data_5UHA
# 
_entry.id   5UHA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5UHA         
WWPDB D_1000225863 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5UH6 unspecified 
PDB . 5UH7 unspecified 
PDB . 5UH8 unspecified 
PDB . 5UH9 unspecified 
PDB . 5UHB unspecified 
PDB . 5UHC unspecified 
PDB . 5UHD unspecified 
PDB . 5UHE unspecified 
PDB . 5UHF unspecified 
PDB . 5UHG unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5UHA 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lin, W.'       1 ? 
'Das, K.'       2 ? 
'Feng, Y.'      3 ? 
'Ebright, R.H.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            66 
_citation.language                  ? 
_citation.page_first                169 
_citation.page_last                 179.e8 
_citation.title                     'Structural Basis of Mycobacterium tuberculosis Transcription and Transcription Inhibition.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2017.03.001 
_citation.pdbx_database_id_PubMed   28392175 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lin, W.'       1  
primary 'Mandal, S.'    2  
primary 'Degen, D.'     3  
primary 'Liu, Y.'       4  
primary 'Ebright, Y.W.' 5  
primary 'Li, S.'        6  
primary 'Feng, Y.'      7  
primary 'Zhang, Y.'     8  
primary 'Mandal, S.'    9  
primary 'Jiang, Y.'     10 
primary 'Liu, S.'       11 
primary 'Gigliotti, M.' 12 
primary 'Talaue, M.'    13 
primary 'Connell, N.'   14 
primary 'Das, K.'       15 
primary 'Arnold, E.'    16 
primary 'Ebright, R.H.' 17 
# 
_cell.length_a           150.197 
_cell.length_b           163.481 
_cell.length_c           195.653 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5UHA 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         5UHA 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA-directed RNA polymerase subunit alpha'                                           37745.328  2 2.7.7.6 ? ? ? 
2 polymer     man 'DNA-directed RNA polymerase subunit beta'                                            130018.828 1 2.7.7.6 ? ? ? 
3 polymer     man 
;DNA-directed RNA polymerase subunit beta'
;
146968.969 1 2.7.7.6 ? ? ? 
4 polymer     man 'DNA-directed RNA polymerase subunit omega'                                           11851.140  1 2.7.7.6 ? ? ? 
5 polymer     man 'RNA polymerase sigma factor SigA'                                                    57877.160  1 ?       ? ? ? 
6 polymer     syn 
;DNA (5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*G)-3')
;
7160.632   1 ?       ? ? ? 
7 polymer     syn 
;DNA (5'-D(*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*GP*G)-3')
;
4939.204   1 ?       ? ? ? 
8 non-polymer syn 'ZINC ION'                                                                            65.409     2 ?       ? ? ? 
9 non-polymer syn 'MAGNESIUM ION'                                                                       24.305     1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
5 Sigma-A                                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
A,B ? 
2 'polypeptide(L)'        no no 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
C   ? 
3 'polypeptide(L)'        no no 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
D   ? 
4 'polypeptide(L)'        no no 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
E   ? 
5 'polypeptide(L)'        no no 
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
F   ? 
6 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)
;
TATAATGGGAGCTGTCACGGATG H   ? 
7 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)' CATCCGTGAGTCGAGG G   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ILE n 
1 4    SER n 
1 5    GLN n 
1 6    ARG n 
1 7    PRO n 
1 8    THR n 
1 9    LEU n 
1 10   SER n 
1 11   GLU n 
1 12   ASP n 
1 13   VAL n 
1 14   LEU n 
1 15   THR n 
1 16   ASP n 
1 17   ASN n 
1 18   ARG n 
1 19   SER n 
1 20   GLN n 
1 21   PHE n 
1 22   VAL n 
1 23   ILE n 
1 24   GLU n 
1 25   PRO n 
1 26   LEU n 
1 27   GLU n 
1 28   PRO n 
1 29   GLY n 
1 30   PHE n 
1 31   GLY n 
1 32   TYR n 
1 33   THR n 
1 34   LEU n 
1 35   GLY n 
1 36   ASN n 
1 37   SER n 
1 38   LEU n 
1 39   ARG n 
1 40   ARG n 
1 41   THR n 
1 42   LEU n 
1 43   LEU n 
1 44   SER n 
1 45   SER n 
1 46   ILE n 
1 47   PRO n 
1 48   GLY n 
1 49   ALA n 
1 50   ALA n 
1 51   VAL n 
1 52   THR n 
1 53   SER n 
1 54   ILE n 
1 55   ARG n 
1 56   ILE n 
1 57   ASP n 
1 58   GLY n 
1 59   VAL n 
1 60   LEU n 
1 61   HIS n 
1 62   GLU n 
1 63   PHE n 
1 64   THR n 
1 65   THR n 
1 66   VAL n 
1 67   PRO n 
1 68   GLY n 
1 69   VAL n 
1 70   LYS n 
1 71   GLU n 
1 72   ASP n 
1 73   VAL n 
1 74   THR n 
1 75   GLU n 
1 76   ILE n 
1 77   ILE n 
1 78   LEU n 
1 79   ASN n 
1 80   LEU n 
1 81   LYS n 
1 82   SER n 
1 83   LEU n 
1 84   VAL n 
1 85   VAL n 
1 86   SER n 
1 87   SER n 
1 88   GLU n 
1 89   GLU n 
1 90   ASP n 
1 91   GLU n 
1 92   PRO n 
1 93   VAL n 
1 94   THR n 
1 95   MET n 
1 96   TYR n 
1 97   LEU n 
1 98   ARG n 
1 99   LYS n 
1 100  GLN n 
1 101  GLY n 
1 102  PRO n 
1 103  GLY n 
1 104  GLU n 
1 105  VAL n 
1 106  THR n 
1 107  ALA n 
1 108  GLY n 
1 109  ASP n 
1 110  ILE n 
1 111  VAL n 
1 112  PRO n 
1 113  PRO n 
1 114  ALA n 
1 115  GLY n 
1 116  VAL n 
1 117  THR n 
1 118  VAL n 
1 119  HIS n 
1 120  ASN n 
1 121  PRO n 
1 122  GLY n 
1 123  MET n 
1 124  HIS n 
1 125  ILE n 
1 126  ALA n 
1 127  THR n 
1 128  LEU n 
1 129  ASN n 
1 130  ASP n 
1 131  LYS n 
1 132  GLY n 
1 133  LYS n 
1 134  LEU n 
1 135  GLU n 
1 136  VAL n 
1 137  GLU n 
1 138  LEU n 
1 139  VAL n 
1 140  VAL n 
1 141  GLU n 
1 142  ARG n 
1 143  GLY n 
1 144  ARG n 
1 145  GLY n 
1 146  TYR n 
1 147  VAL n 
1 148  PRO n 
1 149  ALA n 
1 150  VAL n 
1 151  GLN n 
1 152  ASN n 
1 153  ARG n 
1 154  ALA n 
1 155  SER n 
1 156  GLY n 
1 157  ALA n 
1 158  GLU n 
1 159  ILE n 
1 160  GLY n 
1 161  ARG n 
1 162  ILE n 
1 163  PRO n 
1 164  VAL n 
1 165  ASP n 
1 166  SER n 
1 167  ILE n 
1 168  TYR n 
1 169  SER n 
1 170  PRO n 
1 171  VAL n 
1 172  LEU n 
1 173  LYS n 
1 174  VAL n 
1 175  THR n 
1 176  TYR n 
1 177  LYS n 
1 178  VAL n 
1 179  ASP n 
1 180  ALA n 
1 181  THR n 
1 182  ARG n 
1 183  VAL n 
1 184  GLU n 
1 185  GLN n 
1 186  ARG n 
1 187  THR n 
1 188  ASP n 
1 189  PHE n 
1 190  ASP n 
1 191  LYS n 
1 192  LEU n 
1 193  ILE n 
1 194  LEU n 
1 195  ASP n 
1 196  VAL n 
1 197  GLU n 
1 198  THR n 
1 199  LYS n 
1 200  ASN n 
1 201  SER n 
1 202  ILE n 
1 203  SER n 
1 204  PRO n 
1 205  ARG n 
1 206  ASP n 
1 207  ALA n 
1 208  LEU n 
1 209  ALA n 
1 210  SER n 
1 211  ALA n 
1 212  GLY n 
1 213  LYS n 
1 214  THR n 
1 215  LEU n 
1 216  VAL n 
1 217  GLU n 
1 218  LEU n 
1 219  PHE n 
1 220  GLY n 
1 221  LEU n 
1 222  ALA n 
1 223  ARG n 
1 224  GLU n 
1 225  LEU n 
1 226  ASN n 
1 227  VAL n 
1 228  GLU n 
1 229  ALA n 
1 230  GLU n 
1 231  GLY n 
1 232  ILE n 
1 233  GLU n 
1 234  ILE n 
1 235  GLY n 
1 236  PRO n 
1 237  SER n 
1 238  PRO n 
1 239  ALA n 
1 240  GLU n 
1 241  ALA n 
1 242  ASP n 
1 243  HIS n 
1 244  ILE n 
1 245  ALA n 
1 246  SER n 
1 247  PHE n 
1 248  ALA n 
1 249  LEU n 
1 250  PRO n 
1 251  ILE n 
1 252  ASP n 
1 253  ASP n 
1 254  LEU n 
1 255  ASP n 
1 256  LEU n 
1 257  THR n 
1 258  VAL n 
1 259  ARG n 
1 260  SER n 
1 261  TYR n 
1 262  ASN n 
1 263  CYS n 
1 264  LEU n 
1 265  LYS n 
1 266  ARG n 
1 267  GLU n 
1 268  GLY n 
1 269  VAL n 
1 270  HIS n 
1 271  THR n 
1 272  VAL n 
1 273  GLY n 
1 274  GLU n 
1 275  LEU n 
1 276  VAL n 
1 277  ALA n 
1 278  ARG n 
1 279  THR n 
1 280  GLU n 
1 281  SER n 
1 282  ASP n 
1 283  LEU n 
1 284  LEU n 
1 285  ASP n 
1 286  ILE n 
1 287  ARG n 
1 288  ASN n 
1 289  PHE n 
1 290  GLY n 
1 291  GLN n 
1 292  LYS n 
1 293  SER n 
1 294  ILE n 
1 295  ASP n 
1 296  GLU n 
1 297  VAL n 
1 298  LYS n 
1 299  ILE n 
1 300  LYS n 
1 301  LEU n 
1 302  HIS n 
1 303  GLN n 
1 304  LEU n 
1 305  GLY n 
1 306  LEU n 
1 307  SER n 
1 308  LEU n 
1 309  LYS n 
1 310  ASP n 
1 311  SER n 
1 312  PRO n 
1 313  PRO n 
1 314  SER n 
1 315  PHE n 
1 316  ASP n 
1 317  PRO n 
1 318  SER n 
1 319  GLU n 
1 320  VAL n 
1 321  ALA n 
1 322  GLY n 
1 323  TYR n 
1 324  ASP n 
1 325  VAL n 
1 326  ALA n 
1 327  THR n 
1 328  GLY n 
1 329  THR n 
1 330  TRP n 
1 331  SER n 
1 332  THR n 
1 333  GLU n 
1 334  GLY n 
1 335  ALA n 
1 336  TYR n 
1 337  ASP n 
1 338  GLU n 
1 339  GLN n 
1 340  ASP n 
1 341  TYR n 
1 342  ALA n 
1 343  GLU n 
1 344  THR n 
1 345  GLU n 
1 346  GLN n 
1 347  LEU n 
2 1    MET n 
2 2    LEU n 
2 3    GLU n 
2 4    GLY n 
2 5    CYS n 
2 6    ILE n 
2 7    LEU n 
2 8    ALA n 
2 9    ASP n 
2 10   SER n 
2 11   ARG n 
2 12   GLN n 
2 13   SER n 
2 14   LYS n 
2 15   THR n 
2 16   ALA n 
2 17   ALA n 
2 18   SER n 
2 19   PRO n 
2 20   SER n 
2 21   PRO n 
2 22   SER n 
2 23   ARG n 
2 24   PRO n 
2 25   GLN n 
2 26   SER n 
2 27   SER n 
2 28   SER n 
2 29   ASN n 
2 30   ASN n 
2 31   SER n 
2 32   VAL n 
2 33   PRO n 
2 34   GLY n 
2 35   ALA n 
2 36   PRO n 
2 37   ASN n 
2 38   ARG n 
2 39   VAL n 
2 40   SER n 
2 41   PHE n 
2 42   ALA n 
2 43   LYS n 
2 44   LEU n 
2 45   ARG n 
2 46   GLU n 
2 47   PRO n 
2 48   LEU n 
2 49   GLU n 
2 50   VAL n 
2 51   PRO n 
2 52   GLY n 
2 53   LEU n 
2 54   LEU n 
2 55   ASP n 
2 56   VAL n 
2 57   GLN n 
2 58   THR n 
2 59   ASP n 
2 60   SER n 
2 61   PHE n 
2 62   GLU n 
2 63   TRP n 
2 64   LEU n 
2 65   ILE n 
2 66   GLY n 
2 67   SER n 
2 68   PRO n 
2 69   ARG n 
2 70   TRP n 
2 71   ARG n 
2 72   GLU n 
2 73   SER n 
2 74   ALA n 
2 75   ALA n 
2 76   GLU n 
2 77   ARG n 
2 78   GLY n 
2 79   ASP n 
2 80   VAL n 
2 81   ASN n 
2 82   PRO n 
2 83   VAL n 
2 84   GLY n 
2 85   GLY n 
2 86   LEU n 
2 87   GLU n 
2 88   GLU n 
2 89   VAL n 
2 90   LEU n 
2 91   TYR n 
2 92   GLU n 
2 93   LEU n 
2 94   SER n 
2 95   PRO n 
2 96   ILE n 
2 97   GLU n 
2 98   ASP n 
2 99   PHE n 
2 100  SER n 
2 101  GLY n 
2 102  SER n 
2 103  MET n 
2 104  SER n 
2 105  LEU n 
2 106  SER n 
2 107  PHE n 
2 108  SER n 
2 109  ASP n 
2 110  PRO n 
2 111  ARG n 
2 112  PHE n 
2 113  ASP n 
2 114  ASP n 
2 115  VAL n 
2 116  LYS n 
2 117  ALA n 
2 118  PRO n 
2 119  VAL n 
2 120  ASP n 
2 121  GLU n 
2 122  CYS n 
2 123  LYS n 
2 124  ASP n 
2 125  LYS n 
2 126  ASP n 
2 127  MET n 
2 128  THR n 
2 129  TYR n 
2 130  ALA n 
2 131  ALA n 
2 132  PRO n 
2 133  LEU n 
2 134  PHE n 
2 135  VAL n 
2 136  THR n 
2 137  ALA n 
2 138  GLU n 
2 139  PHE n 
2 140  ILE n 
2 141  ASN n 
2 142  ASN n 
2 143  ASN n 
2 144  THR n 
2 145  GLY n 
2 146  GLU n 
2 147  ILE n 
2 148  LYS n 
2 149  SER n 
2 150  GLN n 
2 151  THR n 
2 152  VAL n 
2 153  PHE n 
2 154  MET n 
2 155  GLY n 
2 156  ASP n 
2 157  PHE n 
2 158  PRO n 
2 159  MET n 
2 160  MET n 
2 161  THR n 
2 162  GLU n 
2 163  LYS n 
2 164  GLY n 
2 165  THR n 
2 166  PHE n 
2 167  ILE n 
2 168  ILE n 
2 169  ASN n 
2 170  GLY n 
2 171  THR n 
2 172  GLU n 
2 173  ARG n 
2 174  VAL n 
2 175  VAL n 
2 176  VAL n 
2 177  SER n 
2 178  GLN n 
2 179  LEU n 
2 180  VAL n 
2 181  ARG n 
2 182  SER n 
2 183  PRO n 
2 184  GLY n 
2 185  VAL n 
2 186  TYR n 
2 187  PHE n 
2 188  ASP n 
2 189  GLU n 
2 190  THR n 
2 191  ILE n 
2 192  ASP n 
2 193  LYS n 
2 194  SER n 
2 195  THR n 
2 196  ASP n 
2 197  LYS n 
2 198  THR n 
2 199  LEU n 
2 200  HIS n 
2 201  SER n 
2 202  VAL n 
2 203  LYS n 
2 204  VAL n 
2 205  ILE n 
2 206  PRO n 
2 207  SER n 
2 208  ARG n 
2 209  GLY n 
2 210  ALA n 
2 211  TRP n 
2 212  LEU n 
2 213  GLU n 
2 214  PHE n 
2 215  ASP n 
2 216  VAL n 
2 217  ASP n 
2 218  LYS n 
2 219  ARG n 
2 220  ASP n 
2 221  THR n 
2 222  VAL n 
2 223  GLY n 
2 224  VAL n 
2 225  ARG n 
2 226  ILE n 
2 227  ASP n 
2 228  ARG n 
2 229  LYS n 
2 230  ARG n 
2 231  ARG n 
2 232  GLN n 
2 233  PRO n 
2 234  VAL n 
2 235  THR n 
2 236  VAL n 
2 237  LEU n 
2 238  LEU n 
2 239  LYS n 
2 240  ALA n 
2 241  LEU n 
2 242  GLY n 
2 243  TRP n 
2 244  THR n 
2 245  SER n 
2 246  GLU n 
2 247  GLN n 
2 248  ILE n 
2 249  VAL n 
2 250  GLU n 
2 251  ARG n 
2 252  PHE n 
2 253  GLY n 
2 254  PHE n 
2 255  SER n 
2 256  GLU n 
2 257  ILE n 
2 258  MET n 
2 259  ARG n 
2 260  SER n 
2 261  THR n 
2 262  LEU n 
2 263  GLU n 
2 264  LYS n 
2 265  ASP n 
2 266  ASN n 
2 267  THR n 
2 268  VAL n 
2 269  GLY n 
2 270  THR n 
2 271  ASP n 
2 272  GLU n 
2 273  ALA n 
2 274  LEU n 
2 275  LEU n 
2 276  ASP n 
2 277  ILE n 
2 278  TYR n 
2 279  ARG n 
2 280  LYS n 
2 281  LEU n 
2 282  ARG n 
2 283  PRO n 
2 284  GLY n 
2 285  GLU n 
2 286  PRO n 
2 287  PRO n 
2 288  THR n 
2 289  LYS n 
2 290  GLU n 
2 291  SER n 
2 292  ALA n 
2 293  GLN n 
2 294  THR n 
2 295  LEU n 
2 296  LEU n 
2 297  GLU n 
2 298  ASN n 
2 299  LEU n 
2 300  PHE n 
2 301  PHE n 
2 302  LYS n 
2 303  GLU n 
2 304  LYS n 
2 305  ARG n 
2 306  TYR n 
2 307  ASP n 
2 308  LEU n 
2 309  ALA n 
2 310  ARG n 
2 311  VAL n 
2 312  GLY n 
2 313  ARG n 
2 314  TYR n 
2 315  LYS n 
2 316  VAL n 
2 317  ASN n 
2 318  LYS n 
2 319  LYS n 
2 320  LEU n 
2 321  GLY n 
2 322  LEU n 
2 323  HIS n 
2 324  VAL n 
2 325  GLY n 
2 326  GLU n 
2 327  PRO n 
2 328  ILE n 
2 329  THR n 
2 330  SER n 
2 331  SER n 
2 332  THR n 
2 333  LEU n 
2 334  THR n 
2 335  GLU n 
2 336  GLU n 
2 337  ASP n 
2 338  VAL n 
2 339  VAL n 
2 340  ALA n 
2 341  THR n 
2 342  ILE n 
2 343  GLU n 
2 344  TYR n 
2 345  LEU n 
2 346  VAL n 
2 347  ARG n 
2 348  LEU n 
2 349  HIS n 
2 350  GLU n 
2 351  GLY n 
2 352  GLN n 
2 353  THR n 
2 354  THR n 
2 355  MET n 
2 356  THR n 
2 357  VAL n 
2 358  PRO n 
2 359  GLY n 
2 360  GLY n 
2 361  VAL n 
2 362  GLU n 
2 363  VAL n 
2 364  PRO n 
2 365  VAL n 
2 366  GLU n 
2 367  THR n 
2 368  ASP n 
2 369  ASP n 
2 370  ILE n 
2 371  ASP n 
2 372  HIS n 
2 373  PHE n 
2 374  GLY n 
2 375  ASN n 
2 376  ARG n 
2 377  ARG n 
2 378  LEU n 
2 379  ARG n 
2 380  THR n 
2 381  VAL n 
2 382  GLY n 
2 383  GLU n 
2 384  LEU n 
2 385  ILE n 
2 386  GLN n 
2 387  ASN n 
2 388  GLN n 
2 389  ILE n 
2 390  ARG n 
2 391  VAL n 
2 392  GLY n 
2 393  MET n 
2 394  SER n 
2 395  ARG n 
2 396  MET n 
2 397  GLU n 
2 398  ARG n 
2 399  VAL n 
2 400  VAL n 
2 401  ARG n 
2 402  GLU n 
2 403  ARG n 
2 404  MET n 
2 405  THR n 
2 406  THR n 
2 407  GLN n 
2 408  ASP n 
2 409  VAL n 
2 410  GLU n 
2 411  ALA n 
2 412  ILE n 
2 413  THR n 
2 414  PRO n 
2 415  GLN n 
2 416  THR n 
2 417  LEU n 
2 418  ILE n 
2 419  ASN n 
2 420  ILE n 
2 421  ARG n 
2 422  PRO n 
2 423  VAL n 
2 424  VAL n 
2 425  ALA n 
2 426  ALA n 
2 427  ILE n 
2 428  LYS n 
2 429  GLU n 
2 430  PHE n 
2 431  PHE n 
2 432  GLY n 
2 433  THR n 
2 434  SER n 
2 435  GLN n 
2 436  LEU n 
2 437  SER n 
2 438  GLN n 
2 439  PHE n 
2 440  MET n 
2 441  ASP n 
2 442  GLN n 
2 443  ASN n 
2 444  ASN n 
2 445  PRO n 
2 446  LEU n 
2 447  SER n 
2 448  GLY n 
2 449  LEU n 
2 450  THR n 
2 451  HIS n 
2 452  LYS n 
2 453  ARG n 
2 454  ARG n 
2 455  LEU n 
2 456  SER n 
2 457  ALA n 
2 458  LEU n 
2 459  GLY n 
2 460  PRO n 
2 461  GLY n 
2 462  GLY n 
2 463  LEU n 
2 464  SER n 
2 465  ARG n 
2 466  GLU n 
2 467  ARG n 
2 468  ALA n 
2 469  GLY n 
2 470  LEU n 
2 471  GLU n 
2 472  VAL n 
2 473  ARG n 
2 474  ASP n 
2 475  VAL n 
2 476  HIS n 
2 477  PRO n 
2 478  SER n 
2 479  HIS n 
2 480  TYR n 
2 481  GLY n 
2 482  ARG n 
2 483  MET n 
2 484  CYS n 
2 485  PRO n 
2 486  ILE n 
2 487  GLU n 
2 488  THR n 
2 489  PRO n 
2 490  GLU n 
2 491  GLY n 
2 492  PRO n 
2 493  ASN n 
2 494  ILE n 
2 495  GLY n 
2 496  LEU n 
2 497  ILE n 
2 498  GLY n 
2 499  SER n 
2 500  LEU n 
2 501  SER n 
2 502  VAL n 
2 503  TYR n 
2 504  ALA n 
2 505  ARG n 
2 506  VAL n 
2 507  ASN n 
2 508  PRO n 
2 509  PHE n 
2 510  GLY n 
2 511  PHE n 
2 512  ILE n 
2 513  GLU n 
2 514  THR n 
2 515  PRO n 
2 516  TYR n 
2 517  ARG n 
2 518  LYS n 
2 519  VAL n 
2 520  VAL n 
2 521  ASP n 
2 522  GLY n 
2 523  VAL n 
2 524  VAL n 
2 525  SER n 
2 526  ASP n 
2 527  GLU n 
2 528  ILE n 
2 529  VAL n 
2 530  TYR n 
2 531  LEU n 
2 532  THR n 
2 533  ALA n 
2 534  ASP n 
2 535  GLU n 
2 536  GLU n 
2 537  ASP n 
2 538  ARG n 
2 539  HIS n 
2 540  VAL n 
2 541  VAL n 
2 542  ALA n 
2 543  GLN n 
2 544  ALA n 
2 545  ASN n 
2 546  SER n 
2 547  PRO n 
2 548  ILE n 
2 549  ASP n 
2 550  ALA n 
2 551  ASP n 
2 552  GLY n 
2 553  ARG n 
2 554  PHE n 
2 555  VAL n 
2 556  GLU n 
2 557  PRO n 
2 558  ARG n 
2 559  VAL n 
2 560  LEU n 
2 561  VAL n 
2 562  ARG n 
2 563  ARG n 
2 564  LYS n 
2 565  ALA n 
2 566  GLY n 
2 567  GLU n 
2 568  VAL n 
2 569  GLU n 
2 570  TYR n 
2 571  VAL n 
2 572  PRO n 
2 573  SER n 
2 574  SER n 
2 575  GLU n 
2 576  VAL n 
2 577  ASP n 
2 578  TYR n 
2 579  MET n 
2 580  ASP n 
2 581  VAL n 
2 582  SER n 
2 583  PRO n 
2 584  ARG n 
2 585  GLN n 
2 586  MET n 
2 587  VAL n 
2 588  SER n 
2 589  VAL n 
2 590  ALA n 
2 591  THR n 
2 592  ALA n 
2 593  MET n 
2 594  ILE n 
2 595  PRO n 
2 596  PHE n 
2 597  LEU n 
2 598  GLU n 
2 599  HIS n 
2 600  ASP n 
2 601  ASP n 
2 602  ALA n 
2 603  ASN n 
2 604  ARG n 
2 605  ALA n 
2 606  LEU n 
2 607  MET n 
2 608  GLY n 
2 609  ALA n 
2 610  ASN n 
2 611  MET n 
2 612  GLN n 
2 613  ARG n 
2 614  GLN n 
2 615  ALA n 
2 616  VAL n 
2 617  PRO n 
2 618  LEU n 
2 619  VAL n 
2 620  ARG n 
2 621  SER n 
2 622  GLU n 
2 623  ALA n 
2 624  PRO n 
2 625  LEU n 
2 626  VAL n 
2 627  GLY n 
2 628  THR n 
2 629  GLY n 
2 630  MET n 
2 631  GLU n 
2 632  LEU n 
2 633  ARG n 
2 634  ALA n 
2 635  ALA n 
2 636  ILE n 
2 637  ASP n 
2 638  ALA n 
2 639  GLY n 
2 640  ASP n 
2 641  VAL n 
2 642  VAL n 
2 643  VAL n 
2 644  ALA n 
2 645  GLU n 
2 646  GLU n 
2 647  SER n 
2 648  GLY n 
2 649  VAL n 
2 650  ILE n 
2 651  GLU n 
2 652  GLU n 
2 653  VAL n 
2 654  SER n 
2 655  ALA n 
2 656  ASP n 
2 657  TYR n 
2 658  ILE n 
2 659  THR n 
2 660  VAL n 
2 661  MET n 
2 662  HIS n 
2 663  ASP n 
2 664  ASN n 
2 665  GLY n 
2 666  THR n 
2 667  ARG n 
2 668  ARG n 
2 669  THR n 
2 670  TYR n 
2 671  ARG n 
2 672  MET n 
2 673  ARG n 
2 674  LYS n 
2 675  PHE n 
2 676  ALA n 
2 677  ARG n 
2 678  SER n 
2 679  ASN n 
2 680  HIS n 
2 681  GLY n 
2 682  THR n 
2 683  CYS n 
2 684  ALA n 
2 685  ASN n 
2 686  GLN n 
2 687  CYS n 
2 688  PRO n 
2 689  ILE n 
2 690  VAL n 
2 691  ASP n 
2 692  ALA n 
2 693  GLY n 
2 694  ASP n 
2 695  ARG n 
2 696  VAL n 
2 697  GLU n 
2 698  ALA n 
2 699  GLY n 
2 700  GLN n 
2 701  VAL n 
2 702  ILE n 
2 703  ALA n 
2 704  ASP n 
2 705  GLY n 
2 706  PRO n 
2 707  CYS n 
2 708  THR n 
2 709  ASP n 
2 710  ASP n 
2 711  GLY n 
2 712  GLU n 
2 713  MET n 
2 714  ALA n 
2 715  LEU n 
2 716  GLY n 
2 717  LYS n 
2 718  ASN n 
2 719  LEU n 
2 720  LEU n 
2 721  VAL n 
2 722  ALA n 
2 723  ILE n 
2 724  MET n 
2 725  PRO n 
2 726  TRP n 
2 727  GLU n 
2 728  GLY n 
2 729  HIS n 
2 730  ASN n 
2 731  TYR n 
2 732  GLU n 
2 733  ASP n 
2 734  ALA n 
2 735  ILE n 
2 736  ILE n 
2 737  LEU n 
2 738  SER n 
2 739  ASN n 
2 740  ARG n 
2 741  LEU n 
2 742  VAL n 
2 743  GLU n 
2 744  GLU n 
2 745  ASP n 
2 746  VAL n 
2 747  LEU n 
2 748  THR n 
2 749  SER n 
2 750  ILE n 
2 751  HIS n 
2 752  ILE n 
2 753  GLU n 
2 754  GLU n 
2 755  HIS n 
2 756  GLU n 
2 757  ILE n 
2 758  ASP n 
2 759  ALA n 
2 760  ARG n 
2 761  ASP n 
2 762  THR n 
2 763  LYS n 
2 764  LEU n 
2 765  GLY n 
2 766  ALA n 
2 767  GLU n 
2 768  GLU n 
2 769  ILE n 
2 770  THR n 
2 771  ARG n 
2 772  ASP n 
2 773  ILE n 
2 774  PRO n 
2 775  ASN n 
2 776  ILE n 
2 777  SER n 
2 778  ASP n 
2 779  GLU n 
2 780  VAL n 
2 781  LEU n 
2 782  ALA n 
2 783  ASP n 
2 784  LEU n 
2 785  ASP n 
2 786  GLU n 
2 787  ARG n 
2 788  GLY n 
2 789  ILE n 
2 790  VAL n 
2 791  ARG n 
2 792  ILE n 
2 793  GLY n 
2 794  ALA n 
2 795  GLU n 
2 796  VAL n 
2 797  ARG n 
2 798  ASP n 
2 799  GLY n 
2 800  ASP n 
2 801  ILE n 
2 802  LEU n 
2 803  VAL n 
2 804  GLY n 
2 805  LYS n 
2 806  VAL n 
2 807  THR n 
2 808  PRO n 
2 809  LYS n 
2 810  GLY n 
2 811  GLU n 
2 812  THR n 
2 813  GLU n 
2 814  LEU n 
2 815  THR n 
2 816  PRO n 
2 817  GLU n 
2 818  GLU n 
2 819  ARG n 
2 820  LEU n 
2 821  LEU n 
2 822  ARG n 
2 823  ALA n 
2 824  ILE n 
2 825  PHE n 
2 826  GLY n 
2 827  GLU n 
2 828  LYS n 
2 829  ALA n 
2 830  ARG n 
2 831  GLU n 
2 832  VAL n 
2 833  ARG n 
2 834  ASP n 
2 835  THR n 
2 836  SER n 
2 837  LEU n 
2 838  LYS n 
2 839  VAL n 
2 840  PRO n 
2 841  HIS n 
2 842  GLY n 
2 843  GLU n 
2 844  SER n 
2 845  GLY n 
2 846  LYS n 
2 847  VAL n 
2 848  ILE n 
2 849  GLY n 
2 850  ILE n 
2 851  ARG n 
2 852  VAL n 
2 853  PHE n 
2 854  SER n 
2 855  ARG n 
2 856  GLU n 
2 857  ASP n 
2 858  GLU n 
2 859  ASP n 
2 860  GLU n 
2 861  LEU n 
2 862  PRO n 
2 863  ALA n 
2 864  GLY n 
2 865  VAL n 
2 866  ASN n 
2 867  GLU n 
2 868  LEU n 
2 869  VAL n 
2 870  ARG n 
2 871  VAL n 
2 872  TYR n 
2 873  VAL n 
2 874  ALA n 
2 875  GLN n 
2 876  LYS n 
2 877  ARG n 
2 878  LYS n 
2 879  ILE n 
2 880  SER n 
2 881  ASP n 
2 882  GLY n 
2 883  ASP n 
2 884  LYS n 
2 885  LEU n 
2 886  ALA n 
2 887  GLY n 
2 888  ARG n 
2 889  HIS n 
2 890  GLY n 
2 891  ASN n 
2 892  LYS n 
2 893  GLY n 
2 894  VAL n 
2 895  ILE n 
2 896  GLY n 
2 897  LYS n 
2 898  ILE n 
2 899  LEU n 
2 900  PRO n 
2 901  VAL n 
2 902  GLU n 
2 903  ASP n 
2 904  MET n 
2 905  PRO n 
2 906  PHE n 
2 907  LEU n 
2 908  ALA n 
2 909  ASP n 
2 910  GLY n 
2 911  THR n 
2 912  PRO n 
2 913  VAL n 
2 914  ASP n 
2 915  ILE n 
2 916  ILE n 
2 917  LEU n 
2 918  ASN n 
2 919  THR n 
2 920  HIS n 
2 921  GLY n 
2 922  VAL n 
2 923  PRO n 
2 924  ARG n 
2 925  ARG n 
2 926  MET n 
2 927  ASN n 
2 928  ILE n 
2 929  GLY n 
2 930  GLN n 
2 931  ILE n 
2 932  LEU n 
2 933  GLU n 
2 934  THR n 
2 935  HIS n 
2 936  LEU n 
2 937  GLY n 
2 938  TRP n 
2 939  CYS n 
2 940  ALA n 
2 941  HIS n 
2 942  SER n 
2 943  GLY n 
2 944  TRP n 
2 945  LYS n 
2 946  VAL n 
2 947  ASP n 
2 948  ALA n 
2 949  ALA n 
2 950  LYS n 
2 951  GLY n 
2 952  VAL n 
2 953  PRO n 
2 954  ASP n 
2 955  TRP n 
2 956  ALA n 
2 957  ALA n 
2 958  ARG n 
2 959  LEU n 
2 960  PRO n 
2 961  ASP n 
2 962  GLU n 
2 963  LEU n 
2 964  LEU n 
2 965  GLU n 
2 966  ALA n 
2 967  GLN n 
2 968  PRO n 
2 969  ASN n 
2 970  ALA n 
2 971  ILE n 
2 972  VAL n 
2 973  SER n 
2 974  THR n 
2 975  PRO n 
2 976  VAL n 
2 977  PHE n 
2 978  ASP n 
2 979  GLY n 
2 980  ALA n 
2 981  GLN n 
2 982  GLU n 
2 983  ALA n 
2 984  GLU n 
2 985  LEU n 
2 986  GLN n 
2 987  GLY n 
2 988  LEU n 
2 989  LEU n 
2 990  SER n 
2 991  CYS n 
2 992  THR n 
2 993  LEU n 
2 994  PRO n 
2 995  ASN n 
2 996  ARG n 
2 997  ASP n 
2 998  GLY n 
2 999  ASP n 
2 1000 VAL n 
2 1001 LEU n 
2 1002 VAL n 
2 1003 ASP n 
2 1004 ALA n 
2 1005 ASP n 
2 1006 GLY n 
2 1007 LYS n 
2 1008 ALA n 
2 1009 MET n 
2 1010 LEU n 
2 1011 PHE n 
2 1012 ASP n 
2 1013 GLY n 
2 1014 ARG n 
2 1015 SER n 
2 1016 GLY n 
2 1017 GLU n 
2 1018 PRO n 
2 1019 PHE n 
2 1020 PRO n 
2 1021 TYR n 
2 1022 PRO n 
2 1023 VAL n 
2 1024 THR n 
2 1025 VAL n 
2 1026 GLY n 
2 1027 TYR n 
2 1028 MET n 
2 1029 TYR n 
2 1030 ILE n 
2 1031 MET n 
2 1032 LYS n 
2 1033 LEU n 
2 1034 HIS n 
2 1035 HIS n 
2 1036 LEU n 
2 1037 VAL n 
2 1038 ASP n 
2 1039 ASP n 
2 1040 LYS n 
2 1041 ILE n 
2 1042 HIS n 
2 1043 ALA n 
2 1044 ARG n 
2 1045 SER n 
2 1046 THR n 
2 1047 GLY n 
2 1048 PRO n 
2 1049 TYR n 
2 1050 SER n 
2 1051 MET n 
2 1052 ILE n 
2 1053 THR n 
2 1054 GLN n 
2 1055 GLN n 
2 1056 PRO n 
2 1057 LEU n 
2 1058 GLY n 
2 1059 GLY n 
2 1060 LYS n 
2 1061 ALA n 
2 1062 GLN n 
2 1063 PHE n 
2 1064 GLY n 
2 1065 GLY n 
2 1066 GLN n 
2 1067 ARG n 
2 1068 PHE n 
2 1069 GLY n 
2 1070 GLU n 
2 1071 MET n 
2 1072 GLU n 
2 1073 CYS n 
2 1074 TRP n 
2 1075 ALA n 
2 1076 MET n 
2 1077 GLN n 
2 1078 ALA n 
2 1079 TYR n 
2 1080 GLY n 
2 1081 ALA n 
2 1082 ALA n 
2 1083 TYR n 
2 1084 THR n 
2 1085 LEU n 
2 1086 GLN n 
2 1087 GLU n 
2 1088 LEU n 
2 1089 LEU n 
2 1090 THR n 
2 1091 ILE n 
2 1092 LYS n 
2 1093 SER n 
2 1094 ASP n 
2 1095 ASP n 
2 1096 THR n 
2 1097 VAL n 
2 1098 GLY n 
2 1099 ARG n 
2 1100 VAL n 
2 1101 LYS n 
2 1102 VAL n 
2 1103 TYR n 
2 1104 GLU n 
2 1105 ALA n 
2 1106 ILE n 
2 1107 VAL n 
2 1108 LYS n 
2 1109 GLY n 
2 1110 GLU n 
2 1111 ASN n 
2 1112 ILE n 
2 1113 PRO n 
2 1114 GLU n 
2 1115 PRO n 
2 1116 GLY n 
2 1117 ILE n 
2 1118 PRO n 
2 1119 GLU n 
2 1120 SER n 
2 1121 PHE n 
2 1122 LYS n 
2 1123 VAL n 
2 1124 LEU n 
2 1125 LEU n 
2 1126 LYS n 
2 1127 GLU n 
2 1128 LEU n 
2 1129 GLN n 
2 1130 SER n 
2 1131 LEU n 
2 1132 CYS n 
2 1133 LEU n 
2 1134 ASN n 
2 1135 VAL n 
2 1136 GLU n 
2 1137 VAL n 
2 1138 LEU n 
2 1139 SER n 
2 1140 SER n 
2 1141 ASP n 
2 1142 GLY n 
2 1143 ALA n 
2 1144 ALA n 
2 1145 ILE n 
2 1146 GLU n 
2 1147 LEU n 
2 1148 ARG n 
2 1149 GLU n 
2 1150 GLY n 
2 1151 GLU n 
2 1152 ASP n 
2 1153 GLU n 
2 1154 ASP n 
2 1155 LEU n 
2 1156 GLU n 
2 1157 ARG n 
2 1158 ALA n 
2 1159 ALA n 
2 1160 ALA n 
2 1161 ASN n 
2 1162 LEU n 
2 1163 GLY n 
2 1164 ILE n 
2 1165 ASN n 
2 1166 LEU n 
2 1167 SER n 
2 1168 ARG n 
2 1169 ASN n 
2 1170 GLU n 
2 1171 SER n 
2 1172 ALA n 
2 1173 SER n 
2 1174 VAL n 
2 1175 GLU n 
2 1176 ASP n 
2 1177 LEU n 
2 1178 ALA n 
3 1    MET n 
3 2    LEU n 
3 3    ASP n 
3 4    VAL n 
3 5    ASN n 
3 6    PHE n 
3 7    PHE n 
3 8    ASP n 
3 9    GLU n 
3 10   LEU n 
3 11   ARG n 
3 12   ILE n 
3 13   GLY n 
3 14   LEU n 
3 15   ALA n 
3 16   THR n 
3 17   ALA n 
3 18   GLU n 
3 19   ASP n 
3 20   ILE n 
3 21   ARG n 
3 22   GLN n 
3 23   TRP n 
3 24   SER n 
3 25   TYR n 
3 26   GLY n 
3 27   GLU n 
3 28   VAL n 
3 29   LYS n 
3 30   LYS n 
3 31   PRO n 
3 32   GLU n 
3 33   THR n 
3 34   ILE n 
3 35   ASN n 
3 36   TYR n 
3 37   ARG n 
3 38   THR n 
3 39   LEU n 
3 40   LYS n 
3 41   PRO n 
3 42   GLU n 
3 43   LYS n 
3 44   ASP n 
3 45   GLY n 
3 46   LEU n 
3 47   PHE n 
3 48   CYS n 
3 49   GLU n 
3 50   LYS n 
3 51   ILE n 
3 52   PHE n 
3 53   GLY n 
3 54   PRO n 
3 55   THR n 
3 56   ARG n 
3 57   ASP n 
3 58   TRP n 
3 59   GLU n 
3 60   CYS n 
3 61   TYR n 
3 62   CYS n 
3 63   GLY n 
3 64   LYS n 
3 65   TYR n 
3 66   LYS n 
3 67   ARG n 
3 68   VAL n 
3 69   ARG n 
3 70   PHE n 
3 71   LYS n 
3 72   GLY n 
3 73   ILE n 
3 74   ILE n 
3 75   CYS n 
3 76   GLU n 
3 77   ARG n 
3 78   CYS n 
3 79   GLY n 
3 80   VAL n 
3 81   GLU n 
3 82   VAL n 
3 83   THR n 
3 84   ARG n 
3 85   ALA n 
3 86   LYS n 
3 87   VAL n 
3 88   ARG n 
3 89   ARG n 
3 90   GLU n 
3 91   ARG n 
3 92   MET n 
3 93   GLY n 
3 94   HIS n 
3 95   ILE n 
3 96   GLU n 
3 97   LEU n 
3 98   ALA n 
3 99   ALA n 
3 100  PRO n 
3 101  VAL n 
3 102  THR n 
3 103  HIS n 
3 104  ILE n 
3 105  TRP n 
3 106  TYR n 
3 107  PHE n 
3 108  LYS n 
3 109  GLY n 
3 110  VAL n 
3 111  PRO n 
3 112  SER n 
3 113  ARG n 
3 114  LEU n 
3 115  GLY n 
3 116  TYR n 
3 117  LEU n 
3 118  LEU n 
3 119  ASP n 
3 120  LEU n 
3 121  ALA n 
3 122  PRO n 
3 123  LYS n 
3 124  ASP n 
3 125  LEU n 
3 126  GLU n 
3 127  LYS n 
3 128  ILE n 
3 129  ILE n 
3 130  TYR n 
3 131  PHE n 
3 132  ALA n 
3 133  ALA n 
3 134  TYR n 
3 135  VAL n 
3 136  ILE n 
3 137  THR n 
3 138  SER n 
3 139  VAL n 
3 140  ASP n 
3 141  GLU n 
3 142  GLU n 
3 143  MET n 
3 144  ARG n 
3 145  HIS n 
3 146  ASN n 
3 147  GLU n 
3 148  LEU n 
3 149  SER n 
3 150  THR n 
3 151  LEU n 
3 152  GLU n 
3 153  ALA n 
3 154  GLU n 
3 155  MET n 
3 156  ALA n 
3 157  VAL n 
3 158  GLU n 
3 159  ARG n 
3 160  LYS n 
3 161  ALA n 
3 162  VAL n 
3 163  GLU n 
3 164  ASP n 
3 165  GLN n 
3 166  ARG n 
3 167  ASP n 
3 168  GLY n 
3 169  GLU n 
3 170  LEU n 
3 171  GLU n 
3 172  ALA n 
3 173  ARG n 
3 174  ALA n 
3 175  GLN n 
3 176  LYS n 
3 177  LEU n 
3 178  GLU n 
3 179  ALA n 
3 180  ASP n 
3 181  LEU n 
3 182  ALA n 
3 183  GLU n 
3 184  LEU n 
3 185  GLU n 
3 186  ALA n 
3 187  GLU n 
3 188  GLY n 
3 189  ALA n 
3 190  LYS n 
3 191  ALA n 
3 192  ASP n 
3 193  ALA n 
3 194  ARG n 
3 195  ARG n 
3 196  LYS n 
3 197  VAL n 
3 198  ARG n 
3 199  ASP n 
3 200  GLY n 
3 201  GLY n 
3 202  GLU n 
3 203  ARG n 
3 204  GLU n 
3 205  MET n 
3 206  ARG n 
3 207  GLN n 
3 208  ILE n 
3 209  ARG n 
3 210  ASP n 
3 211  ARG n 
3 212  ALA n 
3 213  GLN n 
3 214  ARG n 
3 215  GLU n 
3 216  LEU n 
3 217  ASP n 
3 218  ARG n 
3 219  LEU n 
3 220  GLU n 
3 221  ASP n 
3 222  ILE n 
3 223  TRP n 
3 224  SER n 
3 225  THR n 
3 226  PHE n 
3 227  THR n 
3 228  LYS n 
3 229  LEU n 
3 230  ALA n 
3 231  PRO n 
3 232  LYS n 
3 233  GLN n 
3 234  LEU n 
3 235  ILE n 
3 236  VAL n 
3 237  ASP n 
3 238  GLU n 
3 239  ASN n 
3 240  LEU n 
3 241  TYR n 
3 242  ARG n 
3 243  GLU n 
3 244  LEU n 
3 245  VAL n 
3 246  ASP n 
3 247  ARG n 
3 248  TYR n 
3 249  GLY n 
3 250  GLU n 
3 251  TYR n 
3 252  PHE n 
3 253  THR n 
3 254  GLY n 
3 255  ALA n 
3 256  MET n 
3 257  GLY n 
3 258  ALA n 
3 259  GLU n 
3 260  SER n 
3 261  ILE n 
3 262  GLN n 
3 263  LYS n 
3 264  LEU n 
3 265  ILE n 
3 266  GLU n 
3 267  ASN n 
3 268  PHE n 
3 269  ASP n 
3 270  ILE n 
3 271  ASP n 
3 272  ALA n 
3 273  GLU n 
3 274  ALA n 
3 275  GLU n 
3 276  SER n 
3 277  LEU n 
3 278  ARG n 
3 279  ASP n 
3 280  VAL n 
3 281  ILE n 
3 282  ARG n 
3 283  ASN n 
3 284  GLY n 
3 285  LYS n 
3 286  GLY n 
3 287  GLN n 
3 288  LYS n 
3 289  LYS n 
3 290  LEU n 
3 291  ARG n 
3 292  ALA n 
3 293  LEU n 
3 294  LYS n 
3 295  ARG n 
3 296  LEU n 
3 297  LYS n 
3 298  VAL n 
3 299  VAL n 
3 300  ALA n 
3 301  ALA n 
3 302  PHE n 
3 303  GLN n 
3 304  GLN n 
3 305  SER n 
3 306  GLY n 
3 307  ASN n 
3 308  SER n 
3 309  PRO n 
3 310  MET n 
3 311  GLY n 
3 312  MET n 
3 313  VAL n 
3 314  LEU n 
3 315  ASP n 
3 316  ALA n 
3 317  VAL n 
3 318  PRO n 
3 319  VAL n 
3 320  ILE n 
3 321  PRO n 
3 322  PRO n 
3 323  GLU n 
3 324  LEU n 
3 325  ARG n 
3 326  PRO n 
3 327  MET n 
3 328  VAL n 
3 329  GLN n 
3 330  LEU n 
3 331  ASP n 
3 332  GLY n 
3 333  GLY n 
3 334  ARG n 
3 335  PHE n 
3 336  ALA n 
3 337  THR n 
3 338  SER n 
3 339  ASP n 
3 340  LEU n 
3 341  ASN n 
3 342  ASP n 
3 343  LEU n 
3 344  TYR n 
3 345  ARG n 
3 346  ARG n 
3 347  VAL n 
3 348  ILE n 
3 349  ASN n 
3 350  ARG n 
3 351  ASN n 
3 352  ASN n 
3 353  ARG n 
3 354  LEU n 
3 355  LYS n 
3 356  ARG n 
3 357  LEU n 
3 358  ILE n 
3 359  ASP n 
3 360  LEU n 
3 361  GLY n 
3 362  ALA n 
3 363  PRO n 
3 364  GLU n 
3 365  ILE n 
3 366  ILE n 
3 367  VAL n 
3 368  ASN n 
3 369  ASN n 
3 370  GLU n 
3 371  LYS n 
3 372  ARG n 
3 373  MET n 
3 374  LEU n 
3 375  GLN n 
3 376  GLU n 
3 377  SER n 
3 378  VAL n 
3 379  ASP n 
3 380  ALA n 
3 381  LEU n 
3 382  PHE n 
3 383  ASP n 
3 384  ASN n 
3 385  GLY n 
3 386  ARG n 
3 387  ARG n 
3 388  GLY n 
3 389  ARG n 
3 390  PRO n 
3 391  VAL n 
3 392  THR n 
3 393  GLY n 
3 394  PRO n 
3 395  GLY n 
3 396  ASN n 
3 397  ARG n 
3 398  PRO n 
3 399  LEU n 
3 400  LYS n 
3 401  SER n 
3 402  LEU n 
3 403  SER n 
3 404  ASP n 
3 405  LEU n 
3 406  LEU n 
3 407  LYS n 
3 408  GLY n 
3 409  LYS n 
3 410  GLN n 
3 411  GLY n 
3 412  ARG n 
3 413  PHE n 
3 414  ARG n 
3 415  GLN n 
3 416  ASN n 
3 417  LEU n 
3 418  LEU n 
3 419  GLY n 
3 420  LYS n 
3 421  ARG n 
3 422  VAL n 
3 423  ASP n 
3 424  TYR n 
3 425  SER n 
3 426  GLY n 
3 427  ARG n 
3 428  SER n 
3 429  VAL n 
3 430  ILE n 
3 431  VAL n 
3 432  VAL n 
3 433  GLY n 
3 434  PRO n 
3 435  GLN n 
3 436  LEU n 
3 437  LYS n 
3 438  LEU n 
3 439  HIS n 
3 440  GLN n 
3 441  CYS n 
3 442  GLY n 
3 443  LEU n 
3 444  PRO n 
3 445  LYS n 
3 446  LEU n 
3 447  MET n 
3 448  ALA n 
3 449  LEU n 
3 450  GLU n 
3 451  LEU n 
3 452  PHE n 
3 453  LYS n 
3 454  PRO n 
3 455  PHE n 
3 456  VAL n 
3 457  MET n 
3 458  LYS n 
3 459  ARG n 
3 460  LEU n 
3 461  VAL n 
3 462  ASP n 
3 463  LEU n 
3 464  ASN n 
3 465  HIS n 
3 466  ALA n 
3 467  GLN n 
3 468  ASN n 
3 469  ILE n 
3 470  LYS n 
3 471  SER n 
3 472  ALA n 
3 473  LYS n 
3 474  ARG n 
3 475  MET n 
3 476  VAL n 
3 477  GLU n 
3 478  ARG n 
3 479  GLN n 
3 480  ARG n 
3 481  PRO n 
3 482  GLN n 
3 483  VAL n 
3 484  TRP n 
3 485  ASP n 
3 486  VAL n 
3 487  LEU n 
3 488  GLU n 
3 489  GLU n 
3 490  VAL n 
3 491  ILE n 
3 492  ALA n 
3 493  GLU n 
3 494  HIS n 
3 495  PRO n 
3 496  VAL n 
3 497  LEU n 
3 498  LEU n 
3 499  ASN n 
3 500  ARG n 
3 501  ALA n 
3 502  PRO n 
3 503  THR n 
3 504  LEU n 
3 505  HIS n 
3 506  ARG n 
3 507  LEU n 
3 508  GLY n 
3 509  ILE n 
3 510  GLN n 
3 511  ALA n 
3 512  PHE n 
3 513  GLU n 
3 514  PRO n 
3 515  MET n 
3 516  LEU n 
3 517  VAL n 
3 518  GLU n 
3 519  GLY n 
3 520  LYS n 
3 521  ALA n 
3 522  ILE n 
3 523  GLN n 
3 524  LEU n 
3 525  HIS n 
3 526  PRO n 
3 527  LEU n 
3 528  VAL n 
3 529  CYS n 
3 530  GLU n 
3 531  ALA n 
3 532  PHE n 
3 533  ASN n 
3 534  ALA n 
3 535  ASP n 
3 536  PHE n 
3 537  ASP n 
3 538  GLY n 
3 539  ASP n 
3 540  GLN n 
3 541  MET n 
3 542  ALA n 
3 543  VAL n 
3 544  HIS n 
3 545  LEU n 
3 546  PRO n 
3 547  LEU n 
3 548  SER n 
3 549  ALA n 
3 550  GLU n 
3 551  ALA n 
3 552  GLN n 
3 553  ALA n 
3 554  GLU n 
3 555  ALA n 
3 556  ARG n 
3 557  ILE n 
3 558  LEU n 
3 559  MET n 
3 560  LEU n 
3 561  SER n 
3 562  SER n 
3 563  ASN n 
3 564  ASN n 
3 565  ILE n 
3 566  LEU n 
3 567  SER n 
3 568  PRO n 
3 569  ALA n 
3 570  SER n 
3 571  GLY n 
3 572  ARG n 
3 573  PRO n 
3 574  LEU n 
3 575  ALA n 
3 576  MET n 
3 577  PRO n 
3 578  ARG n 
3 579  LEU n 
3 580  ASP n 
3 581  MET n 
3 582  VAL n 
3 583  THR n 
3 584  GLY n 
3 585  LEU n 
3 586  TYR n 
3 587  TYR n 
3 588  LEU n 
3 589  THR n 
3 590  THR n 
3 591  GLU n 
3 592  VAL n 
3 593  PRO n 
3 594  GLY n 
3 595  ASP n 
3 596  THR n 
3 597  GLY n 
3 598  GLU n 
3 599  TYR n 
3 600  GLN n 
3 601  PRO n 
3 602  ALA n 
3 603  SER n 
3 604  GLY n 
3 605  ASP n 
3 606  HIS n 
3 607  PRO n 
3 608  GLU n 
3 609  THR n 
3 610  GLY n 
3 611  VAL n 
3 612  TYR n 
3 613  SER n 
3 614  SER n 
3 615  PRO n 
3 616  ALA n 
3 617  GLU n 
3 618  ALA n 
3 619  ILE n 
3 620  MET n 
3 621  ALA n 
3 622  ALA n 
3 623  ASP n 
3 624  ARG n 
3 625  GLY n 
3 626  VAL n 
3 627  LEU n 
3 628  SER n 
3 629  VAL n 
3 630  ARG n 
3 631  ALA n 
3 632  LYS n 
3 633  ILE n 
3 634  LYS n 
3 635  VAL n 
3 636  ARG n 
3 637  LEU n 
3 638  THR n 
3 639  GLN n 
3 640  LEU n 
3 641  ARG n 
3 642  PRO n 
3 643  PRO n 
3 644  VAL n 
3 645  GLU n 
3 646  ILE n 
3 647  GLU n 
3 648  ALA n 
3 649  GLU n 
3 650  LEU n 
3 651  PHE n 
3 652  GLY n 
3 653  HIS n 
3 654  SER n 
3 655  GLY n 
3 656  TRP n 
3 657  GLN n 
3 658  PRO n 
3 659  GLY n 
3 660  ASP n 
3 661  ALA n 
3 662  TRP n 
3 663  MET n 
3 664  ALA n 
3 665  GLU n 
3 666  THR n 
3 667  THR n 
3 668  LEU n 
3 669  GLY n 
3 670  ARG n 
3 671  VAL n 
3 672  MET n 
3 673  PHE n 
3 674  ASN n 
3 675  GLU n 
3 676  LEU n 
3 677  LEU n 
3 678  PRO n 
3 679  LEU n 
3 680  GLY n 
3 681  TYR n 
3 682  PRO n 
3 683  PHE n 
3 684  VAL n 
3 685  ASN n 
3 686  LYS n 
3 687  GLN n 
3 688  MET n 
3 689  HIS n 
3 690  LYS n 
3 691  LYS n 
3 692  VAL n 
3 693  GLN n 
3 694  ALA n 
3 695  ALA n 
3 696  ILE n 
3 697  ILE n 
3 698  ASN n 
3 699  ASP n 
3 700  LEU n 
3 701  ALA n 
3 702  GLU n 
3 703  ARG n 
3 704  TYR n 
3 705  PRO n 
3 706  MET n 
3 707  ILE n 
3 708  VAL n 
3 709  VAL n 
3 710  ALA n 
3 711  GLN n 
3 712  THR n 
3 713  VAL n 
3 714  ASP n 
3 715  LYS n 
3 716  LEU n 
3 717  LYS n 
3 718  ASP n 
3 719  ALA n 
3 720  GLY n 
3 721  PHE n 
3 722  TYR n 
3 723  TRP n 
3 724  ALA n 
3 725  THR n 
3 726  ARG n 
3 727  SER n 
3 728  GLY n 
3 729  VAL n 
3 730  THR n 
3 731  VAL n 
3 732  SER n 
3 733  MET n 
3 734  ALA n 
3 735  ASP n 
3 736  VAL n 
3 737  LEU n 
3 738  VAL n 
3 739  PRO n 
3 740  PRO n 
3 741  ARG n 
3 742  LYS n 
3 743  LYS n 
3 744  GLU n 
3 745  ILE n 
3 746  LEU n 
3 747  ASP n 
3 748  HIS n 
3 749  TYR n 
3 750  GLU n 
3 751  GLU n 
3 752  ARG n 
3 753  ALA n 
3 754  ASP n 
3 755  LYS n 
3 756  VAL n 
3 757  GLU n 
3 758  LYS n 
3 759  GLN n 
3 760  PHE n 
3 761  GLN n 
3 762  ARG n 
3 763  GLY n 
3 764  ALA n 
3 765  LEU n 
3 766  ASN n 
3 767  HIS n 
3 768  ASP n 
3 769  GLU n 
3 770  ARG n 
3 771  ASN n 
3 772  GLU n 
3 773  ALA n 
3 774  LEU n 
3 775  VAL n 
3 776  GLU n 
3 777  ILE n 
3 778  TRP n 
3 779  LYS n 
3 780  GLU n 
3 781  ALA n 
3 782  THR n 
3 783  ASP n 
3 784  GLU n 
3 785  VAL n 
3 786  GLY n 
3 787  GLN n 
3 788  ALA n 
3 789  LEU n 
3 790  ARG n 
3 791  GLU n 
3 792  HIS n 
3 793  TYR n 
3 794  PRO n 
3 795  ASP n 
3 796  ASP n 
3 797  ASN n 
3 798  PRO n 
3 799  ILE n 
3 800  ILE n 
3 801  THR n 
3 802  ILE n 
3 803  VAL n 
3 804  ASP n 
3 805  SER n 
3 806  GLY n 
3 807  ALA n 
3 808  THR n 
3 809  GLY n 
3 810  ASN n 
3 811  PHE n 
3 812  THR n 
3 813  GLN n 
3 814  THR n 
3 815  ARG n 
3 816  THR n 
3 817  LEU n 
3 818  ALA n 
3 819  GLY n 
3 820  MET n 
3 821  LYS n 
3 822  GLY n 
3 823  LEU n 
3 824  VAL n 
3 825  THR n 
3 826  ASN n 
3 827  PRO n 
3 828  LYS n 
3 829  GLY n 
3 830  GLU n 
3 831  PHE n 
3 832  ILE n 
3 833  PRO n 
3 834  ARG n 
3 835  PRO n 
3 836  VAL n 
3 837  LYS n 
3 838  SER n 
3 839  SER n 
3 840  PHE n 
3 841  ARG n 
3 842  GLU n 
3 843  GLY n 
3 844  LEU n 
3 845  THR n 
3 846  VAL n 
3 847  LEU n 
3 848  GLU n 
3 849  TYR n 
3 850  PHE n 
3 851  ILE n 
3 852  ASN n 
3 853  THR n 
3 854  HIS n 
3 855  GLY n 
3 856  ALA n 
3 857  ARG n 
3 858  LYS n 
3 859  GLY n 
3 860  LEU n 
3 861  ALA n 
3 862  ASP n 
3 863  THR n 
3 864  ALA n 
3 865  LEU n 
3 866  ARG n 
3 867  THR n 
3 868  ALA n 
3 869  ASP n 
3 870  SER n 
3 871  GLY n 
3 872  TYR n 
3 873  LEU n 
3 874  THR n 
3 875  ARG n 
3 876  ARG n 
3 877  LEU n 
3 878  VAL n 
3 879  ASP n 
3 880  VAL n 
3 881  SER n 
3 882  GLN n 
3 883  ASP n 
3 884  VAL n 
3 885  ILE n 
3 886  VAL n 
3 887  ARG n 
3 888  GLU n 
3 889  HIS n 
3 890  ASP n 
3 891  CYS n 
3 892  GLN n 
3 893  THR n 
3 894  GLU n 
3 895  ARG n 
3 896  GLY n 
3 897  ILE n 
3 898  VAL n 
3 899  VAL n 
3 900  GLU n 
3 901  LEU n 
3 902  ALA n 
3 903  GLU n 
3 904  ARG n 
3 905  ALA n 
3 906  PRO n 
3 907  ASP n 
3 908  GLY n 
3 909  THR n 
3 910  LEU n 
3 911  ILE n 
3 912  ARG n 
3 913  ASP n 
3 914  PRO n 
3 915  TYR n 
3 916  ILE n 
3 917  GLU n 
3 918  THR n 
3 919  SER n 
3 920  ALA n 
3 921  TYR n 
3 922  ALA n 
3 923  ARG n 
3 924  THR n 
3 925  LEU n 
3 926  GLY n 
3 927  THR n 
3 928  ASP n 
3 929  ALA n 
3 930  VAL n 
3 931  ASP n 
3 932  GLU n 
3 933  ALA n 
3 934  GLY n 
3 935  ASN n 
3 936  VAL n 
3 937  ILE n 
3 938  VAL n 
3 939  GLU n 
3 940  ARG n 
3 941  GLY n 
3 942  GLN n 
3 943  ASP n 
3 944  LEU n 
3 945  GLY n 
3 946  ASP n 
3 947  PRO n 
3 948  GLU n 
3 949  ILE n 
3 950  ASP n 
3 951  ALA n 
3 952  LEU n 
3 953  LEU n 
3 954  ALA n 
3 955  ALA n 
3 956  GLY n 
3 957  ILE n 
3 958  THR n 
3 959  GLN n 
3 960  VAL n 
3 961  LYS n 
3 962  VAL n 
3 963  ARG n 
3 964  SER n 
3 965  VAL n 
3 966  LEU n 
3 967  THR n 
3 968  CYS n 
3 969  ALA n 
3 970  THR n 
3 971  SER n 
3 972  THR n 
3 973  GLY n 
3 974  VAL n 
3 975  CYS n 
3 976  ALA n 
3 977  THR n 
3 978  CYS n 
3 979  TYR n 
3 980  GLY n 
3 981  ARG n 
3 982  SER n 
3 983  MET n 
3 984  ALA n 
3 985  THR n 
3 986  GLY n 
3 987  LYS n 
3 988  LEU n 
3 989  VAL n 
3 990  ASP n 
3 991  ILE n 
3 992  GLY n 
3 993  GLU n 
3 994  ALA n 
3 995  VAL n 
3 996  GLY n 
3 997  ILE n 
3 998  VAL n 
3 999  ALA n 
3 1000 ALA n 
3 1001 GLN n 
3 1002 SER n 
3 1003 ILE n 
3 1004 GLY n 
3 1005 GLU n 
3 1006 PRO n 
3 1007 GLY n 
3 1008 THR n 
3 1009 GLN n 
3 1010 LEU n 
3 1011 THR n 
3 1012 MET n 
3 1013 ARG n 
3 1014 THR n 
3 1015 PHE n 
3 1016 HIS n 
3 1017 GLN n 
3 1018 GLY n 
3 1019 GLY n 
3 1020 VAL n 
3 1021 GLY n 
3 1022 GLU n 
3 1023 ASP n 
3 1024 ILE n 
3 1025 THR n 
3 1026 GLY n 
3 1027 GLY n 
3 1028 LEU n 
3 1029 PRO n 
3 1030 ARG n 
3 1031 VAL n 
3 1032 GLN n 
3 1033 GLU n 
3 1034 LEU n 
3 1035 PHE n 
3 1036 GLU n 
3 1037 ALA n 
3 1038 ARG n 
3 1039 VAL n 
3 1040 PRO n 
3 1041 ARG n 
3 1042 GLY n 
3 1043 LYS n 
3 1044 ALA n 
3 1045 PRO n 
3 1046 ILE n 
3 1047 ALA n 
3 1048 ASP n 
3 1049 VAL n 
3 1050 THR n 
3 1051 GLY n 
3 1052 ARG n 
3 1053 VAL n 
3 1054 ARG n 
3 1055 LEU n 
3 1056 GLU n 
3 1057 ASP n 
3 1058 GLY n 
3 1059 GLU n 
3 1060 ARG n 
3 1061 PHE n 
3 1062 TYR n 
3 1063 LYS n 
3 1064 ILE n 
3 1065 THR n 
3 1066 ILE n 
3 1067 VAL n 
3 1068 PRO n 
3 1069 ASP n 
3 1070 ASP n 
3 1071 GLY n 
3 1072 GLY n 
3 1073 GLU n 
3 1074 GLU n 
3 1075 VAL n 
3 1076 VAL n 
3 1077 TYR n 
3 1078 ASP n 
3 1079 LYS n 
3 1080 ILE n 
3 1081 SER n 
3 1082 LYS n 
3 1083 ARG n 
3 1084 GLN n 
3 1085 ARG n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 VAL n 
3 1089 PHE n 
3 1090 LYS n 
3 1091 HIS n 
3 1092 GLU n 
3 1093 ASP n 
3 1094 GLY n 
3 1095 SER n 
3 1096 GLU n 
3 1097 ARG n 
3 1098 VAL n 
3 1099 LEU n 
3 1100 SER n 
3 1101 ASP n 
3 1102 GLY n 
3 1103 ASP n 
3 1104 HIS n 
3 1105 VAL n 
3 1106 GLU n 
3 1107 VAL n 
3 1108 GLY n 
3 1109 GLN n 
3 1110 GLN n 
3 1111 LEU n 
3 1112 MET n 
3 1113 GLU n 
3 1114 GLY n 
3 1115 SER n 
3 1116 ALA n 
3 1117 ASP n 
3 1118 PRO n 
3 1119 HIS n 
3 1120 GLU n 
3 1121 VAL n 
3 1122 LEU n 
3 1123 ARG n 
3 1124 VAL n 
3 1125 GLN n 
3 1126 GLY n 
3 1127 PRO n 
3 1128 ARG n 
3 1129 GLU n 
3 1130 VAL n 
3 1131 GLN n 
3 1132 ILE n 
3 1133 HIS n 
3 1134 LEU n 
3 1135 VAL n 
3 1136 ARG n 
3 1137 GLU n 
3 1138 VAL n 
3 1139 GLN n 
3 1140 GLU n 
3 1141 VAL n 
3 1142 TYR n 
3 1143 ARG n 
3 1144 ALA n 
3 1145 GLN n 
3 1146 GLY n 
3 1147 VAL n 
3 1148 SER n 
3 1149 ILE n 
3 1150 HIS n 
3 1151 ASP n 
3 1152 LYS n 
3 1153 HIS n 
3 1154 ILE n 
3 1155 GLU n 
3 1156 VAL n 
3 1157 ILE n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 GLN n 
3 1161 MET n 
3 1162 LEU n 
3 1163 ARG n 
3 1164 ARG n 
3 1165 VAL n 
3 1166 THR n 
3 1167 ILE n 
3 1168 ILE n 
3 1169 ASP n 
3 1170 SER n 
3 1171 GLY n 
3 1172 SER n 
3 1173 THR n 
3 1174 GLU n 
3 1175 PHE n 
3 1176 LEU n 
3 1177 PRO n 
3 1178 GLY n 
3 1179 SER n 
3 1180 LEU n 
3 1181 ILE n 
3 1182 ASP n 
3 1183 ARG n 
3 1184 ALA n 
3 1185 GLU n 
3 1186 PHE n 
3 1187 GLU n 
3 1188 ALA n 
3 1189 GLU n 
3 1190 ASN n 
3 1191 ARG n 
3 1192 ARG n 
3 1193 VAL n 
3 1194 VAL n 
3 1195 ALA n 
3 1196 GLU n 
3 1197 GLY n 
3 1198 GLY n 
3 1199 GLU n 
3 1200 PRO n 
3 1201 ALA n 
3 1202 ALA n 
3 1203 GLY n 
3 1204 ARG n 
3 1205 PRO n 
3 1206 VAL n 
3 1207 LEU n 
3 1208 MET n 
3 1209 GLY n 
3 1210 ILE n 
3 1211 THR n 
3 1212 LYS n 
3 1213 ALA n 
3 1214 SER n 
3 1215 LEU n 
3 1216 ALA n 
3 1217 THR n 
3 1218 ASP n 
3 1219 SER n 
3 1220 TRP n 
3 1221 LEU n 
3 1222 SER n 
3 1223 ALA n 
3 1224 ALA n 
3 1225 SER n 
3 1226 PHE n 
3 1227 GLN n 
3 1228 GLU n 
3 1229 THR n 
3 1230 THR n 
3 1231 ARG n 
3 1232 VAL n 
3 1233 LEU n 
3 1234 THR n 
3 1235 ASP n 
3 1236 ALA n 
3 1237 ALA n 
3 1238 ILE n 
3 1239 ASN n 
3 1240 CYS n 
3 1241 ARG n 
3 1242 SER n 
3 1243 ASP n 
3 1244 LYS n 
3 1245 LEU n 
3 1246 ASN n 
3 1247 GLY n 
3 1248 LEU n 
3 1249 LYS n 
3 1250 GLU n 
3 1251 ASN n 
3 1252 VAL n 
3 1253 ILE n 
3 1254 ILE n 
3 1255 GLY n 
3 1256 LYS n 
3 1257 LEU n 
3 1258 ILE n 
3 1259 PRO n 
3 1260 ALA n 
3 1261 GLY n 
3 1262 THR n 
3 1263 GLY n 
3 1264 ILE n 
3 1265 ASN n 
3 1266 ARG n 
3 1267 TYR n 
3 1268 ARG n 
3 1269 ASN n 
3 1270 ILE n 
3 1271 ALA n 
3 1272 VAL n 
3 1273 GLN n 
3 1274 PRO n 
3 1275 THR n 
3 1276 GLU n 
3 1277 GLU n 
3 1278 ALA n 
3 1279 ARG n 
3 1280 ALA n 
3 1281 ALA n 
3 1282 ALA n 
3 1283 TYR n 
3 1284 THR n 
3 1285 ILE n 
3 1286 PRO n 
3 1287 SER n 
3 1288 TYR n 
3 1289 GLU n 
3 1290 ASP n 
3 1291 GLN n 
3 1292 TYR n 
3 1293 TYR n 
3 1294 SER n 
3 1295 PRO n 
3 1296 ASP n 
3 1297 PHE n 
3 1298 GLY n 
3 1299 ALA n 
3 1300 ALA n 
3 1301 THR n 
3 1302 GLY n 
3 1303 ALA n 
3 1304 ALA n 
3 1305 VAL n 
3 1306 PRO n 
3 1307 LEU n 
3 1308 ASP n 
3 1309 ASP n 
3 1310 TYR n 
3 1311 GLY n 
3 1312 TYR n 
3 1313 SER n 
3 1314 ASP n 
3 1315 TYR n 
3 1316 ARG n 
4 1    MET n 
4 2    SER n 
4 3    ILE n 
4 4    SER n 
4 5    GLN n 
4 6    SER n 
4 7    ASP n 
4 8    ALA n 
4 9    SER n 
4 10   LEU n 
4 11   ALA n 
4 12   ALA n 
4 13   VAL n 
4 14   PRO n 
4 15   ALA n 
4 16   VAL n 
4 17   ASP n 
4 18   GLN n 
4 19   PHE n 
4 20   ASP n 
4 21   PRO n 
4 22   SER n 
4 23   SER n 
4 24   GLY n 
4 25   ALA n 
4 26   SER n 
4 27   GLY n 
4 28   GLY n 
4 29   TYR n 
4 30   ASP n 
4 31   THR n 
4 32   PRO n 
4 33   LEU n 
4 34   GLY n 
4 35   ILE n 
4 36   THR n 
4 37   ASN n 
4 38   PRO n 
4 39   PRO n 
4 40   ILE n 
4 41   ASP n 
4 42   GLU n 
4 43   LEU n 
4 44   LEU n 
4 45   ASP n 
4 46   ARG n 
4 47   VAL n 
4 48   SER n 
4 49   SER n 
4 50   LYS n 
4 51   TYR n 
4 52   ALA n 
4 53   LEU n 
4 54   VAL n 
4 55   ILE n 
4 56   TYR n 
4 57   ALA n 
4 58   ALA n 
4 59   LYS n 
4 60   ARG n 
4 61   ALA n 
4 62   ARG n 
4 63   GLN n 
4 64   ILE n 
4 65   ASN n 
4 66   ASP n 
4 67   TYR n 
4 68   TYR n 
4 69   ASN n 
4 70   GLN n 
4 71   LEU n 
4 72   GLY n 
4 73   GLU n 
4 74   GLY n 
4 75   ILE n 
4 76   LEU n 
4 77   GLU n 
4 78   TYR n 
4 79   VAL n 
4 80   GLY n 
4 81   PRO n 
4 82   LEU n 
4 83   VAL n 
4 84   GLU n 
4 85   PRO n 
4 86   GLY n 
4 87   LEU n 
4 88   GLN n 
4 89   GLU n 
4 90   LYS n 
4 91   PRO n 
4 92   LEU n 
4 93   SER n 
4 94   ILE n 
4 95   ALA n 
4 96   LEU n 
4 97   ARG n 
4 98   GLU n 
4 99   ILE n 
4 100  HIS n 
4 101  ALA n 
4 102  ASP n 
4 103  LEU n 
4 104  LEU n 
4 105  GLU n 
4 106  HIS n 
4 107  THR n 
4 108  GLU n 
4 109  GLY n 
4 110  GLU n 
5 1    MET n 
5 2    ALA n 
5 3    ALA n 
5 4    THR n 
5 5    LYS n 
5 6    ALA n 
5 7    SER n 
5 8    THR n 
5 9    ALA n 
5 10   THR n 
5 11   ASP n 
5 12   GLU n 
5 13   PRO n 
5 14   VAL n 
5 15   LYS n 
5 16   ARG n 
5 17   THR n 
5 18   ALA n 
5 19   THR n 
5 20   LYS n 
5 21   SER n 
5 22   PRO n 
5 23   ALA n 
5 24   ALA n 
5 25   SER n 
5 26   ALA n 
5 27   SER n 
5 28   GLY n 
5 29   ALA n 
5 30   LYS n 
5 31   THR n 
5 32   GLY n 
5 33   ALA n 
5 34   LYS n 
5 35   ARG n 
5 36   THR n 
5 37   ALA n 
5 38   ALA n 
5 39   LYS n 
5 40   SER n 
5 41   ALA n 
5 42   SER n 
5 43   GLY n 
5 44   SER n 
5 45   PRO n 
5 46   PRO n 
5 47   ALA n 
5 48   LYS n 
5 49   ARG n 
5 50   ALA n 
5 51   THR n 
5 52   LYS n 
5 53   PRO n 
5 54   ALA n 
5 55   ALA n 
5 56   ARG n 
5 57   SER n 
5 58   VAL n 
5 59   LYS n 
5 60   PRO n 
5 61   ALA n 
5 62   SER n 
5 63   ALA n 
5 64   PRO n 
5 65   GLN n 
5 66   ASP n 
5 67   THR n 
5 68   THR n 
5 69   THR n 
5 70   SER n 
5 71   THR n 
5 72   ILE n 
5 73   PRO n 
5 74   LYS n 
5 75   ARG n 
5 76   LYS n 
5 77   THR n 
5 78   ARG n 
5 79   ALA n 
5 80   ALA n 
5 81   ALA n 
5 82   LYS n 
5 83   SER n 
5 84   ALA n 
5 85   ALA n 
5 86   ALA n 
5 87   LYS n 
5 88   ALA n 
5 89   PRO n 
5 90   SER n 
5 91   ALA n 
5 92   ARG n 
5 93   GLY n 
5 94   HIS n 
5 95   ALA n 
5 96   THR n 
5 97   LYS n 
5 98   PRO n 
5 99   ARG n 
5 100  ALA n 
5 101  PRO n 
5 102  LYS n 
5 103  ASP n 
5 104  ALA n 
5 105  GLN n 
5 106  HIS n 
5 107  GLU n 
5 108  ALA n 
5 109  ALA n 
5 110  THR n 
5 111  ASP n 
5 112  PRO n 
5 113  GLU n 
5 114  ASP n 
5 115  ALA n 
5 116  LEU n 
5 117  ASP n 
5 118  SER n 
5 119  VAL n 
5 120  GLU n 
5 121  GLU n 
5 122  LEU n 
5 123  ASP n 
5 124  ALA n 
5 125  GLU n 
5 126  PRO n 
5 127  ASP n 
5 128  LEU n 
5 129  ASP n 
5 130  VAL n 
5 131  GLU n 
5 132  PRO n 
5 133  GLY n 
5 134  GLU n 
5 135  ASP n 
5 136  LEU n 
5 137  ASP n 
5 138  LEU n 
5 139  ASP n 
5 140  ALA n 
5 141  ALA n 
5 142  ASP n 
5 143  LEU n 
5 144  ASN n 
5 145  LEU n 
5 146  ASP n 
5 147  ASP n 
5 148  LEU n 
5 149  GLU n 
5 150  ASP n 
5 151  ASP n 
5 152  VAL n 
5 153  ALA n 
5 154  PRO n 
5 155  ASP n 
5 156  ALA n 
5 157  ASP n 
5 158  ASP n 
5 159  ASP n 
5 160  LEU n 
5 161  ASP n 
5 162  SER n 
5 163  GLY n 
5 164  ASP n 
5 165  ASP n 
5 166  GLU n 
5 167  ASP n 
5 168  HIS n 
5 169  GLU n 
5 170  ASP n 
5 171  LEU n 
5 172  GLU n 
5 173  ALA n 
5 174  GLU n 
5 175  ALA n 
5 176  ALA n 
5 177  VAL n 
5 178  ALA n 
5 179  PRO n 
5 180  GLY n 
5 181  GLN n 
5 182  THR n 
5 183  ALA n 
5 184  ASP n 
5 185  ASP n 
5 186  ASP n 
5 187  GLU n 
5 188  GLU n 
5 189  ILE n 
5 190  ALA n 
5 191  GLU n 
5 192  PRO n 
5 193  THR n 
5 194  GLU n 
5 195  LYS n 
5 196  ASP n 
5 197  LYS n 
5 198  ALA n 
5 199  SER n 
5 200  GLY n 
5 201  ASP n 
5 202  PHE n 
5 203  VAL n 
5 204  TRP n 
5 205  ASP n 
5 206  GLU n 
5 207  ASP n 
5 208  GLU n 
5 209  SER n 
5 210  GLU n 
5 211  ALA n 
5 212  LEU n 
5 213  ARG n 
5 214  GLN n 
5 215  ALA n 
5 216  ARG n 
5 217  LYS n 
5 218  ASP n 
5 219  ALA n 
5 220  GLU n 
5 221  LEU n 
5 222  THR n 
5 223  ALA n 
5 224  SER n 
5 225  ALA n 
5 226  ASP n 
5 227  SER n 
5 228  VAL n 
5 229  ARG n 
5 230  ALA n 
5 231  TYR n 
5 232  LEU n 
5 233  LYS n 
5 234  GLN n 
5 235  ILE n 
5 236  GLY n 
5 237  LYS n 
5 238  VAL n 
5 239  ALA n 
5 240  LEU n 
5 241  LEU n 
5 242  ASN n 
5 243  ALA n 
5 244  GLU n 
5 245  GLU n 
5 246  GLU n 
5 247  VAL n 
5 248  GLU n 
5 249  LEU n 
5 250  ALA n 
5 251  LYS n 
5 252  ARG n 
5 253  ILE n 
5 254  GLU n 
5 255  ALA n 
5 256  GLY n 
5 257  LEU n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  GLN n 
5 262  LEU n 
5 263  MET n 
5 264  THR n 
5 265  GLU n 
5 266  LEU n 
5 267  SER n 
5 268  GLU n 
5 269  ARG n 
5 270  GLY n 
5 271  GLU n 
5 272  LYS n 
5 273  LEU n 
5 274  PRO n 
5 275  ALA n 
5 276  ALA n 
5 277  GLN n 
5 278  ARG n 
5 279  ARG n 
5 280  ASP n 
5 281  MET n 
5 282  MET n 
5 283  TRP n 
5 284  ILE n 
5 285  CYS n 
5 286  ARG n 
5 287  ASP n 
5 288  GLY n 
5 289  ASP n 
5 290  ARG n 
5 291  ALA n 
5 292  LYS n 
5 293  ASN n 
5 294  HIS n 
5 295  LEU n 
5 296  LEU n 
5 297  GLU n 
5 298  ALA n 
5 299  ASN n 
5 300  LEU n 
5 301  ARG n 
5 302  LEU n 
5 303  VAL n 
5 304  VAL n 
5 305  SER n 
5 306  LEU n 
5 307  ALA n 
5 308  LYS n 
5 309  ARG n 
5 310  TYR n 
5 311  THR n 
5 312  GLY n 
5 313  ARG n 
5 314  GLY n 
5 315  MET n 
5 316  ALA n 
5 317  PHE n 
5 318  LEU n 
5 319  ASP n 
5 320  LEU n 
5 321  ILE n 
5 322  GLN n 
5 323  GLU n 
5 324  GLY n 
5 325  ASN n 
5 326  LEU n 
5 327  GLY n 
5 328  LEU n 
5 329  ILE n 
5 330  ARG n 
5 331  ALA n 
5 332  VAL n 
5 333  GLU n 
5 334  LYS n 
5 335  PHE n 
5 336  ASP n 
5 337  TYR n 
5 338  THR n 
5 339  LYS n 
5 340  GLY n 
5 341  TYR n 
5 342  LYS n 
5 343  PHE n 
5 344  SER n 
5 345  THR n 
5 346  TYR n 
5 347  ALA n 
5 348  THR n 
5 349  TRP n 
5 350  TRP n 
5 351  ILE n 
5 352  ARG n 
5 353  GLN n 
5 354  ALA n 
5 355  ILE n 
5 356  THR n 
5 357  ARG n 
5 358  ALA n 
5 359  MET n 
5 360  ALA n 
5 361  ASP n 
5 362  GLN n 
5 363  ALA n 
5 364  ARG n 
5 365  THR n 
5 366  ILE n 
5 367  ARG n 
5 368  ILE n 
5 369  PRO n 
5 370  VAL n 
5 371  HIS n 
5 372  MET n 
5 373  VAL n 
5 374  GLU n 
5 375  VAL n 
5 376  ILE n 
5 377  ASN n 
5 378  LYS n 
5 379  LEU n 
5 380  GLY n 
5 381  ARG n 
5 382  ILE n 
5 383  GLN n 
5 384  ARG n 
5 385  GLU n 
5 386  LEU n 
5 387  LEU n 
5 388  GLN n 
5 389  ASP n 
5 390  LEU n 
5 391  GLY n 
5 392  ARG n 
5 393  GLU n 
5 394  PRO n 
5 395  THR n 
5 396  PRO n 
5 397  GLU n 
5 398  GLU n 
5 399  LEU n 
5 400  ALA n 
5 401  LYS n 
5 402  GLU n 
5 403  MET n 
5 404  ASP n 
5 405  ILE n 
5 406  THR n 
5 407  PRO n 
5 408  GLU n 
5 409  LYS n 
5 410  VAL n 
5 411  LEU n 
5 412  GLU n 
5 413  ILE n 
5 414  GLN n 
5 415  GLN n 
5 416  TYR n 
5 417  ALA n 
5 418  ARG n 
5 419  GLU n 
5 420  PRO n 
5 421  ILE n 
5 422  SER n 
5 423  LEU n 
5 424  ASP n 
5 425  GLN n 
5 426  THR n 
5 427  ILE n 
5 428  GLY n 
5 429  ASP n 
5 430  GLU n 
5 431  GLY n 
5 432  ASP n 
5 433  SER n 
5 434  GLN n 
5 435  LEU n 
5 436  GLY n 
5 437  ASP n 
5 438  PHE n 
5 439  ILE n 
5 440  GLU n 
5 441  ASP n 
5 442  SER n 
5 443  GLU n 
5 444  ALA n 
5 445  VAL n 
5 446  VAL n 
5 447  ALA n 
5 448  VAL n 
5 449  ASP n 
5 450  ALA n 
5 451  VAL n 
5 452  SER n 
5 453  PHE n 
5 454  THR n 
5 455  LEU n 
5 456  LEU n 
5 457  GLN n 
5 458  ASP n 
5 459  GLN n 
5 460  LEU n 
5 461  GLN n 
5 462  SER n 
5 463  VAL n 
5 464  LEU n 
5 465  ASP n 
5 466  THR n 
5 467  LEU n 
5 468  SER n 
5 469  GLU n 
5 470  ARG n 
5 471  GLU n 
5 472  ALA n 
5 473  GLY n 
5 474  VAL n 
5 475  VAL n 
5 476  ARG n 
5 477  LEU n 
5 478  ARG n 
5 479  PHE n 
5 480  GLY n 
5 481  LEU n 
5 482  THR n 
5 483  ASP n 
5 484  GLY n 
5 485  GLN n 
5 486  PRO n 
5 487  ARG n 
5 488  THR n 
5 489  LEU n 
5 490  ASP n 
5 491  GLU n 
5 492  ILE n 
5 493  GLY n 
5 494  GLN n 
5 495  VAL n 
5 496  TYR n 
5 497  GLY n 
5 498  VAL n 
5 499  THR n 
5 500  ARG n 
5 501  GLU n 
5 502  ARG n 
5 503  ILE n 
5 504  ARG n 
5 505  GLN n 
5 506  ILE n 
5 507  GLU n 
5 508  SER n 
5 509  LYS n 
5 510  THR n 
5 511  MET n 
5 512  SER n 
5 513  LYS n 
5 514  LEU n 
5 515  ARG n 
5 516  HIS n 
5 517  PRO n 
5 518  SER n 
5 519  ARG n 
5 520  SER n 
5 521  GLN n 
5 522  VAL n 
5 523  LEU n 
5 524  ARG n 
5 525  ASP n 
5 526  TYR n 
5 527  LEU n 
5 528  ASP n 
6 1    DT  n 
6 2    DA  n 
6 3    DT  n 
6 4    DA  n 
6 5    DA  n 
6 6    DT  n 
6 7    DG  n 
6 8    DG  n 
6 9    DG  n 
6 10   DA  n 
6 11   DG  n 
6 12   DC  n 
6 13   DT  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DA  n 
6 18   DC  n 
6 19   DG  n 
6 20   DG  n 
6 21   DA  n 
6 22   DT  n 
6 23   DG  n 
7 1    DC  n 
7 2    DA  n 
7 3    DT  n 
7 4    DC  n 
7 5    DC  n 
7 6    DG  n 
7 7    DT  n 
7 8    DG  n 
7 9    DA  n 
7 10   DG  n 
7 11   DT  n 
7 12   DC  n 
7 13   DG  n 
7 14   DA  n 
7 15   DG  n 
7 16   DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 347  ? ? 'rpoA, Rv3457c, MTCY13E12.10c'                ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1178 ? ? 'rpoB, Rv0667, MTCI376.08c'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 1316 ? ? 'rpoC, Rv0668, MTCI376.07c'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 110  ? ? 'rpoZ, Rv1390, MTCY21B4.07'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 528  ? ? 'sigA, mysA, rpoD, rpoV, Rv2703, MTCY05A6.24' ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 23 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' ? 83332 ? 
