYR C 2  570  ? -46.262 -20.201 13.380  1.00 92.79  ? 570  TYR C N     1 
ATOM   7670  C  CA    . TYR C 2  570  ? -47.522 -19.518 13.101  1.00 86.35  ? 570  TYR C CA    1 
ATOM   7671  C  C     . TYR C 2  570  ? -48.465 -19.626 14.288  1.00 81.36  ? 570  TYR C C     1 
ATOM   7672  O  O     . TYR C 2  570  ? -48.648 -20.704 14.850  1.00 85.64  ? 570  TYR C O     1 
ATOM   7673  C  CB    . TYR C 2  570  ? -48.197 -20.098 11.859  1.00 98.68  ? 570  TYR C CB    1 
ATOM   7674  C  CG    . TYR C 2  570  ? -47.545 -19.704 10.559  1.00 98.52  ? 570  TYR C CG    1 
ATOM   7675  C  CD1   . TYR C 2  570  ? -47.748 -18.441 10.017  1.00 96.13  ? 570  TYR C CD1   1 
ATOM   7676  C  CD2   . TYR C 2  570  ? -46.737 -20.595 9.866   1.00 94.35  ? 570  TYR C CD2   1 
ATOM   7677  C  CE1   . TYR C 2  570  ? -47.159 -18.073 8.827   1.00 90.01  ? 570  TYR C CE1   1 
ATOM   7678  C  CE2   . TYR C 2  570  ? -46.143 -20.236 8.673   1.00 102.68 ? 570  TYR C CE2   1 
ATOM   7679  C  CZ    . TYR C 2  570  ? -46.357 -18.972 8.159   1.00 102.70 ? 570  TYR C CZ    1 
ATOM   7680  O  OH    . TYR C 2  570  ? -45.768 -18.603 6.970   1.00 113.30 ? 570  TYR C OH    1 
ATOM   7681  N  N     . VAL C 2  571  ? -49.069 -18.510 14.671  1.00 75.29  ? 571  VAL C N     1 
ATOM   7682  C  CA    . VAL C 2  571  ? -49.934 -18.498 15.840  1.00 83.14  ? 571  VAL C CA    1 
ATOM   7683  C  C     . VAL C 2  571  ? -51.210 -17.715 15.554  1.00 86.18  ? 571  VAL C C     1 
ATOM   7684  O  O     . VAL C 2  571  ? -51.150 -16.617 15.000  1.00 86.64  ? 571  VAL C O     1 
ATOM   7685  C  CB    . VAL C 2  571  ? -49.205 -17.897 17.065  1.00 86.54  ? 571  VAL C CB    1 
ATOM   7686  C  CG1   . VAL C 2  571  ? -50.154 -17.725 18.231  1.00 87.80  ? 571  VAL C CG1   1 
ATOM   7687  C  CG2   . VAL C 2  571  ? -48.024 -18.770 17.472  1.00 92.39  ? 571  VAL C CG2   1 
ATOM   7688  N  N     . PRO C 2  572  ? -52.371 -18.289 15.913  1.00 85.10  ? 572  PRO C N     1 
ATOM   7689  C  CA    . PRO C 2  572  ? -53.660 -17.603 15.769  1.00 78.71  ? 572  PRO C CA    1 
ATOM   7690  C  C     . PRO C 2  572  ? -53.661 -16.234 16.442  1.00 79.83  ? 572  PRO C C     1 
ATOM   7691  O  O     . PRO C 2  572  ? -53.054 -16.064 17.500  1.00 82.31  ? 572  PRO C O     1 
ATOM   7692  C  CB    . PRO C 2  572  ? -54.650 -18.555 16.454  1.00 79.08  ? 572  PRO C CB    1 
ATOM   7693  C  CG    . PRO C 2  572  ? -53.807 -19.528 17.227  1.00 80.07  ? 572  PRO C CG    1 
ATOM   7694  C  CD    . PRO C 2  572  ? -52.536 -19.645 16.459  1.00 82.59  ? 572  PRO C CD    1 
ATOM   7695  N  N     . SER C 2  573  ? -54.345 -15.276 15.823  1.00 76.48  ? 573  SER C N     1 
ATOM   7696  C  CA    . SER C 2  573  ? -54.339 -13.883 16.264  1.00 72.45  ? 573  SER C CA    1 
ATOM   7697  C  C     . SER C 2  573  ? -54.805 -13.680 17.705  1.00 73.91  ? 573  SER C C     1 
ATOM   7698  O  O     . SER C 2  573  ? -54.557 -12.631 18.296  1.00 76.20  ? 573  SER C O     1 
ATOM   7699  C  CB    . SER C 2  573  ? -55.212 -13.042 15.332  1.00 69.64  ? 573  SER C CB    1 
ATOM   7700  O  OG    . SER C 2  573  ? -55.209 -11.680 15.724  1.00 73.26  ? 573  SER C OG    1 
ATOM   7701  N  N     . SER C 2  574  ? -55.480 -14.676 18.268  1.00 79.12  ? 574  SER C N     1 
ATOM   7702  C  CA    . SER C 2  574  ? -55.993 -14.563 19.628  1.00 81.82  ? 574  SER C CA    1 
ATOM   7703  C  C     . SER C 2  574  ? -54.867 -14.553 20.649  1.00 75.12  ? 574  SER C C     1 
ATOM   7704  O  O     . SER C 2  574  ? -55.022 -14.039 21.755  1.00 82.18  ? 574  SER C O     1 
ATOM   7705  C  CB    . SER C 2  574  ? -56.955 -15.711 19.938  1.00 90.85  ? 574  SER C CB    1 
ATOM   7706  O  OG    . SER C 2  574  ? -58.026 -15.745 19.014  1.00 98.62  ? 574  SER C OG    1 
ATOM   7707  N  N     . GLU C 2  575  ? -53.728 -15.113 20.262  1.00 70.68  ? 575  GLU C N     1 
ATOM   7708  C  CA    . GLU C 2  575  ? -52.652 -15.377 21.203  1.00 73.18  ? 575  GLU C CA    1 
ATOM   7709  C  C     . GLU C 2  575  ? -51.519 -14.357 21.106  1.00 72.26  ? 575  GLU C C     1 
ATOM   7710  O  O     . GLU C 2  575  ? -50.572 -14.388 21.893  1.00 68.10  ? 575  GLU C O     1 
ATOM   7711  C  CB    . GLU C 2  575  ? -52.121 -16.787 20.970  1.00 74.72  ? 575  GLU C CB    1 
ATOM   7712  C  CG    . GLU C 2  575  ? -51.375 -17.387 22.134  1.00 80.14  ? 575  GLU C CG    1 
ATOM   7713  C  CD    . GLU C 2  575  ? -51.132 -18.864 21.938  1.00 80.40  ? 575  GLU C CD    1 
ATOM   7714  O  OE1   . GLU C 2  575  ? -51.965 -19.514 21.270  1.00 84.36  ? 575  GLU C OE1   1 
ATOM   7715  O  OE2   . GLU C 2  575  ? -50.110 -19.373 22.440  1.00 78.37  ? 575  GLU C OE2   1 
ATOM   7716  N  N     . VAL C 2  576  ? -51.623 -13.446 20.144  1.00 71.30  ? 576  VAL C N     1 
ATOM   7717  C  CA    . VAL C 2  576  ? -50.611 -12.411 19.965  1.00 66.78  ? 576  VAL C CA    1 
ATOM   7718  C  C     . VAL C 2  576  ? -50.644 -11.383 21.095  1.00 71.77  ? 576  VAL C C     1 
ATOM   7719  O  O     . VAL C 2  576  ? -51.656 -10.718 21.309  1.00 76.57  ? 576  VAL C O     1 
ATOM   7720  C  CB    . VAL C 2  576  ? -50.789 -11.679 18.627  1.00 68.48  ? 576  VAL C CB    1 
ATOM   7721  C  CG1   . VAL C 2  576  ? -49.736 -10.594 18.478  1.00 70.17  ? 576  VAL C CG1   1 
ATOM   7722  C  CG2   . VAL C 2  576  ? -50.722 -12.664 17.471  1.00 74.77  ? 576  VAL C CG2   1 
ATOM   7723  N  N     . ASP C 2  577  ? -49.530 -11.253 21.812  1.00 72.36  ? 577  ASP C N     1 
ATOM   7724  C  CA    . ASP C 2  577  ? -49.430 -10.292 22.908  1.00 73.22  ? 577  ASP C CA    1 
ATOM   7725  C  C     . ASP C 2  577  ? -48.928 -8.931  22.424  1.00 70.19  ? 577  ASP C C     1 
ATOM   7726  O  O     . ASP C 2  577  ? -49.584 -7.909  22.633  1.00 71.29  ? 577  ASP C O     1 
ATOM   7727  C  CB    . ASP C 2  577  ? -48.510 -10.828 24.009  1.00 69.13  ? 577  ASP C CB    1 
ATOM   7728  C  CG    . ASP C 2  577  ? -49.047 -12.095 24.654  1.00 71.88  ? 577  ASP C CG    1 
ATOM   7729  O  OD1   . ASP C 2  577  ? -50.283 -12.213 24.807  1.00 76.98  ? 577  ASP C OD1   1 
ATOM   7730  O  OD2   . ASP C 2  577  ? -48.233 -12.975 25.008  1.00 70.46  ? 577  ASP C OD2   1 
ATOM   7731  N  N     . TYR C 2  578  ? -47.763 -8.921  21.783  1.00 65.71  ? 578  TYR C N     1 
ATOM   7732  C  CA    . TYR C 2  578  ? -47.193 -7.690  21.248  1.00 61.09  ? 578  TYR C CA    1 
ATOM   7733  C  C     . TYR C 2  578  ? -46.777 -7.860  19.793  1.00 58.09  ? 578  TYR C C     1 
ATOM   7734  O  O     . TYR C 2  578  ? -46.810 -8.964  19.251  1.00 54.58  ? 578  TYR C O     1 
ATOM   7735  C  CB    . TYR C 2  578  ? -45.979 -7.248  22.069  1.00 57.48  ? 578  TYR C CB    1 
ATOM   7736  C  CG    . TYR C 2  578  ? -46.248 -7.034  23.537  1.00 54.88  ? 578  TYR C CG    1 
ATOM   7737  C  CD1   . TYR C 2  578  ? -46.907 -5.897  23.982  1.00 63.48  ? 578  TYR C CD1   1 
ATOM   7738  C  CD2   . TYR C 2  578  ? -45.826 -7.959  24.482  1.00 52.23  ? 578  TYR C CD2   1 
ATOM   7739  C  CE1   . TYR C 2  578  ? -47.150 -5.693  25.325  1.00 64.33  ? 578  TYR C CE1   1 
ATOM   7740  C  CE2   . TYR C 2  578  ? -46.063 -7.764  25.827  1.00 55.75  ? 578  TYR C CE2   1 
ATOM   7741  C  CZ    . TYR C 2  578  ? -46.725 -6.628  26.243  1.00 59.06  ? 578  TYR C CZ    1 
ATOM   7742  O  OH    . TYR C 2  578  ? -46.967 -6.426  27.582  1.00 65.03  ? 578  TYR C OH    1 
ATOM   7743  N  N     . MET C 2  579  ? -46.381 -6.757  19.168  1.00 58.17  ? 579  MET C N     1 
ATOM   7744  C  CA    . MET C 2  579  ? -45.781 -6.802  17.842  1.00 56.01  ? 579  MET C CA    1 
ATOM   7745  C  C     . MET C 2  579  ? -44.655 -5.785  17.763  1.00 50.19  ? 579  MET C C     1 
ATOM   7746  O  O     . MET C 2  579  ? -44.587 -4.862  18.575  1.00 51.02  ? 579  MET C O     1 
ATOM   7747  C  CB    . MET C 2  579  ? -46.816 -6.529  16.752  1.00 62.34  ? 579  MET C CB    1 
ATOM   7748  C  CG    . MET C 2  579  ? -47.148 -5.061  16.566  1.00 61.49  ? 579  MET C CG    1 
ATOM   7749  S  SD    . MET C 2  579  ? -48.193 -4.813  15.124  1.00 59.45  ? 579  MET C SD    1 
ATOM   7750  C  CE    . MET C 2  579  ? -47.109 -5.408  13.830  1.00 59.23  ? 579  MET C CE    1 
ATOM   7751  N  N     . ASP C 2  580  ? -43.776 -5.950  16.783  1.00 52.02  ? 580  ASP C N     1 
ATOM   7752  C  CA    . ASP C 2  580  ? -42.619 -5.076  16.668  1.00 53.31  ? 580  ASP C CA    1 
ATOM   7753  C  C     . ASP C 2  580  ? -43.004 -3.638  16.352  1.00 42.04  ? 580  ASP C C     1 
ATOM   7754  O  O     . ASP C 2  580  ? -44.067 -3.364  15.793  1.00 37.32  ? 580  ASP C O     1 
ATOM   7755  C  CB    . ASP C 2  580  ? -41.651 -5.601  15.607  1.00 53.99  ? 580  ASP C CB    1 
ATOM   7756  C  CG    . ASP C 2  580  ? -40.858 -6.801  16.085  1.00 57.59  ? 580  ASP C CG    1 
ATOM   7757  O  OD1   . ASP C 2  580  ? -40.787 -7.017  17.312  1.00 55.32  ? 580  ASP C OD1   1 
ATOM   7758  O  OD2   . ASP C 2  580  ? -40.303 -7.524  15.233  1.00 66.27  ? 580  ASP C OD2   1 
ATOM   7759  N  N     . VAL C 2  581  ? -42.116 -2.731  16.741  1.00 39.38  ? 581  VAL C N     1 
ATOM   7760  C  CA    . VAL C 2  581  ? -42.273 -1.312  16.486  1.00 39.57  ? 581  VAL C CA    1 
ATOM   7761  C  C     . VAL C 2  581  ? -42.055 -0.996  15.014  1.00 44.79  ? 581  VAL C C     1 
ATOM   7762  O  O     . VAL C 2  581  ? -42.867 -0.318  14.392  1.00 51.62  ? 581  VAL C O     1 
ATOM   7763  C  CB    . VAL C 2  581  ? -41.292 -0.486  17.339  1.00 35.57  ? 581  VAL C CB    1 
ATOM   7764  C  CG1   . VAL C 2  581  ? -40.938 0.820   16.647  1.00 41.13  ? 581  VAL C CG1   1 
ATOM   7765  C  CG2   . VAL C 2  581  ? -41.877 -0.230  18.709  1.00 36.87  ? 581  VAL C CG2   1 
ATOM   7766  N  N     . SER C 2  582  ? -40.963 -1.496  14.452  1.00 39.75  ? 582  SER C N     1 
ATOM   7767  C  CA    . SER C 2  582  ? -40.620 -1.167  13.080  1.00 33.68  ? 582  SER C CA    1 
ATOM   7768  C  C     . SER C 2  582  ? -39.890 -2.339  12.441  1.00 29.56  ? 582  SER C C     1 
ATOM   7769  O  O     . SER C 2  582  ? -39.350 -3.188  13.143  1.00 32.45  ? 582  SER C O     1 
ATOM   7770  C  CB    . SER C 2  582  ? -39.766 0.103   13.041  1.00 31.44  ? 582  SER C CB    1 
ATOM   7771  O  OG    . SER C 2  582  ? -39.955 0.815   11.831  1.00 33.22  ? 582  SER C OG    1 
ATOM   7772  N  N     . PRO C 2  583  ? -39.898 -2.412  11.104  1.00 28.42  ? 583  PRO C N     1 
ATOM   7773  C  CA    . PRO C 2  583  ? -39.121 -3.461  10.442  1.00 34.54  ? 583  PRO C CA    1 
ATOM   7774  C  C     . PRO C 2  583  ? -37.629 -3.328  10.748  1.00 43.06  ? 583  PRO C C     1 
ATOM   7775  O  O     . PRO C 2  583  ? -36.979 -4.308  11.114  1.00 45.87  ? 583  PRO C O     1 
ATOM   7776  C  CB    . PRO C 2  583  ? -39.400 -3.219  8.958   1.00 37.87  ? 583  PRO C CB    1 
ATOM   7777  C  CG    . PRO C 2  583  ? -40.703 -2.497  8.933   1.00 39.53  ? 583  PRO C CG    1 
ATOM   7778  C  CD    . PRO C 2  583  ? -40.709 -1.638  10.149  1.00 33.30  ? 583  PRO C CD    1 
ATOM   7779  N  N     . ARG C 2  584  ? -37.113 -2.109  10.622  1.00 43.62  ? 584  ARG C N     1 
ATOM   7780  C  CA    . ARG C 2  584  ? -35.694 -1.817  10.814  1.00 33.93  ? 584  ARG C CA    1 
ATOM   7781  C  C     . ARG C 2  584  ? -35.295 -1.759  12.295  1.00 29.67  ? 584  ARG C C     1 
ATOM   7782  O  O     . ARG C 2  584  ? -34.338 -1.079  12.656  1.00 28.88  ? 584  ARG C O     1 
ATOM   7783  C  CB    . ARG C 2  584  ? -35.344 -0.490  10.124  1.00 30.42  ? 584  ARG C CB    1 
ATOM   7784  C  CG    . ARG C 2  584  ? -36.166 0.705   10.621  1.00 31.70  ? 584  ARG C CG    1 
ATOM   7785  C  CD    . ARG C 2  584  ? -35.842 2.007   9.888   1.00 32.34  ? 584  ARG C CD    1 
ATOM   7786  N  NE    . ARG C 2  584  ? -36.234 3.169   10.686  1.00 33.51  ? 584  ARG C NE    1 
ATOM   7787  C  CZ    . ARG C 2  584  ? -35.939 4.432   10.385  1.00 42.63  ? 584  ARG C CZ    1 
ATOM   7788  N  NH1   . ARG C 2  584  ? -35.246 4.717   9.290   1.00 39.51  ? 584  ARG C NH1   1 
ATOM   7789  N  NH2   . ARG C 2  584  ? -36.340 5.414   11.182  1.00 48.47  ? 584  ARG C NH2   1 
ATOM   7790  N  N     . GLN C 2  585  ? -36.021 -2.484  13.142  1.00 31.12  ? 585  GLN C N     1 
ATOM   7791  C  CA    . GLN C 2  585  ? -35.840 -2.405  14.592  1.00 31.44  ? 585  GLN C CA    1 
ATOM   7792  C  C     . GLN C 2  585  ? -34.590 -3.133  15.081  1.00 30.52  ? 585  GLN C C     1 
ATOM   7793  O  O     . GLN C 2  585  ? -34.007 -2.767  16.103  1.00 32.78  ? 585  GLN C O     1 
ATOM   7794  C  CB    . GLN C 2  585  ? -37.070 -2.974  15.301  1.00 35.83  ? 585  GLN C CB    1 
ATOM   7795  C  CG    . GLN C 2  585  ? -37.027 -2.931  16.819  1.00 32.00  ? 585  GLN C CG    1 
ATOM   7796  C  CD    . GLN C 2  585  ? -38.322 -3.411  17.434  1.00 38.72  ? 585  GLN C CD    1 
ATOM   7797  O  OE1   . GLN C 2  585  ? -39.397 -3.191  16.882  1.00 46.27  ? 585  GLN C OE1   1 
ATOM   7798  N  NE2   . GLN C 2  585  ? -38.226 -4.085  18.572  1.00 39.57  ? 585  GLN C NE2   1 
ATOM   7799  N  N     . MET C 2  586  ? -34.175 -4.160  14.346  1.00 28.78  ? 586  MET C N     1 
ATOM   7800  C  CA    . MET C 2  586  ? -33.083 -5.022  14.786  1.00 31.84  ? 586  MET C CA    1 
ATOM   7801  C  C     . MET C 2  586  ? -31.702 -4.418  14.559  1.00 25.19  ? 586  MET C C     1 
ATOM   7802  O  O     . MET C 2  586  ? -30.733 -4.820  15.197  1.00 20.80  ? 586  MET C O     1 
ATOM   7803  C  CB    . MET C 2  586  ? -33.171 -6.366  14.070  1.00 30.71  ? 586  MET C CB    1 
ATOM   7804  C  CG    . MET C 2  586  ? -33.217 -6.231  12.565  1.00 26.53  ? 586  MET C CG    1 
ATOM   7805  S  SD    . MET C 2  586  ? -33.223 -7.826  11.737  1.00 33.00  ? 586  MET C SD    1 
ATOM   7806  C  CE    . MET C 2  586  ? -31.540 -8.361  11.981  1.00 19.64  ? 586  MET C CE    1 
ATOM   7807  N  N     . VAL C 2  587  ? -31.623 -3.453  13.652  1.00 20.89  ? 587  VAL C N     1 
ATOM   7808  C  CA    . VAL C 2  587  ? -30.342 -2.921  13.202  1.00 18.88  ? 587  VAL C CA    1 
ATOM   7809  C  C     . VAL C 2  587  ? -29.804 -1.794  14.071  1.00 19.50  ? 587  VAL C C     1 
ATOM   7810  O  O     . VAL C 2  587  ? -30.480 -1.313  14.979  1.00 22.05  ? 587  VAL C O     1 
ATOM   7811  C  CB    . VAL C 2  587  ? -30.450 -2.404  11.767  1.00 19.37  ? 587  VAL C CB    1 
ATOM   7812  C  CG1   . VAL C 2  587  ? -31.085 -3.460  10.887  1.00 27.97  ? 587  VAL C CG1   1 
ATOM   7813  C  CG2   . VAL C 2  587  ? -31.268 -1.125  11.734  1.00 18.09  ? 587  VAL C CG2   1 
ATOM   7814  N  N     . SER C 2  588  ? -28.578 -1.374  13.778  1.00 18.61  ? 588  SER C N     1 
ATOM   7815  C  CA    . SER C 2  588  ? -27.977 -0.248  14.474  1.00 18.35  ? 588  SER C CA    1 
ATOM   7816  C  C     . SER C 2  588  ? -28.195 1.024   13.672  1.00 19.51  ? 588  SER C C     1 
ATOM   7817  O  O     . SER C 2  588  ? -28.952 1.036   12.696  1.00 16.60  ? 588  SER C O     1 
ATOM   7818  C  CB    . SER C 2  588  ? -26.484 -0.469  14.702  1.00 18.78  ? 588  SER C CB    1 
ATOM   7819  O  OG    . SER C 2  588  ? -25.740 -0.236  13.520  1.00 19.66  ? 588  SER C OG    1 
ATOM   7820  N  N     . VAL C 2  589  ? -27.528 2.097   14.086  1.00 23.21  ? 589  VAL C N     1 
ATOM   7821  C  CA    . VAL C 2  589  ? -27.643 3.369   13.388  1.00 23.33  ? 589  VAL C CA    1 
ATOM   7822  C  C     . VAL C 2  589  ? -26.826 3.326   12.109  1.00 19.91  ? 589  VAL C C     1 
ATOM   7823  O  O     . VAL C 2  589  ? -27.206 3.912   11.096  1.00 21.74  ? 589  VAL C O     1 
ATOM   7824  C  CB    . VAL C 2  589  ? -27.164 4.552   14.243  1.00 21.10  ? 589  VAL C CB    1 
ATOM   7825  C  CG1   . VAL C 2  589  ? -27.688 5.862   13.664  1.00 21.50  ? 589  VAL C CG1   1 
ATOM   7826  C  CG2   . VAL C 2  589  ? -27.603 4.386   15.692  1.00 23.06  ? 589  VAL C CG2   1 
ATOM   7827  N  N     . ALA C 2  590  ? -25.696 2.630   12.166  1.00 15.15  ? 590  ALA C N     1 
ATOM   7828  C  CA    . ALA C 2  590  ? -24.812 2.521   11.019  1.00 15.16  ? 590  ALA C CA    1 
ATOM   7829  C  C     . ALA C 2  590  ? -25.373 1.538   10.009  1.00 16.68  ? 590  ALA C C     1 
ATOM   7830  O  O     . ALA C 2  590  ? -25.219 1.710   8.802   1.00 13.42  ? 590  ALA C O     1 
ATOM   7831  C  CB    . ALA C 2  590  ? -23.425 2.097   11.459  1.00 18.86  ? 590  ALA C CB    1 
ATOM   7832  N  N     . THR C 2  591  ? -26.033 0.507   10.517  1.00 13.80  ? 591  THR C N     1 
ATOM   7833  C  CA    . THR C 2  591  ? -26.571 -0.544  9.668   1.00 15.71  ? 591  THR C CA    1 
ATOM   7834  C  C     . THR C 2  591  ? -27.687 -0.023  8.774   1.00 17.07  ? 591  THR C C     1 
ATOM   7835  O  O     . THR C 2  591  ? -27.809 -0.422  7.616   1.00 17.69  ? 591  THR C O     1 
ATOM   7836  C  CB    . THR C 2  591  ? -27.119 -1.718  10.504  1.00 20.37  ? 591  THR C CB    1 
ATOM   7837  O  OG1   . THR C 2  591  ? -26.212 -2.018  11.572  1.00 23.06  ? 591  THR C OG1   1 
ATOM   7838  C  CG2   . THR C 2  591  ? -27.308 -2.952  9.636   1.00 19.65  ? 591  THR C CG2   1 
ATOM   7839  N  N     . ALA C 2  592  ? -28.489 0.883   9.325   1.00 18.11  ? 592  ALA C N     1 
ATOM   7840  C  CA    . ALA C 2  592  ? -29.735 1.319   8.701   1.00 16.08  ? 592  ALA C CA    1 
ATOM   7841  C  C     . ALA C 2  592  ? -29.535 2.137   7.430   1.00 14.48  ? 592  ALA C C     1 
ATOM   7842  O  O     . ALA C 2  592  ? -30.465 2.309   6.646   1.00 15.27  ? 592  ALA C O     1 
ATOM   7843  C  CB    . ALA C 2  592  ? -30.556 2.117   9.703   1.00 20.11  ? 592  ALA C CB    1 
ATOM   7844  N  N     . MET C 2  593  ? -28.327 2.643   7.224   1.00 13.72  ? 593  MET C N     1 
ATOM   7845  C  CA    . MET C 2  593  ? -28.064 3.503   6.078   1.00 16.56  ? 593  MET C CA    1 
ATOM   7846  C  C     . MET C 2  593  ? -27.585 2.728   4.860   1.00 20.47  ? 593  MET C C     1 
ATOM   7847  O  O     . MET C 2  593  ? -27.031 3.309   3.928   1.00 24.37  ? 593  MET C O     1 
ATOM   7848  C  CB    . MET C 2  593  ? -27.038 4.570   6.443   1.00 17.17  ? 593  MET C CB    1 
ATOM   7849  C  CG    . MET C 2  593  ? -27.624 5.746   7.188   1.00 19.54  ? 593  MET C CG    1 
ATOM   7850  S  SD    . MET C 2  593  ? -26.334 6.805   7.840   1.00 29.80  ? 593  MET C SD    1 
ATOM   7851  C  CE    . MET C 2  593  ? -25.575 5.695   9.022   1.00 19.67  ? 593  MET C CE    1 
ATOM   7852  N  N     . ILE C 2  594  ? -27.800 1.418   4.871   1.00 21.31  ? 594  ILE C N     1 
ATOM   7853  C  CA    . ILE C 2  594  ? -27.414 0.573   3.749   1.00 21.13  ? 594  ILE C CA    1 
ATOM   7854  C  C     . ILE C 2  594  ? -28.630 0.211   2.907   1.00 20.49  ? 594  ILE C C     1 
ATOM   7855  O  O     . ILE C 2  594  ? -29.378 -0.702  3.256   1.00 17.78  ? 594  ILE C O     1 
ATOM   7856  C  CB    . ILE C 2  594  ? -26.728 -0.714  4.221   1.00 20.11  ? 594  ILE C CB    1 
ATOM   7857  C  CG1   . ILE C 2  594  ? -25.595 -0.389  5.194   1.00 18.24  ? 594  ILE C CG1   1 
ATOM   7858  C  CG2   . ILE C 2  594  ? -26.204 -1.500  3.031   1.00 24.90  ? 594  ILE C CG2   1 
ATOM   7859  C  CD1   . ILE C 2  594  ? -24.871 -1.610  5.698   1.00 22.25  ? 594  ILE C CD1   1 
ATOM   7860  N  N     . PRO C 2  595  ? -28.826 0.927   1.790   1.00 19.73  ? 595  PRO C N     1 
ATOM   7861  C  CA    . PRO C 2  595  ? -30.008 0.746   0.940   1.00 17.87  ? 595  PRO C CA    1 
ATOM   7862  C  C     . PRO C 2  595  ? -30.082 -0.668  0.389   1.00 17.00  ? 595  PRO C C     1 
ATOM   7863  O  O     . PRO C 2  595  ? -29.046 -1.238  0.060   1.00 18.24  ? 595  PRO C O     1 
ATOM   7864  C  CB    . PRO C 2  595  ? -29.799 1.769   -0.179  1.00 21.66  ? 595  PRO C CB    1 
ATOM   7865  C  CG    . PRO C 2  595  ? -28.325 2.002   -0.210  1.00 21.58  ? 595  PRO C CG    1 
ATOM   7866  C  CD    . PRO C 2  595  ? -27.855 1.864   1.202   1.00 19.77  ? 595  PRO C CD    1 
ATOM   7867  N  N     . PHE C 2  596  ? -31.289 -1.218  0.304   1.00 19.72  ? 596  PHE C N     1 
ATOM   7868  C  CA    . PHE C 2  596  ? -31.483 -2.603  -0.116  1.00 24.03  ? 596  PHE C CA    1 
ATOM   7869  C  C     . PHE C 2  596  ? -30.602 -3.549  0.691   1.00 23.36  ? 596  PHE C C     1 
ATOM   7870  O  O     . PHE C 2  596  ? -29.921 -4.404  0.127   1.00 21.88  ? 596  PHE C O     1 
ATOM   7871  C  CB    . PHE C 2  596  ? -31.180 -2.770  -1.604  1.00 28.20  ? 596  PHE C CB    1 
ATOM   7872  C  CG    . PHE C 2  596  ? -31.902 -1.797  -2.488  1.00 27.46  ? 596  PHE C CG    1 
ATOM   7873  C  CD1   . PHE C 2  596  ? -33.246 -1.962  -2.769  1.00 26.63  ? 596  PHE C CD1   1 
ATOM   7874  C  CD2   . PHE C 2  596  ? -31.229 -0.730  -3.057  1.00 25.70  ? 596  PHE C CD2   1 
ATOM   7875  C  CE1   . PHE C 2  596  ? -33.906 -1.072  -3.592  1.00 28.69  ? 596  PHE C CE1   1 
ATOM   7876  C  CE2   . PHE C 2  596  ? -31.884 0.160   -3.880  1.00 24.29  ? 596  PHE C CE2   1 
ATOM   7877  C  CZ    . PHE C 2  596  ? -33.223 -0.011  -4.148  1.00 25.16  ? 596  PHE C CZ    1 
ATOM   7878  N  N     . LEU C 2  597  ? -30.609 -3.377  2.009   1.00 25.45  ? 597  LEU C N     1 
ATOM   7879  C  CA    . LEU C 2  597  ? -29.756 -4.162  2.894   1.00 23.40  ? 597  LEU C CA    1 
ATOM   7880  C  C     . LEU C 2  597  ? -30.084 -5.649  2.828   1.00 27.29  ? 597  LEU C C     1 
ATOM   7881  O  O     . LEU C 2  597  ? -29.199 -6.496  2.963   1.00 31.65  ? 597  LEU C O     1 
ATOM   7882  C  CB    . LEU C 2  597  ? -29.880 -3.662  4.335   1.00 19.44  ? 597  LEU C CB    1 
ATOM   7883  C  CG    . LEU C 2  597  ? -29.157 -4.480  5.404   1.00 18.98  ? 597  LEU C CG    1 
ATOM   7884  C  CD1   . LEU C 2  597  ? -27.676 -4.569  5.092   1.00 23.75  ? 597  LEU C CD1   1 
ATOM   7885  C  CD2   . LEU C 2  597  ? -29.376 -3.880  6.778   1.00 18.34  ? 597  LEU C CD2   1 
ATOM   7886  N  N     . GLU C 2  598  ? -31.354 -5.968  2.598   1.00 27.32  ? 598  GLU C N     1 
ATOM   7887  C  CA    . GLU C 2  598  ? -31.793 -7.359  2.590   1.00 30.92  ? 598  GLU C CA    1 
ATOM   7888  C  C     . GLU C 2  598  ? -31.373 -8.078  1.303   1.00 31.37  ? 598  GLU C C     1 
ATOM   7889  O  O     . GLU C 2  598  ? -31.716 -9.240  1.086   1.00 31.15  ? 598  GLU C O     1 
ATOM   7890  C  CB    . GLU C 2  598  ? -33.312 -7.439  2.784   1.00 37.95  ? 598  GLU C CB    1 
ATOM   7891  C  CG    . GLU C 2  598  ? -34.141 -6.805  1.673   1.00 46.91  ? 598  GLU C CG    1 
ATOM   7892  C  CD    . GLU C 2  598  ? -34.765 -5.476  2.073   1.00 37.00  ? 598  GLU C CD    1 
ATOM   7893  O  OE1   . GLU C 2  598  ? -34.178 -4.765  2.916   1.00 31.23  ? 598  GLU C OE1   1 
ATOM   7894  O  OE2   . GLU C 2  598  ? -35.848 -5.145  1.544   1.00 47.20  ? 598  GLU C OE2   1 
ATOM   7895  N  N     . HIS C 2  599  ? -30.614 -7.381  0.464   1.00 30.88  ? 599  HIS C N     1 
ATOM   7896  C  CA    . HIS C 2  599  ? -30.113 -7.943  -0.784  1.00 29.88  ? 599  HIS C CA    1 
ATOM   7897  C  C     . HIS C 2  599  ? -28.605 -8.182  -0.720  1.00 28.55  ? 599  HIS C C     1 
ATOM   7898  O  O     . HIS C 2  599  ? -27.994 -8.624  -1.694  1.00 28.08  ? 599  HIS C O     1 
ATOM   7899  C  CB    . HIS C 2  599  ? -30.446 -7.019  -1.955  1.00 28.80  ? 599  HIS C CB    1 
ATOM   7900  C  CG    . HIS C 2  599  ? -31.913 -6.833  -2.185  1.00 32.70  ? 599  HIS C CG    1 
ATOM   7901  N  ND1   . HIS C 2  599  ? -32.684 -7.753  -2.863  1.00 35.35  ? 599  HIS C ND1   1 
ATOM   7902  C  CD2   . HIS C 2  599  ? -32.751 -5.829  -1.832  1.00 35.44  ? 599  HIS C CD2   1 
ATOM   7903  C  CE1   . HIS C 2  599  ? -33.933 -7.326  -2.915  1.00 36.96  ? 599  HIS C CE1   1 
ATOM   7904  N  NE2   . HIS C 2  599  ? -34.001 -6.160  -2.298  1.00 37.58  ? 599  HIS C NE2   1 
ATOM   7905  N  N     . ASP C 2  600  ? -28.008 -7.881  0.428   1.00 25.68  ? 600  ASP C N     1 
ATOM   7906  C  CA    . ASP C 2  600  ? -26.573 -8.066  0.615   1.00 21.01  ? 600  ASP C CA    1 
ATOM   7907  C  C     . ASP C 2  600  ? -26.294 -9.012  1.766   1.00 22.92  ? 600  ASP C C     1 
ATOM   7908  O  O     . ASP C 2  600  ? -26.843 -8.854  2.854   1.00 24.27  ? 600  ASP C O     1 
ATOM   7909  C  CB    . ASP C 2  600  ? -25.877 -6.734  0.874   1.00 20.32  ? 600  ASP C CB    1 
ATOM   7910  C  CG    . ASP C 2  600  ? -26.108 -5.734  -0.232  1.00 25.81  ? 600  ASP C CG    1 
ATOM   7911  O  OD1   . ASP C 2  600  ? -26.517 -6.151  -1.335  1.00 26.78  ? 600  ASP C OD1   1 
ATOM   7912  O  OD2   . ASP C 2  600  ? -25.878 -4.528  -0.000  1.00 23.65  ? 600  ASP C OD2   1 
ATOM   7913  N  N     . ASP C 2  601  ? -25.422 -9.984  1.522   1.00 24.90  ? 601  ASP C N     1 
ATOM   7914  C  CA    . ASP C 2  601  ? -25.103 -11.003 2.513   1.00 24.89  ? 601  ASP C CA    1 
ATOM   7915  C  C     . ASP C 2  601  ? -24.465 -10.395 3.759   1.00 22.82  ? 601  ASP C C     1 
ATOM   7916  O  O     . ASP C 2  601  ? -23.918 -9.293  3.718   1.00 23.94  ? 601  ASP C O     1 
ATOM   7917  C  CB    . ASP C 2  601  ? -24.182 -12.060 1.904   1.00 26.40  ? 601  ASP C CB    1 
ATOM   7918  C  CG    . ASP C 2  601  ? -24.222 -13.369 2.659   1.00 27.78  ? 601  ASP C CG    1 
ATOM   7919  O  OD1   . ASP C 2  601  ? -24.320 -14.431 2.008   1.00 30.30  ? 601  ASP C OD1   1 
ATOM   7920  O  OD2   . ASP C 2  601  ? -24.158 -13.335 3.905   1.00 25.96  ? 601  ASP C OD2   1 
ATOM   7921  N  N     . ALA C 2  602  ? -24.533 -11.135 4.860   1.00 22.52  ? 602  ALA C N     1 
ATOM   7922  C  CA    . ALA C 2  602  ? -24.129 -10.629 6.166   1.00 21.64  ? 602  ALA C CA    1 
ATOM   7923  C  C     . ALA C 2  602  ? -22.643 -10.303 6.238   1.00 20.25  ? 602  ALA C C     1 
ATOM   7924  O  O     . ALA C 2  602  ? -22.196 -9.612  7.152   1.00 20.29  ? 602  ALA C O     1 
ATOM   7925  C  CB    . ALA C 2  602  ? -24.496 -11.633 7.244   1.00 21.60  ? 602  ALA C CB    1 
ATOM   7926  N  N     . ASN C 2  603  ? -21.880 -10.801 5.272   1.00 20.34  ? 603  ASN C N     1 
ATOM   7927  C  CA    . ASN C 2  603  ? -20.440 -10.593 5.257   1.00 22.01  ? 603  ASN C CA    1 
ATOM   7928  C  C     . ASN C 2  603  ? -20.053 -9.259  4.648   1.00 21.44  ? 603  ASN C C     1 
ATOM   7929  O  O     . ASN C 2  603  ? -19.157 -8.577  5.142   1.00 25.98  ? 603  ASN C O     1 
ATOM   7930  C  CB    . ASN C 2  603  ? -19.754 -11.727 4.503   1.00 27.92  ? 603  ASN C CB    1 
ATOM   7931  C  CG    . ASN C 2  603  ? -19.914 -13.056 5.197   1.00 34.47  ? 603  ASN C CG    1 
ATOM   7932  O  OD1   . ASN C 2  603  ? -19.106 -13.423 6.049   1.00 35.08  ? 603  ASN C OD1   1 
ATOM   7933  N  ND2   . ASN C 2  603  ? -20.967 -13.786 4.846   1.00 43.64  ? 603  ASN C ND2   1 
ATOM   7934  N  N     . ARG C 2  604  ? -20.724 -8.884  3.569   1.00 18.15  ? 604  ARG C N     1 
ATOM   7935  C  CA    . ARG C 2  604  ? -20.419 -7.613  2.937   1.00 18.52  ? 604  ARG C CA    1 
ATOM   7936  C  C     . ARG C 2  604  ? -21.215 -6.497  3.599   1.00 17.73  ? 604  ARG C C     1 
ATOM   7937  O  O     . ARG C 2  604  ? -20.765 -5.354  3.649   1.00 17.41  ? 604  ARG C O     1 
ATOM   7938  C  CB    . ARG C 2  604  ? -20.695 -7.666  1.435   1.00 18.49  ? 604  ARG C CB    1 
ATOM   7939  C  CG    . ARG C 2  604  ? -19.871 -8.721  0.705   1.00 24.63  ? 604  ARG C CG    1 
ATOM   7940  C  CD    . ARG C 2  604  ? -18.413 -8.704  1.150   1.00 23.18  ? 604  ARG C CD    1 
ATOM   7941  N  NE    . ARG C 2  604  ? -17.590 -7.808  0.344   1.00 20.90  ? 604  ARG C NE    1 
ATOM   7942  C  CZ    . ARG C 2  604  ? -16.384 -8.122  -0.117  1.00 22.41  ? 604  ARG C CZ    1 
ATOM   7943  N  NH1   . ARG C 2  604  ? -15.863 -9.311  0.150   1.00 28.30  ? 604  ARG C NH1   1 
ATOM   7944  N  NH2   . ARG C 2  604  ? -15.700 -7.249  -0.844  1.00 19.59  ? 604  ARG C NH2   1 
ATOM   7945  N  N     . ALA C 2  605  ? -22.390 -6.831  4.125   1.00 18.37  ? 605  ALA C N     1 
ATOM   7946  C  CA    . ALA C 2  605  ? -23.189 -5.852  4.855   1.00 18.54  ? 605  ALA C CA    1 
ATOM   7947  C  C     . ALA C 2  605  ? -22.450 -5.415  6.111   1.00 16.78  ? 605  ALA C C     1 
ATOM   7948  O  O     . ALA C 2  605  ? -22.527 -4.258  6.517   1.00 15.35  ? 605  ALA C O     1 
ATOM   7949  C  CB    . ALA C 2  605  ? -24.554 -6.422  5.209   1.00 20.23  ? 605  ALA C CB    1 
ATOM   7950  N  N     . LEU C 2  606  ? -21.730 -6.352  6.717   1.00 16.31  ? 606  LEU C N     1 
ATOM   7951  C  CA    . LEU C 2  606  ? -20.921 -6.060  7.891   1.00 14.82  ? 606  LEU C CA    1 
ATOM   7952  C  C     . LEU C 2  606  ? -19.851 -5.038  7.539   1.00 13.24  ? 606  LEU C C     1 
ATOM   7953  O  O     . LEU C 2  606  ? -19.718 -4.014  8.204   1.00 15.72  ? 606  LEU C O     1 
ATOM   7954  C  CB    . LEU C 2  606  ? -20.290 -7.344  8.438   1.00 12.22  ? 606  LEU C CB    1 
ATOM   7955  C  CG    . LEU C 2  606  ? -19.569 -7.325  9.786   1.00 11.98  ? 606  LEU C CG    1 
ATOM   7956  C  CD1   . LEU C 2  606  ? -19.675 -8.693  10.430  1.00 14.71  ? 606  LEU C CD1   1 
ATOM   7957  C  CD2   . LEU C 2  606  ? -18.110 -6.939  9.618   1.00 15.42  ? 606  LEU C CD2   1 
ATOM   7958  N  N     . MET C 2  607  ? -19.093 -5.318  6.486   1.00 12.66  ? 607  MET C N     1 
ATOM   7959  C  CA    . MET C 2  607  ? -18.055 -4.397  6.054   1.00 12.82  ? 607  MET C CA    1 
ATOM   7960  C  C     . MET C 2  607  ? -18.682 -3.064  5.680   1.00 13.81  ? 607  MET C C     1 
ATOM   7961  O  O     . MET C 2  607  ? -18.166 -2.010  6.039   1.00 16.84  ? 607  MET C O     1 
ATOM   7962  C  CB    . MET C 2  607  ? -17.269 -4.965  4.875   1.00 14.36  ? 607  MET C CB    1 
ATOM   7963  C  CG    . MET C 2  607  ? -16.743 -6.363  5.103   1.00 17.71  ? 607  MET C CG    1 
ATOM   7964  S  SD    . MET C 2  607  ? -16.075 -7.083  3.596   1.00 18.39  ? 607  MET C SD    1 
ATOM   7965  C  CE    . MET C 2  607  ? -15.897 -8.788  4.102   1.00 27.82  ? 607  MET C CE    1 
ATOM   7966  N  N     . GLY C 2  608  ? -19.812 -3.116  4.983   1.00 11.79  ? 608  GLY C N     1 
ATOM   7967  C  CA    . GLY C 2  608  ? -20.533 -1.911  4.612   1.00 15.47  ? 608  GLY C CA    1 
ATOM   7968  C  C     . GLY C 2  608  ? -20.810 -0.955  5.763   1.00 17.45  ? 608  GLY C C     1 
ATOM   7969  O  O     . GLY C 2  608  ? -20.863 0.258   5.563   1.00 18.30  ? 608  GLY C O     1 
ATOM   7970  N  N     . ALA C 2  609  ? -20.977 -1.500  6.966   1.00 16.76  ? 609  ALA C N     1 
ATOM   7971  C  CA    . ALA C 2  609  ? -21.294 -0.705  8.153   1.00 15.19  ? 609  ALA C CA    1 
ATOM   7972  C  C     . ALA C 2  609  ? -20.025 -0.262  8.853   1.00 16.18  ? 609  ALA C C     1 
ATOM   7973  O  O     . ALA C 2  609  ? -19.961 0.811   9.458   1.00 12.33  ? 609  ALA C O     1 
ATOM   7974  C  CB    . ALA C 2  609  ? -22.160 -1.504  9.103   1.00 13.87  ? 609  ALA C CB    1 
ATOM   7975  N  N     . ASN C 2  610  ? -19.021 -1.125  8.754   1.00 15.27  ? 610  ASN C N     1 
ATOM   7976  C  CA    . ASN C 2  610  ? -17.712 -0.919  9.351   1.00 18.96  ? 610  ASN C CA    1 
ATOM   7977  C  C     . ASN C 2  610  ? -16.846 0.014   8.517   1.00 16.64  ? 610  ASN C C     1 
ATOM   7978  O  O     . ASN C 2  610  ? -15.803 0.488   8.967   1.00 17.37  ? 610  ASN C O     1 
ATOM   7979  C  CB    . ASN C 2  610  ? -17.010 -2.267  9.535   1.00 21.25  ? 610  ASN C CB    1 
ATOM   7980  C  CG    . ASN C 2  610  ? -16.960 -2.704  10.983  1.00 19.62  ? 610  ASN C CG    1 
ATOM   7981  O  OD1   . ASN C 2  610  ? -17.467 -2.014  11.866  1.00 21.46  ? 610  ASN C OD1   1 
ATOM   7982  N  ND2   . ASN C 2  610  ? -16.349 -3.857  11.234  1.00 16.67  ? 610  ASN C ND2   1 
ATOM   7983  N  N     . MET C 2  611  ? -17.282 0.283   7.296   1.00 13.11  ? 611  MET C N     1 
ATOM   7984  C  CA    . MET C 2  611  ? -16.544 1.203   6.449   1.00 13.29  ? 611  MET C CA    1 
ATOM   7985  C  C     . MET C 2  611  ? -17.145 2.615   6.459   1.00 13.62  ? 611  MET C C     1 
ATOM   7986  O  O     . MET C 2  611  ? -16.420 3.585   6.257   1.00 12.92  ? 611  MET C O     1 
ATOM   7987  C  CB    . MET C 2  611  ? -16.466 0.669   5.015   1.00 15.84  ? 611  MET C CB    1 
ATOM   7988  C  CG    . MET C 2  611  ? -15.599 -0.575  4.831   1.00 14.50  ? 611  MET C CG    1 
ATOM   7989  S  SD    . MET C 2  611  ? -15.452 -1.001  3.085   1.00 9.38   ? 611  MET C SD    1 
ATOM   7990  C  CE    . MET C 2  611  ? -17.163 -0.902  2.577   1.00 10.81  ? 611  MET C CE    1 
ATOM   7991  N  N     . GLN C 2  612  ? -18.452 2.737   6.696   1.00 14.51  ? 612  GLN C N     1 
ATOM   7992  C  CA    . GLN C 2  612  ? -19.102 4.057   6.702   1.00 14.29  ? 612  GLN C CA    1 
ATOM   7993  C  C     . GLN C 2  612  ? -18.444 4.980   7.727   1.00 12.95  ? 612  GLN C C     1 
ATOM   7994  O  O     . GLN C 2  612  ? -18.287 6.181   7.494   1.00 10.93  ? 612  GLN C O     1 
ATOM   7995  C  CB    . GLN C 2  612  ? -20.596 3.947   7.008   1.00 15.92  ? 612  GLN C CB    1 
ATOM   7996  C  CG    . GLN C 2  612  ? -21.445 3.323   5.906   1.00 17.96  ? 612  GLN C CG    1 
ATOM   7997  C  CD    . GLN C 2  612  ? -22.877 3.072   6.358   1.00 26.52  ? 612  GLN C CD    1 
ATOM   7998  O  OE1   . GLN C 2  612  ? -23.363 3.708   7.296   1.00 32.51  ? 612  GLN C OE1   1 
ATOM   7999  N  NE2   . GLN C 2  612  ? -23.554 2.135   5.702   1.00 25.30  ? 612  GLN C NE2   1 
ATOM   8000  N  N     . ARG C 2  613  ? -18.059 4.396   8.857   1.00 10.93  ? 613  ARG C N     1 
ATOM   8001  C  CA    . ARG C 2  613  ? -17.316 5.081   9.910   1.00 12.76  ? 613  ARG C CA    1 
ATOM   8002  C  C     . ARG C 2  613  ? -15.992 5.650   9.390   1.00 12.34  ? 613  ARG C C     1 
ATOM   8003  O  O     . ARG C 2  613  ? -15.484 6.648   9.911   1.00 12.79  ? 613  ARG C O     1 
ATOM   8004  C  CB    . ARG C 2  613  ? -17.067 4.107   11.061  1.00 13.74  ? 613  ARG C CB    1 
ATOM   8005  C  CG    . ARG C 2  613  ? -15.795 4.329   11.861  1.00 15.62  ? 613  ARG C CG    1 
ATOM   8006  C  CD    . ARG C 2  613  ? -15.649 3.281   12.950  1.00 21.60  ? 613  ARG C CD    1 
ATOM   8007  N  NE    . ARG C 2  613  ? -15.625 1.923   12.419  1.00 28.27  ? 613  ARG C NE    1 
ATOM   8008  C  CZ    . ARG C 2  613  ? -14.520 1.290   12.040  1.00 27.36  ? 613  ARG C CZ    1 
ATOM   8009  N  NH1   . ARG C 2  613  ? -13.343 1.894   12.129  1.00 29.23  ? 613  ARG C NH1   1 
ATOM   8010  N  NH2   . ARG C 2  613  ? -14.590 0.054   11.571  1.00 24.06  ? 613  ARG C NH2   1 
ATOM   8011  N  N     . GLN C 2  614  ? -15.458 5.025   8.340   1.00 12.64  ? 614  GLN C N     1 
ATOM   8012  C  CA    . GLN C 2  614  ? -14.128 5.339   7.821   1.00 12.36  ? 614  GLN C CA    1 
ATOM   8013  C  C     . GLN C 2  614  ? -14.134 6.373   6.693   1.00 12.24  ? 614  GLN C C     1 
ATOM   8014  O  O     . GLN C 2  614  ? -13.104 6.624   6.078   1.00 7.37   ? 614  GLN C O     1 
ATOM   8015  C  CB    . GLN C 2  614  ? -13.450 4.040   7.340   1.00 14.18  ? 614  GLN C CB    1 
ATOM   8016  C  CG    . GLN C 2  614  ? -13.335 2.932   8.383   1.00 19.63  ? 614  GLN C CG    1 
ATOM   8017  C  CD    . GLN C 2  614  ? -12.566 1.717   7.881   1.00 22.21  ? 614  GLN C CD    1 
ATOM   8018  O  OE1   . GLN C 2  614  ? -12.203 1.644   6.711   1.00 21.23  ? 614  GLN C OE1   1 
ATOM   8019  N  NE2   . GLN C 2  614  ? -12.313 0.758   8.771   1.00 30.83  ? 614  GLN C NE2   1 
ATOM   8020  N  N     . ALA C 2  615  ? -15.289 6.969   6.426   1.00 9.04   ? 615  ALA C N     1 
ATOM   8021  C  CA    . ALA C 2  615  ? -15.409 7.907   5.311   1.00 11.28  ? 615  ALA C CA    1 
ATOM   8022  C  C     . ALA C 2  615  ? -14.775 9.257   5.641   1.00 7.25   ? 615  ALA C C     1 
ATOM   8023  O  O     . ALA C 2  615  ? -14.879 9.732   6.765   1.00 10.14  ? 615  ALA C O     1 
ATOM   8024  C  CB    . ALA C 2  615  ? -16.869 8.091   4.927   1.00 9.20   ? 615  ALA C CB    1 
ATOM   8025  N  N     . VAL C 2  616  ? -14.119 9.872   4.661   1.00 23.97  ? 616  VAL C N     1 
ATOM   8026  C  CA    . VAL C 2  616  ? -13.474 11.169  4.852   1.00 10.29  ? 616  VAL C CA    1 
ATOM   8027  C  C     . VAL C 2  616  ? -14.393 12.310  4.430   1.00 7.66   ? 616  VAL C C     1 
ATOM   8028  O  O     . VAL C 2  616  ? -15.015 12.241  3.378   1.00 12.61  ? 616  VAL C O     1 
ATOM   8029  C  CB    . VAL C 2  616  ? -12.157 11.254  4.049   1.00 10.01  ? 616  VAL C CB    1 
ATOM   8030  C  CG1   . VAL C 2  616  ? -11.516 12.624  4.184   1.00 12.31  ? 616  VAL C CG1   1 
ATOM   8031  C  CG2   . VAL C 2  616  ? -11.199 10.192  4.501   1.00 10.91  ? 616  VAL C CG2   1 
ATOM   8032  N  N     . PRO C 2  617  ? -14.481 13.368  5.251   1.00 9.01   ? 617  PRO C N     1 
ATOM   8033  C  CA    . PRO C 2  617  ? -15.239 14.569  4.886   1.00 8.77   ? 617  PRO C CA    1 
ATOM   8034  C  C     . PRO C 2  617  ? -14.640 15.279  3.678   1.00 8.53   ? 617  PRO C C     1 
ATOM   8035  O  O     . PRO C 2  617  ? -13.441 15.541  3.665   1.00 10.36  ? 617  PRO C O     1 
ATOM   8036  C  CB    . PRO C 2  617  ? -15.129 15.436  6.138   1.00 11.57  ? 617  PRO C CB    1 
ATOM   8037  C  CG    . PRO C 2  617  ? -13.848 15.001  6.760   1.00 11.67  ? 617  PRO C CG    1 
ATOM   8038  C  CD    . PRO C 2  617  ? -13.830 13.520  6.561   1.00 11.23  ? 617  PRO C CD    1 
ATOM   8039  N  N     . LEU C 2  618  ? -15.460 15.591  2.681   1.00 9.51   ? 618  LEU C N     1 
ATOM   8040  C  CA    . LEU C 2  618  ? -14.951 16.183  1.448   1.00 12.19  ? 618  LEU C CA    1 
ATOM   8041  C  C     . LEU C 2  618  ? -15.052 17.705  1.468   1.00 17.11  ? 618  LEU C C     1 
ATOM   8042  O  O     . LEU C 2  618  ? -15.779 18.263  2.290   1.00 21.74  ? 618  LEU C O     1 
ATOM   8043  C  CB    . LEU C 2  618  ? -15.704 15.612  0.250   1.00 13.83  ? 618  LEU C CB    1 
ATOM   8044  C  CG    . LEU C 2  618  ? -15.660 14.084  0.196   1.00 12.95  ? 618  LEU C CG    1 
ATOM   8045  C  CD1   . LEU C 2  618  ? -16.573 13.546  -0.892  1.00 13.60  ? 618  LEU C CD1   1 
ATOM   8046  C  CD2   . LEU C 2  618  ? -14.232 13.588  0.000   1.00 12.30  ? 618  LEU C CD2   1 
ATOM   8047  N  N     . VAL C 2  619  ? -14.314 18.358  0.565   1.00 18.06  ? 619  VAL C N     1 
ATOM   8048  C  CA    . VAL C 2  619  ? -14.249 19.823  0.479   1.00 17.50  ? 619  VAL C CA    1 
ATOM   8049  C  C     . VAL C 2  619  ? -15.643 20.438  0.494   1.00 21.08  ? 619  VAL C C     1 
ATOM   8050  O  O     . VAL C 2  619  ? -15.908 21.391  1.231   1.00 24.68  ? 619  VAL C O     1 
ATOM   8051  C  CB    . VAL C 2  619  ? -13.506 20.285  -0.790  1.00 17.49  ? 619  VAL C CB    1 
ATOM   8052  C  CG1   . VAL C 2  619  ? -13.583 21.793  -0.937  1.00 15.45  ? 619  VAL C CG1   1 
ATOM   8053  C  CG2   . VAL C 2  619  ? -12.057 19.829  -0.753  1.00 17.38  ? 619  VAL C CG2   1 
ATOM   8054  N  N     . ARG C 2  620  ? -16.531 19.886  -0.324  1.00 18.79  ? 620  ARG C N     1 
ATOM   8055  C  CA    . ARG C 2  620  ? -17.956 20.132  -0.163  1.00 27.00  ? 620  ARG C CA    1 
ATOM   8056  C  C     . ARG C 2  620  ? -18.693 18.834  -0.432  1.00 25.13  ? 620  ARG C C     1 
ATOM   8057  O  O     . ARG C 2  620  ? -18.244 18.026  -1.241  1.00 19.68  ? 620  ARG C O     1 
ATOM   8058  C  CB    . ARG C 2  620  ? -18.449 21.251  -1.080  1.00 41.98  ? 620  ARG C CB    1 
ATOM   8059  C  CG    . ARG C 2  620  ? -18.757 20.865  -2.521  1.00 44.38  ? 620  ARG C CG    1 
ATOM   8060  C  CD    . ARG C 2  620  ? -19.390 22.059  -3.224  1.00 53.49  ? 620  ARG C CD    1 
ATOM   8061  N  NE    . ARG C 2  620  ? -19.632 21.844  -4.646  1.00 60.17  ? 620  ARG C NE    1 
ATOM   8062  C  CZ    . ARG C 2  620  ? -20.082 22.787  -5.467  1.00 62.55  ? 620  ARG C CZ    1 
ATOM   8063  N  NH1   . ARG C 2  620  ? -20.278 22.517  -6.750  1.00 73.17  ? 620  ARG C NH1   1 
ATOM   8064  N  NH2   . ARG C 2  620  ? -20.333 24.006  -5.004  1.00 54.77  ? 620  ARG C NH2   1 
ATOM   8065  N  N     . SER C 2  621  ? -19.817 18.638  0.251   1.00 30.88  ? 621  SER C N     1 
ATOM   8066  C  CA    . SER C 2  621  ? -20.498 17.345  0.266   1.00 28.72  ? 621  SER C CA    1 
ATOM   8067  C  C     . SER C 2  621  ? -21.889 17.370  -0.363  1.00 20.48  ? 621  SER C C     1 
ATOM   8068  O  O     . SER C 2  621  ? -22.624 18.350  -0.253  1.00 19.54  ? 621  SER C O     1 
ATOM   8069  C  CB    . SER C 2  621  ? -20.598 16.834  1.708   1.00 26.35  ? 621  SER C CB    1 
ATOM   8070  O  OG    . SER C 2  621  ? -20.995 17.878  2.590   1.00 24.61  ? 621  SER C OG    1 
ATOM   8071  N  N     . GLU C 2  622  ? -22.238 16.276  -1.030  1.00 18.69  ? 622  GLU C N     1 
ATOM   8072  C  CA    . GLU C 2  622  ? -23.577 16.096  -1.570  1.00 18.15  ? 622  GLU C CA    1 
ATOM   8073  C  C     . GLU C 2  622  ? -24.292 15.002  -0.795  1.00 21.93  ? 622  GLU C C     1 
ATOM   8074  O  O     . GLU C 2  622  ? -23.673 14.020  -0.389  1.00 23.20  ? 622  GLU C O     1 
ATOM   8075  C  CB    . GLU C 2  622  ? -23.536 15.716  -3.053  1.00 22.45  ? 622  GLU C CB    1 
ATOM   8076  C  CG    . GLU C 2  622  ? -22.474 16.422  -3.877  1.00 36.05  ? 622  GLU C CG    1 
ATOM   8077  C  CD    . GLU C 2  622  ? -22.240 15.750  -5.225  1.00 37.23  ? 622  GLU C CD    1 
ATOM   8078  O  OE1   . GLU C 2  622  ? -22.701 14.602  -5.417  1.00 21.86  ? 622  GLU C OE1   1 
ATOM   8079  O  OE2   . GLU C 2  622  ? -21.592 16.370  -6.093  1.00 46.52  ? 622  GLU C OE2   1 
ATOM   8080  N  N     . ALA C 2  623  ? -25.593 15.160  -0.596  1.00 23.98  ? 623  ALA C N     1 
ATOM   8081  C  CA    . ALA C 2  623  ? -26.399 14.066  -0.073  1.00 20.55  ? 623  ALA C CA    1 
ATOM   8082  C  C     . ALA C 2  623  ? -26.530 12.987  -1.143  1.00 15.85  ? 623  ALA C C     1 
ATOM   8083  O  O     . ALA C 2  623  ? -26.389 13.271  -2.331  1.00 16.77  ? 623  ALA C O     1 
ATOM   8084  C  CB    . ALA C 2  623  ? -27.764 14.567  0.358   1.00 31.37  ? 623  ALA C CB    1 
ATOM   8085  N  N     . PRO C 2  624  ? -26.793 11.741  -0.733  1.00 14.36  ? 624  PRO C N     1 
ATOM   8086  C  CA    . PRO C 2  624  ? -26.986 10.703  -1.745  1.00 17.67  ? 624  PRO C CA    1 
ATOM   8087  C  C     . PRO C 2  624  ? -28.335 10.830  -2.437  1.00 19.44  ? 624  PRO C C     1 
ATOM   8088  O  O     . PRO C 2  624  ? -29.321 11.196  -1.799  1.00 19.74  ? 624  PRO C O     1 
ATOM   8089  C  CB    . PRO C 2  624  ? -26.916 9.414   -0.932  1.00 20.20  ? 624  PRO C CB    1 
ATOM   8090  C  CG    . PRO C 2  624  ? -27.454 9.812   0.394   1.00 20.81  ? 624  PRO C CG    1 
ATOM   8091  C  CD    . PRO C 2  624  ? -26.914 11.199  0.631   1.00 16.18  ? 624  PRO C CD    1 
ATOM   8092  N  N     . LEU C 2  625  ? -28.365 10.537  -3.733  1.00 20.13  ? 625  LEU C N     1 
ATOM   8093  C  CA    . LEU C 2  625  ? -29.613 10.470  -4.479  1.00 19.60  ? 625  LEU C CA    1 
ATOM   8094  C  C     . LEU C 2  625  ? -30.507 9.375   -3.918  1.00 22.19  ? 625  LEU C C     1 
ATOM   8095  O  O     . LEU C 2  625  ? -31.722 9.535   -3.818  1.00 27.84  ? 625  LEU C O     1 
ATOM   8096  C  CB    . LEU C 2  625  ? -29.338 10.216  -5.958  1.00 19.37  ? 625  LEU C CB    1 
ATOM   8097  C  CG    . LEU C 2  625  ? -28.901 11.430  -6.772  1.00 20.64  ? 625  LEU C CG    1 
ATOM   8098  C  CD1   . LEU C 2  625  ? -28.335 10.987  -8.106  1.00 26.58  ? 625  LEU C CD1   1 
ATOM   8099  C  CD2   . LEU C 2  625  ? -30.080 12.364  -6.974  1.00 25.95  ? 625  LEU C CD2   1 
ATOM   8100  N  N     . VAL C 2  626  ? -29.895 8.254   -3.559  1.00 20.37  ? 626  VAL C N     1 