7 1 sample 1 16 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' ? 83332 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_MYCTU P9WGZ1 ? 1 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
1 
2 UNP RPOB_MYCTU P9WGY9 ? 2 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
1 
3 UNP RPOC_MYCTU P9WGY7 ? 3 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
1 
4 UNP RPOZ_MYCTU P9WGY5 ? 4 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
1 
5 UNP SIGA_MYCTU P9WGI1 ? 5 
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
1 
6 PDB 5UHA       5UHA   ? 6 ? 1 
7 PDB 5UHA       5UHA   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5UHA A 1 ? 347  ? P9WGZ1 1 ? 347  ? 1 347  
2 1 5UHA B 1 ? 347  ? P9WGZ1 1 ? 347  ? 1 347  
3 2 5UHA C 1 ? 1178 ? P9WGY9 1 ? 1178 ? 1 1178 
4 3 5UHA D 1 ? 1316 ? P9WGY7 1 ? 1316 ? 1 1316 
5 4 5UHA E 1 ? 110  ? P9WGY5 1 ? 110  ? 1 110  
6 5 5UHA F 1 ? 528  ? P9WGI1 1 ? 528  ? 1 528  
7 6 5UHA H 1 ? 23   ? 5UHA   1 ? 23   ? 1 23   
8 7 5UHA G 1 ? 16   ? 5UHA   5 ? 20   ? 5 20   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5UHA 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.75 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.32 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM Tris-HCl, pH 8.2, 200 mM KCl, 50 mM MgCl2, and 10% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-04-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.925 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.925 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.entry_id                     5UHA 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.900 
_reflns.number_obs                   44080 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.200 
_reflns.pdbx_Rmerge_I_obs            0.219 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        3.600 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              15.000 
_reflns.pdbx_Rrim_I_all              0.226 
_reflns.pdbx_Rpim_I_all              0.057 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_netI_over_av_sigmaI     ? 
_reflns.pdbx_number_measured_all     659212 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_chi_squared             0.975 
_reflns.Rmerge_F_all                 ? 
_reflns.Rmerge_F_obs                 ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.observed_criterion_I_max     ? 
_reflns.observed_criterion_I_min     ? 
_reflns.pdbx_d_res_high_opt          ? 
_reflns.pdbx_d_res_low_opt           ? 
_reflns.details                      ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  3.900 4.040  ? ? ? ? ?     ? ? 0.826 8.200  ? ? ? 4351 ? ? ? ? 99.400  ?     0.387 0.144 
1 2  4.040 4.200  ? ? ? ? 0.928 ? ? 0.848 9.100  ? ? ? 4232 ? ? ? ? 97.300  0.985 0.316 0.183 
1 3  4.200 4.390  ? ? ? ? 0.837 ? ? 0.870 11.600 ? ? ? 4388 ? ? ? ? 99.900  0.877 0.253 0.422 
1 4  4.390 4.620  ? ? ? ? 0.720 ? ? 0.936 13.900 ? ? ? 4393 ? ? ? ? 99.900  0.748 0.198 0.689 
1 5  4.620 4.910  ? ? ? ? 0.638 ? ? 0.944 16.000 ? ? ? 4377 ? ? ? ? 99.800  0.658 0.161 0.820 
1 6  4.910 5.290  ? ? ? ? 0.577 ? ? 0.942 16.800 ? ? ? 4433 ? ? ? ? 100.000 0.595 0.143 0.861 
1 7  5.290 5.820  ? ? ? ? 0.498 ? ? 0.959 16.600 ? ? ? 4354 ? ? ? ? 98.400  0.514 0.123 0.876 
1 8  5.820 6.660  ? ? ? ? 0.384 ? ? 0.988 18.600 ? ? ? 4448 ? ? ? ? 99.900  0.395 0.090 0.955 
1 9  6.660 8.390  ? ? ? ? 0.202 ? ? 1.089 18.100 ? ? ? 4444 ? ? ? ? 98.700  0.208 0.048 0.984 
1 10 8.390 50.000 ? ? ? ? 0.110 ? ? 1.106 20.000 ? ? ? 4660 ? ? ? ? 99.000  0.113 0.025 0.994 
# 
_refine.entry_id                                 5UHA 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            3.9060 
_refine.ls_d_res_low                             48.9130 
_refine.pdbx_ls_sigma_F                          1.500 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    77.9100 
_refine.ls_number_reflns_obs                     34564 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2149 
_refine.ls_R_factor_R_work                       0.2111 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2791 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.7500 
_refine.ls_number_reflns_R_free                  1988 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               38.2255 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.4600 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                179.920 
_refine.B_iso_min                                0.010 
_refine.pdbx_overall_phase_error                 21.2800 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.9060 
_refine_hist.d_res_low                        48.9130 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               25998 
_refine_hist.pdbx_number_residues_total       3283 
_refine_hist.pdbx_B_iso_mean_ligand           27.65 
_refine_hist.pdbx_number_atoms_protein        25213 
_refine_hist.pdbx_number_atoms_nucleic_acid   782 
# 
_struct.entry_id                     5UHA 
_struct.title                        'Crystal structure of Mycobacterium tuberculosis transcription initiation complex' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5UHA 
_struct_keywords.text            'RNA polymerase complex, transcription, DNA, RNA, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
K N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? ILE A 46   ? GLY A 31   ILE A 46   1 ? 16 
HELX_P HELX_P2   AA2 ASP A 72   ? LYS A 81   ? ASP A 72   LYS A 81   1 ? 10 
HELX_P HELX_P3   AA3 PRO A 148  ? ASN A 152  ? PRO A 148  ASN A 152  5 ? 5  
HELX_P HELX_P4   AA4 SER A 203  ? GLY A 220  ? SER A 203  GLY A 220  1 ? 18 
HELX_P HELX_P5   AA5 LEU A 221  ? ARG A 223  ? LEU A 221  ARG A 223  5 ? 3  
HELX_P HELX_P6   AA6 PHE B 30   ? LEU B 43   ? PHE B 30   LEU B 43   1 ? 14 
HELX_P HELX_P7   AA7 ASP B 72   ? SER B 82   ? ASP B 72   SER B 82   1 ? 11 
HELX_P HELX_P8   AA8 ALA B 149  ? ARG B 153  ? ALA B 149  ARG B 153  5 ? 5  
HELX_P HELX_P9   AA9 SER B 203  ? GLU B 224  ? SER B 203  GLU B 224  1 ? 22 
HELX_P HELX_P10  AB1 LEU C 54   ? GLY C 66   ? LEU C 54   GLY C 66   1 ? 13 
HELX_P HELX_P11  AB2 SER C 67   ? ARG C 77   ? SER C 67   ARG C 77   1 ? 11 
HELX_P HELX_P12  AB3 GLY C 84   ? SER C 94   ? GLY C 84   SER C 94   1 ? 11 
HELX_P HELX_P13  AB4 PRO C 118  ? ASP C 126  ? PRO C 118  ASP C 126  1 ? 9  
HELX_P HELX_P14  AB5 VAL C 234  ? GLY C 242  ? VAL C 234  GLY C 242  1 ? 9  
HELX_P HELX_P15  AB6 THR C 244  ? PHE C 252  ? THR C 244  PHE C 252  1 ? 9  
HELX_P HELX_P16  AB7 SER C 255  ? ASP C 265  ? SER C 255  ASP C 265  1 ? 11 
HELX_P HELX_P17  AB8 GLY C 269  ? ARG C 282  ? GLY C 269  ARG C 282  1 ? 14 
HELX_P HELX_P18  AB9 SER C 291  ? LYS C 302  ? SER C 291  LYS C 302  1 ? 12 
HELX_P HELX_P19  AC1 ALA C 309  ? GLY C 321  ? ALA C 309  GLY C 321  1 ? 13 
HELX_P HELX_P20  AC2 THR C 334  ? GLU C 350  ? THR C 334  GLU C 350  1 ? 17 
HELX_P HELX_P21  AC3 THR C 380  ? GLN C 407  ? THR C 380  GLN C 407  1 ? 28 
HELX_P HELX_P22  AC4 ASP C 408  ? ILE C 412  ? ASP C 408  ILE C 412  5 ? 5  
HELX_P HELX_P23  AC5 THR C 413  ? ILE C 418  ? THR C 413  ILE C 418  1 ? 6  
HELX_P HELX_P24  AC6 ILE C 420  ? SER C 434  ? ILE C 420  SER C 434  1 ? 15 
HELX_P HELX_P25  AC7 ASN C 444  ? ARG C 453  ? ASN C 444  ARG C 453  1 ? 10 
HELX_P HELX_P26  AC8 GLY C 469  ? ASP C 474  ? GLY C 469  ASP C 474  1 ? 6  
HELX_P HELX_P27  AC9 HIS C 476  ? TYR C 480  ? HIS C 476  TYR C 480  5 ? 5  
HELX_P HELX_P28  AD1 THR C 532  ? ARG C 538  ? THR C 532  ARG C 538  1 ? 7  
HELX_P HELX_P29  AD2 LYS C 564  ? GLY C 566  ? LYS C 564  GLY C 566  5 ? 3  
HELX_P HELX_P30  AD3 SER C 582  ? MET C 586  ? SER C 582  MET C 586  5 ? 5  
HELX_P HELX_P31  AD4 ALA C 590  ? ILE C 594  ? ALA C 590  ILE C 594  5 ? 5  
HELX_P HELX_P32  AD5 PHE C 596  ? ASP C 600  ? PHE C 596  ASP C 600  5 ? 5  
HELX_P HELX_P33  AD6 ASP C 601  ? ARG C 613  ? ASP C 601  ARG C 613  1 ? 13 
HELX_P HELX_P34  AD7 GLY C 629  ? ALA C 638  ? GLY C 629  ALA C 638  1 ? 10 
HELX_P HELX_P35  AD8 ASN C 739  ? GLU C 744  ? ASN C 739  GLU C 744  1 ? 6  
HELX_P HELX_P36  AD9 GLU C 779  ? LEU C 784  ? GLU C 779  LEU C 784  5 ? 6  
HELX_P HELX_P37  AE1 THR C 815  ? PHE C 825  ? THR C 815  PHE C 825  1 ? 11 
HELX_P HELX_P38  AE2 ASN C 918  ? VAL C 922  ? ASN C 918  VAL C 922  5 ? 5  
HELX_P HELX_P39  AE3 ILE C 928  ? GLY C 943  ? ILE C 928  GLY C 943  1 ? 16 
HELX_P HELX_P40  AE4 ASP C 954  ? ARG C 958  ? ASP C 954  ARG C 958  5 ? 5  
HELX_P HELX_P41  AE5 PRO C 960  ? LEU C 963  ? PRO C 960  LEU C 963  5 ? 4  
HELX_P HELX_P42  AE6 GLN C 981  ? THR C 992  ? GLN C 981  THR C 992  1 ? 12 
HELX_P HELX_P43  AE7 LEU C 1036 ? ILE C 1041 ? LEU C 1036 ILE C 1041 1 ? 6  
HELX_P HELX_P44  AE8 GLY C 1069 ? GLY C 1080 ? GLY C 1069 GLY C 1080 1 ? 12 
HELX_P HELX_P45  AE9 ALA C 1081 ? LEU C 1089 ? ALA C 1081 LEU C 1089 1 ? 9  
HELX_P HELX_P46  AF1 ASP C 1095 ? GLY C 1109 ? ASP C 1095 GLY C 1109 1 ? 15 
HELX_P HELX_P47  AF2 PRO C 1118 ? SER C 1130 ? PRO C 1118 SER C 1130 1 ? 13 
HELX_P HELX_P48  AF3 THR D 16   ? SER D 24   ? THR D 16   SER D 24   1 ? 9  
HELX_P HELX_P49  AF4 ARG D 84   ? GLU D 90   ? ARG D 84   GLU D 90   5 ? 7  
HELX_P HELX_P50  AF5 HIS D 103  ? LYS D 108  ? HIS D 103  LYS D 108  1 ? 6  
HELX_P HELX_P51  AF6 SER D 112  ? LEU D 118  ? SER D 112  LEU D 118  1 ? 7  
HELX_P HELX_P52  AF7 ALA D 121  ? TYR D 130  ? ALA D 121  TYR D 130  1 ? 10 
HELX_P HELX_P53  AF8 ASP D 140  ? GLU D 187  ? ASP D 140  GLU D 187  1 ? 48 
HELX_P HELX_P54  AF9 LYS D 190  ? LYS D 228  ? LYS D 190  LYS D 228  1 ? 39 
HELX_P HELX_P55  AG1 ASP D 237  ? GLY D 249  ? ASP D 237  GLY D 249  1 ? 13 
HELX_P HELX_P56  AG2 GLY D 257  ? ASN D 267  ? GLY D 257  ASN D 267  1 ? 11 
HELX_P HELX_P57  AG3 ASP D 269  ? ASN D 283  ? ASP D 269  ASN D 283  1 ? 15 
HELX_P HELX_P58  AG4 LYS D 285  ? SER D 305  ? LYS D 285  SER D 305  1 ? 21 
HELX_P HELX_P59  AG5 SER D 308  ? GLY D 311  ? SER D 308  GLY D 311  5 ? 4  
HELX_P HELX_P60  AG6 PRO D 321  ? ARG D 325  ? PRO D 321  ARG D 325  5 ? 5  
HELX_P HELX_P61  AG7 ASP D 339  ? GLY D 361  ? ASP D 339  GLY D 361  1 ? 23 
HELX_P HELX_P62  AG8 PRO D 363  ? ASP D 383  ? PRO D 363  ASP D 383  1 ? 21 
HELX_P HELX_P63  AG9 GLY D 393  ? ARG D 397  ? GLY D 393  ARG D 397  5 ? 5  
HELX_P HELX_P64  AH1 SER D 401  ? LEU D 406  ? SER D 401  LEU D 406  5 ? 6  
HELX_P HELX_P65  AH2 GLY D 411  ? LEU D 417  ? GLY D 411  LEU D 417  1 ? 7  
HELX_P HELX_P66  AH3 LYS D 445  ? PHE D 452  ? LYS D 445  PHE D 452  1 ? 8  
HELX_P HELX_P67  AH4 PHE D 452  ? LEU D 463  ? PHE D 452  LEU D 463  1 ? 12 
HELX_P HELX_P68  AH5 ASN D 468  ? GLN D 479  ? ASN D 468  GLN D 479  1 ? 12 
HELX_P HELX_P69  AH6 GLN D 482  ? ILE D 491  ? GLN D 482  ILE D 491  1 ? 10 
HELX_P HELX_P70  AH7 HIS D 505  ? LEU D 507  ? HIS D 505  LEU D 507  5 ? 3  
HELX_P HELX_P71  AH8 VAL D 528  ? ASN D 533  ? VAL D 528  ASN D 533  1 ? 6  
HELX_P HELX_P72  AH9 SER D 548  ? MET D 559  ? SER D 548  MET D 559  1 ? 12 
HELX_P HELX_P73  AI1 LEU D 579  ? THR D 589  ? LEU D 579  THR D 589  1 ? 11 
HELX_P HELX_P74  AI2 SER D 614  ? GLY D 625  ? SER D 614  GLY D 625  1 ? 12 
HELX_P HELX_P75  AI3 PRO D 643  ? GLY D 652  ? PRO D 643  GLY D 652  1 ? 10 
HELX_P HELX_P76  AI4 LEU D 668  ? GLU D 675  ? LEU D 668  GLU D 675  1 ? 8  
HELX_P HELX_P77  AI5 HIS D 689  ? ARG D 703  ? HIS D 689  ARG D 703  1 ? 15 
HELX_P HELX_P78  AI6 PRO D 705  ? ARG D 726  ? PRO D 705  ARG D 726  1 ? 22 
HELX_P HELX_P79  AI7 ARG D 741  ? ARG D 762  ? ARG D 741  ARG D 762  1 ? 22 
HELX_P HELX_P80  AI8 ASN D 766  ? TYR D 793  ? ASN D 766  TYR D 793  1 ? 28 
HELX_P HELX_P81  AI9 ASN D 797  ? ASP D 804  ? ASN D 797  ASP D 804  1 ? 8  
HELX_P HELX_P82  AJ1 ASN D 810  ? GLY D 819  ? ASN D 810  GLY D 819  1 ? 10 
HELX_P HELX_P83  AJ2 THR D 845  ? SER D 881  ? THR D 845  SER D 881  1 ? 37 
HELX_P HELX_P84  AJ3 TYR D 915  ? ALA D 920  ? TYR D 915  ALA D 920  1 ? 6  
HELX_P HELX_P85  AJ4 GLY D 945  ? ALA D 955  ? GLY D 945  ALA D 955  1 ? 11 
HELX_P HELX_P86  AJ5 ALA D 976  ? GLY D 980  ? ALA D 976  GLY D 980  1 ? 5  
HELX_P HELX_P87  AJ6 ALA D 994  ? GLU D 1005 ? ALA D 994  GLU D 1005 1 ? 12 
HELX_P HELX_P88  AJ7 GLY D 1027 ? GLU D 1036 ? GLY D 1027 GLU D 1036 1 ? 10 
HELX_P HELX_P89  AJ8 ASP D 1117 ? GLN D 1145 ? ASP D 1117 GLN D 1145 1 ? 29 
HELX_P HELX_P90  AJ9 HIS D 1150 ? LEU D 1162 ? HIS D 1150 LEU D 1162 1 ? 13 
HELX_P HELX_P91  AK1 ARG D 1183 ? ASN D 1190 ? ARG D 1183 ASN D 1190 1 ? 8  
HELX_P HELX_P92  AK2 GLY D 1209 ? ALA D 1216 ? GLY D 1209 ALA D 1216 1 ? 8  
HELX_P HELX_P93  AK3 SER D 1219 ? SER D 1225 ? SER D 1219 SER D 1225 1 ? 7  
HELX_P HELX_P94  AK4 GLU D 1228 ? ASN D 1239 ? GLU D 1228 ASN D 1239 1 ? 12 
HELX_P HELX_P95  AK5 GLY D 1247 ? GLY D 1255 ? GLY D 1247 GLY D 1255 1 ? 9  
HELX_P HELX_P96  AK6 ALA D 1260 ? GLY D 1263 ? ALA D 1260 GLY D 1263 5 ? 4  
HELX_P HELX_P97  AK7 ILE D 1264 ? ASN D 1269 ? ILE D 1264 ASN D 1269 1 ? 6  
HELX_P HELX_P98  AK8 LEU E 33   ? ASN E 37   ? LEU E 33   ASN E 37   5 ? 5  
HELX_P HELX_P99  AK9 PRO E 39   ? ASP E 45   ? PRO E 39   ASP E 45   1 ? 7  
HELX_P HELX_P100 AL1 SER E 49   ? GLY E 72   ? SER E 49   GLY E 72   1 ? 24 
HELX_P HELX_P101 AL2 LYS E 90   ? ALA E 101  ? LYS E 90   ALA E 101  1 ? 12 
HELX_P HELX_P102 AL3 SER F 209  ? THR F 222  ? SER F 209  THR F 222  1 ? 14 
HELX_P HELX_P103 AL4 VAL F 228  ? GLY F 236  ? VAL F 228  GLY F 236  1 ? 9  
HELX_P HELX_P104 AL5 ASN F 242  ? GLY F 270  ? ASN F 242  GLY F 270  1 ? 29 
HELX_P HELX_P105 AL6 PRO F 274  ? ASN F 299  ? PRO F 274  ASN F 299  1 ? 26 
HELX_P HELX_P106 AL7 ASN F 299  ? LEU F 306  ? ASN F 299  LEU F 306  1 ? 8  
HELX_P HELX_P107 AL8 ALA F 307  ? THR F 311  ? ALA F 307  THR F 311  5 ? 5  
HELX_P HELX_P108 AL9 ALA F 316  ? LYS F 334  ? ALA F 316  LYS F 334  1 ? 19 
HELX_P HELX_P109 AM1 LYS F 342  ? ARG F 364  ? LYS F 342  ARG F 364  1 ? 23 
HELX_P HELX_P110 AM2 PRO F 369  ? GLN F 388  ? PRO F 369  GLN F 388  1 ? 20 
HELX_P HELX_P111 AM3 THR F 395  ? ASP F 404  ? THR F 395  ASP F 404  1 ? 10 
HELX_P HELX_P112 AM4 THR F 406  ? ALA F 417  ? THR F 406  ALA F 417  1 ? 12 
HELX_P HELX_P113 AM5 GLN F 434  ? ILE F 439  ? GLN F 434  ILE F 439  5 ? 6  
HELX_P HELX_P114 AM6 VAL F 446  ? SER F 462  ? VAL F 446  SER F 462  1 ? 17 
HELX_P HELX_P115 AM7 ARG F 470  ? PHE F 479  ? ARG F 470  PHE F 479  1 ? 10 
HELX_P HELX_P116 AM8 THR F 488  ? TYR F 496  ? THR F 488  TYR F 496  1 ? 9  
HELX_P HELX_P117 AM9 GLU F 501  ? SER F 512  ? GLU F 501  SER F 512  1 ? 12 
HELX_P HELX_P118 AN1 LEU F 514  ? SER F 520  ? LEU F 514  SER F 520  1 ? 7  
HELX_P HELX_P119 AN2 ARG F 524  ? ASP F 528  ? ARG F 524  ASP F 528  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CYS 60  SG  ? ? ? 1_555 J ZN . ZN ? ? D CYS 60  D ZN 1402 1_555 ? ? ? ? ? ? ?                       2.207 ? 
metalc2  metalc ? ? D CYS 62  SG  ? ? ? 1_555 J ZN . ZN ? ? D CYS 62  D ZN 1402 1_555 ? ? ? ? ? ? ?                       2.239 ? 
metalc3  metalc ? ? D CYS 75  SG  ? ? ? 1_555 J ZN . ZN ? ? D CYS 75  D ZN 1402 1_555 ? ? ? ? ? ? ?                       2.221 ? 
metalc4  metalc ? ? D CYS 78  SG  ? ? ? 1_555 J ZN . ZN ? ? D CYS 78  D ZN 1402 1_555 ? ? ? ? ? ? ?                       2.266 ? 
metalc5  metalc ? ? D ASP 535 OD1 ? ? ? 1_555 K MG . MG ? ? D ASP 535 D MG 1403 1_555 ? ? ? ? ? ? ?                       1.907 ? 
metalc6  metalc ? ? D ASP 535 OD2 ? ? ? 1_555 K MG . MG ? ? D ASP 535 D MG 1403 1_555 ? ? ? ? ? ? ?                       2.811 ? 
metalc7  metalc ? ? D ASP 537 OD1 ? ? ? 1_555 K MG . MG ? ? D ASP 537 D MG 1403 1_555 ? ? ? ? ? ? ?                       1.976 ? 
metalc8  metalc ? ? D ASP 537 OD2 ? ? ? 1_555 K MG . MG ? ? D ASP 537 D MG 1403 1_555 ? ? ? ? ? ? ?                       2.862 ? 
metalc9  metalc ? ? D ASP 539 OD1 ? ? ? 1_555 K MG . MG ? ? D ASP 539 D MG 1403 1_555 ? ? ? ? ? ? ?                       2.382 ? 
metalc10 metalc ? ? D CYS 891 SG  ? ? ? 1_555 I ZN . ZN ? ? D CYS 891 D ZN 1401 1_555 ? ? ? ? ? ? ?                       2.265 ? 
metalc11 metalc ? ? D CYS 968 SG  ? ? ? 1_555 I ZN . ZN ? ? D CYS 968 D ZN 1401 1_555 ? ? ? ? ? ? ?                       2.200 ? 
metalc12 metalc ? ? D CYS 975 SG  ? ? ? 1_555 I ZN . ZN ? ? D CYS 975 D ZN 1401 1_555 ? ? ? ? ? ? ?                       2.286 ? 
metalc13 metalc ? ? D CYS 978 SG  ? ? ? 1_555 I ZN . ZN ? ? D CYS 978 D ZN 1401 1_555 ? ? ? ? ? ? ?                       2.283 ? 
hydrog1  hydrog ? ? G DT  15  N3  ? ? ? 1_555 H DA 9 N1 ? ? H DT  15  G DA 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog2  hydrog ? ? G DT  15  O4  ? ? ? 1_555 H DA 9 N6 ? ? H DT  15  G DA 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog3  hydrog ? ? G DC  16  N3  ? ? ? 1_555 H DG 8 N2 ? ? H DC  16  G DG 12   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     ? 
hydrog4  hydrog ? ? G DC  16  O2  ? ? ? 1_555 H DG 8 N1 ? ? H DC  16  G DG 12   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     ? 
hydrog5  hydrog ? ? G DA  17  N1  ? ? ? 1_555 H DG 6 N1 ? ? H DA  17  G DG 10   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog6  hydrog ? ? G DA  17  N6  ? ? ? 1_555 H DG 6 O6 ? ? H DA  17  G DG 10   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     ? 
hydrog7  hydrog ? ? G DA  17  N1  ? ? ? 1_555 H DT 7 N3 ? ? H DA  17  G DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog8  hydrog ? ? G DA  17  N6  ? ? ? 1_555 H DT 7 O4 ? ? H DA  17  G DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog9  hydrog ? ? G DC  18  N3  ? ? ? 1_555 H DG 6 N1 ? ? H DC  18  G DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog10 hydrog ? ? G DC  18  N4  ? ? ? 1_555 H DG 6 O6 ? ? H DC  18  G DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog11 hydrog ? ? G DC  18  O2  ? ? ? 1_555 H DG 6 N2 ? ? H DC  18  G DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog12 hydrog ? ? G DG  19  N1  ? ? ? 1_555 H DC 5 N3 ? ? H DG  19  G DC 9    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog13 hydrog ? ? G DG  19  N2  ? ? ? 1_555 H DC 5 O2 ? ? H DG  19  G DC 9    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog14 hydrog ? ? G DG  19  O6  ? ? ? 1_555 H DC 5 N4 ? ? H DG  19  G DC 9    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog15 hydrog ? ? G DG  20  N1  ? ? ? 1_555 H DC 4 N3 ? ? H DG  20  G DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog16 hydrog ? ? G DG  20  N2  ? ? ? 1_555 H DC 4 O2 ? ? H DG  20  G DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog17 hydrog ? ? G DG  20  O6  ? ? ? 1_555 H DC 4 N4 ? ? H DG  20  G DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog18 hydrog ? ? G DA  21  N1  ? ? ? 1_555 H DT 3 N3 ? ? H DA  21  G DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog19 hydrog ? ? G DA  21  N6  ? ? ? 1_555 H DT 3 O4 ? ? H DA  21  G DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog20 hydrog ? ? G DT  22  N3  ? ? ? 1_555 H DA 2 N1 ? ? H DT  22  G DA 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog21 hydrog ? ? G DT  22  O4  ? ? ? 1_555 H DA 2 N6 ? ? H DT  22  G DA 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog22 hydrog ? ? G DG  23  N1  ? ? ? 1_555 H DC 1 N3 ? ? H DG  23  G DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog23 hydrog ? ? G DG  23  N2  ? ? ? 1_555 H DC 1 O2 ? ? H DG  23  G DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog24 hydrog ? ? G DG  23  O6  ? ? ? 1_555 H DC 1 N4 ? ? H DG  23  G DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 24  A . ? GLU 24  A PRO 25  A ? PRO 25  A 1 -3.45 
2 GLU 24  B . ? GLU 24  B PRO 25  B ? PRO 25  B 1 -1.67 
3 SER 94  C . ? SER 94  C PRO 95  C ? PRO 95  C 1 -5.27 
4 VAL 110 D . ? VAL 110 D PRO 111 D ? PRO 111 D 1 2.60  
5 ALA 501 D . ? ALA 501 D PRO 502 D ? PRO 502 D 1 -4.21 
6 LEU 677 D . ? LEU 677 D PRO 678 D ? PRO 678 D 1 -6.23 
7 ASN 37  E . ? ASN 37  E PRO 38  E ? PRO 38  E 1 4.43  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 6 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 4 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 2 ? 
AD2 ? 8 ? 
AD3 ? 2 ? 
AD4 ? 3 ? 
AD5 ? 2 ? 
AD6 ? 3 ? 
AD7 ? 3 ? 
AD8 ? 3 ? 
AD9 ? 2 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 4 ? 
AE6 ? 3 ? 
AE7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC1 4 5 ? anti-parallel 
AC1 5 6 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD2 5 6 ? parallel      
AD2 6 7 ? anti-parallel 
AD2 7 8 ? parallel      
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? parallel      
AD8 1 2 ? parallel      
AD8 2 3 ? anti-parallel 
AD9 1 2 ? parallel      
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 11   ? VAL A 13   ? GLU A 11   VAL A 13   
AA1 2 ARG A 18   ? LEU A 26   ? ARG A 18   LEU A 26   
AA1 3 PHE A 189  ? THR A 198  ? PHE A 189  THR A 198  
AA1 4 VAL A 171  ? THR A 181  ? VAL A 171  THR A 181  
AA2 1 VAL A 93   ? THR A 94   ? VAL A 93   THR A 94   
AA2 2 LEU A 134  ? ARG A 144  ? LEU A 134  ARG A 144  
AA2 3 TYR A 96   ? LYS A 99   ? TYR A 96   LYS A 99   
AA2 4 ILE A 110  ? VAL A 111  ? ILE A 110  VAL A 111  
AA3 1 VAL A 93   ? THR A 94   ? VAL A 93   THR A 94   
AA3 2 LEU A 134  ? ARG A 144  ? LEU A 134  ARG A 144  
AA3 3 PRO A 47   ? ILE A 56   ? PRO A 47   ILE A 56   
AA3 4 ILE A 162  ? PRO A 163  ? ILE A 162  PRO A 163  
AA4 1 VAL A 85   ? SER A 87   ? VAL A 85   SER A 87   
AA4 2 VAL A 116  ? VAL A 118  ? VAL A 116  VAL A 118  
AA5 1 GLY A 103  ? THR A 106  ? GLY A 103  THR A 106  
AA5 2 HIS A 124  ? LEU A 128  ? HIS A 124  LEU A 128  
AA6 1 TYR A 146  ? VAL A 147  ? TYR A 146  VAL A 147  
AA6 2 SER A 166  ? ILE A 167  ? SER A 166  ILE A 167  
AA7 1 LEU B 9    ? VAL B 13   ? LEU B 9    VAL B 13   
AA7 2 ARG B 18   ? LEU B 26   ? ARG B 18   LEU B 26   
AA7 3 ASP B 190  ? THR B 198  ? ASP B 190  THR B 198  
AA7 4 VAL B 171  ? ALA B 180  ? VAL B 171  ALA B 180  
AA8 1 VAL B 93   ? GLN B 100  ? VAL B 93   GLN B 100  
AA8 2 LYS B 133  ? GLU B 141  ? LYS B 133  GLU B 141  
AA8 3 ALA B 50   ? ILE B 56   ? ALA B 50   ILE B 56   
AA8 4 ARG B 161  ? PRO B 163  ? ARG B 161  PRO B 163  
AA9 1 VAL B 85   ? SER B 87   ? VAL B 85   SER B 87   
AA9 2 VAL B 116  ? VAL B 118  ? VAL B 116  VAL B 118  
AB1 1 GLY B 103  ? VAL B 105  ? GLY B 103  VAL B 105  
AB1 2 ALA B 126  ? LEU B 128  ? ALA B 126  LEU B 128  
AB2 1 VAL C 39   ? SER C 40   ? VAL C 39   SER C 40   
AB2 2 VAL C 972  ? SER C 973  ? VAL C 972  SER C 973  
AB2 3 VAL C 626  ? GLY C 627  ? VAL C 626  GLY C 627  
AB3 1 ILE C 96   ? GLU C 97   ? ILE C 96   GLU C 97   
AB3 2 MET C 103  ? PHE C 112  ? MET C 103  PHE C 112  
AB3 3 ALA C 130  ? ASN C 141  ? ALA C 130  ASN C 141  
AB3 4 ILE C 147  ? PRO C 158  ? ILE C 147  PRO C 158  
AB4 1 PHE C 166  ? ILE C 168  ? PHE C 166  ILE C 168  
AB4 2 THR C 171  ? VAL C 175  ? THR C 171  VAL C 175  
AB4 3 SER C 437  ? PHE C 439  ? SER C 437  PHE C 439  
AB5 1 ARG C 376  ? ARG C 379  ? ARG C 376  ARG C 379  
AB5 2 SER C 177  ? ARG C 181  ? SER C 177  ARG C 181  
AB5 3 ARG C 454  ? SER C 456  ? ARG C 454  SER C 456  
AB5 4 ILE C 497  ? SER C 499  ? ILE C 497  SER C 499  
AB6 1 GLY C 184  ? ILE C 191  ? GLY C 184  ILE C 191  
AB6 2 THR C 198  ? ILE C 205  ? THR C 198  ILE C 205  
AB7 1 LEU C 212  ? VAL C 216  ? LEU C 212  VAL C 216  
AB7 2 VAL C 222  ? ILE C 226  ? VAL C 222  ILE C 226  
AB7 3 GLN C 232  ? PRO C 233  ? GLN C 232  PRO C 233  
AB8 1 THR C 354  ? THR C 356  ? THR C 354  THR C 356  
AB8 2 GLU C 362  ? PRO C 364  ? GLU C 362  PRO C 364  
AB9 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AB9 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AB9 3 VAL C 524  ? LEU C 531  ? VAL C 524  LEU C 531  
AC1 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AC1 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AC1 3 TYR C 578  ? ASP C 580  ? TYR C 578  ASP C 580  
AC1 4 VAL C 541  ? ALA C 542  ? VAL C 541  ALA C 542  
AC1 5 ARG C 558  ? ARG C 563  ? ARG C 558  ARG C 563  
AC1 6 GLU C 567  ? PRO C 572  ? GLU C 567  PRO C 572  
AC2 1 VAL C 642  ? VAL C 643  ? VAL C 642  VAL C 643  
AC2 2 VAL C 701  ? ASP C 704  ? VAL C 701  ASP C 704  
AC2 3 CYS C 687  ? PRO C 688  ? CYS C 687  PRO C 688  
AC3 1 ARG C 667  ? ARG C 671  ? ARG C 667  ARG C 671  
AC3 2 TYR C 657  ? HIS C 662  ? TYR C 657  HIS C 662  
AC3 3 GLY C 648  ? VAL C 653  ? GLY C 648  VAL C 653  
AC3 4 ARG C 695  ? VAL C 696  ? ARG C 695  VAL C 696  
AC4 1 ALA C 676  ? ARG C 677  ? ALA C 676  ARG C 677  
AC4 2 CYS C 683  ? ALA C 684  ? CYS C 683  ALA C 684  
AC5 1 THR C 708  ? ASP C 709  ? THR C 708  ASP C 709  
AC5 2 GLU C 712  ? MET C 713  ? GLU C 712  MET C 713  
AC6 1 LYS C 1007 ? ALA C 1008 ? LYS C 1007 ALA C 1008 
AC6 2 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC6 3 LYS C 884  ? GLY C 887  ? LYS C 884  GLY C 887  
AC6 4 GLY C 893  ? LEU C 899  ? GLY C 893  LEU C 899  
AC6 5 ILE C 735  ? SER C 738  ? ILE C 735  SER C 738  
AC6 6 ILE C 915  ? LEU C 917  ? ILE C 915  LEU C 917  
AC6 7 GLY C 716  ? ILE C 723  ? GLY C 716  ILE C 723  
AC6 8 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC7 1 THR C 748  ? ARG C 760  ? THR C 748  ARG C 760  
AC7 2 VAL C 865  ? LYS C 878  ? VAL C 865  LYS C 878  
AC7 3 GLY C 845  ? SER C 854  ? GLY C 845  SER C 854  
AC7 4 GLU C 795  ? VAL C 796  ? GLU C 795  VAL C 796  
AC8 1 GLU C 768  ? ILE C 769  ? GLU C 768  ILE C 769  
AC8 2 LYS C 805  ? PRO C 808  ? LYS C 805  PRO C 808  
AC8 3 VAL C 832  ? ASP C 834  ? VAL C 832  ASP C 834  
AC9 1 ILE C 801  ? VAL C 803  ? ILE C 801  VAL C 803  
AC9 2 LEU C 837  ? LYS C 838  ? LEU C 837  LYS C 838  
AD1 1 TRP C 944  ? LYS C 945  ? TRP C 944  LYS C 945  
AD1 2 GLU C 965  ? ALA C 966  ? GLU C 965  ALA C 966  
AD2 1 HIS C 1042 ? ARG C 1044 ? HIS C 1042 ARG C 1044 
AD2 2 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD2 3 GLN D 540  ? HIS D 544  ? GLN D 540  HIS D 544  
AD2 4 VAL D 496  ? ASN D 499  ? VAL D 496  ASN D 499  
AD2 5 ILE D 509  ? VAL D 517  ? ILE D 509  VAL D 517  
AD2 6 GLN D 440  ? PRO D 444  ? GLN D 440  PRO D 444  
AD2 7 ILE D 522  ? LEU D 524  ? ILE D 522  LEU D 524  
AD2 8 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD3 1 ARG C 1067 ? PHE C 1068 ? ARG C 1067 PHE C 1068 
AD3 2 LYS D 420  ? ARG D 421  ? LYS D 420  ARG D 421  
AD4 1 LEU C 1133 ? LEU C 1138 ? LEU C 1133 LEU C 1138 
AD4 2 GLU D 9    ? LEU D 14   ? GLU D 9    LEU D 14   
AD4 3 SER D 1242 ? LYS D 1244 ? SER D 1242 LYS D 1244 
AD5 1 GLY D 93   ? THR D 102  ? GLY D 93   THR D 102  
AD5 2 VAL D 313  ? VAL D 319  ? VAL D 313  VAL D 319  
AD6 1 LEU D 234  ? ILE D 235  ? LEU D 234  ILE D 235  
AD6 2 TYR D 134  ? VAL D 139  ? TYR D 134  VAL D 139  
AD6 3 PHE D 252  ? ALA D 255  ? PHE D 252  ALA D 255  
AD7 1 MET D 327  ? GLN D 329  ? MET D 327  GLN D 329  
AD7 2 PHE D 335  ? THR D 337  ? PHE D 335  THR D 337  
AD7 3 ILE F 421  ? SER F 422  ? ILE F 421  SER F 422  
AD8 1 VAL D 611  ? TYR D 612  ? VAL D 611  TYR D 612  
AD8 2 LYS D 632  ? LEU D 637  ? LYS D 632  LEU D 637  
AD8 3 TRP D 662  ? THR D 667  ? TRP D 662  THR D 667  
AD9 1 VAL D 886  ? GLU D 888  ? VAL D 886  GLU D 888  
AD9 2 VAL D 974  ? CYS D 975  ? VAL D 974  CYS D 975  
AE1 1 ILE D 897  ? GLU D 900  ? ILE D 897  GLU D 900  
AE1 2 GLN D 959  ? VAL D 962  ? GLN D 959  VAL D 962  
AE2 1 ALA D 902  ? ARG D 904  ? ALA D 902  ARG D 904  
AE2 2 LEU D 910  ? ARG D 912  ? LEU D 910  ARG D 912  
AE3 1 ALA D 929  ? VAL D 930  ? ALA D 929  VAL D 930  
AE3 2 VAL D 936  ? VAL D 938  ? VAL D 936  VAL D 938  
AE4 1 ARG D 981  ? SER D 982  ? ARG D 981  SER D 982  
AE4 2 LYS D 987  ? LEU D 988  ? LYS D 987  LEU D 988  
AE5 1 VAL D 1075 ? LYS D 1079 ? VAL D 1075 LYS D 1079 
AE5 2 TYR D 1062 ? PRO D 1068 ? TYR D 1062 PRO D 1068 
AE5 3 GLY D 1051 ? LEU D 1055 ? GLY D 1051 LEU D 1055 
AE5 4 HIS D 1104 ? VAL D 1105 ? HIS D 1104 VAL D 1105 
AE6 1 ILE D 1181 ? ASP D 1182 ? ILE D 1181 ASP D 1182 
AE6 2 ARG D 1164 ? ASP D 1169 ? ARG D 1164 ASP D 1169 
AE6 3 ALA D 1202 ? PRO D 1205 ? ALA D 1202 PRO D 1205 
AE7 1 ALA D 1271 ? PRO D 1274 ? ALA D 1271 PRO D 1274 
AE7 2 LEU E 104  ? THR E 107  ? LEU E 104  THR E 107  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 11   ? N GLU A 11   O VAL A 22   ? O VAL A 22   
AA1 2 3 N PHE A 21   ? N PHE A 21   O LEU A 194  ? O LEU A 194  
AA1 3 4 O LYS A 191  ? O LYS A 191  N ASP A 179  ? N ASP A 179  
AA2 1 2 N VAL A 93   ? N VAL A 93   O VAL A 140  ? O VAL A 140  
AA2 2 3 O VAL A 136  ? O VAL A 136  N LEU A 97   ? N LEU A 97   
AA2 3 4 N TYR A 96   ? N TYR A 96   O VAL A 111  ? O VAL A 111  
AA3 1 2 N VAL A 93   ? N VAL A 93   O VAL A 140  ? O VAL A 140  
AA3 2 3 O GLY A 143  ? O GLY A 143  N GLY A 48   ? N GLY A 48   
AA3 3 4 N ILE A 54   ? N ILE A 54   O ILE A 162  ? O ILE A 162  
AA4 1 2 N SER A 86   ? N SER A 86   O THR A 117  ? O THR A 117  
AA5 1 2 N VAL A 105  ? N VAL A 105  O ALA A 126  ? O ALA A 126  
AA6 1 2 N VAL A 147  ? N VAL A 147  O SER A 166  ? O SER A 166  
AA7 1 2 N LEU B 9    ? N LEU B 9    O GLU B 24   ? O GLU B 24   
AA7 2 3 N LEU B 26   ? N LEU B 26   O ASP B 190  ? O ASP B 190  
AA7 3 4 O ASP B 195  ? O ASP B 195  N THR B 175  ? N THR B 175  
AA8 1 2 N MET B 95   ? N MET B 95   O LEU B 138  ? O LEU B 138  
AA8 2 3 O VAL B 139  ? O VAL B 139  N THR B 52   ? N THR B 52   
AA8 3 4 N ILE B 54   ? N ILE B 54   O ILE B 162  ? O ILE B 162  
AA9 1 2 N SER B 86   ? N SER B 86   O THR B 117  ? O THR B 117  
AB1 1 2 N VAL B 105  ? N VAL B 105  O ALA B 126  ? O ALA B 126  
AB2 1 2 N VAL C 39   ? N VAL C 39   O SER C 973  ? O SER C 973  
AB2 2 3 O VAL C 972  ? O VAL C 972  N GLY C 627  ? N GLY C 627  
AB3 1 2 N ILE C 96   ? N ILE C 96   O LEU C 105  ? O LEU C 105  
AB3 2 3 N SER C 104  ? N SER C 104  O ILE C 140  ? O ILE C 140  
AB3 3 4 N PHE C 139  ? N PHE C 139  O LYS C 148  ? O LYS C 148  
AB4 1 2 N ILE C 168  ? N ILE C 168  O THR C 171  ? O THR C 171  
AB4 2 3 N VAL C 174  ? N VAL C 174  O GLN C 438  ? O GLN C 438  
AB5 1 2 O ARG C 377  ? O ARG C 377  N VAL C 180  ? N VAL C 180  
AB5 2 3 N LEU C 179  ? N LEU C 179  O SER C 456  ? O SER C 456  
AB5 3 4 N LEU C 455  ? N LEU C 455  O GLY C 498  ? O GLY C 498  
AB6 1 2 N ASP C 188  ? N ASP C 188  O SER C 201  ? O SER C 201  
AB7 1 2 N ASP C 215  ? N ASP C 215  O GLY C 223  ? O GLY C 223  
AB7 2 3 N VAL C 224  ? N VAL C 224  O GLN C 232  ? O GLN C 232  
AB8 1 2 N MET C 355  ? N MET C 355  O VAL C 363  ? O VAL C 363  
AB9 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AB9 2 3 N LYS C 518  ? N LYS C 518  O SER C 525  ? O SER C 525  
AC1 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AC1 2 3 N ARG C 517  ? N ARG C 517  O MET C 579  ? O MET C 579  
AC1 3 4 O TYR C 578  ? O TYR C 578  N ALA C 542  ? N ALA C 542  
AC1 4 5 N VAL C 541  ? N VAL C 541  O ARG C 562  ? O ARG C 562  
AC1 5 6 N ARG C 563  ? N ARG C 563  O GLU C 567  ? O GLU C 567  
AC2 1 2 N VAL C 642  ? N VAL C 642  O ILE C 702  ? O ILE C 702  
AC2 2 3 O ASP C 704  ? O ASP C 704  N CYS C 687  ? N CYS C 687  
AC3 1 2 O ARG C 668  ? O ARG C 668  N VAL C 660  ? N VAL C 660  
AC3 2 3 O THR C 659  ? O THR C 659  N GLU C 652  ? N GLU C 652  
AC3 3 4 N GLY C 648  ? N GLY C 648  O VAL C 696  ? O VAL C 696  
AC4 1 2 N ALA C 676  ? N ALA C 676  O ALA C 684  ? O ALA C 684  
AC5 1 2 N ASP C 709  ? N ASP C 709  O GLU C 712  ? O GLU C 712  
AC6 1 2 N ALA C 1008 ? N ALA C 1008 O VAL C 1023 ? O VAL C 1023 
AC6 2 3 O MET C 1031 ? O MET C 1031 N ALA C 886  ? N ALA C 886  
AC6 3 4 N LEU C 885  ? N LEU C 885  O GLY C 893  ? O GLY C 893  
AC6 4 5 O VAL C 894  ? O VAL C 894  N ILE C 735  ? N ILE C 735  
AC6 5 6 N ILE C 736  ? N ILE C 736  O ILE C 916  ? O ILE C 916  
AC6 6 7 N ILE C 915  ? N ILE C 915  O LEU C 720  ? O LEU C 720  
AC6 7 8 N ILE C 723  ? N ILE C 723  O THR C 1024 ? O THR C 1024 
AC7 1 2 N HIS C 755  ? N HIS C 755  O VAL C 871  ? O VAL C 871  
AC7 2 3 O LEU C 868  ? O LEU C 868  N PHE C 853  ? N PHE C 853  
AC7 3 4 O GLY C 845  ? O GLY C 845  N VAL C 796  ? N VAL C 796  
AC8 1 2 N GLU C 768  ? N GLU C 768  O VAL C 806  ? O VAL C 806  
AC8 2 3 N THR C 807  ? N THR C 807  O ARG C 833  ? O ARG C 833  
AC9 1 2 N LEU C 802  ? N LEU C 802  O LEU C 837  ? O LEU C 837  
AD1 1 2 N TRP C 944  ? N TRP C 944  O ALA C 966  ? O ALA C 966  
AD2 1 2 N HIS C 1042 ? N HIS C 1042 O ARG D 427  ? O ARG D 427  
AD2 2 3 N GLY D 426  ? N GLY D 426  O VAL D 543  ? O VAL D 543  
AD2 3 4 O ALA D 542  ? O ALA D 542  N ASN D 499  ? N ASN D 499  
AD2 4 5 N LEU D 498  ? N LEU D 498  O GLN D 510  ? O GLN D 510  
AD2 5 6 O MET D 515  ? O MET D 515  N LEU D 443  ? N LEU D 443  
AD2 6 7 N GLY D 442  ? N GLY D 442  O GLN D 523  ? O GLN D 523  
AD2 7 8 O ILE D 522  ? O ILE D 522  N VAL D 429  ? N VAL D 429  
AD3 1 2 N PHE C 1068 ? N PHE C 1068 O LYS D 420  ? O LYS D 420  
AD4 1 2 N LEU C 1138 ? N LEU C 1138 O GLU D 9    ? O GLU D 9    
AD4 2 3 N LEU D 10   ? N LEU D 10   O ASP D 1243 ? O ASP D 1243 
AD5 1 2 N GLY D 93   ? N GLY D 93   O VAL D 319  ? O VAL D 319  
AD6 1 2 O ILE D 235  ? O ILE D 235  N TYR D 134  ? N TYR D 134  
AD6 2 3 N SER D 138  ? N SER D 138  O THR D 253  ? O THR D 253  
AD7 1 2 N VAL D 328  ? N VAL D 328  O ALA D 336  ? O ALA D 336  
AD7 2 3 N PHE D 335  ? N PHE D 335  O ILE F 421  ? O ILE F 421  
AD8 1 2 N TYR D 612  ? N TYR D 612  O LYS D 634  ? O LYS D 634  
AD8 2 3 N ILE D 633  ? N ILE D 633  O THR D 666  ? O THR D 666  
AD9 1 2 N ARG D 887  ? N ARG D 887  O VAL D 974  ? O VAL D 974  
AE1 1 2 N VAL D 899  ? N VAL D 899  O VAL D 960  ? O VAL D 960  
AE2 1 2 N GLU D 903  ? N GLU D 903  O ILE D 911  ? O ILE D 911  
AE3 1 2 N ALA D 929  ? N ALA D 929  O ILE D 937  ? O ILE D 937  
AE4 1 2 N SER D 982  ? N SER D 982  O LYS D 987  ? O LYS D 987  
AE5 1 2 O TYR D 1077 ? O TYR D 1077 N ILE D 1064 ? N ILE D 1064 
AE5 2 3 O VAL D 1067 ? O VAL D 1067 N ARG D 1052 ? N ARG D 1052 
AE5 3 4 N GLY D 1051 ? N GLY D 1051 O VAL D 1105 ? O VAL D 1105 
AE6 1 2 O ILE D 1181 ? O ILE D 1181 N VAL D 1165 ? N VAL D 1165 
AE6 2 3 N THR D 1166 ? N THR D 1166 O ARG D 1204 ? O ARG D 1204 
AE7 1 2 N GLN D 1273 ? N GLN D 1273 O GLU E 105  ? O GLU E 105  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D ZN 1401 ? 4 'binding site for residue ZN D 1401' 
AC2 Software D ZN 1402 ? 4 'binding site for residue ZN D 1402' 
AC3 Software D MG 1403 ? 3 'binding site for residue MG D 1403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS D 891 ? CYS D 891 . ? 1_555 ? 
2  AC1 4 CYS D 968 ? CYS D 968 . ? 1_555 ? 
3  AC1 4 CYS D 975 ? CYS D 975 . ? 1_555 ? 
4  AC1 4 CYS D 978 ? CYS D 978 . ? 1_555 ? 
5  AC2 4 CYS D 60  ? CYS D 60  . ? 1_555 ? 
6  AC2 4 CYS D 62  ? CYS D 62  . ? 1_555 ? 
7  AC2 4 CYS D 75  ? CYS D 75  . ? 1_555 ? 
8  AC2 4 CYS D 78  ? CYS D 78  . ? 1_555 ? 
9  AC3 3 ASP D 535 ? ASP D 535 . ? 1_555 ? 
10 AC3 3 ASP D 537 ? ASP D 537 . ? 1_555 ? 
11 AC3 3 ASP D 539 ? ASP D 539 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5UHA 
_atom_sites.fract_transf_matrix[1][1]   0.006658 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006117 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005111 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ILE A 1 3    ? -18.486 -0.377  -55.075 1.00 123.26 ? 3    ILE A N     1 
ATOM   2     C  CA    . ILE A 1 3    ? -18.152 -0.153  -56.476 1.00 129.77 ? 3    ILE A CA    1 
ATOM   3     C  C     . ILE A 1 3    ? -18.665 1.212   -56.933 1.00 137.53 ? 3    ILE A C     1 
ATOM   4     O  O     . ILE A 1 3    ? -19.362 1.324   -57.942 1.00 138.52 ? 3    ILE A O     1 
ATOM   5     C  CB    . ILE A 1 3    ? -18.736 -1.262  -57.376 1.00 130.46 ? 3    ILE A CB    1 
ATOM   6     C  CG1   . ILE A 1 3    ? -18.749 -2.599  -56.630 1.00 117.22 ? 3    ILE A CG1   1 
ATOM   7     C  CG2   . ILE A 1 3    ? -17.947 -1.372  -58.677 1.00 132.49 ? 3    ILE A CG2   1 
ATOM   8     C  CD1   . ILE A 1 3    ? -19.316 -3.749  -57.434 1.00 112.30 ? 3    ILE A CD1   1 
ATOM   9     N  N     . SER A 1 4    ? -18.318 2.248   -56.175 1.00 153.19 ? 4    SER A N     1 
ATOM   10    C  CA    . SER A 1 4    ? -18.745 3.608   -56.488 1.00 156.46 ? 4    SER A CA    1 
ATOM   11    C  C     . SER A 1 4    ? -17.807 4.650   -55.878 1.00 155.12 ? 4    SER A C     1 
ATOM   12    O  O     . SER A 1 4    ? -17.179 4.410   -54.845 1.00 151.23 ? 4    SER A O     1 
ATOM   13    C  CB    . SER A 1 4    ? -20.177 3.845   -56.002 1.00 152.38 ? 4    SER A CB    1 
ATOM   14    O  OG    . SER A 1 4    ? -20.293 3.626   -54.605 1.00 150.88 ? 4    SER A OG    1 
ATOM   15    N  N     . GLN A 1 5    ? -17.720 5.809   -56.524 1.00 154.51 ? 5    GLN A N     1 
ATOM   16    C  CA    . GLN A 1 5    ? -16.846 6.883   -56.063 1.00 149.28 ? 5    GLN A CA    1 
ATOM   17    C  C     . GLN A 1 5    ? -17.571 8.224   -55.979 1.00 147.94 ? 5    GLN A C     1 
ATOM   18    O  O     . GLN A 1 5    ? -18.096 8.719   -56.978 1.00 148.09 ? 5    GLN A O     1 
ATOM   19    C  CB    . GLN A 1 5    ? -15.631 7.015   -56.983 1.00 146.39 ? 5    GLN A CB    1 
ATOM   20    C  CG    . GLN A 1 5    ? -14.599 5.908   -56.840 1.00 136.99 ? 5    GLN A CG    1 
ATOM   21    C  CD    . GLN A 1 5    ? -13.415 6.099   -57.770 1.00 135.42 ? 5    GLN A CD    1 
ATOM   22    O  OE1   . GLN A 1 5    ? -12.275 5.800   -57.414 1.00 133.66 ? 5    GLN A OE1   1 
ATOM   23    N  NE2   . GLN A 1 5    ? -13.683 6.599   -58.971 1.00 128.22 ? 5    GLN A NE2   1 
ATOM   24    N  N     . ARG A 1 6    ? -17.591 8.803   -54.782 1.00 137.39 ? 6    ARG A N     1 
ATOM   25    C  CA    . ARG A 1 6    ? -18.162 10.127  -54.560 1.00 127.79 ? 6    ARG A CA    1 
ATOM   26    C  C     . ARG A 1 6    ? -17.456 10.840  -53.410 1.00 122.40 ? 6    ARG A C     1 
ATOM   27    O  O     . ARG A 1 6    ? -17.411 10.323  -52.294 1.00 121.53 ? 6    ARG A O     1 
ATOM   28    C  CB    . ARG A 1 6    ? -19.662 10.038  -54.259 1.00 128.48 ? 6    ARG A CB    1 
ATOM   29    C  CG    . ARG A 1 6    ? -20.555 9.834   -55.473 1.00 136.08 ? 6    ARG A CG    1 
ATOM   30    C  CD    . ARG A 1 6    ? -22.022 9.824   -55.079 1.00 139.23 ? 6    ARG A CD    1 
ATOM   31    N  NE    . ARG A 1 6    ? -22.292 8.863   -54.013 1.00 143.21 ? 6    ARG A NE    1 
ATOM   32    C  CZ    . ARG A 1 6    ? -22.576 7.581   -54.214 1.00 143.55 ? 6    ARG A CZ    1 
ATOM   33    N  NH1   . ARG A 1 6    ? -22.629 7.097   -55.448 1.00 140.52 ? 6    ARG A NH1   1 
ATOM   34    N  NH2   . ARG A 1 6    ? -22.808 6.780   -53.182 1.00 140.98 ? 6    ARG A NH2   1 
ATOM   35    N  N     . PRO A 1 7    ? -16.893 12.028  -53.684 1.00 112.56 ? 7    PRO A N     1 
ATOM   36    C  CA    . PRO A 1 7    ? -16.348 12.884  -52.624 1.00 105.59 ? 7    PRO A CA    1 
ATOM   37    C  C     . PRO A 1 7    ? -17.403 13.186  -51.563 1.00 100.05 ? 7    PRO A C     1 
ATOM   38    O  O     . PRO A 1 7    ? -18.569 13.405  -51.892 1.00 102.18 ? 7    PRO A O     1 
ATOM   39    C  CB    . PRO A 1 7    ? -15.932 14.150  -53.376 1.00 106.18 ? 7    PRO A CB    1 
ATOM   40    C  CG    . PRO A 1 7    ? -15.636 13.672  -54.760 1.00 108.12 ? 7    PRO A CG    1 
ATOM   41    C  CD    . PRO A 1 7    ? -16.638 12.583  -55.024 1.00 114.76 ? 7    PRO A CD    1 
ATOM   42    N  N     . THR A 1 8    ? -16.994 13.191  -50.302 1.00 84.11  ? 8    THR A N     1 
ATOM   43    C  CA    . THR A 1 8    ? -17.938 13.251  -49.195 1.00 78.05  ? 8    THR A CA    1 
ATOM   44    C  C     . THR A 1 8    ? -18.425 14.669  -48.906 1.00 70.08  ? 8    THR A C     1 
ATOM   45    O  O     . THR A 1 8    ? -17.850 15.644  -49.383 1.00 66.74  ? 8    THR A O     1 
ATOM   46    C  CB    . THR A 1 8    ? -17.310 12.660  -47.927 1.00 78.28  ? 8    THR A CB    1 
ATOM   47    O  OG1   . THR A 1 8    ? -16.187 13.458  -47.536 1.00 79.77  ? 8    THR A OG1   1 
ATOM   48    C  CG2   . THR A 1 8    ? -16.835 11.245  -48.194 1.00 70.50  ? 8    THR A CG2   1 
ATOM   49    N  N     . LEU A 1 9    ? -19.494 14.770  -48.121 1.00 70.11  ? 9    LEU A N     1 
ATOM   50    C  CA    . LEU A 1 9    ? -20.076 16.061  -47.771 1.00 65.30  ? 9    LEU A CA    1 
ATOM   51    C  C     . LEU A 1 9    ? -19.982 16.349  -46.276 1.00 68.77  ? 9    LEU A C     1 
ATOM   52    O  O     . LEU A 1 9    ? -19.658 15.467  -45.485 1.00 78.03  ? 9    LEU A O     1 
ATOM   53    C  CB    . LEU A 1 9    ? -21.538 16.122  -48.211 1.00 72.91  ? 9    LEU A CB    1 
ATOM   54    C  CG    . LEU A 1 9    ? -21.800 16.071  -49.715 1.00 85.67  ? 9    LEU A CG    1 
ATOM   55    C  CD1   . LEU A 1 9    ? -23.276 16.311  -50.013 1.00 80.26  ? 9    LEU A CD1   1 
ATOM   56    C  CD2   . LEU A 1 9    ? -20.925 17.083  -50.440 1.00 88.25  ? 9    LEU A CD2   1 
ATOM   57    N  N     . SER A 1 10   ? -20.276 17.589  -45.895 1.00 65.21  ? 10   SER A N     1 
ATOM   58    C  CA    . SER A 1 10   ? -20.276 17.986  -44.490 1.00 59.39  ? 10   SER A CA    1 
ATOM   59    C  C     . SER A 1 10   ? -21.424 18.949  -44.196 1.00 58.49  ? 10   SER A C     1 
ATOM   60    O  O     . SER A 1 10   ? -21.233 20.165  -44.165 1.00 51.07  ? 10   SER A O     1 
ATOM   61    C  CB    . SER A 1 10   ? -18.940 18.626  -44.114 1.00 54.62  ? 10   SER A CB    1 
ATOM   62    O  OG    . SER A 1 10   ? -18.903 18.942  -42.737 1.00 52.44  ? 10   SER A OG    1 
ATOM   63    N  N     . GLU A 1 11   ? -22.615 18.394  -43.982 1.00 57.84  ? 11   GLU A N     1 
ATOM   64    C  CA    . GLU A 1 11   ? -23.824 19.190  -43.780 1.00 57.53  ? 11   GLU A CA    1 
ATOM   65    C  C     . GLU A 1 11   ? -23.935 19.674  -42.343 1.00 49.79  ? 11   GLU A C     1 
ATOM   66    O  O     . GLU A 1 11   ? -23.075 19.373  -41.519 1.00 55.83  ? 11   GLU A O     1 
ATOM   67    C  CB    . GLU A 1 11   ? -25.067 18.380  -44.152 1.00 71.86  ? 11   GLU A CB    1 
ATOM   68    C  CG    . GLU A 1 11   ? -25.002 17.742  -45.533 1.00 89.62  ? 11   GLU A CG    1 
ATOM   69    C  CD    . GLU A 1 11   ? -26.276 17.003  -45.905 1.00 98.23  ? 11   GLU A CD    1 
ATOM   70    O  OE1   . GLU A 1 11   ? -27.308 17.211  -45.231 1.00 99.95  ? 11   GLU A OE1   1 
ATOM   71    O  OE2   . GLU A 1 11   ? -26.243 16.214  -46.874 1.00 94.03  ? 11   GLU A OE2   1 
ATOM   72    N  N     . ASP A 1 12   ? -24.998 20.415  -42.039 1.00 50.99  ? 12   ASP A N     1 
ATOM   73    C  CA    . ASP A 1 12   ? -25.179 20.959  -40.697 1.00 48.68  ? 12   ASP A CA    1 
ATOM   74    C  C     . ASP A 1 12   ? -26.641 21.223  -40.352 1.00 47.43  ? 12   ASP A C     1 
ATOM   75    O  O     . ASP A 1 12   ? -27.312 22.026  -40.995 1.00 52.78  ? 12   ASP A O     1 
ATOM   76    C  CB    . ASP A 1 12   ? -24.380 22.257  -40.540 1.00 47.92  ? 12   ASP A CB    1 
ATOM   77    C  CG    . ASP A 1 12   ? -24.227 22.686  -39.084 1.00 52.31  ? 12   ASP A CG    1 
ATOM   78    O  OD1   . ASP A 1 12   ? -25.041 22.271  -38.233 1.00 52.33  ? 12   ASP A OD1   1 
ATOM   79    O  OD2   . ASP A 1 12   ? -23.284 23.449  -38.788 1.00 58.01  ? 12   ASP A OD2   1 
ATOM   80    N  N     . VAL A 1 13   ? -27.124 20.549  -39.317 1.00 41.51  ? 13   VAL A N     1 
ATOM   81    C  CA    . VAL A 1 13   ? -28.403 20.897  -38.723 1.00 42.20  ? 13   VAL A CA    1 
ATOM   82    C  C     . VAL A 1 13   ? -28.113 21.482  -37.343 1.00 47.63  ? 13   VAL A C     1 
ATOM   83    O  O     . VAL A 1 13   ? -27.280 20.956  -36.608 1.00 55.93  ? 13   VAL A O     1 
ATOM   84    C  CB    . VAL A 1 13   ? -29.335 19.687  -38.627 1.00 42.02  ? 13   VAL A CB    1 
ATOM   85    C  CG1   . VAL A 1 13   ? -30.775 20.154  -38.483 1.00 45.66  ? 13   VAL A CG1   1 
ATOM   86    C  CG2   . VAL A 1 13   ? -29.175 18.800  -39.859 1.00 28.43  ? 13   VAL A CG2   1 
ATOM   87    N  N     . LEU A 1 14   ? -28.778 22.576  -36.990 1.00 44.08  ? 14   LEU A N     1 
ATOM   88    C  CA    . LEU A 1 14   ? -28.325 23.361  -35.844 1.00 44.11  ? 14   LEU A CA    1 
ATOM   89    C  C     . LEU A 1 14   ? -29.244 23.387  -34.628 1.00 44.89  ? 14   LEU A C     1 
ATOM   90    O  O     . LEU A 1 14   ? -30.376 22.900  -34.653 1.00 41.21  ? 14   LEU A O     1 
ATOM   91    C  CB    . LEU A 1 14   ? -28.077 24.811  -36.275 1.00 49.15  ? 14   LEU A CB    1 
ATOM   92    C  CG    . LEU A 1 14   ? -26.882 25.164  -37.164 1.00 53.10  ? 14   LEU A CG    1 
ATOM   93    C  CD1   . LEU A 1 14   ? -27.070 26.562  -37.716 1.00 55.00  ? 14   LEU A CD1   1 
ATOM   94    C  CD2   . LEU A 1 14   ? -25.575 25.078  -36.397 1.00 48.93  ? 14   LEU A CD2   1 
ATOM   95    N  N     . THR A 1 15   ? -28.692 23.952  -33.558 1.00 47.98  ? 15   THR A N     1 
ATOM   96    C  CA    . THR A 1 15   ? -29.418 24.458  -32.397 1.00 47.88  ? 15   THR A CA    1 
ATOM   97    C  C     . THR A 1 15   ? -28.414 25.369  -31.684 1.00 50.81  ? 15   THR A C     1 
ATOM   98    O  O     . THR A 1 15   ? -27.210 25.112  -31.735 1.00 50.07  ? 15   THR A O     1 
ATOM   99    C  CB    . THR A 1 15   ? -29.933 23.346  -31.464 1.00 36.51  ? 15   THR A CB    1 
ATOM   100   O  OG1   . THR A 1 15   ? -30.732 22.423  -32.213 1.00 29.63  ? 15   THR A OG1   1 
ATOM   101   C  CG2   . THR A 1 15   ? -30.779 23.937  -30.351 1.00 27.89  ? 15   THR A CG2   1 
ATOM   102   N  N     . ASP A 1 16   ? -28.901 26.433  -31.048 1.00 54.60  ? 16   ASP A N     1 
ATOM   103   C  CA    . ASP A 1 16   ? -28.044 27.521  -30.561 1.00 65.14  ? 16   ASP A CA    1 
ATOM   104   C  C     . ASP A 1 16   ? -26.790 27.034  -29.834 1.00 55.93  ? 16   ASP A C     1 
ATOM   105   O  O     . ASP A 1 16   ? -25.678 27.474  -30.131 1.00 45.01  ? 16   ASP A O     1 
ATOM   106   C  CB    . ASP A 1 16   ? -28.838 28.455  -29.639 1.00 72.87  ? 16   ASP A CB    1 
ATOM   107   C  CG    . ASP A 1 16   ? -28.205 29.841  -29.511 1.00 71.58  ? 16   ASP A CG    1 
ATOM   108   O  OD1   . ASP A 1 16   ? -26.975 29.970  -29.689 1.00 61.25  ? 16   ASP A OD1   1 
ATOM   109   O  OD2   . ASP A 1 16   ? -28.944 30.809  -29.234 1.00 76.31  ? 16   ASP A OD2   1 
ATOM   110   N  N     . ASN A 1 17   ? -26.968 26.111  -28.898 1.00 53.66  ? 17   ASN A N     1 
ATOM   111   C  CA    . ASN A 1 17   ? -25.843 25.647  -28.102 1.00 54.44  ? 17   ASN A CA    1 
ATOM   112   C  C     . ASN A 1 17   ? -25.164 24.427  -28.704 1.00 51.05  ? 17   ASN A C     1 
ATOM   113   O  O     . ASN A 1 17   ? -23.958 24.249  -28.558 1.00 51.76  ? 17   ASN A O     1 
ATOM   114   C  CB    . ASN A 1 17   ? -26.292 25.335  -26.676 1.00 54.64  ? 17   ASN A CB    1 
ATOM   115   C  CG    . ASN A 1 17   ? -25.132 25.285  -25.707 1.00 50.78  ? 17   ASN A CG    1 
ATOM   116   O  OD1   . ASN A 1 17   ? -23.994 25.587  -26.069 1.00 50.54  ? 17   ASN A OD1   1 
ATOM   117   N  ND2   . ASN A 1 17   ? -25.413 24.918  -24.465 1.00 54.57  ? 17   ASN A ND2   1 
ATOM   118   N  N     . ARG A 1 18   ? -25.939 23.587  -29.381 1.00 48.16  ? 18   ARG A N     1 
ATOM   119   C  CA    . ARG A 1 18   ? -25.412 22.334  -29.908 1.00 45.71  ? 18   ARG A CA    1 
ATOM   120   C  C     . ARG A 1 18   ? -25.828 22.121  -31.355 1.00 42.40  ? 18   ARG A C     1 
ATOM   121   O  O     . ARG A 1 18   ? -26.935 22.468  -31.744 1.00 51.47  ? 18   ARG A O     1 
ATOM   122   C  CB    . ARG A 1 18   ? -25.868 21.154  -29.037 1.00 41.93  ? 18   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1 18   ? -27.370 21.025  -28.883 1.00 33.09  ? 18   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1 18   ? -27.744 19.879  -27.946 1.00 30.43  ? 18   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1 18   ? -27.284 18.582  -28.437 1.00 25.31  ? 18   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1 18   ? -27.710 17.412  -27.964 1.00 29.42  ? 18   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1 18   ? -28.616 17.368  -26.991 1.00 33.50  ? 18   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1 18   ? -27.239 16.279  -28.467 1.00 21.56  ? 18   ARG A NH2   1 
ATOM   129   N  N     . SER A 1 19   ? -24.937 21.544  -32.152 1.00 38.17  ? 19   SER A N     1 
ATOM   130   C  CA    . SER A 1 19   ? -25.220 21.359  -33.568 1.00 41.05  ? 19   SER A CA    1 
ATOM   131   C  C     . SER A 1 19   ? -24.824 19.971  -34.051 1.00 39.56  ? 19   SER A C     1 
ATOM   132   O  O     . SER A 1 19   ? -23.743 19.481  -33.732 1.00 42.41  ? 19   SER A O     1 
ATOM   133   C  CB    . SER A 1 19   ? -24.496 22.415  -34.395 1.00 38.48  ? 19   SER A CB    1 
ATOM   134   O  OG    . SER A 1 19   ? -23.125 22.106  -34.512 1.00 38.12  ? 19   SER A OG    1 
ATOM   135   N  N     . GLN A 1 20   ? -25.701 19.343  -34.825 1.00 31.41  ? 20   GLN A N     1 
ATOM   136   C  CA    . GLN A 1 20   ? -25.405 18.044  -35.410 1.00 24.00  ? 20   GLN A CA    1 
ATOM   137   C  C     . GLN A 1 20   ? -24.724 18.196  -36.761 1.00 29.90  ? 20   GLN A C     1 
ATOM   138   O  O     . GLN A 1 20   ? -25.172 18.969  -37.603 1.00 36.17  ? 20   GLN A O     1 
ATOM   139   C  CB    . GLN A 1 20   ? -26.676 17.220  -35.573 1.00 21.54  ? 20   GLN A CB    1 
ATOM   140   C  CG    . GLN A 1 20   ? -27.372 16.863  -34.282 1.00 22.23  ? 20   GLN A CG    1 
ATOM   141   C  CD    . GLN A 1 20   ? -28.483 15.863  -34.508 1.00 27.70  ? 20   GLN A CD    1 
ATOM   142   O  OE1   . GLN A 1 20   ? -28.559 15.243  -35.565 1.00 32.01  ? 20   GLN A OE1   1 
ATOM   143   N  NE2   . GLN A 1 20   ? -29.354 15.703  -33.520 1.00 28.42  ? 20   GLN A NE2   1 
ATOM   144   N  N     . PHE A 1 21   ? -23.643 17.452  -36.963 1.00 37.22  ? 21   PHE A N     1 
ATOM   145   C  CA    . PHE A 1 21   ? -22.944 17.437  -38.245 1.00 39.72  ? 21   PHE A CA    1 
ATOM   146   C  C     . PHE A 1 21   ? -23.177 16.124  -38.983 1.00 44.31  ? 21   PHE A C     1 
ATOM   147   O  O     . PHE A 1 21   ? -22.986 15.046  -38.424 1.00 41.59  ? 21   PHE A O     1 
ATOM   148   C  CB    . PHE A 1 21   ? -21.443 17.663  -38.049 1.00 28.53  ? 21   PHE A CB    1 
ATOM   149   C  CG    . PHE A 1 21   ? -21.095 19.038  -37.568 1.00 23.54  ? 21   PHE A CG    1 
ATOM   150   C  CD1   . PHE A 1 21   ? -20.783 20.041  -38.465 1.00 28.77  ? 21   PHE A CD1   1 
ATOM   151   C  CD2   . PHE A 1 21   ? -21.081 19.327  -36.218 1.00 27.11  ? 21   PHE A CD2   1 
ATOM   152   C  CE1   . PHE A 1 21   ? -20.462 21.307  -38.025 1.00 31.45  ? 21   PHE A CE1   1 
ATOM   153   C  CE2   . PHE A 1 21   ? -20.760 20.588  -35.773 1.00 30.71  ? 21   PHE A CE2   1 
ATOM   154   C  CZ    . PHE A 1 21   ? -20.451 21.581  -36.677 1.00 32.91  ? 21   PHE A CZ    1 
ATOM   155   N  N     . VAL A 1 22   ? -23.595 16.223  -40.241 1.00 57.26  ? 22   VAL A N     1 
ATOM   156   C  CA    . VAL A 1 22   ? -23.829 15.047  -41.067 1.00 53.29  ? 22   VAL A CA    1 
ATOM   157   C  C     . VAL A 1 22   ? -22.740 14.915  -42.122 1.00 56.57  ? 22   VAL A C     1 
ATOM   158   O  O     . VAL A 1 22   ? -22.445 15.867  -42.847 1.00 53.53  ? 22   VAL A O     1 
ATOM   159   C  CB    . VAL A 1 22   ? -25.201 15.100  -41.758 1.00 58.86  ? 22   VAL A CB    1 
ATOM   160   C  CG1   . VAL A 1 22   ? -25.424 13.851  -42.594 1.00 63.58  ? 22   VAL A CG1   1 
ATOM   161   C  CG2   . VAL A 1 22   ? -26.303 15.258  -40.725 1.00 63.25  ? 22   VAL A CG2   1 
ATOM   162   N  N     . ILE A 1 23   ? -22.143 13.731  -42.196 1.00 59.41  ? 23   ILE A N     1 
ATOM   163   C  CA    . ILE A 1 23   ? -21.066 13.466  -43.141 1.00 61.92  ? 23   ILE A CA    1 
ATOM   164   C  C     . ILE A 1 23   ? -21.314 12.170  -43.910 1.00 63.95  ? 23   ILE A C     1 
ATOM   165   O  O     . ILE A 1 23   ? -21.411 11.090  -43.325 1.00 59.09  ? 23   ILE A O     1 
ATOM   166   C  CB    . ILE A 1 23   ? -19.703 13.402  -42.427 1.00 52.11  ? 23   ILE A CB    1 
ATOM   167   C  CG1   . ILE A 1 23   ? -19.302 14.798  -41.947 1.00 44.80  ? 23   ILE A CG1   1 
ATOM   168   C  CG2   . ILE A 1 23   ? -18.639 12.840  -43.352 1.00 54.94  ? 23   ILE A CG2   1 
ATOM   169   C  CD1   . ILE A 1 23   ? -17.910 14.872  -41.381 1.00 42.71  ? 23   ILE A CD1   1 
ATOM   170   N  N     . GLU A 1 24   ? -21.419 12.298  -45.230 1.00 72.34  ? 24   GLU A N     1 
ATOM   171   C  CA    . GLU A 1 24   ? -21.734 11.179  -46.108 1.00 74.98  ? 24   GLU A CA    1 
ATOM   172   C  C     . GLU A 1 24   ? -21.286 11.487  -47.537 1.00 69.95  ? 24   GLU A C     1 
ATOM   173   O  O     . GLU A 1 24   ? -21.170 12.654  -47.911 1.00 64.30  ? 24   GLU A O     1 
ATOM   174   C  CB    . GLU A 1 24   ? -23.236 10.880  -46.070 1.00 76.99  ? 24   GLU A CB    1 
ATOM   175   C  CG    . GLU A 1 24   ? -24.108 12.023  -46.559 1.00 70.86  ? 24   GLU A CG    1 
ATOM   176   C  CD    . GLU A 1 24   ? -25.579 11.663  -46.581 1.00 72.75  ? 24   GLU A CD    1 
ATOM   177   O  OE1   . GLU A 1 24   ? -25.906 10.470  -46.412 1.00 71.29  ? 24   GLU A OE1   1 
ATOM   178   O  OE2   . GLU A 1 24   ? -26.410 12.576  -46.765 1.00 75.54  ? 24   GLU A OE2   1 
ATOM   179   N  N     . PRO A 1 25   ? -21.026 10.445  -48.344 1.00 74.38  ? 25   PRO A N     1 
ATOM   180   C  CA    . PRO A 1 25   ? -21.050 9.018   -48.010 1.00 80.29  ? 25   PRO A CA    1 
ATOM   181   C  C     . PRO A 1 25   ? -19.669 8.470   -47.664 1.00 74.86  ? 25   PRO A C     1 
ATOM   182   O  O     . PRO A 1 25   ? -18.685 8.775   -48.338 1.00 66.94  ? 25   PRO A O     1 
ATOM   183   C  CB    . PRO A 1 25   ? -21.584 8.382   -49.291 1.00 83.14  ? 25   PRO A CB    1 
ATOM   184   C  CG    . PRO A 1 25   ? -21.027 9.257   -50.372 1.00 93.42  ? 25   PRO A CG    1 
ATOM   185   C  CD    . PRO A 1 25   ? -20.883 10.652  -49.796 1.00 82.33  ? 25   PRO A CD    1 
ATOM   186   N  N     . LEU A 1 26   ? -19.604 7.657   -46.618 1.00 72.84  ? 26   LEU A N     1 
ATOM   187   C  CA    . LEU A 1 26   ? -18.335 7.114   -46.159 1.00 66.52  ? 26   LEU A CA    1 
ATOM   188   C  C     . LEU A 1 26   ? -18.242 5.614   -46.396 1.00 73.33  ? 26   LEU A C     1 
ATOM   189   O  O     . LEU A 1 26   ? -19.234 4.961   -46.717 1.00 76.35  ? 26   LEU A O     1 
ATOM   190   C  CB    . LEU A 1 26   ? -18.140 7.425   -44.679 1.00 66.36  ? 26   LEU A CB    1 
ATOM   191   C  CG    . LEU A 1 26   ? -17.987 8.916   -44.386 1.00 73.44  ? 26   LEU A CG    1 
ATOM   192   C  CD1   . LEU A 1 26   ? -18.289 9.210   -42.930 1.00 73.85  ? 26   LEU A CD1   1 
ATOM   193   C  CD2   . LEU A 1 26   ? -16.584 9.380   -44.753 1.00 76.07  ? 26   LEU A CD2   1 
ATOM   194   N  N     . GLU A 1 27   ? -17.034 5.082   -46.239 1.00 72.63  ? 27   GLU A N     1 
ATOM   195   C  CA    . GLU A 1 27   ? -16.768 3.658   -46.407 1.00 69.37  ? 27   GLU A CA    1 
ATOM   196   C  C     . GLU A 1 27   ? -17.604 2.821   -45.441 1.00 66.41  ? 27   GLU A C     1 
ATOM   197   O  O     . GLU A 1 27   ? -17.945 3.284   -44.356 1.00 73.49  ? 27   GLU A O     1 
ATOM   198   C  CB    . GLU A 1 27   ? -15.277 3.380   -46.199 1.00 69.30  ? 27   GLU A CB    1 
ATOM   199   C  CG    . GLU A 1 27   ? -14.366 4.201   -47.100 1.00 73.53  ? 27   GLU A CG    1 
ATOM   200   C  CD    . GLU A 1 27   ? -14.467 3.789   -48.555 1.00 76.97  ? 27   GLU A CD    1 
ATOM   201   O  OE1   . GLU A 1 27   ? -14.738 2.598   -48.813 1.00 81.49  ? 27   GLU A OE1   1 
ATOM   202   O  OE2   . GLU A 1 27   ? -14.281 4.652   -49.439 1.00 73.06  ? 27   GLU A OE2   1 
ATOM   203   N  N     . PRO A 1 28   ? -17.948 1.586   -45.836 1.00 63.65  ? 28   PRO A N     1 
ATOM   204   C  CA    . PRO A 1 28   ? -18.729 0.698   -44.964 1.00 66.97  ? 28   PRO A CA    1 
ATOM   205   C  C     . PRO A 1 28   ? -17.979 0.285   -43.698 1.00 64.44  ? 28   PRO A C     1 
ATOM   206   O  O     . PRO A 1 28   ? -16.855 -0.207  -43.781 1.00 72.09  ? 28   PRO A O     1 
ATOM   207   C  CB    . PRO A 1 28   ? -18.995 -0.520  -45.855 1.00 75.25  ? 28   PRO A CB    1 
ATOM   208   C  CG    . PRO A 1 28   ? -17.899 -0.490  -46.872 1.00 78.17  ? 28   PRO A CG    1 
ATOM   209   C  CD    . PRO A 1 28   ? -17.653 0.961   -47.137 1.00 68.51  ? 28   PRO A CD    1 
ATOM   210   N  N     . GLY A 1 29   ? -18.603 0.479   -42.541 1.00 61.73  ? 29   GLY A N     1 
ATOM   211   C  CA    . GLY A 1 29   ? -17.979 0.135   -41.277 1.00 56.17  ? 29   GLY A CA    1 
ATOM   212   C  C     . GLY A 1 29   ? -16.803 1.046   -41.005 1.00 45.76  ? 29   GLY A C     1 
ATOM   213   O  O     . GLY A 1 29   ? -15.718 0.595   -40.638 1.00 42.42  ? 29   GLY A O     1 
ATOM   214   N  N     . PHE A 1 30   ? -17.028 2.340   -41.191 1.00 37.84  ? 30   PHE A N     1 
ATOM   215   C  CA    . PHE A 1 30   ? -15.968 3.326   -41.066 1.00 35.55  ? 30   PHE A CA    1 
ATOM   216   C  C     . PHE A 1 30   ? -16.424 4.504   -40.220 1.00 32.66  ? 30   PHE A C     1 
ATOM   217   O  O     . PHE A 1 30   ? -15.619 5.138   -39.543 1.00 38.24  ? 30   PHE A O     1 
ATOM   218   C  CB    . PHE A 1 30   ? -15.532 3.811   -42.448 1.00 38.88  ? 30   PHE A CB    1 
ATOM   219   C  CG    . PHE A 1 30   ? -14.216 4.522   -42.454 1.00 36.32  ? 30   PHE A CG    1 
ATOM   220   C  CD1   . PHE A 1 30   ? -14.144 5.879   -42.194 1.00 36.94  ? 30   PHE A CD1   1 
ATOM   221   C  CD2   . PHE A 1 30   ? -13.050 3.833   -42.728 1.00 37.01  ? 30   PHE A CD2   1 
ATOM   222   C  CE1   . PHE A 1 30   ? -12.931 6.533   -42.200 1.00 43.25  ? 30   PHE A CE1   1 
ATOM   223   C  CE2   . PHE A 1 30   ? -11.834 4.480   -42.738 1.00 41.50  ? 30   PHE A CE2   1 
ATOM   224   C  CZ    . PHE A 1 30   ? -11.773 5.832   -42.474 1.00 46.06  ? 30   PHE A CZ    1 
ATOM   225   N  N     . GLY A 1 31   ? -17.721 4.788   -40.261 1.00 30.37  ? 31   GLY A N     1 
ATOM   226   C  CA    . GLY A 1 31   ? -18.274 5.954   -39.596 1.00 31.92  ? 31   GLY A CA    1 
ATOM   227   C  C     . GLY A 1 31   ? -18.080 5.957   -38.093 1.00 29.63  ? 31   GLY A C     1 
ATOM   228   O  O     . GLY A 1 31   ? -17.946 7.016   -37.479 1.00 31.42  ? 31   GLY A O     1 
ATOM   229   N  N     . TYR A 1 32   ? -18.062 4.768   -37.502 1.00 27.27  ? 32   TYR A N     1 
ATOM   230   C  CA    . TYR A 1 32   ? -17.914 4.632   -36.059 1.00 20.75  ? 32   TYR A CA    1 
ATOM   231   C  C     . TYR A 1 32   ? -16.539 5.070   -35.576 1.00 24.63  ? 32   TYR A C     1 
ATOM   232   O  O     . TYR A 1 32   ? -16.429 5.920   -34.694 1.00 31.68  ? 32   TYR A O     1 
ATOM   233   C  CB    . TYR A 1 32   ? -18.178 3.192   -35.634 1.00 14.17  ? 32   TYR A CB    1 
ATOM   234   C  CG    . TYR A 1 32   ? -19.639 2.905   -35.402 1.00 18.88  ? 32   TYR A CG    1 
ATOM   235   C  CD1   . TYR A 1 32   ? -20.528 3.931   -35.119 1.00 23.02  ? 32   TYR A CD1   1 
ATOM   236   C  CD2   . TYR A 1 32   ? -20.130 1.611   -35.464 1.00 26.87  ? 32   TYR A CD2   1 
ATOM   237   C  CE1   . TYR A 1 32   ? -21.867 3.678   -34.904 1.00 23.73  ? 32   TYR A CE1   1 
ATOM   238   C  CE2   . TYR A 1 32   ? -21.467 1.346   -35.248 1.00 28.30  ? 32   TYR A CE2   1 
ATOM   239   C  CZ    . TYR A 1 32   ? -22.331 2.382   -34.969 1.00 22.91  ? 32   TYR A CZ    1 
ATOM   240   O  OH    . TYR A 1 32   ? -23.664 2.120   -34.755 1.00 19.62  ? 32   TYR A OH    1 
ATOM   241   N  N     . THR A 1 33   ? -15.489 4.497   -36.156 1.00 27.91  ? 33   THR A N     1 
ATOM   242   C  CA    . THR A 1 33   ? -14.129 4.858   -35.769 1.00 23.69  ? 33   THR A CA    1 
ATOM   243   C  C     . THR A 1 33   ? -13.674 6.155   -36.419 1.00 21.32  ? 33   THR A C     1 
ATOM   244   O  O     . THR A 1 33   ? -12.512 6.537   -36.302 1.00 18.41  ? 33   THR A O     1 
ATOM   245   C  CB    . THR A 1 33   ? -13.117 3.765   -36.131 1.00 25.79  ? 33   THR A CB    1 
ATOM   246   O  OG1   . THR A 1 33   ? -11.794 4.238   -35.850 1.00 23.02  ? 33   THR A OG1   1 
ATOM   247   C  CG2   . THR A 1 33   ? -13.219 3.417   -37.604 1.00 29.87  ? 33   THR A CG2   1 
ATOM   248   N  N     . LEU A 1 34   ? -14.586 6.824   -37.113 1.00 22.56  ? 34   LEU A N     1 
ATOM   249   C  CA    . LEU A 1 34   ? -14.274 8.111   -37.711 1.00 24.84  ? 34   LEU A CA    1 
ATOM   250   C  C     . LEU A 1 34   ? -14.848 9.231   -36.853 1.00 26.86  ? 34   LEU A C     1 
ATOM   251   O  O     . LEU A 1 34   ? -14.183 10.233  -36.598 1.00 31.97  ? 34   LEU A O     1 
ATOM   252   C  CB    . LEU A 1 34   ? -14.811 8.191   -39.137 1.00 28.63  ? 34   LEU A CB    1 
ATOM   253   C  CG    . LEU A 1 34   ? -14.427 9.430   -39.945 1.00 35.00  ? 34   LEU A CG    1 
ATOM   254   C  CD1   . LEU A 1 34   ? -12.917 9.626   -39.976 1.00 31.38  ? 34   LEU A CD1   1 
ATOM   255   C  CD2   . LEU A 1 34   ? -14.982 9.314   -41.350 1.00 38.14  ? 34   LEU A CD2   1 
ATOM   256   N  N     . GLY A 1 35   ? -16.083 9.052   -36.400 1.00 24.17  ? 35   GLY A N     1 
ATOM   257   C  CA    . GLY A 1 35   ? -16.694 10.000  -35.489 1.00 25.80  ? 35   GLY A CA    1 
ATOM   258   C  C     . GLY A 1 35   ? -15.965 10.034  -34.159 1.00 19.14  ? 35   GLY A C     1 
ATOM   259   O  O     . GLY A 1 35   ? -15.760 11.098  -33.575 1.00 17.36  ? 35   GLY A O     1 
ATOM   260   N  N     . ASN A 1 36   ? -15.567 8.860   -33.683 1.00 18.78  ? 36   ASN A N     1 
ATOM   261   C  CA    . ASN A 1 36   ? -14.861 8.745   -32.416 1.00 16.14  ? 36   ASN A CA    1 
ATOM   262   C  C     . ASN A 1 36   ? -13.556 9.520   -32.441 1.00 14.68  ? 36   ASN A C     1 
ATOM   263   O  O     . ASN A 1 36   ? -13.178 10.151  -31.456 1.00 19.26  ? 36   ASN A O     1 
ATOM   264   C  CB    . ASN A 1 36   ? -14.597 7.275   -32.085 1.00 12.59  ? 36   ASN A CB    1 
ATOM   265   C  CG    . ASN A 1 36   ? -14.166 7.069   -30.649 1.00 7.64   ? 36   ASN A CG    1 
ATOM   266   O  OD1   . ASN A 1 36   ? -13.104 6.512   -30.380 1.00 7.58   ? 36   ASN A OD1   1 
ATOM   267   N  ND2   . ASN A 1 36   ? -14.991 7.523   -29.717 1.00 9.17   ? 36   ASN A ND2   1 
ATOM   268   N  N     . SER A 1 37   ? -12.883 9.486   -33.585 1.00 11.31  ? 37   SER A N     1 
ATOM   269   C  CA    . SER A 1 37   ? -11.607 10.166  -33.751 1.00 13.23  ? 37   SER A CA    1 
ATOM   270   C  C     . SER A 1 37   ? -11.752 11.678  -33.665 1.00 19.07  ? 37   SER A C     1 
ATOM   271   O  O     . SER A 1 37   ? -10.768 12.400  -33.512 1.00 25.62  ? 37   SER A O     1 
ATOM   272   C  CB    . SER A 1 37   ? -10.977 9.783   -35.085 1.00 18.87  ? 37   SER A CB    1 
ATOM   273   O  OG    . SER A 1 37   ? -10.884 8.378   -35.202 1.00 25.29  ? 37   SER A OG    1 
ATOM   274   N  N     . LEU A 1 38   ? -12.981 12.158  -33.775 1.00 15.85  ? 38   LEU A N     1 
ATOM   275   C  CA    . LEU A 1 38   ? -13.244 13.572  -33.579 1.00 19.46  ? 38   LEU A CA    1 
ATOM   276   C  C     . LEU A 1 38   ? -13.667 13.813  -32.136 1.00 18.72  ? 38   LEU A C     1 
ATOM   277   O  O     . LEU A 1 38   ? -13.313 14.827  -31.532 1.00 19.30  ? 38   LEU A O     1 
ATOM   278   C  CB    . LEU A 1 38   ? -14.314 14.055  -34.551 1.00 21.19  ? 38   LEU A CB    1 
ATOM   279   C  CG    . LEU A 1 38   ? -13.923 13.907  -36.021 1.00 20.64  ? 38   LEU A CG    1 
ATOM   280   C  CD1   . LEU A 1 38   ? -15.156 13.806  -36.897 1.00 24.01  ? 38   LEU A CD1   1 
ATOM   281   C  CD2   . LEU A 1 38   ? -13.052 15.071  -36.458 1.00 18.84  ? 38   LEU A CD2   1 
ATOM   282   N  N     . ARG A 1 39   ? -14.417 12.865  -31.585 1.00 19.22  ? 39   ARG A N     1 
ATOM   283   C  CA    . ARG A 1 39   ? -14.881 12.960  -30.207 1.00 18.32  ? 39   ARG A CA    1 
ATOM   284   C  C     . ARG A 1 39   ? -13.707 12.999  -29.252 1.00 14.58  ? 39   ARG A C     1 
ATOM   285   O  O     . ARG A 1 39   ? -13.713 13.730  -28.266 1.00 15.33  ? 39   ARG A O     1 
ATOM   286   C  CB    . ARG A 1 39   ? -15.796 11.785  -29.863 1.00 16.72  ? 39   ARG A CB    1 
ATOM   287   C  CG    . ARG A 1 39   ? -16.237 11.743  -28.412 1.00 10.76  ? 39   ARG A CG    1 
ATOM   288   C  CD    . ARG A 1 39   ? -17.189 10.588  -28.182 1.00 7.15   ? 39   ARG A CD    1 
ATOM   289   N  NE    . ARG A 1 39   ? -17.498 10.404  -26.769 1.00 2.87   ? 39   ARG A NE    1 
ATOM   290   C  CZ    . ARG A 1 39   ? -16.726 9.732   -25.924 1.00 9.67   ? 39   ARG A CZ    1 
ATOM   291   N  NH1   . ARG A 1 39   ? -15.598 9.182   -26.351 1.00 9.61   ? 39   ARG A NH1   1 
ATOM   292   N  NH2   . ARG A 1 39   ? -17.079 9.608   -24.653 1.00 12.87  ? 39   ARG A NH2   1 
ATOM   293   N  N     . ARG A 1 40   ? -12.695 12.202  -29.559 1.00 13.38  ? 40   ARG A N     1 
ATOM   294   C  CA    . ARG A 1 40   ? -11.500 12.147  -28.735 1.00 18.94  ? 40   ARG A CA    1 
ATOM   295   C  C     . ARG A 1 40   ? -10.630 13.368  -28.972 1.00 21.18  ? 40   ARG A C     1 
ATOM   296   O  O     . ARG A 1 40   ? -9.709  13.649  -28.208 1.00 24.61  ? 40   ARG A O     1 
ATOM   297   C  CB    . ARG A 1 40   ? -10.719 10.871  -29.020 1.00 15.10  ? 40   ARG A CB    1 
ATOM   298   C  CG    . ARG A 1 40   ? -11.517 9.623   -28.715 1.00 17.32  ? 40   ARG A CG    1 
ATOM   299   C  CD    . ARG A 1 40   ? -10.710 8.376   -28.979 1.00 14.03  ? 40   ARG A CD    1 
ATOM   300   N  NE    . ARG A 1 40   ? -9.395  8.439   -28.354 1.00 14.78  ? 40   ARG A NE    1 
ATOM   301   C  CZ    . ARG A 1 40   ? -9.171  8.225   -27.063 1.00 15.32  ? 40   ARG A CZ    1 
ATOM   302   N  NH1   . ARG A 1 40   ? -10.180 7.941   -26.248 1.00 14.66  ? 40   ARG A NH1   1 
ATOM   303   N  NH2   . ARG A 1 40   ? -7.936  8.300   -26.586 1.00 15.50  ? 40   ARG A NH2   1 
ATOM   304   N  N     . THR A 1 41   ? -10.925 14.104  -30.031 1.00 18.64  ? 41   THR A N     1 
ATOM   305   C  CA    . THR A 1 41   ? -10.168 15.306  -30.309 1.00 16.05  ? 41   THR A CA    1 
ATOM   306   C  C     . THR A 1 41   ? -10.802 16.474  -29.565 1.00 14.95  ? 41   THR A C     1 
ATOM   307   O  O     . THR A 1 41   ? -10.112 17.246  -28.898 1.00 16.11  ? 41   THR A O     1 
ATOM   308   C  CB    . THR A 1 41   ? -10.105 15.589  -31.814 1.00 24.11  ? 41   THR A CB    1 
ATOM   309   O  OG1   . THR A 1 41   ? -9.755  14.387  -32.512 1.00 24.24  ? 41   THR A OG1   1 
ATOM   310   C  CG2   . THR A 1 41   ? -9.060  16.646  -32.105 1.00 37.44  ? 41   THR A CG2   1 
ATOM   311   N  N     . LEU A 1 42   ? -12.126 16.568  -29.657 1.00 16.98  ? 42   LEU A N     1 
ATOM   312   C  CA    . LEU A 1 42   ? -12.891 17.670  -29.074 1.00 22.34  ? 42   LEU A CA    1 
ATOM   313   C  C     . LEU A 1 42   ? -12.701 17.826  -27.571 1.00 22.62  ? 42   LEU A C     1 
ATOM   314   O  O     . LEU A 1 42   ? -12.207 18.847  -27.093 1.00 23.81  ? 42   LEU A O     1 
ATOM   315   C  CB    . LEU A 1 42   ? -14.379 17.482  -29.370 1.00 16.65  ? 42   LEU A CB    1 
ATOM   316   C  CG    . LEU A 1 42   ? -14.804 17.778  -30.802 1.00 13.42  ? 42   LEU A CG    1 
ATOM   317   C  CD1   . LEU A 1 42   ? -16.148 17.153  -31.083 1.00 12.41  ? 42   LEU A CD1   1 
ATOM   318   C  CD2   . LEU A 1 42   ? -14.856 19.277  -31.019 1.00 21.20  ? 42   LEU A CD2   1 
ATOM   319   N  N     . LEU A 1 43   ? -13.112 16.799  -26.836 1.00 20.26  ? 43   LEU A N     1 
ATOM   320   C  CA    . LEU A 1 43   ? -13.082 16.802  -25.381 1.00 15.90  ? 43   LEU A CA    1 
ATOM   321   C  C     . LEU A 1 43   ? -11.703 17.124  -24.807 1.00 21.22  ? 43   LEU A C     1 
ATOM   322   O  O     . LEU A 1 43   ? -11.593 17.666  -23.710 1.00 25.71  ? 43   LEU A O     1 
ATOM   323   C  CB    . LEU A 1 43   ? -13.550 15.442  -24.858 1.00 12.24  ? 43   LEU A CB    1 
ATOM   324   C  CG    . LEU A 1 43   ? -14.885 14.930  -25.400 1.00 8.38   ? 43   LEU A CG    1 
ATOM   325   C  CD1   . LEU A 1 43   ? -15.020 13.434  -25.180 1.00 7.54   ? 43   LEU A CD1   1 
ATOM   326   C  CD2   . LEU A 1 43   ? -16.050 15.669  -24.760 1.00 17.88  ? 43   LEU A CD2   1 
ATOM   327   N  N     . SER A 1 44   ? -10.653 16.805  -25.558 1.00 18.73  ? 44   SER A N     1 
ATOM   328   C  CA    . SER A 1 44   ? -9.297  16.847  -25.022 1.00 16.80  ? 44   SER A CA    1 
ATOM   329   C  C     . SER A 1 44   ? -8.495  18.076  -25.420 1.00 14.69  ? 44   SER A C     1 
ATOM   330   O  O     . SER A 1 44   ? -7.924  18.753  -24.568 1.00 17.74  ? 44   SER A O     1 
ATOM   331   C  CB    . SER A 1 44   ? -8.528  15.605  -25.467 1.00 19.82  ? 44   SER A CB    1 
ATOM   332   O  OG    . SER A 1 44   ? -8.324  15.631  -26.874 1.00 19.59  ? 44   SER A OG    1 
ATOM   333   N  N     . SER A 1 45   ? -8.443  18.352  -26.718 1.00 14.70  ? 45   SER A N     1 
ATOM   334   C  CA    . SER A 1 45   ? -7.440  19.267  -27.239 1.00 19.05  ? 45   SER A CA    1 
ATOM   335   C  C     . SER A 1 45   ? -8.010  20.516  -27.908 1.00 20.32  ? 45   SER A C     1 
ATOM   336   O  O     . SER A 1 45   ? -7.347  21.127  -28.741 1.00 26.02  ? 45   SER A O     1 
ATOM   337   C  CB    . SER A 1 45   ? -6.542  18.519  -28.223 1.00 19.25  ? 45   SER A CB    1 
ATOM   338   O  OG    . SER A 1 45   ? -6.097  17.301  -27.656 1.00 18.72  ? 45   SER A OG    1 
ATOM   339   N  N     . ILE A 1 46   ? -9.228  20.905  -27.545 1.00 18.32  ? 46   ILE A N     1 
ATOM   340   C  CA    . ILE A 1 46   ? -9.787  22.157  -28.046 1.00 14.86  ? 46   ILE A CA    1 
ATOM   341   C  C     . ILE A 1 46   ? -9.443  23.314  -27.123 1.00 17.95  ? 46   ILE A C     1 
ATOM   342   O  O     . ILE A 1 46   ? -9.778  23.290  -25.948 1.00 26.42  ? 46   ILE A O     1 
ATOM   343   C  CB    . ILE A 1 46   ? -11.305 22.089  -28.198 1.00 15.75  ? 46   ILE A CB    1 
ATOM   344   C  CG1   . ILE A 1 46   ? -11.681 21.078  -29.275 1.00 13.93  ? 46   ILE A CG1   1 
ATOM   345   C  CG2   . ILE A 1 46   ? -11.855 23.456  -28.557 1.00 23.66  ? 46   ILE A CG2   1 
ATOM   346   C  CD1   . ILE A 1 46   ? -10.991 21.320  -30.592 1.00 23.30  ? 46   ILE A CD1   1 
ATOM   347   N  N     . PRO A 1 47   ? -8.777  24.343  -27.661 1.00 14.27  ? 47   PRO A N     1 
ATOM   348   C  CA    . PRO A 1 47   ? -8.302  25.463  -26.844 1.00 19.34  ? 47   PRO A CA    1 
ATOM   349   C  C     . PRO A 1 47   ? -9.410  26.398  -26.358 1.00 21.80  ? 47   PRO A C     1 
ATOM   350   O  O     . PRO A 1 47   ? -10.488 26.471  -26.953 1.00 17.50  ? 47   PRO A O     1 
ATOM   351   C  CB    . PRO A 1 47   ? -7.352  26.201  -27.794 1.00 18.58  ? 47   PRO A CB    1 
ATOM   352   C  CG    . PRO A 1 47   ? -7.880  25.903  -29.139 1.00 23.30  ? 47   PRO A CG    1 
ATOM   353   C  CD    . PRO A 1 47   ? -8.418  24.505  -29.079 1.00 20.73  ? 47   PRO A CD    1 
ATOM   354   N  N     . GLY A 1 48   ? -9.120  27.110  -25.274 1.00 28.82  ? 48   GLY A N     1 
ATOM   355   C  CA    . GLY A 1 48   ? -10.045 28.062  -24.689 1.00 26.78  ? 48   GLY A CA    1 
ATOM   356   C  C     . GLY A 1 48   ? -9.354  28.853  -23.593 1.00 22.92  ? 48   GLY A C     1 
ATOM   357   O  O     . GLY A 1 48   ? -8.134  29.034  -23.617 1.00 20.32  ? 48   GLY A O     1 
ATOM   358   N  N     . ALA A 1 49   ? -10.123 29.322  -22.620 1.00 22.10  ? 49   ALA A N     1 
ATOM   359   C  CA    . ALA A 1 49   ? -9.538  30.098  -21.536 1.00 20.15  ? 49   ALA A CA    1 
ATOM   360   C  C     . ALA A 1 49   ? -10.364 29.999  -20.266 1.00 20.27  ? 49   ALA A C     1 
ATOM   361   O  O     . ALA A 1 49   ? -11.579 29.799  -20.310 1.00 22.83  ? 49   ALA A O     1 
ATOM   362   C  CB    . ALA A 1 49   ? -9.383  31.547  -21.951 1.00 29.53  ? 49   ALA A CB    1 
ATOM   363   N  N     . ALA A 1 50   ? -9.686  30.144  -19.134 1.00 16.17  ? 50   ALA A N     1 
ATOM   364   C  CA    . ALA A 1 50   ? -10.329 30.094  -17.833 1.00 14.22  ? 50   ALA A CA    1 
ATOM   365   C  C     . ALA A 1 50   ? -9.394  30.640  -16.769 1.00 12.93  ? 50   ALA A C     1 
ATOM   366   O  O     . ALA A 1 50   ? -8.347  31.201  -17.082 1.00 14.02  ? 50   ALA A O     1 
ATOM   367   C  CB    . ALA A 1 50   ? -10.745 28.679  -17.496 1.00 19.51  ? 50   ALA A CB    1 
ATOM   368   N  N     . VAL A 1 51   ? -9.774  30.448  -15.512 1.00 11.44  ? 51   VAL A N     1 
ATOM   369   C  CA    . VAL A 1 51   ? -9.055  31.025  -14.387 1.00 7.62   ? 51   VAL A CA    1 
ATOM   370   C  C     . VAL A 1 51   ? -7.941  30.123  -13.879 1.00 8.43   ? 51   VAL A C     1 
ATOM   371   O  O     . VAL A 1 51   ? -8.132  28.922  -13.738 1.00 10.71  ? 51   VAL A O     1 
ATOM   372   C  CB    . VAL A 1 51   ? -10.005 31.311  -13.228 1.00 1.87   ? 51   VAL A CB    1 
ATOM   373   C  CG1   . VAL A 1 51   ? -9.336  32.228  -12.229 1.00 10.41  ? 51   VAL A CG1   1 
ATOM   374   C  CG2   . VAL A 1 51   ? -11.292 31.924  -13.747 1.00 0.95   ? 51   VAL A CG2   1 
ATOM   375   N  N     . THR A 1 52   ? -6.779  30.705  -13.594 1.00 8.54   ? 52   THR A N     1 
ATOM   376   C  CA    . THR A 1 52   ? -5.664  29.945  -13.037 1.00 6.87   ? 52   THR A CA    1 
ATOM   377   C  C     . THR A 1 52   ? -5.455  30.227  -11.553 1.00 8.52   ? 52   THR A C     1 
ATOM   378   O  O     . THR A 1 52   ? -5.268  29.305  -10.761 1.00 8.64   ? 52   THR A O     1 
ATOM   379   C  CB    . THR A 1 52   ? -4.346  30.237  -13.777 1.00 7.28   ? 52   THR A CB    1 
ATOM   380   O  OG1   . THR A 1 52   ? -3.966  31.604  -13.577 1.00 11.37  ? 52   THR A OG1   1 
ATOM   381   C  CG2   . THR A 1 52   ? -4.497  29.962  -15.257 1.00 18.14  ? 52   THR A CG2   1 
ATOM   382   N  N     . SER A 1 53   ? -5.475  31.499  -11.175 1.00 9.54   ? 53   SER A N     1 
ATOM   383   C  CA    . SER A 1 53   ? -5.282  31.865  -9.778  1.00 8.47   ? 53   SER A CA    1 
ATOM   384   C  C     . SER A 1 53   ? -6.116  33.081  -9.413  1.00 5.90   ? 53   SER A C     1 
ATOM   385   O  O     . SER A 1 53   ? -6.545  33.835  -10.280 1.00 10.69  ? 53   SER A O     1 
ATOM   386   C  CB    . SER A 1 53   ? -3.802  32.134  -9.490  1.00 12.58  ? 53   SER A CB    1 
ATOM   387   O  OG    . SER A 1 53   ? -3.330  33.260  -10.213 1.00 13.22  ? 53   SER A OG    1 
ATOM   388   N  N     . ILE A 1 54   ? -6.359  33.253  -8.120  1.00 7.63   ? 54   ILE A N     1 
ATOM   389   C  CA    . ILE A 1 54   ? -7.122  34.390  -7.626  1.00 9.73   ? 54   ILE A CA    1 
ATOM   390   C  C     . ILE A 1 54   ? -6.478  34.994  -6.381  1.00 13.69  ? 54   ILE A C     1 
ATOM   391   O  O     . ILE A 1 54   ? -5.507  34.458  -5.852  1.00 19.88  ? 54   ILE A O     1 
ATOM   392   C  CB    . ILE A 1 54   ? -8.572  34.000  -7.281  1.00 7.88   ? 54   ILE A CB    1 
ATOM   393   C  CG1   . ILE A 1 54   ? -8.597  33.135  -6.024  1.00 8.88   ? 54   ILE A CG1   1 
ATOM   394   C  CG2   . ILE A 1 54   ? -9.240  33.283  -8.445  1.00 5.20   ? 54   ILE A CG2   1 
ATOM   395   C  CD1   . ILE A 1 54   ? -9.980  32.860  -5.520  1.00 11.65  ? 54   ILE A CD1   1 
ATOM   396   N  N     . ARG A 1 55   ? -7.030  36.113  -5.925  1.00 13.42  ? 55   ARG A N     1 
ATOM   397   C  CA    . ARG A 1 55   ? -6.599  36.760  -4.691  1.00 13.73  ? 55   ARG A CA    1 
ATOM   398   C  C     . ARG A 1 55   ? -7.775  37.491  -4.060  1.00 14.48  ? 55   ARG A C     1 
ATOM   399   O  O     . ARG A 1 55   ? -8.562  38.125  -4.759  1.00 19.07  ? 55   ARG A O     1 
ATOM   400   C  CB    . ARG A 1 55   ? -5.444  37.733  -4.950  1.00 15.67  ? 55   ARG A CB    1 
ATOM   401   C  CG    . ARG A 1 55   ? -4.070  37.111  -4.806  1.00 18.95  ? 55   ARG A CG    1 
ATOM   402   C  CD    . ARG A 1 55   ? -2.953  38.129  -4.963  1.00 21.71  ? 55   ARG A CD    1 
ATOM   403   N  NE    . ARG A 1 55   ? -2.915  39.077  -3.856  1.00 34.92  ? 55   ARG A NE    1 
ATOM   404   C  CZ    . ARG A 1 55   ? -1.881  39.873  -3.603  1.00 49.79  ? 55   ARG A CZ    1 
ATOM   405   N  NH1   . ARG A 1 55   ? -0.798  39.821  -4.374  1.00 47.32  ? 55   ARG A NH1   1 
ATOM   406   N  NH2   . ARG A 1 55   ? -1.921  40.715  -2.577  1.00 55.94  ? 55   ARG A NH2   1 
ATOM   407   N  N     . ILE A 1 56   ? -7.899  37.392  -2.740  1.00 16.28  ? 56   ILE A N     1 
ATOM   408   C  CA    . ILE A 1 56   ? -8.982  38.063  -2.026  1.00 15.03  ? 56   ILE A CA    1 
ATOM   409   C  C     . ILE A 1 56   ? -8.440  38.967  -0.919  1.00 19.70  ? 56   ILE A C     1 
ATOM   410   O  O     . ILE A 1 56   ? -7.446  38.637  -0.273  1.00 27.37  ? 56   ILE A O     1 
ATOM   411   C  CB    . ILE A 1 56   ? -9.963  37.055  -1.405  1.00 8.94   ? 56   ILE A CB    1 
ATOM   412   C  CG1   . ILE A 1 56   ? -10.385 36.004  -2.426  1.00 10.73  ? 56   ILE A CG1   1 
ATOM   413   C  CG2   . ILE A 1 56   ? -11.192 37.761  -0.875  1.00 15.74  ? 56   ILE A CG2   1 
ATOM   414   C  CD1   . ILE A 1 56   ? -11.387 35.014  -1.877  1.00 8.12   ? 56   ILE A CD1   1 
ATOM   415   N  N     . ASP A 1 57   ? -9.097  40.105  -0.703  1.00 17.49  ? 57   ASP A N     1 
ATOM   416   C  CA    . ASP A 1 57   ? -8.690  41.051  0.330   1.00 17.63  ? 57   ASP A CA    1 
ATOM   417   C  C     . ASP A 1 57   ? -8.765  40.426  1.722   1.00 11.49  ? 57   ASP A C     1 
ATOM   418   O  O     . ASP A 1 57   ? -9.848  40.107  2.212   1.00 6.31   ? 57   ASP A O     1 
ATOM   419   C  CB    . ASP A 1 57   ? -9.558  42.315  0.267   1.00 25.67  ? 57   ASP A CB    1 
ATOM   420   C  CG    . ASP A 1 57   ? -8.895  43.518  0.919   1.00 21.68  ? 57   ASP A CG    1 
ATOM   421   O  OD1   . ASP A 1 57   ? -7.964  43.328  1.727   1.00 19.54  ? 57   ASP A OD1   1 
ATOM   422   O  OD2   . ASP A 1 57   ? -9.309  44.660  0.624   1.00 24.12  ? 57   ASP A OD2   1 
ATOM   423   N  N     . GLY A 1 58   ? -7.602  40.251  2.343   1.00 11.87  ? 58   GLY A N     1 
ATOM   424   C  CA    . GLY A 1 58   ? -7.518  39.747  3.702   1.00 9.01   ? 58   GLY A CA    1 
ATOM   425   C  C     . GLY A 1 58   ? -7.433  38.237  3.789   1.00 9.75   ? 58   GLY A C     1 
ATOM   426   O  O     . GLY A 1 58   ? -7.579  37.660  4.866   1.00 13.48  ? 58   GLY A O     1 
ATOM   427   N  N     . VAL A 1 59   ? -7.192  37.594  2.653   1.00 10.75  ? 59   VAL A N     1 
ATOM   428   C  CA    . VAL A 1 59   ? -7.133  36.140  2.598   1.00 7.56   ? 59   VAL A CA    1 
ATOM   429   C  C     . VAL A 1 59   ? -5.743  35.639  2.221   1.00 6.25   ? 59   VAL A C     1 
ATOM   430   O  O     . VAL A 1 59   ? -5.177  36.047  1.211   1.00 6.77   ? 59   VAL A O     1 
ATOM   431   C  CB    . VAL A 1 59   ? -8.151  35.587  1.599   1.00 7.25   ? 59   VAL A CB    1 
ATOM   432   C  CG1   . VAL A 1 59   ? -8.063  34.076  1.542   1.00 12.40  ? 59   VAL A CG1   1 
ATOM   433   C  CG2   . VAL A 1 59   ? -9.550  36.023  1.990   1.00 10.47  ? 59   VAL A CG2   1 
ATOM   434   N  N     . LEU A 1 60   ? -5.204  34.738  3.035   1.00 8.04   ? 60   LEU A N     1 
ATOM   435   C  CA    . LEU A 1 60   ? -3.850  34.238  2.826   1.00 6.91   ? 60   LEU A CA    1 
ATOM   436   C  C     . LEU A 1 60   ? -3.800  32.796  2.323   1.00 3.75   ? 60   LEU A C     1 
ATOM   437   O  O     . LEU A 1 60   ? -2.753  32.333  1.871   1.00 5.37   ? 60   LEU A O     1 
ATOM   438   C  CB    . LEU A 1 60   ? -3.042  34.354  4.117   1.00 8.83   ? 60   LEU A CB    1 
ATOM   439   C  CG    . LEU A 1 60   ? -2.614  35.759  4.542   1.00 11.34  ? 60   LEU A CG    1 
ATOM   440   C  CD1   . LEU A 1 60   ? -3.732  36.498  5.266   1.00 9.12   ? 60   LEU A CD1   1 
ATOM   441   C  CD2   . LEU A 1 60   ? -1.366  35.677  5.404   1.00 13.63  ? 60   LEU A CD2   1 
ATOM   442   N  N     . HIS A 1 61   ? -4.919  32.086  2.408   1.00 4.07   ? 61   HIS A N     1 
ATOM   443   C  CA    . HIS A 1 61   ? -4.991  30.744  1.851   1.00 1.42   ? 61   HIS A CA    1 
ATOM   444   C  C     . HIS A 1 61   ? -6.432  30.295  1.604   1.00 3.23   ? 61   HIS A C     1 
ATOM   445   O  O     . HIS A 1 61   ? -7.383  30.942  2.034   1.00 4.16   ? 61   HIS A O     1 
ATOM   446   C  CB    . HIS A 1 61   ? -4.261  29.743  2.759   1.00 1.97   ? 61   HIS A CB    1 
ATOM   447   C  CG    . HIS A 1 61   ? -4.840  29.607  4.138   1.00 3.95   ? 61   HIS A CG    1 
ATOM   448   N  ND1   . HIS A 1 61   ? -6.099  29.099  4.376   1.00 3.92   ? 61   HIS A ND1   1 
ATOM   449   C  CD2   . HIS A 1 61   ? -4.306  29.864  5.356   1.00 2.94   ? 61   HIS A CD2   1 
ATOM   450   C  CE1   . HIS A 1 61   ? -6.325  29.074  5.678   1.00 0.63   ? 61   HIS A CE1   1 
ATOM   451   N  NE2   . HIS A 1 61   ? -5.253  29.532  6.295   1.00 12.22  ? 61   HIS A NE2   1 
ATOM   452   N  N     . GLU A 1 62   ? -6.569  29.173  0.905   1.00 3.66   ? 62   GLU A N     1 
ATOM   453   C  CA    . GLU A 1 62   ? -7.855  28.648  0.439   1.00 4.89   ? 62   GLU A CA    1 
ATOM   454   C  C     . GLU A 1 62   ? -8.853  28.313  1.550   1.00 2.83   ? 62   GLU A C     1 
ATOM   455   O  O     . GLU A 1 62   ? -10.065 28.317  1.336   1.00 7.32   ? 62   GLU A O     1 
ATOM   456   C  CB    . GLU A 1 62   ? -7.598  27.394  -0.410  1.00 5.69   ? 62   GLU A CB    1 
ATOM   457   C  CG    . GLU A 1 62   ? -8.809  26.828  -1.141  1.00 13.83  ? 62   GLU A CG    1 
ATOM   458   C  CD    . GLU A 1 62   ? -8.444  25.671  -2.064  1.00 18.17  ? 62   GLU A CD    1 
ATOM   459   O  OE1   . GLU A 1 62   ? -7.236  25.471  -2.324  1.00 20.61  ? 62   GLU A OE1   1 
ATOM   460   O  OE2   . GLU A 1 62   ? -9.363  24.959  -2.525  1.00 20.24  ? 62   GLU A OE2   1 
ATOM   461   N  N     . PHE A 1 63   ? -8.338  28.035  2.739   1.00 2.38   ? 63   PHE A N     1 
ATOM   462   C  CA    . PHE A 1 63   ? -9.137  27.427  3.794   1.00 2.37   ? 63   PHE A CA    1 
ATOM   463   C  C     . PHE A 1 63   ? -9.517  28.418  4.894   1.00 2.41   ? 63   PHE A C     1 
ATOM   464   O  O     . PHE A 1 63   ? -9.098  28.273  6.039   1.00 1.41   ? 63   PHE A O     1 
ATOM   465   C  CB    . PHE A 1 63   ? -8.377  26.242  4.399   1.00 3.05   ? 63   PHE A CB    1 
ATOM   466   C  CG    . PHE A 1 63   ? -7.801  25.292  3.376   1.00 1.60   ? 63   PHE A CG    1 
ATOM   467   C  CD1   . PHE A 1 63   ? -8.470  24.130  3.035   1.00 2.54   ? 63   PHE A CD1   1 
ATOM   468   C  CD2   . PHE A 1 63   ? -6.581  25.554  2.772   1.00 1.26   ? 63   PHE A CD2   1 
ATOM   469   C  CE1   . PHE A 1 63   ? -7.939  23.258  2.106   1.00 6.09   ? 63   PHE A CE1   1 
ATOM   470   C  CE2   . PHE A 1 63   ? -6.049  24.687  1.840   1.00 1.79   ? 63   PHE A CE2   1 
ATOM   471   C  CZ    . PHE A 1 63   ? -6.727  23.540  1.508   1.00 4.49   ? 63   PHE A CZ    1 
ATOM   472   N  N     . THR A 1 64   ? -10.316 29.421  4.550   1.00 3.16   ? 64   THR A N     1 
ATOM   473   C  CA    . THR A 1 64   ? -10.745 30.401  5.544   1.00 7.85   ? 64   THR A CA    1 
ATOM   474   C  C     . THR A 1 64   ? -12.059 31.087  5.190   1.00 4.68   ? 64   THR A C     1 
ATOM   475   O  O     . THR A 1 64   ? -12.745 30.700  4.246   1.00 4.81   ? 64   THR A O     1 
ATOM   476   C  CB    . THR A 1 64   ? -9.681  31.491  5.759   1.00 10.98  ? 64   THR A CB    1 
ATOM   477   O  OG1   . THR A 1 64   ? -10.157 32.431  6.730   1.00 13.49  ? 64   THR A OG1   1 
ATOM   478   C  CG2   . THR A 1 64   ? -9.393  32.221  4.457   1.00 6.52   ? 64   THR A CG2   1 
ATOM   479   N  N     . THR A 1 65   ? -12.401 32.111  5.966   1.00 0.99   ? 65   THR A N     1 
ATOM   480   C  CA    . THR A 1 65   ? -13.651 32.830  5.774   1.00 3.48   ? 65   THR A CA    1 
ATOM   481   C  C     . THR A 1 65   ? -13.478 34.338  5.753   1.00 6.22   ? 65   THR A C     1 
ATOM   482   O  O     . THR A 1 65   ? -12.633 34.894  6.448   1.00 9.50   ? 65   THR A O     1 
ATOM   483   C  CB    . THR A 1 65   ? -14.655 32.496  6.875   1.00 6.08   ? 65   THR A CB    1 
ATOM   484   O  OG1   . THR A 1 65   ? -14.092 32.839  8.146   1.00 6.89   ? 65   THR A OG1   1 
ATOM   485   C  CG2   . THR A 1 65   ? -14.984 31.021  6.857   1.00 10.58  ? 65   THR A CG2   1 
ATOM   486   N  N     . VAL A 1 66   ? -14.302 35.001  4.957   1.00 3.39   ? 66   VAL A N     1 
ATOM   487   C  CA    . VAL A 1 66   ? -14.321 36.450  4.943   1.00 4.67   ? 66   VAL A CA    1 
ATOM   488   C  C     . VAL A 1 66   ? -15.517 36.944  5.738   1.00 9.58   ? 66   VAL A C     1 
ATOM   489   O  O     . VAL A 1 66   ? -16.651 36.576  5.441   1.00 14.52  ? 66   VAL A O     1 
ATOM   490   C  CB    . VAL A 1 66   ? -14.388 36.995  3.522   1.00 7.23   ? 66   VAL A CB    1 
ATOM   491   C  CG1   . VAL A 1 66   ? -14.422 38.512  3.543   1.00 13.03  ? 66   VAL A CG1   1 
ATOM   492   C  CG2   . VAL A 1 66   ? -13.201 36.499  2.729   1.00 15.06  ? 66   VAL A CG2   1 
ATOM   493   N  N     . PRO A 1 67   ? -15.263 37.774  6.757   1.00 5.61   ? 67   PRO A N     1 
ATOM   494   C  CA    . PRO A 1 67   ? -16.311 38.284  7.643   1.00 4.85   ? 67   PRO A CA    1 
ATOM   495   C  C     . PRO A 1 67   ? -17.488 38.863  6.880   1.00 3.97   ? 67   PRO A C     1 
ATOM   496   O  O     . PRO A 1 67   ? -17.337 39.845  6.165   1.00 5.18   ? 67   PRO A O     1 
ATOM   497   C  CB    . PRO A 1 67   ? -15.595 39.373  8.436   1.00 10.82  ? 67   PRO A CB    1 
ATOM   498   C  CG    . PRO A 1 67   ? -14.173 38.970  8.423   1.00 11.32  ? 67   PRO A CG    1 
ATOM   499   C  CD    . PRO A 1 67   ? -13.938 38.313  7.100   1.00 7.16   ? 67   PRO A CD    1 
ATOM   500   N  N     . GLY A 1 68   ? -18.647 38.236  7.021   1.00 6.50   ? 68   GLY A N     1 
ATOM   501   C  CA    . GLY A 1 68   ? -19.871 38.779  6.470   1.00 7.41   ? 68   GLY A CA    1 
ATOM   502   C  C     . GLY A 1 68   ? -20.350 38.056  5.234   1.00 7.82   ? 68   GLY A C     1 
ATOM   503   O  O     . GLY A 1 68   ? -21.380 38.404  4.666   1.00 18.72  ? 68   GLY A O     1 
ATOM   504   N  N     . VAL A 1 69   ? -19.606 37.044  4.811   1.00 4.22   ? 69   VAL A N     1 
ATOM   505   C  CA    . VAL A 1 69   ? -19.986 36.294  3.626   1.00 5.79   ? 69   VAL A CA    1 
ATOM   506   C  C     . VAL A 1 69   ? -20.475 34.906  4.014   1.00 9.37   ? 69   VAL A C     1 
ATOM   507   O  O     . VAL A 1 69   ? -19.876 34.248  4.857   1.00 8.99   ? 69   VAL A O     1 
ATOM   508   C  CB    . VAL A 1 69   ? -18.821 36.172  2.644   1.00 5.43   ? 69   VAL A CB    1 
ATOM   509   C  CG1   . VAL A 1 69   ? -19.345 35.987  1.234   1.00 10.41  ? 69   VAL A CG1   1 
ATOM   510   C  CG2   . VAL A 1 69   ? -17.955 37.412  2.715   1.00 10.62  ? 69   VAL A CG2   1 
ATOM   511   N  N     . LYS A 1 70   ? -21.566 34.469  3.395   1.00 11.97  ? 70   LYS A N     1 
ATOM   512   C  CA    . LYS A 1 70   ? -22.193 33.195  3.735   1.00 7.55   ? 70   LYS A CA    1 
ATOM   513   C  C     . LYS A 1 70   ? -21.275 32.011  3.457   1.00 6.28   ? 70   LYS A C     1 
ATOM   514   O  O     . LYS A 1 70   ? -21.140 31.117  4.284   1.00 9.03   ? 70   LYS A O     1 
ATOM   515   C  CB    . LYS A 1 70   ? -23.511 33.032  2.967   1.00 10.90  ? 70   LYS A CB    1 
ATOM   516   C  CG    . LYS A 1 70   ? -24.346 31.820  3.379   1.00 11.04  ? 70   LYS A CG    1 
ATOM   517   C  CD    . LYS A 1 70   ? -25.642 31.742  2.572   1.00 11.60  ? 70   LYS A CD    1 
ATOM   518   C  CE    . LYS A 1 70   ? -26.510 30.559  2.990   1.00 3.48   ? 70   LYS A CE    1 
ATOM   519   N  NZ    . LYS A 1 70   ? -27.724 30.420  2.133   1.00 0.75   ? 70   LYS A NZ    1 
ATOM   520   N  N     . GLU A 1 71   ? -20.644 32.003  2.291   1.00 5.86   ? 71   GLU A N     1 
ATOM   521   C  CA    . GLU A 1 71   ? -19.774 30.896  1.926   1.00 2.97   ? 71   GLU A CA    1 
ATOM   522   C  C     . GLU A 1 71   ? -18.378 31.093  2.492   1.00 6.42   ? 71   GLU A C     1 
ATOM   523   O  O     . GLU A 1 71   ? -18.037 32.176  2.964   1.00 12.52  ? 71   GLU A O     1 
ATOM   524   C  CB    . GLU A 1 71   ? -19.704 30.740  0.408   1.00 5.10   ? 71   GLU A CB    1 
ATOM   525   C  CG    . GLU A 1 71   ? -21.050 30.460  -0.256  1.00 11.45  ? 71   GLU A CG    1 
ATOM   526   C  CD    . GLU A 1 71   ? -21.865 31.715  -0.520  1.00 19.25  ? 71   GLU A CD    1 
ATOM   527   O  OE1   . GLU A 1 71   ? -21.512 32.781  0.025   1.00 20.56  ? 71   GLU A OE1   1 
ATOM   528   O  OE2   . GLU A 1 71   ? -22.857 31.638  -1.277  1.00 18.55  ? 71   GLU A OE2   1 
ATOM   529   N  N     . ASP A 1 72   ? -17.580 30.032  2.461   1.00 6.92   ? 72   ASP A N     1 
ATOM   530   C  CA    . ASP A 1 72   ? -16.172 30.121  2.820   1.00 4.70   ? 72   ASP A CA    1 
ATOM   531   C  C     . ASP A 1 72   ? -15.369 30.091  1.540   1.00 3.33   ? 72   ASP A C     1 
ATOM   532   O  O     . ASP A 1 72   ? -15.874 29.654  0.509   1.00 8.15   ? 72   ASP A O     1 
ATOM   533   C  CB    . ASP A 1 72   ? -15.758 28.987  3.762   1.00 5.80   ? 72   ASP A CB    1 
ATOM   534   C  CG    . ASP A 1 72   ? -16.024 27.605  3.184   1.00 9.44   ? 72   ASP A CG    1 
ATOM   535   O  OD1   . ASP A 1 72   ? -15.658 27.343  2.019   1.00 12.71  ? 72   ASP A OD1   1 
ATOM   536   O  OD2   . ASP A 1 72   ? -16.605 26.769  3.907   1.00 8.86   ? 72   ASP A OD2   1 
ATOM   537   N  N     . VAL A 1 73   ? -14.122 30.540  1.609   1.00 2.48   ? 73   VAL A N     1 
ATOM   538   C  CA    . VAL A 1 73   ? -13.304 30.706  0.415   1.00 7.33   ? 73   VAL A CA    1 
ATOM   539   C  C     . VAL A 1 73   ? -13.228 29.446  -0.443  1.00 10.37  ? 73   VAL A C     1 
ATOM   540   O  O     . VAL A 1 73   ? -13.221 29.529  -1.669  1.00 14.58  ? 73   VAL A O     1 
ATOM   541   C  CB    . VAL A 1 73   ? -11.873 31.139  0.776   1.00 7.64   ? 73   VAL A CB    1 
ATOM   542   C  CG1   . VAL A 1 73   ? -11.081 31.452  -0.485  1.00 7.37   ? 73   VAL A CG1   1 
ATOM   543   C  CG2   . VAL A 1 73   ? -11.908 32.349  1.682   1.00 8.20   ? 73   VAL A CG2   1 
ATOM   544   N  N     . THR A 1 74   ? -13.184 28.281  0.192   1.00 5.16   ? 74   THR A N     1 
ATOM   545   C  CA    . THR A 1 74   ? -13.129 27.038  -0.568  1.00 7.24   ? 74   THR A CA    1 
ATOM   546   C  C     . THR A 1 74   ? -14.391 26.882  -1.404  1.00 10.62  ? 74   THR A C     1 
ATOM   547   O  O     . THR A 1 74   ? -14.336 26.438  -2.549  1.00 17.15  ? 74   THR A O     1 
ATOM   548   C  CB    . THR A 1 74   ? -12.965 25.818  0.338   1.00 10.09  ? 74   THR A CB    1 
ATOM   549   O  OG1   . THR A 1 74   ? -11.818 26.004  1.170   1.00 8.35   ? 74   THR A OG1   1 
ATOM   550   C  CG2   . THR A 1 74   ? -12.776 24.555  -0.498  1.00 8.18   ? 74   THR A CG2   1 
ATOM   551   N  N     . GLU A 1 75   ? -15.526 27.269  -0.837  1.00 8.91   ? 75   GLU A N     1 
ATOM   552   C  CA    . GLU A 1 75   ? -16.789 27.172  -1.552  1.00 9.29   ? 75   GLU A CA    1 
ATOM   553   C  C     . GLU A 1 75   ? -16.888 28.239  -2.633  1.00 8.50   ? 75   GLU A C     1 
ATOM   554   O  O     . GLU A 1 75   ? -17.569 28.062  -3.644  1.00 9.33   ? 75   GLU A O     1 
ATOM   555   C  CB    . GLU A 1 75   ? -17.955 27.297  -0.586  1.00 7.40   ? 75   GLU A CB    1 
ATOM   556   C  CG    . GLU A 1 75   ? -19.293 27.000  -1.215  1.00 10.59  ? 75   GLU A CG    1 
ATOM   557   C  CD    . GLU A 1 75   ? -20.427 27.205  -0.246  1.00 17.02  ? 75   GLU A CD    1 
ATOM   558   O  OE1   . GLU A 1 75   ? -20.144 27.481  0.938   1.00 19.77  ? 75   GLU A OE1   1 
ATOM   559   O  OE2   . GLU A 1 75   ? -21.598 27.107  -0.667  1.00 23.15  ? 75   GLU A OE2   1 
ATOM   560   N  N     . ILE A 1 76   ? -16.207 29.355  -2.408  1.00 10.90  ? 76   ILE A N     1 
ATOM   561   C  CA    . ILE A 1 76   ? -16.159 30.424  -3.391  1.00 5.35   ? 76   ILE A CA    1 
ATOM   562   C  C     . ILE A 1 76   ? -15.369 29.973  -4.601  1.00 5.16   ? 76   ILE A C     1 
ATOM   563   O  O     . ILE A 1 76   ? -15.853 30.039  -5.726  1.00 7.75   ? 76   ILE A O     1 
ATOM   564   C  CB    . ILE A 1 76   ? -15.530 31.692  -2.815  1.00 2.68   ? 76   ILE A CB    1 
ATOM   565   C  CG1   . ILE A 1 76   ? -16.462 32.302  -1.768  1.00 5.71   ? 76   ILE A CG1   1 
ATOM   566   C  CG2   . ILE A 1 76   ? -15.233 32.684  -3.926  1.00 2.31   ? 76   ILE A CG2   1 
ATOM   567   C  CD1   . ILE A 1 76   ? -15.895 33.516  -1.086  1.00 9.93   ? 76   ILE A CD1   1 
ATOM   568   N  N     . ILE A 1 77   ? -14.154 29.499  -4.355  1.00 4.03   ? 77   ILE A N     1 
ATOM   569   C  CA    . ILE A 1 77   ? -13.282 29.006  -5.413  1.00 7.74   ? 77   ILE A CA    1 
ATOM   570   C  C     . ILE A 1 77   ? -13.936 27.850  -6.155  1.00 9.42   ? 77   ILE A C     1 
ATOM   571   O  O     . ILE A 1 77   ? -13.742 27.669  -7.356  1.00 13.13  ? 77   ILE A O     1 
ATOM   572   C  CB    . ILE A 1 77   ? -11.932 28.559  -4.845  1.00 7.22   ? 77   ILE A CB    1 
ATOM   573   C  CG1   . ILE A 1 77   ? -11.262 29.736  -4.138  1.00 4.31   ? 77   ILE A CG1   1 
ATOM   574   C  CG2   . ILE A 1 77   ? -11.037 28.009  -5.943  1.00 10.21  ? 77   ILE A CG2   1 
ATOM   575   C  CD1   . ILE A 1 77   ? -9.922  29.419  -3.536  1.00 5.86   ? 77   ILE A CD1   1 
ATOM   576   N  N     . LEU A 1 78   ? -14.735 27.082  -5.429  1.00 10.04  ? 78   LEU A N     1 
ATOM   577   C  CA    . LEU A 1 78   ? -15.441 25.954  -6.010  1.00 10.01  ? 78   LEU A CA    1 
ATOM   578   C  C     . LEU A 1 78   ? -16.546 26.418  -6.955  1.00 10.82  ? 78   LEU A C     1 
ATOM   579   O  O     . LEU A 1 78   ? -16.883 25.726  -7.914  1.00 12.66  ? 78   LEU A O     1 
ATOM   580   C  CB    . LEU A 1 78   ? -16.020 25.076  -4.905  1.00 14.83  ? 78   LEU A CB    1 
ATOM   581   C  CG    . LEU A 1 78   ? -16.300 23.625  -5.279  1.00 24.97  ? 78   LEU A CG    1 
ATOM   582   C  CD1   . LEU A 1 78   ? -16.065 22.742  -4.067  1.00 33.98  ? 78   LEU A CD1   1 
ATOM   583   C  CD2   . LEU A 1 78   ? -17.720 23.464  -5.798  1.00 27.48  ? 78   LEU A CD2   1 
ATOM   584   N  N     . ASN A 1 79   ? -17.112 27.587  -6.677  1.00 9.95   ? 79   ASN A N     1 
ATOM   585   C  CA    . ASN A 1 79   ? -18.149 28.151  -7.531  1.00 6.12   ? 79   ASN A CA    1 
ATOM   586   C  C     . ASN A 1 79   ? -17.551 28.726  -8.798  1.00 4.55   ? 79   ASN A C     1 
ATOM   587   O  O     . ASN A 1 79   ? -18.169 28.708  -9.859  1.00 7.83   ? 79   ASN A O     1 
ATOM   588   C  CB    . ASN A 1 79   ? -18.927 29.233  -6.786  1.00 6.52   ? 79   ASN A CB    1 
ATOM   589   C  CG    . ASN A 1 79   ? -19.796 28.670  -5.685  1.00 5.46   ? 79   ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1 79   ? -20.384 27.602  -5.830  1.00 12.34  ? 79   ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1 79   ? -19.882 29.388  -4.576  1.00 3.94   ? 79   ASN A ND2   1 
ATOM   592   N  N     . LEU A 1 80   ? -16.330 29.231  -8.670  1.00 7.14   ? 80   LEU A N     1 
ATOM   593   C  CA    . LEU A 1 80   ? -15.650 29.917  -9.759  1.00 7.66   ? 80   LEU A CA    1 
ATOM   594   C  C     . LEU A 1 80   ? -15.161 28.965  -10.832 1.00 10.32  ? 80   LEU A C     1 
ATOM   595   O  O     . LEU A 1 80   ? -14.800 29.385  -11.924 1.00 13.16  ? 80   LEU A O     1 
ATOM   596   C  CB    . LEU A 1 80   ? -14.470 30.720  -9.222  1.00 9.36   ? 80   LEU A CB    1 
ATOM   597   C  CG    . LEU A 1 80   ? -14.740 32.170  -8.836  1.00 2.98   ? 80   LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1 80   ? -13.493 32.769  -8.221  1.00 16.05  ? 80   LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1 80   ? -15.168 32.956  -10.059 1.00 5.06   ? 80   LEU A CD2   1 
ATOM   600   N  N     . LYS A 1 81   ? -15.136 27.678  -10.515 1.00 10.17  ? 81   LYS A N     1 
ATOM   601   C  CA    . LYS A 1 81   ? -14.737 26.678  -11.494 1.00 11.93  ? 81   LYS A CA    1 
ATOM   602   C  C     . LYS A 1 81   ? -15.745 26.648  -12.644 1.00 17.53  ? 81   LYS A C     1 
ATOM   603   O  O     . LYS A 1 81   ? -15.394 26.350  -13.788 1.00 16.64  ? 81   LYS A O     1 
ATOM   604   C  CB    . LYS A 1 81   ? -14.633 25.295  -10.851 1.00 13.92  ? 81   LYS A CB    1 
ATOM   605   C  CG    . LYS A 1 81   ? -13.982 25.282  -9.476  1.00 15.23  ? 81   LYS A CG    1 
ATOM   606   C  CD    . LYS A 1 81   ? -12.501 24.955  -9.549  1.00 15.00  ? 81   LYS A CD    1 
ATOM   607   C  CE    . LYS A 1 81   ? -11.938 24.690  -8.161  1.00 16.41  ? 81   LYS A CE    1 
ATOM   608   N  NZ    . LYS A 1 81   ? -10.600 24.046  -8.215  1.00 14.44  ? 81   LYS A NZ    1 
ATOM   609   N  N     . SER A 1 82   ? -16.999 26.970  -12.332 1.00 18.29  ? 82   SER A N     1 
ATOM   610   C  CA    . SER A 1 82   ? -18.082 26.916  -13.312 1.00 17.99  ? 82   SER A CA    1 
ATOM   611   C  C     . SER A 1 82   ? -18.162 28.205  -14.113 1.00 15.81  ? 82   SER A C     1 
ATOM   612   O  O     . SER A 1 82   ? -19.044 28.381  -14.949 1.00 21.42  ? 82   SER A O     1 
ATOM   613   C  CB    . SER A 1 82   ? -19.421 26.634  -12.616 1.00 16.70  ? 82   SER A CB    1 
ATOM   614   O  OG    . SER A 1 82   ? -19.592 27.464  -11.475 1.00 14.78  ? 82   SER A OG    1 
ATOM   615   N  N     . LEU A 1 83   ? -17.227 29.105  -13.847 1.00 14.45  ? 83   LEU A N     1 
ATOM   616   C  CA    . LEU A 1 83   ? -17.155 30.359  -14.571 1.00 16.95  ? 83   LEU A CA    1 
ATOM   617   C  C     . LEU A 1 83   ? -16.727 30.121  -16.013 1.00 18.59  ? 83   LEU A C     1 
ATOM   618   O  O     . LEU A 1 83   ? -15.746 29.421  -16.269 1.00 19.46  ? 83   LEU A O     1 
ATOM   619   C  CB    . LEU A 1 83   ? -16.188 31.309  -13.876 1.00 14.81  ? 83   LEU A CB    1 
ATOM   620   C  CG    . LEU A 1 83   ? -15.939 32.649  -14.552 1.00 11.25  ? 83   LEU A CG    1 
ATOM   621   C  CD1   . LEU A 1 83   ? -17.227 33.443  -14.647 1.00 12.14  ? 83   LEU A CD1   1 
ATOM   622   C  CD2   . LEU A 1 83   ? -14.880 33.405  -13.779 1.00 15.03  ? 83   LEU A CD2   1 
ATOM   623   N  N     . VAL A 1 84   ? -17.470 30.697  -16.951 1.00 18.92  ? 84   VAL A N     1 
ATOM   624   C  CA    . VAL A 1 84   ? -17.196 30.506  -18.367 1.00 15.33  ? 84   VAL A CA    1 
ATOM   625   C  C     . VAL A 1 84   ? -16.573 31.751  -18.983 1.00 14.81  ? 84   VAL A C     1 
ATOM   626   O  O     . VAL A 1 84   ? -17.190 32.811  -19.029 1.00 20.14  ? 84   VAL A O     1 
ATOM   627   C  CB    . VAL A 1 84   ? -18.467 30.151  -19.136 1.00 14.36  ? 84   VAL A CB    1 
ATOM   628   C  CG1   . VAL A 1 84   ? -18.146 29.978  -20.606 1.00 25.49  ? 84   VAL A CG1   1 
ATOM   629   C  CG2   . VAL A 1 84   ? -19.092 28.888  -18.565 1.00 13.08  ? 84   VAL A CG2   1 
ATOM   630   N  N     . VAL A 1 85   ? -15.344 31.614  -19.461 1.00 11.88  ? 85   VAL A N     1 
ATOM   631   C  CA    . VAL A 1 85   ? -14.583 32.760  -19.930 1.00 15.84  ? 85   VAL A CA    1 
ATOM   632   C  C     . VAL A 1 85   ? -14.018 32.505  -21.318 1.00 20.73  ? 85   VAL A C     1 
ATOM   633   O  O     . VAL A 1 85   ? -13.718 31.370  -21.684 1.00 25.45  ? 85   VAL A O     1 
ATOM   634   C  CB    . VAL A 1 85   ? -13.423 33.101  -18.950 1.00 20.17  ? 85   VAL A CB    1 
ATOM   635   C  CG1   . VAL A 1 85   ? -12.685 34.360  -19.378 1.00 19.61  ? 85   VAL A CG1   1 
ATOM   636   C  CG2   . VAL A 1 85   ? -13.946 33.271  -17.540 1.00 22.17  ? 85   VAL A CG2   1 
ATOM   637   N  N     . SER A 1 86   ? -13.905 33.572  -22.097 1.00 27.14  ? 86   SER A N     1 
ATOM   638   C  CA    . SER A 1 86   ? -13.158 33.538  -23.342 1.00 32.87  ? 86   SER A CA    1 
ATOM   639   C  C     . SER A 1 86   ? -12.195 34.721  -23.382 1.00 37.21  ? 86   SER A C     1 
ATOM   640   O  O     . SER A 1 86   ? -12.608 35.880  -23.312 1.00 39.47  ? 86   SER A O     1 
ATOM   641   C  CB    . SER A 1 86   ? -14.099 33.567  -24.545 1.00 36.86  ? 86   SER A CB    1 
ATOM   642   O  OG    . SER A 1 86   ? -14.932 34.714  -24.508 1.00 47.33  ? 86   SER A OG    1 
ATOM   643   N  N     . SER A 1 87   ? -10.905 34.422  -23.472 1.00 38.32  ? 87   SER A N     1 
ATOM   644   C  CA    . SER A 1 87   ? -9.887  35.458  -23.553 1.00 40.27  ? 87   SER A CA    1 
ATOM   645   C  C     . SER A 1 87   ? -9.163  35.400  -24.886 1.00 39.57  ? 87   SER A C     1 
ATOM   646   O  O     . SER A 1 87   ? -8.928  34.323  -25.428 1.00 40.14  ? 87   SER A O     1 
ATOM   647   C  CB    . SER A 1 87   ? -8.884  35.323  -22.409 1.00 44.75  ? 87   SER A CB    1 
ATOM   648   O  OG    . SER A 1 87   ? -7.758  36.158  -22.625 1.00 48.19  ? 87   SER A OG    1 
ATOM   649   N  N     . GLU A 1 88   ? -8.805  36.566  -25.408 1.00 42.02  ? 88   GLU A N     1 
ATOM   650   C  CA    . GLU A 1 88   ? -8.094  36.642  -26.675 1.00 45.94  ? 88   GLU A CA    1 
ATOM   651   C  C     . GLU A 1 88   ? -6.606  36.884  -26.456 1.00 51.89  ? 88   GLU A C     1 
ATOM   652   O  O     . GLU A 1 88   ? -5.781  36.574  -27.317 1.00 53.91  ? 88   GLU A O     1 
ATOM   653   C  CB    . GLU A 1 88   ? -8.685  37.744  -27.544 1.00 49.38  ? 88   GLU A CB    1 
ATOM   654   C  CG    . GLU A 1 88   ? -10.171 37.579  -27.793 1.00 57.01  ? 88   GLU A CG    1 
ATOM   655   C  CD    . GLU A 1 88   ? -10.760 38.731  -28.577 1.00 75.97  ? 88   GLU A CD    1 
ATOM   656   O  OE1   . GLU A 1 88   ? -10.068 39.760  -28.732 1.00 82.14  ? 88   GLU A OE1   1 
ATOM   657   O  OE2   . GLU A 1 88   ? -11.913 38.606  -29.039 1.00 77.07  ? 88   GLU A OE2   1 
ATOM   658   N  N     . GLU A 1 89   ? -6.268  37.437  -25.297 1.00 53.00  ? 89   GLU A N     1 
ATOM   659   C  CA    . GLU A 1 89   ? -4.877  37.682  -24.949 1.00 51.06  ? 89   GLU A CA    1 
ATOM   660   C  C     . GLU A 1 89   ? -4.149  36.357  -24.765 1.00 50.41  ? 89   GLU A C     1 
ATOM   661   O  O     . GLU A 1 89   ? -4.539  35.538  -23.934 1.00 48.54  ? 89   GLU A O     1 
ATOM   662   C  CB    . GLU A 1 89   ? -4.785  38.525  -23.678 1.00 44.61  ? 89   GLU A CB    1 
ATOM   663   C  CG    . GLU A 1 89   ? -5.603  39.802  -23.726 1.00 40.50  ? 89   GLU A CG    1 
ATOM   664   C  CD    . GLU A 1 89   ? -4.878  40.926  -24.431 1.00 51.80  ? 89   GLU A CD    1 
ATOM   665   O  OE1   . GLU A 1 89   ? -3.648  40.809  -24.617 1.00 48.23  ? 89   GLU A OE1   1 
ATOM   666   O  OE2   . GLU A 1 89   ? -5.535  41.924  -24.796 1.00 56.68  ? 89   GLU A OE2   1 
ATOM   667   N  N     . ASP A 1 90   ? -3.100  36.139  -25.549 1.00 49.59  ? 90   ASP A N     1 
ATOM   668   C  CA    . ASP A 1 90   ? -2.304  34.928  -25.403 1.00 55.78  ? 90   ASP A CA    1 
ATOM   669   C  C     . ASP A 1 90   ? -1.609  34.960  -24.047 1.00 48.31  ? 90   ASP A C     1 
ATOM   670   O  O     . ASP A 1 90   ? -1.360  33.927  -23.427 1.00 49.01  ? 90   ASP A O     1 
ATOM   671   C  CB    . ASP A 1 90   ? -1.284  34.805  -26.538 1.00 66.00  ? 90   ASP A CB    1 
ATOM   672   C  CG    . ASP A 1 90   ? -0.942  33.362  -26.863 1.00 62.93  ? 90   ASP A CG    1 
ATOM   673   O  OD1   . ASP A 1 90   ? -0.963  32.520  -25.941 1.00 66.19  ? 90   ASP A OD1   1 
ATOM   674   O  OD2   . ASP A 1 90   ? -0.657  33.071  -28.044 1.00 56.37  ? 90   ASP A OD2   1 
ATOM   675   N  N     . GLU A 1 91   ? -1.318  36.170  -23.591 1.00 37.42  ? 91   GLU A N     1 
ATOM   676   C  CA    . GLU A 1 91   ? -0.656  36.385  -22.319 1.00 33.48  ? 91   GLU A CA    1 
ATOM   677   C  C     . GLU A 1 91   ? -1.682  36.592  -21.207 1.00 33.03  ? 91   GLU A C     1 
ATOM   678   O  O     . GLU A 1 91   ? -2.786  37.064  -21.465 1.00 41.40  ? 91   GLU A O     1 
ATOM   679   C  CB    . GLU A 1 91   ? 0.280   37.585  -22.428 1.00 36.79  ? 91   GLU A CB    1 
ATOM   680   C  CG    . GLU A 1 91   ? -0.231  38.667  -23.361 1.00 39.89  ? 91   GLU A CG    1 
ATOM   681   C  CD    . GLU A 1 91   ? 0.551   39.951  -23.223 1.00 52.70  ? 91   GLU A CD    1 
ATOM   682   O  OE1   . GLU A 1 91   ? 1.587   39.930  -22.527 1.00 60.09  ? 91   GLU A OE1   1 
ATOM   683   O  OE2   . GLU A 1 91   ? 0.130   40.978  -23.797 1.00 51.58  ? 91   GLU A OE2   1 
ATOM   684   N  N     . PRO A 1 92   ? -1.323  36.227  -19.966 1.00 24.85  ? 92   PRO A N     1 
ATOM   685   C  CA    . PRO A 1 92   ? -2.217  36.332  -18.805 1.00 25.10  ? 92   PRO A CA    1 
ATOM   686   C  C     . PRO A 1 92   ? -2.788  37.730  -18.575 1.00 22.85  ? 92   PRO A C     1 
ATOM   687   O  O     . PRO A 1 92   ? -2.111  38.723  -18.820 1.00 18.85  ? 92   PRO A O     1 
ATOM   688   C  CB    . PRO A 1 92   ? -1.313  35.932  -17.641 1.00 28.18  ? 92   PRO A CB    1 
ATOM   689   C  CG    . PRO A 1 92   ? -0.322  35.014  -18.252 1.00 29.69  ? 92   PRO A CG    1 
ATOM   690   C  CD    . PRO A 1 92   ? -0.057  35.557  -19.620 1.00 23.67  ? 92   PRO A CD    1 
ATOM   691   N  N     . VAL A 1 93   ? -4.028  37.796  -18.100 1.00 21.58  ? 93   VAL A N     1 
ATOM   692   C  CA    . VAL A 1 93   ? -4.695  39.069  -17.851 1.00 18.69  ? 93   VAL A CA    1 
ATOM   693   C  C     . VAL A 1 93   ? -5.437  39.084  -16.511 1.00 21.97  ? 93   VAL A C     1 
ATOM   694   O  O     . VAL A 1 93   ? -5.878  38.043  -16.028 1.00 30.24  ? 93   VAL A O     1 
ATOM   695   C  CB    . VAL A 1 93   ? -5.680  39.399  -18.983 1.00 22.12  ? 93   VAL A CB    1 
ATOM   696   C  CG1   . VAL A 1 93   ? -4.922  39.815  -20.228 1.00 31.16  ? 93   VAL A CG1   1 
ATOM   697   C  CG2   . VAL A 1 93   ? -6.575  38.206  -19.276 1.00 18.69  ? 93   VAL A CG2   1 
ATOM   698   N  N     . THR A 1 94   ? -5.575  40.270  -15.920 1.00 26.77  ? 94   THR A N     1 
ATOM   699   C  CA    . THR A 1 94   ? -6.174  40.416  -14.590 1.00 23.19  ? 94   THR A CA    1 
ATOM   700   C  C     . THR A 1 94   ? -7.581  41.009  -14.618 1.00 22.60  ? 94   THR A C     1 
ATOM   701   O  O     . THR A 1 94   ? -7.764  42.173  -14.969 1.00 25.17  ? 94   THR A O     1 
ATOM   702   C  CB    . THR A 1 94   ? -5.303  41.306  -13.679 1.00 23.75  ? 94   THR A CB    1 
ATOM   703   O  OG1   . THR A 1 94   ? -4.013  40.709  -13.510 1.00 31.35  ? 94   THR A OG1   1 
ATOM   704   C  CG2   . THR A 1 94   ? -5.954  41.480  -12.320 1.00 17.23  ? 94   THR A CG2   1 
ATOM   705   N  N     . MET A 1 95   ? -8.569  40.208  -14.236 1.00 21.94  ? 95   MET A N     1 
ATOM   706   C  CA    . MET A 1 95   ? -9.939  40.690  -14.093 1.00 23.68  ? 95   MET A CA    1 
ATOM   707   C  C     . MET A 1 95   ? -10.099 41.306  -12.708 1.00 25.18  ? 95   MET A C     1 
ATOM   708   O  O     . MET A 1 95   ? -9.146  41.328  -11.933 1.00 28.90  ? 95   MET A O     1 
ATOM   709   C  CB    . MET A 1 95   ? -10.943 39.553  -14.305 1.00 19.97  ? 95   MET A CB    1 
ATOM   710   C  CG    . MET A 1 95   ? -10.588 38.612  -15.446 1.00 14.82  ? 95   MET A CG    1 
ATOM   711   S  SD    . MET A 1 95   ? -11.920 37.476  -15.874 1.00 12.06  ? 95   MET A SD    1 
ATOM   712   C  CE    . MET A 1 95   ? -12.433 36.911  -14.257 1.00 16.77  ? 95   MET A CE    1 
ATOM   713   N  N     . TYR A 1 96   ? -11.290 41.805  -12.389 1.00 21.58  ? 96   TYR A N     1 
ATOM   714   C  CA    . TYR A 1 96   ? -11.527 42.379  -11.064 1.00 26.85  ? 96   TYR A CA    1 
ATOM   715   C  C     . TYR A 1 96   ? -12.962 42.176  -10.585 1.00 23.59  ? 96   TYR A C     1 
ATOM   716   O  O     . TYR A 1 96   ? -13.878 41.996  -11.387 1.00 24.47  ? 96   TYR A O     1 
ATOM   717   C  CB    . TYR A 1 96   ? -11.177 43.873  -11.056 1.00 31.11  ? 96   TYR A CB    1 
ATOM   718   C  CG    . TYR A 1 96   ? -9.700  44.156  -10.862 1.00 37.01  ? 96   TYR A CG    1 
ATOM   719   C  CD1   . TYR A 1 96   ? -9.153  44.268  -9.586  1.00 35.72  ? 96   TYR A CD1   1 
ATOM   720   C  CD2   . TYR A 1 96   ? -8.850  44.308  -11.954 1.00 36.83  ? 96   TYR A CD2   1 
ATOM   721   C  CE1   . TYR A 1 96   ? -7.803  44.522  -9.406  1.00 33.70  ? 96   TYR A CE1   1 
ATOM   722   C  CE2   . TYR A 1 96   ? -7.500  44.559  -11.780 1.00 35.73  ? 96   TYR A CE2   1 
ATOM   723   C  CZ    . TYR A 1 96   ? -6.983  44.665  -10.506 1.00 32.95  ? 96   TYR A CZ    1 
ATOM   724   O  OH    . TYR A 1 96   ? -5.640  44.918  -10.339 1.00 31.15  ? 96   TYR A OH    1 
ATOM   725   N  N     . LEU A 1 97   ? -13.145 42.196  -9.269  1.00 20.97  ? 97   LEU A N     1 
ATOM   726   C  CA    . LEU A 1 97   ? -14.472 42.085  -8.679  1.00 23.63  ? 97   LEU A CA    1 
ATOM   727   C  C     . LEU A 1 97   ? -14.495 42.691  -7.281  1.00 25.48  ? 97   LEU A C     1 
ATOM   728   O  O     . LEU A 1 97   ? -13.769 42.252  -6.391  1.00 23.58  ? 97   LEU A O     1 
ATOM   729   C  CB    . LEU A 1 97   ? -14.926 40.620  -8.638  1.00 22.73  ? 97   LEU A CB    1 
ATOM   730   C  CG    . LEU A 1 97   ? -16.333 40.314  -8.106  1.00 26.06  ? 97   LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1 97   ? -16.967 39.165  -8.868  1.00 23.24  ? 97   LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1 97   ? -16.300 39.987  -6.623  1.00 32.73  ? 97   LEU A CD2   1 
ATOM   733   N  N     . ARG A 1 98   ? -15.333 43.708  -7.103  1.00 28.72  ? 98   ARG A N     1 
ATOM   734   C  CA    . ARG A 1 98   ? -15.538 44.332  -5.801  1.00 25.37  ? 98   ARG A CA    1 
ATOM   735   C  C     . ARG A 1 98   ? -17.012 44.673  -5.606  1.00 23.71  ? 98   ARG A C     1 
ATOM   736   O  O     . ARG A 1 98   ? -17.677 45.131  -6.534  1.00 27.54  ? 98   ARG A O     1 
ATOM   737   C  CB    . ARG A 1 98   ? -14.678 45.591  -5.657  1.00 22.47  ? 98   ARG A CB    1 
ATOM   738   C  CG    . ARG A 1 98   ? -13.190 45.312  -5.625  1.00 26.23  ? 98   ARG A CG    1 
ATOM   739   C  CD    . ARG A 1 98   ? -12.368 46.587  -5.686  1.00 44.90  ? 98   ARG A CD    1 
ATOM   740   N  NE    . ARG A 1 98   ? -10.965 46.292  -5.959  1.00 59.53  ? 98   ARG A NE    1 
ATOM   741   C  CZ    . ARG A 1 98   ? -10.020 47.214  -6.119  1.00 52.74  ? 98   ARG A CZ    1 
ATOM   742   N  NH1   . ARG A 1 98   ? -10.320 48.504  -6.031  1.00 40.41  ? 98   ARG A NH1   1 
ATOM   743   N  NH2   . ARG A 1 98   ? -8.769  46.844  -6.367  1.00 50.99  ? 98   ARG A NH2   1 
ATOM   744   N  N     . LYS A 1 99   ? -17.516 44.443  -4.398  1.00 18.50  ? 99   LYS A N     1 
ATOM   745   C  CA    . LYS A 1 99   ? -18.907 44.745  -4.075  1.00 17.60  ? 99   LYS A CA    1 
ATOM   746   C  C     . LYS A 1 99   ? -19.129 44.720  -2.564  1.00 17.40  ? 99   LYS A C     1 
ATOM   747   O  O     . LYS A 1 99   ? -18.572 43.878  -1.864  1.00 19.05  ? 99   LYS A O     1 
ATOM   748   C  CB    . LYS A 1 99   ? -19.839 43.753  -4.771  1.00 16.80  ? 99   LYS A CB    1 
ATOM   749   C  CG    . LYS A 1 99   ? -21.303 44.163  -4.805  1.00 23.15  ? 99   LYS A CG    1 
ATOM   750   C  CD    . LYS A 1 99   ? -22.093 43.214  -5.694  1.00 27.82  ? 99   LYS A CD    1 
ATOM   751   C  CE    . LYS A 1 99   ? -23.541 43.651  -5.841  1.00 27.57  ? 99   LYS A CE    1 
ATOM   752   N  NZ    . LYS A 1 99   ? -24.233 43.737  -4.525  1.00 18.69  ? 99   LYS A NZ    1 
ATOM   753   N  N     . GLN A 1 100  ? -19.943 45.645  -2.066  1.00 17.83  ? 100  GLN A N     1 
ATOM   754   C  CA    . GLN A 1 100  ? -20.161 45.777  -0.629  1.00 21.85  ? 100  GLN A CA    1 
ATOM   755   C  C     . GLN A 1 100  ? -21.644 45.770  -0.277  1.00 23.97  ? 100  GLN A C     1 
ATOM   756   O  O     . GLN A 1 100  ? -22.492 45.500  -1.128  1.00 24.09  ? 100  GLN A O     1 
ATOM   757   C  CB    . GLN A 1 100  ? -19.517 47.062  -0.109  1.00 29.50  ? 100  GLN A CB    1 
ATOM   758   C  CG    . GLN A 1 100  ? -18.901 46.927  1.275   1.00 41.72  ? 100  GLN A CG    1 
ATOM   759   C  CD    . GLN A 1 100  ? -18.563 48.266  1.900   1.00 54.80  ? 100  GLN A CD    1 
ATOM   760   O  OE1   . GLN A 1 100  ? -19.207 49.276  1.615   1.00 58.59  ? 100  GLN A OE1   1 
ATOM   761   N  NE2   . GLN A 1 100  ? -17.547 48.281  2.758   1.00 51.07  ? 100  GLN A NE2   1 
ATOM   762   N  N     . GLY A 1 101  ? -21.946 46.064  0.984   1.00 21.82  ? 101  GLY A N     1 
ATOM   763   C  CA    . GLY A 1 101  ? -23.314 46.126  1.463   1.00 22.65  ? 101  GLY A CA    1 
ATOM   764   C  C     . GLY A 1 101  ? -24.055 44.812  1.316   1.00 23.85  ? 101  GLY A C     1 
ATOM   765   O  O     . GLY A 1 101  ? -23.479 43.808  0.905   1.00 28.13  ? 101  GLY A O     1 
ATOM   766   N  N     . PRO A 1 102  ? -25.347 44.805  1.660   1.00 19.86  ? 102  PRO A N     1 
ATOM   767   C  CA    . PRO A 1 102  ? -26.155 43.604  1.455   1.00 17.04  ? 102  PRO A CA    1 
ATOM   768   C  C     . PRO A 1 102  ? -26.303 43.314  -0.032  1.00 22.41  ? 102  PRO A C     1 
ATOM   769   O  O     . PRO A 1 102  ? -26.001 44.182  -0.849  1.00 20.13  ? 102  PRO A O     1 
ATOM   770   C  CB    . PRO A 1 102  ? -27.501 43.972  2.088   1.00 13.28  ? 102  PRO A CB    1 
ATOM   771   C  CG    . PRO A 1 102  ? -27.193 45.093  3.016   1.00 19.55  ? 102  PRO A CG    1 
ATOM   772   C  CD    . PRO A 1 102  ? -26.103 45.863  2.345   1.00 25.84  ? 102  PRO A CD    1 
ATOM   773   N  N     . GLY A 1 103  ? -26.743 42.109  -0.377  1.00 24.37  ? 103  GLY A N     1 
ATOM   774   C  CA    . GLY A 1 103  ? -26.947 41.749  -1.768  1.00 25.77  ? 103  GLY A CA    1 
ATOM   775   C  C     . GLY A 1 103  ? -26.180 40.523  -2.226  1.00 25.12  ? 103  GLY A C     1 
ATOM   776   O  O     . GLY A 1 103  ? -25.282 40.034  -1.543  1.00 24.10  ? 103  GLY A O     1 
ATOM   777   N  N     . GLU A 1 104  ? -26.539 40.030  -3.404  1.00 30.12  ? 104  GLU A N     1 
ATOM   778   C  CA    . GLU A 1 104  ? -25.916 38.844  -3.967  1.00 22.26  ? 104  GLU A CA    1 
ATOM   779   C  C     . GLU A 1 104  ? -24.895 39.222  -5.037  1.00 26.47  ? 104  GLU A C     1 
ATOM   780   O  O     . GLU A 1 104  ? -25.186 40.026  -5.919  1.00 34.65  ? 104  GLU A O     1 
ATOM   781   C  CB    . GLU A 1 104  ? -26.988 37.931  -4.556  1.00 23.32  ? 104  GLU A CB    1 
ATOM   782   C  CG    . GLU A 1 104  ? -26.539 36.514  -4.819  1.00 37.09  ? 104  GLU A CG    1 
ATOM   783   C  CD    . GLU A 1 104  ? -27.636 35.674  -5.445  1.00 49.58  ? 104  GLU A CD    1 
ATOM   784   O  OE1   . GLU A 1 104  ? -28.408 36.225  -6.257  1.00 53.97  ? 104  GLU A OE1   1 
ATOM   785   O  OE2   . GLU A 1 104  ? -27.733 34.471  -5.120  1.00 47.48  ? 104  GLU A OE2   1 
ATOM   786   N  N     . VAL A 1 105  ? -23.696 38.654  -4.960  1.00 24.00  ? 105  VAL A N     1 
ATOM   787   C  CA    . VAL A 1 105  ? -22.678 38.928  -5.970  1.00 23.98  ? 105  VAL A CA    1 
ATOM   788   C  C     . VAL A 1 105  ? -22.710 37.842  -7.044  1.00 27.27  ? 105  VAL A C     1 
ATOM   789   O  O     . VAL A 1 105  ? -22.918 36.666  -6.747  1.00 27.42  ? 105  VAL A O     1 
ATOM   790   C  CB    . VAL A 1 105  ? -21.264 39.032  -5.351  1.00 18.02  ? 105  VAL A CB    1 
ATOM   791   C  CG1   . VAL A 1 105  ? -20.832 37.711  -4.740  1.00 19.87  ? 105  VAL A CG1   1 