ATOM   8101  C  CA    . VAL C 2  626  ? -30.622 7.165   -2.927  1.00 22.66  ? 626  VAL C CA    1 
ATOM   8102  C  C     . VAL C 2  626  ? -30.316 7.136   -1.434  1.00 26.20  ? 626  VAL C C     1 
ATOM   8103  O  O     . VAL C 2  626  ? -29.156 7.089   -1.031  1.00 28.43  ? 626  VAL C O     1 
ATOM   8104  C  CB    . VAL C 2  626  ? -30.268 5.803   -3.550  1.00 25.21  ? 626  VAL C CB    1 
ATOM   8105  C  CG1   . VAL C 2  626  ? -31.118 4.698   -2.929  1.00 24.46  ? 626  VAL C CG1   1 
ATOM   8106  C  CG2   . VAL C 2  626  ? -30.448 5.845   -5.064  1.00 24.92  ? 626  VAL C CG2   1 
ATOM   8107  N  N     . GLY C 2  627  ? -31.362 7.171   -0.615  1.00 27.57  ? 627  GLY C N     1 
ATOM   8108  C  CA    . GLY C 2  627  ? -31.198 7.147   0.827   1.00 27.44  ? 627  GLY C CA    1 
ATOM   8109  C  C     . GLY C 2  627  ? -32.059 6.087   1.489   1.00 25.24  ? 627  GLY C C     1 
ATOM   8110  O  O     . GLY C 2  627  ? -32.740 5.322   0.808   1.00 24.88  ? 627  GLY C O     1 
ATOM   8111  N  N     . THR C 2  628  ? -32.020 6.037   2.818   1.00 22.46  ? 628  THR C N     1 
ATOM   8112  C  CA    . THR C 2  628  ? -32.858 5.120   3.585   1.00 22.24  ? 628  THR C CA    1 
ATOM   8113  C  C     . THR C 2  628  ? -33.680 5.871   4.626   1.00 22.79  ? 628  THR C C     1 
ATOM   8114  O  O     . THR C 2  628  ? -34.518 5.283   5.312   1.00 23.37  ? 628  THR C O     1 
ATOM   8115  C  CB    . THR C 2  628  ? -32.027 4.059   4.301   1.00 20.10  ? 628  THR C CB    1 
ATOM   8116  O  OG1   . THR C 2  628  ? -31.406 4.643   5.450   1.00 25.57  ? 628  THR C OG1   1 
ATOM   8117  C  CG2   . THR C 2  628  ? -30.956 3.513   3.379   1.00 22.90  ? 628  THR C CG2   1 
ATOM   8118  N  N     . GLY C 2  629  ? -33.414 7.169   4.746   1.00 23.96  ? 629  GLY C N     1 
ATOM   8119  C  CA    . GLY C 2  629  ? -34.143 8.038   5.653   1.00 27.93  ? 629  GLY C CA    1 
ATOM   8120  C  C     . GLY C 2  629  ? -33.360 8.371   6.908   1.00 26.74  ? 629  GLY C C     1 
ATOM   8121  O  O     . GLY C 2  629  ? -33.582 9.404   7.539   1.00 33.62  ? 629  GLY C O     1 
ATOM   8122  N  N     . MET C 2  630  ? -32.431 7.490   7.261   1.00 23.06  ? 630  MET C N     1 
ATOM   8123  C  CA    . MET C 2  630  ? -31.678 7.609   8.506   1.00 25.08  ? 630  MET C CA    1 
ATOM   8124  C  C     . MET C 2  630  ? -30.693 8.774   8.465   1.00 25.36  ? 630  MET C C     1 
ATOM   8125  O  O     . MET C 2  630  ? -30.260 9.280   9.507   1.00 23.74  ? 630  MET C O     1 
ATOM   8126  C  CB    . MET C 2  630  ? -30.927 6.307   8.789   1.00 24.86  ? 630  MET C CB    1 
ATOM   8127  C  CG    . MET C 2  630  ? -30.263 6.243   10.156  1.00 27.27  ? 630  MET C CG    1 
ATOM   8128  S  SD    . MET C 2  630  ? -31.460 6.379   11.496  1.00 46.28  ? 630  MET C SD    1 
ATOM   8129  C  CE    . MET C 2  630  ? -32.510 4.972   11.154  1.00 30.24  ? 630  MET C CE    1 
ATOM   8130  N  N     . GLU C 2  631  ? -30.360 9.199   7.249   1.00 25.32  ? 631  GLU C N     1 
ATOM   8131  C  CA    . GLU C 2  631  ? -29.310 10.182  6.991   1.00 24.25  ? 631  GLU C CA    1 
ATOM   8132  C  C     . GLU C 2  631  ? -29.564 11.533  7.632   1.00 22.14  ? 631  GLU C C     1 
ATOM   8133  O  O     . GLU C 2  631  ? -28.647 12.334  7.794   1.00 18.94  ? 631  GLU C O     1 
ATOM   8134  C  CB    . GLU C 2  631  ? -29.137 10.376  5.488   1.00 25.61  ? 631  GLU C CB    1 
ATOM   8135  C  CG    . GLU C 2  631  ? -28.818 9.103   4.725   1.00 33.86  ? 631  GLU C CG    1 
ATOM   8136  C  CD    . GLU C 2  631  ? -30.059 8.303   4.356   1.00 35.60  ? 631  GLU C CD    1 
ATOM   8137  O  OE1   . GLU C 2  631  ? -31.179 8.719   4.724   1.00 30.99  ? 631  GLU C OE1   1 
ATOM   8138  O  OE2   . GLU C 2  631  ? -29.910 7.254   3.693   1.00 32.29  ? 631  GLU C OE2   1 
ATOM   8139  N  N     . LEU C 2  632  ? -30.816 11.795  7.975   1.00 24.67  ? 632  LEU C N     1 
ATOM   8140  C  CA    . LEU C 2  632  ? -31.161 13.050  8.617   1.00 24.82  ? 632  LEU C CA    1 
ATOM   8141  C  C     . LEU C 2  632  ? -30.880 12.986  10.106  1.00 22.33  ? 632  LEU C C     1 
ATOM   8142  O  O     . LEU C 2  632  ? -30.051 13.734  10.623  1.00 23.64  ? 632  LEU C O     1 
ATOM   8143  C  CB    . LEU C 2  632  ? -32.627 13.399  8.382   1.00 26.37  ? 632  LEU C CB    1 
ATOM   8144  C  CG    . LEU C 2  632  ? -33.104 14.605  9.189   1.00 23.82  ? 632  LEU C CG    1 
ATOM   8145  C  CD1   . LEU C 2  632  ? -32.471 15.892  8.681   1.00 18.12  ? 632  LEU C CD1   1 
ATOM   8146  C  CD2   . LEU C 2  632  ? -34.615 14.686  9.151   1.00 43.61  ? 632  LEU C CD2   1 
ATOM   8147  N  N     . ARG C 2  633  ? -31.572 12.082  10.791  1.00 21.69  ? 633  ARG C N     1 
ATOM   8148  C  CA    . ARG C 2  633  ? -31.492 12.014  12.242  1.00 21.88  ? 633  ARG C CA    1 
ATOM   8149  C  C     . ARG C 2  633  ? -30.060 11.746  12.700  1.00 21.52  ? 633  ARG C C     1 
ATOM   8150  O  O     . ARG C 2  633  ? -29.627 12.269  13.727  1.00 24.13  ? 633  ARG C O     1 
ATOM   8151  C  CB    . ARG C 2  633  ? -32.448 10.947  12.785  1.00 21.47  ? 633  ARG C CB    1 
ATOM   8152  C  CG    . ARG C 2  633  ? -33.913 11.389  12.832  1.00 27.61  ? 633  ARG C CG    1 
ATOM   8153  C  CD    . ARG C 2  633  ? -34.128 12.551  13.797  1.00 21.99  ? 633  ARG C CD    1 
ATOM   8154  N  NE    . ARG C 2  633  ? -33.574 12.272  15.118  1.00 18.81  ? 633  ARG C NE    1 
ATOM   8155  C  CZ    . ARG C 2  633  ? -34.198 11.572  16.059  1.00 19.01  ? 633  ARG C CZ    1 
ATOM   8156  N  NH1   . ARG C 2  633  ? -35.404 11.073  15.829  1.00 20.02  ? 633  ARG C NH1   1 
ATOM   8157  N  NH2   . ARG C 2  633  ? -33.614 11.366  17.231  1.00 19.57  ? 633  ARG C NH2   1 
ATOM   8158  N  N     . ALA C 2  634  ? -29.322 10.963  11.920  1.00 17.90  ? 634  ALA C N     1 
ATOM   8159  C  CA    . ALA C 2  634  ? -27.934 10.648  12.242  1.00 18.04  ? 634  ALA C CA    1 
ATOM   8160  C  C     . ALA C 2  634  ? -27.059 11.900  12.284  1.00 19.94  ? 634  ALA C C     1 
ATOM   8161  O  O     . ALA C 2  634  ? -26.254 12.070  13.199  1.00 20.07  ? 634  ALA C O     1 
ATOM   8162  C  CB    . ALA C 2  634  ? -27.375 9.652   11.243  1.00 20.77  ? 634  ALA C CB    1 
ATOM   8163  N  N     . ALA C 2  635  ? -27.219 12.770  11.290  1.00 21.86  ? 635  ALA C N     1 
ATOM   8164  C  CA    . ALA C 2  635  ? -26.440 14.004  11.225  1.00 19.43  ? 635  ALA C CA    1 
ATOM   8165  C  C     . ALA C 2  635  ? -26.771 14.911  12.399  1.00 18.70  ? 635  ALA C C     1 
ATOM   8166  O  O     . ALA C 2  635  ? -25.885 15.518  12.998  1.00 22.12  ? 635  ALA C O     1 
ATOM   8167  C  CB    . ALA C 2  635  ? -26.686 14.731  9.906   1.00 19.63  ? 635  ALA C CB    1 
ATOM   8168  N  N     . ILE C 2  636  ? -28.052 14.993  12.734  1.00 16.29  ? 636  ILE C N     1 
ATOM   8169  C  CA    . ILE C 2  636  ? -28.486 15.896  13.786  1.00 14.18  ? 636  ILE C CA    1 
ATOM   8170  C  C     . ILE C 2  636  ? -27.979 15.449  15.145  1.00 14.81  ? 636  ILE C C     1 
ATOM   8171  O  O     . ILE C 2  636  ? -27.374 16.228  15.875  1.00 19.11  ? 636  ILE C O     1 
ATOM   8172  C  CB    . ILE C 2  636  ? -30.011 16.011  13.825  1.00 16.50  ? 636  ILE C CB    1 
ATOM   8173  C  CG1   . ILE C 2  636  ? -30.506 16.745  12.578  1.00 20.94  ? 636  ILE C CG1   1 
ATOM   8174  C  CG2   . ILE C 2  636  ? -30.451 16.756  15.071  1.00 22.04  ? 636  ILE C CG2   1 
ATOM   8175  C  CD1   . ILE C 2  636  ? -32.009 16.921  12.523  1.00 25.30  ? 636  ILE C CD1   1 
ATOM   8176  N  N     . ASP C 2  637  ? -28.216 14.185  15.470  1.00 14.98  ? 637  ASP C N     1 
ATOM   8177  C  CA    . ASP C 2  637  ? -27.851 13.647  16.775  1.00 18.75  ? 637  ASP C CA    1 
ATOM   8178  C  C     . ASP C 2  637  ? -26.346 13.620  17.010  1.00 18.64  ? 637  ASP C C     1 
ATOM   8179  O  O     . ASP C 2  637  ? -25.888 13.651  18.152  1.00 15.15  ? 637  ASP C O     1 
ATOM   8180  C  CB    . ASP C 2  637  ? -28.417 12.238  16.935  1.00 19.23  ? 637  ASP C CB    1 
ATOM   8181  C  CG    . ASP C 2  637  ? -29.918 12.235  17.141  1.00 19.52  ? 637  ASP C CG    1 
ATOM   8182  O  OD1   . ASP C 2  637  ? -30.590 13.186  16.680  1.00 22.80  ? 637  ASP C OD1   1 
ATOM   8183  O  OD2   . ASP C 2  637  ? -30.421 11.281  17.771  1.00 15.91  ? 637  ASP C OD2   1 
ATOM   8184  N  N     . ALA C 2  638  ? -25.588 13.562  15.920  1.00 19.99  ? 638  ALA C N     1 
ATOM   8185  C  CA    . ALA C 2  638  ? -24.134 13.461  15.976  1.00 20.57  ? 638  ALA C CA    1 
ATOM   8186  C  C     . ALA C 2  638  ? -23.512 14.602  16.768  1.00 25.88  ? 638  ALA C C     1 
ATOM   8187  O  O     . ALA C 2  638  ? -22.571 14.398  17.531  1.00 24.52  ? 638  ALA C O     1 
ATOM   8188  C  CB    . ALA C 2  638  ? -23.559 13.427  14.572  1.00 21.30  ? 638  ALA C CB    1 
ATOM   8189  N  N     . GLY C 2  639  ? -24.042 15.805  16.579  1.00 28.03  ? 639  GLY C N     1 
ATOM   8190  C  CA    . GLY C 2  639  ? -23.552 16.967  17.296  1.00 33.01  ? 639  GLY C CA    1 
ATOM   8191  C  C     . GLY C 2  639  ? -22.485 17.735  16.542  1.00 34.35  ? 639  GLY C C     1 
ATOM   8192  O  O     . GLY C 2  639  ? -21.878 18.656  17.087  1.00 33.11  ? 639  GLY C O     1 
ATOM   8193  N  N     . ASP C 2  640  ? -22.251 17.360  15.289  1.00 31.60  ? 640  ASP C N     1 
ATOM   8194  C  CA    . ASP C 2  640  ? -21.282 18.071  14.463  1.00 34.60  ? 640  ASP C CA    1 
ATOM   8195  C  C     . ASP C 2  640  ? -21.990 18.947  13.432  1.00 30.89  ? 640  ASP C C     1 
ATOM   8196  O  O     . ASP C 2  640  ? -21.399 19.355  12.433  1.00 29.92  ? 640  ASP C O     1 
ATOM   8197  C  CB    . ASP C 2  640  ? -20.324 17.088  13.786  1.00 36.89  ? 640  ASP C CB    1 
ATOM   8198  C  CG    . ASP C 2  640  ? -19.291 16.521  14.754  1.00 46.90  ? 640  ASP C CG    1 
ATOM   8199  O  OD1   . ASP C 2  640  ? -19.550 16.546  15.977  1.00 51.65  ? 640  ASP C OD1   1 
ATOM   8200  O  OD2   . ASP C 2  640  ? -18.222 16.056  14.299  1.00 39.60  ? 640  ASP C OD2   1 
ATOM   8201  N  N     . VAL C 2  641  ? -23.264 19.225  13.685  1.00 28.58  ? 641  VAL C N     1 
ATOM   8202  C  CA    . VAL C 2  641  ? -23.999 20.242  12.945  1.00 27.08  ? 641  VAL C CA    1 
ATOM   8203  C  C     . VAL C 2  641  ? -24.443 21.304  13.936  1.00 26.49  ? 641  VAL C C     1 
ATOM   8204  O  O     . VAL C 2  641  ? -24.194 21.172  15.131  1.00 31.55  ? 641  VAL C O     1 
ATOM   8205  C  CB    . VAL C 2  641  ? -25.225 19.671  12.209  1.00 27.03  ? 641  VAL C CB    1 
ATOM   8206  C  CG1   . VAL C 2  641  ? -24.788 18.787  11.051  1.00 30.21  ? 641  VAL C CG1   1 
ATOM   8207  C  CG2   . VAL C 2  641  ? -26.130 18.916  13.179  1.00 25.19  ? 641  VAL C CG2   1 
ATOM   8208  N  N     . VAL C 2  642  ? -25.096 22.355  13.451  1.00 26.67  ? 642  VAL C N     1 
ATOM   8209  C  CA    . VAL C 2  642  ? -25.577 23.408  14.340  1.00 23.49  ? 642  VAL C CA    1 
ATOM   8210  C  C     . VAL C 2  642  ? -27.089 23.553  14.301  1.00 25.09  ? 642  VAL C C     1 
ATOM   8211  O  O     . VAL C 2  642  ? -27.670 23.935  13.286  1.00 27.27  ? 642  VAL C O     1 
ATOM   8212  C  CB    . VAL C 2  642  ? -24.958 24.766  14.003  1.00 19.81  ? 642  VAL C CB    1 
ATOM   8213  C  CG1   . VAL C 2  642  ? -25.503 25.821  14.942  1.00 20.55  ? 642  VAL C CG1   1 
ATOM   8214  C  CG2   . VAL C 2  642  ? -23.450 24.694  14.105  1.00 24.63  ? 642  VAL C CG2   1 
ATOM   8215  N  N     . VAL C 2  643  ? -27.722 23.261  15.428  1.00 26.59  ? 643  VAL C N     1 
ATOM   8216  C  CA    . VAL C 2  643  ? -29.168 23.298  15.508  1.00 26.16  ? 643  VAL C CA    1 
ATOM   8217  C  C     . VAL C 2  643  ? -29.623 24.529  16.279  1.00 30.94  ? 643  VAL C C     1 
ATOM   8218  O  O     . VAL C 2  643  ? -28.923 25.005  17.174  1.00 31.68  ? 643  VAL C O     1 
ATOM   8219  C  CB    . VAL C 2  643  ? -29.708 22.029  16.169  1.00 26.88  ? 643  VAL C CB    1 
ATOM   8220  C  CG1   . VAL C 2  643  ? -31.199 21.909  15.945  1.00 29.51  ? 643  VAL C CG1   1 
ATOM   8221  C  CG2   . VAL C 2  643  ? -28.994 20.817  15.599  1.00 32.12  ? 643  VAL C CG2   1 
ATOM   8222  N  N     . ALA C 2  644  ? -30.790 25.047  15.909  1.00 30.74  ? 644  ALA C N     1 
ATOM   8223  C  CA    . ALA C 2  644  ? -31.363 26.221  16.551  1.00 28.42  ? 644  ALA C CA    1 
ATOM   8224  C  C     . ALA C 2  644  ? -32.186 25.833  17.775  1.00 32.88  ? 644  ALA C C     1 
ATOM   8225  O  O     . ALA C 2  644  ? -33.135 25.054  17.679  1.00 29.58  ? 644  ALA C O     1 
ATOM   8226  C  CB    . ALA C 2  644  ? -32.211 26.992  15.566  1.00 30.47  ? 644  ALA C CB    1 
ATOM   8227  N  N     . GLU C 2  645  ? -31.815 26.391  18.923  1.00 36.17  ? 645  GLU C N     1 
ATOM   8228  C  CA    . GLU C 2  645  ? -32.438 26.038  20.194  1.00 41.40  ? 645  GLU C CA    1 
ATOM   8229  C  C     . GLU C 2  645  ? -33.840 26.604  20.297  1.00 40.48  ? 645  GLU C C     1 
ATOM   8230  O  O     . GLU C 2  645  ? -34.796 25.873  20.548  1.00 48.34  ? 645  GLU C O     1 
ATOM   8231  C  CB    . GLU C 2  645  ? -31.592 26.536  21.369  1.00 52.35  ? 645  GLU C CB    1 
ATOM   8232  C  CG    . GLU C 2  645  ? -30.228 25.881  21.475  1.00 62.59  ? 645  GLU C CG    1 
ATOM   8233  C  CD    . GLU C 2  645  ? -29.528 26.191  22.786  1.00 71.64  ? 645  GLU C CD    1 
ATOM   8234  O  OE1   . GLU C 2  645  ? -30.199 26.675  23.724  1.00 75.47  ? 645  GLU C OE1   1 
ATOM   8235  O  OE2   . GLU C 2  645  ? -28.306 25.950  22.878  1.00 76.50  ? 645  GLU C OE2   1 
ATOM   8236  N  N     . GLU C 2  646  ? -33.952 27.914  20.110  1.00 44.35  ? 646  GLU C N     1 
ATOM   8237  C  CA    . GLU C 2  646  ? -35.240 28.589  20.172  1.00 47.18  ? 646  GLU C CA    1 
ATOM   8238  C  C     . GLU C 2  646  ? -35.587 29.220  18.830  1.00 43.61  ? 646  GLU C C     1 
ATOM   8239  O  O     . GLU C 2  646  ? -34.722 29.768  18.143  1.00 44.28  ? 646  GLU C O     1 
ATOM   8240  C  CB    . GLU C 2  646  ? -35.242 29.653  21.271  1.00 50.27  ? 646  GLU C CB    1 
ATOM   8241  C  CG    . GLU C 2  646  ? -35.026 29.099  22.671  1.00 59.33  ? 646  GLU C CG    1 
ATOM   8242  C  CD    . GLU C 2  646  ? -34.909 30.186  23.725  1.00 70.69  ? 646  GLU C CD    1 
ATOM   8243  O  OE1   . GLU C 2  646  ? -35.127 31.372  23.394  1.00 63.13  ? 646  GLU C OE1   1 
ATOM   8244  O  OE2   . GLU C 2  646  ? -34.596 29.852  24.887  1.00 82.25  ? 646  GLU C OE2   1 
ATOM   8245  N  N     . SER C 2  647  ? -36.864 29.136  18.472  1.00 34.76  ? 647  SER C N     1 
ATOM   8246  C  CA    . SER C 2  647  ? -37.368 29.661  17.211  1.00 30.82  ? 647  SER C CA    1 
ATOM   8247  C  C     . SER C 2  647  ? -37.117 31.158  17.067  1.00 35.11  ? 647  SER C C     1 
ATOM   8248  O  O     . SER C 2  647  ? -37.009 31.874  18.059  1.00 44.53  ? 647  SER C O     1 
ATOM   8249  C  CB    . SER C 2  647  ? -38.864 29.375  17.096  1.00 34.24  ? 647  SER C CB    1 
ATOM   8250  O  OG    . SER C 2  647  ? -39.152 28.044  17.490  1.00 38.53  ? 647  SER C OG    1 
ATOM   8251  N  N     . GLY C 2  648  ? -37.027 31.631  15.829  1.00 30.18  ? 648  GLY C N     1 
ATOM   8252  C  CA    . GLY C 2  648  ? -36.855 33.051  15.586  1.00 32.49  ? 648  GLY C CA    1 
ATOM   8253  C  C     . GLY C 2  648  ? -36.530 33.389  14.145  1.00 31.02  ? 648  GLY C C     1 
ATOM   8254  O  O     . GLY C 2  648  ? -36.942 32.691  13.222  1.00 32.03  ? 648  GLY C O     1 
ATOM   8255  N  N     . VAL C 2  649  ? -35.782 34.470  13.959  1.00 32.27  ? 649  VAL C N     1 
ATOM   8256  C  CA    . VAL C 2  649  ? -35.438 34.952  12.627  1.00 33.75  ? 649  VAL C CA    1 
ATOM   8257  C  C     . VAL C 2  649  ? -33.966 35.344  12.543  1.00 28.75  ? 649  VAL C C     1 
ATOM   8258  O  O     . VAL C 2  649  ? -33.433 35.991  13.444  1.00 28.34  ? 649  VAL C O     1 
ATOM   8259  C  CB    . VAL C 2  649  ? -36.316 36.160  12.224  1.00 43.71  ? 649  VAL C CB    1 
ATOM   8260  C  CG1   . VAL C 2  649  ? -36.427 37.159  13.373  1.00 43.82  ? 649  VAL C CG1   1 
ATOM   8261  C  CG2   . VAL C 2  649  ? -35.770 36.830  10.965  1.00 44.25  ? 649  VAL C CG2   1 
ATOM   8262  N  N     . ILE C 2  650  ? -33.312 34.946  11.457  1.00 27.42  ? 650  ILE C N     1 
ATOM   8263  C  CA    . ILE C 2  650  ? -31.899 35.241  11.266  1.00 33.86  ? 650  ILE C CA    1 
ATOM   8264  C  C     . ILE C 2  650  ? -31.644 36.749  11.238  1.00 35.49  ? 650  ILE C C     1 
ATOM   8265  O  O     . ILE C 2  650  ? -32.014 37.432  10.283  1.00 38.54  ? 650  ILE C O     1 
ATOM   8266  C  CB    . ILE C 2  650  ? -31.366 34.601  9.969   1.00 34.25  ? 650  ILE C CB    1 
ATOM   8267  C  CG1   . ILE C 2  650  ? -31.807 33.137  9.882   1.00 34.21  ? 650  ILE C CG1   1 
ATOM   8268  C  CG2   . ILE C 2  650  ? -29.850 34.715  9.896   1.00 39.71  ? 650  ILE C CG2   1 
ATOM   8269  C  CD1   . ILE C 2  650  ? -31.451 32.309  11.107  1.00 31.14  ? 650  ILE C CD1   1 
ATOM   8270  N  N     . GLU C 2  651  ? -31.017 37.257  12.299  1.00 34.22  ? 651  GLU C N     1 
ATOM   8271  C  CA    . GLU C 2  651  ? -30.736 38.685  12.434  1.00 38.00  ? 651  GLU C CA    1 
ATOM   8272  C  C     . GLU C 2  651  ? -29.495 39.091  11.641  1.00 44.96  ? 651  GLU C C     1 
ATOM   8273  O  O     . GLU C 2  651  ? -29.479 40.131  10.986  1.00 52.29  ? 651  GLU C O     1 
ATOM   8274  C  CB    . GLU C 2  651  ? -30.569 39.063  13.913  1.00 38.83  ? 651  GLU C CB    1 
ATOM   8275  C  CG    . GLU C 2  651  ? -30.438 40.564  14.174  1.00 43.90  ? 651  GLU C CG    1 
ATOM   8276  C  CD    . GLU C 2  651  ? -30.610 40.933  15.643  1.00 42.71  ? 651  GLU C CD    1 
ATOM   8277  O  OE1   . GLU C 2  651  ? -31.739 40.808  16.167  1.00 40.90  ? 651  GLU C OE1   1 
ATOM   8278  O  OE2   . GLU C 2  651  ? -29.615 41.352  16.271  1.00 39.36  ? 651  GLU C OE2   1 
ATOM   8279  N  N     . GLU C 2  652  ? -28.455 38.267  11.701  1.00 38.92  ? 652  GLU C N     1 
ATOM   8280  C  CA    . GLU C 2  652  ? -27.240 38.531  10.941  1.00 37.69  ? 652  GLU C CA    1 
ATOM   8281  C  C     . GLU C 2  652  ? -26.470 37.248  10.700  1.00 39.23  ? 652  GLU C C     1 
ATOM   8282  O  O     . GLU C 2  652  ? -26.335 36.420  11.598  1.00 40.57  ? 652  GLU C O     1 
ATOM   8283  C  CB    . GLU C 2  652  ? -26.355 39.542  11.667  1.00 43.38  ? 652  GLU C CB    1 
ATOM   8284  C  CG    . GLU C 2  652  ? -24.977 39.692  11.049  1.00 45.86  ? 652  GLU C CG    1 
ATOM   8285  C  CD    . GLU C 2  652  ? -24.238 40.912  11.552  1.00 54.71  ? 652  GLU C CD    1 
ATOM   8286  O  OE1   . GLU C 2  652  ? -24.562 42.030  11.100  1.00 55.56  ? 652  GLU C OE1   1 
ATOM   8287  O  OE2   . GLU C 2  652  ? -23.334 40.752  12.398  1.00 55.89  ? 652  GLU C OE2   1 
ATOM   8288  N  N     . VAL C 2  653  ? -25.965 37.079  9.485   1.00 37.42  ? 653  VAL C N     1 
ATOM   8289  C  CA    . VAL C 2  653  ? -25.226 35.872  9.162   1.00 38.37  ? 653  VAL C CA    1 
ATOM   8290  C  C     . VAL C 2  653  ? -23.868 36.208  8.557   1.00 39.06  ? 653  VAL C C     1 
ATOM   8291  O  O     . VAL C 2  653  ? -23.735 37.139  7.763   1.00 47.57  ? 653  VAL C O     1 
ATOM   8292  C  CB    . VAL C 2  653  ? -26.031 34.969  8.205   1.00 39.50  ? 653  VAL C CB    1 
ATOM   8293  C  CG1   . VAL C 2  653  ? -26.383 35.718  6.930   1.00 41.83  ? 653  VAL C CG1   1 
ATOM   8294  C  CG2   . VAL C 2  653  ? -25.268 33.689  7.901   1.00 38.11  ? 653  VAL C CG2   1 
ATOM   8295  N  N     . SER C 2  654  ? -22.855 35.455  8.972   1.00 32.98  ? 654  SER C N     1 
ATOM   8296  C  CA    . SER C 2  654  ? -21.511 35.587  8.436   1.00 33.01  ? 654  SER C CA    1 
ATOM   8297  C  C     . SER C 2  654  ? -20.895 34.203  8.309   1.00 30.98  ? 654  SER C C     1 
ATOM   8298  O  O     . SER C 2  654  ? -21.458 33.223  8.798   1.00 32.56  ? 654  SER C O     1 
ATOM   8299  C  CB    . SER C 2  654  ? -20.652 36.481  9.334   1.00 33.38  ? 654  SER C CB    1 
ATOM   8300  O  OG    . SER C 2  654  ? -19.351 36.649  8.803   1.00 34.62  ? 654  SER C OG    1 
ATOM   8301  N  N     . ALA C 2  655  ? -19.744 34.122  7.651   1.00 32.33  ? 655  ALA C N     1 
ATOM   8302  C  CA    . ALA C 2  655  ? -19.006 32.867  7.576   1.00 32.34  ? 655  ALA C CA    1 
ATOM   8303  C  C     . ALA C 2  655  ? -18.511 32.502  8.961   1.00 33.13  ? 655  ALA C C     1 
ATOM   8304  O  O     . ALA C 2  655  ? -18.332 31.330  9.292   1.00 31.37  ? 655  ALA C O     1 
ATOM   8305  C  CB    . ALA C 2  655  ? -17.843 32.976  6.610   1.00 31.70  ? 655  ALA C CB    1 
ATOM   8306  N  N     . ASP C 2  656  ? -18.294 33.532  9.769   1.00 35.02  ? 656  ASP C N     1 
ATOM   8307  C  CA    . ASP C 2  656  ? -17.784 33.356  11.115  1.00 33.42  ? 656  ASP C CA    1 
ATOM   8308  C  C     . ASP C 2  656  ? -18.880 32.907  12.064  1.00 34.45  ? 656  ASP C C     1 
ATOM   8309  O  O     . ASP C 2  656  ? -18.690 31.959  12.820  1.00 40.76  ? 656  ASP C O     1 
ATOM   8310  C  CB    . ASP C 2  656  ? -17.140 34.649  11.603  1.00 34.44  ? 656  ASP C CB    1 
ATOM   8311  C  CG    . ASP C 2  656  ? -15.889 34.990  10.824  1.00 42.01  ? 656  ASP C CG    1 
ATOM   8312  O  OD1   . ASP C 2  656  ? -15.006 34.111  10.722  1.00 39.73  ? 656  ASP C OD1   1 
ATOM   8313  O  OD2   . ASP C 2  656  ? -15.799 36.115  10.288  1.00 49.19  ? 656  ASP C OD2   1 
ATOM   8314  N  N     . TYR C 2  657  ? -20.030 33.569  12.031  1.00 30.69  ? 657  TYR C N     1 
ATOM   8315  C  CA    . TYR C 2  657  ? -21.106 33.160  12.922  1.00 29.90  ? 657  TYR C CA    1 
ATOM   8316  C  C     . TYR C 2  657  ? -22.511 33.475  12.416  1.00 29.50  ? 657  TYR C C     1 
ATOM   8317  O  O     . TYR C 2  657  ? -22.697 34.178  11.421  1.00 28.42  ? 657  TYR C O     1 
ATOM   8318  C  CB    . TYR C 2  657  ? -20.903 33.794  14.304  1.00 30.94  ? 657  TYR C CB    1 
ATOM   8319  C  CG    . TYR C 2  657  ? -20.968 35.306  14.326  1.00 34.02  ? 657  TYR C CG    1 
ATOM   8320  C  CD1   . TYR C 2  657  ? -22.189 35.965  14.417  1.00 39.10  ? 657  TYR C CD1   1 
ATOM   8321  C  CD2   . TYR C 2  657  ? -19.812 36.075  14.277  1.00 37.22  ? 657  TYR C CD2   1 
ATOM   8322  C  CE1   . TYR C 2  657  ? -22.262 37.347  14.443  1.00 43.76  ? 657  TYR C CE1   1 
ATOM   8323  C  CE2   . TYR C 2  657  ? -19.875 37.465  14.304  1.00 56.55  ? 657  TYR C CE2   1 
ATOM   8324  C  CZ    . TYR C 2  657  ? -21.105 38.095  14.388  1.00 49.92  ? 657  TYR C CZ    1 
ATOM   8325  O  OH    . TYR C 2  657  ? -21.187 39.472  14.416  1.00 34.91  ? 657  TYR C OH    1 
ATOM   8326  N  N     . ILE C 2  658  ? -23.490 32.930  13.135  1.00 31.90  ? 658  ILE C N     1 
ATOM   8327  C  CA    . ILE C 2  658  ? -24.909 33.164  12.894  1.00 31.05  ? 658  ILE C CA    1 
ATOM   8328  C  C     . ILE C 2  658  ? -25.567 33.725  14.154  1.00 35.94  ? 658  ILE C C     1 
ATOM   8329  O  O     . ILE C 2  658  ? -25.371 33.194  15.248  1.00 38.25  ? 658  ILE C O     1 
ATOM   8330  C  CB    . ILE C 2  658  ? -25.641 31.868  12.486  1.00 26.50  ? 658  ILE C CB    1 
ATOM   8331  C  CG1   . ILE C 2  658  ? -25.361 31.515  11.029  1.00 36.13  ? 658  ILE C CG1   1 
ATOM   8332  C  CG2   . ILE C 2  658  ? -27.135 32.012  12.685  1.00 23.18  ? 658  ILE C CG2   1 
ATOM   8333  C  CD1   . ILE C 2  658  ? -26.145 30.308  10.550  1.00 36.35  ? 658  ILE C CD1   1 
ATOM   8334  N  N     . THR C 2  659  ? -26.342 34.795  14.003  1.00 31.83  ? 659  THR C N     1 
ATOM   8335  C  CA    . THR C 2  659  ? -27.047 35.385  15.136  1.00 28.88  ? 659  THR C CA    1 
ATOM   8336  C  C     . THR C 2  659  ? -28.557 35.311  14.958  1.00 31.40  ? 659  THR C C     1 
ATOM   8337  O  O     . THR C 2  659  ? -29.100 35.836  13.988  1.00 32.09  ? 659  THR C O     1 
ATOM   8338  C  CB    . THR C 2  659  ? -26.649 36.844  15.342  1.00 29.38  ? 659  THR C CB    1 
ATOM   8339  O  OG1   . THR C 2  659  ? -25.226 36.938  15.463  1.00 31.92  ? 659  THR C OG1   1 
ATOM   8340  C  CG2   . THR C 2  659  ? -27.298 37.388  16.600  1.00 39.03  ? 659  THR C CG2   1 
ATOM   8341  N  N     . VAL C 2  660  ? -29.230 34.672  15.911  1.00 29.76  ? 660  VAL C N     1 
ATOM   8342  C  CA    . VAL C 2  660  ? -30.671 34.460  15.836  1.00 28.69  ? 660  VAL C CA    1 
ATOM   8343  C  C     . VAL C 2  660  ? -31.426 35.322  16.848  1.00 37.07  ? 660  VAL C C     1 
ATOM   8344  O  O     . VAL C 2  660  ? -31.098 35.329  18.034  1.00 43.94  ? 660  VAL C O     1 
ATOM   8345  C  CB    . VAL C 2  660  ? -31.020 32.969  16.064  1.00 29.61  ? 660  VAL C CB    1 
ATOM   8346  C  CG1   . VAL C 2  660  ? -32.518 32.775  16.238  1.00 34.50  ? 660  VAL C CG1   1 
ATOM   8347  C  CG2   . VAL C 2  660  ? -30.499 32.122  14.915  1.00 32.41  ? 660  VAL C CG2   1 
ATOM   8348  N  N     . MET C 2  661  ? -32.432 36.051  16.370  1.00 36.61  ? 661  MET C N     1 
ATOM   8349  C  CA    . MET C 2  661  ? -33.287 36.870  17.228  1.00 35.54  ? 661  MET C CA    1 
ATOM   8350  C  C     . MET C 2  661  ? -34.532 36.083  17.635  1.00 32.04  ? 661  MET C C     1 
ATOM   8351  O  O     . MET C 2  661  ? -35.387 35.792  16.802  1.00 39.66  ? 661  MET C O     1 
ATOM   8352  C  CB    . MET C 2  661  ? -33.678 38.169  16.511  1.00 34.56  ? 661  MET C CB    1 
ATOM   8353  C  CG    . MET C 2  661  ? -34.675 39.051  17.257  1.00 38.02  ? 661  MET C CG    1 
ATOM   8354  S  SD    . MET C 2  661  ? -34.050 39.672  18.831  1.00 57.09  ? 661  MET C SD    1 
ATOM   8355  C  CE    . MET C 2  661  ? -35.392 40.744  19.342  1.00 49.70  ? 661  MET C CE    1 
ATOM   8356  N  N     . HIS C 2  662  ? -34.632 35.729  18.911  1.00 29.11  ? 662  HIS C N     1 
ATOM   8357  C  CA    . HIS C 2  662  ? -35.771 34.952  19.384  1.00 33.46  ? 662  HIS C CA    1 
ATOM   8358  C  C     . HIS C 2  662  ? -37.050 35.783  19.371  1.00 44.14  ? 662  HIS C C     1 
ATOM   8359  O  O     . HIS C 2  662  ? -37.034 36.963  19.015  1.00 46.75  ? 662  HIS C O     1 
ATOM   8360  C  CB    . HIS C 2  662  ? -35.519 34.421  20.793  1.00 41.00  ? 662  HIS C CB    1 
ATOM   8361  C  CG    . HIS C 2  662  ? -34.306 33.555  20.910  1.00 41.66  ? 662  HIS C CG    1 
ATOM   8362  N  ND1   . HIS C 2  662  ? -33.454 33.616  21.992  1.00 44.79  ? 662  HIS C ND1   1 
ATOM   8363  C  CD2   . HIS C 2  662  ? -33.804 32.604  20.088  1.00 39.88  ? 662  HIS C CD2   1 
ATOM   8364  C  CE1   . HIS C 2  662  ? -32.478 32.742  21.830  1.00 48.07  ? 662  HIS C CE1   1 
ATOM   8365  N  NE2   . HIS C 2  662  ? -32.666 32.114  20.683  1.00 46.12  ? 662  HIS C NE2   1 
ATOM   8366  N  N     . ASP C 2  663  ? -38.159 35.160  19.759  1.00 48.30  ? 663  ASP C N     1 
ATOM   8367  C  CA    . ASP C 2  663  ? -39.440 35.851  19.822  1.00 41.25  ? 663  ASP C CA    1 
ATOM   8368  C  C     . ASP C 2  663  ? -39.537 36.723  21.069  1.00 34.38  ? 663  ASP C C     1 
ATOM   8369  O  O     . ASP C 2  663  ? -40.085 37.822  21.020  1.00 35.07  ? 663  ASP C O     1 
ATOM   8370  C  CB    . ASP C 2  663  ? -40.595 34.847  19.793  1.00 46.18  ? 663  ASP C CB    1 
ATOM   8371  C  CG    . ASP C 2  663  ? -40.685 34.092  18.476  1.00 52.39  ? 663  ASP C CG    1 
ATOM   8372  O  OD1   . ASP C 2  663  ? -40.487 34.713  17.406  1.00 49.13  ? 663  ASP C OD1   1 
ATOM   8373  O  OD2   . ASP C 2  663  ? -40.955 32.872  18.516  1.00 51.39  ? 663  ASP C OD2   1 
ATOM   8374  N  N     . ASN C 2  664  ? -38.996 36.234  22.182  1.00 33.65  ? 664  ASN C N     1 
ATOM   8375  C  CA    . ASN C 2  664  ? -39.094 36.942  23.456  1.00 36.46  ? 664  ASN C CA    1 
ATOM   8376  C  C     . ASN C 2  664  ? -38.147 38.140  23.567  1.00 38.43  ? 664  ASN C C     1 
ATOM   8377  O  O     . ASN C 2  664  ? -38.198 38.889  24.543  1.00 40.66  ? 664  ASN C O     1 
ATOM   8378  C  CB    . ASN C 2  664  ? -38.844 35.977  24.620  1.00 37.61  ? 664  ASN C CB    1 
ATOM   8379  C  CG    . ASN C 2  664  ? -37.507 35.268  24.521  1.00 44.12  ? 664  ASN C CG    1 
ATOM   8380  O  OD1   . ASN C 2  664  ? -36.678 35.595  23.673  1.00 49.42  ? 664  ASN C OD1   1 
ATOM   8381  N  ND2   . ASN C 2  664  ? -37.289 34.291  25.395  1.00 46.08  ? 664  ASN C ND2   1 
ATOM   8382  N  N     . GLY C 2  665  ? -37.281 38.315  22.574  1.00 36.69  ? 665  GLY C N     1 
ATOM   8383  C  CA    . GLY C 2  665  ? -36.398 39.467  22.539  1.00 38.24  ? 665  GLY C CA    1 
ATOM   8384  C  C     . GLY C 2  665  ? -34.922 39.163  22.730  1.00 45.63  ? 665  GLY C C     1 
ATOM   8385  O  O     . GLY C 2  665  ? -34.065 39.932  22.289  1.00 49.50  ? 665  GLY C O     1 
ATOM   8386  N  N     . THR C 2  666  ? -34.621 38.048  23.389  1.00 38.78  ? 666  THR C N     1 
ATOM   8387  C  CA    . THR C 2  666  ? -33.236 37.672  23.658  1.00 33.37  ? 666  THR C CA    1 
ATOM   8388  C  C     . THR C 2  666  ? -32.531 37.201  22.397  1.00 33.34  ? 666  THR C C     1 
ATOM   8389  O  O     . THR C 2  666  ? -33.170 36.712  21.469  1.00 35.56  ? 666  THR C O     1 
ATOM   8390  C  CB    . THR C 2  666  ? -33.148 36.560  24.717  1.00 31.88  ? 666  THR C CB    1 
ATOM   8391  O  OG1   . THR C 2  666  ? -33.922 35.431  24.293  1.00 30.60  ? 666  THR C OG1   1 
ATOM   8392  C  CG2   . THR C 2  666  ? -33.667 37.055  26.054  1.00 39.39  ? 666  THR C CG2   1 
ATOM   8393  N  N     . ARG C 2  667  ? -31.210 37.346  22.371  1.00 36.40  ? 667  ARG C N     1 
ATOM   8394  C  CA    . ARG C 2  667  ? -30.421 36.928  21.217  1.00 35.41  ? 667  ARG C CA    1 
ATOM   8395  C  C     . ARG C 2  667  ? -29.381 35.873  21.569  1.00 34.15  ? 667  ARG C C     1 
ATOM   8396  O  O     . ARG C 2  667  ? -28.540 36.082  22.444  1.00 35.59  ? 667  ARG C O     1 
ATOM   8397  C  CB    . ARG C 2  667  ? -29.720 38.129  20.584  1.00 34.06  ? 667  ARG C CB    1 
ATOM   8398  C  CG    . ARG C 2  667  ? -30.654 39.214  20.095  1.00 37.77  ? 667  ARG C CG    1 
ATOM   8399  C  CD    . ARG C 2  667  ? -29.883 40.262  19.319  1.00 42.29  ? 667  ARG C CD    1 
ATOM   8400  N  NE    . ARG C 2  667  ? -28.813 40.850  20.120  1.00 47.74  ? 667  ARG C NE    1 
ATOM   8401  C  CZ    . ARG C 2  667  ? -27.877 41.660  19.639  1.00 44.87  ? 667  ARG C CZ    1 
ATOM   8402  N  NH1   . ARG C 2  667  ? -27.869 41.978  18.351  1.00 44.97  ? 667  ARG C NH1   1 
ATOM   8403  N  NH2   . ARG C 2  667  ? -26.945 42.149  20.446  1.00 42.17  ? 667  ARG C NH2   1 
ATOM   8404  N  N     . ARG C 2  668  ? -29.441 34.741  20.875  1.00 32.14  ? 668  ARG C N     1 
ATOM   8405  C  CA    . ARG C 2  668  ? -28.420 33.711  20.998  1.00 32.74  ? 668  ARG C CA    1 
ATOM   8406  C  C     . ARG C 2  668  ? -27.595 33.653  19.716  1.00 34.50  ? 668  ARG C C     1 
ATOM   8407  O  O     . ARG C 2  668  ? -28.145 33.636  18.616  1.00 35.32  ? 668  ARG C O     1 
ATOM   8408  C  CB    . ARG C 2  668  ? -29.050 32.349  21.298  1.00 36.66  ? 668  ARG C CB    1 
ATOM   8409  C  CG    . ARG C 2  668  ? -28.039 31.266  21.658  1.00 40.73  ? 668  ARG C CG    1 
ATOM   8410  C  CD    . ARG C 2  668  ? -28.714 29.941  21.993  1.00 49.42  ? 668  ARG C CD    1 
ATOM   8411  N  NE    . ARG C 2  668  ? -29.961 30.119  22.732  1.00 56.06  ? 668  ARG C NE    1 
ATOM   8412  C  CZ    . ARG C 2  668  ? -30.038 30.305  24.046  1.00 70.02  ? 668  ARG C CZ    1 
ATOM   8413  N  NH1   . ARG C 2  668  ? -28.933 30.346  24.779  1.00 94.25  ? 668  ARG C NH1   1 
ATOM   8414  N  NH2   . ARG C 2  668  ? -31.221 30.455  24.626  1.00 64.26  ? 668  ARG C NH2   1 
ATOM   8415  N  N     . THR C 2  669  ? -26.275 33.638  19.866  1.00 37.90  ? 669  THR C N     1 
ATOM   8416  C  CA    . THR C 2  669  ? -25.366 33.602  18.726  1.00 36.52  ? 669  THR C CA    1 
ATOM   8417  C  C     . THR C 2  669  ? -24.598 32.289  18.698  1.00 41.88  ? 669  THR C C     1 
ATOM   8418  O  O     . THR C 2  669  ? -24.074 31.848  19.721  1.00 51.81  ? 669  THR C O     1 
ATOM   8419  C  CB    . THR C 2  669  ? -24.364 34.775  18.763  1.00 29.10  ? 669  THR C CB    1 
ATOM   8420  O  OG1   . THR C 2  669  ? -25.075 36.016  18.729  1.00 29.34  ? 669  THR C OG1   1 
ATOM   8421  C  CG2   . THR C 2  669  ? -23.418 34.715  17.575  1.00 31.86  ? 669  THR C CG2   1 
ATOM   8422  N  N     . TYR C 2  670  ? -24.534 31.663  17.528  1.00 30.30  ? 670  TYR C N     1 
ATOM   8423  C  CA    . TYR C 2  670  ? -23.780 30.430  17.376  1.00 27.42  ? 670  TYR C CA    1 
ATOM   8424  C  C     . TYR C 2  670  ? -22.492 30.685  16.598  1.00 23.25  ? 670  TYR C C     1 
ATOM   8425  O  O     . TYR C 2  670  ? -22.518 31.272  15.519  1.00 22.32  ? 670  TYR C O     1 
ATOM   8426  C  CB    . TYR C 2  670  ? -24.625 29.370  16.672  1.00 28.69  ? 670  TYR C CB    1 
ATOM   8427  C  CG    . TYR C 2  670  ? -26.037 29.234  17.205  1.00 23.63  ? 670  TYR C CG    1 
ATOM   8428  C  CD1   . TYR C 2  670  ? -26.275 28.828  18.512  1.00 28.40  ? 670  TYR C CD1   1 
ATOM   8429  C  CD2   . TYR C 2  670  ? -27.133 29.492  16.392  1.00 20.55  ? 670  TYR C CD2   1 
ATOM   8430  C  CE1   . TYR C 2  670  ? -27.564 28.693  18.996  1.00 29.08  ? 670  TYR C CE1   1 
ATOM   8431  C  CE2   . TYR C 2  670  ? -28.424 29.358  16.866  1.00 23.85  ? 670  TYR C CE2   1 
ATOM   8432  C  CZ    . TYR C 2  670  ? -28.634 28.960  18.168  1.00 26.70  ? 670  TYR C CZ    1 
ATOM   8433  O  OH    . TYR C 2  670  ? -29.919 28.828  18.640  1.00 29.75  ? 670  TYR C OH    1 
ATOM   8434  N  N     . ARG C 2  671  ? -21.363 30.254  17.147  1.00 21.39  ? 671  ARG C N     1 
ATOM   8435  C  CA    . ARG C 2  671  ? -20.089 30.441  16.467  1.00 22.63  ? 671  ARG C CA    1 
ATOM   8436  C  C     . ARG C 2  671  ? -19.779 29.244  15.584  1.00 23.73  ? 671  ARG C C     1 
ATOM   8437  O  O     . ARG C 2  671  ? -19.994 28.100  15.976  1.00 29.20  ? 671  ARG C O     1 
ATOM   8438  C  CB    . ARG C 2  671  ? -18.962 30.665  17.473  1.00 24.58  ? 671  ARG C CB    1 
ATOM   8439  C  CG    . ARG C 2  671  ? -19.169 31.877  18.361  1.00 32.76  ? 671  ARG C CG    1 
ATOM   8440  C  CD    . ARG C 2  671  ? -18.003 32.055  19.310  1.00 35.28  ? 671  ARG C CD    1 
ATOM   8441  N  NE    . ARG C 2  671  ? -16.741 32.178  18.587  1.00 35.65  ? 671  ARG C NE    1 
ATOM   8442  C  CZ    . ARG C 2  671  ? -15.561 32.334  19.175  1.00 34.45  ? 671  ARG C CZ    1 
ATOM   8443  N  NH1   . ARG C 2  671  ? -15.481 32.386  20.498  1.00 36.69  ? 671  ARG C NH1   1 
ATOM   8444  N  NH2   . ARG C 2  671  ? -14.461 32.440  18.441  1.00 28.23  ? 671  ARG C NH2   1 
ATOM   8445  N  N     . MET C 2  672  ? -19.276 29.515  14.388  1.00 21.66  ? 672  MET C N     1 
ATOM   8446  C  CA    . MET C 2  672  ? -18.991 28.465  13.422  1.00 23.67  ? 672  MET C CA    1 
ATOM   8447  C  C     . MET C 2  672  ? -17.597 27.884  13.614  1.00 25.16  ? 672  MET C C     1 
ATOM   8448  O  O     . MET C 2  672  ? -16.621 28.626  13.713  1.00 23.45  ? 672  MET C O     1 
ATOM   8449  C  CB    . MET C 2  672  ? -19.141 29.007  11.999  1.00 25.35  ? 672  MET C CB    1 
ATOM   8450  C  CG    . MET C 2  672  ? -20.522 29.555  11.707  1.00 24.08  ? 672  MET C CG    1 
ATOM   8451  S  SD    . MET C 2  672  ? -21.726 28.223  11.630  1.00 27.29  ? 672  MET C SD    1 
ATOM   8452  C  CE    . MET C 2  672  ? -23.167 29.031  12.306  1.00 35.53  ? 672  MET C CE    1 
ATOM   8453  N  N     . ARG C 2  673  ? -17.505 26.559  13.680  1.00 25.68  ? 673  ARG C N     1 
ATOM   8454  C  CA    . ARG C 2  673  ? -16.204 25.906  13.648  1.00 26.52  ? 673  ARG C CA    1 
ATOM   8455  C  C     . ARG C 2  673  ? -15.676 26.008  12.227  1.00 25.84  ? 673  ARG C C     1 
ATOM   8456  O  O     . ARG C 2  673  ? -16.323 25.552  11.286  1.00 26.43  ? 673  ARG C O     1 
ATOM   8457  C  CB    . ARG C 2  673  ? -16.284 24.441  14.099  1.00 25.58  ? 673  ARG C CB    1 
ATOM   8458  C  CG    . ARG C 2  673  ? -15.978 24.223  15.579  1.00 27.57  ? 673  ARG C CG    1 
ATOM   8459  C  CD    . ARG C 2  673  ? -15.584 22.775  15.891  1.00 38.03  ? 673  ARG C CD    1 
ATOM   8460  N  NE    . ARG C 2  673  ? -16.721 21.855  15.878  1.00 48.85  ? 673  ARG C NE    1 
ATOM   8461  C  CZ    . ARG C 2  673  ? -16.655 20.575  16.237  1.00 50.00  ? 673  ARG C CZ    1 
ATOM   8462  N  NH1   . ARG C 2  673  ? -15.503 20.053  16.642  1.00 53.55  ? 673  ARG C NH1   1 
ATOM   8463  N  NH2   . ARG C 2  673  ? -17.743 19.815  16.194  1.00 47.07  ? 673  ARG C NH2   1 
ATOM   8464  N  N     . LYS C 2  674  ? -14.513 26.630  12.067  1.00 24.20  ? 674  LYS C N     1 
ATOM   8465  C  CA    . LYS C 2  674  ? -13.946 26.838  10.740  1.00 20.62  ? 674  LYS C CA    1 
ATOM   8466  C  C     . LYS C 2  674  ? -12.546 26.249  10.620  1.00 17.19  ? 674  LYS C C     1 
ATOM   8467  O  O     . LYS C 2  674  ? -11.627 26.665  11.325  1.00 18.59  ? 674  LYS C O     1 
ATOM   8468  C  CB    . LYS C 2  674  ? -13.916 28.330  10.401  1.00 22.19  ? 674  LYS C CB    1 
ATOM   8469  C  CG    . LYS C 2  674  ? -15.264 29.018  10.525  1.00 25.84  ? 674  LYS C CG    1 
ATOM   8470  C  CD    . LYS C 2  674  ? -16.273 28.416  9.567   1.00 27.14  ? 674  LYS C CD    1 
ATOM   8471  C  CE    . LYS C 2  674  ? -15.892 28.692  8.123   1.00 27.43  ? 674  LYS C CE    1 
ATOM   8472  N  NZ    . LYS C 2  674  ? -16.925 28.186  7.181   1.00 26.33  ? 674  LYS C NZ    1 
ATOM   8473  N  N     . PHE C 2  675  ? -12.399 25.283  9.719   1.00 16.50  ? 675  PHE C N     1 
ATOM   8474  C  CA    . PHE C 2  675  ? -11.114 24.652  9.443   1.00 17.14  ? 675  PHE C CA    1 
ATOM   8475  C  C     . PHE C 2  675  ? -10.419 24.194  10.727  1.00 19.14  ? 675  PHE C C     1 
ATOM   8476  O  O     . PHE C 2  675  ? -9.326  24.661  11.046  1.00 24.83  ? 675  PHE C O     1 
ATOM   8477  C  CB    . PHE C 2  675  ? -10.203 25.609  8.660   1.00 16.17  ? 675  PHE C CB    1 
ATOM   8478  C  CG    . PHE C 2  675  ? -10.758 26.030  7.315   1.00 22.85  ? 675  PHE C CG    1 
ATOM   8479  C  CD1   . PHE C 2  675  ? -10.902 25.114  6.284   1.00 27.39  ? 675  PHE C CD1   1 
ATOM   8480  C  CD2   . PHE C 2  675  ? -11.116 27.349  7.077   1.00 27.00  ? 675  PHE C CD2   1 
ATOM   8481  C  CE1   . PHE C 2  675  ? -11.408 25.502  5.047   1.00 25.00  ? 675  PHE C CE1   1 
ATOM   8482  C  CE2   . PHE C 2  675  ? -11.620 27.742  5.842   1.00 26.16  ? 675  PHE C CE2   1 
ATOM   8483  C  CZ    . PHE C 2  675  ? -11.765 26.818  4.829   1.00 25.81  ? 675  PHE C CZ    1 
ATOM   8484  N  N     . ALA C 2  676  ? -11.065 23.293  11.466  1.00 19.42  ? 676  ALA C N     1 
ATOM   8485  C  CA    . ALA C 2  676  ? -10.514 22.777  12.720  1.00 22.48  ? 676  ALA C CA    1 
ATOM   8486  C  C     . ALA C 2  676  ? -9.992  21.361  12.542  1.00 15.41  ? 676  ALA C C     1 
ATOM   8487  O  O     . ALA C 2  676  ? -10.601 20.556  11.845  1.00 16.52  ? 676  ALA C O     1 
ATOM   8488  C  CB    . ALA C 2  676  ? -11.564 22.813  13.820  1.00 24.04  ? 676  ALA C CB    1 
ATOM   8489  N  N     . ARG C 2  677  ? -8.865  21.053  13.171  1.00 14.10  ? 677  ARG C N     1 
ATOM   8490  C  CA    . ARG C 2  677  ? -8.315  19.708  13.085  1.00 15.13  ? 677  ARG C CA    1 
ATOM   8491  C  C     . ARG C 2  677  ? -9.087  18.751  13.976  1.00 15.33  ? 677  ARG C C     1 
ATOM   8492  O  O     . ARG C 2  677  ? -9.283  19.013  15.161  1.00 18.55  ? 677  ARG C O     1 
ATOM   8493  C  CB    . ARG C 2  677  ? -6.841  19.694  13.473  1.00 17.76  ? 677  ARG C CB    1 
ATOM   8494  C  CG    . ARG C 2  677  ? -6.195  18.327  13.377  1.00 16.81  ? 677  ARG C CG    1 
ATOM   8495  C  CD    . ARG C 2  677  ? -4.830  18.340  14.028  1.00 17.71  ? 677  ARG C CD    1 
ATOM   8496  N  NE    . ARG C 2  677  ? -3.971  17.267  13.536  1.00 23.82  ? 677  ARG C NE    1 
ATOM   8497  C  CZ    . ARG C 2  677  ? -3.831  16.088  14.131  1.00 26.07  ? 677  ARG C CZ    1 
ATOM   8498  N  NH1   . ARG C 2  677  ? -4.499  15.825  15.245  1.00 24.21  ? 677  ARG C NH1   1 
ATOM   8499  N  NH2   . ARG C 2  677  ? -3.023  15.173  13.611  1.00 27.43  ? 677  ARG C NH2   1 
ATOM   8500  N  N     . SER C 2  678  ? -9.525  17.641  13.395  1.00 12.99  ? 678  SER C N     1 
ATOM   8501  C  CA    . SER C 2  678  ? -10.175 16.584  14.153  1.00 13.08  ? 678  SER C CA    1 
ATOM   8502  C  C     . SER C 2  678  ? -9.107  15.711  14.789  1.00 13.68  ? 678  SER C C     1 
ATOM   8503  O  O     . SER C 2  678  ? -7.918  15.934  14.577  1.00 12.90  ? 678  SER C O     1 
ATOM   8504  C  CB    . SER C 2  678  ? -11.082 15.755  13.249  1.00 12.77  ? 678  SER C CB    1 
ATOM   8505  O  OG    . SER C 2  678  ? -10.356 15.260  12.139  1.00 14.36  ? 678  SER C OG    1 
ATOM   8506  N  N     . ASN C 2  679  ? -9.520  14.721  15.568  1.00 14.49  ? 679  ASN C N     1 
ATOM   8507  C  CA    . ASN C 2  679  ? -8.556  13.816  16.170  1.00 17.44  ? 679  ASN C CA    1 
ATOM   8508  C  C     . ASN C 2  679  ? -7.756  13.074  15.105  1.00 19.52  ? 679  ASN C C     1 
ATOM   8509  O  O     . ASN C 2  679  ? -6.584  12.763  15.305  1.00 25.40  ? 679  ASN C O     1 
ATOM   8510  C  CB    . ASN C 2  679  ? -9.253  12.821  17.100  1.00 19.19  ? 679  ASN C CB    1 
ATOM   8511  C  CG    . ASN C 2  679  ? -9.640  13.436  18.429  1.00 20.61  ? 679  ASN C CG    1 
ATOM   8512  O  OD1   . ASN C 2  679  ? -8.934  14.292  18.962  1.00 24.72  ? 679  ASN C OD1   1 
ATOM   8513  N  ND2   . ASN C 2  679  ? -10.770 13.005  18.970  1.00 23.13  ? 679  ASN C ND2   1 
ATOM   8514  N  N     . HIS C 2  680  ? -8.381  12.818  13.962  1.00 17.38  ? 680  HIS C N     1 
ATOM   8515  C  CA    . HIS C 2  680  ? -7.748  12.004  12.935  1.00 19.47  ? 680  HIS C CA    1 
ATOM   8516  C  C     . HIS C 2  680  ? -7.305  12.830  11.733  1.00 20.14  ? 680  HIS C C     1 
ATOM   8517  O  O     . HIS C 2  680  ? -7.069  12.295  10.649  1.00 18.90  ? 680  HIS C O     1 
ATOM   8518  C  CB    . HIS C 2  680  ? -8.696  10.891  12.493  1.00 21.67  ? 680  HIS C CB    1 
ATOM   8519  C  CG    . HIS C 2  680  ? -8.989  9.888   13.566  1.00 22.44  ? 680  HIS C CG    1 
ATOM   8520  N  ND1   . HIS C 2  680  ? -9.309  10.252  14.856  1.00 24.46  ? 680  HIS C ND1   1 
ATOM   8521  C  CD2   . HIS C 2  680  ? -9.006  8.534   13.543  1.00 26.74  ? 680  HIS C CD2   1 
ATOM   8522  C  CE1   . HIS C 2  680  ? -9.510  9.167   15.581  1.00 25.31  ? 680  HIS C CE1   1 
ATOM   8523  N  NE2   . HIS C 2  680  ? -9.333  8.111   14.808  1.00 30.63  ? 680  HIS C NE2   1 
ATOM   8524  N  N     . GLY C 2  681  ? -7.185  14.136  11.931  1.00 19.23  ? 681  GLY C N     1 
ATOM   8525  C  CA    . GLY C 2  681  ? -6.629  15.003  10.911  1.00 17.26  ? 681  GLY C CA    1 
ATOM   8526  C  C     . GLY C 2  681  ? -7.582  15.328  9.780   1.00 14.06  ? 681  GLY C C     1 
ATOM   8527  O  O     . GLY C 2  681  ? -7.187  15.948  8.798   1.00 12.56  ? 681  GLY C O     1 
ATOM   8528  N  N     . THR C 2  682  ? -8.835  14.905  9.905   1.00 13.75  ? 682  THR C N     1 
ATOM   8529  C  CA    . THR C 2  682  ? -9.855  15.303  8.944   1.00 12.45  ? 682  THR C CA    1 
ATOM   8530  C  C     . THR C 2  682  ? -10.331 16.705  9.273   1.00 14.23  ? 682  THR C C     1 
ATOM   8531  O  O     . THR C 2  682  ? -10.042 17.226  10.348  1.00 14.75  ? 682  THR C O     1 
ATOM   8532  C  CB    . THR C 2  682  ? -11.058 14.349  8.932   1.00 12.64  ? 682  THR C CB    1 