ATOM   792   C  CG2   . VAL A 1 105  ? -20.258 39.489  -6.392  1.00 20.64  ? 105  VAL A CG2   1 
ATOM   793   N  N     . THR A 1 106  ? -22.537 38.244  -8.300  1.00 26.36  ? 106  THR A N     1 
ATOM   794   C  CA    . THR A 1 106  ? -22.590 37.304  -9.414  1.00 27.81  ? 106  THR A CA    1 
ATOM   795   C  C     . THR A 1 106  ? -21.369 37.433  -10.314 1.00 26.68  ? 106  THR A C     1 
ATOM   796   O  O     . THR A 1 106  ? -20.426 38.159  -10.002 1.00 27.02  ? 106  THR A O     1 
ATOM   797   C  CB    . THR A 1 106  ? -23.858 37.507  -10.275 1.00 28.65  ? 106  THR A CB    1 
ATOM   798   O  OG1   . THR A 1 106  ? -23.845 38.815  -10.862 1.00 26.60  ? 106  THR A OG1   1 
ATOM   799   C  CG2   . THR A 1 106  ? -25.117 37.339  -9.439  1.00 33.38  ? 106  THR A CG2   1 
ATOM   800   N  N     . ALA A 1 107  ? -21.393 36.723  -11.436 1.00 26.71  ? 107  ALA A N     1 
ATOM   801   C  CA    . ALA A 1 107  ? -20.323 36.828  -12.416 1.00 24.85  ? 107  ALA A CA    1 
ATOM   802   C  C     . ALA A 1 107  ? -20.484 38.114  -13.208 1.00 22.49  ? 107  ALA A C     1 
ATOM   803   O  O     . ALA A 1 107  ? -19.595 38.517  -13.956 1.00 17.26  ? 107  ALA A O     1 
ATOM   804   C  CB    . ALA A 1 107  ? -20.319 35.628  -13.337 1.00 32.37  ? 107  ALA A CB    1 
ATOM   805   N  N     . GLY A 1 108  ? -21.636 38.751  -13.035 1.00 24.50  ? 108  GLY A N     1 
ATOM   806   C  CA    . GLY A 1 108  ? -21.898 40.032  -13.658 1.00 32.81  ? 108  GLY A CA    1 
ATOM   807   C  C     . GLY A 1 108  ? -21.086 41.145  -13.029 1.00 27.66  ? 108  GLY A C     1 
ATOM   808   O  O     . GLY A 1 108  ? -20.710 42.106  -13.696 1.00 27.63  ? 108  GLY A O     1 
ATOM   809   N  N     . ASP A 1 109  ? -20.806 41.012  -11.737 1.00 28.91  ? 109  ASP A N     1 
ATOM   810   C  CA    . ASP A 1 109  ? -20.040 42.026  -11.020 1.00 32.75  ? 109  ASP A CA    1 
ATOM   811   C  C     . ASP A 1 109  ? -18.541 41.911  -11.293 1.00 28.05  ? 109  ASP A C     1 
ATOM   812   O  O     . ASP A 1 109  ? -17.736 42.586  -10.654 1.00 28.76  ? 109  ASP A O     1 
ATOM   813   C  CB    . ASP A 1 109  ? -20.299 41.937  -9.511  1.00 37.41  ? 109  ASP A CB    1 
ATOM   814   C  CG    . ASP A 1 109  ? -21.734 42.283  -9.137  1.00 34.45  ? 109  ASP A CG    1 
ATOM   815   O  OD1   . ASP A 1 109  ? -22.075 43.487  -9.124  1.00 27.02  ? 109  ASP A OD1   1 
ATOM   816   O  OD2   . ASP A 1 109  ? -22.512 41.350  -8.842  1.00 34.74  ? 109  ASP A OD2   1 
ATOM   817   N  N     . ILE A 1 110  ? -18.164 41.054  -12.235 1.00 24.54  ? 110  ILE A N     1 
ATOM   818   C  CA    . ILE A 1 110  ? -16.771 40.957  -12.648 1.00 25.78  ? 110  ILE A CA    1 
ATOM   819   C  C     . ILE A 1 110  ? -16.477 42.045  -13.672 1.00 26.84  ? 110  ILE A C     1 
ATOM   820   O  O     . ILE A 1 110  ? -17.343 42.398  -14.469 1.00 31.63  ? 110  ILE A O     1 
ATOM   821   C  CB    . ILE A 1 110  ? -16.444 39.576  -13.252 1.00 27.69  ? 110  ILE A CB    1 
ATOM   822   C  CG1   . ILE A 1 110  ? -16.929 38.458  -12.335 1.00 26.34  ? 110  ILE A CG1   1 
ATOM   823   C  CG2   . ILE A 1 110  ? -14.948 39.421  -13.489 1.00 28.36  ? 110  ILE A CG2   1 
ATOM   824   C  CD1   . ILE A 1 110  ? -16.707 37.079  -12.904 1.00 22.26  ? 110  ILE A CD1   1 
ATOM   825   N  N     . VAL A 1 111  ? -15.264 42.582  -13.648 1.00 23.48  ? 111  VAL A N     1 
ATOM   826   C  CA    . VAL A 1 111  ? -14.866 43.583  -14.627 1.00 22.26  ? 111  VAL A CA    1 
ATOM   827   C  C     . VAL A 1 111  ? -13.838 43.023  -15.605 1.00 29.12  ? 111  VAL A C     1 
ATOM   828   O  O     . VAL A 1 111  ? -12.639 43.039  -15.331 1.00 32.01  ? 111  VAL A O     1 
ATOM   829   C  CB    . VAL A 1 111  ? -14.295 44.820  -13.943 1.00 23.86  ? 111  VAL A CB    1 
ATOM   830   C  CG1   . VAL A 1 111  ? -14.006 45.900  -14.969 1.00 31.90  ? 111  VAL A CG1   1 
ATOM   831   C  CG2   . VAL A 1 111  ? -15.269 45.320  -12.894 1.00 29.75  ? 111  VAL A CG2   1 
ATOM   832   N  N     . PRO A 1 112  ? -14.309 42.521  -16.757 1.00 34.86  ? 112  PRO A N     1 
ATOM   833   C  CA    . PRO A 1 112  ? -13.417 41.896  -17.737 1.00 37.03  ? 112  PRO A CA    1 
ATOM   834   C  C     . PRO A 1 112  ? -12.619 42.909  -18.544 1.00 36.00  ? 112  PRO A C     1 
ATOM   835   O  O     . PRO A 1 112  ? -13.194 43.818  -19.141 1.00 40.82  ? 112  PRO A O     1 
ATOM   836   C  CB    . PRO A 1 112  ? -14.381 41.125  -18.639 1.00 37.73  ? 112  PRO A CB    1 
ATOM   837   C  CG    . PRO A 1 112  ? -15.635 41.912  -18.586 1.00 32.22  ? 112  PRO A CG    1 
ATOM   838   C  CD    . PRO A 1 112  ? -15.715 42.484  -17.193 1.00 33.06  ? 112  PRO A CD    1 
ATOM   839   N  N     . PRO A 1 113  ? -11.293 42.748  -18.571 1.00 36.18  ? 113  PRO A N     1 
ATOM   840   C  CA    . PRO A 1 113  ? -10.440 43.662  -19.328 1.00 44.74  ? 113  PRO A CA    1 
ATOM   841   C  C     . PRO A 1 113  ? -10.594 43.462  -20.826 1.00 41.35  ? 113  PRO A C     1 
ATOM   842   O  O     . PRO A 1 113  ? -11.394 42.638  -21.267 1.00 35.46  ? 113  PRO A O     1 
ATOM   843   C  CB    . PRO A 1 113  ? -9.032  43.287  -18.865 1.00 49.30  ? 113  PRO A CB    1 
ATOM   844   C  CG    . PRO A 1 113  ? -9.144  41.854  -18.503 1.00 42.78  ? 113  PRO A CG    1 
ATOM   845   C  CD    . PRO A 1 113  ? -10.516 41.679  -17.922 1.00 36.12  ? 113  PRO A CD    1 
ATOM   846   N  N     . ALA A 1 114  ? -9.820  44.218  -21.592 1.00 48.30  ? 114  ALA A N     1 
ATOM   847   C  CA    . ALA A 1 114  ? -9.872  44.151  -23.042 1.00 54.88  ? 114  ALA A CA    1 
ATOM   848   C  C     . ALA A 1 114  ? -9.563  42.747  -23.549 1.00 49.88  ? 114  ALA A C     1 
ATOM   849   O  O     . ALA A 1 114  ? -8.530  42.167  -23.215 1.00 45.23  ? 114  ALA A O     1 
ATOM   850   C  CB    . ALA A 1 114  ? -8.906  45.157  -23.645 1.00 61.94  ? 114  ALA A CB    1 
ATOM   851   N  N     . GLY A 1 115  ? -10.477 42.203  -24.346 1.00 50.87  ? 115  GLY A N     1 
ATOM   852   C  CA    . GLY A 1 115  ? -10.282 40.904  -24.963 1.00 61.23  ? 115  GLY A CA    1 
ATOM   853   C  C     . GLY A 1 115  ? -10.824 39.752  -24.138 1.00 70.00  ? 115  GLY A C     1 
ATOM   854   O  O     . GLY A 1 115  ? -10.650 38.584  -24.495 1.00 68.83  ? 115  GLY A O     1 
ATOM   855   N  N     . VAL A 1 116  ? -11.482 40.082  -23.031 1.00 63.79  ? 116  VAL A N     1 
ATOM   856   C  CA    . VAL A 1 116  ? -12.035 39.068  -22.138 1.00 53.33  ? 116  VAL A CA    1 
ATOM   857   C  C     . VAL A 1 116  ? -13.544 39.229  -21.996 1.00 54.06  ? 116  VAL A C     1 
ATOM   858   O  O     . VAL A 1 116  ? -14.037 40.328  -21.741 1.00 61.39  ? 116  VAL A O     1 
ATOM   859   C  CB    . VAL A 1 116  ? -11.395 39.134  -20.746 1.00 49.18  ? 116  VAL A CB    1 
ATOM   860   C  CG1   . VAL A 1 116  ? -11.812 37.928  -19.923 1.00 53.60  ? 116  VAL A CG1   1 
ATOM   861   C  CG2   . VAL A 1 116  ? -9.881  39.210  -20.861 1.00 50.18  ? 116  VAL A CG2   1 
ATOM   862   N  N     . THR A 1 117  ? -14.279 38.136  -22.161 1.00 41.14  ? 117  THR A N     1 
ATOM   863   C  CA    . THR A 1 117  ? -15.732 38.207  -22.138 1.00 35.41  ? 117  THR A CA    1 
ATOM   864   C  C     . THR A 1 117  ? -16.343 37.121  -21.267 1.00 29.15  ? 117  THR A C     1 
ATOM   865   O  O     . THR A 1 117  ? -16.018 35.948  -21.411 1.00 37.17  ? 117  THR A O     1 
ATOM   866   C  CB    . THR A 1 117  ? -16.313 38.089  -23.555 1.00 39.78  ? 117  THR A CB    1 
ATOM   867   O  OG1   . THR A 1 117  ? -15.866 36.867  -24.153 1.00 34.31  ? 117  THR A OG1   1 
ATOM   868   C  CG2   . THR A 1 117  ? -15.869 39.263  -24.419 1.00 53.80  ? 117  THR A CG2   1 
ATOM   869   N  N     . VAL A 1 118  ? -17.234 37.519  -20.368 1.00 24.77  ? 118  VAL A N     1 
ATOM   870   C  CA    . VAL A 1 118  ? -17.940 36.567  -19.520 1.00 24.01  ? 118  VAL A CA    1 
ATOM   871   C  C     . VAL A 1 118  ? -19.246 36.135  -20.176 1.00 26.58  ? 118  VAL A C     1 
ATOM   872   O  O     . VAL A 1 118  ? -20.023 36.971  -20.626 1.00 32.18  ? 118  VAL A O     1 
ATOM   873   C  CB    . VAL A 1 118  ? -18.242 37.161  -18.142 1.00 21.12  ? 118  VAL A CB    1 
ATOM   874   C  CG1   . VAL A 1 118  ? -18.974 36.149  -17.287 1.00 24.48  ? 118  VAL A CG1   1 
ATOM   875   C  CG2   . VAL A 1 118  ? -16.956 37.618  -17.467 1.00 20.12  ? 118  VAL A CG2   1 
ATOM   876   N  N     . HIS A 1 119  ? -19.499 34.832  -20.228 1.00 27.28  ? 119  HIS A N     1 
ATOM   877   C  CA    . HIS A 1 119  ? -20.666 34.332  -20.952 1.00 32.71  ? 119  HIS A CA    1 
ATOM   878   C  C     . HIS A 1 119  ? -21.776 33.806  -20.057 1.00 36.49  ? 119  HIS A C     1 
ATOM   879   O  O     . HIS A 1 119  ? -22.647 33.072  -20.521 1.00 40.82  ? 119  HIS A O     1 
ATOM   880   C  CB    . HIS A 1 119  ? -20.249 33.233  -21.925 1.00 25.84  ? 119  HIS A CB    1 
ATOM   881   C  CG    . HIS A 1 119  ? -19.221 33.674  -22.913 1.00 26.39  ? 119  HIS A CG    1 
ATOM   882   N  ND1   . HIS A 1 119  ? -19.543 34.357  -24.064 1.00 31.32  ? 119  HIS A ND1   1 
ATOM   883   C  CD2   . HIS A 1 119  ? -17.875 33.539  -22.917 1.00 29.38  ? 119  HIS A CD2   1 
ATOM   884   C  CE1   . HIS A 1 119  ? -18.438 34.620  -24.739 1.00 35.56  ? 119  HIS A CE1   1 
ATOM   885   N  NE2   . HIS A 1 119  ? -17.413 34.134  -24.065 1.00 35.03  ? 119  HIS A NE2   1 
ATOM   886   N  N     . ASN A 1 120  ? -21.752 34.176  -18.784 1.00 28.01  ? 120  ASN A N     1 
ATOM   887   C  CA    . ASN A 1 120  ? -22.788 33.726  -17.863 1.00 28.34  ? 120  ASN A CA    1 
ATOM   888   C  C     . ASN A 1 120  ? -22.845 34.592  -16.616 1.00 26.87  ? 120  ASN A C     1 
ATOM   889   O  O     . ASN A 1 120  ? -22.438 34.167  -15.539 1.00 34.75  ? 120  ASN A O     1 
ATOM   890   C  CB    . ASN A 1 120  ? -22.553 32.265  -17.488 1.00 30.28  ? 120  ASN A CB    1 
ATOM   891   C  CG    . ASN A 1 120  ? -21.095 31.974  -17.188 1.00 30.72  ? 120  ASN A CG    1 
ATOM   892   O  OD1   . ASN A 1 120  ? -20.207 32.740  -17.568 1.00 28.50  ? 120  ASN A OD1   1 
ATOM   893   N  ND2   . ASN A 1 120  ? -20.841 30.864  -16.508 1.00 32.02  ? 120  ASN A ND2   1 
ATOM   894   N  N     . PRO A 1 121  ? -23.360 35.818  -16.763 1.00 27.72  ? 121  PRO A N     1 
ATOM   895   C  CA    . PRO A 1 121  ? -23.353 36.842  -15.715 1.00 27.36  ? 121  PRO A CA    1 
ATOM   896   C  C     . PRO A 1 121  ? -24.236 36.505  -14.518 1.00 30.93  ? 121  PRO A C     1 
ATOM   897   O  O     . PRO A 1 121  ? -24.001 37.036  -13.433 1.00 28.05  ? 121  PRO A O     1 
ATOM   898   C  CB    . PRO A 1 121  ? -23.888 38.082  -16.441 1.00 35.48  ? 121  PRO A CB    1 
ATOM   899   C  CG    . PRO A 1 121  ? -23.699 37.789  -17.904 1.00 40.08  ? 121  PRO A CG    1 
ATOM   900   C  CD    . PRO A 1 121  ? -23.933 36.328  -18.017 1.00 37.18  ? 121  PRO A CD    1 
ATOM   901   N  N     . GLY A 1 122  ? -25.227 35.639  -14.709 1.00 39.90  ? 122  GLY A N     1 
ATOM   902   C  CA    . GLY A 1 122  ? -26.172 35.316  -13.651 1.00 40.21  ? 122  GLY A CA    1 
ATOM   903   C  C     . GLY A 1 122  ? -25.655 34.299  -12.649 1.00 37.73  ? 122  GLY A C     1 
ATOM   904   O  O     . GLY A 1 122  ? -26.328 33.982  -11.668 1.00 26.35  ? 122  GLY A O     1 
ATOM   905   N  N     . MET A 1 123  ? -24.451 33.796  -12.900 1.00 43.21  ? 123  MET A N     1 
ATOM   906   C  CA    . MET A 1 123  ? -23.855 32.743  -12.086 1.00 29.05  ? 123  MET A CA    1 
ATOM   907   C  C     . MET A 1 123  ? -23.567 33.206  -10.667 1.00 25.08  ? 123  MET A C     1 
ATOM   908   O  O     . MET A 1 123  ? -22.749 34.098  -10.446 1.00 25.21  ? 123  MET A O     1 
ATOM   909   C  CB    . MET A 1 123  ? -22.569 32.246  -12.738 1.00 24.66  ? 123  MET A CB    1 
ATOM   910   C  CG    . MET A 1 123  ? -21.876 31.133  -11.997 1.00 19.27  ? 123  MET A CG    1 
ATOM   911   S  SD    . MET A 1 123  ? -20.248 30.884  -12.710 1.00 16.89  ? 123  MET A SD    1 
ATOM   912   C  CE    . MET A 1 123  ? -19.417 32.346  -12.109 1.00 18.21  ? 123  MET A CE    1 
ATOM   913   N  N     . HIS A 1 124  ? -24.247 32.589  -9.710  1.00 23.36  ? 124  HIS A N     1 
ATOM   914   C  CA    . HIS A 1 124  ? -24.083 32.930  -8.307  1.00 23.64  ? 124  HIS A CA    1 
ATOM   915   C  C     . HIS A 1 124  ? -22.646 32.668  -7.876  1.00 19.14  ? 124  HIS A C     1 
ATOM   916   O  O     . HIS A 1 124  ? -22.064 31.649  -8.235  1.00 25.61  ? 124  HIS A O     1 
ATOM   917   C  CB    . HIS A 1 124  ? -25.070 32.131  -7.449  1.00 24.81  ? 124  HIS A CB    1 
ATOM   918   C  CG    . HIS A 1 124  ? -25.024 32.455  -5.993  1.00 20.62  ? 124  HIS A CG    1 
ATOM   919   N  ND1   . HIS A 1 124  ? -25.678 31.710  -5.035  1.00 21.40  ? 124  HIS A ND1   1 
ATOM   920   C  CD2   . HIS A 1 124  ? -24.398 33.457  -5.318  1.00 20.56  ? 124  HIS A CD2   1 
ATOM   921   C  CE1   . HIS A 1 124  ? -25.459 32.225  -3.846  1.00 19.92  ? 124  HIS A CE1   1 
ATOM   922   N  NE2   . HIS A 1 124  ? -24.683 33.286  -3.986  1.00 20.55  ? 124  HIS A NE2   1 
ATOM   923   N  N     . ILE A 1 125  ? -22.062 33.599  -7.134  1.00 15.50  ? 125  ILE A N     1 
ATOM   924   C  CA    . ILE A 1 125  ? -20.738 33.370  -6.584  1.00 11.96  ? 125  ILE A CA    1 
ATOM   925   C  C     . ILE A 1 125  ? -20.803 33.280  -5.068  1.00 17.42  ? 125  ILE A C     1 
ATOM   926   O  O     . ILE A 1 125  ? -20.307 32.325  -4.478  1.00 23.33  ? 125  ILE A O     1 
ATOM   927   C  CB    . ILE A 1 125  ? -19.757 34.465  -6.994  1.00 10.74  ? 125  ILE A CB    1 
ATOM   928   C  CG1   . ILE A 1 125  ? -19.461 34.361  -8.485  1.00 9.60   ? 125  ILE A CG1   1 
ATOM   929   C  CG2   . ILE A 1 125  ? -18.468 34.338  -6.210  1.00 7.83   ? 125  ILE A CG2   1 
ATOM   930   C  CD1   . ILE A 1 125  ? -18.381 35.300  -8.948  1.00 16.35  ? 125  ILE A CD1   1 
ATOM   931   N  N     . ALA A 1 126  ? -21.433 34.265  -4.441  1.00 16.42  ? 126  ALA A N     1 
ATOM   932   C  CA    . ALA A 1 126  ? -21.533 34.294  -2.989  1.00 10.91  ? 126  ALA A CA    1 
ATOM   933   C  C     . ALA A 1 126  ? -22.691 35.170  -2.548  1.00 16.57  ? 126  ALA A C     1 
ATOM   934   O  O     . ALA A 1 126  ? -23.093 36.076  -3.269  1.00 29.01  ? 126  ALA A O     1 
ATOM   935   C  CB    . ALA A 1 126  ? -20.231 34.791  -2.380  1.00 13.45  ? 126  ALA A CB    1 
ATOM   936   N  N     . THR A 1 127  ? -23.230 34.898  -1.366  1.00 14.67  ? 127  THR A N     1 
ATOM   937   C  CA    . THR A 1 127  ? -24.305 35.722  -0.827  1.00 19.82  ? 127  THR A CA    1 
ATOM   938   C  C     . THR A 1 127  ? -23.773 36.612  0.292   1.00 18.65  ? 127  THR A C     1 
ATOM   939   O  O     . THR A 1 127  ? -23.708 36.196  1.446   1.00 16.14  ? 127  THR A O     1 
ATOM   940   C  CB    . THR A 1 127  ? -25.474 34.863  -0.303  1.00 10.52  ? 127  THR A CB    1 
ATOM   941   O  OG1   . THR A 1 127  ? -25.969 34.036  -1.361  1.00 17.45  ? 127  THR A OG1   1 
ATOM   942   C  CG2   . THR A 1 127  ? -26.606 35.740  0.193   1.00 11.13  ? 127  THR A CG2   1 
ATOM   943   N  N     . LEU A 1 128  ? -23.376 37.833  -0.058  1.00 16.59  ? 128  LEU A N     1 
ATOM   944   C  CA    . LEU A 1 128  ? -22.877 38.781  0.931   1.00 10.05  ? 128  LEU A CA    1 
ATOM   945   C  C     . LEU A 1 128  ? -24.001 39.325  1.786   1.00 17.56  ? 128  LEU A C     1 
ATOM   946   O  O     . LEU A 1 128  ? -24.939 39.932  1.282   1.00 24.09  ? 128  LEU A O     1 
ATOM   947   C  CB    . LEU A 1 128  ? -22.143 39.945  0.269   1.00 6.79   ? 128  LEU A CB    1 
ATOM   948   C  CG    . LEU A 1 128  ? -20.662 39.726  -0.022  1.00 11.99  ? 128  LEU A CG    1 
ATOM   949   C  CD1   . LEU A 1 128  ? -20.494 38.893  -1.276  1.00 20.16  ? 128  LEU A CD1   1 
ATOM   950   C  CD2   . LEU A 1 128  ? -19.931 41.052  -0.143  1.00 11.99  ? 128  LEU A CD2   1 
ATOM   951   N  N     . ASN A 1 129  ? -23.892 39.110  3.088   1.00 18.22  ? 129  ASN A N     1 
ATOM   952   C  CA    . ASN A 1 129  ? -24.861 39.637  4.028   1.00 24.24  ? 129  ASN A CA    1 
ATOM   953   C  C     . ASN A 1 129  ? -24.498 41.068  4.392   1.00 17.28  ? 129  ASN A C     1 
ATOM   954   O  O     . ASN A 1 129  ? -23.563 41.642  3.830   1.00 16.46  ? 129  ASN A O     1 
ATOM   955   C  CB    . ASN A 1 129  ? -24.918 38.763  5.279   1.00 23.77  ? 129  ASN A CB    1 
ATOM   956   C  CG    . ASN A 1 129  ? -26.217 38.912  6.037   1.00 21.45  ? 129  ASN A CG    1 
ATOM   957   O  OD1   . ASN A 1 129  ? -27.264 39.187  5.452   1.00 26.37  ? 129  ASN A OD1   1 
ATOM   958   N  ND2   . ASN A 1 129  ? -26.156 38.741  7.351   1.00 17.93  ? 129  ASN A ND2   1 
ATOM   959   N  N     . ASP A 1 130  ? -25.241 41.643  5.329   1.00 22.14  ? 130  ASP A N     1 
ATOM   960   C  CA    . ASP A 1 130  ? -24.902 42.949  5.854   1.00 16.75  ? 130  ASP A CA    1 
ATOM   961   C  C     . ASP A 1 130  ? -23.483 42.886  6.380   1.00 14.85  ? 130  ASP A C     1 
ATOM   962   O  O     . ASP A 1 130  ? -23.018 41.823  6.785   1.00 10.53  ? 130  ASP A O     1 
ATOM   963   C  CB    . ASP A 1 130  ? -25.871 43.371  6.955   1.00 20.77  ? 130  ASP A CB    1 
ATOM   964   C  CG    . ASP A 1 130  ? -26.232 44.833  6.872   1.00 22.75  ? 130  ASP A CG    1 
ATOM   965   O  OD1   . ASP A 1 130  ? -25.357 45.631  6.476   1.00 23.40  ? 130  ASP A OD1   1 
ATOM   966   O  OD2   . ASP A 1 130  ? -27.388 45.183  7.186   1.00 24.02  ? 130  ASP A OD2   1 
ATOM   967   N  N     . LYS A 1 131  ? -22.795 44.022  6.315   1.00 20.74  ? 131  LYS A N     1 
ATOM   968   C  CA    . LYS A 1 131  ? -21.420 44.177  6.791   1.00 28.16  ? 131  LYS A CA    1 
ATOM   969   C  C     . LYS A 1 131  ? -20.441 43.325  5.971   1.00 22.11  ? 131  LYS A C     1 
ATOM   970   O  O     . LYS A 1 131  ? -19.246 43.272  6.263   1.00 21.95  ? 131  LYS A O     1 
ATOM   971   C  CB    . LYS A 1 131  ? -21.334 43.855  8.298   1.00 31.48  ? 131  LYS A CB    1 
ATOM   972   C  CG    . LYS A 1 131  ? -20.851 42.453  8.680   1.00 23.70  ? 131  LYS A CG    1 
ATOM   973   C  CD    . LYS A 1 131  ? -21.090 42.164  10.155  1.00 24.01  ? 131  LYS A CD    1 
ATOM   974   C  CE    . LYS A 1 131  ? -22.575 42.157  10.485  1.00 24.06  ? 131  LYS A CE    1 
ATOM   975   N  NZ    . LYS A 1 131  ? -22.836 41.787  11.908  1.00 28.79  ? 131  LYS A NZ    1 
ATOM   976   N  N     . GLY A 1 132  ? -20.952 42.700  4.915   1.00 20.21  ? 132  GLY A N     1 
ATOM   977   C  CA    . GLY A 1 132  ? -20.148 41.840  4.069   1.00 17.58  ? 132  GLY A CA    1 
ATOM   978   C  C     . GLY A 1 132  ? -19.462 42.569  2.933   1.00 15.27  ? 132  GLY A C     1 
ATOM   979   O  O     . GLY A 1 132  ? -20.092 43.294  2.165   1.00 18.15  ? 132  GLY A O     1 
ATOM   980   N  N     . LYS A 1 133  ? -18.156 42.370  2.825   1.00 13.62  ? 133  LYS A N     1 
ATOM   981   C  CA    . LYS A 1 133  ? -17.377 43.000  1.771   1.00 11.99  ? 133  LYS A CA    1 
ATOM   982   C  C     . LYS A 1 133  ? -16.444 42.004  1.107   1.00 15.64  ? 133  LYS A C     1 
ATOM   983   O  O     . LYS A 1 133  ? -15.690 41.303  1.780   1.00 21.13  ? 133  LYS A O     1 
ATOM   984   C  CB    . LYS A 1 133  ? -16.564 44.164  2.318   1.00 18.69  ? 133  LYS A CB    1 
ATOM   985   C  CG    . LYS A 1 133  ? -15.476 44.591  1.372   1.00 16.02  ? 133  LYS A CG    1 
ATOM   986   C  CD    . LYS A 1 133  ? -14.609 45.676  1.940   1.00 16.63  ? 133  LYS A CD    1 
ATOM   987   C  CE    . LYS A 1 133  ? -13.355 45.815  1.097   1.00 39.81  ? 133  LYS A CE    1 
ATOM   988   N  NZ    . LYS A 1 133  ? -13.675 46.051  -0.343  1.00 43.03  ? 133  LYS A NZ    1 
ATOM   989   N  N     . LEU A 1 134  ? -16.475 41.958  -0.218  1.00 16.66  ? 134  LEU A N     1 
ATOM   990   C  CA    . LEU A 1 134  ? -15.723 40.950  -0.948  1.00 9.46   ? 134  LEU A CA    1 
ATOM   991   C  C     . LEU A 1 134  ? -14.935 41.538  -2.109  1.00 10.98  ? 134  LEU A C     1 
ATOM   992   O  O     . LEU A 1 134  ? -15.503 41.922  -3.128  1.00 16.82  ? 134  LEU A O     1 
ATOM   993   C  CB    . LEU A 1 134  ? -16.675 39.874  -1.452  1.00 7.79   ? 134  LEU A CB    1 
ATOM   994   C  CG    . LEU A 1 134  ? -16.045 38.599  -1.986  1.00 9.25   ? 134  LEU A CG    1 
ATOM   995   C  CD1   . LEU A 1 134  ? -15.061 38.029  -0.982  1.00 11.61  ? 134  LEU A CD1   1 
ATOM   996   C  CD2   . LEU A 1 134  ? -17.145 37.602  -2.287  1.00 11.78  ? 134  LEU A CD2   1 
ATOM   997   N  N     . GLU A 1 135  ? -13.620 41.599  -1.948  1.00 10.67  ? 135  GLU A N     1 
ATOM   998   C  CA    . GLU A 1 135  ? -12.748 42.149  -2.975  1.00 19.08  ? 135  GLU A CA    1 
ATOM   999   C  C     . GLU A 1 135  ? -11.858 41.063  -3.572  1.00 21.57  ? 135  GLU A C     1 
ATOM   1000  O  O     . GLU A 1 135  ? -11.004 40.506  -2.880  1.00 20.64  ? 135  GLU A O     1 
ATOM   1001  C  CB    . GLU A 1 135  ? -11.905 43.283  -2.392  1.00 29.14  ? 135  GLU A CB    1 
ATOM   1002  C  CG    . GLU A 1 135  ? -10.807 43.780  -3.307  1.00 41.44  ? 135  GLU A CG    1 
ATOM   1003  C  CD    . GLU A 1 135  ? -10.040 44.938  -2.704  1.00 51.93  ? 135  GLU A CD    1 
ATOM   1004  O  OE1   . GLU A 1 135  ? -8.837  45.083  -3.011  1.00 57.15  ? 135  GLU A OE1   1 
ATOM   1005  O  OE2   . GLU A 1 135  ? -10.646 45.703  -1.922  1.00 51.18  ? 135  GLU A OE2   1 
ATOM   1006  N  N     . VAL A 1 136  ? -12.074 40.766  -4.856  1.00 22.20  ? 136  VAL A N     1 
ATOM   1007  C  CA    . VAL A 1 136  ? -11.381 39.671  -5.542  1.00 16.98  ? 136  VAL A CA    1 
ATOM   1008  C  C     . VAL A 1 136  ? -10.650 40.115  -6.808  1.00 11.97  ? 136  VAL A C     1 
ATOM   1009  O  O     . VAL A 1 136  ? -11.012 41.110  -7.434  1.00 16.90  ? 136  VAL A O     1 
ATOM   1010  C  CB    . VAL A 1 136  ? -12.354 38.547  -5.941  1.00 14.74  ? 136  VAL A CB    1 
ATOM   1011  C  CG1   . VAL A 1 136  ? -11.622 37.216  -6.021  1.00 15.94  ? 136  VAL A CG1   1 
ATOM   1012  C  CG2   . VAL A 1 136  ? -13.496 38.452  -4.952  1.00 21.93  ? 136  VAL A CG2   1 
ATOM   1013  N  N     . GLU A 1 137  ? -9.639  39.341  -7.190  1.00 8.08   ? 137  GLU A N     1 
ATOM   1014  C  CA    . GLU A 1 137  ? -8.750  39.667  -8.299  1.00 9.67   ? 137  GLU A CA    1 
ATOM   1015  C  C     . GLU A 1 137  ? -8.348  38.396  -9.051  1.00 13.41  ? 137  GLU A C     1 
ATOM   1016  O  O     . GLU A 1 137  ? -7.556  37.606  -8.547  1.00 22.57  ? 137  GLU A O     1 
ATOM   1017  C  CB    . GLU A 1 137  ? -7.516  40.393  -7.764  1.00 11.68  ? 137  GLU A CB    1 
ATOM   1018  C  CG    . GLU A 1 137  ? -6.346  40.491  -8.722  1.00 18.04  ? 137  GLU A CG    1 
ATOM   1019  C  CD    . GLU A 1 137  ? -5.123  41.099  -8.065  1.00 21.14  ? 137  GLU A CD    1 
ATOM   1020  O  OE1   . GLU A 1 137  ? -5.295  41.931  -7.151  1.00 20.42  ? 137  GLU A OE1   1 
ATOM   1021  O  OE2   . GLU A 1 137  ? -3.992  40.738  -8.452  1.00 30.82  ? 137  GLU A OE2   1 
ATOM   1022  N  N     . LEU A 1 138  ? -8.880  38.198  -10.254 1.00 14.20  ? 138  LEU A N     1 
ATOM   1023  C  CA    . LEU A 1 138  ? -8.734  36.913  -10.944 1.00 10.54  ? 138  LEU A CA    1 
ATOM   1024  C  C     . LEU A 1 138  ? -7.828  36.970  -12.175 1.00 12.62  ? 138  LEU A C     1 
ATOM   1025  O  O     . LEU A 1 138  ? -7.946  37.865  -13.006 1.00 19.97  ? 138  LEU A O     1 
ATOM   1026  C  CB    . LEU A 1 138  ? -10.110 36.372  -11.351 1.00 7.31   ? 138  LEU A CB    1 
ATOM   1027  C  CG    . LEU A 1 138  ? -11.139 36.062  -10.253 1.00 5.54   ? 138  LEU A CG    1 
ATOM   1028  C  CD1   . LEU A 1 138  ? -11.796 37.324  -9.702  1.00 11.31  ? 138  LEU A CD1   1 
ATOM   1029  C  CD2   . LEU A 1 138  ? -12.199 35.091  -10.752 1.00 2.86   ? 138  LEU A CD2   1 
ATOM   1030  N  N     . VAL A 1 139  ? -6.930  35.994  -12.283 1.00 9.33   ? 139  VAL A N     1 
ATOM   1031  C  CA    . VAL A 1 139  ? -6.012  35.889  -13.418 1.00 13.56  ? 139  VAL A CA    1 
ATOM   1032  C  C     . VAL A 1 139  ? -6.526  34.871  -14.431 1.00 16.79  ? 139  VAL A C     1 
ATOM   1033  O  O     . VAL A 1 139  ? -6.918  33.767  -14.064 1.00 18.48  ? 139  VAL A O     1 
ATOM   1034  C  CB    . VAL A 1 139  ? -4.589  35.481  -12.967 1.00 9.82   ? 139  VAL A CB    1 
ATOM   1035  C  CG1   . VAL A 1 139  ? -3.688  35.225  -14.169 1.00 10.09  ? 139  VAL A CG1   1 
ATOM   1036  C  CG2   . VAL A 1 139  ? -3.990  36.543  -12.050 1.00 11.54  ? 139  VAL A CG2   1 
ATOM   1037  N  N     . VAL A 1 140  ? -6.528  35.244  -15.707 1.00 18.13  ? 140  VAL A N     1 
ATOM   1038  C  CA    . VAL A 1 140  ? -7.028  34.358  -16.752 1.00 16.54  ? 140  VAL A CA    1 
ATOM   1039  C  C     . VAL A 1 140  ? -6.001  34.167  -17.855 1.00 13.55  ? 140  VAL A C     1 
ATOM   1040  O  O     . VAL A 1 140  ? -5.436  35.130  -18.367 1.00 17.26  ? 140  VAL A O     1 
ATOM   1041  C  CB    . VAL A 1 140  ? -8.334  34.894  -17.367 1.00 18.65  ? 140  VAL A CB    1 
ATOM   1042  C  CG1   . VAL A 1 140  ? -8.799  33.995  -18.503 1.00 18.92  ? 140  VAL A CG1   1 
ATOM   1043  C  CG2   . VAL A 1 140  ? -9.412  35.010  -16.304 1.00 17.81  ? 140  VAL A CG2   1 
ATOM   1044  N  N     . GLU A 1 141  ? -5.763  32.912  -18.216 1.00 18.23  ? 141  GLU A N     1 
ATOM   1045  C  CA    . GLU A 1 141  ? -4.848  32.593  -19.298 1.00 19.00  ? 141  GLU A CA    1 
ATOM   1046  C  C     . GLU A 1 141  ? -5.545  31.776  -20.370 1.00 15.12  ? 141  GLU A C     1 
ATOM   1047  O  O     . GLU A 1 141  ? -6.691  31.361  -20.207 1.00 15.13  ? 141  GLU A O     1 
ATOM   1048  C  CB    . GLU A 1 141  ? -3.637  31.826  -18.773 1.00 21.95  ? 141  GLU A CB    1 
ATOM   1049  C  CG    . GLU A 1 141  ? -2.972  32.461  -17.560 1.00 33.32  ? 141  GLU A CG    1 
ATOM   1050  C  CD    . GLU A 1 141  ? -1.799  31.643  -17.046 1.00 36.85  ? 141  GLU A CD    1 
ATOM   1051  O  OE1   . GLU A 1 141  ? -1.288  30.801  -17.816 1.00 36.37  ? 141  GLU A OE1   1 
ATOM   1052  O  OE2   . GLU A 1 141  ? -1.394  31.835  -15.878 1.00 33.44  ? 141  GLU A OE2   1 
ATOM   1053  N  N     . ARG A 1 142  ? -4.848  31.557  -21.475 1.00 13.97  ? 142  ARG A N     1 
ATOM   1054  C  CA    . ARG A 1 142  ? -5.351  30.685  -22.520 1.00 23.64  ? 142  ARG A CA    1 
ATOM   1055  C  C     . ARG A 1 142  ? -4.647  29.339  -22.448 1.00 28.80  ? 142  ARG A C     1 
ATOM   1056  O  O     . ARG A 1 142  ? -3.527  29.245  -21.951 1.00 37.37  ? 142  ARG A O     1 
ATOM   1057  C  CB    . ARG A 1 142  ? -5.153  31.316  -23.898 1.00 36.30  ? 142  ARG A CB    1 
ATOM   1058  C  CG    . ARG A 1 142  ? -6.108  32.452  -24.212 1.00 36.13  ? 142  ARG A CG    1 
ATOM   1059  C  CD    . ARG A 1 142  ? -5.996  32.871  -25.672 1.00 37.49  ? 142  ARG A CD    1 
ATOM   1060  N  NE    . ARG A 1 142  ? -6.277  31.772  -26.595 1.00 28.50  ? 142  ARG A NE    1 
ATOM   1061  C  CZ    . ARG A 1 142  ? -7.497  31.423  -26.991 1.00 17.77  ? 142  ARG A CZ    1 
ATOM   1062  N  NH1   . ARG A 1 142  ? -8.555  32.080  -26.538 1.00 22.92  ? 142  ARG A NH1   1 
ATOM   1063  N  NH2   . ARG A 1 142  ? -7.663  30.414  -27.834 1.00 12.80  ? 142  ARG A NH2   1 
ATOM   1064  N  N     . GLY A 1 143  ? -5.306  28.298  -22.943 1.00 23.83  ? 143  GLY A N     1 
ATOM   1065  C  CA    . GLY A 1 143  ? -4.724  26.970  -22.946 1.00 25.15  ? 143  GLY A CA    1 
ATOM   1066  C  C     . GLY A 1 143  ? -5.727  25.905  -23.342 1.00 29.53  ? 143  GLY A C     1 
ATOM   1067  O  O     . GLY A 1 143  ? -6.832  26.218  -23.785 1.00 31.91  ? 143  GLY A O     1 
ATOM   1068  N  N     . ARG A 1 144  ? -5.343  24.643  -23.178 1.00 30.01  ? 144  ARG A N     1 
ATOM   1069  C  CA    . ARG A 1 144  ? -6.199  23.528  -23.569 1.00 25.81  ? 144  ARG A CA    1 
ATOM   1070  C  C     . ARG A 1 144  ? -6.193  22.414  -22.530 1.00 22.28  ? 144  ARG A C     1 
ATOM   1071  O  O     . ARG A 1 144  ? -5.289  22.327  -21.700 1.00 20.98  ? 144  ARG A O     1 
ATOM   1072  C  CB    . ARG A 1 144  ? -5.761  22.970  -24.927 1.00 30.07  ? 144  ARG A CB    1 
ATOM   1073  C  CG    . ARG A 1 144  ? -4.464  22.182  -24.873 1.00 34.99  ? 144  ARG A CG    1 
ATOM   1074  C  CD    . ARG A 1 144  ? -4.016  21.725  -26.251 1.00 28.79  ? 144  ARG A CD    1 
ATOM   1075  N  NE    . ARG A 1 144  ? -2.686  21.132  -26.196 1.00 34.84  ? 144  ARG A NE    1 
ATOM   1076  C  CZ    . ARG A 1 144  ? -1.556  21.833  -26.191 1.00 42.88  ? 144  ARG A CZ    1 
ATOM   1077  N  NH1   . ARG A 1 144  ? -1.589  23.159  -26.243 1.00 39.21  ? 144  ARG A NH1   1 
ATOM   1078  N  NH2   . ARG A 1 144  ? -0.389  21.206  -26.134 1.00 50.52  ? 144  ARG A NH2   1 
ATOM   1079  N  N     . GLY A 1 145  ? -7.210  21.562  -22.590 1.00 19.71  ? 145  GLY A N     1 
ATOM   1080  C  CA    . GLY A 1 145  ? -7.301  20.413  -21.708 1.00 20.73  ? 145  GLY A CA    1 
ATOM   1081  C  C     . GLY A 1 145  ? -7.555  20.777  -20.258 1.00 17.62  ? 145  GLY A C     1 
ATOM   1082  O  O     . GLY A 1 145  ? -8.300  21.710  -19.964 1.00 22.64  ? 145  GLY A O     1 
ATOM   1083  N  N     . TYR A 1 146  ? -6.931  20.034  -19.351 1.00 13.12  ? 146  TYR A N     1 
ATOM   1084  C  CA    . TYR A 1 146  ? -7.098  20.258  -17.919 1.00 12.32  ? 146  TYR A CA    1 
ATOM   1085  C  C     . TYR A 1 146  ? -5.752  20.400  -17.229 1.00 10.56  ? 146  TYR A C     1 
ATOM   1086  O  O     . TYR A 1 146  ? -4.919  19.503  -17.294 1.00 11.53  ? 146  TYR A O     1 
ATOM   1087  C  CB    . TYR A 1 146  ? -7.894  19.113  -17.286 1.00 12.38  ? 146  TYR A CB    1 
ATOM   1088  C  CG    . TYR A 1 146  ? -7.751  19.003  -15.781 1.00 12.56  ? 146  TYR A CG    1 
ATOM   1089  C  CD1   . TYR A 1 146  ? -8.511  19.794  -14.929 1.00 11.21  ? 146  TYR A CD1   1 
ATOM   1090  C  CD2   . TYR A 1 146  ? -6.866  18.093  -15.212 1.00 12.59  ? 146  TYR A CD2   1 
ATOM   1091  C  CE1   . TYR A 1 146  ? -8.386  19.690  -13.554 1.00 9.22   ? 146  TYR A CE1   1 
ATOM   1092  C  CE2   . TYR A 1 146  ? -6.734  17.984  -13.841 1.00 8.68   ? 146  TYR A CE2   1 
ATOM   1093  C  CZ    . TYR A 1 146  ? -7.496  18.784  -13.018 1.00 7.71   ? 146  TYR A CZ    1 
ATOM   1094  O  OH    . TYR A 1 146  ? -7.366  18.676  -11.653 1.00 7.96   ? 146  TYR A OH    1 
ATOM   1095  N  N     . VAL A 1 147  ? -5.540  21.527  -16.563 1.00 11.86  ? 147  VAL A N     1 
ATOM   1096  C  CA    . VAL A 1 147  ? -4.280  21.762  -15.871 1.00 14.18  ? 147  VAL A CA    1 
ATOM   1097  C  C     . VAL A 1 147  ? -4.524  22.106  -14.404 1.00 17.08  ? 147  VAL A C     1 
ATOM   1098  O  O     . VAL A 1 147  ? -5.199  23.086  -14.094 1.00 17.67  ? 147  VAL A O     1 
ATOM   1099  C  CB    . VAL A 1 147  ? -3.469  22.886  -16.541 1.00 19.33  ? 147  VAL A CB    1 
ATOM   1100  C  CG1   . VAL A 1 147  ? -2.176  23.130  -15.783 1.00 24.12  ? 147  VAL A CG1   1 
ATOM   1101  C  CG2   . VAL A 1 147  ? -3.178  22.539  -17.998 1.00 17.76  ? 147  VAL A CG2   1 
ATOM   1102  N  N     . PRO A 1 148  ? -3.970  21.289  -13.498 1.00 16.04  ? 148  PRO A N     1 
ATOM   1103  C  CA    . PRO A 1 148  ? -4.168  21.413  -12.051 1.00 17.56  ? 148  PRO A CA    1 
ATOM   1104  C  C     . PRO A 1 148  ? -3.697  22.750  -11.495 1.00 19.87  ? 148  PRO A C     1 
ATOM   1105  O  O     . PRO A 1 148  ? -2.844  23.410  -12.084 1.00 26.77  ? 148  PRO A O     1 
ATOM   1106  C  CB    . PRO A 1 148  ? -3.323  20.267  -11.483 1.00 16.00  ? 148  PRO A CB    1 
ATOM   1107  C  CG    . PRO A 1 148  ? -3.204  19.297  -12.598 1.00 19.71  ? 148  PRO A CG    1 
ATOM   1108  C  CD    . PRO A 1 148  ? -3.124  20.133  -13.833 1.00 18.68  ? 148  PRO A CD    1 
ATOM   1109  N  N     . ALA A 1 149  ? -4.271  23.145  -10.367 1.00 21.72  ? 149  ALA A N     1 
ATOM   1110  C  CA    . ALA A 1 149  ? -3.817  24.326  -9.650  1.00 24.15  ? 149  ALA A CA    1 
ATOM   1111  C  C     . ALA A 1 149  ? -2.354  24.173  -9.277  1.00 31.71  ? 149  ALA A C     1 
ATOM   1112  O  O     . ALA A 1 149  ? -1.516  25.016  -9.609  1.00 25.58  ? 149  ALA A O     1 
ATOM   1113  C  CB    . ALA A 1 149  ? -4.646  24.538  -8.401  1.00 28.31  ? 149  ALA A CB    1 
ATOM   1114  N  N     . VAL A 1 150  ? -2.075  23.053  -8.615  1.00 35.10  ? 150  VAL A N     1 
ATOM   1115  C  CA    . VAL A 1 150  ? -0.827  22.785  -7.901  1.00 35.58  ? 150  VAL A CA    1 
ATOM   1116  C  C     . VAL A 1 150  ? 0.442   23.261  -8.597  1.00 41.66  ? 150  VAL A C     1 
ATOM   1117  O  O     . VAL A 1 150  ? 1.463   23.483  -7.949  1.00 46.27  ? 150  VAL A O     1 
ATOM   1118  C  CB    . VAL A 1 150  ? -0.682  21.275  -7.628  1.00 43.25  ? 150  VAL A CB    1 
ATOM   1119  C  CG1   . VAL A 1 150  ? -1.849  20.776  -6.788  1.00 46.80  ? 150  VAL A CG1   1 
ATOM   1120  C  CG2   . VAL A 1 150  ? -0.596  20.496  -8.936  1.00 43.08  ? 150  VAL A CG2   1 
ATOM   1121  N  N     . GLN A 1 151  ? 0.373   23.426  -9.911  1.00 48.92  ? 151  GLN A N     1 
ATOM   1122  C  CA    . GLN A 1 151  ? 1.549   23.763  -10.692 1.00 57.20  ? 151  GLN A CA    1 
ATOM   1123  C  C     . GLN A 1 151  ? 1.932   25.231  -10.541 1.00 44.94  ? 151  GLN A C     1 
ATOM   1124  O  O     . GLN A 1 151  ? 3.096   25.591  -10.700 1.00 55.24  ? 151  GLN A O     1 
ATOM   1125  C  CB    . GLN A 1 151  ? 1.321   23.416  -12.167 1.00 63.08  ? 151  GLN A CB    1 
ATOM   1126  C  CG    . GLN A 1 151  ? 1.144   21.919  -12.430 1.00 54.69  ? 151  GLN A CG    1 
ATOM   1127  C  CD    . GLN A 1 151  ? 1.311   21.551  -13.896 1.00 49.07  ? 151  GLN A CD    1 
ATOM   1128  O  OE1   . GLN A 1 151  ? 1.942   22.279  -14.662 1.00 55.06  ? 151  GLN A OE1   1 
ATOM   1129  N  NE2   . GLN A 1 151  ? 0.743   20.414  -14.292 1.00 35.66  ? 151  GLN A NE2   1 
ATOM   1130  N  N     . ASN A 1 152  ? 0.960   26.073  -10.215 1.00 32.62  ? 152  ASN A N     1 
ATOM   1131  C  CA    . ASN A 1 152  ? 1.217   27.504  -10.089 1.00 47.11  ? 152  ASN A CA    1 
ATOM   1132  C  C     . ASN A 1 152  ? 2.169   27.868  -8.952  1.00 52.28  ? 152  ASN A C     1 
ATOM   1133  O  O     . ASN A 1 152  ? 3.069   28.689  -9.120  1.00 57.93  ? 152  ASN A O     1 
ATOM   1134  C  CB    . ASN A 1 152  ? -0.098  28.258  -9.892  1.00 64.12  ? 152  ASN A CB    1 
ATOM   1135  C  CG    . ASN A 1 152  ? 0.114   29.734  -9.571  1.00 73.08  ? 152  ASN A CG    1 
ATOM   1136  O  OD1   . ASN A 1 152  ? 0.217   30.122  -8.404  1.00 63.49  ? 152  ASN A OD1   1 
ATOM   1137  N  ND2   . ASN A 1 152  ? 0.174   30.563  -10.609 1.00 79.30  ? 152  ASN A ND2   1 
ATOM   1138  N  N     . ARG A 1 153  ? 1.962   27.243  -7.800  1.00 45.87  ? 153  ARG A N     1 
ATOM   1139  C  CA    . ARG A 1 153  ? 2.587   27.662  -6.548  1.00 45.55  ? 153  ARG A CA    1 
ATOM   1140  C  C     . ARG A 1 153  ? 4.113   27.551  -6.526  1.00 43.27  ? 153  ARG A C     1 
ATOM   1141  O  O     . ARG A 1 153  ? 4.789   28.290  -5.808  1.00 44.34  ? 153  ARG A O     1 
ATOM   1142  C  CB    . ARG A 1 153  ? 1.988   26.846  -5.402  1.00 44.25  ? 153  ARG A CB    1 
ATOM   1143  C  CG    . ARG A 1 153  ? 2.991   26.287  -4.407  1.00 40.87  ? 153  ARG A CG    1 
ATOM   1144  C  CD    . ARG A 1 153  ? 2.409   25.083  -3.709  1.00 39.25  ? 153  ARG A CD    1 
ATOM   1145  N  NE    . ARG A 1 153  ? 1.056   25.357  -3.236  1.00 37.98  ? 153  ARG A NE    1 
ATOM   1146  C  CZ    . ARG A 1 153  ? -0.032  24.740  -3.689  1.00 43.84  ? 153  ARG A CZ    1 
ATOM   1147  N  NH1   . ARG A 1 153  ? 0.074   23.794  -4.616  1.00 49.87  ? 153  ARG A NH1   1 
ATOM   1148  N  NH2   . ARG A 1 153  ? -1.224  25.060  -3.206  1.00 38.60  ? 153  ARG A NH2   1 
ATOM   1149  N  N     . ALA A 1 154  ? 4.652   26.633  -7.318  1.00 41.44  ? 154  ALA A N     1 
ATOM   1150  C  CA    . ALA A 1 154  ? 6.089   26.377  -7.331  1.00 43.84  ? 154  ALA A CA    1 
ATOM   1151  C  C     . ALA A 1 154  ? 6.862   27.450  -8.093  1.00 45.03  ? 154  ALA A C     1 
ATOM   1152  O  O     . ALA A 1 154  ? 8.081   27.565  -7.950  1.00 43.81  ? 154  ALA A O     1 
ATOM   1153  C  CB    . ALA A 1 154  ? 6.367   25.013  -7.934  1.00 49.61  ? 154  ALA A CB    1 
ATOM   1154  N  N     . SER A 1 155  ? 6.142   28.227  -8.899  1.00 48.12  ? 155  SER A N     1 
ATOM   1155  C  CA    . SER A 1 155  ? 6.741   29.201  -9.809  1.00 45.92  ? 155  SER A CA    1 
ATOM   1156  C  C     . SER A 1 155  ? 7.520   30.290  -9.087  1.00 50.68  ? 155  SER A C     1 
ATOM   1157  O  O     . SER A 1 155  ? 8.654   30.608  -9.444  1.00 57.41  ? 155  SER A O     1 
ATOM   1158  C  CB    . SER A 1 155  ? 5.656   29.855  -10.663 1.00 39.37  ? 155  SER A CB    1 
ATOM   1159  O  OG    . SER A 1 155  ? 4.676   28.912  -11.048 1.00 46.99  ? 155  SER A OG    1 
ATOM   1160  N  N     . GLY A 1 156  ? 6.887   30.867  -8.075  1.00 46.62  ? 156  GLY A N     1 
ATOM   1161  C  CA    . GLY A 1 156  ? 7.458   31.979  -7.344  1.00 41.34  ? 156  GLY A CA    1 
ATOM   1162  C  C     . GLY A 1 156  ? 6.338   32.886  -6.890  1.00 39.37  ? 156  GLY A C     1 
ATOM   1163  O  O     . GLY A 1 156  ? 6.579   33.990  -6.406  1.00 46.60  ? 156  GLY A O     1 
ATOM   1164  N  N     . ALA A 1 157  ? 5.107   32.411  -7.058  1.00 39.70  ? 157  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1 157  ? 3.932   33.178  -6.676  1.00 36.67  ? 157  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1 157  ? 4.008   33.540  -5.206  1.00 38.31  ? 157  ALA A C     1 
ATOM   1167  O  O     . ALA A 1 157  ? 4.320   32.699  -4.365  1.00 43.17  ? 157  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1 157  ? 2.657   32.399  -6.975  1.00 41.42  ? 157  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1 158  ? 3.746   34.808  -4.909  1.00 34.50  ? 158  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1 158  ? 3.806   35.306  -3.543  1.00 27.20  ? 158  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1 158  ? 2.728   34.657  -2.694  1.00 19.05  ? 158  GLU A C     1 
ATOM   1172  O  O     . GLU A 1 158  ? 1.735   34.150  -3.211  1.00 23.92  ? 158  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1 158  ? 3.662   36.829  -3.515  1.00 27.51  ? 158  GLU A CB    1 
ATOM   1174  N  N     . ILE A 1 159  ? 2.917   34.699  -1.384  1.00 14.49  ? 159  ILE A N     1 
ATOM   1175  C  CA    . ILE A 1 159  ? 2.069   33.970  -0.455  1.00 11.52  ? 159  ILE A CA    1 
ATOM   1176  C  C     . ILE A 1 159  ? 0.618   34.464  -0.443  1.00 8.07   ? 159  ILE A C     1 
ATOM   1177  O  O     . ILE A 1 159  ? -0.236  33.911  0.246   1.00 6.41   ? 159  ILE A O     1 
ATOM   1178  C  CB    . ILE A 1 159  ? 2.672   34.052  0.952   1.00 11.66  ? 159  ILE A CB    1 
ATOM   1179  C  CG1   . ILE A 1 159  ? 4.197   33.993  0.839   1.00 9.18   ? 159  ILE A CG1   1 
ATOM   1180  C  CG2   . ILE A 1 159  ? 2.139   32.943  1.844   1.00 11.76  ? 159  ILE A CG2   1 
ATOM   1181  C  CD1   . ILE A 1 159  ? 4.887   33.376  2.023   1.00 16.81  ? 159  ILE A CD1   1 
ATOM   1182  N  N     . GLY A 1 160  ? 0.332   35.495  -1.225  1.00 8.15   ? 160  GLY A N     1 
ATOM   1183  C  CA    . GLY A 1 160  ? -1.011  36.031  -1.284  1.00 14.26  ? 160  GLY A CA    1 
ATOM   1184  C  C     . GLY A 1 160  ? -1.895  35.289  -2.265  1.00 15.41  ? 160  GLY A C     1 
ATOM   1185  O  O     . GLY A 1 160  ? -3.104  35.183  -2.067  1.00 18.58  ? 160  GLY A O     1 
ATOM   1186  N  N     . ARG A 1 161  ? -1.285  34.761  -3.322  1.00 13.29  ? 161  ARG A N     1 
ATOM   1187  C  CA    . ARG A 1 161  ? -2.035  34.180  -4.432  1.00 14.16  ? 161  ARG A CA    1 
ATOM   1188  C  C     . ARG A 1 161  ? -2.558  32.784  -4.132  1.00 6.79   ? 161  ARG A C     1 
ATOM   1189  O  O     . ARG A 1 161  ? -1.924  32.009  -3.424  1.00 11.98  ? 161  ARG A O     1 
ATOM   1190  C  CB    . ARG A 1 161  ? -1.172  34.157  -5.696  1.00 22.65  ? 161  ARG A CB    1 
ATOM   1191  C  CG    . ARG A 1 161  ? -1.071  35.514  -6.383  1.00 30.30  ? 161  ARG A CG    1 
ATOM   1192  C  CD    . ARG A 1 161  ? -0.049  35.510  -7.505  1.00 38.09  ? 161  ARG A CD    1 
ATOM   1193  N  NE    . ARG A 1 161  ? 1.064   36.408  -7.216  1.00 41.54  ? 161  ARG A NE    1 
ATOM   1194  C  CZ    . ARG A 1 161  ? 2.170   36.487  -7.952  1.00 52.39  ? 161  ARG A CZ    1 
ATOM   1195  N  NH1   . ARG A 1 161  ? 3.135   37.333  -7.616  1.00 58.45  ? 161  ARG A NH1   1 
ATOM   1196  N  NH2   . ARG A 1 161  ? 2.316   35.718  -9.025  1.00 51.79  ? 161  ARG A NH2   1 
ATOM   1197  N  N     . ILE A 1 162  ? -3.728  32.477  -4.679  1.00 6.69   ? 162  ILE A N     1 
ATOM   1198  C  CA    . ILE A 1 162  ? -4.393  31.207  -4.428  1.00 9.40   ? 162  ILE A CA    1 
ATOM   1199  C  C     . ILE A 1 162  ? -4.657  30.466  -5.729  1.00 10.24  ? 162  ILE A C     1 
ATOM   1200  O  O     . ILE A 1 162  ? -5.687  30.669  -6.363  1.00 16.57  ? 162  ILE A O     1 
ATOM   1201  C  CB    . ILE A 1 162  ? -5.726  31.406  -3.694  1.00 9.18   ? 162  ILE A CB    1 
ATOM   1202  C  CG1   . ILE A 1 162  ? -5.548  32.358  -2.513  1.00 7.34   ? 162  ILE A CG1   1 
ATOM   1203  C  CG2   . ILE A 1 162  ? -6.284  30.070  -3.239  1.00 12.83  ? 162  ILE A CG2   1 
ATOM   1204  C  CD1   . ILE A 1 162  ? -6.829  32.646  -1.774  1.00 7.39   ? 162  ILE A CD1   1 
ATOM   1205  N  N     . PRO A 1 163  ? -3.721  29.600  -6.128  1.00 9.15   ? 163  PRO A N     1 
ATOM   1206  C  CA    . PRO A 1 163  ? -3.801  28.833  -7.375  1.00 9.27   ? 163  PRO A CA    1 
ATOM   1207  C  C     . PRO A 1 163  ? -5.082  28.020  -7.489  1.00 6.05   ? 163  PRO A C     1 
ATOM   1208  O  O     . PRO A 1 163  ? -5.534  27.439  -6.506  1.00 6.59   ? 163  PRO A O     1 
ATOM   1209  C  CB    . PRO A 1 163  ? -2.576  27.917  -7.301  1.00 23.27  ? 163  PRO A CB    1 
ATOM   1210  C  CG    . PRO A 1 163  ? -2.164  27.923  -5.862  1.00 22.39  ? 163  PRO A CG    1 
ATOM   1211  C  CD    . PRO A 1 163  ? -2.514  29.273  -5.358  1.00 17.02  ? 163  PRO A CD    1 
ATOM   1212  N  N     . VAL A 1 164  ? -5.663  27.998  -8.684  1.00 5.08   ? 164  VAL A N     1 
ATOM   1213  C  CA    . VAL A 1 164  ? -6.906  27.271  -8.925  1.00 10.75  ? 164  VAL A CA    1 
ATOM   1214  C  C     . VAL A 1 164  ? -6.745  26.349  -10.129 1.00 12.67  ? 164  VAL A C     1 
ATOM   1215  O  O     . VAL A 1 164  ? -5.974  26.634  -11.045 1.00 13.51  ? 164  VAL A O     1 
ATOM   1216  C  CB    . VAL A 1 164  ? -8.094  28.231  -9.161  1.00 12.69  ? 164  VAL A CB    1 
ATOM   1217  C  CG1   . VAL A 1 164  ? -9.418  27.471  -9.165  1.00 6.68   ? 164  VAL A CG1   1 
ATOM   1218  C  CG2   . VAL A 1 164  ? -8.117  29.321  -8.097  1.00 19.16  ? 164  VAL A CG2   1 
ATOM   1219  N  N     . ASP A 1 165  ? -7.446  25.221  -10.100 1.00 10.83  ? 165  ASP A N     1 
ATOM   1220  C  CA    . ASP A 1 165  ? -7.442  24.288  -11.214 1.00 13.54  ? 165  ASP A CA    1 
ATOM   1221  C  C     . ASP A 1 165  ? -8.013  24.956  -12.454 1.00 14.28  ? 165  ASP A C     1 
ATOM   1222  O  O     . ASP A 1 165  ? -8.843  25.855  -12.350 1.00 12.82  ? 165  ASP A O     1 
ATOM   1223  C  CB    . ASP A 1 165  ? -8.246  23.034  -10.868 1.00 16.15  ? 165  ASP A CB    1 
ATOM   1224  C  CG    . ASP A 1 165  ? -7.611  22.223  -9.761  1.00 11.81  ? 165  ASP A CG    1 
ATOM   1225  O  OD1   . ASP A 1 165  ? -8.347  21.735  -8.877  1.00 8.28   ? 165  ASP A OD1   1 
ATOM   1226  O  OD2   . ASP A 1 165  ? -6.374  22.074  -9.777  1.00 14.57  ? 165  ASP A OD2   1 
ATOM   1227  N  N     . SER A 1 166  ? -7.565  24.516  -13.624 1.00 14.63  ? 166  SER A N     1 
ATOM   1228  C  CA    . SER A 1 166  ? -8.048  25.082  -14.874 1.00 12.11  ? 166  SER A CA    1 
ATOM   1229  C  C     . SER A 1 166  ? -8.656  24.030  -15.781 1.00 9.94   ? 166  SER A C     1 
ATOM   1230  O  O     . SER A 1 166  ? -8.050  22.995  -16.051 1.00 14.57  ? 166  SER A O     1 
ATOM   1231  C  CB    . SER A 1 166  ? -6.917  25.798  -15.608 1.00 14.37  ? 166  SER A CB    1 
ATOM   1232  O  OG    . SER A 1 166  ? -6.354  26.808  -14.791 1.00 16.07  ? 166  SER A OG    1 
ATOM   1233  N  N     . ILE A 1 167  ? -9.861  24.307  -16.254 1.00 8.87   ? 167  ILE A N     1 
ATOM   1234  C  CA    . ILE A 1 167  ? -10.521 23.435  -17.206 1.00 18.68  ? 167  ILE A CA    1 
ATOM   1235  C  C     . ILE A 1 167  ? -10.711 24.178  -18.518 1.00 22.63  ? 167  ILE A C     1 
ATOM   1236  O  O     . ILE A 1 167  ? -11.809 24.642  -18.820 1.00 28.70  ? 167  ILE A O     1 
ATOM   1237  C  CB    . ILE A 1 167  ? -11.874 22.959  -16.677 1.00 20.45  ? 167  ILE A CB    1 
ATOM   1238  C  CG1   . ILE A 1 167  ? -11.775 22.691  -15.175 1.00 19.77  ? 167  ILE A CG1   1 
ATOM   1239  C  CG2   . ILE A 1 167  ? -12.337 21.725  -17.439 1.00 24.24  ? 167  ILE A CG2   1 
ATOM   1240  C  CD1   . ILE A 1 167  ? -13.035 22.117  -14.565 1.00 32.26  ? 167  ILE A CD1   1 
ATOM   1241  N  N     . TYR A 1 168  ? -9.638  24.295  -19.292 1.00 16.37  ? 168  TYR A N     1 
ATOM   1242  C  CA    . TYR A 1 168  ? -9.671  25.112  -20.495 1.00 14.09  ? 168  TYR A CA    1 
ATOM   1243  C  C     . TYR A 1 168  ? -10.641 24.599  -21.541 1.00 20.05  ? 168  TYR A C     1 
ATOM   1244  O  O     . TYR A 1 168  ? -11.160 25.386  -22.333 1.00 25.93  ? 168  TYR A O     1 
ATOM   1245  C  CB    . TYR A 1 168  ? -8.286  25.207  -21.116 1.00 16.82  ? 168  TYR A CB    1 
ATOM   1246  C  CG    . TYR A 1 168  ? -7.274  25.863  -20.223 1.00 19.72  ? 168  TYR A CG    1 
ATOM   1247  C  CD1   . TYR A 1 168  ? -7.443  27.172  -19.800 1.00 23.82  ? 168  TYR A CD1   1 
ATOM   1248  C  CD2   . TYR A 1 168  ? -6.147  25.177  -19.804 1.00 25.79  ? 168  TYR A CD2   1 
ATOM   1249  C  CE1   . TYR A 1 168  ? -6.520  27.779  -18.981 1.00 25.11  ? 168  TYR A CE1   1 
ATOM   1250  C  CE2   . TYR A 1 168  ? -5.217  25.771  -18.988 1.00 24.99  ? 168  TYR A CE2   1 
ATOM   1251  C  CZ    . TYR A 1 168  ? -5.407  27.072  -18.578 1.00 22.63  ? 168  TYR A CZ    1 
ATOM   1252  O  OH    . TYR A 1 168  ? -4.479  27.669  -17.762 1.00 20.90  ? 168  TYR A OH    1 
ATOM   1253  N  N     . SER A 1 169  ? -10.888 23.291  -21.544 1.00 20.45  ? 169  SER A N     1 
ATOM   1254  C  CA    . SER A 1 169  ? -11.703 22.671  -22.588 1.00 20.97  ? 169  SER A CA    1 
ATOM   1255  C  C     . SER A 1 169  ? -13.104 23.257  -22.638 1.00 23.02  ? 169  SER A C     1 
ATOM   1256  O  O     . SER A 1 169  ? -13.890 23.079  -21.713 1.00 20.59  ? 169  SER A O     1 
ATOM   1257  C  CB    . SER A 1 169  ? -11.792 21.161  -22.389 1.00 13.88  ? 169  SER A CB    1 
ATOM   1258  O  OG    . SER A 1 169  ? -12.580 20.579  -23.411 1.00 12.56  ? 169  SER A OG    1 
ATOM   1259  N  N     . PRO A 1 170  ? -13.421 23.953  -23.733 1.00 21.36  ? 170  PRO A N     1 
ATOM   1260  C  CA    . PRO A 1 170  ? -14.694 24.654  -23.850 1.00 19.46  ? 170  PRO A CA    1 
ATOM   1261  C  C     . PRO A 1 170  ? -15.791 23.739  -24.378 1.00 22.25  ? 170  PRO A C     1 
ATOM   1262  O  O     . PRO A 1 170  ? -16.887 24.206  -24.676 1.00 32.37  ? 170  PRO A O     1 
ATOM   1263  C  CB    . PRO A 1 170  ? -14.373 25.766  -24.842 1.00 22.44  ? 170  PRO A CB    1 
ATOM   1264  C  CG    . PRO A 1 170  ? -13.354 25.152  -25.746 1.00 20.11  ? 170  PRO A CG    1 
ATOM   1265  C  CD    . PRO A 1 170  ? -12.591 24.123  -24.937 1.00 20.00  ? 170  PRO A CD    1 
ATOM   1266  N  N     . VAL A 1 171  ? -15.497 22.448  -24.482 1.00 18.76  ? 171  VAL A N     1 
ATOM   1267  C  CA    . VAL A 1 171  ? -16.466 21.484  -24.985 1.00 22.44  ? 171  VAL A CA    1 
ATOM   1268  C  C     . VAL A 1 171  ? -17.275 20.859  -23.845 1.00 21.27  ? 171  VAL A C     1 
ATOM   1269  O  O     . VAL A 1 171  ? -16.782 20.707  -22.729 1.00 24.33  ? 171  VAL A O     1 
ATOM   1270  C  CB    . VAL A 1 171  ? -15.765 20.384  -25.800 1.00 27.09  ? 171  VAL A CB    1 
ATOM   1271  C  CG1   . VAL A 1 171  ? -16.770 19.624  -26.655 1.00 26.89  ? 171  VAL A CG1   1 
ATOM   1272  C  CG2   . VAL A 1 171  ? -14.683 20.999  -26.674 1.00 24.29  ? 171  VAL A CG2   1 
ATOM   1273  N  N     . LEU A 1 172  ? -18.523 20.506  -24.128 1.00 22.49  ? 172  LEU A N     1 
ATOM   1274  C  CA    . LEU A 1 172  ? -19.405 19.975  -23.099 1.00 28.97  ? 172  LEU A CA    1 
ATOM   1275  C  C     . LEU A 1 172  ? -19.621 18.469  -23.277 1.00 33.93  ? 172  LEU A C     1 
ATOM   1276  O  O     . LEU A 1 172  ? -19.128 17.672  -22.482 1.00 36.99  ? 172  LEU A O     1 
ATOM   1277  C  CB    . LEU A 1 172  ? -20.745 20.722  -23.112 1.00 36.15  ? 172  LEU A CB    1 
ATOM   1278  C  CG    . LEU A 1 172  ? -21.615 20.719  -21.849 1.00 35.93  ? 172  LEU A CG    1 
ATOM   1279  C  CD1   . LEU A 1 172  ? -22.454 21.987  -21.778 1.00 29.53  ? 172  LEU A CD1   1 
ATOM   1280  C  CD2   . LEU A 1 172  ? -22.512 19.487  -21.788 1.00 36.04  ? 172  LEU A CD2   1 
ATOM   1281  N  N     . LYS A 1 173  ? -20.345 18.082  -24.324 1.00 36.36  ? 173  LYS A N     1 
ATOM   1282  C  CA    . LYS A 1 173  ? -20.722 16.684  -24.518 1.00 24.82  ? 173  LYS A CA    1 
ATOM   1283  C  C     . LYS A 1 173  ? -20.791 16.321  -25.991 1.00 22.36  ? 173  LYS A C     1 
ATOM   1284  O  O     . LYS A 1 173  ? -21.471 16.986  -26.763 1.00 25.88  ? 173  LYS A O     1 
ATOM   1285  C  CB    . LYS A 1 173  ? -22.069 16.406  -23.852 1.00 21.68  ? 173  LYS A CB    1 
ATOM   1286  C  CG    . LYS A 1 173  ? -22.649 15.041  -24.165 1.00 14.69  ? 173  LYS A CG    1 
ATOM   1287  C  CD    . LYS A 1 173  ? -24.019 14.887  -23.542 1.00 11.90  ? 173  LYS A CD    1 
ATOM   1288  C  CE    . LYS A 1 173  ? -23.970 15.180  -22.056 1.00 14.67  ? 173  LYS A CE    1 
ATOM   1289  N  NZ    . LYS A 1 173  ? -25.268 14.887  -21.396 1.00 26.10  ? 173  LYS A NZ    1 
ATOM   1290  N  N     . VAL A 1 174  ? -20.094 15.257  -26.378 1.00 18.95  ? 174  VAL A N     1 
ATOM   1291  C  CA    . VAL A 1 174  ? -20.028 14.863  -27.783 1.00 20.36  ? 174  VAL A CA    1 
ATOM   1292  C  C     . VAL A 1 174  ? -20.429 13.403  -27.978 1.00 19.25  ? 174  VAL A C     1 
ATOM   1293  O  O     . VAL A 1 174  ? -20.087 12.543  -27.170 1.00 24.24  ? 174  VAL A O     1 
ATOM   1294  C  CB    . VAL A 1 174  ? -18.615 15.081  -28.357 1.00 16.32  ? 174  VAL A CB    1 
ATOM   1295  C  CG1   . VAL A 1 174  ? -18.572 14.749  -29.837 1.00 13.77  ? 174  VAL A CG1   1 
ATOM   1296  C  CG2   . VAL A 1 174  ? -18.167 16.512  -28.123 1.00 21.96  ? 174  VAL A CG2   1 
ATOM   1297  N  N     . THR A 1 175  ? -21.163 13.136  -29.053 1.00 16.12  ? 175  THR A N     1 
ATOM   1298  C  CA    . THR A 1 175  ? -21.565 11.781  -29.405 1.00 15.66  ? 175  THR A CA    1 
ATOM   1299  C  C     . THR A 1 175  ? -21.760 11.661  -30.911 1.00 26.90  ? 175  THR A C     1 
ATOM   1300  O  O     . THR A 1 175  ? -21.478 12.602  -31.655 1.00 36.84  ? 175  THR A O     1 
ATOM   1301  C  CB    . THR A 1 175  ? -22.861 11.373  -28.692 1.00 12.10  ? 175  THR A CB    1 
ATOM   1302  O  OG1   . THR A 1 175  ? -23.369 10.162  -29.265 1.00 15.79  ? 175  THR A OG1   1 
ATOM   1303  C  CG2   . THR A 1 175  ? -23.906 12.453  -28.834 1.00 16.82  ? 175  THR A CG2   1 
ATOM   1304  N  N     . TYR A 1 176  ? -22.244 10.503  -31.353 1.00 26.89  ? 176  TYR A N     1 
ATOM   1305  C  CA    . TYR A 1 176  ? -22.493 10.264  -32.771 1.00 25.36  ? 176  TYR A CA    1 
ATOM   1306  C  C     . TYR A 1 176  ? -23.333 9.012   -33.016 1.00 26.27  ? 176  TYR A C     1 
ATOM   1307  O  O     . TYR A 1 176  ? -23.355 8.087   -32.202 1.00 20.87  ? 176  TYR A O     1 
ATOM   1308  C  CB    . TYR A 1 176  ? -21.169 10.155  -33.538 1.00 26.74  ? 176  TYR A CB    1 
ATOM   1309  C  CG    . TYR A 1 176  ? -20.196 9.133   -32.987 1.00 22.99  ? 176  TYR A CG    1 
ATOM   1310  C  CD1   . TYR A 1 176  ? -20.330 7.785   -33.291 1.00 25.60  ? 176  TYR A CD1   1 
ATOM   1311  C  CD2   . TYR A 1 176  ? -19.134 9.518   -32.177 1.00 23.66  ? 176  TYR A CD2   1 
ATOM   1312  C  CE1   . TYR A 1 176  ? -19.447 6.846   -32.795 1.00 22.91  ? 176  TYR A CE1   1 
ATOM   1313  C  CE2   . TYR A 1 176  ? -18.241 8.584   -31.676 1.00 22.21  ? 176  TYR A CE2   1 
ATOM   1314  C  CZ    . TYR A 1 176  ? -18.405 7.249   -31.991 1.00 20.37  ? 176  TYR A CZ    1 
ATOM   1315  O  OH    . TYR A 1 176  ? -17.532 6.305   -31.504 1.00 19.28  ? 176  TYR A OH    1 
ATOM   1316  N  N     . LYS A 1 177  ? -24.025 8.996   -34.149 1.00 39.10  ? 177  LYS A N     1 
ATOM   1317  C  CA    . LYS A 1 177  ? -24.763 7.818   -34.584 1.00 47.69  ? 177  LYS A CA    1 
ATOM   1318  C  C     . LYS A 1 177  ? -24.588 7.622   -36.087 1.00 54.66  ? 177  LYS A C     1 
ATOM   1319  O  O     . LYS A 1 177  ? -24.391 8.586   -36.830 1.00 57.18  ? 177  LYS A O     1 
ATOM   1320  C  CB    . LYS A 1 177  ? -26.245 7.930   -34.218 1.00 55.31  ? 177  LYS A CB    1 
ATOM   1321  C  CG    . LYS A 1 177  ? -26.971 9.149   -34.770 1.00 59.18  ? 177  LYS A CG    1 
ATOM   1322  C  CD    . LYS A 1 177  ? -28.415 9.176   -34.275 1.00 60.96  ? 177  LYS A CD    1 
ATOM   1323  C  CE    . LYS A 1 177  ? -29.138 10.451  -34.678 1.00 61.13  ? 177  LYS A CE    1 
ATOM   1324  N  NZ    . LYS A 1 177  ? -30.535 10.473  -34.155 1.00 51.03  ? 177  LYS A NZ    1 
ATOM   1325  N  N     . VAL A 1 178  ? -24.656 6.371   -36.530 1.00 54.50  ? 178  VAL A N     1 
ATOM   1326  C  CA    . VAL A 1 178  ? -24.327 6.035   -37.911 1.00 62.28  ? 178  VAL A CA    1 
ATOM   1327  C  C     . VAL A 1 178  ? -25.453 5.295   -38.633 1.00 67.82  ? 178  VAL A C     1 
ATOM   1328  O  O     . VAL A 1 178  ? -25.974 4.293   -38.139 1.00 64.62  ? 178  VAL A O     1 
ATOM   1329  C  CB    . VAL A 1 178  ? -23.043 5.185   -37.970 1.00 59.03  ? 178  VAL A CB    1 
ATOM   1330  C  CG1   . VAL A 1 178  ? -22.874 4.548   -39.341 1.00 75.49  ? 178  VAL A CG1   1 
ATOM   1331  C  CG2   . VAL A 1 178  ? -21.833 6.039   -37.621 1.00 54.36  ? 178  VAL A CG2   1 
ATOM   1332  N  N     . ASP A 1 179  ? -25.824 5.805   -39.804 1.00 66.24  ? 179  ASP A N     1 
ATOM   1333  C  CA    . ASP A 1 179  ? -26.790 5.137   -40.666 1.00 65.62  ? 179  ASP A CA    1 
ATOM   1334  C  C     . ASP A 1 179  ? -26.077 4.393   -41.786 1.00 66.64  ? 179  ASP A C     1 
ATOM   1335  O  O     . ASP A 1 179  ? -25.747 4.974   -42.818 1.00 69.02  ? 179  ASP A O     1 
ATOM   1336  C  CB    . ASP A 1 179  ? -27.785 6.142   -41.252 1.00 69.34  ? 179  ASP A CB    1 
ATOM   1337  C  CG    . ASP A 1 179  ? -28.822 6.596   -40.243 1.00 65.36  ? 179  ASP A CG    1 
ATOM   1338  O  OD1   . ASP A 1 179  ? -29.244 7.769   -40.309 1.00 53.91  ? 179  ASP A OD1   1 
ATOM   1339  O  OD2   . ASP A 1 179  ? -29.215 5.780   -39.387 1.00 73.82  ? 179  ASP A OD2   1 
ATOM   1340  N  N     . ALA A 1 180  ? -25.840 3.104   -41.576 1.00 75.49  ? 180  ALA A N     1 
ATOM   1341  C  CA    . ALA A 1 180  ? -25.132 2.298   -42.560 1.00 86.94  ? 180  ALA A CA    1 
ATOM   1342  C  C     . ALA A 1 180  ? -26.101 1.524   -43.444 1.00 95.16  ? 180  ALA A C     1 
ATOM   1343  O  O     . ALA A 1 180  ? -26.842 0.662   -42.971 1.00 93.11  ? 180  ALA A O     1 
ATOM   1344  C  CB    . ALA A 1 180  ? -24.168 1.347   -41.873 1.00 86.57  ? 180  ALA A CB    1 
ATOM   1345  N  N     . THR A 1 181  ? -26.096 1.844   -44.732 1.00 96.99  ? 181  THR A N     1 
ATOM   1346  C  CA    . THR A 1 181  ? -26.914 1.126   -45.695 1.00 100.19 ? 181  THR A CA    1 
ATOM   1347  C  C     . THR A 1 181  ? -26.218 -0.174  -46.065 1.00 96.73  ? 181  THR A C     1 
ATOM   1348  O  O     . THR A 1 181  ? -25.231 -0.170  -46.794 1.00 93.19  ? 181  THR A O     1 
ATOM   1349  C  CB    . THR A 1 181  ? -27.171 1.963   -46.957 1.00 101.67 ? 181  THR A CB    1 
ATOM   1350  O  OG1   . THR A 1 181  ? -27.821 3.188   -46.592 1.00 94.94  ? 181  THR A OG1   1 
ATOM   1351  C  CG2   . THR A 1 181  ? -28.053 1.199   -47.933 1.00 106.82 ? 181  THR A CG2   1 
ATOM   1352  N  N     . ARG A 1 182  ? -26.724 -1.286  -45.547 1.00 92.76  ? 182  ARG A N     1 
ATOM   1353  C  CA    . ARG A 1 182  ? -26.086 -2.573  -45.777 1.00 94.94  ? 182  ARG A CA    1 
ATOM   1354  C  C     . ARG A 1 182  ? -26.841 -3.405  -46.803 1.00 102.42 ? 182  ARG A C     1 
ATOM   1355  O  O     . ARG A 1 182  ? -26.619 -4.610  -46.914 1.00 109.71 ? 182  ARG A O     1 
ATOM   1356  C  CB    . ARG A 1 182  ? -25.963 -3.348  -44.466 1.00 101.37 ? 182  ARG A CB    1 
ATOM   1357  C  CG    . ARG A 1 182  ? -24.543 -3.781  -44.144 1.00 106.32 ? 182  ARG A CG    1 
ATOM   1358  C  CD    . ARG A 1 182  ? -23.620 -2.577  -44.004 1.00 99.51  ? 182  ARG A CD    1 
ATOM   1359  N  NE    . ARG A 1 182  ? -22.248 -2.966  -43.686 1.00 79.55  ? 182  ARG A NE    1 
ATOM   1360  C  CZ    . ARG A 1 182  ? -21.242 -2.111  -43.539 1.00 62.46  ? 182  ARG A CZ    1 
ATOM   1361  N  NH1   . ARG A 1 182  ? -20.027 -2.557  -43.250 1.00 53.18  ? 182  ARG A NH1   1 
ATOM   1362  N  NH2   . ARG A 1 182  ? -21.452 -0.811  -43.681 1.00 65.04  ? 182  ARG A NH2   1 
ATOM   1363  N  N     . VAL A 1 183  ? -27.731 -2.758  -47.549 1.00 111.43 ? 183  VAL A N     1 
ATOM   1364  C  CA    . VAL A 1 183  ? -28.512 -3.435  -48.580 1.00 116.67 ? 183  VAL A CA    1 
ATOM   1365  C  C     . VAL A 1 183  ? -27.598 -4.058  -49.632 1.00 120.94 ? 183  VAL A C     1 