ATOM   8533  O  OG1   . THR C 2  682  ? -11.507 14.122  10.273  1.00 13.66  ? 682  THR C OG1   1 
ATOM   8534  C  CG2   . THR C 2  682  ? -10.681 13.027  8.302   1.00 16.47  ? 682  THR C CG2   1 
ATOM   8535  N  N     . CYS C 2  683  ? -11.081 17.302  8.355   1.00 15.74  ? 683  CYS C N     1 
ATOM   8536  C  CA    . CYS C 2  683  ? -11.441 18.711  8.469   1.00 18.18  ? 683  CYS C CA    1 
ATOM   8537  C  C     . CYS C 2  683  ? -12.905 18.972  8.837   1.00 20.07  ? 683  CYS C C     1 
ATOM   8538  O  O     . CYS C 2  683  ? -13.805 18.830  8.007   1.00 22.21  ? 683  CYS C O     1 
ATOM   8539  C  CB    . CYS C 2  683  ? -11.118 19.424  7.159   1.00 19.21  ? 683  CYS C CB    1 
ATOM   8540  S  SG    . CYS C 2  683  ? -11.799 21.080  7.054   1.00 22.29  ? 683  CYS C SG    1 
ATOM   8541  N  N     . ALA C 2  684  ? -13.129 19.375  10.084  1.00 19.97  ? 684  ALA C N     1 
ATOM   8542  C  CA    . ALA C 2  684  ? -14.457 19.767  10.539  1.00 17.32  ? 684  ALA C CA    1 
ATOM   8543  C  C     . ALA C 2  684  ? -14.679 21.251  10.275  1.00 18.19  ? 684  ALA C C     1 
ATOM   8544  O  O     . ALA C 2  684  ? -14.208 22.101  11.028  1.00 17.78  ? 684  ALA C O     1 
ATOM   8545  C  CB    . ALA C 2  684  ? -14.632 19.452  12.014  1.00 17.92  ? 684  ALA C CB    1 
ATOM   8546  N  N     . ASN C 2  685  ? -15.394 21.551  9.195   1.00 18.61  ? 685  ASN C N     1 
ATOM   8547  C  CA    . ASN C 2  685  ? -15.649 22.926  8.777   1.00 20.04  ? 685  ASN C CA    1 
ATOM   8548  C  C     . ASN C 2  685  ? -17.139 23.188  8.596   1.00 19.91  ? 685  ASN C C     1 
ATOM   8549  O  O     . ASN C 2  685  ? -17.776 22.598  7.727   1.00 21.28  ? 685  ASN C O     1 
ATOM   8550  C  CB    . ASN C 2  685  ? -14.904 23.229  7.474   1.00 23.13  ? 685  ASN C CB    1 
ATOM   8551  C  CG    . ASN C 2  685  ? -15.006 24.687  7.063   1.00 25.27  ? 685  ASN C CG    1 
ATOM   8552  O  OD1   . ASN C 2  685  ? -15.026 25.583  7.907   1.00 27.40  ? 685  ASN C OD1   1 
ATOM   8553  N  ND2   . ASN C 2  685  ? -15.065 24.930  5.758   1.00 27.15  ? 685  ASN C ND2   1 
ATOM   8554  N  N     . GLN C 2  686  ? -17.695 24.076  9.411   1.00 20.28  ? 686  GLN C N     1 
ATOM   8555  C  CA    . GLN C 2  686  ? -19.124 24.357  9.353   1.00 20.21  ? 686  GLN C CA    1 
ATOM   8556  C  C     . GLN C 2  686  ? -19.448 25.573  8.488   1.00 23.67  ? 686  GLN C C     1 
ATOM   8557  O  O     . GLN C 2  686  ? -18.735 26.576  8.504   1.00 25.71  ? 686  GLN C O     1 
ATOM   8558  C  CB    . GLN C 2  686  ? -19.677 24.553  10.763  1.00 19.12  ? 686  GLN C CB    1 
ATOM   8559  C  CG    . GLN C 2  686  ? -19.681 23.281  11.589  1.00 20.41  ? 686  GLN C CG    1 
ATOM   8560  C  CD    . GLN C 2  686  ? -20.084 23.522  13.026  1.00 24.92  ? 686  GLN C CD    1 
ATOM   8561  O  OE1   . GLN C 2  686  ? -19.781 24.567  13.599  1.00 20.02  ? 686  GLN C OE1   1 
ATOM   8562  N  NE2   . GLN C 2  686  ? -20.778 22.555  13.617  1.00 27.00  ? 686  GLN C NE2   1 
ATOM   8563  N  N     . CYS C 2  687  ? -20.529 25.472  7.724   1.00 23.82  ? 687  CYS C N     1 
ATOM   8564  C  CA    . CYS C 2  687  ? -20.977 26.581  6.894   1.00 25.67  ? 687  CYS C CA    1 
ATOM   8565  C  C     . CYS C 2  687  ? -22.476 26.797  7.069   1.00 26.36  ? 687  CYS C C     1 
ATOM   8566  O  O     . CYS C 2  687  ? -23.253 25.842  7.046   1.00 28.49  ? 687  CYS C O     1 
ATOM   8567  C  CB    . CYS C 2  687  ? -20.632 26.327  5.426   1.00 29.51  ? 687  CYS C CB    1 
ATOM   8568  S  SG    . CYS C 2  687  ? -18.854 26.163  5.116   1.00 35.12  ? 687  CYS C SG    1 
ATOM   8569  N  N     . PRO C 2  688  ? -22.880 28.059  7.272   1.00 26.02  ? 688  PRO C N     1 
ATOM   8570  C  CA    . PRO C 2  688  ? -24.281 28.431  7.489   1.00 20.65  ? 688  PRO C CA    1 
ATOM   8571  C  C     . PRO C 2  688  ? -25.197 27.977  6.356   1.00 21.28  ? 688  PRO C C     1 
ATOM   8572  O  O     . PRO C 2  688  ? -24.817 28.074  5.193   1.00 23.96  ? 688  PRO C O     1 
ATOM   8573  C  CB    . PRO C 2  688  ? -24.220 29.957  7.566   1.00 19.58  ? 688  PRO C CB    1 
ATOM   8574  C  CG    . PRO C 2  688  ? -22.840 30.246  8.053   1.00 20.66  ? 688  PRO C CG    1 
ATOM   8575  C  CD    . PRO C 2  688  ? -21.976 29.215  7.398   1.00 22.86  ? 688  PRO C CD    1 
ATOM   8576  N  N     . ILE C 2  689  ? -26.381 27.479  6.697   1.00 20.26  ? 689  ILE C N     1 
ATOM   8577  C  CA    . ILE C 2  689  ? -27.371 27.092  5.696   1.00 20.99  ? 689  ILE C CA    1 
ATOM   8578  C  C     . ILE C 2  689  ? -28.282 28.261  5.330   1.00 28.95  ? 689  ILE C C     1 
ATOM   8579  O  O     . ILE C 2  689  ? -28.435 28.609  4.156   1.00 28.47  ? 689  ILE C O     1 
ATOM   8580  C  CB    . ILE C 2  689  ? -28.252 25.925  6.186   1.00 21.34  ? 689  ILE C CB    1 
ATOM   8581  C  CG1   . ILE C 2  689  ? -27.469 24.614  6.193   1.00 27.53  ? 689  ILE C CG1   1 
ATOM   8582  C  CG2   . ILE C 2  689  ? -29.486 25.779  5.309   1.00 27.38  ? 689  ILE C CG2   1 
ATOM   8583  C  CD1   . ILE C 2  689  ? -28.322 23.407  6.558   1.00 31.46  ? 689  ILE C CD1   1 
ATOM   8584  N  N     . VAL C 2  690  ? -28.881 28.857  6.356   1.00 30.78  ? 690  VAL C N     1 
ATOM   8585  C  CA    . VAL C 2  690  ? -29.868 29.919  6.200   1.00 28.30  ? 690  VAL C CA    1 
ATOM   8586  C  C     . VAL C 2  690  ? -29.274 31.253  5.753   1.00 39.04  ? 690  VAL C C     1 
ATOM   8587  O  O     . VAL C 2  690  ? -28.154 31.601  6.127   1.00 40.57  ? 690  VAL C O     1 
ATOM   8588  C  CB    . VAL C 2  690  ? -30.621 30.147  7.521   1.00 26.04  ? 690  VAL C CB    1 
ATOM   8589  C  CG1   . VAL C 2  690  ? -31.560 28.990  7.799   1.00 29.32  ? 690  VAL C CG1   1 
ATOM   8590  C  CG2   . VAL C 2  690  ? -29.632 30.318  8.663   1.00 26.77  ? 690  VAL C CG2   1 
ATOM   8591  N  N     . ASP C 2  691  ? -30.040 31.995  4.955   1.00 41.81  ? 691  ASP C N     1 
ATOM   8592  C  CA    . ASP C 2  691  ? -29.677 33.351  4.547   1.00 42.65  ? 691  ASP C CA    1 
ATOM   8593  C  C     . ASP C 2  691  ? -30.326 34.364  5.494   1.00 42.16  ? 691  ASP C C     1 
ATOM   8594  O  O     . ASP C 2  691  ? -31.350 34.068  6.109   1.00 40.70  ? 691  ASP C O     1 
ATOM   8595  C  CB    . ASP C 2  691  ? -30.105 33.616  3.100   1.00 46.07  ? 691  ASP C CB    1 
ATOM   8596  C  CG    . ASP C 2  691  ? -28.954 34.085  2.218   1.00 52.02  ? 691  ASP C CG    1 
ATOM   8597  O  OD1   . ASP C 2  691  ? -28.102 34.862  2.701   1.00 53.97  ? 691  ASP C OD1   1 
ATOM   8598  O  OD2   . ASP C 2  691  ? -28.901 33.676  1.038   1.00 54.90  ? 691  ASP C OD2   1 
ATOM   8599  N  N     . ALA C 2  692  ? -29.732 35.551  5.606   1.00 45.21  ? 692  ALA C N     1 
ATOM   8600  C  CA    . ALA C 2  692  ? -30.181 36.566  6.564   1.00 42.86  ? 692  ALA C CA    1 
ATOM   8601  C  C     . ALA C 2  692  ? -31.659 36.908  6.412   1.00 39.55  ? 692  ALA C C     1 
ATOM   8602  O  O     . ALA C 2  692  ? -32.135 37.184  5.312   1.00 42.16  ? 692  ALA C O     1 
ATOM   8603  C  CB    . ALA C 2  692  ? -29.338 37.833  6.431   1.00 49.03  ? 692  ALA C CB    1 
ATOM   8604  N  N     . GLY C 2  693  ? -32.379 36.886  7.528   1.00 33.69  ? 693  GLY C N     1 
ATOM   8605  C  CA    . GLY C 2  693  ? -33.788 37.226  7.533   1.00 34.11  ? 693  GLY C CA    1 
ATOM   8606  C  C     . GLY C 2  693  ? -34.709 36.032  7.387   1.00 32.71  ? 693  GLY C C     1 
ATOM   8607  O  O     . GLY C 2  693  ? -35.928 36.186  7.340   1.00 38.93  ? 693  GLY C O     1 
ATOM   8608  N  N     . ASP C 2  694  ? -34.139 34.836  7.309   1.00 34.12  ? 694  ASP C N     1 
ATOM   8609  C  CA    . ASP C 2  694  ? -34.960 33.637  7.198   1.00 34.73  ? 694  ASP C CA    1 
ATOM   8610  C  C     . ASP C 2  694  ? -35.676 33.348  8.503   1.00 32.41  ? 694  ASP C C     1 
ATOM   8611  O  O     . ASP C 2  694  ? -35.091 33.447  9.580   1.00 34.31  ? 694  ASP C O     1 
ATOM   8612  C  CB    . ASP C 2  694  ? -34.120 32.427  6.791   1.00 47.08  ? 694  ASP C CB    1 
ATOM   8613  C  CG    . ASP C 2  694  ? -33.896 32.351  5.294   1.00 50.60  ? 694  ASP C CG    1 
ATOM   8614  O  OD1   . ASP C 2  694  ? -34.621 33.047  4.550   1.00 51.93  ? 694  ASP C OD1   1 
ATOM   8615  O  OD2   . ASP C 2  694  ? -33.004 31.592  4.860   1.00 47.70  ? 694  ASP C OD2   1 
ATOM   8616  N  N     . ARG C 2  695  ? -36.953 33.004  8.401   1.00 30.82  ? 695  ARG C N     1 
ATOM   8617  C  CA    . ARG C 2  695  ? -37.703 32.552  9.558   1.00 30.37  ? 695  ARG C CA    1 
ATOM   8618  C  C     . ARG C 2  695  ? -37.293 31.132  9.871   1.00 30.76  ? 695  ARG C C     1 
ATOM   8619  O  O     . ARG C 2  695  ? -37.426 30.241  9.035   1.00 32.32  ? 695  ARG C O     1 
ATOM   8620  C  CB    . ARG C 2  695  ? -39.207 32.626  9.311   1.00 41.20  ? 695  ARG C CB    1 
ATOM   8621  C  CG    . ARG C 2  695  ? -40.029 31.841  10.320  1.00 45.44  ? 695  ARG C CG    1 
ATOM   8622  C  CD    . ARG C 2  695  ? -39.981 32.473  11.701  1.00 45.39  ? 695  ARG C CD    1 
ATOM   8623  N  NE    . ARG C 2  695  ? -40.591 31.603  12.701  1.00 45.06  ? 695  ARG C NE    1 
ATOM   8624  C  CZ    . ARG C 2  695  ? -40.822 31.959  13.961  1.00 48.92  ? 695  ARG C CZ    1 
ATOM   8625  N  NH1   . ARG C 2  695  ? -40.501 33.177  14.381  1.00 45.38  ? 695  ARG C NH1   1 
ATOM   8626  N  NH2   . ARG C 2  695  ? -41.379 31.095  14.801  1.00 47.58  ? 695  ARG C NH2   1 
ATOM   8627  N  N     . VAL C 2  696  ? -36.788 30.924  11.078  1.00 34.10  ? 696  VAL C N     1 
ATOM   8628  C  CA    . VAL C 2  696  ? -36.338 29.602  11.473  1.00 41.55  ? 696  VAL C CA    1 
ATOM   8629  C  C     . VAL C 2  696  ? -37.022 29.145  12.752  1.00 38.31  ? 696  VAL C C     1 
ATOM   8630  O  O     . VAL C 2  696  ? -37.200 29.919  13.696  1.00 37.89  ? 696  VAL C O     1 
ATOM   8631  C  CB    . VAL C 2  696  ? -34.809 29.556  11.657  1.00 41.71  ? 696  VAL C CB    1 
ATOM   8632  C  CG1   . VAL C 2  696  ? -34.117 29.625  10.304  1.00 39.87  ? 696  VAL C CG1   1 
ATOM   8633  C  CG2   . VAL C 2  696  ? -34.338 30.681  12.571  1.00 40.35  ? 696  VAL C CG2   1 
ATOM   8634  N  N     . GLU C 2  697  ? -37.414 27.878  12.763  1.00 40.06  ? 697  GLU C N     1 
ATOM   8635  C  CA    . GLU C 2  697  ? -38.099 27.294  13.904  1.00 41.98  ? 697  GLU C CA    1 
ATOM   8636  C  C     . GLU C 2  697  ? -37.142 26.422  14.704  1.00 35.49  ? 697  GLU C C     1 
ATOM   8637  O  O     . GLU C 2  697  ? -36.097 26.011  14.204  1.00 36.60  ? 697  GLU C O     1 
ATOM   8638  C  CB    . GLU C 2  697  ? -39.308 26.485  13.438  1.00 50.60  ? 697  GLU C CB    1 
ATOM   8639  C  CG    . GLU C 2  697  ? -40.264 27.275  12.558  1.00 57.52  ? 697  GLU C CG    1 
ATOM   8640  C  CD    . GLU C 2  697  ? -41.362 26.412  11.971  1.00 77.73  ? 697  GLU C CD    1 
ATOM   8641  O  OE1   . GLU C 2  697  ? -41.630 25.327  12.530  1.00 80.81  ? 697  GLU C OE1   1 
ATOM   8642  O  OE2   . GLU C 2  697  ? -41.951 26.817  10.946  1.00 79.99  ? 697  GLU C OE2   1 
ATOM   8643  N  N     . ALA C 2  698  ? -37.504 26.142  15.950  1.00 31.93  ? 698  ALA C N     1 
ATOM   8644  C  CA    . ALA C 2  698  ? -36.613 25.430  16.858  1.00 35.83  ? 698  ALA C CA    1 
ATOM   8645  C  C     . ALA C 2  698  ? -36.438 23.964  16.473  1.00 36.26  ? 698  ALA C C     1 
ATOM   8646  O  O     . ALA C 2  698  ? -37.400 23.280  16.121  1.00 32.40  ? 698  ALA C O     1 
ATOM   8647  C  CB    . ALA C 2  698  ? -37.125 25.542  18.282  1.00 44.43  ? 698  ALA C CB    1 
ATOM   8648  N  N     . GLY C 2  699  ? -35.198 23.490  16.544  1.00 35.07  ? 699  GLY C N     1 
ATOM   8649  C  CA    . GLY C 2  699  ? -34.882 22.113  16.211  1.00 36.35  ? 699  GLY C CA    1 
ATOM   8650  C  C     . GLY C 2  699  ? -34.443 21.961  14.770  1.00 35.28  ? 699  GLY C C     1 
ATOM   8651  O  O     . GLY C 2  699  ? -34.126 20.867  14.311  1.00 38.02  ? 699  GLY C O     1 
ATOM   8652  N  N     . GLN C 2  700  ? -34.417 23.074  14.051  1.00 34.71  ? 700  GLN C N     1 
ATOM   8653  C  CA    . GLN C 2  700  ? -34.047 23.060  12.644  1.00 34.93  ? 700  GLN C CA    1 
ATOM   8654  C  C     . GLN C 2  700  ? -32.537 23.188  12.474  1.00 30.99  ? 700  GLN C C     1 
ATOM   8655  O  O     . GLN C 2  700  ? -31.863 23.818  13.291  1.00 29.23  ? 700  GLN C O     1 
ATOM   8656  C  CB    . GLN C 2  700  ? -34.766 24.191  11.910  1.00 45.39  ? 700  GLN C CB    1 
ATOM   8657  C  CG    . GLN C 2  700  ? -34.539 24.247  10.414  1.00 47.12  ? 700  GLN C CG    1 
ATOM   8658  C  CD    . GLN C 2  700  ? -35.244 25.431  9.777   1.00 53.07  ? 700  GLN C CD    1 
ATOM   8659  O  OE1   . GLN C 2  700  ? -36.123 26.047  10.382  1.00 49.10  ? 700  GLN C OE1   1 
ATOM   8660  N  NE2   . GLN C 2  700  ? -34.855 25.759  8.551   1.00 63.36  ? 700  GLN C NE2   1 
ATOM   8661  N  N     . VAL C 2  701  ? -32.008 22.581  11.418  1.00 29.07  ? 701  VAL C N     1 
ATOM   8662  C  CA    . VAL C 2  701  ? -30.594 22.718  11.099  1.00 29.14  ? 701  VAL C CA    1 
ATOM   8663  C  C     . VAL C 2  701  ? -30.341 24.042  10.392  1.00 24.51  ? 701  VAL C C     1 
ATOM   8664  O  O     . VAL C 2  701  ? -30.894 24.300  9.323   1.00 26.21  ? 701  VAL C O     1 
ATOM   8665  C  CB    . VAL C 2  701  ? -30.092 21.560  10.216  1.00 30.23  ? 701  VAL C CB    1 
ATOM   8666  C  CG1   . VAL C 2  701  ? -28.627 21.764  9.843   1.00 29.53  ? 701  VAL C CG1   1 
ATOM   8667  C  CG2   . VAL C 2  701  ? -30.284 20.233  10.931  1.00 32.36  ? 701  VAL C CG2   1 
ATOM   8668  N  N     . ILE C 2  702  ? -29.504 24.879  10.994  1.00 22.21  ? 702  ILE C N     1 
ATOM   8669  C  CA    . ILE C 2  702  ? -29.196 26.182  10.419  1.00 24.65  ? 702  ILE C CA    1 
ATOM   8670  C  C     . ILE C 2  702  ? -27.778 26.257  9.847   1.00 26.64  ? 702  ILE C C     1 
ATOM   8671  O  O     . ILE C 2  702  ? -27.464 27.165  9.080   1.00 28.74  ? 702  ILE C O     1 
ATOM   8672  C  CB    . ILE C 2  702  ? -29.356 27.299  11.456  1.00 24.60  ? 702  ILE C CB    1 
ATOM   8673  C  CG1   . ILE C 2  702  ? -28.123 27.357  12.362  1.00 26.38  ? 702  ILE C CG1   1 
ATOM   8674  C  CG2   . ILE C 2  702  ? -30.633 27.097  12.259  1.00 26.13  ? 702  ILE C CG2   1 
ATOM   8675  C  CD1   . ILE C 2  702  ? -28.029 28.615  13.174  1.00 30.88  ? 702  ILE C CD1   1 
ATOM   8676  N  N     . ALA C 2  703  ? -26.927 25.309  10.226  1.00 29.86  ? 703  ALA C N     1 
ATOM   8677  C  CA    . ALA C 2  703  ? -25.547 25.279  9.756   1.00 29.61  ? 703  ALA C CA    1 
ATOM   8678  C  C     . ALA C 2  703  ? -24.966 23.888  9.928   1.00 30.41  ? 703  ALA C C     1 
ATOM   8679  O  O     . ALA C 2  703  ? -24.725 23.450  11.050  1.00 31.98  ? 703  ALA C O     1 
ATOM   8680  C  CB    . ALA C 2  703  ? -24.705 26.303  10.503  1.00 25.71  ? 703  ALA C CB    1 
ATOM   8681  N  N     . ASP C 2  704  ? -24.749 23.188  8.819   1.00 31.26  ? 704  ASP C N     1 
ATOM   8682  C  CA    . ASP C 2  704  ? -24.220 21.828  8.889   1.00 29.28  ? 704  ASP C CA    1 
ATOM   8683  C  C     . ASP C 2  704  ? -22.691 21.808  8.857   1.00 27.49  ? 704  ASP C C     1 
ATOM   8684  O  O     . ASP C 2  704  ? -22.054 22.802  8.508   1.00 24.23  ? 704  ASP C O     1 
ATOM   8685  C  CB    . ASP C 2  704  ? -24.801 20.964  7.755   1.00 33.01  ? 704  ASP C CB    1 
ATOM   8686  C  CG    . ASP C 2  704  ? -24.644 21.601  6.378   1.00 39.75  ? 704  ASP C CG    1 
ATOM   8687  O  OD1   . ASP C 2  704  ? -23.812 22.524  6.224   1.00 49.33  ? 704  ASP C OD1   1 
ATOM   8688  O  OD2   . ASP C 2  704  ? -25.356 21.176  5.442   1.00 31.74  ? 704  ASP C OD2   1 
ATOM   8689  N  N     . GLY C 2  705  ? -22.120 20.665  9.224   1.00 26.39  ? 705  GLY C N     1 
ATOM   8690  C  CA    . GLY C 2  705  ? -20.680 20.514  9.293   1.00 24.51  ? 705  GLY C CA    1 
ATOM   8691  C  C     . GLY C 2  705  ? -20.129 19.622  8.199   1.00 21.03  ? 705  GLY C C     1 
ATOM   8692  O  O     . GLY C 2  705  ? -20.633 19.622  7.079   1.00 24.88  ? 705  GLY C O     1 
ATOM   8693  N  N     . PRO C 2  706  ? -19.081 18.849  8.519   1.00 19.14  ? 706  PRO C N     1 
ATOM   8694  C  CA    . PRO C 2  706  ? -18.455 17.931  7.566   1.00 18.90  ? 706  PRO C CA    1 
ATOM   8695  C  C     . PRO C 2  706  ? -19.372 16.759  7.248   1.00 20.64  ? 706  PRO C C     1 
ATOM   8696  O  O     . PRO C 2  706  ? -20.099 16.303  8.129   1.00 18.60  ? 706  PRO C O     1 
ATOM   8697  C  CB    . PRO C 2  706  ? -17.201 17.466  8.304   1.00 19.08  ? 706  PRO C CB    1 
ATOM   8698  C  CG    . PRO C 2  706  ? -17.572 17.557  9.735   1.00 20.69  ? 706  PRO C CG    1 
ATOM   8699  C  CD    . PRO C 2  706  ? -18.457 18.764  9.850   1.00 21.89  ? 706  PRO C CD    1 
ATOM   8700  N  N     . CYS C 2  707  ? -19.338 16.292  6.003   1.00 21.94  ? 707  CYS C N     1 
ATOM   8701  C  CA    . CYS C 2  707  ? -20.211 15.216  5.542   1.00 24.12  ? 707  CYS C CA    1 
ATOM   8702  C  C     . CYS C 2  707  ? -21.683 15.479  5.857   1.00 23.50  ? 707  CYS C C     1 
ATOM   8703  O  O     . CYS C 2  707  ? -22.370 14.615  6.406   1.00 18.10  ? 707  CYS C O     1 
ATOM   8704  C  CB    . CYS C 2  707  ? -19.787 13.880  6.156   1.00 24.50  ? 707  CYS C CB    1 
ATOM   8705  S  SG    . CYS C 2  707  ? -18.238 13.218  5.513   1.00 21.22  ? 707  CYS C SG    1 
ATOM   8706  N  N     . THR C 2  708  ? -22.163 16.671  5.511   1.00 27.66  ? 708  THR C N     1 
ATOM   8707  C  CA    . THR C 2  708  ? -23.559 17.030  5.751   1.00 27.27  ? 708  THR C CA    1 
ATOM   8708  C  C     . THR C 2  708  ? -24.102 17.990  4.687   1.00 26.66  ? 708  THR C C     1 
ATOM   8709  O  O     . THR C 2  708  ? -23.518 19.043  4.432   1.00 26.21  ? 708  THR C O     1 
ATOM   8710  C  CB    . THR C 2  708  ? -23.745 17.674  7.142   1.00 29.27  ? 708  THR C CB    1 
ATOM   8711  O  OG1   . THR C 2  708  ? -22.783 17.142  8.061   1.00 32.65  ? 708  THR C OG1   1 
ATOM   8712  C  CG2   . THR C 2  708  ? -25.149 17.411  7.674   1.00 30.51  ? 708  THR C CG2   1 
ATOM   8713  N  N     . ASP C 2  709  ? -25.226 17.611  4.078   1.00 28.00  ? 709  ASP C N     1 
ATOM   8714  C  CA    . ASP C 2  709  ? -25.917 18.428  3.078   1.00 28.10  ? 709  ASP C CA    1 
ATOM   8715  C  C     . ASP C 2  709  ? -27.323 18.756  3.558   1.00 21.55  ? 709  ASP C C     1 
ATOM   8716  O  O     . ASP C 2  709  ? -28.189 17.881  3.589   1.00 19.51  ? 709  ASP C O     1 
ATOM   8717  C  CB    . ASP C 2  709  ? -25.973 17.701  1.723   1.00 26.03  ? 709  ASP C CB    1 
ATOM   8718  C  CG    . ASP C 2  709  ? -26.697 18.503  0.644   1.00 19.35  ? 709  ASP C CG    1 
ATOM   8719  O  OD1   . ASP C 2  709  ? -26.820 19.736  0.790   1.00 25.93  ? 709  ASP C OD1   1 
ATOM   8720  O  OD2   . ASP C 2  709  ? -27.131 17.900  -0.361  1.00 17.19  ? 709  ASP C OD2   1 
ATOM   8721  N  N     . ASP C 2  710  ? -27.538 20.012  3.939   1.00 20.01  ? 710  ASP C N     1 
ATOM   8722  C  CA    . ASP C 2  710  ? -28.839 20.473  4.416   1.00 25.29  ? 710  ASP C CA    1 
ATOM   8723  C  C     . ASP C 2  710  ? -29.317 19.624  5.598   1.00 24.76  ? 710  ASP C C     1 
ATOM   8724  O  O     . ASP C 2  710  ? -30.511 19.390  5.766   1.00 30.61  ? 710  ASP C O     1 
ATOM   8725  C  CB    . ASP C 2  710  ? -29.869 20.450  3.275   1.00 36.42  ? 710  ASP C CB    1 
ATOM   8726  C  CG    . ASP C 2  710  ? -30.857 21.613  3.339   1.00 37.85  ? 710  ASP C CG    1 
ATOM   8727  O  OD1   . ASP C 2  710  ? -31.991 21.463  2.834   1.00 41.29  ? 710  ASP C OD1   1 
ATOM   8728  O  OD2   . ASP C 2  710  ? -30.500 22.679  3.884   1.00 30.02  ? 710  ASP C OD2   1 
ATOM   8729  N  N     . GLY C 2  711  ? -28.374 19.154  6.407   1.00 23.27  ? 711  GLY C N     1 
ATOM   8730  C  CA    . GLY C 2  711  ? -28.703 18.409  7.608   1.00 26.67  ? 711  GLY C CA    1 
ATOM   8731  C  C     . GLY C 2  711  ? -28.766 16.901  7.439   1.00 25.78  ? 711  GLY C C     1 
ATOM   8732  O  O     . GLY C 2  711  ? -29.257 16.195  8.318   1.00 30.29  ? 711  GLY C O     1 
ATOM   8733  N  N     . GLU C 2  712  ? -28.268 16.399  6.315   1.00 22.21  ? 712  GLU C N     1 
ATOM   8734  C  CA    . GLU C 2  712  ? -28.262 14.960  6.074   1.00 21.83  ? 712  GLU C CA    1 
ATOM   8735  C  C     . GLU C 2  712  ? -26.842 14.420  5.960   1.00 22.29  ? 712  GLU C C     1 
ATOM   8736  O  O     . GLU C 2  712  ? -25.970 15.075  5.401   1.00 25.87  ? 712  GLU C O     1 
ATOM   8737  C  CB    . GLU C 2  712  ? -29.050 14.622  4.808   1.00 26.64  ? 712  GLU C CB    1 
ATOM   8738  C  CG    . GLU C 2  712  ? -30.556 14.807  4.936   1.00 29.66  ? 712  GLU C CG    1 
ATOM   8739  C  CD    . GLU C 2  712  ? -31.315 14.297  3.721   1.00 24.09  ? 712  GLU C CD    1 
ATOM   8740  O  OE1   . GLU C 2  712  ? -31.183 14.900  2.634   1.00 17.21  ? 712  GLU C OE1   1 
ATOM   8741  O  OE2   . GLU C 2  712  ? -32.038 13.286  3.851   1.00 23.94  ? 712  GLU C OE2   1 
ATOM   8742  N  N     . MET C 2  713  ? -26.617 13.223  6.493   1.00 20.17  ? 713  MET C N     1 
ATOM   8743  C  CA    . MET C 2  713  ? -25.299 12.594  6.437   1.00 21.12  ? 713  MET C CA    1 
ATOM   8744  C  C     . MET C 2  713  ? -24.824 12.390  5.004   1.00 16.94  ? 713  MET C C     1 
ATOM   8745  O  O     . MET C 2  713  ? -25.457 11.685  4.224   1.00 15.52  ? 713  MET C O     1 
ATOM   8746  C  CB    . MET C 2  713  ? -25.319 11.254  7.170   1.00 26.62  ? 713  MET C CB    1 
ATOM   8747  C  CG    . MET C 2  713  ? -25.380 11.386  8.680   1.00 27.51  ? 713  MET C CG    1 
ATOM   8748  S  SD    . MET C 2  713  ? -23.916 12.211  9.317   1.00 21.22  ? 713  MET C SD    1 
ATOM   8749  C  CE    . MET C 2  713  ? -22.633 11.189  8.607   1.00 15.78  ? 713  MET C CE    1 
ATOM   8750  N  N     . ALA C 2  714  ? -23.700 13.007  4.664   1.00 17.30  ? 714  ALA C N     1 
ATOM   8751  C  CA    . ALA C 2  714  ? -23.195 12.953  3.299   1.00 21.54  ? 714  ALA C CA    1 
ATOM   8752  C  C     . ALA C 2  714  ? -21.775 12.409  3.261   1.00 20.76  ? 714  ALA C C     1 
ATOM   8753  O  O     . ALA C 2  714  ? -20.814 13.168  3.172   1.00 24.62  ? 714  ALA C O     1 
ATOM   8754  C  CB    . ALA C 2  714  ? -23.254 14.335  2.663   1.00 25.97  ? 714  ALA C CB    1 
ATOM   8755  N  N     . LEU C 2  715  ? -21.648 11.090  3.317   1.00 14.04  ? 715  LEU C N     1 
ATOM   8756  C  CA    . LEU C 2  715  ? -20.339 10.455  3.384   1.00 12.71  ? 715  LEU C CA    1 
ATOM   8757  C  C     . LEU C 2  715  ? -19.609 10.376  2.047   1.00 16.26  ? 715  LEU C C     1 
ATOM   8758  O  O     . LEU C 2  715  ? -18.484 9.878   1.982   1.00 13.57  ? 715  LEU C O     1 
ATOM   8759  C  CB    . LEU C 2  715  ? -20.478 9.050   3.956   1.00 10.05  ? 715  LEU C CB    1 
ATOM   8760  C  CG    . LEU C 2  715  ? -20.905 9.019   5.416   1.00 11.50  ? 715  LEU C CG    1 
ATOM   8761  C  CD1   . LEU C 2  715  ? -20.974 7.586   5.906   1.00 9.86   ? 715  LEU C CD1   1 
ATOM   8762  C  CD2   . LEU C 2  715  ? -19.935 9.839   6.247   1.00 9.00   ? 715  LEU C CD2   1 
ATOM   8763  N  N     . GLY C 2  716  ? -20.234 10.850  0.977   1.00 16.86  ? 716  GLY C N     1 
ATOM   8764  C  CA    . GLY C 2  716  ? -19.621 10.714  -0.330  1.00 17.33  ? 716  GLY C CA    1 
ATOM   8765  C  C     . GLY C 2  716  ? -20.276 11.495  -1.447  1.00 17.77  ? 716  GLY C C     1 
ATOM   8766  O  O     . GLY C 2  716  ? -21.017 12.446  -1.202  1.00 17.45  ? 716  GLY C O     1 
ATOM   8767  N  N     . LYS C 2  717  ? -20.004 11.079  -2.681  1.00 18.65  ? 717  LYS C N     1 
ATOM   8768  C  CA    . LYS C 2  717  ? -20.509 11.761  -3.866  1.00 17.87  ? 717  LYS C CA    1 
ATOM   8769  C  C     . LYS C 2  717  ? -21.369 10.850  -4.731  1.00 20.43  ? 717  LYS C C     1 
ATOM   8770  O  O     . LYS C 2  717  ? -21.307 9.627   -4.610  1.00 19.23  ? 717  LYS C O     1 
ATOM   8771  C  CB    . LYS C 2  717  ? -19.349 12.303  -4.699  1.00 14.42  ? 717  LYS C CB    1 
ATOM   8772  C  CG    . LYS C 2  717  ? -18.483 13.293  -3.962  1.00 15.10  ? 717  LYS C CG    1 
ATOM   8773  C  CD    . LYS C 2  717  ? -19.326 14.405  -3.377  1.00 18.92  ? 717  LYS C CD    1 
ATOM   8774  C  CE    . LYS C 2  717  ? -18.515 15.672  -3.232  1.00 25.58  ? 717  LYS C CE    1 
ATOM   8775  N  NZ    . LYS C 2  717  ? -18.117 16.216  -4.560  1.00 24.98  ? 717  LYS C NZ    1 
ATOM   8776  N  N     . ASN C 2  718  ? -22.163 11.453  -5.611  1.00 21.08  ? 718  ASN C N     1 
ATOM   8777  C  CA    . ASN C 2  718  ? -22.985 10.695  -6.546  1.00 20.59  ? 718  ASN C CA    1 
ATOM   8778  C  C     . ASN C 2  718  ? -22.277 10.503  -7.875  1.00 20.12  ? 718  ASN C C     1 
ATOM   8779  O  O     . ASN C 2  718  ? -22.149 11.434  -8.669  1.00 23.36  ? 718  ASN C O     1 
ATOM   8780  C  CB    . ASN C 2  718  ? -24.327 11.384  -6.760  1.00 20.20  ? 718  ASN C CB    1 
ATOM   8781  C  CG    . ASN C 2  718  ? -25.161 11.416  -5.503  1.00 22.51  ? 718  ASN C CG    1 
ATOM   8782  O  OD1   . ASN C 2  718  ? -25.963 10.516  -5.256  1.00 24.04  ? 718  ASN C OD1   1 
ATOM   8783  N  ND2   . ASN C 2  718  ? -24.969 12.450  -4.692  1.00 21.89  ? 718  ASN C ND2   1 
ATOM   8784  N  N     . LEU C 2  719  ? -21.823 9.279   -8.110  1.00 17.44  ? 719  LEU C N     1 
ATOM   8785  C  CA    . LEU C 2  719  ? -20.981 8.992   -9.256  1.00 19.07  ? 719  LEU C CA    1 
ATOM   8786  C  C     . LEU C 2  719  ? -21.704 8.214   -10.343 1.00 20.83  ? 719  LEU C C     1 
ATOM   8787  O  O     . LEU C 2  719  ? -22.483 7.308   -10.060 1.00 18.27  ? 719  LEU C O     1 
ATOM   8788  C  CB    . LEU C 2  719  ? -19.740 8.224   -8.807  1.00 21.90  ? 719  LEU C CB    1 
ATOM   8789  C  CG    . LEU C 2  719  ? -18.462 9.059   -8.755  1.00 23.08  ? 719  LEU C CG    1 
ATOM   8790  C  CD1   . LEU C 2  719  ? -18.711 10.369  -8.025  1.00 19.67  ? 719  LEU C CD1   1 
ATOM   8791  C  CD2   . LEU C 2  719  ? -17.325 8.276   -8.107  1.00 25.12  ? 719  LEU C CD2   1 
ATOM   8792  N  N     . LEU C 2  720  ? -21.434 8.580   -11.590 1.00 25.58  ? 720  LEU C N     1 
ATOM   8793  C  CA    . LEU C 2  720  ? -21.953 7.857   -12.743 1.00 21.74  ? 720  LEU C CA    1 
ATOM   8794  C  C     . LEU C 2  720  ? -21.141 6.584   -12.967 1.00 20.91  ? 720  LEU C C     1 
ATOM   8795  O  O     . LEU C 2  720  ? -19.951 6.650   -13.261 1.00 23.09  ? 720  LEU C O     1 
ATOM   8796  C  CB    . LEU C 2  720  ? -21.916 8.748   -13.985 1.00 23.32  ? 720  LEU C CB    1 
ATOM   8797  C  CG    . LEU C 2  720  ? -22.365 8.123   -15.304 1.00 26.67  ? 720  LEU C CG    1 
ATOM   8798  C  CD1   . LEU C 2  720  ? -23.749 7.506   -15.173 1.00 27.18  ? 720  LEU C CD1   1 
ATOM   8799  C  CD2   . LEU C 2  720  ? -22.344 9.163   -16.411 1.00 32.86  ? 720  LEU C CD2   1 
ATOM   8800  N  N     . VAL C 2  721  ? -21.784 5.427   -12.827 1.00 19.49  ? 721  VAL C N     1 
ATOM   8801  C  CA    . VAL C 2  721  ? -21.070 4.153   -12.876 1.00 19.77  ? 721  VAL C CA    1 
ATOM   8802  C  C     . VAL C 2  721  ? -21.287 3.398   -14.190 1.00 22.75  ? 721  VAL C C     1 
ATOM   8803  O  O     . VAL C 2  721  ? -22.287 3.597   -14.882 1.00 26.57  ? 721  VAL C O     1 
ATOM   8804  C  CB    . VAL C 2  721  ? -21.485 3.240   -11.695 1.00 20.29  ? 721  VAL C CB    1 
ATOM   8805  C  CG1   . VAL C 2  721  ? -22.769 2.483   -12.011 1.00 20.05  ? 721  VAL C CG1   1 
ATOM   8806  C  CG2   . VAL C 2  721  ? -20.374 2.270   -11.355 1.00 24.15  ? 721  VAL C CG2   1 
ATOM   8807  N  N     . ALA C 2  722  ? -20.332 2.536   -14.529 1.00 21.93  ? 722  ALA C N     1 
ATOM   8808  C  CA    . ALA C 2  722  ? -20.451 1.656   -15.686 1.00 20.94  ? 722  ALA C CA    1 
ATOM   8809  C  C     . ALA C 2  722  ? -19.919 0.252   -15.369 1.00 23.00  ? 722  ALA C C     1 
ATOM   8810  O  O     . ALA C 2  722  ? -18.718 0.069   -15.191 1.00 24.96  ? 722  ALA C O     1 
ATOM   8811  C  CB    . ALA C 2  722  ? -19.715 2.247   -16.869 1.00 22.29  ? 722  ALA C CB    1 
ATOM   8812  N  N     . ILE C 2  723  ? -20.809 -0.737  -15.313 1.00 22.59  ? 723  ILE C N     1 
ATOM   8813  C  CA    . ILE C 2  723  ? -20.431 -2.088  -14.887 1.00 22.81  ? 723  ILE C CA    1 
ATOM   8814  C  C     . ILE C 2  723  ? -19.846 -2.938  -16.021 1.00 25.04  ? 723  ILE C C     1 
ATOM   8815  O  O     . ILE C 2  723  ? -20.529 -3.790  -16.589 1.00 25.62  ? 723  ILE C O     1 
ATOM   8816  C  CB    . ILE C 2  723  ? -21.634 -2.838  -14.283 1.00 20.93  ? 723  ILE C CB    1 
ATOM   8817  C  CG1   . ILE C 2  723  ? -22.481 -1.891  -13.437 1.00 18.28  ? 723  ILE C CG1   1 
ATOM   8818  C  CG2   . ILE C 2  723  ? -21.169 -4.020  -13.447 1.00 25.37  ? 723  ILE C CG2   1 
ATOM   8819  C  CD1   . ILE C 2  723  ? -21.764 -1.355  -12.230 1.00 17.08  ? 723  ILE C CD1   1 
ATOM   8820  N  N     . MET C 2  724  ? -18.573 -2.714  -16.332 1.00 25.44  ? 724  MET C N     1 
ATOM   8821  C  CA    . MET C 2  724  ? -17.906 -3.445  -17.405 1.00 21.94  ? 724  MET C CA    1 
ATOM   8822  C  C     . MET C 2  724  ? -16.406 -3.596  -17.156 1.00 21.15  ? 724  MET C C     1 
ATOM   8823  O  O     . MET C 2  724  ? -15.758 -2.673  -16.663 1.00 23.13  ? 724  MET C O     1 
ATOM   8824  C  CB    . MET C 2  724  ? -18.129 -2.738  -18.744 1.00 22.59  ? 724  MET C CB    1 
ATOM   8825  C  CG    . MET C 2  724  ? -17.522 -1.338  -18.798 1.00 23.47  ? 724  MET C CG    1 
ATOM   8826  S  SD    . MET C 2  724  ? -17.641 -0.507  -20.396 1.00 25.96  ? 724  MET C SD    1 
ATOM   8827  C  CE    . MET C 2  724  ? -16.937 -1.752  -21.472 1.00 33.80  ? 724  MET C CE    1 
ATOM   8828  N  N     . PRO C 2  725  ? -15.848 -4.767  -17.491 1.00 21.55  ? 725  PRO C N     1 
ATOM   8829  C  CA    . PRO C 2  725  ? -14.389 -4.887  -17.512 1.00 22.31  ? 725  PRO C CA    1 
ATOM   8830  C  C     . PRO C 2  725  ? -13.810 -3.905  -18.524 1.00 20.67  ? 725  PRO C C     1 
ATOM   8831  O  O     . PRO C 2  725  ? -14.401 -3.729  -19.585 1.00 23.59  ? 725  PRO C O     1 
ATOM   8832  C  CB    . PRO C 2  725  ? -14.157 -6.339  -17.945 1.00 22.28  ? 725  PRO C CB    1 
ATOM   8833  C  CG    . PRO C 2  725  ? -15.430 -7.047  -17.607 1.00 20.92  ? 725  PRO C CG    1 
ATOM   8834  C  CD    . PRO C 2  725  ? -16.515 -6.039  -17.816 1.00 22.48  ? 725  PRO C CD    1 
ATOM   8835  N  N     . TRP C 2  726  ? -12.695 -3.258  -18.206 1.00 20.92  ? 726  TRP C N     1 
ATOM   8836  C  CA    . TRP C 2  726  ? -12.116 -2.296  -19.136 1.00 22.34  ? 726  TRP C CA    1 
ATOM   8837  C  C     . TRP C 2  726  ? -10.597 -2.376  -19.188 1.00 27.18  ? 726  TRP C C     1 
ATOM   8838  O  O     . TRP C 2  726  ? -9.907  -1.793  -18.354 1.00 24.86  ? 726  TRP C O     1 
ATOM   8839  C  CB    . TRP C 2  726  ? -12.543 -0.877  -18.770 1.00 20.70  ? 726  TRP C CB    1 
ATOM   8840  C  CG    . TRP C 2  726  ? -12.333 0.104   -19.877 1.00 27.97  ? 726  TRP C CG    1 
ATOM   8841  C  CD1   . TRP C 2  726  ? -13.226 0.435   -20.852 1.00 34.43  ? 726  TRP C CD1   1 
ATOM   8842  C  CD2   . TRP C 2  726  ? -11.156 0.881   -20.130 1.00 28.85  ? 726  TRP C CD2   1 
ATOM   8843  N  NE1   . TRP C 2  726  ? -12.681 1.373   -21.697 1.00 41.62  ? 726  TRP C NE1   1 
ATOM   8844  C  CE2   . TRP C 2  726  ? -11.411 1.664   -21.275 1.00 32.53  ? 726  TRP C CE2   1 
ATOM   8845  C  CE3   . TRP C 2  726  ? -9.914  0.994   -19.500 1.00 28.50  ? 726  TRP C CE3   1 
ATOM   8846  C  CZ2   . TRP C 2  726  ? -10.471 2.545   -21.801 1.00 32.51  ? 726  TRP C CZ2   1 
ATOM   8847  C  CZ3   . TRP C 2  726  ? -8.981  1.866   -20.028 1.00 30.35  ? 726  TRP C CZ3   1 
ATOM   8848  C  CH2   . TRP C 2  726  ? -9.265  2.631   -21.165 1.00 30.87  ? 726  TRP C CH2   1 
ATOM   8849  N  N     . GLU C 2  727  ? -10.092 -3.110  -20.174 1.00 30.28  ? 727  GLU C N     1 
ATOM   8850  C  CA    . GLU C 2  727  ? -8.662  -3.188  -20.451 1.00 28.11  ? 727  GLU C CA    1 
ATOM   8851  C  C     . GLU C 2  727  ? -7.829  -3.572  -19.229 1.00 25.99  ? 727  GLU C C     1 
ATOM   8852  O  O     . GLU C 2  727  ? -6.722  -3.069  -19.047 1.00 29.21  ? 727  GLU C O     1 
ATOM   8853  C  CB    . GLU C 2  727  ? -8.164  -1.854  -21.009 1.00 31.79  ? 727  GLU C CB    1 
ATOM   8854  C  CG    . GLU C 2  727  ? -8.986  -1.308  -22.170 1.00 37.42  ? 727  GLU C CG    1 
ATOM   8855  C  CD    . GLU C 2  727  ? -8.664  -1.980  -23.493 1.00 42.76  ? 727  GLU C CD    1 
ATOM   8856  O  OE1   . GLU C 2  727  ? -8.154  -1.289  -24.402 1.00 53.61  ? 727  GLU C OE1   1 
ATOM   8857  O  OE2   . GLU C 2  727  ? -8.922  -3.195  -23.628 1.00 35.76  ? 727  GLU C OE2   1 
ATOM   8858  N  N     . GLY C 2  728  ? -8.377  -4.443  -18.387 1.00 23.30  ? 728  GLY C N     1 
ATOM   8859  C  CA    . GLY C 2  728  ? -7.651  -4.989  -17.253 1.00 24.02  ? 728  GLY C CA    1 
ATOM   8860  C  C     . GLY C 2  728  ? -7.158  -4.018  -16.191 1.00 31.62  ? 728  GLY C C     1 
ATOM   8861  O  O     . GLY C 2  728  ? -6.332  -4.384  -15.355 1.00 35.79  ? 728  GLY C O     1 
ATOM   8862  N  N     . HIS C 2  729  ? -7.657  -2.788  -16.202 1.00 26.97  ? 729  HIS C N     1 
ATOM   8863  C  CA    . HIS C 2  729  ? -7.212  -1.806  -15.219 1.00 21.24  ? 729  HIS C CA    1 
ATOM   8864  C  C     . HIS C 2  729  ? -8.069  -1.836  -13.957 1.00 24.84  ? 729  HIS C C     1 
ATOM   8865  O  O     . HIS C 2  729  ? -7.683  -1.290  -12.925 1.00 23.97  ? 729  HIS C O     1 
ATOM   8866  C  CB    . HIS C 2  729  ? -7.211  -0.407  -15.826 1.00 23.01  ? 729  HIS C CB    1 
ATOM   8867  C  CG    . HIS C 2  729  ? -5.896  -0.011  -16.419 1.00 26.85  ? 729  HIS C CG    1 
ATOM   8868  N  ND1   . HIS C 2  729  ? -4.803  0.315   -15.647 1.00 30.14  ? 729  HIS C ND1   1 
ATOM   8869  C  CD2   . HIS C 2  729  ? -5.497  0.110   -17.707 1.00 27.88  ? 729  HIS C CD2   1 
ATOM   8870  C  CE1   . HIS C 2  729  ? -3.788  0.624   -16.433 1.00 36.50  ? 729  HIS C CE1   1 
ATOM   8871  N  NE2   . HIS C 2  729  ? -4.182  0.507   -17.688 1.00 32.88  ? 729  HIS C NE2   1 
ATOM   8872  N  N     . ASN C 2  730  ? -9.231  -2.476  -14.051 1.00 23.79  ? 730  ASN C N     1 
ATOM   8873  C  CA    . ASN C 2  730  ? -10.116 -2.663  -12.904 1.00 19.40  ? 730  ASN C CA    1 
ATOM   8874  C  C     . ASN C 2  730  ? -10.142 -4.117  -12.459 1.00 21.91  ? 730  ASN C C     1 
ATOM   8875  O  O     . ASN C 2  730  ? -11.161 -4.625  -11.999 1.00 21.86  ? 730  ASN C O     1 
ATOM   8876  C  CB    . ASN C 2  730  ? -11.527 -2.208  -13.243 1.00 16.70  ? 730  ASN C CB    1 
ATOM   8877  C  CG    . ASN C 2  730  ? -12.093 -2.931  -14.446 1.00 21.30  ? 730  ASN C CG    1 
ATOM   8878  O  OD1   . ASN C 2  730  ? -11.575 -3.964  -14.870 1.00 24.17  ? 730  ASN C OD1   1 
ATOM   8879  N  ND2   . ASN C 2  730  ? -13.159 -2.385  -15.011 1.00 34.30  ? 730  ASN C ND2   1 
ATOM   8880  N  N     . TYR C 2  731  ? -9.010  -4.782  -12.633 1.00 26.51  ? 731  TYR C N     1 
ATOM   8881  C  CA    . TYR C 2  731  ? -8.875  -6.200  -12.341 1.00 27.30  ? 731  TYR C CA    1 
ATOM   8882  C  C     . TYR C 2  731  ? -8.591  -6.433  -10.860 1.00 24.38  ? 731  TYR C C     1 
ATOM   8883  O  O     . TYR C 2  731  ? -7.765  -5.741  -10.271 1.00 25.60  ? 731  TYR C O     1 
ATOM   8884  C  CB    . TYR C 2  731  ? -7.766  -6.788  -13.214 1.00 30.13  ? 731  TYR C CB    1 
ATOM   8885  C  CG    . TYR C 2  731  ? -7.231  -8.122  -12.766 1.00 29.30  ? 731  TYR C CG    1 
ATOM   8886  C  CD1   . TYR C 2  731  ? -7.949  -9.289  -12.981 1.00 31.12  ? 731  TYR C CD1   1 
ATOM   8887  C  CD2   . TYR C 2  731  ? -5.989  -8.218  -12.154 1.00 30.07  ? 731  TYR C CD2   1 
ATOM   8888  C  CE1   . TYR C 2  731  ? -7.453  -10.511 -12.582 1.00 34.80  ? 731  TYR C CE1   1 
ATOM   8889  C  CE2   . TYR C 2  731  ? -5.485  -9.434  -11.753 1.00 32.42  ? 731  TYR C CE2   1 
ATOM   8890  C  CZ    . TYR C 2  731  ? -6.221  -10.578 -11.969 1.00 35.49  ? 731  TYR C CZ    1 
ATOM   8891  O  OH    . TYR C 2  731  ? -5.720  -11.794 -11.568 1.00 37.91  ? 731  TYR C OH    1 
ATOM   8892  N  N     . GLU C 2  732  ? -9.286  -7.404  -10.270 1.00 26.58  ? 732  GLU C N     1 
ATOM   8893  C  CA    . GLU C 2  732  ? -9.162  -7.731  -8.845  1.00 30.64  ? 732  GLU C CA    1 
ATOM   8894  C  C     . GLU C 2  732  ? -9.488  -6.543  -7.940  1.00 24.97  ? 732  GLU C C     1 
ATOM   8895  O  O     . GLU C 2  732  ? -8.652  -6.095  -7.152  1.00 22.12  ? 732  GLU C O     1 
ATOM   8896  C  CB    . GLU C 2  732  ? -7.760  -8.263  -8.529  1.00 37.69  ? 732  GLU C CB    1 
ATOM   8897  C  CG    . GLU C 2  732  ? -7.621  -9.783  -8.601  1.00 38.55  ? 732  GLU C CG    1 
ATOM   8898  C  CD    . GLU C 2  732  ? -8.156  -10.484 -7.360  1.00 39.11  ? 732  GLU C CD    1 
ATOM   8899  O  OE1   . GLU C 2  732  ? -9.392  -10.550 -7.196  1.00 41.18  ? 732  GLU C OE1   1 
ATOM   8900  O  OE2   . GLU C 2  732  ? -7.339  -10.969 -6.546  1.00 34.00  ? 732  GLU C OE2   1 
ATOM   8901  N  N     . ASP C 2  733  ? -10.711 -6.041  -8.086  1.00 25.22  ? 733  ASP C N     1 
ATOM   8902  C  CA    . ASP C 2  733  ? -11.288 -5.023  -7.208  1.00 24.68  ? 733  ASP C CA    1 
ATOM   8903  C  C     . ASP C 2  733  ? -10.619 -3.656  -7.309  1.00 22.54  ? 733  ASP C C     1 
ATOM   8904  O  O     . ASP C 2  733  ? -10.845 -2.787  -6.469  1.00 19.53  ? 733  ASP C O     1 
ATOM   8905  C  CB    . ASP C 2  733  ? -11.264 -5.506  -5.756  1.00 28.29  ? 733  ASP C CB    1 
ATOM   8906  C  CG    . ASP C 2  733  ? -12.138 -6.723  -5.539  1.00 39.39  ? 733  ASP C CG    1 
ATOM   8907  O  OD1   . ASP C 2  733  ? -13.063 -6.934  -6.350  1.00 48.71  ? 733  ASP C OD1   1 
ATOM   8908  O  OD2   . ASP C 2  733  ? -11.903 -7.467  -4.565  1.00 41.29  ? 733  ASP C OD2   1 
ATOM   8909  N  N     . ALA C 2  734  ? -9.805  -3.461  -8.339  1.00 20.22  ? 734  ALA C N     1 
ATOM   8910  C  CA    . ALA C 2  734  ? -9.254  -2.142  -8.605  1.00 17.34  ? 734  ALA C CA    1 
ATOM   8911  C  C     . ALA C 2  734  ? -10.354 -1.266  -9.187  1.00 19.15  ? 734  ALA C C     1 
ATOM   8912  O  O     . ALA C 2  734  ? -11.409 -1.764  -9.580  1.00 20.41  ? 734  ALA C O     1 
ATOM   8913  C  CB    . ALA C 2  734  ? -8.071  -2.226  -9.547  1.00 19.37  ? 734  ALA C CB    1 
ATOM   8914  N  N     . ILE C 2  735  ? -10.114 0.039   -9.235  1.00 19.49  ? 735  ILE C N     1 
ATOM   8915  C  CA    . ILE C 2  735  ? -11.141 0.976   -9.675  1.00 20.10  ? 735  ILE C CA    1 
ATOM   8916  C  C     . ILE C 2  735  ? -10.592 2.001   -10.663 1.00 19.10  ? 735  ILE C C     1 
ATOM   8917  O  O     . ILE C 2  735  ? -9.487  2.517   -10.493 1.00 18.40  ? 735  ILE C O     1 
ATOM   8918  C  CB    . ILE C 2  735  ? -11.774 1.710   -8.475  1.00 19.02  ? 735  ILE C CB    1 
ATOM   8919  C  CG1   . ILE C 2  735  ? -12.468 0.713   -7.545  1.00 18.06  ? 735  ILE C CG1   1 
ATOM   8920  C  CG2   . ILE C 2  735  ? -12.773 2.751   -8.943  1.00 21.04  ? 735  ILE C CG2   1 
ATOM   8921  C  CD1   . ILE C 2  735  ? -13.250 1.362   -6.426  1.00 16.67  ? 735  ILE C CD1   1 
ATOM   8922  N  N     . ILE C 2  736  ? -11.372 2.280   -11.702 1.00 17.67  ? 736  ILE C N     1 
ATOM   8923  C  CA    . ILE C 2  736  ? -10.989 3.244   -12.719 1.00 19.26  ? 736  ILE C CA    1 
ATOM   8924  C  C     . ILE C 2  736  ? -11.772 4.540   -12.559 1.00 20.70  ? 736  ILE C C     1 
ATOM   8925  O  O     . ILE C 2  736  ? -12.990 4.518   -12.402 1.00 19.14  ? 736  ILE C O     1 
ATOM   8926  C  CB    . ILE C 2  736  ? -11.220 2.685   -14.130 1.00 21.08  ? 736  ILE C CB    1 
ATOM   8927  C  CG1   . ILE C 2  736  ? -10.626 1.280   -14.252 1.00 26.03  ? 736  ILE C CG1   1 
ATOM   8928  C  CG2   . ILE C 2  736  ? -10.624 3.611   -15.175 1.00 26.37  ? 736  ILE C CG2   1 
ATOM   8929  C  CD1   . ILE C 2  736  ? -10.773 0.670   -15.633 1.00 28.95  ? 736  ILE C CD1   1 
ATOM   8930  N  N     . LEU C 2  737  ? -11.064 5.665   -12.607 1.00 26.27  ? 737  LEU C N     1 
ATOM   8931  C  CA    . LEU C 2  737  ? -11.680 6.976   -12.419 1.00 21.74  ? 737  LEU C CA    1 
ATOM   8932  C  C     . LEU C 2  737  ? -11.653 7.860   -13.656 1.00 22.89  ? 737  LEU C C     1 
ATOM   8933  O  O     . LEU C 2  737  ? -10.819 7.696   -14.546 1.00 24.64  ? 737  LEU C O     1 
ATOM   8934  C  CB    . LEU C 2  737  ? -10.993 7.734   -11.283 1.00 19.78  ? 737  LEU C CB    1 
ATOM   8935  C  CG    . LEU C 2  737  ? -11.266 7.269   -9.857  1.00 21.92  ? 737  LEU C CG    1 
ATOM   8936  C  CD1   . LEU C 2  737  ? -10.729 8.292   -8.870  1.00 17.08  ? 737  LEU C CD1   1 
ATOM   8937  C  CD2   . LEU C 2  737  ? -12.750 7.008   -9.627  1.00 23.39  ? 737  LEU C CD2   1 
ATOM   8938  N  N     . SER C 2  738  ? -12.574 8.815   -13.683 1.00 26.32  ? 738  SER C N     1 
ATOM   8939  C  CA    . SER C 2  738  ? -12.543 9.884   -14.665 1.00 29.81  ? 738  SER C CA    1 
ATOM   8940  C  C     . SER C 2  738  ? -11.709 11.033  -14.114 1.00 24.04  ? 738  SER C C     1 
ATOM   8941  O  O     . SER C 2  738  ? -11.763 11.332  -12.921 1.00 24.00  ? 738  SER C O     1 
ATOM   8942  C  CB    . SER C 2  738  ? -13.958 10.354  -15.006 1.00 28.80  ? 738  SER C CB    1 
ATOM   8943  O  OG    . SER C 2  738  ? -13.931 11.386  -15.977 1.00 33.06  ? 738  SER C OG    1 
ATOM   8944  N  N     . ASN C 2  739  ? -10.936 11.677  -14.981 1.00 22.65  ? 739  ASN C N     1 
ATOM   8945  C  CA    . ASN C 2  739  ? -10.094 12.783  -14.551 1.00 22.58  ? 739  ASN C CA    1 
ATOM   8946  C  C     . ASN C 2  739  ? -10.939 13.962  -14.109 1.00 24.50  ? 739  ASN C C     1 
ATOM   8947  O  O     . ASN C 2  739  ? -10.439 14.904  -13.499 1.00 26.32  ? 739  ASN C O     1 
ATOM   8948  C  CB    . ASN C 2  739  ? -9.140  13.213  -15.660 1.00 29.18  ? 739  ASN C CB    1 
ATOM   8949  C  CG    . ASN C 2  739  ? -7.842  13.765  -15.115 1.00 34.07  ? 739  ASN C CG    1 
ATOM   8950  O  OD1   . ASN C 2  739  ? -7.499  13.529  -13.957 1.00 34.36  ? 739  ASN C OD1   1 
ATOM   8951  N  ND2   . ASN C 2  739  ? -7.110  14.498  -15.944 1.00 34.70  ? 739  ASN C ND2   1 
ATOM   8952  N  N     . ARG C 2  740  ? -12.227 13.897  -14.425 1.00 26.13  ? 740  ARG C N     1 
ATOM   8953  C  CA    . ARG C 2  740  ? -13.179 14.897  -13.976 1.00 24.95  ? 740  ARG C CA    1 
ATOM   8954  C  C     . ARG C 2  740  ? -13.168 15.025  -12.460 1.00 27.21  ? 740  ARG C C     1 
ATOM   8955  O  O     . ARG C 2  740  ? -13.315 16.121  -11.921 1.00 32.81  ? 740  ARG C O     1 
ATOM   8956  C  CB    . ARG C 2  740  ? -14.585 14.549  -14.446 1.00 20.97  ? 740  ARG C CB    1 
ATOM   8957  C  CG    . ARG C 2  740  ? -15.605 15.604  -14.096 1.00 18.00  ? 740  ARG C CG    1 
ATOM   8958  C  CD    . ARG C 2  740  ? -16.984 15.169  -14.507 1.00 20.87  ? 740  ARG C CD    1 
ATOM   8959  N  NE    . ARG C 2  740  ? -17.546 14.213  -13.564 1.00 17.87  ? 740  ARG C NE    1 
ATOM   8960  C  CZ    . ARG C 2  740  ? -18.316 14.557  -12.539 1.00 17.23  ? 740  ARG C CZ    1 
ATOM   8961  N  NH1   . ARG C 2  740  ? -18.609 15.833  -12.335 1.00 15.93  ? 740  ARG C NH1   1 
ATOM   8962  N  NH2   . ARG C 2  740  ? -18.794 13.632  -11.722 1.00 25.71  ? 740  ARG C NH2   1 
ATOM   8963  N  N     . LEU C 2  741  ? -12.989 13.900  -11.774 1.00 24.29  ? 741  LEU C N     1 
ATOM   8964  C  CA    . LEU C 2  741  ? -13.042 13.883  -10.317 1.00 21.86  ? 741  LEU C CA    1 