ATOM   1366  O  O     . VAL A 1 183  ? -26.699 -3.398  -50.153 1.00 117.62 ? 183  VAL A O     1 
ATOM   1367  C  CB    . VAL A 1 183  ? -29.495 -2.471  -49.268 1.00 107.97 ? 183  VAL A CB    1 
ATOM   1368  C  CG1   . VAL A 1 183  ? -30.337 -3.215  -50.292 1.00 108.00 ? 183  VAL A CG1   1 
ATOM   1369  C  CG2   . VAL A 1 183  ? -30.380 -1.793  -48.234 1.00 99.32  ? 183  VAL A CG2   1 
ATOM   1370  N  N     . GLU A 1 184  ? -27.831 -5.334  -49.930 1.00 123.73 ? 184  GLU A N     1 
ATOM   1371  C  CA    . GLU A 1 184  ? -26.978 -6.078  -50.851 1.00 118.42 ? 184  GLU A CA    1 
ATOM   1372  C  C     . GLU A 1 184  ? -26.954 -5.457  -52.239 1.00 114.42 ? 184  GLU A C     1 
ATOM   1373  O  O     . GLU A 1 184  ? -27.762 -5.797  -53.104 1.00 109.59 ? 184  GLU A O     1 
ATOM   1374  C  CB    . GLU A 1 184  ? -27.428 -7.536  -50.940 1.00 121.37 ? 184  GLU A CB    1 
ATOM   1375  C  CG    . GLU A 1 184  ? -27.062 -8.360  -49.719 1.00 122.34 ? 184  GLU A CG    1 
ATOM   1376  C  CD    . GLU A 1 184  ? -27.127 -9.851  -49.984 1.00 130.72 ? 184  GLU A CD    1 
ATOM   1377  O  OE1   . GLU A 1 184  ? -27.497 -10.239 -51.112 1.00 129.48 ? 184  GLU A OE1   1 
ATOM   1378  O  OE2   . GLU A 1 184  ? -26.805 -10.635 -49.066 1.00 132.40 ? 184  GLU A OE2   1 
ATOM   1379  N  N     . GLN A 1 185  ? -26.007 -4.546  -52.429 1.00 117.00 ? 185  GLN A N     1 
ATOM   1380  C  CA    . GLN A 1 185  ? -25.817 -3.840  -53.688 1.00 123.89 ? 185  GLN A CA    1 
ATOM   1381  C  C     . GLN A 1 185  ? -24.541 -3.014  -53.573 1.00 126.44 ? 185  GLN A C     1 
ATOM   1382  O  O     . GLN A 1 185  ? -23.845 -3.083  -52.558 1.00 120.64 ? 185  GLN A O     1 
ATOM   1383  C  CB    . GLN A 1 185  ? -27.021 -2.944  -54.005 1.00 122.48 ? 185  GLN A CB    1 
ATOM   1384  C  CG    . GLN A 1 185  ? -27.210 -2.636  -55.486 1.00 121.83 ? 185  GLN A CG    1 
ATOM   1385  C  CD    . GLN A 1 185  ? -28.373 -1.698  -55.746 1.00 115.12 ? 185  GLN A CD    1 
ATOM   1386  O  OE1   . GLN A 1 185  ? -29.208 -1.465  -54.872 1.00 109.56 ? 185  GLN A OE1   1 
ATOM   1387  N  NE2   . GLN A 1 185  ? -28.431 -1.152  -56.955 1.00 112.96 ? 185  GLN A NE2   1 
ATOM   1388  N  N     . ARG A 1 186  ? -24.235 -2.235  -54.606 1.00 135.79 ? 186  ARG A N     1 
ATOM   1389  C  CA    . ARG A 1 186  ? -23.142 -1.272  -54.546 1.00 137.91 ? 186  ARG A CA    1 
ATOM   1390  C  C     . ARG A 1 186  ? -23.648 0.033   -53.932 1.00 136.32 ? 186  ARG A C     1 
ATOM   1391  O  O     . ARG A 1 186  ? -23.020 1.085   -54.056 1.00 130.51 ? 186  ARG A O     1 
ATOM   1392  C  CB    . ARG A 1 186  ? -22.547 -1.038  -55.938 1.00 143.53 ? 186  ARG A CB    1 
ATOM   1393  C  CG    . ARG A 1 186  ? -23.574 -0.986  -57.062 1.00 146.34 ? 186  ARG A CG    1 
ATOM   1394  C  CD    . ARG A 1 186  ? -22.990 -1.479  -58.389 1.00 150.41 ? 186  ARG A CD    1 
ATOM   1395  N  NE    . ARG A 1 186  ? -22.038 -0.540  -58.980 1.00 150.03 ? 186  ARG A NE    1 
ATOM   1396  C  CZ    . ARG A 1 186  ? -21.345 -0.776  -60.091 1.00 138.45 ? 186  ARG A CZ    1 
ATOM   1397  N  NH1   . ARG A 1 186  ? -21.492 -1.927  -60.735 1.00 128.19 ? 186  ARG A NH1   1 
ATOM   1398  N  NH2   . ARG A 1 186  ? -20.503 0.137   -60.558 1.00 135.39 ? 186  ARG A NH2   1 
ATOM   1399  N  N     . THR A 1 187  ? -24.796 -0.060  -53.267 1.00 127.07 ? 187  THR A N     1 
ATOM   1400  C  CA    . THR A 1 187  ? -25.386 1.056   -52.540 1.00 123.24 ? 187  THR A CA    1 
ATOM   1401  C  C     . THR A 1 187  ? -25.019 0.992   -51.061 1.00 125.12 ? 187  THR A C     1 
ATOM   1402  O  O     . THR A 1 187  ? -25.666 1.621   -50.223 1.00 118.84 ? 187  THR A O     1 
ATOM   1403  C  CB    . THR A 1 187  ? -26.918 1.068   -52.671 1.00 114.11 ? 187  THR A CB    1 
ATOM   1404  O  OG1   . THR A 1 187  ? -27.449 -0.169  -52.181 1.00 116.23 ? 187  THR A OG1   1 
ATOM   1405  C  CG2   . THR A 1 187  ? -27.326 1.247   -54.120 1.00 109.38 ? 187  THR A CG2   1 
ATOM   1406  N  N     . ASP A 1 188  ? -23.985 0.219   -50.744 1.00 123.81 ? 188  ASP A N     1 
ATOM   1407  C  CA    . ASP A 1 188  ? -23.546 0.068   -49.364 1.00 109.29 ? 188  ASP A CA    1 
ATOM   1408  C  C     . ASP A 1 188  ? -22.619 1.207   -48.949 1.00 102.42 ? 188  ASP A C     1 
ATOM   1409  O  O     . ASP A 1 188  ? -21.534 1.378   -49.505 1.00 102.33 ? 188  ASP A O     1 
ATOM   1410  C  CB    . ASP A 1 188  ? -22.856 -1.284  -49.165 1.00 104.87 ? 188  ASP A CB    1 
ATOM   1411  C  CG    . ASP A 1 188  ? -21.683 -1.481  -50.102 1.00 107.34 ? 188  ASP A CG    1 
ATOM   1412  O  OD1   . ASP A 1 188  ? -21.728 -0.945  -51.230 1.00 114.48 ? 188  ASP A OD1   1 
ATOM   1413  O  OD2   . ASP A 1 188  ? -20.713 -2.160  -49.707 1.00 101.59 ? 188  ASP A OD2   1 
ATOM   1414  N  N     . PHE A 1 189  ? -23.060 1.991   -47.973 1.00 89.93  ? 189  PHE A N     1 
ATOM   1415  C  CA    . PHE A 1 189  ? -22.268 3.107   -47.474 1.00 88.53  ? 189  PHE A CA    1 
ATOM   1416  C  C     . PHE A 1 189  ? -22.657 3.418   -46.035 1.00 87.98  ? 189  PHE A C     1 
ATOM   1417  O  O     . PHE A 1 189  ? -23.606 2.841   -45.503 1.00 90.40  ? 189  PHE A O     1 
ATOM   1418  C  CB    . PHE A 1 189  ? -22.456 4.344   -48.353 1.00 81.03  ? 189  PHE A CB    1 
ATOM   1419  C  CG    . PHE A 1 189  ? -23.770 5.031   -48.147 1.00 74.54  ? 189  PHE A CG    1 
ATOM   1420  C  CD1   . PHE A 1 189  ? -23.841 6.225   -47.452 1.00 68.43  ? 189  PHE A CD1   1 
ATOM   1421  C  CD2   . PHE A 1 189  ? -24.938 4.472   -48.631 1.00 84.48  ? 189  PHE A CD2   1 
ATOM   1422  C  CE1   . PHE A 1 189  ? -25.052 6.852   -47.253 1.00 72.12  ? 189  PHE A CE1   1 
ATOM   1423  C  CE2   . PHE A 1 189  ? -26.152 5.095   -48.435 1.00 85.09  ? 189  PHE A CE2   1 
ATOM   1424  C  CZ    . PHE A 1 189  ? -26.210 6.286   -47.745 1.00 75.65  ? 189  PHE A CZ    1 
ATOM   1425  N  N     . ASP A 1 190  ? -21.920 4.330   -45.409 1.00 78.95  ? 190  ASP A N     1 
ATOM   1426  C  CA    . ASP A 1 190  ? -22.208 4.738   -44.038 1.00 69.39  ? 190  ASP A CA    1 
ATOM   1427  C  C     . ASP A 1 190  ? -22.429 6.244   -43.938 1.00 67.94  ? 190  ASP A C     1 
ATOM   1428  O  O     . ASP A 1 190  ? -21.693 7.030   -44.535 1.00 66.09  ? 190  ASP A O     1 
ATOM   1429  C  CB    . ASP A 1 190  ? -21.079 4.313   -43.099 1.00 65.24  ? 190  ASP A CB    1 
ATOM   1430  C  CG    . ASP A 1 190  ? -21.130 2.838   -42.757 1.00 62.86  ? 190  ASP A CG    1 
ATOM   1431  O  OD1   . ASP A 1 190  ? -20.833 2.486   -41.596 1.00 56.98  ? 190  ASP A OD1   1 
ATOM   1432  O  OD2   . ASP A 1 190  ? -21.467 2.028   -43.645 1.00 66.65  ? 190  ASP A OD2   1 
ATOM   1433  N  N     . LYS A 1 191  ? -23.450 6.634   -43.180 1.00 73.63  ? 191  LYS A N     1 
ATOM   1434  C  CA    . LYS A 1 191  ? -23.784 8.042   -42.975 1.00 75.43  ? 191  LYS A CA    1 
ATOM   1435  C  C     . LYS A 1 191  ? -23.517 8.458   -41.532 1.00 72.97  ? 191  LYS A C     1 
ATOM   1436  O  O     . LYS A 1 191  ? -24.166 7.972   -40.604 1.00 74.07  ? 191  LYS A O     1 
ATOM   1437  C  CB    . LYS A 1 191  ? -25.248 8.302   -43.338 1.00 78.51  ? 191  LYS A CB    1 
ATOM   1438  C  CG    . LYS A 1 191  ? -25.782 9.665   -42.913 1.00 74.64  ? 191  LYS A CG    1 
ATOM   1439  C  CD    . LYS A 1 191  ? -27.295 9.735   -43.101 1.00 80.14  ? 191  LYS A CD    1 
ATOM   1440  C  CE    . LYS A 1 191  ? -27.891 10.995  -42.487 1.00 78.13  ? 191  LYS A CE    1 
ATOM   1441  N  NZ    . LYS A 1 191  ? -29.379 11.010  -42.590 1.00 63.17  ? 191  LYS A NZ    1 
ATOM   1442  N  N     . LEU A 1 192  ? -22.562 9.362   -41.349 1.00 65.41  ? 192  LEU A N     1 
ATOM   1443  C  CA    . LEU A 1 192  ? -22.144 9.762   -40.014 1.00 56.64  ? 192  LEU A CA    1 
ATOM   1444  C  C     . LEU A 1 192  ? -22.855 11.022  -39.544 1.00 56.97  ? 192  LEU A C     1 
ATOM   1445  O  O     . LEU A 1 192  ? -22.882 12.031  -40.247 1.00 59.12  ? 192  LEU A O     1 
ATOM   1446  C  CB    . LEU A 1 192  ? -20.631 9.977   -39.972 1.00 51.00  ? 192  LEU A CB    1 
ATOM   1447  C  CG    . LEU A 1 192  ? -20.076 10.435  -38.624 1.00 45.45  ? 192  LEU A CG    1 
ATOM   1448  C  CD1   . LEU A 1 192  ? -20.321 9.383   -37.553 1.00 44.86  ? 192  LEU A CD1   1 
ATOM   1449  C  CD2   . LEU A 1 192  ? -18.597 10.762  -38.735 1.00 37.34  ? 192  LEU A CD2   1 
ATOM   1450  N  N     . ILE A 1 193  ? -23.433 10.949  -38.349 1.00 53.62  ? 193  ILE A N     1 
ATOM   1451  C  CA    . ILE A 1 193  ? -24.039 12.111  -37.714 1.00 48.41  ? 193  ILE A CA    1 
ATOM   1452  C  C     . ILE A 1 193  ? -23.317 12.438  -36.419 1.00 40.28  ? 193  ILE A C     1 
ATOM   1453  O  O     . ILE A 1 193  ? -23.509 11.778  -35.402 1.00 34.59  ? 193  ILE A O     1 
ATOM   1454  C  CB    . ILE A 1 193  ? -25.529 11.900  -37.409 1.00 52.21  ? 193  ILE A CB    1 
ATOM   1455  C  CG1   . ILE A 1 193  ? -26.304 11.588  -38.687 1.00 60.28  ? 193  ILE A CG1   1 
ATOM   1456  C  CG2   . ILE A 1 193  ? -26.109 13.135  -36.737 1.00 53.83  ? 193  ILE A CG2   1 
ATOM   1457  C  CD1   . ILE A 1 193  ? -27.796 11.452  -38.470 1.00 60.70  ? 193  ILE A CD1   1 
ATOM   1458  N  N     . LEU A 1 194  ? -22.478 13.462  -36.468 1.00 33.78  ? 194  LEU A N     1 
ATOM   1459  C  CA    . LEU A 1 194  ? -21.752 13.906  -35.293 1.00 27.75  ? 194  LEU A CA    1 
ATOM   1460  C  C     . LEU A 1 194  ? -22.629 14.832  -34.453 1.00 34.51  ? 194  LEU A C     1 
ATOM   1461  O  O     . LEU A 1 194  ? -23.533 15.483  -34.976 1.00 42.06  ? 194  LEU A O     1 
ATOM   1462  C  CB    . LEU A 1 194  ? -20.463 14.612  -35.704 1.00 24.27  ? 194  LEU A CB    1 
ATOM   1463  C  CG    . LEU A 1 194  ? -19.567 15.094  -34.567 1.00 21.76  ? 194  LEU A CG    1 
ATOM   1464  C  CD1   . LEU A 1 194  ? -19.066 13.911  -33.753 1.00 25.90  ? 194  LEU A CD1   1 
ATOM   1465  C  CD2   . LEU A 1 194  ? -18.418 15.924  -35.103 1.00 23.25  ? 194  LEU A CD2   1 
ATOM   1466  N  N     . ASP A 1 195  ? -22.368 14.882  -33.152 1.00 33.44  ? 195  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1 195  ? -23.141 15.726  -32.250 1.00 28.64  ? 195  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1 195  ? -22.209 16.463  -31.302 1.00 22.89  ? 195  ASP A C     1 
ATOM   1469  O  O     . ASP A 1 195  ? -21.479 15.845  -30.531 1.00 26.79  ? 195  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1 195  ? -24.152 14.886  -31.468 1.00 30.59  ? 195  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1 195  ? -25.249 15.721  -30.836 1.00 30.44  ? 195  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1 195  ? -26.393 15.226  -30.756 1.00 25.72  ? 195  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1 195  ? -24.975 16.866  -30.417 1.00 31.63  ? 195  ASP A OD2   1 
ATOM   1474  N  N     . VAL A 1 196  ? -22.238 17.788  -31.365 1.00 23.00  ? 196  VAL A N     1 
ATOM   1475  C  CA    . VAL A 1 196  ? -21.370 18.601  -30.529 1.00 27.68  ? 196  VAL A CA    1 
ATOM   1476  C  C     . VAL A 1 196  ? -22.170 19.595  -29.699 1.00 35.60  ? 196  VAL A C     1 
ATOM   1477  O  O     . VAL A 1 196  ? -23.004 20.320  -30.233 1.00 45.71  ? 196  VAL A O     1 
ATOM   1478  C  CB    . VAL A 1 196  ? -20.345 19.370  -31.375 1.00 31.83  ? 196  VAL A CB    1 
ATOM   1479  C  CG1   . VAL A 1 196  ? -19.401 20.155  -30.478 1.00 36.69  ? 196  VAL A CG1   1 
ATOM   1480  C  CG2   . VAL A 1 196  ? -19.571 18.415  -32.268 1.00 35.20  ? 196  VAL A CG2   1 
ATOM   1481  N  N     . GLU A 1 197  ? -21.918 19.621  -28.394 1.00 32.50  ? 197  GLU A N     1 
ATOM   1482  C  CA    . GLU A 1 197  ? -22.506 20.636  -27.527 1.00 36.76  ? 197  GLU A CA    1 
ATOM   1483  C  C     . GLU A 1 197  ? -21.408 21.445  -26.854 1.00 39.37  ? 197  GLU A C     1 
ATOM   1484  O  O     . GLU A 1 197  ? -20.430 20.881  -26.367 1.00 43.01  ? 197  GLU A O     1 
ATOM   1485  C  CB    . GLU A 1 197  ? -23.415 20.004  -26.476 1.00 31.60  ? 197  GLU A CB    1 
ATOM   1486  C  CG    . GLU A 1 197  ? -24.142 21.032  -25.628 1.00 33.18  ? 197  GLU A CG    1 
ATOM   1487  C  CD    . GLU A 1 197  ? -25.101 20.404  -24.644 1.00 29.21  ? 197  GLU A CD    1 
ATOM   1488  O  OE1   . GLU A 1 197  ? -24.831 19.272  -24.193 1.00 27.25  ? 197  GLU A OE1   1 
ATOM   1489  O  OE2   . GLU A 1 197  ? -26.130 21.035  -24.330 1.00 29.49  ? 197  GLU A OE2   1 
ATOM   1490  N  N     . THR A 1 198  ? -21.568 22.765  -26.826 1.00 40.58  ? 198  THR A N     1 
ATOM   1491  C  CA    . THR A 1 198  ? -20.524 23.639  -26.298 1.00 40.49  ? 198  THR A CA    1 
ATOM   1492  C  C     . THR A 1 198  ? -20.847 24.245  -24.942 1.00 37.73  ? 198  THR A C     1 
ATOM   1493  O  O     . THR A 1 198  ? -21.816 23.866  -24.287 1.00 34.44  ? 198  THR A O     1 
ATOM   1494  C  CB    . THR A 1 198  ? -20.214 24.802  -27.263 1.00 38.16  ? 198  THR A CB    1 
ATOM   1495  O  OG1   . THR A 1 198  ? -21.433 25.429  -27.680 1.00 37.54  ? 198  THR A OG1   1 
ATOM   1496  C  CG2   . THR A 1 198  ? -19.457 24.302  -28.476 1.00 39.13  ? 198  THR A CG2   1 
ATOM   1497  N  N     . LYS A 1 199  ? -20.007 25.195  -24.542 1.00 37.12  ? 199  LYS A N     1 
ATOM   1498  C  CA    . LYS A 1 199  ? -20.147 25.893  -23.272 1.00 34.78  ? 199  LYS A CA    1 
ATOM   1499  C  C     . LYS A 1 199  ? -20.541 27.354  -23.466 1.00 32.89  ? 199  LYS A C     1 
ATOM   1500  O  O     . LYS A 1 199  ? -20.299 28.178  -22.588 1.00 36.37  ? 199  LYS A O     1 
ATOM   1501  C  CB    . LYS A 1 199  ? -18.836 25.830  -22.476 1.00 33.10  ? 199  LYS A CB    1 
ATOM   1502  C  CG    . LYS A 1 199  ? -18.458 24.460  -21.934 1.00 34.11  ? 199  LYS A CG    1 
ATOM   1503  C  CD    . LYS A 1 199  ? -17.207 24.551  -21.062 1.00 24.70  ? 199  LYS A CD    1 
ATOM   1504  C  CE    . LYS A 1 199  ? -16.986 23.281  -20.260 1.00 18.94  ? 199  LYS A CE    1 
ATOM   1505  N  NZ    . LYS A 1 199  ? -15.916 23.452  -19.244 1.00 6.41   ? 199  LYS A NZ    1 
ATOM   1506  N  N     . ASN A 1 200  ? -21.129 27.674  -24.617 1.00 33.06  ? 200  ASN A N     1 
ATOM   1507  C  CA    . ASN A 1 200  ? -21.432 29.060  -24.984 1.00 31.98  ? 200  ASN A CA    1 
ATOM   1508  C  C     . ASN A 1 200  ? -20.203 29.961  -24.915 1.00 29.05  ? 200  ASN A C     1 
ATOM   1509  O  O     . ASN A 1 200  ? -20.316 31.183  -24.824 1.00 27.35  ? 200  ASN A O     1 
ATOM   1510  C  CB    . ASN A 1 200  ? -22.543 29.638  -24.096 1.00 27.56  ? 200  ASN A CB    1 
ATOM   1511  C  CG    . ASN A 1 200  ? -23.925 29.193  -24.523 1.00 27.40  ? 200  ASN A CG    1 
ATOM   1512  O  OD1   . ASN A 1 200  ? -24.138 28.799  -25.670 1.00 29.30  ? 200  ASN A OD1   1 
ATOM   1513  N  ND2   . ASN A 1 200  ? -24.877 29.263  -23.601 1.00 27.65  ? 200  ASN A ND2   1 
ATOM   1514  N  N     . SER A 1 201  ? -19.030 29.343  -24.936 1.00 25.39  ? 201  SER A N     1 
ATOM   1515  C  CA    . SER A 1 201  ? -17.787 30.078  -25.014 1.00 31.57  ? 201  SER A CA    1 
ATOM   1516  C  C     . SER A 1 201  ? -17.432 30.190  -26.472 1.00 29.65  ? 201  SER A C     1 
ATOM   1517  O  O     . SER A 1 201  ? -17.187 31.272  -26.997 1.00 26.74  ? 201  SER A O     1 
ATOM   1518  C  CB    . SER A 1 201  ? -16.676 29.373  -24.233 1.00 40.96  ? 201  SER A CB    1 
ATOM   1519  O  OG    . SER A 1 201  ? -15.416 29.986  -24.471 1.00 50.16  ? 201  SER A OG    1 
ATOM   1520  N  N     . ILE A 1 202  ? -17.415 29.037  -27.122 1.00 32.24  ? 202  ILE A N     1 
ATOM   1521  C  CA    . ILE A 1 202  ? -17.241 28.981  -28.558 1.00 43.71  ? 202  ILE A CA    1 
ATOM   1522  C  C     . ILE A 1 202  ? -18.368 28.178  -29.179 1.00 43.82  ? 202  ILE A C     1 
ATOM   1523  O  O     . ILE A 1 202  ? -19.018 27.377  -28.511 1.00 38.67  ? 202  ILE A O     1 
ATOM   1524  C  CB    . ILE A 1 202  ? -15.902 28.347  -28.957 1.00 38.81  ? 202  ILE A CB    1 
ATOM   1525  C  CG1   . ILE A 1 202  ? -15.926 26.852  -28.655 1.00 33.55  ? 202  ILE A CG1   1 
ATOM   1526  C  CG2   . ILE A 1 202  ? -14.746 29.037  -28.245 1.00 37.18  ? 202  ILE A CG2   1 
ATOM   1527  C  CD1   . ILE A 1 202  ? -14.651 26.159  -29.015 1.00 40.57  ? 202  ILE A CD1   1 
ATOM   1528  N  N     . SER A 1 203  ? -18.593 28.412  -30.463 1.00 45.44  ? 203  SER A N     1 
ATOM   1529  C  CA    . SER A 1 203  ? -19.634 27.728  -31.202 1.00 42.00  ? 203  SER A CA    1 
ATOM   1530  C  C     . SER A 1 203  ? -19.272 26.264  -31.415 1.00 41.23  ? 203  SER A C     1 
ATOM   1531  O  O     . SER A 1 203  ? -18.094 25.909  -31.406 1.00 43.42  ? 203  SER A O     1 
ATOM   1532  C  CB    . SER A 1 203  ? -19.856 28.430  -32.542 1.00 45.93  ? 203  SER A CB    1 
ATOM   1533  O  OG    . SER A 1 203  ? -20.678 27.663  -33.402 1.00 52.46  ? 203  SER A OG    1 
ATOM   1534  N  N     . PRO A 1 204  ? -20.288 25.404  -31.582 1.00 43.39  ? 204  PRO A N     1 
ATOM   1535  C  CA    . PRO A 1 204  ? -20.049 24.011  -31.969 1.00 39.17  ? 204  PRO A CA    1 
ATOM   1536  C  C     . PRO A 1 204  ? -19.219 23.916  -33.245 1.00 39.91  ? 204  PRO A C     1 
ATOM   1537  O  O     . PRO A 1 204  ? -18.346 23.054  -33.355 1.00 36.21  ? 204  PRO A O     1 
ATOM   1538  C  CB    . PRO A 1 204  ? -21.458 23.466  -32.192 1.00 40.37  ? 204  PRO A CB    1 
ATOM   1539  C  CG    . PRO A 1 204  ? -22.312 24.283  -31.299 1.00 43.86  ? 204  PRO A CG    1 
ATOM   1540  C  CD    . PRO A 1 204  ? -21.708 25.656  -31.281 1.00 46.62  ? 204  PRO A CD    1 
ATOM   1541  N  N     . ARG A 1 205  ? -19.484 24.813  -34.189 1.00 44.48  ? 205  ARG A N     1 
ATOM   1542  C  CA    . ARG A 1 205  ? -18.811 24.798  -35.482 1.00 45.16  ? 205  ARG A CA    1 
ATOM   1543  C  C     . ARG A 1 205  ? -17.332 25.137  -35.360 1.00 41.80  ? 205  ARG A C     1 
ATOM   1544  O  O     . ARG A 1 205  ? -16.476 24.387  -35.827 1.00 44.02  ? 205  ARG A O     1 
ATOM   1545  C  CB    . ARG A 1 205  ? -19.504 25.767  -36.441 1.00 44.74  ? 205  ARG A CB    1 
ATOM   1546  C  CG    . ARG A 1 205  ? -20.931 25.368  -36.763 1.00 43.59  ? 205  ARG A CG    1 
ATOM   1547  C  CD    . ARG A 1 205  ? -21.637 26.424  -37.581 1.00 48.30  ? 205  ARG A CD    1 
ATOM   1548  N  NE    . ARG A 1 205  ? -22.504 25.820  -38.586 1.00 59.60  ? 205  ARG A NE    1 
ATOM   1549  C  CZ    . ARG A 1 205  ? -22.579 26.235  -39.846 1.00 72.88  ? 205  ARG A CZ    1 
ATOM   1550  N  NH1   . ARG A 1 205  ? -21.842 27.262  -40.251 1.00 81.40  ? 205  ARG A NH1   1 
ATOM   1551  N  NH2   . ARG A 1 205  ? -23.391 25.627  -40.702 1.00 71.54  ? 205  ARG A NH2   1 
ATOM   1552  N  N     . ASP A 1 206  ? -17.041 26.266  -34.725 1.00 40.24  ? 206  ASP A N     1 
ATOM   1553  C  CA    . ASP A 1 206  ? -15.666 26.695  -34.492 1.00 44.82  ? 206  ASP A CA    1 
ATOM   1554  C  C     . ASP A 1 206  ? -14.873 25.623  -33.752 1.00 41.18  ? 206  ASP A C     1 
ATOM   1555  O  O     . ASP A 1 206  ? -13.676 25.450  -33.978 1.00 36.92  ? 206  ASP A O     1 
ATOM   1556  C  CB    . ASP A 1 206  ? -15.646 28.003  -33.699 1.00 50.87  ? 206  ASP A CB    1 
ATOM   1557  C  CG    . ASP A 1 206  ? -16.554 29.059  -34.299 1.00 48.33  ? 206  ASP A CG    1 
ATOM   1558  O  OD1   . ASP A 1 206  ? -16.755 29.037  -35.531 1.00 52.09  ? 206  ASP A OD1   1 
ATOM   1559  O  OD2   . ASP A 1 206  ? -17.069 29.906  -33.539 1.00 46.45  ? 206  ASP A OD2   1 
ATOM   1560  N  N     . ALA A 1 207  ? -15.559 24.909  -32.866 1.00 40.03  ? 207  ALA A N     1 
ATOM   1561  C  CA    . ALA A 1 207  ? -14.955 23.821  -32.112 1.00 37.59  ? 207  ALA A CA    1 
ATOM   1562  C  C     . ALA A 1 207  ? -14.456 22.741  -33.055 1.00 38.72  ? 207  ALA A C     1 
ATOM   1563  O  O     . ALA A 1 207  ? -13.290 22.348  -33.011 1.00 46.42  ? 207  ALA A O     1 
ATOM   1564  C  CB    . ALA A 1 207  ? -15.952 23.240  -31.124 1.00 41.92  ? 207  ALA A CB    1 
ATOM   1565  N  N     . LEU A 1 208  ? -15.349 22.272  -33.917 1.00 35.06  ? 208  LEU A N     1 
ATOM   1566  C  CA    . LEU A 1 208  ? -15.001 21.245  -34.883 1.00 31.11  ? 208  LEU A CA    1 
ATOM   1567  C  C     . LEU A 1 208  ? -13.974 21.774  -35.873 1.00 34.93  ? 208  LEU A C     1 
ATOM   1568  O  O     . LEU A 1 208  ? -13.229 21.008  -36.476 1.00 39.29  ? 208  LEU A O     1 
ATOM   1569  C  CB    . LEU A 1 208  ? -16.247 20.759  -35.613 1.00 30.69  ? 208  LEU A CB    1 
ATOM   1570  C  CG    . LEU A 1 208  ? -16.071 19.489  -36.439 1.00 28.07  ? 208  LEU A CG    1 
ATOM   1571  C  CD1   . LEU A 1 208  ? -15.510 18.375  -35.575 1.00 17.56  ? 208  LEU A CD1   1 
ATOM   1572  C  CD2   . LEU A 1 208  ? -17.399 19.083  -37.042 1.00 39.17  ? 208  LEU A CD2   1 
ATOM   1573  N  N     . ALA A 1 209  ? -13.938 23.093  -36.027 1.00 39.04  ? 209  ALA A N     1 
ATOM   1574  C  CA    . ALA A 1 209  ? -12.983 23.737  -36.921 1.00 47.43  ? 209  ALA A CA    1 
ATOM   1575  C  C     . ALA A 1 209  ? -11.560 23.598  -36.394 1.00 46.86  ? 209  ALA A C     1 
ATOM   1576  O  O     . ALA A 1 209  ? -10.652 23.216  -37.130 1.00 50.53  ? 209  ALA A O     1 
ATOM   1577  C  CB    . ALA A 1 209  ? -13.334 25.202  -37.108 1.00 55.85  ? 209  ALA A CB    1 
ATOM   1578  N  N     . SER A 1 210  ? -11.370 23.909  -35.116 1.00 47.76  ? 210  SER A N     1 
ATOM   1579  C  CA    . SER A 1 210  ? -10.060 23.770  -34.489 1.00 50.76  ? 210  SER A CA    1 
ATOM   1580  C  C     . SER A 1 210  ? -9.732  22.299  -34.270 1.00 45.92  ? 210  SER A C     1 
ATOM   1581  O  O     . SER A 1 210  ? -8.573  21.933  -34.075 1.00 46.88  ? 210  SER A O     1 
ATOM   1582  C  CB    . SER A 1 210  ? -10.003 24.519  -33.159 1.00 48.00  ? 210  SER A CB    1 
ATOM   1583  O  OG    . SER A 1 210  ? -8.717  24.402  -32.572 1.00 34.29  ? 210  SER A OG    1 
ATOM   1584  N  N     . ALA A 1 211  ? -10.765 21.463  -34.294 1.00 41.28  ? 211  ALA A N     1 
ATOM   1585  C  CA    . ALA A 1 211  ? -10.594 20.021  -34.193 1.00 35.06  ? 211  ALA A CA    1 
ATOM   1586  C  C     . ALA A 1 211  ? -9.971  19.493  -35.473 1.00 36.94  ? 211  ALA A C     1 
ATOM   1587  O  O     . ALA A 1 211  ? -9.070  18.662  -35.443 1.00 37.97  ? 211  ALA A O     1 
ATOM   1588  C  CB    . ALA A 1 211  ? -11.924 19.343  -33.924 1.00 34.21  ? 211  ALA A CB    1 
ATOM   1589  N  N     . GLY A 1 212  ? -10.459 19.993  -36.600 1.00 40.47  ? 212  GLY A N     1 
ATOM   1590  C  CA    . GLY A 1 212  ? -9.922  19.614  -37.890 1.00 44.24  ? 212  GLY A CA    1 
ATOM   1591  C  C     . GLY A 1 212  ? -8.528  20.166  -38.106 1.00 48.25  ? 212  GLY A C     1 
ATOM   1592  O  O     . GLY A 1 212  ? -7.650  19.459  -38.599 1.00 51.78  ? 212  GLY A O     1 
ATOM   1593  N  N     . LYS A 1 213  ? -8.323  21.428  -37.735 1.00 48.74  ? 213  LYS A N     1 
ATOM   1594  C  CA    . LYS A 1 213  ? -7.032  22.086  -37.926 1.00 47.54  ? 213  LYS A CA    1 
ATOM   1595  C  C     . LYS A 1 213  ? -5.929  21.323  -37.215 1.00 43.05  ? 213  LYS A C     1 
ATOM   1596  O  O     . LYS A 1 213  ? -4.804  21.235  -37.700 1.00 43.53  ? 213  LYS A O     1 
ATOM   1597  C  CB    . LYS A 1 213  ? -7.080  23.536  -37.429 1.00 56.19  ? 213  LYS A CB    1 
ATOM   1598  C  CG    . LYS A 1 213  ? -5.711  24.211  -37.298 1.00 66.32  ? 213  LYS A CG    1 
ATOM   1599  C  CD    . LYS A 1 213  ? -4.980  24.286  -38.633 1.00 65.93  ? 213  LYS A CD    1 
ATOM   1600  C  CE    . LYS A 1 213  ? -3.581  24.875  -38.479 1.00 59.35  ? 213  LYS A CE    1 
ATOM   1601  N  NZ    . LYS A 1 213  ? -3.603  26.237  -37.875 1.00 59.06  ? 213  LYS A NZ    1 
ATOM   1602  N  N     . THR A 1 214  ? -6.262  20.764  -36.061 1.00 44.45  ? 214  THR A N     1 
ATOM   1603  C  CA    . THR A 1 214  ? -5.302  19.970  -35.313 1.00 47.80  ? 214  THR A CA    1 
ATOM   1604  C  C     . THR A 1 214  ? -5.025  18.653  -36.034 1.00 48.05  ? 214  THR A C     1 
ATOM   1605  O  O     . THR A 1 214  ? -3.873  18.329  -36.323 1.00 50.64  ? 214  THR A O     1 
ATOM   1606  C  CB    . THR A 1 214  ? -5.794  19.692  -33.878 1.00 43.30  ? 214  THR A CB    1 
ATOM   1607  O  OG1   . THR A 1 214  ? -5.788  20.915  -33.131 1.00 44.41  ? 214  THR A OG1   1 
ATOM   1608  C  CG2   . THR A 1 214  ? -4.887  18.695  -33.190 1.00 37.20  ? 214  THR A CG2   1 
ATOM   1609  N  N     . LEU A 1 215  ? -6.084  17.912  -36.347 1.00 48.16  ? 215  LEU A N     1 
ATOM   1610  C  CA    . LEU A 1 215  ? -5.952  16.593  -36.964 1.00 45.85  ? 215  LEU A CA    1 
ATOM   1611  C  C     . LEU A 1 215  ? -5.241  16.632  -38.316 1.00 47.00  ? 215  LEU A C     1 
ATOM   1612  O  O     . LEU A 1 215  ? -4.422  15.765  -38.614 1.00 47.55  ? 215  LEU A O     1 
ATOM   1613  C  CB    . LEU A 1 215  ? -7.328  15.948  -37.122 1.00 45.05  ? 215  LEU A CB    1 
ATOM   1614  C  CG    . LEU A 1 215  ? -8.064  15.686  -35.806 1.00 44.26  ? 215  LEU A CG    1 
ATOM   1615  C  CD1   . LEU A 1 215  ? -9.514  15.323  -36.063 1.00 46.37  ? 215  LEU A CD1   1 
ATOM   1616  C  CD2   . LEU A 1 215  ? -7.371  14.602  -34.992 1.00 34.22  ? 215  LEU A CD2   1 
ATOM   1617  N  N     . VAL A 1 216  ? -5.563  17.637  -39.127 1.00 51.57  ? 216  VAL A N     1 
ATOM   1618  C  CA    . VAL A 1 216  ? -4.909  17.835  -40.420 1.00 50.75  ? 216  VAL A CA    1 
ATOM   1619  C  C     . VAL A 1 216  ? -3.399  17.978  -40.244 1.00 48.41  ? 216  VAL A C     1 
ATOM   1620  O  O     . VAL A 1 216  ? -2.615  17.464  -41.044 1.00 46.83  ? 216  VAL A O     1 
ATOM   1621  C  CB    . VAL A 1 216  ? -5.469  19.080  -41.150 1.00 53.75  ? 216  VAL A CB    1 
ATOM   1622  C  CG1   . VAL A 1 216  ? -4.556  19.509  -42.290 1.00 54.41  ? 216  VAL A CG1   1 
ATOM   1623  C  CG2   . VAL A 1 216  ? -6.874  18.808  -41.665 1.00 53.64  ? 216  VAL A CG2   1 
ATOM   1624  N  N     . GLU A 1 217  ? -2.996  18.658  -39.177 1.00 48.04  ? 217  GLU A N     1 
ATOM   1625  C  CA    . GLU A 1 217  ? -1.581  18.876  -38.910 1.00 49.13  ? 217  GLU A CA    1 
ATOM   1626  C  C     . GLU A 1 217  ? -0.939  17.624  -38.322 1.00 51.39  ? 217  GLU A C     1 
ATOM   1627  O  O     . GLU A 1 217  ? 0.277   17.564  -38.134 1.00 54.95  ? 217  GLU A O     1 
ATOM   1628  C  CB    . GLU A 1 217  ? -1.395  20.059  -37.966 1.00 51.11  ? 217  GLU A CB    1 
ATOM   1629  C  CG    . GLU A 1 217  ? -0.029  20.708  -38.040 1.00 55.96  ? 217  GLU A CG    1 
ATOM   1630  C  CD    . GLU A 1 217  ? 0.005   22.039  -37.327 1.00 62.16  ? 217  GLU A CD    1 
ATOM   1631  O  OE1   . GLU A 1 217  ? 1.108   22.587  -37.125 1.00 68.91  ? 217  GLU A OE1   1 
ATOM   1632  O  OE2   . GLU A 1 217  ? -1.080  22.540  -36.971 1.00 60.51  ? 217  GLU A OE2   1 
ATOM   1633  N  N     . LEU A 1 218  ? -1.763  16.620  -38.039 1.00 49.18  ? 218  LEU A N     1 
ATOM   1634  C  CA    . LEU A 1 218  ? -1.267  15.360  -37.499 1.00 47.41  ? 218  LEU A CA    1 
ATOM   1635  C  C     . LEU A 1 218  ? -1.127  14.295  -38.586 1.00 48.23  ? 218  LEU A C     1 
ATOM   1636  O  O     . LEU A 1 218  ? -0.090  13.648  -38.693 1.00 58.38  ? 218  LEU A O     1 
ATOM   1637  C  CB    . LEU A 1 218  ? -2.183  14.863  -36.379 1.00 45.71  ? 218  LEU A CB    1 
ATOM   1638  C  CG    . LEU A 1 218  ? -1.749  15.204  -34.950 1.00 41.65  ? 218  LEU A CG    1 
ATOM   1639  C  CD1   . LEU A 1 218  ? -0.490  14.437  -34.583 1.00 43.02  ? 218  LEU A CD1   1 
ATOM   1640  C  CD2   . LEU A 1 218  ? -1.541  16.703  -34.768 1.00 44.77  ? 218  LEU A CD2   1 
ATOM   1641  N  N     . PHE A 1 219  ? -2.163  14.120  -39.398 1.00 43.95  ? 219  PHE A N     1 
ATOM   1642  C  CA    . PHE A 1 219  ? -2.121  13.132  -40.473 1.00 40.64  ? 219  PHE A CA    1 
ATOM   1643  C  C     . PHE A 1 219  ? -1.184  13.560  -41.597 1.00 52.29  ? 219  PHE A C     1 
ATOM   1644  O  O     . PHE A 1 219  ? -0.822  12.754  -42.452 1.00 58.44  ? 219  PHE A O     1 
ATOM   1645  C  CB    . PHE A 1 219  ? -3.520  12.889  -41.038 1.00 41.33  ? 219  PHE A CB    1 
ATOM   1646  C  CG    . PHE A 1 219  ? -4.417  12.113  -40.123 1.00 39.16  ? 219  PHE A CG    1 
ATOM   1647  C  CD1   . PHE A 1 219  ? -4.844  10.843  -40.468 1.00 35.39  ? 219  PHE A CD1   1 
ATOM   1648  C  CD2   . PHE A 1 219  ? -4.835  12.650  -38.917 1.00 41.20  ? 219  PHE A CD2   1 
ATOM   1649  C  CE1   . PHE A 1 219  ? -5.670  10.127  -39.629 1.00 33.68  ? 219  PHE A CE1   1 
ATOM   1650  C  CE2   . PHE A 1 219  ? -5.657  11.935  -38.073 1.00 37.34  ? 219  PHE A CE2   1 
ATOM   1651  C  CZ    . PHE A 1 219  ? -6.080  10.675  -38.433 1.00 33.17  ? 219  PHE A CZ    1 
ATOM   1652  N  N     . GLY A 1 220  ? -0.795  14.832  -41.588 1.00 60.49  ? 220  GLY A N     1 
ATOM   1653  C  CA    . GLY A 1 220  ? 0.041   15.396  -42.634 1.00 65.71  ? 220  GLY A CA    1 
ATOM   1654  C  C     . GLY A 1 220  ? 1.459   14.858  -42.653 1.00 69.20  ? 220  GLY A C     1 
ATOM   1655  O  O     . GLY A 1 220  ? 2.144   14.926  -43.673 1.00 78.16  ? 220  GLY A O     1 
ATOM   1656  N  N     . LEU A 1 221  ? 1.903   14.324  -41.522 1.00 69.66  ? 221  LEU A N     1 
ATOM   1657  C  CA    . LEU A 1 221  ? 3.234   13.738  -41.426 1.00 73.29  ? 221  LEU A CA    1 
ATOM   1658  C  C     . LEU A 1 221  ? 3.257   12.337  -42.029 1.00 66.91  ? 221  LEU A C     1 
ATOM   1659  O  O     . LEU A 1 221  ? 4.322   11.782  -42.294 1.00 68.05  ? 221  LEU A O     1 
ATOM   1660  C  CB    . LEU A 1 221  ? 3.693   13.700  -39.970 1.00 74.79  ? 221  LEU A CB    1 
ATOM   1661  C  CG    . LEU A 1 221  ? 3.769   15.070  -39.296 1.00 73.99  ? 221  LEU A CG    1 
ATOM   1662  C  CD1   . LEU A 1 221  ? 3.559   14.945  -37.799 1.00 66.49  ? 221  LEU A CD1   1 
ATOM   1663  C  CD2   . LEU A 1 221  ? 5.100   15.746  -39.596 1.00 79.51  ? 221  LEU A CD2   1 
ATOM   1664  N  N     . ALA A 1 222  ? 2.076   11.770  -42.247 1.00 61.93  ? 222  ALA A N     1 
ATOM   1665  C  CA    . ALA A 1 222  ? 1.970   10.452  -42.856 1.00 63.43  ? 222  ALA A CA    1 
ATOM   1666  C  C     . ALA A 1 222  ? 2.110   10.554  -44.368 1.00 70.92  ? 222  ALA A C     1 
ATOM   1667  O  O     . ALA A 1 222  ? 2.122   9.545   -45.071 1.00 77.84  ? 222  ALA A O     1 
ATOM   1668  C  CB    . ALA A 1 222  ? 0.648   9.798   -42.485 1.00 60.22  ? 222  ALA A CB    1 
ATOM   1669  N  N     . ARG A 1 223  ? 2.225   11.781  -44.861 1.00 77.57  ? 223  ARG A N     1 
ATOM   1670  C  CA    . ARG A 1 223  ? 2.294   12.022  -46.295 1.00 86.44  ? 223  ARG A CA    1 
ATOM   1671  C  C     . ARG A 1 223  ? 3.684   12.496  -46.728 1.00 96.61  ? 223  ARG A C     1 
ATOM   1672  O  O     . ARG A 1 223  ? 4.027   12.442  -47.909 1.00 104.64 ? 223  ARG A O     1 
ATOM   1673  C  CB    . ARG A 1 223  ? 1.226   13.041  -46.704 1.00 86.32  ? 223  ARG A CB    1 
ATOM   1674  C  CG    . ARG A 1 223  ? 1.049   13.213  -48.203 1.00 87.49  ? 223  ARG A CG    1 
ATOM   1675  C  CD    . ARG A 1 223  ? -0.285  13.857  -48.520 1.00 81.33  ? 223  ARG A CD    1 
ATOM   1676  N  NE    . ARG A 1 223  ? -0.574  14.968  -47.619 1.00 82.52  ? 223  ARG A NE    1 
ATOM   1677  C  CZ    . ARG A 1 223  ? -0.134  16.209  -47.800 1.00 96.88  ? 223  ARG A CZ    1 
ATOM   1678  N  NH1   . ARG A 1 223  ? 0.618   16.499  -48.854 1.00 107.13 ? 223  ARG A NH1   1 
ATOM   1679  N  NH2   . ARG A 1 223  ? -0.445  17.160  -46.929 1.00 86.44  ? 223  ARG A NH2   1 
ATOM   1680  N  N     . GLU A 1 224  ? 4.489   12.952  -45.773 1.00 93.83  ? 224  GLU A N     1 
ATOM   1681  C  CA    . GLU A 1 224  ? 5.840   13.404  -46.091 1.00 96.36  ? 224  GLU A CA    1 
ATOM   1682  C  C     . GLU A 1 224  ? 6.735   12.213  -46.414 1.00 101.71 ? 224  GLU A C     1 
ATOM   1683  O  O     . GLU A 1 224  ? 6.562   11.124  -45.865 1.00 99.61  ? 224  GLU A O     1 
ATOM   1684  C  CB    . GLU A 1 224  ? 6.434   14.218  -44.941 1.00 95.04  ? 224  GLU A CB    1 
ATOM   1685  C  CG    . GLU A 1 224  ? 6.653   13.431  -43.664 1.00 92.95  ? 224  GLU A CG    1 
ATOM   1686  C  CD    . GLU A 1 224  ? 7.302   14.259  -42.574 1.00 94.51  ? 224  GLU A CD    1 
ATOM   1687  O  OE1   . GLU A 1 224  ? 7.677   15.418  -42.852 1.00 106.83 ? 224  GLU A OE1   1 
ATOM   1688  O  OE2   . GLU A 1 224  ? 7.437   13.750  -41.442 1.00 83.96  ? 224  GLU A OE2   1 
ATOM   1689  N  N     . LEU A 1 225  ? 7.688   12.427  -47.314 1.00 103.57 ? 225  LEU A N     1 
ATOM   1690  C  CA    . LEU A 1 225  ? 8.557   11.354  -47.783 1.00 101.07 ? 225  LEU A CA    1 
ATOM   1691  C  C     . LEU A 1 225  ? 9.787   11.200  -46.896 1.00 106.00 ? 225  LEU A C     1 
ATOM   1692  O  O     . LEU A 1 225  ? 10.198  12.142  -46.221 1.00 110.01 ? 225  LEU A O     1 
ATOM   1693  C  CB    . LEU A 1 225  ? 8.975   11.595  -49.245 1.00 93.94  ? 225  LEU A CB    1 
ATOM   1694  C  CG    . LEU A 1 225  ? 9.813   12.788  -49.753 1.00 97.45  ? 225  LEU A CG    1 
ATOM   1695  C  CD1   . LEU A 1 225  ? 9.214   14.148  -49.386 1.00 100.20 ? 225  LEU A CD1   1 
ATOM   1696  C  CD2   . LEU A 1 225  ? 11.285  12.715  -49.339 1.00 92.10  ? 225  LEU A CD2   1 
ATOM   1697  N  N     . ASN A 1 226  ? 10.372  10.008  -46.908 1.00 107.62 ? 226  ASN A N     1 
ATOM   1698  C  CA    . ASN A 1 226  ? 11.562  9.729   -46.115 1.00 100.50 ? 226  ASN A CA    1 
ATOM   1699  C  C     . ASN A 1 226  ? 12.821  10.299  -46.762 1.00 97.36  ? 226  ASN A C     1 
ATOM   1700  O  O     . ASN A 1 226  ? 13.197  11.444  -46.508 1.00 85.44  ? 226  ASN A O     1 
ATOM   1701  C  CB    . ASN A 1 226  ? 11.713  8.221   -45.905 1.00 96.47  ? 226  ASN A CB    1 
ATOM   1702  C  CG    . ASN A 1 226  ? 12.981  7.860   -45.161 1.00 98.34  ? 226  ASN A CG    1 
ATOM   1703  O  OD1   . ASN A 1 226  ? 13.528  8.668   -44.411 1.00 104.02 ? 226  ASN A OD1   1 
ATOM   1704  N  ND2   . ASN A 1 226  ? 13.457  6.638   -45.368 1.00 88.76  ? 226  ASN A ND2   1 
ATOM   1705  N  N     . ARG B 1 6    ? 7.385   19.054  -28.685 1.00 79.48  ? 6    ARG B N     1 
ATOM   1706  C  CA    . ARG B 1 6    ? 8.271   18.414  -29.652 1.00 80.06  ? 6    ARG B CA    1 
ATOM   1707  C  C     . ARG B 1 6    ? 7.478   17.682  -30.735 1.00 76.51  ? 6    ARG B C     1 
ATOM   1708  O  O     . ARG B 1 6    ? 6.733   16.747  -30.435 1.00 65.61  ? 6    ARG B O     1 
ATOM   1709  C  CB    . ARG B 1 6    ? 9.220   17.440  -28.945 1.00 62.19  ? 6    ARG B CB    1 
ATOM   1710  N  N     . PRO B 1 7    ? 7.637   18.112  -31.999 1.00 71.10  ? 7    PRO B N     1 
ATOM   1711  C  CA    . PRO B 1 7    ? 6.974   17.490  -33.152 1.00 55.71  ? 7    PRO B CA    1 
ATOM   1712  C  C     . PRO B 1 7    ? 7.202   15.982  -33.201 1.00 52.59  ? 7    PRO B C     1 
ATOM   1713  O  O     . PRO B 1 7    ? 8.163   15.490  -32.613 1.00 53.58  ? 7    PRO B O     1 
ATOM   1714  C  CB    . PRO B 1 7    ? 7.627   18.186  -34.347 1.00 60.57  ? 7    PRO B CB    1 
ATOM   1715  C  CG    . PRO B 1 7    ? 8.046   19.515  -33.816 1.00 76.50  ? 7    PRO B CG    1 
ATOM   1716  C  CD    . PRO B 1 7    ? 8.460   19.269  -32.394 1.00 77.55  ? 7    PRO B CD    1 
ATOM   1717  N  N     . THR B 1 8    ? 6.325   15.270  -33.902 1.00 54.55  ? 8    THR B N     1 
ATOM   1718  C  CA    . THR B 1 8    ? 6.307   13.807  -33.896 1.00 48.22  ? 8    THR B CA    1 
ATOM   1719  C  C     . THR B 1 8    ? 7.070   13.177  -35.065 1.00 43.34  ? 8    THR B C     1 
ATOM   1720  O  O     . THR B 1 8    ? 6.890   13.572  -36.214 1.00 45.28  ? 8    THR B O     1 
ATOM   1721  C  CB    . THR B 1 8    ? 4.866   13.285  -33.941 1.00 38.69  ? 8    THR B CB    1 
ATOM   1722  O  OG1   . THR B 1 8    ? 4.403   13.300  -35.295 1.00 30.14  ? 8    THR B OG1   1 
ATOM   1723  C  CG2   . THR B 1 8    ? 3.954   14.157  -33.089 1.00 33.47  ? 8    THR B CG2   1 
ATOM   1724  N  N     . LEU B 1 9    ? 7.899   12.180  -34.771 1.00 41.98  ? 9    LEU B N     1 
ATOM   1725  C  CA    . LEU B 1 9    ? 8.693   11.518  -35.803 1.00 35.69  ? 9    LEU B CA    1 
ATOM   1726  C  C     . LEU B 1 9    ? 7.943   10.367  -36.457 1.00 43.98  ? 9    LEU B C     1 
ATOM   1727  O  O     . LEU B 1 9    ? 6.858   9.988   -36.019 1.00 48.42  ? 9    LEU B O     1 
ATOM   1728  C  CB    . LEU B 1 9    ? 10.003  10.993  -35.218 1.00 37.88  ? 9    LEU B CB    1 
ATOM   1729  C  CG    . LEU B 1 9    ? 10.705  11.878  -34.191 1.00 40.47  ? 9    LEU B CG    1 
ATOM   1730  C  CD1   . LEU B 1 9    ? 11.929  11.167  -33.642 1.00 35.10  ? 9    LEU B CD1   1 
ATOM   1731  C  CD2   . LEU B 1 9    ? 11.084  13.217  -34.798 1.00 43.83  ? 9    LEU B CD2   1 
ATOM   1732  N  N     . SER B 1 10   ? 8.537   9.812   -37.508 1.00 50.30  ? 10   SER B N     1 
ATOM   1733  C  CA    . SER B 1 10   ? 8.023   8.605   -38.144 1.00 48.28  ? 10   SER B CA    1 
ATOM   1734  C  C     . SER B 1 10   ? 9.173   7.671   -38.475 1.00 41.88  ? 10   SER B C     1 
ATOM   1735  O  O     . SER B 1 10   ? 10.204  8.100   -38.986 1.00 40.65  ? 10   SER B O     1 
ATOM   1736  C  CB    . SER B 1 10   ? 7.235   8.932   -39.410 1.00 49.43  ? 10   SER B CB    1 
ATOM   1737  O  OG    . SER B 1 10   ? 6.809   7.742   -40.047 1.00 26.82  ? 10   SER B OG    1 
ATOM   1738  N  N     . GLU B 1 11   ? 8.990   6.389   -38.184 1.00 49.42  ? 11   GLU B N     1 
ATOM   1739  C  CA    . GLU B 1 11   ? 10.069  5.420   -38.318 1.00 57.32  ? 11   GLU B CA    1 
ATOM   1740  C  C     . GLU B 1 11   ? 9.614   4.178   -39.084 1.00 57.05  ? 11   GLU B C     1 
ATOM   1741  O  O     . GLU B 1 11   ? 8.416   3.967   -39.278 1.00 57.02  ? 11   GLU B O     1 
ATOM   1742  C  CB    . GLU B 1 11   ? 10.601  5.035   -36.935 1.00 65.14  ? 11   GLU B CB    1 
ATOM   1743  C  CG    . GLU B 1 11   ? 11.125  6.220   -36.127 1.00 66.16  ? 11   GLU B CG    1 
ATOM   1744  C  CD    . GLU B 1 11   ? 11.616  5.824   -34.748 1.00 71.86  ? 11   GLU B CD    1 
ATOM   1745  O  OE1   . GLU B 1 11   ? 11.724  4.608   -34.478 1.00 74.39  ? 11   GLU B OE1   1 
ATOM   1746  O  OE2   . GLU B 1 11   ? 11.891  6.732   -33.934 1.00 67.82  ? 11   GLU B OE2   1 
ATOM   1747  N  N     . ASP B 1 12   ? 10.573  3.362   -39.516 1.00 61.09  ? 12   ASP B N     1 
ATOM   1748  C  CA    . ASP B 1 12   ? 10.276  2.230   -40.388 1.00 61.28  ? 12   ASP B CA    1 
ATOM   1749  C  C     . ASP B 1 12   ? 11.237  1.054   -40.191 1.00 58.14  ? 12   ASP B C     1 
ATOM   1750  O  O     . ASP B 1 12   ? 12.421  1.140   -40.511 1.00 60.20  ? 12   ASP B O     1 
ATOM   1751  C  CB    . ASP B 1 12   ? 10.308  2.681   -41.853 1.00 53.95  ? 12   ASP B CB    1 
ATOM   1752  C  CG    . ASP B 1 12   ? 9.547   1.742   -42.777 1.00 58.50  ? 12   ASP B CG    1 
ATOM   1753  O  OD1   . ASP B 1 12   ? 9.291   0.583   -42.384 1.00 63.72  ? 12   ASP B OD1   1 
ATOM   1754  O  OD2   . ASP B 1 12   ? 9.205   2.168   -43.903 1.00 53.92  ? 12   ASP B OD2   1 
ATOM   1755  N  N     . VAL B 1 13   ? 10.712  -0.046  -39.663 1.00 52.31  ? 13   VAL B N     1 
ATOM   1756  C  CA    . VAL B 1 13   ? 11.445  -1.304  -39.637 1.00 52.67  ? 13   VAL B CA    1 
ATOM   1757  C  C     . VAL B 1 13   ? 10.824  -2.188  -40.725 1.00 47.04  ? 13   VAL B C     1 
ATOM   1758  O  O     . VAL B 1 13   ? 9.605   -2.216  -40.885 1.00 46.51  ? 13   VAL B O     1 
ATOM   1759  C  CB    . VAL B 1 13   ? 11.395  -1.969  -38.245 1.00 57.82  ? 13   VAL B CB    1 
ATOM   1760  C  CG1   . VAL B 1 13   ? 12.484  -3.021  -38.118 1.00 54.29  ? 13   VAL B CG1   1 
ATOM   1761  C  CG2   . VAL B 1 13   ? 11.567  -0.918  -37.153 1.00 46.81  ? 13   VAL B CG2   1 
ATOM   1762  N  N     . LEU B 1 14   ? 11.658  -2.891  -41.484 1.00 42.37  ? 14   LEU B N     1 
ATOM   1763  C  CA    . LEU B 1 14   ? 11.231  -3.400  -42.785 1.00 44.98  ? 14   LEU B CA    1 
ATOM   1764  C  C     . LEU B 1 14   ? 11.106  -4.914  -42.933 1.00 46.39  ? 14   LEU B C     1 
ATOM   1765  O  O     . LEU B 1 14   ? 11.572  -5.686  -42.098 1.00 48.37  ? 14   LEU B O     1 
ATOM   1766  C  CB    . LEU B 1 14   ? 12.197  -2.892  -43.858 1.00 50.06  ? 14   LEU B CB    1 
ATOM   1767  C  CG    . LEU B 1 14   ? 12.213  -1.383  -44.107 1.00 48.56  ? 14   LEU B CG    1 
ATOM   1768  C  CD1   . LEU B 1 14   ? 13.361  -1.007  -45.027 1.00 40.47  ? 14   LEU B CD1   1 
ATOM   1769  C  CD2   . LEU B 1 14   ? 10.887  -0.934  -44.697 1.00 52.14  ? 14   LEU B CD2   1 
ATOM   1770  N  N     . THR B 1 15   ? 10.443  -5.306  -44.019 1.00 48.56  ? 15   THR B N     1 
ATOM   1771  C  CA    . THR B 1 15   ? 10.433  -6.667  -44.550 1.00 50.38  ? 15   THR B CA    1 
ATOM   1772  C  C     . THR B 1 15   ? 9.900   -6.509  -45.975 1.00 56.74  ? 15   THR B C     1 
ATOM   1773  O  O     . THR B 1 15   ? 9.298   -5.483  -46.291 1.00 64.12  ? 15   THR B O     1 
ATOM   1774  C  CB    . THR B 1 15   ? 9.563   -7.643  -43.724 1.00 45.11  ? 15   THR B CB    1 
ATOM   1775  O  OG1   . THR B 1 15   ? 9.872   -7.507  -42.333 1.00 37.81  ? 15   THR B OG1   1 
ATOM   1776  C  CG2   . THR B 1 15   ? 9.813   -9.086  -44.145 1.00 44.59  ? 15   THR B CG2   1 
ATOM   1777  N  N     . ASP B 1 16   ? 10.127  -7.495  -46.836 1.00 52.02  ? 16   ASP B N     1 
ATOM   1778  C  CA    . ASP B 1 16   ? 9.827   -7.348  -48.258 1.00 54.93  ? 16   ASP B CA    1 
ATOM   1779  C  C     . ASP B 1 16   ? 8.379   -6.999  -48.557 1.00 58.16  ? 16   ASP B C     1 
ATOM   1780  O  O     . ASP B 1 16   ? 8.102   -6.117  -49.370 1.00 61.73  ? 16   ASP B O     1 
ATOM   1781  C  CB    . ASP B 1 16   ? 10.198  -8.623  -49.000 1.00 51.81  ? 16   ASP B CB    1 
ATOM   1782  C  CG    . ASP B 1 16   ? 11.684  -8.804  -49.100 1.00 58.12  ? 16   ASP B CG    1 
ATOM   1783  O  OD1   . ASP B 1 16   ? 12.398  -7.780  -49.099 1.00 63.14  ? 16   ASP B OD1   1 
ATOM   1784  O  OD2   . ASP B 1 16   ? 12.138  -9.961  -49.169 1.00 66.28  ? 16   ASP B OD2   1 
ATOM   1785  N  N     . ASN B 1 17   ? 7.456   -7.686  -47.900 1.00 50.06  ? 17   ASN B N     1 
ATOM   1786  C  CA    . ASN B 1 17   ? 6.054   -7.492  -48.215 1.00 49.68  ? 17   ASN B CA    1 
ATOM   1787  C  C     . ASN B 1 17   ? 5.309   -6.693  -47.162 1.00 58.58  ? 17   ASN B C     1 
ATOM   1788  O  O     . ASN B 1 17   ? 4.219   -6.185  -47.420 1.00 61.28  ? 17   ASN B O     1 
ATOM   1789  C  CB    . ASN B 1 17   ? 5.371   -8.836  -48.417 1.00 59.38  ? 17   ASN B CB    1 
ATOM   1790  C  CG    . ASN B 1 17   ? 4.504   -8.852  -49.649 1.00 64.43  ? 17   ASN B CG    1 
ATOM   1791  O  OD1   . ASN B 1 17   ? 4.684   -8.035  -50.552 1.00 55.43  ? 17   ASN B OD1   1 
ATOM   1792  N  ND2   . ASN B 1 17   ? 3.554   -9.776  -49.697 1.00 73.54  ? 17   ASN B ND2   1 
ATOM   1793  N  N     . ARG B 1 18   ? 5.894   -6.577  -45.977 1.00 60.91  ? 18   ARG B N     1 
ATOM   1794  C  CA    . ARG B 1 18   ? 5.251   -5.826  -44.909 1.00 62.16  ? 18   ARG B CA    1 
ATOM   1795  C  C     . ARG B 1 18   ? 6.270   -5.077  -44.057 1.00 63.74  ? 18   ARG B C     1 
ATOM   1796  O  O     . ARG B 1 18   ? 7.466   -5.349  -44.122 1.00 62.22  ? 18   ARG B O     1 
ATOM   1797  C  CB    . ARG B 1 18   ? 4.404   -6.757  -44.039 1.00 58.34  ? 18   ARG B CB    1 
ATOM   1798  C  CG    . ARG B 1 18   ? 5.160   -7.561  -43.002 1.00 56.46  ? 18   ARG B CG    1 
ATOM   1799  C  CD    . ARG B 1 18   ? 4.172   -8.324  -42.131 1.00 56.43  ? 18   ARG B CD    1 
ATOM   1800  N  NE    . ARG B 1 18   ? 4.804   -8.950  -40.975 1.00 57.71  ? 18   ARG B NE    1 
ATOM   1801  C  CZ    . ARG B 1 18   ? 4.136   -9.584  -40.015 1.00 58.11  ? 18   ARG B CZ    1 
ATOM   1802  N  NH1   . ARG B 1 18   ? 2.814   -9.673  -40.073 1.00 61.25  ? 18   ARG B NH1   1 
ATOM   1803  N  NH2   . ARG B 1 18   ? 4.787   -10.127 -38.996 1.00 53.21  ? 18   ARG B NH2   1 
ATOM   1804  N  N     . SER B 1 19   ? 5.793   -4.124  -43.265 1.00 62.54  ? 19   SER B N     1 
ATOM   1805  C  CA    . SER B 1 19   ? 6.686   -3.326  -42.435 1.00 58.34  ? 19   SER B CA    1 
ATOM   1806  C  C     . SER B 1 19   ? 5.969   -2.732  -41.226 1.00 57.90  ? 19   SER B C     1 
ATOM   1807  O  O     . SER B 1 19   ? 4.740   -2.640  -41.199 1.00 51.42  ? 19   SER B O     1 
ATOM   1808  C  CB    . SER B 1 19   ? 7.325   -2.213  -43.267 1.00 50.15  ? 19   SER B CB    1 
ATOM   1809  O  OG    . SER B 1 19   ? 6.335   -1.416  -43.888 1.00 49.41  ? 19   SER B OG    1 
ATOM   1810  N  N     . GLN B 1 20   ? 6.755   -2.340  -40.227 1.00 59.57  ? 20   GLN B N     1 
ATOM   1811  C  CA    . GLN B 1 20   ? 6.233   -1.752  -38.998 1.00 52.56  ? 20   GLN B CA    1 
ATOM   1812  C  C     . GLN B 1 20   ? 6.558   -0.265  -38.935 1.00 47.90  ? 20   GLN B C     1 
ATOM   1813  O  O     . GLN B 1 20   ? 7.704   0.135   -39.137 1.00 51.87  ? 20   GLN B O     1 
ATOM   1814  C  CB    . GLN B 1 20   ? 6.803   -2.468  -37.765 1.00 52.31  ? 20   GLN B CB    1 
ATOM   1815  C  CG    . GLN B 1 20   ? 6.186   -3.837  -37.488 1.00 52.73  ? 20   GLN B CG    1 
ATOM   1816  C  CD    . GLN B 1 20   ? 6.571   -4.403  -36.127 1.00 46.88  ? 20   GLN B CD    1 
ATOM   1817  O  OE1   . GLN B 1 20   ? 7.595   -4.034  -35.550 1.00 42.49  ? 20   GLN B OE1   1 
ATOM   1818  N  NE2   . GLN B 1 20   ? 5.742   -5.305  -35.607 1.00 44.08  ? 20   GLN B NE2   1 
ATOM   1819  N  N     . PHE B 1 21   ? 5.549   0.554   -38.658 1.00 42.50  ? 21   PHE B N     1 
ATOM   1820  C  CA    . PHE B 1 21   ? 5.751   1.993   -38.566 1.00 43.74  ? 21   PHE B CA    1 
ATOM   1821  C  C     . PHE B 1 21   ? 5.650   2.465   -37.128 1.00 49.46  ? 21   PHE B C     1 
ATOM   1822  O  O     . PHE B 1 21   ? 4.839   1.958   -36.352 1.00 51.94  ? 21   PHE B O     1 
ATOM   1823  C  CB    . PHE B 1 21   ? 4.742   2.733   -39.435 1.00 46.71  ? 21   PHE B CB    1 
ATOM   1824  C  CG    . PHE B 1 21   ? 4.810   2.354   -40.878 1.00 46.59  ? 21   PHE B CG    1 
ATOM   1825  C  CD1   . PHE B 1 21   ? 5.710   2.972   -41.725 1.00 50.66  ? 21   PHE B CD1   1 
ATOM   1826  C  CD2   . PHE B 1 21   ? 3.989   1.364   -41.384 1.00 49.25  ? 21   PHE B CD2   1 
ATOM   1827  C  CE1   . PHE B 1 21   ? 5.782   2.619   -43.054 1.00 55.56  ? 21   PHE B CE1   1 
ATOM   1828  C  CE2   . PHE B 1 21   ? 4.055   1.005   -42.710 1.00 53.55  ? 21   PHE B CE2   1 
ATOM   1829  C  CZ    . PHE B 1 21   ? 4.953   1.634   -43.548 1.00 59.68  ? 21   PHE B CZ    1 
ATOM   1830  N  N     . VAL B 1 22   ? 6.488   3.430   -36.772 1.00 51.10  ? 22   VAL B N     1 
ATOM   1831  C  CA    . VAL B 1 22   ? 6.496   3.960   -35.419 1.00 52.32  ? 22   VAL B CA    1 
ATOM   1832  C  C     . VAL B 1 22   ? 6.256   5.458   -35.446 1.00 51.04  ? 22   VAL B C     1 
ATOM   1833  O  O     . VAL B 1 22   ? 6.932   6.198   -36.159 1.00 54.75  ? 22   VAL B O     1 
ATOM   1834  C  CB    . VAL B 1 22   ? 7.823   3.674   -34.694 1.00 56.81  ? 22   VAL B CB    1 
ATOM   1835  C  CG1   . VAL B 1 22   ? 7.718   4.084   -33.237 1.00 54.24  ? 22   VAL B CG1   1 
ATOM   1836  C  CG2   . VAL B 1 22   ? 8.186   2.201   -34.805 1.00 66.80  ? 22   VAL B CG2   1 
ATOM   1837  N  N     . ILE B 1 23   ? 5.279   5.898   -34.665 1.00 48.17  ? 23   ILE B N     1 
ATOM   1838  C  CA    . ILE B 1 23   ? 4.928   7.305   -34.606 1.00 42.39  ? 23   ILE B CA    1 
ATOM   1839  C  C     . ILE B 1 23   ? 4.977   7.805   -33.175 1.00 48.66  ? 23   ILE B C     1 
ATOM   1840  O  O     . ILE B 1 23   ? 4.125   7.458   -32.359 1.00 54.64  ? 23   ILE B O     1 
ATOM   1841  C  CB    . ILE B 1 23   ? 3.534   7.552   -35.172 1.00 34.45  ? 23   ILE B CB    1 
ATOM   1842  C  CG1   . ILE B 1 23   ? 3.387   6.860   -36.524 1.00 34.03  ? 23   ILE B CG1   1 
ATOM   1843  C  CG2   . ILE B 1 23   ? 3.273   9.040   -35.284 1.00 38.96  ? 23   ILE B CG2   1 
ATOM   1844  C  CD1   . ILE B 1 23   ? 1.960   6.736   -36.979 1.00 43.56  ? 23   ILE B CD1   1 
ATOM   1845  N  N     . GLU B 1 24   ? 5.974   8.625   -32.874 1.00 42.52  ? 24   GLU B N     1 
ATOM   1846  C  CA    . GLU B 1 24   ? 6.145   9.122   -31.520 1.00 42.40  ? 24   GLU B CA    1 
ATOM   1847  C  C     . GLU B 1 24   ? 6.908   10.441  -31.510 1.00 36.28  ? 24   GLU B C     1 
ATOM   1848  O  O     . GLU B 1 24   ? 7.725   10.696  -32.394 1.00 38.77  ? 24   GLU B O     1 
ATOM   1849  C  CB    . GLU B 1 24   ? 6.867   8.079   -30.668 1.00 47.29  ? 24   GLU B CB    1 
ATOM   1850  C  CG    . GLU B 1 24   ? 8.230   7.686   -31.194 1.00 43.37  ? 24   GLU B CG    1 
ATOM   1851  C  CD    . GLU B 1 24   ? 8.990   6.820   -30.214 1.00 44.52  ? 24   GLU B CD    1 
ATOM   1852  O  OE1   . GLU B 1 24   ? 8.435   6.508   -29.139 1.00 37.15  ? 24   GLU B OE1   1 
ATOM   1853  O  OE2   . GLU B 1 24   ? 10.145  6.454   -30.516 1.00 51.37  ? 24   GLU B OE2   1 
ATOM   1854  N  N     . PRO B 1 25   ? 6.639   11.291  -30.510 1.00 32.45  ? 25   PRO B N     1 
ATOM   1855  C  CA    . PRO B 1 25   ? 5.659   11.101  -29.437 1.00 37.54  ? 25   PRO B CA    1 
ATOM   1856  C  C     . PRO B 1 25   ? 4.321   11.790  -29.708 1.00 46.05  ? 25   PRO B C     1 
ATOM   1857  O  O     . PRO B 1 25   ? 4.293   12.952  -30.115 1.00 56.35  ? 25   PRO B O     1 
ATOM   1858  C  CB    . PRO B 1 25   ? 6.354   11.735  -28.240 1.00 47.98  ? 25   PRO B CB    1 
ATOM   1859  C  CG    . PRO B 1 25   ? 7.130   12.866  -28.842 1.00 51.08  ? 25   PRO B CG    1 
ATOM   1860  C  CD    . PRO B 1 25   ? 7.503   12.455  -30.253 1.00 37.43  ? 25   PRO B CD    1 
ATOM   1861  N  N     . LEU B 1 26   ? 3.221   11.084  -29.475 1.00 42.10  ? 26   LEU B N     1 
ATOM   1862  C  CA    . LEU B 1 26   ? 1.904   11.685  -29.635 1.00 40.38  ? 26   LEU B CA    1 
ATOM   1863  C  C     . LEU B 1 26   ? 1.413   12.276  -28.324 1.00 41.30  ? 26   LEU B C     1 
ATOM   1864  O  O     . LEU B 1 26   ? 1.669   11.724  -27.255 1.00 48.46  ? 26   LEU B O     1 
ATOM   1865  C  CB    . LEU B 1 26   ? 0.899   10.656  -30.151 1.00 43.26  ? 26   LEU B CB    1 
ATOM   1866  C  CG    . LEU B 1 26   ? 1.172   10.093  -31.545 1.00 41.12  ? 26   LEU B CG    1 
ATOM   1867  C  CD1   . LEU B 1 26   ? 0.004   9.239   -32.008 1.00 42.61  ? 26   LEU B CD1   1 
ATOM   1868  C  CD2   . LEU B 1 26   ? 1.446   11.216  -32.532 1.00 37.74  ? 26   LEU B CD2   1 
ATOM   1869  N  N     . GLU B 1 27   ? 0.717   13.406  -28.415 1.00 38.92  ? 27   GLU B N     1 
ATOM   1870  C  CA    . GLU B 1 27   ? 0.097   14.035  -27.253 1.00 45.40  ? 27   GLU B CA    1 
ATOM   1871  C  C     . GLU B 1 27   ? -0.798  13.017  -26.546 1.00 43.71  ? 27   GLU B C     1 
ATOM   1872  O  O     . GLU B 1 27   ? -1.576  12.323  -27.200 1.00 37.11  ? 27   GLU B O     1 
ATOM   1873  C  CB    . GLU B 1 27   ? -0.692  15.278  -27.687 1.00 42.80  ? 27   GLU B CB    1 
ATOM   1874  C  CG    . GLU B 1 27   ? -1.322  16.090  -26.565 1.00 41.33  ? 27   GLU B CG    1 
ATOM   1875  C  CD    . GLU B 1 27   ? -1.367  17.573  -26.885 1.00 36.55  ? 27   GLU B CD    1 
ATOM   1876  O  OE1   . GLU B 1 27   ? -0.456  18.056  -27.591 1.00 29.36  ? 27   GLU B OE1   1 
ATOM   1877  O  OE2   . GLU B 1 27   ? -2.312  18.255  -26.434 1.00 39.58  ? 27   GLU B OE2   1 
ATOM   1878  N  N     . PRO B 1 28   ? -0.661  12.906  -25.213 1.00 47.30  ? 28   PRO B N     1 
ATOM   1879  C  CA    . PRO B 1 28   ? -1.357  11.906  -24.395 1.00 42.07  ? 28   PRO B CA    1 
ATOM   1880  C  C     . PRO B 1 28   ? -2.825  11.718  -24.758 1.00 28.77  ? 28   PRO B C     1 
ATOM   1881  O  O     . PRO B 1 28   ? -3.617  12.655  -24.686 1.00 25.49  ? 28   PRO B O     1 
ATOM   1882  C  CB    . PRO B 1 28   ? -1.221  12.463  -22.969 1.00 50.36  ? 28   PRO B CB    1 
ATOM   1883  C  CG    . PRO B 1 28   ? -0.683  13.867  -23.127 1.00 51.92  ? 28   PRO B CG    1 
ATOM   1884  C  CD    . PRO B 1 28   ? 0.127   13.820  -24.373 1.00 53.33  ? 28   PRO B CD    1 
ATOM   1885  N  N     . GLY B 1 29   ? -3.171  10.501  -25.158 1.00 26.95  ? 29   GLY B N     1 
ATOM   1886  C  CA    . GLY B 1 29   ? -4.543  10.167  -25.479 1.00 28.75  ? 29   GLY B CA    1 
ATOM   1887  C  C     . GLY B 1 29   ? -4.781  10.051  -26.969 1.00 31.04  ? 29   GLY B C     1 
ATOM   1888  O  O     . GLY B 1 29   ? -5.836  9.580   -27.400 1.00 26.90  ? 29   GLY B O     1 
ATOM   1889  N  N     . PHE B 1 30   ? -3.798  10.469  -27.761 1.00 29.49  ? 30   PHE B N     1 
ATOM   1890  C  CA    . PHE B 1 30   ? -3.961  10.494  -29.210 1.00 26.31  ? 30   PHE B CA    1 
ATOM   1891  C  C     . PHE B 1 30   ? -3.551  9.198   -29.891 1.00 21.64  ? 30   PHE B C     1 
ATOM   1892  O  O     . PHE B 1 30   ? -3.977  8.929   -31.013 1.00 19.63  ? 30   PHE B O     1 
ATOM   1893  C  CB    . PHE B 1 30   ? -3.179  11.656  -29.815 1.00 27.76  ? 30   PHE B CB    1 
ATOM   1894  C  CG    . PHE B 1 30   ? -3.939  12.946  -29.826 1.00 25.27  ? 30   PHE B CG    1 
ATOM   1895  C  CD1   . PHE B 1 30   ? -5.092  13.070  -30.581 1.00 29.24  ? 30   PHE B CD1   1 
ATOM   1896  C  CD2   . PHE B 1 30   ? -3.513  14.029  -29.081 1.00 23.74  ? 30   PHE B CD2   1 
ATOM   1897  C  CE1   . PHE B 1 30   ? -5.804  14.248  -30.595 1.00 31.28  ? 30   PHE B CE1   1 
ATOM   1898  C  CE2   . PHE B 1 30   ? -4.219  15.213  -29.090 1.00 20.73  ? 30   PHE B CE2   1 
ATOM   1899  C  CZ    . PHE B 1 30   ? -5.366  15.322  -29.849 1.00 26.60  ? 30   PHE B CZ    1 
ATOM   1900  N  N     . GLY B 1 31   ? -2.729  8.402   -29.215 1.00 22.43  ? 31   GLY B N     1 
ATOM   1901  C  CA    . GLY B 1 31   ? -2.334  7.108   -29.733 1.00 18.83  ? 31   GLY B CA    1 
ATOM   1902  C  C     . GLY B 1 31   ? -3.551  6.290   -30.118 1.00 24.01  ? 31   GLY B C     1 
ATOM   1903  O  O     . GLY B 1 31   ? -3.582  5.669   -31.178 1.00 25.98  ? 31   GLY B O     1 
ATOM   1904  N  N     . TYR B 1 32   ? -4.566  6.315   -29.259 1.00 27.21  ? 32   TYR B N     1 
ATOM   1905  C  CA    . TYR B 1 32   ? -5.808  5.585   -29.498 1.00 30.09  ? 32   TYR B CA    1 
ATOM   1906  C  C     . TYR B 1 32   ? -6.765  6.389   -30.362 1.00 23.52  ? 32   TYR B C     1 
ATOM   1907  O  O     . TYR B 1 32   ? -7.705  5.846   -30.946 1.00 21.59  ? 32   TYR B O     1 
ATOM   1908  C  CB    . TYR B 1 32   ? -6.484  5.227   -28.174 1.00 31.11  ? 32   TYR B CB    1 
ATOM   1909  C  CG    . TYR B 1 32   ? -5.805  4.105   -27.430 1.00 25.88  ? 32   TYR B CG    1 
ATOM   1910  C  CD1   . TYR B 1 32   ? -6.277  2.804   -27.524 1.00 17.51  ? 32   TYR B CD1   1 
ATOM   1911  C  CD2   . TYR B 1 32   ? -4.687  4.343   -26.642 1.00 27.25  ? 32   TYR B CD2   1 
ATOM   1912  C  CE1   . TYR B 1 32   ? -5.660  1.775   -26.850 1.00 24.09  ? 32   TYR B CE1   1 
ATOM   1913  C  CE2   . TYR B 1 32   ? -4.062  3.319   -25.965 1.00 24.68  ? 32   TYR B CE2   1 
ATOM   1914  C  CZ    . TYR B 1 32   ? -4.551  2.037   -26.072 1.00 26.92  ? 32   TYR B CZ    1 
ATOM   1915  O  OH    . TYR B 1 32   ? -3.929  1.012   -25.396 1.00 36.10  ? 32   TYR B OH    1 
ATOM   1916  N  N     . THR B 1 33   ? -6.519  7.691   -30.430 1.00 22.96  ? 33   THR B N     1 
ATOM   1917  C  CA    . THR B 1 33   ? -7.339  8.589   -31.225 1.00 24.11  ? 33   THR B CA    1 
ATOM   1918  C  C     . THR B 1 33   ? -6.984  8.428   -32.699 1.00 18.70  ? 33   THR B C     1 
ATOM   1919  O  O     . THR B 1 33   ? -7.803  8.667   -33.583 1.00 16.87  ? 33   THR B O     1 
ATOM   1920  C  CB    . THR B 1 33   ? -7.150  10.057  -30.781 1.00 25.08  ? 33   THR B CB    1 
ATOM   1921  O  OG1   . THR B 1 33   ? -7.376  10.161  -29.369 1.00 23.35  ? 33   THR B OG1   1 
ATOM   1922  C  CG2   . THR B 1 33   ? -8.110  10.983  -31.512 1.00 23.15  ? 33   THR B CG2   1 
ATOM   1923  N  N     . LEU B 1 34   ? -5.761  7.990   -32.959 1.00 19.32  ? 34   LEU B N     1 
ATOM   1924  C  CA    . LEU B 1 34   ? -5.293  7.834   -34.325 1.00 19.84  ? 34   LEU B CA    1 
ATOM   1925  C  C     . LEU B 1 34   ? -5.274  6.364   -34.750 1.00 27.31  ? 34   LEU B C     1 
ATOM   1926  O  O     . LEU B 1 34   ? -5.395  6.053   -35.935 1.00 31.38  ? 34   LEU B O     1 
ATOM   1927  C  CB    . LEU B 1 34   ? -3.906  8.461   -34.464 1.00 23.23  ? 34   LEU B CB    1 
ATOM   1928  C  CG    . LEU B 1 34   ? -3.065  8.177   -35.708 1.00 27.50  ? 34   LEU B CG    1 
ATOM   1929  C  CD1   . LEU B 1 34   ? -3.782  8.616   -36.964 1.00 28.83  ? 34   LEU B CD1   1 
ATOM   1930  C  CD2   . LEU B 1 34   ? -1.720  8.870   -35.591 1.00 33.76  ? 34   LEU B CD2   1 
ATOM   1931  N  N     . GLY B 1 35   ? -5.151  5.468   -33.774 1.00 28.69  ? 35   GLY B N     1 
ATOM   1932  C  CA    . GLY B 1 35   ? -5.045  4.039   -34.028 1.00 30.36  ? 35   GLY B CA    1 
ATOM   1933  C  C     . GLY B 1 35   ? -6.092  3.414   -34.937 1.00 33.06  ? 35   GLY B C     1 
ATOM   1934  O  O     . GLY B 1 35   ? -5.842  3.220   -36.129 1.00 34.34  ? 35   GLY B O     1 
ATOM   1935  N  N     . ASN B 1 36   ? -7.258  3.098   -34.376 1.00 32.26  ? 36   ASN B N     1 
ATOM   1936  C  CA    . ASN B 1 36   ? -8.298  2.355   -35.094 1.00 29.62  ? 36   ASN B CA    1 
ATOM   1937  C  C     . ASN B 1 36   ? -8.762  3.049   -36.370 1.00 30.64  ? 36   ASN B C     1 
ATOM   1938  O  O     . ASN B 1 36   ? -9.171  2.398   -37.335 1.00 35.38  ? 36   ASN B O     1 
ATOM   1939  C  CB    . ASN B 1 36   ? -9.503  2.114   -34.186 1.00 23.99  ? 36   ASN B CB    1 
ATOM   1940  C  CG    . ASN B 1 36   ? -10.531 1.192   -34.815 1.00 23.96  ? 36   ASN B CG    1 
ATOM   1941  O  OD1   . ASN B 1 36   ? -10.219 0.416   -35.716 1.00 29.02  ? 36   ASN B OD1   1 
ATOM   1942  N  ND2   . ASN B 1 36   ? -11.767 1.272   -34.338 1.00 27.17  ? 36   ASN B ND2   1 
ATOM   1943  N  N     . SER B 1 37   ? -8.700  4.376   -36.356 1.00 26.52  ? 37   SER B N     1 
ATOM   1944  C  CA    . SER B 1 37   ? -9.063  5.190   -37.506 1.00 25.57  ? 37   SER B CA    1 
ATOM   1945  C  C     . SER B 1 37   ? -8.152  4.932   -38.696 1.00 26.37  ? 37   SER B C     1 
ATOM   1946  O  O     . SER B 1 37   ? -8.605  4.812   -39.832 1.00 33.02  ? 37   SER B O     1 
ATOM   1947  C  CB    . SER B 1 37   ? -9.002  6.664   -37.131 1.00 27.53  ? 37   SER B CB    1 
ATOM   1948  O  OG    . SER B 1 37   ? -7.736  6.973   -36.575 1.00 31.84  ? 37   SER B OG    1 
ATOM   1949  N  N     . LEU B 1 38   ? -6.857  4.859   -38.430 1.00 25.52  ? 38   LEU B N     1 
ATOM   1950  C  CA    . LEU B 1 38   ? -5.894  4.700   -39.501 1.00 26.33  ? 38   LEU B CA    1 
ATOM   1951  C  C     . LEU B 1 38   ? -5.969  3.296   -40.087 1.00 32.86  ? 38   LEU B C     1 
ATOM   1952  O  O     . LEU B 1 38   ? -5.701  3.101   -41.273 1.00 35.49  ? 38   LEU B O     1 
ATOM   1953  C  CB    . LEU B 1 38   ? -4.483  5.004   -39.001 1.00 28.98  ? 38   LEU B CB    1 
ATOM   1954  C  CG    . LEU B 1 38   ? -3.414  5.108   -40.088 1.00 30.90  ? 38   LEU B CG    1 
ATOM   1955  C  CD1   . LEU B 1 38   ? -3.945  5.888   -41.280 1.00 36.14  ? 38   LEU B CD1   1 
ATOM   1956  C  CD2   . LEU B 1 38   ? -2.158  5.764   -39.537 1.00 26.12  ? 38   LEU B CD2   1 
ATOM   1957  N  N     . ARG B 1 39   ? -6.351  2.328   -39.256 1.00 38.20  ? 39   ARG B N     1 
ATOM   1958  C  CA    . ARG B 1 39   ? -6.446  0.933   -39.689 1.00 47.75  ? 39   ARG B CA    1 
ATOM   1959  C  C     . ARG B 1 39   ? -7.604  0.714   -40.657 1.00 46.10  ? 39   ARG B C     1 
ATOM   1960  O  O     . ARG B 1 39   ? -7.414  0.174   -41.747 1.00 52.90  ? 39   ARG B O     1 
ATOM   1961  C  CB    . ARG B 1 39   ? -6.598  -0.008  -38.487 1.00 43.78  ? 39   ARG B CB    1 
ATOM   1962  C  CG    . ARG B 1 39   ? -6.978  -1.444  -38.871 1.00 39.98  ? 39   ARG B CG    1 
ATOM   1963  C  CD    . ARG B 1 39   ? -6.904  -2.408  -37.691 1.00 37.27  ? 39   ARG B CD    1 
ATOM   1964  N  NE    . ARG B 1 39   ? -7.328  -3.758  -38.061 1.00 32.99  ? 39   ARG B NE    1 
ATOM   1965  C  CZ    . ARG B 1 39   ? -8.539  -4.250  -37.822 1.00 36.46  ? 39   ARG B CZ    1 
ATOM   1966  N  NH1   . ARG B 1 39   ? -9.445  -3.506  -37.204 1.00 39.58  ? 39   ARG B NH1   1 
ATOM   1967  N  NH2   . ARG B 1 39   ? -8.844  -5.486  -38.194 1.00 36.50  ? 39   ARG B NH2   1 
ATOM   1968  N  N     . ARG B 1 40   ? -8.800  1.142   -40.263 1.00 35.04  ? 40   ARG B N     1 
ATOM   1969  C  CA    . ARG B 1 40   ? -9.986  0.954   -41.092 1.00 37.00  ? 40   ARG B CA    1 
ATOM   1970  C  C     . ARG B 1 40   ? -9.873  1.709   -42.416 1.00 43.77  ? 40   ARG B C     1 
ATOM   1971  O  O     . ARG B 1 40   ? -10.678 1.510   -43.323 1.00 50.15  ? 40   ARG B O     1 
ATOM   1972  C  CB    . ARG B 1 40   ? -11.239 1.400   -40.340 1.00 38.80  ? 40   ARG B CB    1 
ATOM   1973  C  CG    . ARG B 1 40   ? -12.526 0.799   -40.878 1.00 42.60  ? 40   ARG B CG    1 
ATOM   1974  C  CD    . ARG B 1 40   ? -12.501 -0.719  -40.792 1.00 42.37  ? 40   ARG B CD    1 
ATOM   1975  N  NE    . ARG B 1 40   ? -12.349 -1.179  -39.415 1.00 50.61  ? 40   ARG B NE    1 
ATOM   1976  C  CZ    . ARG B 1 40   ? -13.362 -1.380  -38.579 1.00 49.97  ? 40   ARG B CZ    1 
ATOM   1977  N  NH1   . ARG B 1 40   ? -14.607 -1.161  -38.981 1.00 49.80  ? 40   ARG B NH1   1 
ATOM   1978  N  NH2   . ARG B 1 40   ? -13.133 -1.798  -37.340 1.00 45.59  ? 40   ARG B NH2   1 
ATOM   1979  N  N     . THR B 1 41   ? -8.871  2.577   -42.520 1.00 41.35  ? 41   THR B N     1 
ATOM   1980  C  CA    . THR B 1 41   ? -8.618  3.319   -43.749 1.00 44.53  ? 41   THR B CA    1 
ATOM   1981  C  C     . THR B 1 41   ? -7.815  2.480   -44.737 1.00 50.18  ? 41   THR B C     1 
ATOM   1982  O  O     . THR B 1 41   ? -8.129  2.429   -45.926 1.00 53.67  ? 41   THR B O     1 
ATOM   1983  C  CB    . THR B 1 41   ? -7.866  4.625   -43.465 1.00 36.59  ? 41   THR B CB    1 
ATOM   1984  O  OG1   . THR B 1 41   ? -8.578  5.378   -42.477 1.00 31.98  ? 41   THR B OG1   1 
ATOM   1985  C  CG2   . THR B 1 41   ? -7.738  5.453   -44.734 1.00 39.85  ? 41   THR B CG2   1 
ATOM   1986  N  N     . LEU B 1 42   ? -6.778  1.822   -44.231 1.00 50.21  ? 42   LEU B N     1 
ATOM   1987  C  CA    . LEU B 1 42   ? -5.931  0.963   -45.050 1.00 49.16  ? 42   LEU B CA    1 
ATOM   1988  C  C     . LEU B 1 42   ? -6.706  -0.220  -45.629 1.00 55.74  ? 42   LEU B C     1 
ATOM   1989  O  O     . LEU B 1 42   ? -6.634  -0.490  -46.827 1.00 62.05  ? 42   LEU B O     1 
ATOM   1990  C  CB    . LEU B 1 42   ? -4.740  0.461   -44.231 1.00 44.11  ? 42   LEU B CB    1 
ATOM   1991  C  CG    . LEU B 1 42   ? -3.670  1.504   -43.896 1.00 41.21  ? 42   LEU B CG    1 
ATOM   1992  C  CD1   . LEU B 1 42   ? -2.841  1.048   -42.712 1.00 45.58  ? 42   LEU B CD1   1 
ATOM   1993  C  CD2   . LEU B 1 42   ? -2.769  1.792   -45.094 1.00 41.81  ? 42   LEU B CD2   1 
ATOM   1994  N  N     . LEU B 1 43   ? -7.454  -0.916  -44.779 1.00 59.20  ? 43   LEU B N     1 
ATOM   1995  C  CA    . LEU B 1 43   ? -8.183  -2.111  -45.198 1.00 61.19  ? 43   LEU B CA    1 
ATOM   1996  C  C     . LEU B 1 43   ? -9.368  -1.808  -46.111 1.00 66.10  ? 43   LEU B C     1 
ATOM   1997  O  O     . LEU B 1 43   ? -9.827  -2.682  -46.848 1.00 64.56  ? 43   LEU B O     1 
ATOM   1998  C  CB    . LEU B 1 43   ? -8.681  -2.881  -43.976 1.00 53.64  ? 43   LEU B CB    1 
ATOM   1999  C  CG    . LEU B 1 43   ? -7.605  -3.328  -42.991 1.00 53.42  ? 43   LEU B CG    1 
ATOM   2000  C  CD1   . LEU B 1 43   ? -8.237  -3.980  -41.776 1.00 54.14  ? 43   LEU B CD1   1 
ATOM   2001  C  CD2   . LEU B 1 43   ? -6.642  -4.280  -43.668 1.00 55.68  ? 43   LEU B CD2   1 
ATOM   2002  N  N     . SER B 1 44   ? -9.864  -0.576  -46.060 1.00 62.64  ? 44   SER B N     1 
ATOM   2003  C  CA    . SER B 1 44   ? -11.114 -0.253  -46.737 1.00 59.69  ? 44   SER B CA    1 
ATOM   2004  C  C     . SER B 1 44   ? -11.011 0.887   -47.749 1.00 59.37  ? 44   SER B C     1 
ATOM   2005  O  O     . SER B 1 44   ? -11.646 0.837   -48.799 1.00 65.36  ? 44   SER B O     1 
ATOM   2006  C  CB    . SER B 1 44   ? -12.192 0.090   -45.704 1.00 53.94  ? 44   SER B CB    1 
ATOM   2007  O  OG    . SER B 1 44   ? -12.312 -0.931  -44.727 1.00 49.80  ? 44   SER B OG    1 
ATOM   2008  N  N     . SER B 1 45   ? -10.220 1.912   -47.452 1.00 52.94  ? 45   SER B N     1 
ATOM   2009  C  CA    . SER B 1 45   ? -10.275 3.128   -48.260 1.00 54.46  ? 45   SER B CA    1 
ATOM   2010  C  C     . SER B 1 45   ? -9.211  3.222   -49.348 1.00 61.77  ? 45   SER B C     1 
ATOM   2011  O  O     . SER B 1 45   ? -8.876  4.321   -49.790 1.00 58.83  ? 45   SER B O     1 
ATOM   2012  C  CB    . SER B 1 45   ? -10.172 4.358   -47.365 1.00 54.67  ? 45   SER B CB    1 
ATOM   2013  O  OG    . SER B 1 45   ? -10.164 5.535   -48.147 1.00 54.94  ? 45   SER B OG    1 
ATOM   2014  N  N     . ILE B 1 46   ? -8.686  2.082   -49.785 1.00 67.31  ? 46   ILE B N     1 
ATOM   2015  C  CA    . ILE B 1 46   ? -7.736  2.065   -50.896 1.00 68.81  ? 46   ILE B CA    1 
ATOM   2016  C  C     . ILE B 1 46   ? -8.238  1.176   -52.032 1.00 67.37  ? 46   ILE B C     1 
ATOM   2017  O  O     . ILE B 1 46   ? -8.558  0.010   -51.815 1.00 71.92  ? 46   ILE B O     1 
ATOM   2018  C  CB    . ILE B 1 46   ? -6.346  1.578   -50.459 1.00 60.93  ? 46   ILE B CB    1 
ATOM   2019  C  CG1   . ILE B 1 46   ? -5.894  2.308   -49.194 1.00 64.71  ? 46   ILE B CG1   1 
ATOM   2020  C  CG2   . ILE B 1 46   ? -5.342  1.796   -51.576 1.00 52.75  ? 46   ILE B CG2   1 
ATOM   2021  C  CD1   . ILE B 1 46   ? -5.711  3.798   -49.381 1.00 61.48  ? 46   ILE B CD1   1 
ATOM   2022  N  N     . PRO B 1 47   ? -8.309  1.731   -53.251 1.00 66.56  ? 47   PRO B N     1 
ATOM   2023  C  CA    . PRO B 1 47   ? -8.832  1.007   -54.412 1.00 66.76  ? 47   PRO B CA    1 
ATOM   2024  C  C     . PRO B 1 47   ? -7.794  0.134   -55.109 1.00 73.34  ? 47   PRO B C     1 
ATOM   2025  O  O     . PRO B 1 47   ? -6.613  0.477   -55.133 1.00 71.34  ? 47   PRO B O     1 
ATOM   2026  C  CB    . PRO B 1 47   ? -9.301  2.137   -55.329 1.00 67.37  ? 47   PRO B CB    1 
ATOM   2027  C  CG    . PRO B 1 47   ? -8.344  3.239   -55.040 1.00 71.91  ? 47   PRO B CG    1 
ATOM   2028  C  CD    . PRO B 1 47   ? -7.993  3.133   -53.576 1.00 73.32  ? 47   PRO B CD    1 
ATOM   2029  N  N     . GLY B 1 48   ? -8.249  -0.980  -55.674 1.00 83.96  ? 48   GLY B N     1 
ATOM   2030  C  CA    . GLY B 1 48   ? -7.385  -1.873  -56.419 1.00 82.52  ? 48   GLY B CA    1 
ATOM   2031  C  C     . GLY B 1 48   ? -8.172  -2.624  -57.478 1.00 86.67  ? 48   GLY B C     1 
ATOM   2032  O  O     . GLY B 1 48   ? -8.989  -2.033  -58.188 1.00 92.32  ? 48   GLY B O     1 
ATOM   2033  N  N     . ALA B 1 49   ? -7.935  -3.929  -57.580 1.00 84.34  ? 49   ALA B N     1 
ATOM   2034  C  CA    . ALA B 1 49   ? -8.635  -4.767  -58.549 1.00 82.36  ? 49   ALA B CA    1 
ATOM   2035  C  C     . ALA B 1 49   ? -8.582  -6.233  -58.142 1.00 75.62  ? 49   ALA B C     1 
ATOM   2036  O  O     . ALA B 1 49   ? -7.544  -6.728  -57.710 1.00 79.45  ? 49   ALA B O     1 
ATOM   2037  C  CB    . ALA B 1 49   ? -8.042  -4.584  -59.935 1.00 89.12  ? 49   ALA B CB    1 
ATOM   2038  N  N     . ALA B 1 50   ? -9.708  -6.923  -58.289 1.00 73.30  ? 50   ALA B N     1 
ATOM   2039  C  CA    . ALA B 1 50   ? -9.790  -8.336  -57.946 1.00 75.84  ? 50   ALA B CA    1 
ATOM   2040  C  C     . ALA B 1 50   ? -10.786 -9.061  -58.840 1.00 74.55  ? 50   ALA B C     1 
ATOM   2041  O  O     . ALA B 1 50   ? -11.267 -8.508  -59.827 1.00 85.23  ? 50   ALA B O     1 
ATOM   2042  C  CB    . ALA B 1 50   ? -10.171 -8.505  -56.484 1.00 80.67  ? 50   ALA B CB    1 
ATOM   2043  N  N     . VAL B 1 51   ? -11.096 -10.302 -58.483 1.00 71.07  ? 51   VAL B N     1 
ATOM   2044  C  CA    . VAL B 1 51   ? -11.997 -11.122 -59.281 1.00 80.84  ? 51   VAL B CA    1 
ATOM   2045  C  C     . VAL B 1 51   ? -13.418 -11.090 -58.737 1.00 82.82  ? 51   VAL B C     1 
ATOM   2046  O  O     . VAL B 1 51   ? -13.643 -11.291 -57.544 1.00 87.75  ? 51   VAL B O     1 
ATOM   2047  C  CB    . VAL B 1 51   ? -11.520 -12.581 -59.340 1.00 85.04  ? 51   VAL B CB    1 
ATOM   2048  C  CG1   . VAL B 1 51   ? -12.478 -13.421 -60.172 1.00 93.98  ? 51   VAL B CG1   1 
ATOM   2049  C  CG2   . VAL B 1 51   ? -10.111 -12.650 -59.905 1.00 88.07  ? 51   VAL B CG2   1 
ATOM   2050  N  N     . THR B 1 52   ? -14.374 -10.839 -59.622 1.00 88.11  ? 52   THR B N     1 
ATOM   2051  C  CA    . THR B 1 52   ? -15.776 -10.797 -59.242 1.00 92.43  ? 52   THR B CA    1 
ATOM   2052  C  C     . THR B 1 52   ? -16.441 -12.150 -59.452 1.00 97.26  ? 52   THR B C     1 
ATOM   2053  O  O     . THR B 1 52   ? -17.052 -12.703 -58.536 1.00 94.61  ? 52   THR B O     1 
ATOM   2054  C  CB    . THR B 1 52   ? -16.536 -9.730  -60.041 1.00 102.78 ? 52   THR B CB    1 
ATOM   2055  O  OG1   . THR B 1 52   ? -16.005 -8.435  -59.732 1.00 99.25  ? 52   THR B OG1   1 
ATOM   2056  C  CG2   . THR B 1 52   ? -18.016 -9.763  -59.698 1.00 113.63 ? 52   THR B CG2   1 
ATOM   2057  N  N     . SER B 1 53   ? -16.315 -12.683 -60.662 1.00 105.65 ? 53   SER B N     1 
ATOM   2058  C  CA    . SER B 1 53   ? -16.933 -13.960 -60.994 1.00 113.60 ? 53   SER B CA    1 
ATOM   2059  C  C     . SER B 1 53   ? -16.102 -14.746 -62.000 1.00 117.65 ? 53   SER B C     1 
ATOM   2060  O  O     . SER B 1 53   ? -15.302 -14.173 -62.743 1.00 114.26 ? 53   SER B O     1 
ATOM   2061  C  CB    . SER B 1 53   ? -18.339 -13.745 -61.548 1.00 119.72 ? 53   SER B CB    1 
ATOM   2062  O  OG    . SER B 1 53   ? -18.293 -13.079 -62.798 1.00 118.76 ? 53   SER B OG    1 
ATOM   2063  N  N     . ILE B 1 54   ? -16.297 -16.062 -62.018 1.00 114.94 ? 54   ILE B N     1 
ATOM   2064  C  CA    . ILE B 1 54   ? -15.565 -16.939 -62.927 1.00 120.47 ? 54   ILE B CA    1 
ATOM   2065  C  C     . ILE B 1 54   ? -16.497 -17.904 -63.654 1.00 122.55 ? 54   ILE B C     1 
ATOM   2066  O  O     . ILE B 1 54   ? -17.682 -18.002 -63.330 1.00 119.35 ? 54   ILE B O     1 
ATOM   2067  C  CB    . ILE B 1 54   ? -14.490 -17.762 -62.183 1.00 114.29 ? 54   ILE B CB    1 
ATOM   2068  C  CG1   . ILE B 1 54   ? -15.146 -18.749 -61.216 1.00 116.99 ? 54   ILE B CG1   1 
ATOM   2069  C  CG2   . ILE B 1 54   ? -13.527 -16.853 -61.442 1.00 110.70 ? 54   ILE B CG2   1 
ATOM   2070  C  CD1   . ILE B 1 54   ? -14.154 -19.599 -60.454 1.00 113.23 ? 54   ILE B CD1   1 
ATOM   2071  N  N     . ARG B 1 55   ? -15.948 -18.611 -64.638 1.00 116.67 ? 55   ARG B N     1 
ATOM   2072  C  CA    . ARG B 1 55   ? -16.691 -19.616 -65.388 1.00 111.18 ? 55   ARG B CA    1 
ATOM   2073  C  C     . ARG B 1 55   ? -15.785 -20.777 -65.789 1.00 107.87 ? 55   ARG B C     1 
ATOM   2074  O  O     . ARG B 1 55   ? -14.708 -20.570 -66.350 1.00 97.72  ? 55   ARG B O     1 
ATOM   2075  C  CB    . ARG B 1 55   ? -17.334 -18.997 -66.632 1.00 112.94 ? 55   ARG B CB    1 
ATOM   2076  C  CG    . ARG B 1 55   ? -18.564 -18.149 -66.345 1.00 120.65 ? 55   ARG B CG    1 
ATOM   2077  C  CD    . ARG B 1 55   ? -19.050 -17.433 -67.590 1.00 122.88 ? 55   ARG B CD    1 
ATOM   2078  N  NE    . ARG B 1 55   ? -19.502 -18.365 -68.617 1.00 121.56 ? 55   ARG B NE    1 
ATOM   2079  C  CZ    . ARG B 1 55   ? -19.877 -17.998 -69.838 1.00 117.88 ? 55   ARG B CZ    1 
ATOM   2080  N  NH1   . ARG B 1 55   ? -19.848 -16.718 -70.182 1.00 118.92 ? 55   ARG B NH1   1 
ATOM   2081  N  NH2   . ARG B 1 55   ? -20.276 -18.909 -70.715 1.00 112.21 ? 55   ARG B NH2   1 
ATOM   2082  N  N     . ILE B 1 56   ? -16.225 -21.997 -65.489 1.00 111.13 ? 56   ILE B N     1 
ATOM   2083  C  CA    . ILE B 1 56   ? -15.490 -23.202 -65.862 1.00 107.13 ? 56   ILE B CA    1 
ATOM   2084  C  C     . ILE B 1 56   ? -16.244 -23.995 -66.921 1.00 108.76 ? 56   ILE B C     1 
ATOM   2085  O  O     . ILE B 1 56   ? -17.459 -24.172 -66.829 1.00 113.49 ? 56   ILE B O     1 
ATOM   2086  C  CB    . ILE B 1 56   ? -15.243 -24.119 -64.658 1.00 104.43 ? 56   ILE B CB    1 
ATOM   2087  C  CG1   . ILE B 1 56   ? -14.773 -23.311 -63.452 1.00 110.60 ? 56   ILE B CG1   1 
ATOM   2088  C  CG2   . ILE B 1 56   ? -14.229 -25.196 -65.011 1.00 107.18 ? 56   ILE B CG2   1 
ATOM   2089  C  CD1   . ILE B 1 56   ? -14.585 -24.150 -62.209 1.00 117.44 ? 56   ILE B CD1   1 
ATOM   2090  N  N     . ASP B 1 57   ? -15.511 -24.483 -67.916 1.00 101.76 ? 57   ASP B N     1 
ATOM   2091  C  CA    . ASP B 1 57   ? -16.109 -25.192 -69.039 1.00 104.51 ? 57   ASP B CA    1 
ATOM   2092  C  C     . ASP B 1 57   ? -16.830 -26.467 -68.601 1.00 107.97 ? 57   ASP B C     1 
ATOM   2093  O  O     . ASP B 1 57   ? -18.033 -26.610 -68.813 1.00 115.91 ? 57   ASP B O     1 
ATOM   2094  C  CB    . ASP B 1 57   ? -15.037 -25.530 -70.076 1.00 100.73 ? 57   ASP B CB    1 
ATOM   2095  C  CG    . ASP B 1 57   ? -15.622 -25.839 -71.438 1.00 96.21  ? 57   ASP B CG    1 
ATOM   2096  O  OD1   . ASP B 1 57   ? -16.865 -25.872 -71.563 1.00 98.65  ? 57   ASP B OD1   1 
ATOM   2097  O  OD2   . ASP B 1 57   ? -14.838 -26.057 -72.384 1.00 88.63  ? 57   ASP B OD2   1 
ATOM   2098  N  N     . GLY B 1 58   ? -16.094 -27.386 -67.986 1.00 109.47 ? 58   GLY B N     1 
ATOM   2099  C  CA    . GLY B 1 58   ? -16.655 -28.669 -67.604 1.00 110.31 ? 58   GLY B CA    1 
ATOM   2100  C  C     . GLY B 1 58   ? -17.339 -28.675 -66.252 1.00 115.25 ? 58   GLY B C     1 
ATOM   2101  O  O     . GLY B 1 58   ? -17.112 -29.572 -65.441 1.00 119.90 ? 58   GLY B O     1 
ATOM   2102  N  N     . VAL B 1 59   ? -18.181 -27.676 -66.002 1.00 121.54 ? 59   VAL B N     1 
ATOM   2103  C  CA    . VAL B 1 59   ? -18.918 -27.600 -64.744 1.00 132.03 ? 59   VAL B CA    1 
ATOM   2104  C  C     . VAL B 1 59   ? -20.384 -27.230 -64.963 1.00 132.70 ? 59   VAL B C     1 
ATOM   2105  O  O     . VAL B 1 59   ? -20.690 -26.189 -65.544 1.00 130.72 ? 59   VAL B O     1 
ATOM   2106  C  CB    . VAL B 1 59   ? -18.281 -26.576 -63.773 1.00 133.93 ? 59   VAL B CB    1 
ATOM   2107  C  CG1   . VAL B 1 59   ? -19.227 -26.267 -62.622 1.00 133.92 ? 59   VAL B CG1   1 
ATOM   2108  C  CG2   . VAL B 1 59   ? -16.947 -27.091 -63.246 1.00 130.30 ? 59   VAL B CG2   1 
ATOM   2109  N  N     . LEU B 1 60   ? -21.285 -28.093 -64.500 1.00 141.45 ? 60   LEU B N     1 
ATOM   2110  C  CA    . LEU B 1 60   ? -22.717 -27.801 -64.512 1.00 142.21 ? 60   LEU B CA    1 
ATOM   2111  C  C     . LEU B 1 60   ? -23.237 -27.684 -63.080 1.00 142.64 ? 60   LEU B C     1 
ATOM   2112  O  O     . LEU B 1 60   ? -24.316 -27.140 -62.841 1.00 135.32 ? 60   LEU B O     1 
ATOM   2113  C  CB    . LEU B 1 60   ? -23.497 -28.873 -65.281 1.00 138.50 ? 60   LEU B CB    1 
ATOM   2114  C  CG    . LEU B 1 60   ? -23.457 -28.798 -66.812 1.00 142.68 ? 60   LEU B CG    1 
ATOM   2115  C  CD1   . LEU B 1 60   ? -22.139 -29.325 -67.375 1.00 134.71 ? 60   LEU B CD1   1 
ATOM   2116  C  CD2   . LEU B 1 60   ? -24.643 -29.532 -67.429 1.00 136.80 ? 60   LEU B CD2   1 
ATOM   2117  N  N     . HIS B 1 61   ? -22.459 -28.209 -62.137 1.00 148.70 ? 61   HIS B N     1 
ATOM   2118  C  CA    . HIS B 1 61   ? -22.704 -28.010 -60.711 1.00 147.49 ? 61   HIS B CA    1 
ATOM   2119  C  C     . HIS B 1 61   ? -21.383 -28.115 -59.942 1.00 145.27 ? 61   HIS B C     1 
ATOM   2120  O  O     . HIS B 1 61   ? -20.390 -28.620 -60.466 1.00 147.37 ? 61   HIS B O     1 
ATOM   2121  C  CB    . HIS B 1 61   ? -23.736 -29.010 -60.180 1.00 148.39 ? 61   HIS B CB    1 
ATOM   2122  C  CG    . HIS B 1 61   ? -23.384 -30.442 -60.431 1.00 145.80 ? 61   HIS B CG    1 
ATOM   2123  N  ND1   . HIS B 1 61   ? -23.374 -30.996 -61.693 1.00 141.65 ? 61   HIS B ND1   1 
ATOM   2124  C  CD2   . HIS B 1 61   ? -23.047 -31.439 -59.579 1.00 142.81 ? 61   HIS B CD2   1 
ATOM   2125  C  CE1   . HIS B 1 61   ? -23.035 -32.270 -61.608 1.00 144.88 ? 61   HIS B CE1   1 
ATOM   2126  N  NE2   . HIS B 1 61   ? -22.833 -32.564 -60.337 1.00 145.02 ? 61   HIS B NE2   1 
ATOM   2127  N  N     . GLU B 1 62   ? -21.382 -27.643 -58.699 1.00 143.51 ? 62   GLU B N     1 
ATOM   2128  C  CA    . GLU B 1 62   ? -20.141 -27.371 -57.971 1.00 140.57 ? 62   GLU B CA    1 
ATOM   2129  C  C     . GLU B 1 62   ? -19.463 -28.575 -57.319 1.00 139.81 ? 62   GLU B C     1 
ATOM   2130  O  O     . GLU B 1 62   ? -18.234 -28.624 -57.238 1.00 129.05 ? 62   GLU B O     1 
ATOM   2131  C  CB    . GLU B 1 62   ? -20.404 -26.319 -56.891 1.00 145.32 ? 62   GLU B CB    1 
ATOM   2132  C  CG    . GLU B 1 62   ? -20.214 -24.887 -57.359 1.00 145.18 ? 62   GLU B CG    1 
ATOM   2133  C  CD    . GLU B 1 62   ? -21.109 -24.528 -58.528 1.00 154.44 ? 62   GLU B CD    1 
ATOM   2134  O  OE1   . GLU B 1 62   ? -20.626 -23.844 -59.454 1.00 159.91 ? 62   GLU B OE1   1 
ATOM   2135  O  OE2   . GLU B 1 62   ? -22.294 -24.925 -58.518 1.00 159.94 ? 62   GLU B OE2   1 
ATOM   2136  N  N     . PHE B 1 63   ? -20.253 -29.531 -56.842 1.00 143.52 ? 63   PHE B N     1 
ATOM   2137  C  CA    . PHE B 1 63   ? -19.713 -30.630 -56.046 1.00 142.88 ? 63   PHE B CA    1 
ATOM   2138  C  C     . PHE B 1 63   ? -18.715 -31.484 -56.824 1.00 141.31 ? 63   PHE B C     1 
ATOM   2139  O  O     . PHE B 1 63   ? -17.698 -31.913 -56.278 1.00 134.86 ? 63   PHE B O     1 
ATOM   2140  C  CB    . PHE B 1 63   ? -20.841 -31.511 -55.510 1.00 138.48 ? 63   PHE B CB    1 
ATOM   2141  C  CG    . PHE B 1 63   ? -20.469 -32.270 -54.270 1.00 134.69 ? 63   PHE B CG    1 
ATOM   2142  C  CD1   . PHE B 1 63   ? -20.373 -31.619 -53.051 1.00 132.16 ? 63   PHE B CD1   1 
ATOM   2143  C  CD2   . PHE B 1 63   ? -20.207 -33.628 -54.321 1.00 133.99 ? 63   PHE B CD2   1 
ATOM   2144  C  CE1   . PHE B 1 63   ? -20.027 -32.307 -51.905 1.00 122.42 ? 63   PHE B CE1   1 
ATOM   2145  C  CE2   . PHE B 1 63   ? -19.861 -34.322 -53.176 1.00 135.38 ? 63   PHE B CE2   1 
ATOM   2146  C  CZ    . PHE B 1 63   ? -19.771 -33.660 -51.967 1.00 124.24 ? 63   PHE B CZ    1 
ATOM   2147  N  N     . THR B 1 64   ? -19.003 -31.726 -58.098 1.00 144.71 ? 64   THR B N     1 
ATOM   2148  C  CA    . THR B 1 64   ? -18.098 -32.504 -58.935 1.00 141.46 ? 64   THR B CA    1 
ATOM   2149  C  C     . THR B 1 64   ? -16.852 -31.697 -59.280 1.00 137.84 ? 64   THR B C     1 
ATOM   2150  O  O     . THR B 1 64   ? -16.938 -30.505 -59.574 1.00 139.57 ? 64   THR B O     1 
ATOM   2151  C  CB    . THR B 1 64   ? -18.780 -32.971 -60.237 1.00 140.41 ? 64   THR B CB    1 
ATOM   2152  O  OG1   . THR B 1 64   ? -19.304 -31.839 -60.944 1.00 134.15 ? 64   THR B OG1   1 
ATOM   2153  C  CG2   . THR B 1 64   ? -19.907 -33.941 -59.928 1.00 142.20 ? 64   THR B CG2   1 
ATOM   2154  N  N     . THR B 1 65   ? -15.696 -32.352 -59.231 1.00 130.35 ? 65   THR B N     1 
ATOM   2155  C  CA    . THR B 1 65   ? -14.435 -31.711 -59.586 1.00 128.33 ? 65   THR B CA    1 
ATOM   2156  C  C     . THR B 1 65   ? -14.283 -31.617 -61.100 1.00 130.20 ? 65   THR B C     1 
ATOM   2157  O  O     . THR B 1 65   ? -14.791 -32.464 -61.835 1.00 132.01 ? 65   THR B O     1 
ATOM   2158  C  CB    . THR B 1 65   ? -13.224 -32.469 -59.012 1.00 110.06 ? 65   THR B CB    1 
ATOM   2159  O  OG1   . THR B 1 65   ? -13.070 -33.718 -59.697 1.00 103.71 ? 65   THR B OG1   1 
ATOM   2160  C  CG2   . THR B 1 65   ? -13.408 -32.722 -57.525 1.00 107.14 ? 65   THR B CG2   1 
ATOM   2161  N  N     . VAL B 1 66   ? -13.582 -30.584 -61.556 1.00 119.92 ? 66   VAL B N     1 
ATOM   2162  C  CA    . VAL B 1 66   ? -13.353 -30.372 -62.979 1.00 111.38 ? 66   VAL B CA    1 
ATOM   2163  C  C     . VAL B 1 66   ? -12.544 -31.518 -63.577 1.00 110.61 ? 66   VAL B C     1 
ATOM   2164  O  O     . VAL B 1 66   ? -11.489 -31.873 -63.049 1.00 111.75 ? 66   VAL B O     1 
ATOM   2165  C  CB    . VAL B 1 66   ? -12.624 -29.043 -63.233 1.00 113.79 ? 66   VAL B CB    1 
ATOM   2166  C  CG1   . VAL B 1 66   ? -12.431 -28.812 -64.726 1.00 114.07 ? 66   VAL B CG1   1 
ATOM   2167  C  CG2   . VAL B 1 66   ? -13.393 -27.893 -62.602 1.00 112.66 ? 66   VAL B CG2   1 
ATOM   2168  N  N     . PRO B 1 67   ? -13.048 -32.108 -64.674 1.00 113.16 ? 67   PRO B N     1 
ATOM   2169  C  CA    . PRO B 1 67   ? -12.428 -33.246 -65.363 1.00 115.23 ? 67   PRO B CA    1 
ATOM   2170  C  C     . PRO B 1 67   ? -10.946 -33.043 -65.669 1.00 114.87 ? 67   PRO B C     1 
ATOM   2171  O  O     . PRO B 1 67   ? -10.586 -32.168 -66.456 1.00 115.41 ? 67   PRO B O     1 
ATOM   2172  C  CB    . PRO B 1 67   ? -13.238 -33.344 -66.658 1.00 110.92 ? 67   PRO B CB    1 
ATOM   2173  C  CG    . PRO B 1 67   ? -14.578 -32.833 -66.284 1.00 111.93 ? 67   PRO B CG    1 
ATOM   2174  C  CD    . PRO B 1 67   ? -14.330 -31.728 -65.297 1.00 115.63 ? 67   PRO B CD    1 
ATOM   2175  N  N     . GLY B 1 68   ? -10.101 -33.853 -65.038 1.00 115.08 ? 68   GLY B N     1 
ATOM   2176  C  CA    . GLY B 1 68   ? -8.672  -33.817 -65.287 1.00 110.82 ? 68   GLY B CA    1 
ATOM   2177  C  C     . GLY B 1 68   ? -7.895  -32.943 -64.321 1.00 109.75 ? 68   GLY B C     1 
ATOM   2178  O  O     . GLY B 1 68   ? -6.701  -32.714 -64.505 1.00 109.33 ? 68   GLY B O     1 
ATOM   2179  N  N     . VAL B 1 69   ? -8.567  -32.453 -63.287 1.00 106.23 ? 69   VAL B N     1 
ATOM   2180  C  CA    . VAL B 1 69   ? -7.925  -31.569 -62.324 1.00 97.26  ? 69   VAL B CA    1 
ATOM   2181  C  C     . VAL B 1 69   ? -7.849  -32.214 -60.948 1.00 93.95  ? 69   VAL B C     1 
ATOM   2182  O  O     . VAL B 1 69   ? -8.801  -32.848 -60.498 1.00 98.14  ? 69   VAL B O     1 
ATOM   2183  C  CB    . VAL B 1 69   ? -8.669  -30.230 -62.209 1.00 97.49  ? 69   VAL B CB    1 
ATOM   2184  C  CG1   . VAL B 1 69   ? -7.786  -29.197 -61.531 1.00 98.65  ? 69   VAL B CG1   1 
ATOM   2185  C  CG2   . VAL B 1 69   ? -9.090  -29.743 -63.581 1.00 95.01  ? 69   VAL B CG2   1 
ATOM   2186  N  N     . LYS B 1 70   ? -6.712  -32.049 -60.282 1.00 87.48  ? 70   LYS B N     1 
ATOM   2187  C  CA    . LYS B 1 70   ? -6.539  -32.605 -58.948 1.00 95.43  ? 70   LYS B CA    1 
ATOM   2188  C  C     . LYS B 1 70   ? -7.435  -31.903 -57.931 1.00 97.05  ? 70   LYS B C     1 
ATOM   2189  O  O     . LYS B 1 70   ? -8.176  -32.550 -57.192 1.00 95.78  ? 70   LYS B O     1 
ATOM   2190  C  CB    . LYS B 1 70   ? -5.078  -32.507 -58.505 1.00 98.82  ? 70   LYS B CB    1 
ATOM   2191  C  CG    . LYS B 1 70   ? -4.833  -33.026 -57.093 1.00 100.13 ? 70   LYS B CG    1 
ATOM   2192  C  CD    . LYS B 1 70   ? -3.414  -32.742 -56.625 1.00 97.00  ? 70   LYS B CD    1 
ATOM   2193  C  CE    . LYS B 1 70   ? -3.190  -33.256 -55.211 1.00 87.70  ? 70   LYS B CE    1 
ATOM   2194  N  NZ    . LYS B 1 70   ? -1.829  -32.927 -54.708 1.00 94.05  ? 70   LYS B NZ    1 
ATOM   2195  N  N     . GLU B 1 71   ? -7.368  -30.576 -57.905 1.00 89.38  ? 71   GLU B N     1 
ATOM   2196  C  CA    . GLU B 1 71   ? -8.066  -29.794 -56.889 1.00 88.38  ? 71   GLU B CA    1 
ATOM   2197  C  C     . GLU B 1 71   ? -9.577  -29.798 -57.088 1.00 89.89  ? 71   GLU B C     1 
ATOM   2198  O  O     . GLU B 1 71   ? -10.066 -29.914 -58.211 1.00 89.49  ? 71   GLU B O     1 
ATOM   2199  C  CB    . GLU B 1 71   ? -7.553  -28.350 -56.882 1.00 85.35  ? 71   GLU B CB    1 
ATOM   2200  C  CG    . GLU B 1 71   ? -6.083  -28.202 -56.521 1.00 82.00  ? 71   GLU B CG    1 
ATOM   2201  C  CD    . GLU B 1 71   ? -5.163  -28.565 -57.667 1.00 80.24  ? 71   GLU B CD    1 
ATOM   2202  O  OE1   . GLU B 1 71   ? -5.673  -28.850 -58.772 1.00 74.85  ? 71   GLU B OE1   1 
ATOM   2203  O  OE2   . GLU B 1 71   ? -3.932  -28.566 -57.465 1.00 85.96  ? 71   GLU B OE2   1 
ATOM   2204  N  N     . ASP B 1 72   ? -10.311 -29.672 -55.987 1.00 89.20  ? 72   ASP B N     1 
ATOM   2205  C  CA    . ASP B 1 72   ? -11.762 -29.554 -56.049 1.00 87.33  ? 72   ASP B CA    1 
ATOM   2206  C  C     . ASP B 1 72   ? -12.118 -28.170 -56.570 1.00 79.87  ? 72   ASP B C     1 
ATOM   2207  O  O     . ASP B 1 72   ? -11.257 -27.298 -56.650 1.00 79.57  ? 72   ASP B O     1 
ATOM   2208  C  CB    . ASP B 1 72   ? -12.392 -29.795 -54.672 1.00 84.16  ? 72   ASP B CB    1 
ATOM   2209  C  CG    . ASP B 1 72   ? -13.877 -30.110 -54.754 1.00 81.83  ? 72   ASP B CG    1 
ATOM   2210  O  OD1   . ASP B 1 72   ? -14.536 -29.664 -55.716 1.00 83.55  ? 72   ASP B OD1   1 
ATOM   2211  O  OD2   . ASP B 1 72   ? -14.386 -30.806 -53.853 1.00 76.95  ? 72   ASP B OD2   1 
ATOM   2212  N  N     . VAL B 1 73   ? -13.382 -27.973 -56.928 1.00 83.73  ? 73   VAL B N     1 
ATOM   2213  C  CA    . VAL B 1 73   ? -13.849 -26.673 -57.392 1.00 83.12  ? 73   VAL B CA    1 
ATOM   2214  C  C     . VAL B 1 73   ? -13.565 -25.620 -56.332 1.00 75.27  ? 73   VAL B C     1 
ATOM   2215  O  O     . VAL B 1 73   ? -13.200 -24.485 -56.637 1.00 72.08  ? 73   VAL B O     1 
ATOM   2216  C  CB    . VAL B 1 73   ? -15.356 -26.695 -57.717 1.00 88.36  ? 73   VAL B CB    1 
ATOM   2217  C  CG1   . VAL B 1 73   ? -15.860 -25.297 -58.039 1.00 92.61  ? 73   VAL B CG1   1 
ATOM   2218  C  CG2   . VAL B 1 73   ? -15.629 -27.638 -58.874 1.00 94.15  ? 73   VAL B CG2   1 
ATOM   2219  N  N     . THR B 1 74   ? -13.708 -26.028 -55.079 1.00 74.73  ? 74   THR B N     1 
ATOM   2220  C  CA    . THR B 1 74   ? -13.483 -25.149 -53.945 1.00 72.34  ? 74   THR B CA    1 
ATOM   2221  C  C     . THR B 1 74   ? -12.066 -24.583 -53.915 1.00 70.09  ? 74   THR B C     1 
ATOM   2222  O  O     . THR B 1 74   ? -11.879 -23.374 -54.030 1.00 69.51  ? 74   THR B O     1 
ATOM   2223  C  CB    . THR B 1 74   ? -13.757 -25.885 -52.626 1.00 78.03  ? 74   THR B CB    1 
ATOM   2224  O  OG1   . THR B 1 74   ? -12.913 -27.040 -52.542 1.00 80.63  ? 74   THR B OG1   1 
ATOM   2225  C  CG2   . THR B 1 74   ? -15.207 -26.331 -52.568 1.00 70.88  ? 74   THR B CG2   1 
ATOM   2226  N  N     . GLU B 1 75   ? -11.072 -25.455 -53.776 1.00 69.34  ? 75   GLU B N     1 
ATOM   2227  C  CA    . GLU B 1 75   ? -9.691  -25.016 -53.576 1.00 67.50  ? 75   GLU B CA    1 
ATOM   2228  C  C     . GLU B 1 75   ? -9.176  -24.130 -54.702 1.00 69.93  ? 75   GLU B C     1 
ATOM   2229  O  O     . GLU B 1 75   ? -8.283  -23.308 -54.495 1.00 67.77  ? 75   GLU B O     1 
ATOM   2230  C  CB    . GLU B 1 75   ? -8.771  -26.222 -53.411 1.00 65.71  ? 75   GLU B CB    1 
ATOM   2231  C  CG    . GLU B 1 75   ? -8.953  -26.924 -52.085 1.00 72.78  ? 75   GLU B CG    1 
ATOM   2232  C  CD    . GLU B 1 75   ? -8.133  -28.185 -51.978 1.00 78.89  ? 75   GLU B CD    1 
ATOM   2233  O  OE1   . GLU B 1 75   ? -7.630  -28.655 -53.019 1.00 84.96  ? 75   GLU B OE1   1 
ATOM   2234  O  OE2   . GLU B 1 75   ? -7.994  -28.705 -50.852 1.00 77.59  ? 75   GLU B OE2   1 
ATOM   2235  N  N     . ILE B 1 76   ? -9.750  -24.295 -55.888 1.00 76.56  ? 76   ILE B N     1 
ATOM   2236  C  CA    . ILE B 1 76   ? -9.366  -23.497 -57.043 1.00 73.14  ? 76   ILE B CA    1 
ATOM   2237  C  C     . ILE B 1 76   ? -9.807  -22.051 -56.868 1.00 65.44  ? 76   ILE B C     1 
ATOM   2238  O  O     . ILE B 1 76   ? -9.045  -21.121 -57.137 1.00 61.96  ? 76   ILE B O     1 
ATOM   2239  C  CB    . ILE B 1 76   ? -9.968  -24.060 -58.332 1.00 68.34  ? 76   ILE B CB    1 
ATOM   2240  C  CG1   . ILE B 1 76   ? -9.515  -25.506 -58.530 1.00 71.44  ? 76   ILE B CG1   1 
ATOM   2241  C  CG2   . ILE B 1 76   ? -9.553  -23.215 -59.516 1.00 74.46  ? 76   ILE B CG2   1 
ATOM   2242  C  CD1   . ILE B 1 76   ? -10.207 -26.211 -59.665 1.00 67.75  ? 76   ILE B CD1   1 
ATOM   2243  N  N     . ILE B 1 77   ? -11.044 -21.875 -56.419 1.00 65.83  ? 77   ILE B N     1 
ATOM   2244  C  CA    . ILE B 1 77   ? -11.566 -20.554 -56.101 1.00 65.75  ? 77   ILE B CA    1 
ATOM   2245  C  C     . ILE B 1 77   ? -10.639 -19.840 -55.127 1.00 64.63  ? 77   ILE B C     1 
ATOM   2246  O  O     . ILE B 1 77   ? -10.300 -18.672 -55.314 1.00 62.66  ? 77   ILE B O     1 
ATOM   2247  C  CB    . ILE B 1 77   ? -12.977 -20.641 -55.490 1.00 64.71  ? 77   ILE B CB    1 
ATOM   2248  C  CG1   . ILE B 1 77   ? -13.926 -21.360 -56.450 1.00 70.39  ? 77   ILE B CG1   1 
ATOM   2249  C  CG2   . ILE B 1 77   ? -13.500 -19.255 -55.147 1.00 58.23  ? 77   ILE B CG2   1 
ATOM   2250  C  CD1   . ILE B 1 77   ? -15.232 -21.782 -55.819 1.00 72.88  ? 77   ILE B CD1   1 
ATOM   2251  N  N     . LEU B 1 78   ? -10.216 -20.566 -54.098 1.00 69.18  ? 78   LEU B N     1 
ATOM   2252  C  CA    . LEU B 1 78   ? -9.382  -20.002 -53.044 1.00 66.73  ? 78   LEU B CA    1 
ATOM   2253  C  C     . LEU B 1 78   ? -8.042  -19.543 -53.598 1.00 64.04  ? 78   LEU B C     1 
ATOM   2254  O  O     . LEU B 1 78   ? -7.583  -18.438 -53.307 1.00 63.09  ? 78   LEU B O     1 
ATOM   2255  C  CB    . LEU B 1 78   ? -9.169  -21.021 -51.923 1.00 61.10  ? 78   LEU B CB    1 
ATOM   2256  C  CG    . LEU B 1 78   ? -10.253 -21.110 -50.843 1.00 55.57  ? 78   LEU B CG    1 
ATOM   2257  C  CD1   . LEU B 1 78   ? -11.637 -21.329 -51.437 1.00 61.27  ? 78   LEU B CD1   1 
ATOM   2258  C  CD2   . LEU B 1 78   ? -9.920  -22.216 -49.858 1.00 54.10  ? 78   LEU B CD2   1 
ATOM   2259  N  N     . ASN B 1 79   ? -7.423  -20.399 -54.402 1.00 59.65  ? 79   ASN B N     1 
ATOM   2260  C  CA    . ASN B 1 79   ? -6.176  -20.054 -55.064 1.00 59.76  ? 79   ASN B CA    1 
ATOM   2261  C  C     . ASN B 1 79   ? -6.343  -18.819 -55.938 1.00 56.41  ? 79   ASN B C     1 
ATOM   2262  O  O     . ASN B 1 79   ? -5.437  -17.993 -56.047 1.00 54.63  ? 79   ASN B O     1 
ATOM   2263  C  CB    . ASN B 1 79   ? -5.675  -21.232 -55.900 1.00 67.98  ? 79   ASN B CB    1 
ATOM   2264  C  CG    . ASN B 1 79   ? -5.159  -22.376 -55.045 1.00 68.46  ? 79   ASN B CG    1 
ATOM   2265  O  OD1   . ASN B 1 79   ? -4.003  -22.374 -54.623 1.00 72.71  ? 79   ASN B OD1   1 
ATOM   2266  N  ND2   . ASN B 1 79   ? -6.013  -23.359 -54.786 1.00 66.70  ? 79   ASN B ND2   1 
ATOM   2267  N  N     . LEU B 1 80   ? -7.517  -18.689 -56.545 1.00 54.62  ? 80   LEU B N     1 
ATOM   2268  C  CA    . LEU B 1 80   ? -7.795  -17.564 -57.422 1.00 51.01  ? 80   LEU B CA    1 
ATOM   2269  C  C     . LEU B 1 80   ? -8.079  -16.285 -56.650 1.00 53.31  ? 80   LEU B C     1 
ATOM   2270  O  O     . LEU B 1 80   ? -7.818  -15.191 -57.146 1.00 57.45  ? 80   LEU B O     1 
ATOM   2271  C  CB    . LEU B 1 80   ? -8.969  -17.884 -58.338 1.00 52.61  ? 80   LEU B CB    1 
ATOM   2272  C  CG    . LEU B 1 80   ? -8.597  -18.769 -59.522 1.00 61.78  ? 80   LEU B CG    1 
ATOM   2273  C  CD1   . LEU B 1 80   ? -9.803  -18.985 -60.417 1.00 68.98  ? 80   LEU B CD1   1 
ATOM   2274  C  CD2   . LEU B 1 80   ? -7.445  -18.146 -60.299 1.00 63.03  ? 80   LEU B CD2   1 
ATOM   2275  N  N     . LYS B 1 81   ? -8.619  -16.419 -55.444 1.00 52.61  ? 81   LYS B N     1 
ATOM   2276  C  CA    . LYS B 1 81   ? -8.867  -15.255 -54.602 1.00 49.64  ? 81   LYS B CA    1 
ATOM   2277  C  C     . LYS B 1 81   ? -7.546  -14.572 -54.279 1.00 52.96  ? 81   LYS B C     1 
ATOM   2278  O  O     . LYS B 1 81   ? -7.480  -13.351 -54.135 1.00 51.20  ? 81   LYS B O     1 
ATOM   2279  C  CB    . LYS B 1 81   ? -9.580  -15.648 -53.309 1.00 51.47  ? 81   LYS B CB    1 
ATOM   2280  C  CG    . LYS B 1 81   ? -11.016 -16.114 -53.473 1.00 54.29  ? 81   LYS B CG    1 
ATOM   2281  C  CD    . LYS B 1 81   ? -11.635 -16.389 -52.109 1.00 57.43  ? 81   LYS B CD    1 
ATOM   2282  C  CE    . LYS B 1 81   ? -13.010 -17.022 -52.224 1.00 64.15  ? 81   LYS B CE    1 
ATOM   2283  N  NZ    . LYS B 1 81   ? -13.605 -17.280 -50.882 1.00 57.68  ? 81   LYS B NZ    1 
ATOM   2284  N  N     . SER B 1 82   ? -6.496  -15.380 -54.183 1.00 61.47  ? 82   SER B N     1 
ATOM   2285  C  CA    . SER B 1 82   ? -5.177  -14.914 -53.777 1.00 71.48  ? 82   SER B CA    1 
ATOM   2286  C  C     . SER B 1 82   ? -4.403  -14.262 -54.929 1.00 74.99  ? 82   SER B C     1 
ATOM   2287  O  O     . SER B 1 82   ? -3.269  -13.814 -54.750 1.00 78.14  ? 82   SER B O     1 
ATOM   2288  C  CB    . SER B 1 82   ? -4.376  -16.084 -53.196 1.00 69.56  ? 82   SER B CB    1 
ATOM   2289  O  OG    . SER B 1 82   ? -3.292  -15.635 -52.402 1.00 69.76  ? 82   SER B OG    1 
ATOM   2290  N  N     . LEU B 1 83   ? -5.019  -14.207 -56.106 1.00 69.58  ? 83   LEU B N     1 
ATOM   2291  C  CA    . LEU B 1 83   ? -4.383  -13.603 -57.274 1.00 62.96  ? 83   LEU B CA    1 
ATOM   2292  C  C     . LEU B 1 83   ? -4.391  -12.082 -57.187 1.00 57.89  ? 83   LEU B C     1 
ATOM   2293  O  O     . LEU B 1 83   ? -5.435  -11.472 -56.970 1.00 55.51  ? 83   LEU B O     1 
ATOM   2294  C  CB    . LEU B 1 83   ? -5.082  -14.052 -58.556 1.00 65.01  ? 83   LEU B CB    1 
ATOM   2295  C  CG    . LEU B 1 83   ? -4.573  -13.393 -59.839 1.00 70.38  ? 83   LEU B CG    1 
ATOM   2296  C  CD1   . LEU B 1 83   ? -3.123  -13.773 -60.097 1.00 74.71  ? 83   LEU B CD1   1 
ATOM   2297  C  CD2   . LEU B 1 83   ? -5.452  -13.755 -61.028 1.00 73.44  ? 83   LEU B CD2   1 
ATOM   2298  N  N     . VAL B 1 84   ? -3.224  -11.472 -57.363 1.00 59.49  ? 84   VAL B N     1 
ATOM   2299  C  CA    . VAL B 1 84   ? -3.110  -10.020 -57.301 1.00 64.74  ? 84   VAL B CA    1 
ATOM   2300  C  C     . VAL B 1 84   ? -3.129  -9.402  -58.697 1.00 66.01  ? 84   VAL B C     1 
ATOM   2301  O  O     . VAL B 1 84   ? -2.355  -9.792  -59.571 1.00 71.41  ? 84   VAL B O     1 
ATOM   2302  C  CB    . VAL B 1 84   ? -1.829  -9.593  -56.557 1.00 72.24  ? 84   VAL B CB    1 
ATOM   2303  C  CG1   . VAL B 1 84   ? -2.035  -9.690  -55.059 1.00 77.56  ? 84   VAL B CG1   1 
ATOM   2304  C  CG2   . VAL B 1 84   ? -0.655  -10.452 -56.981 1.00 70.20  ? 84   VAL B CG2   1 
ATOM   2305  N  N     . VAL B 1 85   ? -4.027  -8.441  -58.901 1.00 64.17  ? 85   VAL B N     1 
ATOM   2306  C  CA    . VAL B 1 85   ? -4.254  -7.857  -60.222 1.00 70.43  ? 85   VAL B CA    1 
ATOM   2307  C  C     . VAL B 1 85   ? -4.514  -6.349  -60.140 1.00 72.43  ? 85   VAL B C     1 
ATOM   2308  O  O     . VAL B 1 85   ? -5.171  -5.876  -59.214 1.00 74.57  ? 85   VAL B O     1 
ATOM   2309  C  CB    . VAL B 1 85   ? -5.447  -8.554  -60.936 1.00 77.92  ? 85   VAL B CB    1 
ATOM   2310  C  CG1   . VAL B 1 85   ? -5.880  -7.789  -62.179 1.00 89.75  ? 85   VAL B CG1   1 
ATOM   2311  C  CG2   . VAL B 1 85   ? -5.095  -9.990  -61.300 1.00 76.03  ? 85   VAL B CG2   1 
ATOM   2312  N  N     . SER B 1 86   ? -3.983  -5.600  -61.105 1.00 76.94  ? 86   SER B N     1 
ATOM   2313  C  CA    . SER B 1 86   ? -4.250  -4.167  -61.211 1.00 74.88  ? 86   SER B CA    1 
ATOM   2314  C  C     . SER B 1 86   ? -4.790  -3.790  -62.591 1.00 82.30  ? 86   SER B C     1 
ATOM   2315  O  O     . SER B 1 86   ? -4.070  -3.857  -63.587 1.00 83.18  ? 86   SER B O     1 
ATOM   2316  C  CB    . SER B 1 86   ? -2.984  -3.366  -60.914 1.00 72.85  ? 86   SER B CB    1 
ATOM   2317  O  OG    . SER B 1 86   ? -2.582  -3.545  -59.570 1.00 80.72  ? 86   SER B OG    1 
ATOM   2318  N  N     . SER B 1 87   ? -6.058  -3.391  -62.642 1.00 94.32  ? 87   SER B N     1 
ATOM   2319  C  CA    . SER B 1 87   ? -6.687  -2.984  -63.897 1.00 95.93  ? 87   SER B CA    1 
ATOM   2320  C  C     . SER B 1 87   ? -6.615  -1.474  -64.070 1.00 96.28  ? 87   SER B C     1 
ATOM   2321  O  O     . SER B 1 87   ? -6.713  -0.724  -63.099 1.00 97.96  ? 87   SER B O     1 
ATOM   2322  C  CB    . SER B 1 87   ? -8.145  -3.453  -63.952 1.00 89.72  ? 87   SER B CB    1 
ATOM   2323  O  OG    . SER B 1 87   ? -8.783  -3.022  -65.144 1.00 78.84  ? 87   SER B OG    1 
ATOM   2324  N  N     . GLU B 1 88   ? -6.447  -1.026  -65.307 1.00 94.61  ? 88   GLU B N     1 
ATOM   2325  C  CA    . GLU B 1 88   ? -6.297  0.398   -65.562 1.00 95.06  ? 88   GLU B CA    1 
ATOM   2326  C  C     . GLU B 1 88   ? -7.650  1.089   -65.701 1.00 95.21  ? 88   GLU B C     1 
ATOM   2327  O  O     . GLU B 1 88   ? -7.790  2.265   -65.362 1.00 89.86  ? 88   GLU B O     1 
ATOM   2328  C  CB    . GLU B 1 88   ? -5.459  0.632   -66.814 1.00 93.89  ? 88   GLU B CB    1 
ATOM   2329  C  CG    . GLU B 1 88   ? -4.970  2.055   -66.954 1.00 97.63  ? 88   GLU B CG    1 
ATOM   2330  C  CD    . GLU B 1 88   ? -3.636  2.139   -67.660 1.00 106.51 ? 88   GLU B CD    1 
ATOM   2331  O  OE1   . GLU B 1 88   ? -3.205  1.119   -68.237 1.00 101.99 ? 88   GLU B OE1   1 
ATOM   2332  O  OE2   . GLU B 1 88   ? -3.015  3.221   -67.629 1.00 112.46 ? 88   GLU B OE2   1 
ATOM   2333  N  N     . GLU B 1 89   ? -8.644  0.355   -66.192 1.00 102.51 ? 89   GLU B N     1 
ATOM   2334  C  CA    . GLU B 1 89   ? -9.981  0.909   -66.370 1.00 104.18 ? 89   GLU B CA    1 
ATOM   2335  C  C     . GLU B 1 89   ? -10.973 0.359   -65.349 1.00 104.62 ? 89   GLU B C     1 
ATOM   2336  O  O     . GLU B 1 89   ? -11.023 -0.849  -65.100 1.00 103.07 ? 89   GLU B O     1 
ATOM   2337  C  CB    . GLU B 1 89   ? -10.490 0.639   -67.787 1.00 108.41 ? 89   GLU B CB    1 
ATOM   2338  C  CG    . GLU B 1 89   ? -9.951  1.602   -68.840 1.00 108.71 ? 89   GLU B CG    1 
ATOM   2339  C  CD    . GLU B 1 89   ? -10.496 3.014   -68.685 1.00 108.70 ? 89   GLU B CD    1 
ATOM   2340  O  OE1   . GLU B 1 89   ? -11.458 3.207   -67.911 1.00 104.93 ? 89   GLU B OE1   1 
ATOM   2341  O  OE2   . GLU B 1 89   ? -9.962  3.934   -69.340 1.00 109.66 ? 89   GLU B OE2   1 
ATOM   2342  N  N     . ASP B 1 90   ? -11.761 1.266   -64.774 1.00 106.83 ? 90   ASP B N     1 
ATOM   2343  C  CA    . ASP B 1 90   ? -12.764 0.929   -63.767 1.00 109.13 ? 90   ASP B CA    1 
ATOM   2344  C  C     . ASP B 1 90   ? -13.730 -0.113  -64.299 1.00 102.55 ? 90   ASP B C     1 
ATOM   2345  O  O     . ASP B 1 90   ? -14.124 -1.038  -63.589 1.00 103.03 ? 90   ASP B O     1 
ATOM   2346  C  CB    . ASP B 1 90   ? -13.538 2.179   -63.341 1.00 113.65 ? 90   ASP B CB    1 
ATOM   2347  C  CG    . ASP B 1 90   ? -14.344 1.971   -62.065 1.00 116.53 ? 90   ASP B CG    1 
ATOM   2348  O  OD1   . ASP B 1 90   ? -15.060 0.952   -61.949 1.00 103.03 ? 90   ASP B OD1   1 
ATOM   2349  O  OD2   . ASP B 1 90   ? -14.254 2.837   -61.168 1.00 123.11 ? 90   ASP B OD2   1 
ATOM   2350  N  N     . GLU B 1 91   ? -14.106 0.052   -65.559 1.00 97.52  ? 91   GLU B N     1 
ATOM   2351  C  CA    . GLU B 1 91   ? -15.074 -0.822  -66.192 1.00 101.71 ? 91   GLU B CA    1 
ATOM   2352  C  C     . GLU B 1 91   ? -14.539 -2.255  -66.257 1.00 97.60  ? 91   GLU B C     1 
ATOM   2353  O  O     . GLU B 1 91   ? -13.341 -2.467  -66.469 1.00 88.67  ? 91   GLU B O     1 
ATOM   2354  C  CB    . GLU B 1 91   ? -15.428 -0.280  -67.579 1.00 101.89 ? 91   GLU B CB    1 
ATOM   2355  C  CG    . GLU B 1 91   ? -16.521 0.805   -67.567 1.00 101.49 ? 91   GLU B CG    1 
ATOM   2356  C  CD    . GLU B 1 91   ? -16.226 1.959   -66.613 1.00 97.57  ? 91   GLU B CD    1 
ATOM   2357  O  OE1   . GLU B 1 91   ? -15.056 2.391   -66.533 1.00 95.15  ? 91   GLU B OE1   1 
ATOM   2358  O  OE2   . GLU B 1 91   ? -17.168 2.434   -65.941 1.00 90.75  ? 91   GLU B OE2   1 
ATOM   2359  N  N     . PRO B 1 92   ? -15.429 -3.242  -66.046 1.00 98.51  ? 92   PRO B N     1 
ATOM   2360  C  CA    . PRO B 1 92   ? -15.049 -4.657  -65.931 1.00 96.65  ? 92   PRO B CA    1 
ATOM   2361  C  C     . PRO B 1 92   ? -14.431 -5.219  -67.209 1.00 103.76 ? 92   PRO B C     1 
ATOM   2362  O  O     . PRO B 1 92   ? -15.003 -5.074  -68.288 1.00 111.02 ? 92   PRO B O     1 
ATOM   2363  C  CB    . PRO B 1 92   ? -16.380 -5.358  -65.615 1.00 91.30  ? 92   PRO B CB    1 
ATOM   2364  C  CG    . PRO B 1 92   ? -17.435 -4.414  -66.070 1.00 87.18  ? 92   PRO B CG    1 
ATOM   2365  C  CD    . PRO B 1 92   ? -16.882 -3.045  -65.896 1.00 96.32  ? 92   PRO B CD    1 
ATOM   2366  N  N     . VAL B 1 93   ? -13.262 -5.840  -67.088 1.00 110.87 ? 93   VAL B N     1 
ATOM   2367  C  CA    . VAL B 1 93   ? -12.619 -6.474  -68.232 1.00 109.24 ? 93   VAL B CA    1 
ATOM   2368  C  C     . VAL B 1 93   ? -12.728 -7.990  -68.081 1.00 103.04 ? 93   VAL B C     1 
ATOM   2369  O  O     . VAL B 1 93   ? -13.344 -8.478  -67.134 1.00 101.11 ? 93   VAL B O     1 
ATOM   2370  C  CB    . VAL B 1 93   ? -11.134 -6.044  -68.374 1.00 111.38 ? 93   VAL B CB    1 
ATOM   2371  C  CG1   . VAL B 1 93   ? -11.017 -4.519  -68.393 1.00 102.84 ? 93   VAL B CG1   1 
ATOM   2372  C  CG2   . VAL B 1 93   ? -10.280 -6.637  -67.260 1.00 112.83 ? 93   VAL B CG2   1 
ATOM   2373  N  N     . THR B 1 94   ? -12.153 -8.733  -69.021 1.00 100.87 ? 94   THR B N     1 
ATOM   2374  C  CA    . THR B 1 94   ? -12.173 -10.190 -68.948 1.00 100.55 ? 94   THR B CA    1 
ATOM   2375  C  C     . THR B 1 94   ? -10.873 -10.786 -69.469 1.00 96.82  ? 94   THR B C     1 
ATOM   2376  O  O     . THR B 1 94   ? -10.404 -10.443 -70.553 1.00 91.10  ? 94   THR B O     1 
ATOM   2377  C  CB    . THR B 1 94   ? -13.357 -10.791 -69.740 1.00 103.80 ? 94   THR B CB    1 
ATOM   2378  O  OG1   . THR B 1 94   ? -14.593 -10.369 -69.151 1.00 101.66 ? 94   THR B OG1   1 
ATOM   2379  C  CG2   . THR B 1 94   ? -13.296 -12.315 -69.728 1.00 97.03  ? 94   THR B CG2   1 
ATOM   2380  N  N     . MET B 1 95   ? -10.293 -11.678 -68.680 1.00 98.60  ? 95   MET B N     1 
ATOM   2381  C  CA    . MET B 1 95   ? -9.075  -12.365 -69.071 1.00 99.65  ? 95   MET B CA    1 
ATOM   2382  C  C     . MET B 1 95   ? -9.340  -13.858 -69.182 1.00 106.31 ? 95   MET B C     1 
ATOM   2383  O  O     . MET B 1 95   ? -10.205 -14.398 -68.490 1.00 107.00 ? 95   MET B O     1 
ATOM   2384  C  CB    . MET B 1 95   ? -7.967  -12.098 -68.063 1.00 97.02  ? 95   MET B CB    1 
ATOM   2385  C  CG    . MET B 1 95   ? -8.343  -12.499 -66.655 1.00 97.04  ? 95   MET B CG    1 
ATOM   2386  S  SD    . MET B 1 95   ? -7.077  -12.076 -65.458 1.00 109.10 ? 95   MET B SD    1 
ATOM   2387  C  CE    . MET B 1 95   ? -7.031  -10.299 -65.651 1.00 97.02  ? 95   MET B CE    1 
ATOM   2388  N  N     . TYR B 1 96   ? -8.596  -14.524 -70.056 1.00 105.69 ? 96   TYR B N     1 
ATOM   2389  C  CA    . TYR B 1 96   ? -8.788  -15.951 -70.265 1.00 103.84 ? 96   TYR B CA    1 
ATOM   2390  C  C     . TYR B 1 96   ? -7.568  -16.753 -69.839 1.00 96.53  ? 96   TYR B C     1 
ATOM   2391  O  O     . TYR B 1 96   ? -6.429  -16.338 -70.052 1.00 90.60  ? 96   TYR B O     1 
ATOM   2392  C  CB    . TYR B 1 96   ? -9.116  -16.238 -71.733 1.00 105.55 ? 96   TYR B CB    1 
ATOM   2393  C  CG    . TYR B 1 96   ? -10.507 -15.811 -72.147 1.00 100.81 ? 96   TYR B CG    1 
ATOM   2394  C  CD1   . TYR B 1 96   ? -11.618 -16.571 -71.801 1.00 95.54  ? 96   TYR B CD1   1 
ATOM   2395  C  CD2   . TYR B 1 96   ? -10.708 -14.653 -72.887 1.00 102.22 ? 96   TYR B CD2   1 
ATOM   2396  C  CE1   . TYR B 1 96   ? -12.892 -16.187 -72.177 1.00 97.61  ? 96   TYR B CE1   1 
ATOM   2397  C  CE2   . TYR B 1 96   ? -11.979 -14.261 -73.269 1.00 105.36 ? 96   TYR B CE2   1 
ATOM   2398  C  CZ    . TYR B 1 96   ? -13.067 -15.031 -72.911 1.00 105.87 ? 96   TYR B CZ    1 
ATOM   2399  O  OH    . TYR B 1 96   ? -14.333 -14.643 -73.289 1.00 105.75 ? 96   TYR B OH    1 
ATOM   2400  N  N     . LEU B 1 97   ? -7.820  -17.905 -69.231 1.00 92.80  ? 97   LEU B N     1 
ATOM   2401  C  CA    . LEU B 1 97   ? -6.753  -18.829 -68.884 1.00 92.73  ? 97   LEU B CA    1 
ATOM   2402  C  C     . LEU B 1 97   ? -7.066  -20.231 -69.407 1.00 100.95 ? 97   LEU B C     1 
ATOM   2403  O  O     . LEU B 1 97   ? -7.982  -20.898 -68.922 1.00 97.85  ? 97   LEU B O     1 
ATOM   2404  C  CB    . LEU B 1 97   ? -6.534  -18.853 -67.372 1.00 81.87  ? 97   LEU B CB    1 
ATOM   2405  C  CG    . LEU B 1 97   ? -5.432  -19.790 -66.877 1.00 83.36  ? 97   LEU B CG    1 
ATOM   2406  C  CD1   . LEU B 1 97   ? -4.163  -19.579 -67.672 1.00 85.18  ? 97   LEU B CD1   1 
ATOM   2407  C  CD2   . LEU B 1 97   ? -5.171  -19.572 -65.400 1.00 93.82  ? 97   LEU B CD2   1 
ATOM   2408  N  N     . ARG B 1 98   ? -6.304  -20.664 -70.409 1.00 102.55 ? 98   ARG B N     1 
ATOM   2409  C  CA    . ARG B 1 98   ? -6.493  -21.977 -71.022 1.00 94.34  ? 98   ARG B CA    1 
ATOM   2410  C  C     . ARG B 1 98   ? -5.200  -22.783 -71.027 1.00 89.62  ? 98   ARG B C     1 
ATOM   2411  O  O     . ARG B 1 98   ? -4.132  -22.252 -71.336 1.00 79.44  ? 98   ARG B O     1 
ATOM   2412  C  CB    . ARG B 1 98   ? -7.003  -21.837 -72.456 1.00 94.14  ? 98   ARG B CB    1 
ATOM   2413  C  CG    . ARG B 1 98   ? -8.135  -20.848 -72.636 1.00 92.14  ? 98   ARG B CG    1 
ATOM   2414  C  CD    . ARG B 1 98   ? -8.534  -20.753 -74.097 1.00 91.37  ? 98   ARG B CD    1 
ATOM   2415  N  NE    . ARG B 1 98   ? -9.520  -19.702 -74.320 1.00 90.72  ? 98   ARG B NE    1 
ATOM   2416  C  CZ    . ARG B 1 98   ? -9.219  -18.459 -74.680 1.00 86.84  ? 98   ARG B CZ    1 
ATOM   2417  N  NH1   . ARG B 1 98   ? -7.954  -18.105 -74.866 1.00 73.26  ? 98   ARG B NH1   1 
ATOM   2418  N  NH2   . ARG B 1 98   ? -10.183 -17.567 -74.857 1.00 91.09  ? 98   ARG B NH2   1 
ATOM   2419  N  N     . LYS B 1 99   ? -5.308  -24.068 -70.703 1.00 93.03  ? 99   LYS B N     1 
ATOM   2420  C  CA    . LYS B 1 99   ? -4.150  -24.957 -70.684 1.00 97.21  ? 99   LYS B CA    1 
ATOM   2421  C  C     . LYS B 1 99   ? -4.587  -26.419 -70.585 1.00 93.48  ? 99   LYS B C     1 
ATOM   2422  O  O     . LYS B 1 99   ? -5.547  -26.741 -69.884 1.00 88.28  ? 99   LYS B O     1 
ATOM   2423  C  CB    . LYS B 1 99   ? -3.222  -24.598 -69.521 1.00 94.52  ? 99   LYS B CB    1 
ATOM   2424  C  CG    . LYS B 1 99   ? -1.747  -24.858 -69.776 1.00 78.62  ? 99   LYS B CG    1 
ATOM   2425  C  CD    . LYS B 1 99   ? -0.900  -24.250 -68.668 1.00 75.45  ? 99   LYS B CD    1 
ATOM   2426  C  CE    . LYS B 1 99   ? 0.568   -24.585 -68.836 1.00 82.67  ? 99   LYS B CE    1 
ATOM   2427  N  NZ    . LYS B 1 99   ? 0.791   -26.056 -68.860 1.00 99.63  ? 99   LYS B NZ    1 
ATOM   2428  N  N     . GLN B 1 100  ? -3.878  -27.297 -71.290 1.00 90.35  ? 100  GLN B N     1 
ATOM   2429  C  CA    . GLN B 1 100  ? -4.214  -28.717 -71.311 1.00 88.58  ? 100  GLN B CA    1 
ATOM   2430  C  C     . GLN B 1 100  ? -2.950  -29.573 -71.214 1.00 89.76  ? 100  GLN B C     1 
ATOM   2431  O  O     . GLN B 1 100  ? -1.835  -29.059 -71.307 1.00 88.52  ? 100  GLN B O     1 
ATOM   2432  C  CB    . GLN B 1 100  ? -5.001  -29.058 -72.583 1.00 95.11  ? 100  GLN B CB    1 
ATOM   2433  C  CG    . GLN B 1 100  ? -5.797  -30.358 -72.515 1.00 93.20  ? 100  GLN B CG    1 
ATOM   2434  C  CD    . GLN B 1 100  ? -6.645  -30.597 -73.746 1.00 97.13  ? 100  GLN B CD    1 
ATOM   2435  O  OE1   . GLN B 1 100  ? -7.019  -29.659 -74.450 1.00 105.46 ? 100  GLN B OE1   1 
ATOM   2436  N  NE2   . GLN B 1 100  ? -6.952  -31.861 -74.014 1.00 93.74  ? 100  GLN B NE2   1 
ATOM   2437  N  N     . GLY B 1 101  ? -3.130  -30.876 -71.019 1.00 97.50  ? 101  GLY B N     1 
ATOM   2438  C  CA    . GLY B 1 101  ? -2.017  -31.801 -70.913 1.00 103.52 ? 101  GLY B CA    1 
ATOM   2439  C  C     . GLY B 1 101  ? -1.564  -31.978 -69.478 1.00 102.32 ? 101  GLY B C     1 
ATOM   2440  O  O     . GLY B 1 101  ? -2.200  -31.467 -68.558 1.00 111.80 ? 101  GLY B O     1 
ATOM   2441  N  N     . PRO B 1 102  ? -0.464  -32.715 -69.277 1.00 94.14  ? 102  PRO B N     1 
ATOM   2442  C  CA    . PRO B 1 102  ? 0.106   -32.890 -67.940 1.00 96.69  ? 102  PRO B CA    1 
ATOM   2443  C  C     . PRO B 1 102  ? 0.884   -31.656 -67.498 1.00 96.50  ? 102  PRO B C     1 
ATOM   2444  O  O     . PRO B 1 102  ? 1.412   -30.930 -68.340 1.00 95.40  ? 102  PRO B O     1 
ATOM   2445  C  CB    . PRO B 1 102  ? 1.034   -34.091 -68.114 1.00 95.63  ? 102  PRO B CB    1 
ATOM   2446  C  CG    . PRO B 1 102  ? 1.458   -34.017 -69.537 1.00 90.35  ? 102  PRO B CG    1 
ATOM   2447  C  CD    . PRO B 1 102  ? 0.276   -33.477 -70.297 1.00 97.19  ? 102  PRO B CD    1 
ATOM   2448  N  N     . GLY B 1 103  ? 0.945   -31.421 -66.193 1.00 100.18 ? 103  GLY B N     1 
ATOM   2449  C  CA    . GLY B 1 103  ? 1.687   -30.291 -65.668 1.00 104.67 ? 103  GLY B CA    1 
ATOM   2450  C  C     . GLY B 1 103  ? 0.918   -29.482 -64.644 1.00 106.63 ? 103  GLY B C     1 
ATOM   2451  O  O     . GLY B 1 103  ? -0.044  -29.962 -64.043 1.00 107.30 ? 103  GLY B O     1 
ATOM   2452  N  N     . GLU B 1 104  ? 1.353   -28.242 -64.445 1.00 103.65 ? 104  GLU B N     1 
ATOM   2453  C  CA    . GLU B 1 104  ? 0.742   -27.360 -63.459 1.00 101.60 ? 104  GLU B CA    1 
ATOM   2454  C  C     . GLU B 1 104  ? 0.444   -25.989 -64.064 1.00 103.32 ? 104  GLU B C     1 
ATOM   2455  O  O     . GLU B 1 104  ? 1.275   -25.421 -64.776 1.00 101.05 ? 104  GLU B O     1 
ATOM   2456  C  CB    . GLU B 1 104  ? 1.652   -27.212 -62.238 1.00 91.78  ? 104  GLU B CB    1 
ATOM   2457  C  CG    . GLU B 1 104  ? 1.962   -28.516 -61.522 1.00 79.46  ? 104  GLU B CG    1 
ATOM   2458  C  CD    . GLU B 1 104  ? 2.905   -28.322 -60.356 1.00 80.36  ? 104  GLU B CD    1 
ATOM   2459  O  OE1   . GLU B 1 104  ? 3.363   -27.180 -60.145 1.00 80.17  ? 104  GLU B OE1   1 
ATOM   2460  O  OE2   . GLU B 1 104  ? 3.187   -29.310 -59.650 1.00 83.70  ? 104  GLU B OE2   1 
ATOM   2461  N  N     . VAL B 1 105  ? -0.744  -25.464 -63.779 1.00 102.83 ? 105  VAL B N     1 
ATOM   2462  C  CA    . VAL B 1 105  ? -1.152  -24.159 -64.288 1.00 95.32  ? 105  VAL B CA    1 
ATOM   2463  C  C     . VAL B 1 105  ? -0.893  -23.067 -63.261 1.00 98.03  ? 105  VAL B C     1 
ATOM   2464  O  O     . VAL B 1 105  ? -1.248  -23.208 -62.092 1.00 100.74 ? 105  VAL B O     1 
ATOM   2465  C  CB    . VAL B 1 105  ? -2.638  -24.138 -64.667 1.00 90.84  ? 105  VAL B CB    1 
ATOM   2466  C  CG1   . VAL B 1 105  ? -3.002  -22.801 -65.301 1.00 88.18  ? 105  VAL B CG1   1 
ATOM   2467  C  CG2   . VAL B 1 105  ? -2.958  -25.285 -65.606 1.00 96.89  ? 105  VAL B CG2   1 
ATOM   2468  N  N     . THR B 1 106  ? -0.279  -21.975 -63.703 1.00 99.92  ? 106  THR B N     1 
ATOM   2469  C  CA    . THR B 1 106  ? 0.077   -20.890 -62.800 1.00 94.81  ? 106  THR B CA    1 
ATOM   2470  C  C     . THR B 1 106  ? -0.591  -19.580 -63.193 1.00 89.18  ? 106  THR B C     1 
ATOM   2471  O  O     . THR B 1 106  ? -1.512  -19.557 -64.011 1.00 86.11  ? 106  THR B O     1 
ATOM   2472  C  CB    . THR B 1 106  ? 1.601   -20.677 -62.756 1.00 92.93  ? 106  THR B CB    1 
ATOM   2473  O  OG1   . THR B 1 106  ? 2.068   -20.285 -64.053 1.00 94.88  ? 106  THR B OG1   1 
ATOM   2474  C  CG2   . THR B 1 106  ? 2.305   -21.958 -62.334 1.00 92.71  ? 106  THR B CG2   1 
ATOM   2475  N  N     . ALA B 1 107  ? -0.114  -18.491 -62.600 1.00 88.59  ? 107  ALA B N     1 
ATOM   2476  C  CA    . ALA B 1 107  ? -0.635  -17.162 -62.890 1.00 92.86  ? 107  ALA B CA    1 
ATOM   2477  C  C     . ALA B 1 107  ? 0.135   -16.509 -64.032 1.00 95.40  ? 107  ALA B C     1 
ATOM   2478  O  O     . ALA B 1 107  ? -0.259  -15.458 -64.539 1.00 91.68  ? 107  ALA B O     1 
ATOM   2479  C  CB    . ALA B 1 107  ? -0.580  -16.292 -61.647 1.00 92.35  ? 107  ALA B CB    1 
ATOM   2480  N  N     . GLY B 1 108  ? 1.240   -17.133 -64.426 1.00 98.13  ? 108  GLY B N     1 
ATOM   2481  C  CA    . GLY B 1 108  ? 2.014   -16.665 -65.560 1.00 98.44  ? 108  GLY B CA    1 
ATOM   2482  C  C     . GLY B 1 108  ? 1.371   -17.110 -66.857 1.00 103.83 ? 108  GLY B C     1 
ATOM   2483  O  O     . GLY B 1 108  ? 1.587   -16.515 -67.913 1.00 105.90 ? 108  GLY B O     1 
ATOM   2484  N  N     . ASP B 1 109  ? 0.569   -18.166 -66.769 1.00 104.49 ? 109  ASP B N     1 
ATOM   2485  C  CA    . ASP B 1 109  ? -0.138  -18.694 -67.928 1.00 108.12 ? 109  ASP B CA    1 
ATOM   2486  C  C     . ASP B 1 109  ? -1.318  -17.799 -68.302 1.00 105.05 ? 109  ASP B C     1 
ATOM   2487  O  O     . ASP B 1 109  ? -1.879  -17.918 -69.391 1.00 108.10 ? 109  ASP B O     1 
ATOM   2488  C  CB    . ASP B 1 109  ? -0.620  -20.122 -67.654 1.00 106.48 ? 109  ASP B CB    1 
ATOM   2489  C  CG    . ASP B 1 109  ? 0.516   -21.066 -67.306 1.00 99.18  ? 109  ASP B CG    1 
ATOM   2490  O  OD1   . ASP B 1 109  ? 0.282   -22.018 -66.531 1.00 97.36  ? 109  ASP B OD1   1 
ATOM   2491  O  OD2   . ASP B 1 109  ? 1.641   -20.852 -67.804 1.00 92.82  ? 109  ASP B OD2   1 
ATOM   2492  N  N     . ILE B 1 110  ? -1.685  -16.901 -67.395 1.00 98.60  ? 110  ILE B N     1 
ATOM   2493  C  CA    . ILE B 1 110  ? -2.834  -16.027 -67.597 1.00 97.18  ? 110  ILE B CA    1 
ATOM   2494  C  C     . ILE B 1 110  ? -2.653  -15.095 -68.794 1.00 98.85  ? 110  ILE B C     1 
ATOM   2495  O  O     . ILE B 1 110  ? -1.584  -14.513 -68.984 1.00 92.20  ? 110  ILE B O     1 
ATOM   2496  C  CB    . ILE B 1 110  ? -3.111  -15.186 -66.335 1.00 95.12  ? 110  ILE B CB    1 
ATOM   2497  C  CG1   . ILE B 1 110  ? -3.422  -16.104 -65.152 1.00 97.87  ? 110  ILE B CG1   1 
ATOM   2498  C  CG2   . ILE B 1 110  ? -4.264  -14.226 -66.567 1.00 96.89  ? 110  ILE B CG2   1 
ATOM   2499  C  CD1   . ILE B 1 110  ? -3.798  -15.368 -63.886 1.00 91.19  ? 110  ILE B CD1   1 
ATOM   2500  N  N     . VAL B 1 111  ? -3.704  -14.980 -69.605 1.00 99.78  ? 111  VAL B N     1 
ATOM   2501  C  CA    . VAL B 1 111  ? -3.738  -14.052 -70.732 1.00 92.24  ? 111  VAL B CA    1 
ATOM   2502  C  C     . VAL B 1 111  ? -4.441  -12.756 -70.341 1.00 81.08  ? 111  VAL B C     1 
ATOM   2503  O  O     . VAL B 1 111  ? -5.671  -12.703 -70.302 1.00 78.02  ? 111  VAL B O     1 
ATOM   2504  C  CB    . VAL B 1 111  ? -4.465  -14.656 -71.945 1.00 90.18  ? 111  VAL B CB    1 
ATOM   2505  C  CG1   . VAL B 1 111  ? -4.420  -13.693 -73.120 1.00 94.41  ? 111  VAL B CG1   1 
ATOM   2506  C  CG2   . VAL B 1 111  ? -3.859  -15.999 -72.318 1.00 91.23  ? 111  VAL B CG2   1 
ATOM   2507  N  N     . PRO B 1 112  ? -3.661  -11.703 -70.058 1.00 67.41  ? 112  PRO B N     1 
ATOM   2508  C  CA    . PRO B 1 112  ? -4.193  -10.434 -69.560 1.00 71.39  ? 112  PRO B CA    1 
ATOM   2509  C  C     . PRO B 1 112  ? -4.492  -9.417  -70.660 1.00 77.32  ? 112  PRO B C     1 
ATOM   2510  O  O     . PRO B 1 112  ? -3.733  -9.322  -71.623 1.00 78.31  ? 112  PRO B O     1 
ATOM   2511  C  CB    . PRO B 1 112  ? -3.063  -9.934  -68.671 1.00 72.50  ? 112  PRO B CB    1 
ATOM   2512  C  CG    . PRO B 1 112  ? -1.831  -10.393 -69.393 1.00 65.22  ? 112  PRO B CG    1 