ATOM   8965  C  C     . LEU C 2  741  ? -11.810 14.541  -9.712  1.00 21.41  ? 741  LEU C C     1 
ATOM   8966  O  O     . LEU C 2  741  ? -11.796 14.896  -8.536  1.00 19.07  ? 741  LEU C O     1 
ATOM   8967  C  CB    . LEU C 2  741  ? -13.184 12.451  -9.808  1.00 17.70  ? 741  LEU C CB    1 
ATOM   8968  C  CG    . LEU C 2  741  ? -14.359 11.670  -10.401 1.00 20.79  ? 741  LEU C CG    1 
ATOM   8969  C  CD1   . LEU C 2  741  ? -14.443 10.282  -9.790  1.00 25.14  ? 741  LEU C CD1   1 
ATOM   8970  C  CD2   . LEU C 2  741  ? -15.672 12.422  -10.222 1.00 22.50  ? 741  LEU C CD2   1 
ATOM   8971  N  N     . VAL C 2  742  ? -10.778 14.701  -10.531 1.00 21.00  ? 742  VAL C N     1 
ATOM   8972  C  CA    . VAL C 2  742  ? -9.563  15.387  -10.122 1.00 21.23  ? 742  VAL C CA    1 
ATOM   8973  C  C     . VAL C 2  742  ? -9.680  16.886  -10.373 1.00 27.60  ? 742  VAL C C     1 
ATOM   8974  O  O     . VAL C 2  742  ? -9.343  17.703  -9.514  1.00 26.53  ? 742  VAL C O     1 
ATOM   8975  C  CB    . VAL C 2  742  ? -8.341  14.835  -10.873 1.00 23.31  ? 742  VAL C CB    1 
ATOM   8976  C  CG1   . VAL C 2  742  ? -7.153  15.772  -10.741 1.00 32.89  ? 742  VAL C CG1   1 
ATOM   8977  C  CG2   . VAL C 2  742  ? -7.998  13.448  -10.367 1.00 25.39  ? 742  VAL C CG2   1 
ATOM   8978  N  N     . GLU C 2  743  ? -10.176 17.237  -11.555 1.00 31.42  ? 743  GLU C N     1 
ATOM   8979  C  CA    . GLU C 2  743  ? -10.252 18.629  -11.987 1.00 31.42  ? 743  GLU C CA    1 
ATOM   8980  C  C     . GLU C 2  743  ? -11.363 19.416  -11.304 1.00 25.99  ? 743  GLU C C     1 
ATOM   8981  O  O     . GLU C 2  743  ? -11.249 20.627  -11.123 1.00 28.53  ? 743  GLU C O     1 
ATOM   8982  C  CB    . GLU C 2  743  ? -10.447 18.695  -13.498 1.00 32.62  ? 743  GLU C CB    1 
ATOM   8983  C  CG    . GLU C 2  743  ? -9.407  17.927  -14.275 1.00 34.75  ? 743  GLU C CG    1 
ATOM   8984  C  CD    . GLU C 2  743  ? -9.656  17.971  -15.762 1.00 46.81  ? 743  GLU C CD    1 
ATOM   8985  O  OE1   . GLU C 2  743  ? -10.715 18.497  -16.167 1.00 53.75  ? 743  GLU C OE1   1 
ATOM   8986  O  OE2   . GLU C 2  743  ? -8.795  17.482  -16.523 1.00 59.20  ? 743  GLU C OE2   1 
ATOM   8987  N  N     . GLU C 2  744  ? -12.440 18.736  -10.933 1.00 22.45  ? 744  GLU C N     1 
ATOM   8988  C  CA    . GLU C 2  744  ? -13.573 19.417  -10.324 1.00 24.24  ? 744  GLU C CA    1 
ATOM   8989  C  C     . GLU C 2  744  ? -13.620 19.209  -8.815  1.00 24.83  ? 744  GLU C C     1 
ATOM   8990  O  O     . GLU C 2  744  ? -14.617 19.536  -8.172  1.00 25.83  ? 744  GLU C O     1 
ATOM   8991  C  CB    . GLU C 2  744  ? -14.881 18.946  -10.956 1.00 22.54  ? 744  GLU C CB    1 
ATOM   8992  C  CG    . GLU C 2  744  ? -15.000 19.260  -12.440 1.00 31.28  ? 744  GLU C CG    1 
ATOM   8993  C  CD    . GLU C 2  744  ? -16.350 18.867  -13.013 1.00 37.55  ? 744  GLU C CD    1 
ATOM   8994  O  OE1   . GLU C 2  744  ? -17.112 18.169  -12.311 1.00 33.02  ? 744  GLU C OE1   1 
ATOM   8995  O  OE2   . GLU C 2  744  ? -16.651 19.259  -14.162 1.00 44.36  ? 744  GLU C OE2   1 
ATOM   8996  N  N     . ASP C 2  745  ? -12.533 18.670  -8.264  1.00 27.76  ? 745  ASP C N     1 
ATOM   8997  C  CA    . ASP C 2  745  ? -12.399 18.418  -6.824  1.00 27.59  ? 745  ASP C CA    1 
ATOM   8998  C  C     . ASP C 2  745  ? -13.607 17.715  -6.211  1.00 23.67  ? 745  ASP C C     1 
ATOM   8999  O  O     . ASP C 2  745  ? -13.973 17.972  -5.064  1.00 21.03  ? 745  ASP C O     1 
ATOM   9000  C  CB    . ASP C 2  745  ? -12.133 19.727  -6.074  1.00 29.49  ? 745  ASP C CB    1 
ATOM   9001  C  CG    . ASP C 2  745  ? -10.656 20.098  -6.047  1.00 30.59  ? 745  ASP C CG    1 
ATOM   9002  O  OD1   . ASP C 2  745  ? -9.813  19.190  -6.203  1.00 30.34  ? 745  ASP C OD1   1 
ATOM   9003  O  OD2   . ASP C 2  745  ? -10.337 21.294  -5.864  1.00 28.84  ? 745  ASP C OD2   1 
ATOM   9004  N  N     . VAL C 2  746  ? -14.216 16.827  -6.990  1.00 25.95  ? 746  VAL C N     1 
ATOM   9005  C  CA    . VAL C 2  746  ? -15.349 16.041  -6.526  1.00 22.10  ? 746  VAL C CA    1 
ATOM   9006  C  C     . VAL C 2  746  ? -14.915 15.128  -5.381  1.00 20.32  ? 746  VAL C C     1 
ATOM   9007  O  O     . VAL C 2  746  ? -15.607 15.015  -4.370  1.00 24.03  ? 746  VAL C O     1 
ATOM   9008  C  CB    . VAL C 2  746  ? -15.962 15.199  -7.662  1.00 18.57  ? 746  VAL C CB    1 
ATOM   9009  C  CG1   . VAL C 2  746  ? -17.093 14.342  -7.133  1.00 25.46  ? 746  VAL C CG1   1 
ATOM   9010  C  CG2   . VAL C 2  746  ? -16.462 16.099  -8.778  1.00 19.70  ? 746  VAL C CG2   1 
ATOM   9011  N  N     . LEU C 2  747  ? -13.763 14.486  -5.529  1.00 14.91  ? 747  LEU C N     1 
ATOM   9012  C  CA    . LEU C 2  747  ? -13.249 13.642  -4.463  1.00 13.46  ? 747  LEU C CA    1 
ATOM   9013  C  C     . LEU C 2  747  ? -11.979 14.237  -3.878  1.00 16.92  ? 747  LEU C C     1 
ATOM   9014  O  O     . LEU C 2  747  ? -10.916 13.624  -3.926  1.00 22.04  ? 747  LEU C O     1 
ATOM   9015  C  CB    . LEU C 2  747  ? -13.001 12.227  -4.978  1.00 13.60  ? 747  LEU C CB    1 
ATOM   9016  C  CG    . LEU C 2  747  ? -14.300 11.539  -5.396  1.00 14.54  ? 747  LEU C CG    1 
ATOM   9017  C  CD1   . LEU C 2  747  ? -14.025 10.235  -6.113  1.00 16.96  ? 747  LEU C CD1   1 
ATOM   9018  C  CD2   . LEU C 2  747  ? -15.192 11.308  -4.185  1.00 16.45  ? 747  LEU C CD2   1 
ATOM   9019  N  N     . THR C 2  748  ? -12.100 15.442  -3.331  1.00 16.05  ? 748  THR C N     1 
ATOM   9020  C  CA    . THR C 2  748  ? -10.973 16.118  -2.701  1.00 18.86  ? 748  THR C CA    1 
ATOM   9021  C  C     . THR C 2  748  ? -11.285 16.412  -1.237  1.00 16.50  ? 748  THR C C     1 
ATOM   9022  O  O     . THR C 2  748  ? -12.428 16.691  -0.882  1.00 16.93  ? 748  THR C O     1 
ATOM   9023  C  CB    . THR C 2  748  ? -10.616 17.428  -3.440  1.00 19.59  ? 748  THR C CB    1 
ATOM   9024  O  OG1   . THR C 2  748  ? -10.308 17.133  -4.807  1.00 22.95  ? 748  THR C OG1   1 
ATOM   9025  C  CG2   . THR C 2  748  ? -9.412  18.108  -2.804  1.00 18.10  ? 748  THR C CG2   1 
ATOM   9026  N  N     . SER C 2  749  ? -10.265 16.326  -0.389  1.00 16.66  ? 749  SER C N     1 
ATOM   9027  C  CA    . SER C 2  749  ? -10.427 16.563  1.039   1.00 16.25  ? 749  SER C CA    1 
ATOM   9028  C  C     . SER C 2  749  ? -9.243  17.316  1.631   1.00 15.49  ? 749  SER C C     1 
ATOM   9029  O  O     . SER C 2  749  ? -8.141  17.295  1.088   1.00 16.99  ? 749  SER C O     1 
ATOM   9030  C  CB    . SER C 2  749  ? -10.621 15.235  1.777   1.00 17.48  ? 749  SER C CB    1 
ATOM   9031  O  OG    . SER C 2  749  ? -9.497  14.386  1.613   1.00 16.80  ? 749  SER C OG    1 
ATOM   9032  N  N     . ILE C 2  750  ? -9.483  17.973  2.757   1.00 13.80  ? 750  ILE C N     1 
ATOM   9033  C  CA    . ILE C 2  750  ? -8.441  18.699  3.465   1.00 15.54  ? 750  ILE C CA    1 
ATOM   9034  C  C     . ILE C 2  750  ? -7.968  17.887  4.668   1.00 19.12  ? 750  ILE C C     1 
ATOM   9035  O  O     . ILE C 2  750  ? -8.754  17.171  5.286   1.00 22.95  ? 750  ILE C O     1 
ATOM   9036  C  CB    . ILE C 2  750  ? -8.947  20.078  3.923   1.00 17.64  ? 750  ILE C CB    1 
ATOM   9037  C  CG1   . ILE C 2  750  ? -9.609  20.808  2.754   1.00 24.83  ? 750  ILE C CG1   1 
ATOM   9038  C  CG2   . ILE C 2  750  ? -7.818  20.911  4.494   1.00 19.61  ? 750  ILE C CG2   1 
ATOM   9039  C  CD1   . ILE C 2  750  ? -10.100 22.204  3.094   1.00 28.36  ? 750  ILE C CD1   1 
ATOM   9040  N  N     . HIS C 2  751  ? -6.681  17.977  4.986   1.00 19.19  ? 751  HIS C N     1 
ATOM   9041  C  CA    . HIS C 2  751  ? -6.148  17.296  6.156   1.00 16.89  ? 751  HIS C CA    1 
ATOM   9042  C  C     . HIS C 2  751  ? -5.202  18.212  6.920   1.00 17.70  ? 751  HIS C C     1 
ATOM   9043  O  O     . HIS C 2  751  ? -4.305  18.819  6.340   1.00 18.43  ? 751  HIS C O     1 
ATOM   9044  C  CB    . HIS C 2  751  ? -5.437  16.006  5.750   1.00 17.55  ? 751  HIS C CB    1 
ATOM   9045  C  CG    . HIS C 2  751  ? -6.305  15.053  4.989   1.00 17.23  ? 751  HIS C CG    1 
ATOM   9046  N  ND1   . HIS C 2  751  ? -6.892  13.950  5.572   1.00 19.58  ? 751  HIS C ND1   1 
ATOM   9047  C  CD2   . HIS C 2  751  ? -6.687  15.038  3.691   1.00 17.50  ? 751  HIS C CD2   1 
ATOM   9048  C  CE1   . HIS C 2  751  ? -7.596  13.297  4.665   1.00 18.66  ? 751  HIS C CE1   1 
ATOM   9049  N  NE2   . HIS C 2  751  ? -7.489  13.937  3.515   1.00 18.33  ? 751  HIS C NE2   1 
ATOM   9050  N  N     . ILE C 2  752  ? -5.417  18.310  8.227   1.00 19.96  ? 752  ILE C N     1 
ATOM   9051  C  CA    . ILE C 2  752  ? -4.643  19.210  9.070   1.00 17.12  ? 752  ILE C CA    1 
ATOM   9052  C  C     . ILE C 2  752  ? -3.771  18.446  10.051  1.00 16.17  ? 752  ILE C C     1 
ATOM   9053  O  O     . ILE C 2  752  ? -4.242  17.545  10.740  1.00 18.43  ? 752  ILE C O     1 
ATOM   9054  C  CB    . ILE C 2  752  ? -5.556  20.156  9.866   1.00 16.09  ? 752  ILE C CB    1 
ATOM   9055  C  CG1   . ILE C 2  752  ? -6.544  20.860  8.935   1.00 17.56  ? 752  ILE C CG1   1 
ATOM   9056  C  CG2   . ILE C 2  752  ? -4.727  21.162  10.643  1.00 13.67  ? 752  ILE C CG2   1 
ATOM   9057  C  CD1   . ILE C 2  752  ? -7.518  21.767  9.657   1.00 20.37  ? 752  ILE C CD1   1 
ATOM   9058  N  N     . GLU C 2  753  ? -2.498  18.811  10.119  1.00 15.01  ? 753  GLU C N     1 
ATOM   9059  C  CA    . GLU C 2  753  ? -1.594  18.196  11.077  1.00 21.29  ? 753  GLU C CA    1 
ATOM   9060  C  C     . GLU C 2  753  ? -1.259  19.181  12.192  1.00 19.77  ? 753  GLU C C     1 
ATOM   9061  O  O     . GLU C 2  753  ? -1.318  20.390  11.988  1.00 17.18  ? 753  GLU C O     1 
ATOM   9062  C  CB    . GLU C 2  753  ? -0.322  17.711  10.373  1.00 29.74  ? 753  GLU C CB    1 
ATOM   9063  C  CG    . GLU C 2  753  ? -0.518  16.456  9.534   1.00 38.11  ? 753  GLU C CG    1 
ATOM   9064  C  CD    . GLU C 2  753  ? -0.771  15.229  10.393  1.00 47.90  ? 753  GLU C CD    1 
ATOM   9065  O  OE1   . GLU C 2  753  ? -0.360  15.236  11.575  1.00 38.07  ? 753  GLU C OE1   1 
ATOM   9066  O  OE2   . GLU C 2  753  ? -1.386  14.263  9.892   1.00 55.18  ? 753  GLU C OE2   1 
ATOM   9067  N  N     . GLU C 2  754  ? -0.930  18.661  13.372  1.00 21.90  ? 754  GLU C N     1 
ATOM   9068  C  CA    . GLU C 2  754  ? -0.499  19.500  14.489  1.00 20.36  ? 754  GLU C CA    1 
ATOM   9069  C  C     . GLU C 2  754  ? 0.947   19.184  14.846  1.00 22.32  ? 754  GLU C C     1 
ATOM   9070  O  O     . GLU C 2  754  ? 1.243   18.101  15.352  1.00 32.55  ? 754  GLU C O     1 
ATOM   9071  C  CB    . GLU C 2  754  ? -1.401  19.302  15.718  1.00 24.09  ? 754  GLU C CB    1 
ATOM   9072  C  CG    . GLU C 2  754  ? -0.931  20.053  16.970  1.00 24.03  ? 754  GLU C CG    1 
ATOM   9073  C  CD    . GLU C 2  754  ? -1.632  19.606  18.250  1.00 29.07  ? 754  GLU C CD    1 
ATOM   9074  O  OE1   . GLU C 2  754  ? -1.198  18.600  18.850  1.00 42.19  ? 754  GLU C OE1   1 
ATOM   9075  O  OE2   . GLU C 2  754  ? -2.606  20.270  18.665  1.00 26.96  ? 754  GLU C OE2   1 
ATOM   9076  N  N     . HIS C 2  755  ? 1.844   20.123  14.569  1.00 14.19  ? 755  HIS C N     1 
ATOM   9077  C  CA    . HIS C 2  755  ? 3.249   19.949  14.903  1.00 12.27  ? 755  HIS C CA    1 
ATOM   9078  C  C     . HIS C 2  755  ? 3.578   20.759  16.147  1.00 13.95  ? 755  HIS C C     1 
ATOM   9079  O  O     . HIS C 2  755  ? 3.040   21.843  16.349  1.00 15.23  ? 755  HIS C O     1 
ATOM   9080  C  CB    . HIS C 2  755  ? 4.132   20.356  13.727  1.00 9.70   ? 755  HIS C CB    1 
ATOM   9081  C  CG    . HIS C 2  755  ? 3.872   19.563  12.485  1.00 17.51  ? 755  HIS C CG    1 
ATOM   9082  N  ND1   . HIS C 2  755  ? 4.059   18.200  12.422  1.00 26.39  ? 755  HIS C ND1   1 
ATOM   9083  C  CD2   . HIS C 2  755  ? 3.430   19.938  11.261  1.00 18.81  ? 755  HIS C CD2   1 
ATOM   9084  C  CE1   . HIS C 2  755  ? 3.747   17.769  11.213  1.00 29.57  ? 755  HIS C CE1   1 
ATOM   9085  N  NE2   . HIS C 2  755  ? 3.363   18.804  10.488  1.00 25.67  ? 755  HIS C NE2   1 
ATOM   9086  N  N     . GLU C 2  756  ? 4.456   20.226  16.987  1.00 16.58  ? 756  GLU C N     1 
ATOM   9087  C  CA    . GLU C 2  756  ? 4.677   20.793  18.309  1.00 16.53  ? 756  GLU C CA    1 
ATOM   9088  C  C     . GLU C 2  756  ? 6.142   20.705  18.700  1.00 16.90  ? 756  GLU C C     1 
ATOM   9089  O  O     . GLU C 2  756  ? 6.832   19.764  18.322  1.00 26.03  ? 756  GLU C O     1 
ATOM   9090  C  CB    . GLU C 2  756  ? 3.808   20.062  19.335  1.00 19.72  ? 756  GLU C CB    1 
ATOM   9091  C  CG    . GLU C 2  756  ? 3.550   20.818  20.623  1.00 25.13  ? 756  GLU C CG    1 
ATOM   9092  C  CD    . GLU C 2  756  ? 2.617   20.060  21.553  1.00 29.62  ? 756  GLU C CD    1 
ATOM   9093  O  OE1   . GLU C 2  756  ? 2.811   18.837  21.719  1.00 34.47  ? 756  GLU C OE1   1 
ATOM   9094  O  OE2   . GLU C 2  756  ? 1.685   20.681  22.107  1.00 30.64  ? 756  GLU C OE2   1 
ATOM   9095  N  N     . ILE C 2  757  ? 6.617   21.687  19.455  1.00 14.51  ? 757  ILE C N     1 
ATOM   9096  C  CA    . ILE C 2  757  ? 7.977   21.643  19.970  1.00 19.90  ? 757  ILE C CA    1 
ATOM   9097  C  C     . ILE C 2  757  ? 8.122   22.611  21.136  1.00 21.95  ? 757  ILE C C     1 
ATOM   9098  O  O     . ILE C 2  757  ? 7.375   23.581  21.251  1.00 22.66  ? 757  ILE C O     1 
ATOM   9099  C  CB    . ILE C 2  757  ? 9.013   21.969  18.873  1.00 19.17  ? 757  ILE C CB    1 
ATOM   9100  C  CG1   . ILE C 2  757  ? 10.425  21.578  19.331  1.00 25.77  ? 757  ILE C CG1   1 
ATOM   9101  C  CG2   . ILE C 2  757  ? 8.921   23.429  18.470  1.00 19.17  ? 757  ILE C CG2   1 
ATOM   9102  C  CD1   . ILE C 2  757  ? 11.487  21.694  18.262  1.00 27.14  ? 757  ILE C CD1   1 
ATOM   9103  N  N     . ASP C 2  758  ? 9.079   22.337  22.012  1.00 26.60  ? 758  ASP C N     1 
ATOM   9104  C  CA    . ASP C 2  758  ? 9.211   23.113  23.229  1.00 35.45  ? 758  ASP C CA    1 
ATOM   9105  C  C     . ASP C 2  758  ? 10.650  23.507  23.523  1.00 40.24  ? 758  ASP C C     1 
ATOM   9106  O  O     . ASP C 2  758  ? 11.596  22.922  22.993  1.00 36.13  ? 758  ASP C O     1 
ATOM   9107  C  CB    . ASP C 2  758  ? 8.641   22.326  24.407  1.00 45.48  ? 758  ASP C CB    1 
ATOM   9108  C  CG    . ASP C 2  758  ? 9.310   20.976  24.583  1.00 54.18  ? 758  ASP C CG    1 
ATOM   9109  O  OD1   . ASP C 2  758  ? 9.822   20.429  23.582  1.00 49.58  ? 758  ASP C OD1   1 
ATOM   9110  O  OD2   . ASP C 2  758  ? 9.324   20.464  25.722  1.00 64.09  ? 758  ASP C OD2   1 
ATOM   9111  N  N     . ALA C 2  759  ? 10.792  24.509  24.383  1.00 44.33  ? 759  ALA C N     1 
ATOM   9112  C  CA    . ALA C 2  759  ? 12.089  24.973  24.850  1.00 47.22  ? 759  ALA C CA    1 
ATOM   9113  C  C     . ALA C 2  759  ? 12.222  24.708  26.348  1.00 47.41  ? 759  ALA C C     1 
ATOM   9114  O  O     . ALA C 2  759  ? 11.476  25.263  27.155  1.00 44.84  ? 759  ALA C O     1 
ATOM   9115  C  CB    . ALA C 2  759  ? 12.266  26.451  24.545  1.00 46.58  ? 759  ALA C CB    1 
ATOM   9116  N  N     . ARG C 2  760  ? 13.172  23.855  26.718  1.00 50.73  ? 760  ARG C N     1 
ATOM   9117  C  CA    . ARG C 2  760  ? 13.310  23.430  28.106  1.00 53.89  ? 760  ARG C CA    1 
ATOM   9118  C  C     . ARG C 2  760  ? 14.570  23.973  28.764  1.00 56.02  ? 760  ARG C C     1 
ATOM   9119  O  O     . ARG C 2  760  ? 15.468  24.479  28.092  1.00 59.98  ? 760  ARG C O     1 
ATOM   9120  C  CB    . ARG C 2  760  ? 13.316  21.902  28.196  1.00 59.96  ? 760  ARG C CB    1 
ATOM   9121  C  CG    . ARG C 2  760  ? 12.234  21.224  27.382  1.00 62.67  ? 760  ARG C CG    1 
ATOM   9122  C  CD    . ARG C 2  760  ? 12.322  19.711  27.498  1.00 78.98  ? 760  ARG C CD    1 
ATOM   9123  N  NE    . ARG C 2  760  ? 11.714  19.054  26.345  1.00 80.17  ? 760  ARG C NE    1 
ATOM   9124  C  CZ    . ARG C 2  760  ? 12.390  18.652  25.274  1.00 79.50  ? 760  ARG C CZ    1 
ATOM   9125  N  NH1   . ARG C 2  760  ? 13.704  18.828  25.211  1.00 77.90  ? 760  ARG C NH1   1 
ATOM   9126  N  NH2   . ARG C 2  760  ? 11.755  18.068  24.267  1.00 73.13  ? 760  ARG C NH2   1 
ATOM   9127  N  N     . ASP C 2  761  ? 14.625  23.863  30.087  1.00 54.67  ? 761  ASP C N     1 
ATOM   9128  C  CA    . ASP C 2  761  ? 15.847  24.147  30.827  1.00 58.93  ? 761  ASP C CA    1 
ATOM   9129  C  C     . ASP C 2  761  ? 16.753  22.932  30.818  1.00 67.60  ? 761  ASP C C     1 
ATOM   9130  O  O     . ASP C 2  761  ? 16.341  21.838  31.201  1.00 71.45  ? 761  ASP C O     1 
ATOM   9131  C  CB    . ASP C 2  761  ? 15.543  24.542  32.268  1.00 58.82  ? 761  ASP C CB    1 
ATOM   9132  C  CG    . ASP C 2  761  ? 14.906  25.902  32.374  1.00 63.38  ? 761  ASP C CG    1 
ATOM   9133  O  OD1   . ASP C 2  761  ? 15.282  26.802  31.593  1.00 69.71  ? 761  ASP C OD1   1 
ATOM   9134  O  OD2   . ASP C 2  761  ? 14.025  26.070  33.242  1.00 65.28  ? 761  ASP C OD2   1 
ATOM   9135  N  N     . THR C 2  762  ? 17.989  23.122  30.386  1.00 70.48  ? 762  THR C N     1 
ATOM   9136  C  CA    . THR C 2  762  ? 18.932  22.023  30.372  1.00 71.71  ? 762  THR C CA    1 
ATOM   9137  C  C     . THR C 2  762  ? 20.054  22.313  31.363  1.00 74.84  ? 762  THR C C     1 
ATOM   9138  O  O     . THR C 2  762  ? 20.005  23.301  32.097  1.00 68.85  ? 762  THR C O     1 
ATOM   9139  C  CB    . THR C 2  762  ? 19.489  21.778  28.954  1.00 72.16  ? 762  THR C CB    1 
ATOM   9140  O  OG1   . THR C 2  762  ? 20.255  20.568  28.934  1.00 79.92  ? 762  THR C OG1   1 
ATOM   9141  C  CG2   . THR C 2  762  ? 20.348  22.943  28.495  1.00 75.42  ? 762  THR C CG2   1 
ATOM   9142  N  N     . LYS C 2  763  ? 21.051  21.437  31.397  1.00 87.84  ? 763  LYS C N     1 
ATOM   9143  C  CA    . LYS C 2  763  ? 22.171  21.581  32.318  1.00 82.21  ? 763  LYS C CA    1 
ATOM   9144  C  C     . LYS C 2  763  ? 23.247  22.486  31.740  1.00 73.87  ? 763  LYS C C     1 
ATOM   9145  O  O     . LYS C 2  763  ? 24.143  22.937  32.450  1.00 77.54  ? 763  LYS C O     1 
ATOM   9146  C  CB    . LYS C 2  763  ? 22.763  20.212  32.655  1.00 86.81  ? 763  LYS C CB    1 
ATOM   9147  C  CG    . LYS C 2  763  ? 21.844  19.344  33.489  1.00 84.64  ? 763  LYS C CG    1 
ATOM   9148  C  CD    . LYS C 2  763  ? 21.540  20.011  34.820  1.00 83.42  ? 763  LYS C CD    1 
ATOM   9149  C  CE    . LYS C 2  763  ? 20.481  19.248  35.596  1.00 84.55  ? 763  LYS C CE    1 
ATOM   9150  N  NZ    . LYS C 2  763  ? 19.159  19.277  34.909  1.00 89.86  ? 763  LYS C NZ    1 
ATOM   9151  N  N     . LEU C 2  764  ? 23.149  22.742  30.442  1.00 75.55  ? 764  LEU C N     1 
ATOM   9152  C  CA    . LEU C 2  764  ? 24.114  23.581  29.750  1.00 81.24  ? 764  LEU C CA    1 
ATOM   9153  C  C     . LEU C 2  764  ? 23.513  24.949  29.457  1.00 89.43  ? 764  LEU C C     1 
ATOM   9154  O  O     . LEU C 2  764  ? 24.082  25.748  28.713  1.00 102.58 ? 764  LEU C O     1 
ATOM   9155  C  CB    . LEU C 2  764  ? 24.569  22.906  28.459  1.00 83.15  ? 764  LEU C CB    1 
ATOM   9156  C  CG    . LEU C 2  764  ? 25.182  21.520  28.660  1.00 77.67  ? 764  LEU C CG    1 
ATOM   9157  C  CD1   . LEU C 2  764  ? 24.946  20.668  27.435  1.00 85.38  ? 764  LEU C CD1   1 
ATOM   9158  C  CD2   . LEU C 2  764  ? 26.668  21.630  28.955  1.00 87.81  ? 764  LEU C CD2   1 
ATOM   9159  N  N     . GLY C 2  765  ? 22.357  25.211  30.057  1.00 82.43  ? 765  GLY C N     1 
ATOM   9160  C  CA    . GLY C 2  765  ? 21.665  26.470  29.868  1.00 82.55  ? 765  GLY C CA    1 
ATOM   9161  C  C     . GLY C 2  765  ? 20.189  26.251  29.618  1.00 72.10  ? 765  GLY C C     1 
ATOM   9162  O  O     . GLY C 2  765  ? 19.540  25.471  30.313  1.00 74.73  ? 765  GLY C O     1 
ATOM   9163  N  N     . ALA C 2  766  ? 19.654  26.939  28.619  1.00 67.55  ? 766  ALA C N     1 
ATOM   9164  C  CA    . ALA C 2  766  ? 18.253  26.783  28.266  1.00 61.17  ? 766  ALA C CA    1 
ATOM   9165  C  C     . ALA C 2  766  ? 18.070  26.922  26.766  1.00 62.30  ? 766  ALA C C     1 
ATOM   9166  O  O     . ALA C 2  766  ? 18.689  27.772  26.130  1.00 65.97  ? 766  ALA C O     1 
ATOM   9167  C  CB    . ALA C 2  766  ? 17.398  27.797  29.004  1.00 56.38  ? 766  ALA C CB    1 
ATOM   9168  N  N     . GLU C 2  767  ? 17.222  26.071  26.204  1.00 59.27  ? 767  GLU C N     1 
ATOM   9169  C  CA    . GLU C 2  767  ? 16.904  26.137  24.789  1.00 57.18  ? 767  GLU C CA    1 
ATOM   9170  C  C     . GLU C 2  767  ? 16.168  27.434  24.477  1.00 56.05  ? 767  GLU C C     1 
ATOM   9171  O  O     . GLU C 2  767  ? 15.193  27.776  25.143  1.00 64.08  ? 767  GLU C O     1 
ATOM   9172  C  CB    . GLU C 2  767  ? 16.055  24.934  24.379  1.00 58.00  ? 767  GLU C CB    1 
ATOM   9173  C  CG    . GLU C 2  767  ? 16.383  23.653  25.131  1.00 51.21  ? 767  GLU C CG    1 
ATOM   9174  C  CD    . GLU C 2  767  ? 15.569  22.471  24.642  1.00 51.21  ? 767  GLU C CD    1 
ATOM   9175  O  OE1   . GLU C 2  767  ? 14.346  22.633  24.450  1.00 54.53  ? 767  GLU C OE1   1 
ATOM   9176  O  OE2   . GLU C 2  767  ? 16.150  21.384  24.440  1.00 56.00  ? 767  GLU C OE2   1 
ATOM   9177  N  N     . GLU C 2  768  ? 16.635  28.168  23.475  1.00 50.37  ? 768  GLU C N     1 
ATOM   9178  C  CA    . GLU C 2  768  ? 15.923  29.369  23.063  1.00 55.22  ? 768  GLU C CA    1 
ATOM   9179  C  C     . GLU C 2  768  ? 15.503  29.272  21.604  1.00 52.58  ? 768  GLU C C     1 
ATOM   9180  O  O     . GLU C 2  768  ? 16.287  28.885  20.736  1.00 56.51  ? 768  GLU C O     1 