ATOM   2513  C  CD    . PRO B 1 112  ? -2.189  -11.691 -70.094 1.00 64.86  ? 112  PRO B CD    1 
ATOM   2514  N  N     . PRO B 1 113  ? -5.592  -8.659  -70.514 1.00 81.43  ? 113  PRO B N     1 
ATOM   2515  C  CA    . PRO B 1 113  ? -5.903  -7.540  -71.412 1.00 70.36  ? 113  PRO B CA    1 
ATOM   2516  C  C     . PRO B 1 113  ? -4.874  -6.412  -71.292 1.00 72.93  ? 113  PRO B C     1 
ATOM   2517  O  O     . PRO B 1 113  ? -3.996  -6.474  -70.432 1.00 76.11  ? 113  PRO B O     1 
ATOM   2518  C  CB    . PRO B 1 113  ? -7.284  -7.076  -70.932 1.00 69.36  ? 113  PRO B CB    1 
ATOM   2519  C  CG    . PRO B 1 113  ? -7.857  -8.254  -70.206 1.00 71.99  ? 113  PRO B CG    1 
ATOM   2520  C  CD    . PRO B 1 113  ? -6.682  -8.915  -69.557 1.00 83.13  ? 113  PRO B CD    1 
ATOM   2521  N  N     . ALA B 1 114  ? -4.978  -5.398  -72.146 1.00 77.17  ? 114  ALA B N     1 
ATOM   2522  C  CA    . ALA B 1 114  ? -4.059  -4.263  -72.089 1.00 77.65  ? 114  ALA B CA    1 
ATOM   2523  C  C     . ALA B 1 114  ? -4.360  -3.389  -70.878 1.00 82.33  ? 114  ALA B C     1 
ATOM   2524  O  O     . ALA B 1 114  ? -5.518  -3.080  -70.596 1.00 87.10  ? 114  ALA B O     1 
ATOM   2525  C  CB    . ALA B 1 114  ? -4.139  -3.444  -73.368 1.00 71.92  ? 114  ALA B CB    1 
ATOM   2526  N  N     . GLY B 1 115  ? -3.315  -2.990  -70.163 1.00 77.04  ? 115  GLY B N     1 
ATOM   2527  C  CA    . GLY B 1 115  ? -3.486  -2.168  -68.981 1.00 82.21  ? 115  GLY B CA    1 
ATOM   2528  C  C     . GLY B 1 115  ? -3.995  -2.975  -67.804 1.00 82.56  ? 115  GLY B C     1 
ATOM   2529  O  O     . GLY B 1 115  ? -4.618  -2.439  -66.888 1.00 84.27  ? 115  GLY B O     1 
ATOM   2530  N  N     . VAL B 1 116  ? -3.738  -4.279  -67.843 1.00 82.20  ? 116  VAL B N     1 
ATOM   2531  C  CA    . VAL B 1 116  ? -4.098  -5.187  -66.754 1.00 85.64  ? 116  VAL B CA    1 
ATOM   2532  C  C     . VAL B 1 116  ? -2.929  -6.133  -66.475 1.00 83.52  ? 116  VAL B C     1 
ATOM   2533  O  O     . VAL B 1 116  ? -2.549  -6.928  -67.335 1.00 90.72  ? 116  VAL B O     1 
ATOM   2534  C  CB    . VAL B 1 116  ? -5.362  -6.013  -67.082 1.00 87.33  ? 116  VAL B CB    1 
ATOM   2535  C  CG1   . VAL B 1 116  ? -5.641  -7.019  -65.980 1.00 74.74  ? 116  VAL B CG1   1 
ATOM   2536  C  CG2   . VAL B 1 116  ? -6.567  -5.102  -67.295 1.00 92.13  ? 116  VAL B CG2   1 
ATOM   2537  N  N     . THR B 1 117  ? -2.361  -6.050  -65.275 1.00 73.75  ? 117  THR B N     1 
ATOM   2538  C  CA    . THR B 1 117  ? -1.142  -6.788  -64.960 1.00 69.18  ? 117  THR B CA    1 
ATOM   2539  C  C     . THR B 1 117  ? -1.347  -7.820  -63.845 1.00 67.23  ? 117  THR B C     1 
ATOM   2540  O  O     . THR B 1 117  ? -2.085  -7.580  -62.892 1.00 72.01  ? 117  THR B O     1 
ATOM   2541  C  CB    . THR B 1 117  ? -0.002  -5.821  -64.549 1.00 68.63  ? 117  THR B CB    1 
ATOM   2542  O  OG1   . THR B 1 117  ? -0.116  -4.591  -65.279 1.00 54.12  ? 117  THR B OG1   1 
ATOM   2543  C  CG2   . THR B 1 117  ? 1.359   -6.445  -64.824 1.00 65.12  ? 117  THR B CG2   1 
ATOM   2544  N  N     . VAL B 1 118  ? -0.691  -8.971  -63.979 1.00 67.57  ? 118  VAL B N     1 
ATOM   2545  C  CA    . VAL B 1 118  ? -0.693  -10.010 -62.946 1.00 70.34  ? 118  VAL B CA    1 
ATOM   2546  C  C     . VAL B 1 118  ? 0.636   -9.996  -62.184 1.00 74.51  ? 118  VAL B C     1 
ATOM   2547  O  O     . VAL B 1 118  ? 1.699   -10.120 -62.790 1.00 83.08  ? 118  VAL B O     1 
ATOM   2548  C  CB    . VAL B 1 118  ? -0.927  -11.407 -63.553 1.00 70.02  ? 118  VAL B CB    1 
ATOM   2549  C  CG1   . VAL B 1 118  ? -0.610  -12.494 -62.543 1.00 76.09  ? 118  VAL B CG1   1 
ATOM   2550  C  CG2   . VAL B 1 118  ? -2.355  -11.532 -64.059 1.00 72.23  ? 118  VAL B CG2   1 
ATOM   2551  N  N     . HIS B 1 119  ? 0.579   -9.861  -60.860 1.00 63.95  ? 119  HIS B N     1 
ATOM   2552  C  CA    . HIS B 1 119  ? 1.775   -9.525  -60.083 1.00 60.68  ? 119  HIS B CA    1 
ATOM   2553  C  C     . HIS B 1 119  ? 2.443   -10.694 -59.344 1.00 63.13  ? 119  HIS B C     1 
ATOM   2554  O  O     . HIS B 1 119  ? 3.450   -10.500 -58.663 1.00 61.65  ? 119  HIS B O     1 
ATOM   2555  C  CB    . HIS B 1 119  ? 1.433   -8.425  -59.075 1.00 64.63  ? 119  HIS B CB    1 
ATOM   2556  C  CG    . HIS B 1 119  ? 0.847   -7.195  -59.696 1.00 59.42  ? 119  HIS B CG    1 
ATOM   2557  N  ND1   . HIS B 1 119  ? 1.622   -6.198  -60.249 1.00 57.91  ? 119  HIS B ND1   1 
ATOM   2558  C  CD2   . HIS B 1 119  ? -0.439  -6.798  -59.845 1.00 62.27  ? 119  HIS B CD2   1 
ATOM   2559  C  CE1   . HIS B 1 119  ? 0.838   -5.241  -60.714 1.00 64.22  ? 119  HIS B CE1   1 
ATOM   2560  N  NE2   . HIS B 1 119  ? -0.417  -5.581  -60.481 1.00 60.02  ? 119  HIS B NE2   1 
ATOM   2561  N  N     . ASN B 1 120  ? 1.895   -11.899 -59.473 1.00 74.45  ? 120  ASN B N     1 
ATOM   2562  C  CA    . ASN B 1 120  ? 2.547   -13.086 -58.914 1.00 83.36  ? 120  ASN B CA    1 
ATOM   2563  C  C     . ASN B 1 120  ? 2.459   -14.300 -59.847 1.00 88.74  ? 120  ASN B C     1 
ATOM   2564  O  O     . ASN B 1 120  ? 1.830   -15.303 -59.509 1.00 84.78  ? 120  ASN B O     1 
ATOM   2565  C  CB    . ASN B 1 120  ? 1.943   -13.430 -57.548 1.00 80.89  ? 120  ASN B CB    1 
ATOM   2566  C  CG    . ASN B 1 120  ? 0.439   -13.624 -57.607 1.00 79.19  ? 120  ASN B CG    1 
ATOM   2567  O  OD1   . ASN B 1 120  ? -0.221  -13.152 -58.531 1.00 78.28  ? 120  ASN B OD1   1 
ATOM   2568  N  ND2   . ASN B 1 120  ? -0.108  -14.324 -56.620 1.00 78.36  ? 120  ASN B ND2   1 
ATOM   2569  N  N     . PRO B 1 121  ? 3.123   -14.222 -61.015 1.00 94.06  ? 121  PRO B N     1 
ATOM   2570  C  CA    . PRO B 1 121  ? 2.995   -15.217 -62.090 1.00 88.87  ? 121  PRO B CA    1 
ATOM   2571  C  C     . PRO B 1 121  ? 3.400   -16.631 -61.682 1.00 86.03  ? 121  PRO B C     1 
ATOM   2572  O  O     . PRO B 1 121  ? 3.184   -17.572 -62.447 1.00 84.51  ? 121  PRO B O     1 
ATOM   2573  C  CB    . PRO B 1 121  ? 3.944   -14.691 -63.174 1.00 87.72  ? 121  PRO B CB    1 
ATOM   2574  C  CG    . PRO B 1 121  ? 4.154   -13.251 -62.847 1.00 90.76  ? 121  PRO B CG    1 
ATOM   2575  C  CD    . PRO B 1 121  ? 4.106   -13.181 -61.357 1.00 93.22  ? 121  PRO B CD    1 
ATOM   2576  N  N     . GLY B 1 122  ? 3.986   -16.774 -60.499 1.00 83.23  ? 122  GLY B N     1 
ATOM   2577  C  CA    . GLY B 1 122  ? 4.424   -18.071 -60.024 1.00 82.04  ? 122  GLY B CA    1 
ATOM   2578  C  C     . GLY B 1 122  ? 3.405   -18.727 -59.118 1.00 71.18  ? 122  GLY B C     1 
ATOM   2579  O  O     . GLY B 1 122  ? 3.665   -19.782 -58.543 1.00 66.39  ? 122  GLY B O     1 
ATOM   2580  N  N     . MET B 1 123  ? 2.238   -18.104 -58.994 1.00 68.65  ? 123  MET B N     1 
ATOM   2581  C  CA    . MET B 1 123  ? 1.212   -18.597 -58.085 1.00 71.42  ? 123  MET B CA    1 
ATOM   2582  C  C     . MET B 1 123  ? 0.573   -19.887 -58.578 1.00 68.46  ? 123  MET B C     1 
ATOM   2583  O  O     . MET B 1 123  ? -0.025  -19.927 -59.655 1.00 66.78  ? 123  MET B O     1 
ATOM   2584  C  CB    . MET B 1 123  ? 0.131   -17.541 -57.875 1.00 69.88  ? 123  MET B CB    1 
ATOM   2585  C  CG    . MET B 1 123  ? -0.939  -17.955 -56.885 1.00 63.65  ? 123  MET B CG    1 
ATOM   2586  S  SD    . MET B 1 123  ? -2.354  -16.849 -56.949 1.00 52.04  ? 123  MET B SD    1 
ATOM   2587  C  CE    . MET B 1 123  ? -2.919  -17.154 -58.617 1.00 72.37  ? 123  MET B CE    1 
ATOM   2588  N  N     . HIS B 1 124  ? 0.703   -20.936 -57.776 1.00 67.49  ? 124  HIS B N     1 
ATOM   2589  C  CA    . HIS B 1 124  ? 0.082   -22.215 -58.077 1.00 68.42  ? 124  HIS B CA    1 
ATOM   2590  C  C     . HIS B 1 124  ? -1.427  -22.060 -58.130 1.00 64.47  ? 124  HIS B C     1 
ATOM   2591  O  O     . HIS B 1 124  ? -2.004  -21.314 -57.343 1.00 64.55  ? 124  HIS B O     1 
ATOM   2592  C  CB    . HIS B 1 124  ? 0.468   -23.261 -57.033 1.00 76.32  ? 124  HIS B CB    1 
ATOM   2593  C  CG    . HIS B 1 124  ? -0.166  -24.597 -57.259 1.00 75.79  ? 124  HIS B CG    1 
ATOM   2594  N  ND1   . HIS B 1 124  ? 0.364   -25.534 -58.117 1.00 79.61  ? 124  HIS B ND1   1 
ATOM   2595  C  CD2   . HIS B 1 124  ? -1.294  -25.145 -56.749 1.00 75.34  ? 124  HIS B CD2   1 
ATOM   2596  C  CE1   . HIS B 1 124  ? -0.406  -26.608 -58.121 1.00 84.90  ? 124  HIS B CE1   1 
ATOM   2597  N  NE2   . HIS B 1 124  ? -1.418  -26.397 -57.300 1.00 80.77  ? 124  HIS B NE2   1 
ATOM   2598  N  N     . ILE B 1 125  ? -2.066  -22.757 -59.062 1.00 73.37  ? 125  ILE B N     1 
ATOM   2599  C  CA    . ILE B 1 125  ? -3.513  -22.662 -59.211 1.00 78.82  ? 125  ILE B CA    1 
ATOM   2600  C  C     . ILE B 1 125  ? -4.177  -24.034 -59.204 1.00 75.68  ? 125  ILE B C     1 
ATOM   2601  O  O     . ILE B 1 125  ? -5.118  -24.271 -58.448 1.00 70.49  ? 125  ILE B O     1 
ATOM   2602  C  CB    . ILE B 1 125  ? -3.900  -21.925 -60.507 1.00 76.84  ? 125  ILE B CB    1 
ATOM   2603  C  CG1   . ILE B 1 125  ? -3.310  -20.513 -60.516 1.00 70.02  ? 125  ILE B CG1   1 
ATOM   2604  C  CG2   . ILE B 1 125  ? -5.413  -21.873 -60.654 1.00 60.58  ? 125  ILE B CG2   1 
ATOM   2605  C  CD1   . ILE B 1 125  ? -3.723  -19.687 -61.707 1.00 66.79  ? 125  ILE B CD1   1 
ATOM   2606  N  N     . ALA B 1 126  ? -3.685  -24.935 -60.048 1.00 81.29  ? 126  ALA B N     1 
ATOM   2607  C  CA    . ALA B 1 126  ? -4.248  -26.276 -60.137 1.00 83.55  ? 126  ALA B CA    1 
ATOM   2608  C  C     . ALA B 1 126  ? -3.288  -27.246 -60.810 1.00 86.00  ? 126  ALA B C     1 
ATOM   2609  O  O     . ALA B 1 126  ? -2.490  -26.857 -61.663 1.00 84.33  ? 126  ALA B O     1 
ATOM   2610  C  CB    . ALA B 1 126  ? -5.572  -26.245 -60.884 1.00 90.91  ? 126  ALA B CB    1 
ATOM   2611  N  N     . THR B 1 127  ? -3.374  -28.513 -60.421 1.00 91.55  ? 127  THR B N     1 
ATOM   2612  C  CA    . THR B 1 127  ? -2.534  -29.548 -61.005 1.00 97.73  ? 127  THR B CA    1 
ATOM   2613  C  C     . THR B 1 127  ? -3.329  -30.395 -61.991 1.00 98.33  ? 127  THR B C     1 
ATOM   2614  O  O     . THR B 1 127  ? -4.165  -31.209 -61.598 1.00 95.25  ? 127  THR B O     1 
ATOM   2615  C  CB    . THR B 1 127  ? -1.922  -30.464 -59.927 1.00 98.65  ? 127  THR B CB    1 
ATOM   2616  O  OG1   . THR B 1 127  ? -1.178  -29.674 -58.993 1.00 103.67 ? 127  THR B OG1   1 
ATOM   2617  C  CG2   . THR B 1 127  ? -0.996  -31.487 -60.562 1.00 94.15  ? 127  THR B CG2   1 
ATOM   2618  N  N     . LEU B 1 128  ? -3.064  -30.187 -63.275 1.00 97.70  ? 128  LEU B N     1 
ATOM   2619  C  CA    . LEU B 1 128  ? -3.706  -30.959 -64.328 1.00 97.48  ? 128  LEU B CA    1 
ATOM   2620  C  C     . LEU B 1 128  ? -2.943  -32.245 -64.611 1.00 103.79 ? 128  LEU B C     1 
ATOM   2621  O  O     . LEU B 1 128  ? -1.714  -32.261 -64.595 1.00 101.30 ? 128  LEU B O     1 
ATOM   2622  C  CB    . LEU B 1 128  ? -3.812  -30.132 -65.608 1.00 96.39  ? 128  LEU B CB    1 
ATOM   2623  C  CG    . LEU B 1 128  ? -4.931  -29.097 -65.695 1.00 100.68 ? 128  LEU B CG    1 
ATOM   2624  C  CD1   . LEU B 1 128  ? -4.711  -28.198 -66.895 1.00 101.36 ? 128  LEU B CD1   1 
ATOM   2625  C  CD2   . LEU B 1 128  ? -6.274  -29.792 -65.796 1.00 107.06 ? 128  LEU B CD2   1 
ATOM   2626  N  N     . ASN B 1 129  ? -3.675  -33.322 -64.870 1.00 110.79 ? 129  ASN B N     1 
ATOM   2627  C  CA    . ASN B 1 129  ? -3.055  -34.562 -65.316 1.00 112.80 ? 129  ASN B CA    1 
ATOM   2628  C  C     . ASN B 1 129  ? -3.241  -34.722 -66.821 1.00 113.96 ? 129  ASN B C     1 
ATOM   2629  O  O     . ASN B 1 129  ? -3.742  -33.814 -67.486 1.00 112.71 ? 129  ASN B O     1 
ATOM   2630  C  CB    . ASN B 1 129  ? -3.628  -35.767 -64.562 1.00 104.86 ? 129  ASN B CB    1 
ATOM   2631  C  CG    . ASN B 1 129  ? -5.056  -36.083 -64.957 1.00 97.66  ? 129  ASN B CG    1 
ATOM   2632  O  OD1   . ASN B 1 129  ? -5.808  -35.207 -65.378 1.00 104.74 ? 129  ASN B OD1   1 
ATOM   2633  N  ND2   . ASN B 1 129  ? -5.438  -37.345 -64.817 1.00 93.43  ? 129  ASN B ND2   1 
ATOM   2634  N  N     . ASP B 1 130  ? -2.836  -35.868 -67.359 1.00 123.05 ? 130  ASP B N     1 
ATOM   2635  C  CA    . ASP B 1 130  ? -2.944  -36.099 -68.796 1.00 124.43 ? 130  ASP B CA    1 
ATOM   2636  C  C     . ASP B 1 130  ? -4.410  -36.176 -69.209 1.00 128.43 ? 130  ASP B C     1 
ATOM   2637  O  O     . ASP B 1 130  ? -5.269  -36.552 -68.407 1.00 123.62 ? 130  ASP B O     1 
ATOM   2638  C  CB    . ASP B 1 130  ? -2.197  -37.374 -69.205 1.00 125.83 ? 130  ASP B CB    1 
ATOM   2639  C  CG    . ASP B 1 130  ? -2.935  -38.642 -68.817 1.00 125.84 ? 130  ASP B CG    1 
ATOM   2640  O  OD1   . ASP B 1 130  ? -3.532  -38.683 -67.720 1.00 128.85 ? 130  ASP B OD1   1 
ATOM   2641  O  OD2   . ASP B 1 130  ? -2.918  -39.601 -69.617 1.00 119.23 ? 130  ASP B OD2   1 
ATOM   2642  N  N     . LYS B 1 131  ? -4.688  -35.798 -70.456 1.00 138.29 ? 131  LYS B N     1 
ATOM   2643  C  CA    . LYS B 1 131  ? -6.053  -35.731 -70.978 1.00 135.70 ? 131  LYS B CA    1 
ATOM   2644  C  C     . LYS B 1 131  ? -6.932  -34.830 -70.110 1.00 128.75 ? 131  LYS B C     1 
ATOM   2645  O  O     . LYS B 1 131  ? -8.148  -35.008 -70.048 1.00 128.27 ? 131  LYS B O     1 
ATOM   2646  C  CB    . LYS B 1 131  ? -6.669  -37.135 -71.081 1.00 140.08 ? 131  LYS B CB    1 
ATOM   2647  C  CG    . LYS B 1 131  ? -5.910  -38.104 -71.986 1.00 139.15 ? 131  LYS B CG    1 
ATOM   2648  C  CD    . LYS B 1 131  ? -6.607  -39.461 -72.065 1.00 133.19 ? 131  LYS B CD    1 
ATOM   2649  C  CE    . LYS B 1 131  ? -6.751  -40.096 -70.687 1.00 131.74 ? 131  LYS B CE    1 
ATOM   2650  N  NZ    . LYS B 1 131  ? -7.425  -41.426 -70.738 1.00 124.42 ? 131  LYS B NZ    1 
ATOM   2651  N  N     . GLY B 1 132  ? -6.307  -33.866 -69.440 1.00 120.84 ? 132  GLY B N     1 
ATOM   2652  C  CA    . GLY B 1 132  ? -7.016  -32.949 -68.567 1.00 117.02 ? 132  GLY B CA    1 
ATOM   2653  C  C     . GLY B 1 132  ? -7.179  -31.583 -69.202 1.00 111.95 ? 132  GLY B C     1 
ATOM   2654  O  O     . GLY B 1 132  ? -6.198  -30.882 -69.443 1.00 111.09 ? 132  GLY B O     1 
ATOM   2655  N  N     . LYS B 1 133  ? -8.425  -31.206 -69.471 1.00 109.26 ? 133  LYS B N     1 
ATOM   2656  C  CA    . LYS B 1 133  ? -8.726  -29.960 -70.169 1.00 109.31 ? 133  LYS B CA    1 
ATOM   2657  C  C     . LYS B 1 133  ? -9.241  -28.900 -69.199 1.00 104.66 ? 133  LYS B C     1 
ATOM   2658  O  O     . LYS B 1 133  ? -9.999  -29.206 -68.277 1.00 92.65  ? 133  LYS B O     1 
ATOM   2659  C  CB    . LYS B 1 133  ? -9.745  -30.216 -71.287 1.00 108.12 ? 133  LYS B CB    1 
ATOM   2660  C  CG    . LYS B 1 133  ? -10.009 -29.029 -72.206 1.00 106.95 ? 133  LYS B CG    1 
ATOM   2661  C  CD    . LYS B 1 133  ? -10.840 -29.448 -73.416 1.00 96.41  ? 133  LYS B CD    1 
ATOM   2662  C  CE    . LYS B 1 133  ? -11.276 -28.248 -74.246 1.00 101.75 ? 133  LYS B CE    1 
ATOM   2663  N  NZ    . LYS B 1 133  ? -10.124 -27.413 -74.686 1.00 99.47  ? 133  LYS B NZ    1 
ATOM   2664  N  N     . LEU B 1 134  ? -8.824  -27.655 -69.413 1.00 114.65 ? 134  LEU B N     1 
ATOM   2665  C  CA    . LEU B 1 134  ? -9.165  -26.572 -68.497 1.00 117.74 ? 134  LEU B CA    1 
ATOM   2666  C  C     . LEU B 1 134  ? -9.296  -25.224 -69.207 1.00 117.02 ? 134  LEU B C     1 
ATOM   2667  O  O     . LEU B 1 134  ? -8.324  -24.699 -69.755 1.00 111.83 ? 134  LEU B O     1 
ATOM   2668  C  CB    . LEU B 1 134  ? -8.114  -26.475 -67.389 1.00 116.41 ? 134  LEU B CB    1 
ATOM   2669  C  CG    . LEU B 1 134  ? -8.535  -25.745 -66.114 1.00 109.84 ? 134  LEU B CG    1 
ATOM   2670  C  CD1   . LEU B 1 134  ? -9.732  -26.440 -65.483 1.00 107.32 ? 134  LEU B CD1   1 
ATOM   2671  C  CD2   . LEU B 1 134  ? -7.373  -25.669 -65.136 1.00 104.10 ? 134  LEU B CD2   1 
ATOM   2672  N  N     . GLU B 1 135  ? -10.505 -24.671 -69.192 1.00 115.58 ? 135  GLU B N     1 
ATOM   2673  C  CA    . GLU B 1 135  ? -10.767 -23.349 -69.752 1.00 107.56 ? 135  GLU B CA    1 
ATOM   2674  C  C     . GLU B 1 135  ? -11.537 -22.504 -68.753 1.00 104.23 ? 135  GLU B C     1 
ATOM   2675  O  O     . GLU B 1 135  ? -12.629 -22.879 -68.326 1.00 104.72 ? 135  GLU B O     1 
ATOM   2676  C  CB    . GLU B 1 135  ? -11.554 -23.451 -71.056 1.00 106.87 ? 135  GLU B CB    1 
ATOM   2677  C  CG    . GLU B 1 135  ? -10.830 -24.171 -72.171 1.00 111.63 ? 135  GLU B CG    1 
ATOM   2678  C  CD    . GLU B 1 135  ? -11.695 -24.329 -73.402 1.00 113.19 ? 135  GLU B CD    1 
ATOM   2679  O  OE1   . GLU B 1 135  ? -12.867 -23.898 -73.361 1.00 108.52 ? 135  GLU B OE1   1 
ATOM   2680  O  OE2   . GLU B 1 135  ? -11.207 -24.883 -74.408 1.00 119.77 ? 135  GLU B OE2   1 
ATOM   2681  N  N     . VAL B 1 136  ? -10.968 -21.365 -68.373 1.00 97.92  ? 136  VAL B N     1 
ATOM   2682  C  CA    . VAL B 1 136  ? -11.595 -20.525 -67.362 1.00 97.92  ? 136  VAL B CA    1 
ATOM   2683  C  C     . VAL B 1 136  ? -11.678 -19.063 -67.771 1.00 96.13  ? 136  VAL B C     1 
ATOM   2684  O  O     . VAL B 1 136  ? -10.682 -18.447 -68.152 1.00 88.58  ? 136  VAL B O     1 
ATOM   2685  C  CB    . VAL B 1 136  ? -10.849 -20.600 -66.024 1.00 104.03 ? 136  VAL B CB    1 
ATOM   2686  C  CG1   . VAL B 1 136  ? -11.616 -19.834 -64.963 1.00 107.70 ? 136  VAL B CG1   1 
ATOM   2687  C  CG2   . VAL B 1 136  ? -10.657 -22.047 -65.599 1.00 105.69 ? 136  VAL B CG2   1 
ATOM   2688  N  N     . GLU B 1 137  ? -12.880 -18.513 -67.673 1.00 99.52  ? 137  GLU B N     1 
ATOM   2689  C  CA    . GLU B 1 137  ? -13.104 -17.107 -67.954 1.00 105.31 ? 137  GLU B CA    1 
ATOM   2690  C  C     . GLU B 1 137  ? -13.150 -16.318 -66.656 1.00 108.13 ? 137  GLU B C     1 
ATOM   2691  O  O     . GLU B 1 137  ? -13.857 -16.693 -65.723 1.00 111.24 ? 137  GLU B O     1 
ATOM   2692  C  CB    . GLU B 1 137  ? -14.399 -16.927 -68.736 1.00 105.90 ? 137  GLU B CB    1 
ATOM   2693  C  CG    . GLU B 1 137  ? -14.864 -15.499 -68.833 1.00 105.79 ? 137  GLU B CG    1 
ATOM   2694  C  CD    . GLU B 1 137  ? -16.197 -15.394 -69.526 1.00 111.60 ? 137  GLU B CD    1 
ATOM   2695  O  OE1   . GLU B 1 137  ? -16.522 -16.311 -70.310 1.00 114.75 ? 137  GLU B OE1   1 
ATOM   2696  O  OE2   . GLU B 1 137  ? -16.924 -14.410 -69.282 1.00 115.98 ? 137  GLU B OE2   1 
ATOM   2697  N  N     . LEU B 1 138  ? -12.397 -15.225 -66.597 1.00 103.36 ? 138  LEU B N     1 
ATOM   2698  C  CA    . LEU B 1 138  ? -12.307 -14.432 -65.376 1.00 98.97  ? 138  LEU B CA    1 
ATOM   2699  C  C     . LEU B 1 138  ? -12.897 -13.036 -65.541 1.00 103.88 ? 138  LEU B C     1 
ATOM   2700  O  O     . LEU B 1 138  ? -12.686 -12.382 -66.561 1.00 107.17 ? 138  LEU B O     1 
ATOM   2701  C  CB    . LEU B 1 138  ? -10.852 -14.324 -64.926 1.00 97.40  ? 138  LEU B CB    1 
ATOM   2702  C  CG    . LEU B 1 138  ? -10.103 -15.647 -64.778 1.00 105.75 ? 138  LEU B CG    1 
ATOM   2703  C  CD1   . LEU B 1 138  ? -8.658  -15.403 -64.377 1.00 104.82 ? 138  LEU B CD1   1 
ATOM   2704  C  CD2   . LEU B 1 138  ? -10.800 -16.538 -63.768 1.00 100.88 ? 138  LEU B CD2   1 
ATOM   2705  N  N     . VAL B 1 139  ? -13.628 -12.584 -64.524 1.00 107.31 ? 139  VAL B N     1 
ATOM   2706  C  CA    . VAL B 1 139  ? -14.235 -11.254 -64.528 1.00 110.91 ? 139  VAL B CA    1 
ATOM   2707  C  C     . VAL B 1 139  ? -13.588 -10.335 -63.493 1.00 101.25 ? 139  VAL B C     1 
ATOM   2708  O  O     . VAL B 1 139  ? -13.756 -10.530 -62.289 1.00 98.82  ? 139  VAL B O     1 
ATOM   2709  C  CB    . VAL B 1 139  ? -15.748 -11.320 -64.247 1.00 111.79 ? 139  VAL B CB    1 
ATOM   2710  C  CG1   . VAL B 1 139  ? -16.350 -9.922  -64.264 1.00 108.89 ? 139  VAL B CG1   1 
ATOM   2711  C  CG2   . VAL B 1 139  ? -16.438 -12.219 -65.261 1.00 121.18 ? 139  VAL B CG2   1 
ATOM   2712  N  N     . VAL B 1 140  ? -12.867 -9.325  -63.972 1.00 96.12  ? 140  VAL B N     1 
ATOM   2713  C  CA    . VAL B 1 140  ? -12.114 -8.424  -63.102 1.00 98.51  ? 140  VAL B CA    1 
ATOM   2714  C  C     . VAL B 1 140  ? -12.728 -7.027  -63.014 1.00 101.79 ? 140  VAL B C     1 
ATOM   2715  O  O     . VAL B 1 140  ? -12.892 -6.347  -64.026 1.00 105.39 ? 140  VAL B O     1 
ATOM   2716  C  CB    . VAL B 1 140  ? -10.656 -8.278  -63.582 1.00 106.04 ? 140  VAL B CB    1 
ATOM   2717  C  CG1   . VAL B 1 140  ? -9.919  -7.233  -62.751 1.00 104.15 ? 140  VAL B CG1   1 
ATOM   2718  C  CG2   . VAL B 1 140  ? -9.941  -9.619  -63.534 1.00 102.74 ? 140  VAL B CG2   1 
ATOM   2719  N  N     . GLU B 1 141  ? -13.055 -6.598  -61.798 1.00 103.91 ? 141  GLU B N     1 
ATOM   2720  C  CA    . GLU B 1 141  ? -13.561 -5.247  -61.576 1.00 101.10 ? 141  GLU B CA    1 
ATOM   2721  C  C     . GLU B 1 141  ? -12.623 -4.450  -60.675 1.00 91.58  ? 141  GLU B C     1 
ATOM   2722  O  O     . GLU B 1 141  ? -11.533 -4.908  -60.335 1.00 94.22  ? 141  GLU B O     1 
ATOM   2723  C  CB    . GLU B 1 141  ? -14.966 -5.289  -60.968 1.00 97.65  ? 141  GLU B CB    1 
ATOM   2724  C  CG    . GLU B 1 141  ? -16.008 -5.930  -61.872 1.00 102.63 ? 141  GLU B CG    1 
ATOM   2725  C  CD    . GLU B 1 141  ? -17.427 -5.699  -61.390 1.00 104.08 ? 141  GLU B CD    1 
ATOM   2726  O  OE1   . GLU B 1 141  ? -17.666 -4.682  -60.705 1.00 105.14 ? 141  GLU B OE1   1 
ATOM   2727  O  OE2   . GLU B 1 141  ? -18.303 -6.535  -61.697 1.00 106.76 ? 141  GLU B OE2   1 
ATOM   2728  N  N     . ARG B 1 142  ? -13.044 -3.249  -60.300 1.00 80.71  ? 142  ARG B N     1 
ATOM   2729  C  CA    . ARG B 1 142  ? -12.282 -2.446  -59.357 1.00 78.78  ? 142  ARG B CA    1 
ATOM   2730  C  C     . ARG B 1 142  ? -13.188 -1.968  -58.234 1.00 82.04  ? 142  ARG B C     1 
ATOM   2731  O  O     . ARG B 1 142  ? -14.383 -1.763  -58.438 1.00 95.31  ? 142  ARG B O     1 
ATOM   2732  C  CB    . ARG B 1 142  ? -11.625 -1.261  -60.060 1.00 87.64  ? 142  ARG B CB    1 
ATOM   2733  C  CG    . ARG B 1 142  ? -10.520 -1.657  -61.025 1.00 93.63  ? 142  ARG B CG    1 
ATOM   2734  C  CD    . ARG B 1 142  ? -9.992  -0.450  -61.782 1.00 100.02 ? 142  ARG B CD    1 
ATOM   2735  N  NE    . ARG B 1 142  ? -9.620  0.636   -60.880 1.00 95.61  ? 142  ARG B NE    1 
ATOM   2736  C  CZ    . ARG B 1 142  ? -8.418  0.771   -60.331 1.00 94.44  ? 142  ARG B CZ    1 
ATOM   2737  N  NH1   . ARG B 1 142  ? -7.464  -0.113  -60.593 1.00 95.46  ? 142  ARG B NH1   1 
ATOM   2738  N  NH2   . ARG B 1 142  ? -8.169  1.790   -59.520 1.00 94.56  ? 142  ARG B NH2   1 
ATOM   2739  N  N     . GLY B 1 143  ? -12.617 -1.799  -57.046 1.00 76.40  ? 143  GLY B N     1 
ATOM   2740  C  CA    . GLY B 1 143  ? -13.382 -1.383  -55.887 1.00 74.54  ? 143  GLY B CA    1 
ATOM   2741  C  C     . GLY B 1 143  ? -12.528 -1.194  -54.650 1.00 69.69  ? 143  GLY B C     1 
ATOM   2742  O  O     . GLY B 1 143  ? -11.319 -0.987  -54.742 1.00 65.16  ? 143  GLY B O     1 
ATOM   2743  N  N     . ARG B 1 144  ? -13.164 -1.271  -53.486 1.00 70.35  ? 144  ARG B N     1 
ATOM   2744  C  CA    . ARG B 1 144  ? -12.476 -1.069  -52.216 1.00 67.50  ? 144  ARG B CA    1 
ATOM   2745  C  C     . ARG B 1 144  ? -12.880 -2.119  -51.181 1.00 68.88  ? 144  ARG B C     1 
ATOM   2746  O  O     . ARG B 1 144  ? -14.026 -2.570  -51.149 1.00 70.74  ? 144  ARG B O     1 
ATOM   2747  C  CB    . ARG B 1 144  ? -12.768 0.327   -51.665 1.00 64.47  ? 144  ARG B CB    1 
ATOM   2748  C  CG    . ARG B 1 144  ? -12.457 1.468   -52.616 1.00 63.14  ? 144  ARG B CG    1 
ATOM   2749  C  CD    . ARG B 1 144  ? -13.017 2.780   -52.095 1.00 62.43  ? 144  ARG B CD    1 
ATOM   2750  N  NE    . ARG B 1 144  ? -12.942 3.832   -53.104 1.00 71.98  ? 144  ARG B NE    1 
ATOM   2751  C  CZ    . ARG B 1 144  ? -11.876 4.599   -53.302 1.00 73.02  ? 144  ARG B CZ    1 
ATOM   2752  N  NH1   . ARG B 1 144  ? -10.794 4.433   -52.557 1.00 66.89  ? 144  ARG B NH1   1 
ATOM   2753  N  NH2   . ARG B 1 144  ? -11.892 5.532   -54.244 1.00 76.75  ? 144  ARG B NH2   1 
ATOM   2754  N  N     . GLY B 1 145  ? -11.930 -2.505  -50.336 1.00 60.22  ? 145  GLY B N     1 
ATOM   2755  C  CA    . GLY B 1 145  ? -12.209 -3.379  -49.211 1.00 50.26  ? 145  GLY B CA    1 
ATOM   2756  C  C     . GLY B 1 145  ? -12.539 -4.816  -49.558 1.00 42.10  ? 145  GLY B C     1 
ATOM   2757  O  O     . GLY B 1 145  ? -11.726 -5.536  -50.130 1.00 47.28  ? 145  GLY B O     1 
ATOM   2758  N  N     . TYR B 1 146  ? -13.748 -5.233  -49.204 1.00 35.43  ? 146  TYR B N     1 
ATOM   2759  C  CA    . TYR B 1 146  ? -14.136 -6.631  -49.307 1.00 41.46  ? 146  TYR B CA    1 
ATOM   2760  C  C     . TYR B 1 146  ? -15.623 -6.746  -49.595 1.00 53.31  ? 146  TYR B C     1 
ATOM   2761  O  O     . TYR B 1 146  ? -16.445 -6.189  -48.872 1.00 66.78  ? 146  TYR B O     1 
ATOM   2762  C  CB    . TYR B 1 146  ? -13.777 -7.364  -48.013 1.00 43.43  ? 146  TYR B CB    1 
ATOM   2763  C  CG    . TYR B 1 146  ? -14.078 -8.851  -47.989 1.00 48.34  ? 146  TYR B CG    1 
ATOM   2764  C  CD1   . TYR B 1 146  ? -15.274 -9.332  -47.470 1.00 53.83  ? 146  TYR B CD1   1 
ATOM   2765  C  CD2   . TYR B 1 146  ? -13.151 -9.776  -48.456 1.00 50.10  ? 146  TYR B CD2   1 
ATOM   2766  C  CE1   . TYR B 1 146  ? -15.546 -10.690 -47.432 1.00 51.02  ? 146  TYR B CE1   1 
ATOM   2767  C  CE2   . TYR B 1 146  ? -13.413 -11.135 -48.423 1.00 43.07  ? 146  TYR B CE2   1 
ATOM   2768  C  CZ    . TYR B 1 146  ? -14.611 -11.586 -47.910 1.00 43.75  ? 146  TYR B CZ    1 
ATOM   2769  O  OH    . TYR B 1 146  ? -14.874 -12.936 -47.875 1.00 40.43  ? 146  TYR B OH    1 
ATOM   2770  N  N     . VAL B 1 147  ? -15.968 -7.463  -50.657 1.00 53.77  ? 147  VAL B N     1 
ATOM   2771  C  CA    . VAL B 1 147  ? -17.364 -7.615  -51.045 1.00 58.32  ? 147  VAL B CA    1 
ATOM   2772  C  C     . VAL B 1 147  ? -17.732 -9.090  -51.164 1.00 61.86  ? 147  VAL B C     1 
ATOM   2773  O  O     . VAL B 1 147  ? -17.064 -9.843  -51.868 1.00 67.49  ? 147  VAL B O     1 
ATOM   2774  C  CB    . VAL B 1 147  ? -17.653 -6.891  -52.375 1.00 63.13  ? 147  VAL B CB    1 
ATOM   2775  C  CG1   . VAL B 1 147  ? -19.079 -7.156  -52.837 1.00 71.97  ? 147  VAL B CG1   1 
ATOM   2776  C  CG2   . VAL B 1 147  ? -17.407 -5.398  -52.224 1.00 62.97  ? 147  VAL B CG2   1 
ATOM   2777  N  N     . PRO B 1 148  ? -18.799 -9.505  -50.462 1.00 62.73  ? 148  PRO B N     1 
ATOM   2778  C  CA    . PRO B 1 148  ? -19.289 -10.889 -50.410 1.00 69.88  ? 148  PRO B CA    1 
ATOM   2779  C  C     . PRO B 1 148  ? -19.602 -11.505 -51.778 1.00 79.32  ? 148  PRO B C     1 
ATOM   2780  O  O     . PRO B 1 148  ? -19.431 -10.863 -52.815 1.00 79.56  ? 148  PRO B O     1 
ATOM   2781  C  CB    . PRO B 1 148  ? -20.567 -10.769 -49.576 1.00 73.55  ? 148  PRO B CB    1 
ATOM   2782  C  CG    . PRO B 1 148  ? -20.340 -9.577  -48.722 1.00 67.15  ? 148  PRO B CG    1 
ATOM   2783  C  CD    . PRO B 1 148  ? -19.567 -8.619  -49.571 1.00 65.55  ? 148  PRO B CD    1 
ATOM   2784  N  N     . ALA B 1 149  ? -20.071 -12.749 -51.765 1.00 87.35  ? 149  ALA B N     1 
ATOM   2785  C  CA    . ALA B 1 149  ? -20.310 -13.499 -52.995 1.00 96.30  ? 149  ALA B CA    1 
ATOM   2786  C  C     . ALA B 1 149  ? -21.763 -13.430 -53.470 1.00 103.65 ? 149  ALA B C     1 
ATOM   2787  O  O     . ALA B 1 149  ? -22.026 -13.447 -54.670 1.00 111.13 ? 149  ALA B O     1 
ATOM   2788  C  CB    . ALA B 1 149  ? -19.893 -14.949 -52.808 1.00 97.01  ? 149  ALA B CB    1 
ATOM   2789  N  N     . VAL B 1 150  ? -22.702 -13.363 -52.531 1.00 102.19 ? 150  VAL B N     1 
ATOM   2790  C  CA    . VAL B 1 150  ? -24.121 -13.311 -52.875 1.00 102.43 ? 150  VAL B CA    1 
ATOM   2791  C  C     . VAL B 1 150  ? -24.448 -12.034 -53.649 1.00 105.67 ? 150  VAL B C     1 
ATOM   2792  O  O     . VAL B 1 150  ? -25.370 -12.012 -54.465 1.00 104.67 ? 150  VAL B O     1 
ATOM   2793  C  CB    . VAL B 1 150  ? -25.014 -13.388 -51.617 1.00 107.39 ? 150  VAL B CB    1 
ATOM   2794  C  CG1   . VAL B 1 150  ? -26.458 -13.685 -52.001 1.00 105.28 ? 150  VAL B CG1   1 
ATOM   2795  C  CG2   . VAL B 1 150  ? -24.493 -14.449 -50.663 1.00 113.35 ? 150  VAL B CG2   1 
ATOM   2796  N  N     . GLN B 1 151  ? -23.679 -10.978 -53.392 1.00 111.48 ? 151  GLN B N     1 
ATOM   2797  C  CA    . GLN B 1 151  ? -23.862 -9.694  -54.069 1.00 113.14 ? 151  GLN B CA    1 
ATOM   2798  C  C     . GLN B 1 151  ? -23.300 -9.726  -55.492 1.00 115.59 ? 151  GLN B C     1 
ATOM   2799  O  O     . GLN B 1 151  ? -23.461 -8.772  -56.254 1.00 122.21 ? 151  GLN B O     1 
ATOM   2800  C  CB    . GLN B 1 151  ? -23.201 -8.558  -53.272 1.00 109.17 ? 151  GLN B CB    1 
ATOM   2801  C  CG    . GLN B 1 151  ? -23.817 -8.296  -51.893 1.00 110.55 ? 151  GLN B CG    1 
ATOM   2802  C  CD    . GLN B 1 151  ? -23.371 -6.974  -51.280 1.00 104.52 ? 151  GLN B CD    1 
ATOM   2803  O  OE1   . GLN B 1 151  ? -22.709 -6.166  -51.931 1.00 106.98 ? 151  GLN B OE1   1 
ATOM   2804  N  NE2   . GLN B 1 151  ? -23.737 -6.750  -50.021 1.00 97.45  ? 151  GLN B NE2   1 
ATOM   2805  N  N     . ASN B 1 152  ? -22.643 -10.827 -55.846 1.00 118.49 ? 152  ASN B N     1 
ATOM   2806  C  CA    . ASN B 1 152  ? -22.090 -10.992 -57.186 1.00 121.37 ? 152  ASN B CA    1 
ATOM   2807  C  C     . ASN B 1 152  ? -22.649 -12.239 -57.869 1.00 126.53 ? 152  ASN B C     1 
ATOM   2808  O  O     . ASN B 1 152  ? -21.953 -12.904 -58.637 1.00 123.83 ? 152  ASN B O     1 
ATOM   2809  C  CB    . ASN B 1 152  ? -20.562 -11.061 -57.126 1.00 116.65 ? 152  ASN B CB    1 
ATOM   2810  C  CG    . ASN B 1 152  ? -19.956 -9.908  -56.345 1.00 109.34 ? 152  ASN B CG    1 
ATOM   2811  O  OD1   . ASN B 1 152  ? -19.848 -8.790  -56.849 1.00 111.73 ? 152  ASN B OD1   1 
ATOM   2812  N  ND2   . ASN B 1 152  ? -19.554 -10.178 -55.108 1.00 97.31  ? 152  ASN B ND2   1 
ATOM   2813  N  N     . ARG B 1 153  ? -23.915 -12.540 -57.587 1.00 137.86 ? 153  ARG B N     1 
ATOM   2814  C  CA    . ARG B 1 153  ? -24.558 -13.756 -58.078 1.00 137.86 ? 153  ARG B CA    1 
ATOM   2815  C  C     . ARG B 1 153  ? -25.199 -13.576 -59.455 1.00 140.65 ? 153  ARG B C     1 
ATOM   2816  O  O     . ARG B 1 153  ? -25.854 -14.487 -59.964 1.00 136.46 ? 153  ARG B O     1 
ATOM   2817  C  CB    . ARG B 1 153  ? -25.622 -14.227 -57.088 1.00 129.69 ? 153  ARG B CB    1 
ATOM   2818  C  CG    . ARG B 1 153  ? -26.881 -13.389 -57.136 1.00 133.39 ? 153  ARG B CG    1 
ATOM   2819  C  CD    . ARG B 1 153  ? -27.978 -13.967 -56.269 1.00 132.90 ? 153  ARG B CD    1 
ATOM   2820  N  NE    . ARG B 1 153  ? -29.244 -13.282 -56.503 1.00 135.75 ? 153  ARG B NE    1 
ATOM   2821  C  CZ    . ARG B 1 153  ? -30.336 -13.462 -55.768 1.00 131.62 ? 153  ARG B CZ    1 
ATOM   2822  N  NH1   . ARG B 1 153  ? -31.446 -12.795 -56.055 1.00 121.14 ? 153  ARG B NH1   1 
ATOM   2823  N  NH2   . ARG B 1 153  ? -30.314 -14.306 -54.745 1.00 131.10 ? 153  ARG B NH2   1 
ATOM   2824  N  N     . ALA B 1 154  ? -25.018 -12.400 -60.050 1.00 139.44 ? 154  ALA B N     1 
ATOM   2825  C  CA    . ALA B 1 154  ? -25.574 -12.119 -61.371 1.00 133.34 ? 154  ALA B CA    1 
ATOM   2826  C  C     . ALA B 1 154  ? -24.609 -11.290 -62.215 1.00 135.06 ? 154  ALA B C     1 
ATOM   2827  O  O     . ALA B 1 154  ? -24.959 -10.208 -62.690 1.00 125.73 ? 154  ALA B O     1 
ATOM   2828  C  CB    . ALA B 1 154  ? -26.913 -11.407 -61.242 1.00 120.99 ? 154  ALA B CB    1 
ATOM   2829  N  N     . SER B 1 155  ? -23.397 -11.811 -62.401 1.00 151.71 ? 155  SER B N     1 
ATOM   2830  C  CA    . SER B 1 155  ? -22.353 -11.112 -63.148 1.00 156.54 ? 155  SER B CA    1 
ATOM   2831  C  C     . SER B 1 155  ? -21.671 -12.013 -64.181 1.00 159.58 ? 155  SER B C     1 
ATOM   2832  O  O     . SER B 1 155  ? -20.603 -11.680 -64.698 1.00 158.27 ? 155  SER B O     1 
ATOM   2833  C  CB    . SER B 1 155  ? -21.305 -10.544 -62.188 1.00 151.33 ? 155  SER B CB    1 
ATOM   2834  O  OG    . SER B 1 155  ? -20.738 -11.569 -61.390 1.00 141.85 ? 155  SER B OG    1 
ATOM   2835  N  N     . GLY B 1 156  ? -22.289 -13.153 -64.472 1.00 164.12 ? 156  GLY B N     1 
ATOM   2836  C  CA    . GLY B 1 156  ? -21.777 -14.066 -65.479 1.00 158.88 ? 156  GLY B CA    1 
ATOM   2837  C  C     . GLY B 1 156  ? -22.907 -14.805 -66.167 1.00 161.66 ? 156  GLY B C     1 
ATOM   2838  O  O     . GLY B 1 156  ? -24.027 -14.844 -65.657 1.00 163.92 ? 156  GLY B O     1 
ATOM   2839  N  N     . ALA B 1 157  ? -22.619 -15.390 -67.327 1.00 154.56 ? 157  ALA B N     1 
ATOM   2840  C  CA    . ALA B 1 157  ? -23.620 -16.157 -68.064 1.00 157.60 ? 157  ALA B CA    1 
ATOM   2841  C  C     . ALA B 1 157  ? -24.087 -17.356 -67.242 1.00 162.53 ? 157  ALA B C     1 
ATOM   2842  O  O     . ALA B 1 157  ? -23.270 -18.118 -66.724 1.00 159.86 ? 157  ALA B O     1 
ATOM   2843  C  CB    . ALA B 1 157  ? -23.064 -16.611 -69.403 1.00 150.66 ? 157  ALA B CB    1 
ATOM   2844  N  N     . GLU B 1 158  ? -25.403 -17.530 -67.142 1.00 154.88 ? 158  GLU B N     1 
ATOM   2845  C  CA    . GLU B 1 158  ? -25.991 -18.542 -66.264 1.00 142.21 ? 158  GLU B CA    1 
ATOM   2846  C  C     . GLU B 1 158  ? -25.791 -19.966 -66.791 1.00 138.49 ? 158  GLU B C     1 
ATOM   2847  O  O     . GLU B 1 158  ? -26.517 -20.890 -66.421 1.00 126.53 ? 158  GLU B O     1 
ATOM   2848  C  CB    . GLU B 1 158  ? -27.481 -18.251 -66.060 1.00 132.03 ? 158  GLU B CB    1 
ATOM   2849  C  CG    . GLU B 1 158  ? -28.044 -18.747 -64.735 1.00 128.87 ? 158  GLU B CG    1 
ATOM   2850  C  CD    . GLU B 1 158  ? -29.295 -17.999 -64.318 1.00 124.53 ? 158  GLU B CD    1 
ATOM   2851  O  OE1   . GLU B 1 158  ? -29.404 -16.797 -64.641 1.00 113.93 ? 158  GLU B OE1   1 
ATOM   2852  O  OE2   . GLU B 1 158  ? -30.169 -18.611 -63.668 1.00 123.05 ? 158  GLU B OE2   1 
ATOM   2853  N  N     . ILE B 1 159  ? -24.799 -20.129 -67.659 1.00 151.28 ? 159  ILE B N     1 
ATOM   2854  C  CA    . ILE B 1 159  ? -24.373 -21.439 -68.123 1.00 161.37 ? 159  ILE B CA    1 
ATOM   2855  C  C     . ILE B 1 159  ? -23.119 -21.842 -67.348 1.00 162.84 ? 159  ILE B C     1 
ATOM   2856  O  O     . ILE B 1 159  ? -22.166 -22.383 -67.911 1.00 164.71 ? 159  ILE B O     1 
ATOM   2857  C  CB    . ILE B 1 159  ? -24.088 -21.443 -69.640 1.00 163.89 ? 159  ILE B CB    1 
ATOM   2858  C  CG1   . ILE B 1 159  ? -25.022 -20.470 -70.362 1.00 153.68 ? 159  ILE B CG1   1 
ATOM   2859  C  CG2   . ILE B 1 159  ? -24.223 -22.850 -70.215 1.00 168.76 ? 159  ILE B CG2   1 
ATOM   2860  C  CD1   . ILE B 1 159  ? -24.836 -20.442 -71.863 1.00 144.03 ? 159  ILE B CD1   1 
ATOM   2861  N  N     . GLY B 1 160  ? -23.124 -21.556 -66.050 1.00 154.91 ? 160  GLY B N     1 
ATOM   2862  C  CA    . GLY B 1 160  ? -21.999 -21.882 -65.195 1.00 152.55 ? 160  GLY B CA    1 
ATOM   2863  C  C     . GLY B 1 160  ? -21.263 -20.659 -64.683 1.00 142.59 ? 160  GLY B C     1 
ATOM   2864  O  O     . GLY B 1 160  ? -20.033 -20.605 -64.719 1.00 135.12 ? 160  GLY B O     1 
ATOM   2865  N  N     . ARG B 1 161  ? -22.016 -19.672 -64.207 1.00 137.74 ? 161  ARG B N     1 
ATOM   2866  C  CA    . ARG B 1 161  ? -21.423 -18.483 -63.606 1.00 135.34 ? 161  ARG B CA    1 
ATOM   2867  C  C     . ARG B 1 161  ? -21.212 -18.691 -62.112 1.00 132.88 ? 161  ARG B C     1 
ATOM   2868  O  O     . ARG B 1 161  ? -22.139 -19.061 -61.392 1.00 131.38 ? 161  ARG B O     1 
ATOM   2869  C  CB    . ARG B 1 161  ? -22.302 -17.257 -63.844 1.00 137.41 ? 161  ARG B CB    1 
ATOM   2870  N  N     . ILE B 1 162  ? -19.990 -18.451 -61.650 1.00 125.10 ? 162  ILE B N     1 
ATOM   2871  C  CA    . ILE B 1 162  ? -19.663 -18.650 -60.244 1.00 124.85 ? 162  ILE B CA    1 
ATOM   2872  C  C     . ILE B 1 162  ? -19.303 -17.329 -59.569 1.00 120.36 ? 162  ILE B C     1 
ATOM   2873  O  O     . ILE B 1 162  ? -18.357 -16.655 -59.977 1.00 112.84 ? 162  ILE B O     1 
ATOM   2874  C  CB    . ILE B 1 162  ? -18.497 -19.647 -60.071 1.00 125.99 ? 162  ILE B CB    1 
ATOM   2875  C  CG1   . ILE B 1 162  ? -18.797 -20.956 -60.806 1.00 127.90 ? 162  ILE B CG1   1 
ATOM   2876  C  CG2   . ILE B 1 162  ? -18.236 -19.915 -58.597 1.00 124.42 ? 162  ILE B CG2   1 
ATOM   2877  C  CD1   . ILE B 1 162  ? -17.724 -22.016 -60.642 1.00 118.60 ? 162  ILE B CD1   1 
ATOM   2878  N  N     . PRO B 1 163  ? -20.071 -16.953 -58.534 1.00 114.37 ? 163  PRO B N     1 
ATOM   2879  C  CA    . PRO B 1 163  ? -19.838 -15.736 -57.749 1.00 108.40 ? 163  PRO B CA    1 
ATOM   2880  C  C     . PRO B 1 163  ? -18.671 -15.888 -56.777 1.00 104.41 ? 163  PRO B C     1 
ATOM   2881  O  O     . PRO B 1 163  ? -18.634 -16.843 -56.001 1.00 101.76 ? 163  PRO B O     1 
ATOM   2882  C  CB    . PRO B 1 163  ? -21.156 -15.552 -56.996 1.00 116.04 ? 163  PRO B CB    1 
ATOM   2883  C  CG    . PRO B 1 163  ? -21.691 -16.931 -56.851 1.00 111.39 ? 163  PRO B CG    1 
ATOM   2884  C  CD    . PRO B 1 163  ? -21.278 -17.674 -58.090 1.00 111.14 ? 163  PRO B CD    1 
ATOM   2885  N  N     . VAL B 1 164  ? -17.732 -14.948 -56.821 1.00 98.97  ? 164  VAL B N     1 
ATOM   2886  C  CA    . VAL B 1 164  ? -16.513 -15.047 -56.024 1.00 97.42  ? 164  VAL B CA    1 
ATOM   2887  C  C     . VAL B 1 164  ? -16.380 -13.901 -55.025 1.00 93.28  ? 164  VAL B C     1 
ATOM   2888  O  O     . VAL B 1 164  ? -16.811 -12.779 -55.289 1.00 93.90  ? 164  VAL B O     1 
ATOM   2889  C  CB    . VAL B 1 164  ? -15.260 -15.061 -56.925 1.00 93.43  ? 164  VAL B CB    1 
ATOM   2890  C  CG1   . VAL B 1 164  ? -14.040 -15.543 -56.147 1.00 87.11  ? 164  VAL B CG1   1 
ATOM   2891  C  CG2   . VAL B 1 164  ? -15.495 -15.938 -58.145 1.00 100.50 ? 164  VAL B CG2   1 
ATOM   2892  N  N     . ASP B 1 165  ? -15.784 -14.193 -53.873 1.00 78.74  ? 165  ASP B N     1 
ATOM   2893  C  CA    . ASP B 1 165  ? -15.452 -13.161 -52.903 1.00 75.02  ? 165  ASP B CA    1 
ATOM   2894  C  C     . ASP B 1 165  ? -14.408 -12.216 -53.500 1.00 74.95  ? 165  ASP B C     1 
ATOM   2895  O  O     . ASP B 1 165  ? -13.355 -12.656 -53.967 1.00 66.46  ? 165  ASP B O     1 
ATOM   2896  C  CB    . ASP B 1 165  ? -14.943 -13.789 -51.605 1.00 72.44  ? 165  ASP B CB    1 
ATOM   2897  C  CG    . ASP B 1 165  ? -15.904 -14.824 -51.043 1.00 71.92  ? 165  ASP B CG    1 
ATOM   2898  O  OD1   . ASP B 1 165  ? -17.128 -14.647 -51.208 1.00 74.09  ? 165  ASP B OD1   1 
ATOM   2899  O  OD2   . ASP B 1 165  ? -15.437 -15.814 -50.441 1.00 67.36  ? 165  ASP B OD2   1 
ATOM   2900  N  N     . SER B 1 166  ? -14.710 -10.920 -53.488 1.00 79.10  ? 166  SER B N     1 
ATOM   2901  C  CA    . SER B 1 166  ? -13.859 -9.915  -54.121 1.00 69.58  ? 166  SER B CA    1 
ATOM   2902  C  C     . SER B 1 166  ? -13.037 -9.129  -53.104 1.00 62.93  ? 166  SER B C     1 
ATOM   2903  O  O     . SER B 1 166  ? -13.570 -8.284  -52.385 1.00 63.13  ? 166  SER B O     1 
ATOM   2904  C  CB    . SER B 1 166  ? -14.710 -8.947  -54.945 1.00 77.85  ? 166  SER B CB    1 
ATOM   2905  O  OG    . SER B 1 166  ? -15.671 -9.641  -55.723 1.00 90.96  ? 166  SER B OG    1 
ATOM   2906  N  N     . ILE B 1 167  ? -11.737 -9.402  -53.053 1.00 61.86  ? 167  ILE B N     1 
ATOM   2907  C  CA    . ILE B 1 167  ? -10.850 -8.717  -52.116 1.00 60.59  ? 167  ILE B CA    1 
ATOM   2908  C  C     . ILE B 1 167  ? -10.129 -7.571  -52.813 1.00 54.96  ? 167  ILE B C     1 
ATOM   2909  O  O     . ILE B 1 167  ? -8.918  -7.623  -53.051 1.00 44.87  ? 167  ILE B O     1 
ATOM   2910  C  CB    . ILE B 1 167  ? -9.826  -9.682  -51.498 1.00 57.22  ? 167  ILE B CB    1 
ATOM   2911  C  CG1   . ILE B 1 167  ? -10.525 -10.970 -51.059 1.00 52.27  ? 167  ILE B CG1   1 
ATOM   2912  C  CG2   . ILE B 1 167  ? -9.116  -9.027  -50.319 1.00 54.57  ? 167  ILE B CG2   1 
ATOM   2913  C  CD1   . ILE B 1 167  ? -9.621  -11.953 -50.360 1.00 41.38  ? 167  ILE B CD1   1 
ATOM   2914  N  N     . TYR B 1 168  ? -10.901 -6.538  -53.137 1.00 59.87  ? 168  TYR B N     1 
ATOM   2915  C  CA    . TYR B 1 168  ? -10.402 -5.380  -53.864 1.00 61.96  ? 168  TYR B CA    1 
ATOM   2916  C  C     . TYR B 1 168  ? -9.183  -4.758  -53.192 1.00 56.98  ? 168  TYR B C     1 
ATOM   2917  O  O     . TYR B 1 168  ? -8.214  -4.404  -53.861 1.00 56.34  ? 168  TYR B O     1 
ATOM   2918  C  CB    . TYR B 1 168  ? -11.499 -4.316  -54.000 1.00 68.12  ? 168  TYR B CB    1 
ATOM   2919  C  CG    . TYR B 1 168  ? -12.721 -4.716  -54.810 1.00 70.32  ? 168  TYR B CG    1 
ATOM   2920  C  CD1   . TYR B 1 168  ? -12.658 -4.832  -56.193 1.00 72.89  ? 168  TYR B CD1   1 
ATOM   2921  C  CD2   . TYR B 1 168  ? -13.946 -4.939  -54.192 1.00 69.11  ? 168  TYR B CD2   1 
ATOM   2922  C  CE1   . TYR B 1 168  ? -13.774 -5.180  -56.935 1.00 67.99  ? 168  TYR B CE1   1 
ATOM   2923  C  CE2   . TYR B 1 168  ? -15.066 -5.287  -54.925 1.00 67.62  ? 168  TYR B CE2   1 
ATOM   2924  C  CZ    . TYR B 1 168  ? -14.973 -5.407  -56.295 1.00 66.17  ? 168  TYR B CZ    1 
ATOM   2925  O  OH    . TYR B 1 168  ? -16.082 -5.753  -57.029 1.00 69.70  ? 168  TYR B OH    1 
ATOM   2926  N  N     . SER B 1 169  ? -9.237  -4.638  -51.868 1.00 58.58  ? 169  SER B N     1 
ATOM   2927  C  CA    . SER B 1 169  ? -8.232  -3.887  -51.117 1.00 61.58  ? 169  SER B CA    1 
ATOM   2928  C  C     . SER B 1 169  ? -6.833  -4.454  -51.303 1.00 58.02  ? 169  SER B C     1 
ATOM   2929  O  O     . SER B 1 169  ? -6.641  -5.666  -51.245 1.00 61.84  ? 169  SER B O     1 
ATOM   2930  C  CB    . SER B 1 169  ? -8.582  -3.859  -49.627 1.00 62.27  ? 169  SER B CB    1 
ATOM   2931  O  OG    . SER B 1 169  ? -7.751  -2.948  -48.925 1.00 57.48  ? 169  SER B OG    1 
ATOM   2932  N  N     . PRO B 1 170  ? -5.853  -3.569  -51.535 1.00 53.68  ? 170  PRO B N     1 
ATOM   2933  C  CA    . PRO B 1 170  ? -4.454  -3.940  -51.751 1.00 53.72  ? 170  PRO B CA    1 
ATOM   2934  C  C     . PRO B 1 170  ? -3.683  -4.076  -50.447 1.00 56.42  ? 170  PRO B C     1 
ATOM   2935  O  O     . PRO B 1 170  ? -2.474  -4.297  -50.468 1.00 58.09  ? 170  PRO B O     1 
ATOM   2936  C  CB    . PRO B 1 170  ? -3.919  -2.777  -52.576 1.00 57.44  ? 170  PRO B CB    1 
ATOM   2937  C  CG    . PRO B 1 170  ? -4.680  -1.614  -52.066 1.00 60.43  ? 170  PRO B CG    1 
ATOM   2938  C  CD    . PRO B 1 170  ? -6.058  -2.119  -51.695 1.00 59.66  ? 170  PRO B CD    1 
ATOM   2939  N  N     . VAL B 1 171  ? -4.379  -3.927  -49.327 1.00 59.98  ? 171  VAL B N     1 
ATOM   2940  C  CA    . VAL B 1 171  ? -3.771  -4.154  -48.025 1.00 58.38  ? 171  VAL B CA    1 
ATOM   2941  C  C     . VAL B 1 171  ? -4.418  -5.383  -47.391 1.00 54.84  ? 171  VAL B C     1 
ATOM   2942  O  O     . VAL B 1 171  ? -5.642  -5.517  -47.375 1.00 56.82  ? 171  VAL B O     1 
ATOM   2943  C  CB    . VAL B 1 171  ? -3.910  -2.925  -47.109 1.00 57.36  ? 171  VAL B CB    1 
ATOM   2944  C  CG1   . VAL B 1 171  ? -3.210  -3.168  -45.785 1.00 58.27  ? 171  VAL B CG1   1 
ATOM   2945  C  CG2   . VAL B 1 171  ? -3.328  -1.695  -47.792 1.00 56.51  ? 171  VAL B CG2   1 
ATOM   2946  N  N     . LEU B 1 172  ? -3.584  -6.283  -46.883 1.00 55.68  ? 172  LEU B N     1 
ATOM   2947  C  CA    . LEU B 1 172  ? -4.036  -7.603  -46.461 1.00 54.18  ? 172  LEU B CA    1 
ATOM   2948  C  C     . LEU B 1 172  ? -4.464  -7.656  -44.997 1.00 51.97  ? 172  LEU B C     1 
ATOM   2949  O  O     . LEU B 1 172  ? -5.559  -8.125  -44.681 1.00 44.38  ? 172  LEU B O     1 
ATOM   2950  C  CB    . LEU B 1 172  ? -2.931  -8.627  -46.724 1.00 61.68  ? 172  LEU B CB    1 
ATOM   2951  C  CG    . LEU B 1 172  ? -2.538  -8.749  -48.198 1.00 62.52  ? 172  LEU B CG    1 
ATOM   2952  C  CD1   . LEU B 1 172  ? -1.256  -9.549  -48.371 1.00 60.37  ? 172  LEU B CD1   1 
ATOM   2953  C  CD2   . LEU B 1 172  ? -3.677  -9.378  -48.986 1.00 67.64  ? 172  LEU B CD2   1 
ATOM   2954  N  N     . LYS B 1 173  ? -3.597  -7.179  -44.108 1.00 55.09  ? 173  LYS B N     1 
ATOM   2955  C  CA    . LYS B 1 173  ? -3.873  -7.214  -42.675 1.00 54.38  ? 173  LYS B CA    1 
ATOM   2956  C  C     . LYS B 1 173  ? -3.058  -6.168  -41.910 1.00 55.71  ? 173  LYS B C     1 
ATOM   2957  O  O     . LYS B 1 173  ? -1.872  -5.968  -42.180 1.00 52.79  ? 173  LYS B O     1 
ATOM   2958  C  CB    . LYS B 1 173  ? -3.590  -8.610  -42.117 1.00 58.40  ? 173  LYS B CB    1 
ATOM   2959  C  CG    . LYS B 1 173  ? -3.779  -8.723  -40.615 1.00 57.27  ? 173  LYS B CG    1 
ATOM   2960  C  CD    . LYS B 1 173  ? -5.163  -8.241  -40.213 1.00 58.14  ? 173  LYS B CD    1 
ATOM   2961  C  CE    . LYS B 1 173  ? -5.234  -7.939  -38.728 1.00 56.95  ? 173  LYS B CE    1 
ATOM   2962  N  NZ    . LYS B 1 173  ? -6.449  -7.151  -38.386 1.00 55.39  ? 173  LYS B NZ    1 
ATOM   2963  N  N     . VAL B 1 174  ? -3.704  -5.508  -40.950 1.00 54.91  ? 174  VAL B N     1 
ATOM   2964  C  CA    . VAL B 1 174  ? -3.075  -4.434  -40.187 1.00 50.59  ? 174  VAL B CA    1 
ATOM   2965  C  C     . VAL B 1 174  ? -3.388  -4.514  -38.694 1.00 49.97  ? 174  VAL B C     1 
ATOM   2966  O  O     . VAL B 1 174  ? -4.549  -4.598  -38.296 1.00 50.85  ? 174  VAL B O     1 
ATOM   2967  C  CB    . VAL B 1 174  ? -3.515  -3.052  -40.713 1.00 47.59  ? 174  VAL B CB    1 
ATOM   2968  C  CG1   . VAL B 1 174  ? -3.198  -1.962  -39.707 1.00 45.35  ? 174  VAL B CG1   1 
ATOM   2969  C  CG2   . VAL B 1 174  ? -2.852  -2.758  -42.048 1.00 54.90  ? 174  VAL B CG2   1 
ATOM   2970  N  N     . THR B 1 175  ? -2.340  -4.485  -37.874 1.00 51.13  ? 175  THR B N     1 
ATOM   2971  C  CA    . THR B 1 175  ? -2.487  -4.466  -36.421 1.00 50.09  ? 175  THR B CA    1 
ATOM   2972  C  C     . THR B 1 175  ? -1.733  -3.280  -35.811 1.00 47.97  ? 175  THR B C     1 
ATOM   2973  O  O     . THR B 1 175  ? -0.801  -2.749  -36.415 1.00 47.19  ? 175  THR B O     1 
ATOM   2974  C  CB    . THR B 1 175  ? -1.990  -5.782  -35.793 1.00 50.19  ? 175  THR B CB    1 
ATOM   2975  O  OG1   . THR B 1 175  ? -0.663  -6.067  -36.254 1.00 49.46  ? 175  THR B OG1   1 
ATOM   2976  C  CG2   . THR B 1 175  ? -2.905  -6.928  -36.186 1.00 47.24  ? 175  THR B CG2   1 
ATOM   2977  N  N     . TYR B 1 176  ? -2.145  -2.861  -34.619 1.00 39.55  ? 176  TYR B N     1 
ATOM   2978  C  CA    . TYR B 1 176  ? -1.554  -1.687  -33.984 1.00 38.38  ? 176  TYR B CA    1 
ATOM   2979  C  C     . TYR B 1 176  ? -1.543  -1.809  -32.471 1.00 38.63  ? 176  TYR B C     1 
ATOM   2980  O  O     . TYR B 1 176  ? -2.395  -2.474  -31.883 1.00 38.05  ? 176  TYR B O     1 
ATOM   2981  C  CB    . TYR B 1 176  ? -2.307  -0.417  -34.387 1.00 41.24  ? 176  TYR B CB    1 
ATOM   2982  C  CG    . TYR B 1 176  ? -3.711  -0.327  -33.826 1.00 46.65  ? 176  TYR B CG    1 
ATOM   2983  C  CD1   . TYR B 1 176  ? -4.049  0.640   -32.884 1.00 49.98  ? 176  TYR B CD1   1 
ATOM   2984  C  CD2   . TYR B 1 176  ? -4.702  -1.214  -34.236 1.00 51.38  ? 176  TYR B CD2   1 
ATOM   2985  C  CE1   . TYR B 1 176  ? -5.339  0.720   -32.370 1.00 47.70  ? 176  TYR B CE1   1 
ATOM   2986  C  CE2   . TYR B 1 176  ? -5.988  -1.142  -33.726 1.00 47.33  ? 176  TYR B CE2   1 
ATOM   2987  C  CZ    . TYR B 1 176  ? -6.302  -0.175  -32.796 1.00 40.54  ? 176  TYR B CZ    1 
ATOM   2988  O  OH    . TYR B 1 176  ? -7.582  -0.108  -32.294 1.00 27.57  ? 176  TYR B OH    1 
ATOM   2989  N  N     . LYS B 1 177  ? -0.568  -1.158  -31.849 1.00 36.93  ? 177  LYS B N     1 
ATOM   2990  C  CA    . LYS B 1 177  ? -0.470  -1.120  -30.398 1.00 45.97  ? 177  LYS B CA    1 
ATOM   2991  C  C     . LYS B 1 177  ? -0.026  0.274   -29.967 1.00 40.67  ? 177  LYS B C     1 
ATOM   2992  O  O     . LYS B 1 177  ? 0.648   0.974   -30.720 1.00 35.19  ? 177  LYS B O     1 
ATOM   2993  C  CB    . LYS B 1 177  ? 0.501   -2.194  -29.886 1.00 54.11  ? 177  LYS B CB    1 
ATOM   2994  C  CG    . LYS B 1 177  ? 0.516   -2.353  -28.363 1.00 58.65  ? 177  LYS B CG    1 
ATOM   2995  C  CD    . LYS B 1 177  ? 1.336   -3.555  -27.902 1.00 54.81  ? 177  LYS B CD    1 
ATOM   2996  C  CE    . LYS B 1 177  ? 1.296   -3.697  -26.382 1.00 43.42  ? 177  LYS B CE    1 
ATOM   2997  N  NZ    . LYS B 1 177  ? 1.962   -4.942  -25.896 1.00 34.26  ? 177  LYS B NZ    1 
ATOM   2998  N  N     . VAL B 1 178  ? -0.422  0.679   -28.764 1.00 40.47  ? 178  VAL B N     1 
ATOM   2999  C  CA    . VAL B 1 178  ? -0.097  2.007   -28.252 1.00 34.49  ? 178  VAL B CA    1 
ATOM   3000  C  C     . VAL B 1 178  ? 0.529   1.951   -26.860 1.00 37.69  ? 178  VAL B C     1 
ATOM   3001  O  O     . VAL B 1 178  ? -0.179  1.935   -25.855 1.00 35.85  ? 178  VAL B O     1 
ATOM   3002  C  CB    . VAL B 1 178  ? -1.350  2.907   -28.185 1.00 33.16  ? 178  VAL B CB    1 
ATOM   3003  C  CG1   . VAL B 1 178  ? -0.976  4.317   -27.743 1.00 40.58  ? 178  VAL B CG1   1 
ATOM   3004  C  CG2   . VAL B 1 178  ? -2.064  2.940   -29.527 1.00 39.97  ? 178  VAL B CG2   1 
ATOM   3005  N  N     . ASP B 1 179  ? 1.857   1.919   -26.801 1.00 41.69  ? 179  ASP B N     1 
ATOM   3006  C  CA    . ASP B 1 179  ? 2.559   2.033   -25.527 1.00 44.39  ? 179  ASP B CA    1 
ATOM   3007  C  C     . ASP B 1 179  ? 2.695   3.511   -25.173 1.00 44.54  ? 179  ASP B C     1 
ATOM   3008  O  O     . ASP B 1 179  ? 2.096   4.363   -25.825 1.00 49.12  ? 179  ASP B O     1 
ATOM   3009  C  CB    . ASP B 1 179  ? 3.933   1.358   -25.588 1.00 50.71  ? 179  ASP B CB    1 
ATOM   3010  C  CG    . ASP B 1 179  ? 3.842   -0.155  -25.730 1.00 46.91  ? 179  ASP B CG    1 
ATOM   3011  O  OD1   . ASP B 1 179  ? 2.889   -0.756  -25.188 1.00 34.89  ? 179  ASP B OD1   1 
ATOM   3012  O  OD2   . ASP B 1 179  ? 4.729   -0.745  -26.384 1.00 47.86  ? 179  ASP B OD2   1 
ATOM   3013  N  N     . ALA B 1 180  ? 3.476   3.822   -24.145 1.00 51.11  ? 180  ALA B N     1 
ATOM   3014  C  CA    . ALA B 1 180  ? 3.663   5.217   -23.756 1.00 57.14  ? 180  ALA B CA    1 
ATOM   3015  C  C     . ALA B 1 180  ? 5.140   5.585   -23.674 1.00 62.28  ? 180  ALA B C     1 
ATOM   3016  O  O     . ALA B 1 180  ? 5.942   4.842   -23.109 1.00 68.42  ? 180  ALA B O     1 
ATOM   3017  C  CB    . ALA B 1 180  ? 2.974   5.497   -22.429 1.00 61.32  ? 180  ALA B CB    1 
ATOM   3018  N  N     . THR B 1 181  ? 5.494   6.734   -24.243 1.00 60.67  ? 181  THR B N     1 
ATOM   3019  C  CA    . THR B 1 181  ? 6.877   7.195   -24.223 1.00 63.06  ? 181  THR B CA    1 
ATOM   3020  C  C     . THR B 1 181  ? 7.084   8.296   -23.187 1.00 67.14  ? 181  THR B C     1 
ATOM   3021  O  O     . THR B 1 181  ? 6.147   9.016   -22.838 1.00 68.10  ? 181  THR B O     1 
ATOM   3022  C  CB    . THR B 1 181  ? 7.320   7.711   -25.600 1.00 62.27  ? 181  THR B CB    1 
ATOM   3023  O  OG1   . THR B 1 181  ? 8.649   8.238   -25.506 1.00 63.83  ? 181  THR B OG1   1 
ATOM   3024  C  CG2   . THR B 1 181  ? 6.380   8.802   -26.086 1.00 62.39  ? 181  THR B CG2   1 
ATOM   3025  N  N     . ARG B 1 182  ? 8.319   8.422   -22.708 1.00 70.65  ? 182  ARG B N     1 
ATOM   3026  C  CA    . ARG B 1 182  ? 8.642   9.359   -21.635 1.00 74.72  ? 182  ARG B CA    1 
ATOM   3027  C  C     . ARG B 1 182  ? 9.317   10.626  -22.153 1.00 75.22  ? 182  ARG B C     1 
ATOM   3028  O  O     . ARG B 1 182  ? 10.538  10.673  -22.310 1.00 72.49  ? 182  ARG B O     1 
ATOM   3029  C  CB    . ARG B 1 182  ? 9.542   8.689   -20.593 1.00 78.01  ? 182  ARG B CB    1 
ATOM   3030  C  CG    . ARG B 1 182  ? 9.000   7.381   -20.039 1.00 78.81  ? 182  ARG B CG    1 
ATOM   3031  C  CD    . ARG B 1 182  ? 9.873   6.866   -18.906 1.00 67.15  ? 182  ARG B CD    1 
ATOM   3032  N  NE    . ARG B 1 182  ? 11.292  7.026   -19.205 1.00 62.45  ? 182  ARG B NE    1 
ATOM   3033  C  CZ    . ARG B 1 182  ? 11.991  6.206   -19.983 1.00 63.78  ? 182  ARG B CZ    1 
ATOM   3034  N  NH1   . ARG B 1 182  ? 11.401  5.163   -20.551 1.00 64.47  ? 182  ARG B NH1   1 
ATOM   3035  N  NH2   . ARG B 1 182  ? 13.279  6.432   -20.198 1.00 66.00  ? 182  ARG B NH2   1 
ATOM   3036  N  N     . VAL B 1 183  ? 8.509   11.651  -22.406 1.00 76.94  ? 183  VAL B N     1 
ATOM   3037  C  CA    . VAL B 1 183  ? 9.007   12.939  -22.872 1.00 72.45  ? 183  VAL B CA    1 
ATOM   3038  C  C     . VAL B 1 183  ? 9.159   13.891  -21.694 1.00 78.44  ? 183  VAL B C     1 
ATOM   3039  O  O     . VAL B 1 183  ? 8.240   14.027  -20.883 1.00 79.72  ? 183  VAL B O     1 
ATOM   3040  C  CB    . VAL B 1 183  ? 8.066   13.558  -23.921 1.00 66.36  ? 183  VAL B CB    1 
ATOM   3041  C  CG1   . VAL B 1 183  ? 8.515   14.960  -24.288 1.00 70.47  ? 183  VAL B CG1   1 
ATOM   3042  C  CG2   . VAL B 1 183  ? 8.000   12.676  -25.154 1.00 66.17  ? 183  VAL B CG2   1 
ATOM   3043  N  N     . GLU B 1 184  ? 10.318  14.541  -21.609 1.00 75.67  ? 184  GLU B N     1 
ATOM   3044  C  CA    . GLU B 1 184  ? 10.642  15.421  -20.489 1.00 81.45  ? 184  GLU B CA    1 
ATOM   3045  C  C     . GLU B 1 184  ? 10.543  14.650  -19.180 1.00 90.40  ? 184  GLU B C     1 
ATOM   3046  O  O     . GLU B 1 184  ? 11.271  13.682  -18.960 1.00 90.74  ? 184  GLU B O     1 
ATOM   3047  C  CB    . GLU B 1 184  ? 9.717   16.642  -20.459 1.00 81.42  ? 184  GLU B CB    1 
ATOM   3048  C  CG    . GLU B 1 184  ? 9.715   17.467  -21.737 1.00 84.10  ? 184  GLU B CG    1 
ATOM   3049  C  CD    . GLU B 1 184  ? 10.936  18.357  -21.864 1.00 77.60  ? 184  GLU B CD    1 
ATOM   3050  O  OE1   . GLU B 1 184  ? 11.819  18.293  -20.983 1.00 83.37  ? 184  GLU B OE1   1 
ATOM   3051  O  OE2   . GLU B 1 184  ? 11.011  19.129  -22.843 1.00 72.59  ? 184  GLU B OE2   1 
ATOM   3052  N  N     . GLN B 1 185  ? 9.633   15.080  -18.315 1.00 94.91  ? 185  GLN B N     1 
ATOM   3053  C  CA    . GLN B 1 185  ? 9.360   14.351  -17.085 1.00 97.96  ? 185  GLN B CA    1 
ATOM   3054  C  C     . GLN B 1 185  ? 8.074   13.548  -17.248 1.00 92.54  ? 185  GLN B C     1 
ATOM   3055  O  O     . GLN B 1 185  ? 7.800   12.615  -16.488 1.00 86.21  ? 185  GLN B O     1 
ATOM   3056  C  CB    . GLN B 1 185  ? 9.254   15.310  -15.900 1.00 104.02 ? 185  GLN B CB    1 
ATOM   3057  C  CG    . GLN B 1 185  ? 9.029   14.627  -14.566 1.00 93.74  ? 185  GLN B CG    1 
ATOM   3058  C  CD    . GLN B 1 185  ? 8.958   15.609  -13.423 1.00 100.07 ? 185  GLN B CD    1 
ATOM   3059  O  OE1   . GLN B 1 185  ? 9.556   16.684  -13.476 1.00 110.80 ? 185  GLN B OE1   1 
ATOM   3060  N  NE2   . GLN B 1 185  ? 8.220   15.250  -12.382 1.00 93.78  ? 185  GLN B NE2   1 
ATOM   3061  N  N     . ARG B 1 186  ? 7.298   13.912  -18.265 1.00 85.41  ? 186  ARG B N     1 
ATOM   3062  C  CA    . ARG B 1 186  ? 6.010   13.282  -18.519 1.00 74.46  ? 186  ARG B CA    1 
ATOM   3063  C  C     . ARG B 1 186  ? 6.151   11.889  -19.110 1.00 63.47  ? 186  ARG B C     1 
ATOM   3064  O  O     . ARG B 1 186  ? 6.802   11.700  -20.135 1.00 60.61  ? 186  ARG B O     1 
ATOM   3065  C  CB    . ARG B 1 186  ? 5.170   14.145  -19.457 1.00 67.77  ? 186  ARG B CB    1 
ATOM   3066  C  CG    . ARG B 1 186  ? 4.941   15.556  -18.975 1.00 66.19  ? 186  ARG B CG    1 
ATOM   3067  C  CD    . ARG B 1 186  ? 3.756   16.158  -19.693 1.00 68.62  ? 186  ARG B CD    1 
ATOM   3068  N  NE    . ARG B 1 186  ? 2.563   15.337  -19.512 1.00 69.16  ? 186  ARG B NE    1 
ATOM   3069  C  CZ    . ARG B 1 186  ? 1.373   15.625  -20.028 1.00 70.62  ? 186  ARG B CZ    1 
ATOM   3070  N  NH1   . ARG B 1 186  ? 0.340   14.822  -19.812 1.00 60.55  ? 186  ARG B NH1   1 
ATOM   3071  N  NH2   . ARG B 1 186  ? 1.213   16.719  -20.762 1.00 75.87  ? 186  ARG B NH2   1 
ATOM   3072  N  N     . THR B 1 187  ? 5.522   10.920  -18.457 1.00 58.07  ? 187  THR B N     1 
ATOM   3073  C  CA    . THR B 1 187  ? 5.483   9.554   -18.953 1.00 59.71  ? 187  THR B CA    1 
ATOM   3074  C  C     . THR B 1 187  ? 4.103   9.246   -19.522 1.00 63.73  ? 187  THR B C     1 
ATOM   3075  O  O     . THR B 1 187  ? 3.680   8.092   -19.565 1.00 63.58  ? 187  THR B O     1 
ATOM   3076  C  CB    . THR B 1 187  ? 5.805   8.542   -17.846 1.00 53.35  ? 187  THR B CB    1 
ATOM   3077  O  OG1   . THR B 1 187  ? 4.800   8.616   -16.830 1.00 53.34  ? 187  THR B OG1   1 
ATOM   3078  C  CG2   . THR B 1 187  ? 7.156   8.841   -17.223 1.00 53.04  ? 187  THR B CG2   1 
ATOM   3079  N  N     . ASP B 1 188  ? 3.399   10.287  -19.954 1.00 66.63  ? 188  ASP B N     1 
ATOM   3080  C  CA    . ASP B 1 188  ? 2.025   10.134  -20.418 1.00 66.88  ? 188  ASP B CA    1 
ATOM   3081  C  C     . ASP B 1 188  ? 1.941   10.017  -21.935 1.00 68.71  ? 188  ASP B C     1 
ATOM   3082  O  O     . ASP B 1 188  ? 1.037   9.365   -22.462 1.00 70.57  ? 188  ASP B O     1 
ATOM   3083  C  CB    . ASP B 1 188  ? 1.175   11.311  -19.946 1.00 62.07  ? 188  ASP B CB    1 
ATOM   3084  C  CG    . ASP B 1 188  ? 1.396   11.637  -18.485 1.00 60.95  ? 188  ASP B CG    1 
ATOM   3085  O  OD1   . ASP B 1 188  ? 1.508   10.693  -17.674 1.00 62.53  ? 188  ASP B OD1   1 
ATOM   3086  O  OD2   . ASP B 1 188  ? 1.473   12.837  -18.148 1.00 58.77  ? 188  ASP B OD2   1 