ATOM   9181  C  CB    . GLU C 2  768  ? 16.773  30.621  23.289  1.00 64.26  ? 768  GLU C CB    1 
ATOM   9182  C  CG    . GLU C 2  768  ? 18.072  30.651  22.506  1.00 73.38  ? 768  GLU C CG    1 
ATOM   9183  C  CD    . GLU C 2  768  ? 18.485  32.059  22.128  1.00 69.79  ? 768  GLU C CD    1 
ATOM   9184  O  OE1   . GLU C 2  768  ? 17.632  32.811  21.608  1.00 59.98  ? 768  GLU C OE1   1 
ATOM   9185  O  OE2   . GLU C 2  768  ? 19.661  32.414  22.356  1.00 72.05  ? 768  GLU C OE2   1 
ATOM   9186  N  N     . ILE C 2  769  ? 14.246  29.606  21.346  1.00 45.17  ? 769  ILE C N     1 
ATOM   9187  C  CA    . ILE C 2  769  ? 13.735  29.609  19.988  1.00 40.56  ? 769  ILE C CA    1 
ATOM   9188  C  C     . ILE C 2  769  ? 14.105  30.915  19.311  1.00 44.83  ? 769  ILE C C     1 
ATOM   9189  O  O     . ILE C 2  769  ? 13.600  31.979  19.670  1.00 46.10  ? 769  ILE C O     1 
ATOM   9190  C  CB    . ILE C 2  769  ? 12.218  29.420  19.952  1.00 38.64  ? 769  ILE C CB    1 
ATOM   9191  C  CG1   . ILE C 2  769  ? 11.842  28.088  20.596  1.00 41.62  ? 769  ILE C CG1   1 
ATOM   9192  C  CG2   . ILE C 2  769  ? 11.713  29.476  18.525  1.00 41.67  ? 769  ILE C CG2   1 
ATOM   9193  C  CD1   . ILE C 2  769  ? 10.365  27.813  20.590  1.00 37.04  ? 769  ILE C CD1   1 
ATOM   9194  N  N     . THR C 2  770  ? 14.996  30.824  18.331  1.00 44.19  ? 770  THR C N     1 
ATOM   9195  C  CA    . THR C 2  770  ? 15.508  32.006  17.661  1.00 45.12  ? 770  THR C CA    1 
ATOM   9196  C  C     . THR C 2  770  ? 15.602  31.808  16.152  1.00 40.52  ? 770  THR C C     1 
ATOM   9197  O  O     . THR C 2  770  ? 15.610  30.680  15.662  1.00 40.51  ? 770  THR C O     1 
ATOM   9198  C  CB    . THR C 2  770  ? 16.890  32.387  18.199  1.00 47.03  ? 770  THR C CB    1 
ATOM   9199  O  OG1   . THR C 2  770  ? 17.331  33.595  17.570  1.00 52.19  ? 770  THR C OG1   1 
ATOM   9200  C  CG2   . THR C 2  770  ? 17.883  31.276  17.912  1.00 48.28  ? 770  THR C CG2   1 
ATOM   9201  N  N     . ARG C 2  771  ? 15.676  32.914  15.420  1.00 41.50  ? 771  ARG C N     1 
ATOM   9202  C  CA    . ARG C 2  771  ? 15.796  32.856  13.969  1.00 46.68  ? 771  ARG C CA    1 
ATOM   9203  C  C     . ARG C 2  771  ? 17.230  32.527  13.554  1.00 56.28  ? 771  ARG C C     1 
ATOM   9204  O  O     . ARG C 2  771  ? 17.490  32.188  12.400  1.00 60.43  ? 771  ARG C O     1 
ATOM   9205  C  CB    . ARG C 2  771  ? 15.353  34.177  13.336  1.00 48.56  ? 771  ARG C CB    1 
ATOM   9206  C  CG    . ARG C 2  771  ? 15.153  34.104  11.829  1.00 52.30  ? 771  ARG C CG    1 
ATOM   9207  C  CD    . ARG C 2  771  ? 14.871  35.470  11.236  1.00 53.00  ? 771  ARG C CD    1 
ATOM   9208  N  NE    . ARG C 2  771  ? 14.695  35.405  9.788   1.00 59.10  ? 771  ARG C NE    1 
ATOM   9209  C  CZ    . ARG C 2  771  ? 15.698  35.363  8.918   1.00 70.39  ? 771  ARG C CZ    1 
ATOM   9210  N  NH1   . ARG C 2  771  ? 16.951  35.374  9.352   1.00 71.46  ? 771  ARG C NH1   1 
ATOM   9211  N  NH2   . ARG C 2  771  ? 15.450  35.306  7.616   1.00 76.77  ? 771  ARG C NH2   1 
ATOM   9212  N  N     . ASP C 2  772  ? 18.159  32.615  14.500  1.00 60.27  ? 772  ASP C N     1 
ATOM   9213  C  CA    . ASP C 2  772  ? 19.570  32.379  14.204  1.00 60.80  ? 772  ASP C CA    1 
ATOM   9214  C  C     . ASP C 2  772  ? 19.974  30.923  14.431  1.00 57.01  ? 772  ASP C C     1 
ATOM   9215  O  O     . ASP C 2  772  ? 20.280  30.518  15.551  1.00 58.24  ? 772  ASP C O     1 
ATOM   9216  C  CB    . ASP C 2  772  ? 20.448  33.306  15.051  1.00 69.05  ? 772  ASP C CB    1 
ATOM   9217  C  CG    . ASP C 2  772  ? 21.932  33.090  14.813  1.00 68.95  ? 772  ASP C CG    1 
ATOM   9218  O  OD1   . ASP C 2  772  ? 22.560  32.365  15.612  1.00 68.35  ? 772  ASP C OD1   1 
ATOM   9219  O  OD2   . ASP C 2  772  ? 22.471  33.647  13.832  1.00 68.07  ? 772  ASP C OD2   1 
ATOM   9220  N  N     . ILE C 2  773  ? 19.971  30.138  13.361  1.00 57.89  ? 773  ILE C N     1 
ATOM   9221  C  CA    . ILE C 2  773  ? 20.425  28.757  13.438  1.00 62.98  ? 773  ILE C CA    1 
ATOM   9222  C  C     . ILE C 2  773  ? 21.772  28.632  12.743  1.00 69.60  ? 773  ILE C C     1 
ATOM   9223  O  O     . ILE C 2  773  ? 21.920  29.057  11.598  1.00 73.61  ? 773  ILE C O     1 
ATOM   9224  C  CB    . ILE C 2  773  ? 19.415  27.783  12.806  1.00 68.43  ? 773  ILE C CB    1 
ATOM   9225  C  CG1   . ILE C 2  773  ? 18.093  27.813  13.578  1.00 64.02  ? 773  ILE C CG1   1 
ATOM   9226  C  CG2   . ILE C 2  773  ? 19.975  26.370  12.782  1.00 70.01  ? 773  ILE C CG2   1 
ATOM   9227  C  CD1   . ILE C 2  773  ? 17.068  26.818  13.072  1.00 56.70  ? 773  ILE C CD1   1 
ATOM   9228  N  N     . PRO C 2  774  ? 22.764  28.065  13.447  1.00 70.40  ? 774  PRO C N     1 
ATOM   9229  C  CA    . PRO C 2  774  ? 24.140  27.926  12.955  1.00 76.03  ? 774  PRO C CA    1 
ATOM   9230  C  C     . PRO C 2  774  ? 24.250  27.308  11.563  1.00 81.76  ? 774  PRO C C     1 
ATOM   9231  O  O     . PRO C 2  774  ? 23.611  26.295  11.278  1.00 92.13  ? 774  PRO C O     1 
ATOM   9232  C  CB    . PRO C 2  774  ? 24.783  27.015  14.001  1.00 76.62  ? 774  PRO C CB    1 
ATOM   9233  C  CG    . PRO C 2  774  ? 24.061  27.357  15.255  1.00 72.28  ? 774  PRO C CG    1 
ATOM   9234  C  CD    . PRO C 2  774  ? 22.636  27.599  14.840  1.00 64.02  ? 774  PRO C CD    1 
ATOM   9235  N  N     . ASN C 2  775  ? 25.053  27.943  10.712  1.00 82.80  ? 775  ASN C N     1 
ATOM   9236  C  CA    . ASN C 2  775  ? 25.377  27.427  9.385   1.00 86.91  ? 775  ASN C CA    1 
ATOM   9237  C  C     . ASN C 2  775  ? 24.160  27.175  8.499   1.00 79.41  ? 775  ASN C C     1 
ATOM   9238  O  O     . ASN C 2  775  ? 24.087  26.160  7.808   1.00 77.82  ? 775  ASN C O     1 
ATOM   9239  C  CB    . ASN C 2  775  ? 26.194  26.139  9.512   1.00 101.77 ? 775  ASN C CB    1 
ATOM   9240  C  CG    . ASN C 2  775  ? 27.561  26.376  10.125  1.00 113.46 ? 775  ASN C CG    1 
ATOM   9241  O  OD1   . ASN C 2  775  ? 28.188  27.409  9.890   1.00 117.81 ? 775  ASN C OD1   1 
ATOM   9242  N  ND2   . ASN C 2  775  ? 28.029  25.417  10.918  1.00 115.69 ? 775  ASN C ND2   1 
ATOM   9243  N  N     . ILE C 2  776  ? 23.208  28.101  8.521   1.00 75.90  ? 776  ILE C N     1 
ATOM   9244  C  CA    . ILE C 2  776  ? 22.043  28.020  7.648   1.00 77.36  ? 776  ILE C CA    1 
ATOM   9245  C  C     . ILE C 2  776  ? 21.878  29.327  6.877   1.00 85.66  ? 776  ILE C C     1 
ATOM   9246  O  O     . ILE C 2  776  ? 21.959  30.411  7.456   1.00 83.41  ? 776  ILE C O     1 
ATOM   9247  C  CB    . ILE C 2  776  ? 20.754  27.719  8.441   1.00 77.26  ? 776  ILE C CB    1 
ATOM   9248  C  CG1   . ILE C 2  776  ? 20.919  26.449  9.276   1.00 79.58  ? 776  ILE C CG1   1 
ATOM   9249  C  CG2   . ILE C 2  776  ? 19.566  27.576  7.504   1.00 75.23  ? 776  ILE C CG2   1 
ATOM   9250  C  CD1   . ILE C 2  776  ? 21.099  25.194  8.453   1.00 84.32  ? 776  ILE C CD1   1 
ATOM   9251  N  N     . SER C 2  777  ? 21.654  29.224  5.570   1.00 82.90  ? 777  SER C N     1 
ATOM   9252  C  CA    . SER C 2  777  ? 21.493  30.407  4.730   1.00 78.86  ? 777  SER C CA    1 
ATOM   9253  C  C     . SER C 2  777  ? 20.224  31.169  5.087   1.00 75.75  ? 777  SER C C     1 
ATOM   9254  O  O     . SER C 2  777  ? 19.369  30.665  5.811   1.00 77.16  ? 777  SER C O     1 
ATOM   9255  C  CB    . SER C 2  777  ? 21.465  30.021  3.249   1.00 83.69  ? 777  SER C CB    1 
ATOM   9256  O  OG    . SER C 2  777  ? 20.220  29.444  2.893   1.00 82.90  ? 777  SER C OG    1 
ATOM   9257  N  N     . ASP C 2  778  ? 20.099  32.386  4.572   1.00 80.15  ? 778  ASP C N     1 
ATOM   9258  C  CA    . ASP C 2  778  ? 18.883  33.156  4.780   1.00 82.43  ? 778  ASP C CA    1 
ATOM   9259  C  C     . ASP C 2  778  ? 17.814  32.725  3.779   1.00 80.99  ? 778  ASP C C     1 
ATOM   9260  O  O     . ASP C 2  778  ? 16.683  33.208  3.822   1.00 83.92  ? 778  ASP C O     1 
ATOM   9261  C  CB    . ASP C 2  778  ? 19.159  34.658  4.661   1.00 92.72  ? 778  ASP C CB    1 
ATOM   9262  C  CG    . ASP C 2  778  ? 20.116  35.166  5.731   1.00 86.24  ? 778  ASP C CG    1 
ATOM   9263  O  OD1   . ASP C 2  778  ? 20.243  34.509  6.785   1.00 76.80  ? 778  ASP C OD1   1 
ATOM   9264  O  OD2   . ASP C 2  778  ? 20.739  36.228  5.517   1.00 88.13  ? 778  ASP C OD2   1 
ATOM   9265  N  N     . GLU C 2  779  ? 18.178  31.812  2.881   1.00 78.27  ? 779  GLU C N     1 
ATOM   9266  C  CA    . GLU C 2  779  ? 17.239  31.295  1.891   1.00 79.75  ? 779  GLU C CA    1 
ATOM   9267  C  C     . GLU C 2  779  ? 16.269  30.308  2.529   1.00 75.93  ? 779  GLU C C     1 
ATOM   9268  O  O     . GLU C 2  779  ? 15.094  30.253  2.165   1.00 81.92  ? 779  GLU C O     1 
ATOM   9269  C  CB    . GLU C 2  779  ? 17.980  30.623  0.733   1.00 84.63  ? 779  GLU C CB    1 
ATOM   9270  C  CG    . GLU C 2  779  ? 18.893  31.550  -0.051  1.00 92.19  ? 779  GLU C CG    1 
ATOM   9271  C  CD    . GLU C 2  779  ? 19.400  30.918  -1.334  1.00 101.06 ? 779  GLU C CD    1 
ATOM   9272  O  OE1   . GLU C 2  779  ? 18.879  29.850  -1.721  1.00 106.89 ? 779  GLU C OE1   1 
ATOM   9273  O  OE2   . GLU C 2  779  ? 20.320  31.490  -1.955  1.00 100.88 ? 779  GLU C OE2   1 
ATOM   9274  N  N     . VAL C 2  780  ? 16.773  29.529  3.481   1.00 74.35  ? 780  VAL C N     1 
ATOM   9275  C  CA    . VAL C 2  780  ? 15.951  28.567  4.204   1.00 64.91  ? 780  VAL C CA    1 
ATOM   9276  C  C     . VAL C 2  780  ? 15.157  29.259  5.309   1.00 61.89  ? 780  VAL C C     1 
ATOM   9277  O  O     . VAL C 2  780  ? 14.009  28.907  5.576   1.00 64.40  ? 780  VAL C O     1 
ATOM   9278  C  CB    . VAL C 2  780  ? 16.805  27.445  4.819   1.00 60.11  ? 780  VAL C CB    1 
ATOM   9279  C  CG1   . VAL C 2  780  ? 15.915  26.342  5.364   1.00 55.41  ? 780  VAL C CG1   1 
ATOM   9280  C  CG2   . VAL C 2  780  ? 17.772  26.888  3.785   1.00 70.62  ? 780  VAL C CG2   1 
ATOM   9281  N  N     . LEU C 2  781  ? 15.773  30.254  5.942   1.00 63.80  ? 781  LEU C N     1 
ATOM   9282  C  CA    . LEU C 2  781  ? 15.134  30.998  7.025   1.00 63.50  ? 781  LEU C CA    1 
ATOM   9283  C  C     . LEU C 2  781  ? 14.165  32.047  6.489   1.00 60.93  ? 781  LEU C C     1 
ATOM   9284  O  O     . LEU C 2  781  ? 13.590  32.826  7.255   1.00 61.31  ? 781  LEU C O     1 
ATOM   9285  C  CB    . LEU C 2  781  ? 16.189  31.678  7.900   1.00 58.77  ? 781  LEU C CB    1 
ATOM   9286  C  CG    . LEU C 2  781  ? 17.347  30.805  8.379   1.00 57.24  ? 781  LEU C CG    1 
ATOM   9287  C  CD1   . LEU C 2  781  ? 18.375  31.656  9.096   1.00 67.82  ? 781  LEU C CD1   1 
ATOM   9288  C  CD2   . LEU C 2  781  ? 16.847  29.692  9.282   1.00 48.26  ? 781  LEU C CD2   1 
ATOM   9289  N  N     . ALA C 2  782  ? 13.996  32.057  5.170   1.00 57.97  ? 782  ALA C N     1 
ATOM   9290  C  CA    . ALA C 2  782  ? 13.234  33.092  4.485   1.00 59.08  ? 782  ALA C CA    1 
ATOM   9291  C  C     . ALA C 2  782  ? 11.800  33.146  4.978   1.00 49.60  ? 782  ALA C C     1 
ATOM   9292  O  O     . ALA C 2  782  ? 11.254  34.222  5.224   1.00 53.22  ? 782  ALA C O     1 
ATOM   9293  C  CB    . ALA C 2  782  ? 13.268  32.859  2.982   1.00 62.75  ? 782  ALA C CB    1 
ATOM   9294  N  N     . ASP C 2  783  ? 11.201  31.973  5.138   1.00 42.85  ? 783  ASP C N     1 
ATOM   9295  C  CA    . ASP C 2  783  ? 9.814   31.880  5.560   1.00 41.27  ? 783  ASP C CA    1 
ATOM   9296  C  C     . ASP C 2  783  ? 9.679   31.904  7.083   1.00 40.86  ? 783  ASP C C     1 
ATOM   9297  O  O     . ASP C 2  783  ? 8.743   31.329  7.636   1.00 40.76  ? 783  ASP C O     1 
ATOM   9298  C  CB    . ASP C 2  783  ? 9.172   30.614  4.986   1.00 50.47  ? 783  ASP C CB    1 
ATOM   9299  C  CG    . ASP C 2  783  ? 8.975   30.689  3.477   1.00 51.99  ? 783  ASP C CG    1 
ATOM   9300  O  OD1   . ASP C 2  783  ? 9.239   29.680  2.788   1.00 59.71  ? 783  ASP C OD1   1 
ATOM   9301  O  OD2   . ASP C 2  783  ? 8.552   31.755  2.980   1.00 39.62  ? 783  ASP C OD2   1 
ATOM   9302  N  N     . LEU C 2  784  ? 10.610  32.573  7.758   1.00 39.37  ? 784  LEU C N     1 
ATOM   9303  C  CA    . LEU C 2  784  ? 10.504  32.769  9.201   1.00 38.01  ? 784  LEU C CA    1 
ATOM   9304  C  C     . LEU C 2  784  ? 10.343  34.237  9.567   1.00 40.15  ? 784  LEU C C     1 
ATOM   9305  O  O     . LEU C 2  784  ? 10.727  35.124  8.805   1.00 43.76  ? 784  LEU C O     1 
ATOM   9306  C  CB    . LEU C 2  784  ? 11.728  32.209  9.922   1.00 36.26  ? 784  LEU C CB    1 
ATOM   9307  C  CG    . LEU C 2  784  ? 12.017  30.722  9.743   1.00 34.80  ? 784  LEU C CG    1 
ATOM   9308  C  CD1   . LEU C 2  784  ? 13.042  30.265  10.766  1.00 40.62  ? 784  LEU C CD1   1 
ATOM   9309  C  CD2   . LEU C 2  784  ? 10.743  29.903  9.845   1.00 32.27  ? 784  LEU C CD2   1 
ATOM   9310  N  N     . ASP C 2  785  ? 9.779   34.490  10.742  1.00 34.22  ? 785  ASP C N     1 
ATOM   9311  C  CA    . ASP C 2  785  ? 9.718   35.847  11.257  1.00 35.08  ? 785  ASP C CA    1 
ATOM   9312  C  C     . ASP C 2  785  ? 10.911  36.097  12.170  1.00 34.39  ? 785  ASP C C     1 
ATOM   9313  O  O     . ASP C 2  785  ? 11.823  35.275  12.248  1.00 32.65  ? 785  ASP C O     1 
ATOM   9314  C  CB    . ASP C 2  785  ? 8.394   36.109  11.991  1.00 39.15  ? 785  ASP C CB    1 
ATOM   9315  C  CG    . ASP C 2  785  ? 8.119   35.112  13.107  1.00 37.03  ? 785  ASP C CG    1 
ATOM   9316  O  OD1   . ASP C 2  785  ? 9.070   34.493  13.632  1.00 37.57  ? 785  ASP C OD1   1 
ATOM   9317  O  OD2   . ASP C 2  785  ? 6.933   34.956  13.466  1.00 34.02  ? 785  ASP C OD2   1 
ATOM   9318  N  N     . GLU C 2  786  ? 10.891  37.228  12.864  1.00 39.46  ? 786  GLU C N     1 
ATOM   9319  C  CA    . GLU C 2  786  ? 12.008  37.637  13.707  1.00 37.85  ? 786  GLU C CA    1 
ATOM   9320  C  C     . GLU C 2  786  ? 12.178  36.721  14.910  1.00 35.46  ? 786  GLU C C     1 
ATOM   9321  O  O     . GLU C 2  786  ? 13.270  36.612  15.465  1.00 35.04  ? 786  GLU C O     1 
ATOM   9322  C  CB    . GLU C 2  786  ? 11.821  39.081  14.181  1.00 45.28  ? 786  GLU C CB    1 
ATOM   9323  C  CG    . GLU C 2  786  ? 10.876  39.248  15.368  1.00 44.21  ? 786  GLU C CG    1 
ATOM   9324  C  CD    . GLU C 2  786  ? 9.433   38.907  15.038  1.00 46.88  ? 786  GLU C CD    1 
ATOM   9325  O  OE1   . GLU C 2  786  ? 9.109   38.768  13.840  1.00 53.71  ? 786  GLU C OE1   1 
ATOM   9326  O  OE2   . GLU C 2  786  ? 8.621   38.783  15.980  1.00 48.24  ? 786  GLU C OE2   1 
ATOM   9327  N  N     . ARG C 2  787  ? 11.096  36.065  15.316  1.00 35.31  ? 787  ARG C N     1 
ATOM   9328  C  CA    . ARG C 2  787  ? 11.144  35.177  16.467  1.00 37.94  ? 787  ARG C CA    1 
ATOM   9329  C  C     . ARG C 2  787  ? 11.900  33.904  16.118  1.00 39.55  ? 787  ARG C C     1 
ATOM   9330  O  O     . ARG C 2  787  ? 12.767  33.459  16.870  1.00 42.58  ? 787  ARG C O     1 
ATOM   9331  C  CB    . ARG C 2  787  ? 9.731   34.844  16.953  1.00 35.75  ? 787  ARG C CB    1 
ATOM   9332  C  CG    . ARG C 2  787  ? 8.982   36.032  17.533  1.00 35.30  ? 787  ARG C CG    1 
ATOM   9333  C  CD    . ARG C 2  787  ? 7.542   35.679  17.869  1.00 33.41  ? 787  ARG C CD    1 
ATOM   9334  N  NE    . ARG C 2  787  ? 6.848   35.073  16.736  1.00 34.05  ? 787  ARG C NE    1 
ATOM   9335  C  CZ    . ARG C 2  787  ? 5.583   34.668  16.763  1.00 34.86  ? 787  ARG C CZ    1 
ATOM   9336  N  NH1   . ARG C 2  787  ? 4.862   34.808  17.868  1.00 30.51  ? 787  ARG C NH1   1 
ATOM   9337  N  NH2   . ARG C 2  787  ? 5.035   34.124  15.685  1.00 38.22  ? 787  ARG C NH2   1 
ATOM   9338  N  N     . GLY C 2  788  ? 11.572  33.338  14.961  1.00 38.01  ? 788  GLY C N     1 
ATOM   9339  C  CA    . GLY C 2  788  ? 12.117  32.062  14.539  1.00 34.87  ? 788  GLY C CA    1 
ATOM   9340  C  C     . GLY C 2  788  ? 11.022  31.119  14.071  1.00 33.13  ? 788  GLY C C     1 
ATOM   9341  O  O     . GLY C 2  788  ? 11.303  30.021  13.598  1.00 38.08  ? 788  GLY C O     1 
ATOM   9342  N  N     . ILE C 2  789  ? 9.771   31.555  14.199  1.00 28.59  ? 789  ILE C N     1 
ATOM   9343  C  CA    . ILE C 2  789  ? 8.612   30.754  13.800  1.00 20.67  ? 789  ILE C CA    1 
ATOM   9344  C  C     . ILE C 2  789  ? 8.268   30.961  12.320  1.00 24.28  ? 789  ILE C C     1 
ATOM   9345  O  O     . ILE C 2  789  ? 8.564   32.012  11.756  1.00 32.47  ? 789  ILE C O     1 
ATOM   9346  C  CB    . ILE C 2  789  ? 7.373   31.104  14.652  1.00 18.21  ? 789  ILE C CB    1 
ATOM   9347  C  CG1   . ILE C 2  789  ? 7.780   31.470  16.079  1.00 19.96  ? 789  ILE C CG1   1 
ATOM   9348  C  CG2   . ILE C 2  789  ? 6.383   29.957  14.661  1.00 18.05  ? 789  ILE C CG2   1 
ATOM   9349  C  CD1   . ILE C 2  789  ? 8.371   30.323  16.852  1.00 21.94  ? 789  ILE C CD1   1 
ATOM   9350  N  N     . VAL C 2  790  ? 7.645   29.967  11.692  1.00 21.10  ? 790  VAL C N     1 
ATOM   9351  C  CA    . VAL C 2  790  ? 7.195   30.111  10.311  1.00 21.02  ? 790  VAL C CA    1 
ATOM   9352  C  C     . VAL C 2  790  ? 6.063   31.134  10.263  1.00 19.59  ? 790  VAL C C     1 
ATOM   9353  O  O     . VAL C 2  790  ? 5.373   31.352  11.256  1.00 22.24  ? 790  VAL C O     1 
ATOM   9354  C  CB    . VAL C 2  790  ? 6.735   28.755  9.712   1.00 21.70  ? 790  VAL C CB    1 
ATOM   9355  C  CG1   . VAL C 2  790  ? 5.496   28.239  10.424  1.00 19.61  ? 790  VAL C CG1   1 
ATOM   9356  C  CG2   . VAL C 2  790  ? 6.484   28.876  8.214   1.00 24.71  ? 790  VAL C CG2   1 
ATOM   9357  N  N     . ARG C 2  791  ? 5.890   31.784  9.122   1.00 19.14  ? 791  ARG C N     1 
ATOM   9358  C  CA    . ARG C 2  791  ? 4.847   32.785  8.996   1.00 23.04  ? 791  ARG C CA    1 
ATOM   9359  C  C     . ARG C 2  791  ? 3.575   32.159  8.438   1.00 18.04  ? 791  ARG C C     1 
ATOM   9360  O  O     . ARG C 2  791  ? 3.630   31.267  7.592   1.00 16.25  ? 791  ARG C O     1 
ATOM   9361  C  CB    . ARG C 2  791  ? 5.324   33.947  8.115   1.00 35.93  ? 791  ARG C CB    1 
ATOM   9362  C  CG    . ARG C 2  791  ? 6.693   34.505  8.530   1.00 38.93  ? 791  ARG C CG    1 
ATOM   9363  C  CD    . ARG C 2  791  ? 6.968   35.912  7.986   1.00 37.18  ? 791  ARG C CD    1 
ATOM   9364  N  NE    . ARG C 2  791  ? 6.958   35.989  6.525   1.00 41.78  ? 791  ARG C NE    1 
ATOM   9365  C  CZ    . ARG C 2  791  ? 8.039   35.888  5.755   1.00 41.23  ? 791  ARG C CZ    1 
ATOM   9366  N  NH1   . ARG C 2  791  ? 9.233   35.694  6.296   1.00 43.97  ? 791  ARG C NH1   1 
ATOM   9367  N  NH2   . ARG C 2  791  ? 7.924   35.978  4.437   1.00 39.89  ? 791  ARG C NH2   1 
ATOM   9368  N  N     . ILE C 2  792  ? 2.433   32.616  8.942   1.00 17.76  ? 792  ILE C N     1 
ATOM   9369  C  CA    . ILE C 2  792  ? 1.137   32.161  8.460   1.00 15.80  ? 792  ILE C CA    1 
ATOM   9370  C  C     . ILE C 2  792  ? 0.985   32.492  6.989   1.00 18.75  ? 792  ILE C C     1 
ATOM   9371  O  O     . ILE C 2  792  ? 1.253   33.615  6.574   1.00 24.01  ? 792  ILE C O     1 
ATOM   9372  C  CB    . ILE C 2  792  ? -0.020  32.809  9.231   1.00 12.65  ? 792  ILE C CB    1 
ATOM   9373  C  CG1   . ILE C 2  792  ? 0.234   32.744  10.738  1.00 13.42  ? 792  ILE C CG1   1 
ATOM   9374  C  CG2   . ILE C 2  792  ? -1.341  32.158  8.851   1.00 9.39   ? 792  ILE C CG2   1 
ATOM   9375  C  CD1   . ILE C 2  792  ? -0.859  33.379  11.555  1.00 16.83  ? 792  ILE C CD1   1 
ATOM   9376  N  N     . GLY C 2  793  ? 0.552   31.515  6.203   1.00 18.84  ? 793  GLY C N     1 
ATOM   9377  C  CA    . GLY C 2  793  ? 0.376   31.711  4.777   1.00 21.73  ? 793  GLY C CA    1 
ATOM   9378  C  C     . GLY C 2  793  ? 1.514   31.114  3.977   1.00 24.19  ? 793  GLY C C     1 
ATOM   9379  O  O     . GLY C 2  793  ? 1.367   30.823  2.791   1.00 27.42  ? 793  GLY C O     1 
ATOM   9380  N  N     . ALA C 2  794  ? 2.656   30.932  4.629   1.00 25.37  ? 794  ALA C N     1 
ATOM   9381  C  CA    . ALA C 2  794  ? 3.811   30.339  3.972   1.00 31.77  ? 794  ALA C CA    1 
ATOM   9382  C  C     . ALA C 2  794  ? 3.526   28.892  3.602   1.00 30.06  ? 794  ALA C C     1 
ATOM   9383  O  O     . ALA C 2  794  ? 2.736   28.218  4.262   1.00 28.12  ? 794  ALA C O     1 
ATOM   9384  C  CB    . ALA C 2  794  ? 5.039   30.427  4.864   1.00 36.03  ? 794  ALA C CB    1 
ATOM   9385  N  N     . GLU C 2  795  ? 4.159   28.426  2.533   1.00 36.87  ? 795  GLU C N     1 
ATOM   9386  C  CA    . GLU C 2  795  ? 4.070   27.029  2.147   1.00 35.73  ? 795  GLU C CA    1 
ATOM   9387  C  C     . GLU C 2  795  ? 5.250   26.270  2.725   1.00 30.00  ? 795  GLU C C     1 
ATOM   9388  O  O     . GLU C 2  795  ? 6.362   26.792  2.769   1.00 31.56  ? 795  GLU C O     1 
ATOM   9389  C  CB    . GLU C 2  795  ? 4.041   26.888  0.632   1.00 25.45  ? 795  GLU C CB    1 
ATOM   9390  N  N     . VAL C 2  796  ? 5.010   25.042  3.170   1.00 28.86  ? 796  VAL C N     1 
ATOM   9391  C  CA    . VAL C 2  796  ? 6.074   24.230  3.742   1.00 30.20  ? 796  VAL C CA    1 
ATOM   9392  C  C     . VAL C 2  796  ? 6.162   22.853  3.097   1.00 36.42  ? 796  VAL C C     1 
ATOM   9393  O  O     . VAL C 2  796  ? 5.155   22.183  2.859   1.00 34.41  ? 796  VAL C O     1 
ATOM   9394  C  CB    . VAL C 2  796  ? 5.903   24.062  5.259   1.00 26.02  ? 796  VAL C CB    1 
ATOM   9395  C  CG1   . VAL C 2  796  ? 6.129   25.386  5.955   1.00 32.42  ? 796  VAL C CG1   1 
ATOM   9396  C  CG2   . VAL C 2  796  ? 4.528   23.517  5.588   1.00 23.86  ? 796  VAL C CG2   1 
ATOM   9397