ATOM   3087  N  N     . PHE B 1 189  ? 2.885   10.658  -22.623 1.00 67.10  ? 189  PHE B N     1 
ATOM   3088  C  CA    . PHE B 1 189  ? 2.919   10.695  -24.084 1.00 59.22  ? 189  PHE B CA    1 
ATOM   3089  C  C     . PHE B 1 189  ? 2.799   9.307   -24.702 1.00 55.52  ? 189  PHE B C     1 
ATOM   3090  O  O     . PHE B 1 189  ? 3.379   8.342   -24.208 1.00 52.27  ? 189  PHE B O     1 
ATOM   3091  C  CB    . PHE B 1 189  ? 4.206   11.361  -24.573 1.00 62.99  ? 189  PHE B CB    1 
ATOM   3092  C  CG    . PHE B 1 189  ? 4.266   12.842  -24.318 1.00 65.68  ? 189  PHE B CG    1 
ATOM   3093  C  CD1   . PHE B 1 189  ? 4.705   13.333  -23.100 1.00 71.70  ? 189  PHE B CD1   1 
ATOM   3094  C  CD2   . PHE B 1 189  ? 3.899   13.744  -25.303 1.00 64.12  ? 189  PHE B CD2   1 
ATOM   3095  C  CE1   . PHE B 1 189  ? 4.770   14.695  -22.867 1.00 73.24  ? 189  PHE B CE1   1 
ATOM   3096  C  CE2   . PHE B 1 189  ? 3.960   15.107  -25.075 1.00 67.91  ? 189  PHE B CE2   1 
ATOM   3097  C  CZ    . PHE B 1 189  ? 4.396   15.583  -23.855 1.00 72.19  ? 189  PHE B CZ    1 
ATOM   3098  N  N     . ASP B 1 190  ? 2.045   9.222   -25.791 1.00 51.27  ? 190  ASP B N     1 
ATOM   3099  C  CA    . ASP B 1 190  ? 1.766   7.946   -26.435 1.00 45.69  ? 190  ASP B CA    1 
ATOM   3100  C  C     . ASP B 1 190  ? 2.691   7.679   -27.620 1.00 44.92  ? 190  ASP B C     1 
ATOM   3101  O  O     . ASP B 1 190  ? 3.049   8.590   -28.368 1.00 41.07  ? 190  ASP B O     1 
ATOM   3102  C  CB    . ASP B 1 190  ? 0.305   7.893   -26.887 1.00 39.21  ? 190  ASP B CB    1 
ATOM   3103  C  CG    . ASP B 1 190  ? -0.666  7.910   -25.720 1.00 36.56  ? 190  ASP B CG    1 
ATOM   3104  O  OD1   . ASP B 1 190  ? -0.331  7.342   -24.659 1.00 39.67  ? 190  ASP B OD1   1 
ATOM   3105  O  OD2   . ASP B 1 190  ? -1.762  8.490   -25.861 1.00 32.50  ? 190  ASP B OD2   1 
ATOM   3106  N  N     . LYS B 1 191  ? 3.080   6.417   -27.768 1.00 50.61  ? 191  LYS B N     1 
ATOM   3107  C  CA    . LYS B 1 191  ? 3.881   5.956   -28.898 1.00 44.74  ? 191  LYS B CA    1 
ATOM   3108  C  C     . LYS B 1 191  ? 3.085   4.928   -29.694 1.00 42.44  ? 191  LYS B C     1 
ATOM   3109  O  O     . LYS B 1 191  ? 2.611   3.938   -29.138 1.00 45.17  ? 191  LYS B O     1 
ATOM   3110  C  CB    . LYS B 1 191  ? 5.203   5.354   -28.420 1.00 41.93  ? 191  LYS B CB    1 
ATOM   3111  C  CG    . LYS B 1 191  ? 5.918   4.500   -29.454 1.00 33.90  ? 191  LYS B CG    1 
ATOM   3112  C  CD    . LYS B 1 191  ? 6.993   3.639   -28.803 1.00 36.33  ? 191  LYS B CD    1 
ATOM   3113  C  CE    . LYS B 1 191  ? 7.542   2.594   -29.765 1.00 37.83  ? 191  LYS B CE    1 
ATOM   3114  N  NZ    . LYS B 1 191  ? 8.497   1.662   -29.099 1.00 31.38  ? 191  LYS B NZ    1 
ATOM   3115  N  N     . LEU B 1 192  ? 2.935   5.162   -30.993 1.00 41.40  ? 192  LEU B N     1 
ATOM   3116  C  CA    . LEU B 1 192  ? 2.077   4.316   -31.813 1.00 36.57  ? 192  LEU B CA    1 
ATOM   3117  C  C     . LEU B 1 192  ? 2.856   3.432   -32.779 1.00 39.81  ? 192  LEU B C     1 
ATOM   3118  O  O     . LEU B 1 192  ? 3.499   3.919   -33.707 1.00 43.39  ? 192  LEU B O     1 
ATOM   3119  C  CB    . LEU B 1 192  ? 1.083   5.175   -32.591 1.00 31.08  ? 192  LEU B CB    1 
ATOM   3120  C  CG    . LEU B 1 192  ? 0.179   4.417   -33.561 1.00 34.19  ? 192  LEU B CG    1 
ATOM   3121  C  CD1   . LEU B 1 192  ? -0.580  3.300   -32.855 1.00 40.60  ? 192  LEU B CD1   1 
ATOM   3122  C  CD2   . LEU B 1 192  ? -0.783  5.379   -34.234 1.00 37.30  ? 192  LEU B CD2   1 
ATOM   3123  N  N     . ILE B 1 193  ? 2.784   2.126   -32.546 1.00 44.13  ? 193  ILE B N     1 
ATOM   3124  C  CA    . ILE B 1 193  ? 3.374   1.143   -33.446 1.00 43.06  ? 193  ILE B CA    1 
ATOM   3125  C  C     . ILE B 1 193  ? 2.285   0.567   -34.338 1.00 44.17  ? 193  ILE B C     1 
ATOM   3126  O  O     . ILE B 1 193  ? 1.210   0.194   -33.861 1.00 42.03  ? 193  ILE B O     1 
ATOM   3127  C  CB    . ILE B 1 193  ? 4.077   -0.002  -32.680 1.00 45.64  ? 193  ILE B CB    1 
ATOM   3128  C  CG1   . ILE B 1 193  ? 5.212   0.543   -31.812 1.00 53.72  ? 193  ILE B CG1   1 
ATOM   3129  C  CG2   . ILE B 1 193  ? 4.621   -1.040  -33.648 1.00 45.44  ? 193  ILE B CG2   1 
ATOM   3130  C  CD1   . ILE B 1 193  ? 5.956   -0.529  -31.025 1.00 58.69  ? 193  ILE B CD1   1 
ATOM   3131  N  N     . LEU B 1 194  ? 2.564   0.504   -35.634 1.00 44.99  ? 194  LEU B N     1 
ATOM   3132  C  CA    . LEU B 1 194  ? 1.590   0.024   -36.600 1.00 37.02  ? 194  LEU B CA    1 
ATOM   3133  C  C     . LEU B 1 194  ? 2.185   -1.043  -37.503 1.00 38.83  ? 194  LEU B C     1 
ATOM   3134  O  O     . LEU B 1 194  ? 3.251   -0.853  -38.083 1.00 44.30  ? 194  LEU B O     1 
ATOM   3135  C  CB    . LEU B 1 194  ? 1.066   1.181   -37.443 1.00 38.13  ? 194  LEU B CB    1 
ATOM   3136  C  CG    . LEU B 1 194  ? -0.003  0.792   -38.458 1.00 38.66  ? 194  LEU B CG    1 
ATOM   3137  C  CD1   . LEU B 1 194  ? -1.275  0.389   -37.740 1.00 48.53  ? 194  LEU B CD1   1 
ATOM   3138  C  CD2   . LEU B 1 194  ? -0.265  1.926   -39.434 1.00 40.31  ? 194  LEU B CD2   1 
ATOM   3139  N  N     . ASP B 1 195  ? 1.489   -2.166  -37.621 1.00 40.85  ? 195  ASP B N     1 
ATOM   3140  C  CA    . ASP B 1 195  ? 1.947   -3.251  -38.476 1.00 49.38  ? 195  ASP B CA    1 
ATOM   3141  C  C     . ASP B 1 195  ? 1.053   -3.339  -39.705 1.00 57.90  ? 195  ASP B C     1 
ATOM   3142  O  O     . ASP B 1 195  ? -0.168  -3.408  -39.585 1.00 61.00  ? 195  ASP B O     1 
ATOM   3143  C  CB    . ASP B 1 195  ? 1.951   -4.575  -37.712 1.00 49.29  ? 195  ASP B CB    1 
ATOM   3144  C  CG    . ASP B 1 195  ? 2.686   -5.671  -38.453 1.00 53.08  ? 195  ASP B CG    1 
ATOM   3145  O  OD1   . ASP B 1 195  ? 2.100   -6.253  -39.388 1.00 63.00  ? 195  ASP B OD1   1 
ATOM   3146  O  OD2   . ASP B 1 195  ? 3.849   -5.952  -38.099 1.00 53.85  ? 195  ASP B OD2   1 
ATOM   3147  N  N     . VAL B 1 196  ? 1.659   -3.319  -40.887 1.00 57.97  ? 196  VAL B N     1 
ATOM   3148  C  CA    . VAL B 1 196  ? 0.889   -3.299  -42.125 1.00 52.56  ? 196  VAL B CA    1 
ATOM   3149  C  C     . VAL B 1 196  ? 1.418   -4.300  -43.134 1.00 59.19  ? 196  VAL B C     1 
ATOM   3150  O  O     . VAL B 1 196  ? 2.580   -4.234  -43.529 1.00 66.01  ? 196  VAL B O     1 
ATOM   3151  C  CB    . VAL B 1 196  ? 0.902   -1.905  -42.777 1.00 50.79  ? 196  VAL B CB    1 
ATOM   3152  C  CG1   . VAL B 1 196  ? 0.211   -1.950  -44.131 1.00 58.11  ? 196  VAL B CG1   1 
ATOM   3153  C  CG2   . VAL B 1 196  ? 0.245   -0.879  -41.870 1.00 50.37  ? 196  VAL B CG2   1 
ATOM   3154  N  N     . GLU B 1 197  ? 0.564   -5.222  -43.560 1.00 55.64  ? 197  GLU B N     1 
ATOM   3155  C  CA    . GLU B 1 197  ? 0.952   -6.156  -44.604 1.00 60.04  ? 197  GLU B CA    1 
ATOM   3156  C  C     . GLU B 1 197  ? 0.125   -5.941  -45.865 1.00 63.92  ? 197  GLU B C     1 
ATOM   3157  O  O     . GLU B 1 197  ? -1.102  -6.024  -45.836 1.00 64.82  ? 197  GLU B O     1 
ATOM   3158  C  CB    . GLU B 1 197  ? 0.820   -7.596  -44.120 1.00 57.44  ? 197  GLU B CB    1 
ATOM   3159  C  CG    . GLU B 1 197  ? 1.386   -8.598  -45.103 1.00 68.61  ? 197  GLU B CG    1 
ATOM   3160  C  CD    . GLU B 1 197  ? 1.620   -9.957  -44.484 1.00 73.58  ? 197  GLU B CD    1 
ATOM   3161  O  OE1   . GLU B 1 197  ? 1.093   -10.206 -43.380 1.00 75.14  ? 197  GLU B OE1   1 
ATOM   3162  O  OE2   . GLU B 1 197  ? 2.338   -10.774 -45.101 1.00 70.62  ? 197  GLU B OE2   1 
ATOM   3163  N  N     . THR B 1 198  ? 0.809   -5.661  -46.970 1.00 63.24  ? 198  THR B N     1 
ATOM   3164  C  CA    . THR B 1 198  ? 0.142   -5.356  -48.230 1.00 65.14  ? 198  THR B CA    1 
ATOM   3165  C  C     . THR B 1 198  ? 0.344   -6.444  -49.274 1.00 62.22  ? 198  THR B C     1 
ATOM   3166  O  O     . THR B 1 198  ? 1.164   -7.345  -49.101 1.00 60.48  ? 198  THR B O     1 
ATOM   3167  C  CB    . THR B 1 198  ? 0.636   -4.020  -48.817 1.00 63.37  ? 198  THR B CB    1 
ATOM   3168  O  OG1   . THR B 1 198  ? 2.047   -4.092  -49.056 1.00 55.98  ? 198  THR B OG1   1 
ATOM   3169  C  CG2   . THR B 1 198  ? 0.343   -2.878  -47.861 1.00 62.03  ? 198  THR B CG2   1 
ATOM   3170  N  N     . LYS B 1 199  ? -0.411  -6.343  -50.364 1.00 66.66  ? 199  LYS B N     1 
ATOM   3171  C  CA    . LYS B 1 199  ? -0.309  -7.287  -51.470 1.00 69.66  ? 199  LYS B CA    1 
ATOM   3172  C  C     . LYS B 1 199  ? 1.013   -7.126  -52.213 1.00 66.20  ? 199  LYS B C     1 
ATOM   3173  O  O     . LYS B 1 199  ? 1.865   -6.323  -51.829 1.00 66.75  ? 199  LYS B O     1 
ATOM   3174  C  CB    . LYS B 1 199  ? -1.483  -7.109  -52.446 1.00 65.20  ? 199  LYS B CB    1 
ATOM   3175  C  CG    . LYS B 1 199  ? -2.812  -7.685  -51.958 1.00 62.53  ? 199  LYS B CG    1 
ATOM   3176  C  CD    . LYS B 1 199  ? -3.954  -7.446  -52.951 1.00 63.39  ? 199  LYS B CD    1 
ATOM   3177  C  CE    . LYS B 1 199  ? -5.234  -8.173  -52.524 1.00 56.05  ? 199  LYS B CE    1 
ATOM   3178  N  NZ    . LYS B 1 199  ? -6.416  -7.862  -53.385 1.00 44.49  ? 199  LYS B NZ    1 
ATOM   3179  N  N     . ASN B 1 200  ? 1.173   -7.895  -53.283 1.00 53.74  ? 200  ASN B N     1 
ATOM   3180  C  CA    . ASN B 1 200  ? 2.359   -7.805  -54.117 1.00 56.80  ? 200  ASN B CA    1 
ATOM   3181  C  C     . ASN B 1 200  ? 2.215   -6.634  -55.083 1.00 64.66  ? 200  ASN B C     1 
ATOM   3182  O  O     . ASN B 1 200  ? 3.123   -6.330  -55.859 1.00 63.46  ? 200  ASN B O     1 
ATOM   3183  C  CB    . ASN B 1 200  ? 2.579   -9.117  -54.869 1.00 56.09  ? 200  ASN B CB    1 
ATOM   3184  C  CG    . ASN B 1 200  ? 4.044   -9.405  -55.129 1.00 65.10  ? 200  ASN B CG    1 
ATOM   3185  O  OD1   . ASN B 1 200  ? 4.568   -9.091  -56.197 1.00 74.16  ? 200  ASN B OD1   1 
ATOM   3186  N  ND2   . ASN B 1 200  ? 4.712   -10.012 -54.154 1.00 58.58  ? 200  ASN B ND2   1 
ATOM   3187  N  N     . SER B 1 201  ? 1.058   -5.978  -55.013 1.00 67.53  ? 201  SER B N     1 
ATOM   3188  C  CA    . SER B 1 201  ? 0.737   -4.836  -55.864 1.00 70.68  ? 201  SER B CA    1 
ATOM   3189  C  C     . SER B 1 201  ? 1.440   -3.554  -55.442 1.00 66.83  ? 201  SER B C     1 
ATOM   3190  O  O     . SER B 1 201  ? 2.030   -2.861  -56.266 1.00 73.36  ? 201  SER B O     1 
ATOM   3191  C  CB    . SER B 1 201  ? -0.774  -4.593  -55.879 1.00 72.76  ? 201  SER B CB    1 
ATOM   3192  O  OG    . SER B 1 201  ? -1.074  -3.312  -56.409 1.00 69.47  ? 201  SER B OG    1 
ATOM   3193  N  N     . ILE B 1 202  ? 1.361   -3.222  -54.160 1.00 63.95  ? 202  ILE B N     1 
ATOM   3194  C  CA    . ILE B 1 202  ? 1.937   -1.972  -53.693 1.00 65.97  ? 202  ILE B CA    1 
ATOM   3195  C  C     . ILE B 1 202  ? 2.768   -2.182  -52.437 1.00 59.29  ? 202  ILE B C     1 
ATOM   3196  O  O     . ILE B 1 202  ? 2.450   -3.023  -51.597 1.00 62.79  ? 202  ILE B O     1 
ATOM   3197  C  CB    . ILE B 1 202  ? 0.836   -0.914  -53.430 1.00 74.15  ? 202  ILE B CB    1 
ATOM   3198  C  CG1   . ILE B 1 202  ? 1.460   0.458   -53.147 1.00 73.69  ? 202  ILE B CG1   1 
ATOM   3199  C  CG2   . ILE B 1 202  ? -0.107  -1.369  -52.313 1.00 67.30  ? 202  ILE B CG2   1 
ATOM   3200  C  CD1   . ILE B 1 202  ? 2.276   1.013   -54.303 1.00 63.20  ? 202  ILE B CD1   1 
ATOM   3201  N  N     . SER B 1 203  ? 3.857   -1.431  -52.328 1.00 46.98  ? 203  SER B N     1 
ATOM   3202  C  CA    . SER B 1 203  ? 4.665   -1.470  -51.126 1.00 54.23  ? 203  SER B CA    1 
ATOM   3203  C  C     . SER B 1 203  ? 3.896   -0.807  -49.993 1.00 58.37  ? 203  SER B C     1 
ATOM   3204  O  O     . SER B 1 203  ? 3.179   0.166   -50.219 1.00 61.11  ? 203  SER B O     1 
ATOM   3205  C  CB    . SER B 1 203  ? 6.006   -0.775  -51.350 1.00 60.76  ? 203  SER B CB    1 
ATOM   3206  O  OG    . SER B 1 203  ? 6.828   -0.886  -50.203 1.00 66.22  ? 203  SER B OG    1 
ATOM   3207  N  N     . PRO B 1 204  ? 4.034   -1.343  -48.772 1.00 54.88  ? 204  PRO B N     1 
ATOM   3208  C  CA    . PRO B 1 204  ? 3.336   -0.807  -47.600 1.00 51.65  ? 204  PRO B CA    1 
ATOM   3209  C  C     . PRO B 1 204  ? 3.643   0.669   -47.361 1.00 50.34  ? 204  PRO B C     1 
ATOM   3210  O  O     . PRO B 1 204  ? 2.755   1.429   -46.974 1.00 46.43  ? 204  PRO B O     1 
ATOM   3211  C  CB    . PRO B 1 204  ? 3.871   -1.667  -46.454 1.00 52.49  ? 204  PRO B CB    1 
ATOM   3212  C  CG    . PRO B 1 204  ? 4.314   -2.926  -47.103 1.00 51.63  ? 204  PRO B CG    1 
ATOM   3213  C  CD    . PRO B 1 204  ? 4.846   -2.524  -48.435 1.00 54.91  ? 204  PRO B CD    1 
ATOM   3214  N  N     . ARG B 1 205  ? 4.887   1.067   -47.602 1.00 52.91  ? 205  ARG B N     1 
ATOM   3215  C  CA    . ARG B 1 205  ? 5.307   2.445   -47.380 1.00 53.77  ? 205  ARG B CA    1 
ATOM   3216  C  C     . ARG B 1 205  ? 4.484   3.409   -48.221 1.00 60.14  ? 205  ARG B C     1 
ATOM   3217  O  O     . ARG B 1 205  ? 4.203   4.531   -47.804 1.00 64.85  ? 205  ARG B O     1 
ATOM   3218  C  CB    . ARG B 1 205  ? 6.791   2.604   -47.695 1.00 53.08  ? 205  ARG B CB    1 
ATOM   3219  C  CG    . ARG B 1 205  ? 7.671   1.609   -46.971 1.00 53.24  ? 205  ARG B CG    1 
ATOM   3220  C  CD    . ARG B 1 205  ? 9.083   1.691   -47.487 1.00 54.11  ? 205  ARG B CD    1 
ATOM   3221  N  NE    . ARG B 1 205  ? 9.592   3.052   -47.400 1.00 66.47  ? 205  ARG B NE    1 
ATOM   3222  C  CZ    . ARG B 1 205  ? 10.735  3.452   -47.945 1.00 81.38  ? 205  ARG B CZ    1 
ATOM   3223  N  NH1   . ARG B 1 205  ? 11.128  4.712   -47.815 1.00 88.90  ? 205  ARG B NH1   1 
ATOM   3224  N  NH2   . ARG B 1 205  ? 11.483  2.590   -48.622 1.00 72.02  ? 205  ARG B NH2   1 
ATOM   3225  N  N     . ASP B 1 206  ? 4.095   2.959   -49.407 1.00 66.53  ? 206  ASP B N     1 
ATOM   3226  C  CA    . ASP B 1 206  ? 3.241   3.756   -50.272 1.00 69.64  ? 206  ASP B CA    1 
ATOM   3227  C  C     . ASP B 1 206  ? 1.787   3.675   -49.820 1.00 61.70  ? 206  ASP B C     1 
ATOM   3228  O  O     . ASP B 1 206  ? 1.043   4.649   -49.924 1.00 61.47  ? 206  ASP B O     1 
ATOM   3229  C  CB    . ASP B 1 206  ? 3.374   3.300   -51.727 1.00 72.91  ? 206  ASP B CB    1 
ATOM   3230  C  CG    . ASP B 1 206  ? 4.740   3.608   -52.313 1.00 75.15  ? 206  ASP B CG    1 
ATOM   3231  O  OD1   . ASP B 1 206  ? 4.973   4.776   -52.691 1.00 79.70  ? 206  ASP B OD1   1 
ATOM   3232  O  OD2   . ASP B 1 206  ? 5.577   2.684   -52.402 1.00 69.32  ? 206  ASP B OD2   1 
ATOM   3233  N  N     . ALA B 1 207  ? 1.392   2.514   -49.308 1.00 59.33  ? 207  ALA B N     1 
ATOM   3234  C  CA    . ALA B 1 207  ? 0.014   2.285   -48.881 1.00 64.41  ? 207  ALA B CA    1 
ATOM   3235  C  C     . ALA B 1 207  ? -0.367  3.179   -47.704 1.00 66.35  ? 207  ALA B C     1 
ATOM   3236  O  O     . ALA B 1 207  ? -1.542  3.492   -47.504 1.00 66.60  ? 207  ALA B O     1 
ATOM   3237  C  CB    . ALA B 1 207  ? -0.191  0.821   -48.519 1.00 68.14  ? 207  ALA B CB    1 
ATOM   3238  N  N     . LEU B 1 208  ? 0.633   3.585   -46.929 1.00 59.32  ? 208  LEU B N     1 
ATOM   3239  C  CA    . LEU B 1 208  ? 0.411   4.455   -45.782 1.00 52.76  ? 208  LEU B CA    1 
ATOM   3240  C  C     . LEU B 1 208  ? 0.261   5.904   -46.218 1.00 50.80  ? 208  LEU B C     1 
ATOM   3241  O  O     . LEU B 1 208  ? -0.526  6.660   -45.649 1.00 52.02  ? 208  LEU B O     1 
ATOM   3242  C  CB    . LEU B 1 208  ? 1.560   4.331   -44.783 1.00 45.20  ? 208  LEU B CB    1 
ATOM   3243  C  CG    . LEU B 1 208  ? 1.358   5.136   -43.501 1.00 39.89  ? 208  LEU B CG    1 
ATOM   3244  C  CD1   . LEU B 1 208  ? 0.069   4.707   -42.823 1.00 47.44  ? 208  LEU B CD1   1 
ATOM   3245  C  CD2   . LEU B 1 208  ? 2.542   4.973   -42.567 1.00 34.92  ? 208  LEU B CD2   1 
ATOM   3246  N  N     . ALA B 1 209  ? 1.032   6.284   -47.229 1.00 50.88  ? 209  ALA B N     1 
ATOM   3247  C  CA    . ALA B 1 209  ? 0.995   7.639   -47.758 1.00 55.25  ? 209  ALA B CA    1 
ATOM   3248  C  C     . ALA B 1 209  ? -0.340  7.918   -48.441 1.00 58.57  ? 209  ALA B C     1 
ATOM   3249  O  O     . ALA B 1 209  ? -0.862  9.032   -48.378 1.00 55.98  ? 209  ALA B O     1 
ATOM   3250  C  CB    . ALA B 1 209  ? 2.145   7.858   -48.724 1.00 56.93  ? 209  ALA B CB    1 
ATOM   3251  N  N     . SER B 1 210  ? -0.890  6.895   -49.089 1.00 61.05  ? 210  SER B N     1 
ATOM   3252  C  CA    . SER B 1 210  ? -2.186  7.008   -49.751 1.00 59.22  ? 210  SER B CA    1 
ATOM   3253  C  C     . SER B 1 210  ? -3.312  7.105   -48.734 1.00 56.76  ? 210  SER B C     1 
ATOM   3254  O  O     . SER B 1 210  ? -4.115  8.038   -48.768 1.00 60.45  ? 210  SER B O     1 
ATOM   3255  C  CB    . SER B 1 210  ? -2.433  5.816   -50.675 1.00 58.85  ? 210  SER B CB    1 
ATOM   3256  O  OG    . SER B 1 210  ? -3.743  5.858   -51.217 1.00 57.37  ? 210  SER B OG    1 
ATOM   3257  N  N     . ALA B 1 211  ? -3.365  6.132   -47.830 1.00 55.12  ? 211  ALA B N     1 
ATOM   3258  C  CA    . ALA B 1 211  ? -4.381  6.111   -46.790 1.00 52.26  ? 211  ALA B CA    1 
ATOM   3259  C  C     . ALA B 1 211  ? -4.215  7.315   -45.870 1.00 48.91  ? 211  ALA B C     1 
ATOM   3260  O  O     . ALA B 1 211  ? -5.167  7.751   -45.225 1.00 47.24  ? 211  ALA B O     1 
ATOM   3261  C  CB    . ALA B 1 211  ? -4.306  4.816   -46.003 1.00 51.46  ? 211  ALA B CB    1 
ATOM   3262  N  N     . GLY B 1 212  ? -2.997  7.846   -45.819 1.00 49.25  ? 212  GLY B N     1 
ATOM   3263  C  CA    . GLY B 1 212  ? -2.718  9.051   -45.063 1.00 50.20  ? 212  GLY B CA    1 
ATOM   3264  C  C     . GLY B 1 212  ? -3.300  10.273  -45.742 1.00 44.00  ? 212  GLY B C     1 
ATOM   3265  O  O     . GLY B 1 212  ? -4.018  11.056  -45.123 1.00 40.90  ? 212  GLY B O     1 
ATOM   3266  N  N     . LYS B 1 213  ? -2.985  10.432  -47.022 1.00 46.67  ? 213  LYS B N     1 
ATOM   3267  C  CA    . LYS B 1 213  ? -3.519  11.528  -47.819 1.00 46.78  ? 213  LYS B CA    1 
ATOM   3268  C  C     . LYS B 1 213  ? -5.040  11.496  -47.836 1.00 39.82  ? 213  LYS B C     1 
ATOM   3269  O  O     . LYS B 1 213  ? -5.693  12.536  -47.795 1.00 43.15  ? 213  LYS B O     1 
ATOM   3270  C  CB    . LYS B 1 213  ? -2.973  11.458  -49.244 1.00 52.30  ? 213  LYS B CB    1 
ATOM   3271  C  CG    . LYS B 1 213  ? -3.558  12.487  -50.190 1.00 43.56  ? 213  LYS B CG    1 
ATOM   3272  C  CD    . LYS B 1 213  ? -2.944  12.350  -51.564 1.00 33.29  ? 213  LYS B CD    1 
ATOM   3273  C  CE    . LYS B 1 213  ? -3.546  13.340  -52.531 1.00 30.90  ? 213  LYS B CE    1 
ATOM   3274  N  NZ    . LYS B 1 213  ? -2.910  13.216  -53.865 1.00 34.93  ? 213  LYS B NZ    1 
ATOM   3275  N  N     . THR B 1 214  ? -5.588  10.287  -47.895 1.00 38.54  ? 214  THR B N     1 
ATOM   3276  C  CA    . THR B 1 214  ? -7.030  10.074  -47.897 1.00 39.06  ? 214  THR B CA    1 
ATOM   3277  C  C     . THR B 1 214  ? -7.722  10.764  -46.725 1.00 43.17  ? 214  THR B C     1 
ATOM   3278  O  O     . THR B 1 214  ? -8.675  11.521  -46.908 1.00 42.13  ? 214  THR B O     1 
ATOM   3279  C  CB    . THR B 1 214  ? -7.366  8.571   -47.853 1.00 40.21  ? 214  THR B CB    1 
ATOM   3280  O  OG1   . THR B 1 214  ? -7.058  7.974   -49.118 1.00 38.91  ? 214  THR B OG1   1 
ATOM   3281  C  CG2   . THR B 1 214  ? -8.839  8.359   -47.549 1.00 41.47  ? 214  THR B CG2   1 
ATOM   3282  N  N     . LEU B 1 215  ? -7.228  10.506  -45.520 1.00 45.35  ? 215  LEU B N     1 
ATOM   3283  C  CA    . LEU B 1 215  ? -7.860  11.021  -44.314 1.00 37.80  ? 215  LEU B CA    1 
ATOM   3284  C  C     . LEU B 1 215  ? -7.693  12.531  -44.173 1.00 37.84  ? 215  LEU B C     1 
ATOM   3285  O  O     . LEU B 1 215  ? -8.573  13.206  -43.639 1.00 37.59  ? 215  LEU B O     1 
ATOM   3286  C  CB    . LEU B 1 215  ? -7.298  10.298  -43.093 1.00 32.52  ? 215  LEU B CB    1 
ATOM   3287  C  CG    . LEU B 1 215  ? -7.548  8.793   -43.197 1.00 29.96  ? 215  LEU B CG    1 
ATOM   3288  C  CD1   . LEU B 1 215  ? -6.897  8.039   -42.058 1.00 36.86  ? 215  LEU B CD1   1 
ATOM   3289  C  CD2   . LEU B 1 215  ? -9.041  8.517   -43.247 1.00 29.55  ? 215  LEU B CD2   1 
ATOM   3290  N  N     . VAL B 1 216  ? -6.573  13.058  -44.665 1.00 36.47  ? 216  VAL B N     1 
ATOM   3291  C  CA    . VAL B 1 216  ? -6.325  14.499  -44.637 1.00 35.00  ? 216  VAL B CA    1 
ATOM   3292  C  C     . VAL B 1 216  ? -7.426  15.235  -45.395 1.00 39.98  ? 216  VAL B C     1 
ATOM   3293  O  O     . VAL B 1 216  ? -7.791  16.363  -45.052 1.00 41.94  ? 216  VAL B O     1 
ATOM   3294  C  CB    . VAL B 1 216  ? -4.956  14.861  -45.248 1.00 34.00  ? 216  VAL B CB    1 
ATOM   3295  C  CG1   . VAL B 1 216  ? -4.717  16.363  -45.180 1.00 38.19  ? 216  VAL B CG1   1 
ATOM   3296  C  CG2   . VAL B 1 216  ? -3.846  14.129  -44.528 1.00 38.27  ? 216  VAL B CG2   1 
ATOM   3297  N  N     . GLU B 1 217  ? -7.958  14.580  -46.423 1.00 39.04  ? 217  GLU B N     1 
ATOM   3298  C  CA    . GLU B 1 217  ? -9.074  15.130  -47.179 1.00 41.76  ? 217  GLU B CA    1 
ATOM   3299  C  C     . GLU B 1 217  ? -10.305 15.277  -46.285 1.00 47.04  ? 217  GLU B C     1 
ATOM   3300  O  O     . GLU B 1 217  ? -10.980 16.306  -46.317 1.00 59.40  ? 217  GLU B O     1 
ATOM   3301  C  CB    . GLU B 1 217  ? -9.407  14.253  -48.392 1.00 38.79  ? 217  GLU B CB    1 
ATOM   3302  C  CG    . GLU B 1 217  ? -8.436  14.367  -49.571 1.00 37.62  ? 217  GLU B CG    1 
ATOM   3303  C  CD    . GLU B 1 217  ? -8.951  13.667  -50.824 1.00 36.82  ? 217  GLU B CD    1 
ATOM   3304  O  OE1   . GLU B 1 217  ? -10.151 13.327  -50.864 1.00 33.08  ? 217  GLU B OE1   1 
ATOM   3305  O  OE2   . GLU B 1 217  ? -8.161  13.452  -51.769 1.00 35.51  ? 217  GLU B OE2   1 
ATOM   3306  N  N     . LEU B 1 218  ? -10.592 14.253  -45.484 1.00 38.41  ? 218  LEU B N     1 
ATOM   3307  C  CA    . LEU B 1 218  ? -11.777 14.268  -44.629 1.00 37.42  ? 218  LEU B CA    1 
ATOM   3308  C  C     . LEU B 1 218  ? -11.758 15.425  -43.642 1.00 40.88  ? 218  LEU B C     1 
ATOM   3309  O  O     . LEU B 1 218  ? -12.679 16.241  -43.610 1.00 44.61  ? 218  LEU B O     1 
ATOM   3310  C  CB    . LEU B 1 218  ? -11.911 12.950  -43.871 1.00 33.53  ? 218  LEU B CB    1 
ATOM   3311  C  CG    . LEU B 1 218  ? -12.539 11.801  -44.657 1.00 39.35  ? 218  LEU B CG    1 
ATOM   3312  C  CD1   . LEU B 1 218  ? -12.696 10.582  -43.770 1.00 41.82  ? 218  LEU B CD1   1 
ATOM   3313  C  CD2   . LEU B 1 218  ? -13.879 12.218  -45.242 1.00 39.35  ? 218  LEU B CD2   1 
ATOM   3314  N  N     . PHE B 1 219  ? -10.697 15.499  -42.847 1.00 42.36  ? 219  PHE B N     1 
ATOM   3315  C  CA    . PHE B 1 219  ? -10.586 16.526  -41.817 1.00 52.85  ? 219  PHE B CA    1 
ATOM   3316  C  C     . PHE B 1 219  ? -10.470 17.925  -42.419 1.00 50.89  ? 219  PHE B C     1 
ATOM   3317  O  O     . PHE B 1 219  ? -10.571 18.923  -41.708 1.00 52.90  ? 219  PHE B O     1 
ATOM   3318  C  CB    . PHE B 1 219  ? -9.392  16.231  -40.904 1.00 56.11  ? 219  PHE B CB    1 
ATOM   3319  C  CG    . PHE B 1 219  ? -9.523  14.942  -40.139 1.00 51.96  ? 219  PHE B CG    1 
ATOM   3320  C  CD1   . PHE B 1 219  ? -10.751 14.540  -39.640 1.00 53.76  ? 219  PHE B CD1   1 
ATOM   3321  C  CD2   . PHE B 1 219  ? -8.424  14.128  -39.930 1.00 48.64  ? 219  PHE B CD2   1 
ATOM   3322  C  CE1   . PHE B 1 219  ? -10.880 13.354  -38.939 1.00 50.48  ? 219  PHE B CE1   1 
ATOM   3323  C  CE2   . PHE B 1 219  ? -8.548  12.941  -39.232 1.00 48.17  ? 219  PHE B CE2   1 
ATOM   3324  C  CZ    . PHE B 1 219  ? -9.776  12.553  -38.736 1.00 48.90  ? 219  PHE B CZ    1 
ATOM   3325  N  N     . GLY B 1 220  ? -10.265 17.993  -43.730 1.00 47.00  ? 220  GLY B N     1 
ATOM   3326  C  CA    . GLY B 1 220  ? -10.273 19.262  -44.429 1.00 52.19  ? 220  GLY B CA    1 
ATOM   3327  C  C     . GLY B 1 220  ? -11.594 19.989  -44.249 1.00 57.96  ? 220  GLY B C     1 
ATOM   3328  O  O     . GLY B 1 220  ? -11.615 21.195  -44.008 1.00 63.76  ? 220  GLY B O     1 
ATOM   3329  N  N     . LEU B 1 221  ? -12.694 19.244  -44.350 1.00 51.43  ? 221  LEU B N     1 
ATOM   3330  C  CA    . LEU B 1 221  ? -14.040 19.806  -44.250 1.00 49.60  ? 221  LEU B CA    1 
ATOM   3331  C  C     . LEU B 1 221  ? -14.223 20.644  -42.995 1.00 54.37  ? 221  LEU B C     1 
ATOM   3332  O  O     . LEU B 1 221  ? -14.727 21.765  -43.048 1.00 59.28  ? 221  LEU B O     1 
ATOM   3333  C  CB    . LEU B 1 221  ? -15.088 18.693  -44.274 1.00 48.76  ? 221  LEU B CB    1 
ATOM   3334  C  CG    . LEU B 1 221  ? -15.576 18.254  -45.653 1.00 60.45  ? 221  LEU B CG    1 
ATOM   3335  C  CD1   . LEU B 1 221  ? -16.057 19.466  -46.437 1.00 66.42  ? 221  LEU B CD1   1 
ATOM   3336  C  CD2   . LEU B 1 221  ? -14.493 17.511  -46.419 1.00 57.61  ? 221  LEU B CD2   1 
ATOM   3337  N  N     . ALA B 1 222  ? -13.805 20.088  -41.867 1.00 53.46  ? 222  ALA B N     1 
ATOM   3338  C  CA    . ALA B 1 222  ? -13.868 20.797  -40.601 1.00 58.14  ? 222  ALA B CA    1 
ATOM   3339  C  C     . ALA B 1 222  ? -12.960 22.025  -40.604 1.00 60.22  ? 222  ALA B C     1 
ATOM   3340  O  O     . ALA B 1 222  ? -13.385 23.120  -40.234 1.00 57.66  ? 222  ALA B O     1 
ATOM   3341  C  CB    . ALA B 1 222  ? -13.493 19.865  -39.463 1.00 57.38  ? 222  ALA B CB    1 
ATOM   3342  N  N     . ARG B 1 223  ? -11.715 21.836  -41.035 1.00 62.78  ? 223  ARG B N     1 
ATOM   3343  C  CA    . ARG B 1 223  ? -10.696 22.882  -40.953 1.00 62.14  ? 223  ARG B CA    1 
ATOM   3344  C  C     . ARG B 1 223  ? -11.021 24.105  -41.803 1.00 63.37  ? 223  ARG B C     1 
ATOM   3345  O  O     . ARG B 1 223  ? -10.617 25.222  -41.477 1.00 75.04  ? 223  ARG B O     1 
ATOM   3346  C  CB    . ARG B 1 223  ? -9.331  22.341  -41.373 1.00 58.68  ? 223  ARG B CB    1 
ATOM   3347  C  CG    . ARG B 1 223  ? -8.222  23.367  -41.235 1.00 59.85  ? 223  ARG B CG    1 
ATOM   3348  C  CD    . ARG B 1 223  ? -7.040  23.071  -42.131 1.00 65.03  ? 223  ARG B CD    1 
ATOM   3349  N  NE    . ARG B 1 223  ? -6.076  24.163  -42.082 1.00 76.03  ? 223  ARG B NE    1 
ATOM   3350  C  CZ    . ARG B 1 223  ? -4.930  24.183  -42.755 1.00 80.34  ? 223  ARG B CZ    1 
ATOM   3351  N  NH1   . ARG B 1 223  ? -4.115  25.224  -42.646 1.00 80.33  ? 223  ARG B NH1   1 
ATOM   3352  N  NH2   . ARG B 1 223  ? -4.598  23.162  -43.537 1.00 73.50  ? 223  ARG B NH2   1 
ATOM   3353  N  N     . GLU B 1 224  ? -11.749 23.893  -42.893 1.00 61.32  ? 224  GLU B N     1 
ATOM   3354  C  CA    . GLU B 1 224  ? -12.068 24.972  -43.822 1.00 68.30  ? 224  GLU B CA    1 
ATOM   3355  C  C     . GLU B 1 224  ? -12.812 26.128  -43.152 1.00 72.26  ? 224  GLU B C     1 
ATOM   3356  O  O     . GLU B 1 224  ? -12.696 27.279  -43.575 1.00 71.57  ? 224  GLU B O     1 
ATOM   3357  C  CB    . GLU B 1 224  ? -12.904 24.438  -44.984 1.00 69.16  ? 224  GLU B CB    1 
ATOM   3358  C  CG    . GLU B 1 224  ? -12.148 23.548  -45.956 1.00 61.80  ? 224  GLU B CG    1 
ATOM   3359  C  CD    . GLU B 1 224  ? -13.076 22.693  -46.799 1.00 62.62  ? 224  GLU B CD    1 
ATOM   3360  O  OE1   . GLU B 1 224  ? -14.266 23.047  -46.922 1.00 67.61  ? 224  GLU B OE1   1 
ATOM   3361  O  OE2   . GLU B 1 224  ? -12.619 21.660  -47.329 1.00 61.93  ? 224  GLU B OE2   1 
ATOM   3362  N  N     . LEU B 1 225  ? -13.557 25.816  -42.095 1.00 61.58  ? 225  LEU B N     1 
ATOM   3363  C  CA    . LEU B 1 225  ? -14.501 26.760  -41.504 1.00 54.72  ? 225  LEU B CA    1 
ATOM   3364  C  C     . LEU B 1 225  ? -13.876 27.953  -40.766 1.00 51.41  ? 225  LEU B C     1 
ATOM   3365  O  O     . LEU B 1 225  ? -14.550 28.961  -40.561 1.00 45.13  ? 225  LEU B O     1 
ATOM   3366  C  CB    . LEU B 1 225  ? -15.437 26.011  -40.555 1.00 44.87  ? 225  LEU B CB    1 
ATOM   3367  C  CG    . LEU B 1 225  ? -16.472 25.111  -41.233 1.00 36.06  ? 225  LEU B CG    1 
ATOM   3368  C  CD1   . LEU B 1 225  ? -17.223 24.266  -40.216 1.00 30.70  ? 225  LEU B CD1   1 
ATOM   3369  C  CD2   . LEU B 1 225  ? -17.441 25.953  -42.043 1.00 39.81  ? 225  LEU B CD2   1 
ATOM   3370  N  N     . ASN B 1 226  ? -12.605 27.857  -40.378 1.00 55.49  ? 226  ASN B N     1 
ATOM   3371  C  CA    . ASN B 1 226  ? -11.993 28.925  -39.586 1.00 60.84  ? 226  ASN B CA    1 
ATOM   3372  C  C     . ASN B 1 226  ? -10.463 28.907  -39.529 1.00 68.84  ? 226  ASN B C     1 
ATOM   3373  O  O     . ASN B 1 226  ? -9.839  29.966  -39.425 1.00 62.80  ? 226  ASN B O     1 
ATOM   3374  C  CB    . ASN B 1 226  ? -12.537 28.871  -38.158 1.00 64.49  ? 226  ASN B CB    1 
ATOM   3375  C  CG    . ASN B 1 226  ? -12.373 30.188  -37.415 1.00 79.67  ? 226  ASN B CG    1 
ATOM   3376  O  OD1   . ASN B 1 226  ? -11.694 31.101  -37.883 1.00 84.16  ? 226  ASN B OD1   1 
ATOM   3377  N  ND2   . ASN B 1 226  ? -12.996 30.287  -36.246 1.00 75.36  ? 226  ASN B ND2   1 
ATOM   3378  N  N     . VAL B 1 227  ? -9.879  27.710  -39.620 1.00 84.27  ? 227  VAL B N     1 
ATOM   3379  C  CA    . VAL B 1 227  ? -8.460  27.446  -39.323 1.00 88.55  ? 227  VAL B CA    1 
ATOM   3380  C  C     . VAL B 1 227  ? -7.979  28.328  -38.151 1.00 90.85  ? 227  VAL B C     1 
ATOM   3381  O  O     . VAL B 1 227  ? -7.208  29.277  -38.320 1.00 96.64  ? 227  VAL B O     1 
ATOM   3382  C  CB    . VAL B 1 227  ? -7.546  27.603  -40.607 1.00 81.33  ? 227  VAL B CB    1 
ATOM   3383  C  CG1   . VAL B 1 227  ? -7.639  28.989  -41.256 1.00 80.24  ? 227  VAL B CG1   1 
ATOM   3384  C  CG2   . VAL B 1 227  ? -6.090  27.222  -40.311 1.00 68.69  ? 227  VAL B CG2   1 
ATOM   3385  N  N     . GLU B 1 228  ? -8.465  27.999  -36.952 1.00 83.85  ? 228  GLU B N     1 
ATOM   3386  C  CA    . GLU B 1 228  ? -8.247  28.829  -35.763 1.00 83.78  ? 228  GLU B CA    1 
ATOM   3387  C  C     . GLU B 1 228  ? -6.865  28.659  -35.141 1.00 81.03  ? 228  GLU B C     1 
ATOM   3388  O  O     . GLU B 1 228  ? -6.019  29.545  -35.257 1.00 91.04  ? 228  GLU B O     1 
ATOM   3389  C  CB    . GLU B 1 228  ? -9.311  28.545  -34.687 1.00 79.25  ? 228  GLU B CB    1 
ATOM   3390  C  CG    . GLU B 1 228  ? -9.152  29.407  -33.413 1.00 78.27  ? 228  GLU B CG    1 
ATOM   3391  C  CD    . GLU B 1 228  ? -10.293 29.244  -32.407 1.00 68.22  ? 228  GLU B CD    1 
ATOM   3392  O  OE1   . GLU B 1 228  ? -11.147 28.355  -32.601 1.00 61.58  ? 228  GLU B OE1   1 
ATOM   3393  O  OE2   . GLU B 1 228  ? -10.338 30.011  -31.419 1.00 61.17  ? 228  GLU B OE2   1 
ATOM   3394  N  N     . ALA B 1 229  ? -6.639  27.534  -34.467 1.00 72.11  ? 229  ALA B N     1 
ATOM   3395  C  CA    . ALA B 1 229  ? -5.435  27.394  -33.653 1.00 75.95  ? 229  ALA B CA    1 
ATOM   3396  C  C     . ALA B 1 229  ? -4.953  25.955  -33.473 1.00 74.93  ? 229  ALA B C     1 
ATOM   3397  O  O     . ALA B 1 229  ? -5.751  25.027  -33.331 1.00 68.82  ? 229  ALA B O     1 
ATOM   3398  C  CB    . ALA B 1 229  ? -5.668  28.032  -32.288 1.00 70.71  ? 229  ALA B CB    1 
ATOM   3399  N  N     . GLU B 1 230  ? -3.630  25.807  -33.471 1.00 70.79  ? 230  GLU B N     1 
ATOM   3400  C  CA    . GLU B 1 230  ? -2.929  24.551  -33.208 1.00 58.78  ? 230  GLU B CA    1 
ATOM   3401  C  C     . GLU B 1 230  ? -1.431  24.843  -33.221 1.00 59.49  ? 230  GLU B C     1 
ATOM   3402  O  O     . GLU B 1 230  ? -0.994  25.775  -33.892 1.00 73.94  ? 230  GLU B O     1 
ATOM   3403  C  CB    . GLU B 1 230  ? -3.279  23.480  -34.246 1.00 64.12  ? 230  GLU B CB    1 
ATOM   3404  C  CG    . GLU B 1 230  ? -2.530  22.169  -34.072 1.00 57.81  ? 230  GLU B CG    1 
ATOM   3405  C  CD    . GLU B 1 230  ? -2.680  21.598  -32.679 1.00 48.02  ? 230  GLU B CD    1 
ATOM   3406  O  OE1   . GLU B 1 230  ? -3.788  21.700  -32.112 1.00 42.58  ? 230  GLU B OE1   1 
ATOM   3407  O  OE2   . GLU B 1 230  ? -1.689  21.056  -32.149 1.00 48.35  ? 230  GLU B OE2   1 
ATOM   3408  N  N     . GLY B 1 231  ? -0.641  24.059  -32.490 1.00 46.93  ? 231  GLY B N     1 
ATOM   3409  C  CA    . GLY B 1 231  ? 0.795   24.284  -32.441 1.00 56.14  ? 231  GLY B CA    1 
ATOM   3410  C  C     . GLY B 1 231  ? 1.679   23.065  -32.649 1.00 59.85  ? 231  GLY B C     1 
ATOM   3411  O  O     . GLY B 1 231  ? 1.637   22.122  -31.864 1.00 64.49  ? 231  GLY B O     1 
ATOM   3412  N  N     . ILE B 1 232  ? 2.490   23.089  -33.704 1.00 56.70  ? 232  ILE B N     1 
ATOM   3413  C  CA    . ILE B 1 232  ? 3.471   22.031  -33.937 1.00 52.93  ? 232  ILE B CA    1 
ATOM   3414  C  C     . ILE B 1 232  ? 4.889   22.584  -34.035 1.00 58.72  ? 232  ILE B C     1 
ATOM   3415  O  O     . ILE B 1 232  ? 5.174   23.455  -34.857 1.00 58.93  ? 232  ILE B O     1 
ATOM   3416  C  CB    . ILE B 1 232  ? 3.159   21.239  -35.215 1.00 45.75  ? 232  ILE B CB    1 
ATOM   3417  C  CG1   . ILE B 1 232  ? 1.912   20.385  -35.005 1.00 43.59  ? 232  ILE B CG1   1 
ATOM   3418  C  CG2   . ILE B 1 232  ? 4.330   20.352  -35.591 1.00 47.66  ? 232  ILE B CG2   1 
ATOM   3419  C  CD1   . ILE B 1 232  ? 2.084   19.318  -33.956 1.00 54.37  ? 232  ILE B CD1   1 
ATOM   3420  N  N     . SER C 2 28   ? -43.736 10.175  1.963   1.00 49.45  ? 28   SER C N     1 
ATOM   3421  C  CA    . SER C 2 28   ? -42.694 10.671  2.855   1.00 52.97  ? 28   SER C CA    1 
ATOM   3422  C  C     . SER C 2 28   ? -42.245 9.588   3.835   1.00 67.61  ? 28   SER C C     1 
ATOM   3423  O  O     . SER C 2 28   ? -42.897 8.550   3.967   1.00 77.37  ? 28   SER C O     1 
ATOM   3424  C  CB    . SER C 2 28   ? -43.184 11.902  3.617   1.00 44.40  ? 28   SER C CB    1 
ATOM   3425  N  N     . ASN C 2 29   ? -41.131 9.839   4.517   1.00 63.40  ? 29   ASN C N     1 
ATOM   3426  C  CA    . ASN C 2 29   ? -40.577 8.884   5.472   1.00 61.02  ? 29   ASN C CA    1 
ATOM   3427  C  C     . ASN C 2 29   ? -40.638 9.410   6.897   1.00 57.26  ? 29   ASN C C     1 
ATOM   3428  O  O     . ASN C 2 29   ? -41.503 9.023   7.685   1.00 50.58  ? 29   ASN C O     1 
ATOM   3429  C  CB    . ASN C 2 29   ? -39.128 8.544   5.110   1.00 51.94  ? 29   ASN C CB    1 
ATOM   3430  N  N     . ASN C 2 30   ? -39.704 10.297  7.215   1.00 57.86  ? 30   ASN C N     1 
ATOM   3431  C  CA    . ASN C 2 30   ? -39.631 10.909  8.533   1.00 58.12  ? 30   ASN C CA    1 
ATOM   3432  C  C     . ASN C 2 30   ? -40.112 12.350  8.485   1.00 51.01  ? 30   ASN C C     1 
ATOM   3433  O  O     . ASN C 2 30   ? -39.310 13.282  8.487   1.00 48.04  ? 30   ASN C O     1 
ATOM   3434  C  CB    . ASN C 2 30   ? -38.200 10.846  9.067   1.00 56.15  ? 30   ASN C CB    1 
ATOM   3435  C  CG    . ASN C 2 30   ? -37.636 9.436   9.055   1.00 65.49  ? 30   ASN C CG    1 
ATOM   3436  O  OD1   . ASN C 2 30   ? -37.448 8.838   7.994   1.00 60.69  ? 30   ASN C OD1   1 
ATOM   3437  N  ND2   . ASN C 2 30   ? -37.356 8.901   10.238  1.00 66.24  ? 30   ASN C ND2   1 
ATOM   3438  N  N     . SER C 2 31   ? -41.426 12.531  8.441   1.00 49.84  ? 31   SER C N     1 
ATOM   3439  C  CA    . SER C 2 31   ? -42.002 13.859  8.285   1.00 46.30  ? 31   SER C CA    1 
ATOM   3440  C  C     . SER C 2 31   ? -42.014 14.614  9.610   1.00 47.27  ? 31   SER C C     1 
ATOM   3441  O  O     . SER C 2 31   ? -43.048 15.144  10.013  1.00 57.76  ? 31   SER C O     1 
ATOM   3442  C  CB    . SER C 2 31   ? -43.423 13.757  7.722   1.00 42.48  ? 31   SER C CB    1 
ATOM   3443  O  OG    . SER C 2 31   ? -43.456 12.944  6.561   1.00 40.58  ? 31   SER C OG    1 
ATOM   3444  N  N     . VAL C 2 32   ? -40.866 14.671  10.282  1.00 42.35  ? 32   VAL C N     1 
ATOM   3445  C  CA    . VAL C 2 32   ? -40.808 15.235  11.633  1.00 39.36  ? 32   VAL C CA    1 
ATOM   3446  C  C     . VAL C 2 32   ? -39.997 16.538  11.791  1.00 27.07  ? 32   VAL C C     1 
ATOM   3447  O  O     . VAL C 2 32   ? -40.488 17.486  12.399  1.00 24.63  ? 32   VAL C O     1 
ATOM   3448  C  CB    . VAL C 2 32   ? -40.248 14.199  12.645  1.00 33.51  ? 32   VAL C CB    1 
ATOM   3449  C  CG1   . VAL C 2 32   ? -40.491 14.671  14.072  1.00 19.04  ? 32   VAL C CG1   1 
ATOM   3450  C  CG2   . VAL C 2 32   ? -40.885 12.838  12.422  1.00 37.42  ? 32   VAL C CG2   1 
ATOM   3451  N  N     . PRO C 2 33   ? -38.761 16.601  11.257  1.00 24.99  ? 33   PRO C N     1 
ATOM   3452  C  CA    . PRO C 2 33   ? -37.947 17.769  11.620  1.00 22.65  ? 33   PRO C CA    1 
ATOM   3453  C  C     . PRO C 2 33   ? -38.154 19.008  10.744  1.00 16.12  ? 33   PRO C C     1 
ATOM   3454  O  O     . PRO C 2 33   ? -38.451 20.097  11.236  1.00 8.19   ? 33   PRO C O     1 
ATOM   3455  C  CB    . PRO C 2 33   ? -36.505 17.257  11.444  1.00 16.70  ? 33   PRO C CB    1 
ATOM   3456  C  CG    . PRO C 2 33   ? -36.614 15.811  11.003  1.00 16.49  ? 33   PRO C CG    1 
ATOM   3457  C  CD    . PRO C 2 33   ? -37.983 15.653  10.445  1.00 25.39  ? 33   PRO C CD    1 
ATOM   3458  N  N     . GLY C 2 34   ? -37.980 18.823  9.442   1.00 17.71  ? 34   GLY C N     1 
ATOM   3459  C  CA    . GLY C 2 34   ? -37.896 19.915  8.490   1.00 13.87  ? 34   GLY C CA    1 
ATOM   3460  C  C     . GLY C 2 34   ? -36.915 19.464  7.425   1.00 16.96  ? 34   GLY C C     1 
ATOM   3461  O  O     . GLY C 2 34   ? -36.032 20.210  6.999   1.00 5.28   ? 34   GLY C O     1 
ATOM   3462  N  N     . ALA C 2 35   ? -37.091 18.215  7.006   1.00 19.93  ? 35   ALA C N     1 
ATOM   3463  C  CA    . ALA C 2 35   ? -36.123 17.501  6.189   1.00 12.44  ? 35   ALA C CA    1 
ATOM   3464  C  C     . ALA C 2 35   ? -36.626 17.250  4.778   1.00 8.66   ? 35   ALA C C     1 
ATOM   3465  O  O     . ALA C 2 35   ? -37.827 17.138  4.556   1.00 10.80  ? 35   ALA C O     1 
ATOM   3466  C  CB    . ALA C 2 35   ? -35.767 16.175  6.859   1.00 16.48  ? 35   ALA C CB    1 
ATOM   3467  N  N     . PRO C 2 36   ? -35.697 17.145  3.817   1.00 11.05  ? 36   PRO C N     1 
ATOM   3468  C  CA    . PRO C 2 36   ? -36.030 16.875  2.417   1.00 16.12  ? 36   PRO C CA    1 
ATOM   3469  C  C     . PRO C 2 36   ? -36.883 15.632  2.260   1.00 12.52  ? 36   PRO C C     1 
ATOM   3470  O  O     . PRO C 2 36   ? -36.747 14.670  3.015   1.00 13.09  ? 36   PRO C O     1 
ATOM   3471  C  CB    . PRO C 2 36   ? -34.660 16.676  1.754   1.00 14.90  ? 36   PRO C CB    1 
ATOM   3472  C  CG    . PRO C 2 36   ? -33.719 16.402  2.872   1.00 13.52  ? 36   PRO C CG    1 
ATOM   3473  C  CD    . PRO C 2 36   ? -34.243 17.212  4.017   1.00 12.73  ? 36   PRO C CD    1 
ATOM   3474  N  N     . ASN C 2 37   ? -37.768 15.660  1.278   1.00 11.97  ? 37   ASN C N     1 
ATOM   3475  C  CA    . ASN C 2 37   ? -38.728 14.591  1.139   1.00 11.73  ? 37   ASN C CA    1 
ATOM   3476  C  C     . ASN C 2 37   ? -38.130 13.378  0.450   1.00 13.85  ? 37   ASN C C     1 
ATOM   3477  O  O     . ASN C 2 37   ? -37.816 13.417  -0.736  1.00 12.80  ? 37   ASN C O     1 
ATOM   3478  C  CB    . ASN C 2 37   ? -39.946 15.075  0.375   1.00 12.41  ? 37   ASN C CB    1 
ATOM   3479  C  CG    . ASN C 2 37   ? -41.056 14.064  0.384   1.00 21.81  ? 37   ASN C CG    1 
ATOM   3480  O  OD1   . ASN C 2 37   ? -41.385 13.498  1.425   1.00 28.96  ? 37   ASN C OD1   1 
ATOM   3481  N  ND2   . ASN C 2 37   ? -41.626 13.805  -0.782  1.00 23.22  ? 37   ASN C ND2   1 
ATOM   3482  N  N     . ARG C 2 38   ? -37.976 12.301  1.215   1.00 28.63  ? 38   ARG C N     1 
ATOM   3483  C  CA    . ARG C 2 38   ? -37.431 11.044  0.708   1.00 24.63  ? 38   ARG C CA    1 
ATOM   3484  C  C     . ARG C 2 38   ? -38.538 10.002  0.616   1.00 19.38  ? 38   ARG C C     1 
ATOM   3485  O  O     . ARG C 2 38   ? -38.901 9.376   1.610   1.00 24.76  ? 38   ARG C O     1 
ATOM   3486  C  CB    . ARG C 2 38   ? -36.282 10.541  1.601   1.00 25.89  ? 38   ARG C CB    1 
ATOM   3487  C  CG    . ARG C 2 38   ? -35.416 9.458   0.950   1.00 17.64  ? 38   ARG C CG    1 
ATOM   3488  C  CD    . ARG C 2 38   ? -34.113 9.175   1.711   1.00 11.67  ? 38   ARG C CD    1 
ATOM   3489  N  NE    . ARG C 2 38   ? -33.197 10.314  1.713   1.00 11.27  ? 38   ARG C NE    1 
ATOM   3490  C  CZ    . ARG C 2 38   ? -32.255 10.527  0.799   1.00 3.49   ? 38   ARG C CZ    1 
ATOM   3491  N  NH1   . ARG C 2 38   ? -31.476 11.593  0.891   1.00 1.57   ? 38   ARG C NH1   1 
ATOM   3492  N  NH2   . ARG C 2 38   ? -32.091 9.681   -0.206  1.00 7.25   ? 38   ARG C NH2   1 
ATOM   3493  N  N     . VAL C 2 39   ? -39.075 9.831   -0.587  1.00 13.87  ? 39   VAL C N     1 
ATOM   3494  C  CA    . VAL C 2 39   ? -40.218 8.956   -0.807  1.00 14.95  ? 39   VAL C CA    1 
ATOM   3495  C  C     . VAL C 2 39   ? -39.850 7.499   -0.552  1.00 9.68   ? 39   VAL C C     1 
ATOM   3496  O  O     . VAL C 2 39   ? -38.815 7.030   -1.012  1.00 11.75  ? 39   VAL C O     1 
ATOM   3497  C  CB    . VAL C 2 39   ? -40.756 9.114   -2.232  1.00 18.65  ? 39   VAL C CB    1 
ATOM   3498  C  CG1   . VAL C 2 39   ? -42.214 8.740   -2.274  1.00 35.09  ? 39   VAL C CG1   1 
ATOM   3499  C  CG2   . VAL C 2 39   ? -40.577 10.549  -2.699  1.00 16.85  ? 39   VAL C CG2   1 
ATOM   3500  N  N     . SER C 2 40   ? -40.688 6.776   0.181   1.00 11.15  ? 40   SER C N     1 
ATOM   3501  C  CA    . SER C 2 40   ? -40.280 5.453   0.630   1.00 12.03  ? 40   SER C CA    1 
ATOM   3502  C  C     . SER C 2 40   ? -41.195 4.312   0.197   1.00 15.29  ? 40   SER C C     1 
ATOM   3503  O  O     . SER C 2 40   ? -42.401 4.349   0.427   1.00 18.64  ? 40   SER C O     1 
ATOM   3504  C  CB    . SER C 2 40   ? -40.160 5.442   2.152   1.00 12.23  ? 40   SER C CB    1 
ATOM   3505  O  OG    . SER C 2 40   ? -39.573 4.229   2.592   1.00 11.63  ? 40   SER C OG    1 
ATOM   3506  N  N     . PHE C 2 41   ? -40.604 3.300   -0.436  1.00 11.58  ? 41   PHE C N     1 
ATOM   3507  C  CA    . PHE C 2 41   ? -41.250 2.002   -0.573  1.00 8.96   ? 41   PHE C CA    1 
ATOM   3508  C  C     . PHE C 2 41   ? -41.407 1.450   0.833   1.00 9.01   ? 41   PHE C C     1 
ATOM   3509  O  O     . PHE C 2 41   ? -40.406 1.189   1.491   1.00 16.04  ? 41   PHE C O     1 
ATOM   3510  C  CB    . PHE C 2 41   ? -40.417 1.017   -1.406  1.00 13.71  ? 41   PHE C CB    1 
ATOM   3511  C  CG    . PHE C 2 41   ? -39.930 1.551   -2.728  1.00 9.45   ? 41   PHE C CG    1 
ATOM   3512  C  CD1   . PHE C 2 41   ? -40.574 1.215   -3.902  1.00 9.03   ? 41   PHE C CD1   1 
ATOM   3513  C  CD2   . PHE C 2 41   ? -38.793 2.331   -2.802  1.00 13.09  ? 41   PHE C CD2   1 
ATOM   3514  C  CE1   . PHE C 2 41   ? -40.121 1.681   -5.114  1.00 11.88  ? 41   PHE C CE1   1 
ATOM   3515  C  CE2   . PHE C 2 41   ? -38.335 2.801   -4.017  1.00 10.41  ? 41   PHE C CE2   1 
ATOM   3516  C  CZ    . PHE C 2 41   ? -39.001 2.475   -5.171  1.00 6.67   ? 41   PHE C CZ    1 
ATOM   3517  N  N     . ALA C 2 42   ? -42.632 1.263   1.307   1.00 9.61   ? 42   ALA C N     1 
ATOM   3518  C  CA    . ALA C 2 42   ? -42.799 0.761   2.669   1.00 16.74  ? 42   ALA C CA    1 
ATOM   3519  C  C     . ALA C 2 42   ? -44.213 0.337   3.017   1.00 28.16  ? 42   ALA C C     1 
ATOM   3520  O  O     . ALA C 2 42   ? -45.183 0.971   2.602   1.00 31.85  ? 42   ALA C O     1 
ATOM   3521  C  CB    . ALA C 2 42   ? -42.342 1.816   3.669   1.00 18.93  ? 42   ALA C CB    1 
ATOM   3522  N  N     . LYS C 2 43   ? -44.319 -0.737  3.793   1.00 27.67  ? 43   LYS C N     1 
ATOM   3523  C  CA    . LYS C 2 43   ? -45.517 -0.953  4.580   1.00 27.02  ? 43   LYS C CA    1 
ATOM   3524  C  C     . LYS C 2 43   ? -45.452 0.096   5.681   1.00 40.74  ? 43   LYS C C     1 
ATOM   3525  O  O     . LYS C 2 43   ? -44.379 0.354   6.232   1.00 39.64  ? 43   LYS C O     1 
ATOM   3526  C  CB    . LYS C 2 43   ? -45.586 -2.361  5.157   1.00 18.56  ? 43   LYS C CB    1 
ATOM   3527  C  CG    . LYS C 2 43   ? -44.627 -2.621  6.298   1.00 24.61  ? 43   LYS C CG    1 
ATOM   3528  C  CD    . LYS C 2 43   ? -45.248 -3.521  7.341   1.00 37.27  ? 43   LYS C CD    1 
ATOM   3529  C  CE    . LYS C 2 43   ? -44.322 -3.706  8.530   1.00 45.32  ? 43   LYS C CE    1 
ATOM   3530  N  NZ    . LYS C 2 43   ? -44.981 -4.469  9.626   1.00 47.70  ? 43   LYS C NZ    1 
ATOM   3531  N  N     . LEU C 2 44   ? -46.583 0.724   5.983   1.00 54.39  ? 44   LEU C N     1 
ATOM   3532  C  CA    . LEU C 2 44   ? -46.580 1.901   6.848   1.00 52.74  ? 44   LEU C CA    1 
ATOM   3533  C  C     . LEU C 2 44   ? -46.020 1.586   8.229   1.00 51.78  ? 44   LEU C C     1 
ATOM   3534  O  O     . LEU C 2 44   ? -46.555 0.756   8.961   1.00 54.18  ? 44   LEU C O     1 
ATOM   3535  C  CB    . LEU C 2 44   ? -47.989 2.481   6.967   1.00 50.00  ? 44   LEU C CB    1 
ATOM   3536  C  CG    . LEU C 2 44   ? -48.064 3.985   7.233   1.00 46.42  ? 44   LEU C CG    1 
ATOM   3537  C  CD1   . LEU C 2 44   ? -49.404 4.531   6.772   1.00 52.36  ? 44   LEU C CD1   1 
ATOM   3538  C  CD2   . LEU C 2 44   ? -47.836 4.309   8.705   1.00 46.58  ? 44   LEU C CD2   1 
ATOM   3539  N  N     . ARG C 2 45   ? -44.933 2.264   8.573   1.00 54.42  ? 45   ARG C N     1 
ATOM   3540  C  CA    . ARG C 2 45   ? -44.280 2.064   9.857   1.00 53.50  ? 45   ARG C CA    1 
ATOM   3541  C  C     . ARG C 2 45   ? -44.567 3.227   10.793  1.00 58.04  ? 45   ARG C C     1 
ATOM   3542  O  O     . ARG C 2 45   ? -43.860 4.238   10.788  1.00 60.43  ? 45   ARG C O     1 
ATOM   3543  C  CB    . ARG C 2 45   ? -42.771 1.893   9.673   1.00 56.24  ? 45   ARG C CB    1 
ATOM   3544  C  CG    . ARG C 2 45   ? -41.995 1.726   10.967  1.00 51.58  ? 45   ARG C CG    1 
ATOM   3545  C  CD    . ARG C 2 45   ? -40.510 1.914   10.725  1.00 44.77  ? 45   ARG C CD    1 
ATOM   3546  N  NE    . ARG C 2 45   ? -40.226 3.206   10.107  1.00 45.06  ? 45   ARG C NE    1 
ATOM   3547  C  CZ    . ARG C 2 45   ? -40.049 4.334   10.787  1.00 49.87  ? 45   ARG C CZ    1 
ATOM   3548  N  NH1   . ARG C 2 45   ? -39.794 5.467   10.145  1.00 53.86  ? 45   ARG C NH1   1 
ATOM   3549  N  NH2   . ARG C 2 45   ? -40.126 4.329   12.111  1.00 49.23  ? 45   ARG C NH2   1 
ATOM   3550  N  N     . GLU C 2 46   ? -45.616 3.079   11.591  1.00 65.73  ? 46   GLU C N     1 
ATOM   3551  C  CA    . GLU C 2 46   ? -45.910 4.050   12.633  1.00 70.68  ? 46   GLU C CA    1 
ATOM   3552  C  C     . GLU C 2 46   ? -45.775 3.569   14.099  1.00 69.61  ? 46   GLU C C     1 
ATOM   3553  O  O     . GLU C 2 46   ? -46.370 4.193   14.979  1.00 79.63  ? 46   GLU C O     1 
ATOM   3554  C  CB    . GLU C 2 46   ? -47.332 4.590   12.428  1.00 76.68  ? 46   GLU C CB    1 
ATOM   3555  C  CG    . GLU C 2 46   ? -48.438 3.558   12.643  1.00 76.86  ? 46   GLU C CG    1 
ATOM   3556  C  CD    . GLU C 2 46   ? -49.809 4.192   12.797  1.00 70.13  ? 46   GLU C CD    1 
ATOM   3557  O  OE1   . GLU C 2 46   ? -50.657 3.617   13.514  1.00 65.85  ? 46   GLU C OE1   1 
ATOM   3558  O  OE2   . GLU C 2 46   ? -50.037 5.267   12.201  1.00 66.15  ? 46   GLU C OE2   1 
ATOM   3559  N  N     . PRO C 2 47   ? -45.011 2.483   14.382  1.00 48.34  ? 47   PRO C N     1 
ATOM   3560  C  CA    . PRO C 2 47   ? -44.928 2.154   15.811  1.00 43.83  ? 47   PRO C CA    1 
ATOM   3561  C  C     . PRO C 2 47   ? -44.272 3.261   16.638  1.00 48.43  ? 47   PRO C C     1 
ATOM   3562  O  O     . PRO C 2 47   ? -44.987 3.985   17.329  1.00 59.58  ? 47   PRO C O     1 
ATOM   3563  C  CB    . PRO C 2 47   ? -44.087 0.879   15.822  1.00 38.75  ? 47   PRO C CB    1 
ATOM   3564  C  CG    . PRO C 2 47   ? -44.351 0.269   14.501  1.00 40.04  ? 47   PRO C CG    1 
ATOM   3565  C  CD    . PRO C 2 47   ? -44.376 1.427   13.572  1.00 41.24  ? 47   PRO C CD    1 
ATOM   3566  N  N     . LEU C 2 48   ? -42.952 3.402   16.579  1.00 40.80  ? 48   LEU C N     1 
ATOM   3567  C  CA    . LEU C 2 48   ? -42.316 4.539   17.236  1.00 41.28  ? 48   LEU C CA    1 
ATOM   3568  C  C     . LEU C 2 48   ? -41.047 4.972   16.523  1.00 32.24  ? 48   LEU C C     1 
ATOM   3569  O  O     . LEU C 2 48   ? -40.350 4.161   15.910  1.00 27.94  ? 48   LEU C O     1 
ATOM   3570  C  CB    . LEU C 2 48   ? -42.023 4.236   18.720  1.00 41.10  ? 48   LEU C CB    1 
ATOM   3571  C  CG    . LEU C 2 48   ? -41.155 3.096   19.298  1.00 36.66  ? 48   LEU C CG    1 
ATOM   3572  C  CD1   . LEU C 2 48   ? -41.745 1.717   19.052  1.00 30.76  ? 48   LEU C CD1   1 
ATOM   3573  C  CD2   . LEU C 2 48   ? -39.703 3.141   18.844  1.00 34.54  ? 48   LEU C CD2   1 
ATOM   3574  N  N     . GLU C 2 49   ? -40.761 6.266   16.606  1.00 34.19  ? 49   GLU C N     1 
ATOM   3575  C  CA    . GLU C 2 49   ? -39.566 6.823   15.993  1.00 38.34  ? 49   GLU C CA    1 
ATOM   3576  C  C     . GLU C 2 49   ? -38.334 6.225   16.654  1.00 25.89  ? 49   GLU C C     1 
ATOM   3577  O  O     . GLU C 2 49   ? -38.386 5.798   17.808  1.00 19.47  ? 49   GLU C O     1 
ATOM   3578  C  CB    . GLU C 2 49   ? -39.544 8.350   16.116  1.00 38.54  ? 49   GLU C CB    1 
ATOM   3579  C  CG    . GLU C 2 49   ? -40.765 9.059   15.548  1.00 43.33  ? 49   GLU C CG    1 
ATOM   3580  C  CD    . GLU C 2 49   ? -40.848 10.508  15.991  1.00 62.13  ? 49   GLU C CD    1 
ATOM   3581  O  OE1   . GLU C 2 49   ? -40.425 10.807  17.128  1.00 64.63  ? 49   GLU C OE1   1 
ATOM   3582  O  OE2   . GLU C 2 49   ? -41.331 11.349  15.205  1.00 71.68  ? 49   GLU C OE2   1 
ATOM   3583  N  N     . VAL C 2 50   ? -37.238 6.172   15.909  1.00 25.18  ? 50   VAL C N     1 
ATOM   3584  C  CA    . VAL C 2 50   ? -35.960 5.777   16.473  1.00 13.97  ? 50   VAL C CA    1 
ATOM   3585  C  C     . VAL C 2 50   ? -35.645 6.652   17.681  1.00 6.94   ? 50   VAL C C     1 
ATOM   3586  O  O     . VAL C 2 50   ? -35.576 7.874   17.562  1.00 6.31   ? 50   VAL C O     1 
ATOM   3587  C  CB    . VAL C 2 50   ? -34.832 5.890   15.437  1.00 15.56  ? 50   VAL C CB    1 
ATOM   3588  C  CG1   . VAL C 2 50   ? -33.479 5.836   16.122  1.00 12.68  ? 50   VAL C CG1   1 
ATOM   3589  C  CG2   . VAL C 2 50   ? -34.962 4.793   14.384  1.00 16.65  ? 50   VAL C CG2   1 
ATOM   3590  N  N     . PRO C 2 51   ? -35.481 6.028   18.854  1.00 5.45   ? 51   PRO C N     1 
ATOM   3591  C  CA    . PRO C 2 51   ? -35.164 6.760   20.081  1.00 1.46   ? 51   PRO C CA    1 
ATOM   3592  C  C     . PRO C 2 51   ? -33.844 7.506   19.952  1.00 1.78   ? 51   PRO C C     1 
ATOM   3593  O  O     . PRO C 2 51   ? -33.058 7.180   19.066  1.00 3.27   ? 51   PRO C O     1 
ATOM   3594  C  CB    . PRO C 2 51   ? -35.083 5.656   21.131  1.00 0.47   ? 51   PRO C CB    1 
ATOM   3595  C  CG    . PRO C 2 51   ? -34.756 4.433   20.358  1.00 5.32   ? 51   PRO C CG    1 
ATOM   3596  C  CD    . PRO C 2 51   ? -35.488 4.573   19.067  1.00 8.43   ? 51   PRO C CD    1 
ATOM   3597  N  N     . GLY C 2 52   ? -33.617 8.497   20.808  1.00 2.70   ? 52   GLY C N     1 
ATOM   3598  C  CA    . GLY C 2 52   ? -32.401 9.288   20.752  1.00 1.52   ? 52   GLY C CA    1 
ATOM   3599  C  C     . GLY C 2 52   ? -31.176 8.403   20.830  1.00 1.41   ? 52   GLY C C     1 
ATOM   3600  O  O     . GLY C 2 52   ? -30.896 7.809   21.867  1.00 6.28   ? 52   GLY C O     1 
ATOM   3601  N  N     . LEU C 2 53   ? -30.449 8.318   19.722  1.00 0.83   ? 53   LEU C N     1 
ATOM   3602  C  CA    . LEU C 2 53   ? -29.354 7.364   19.579  1.00 3.83   ? 53   LEU C CA    1 
ATOM   3603  C  C     . LEU C 2 53   ? -28.254 7.494   20.633  1.00 5.83   ? 53   LEU C C     1 
ATOM   3604  O  O     . LEU C 2 53   ? -27.616 6.503   20.994  1.00 2.48   ? 53   LEU C O     1 
ATOM   3605  C  CB    . LEU C 2 53   ? -28.742 7.498   18.191  1.00 0.81   ? 53   LEU C CB    1 
ATOM   3606  C  CG    . LEU C 2 53   ? -29.646 6.996   17.073  1.00 0.36   ? 53   LEU C CG    1 
ATOM   3607  C  CD1   . LEU C 2 53   ? -28.993 7.210   15.725  1.00 3.53   ? 53   LEU C CD1   1 
ATOM   3608  C  CD2   . LEU C 2 53   ? -29.977 5.529   17.282  1.00 2.32   ? 53   LEU C CD2   1 
ATOM   3609  N  N     . LEU C 2 54   ? -28.035 8.709   21.124  1.00 2.45   ? 54   LEU C N     1 
ATOM   3610  C  CA    . LEU C 2 54   ? -26.977 8.962   22.094  1.00 1.83   ? 54   LEU C CA    1 
ATOM   3611  C  C     . LEU C 2 54   ? -27.413 8.710   23.534  1.00 6.54   ? 54   LEU C C     1 
ATOM   3612  O  O     . LEU C 2 54   ? -26.659 8.985   24.471  1.00 4.89   ? 54   LEU C O     1 
ATOM   3613  C  CB    . LEU C 2 54   ? -26.480 10.395  21.959  1.00 1.53   ? 54   LEU C CB    1 
ATOM   3614  C  CG    . LEU C 2 54   ? -25.681 10.650  20.689  1.00 5.87   ? 54   LEU C CG    1 
ATOM   3615  C  CD1   . LEU C 2 54   ? -25.092 12.040  20.725  1.00 13.96  ? 54   LEU C CD1   1 
ATOM   3616  C  CD2   . LEU C 2 54   ? -24.589 9.606   20.545  1.00 7.95   ? 54   LEU C CD2   1 
ATOM   3617  N  N     . ASP C 2 55   ? -28.618 8.174   23.711  1.00 6.55   ? 55   ASP C N     1 
ATOM   3618  C  CA    . ASP C 2 55   ? -29.177 7.973   25.047  1.00 4.75   ? 55   ASP C CA    1 
ATOM   3619  C  C     . ASP C 2 55   ? -28.417 6.919   25.847  1.00 4.82   ? 55   ASP C C     1 
ATOM   3620  O  O     . ASP C 2 55   ? -28.580 6.814   27.062  1.00 8.35   ? 55   ASP C O     1 
ATOM   3621  C  CB    . ASP C 2 55   ? -30.654 7.586   24.955  1.00 3.71   ? 55   ASP C CB    1 
ATOM   3622  C  CG    . ASP C 2 55   ? -31.551 8.770   24.657  1.00 4.69   ? 55   ASP C CG    1 
ATOM   3623  O  OD1   . ASP C 2 55   ? -31.064 9.763   24.078  1.00 6.56   ? 55   ASP C OD1   1 
ATOM   3624  O  OD2   . ASP C 2 55   ? -32.748 8.708   25.005  1.00 6.13   ? 55   ASP C OD2   1 
ATOM   3625  N  N     . VAL C 2 56   ? -27.586 6.142   25.164  1.00 5.71   ? 56   VAL C N     1 
ATOM   3626  C  CA    . VAL C 2 56   ? -26.815 5.097   25.822  1.00 4.44   ? 56   VAL C CA    1 
ATOM   3627  C  C     . VAL C 2 56   ? -25.736 5.719   26.690  1.00 5.82   ? 56   VAL C C     1 
ATOM   3628  O  O     . VAL C 2 56   ? -25.347 5.162   27.714  1.00 10.25  ? 56   VAL C O     1 
ATOM   3629  C  CB    . VAL C 2 56   ? -26.166 4.147   24.806  1.00 1.32   ? 56   VAL C CB    1 
ATOM   3630  C  CG1   . VAL C 2 56   ? -25.778 2.849   25.483  1.00 2.97   ? 56   VAL C CG1   1 
ATOM   3631  C  CG2   . VAL C 2 56   ? -27.117 3.887   23.655  1.00 3.63   ? 56   VAL C CG2   1 
ATOM   3632  N  N     . GLN C 2 57   ? -25.264 6.887   26.269  1.00 8.10   ? 57   GLN C N     1 
ATOM   3633  C  CA    . GLN C 2 57   ? -24.228 7.616   26.994  1.00 9.48   ? 57   GLN C CA    1 
ATOM   3634  C  C     . GLN C 2 57   ? -24.824 8.745   27.838  1.00 12.90  ? 57   GLN C C     1 
ATOM   3635  O  O     . GLN C 2 57   ? -24.296 9.084   28.902  1.00 10.48  ? 57   GLN C O     1 
ATOM   3636  C  CB    . GLN C 2 57   ? -23.197 8.187   26.021  1.00 7.27   ? 57   GLN C CB    1 
ATOM   3637  C  CG    . GLN C 2 57   ? -22.485 7.149   25.182  1.00 3.82   ? 57   GLN C CG    1 
ATOM   3638  C  CD    . GLN C 2 57   ? -21.082 6.880   25.667  1.00 12.00  ? 57   GLN C CD    1 
ATOM   3639  O  OE1   . GLN C 2 57   ? -20.581 7.559   26.561  1.00 12.42  ? 57   GLN C OE1   1 
ATOM   3640  N  NE2   . GLN C 2 57   ? -20.435 5.887   25.075  1.00 0.67   ? 57   GLN C NE2   1 
ATOM   3641  N  N     . THR C 2 58   ? -25.926 9.323   27.367  1.00 9.80   ? 58   THR C N     1 
ATOM   3642  C  CA    . THR C 2 58   ? -26.537 10.456  28.056  1.00 7.29   ? 58   THR C CA    1 
ATOM   3643  C  C     . THR C 2 58   ? -27.179 10.026  29.371  1.00 6.50   ? 58   THR C C     1 
ATOM   3644  O  O     . THR C 2 58   ? -26.683 10.364  30.442  1.00 11.01  ? 58   THR C O     1 
ATOM   3645  C  CB    . THR C 2 58   ? -27.594 11.156  27.177  1.00 8.75   ? 58   THR C CB    1 
ATOM   3646  O  OG1   . THR C 2 58   ? -27.028 11.465  25.897  1.00 7.76   ? 58   THR C OG1   1 
ATOM   3647  C  CG2   . THR C 2 58   ? -28.055 12.445  27.833  1.00 11.53  ? 58   THR C CG2   1 
ATOM   3648  N  N     . ASP C 2 59   ? -28.269 9.267   29.283  1.00 5.96   ? 59   ASP C N     1 
ATOM   3649  C  CA    . ASP C 2 59   ? -29.007 8.808   30.465  1.00 9.17   ? 59   ASP C CA    1 
ATOM   3650  C  C     . ASP C 2 59   ? -28.114 8.180   31.535  1.00 12.44  ? 59   ASP C C     1 
ATOM   3651  O  O     . ASP C 2 59   ? -28.391 8.291   32.730  1.00 18.48  ? 59   ASP C O     1 
ATOM   3652  C  CB    . ASP C 2 59   ? -30.083 7.799   30.065  1.00 13.18  ? 59   ASP C CB    1 
ATOM   3653  C  CG    . ASP C 2 59   ? -31.112 8.387   29.122  1.00 12.61  ? 59   ASP C CG    1 
ATOM   3654  O  OD1   . ASP C 2 59   ? -31.135 9.629   28.971  1.00 13.26  ? 59   ASP C OD1   1 
ATOM   3655  O  OD2   . ASP C 2 59   ? -31.901 7.616   28.532  1.00 14.31  ? 59   ASP C OD2   1 
ATOM   3656  N  N     . SER C 2 60   ? -27.045 7.518   31.105  1.00 15.07  ? 60   SER C N     1 
ATOM   3657  C  CA    . SER C 2 60   ? -26.127 6.882   32.042  1.00 7.15   ? 60   SER C CA    1 
ATOM   3658  C  C     . SER C 2 60   ? -25.396 7.918   32.886  1.00 7.60   ? 60   SER C C     1 
ATOM   3659  O  O     . SER C 2 60   ? -25.326 7.788   34.107  1.00 7.63   ? 60   SER C O     1 
ATOM   3660  C  CB    . SER C 2 60   ? -25.115 6.009   31.306  1.00 6.00   ? 60   SER C CB    1 
ATOM   3661  O  OG    . SER C 2 60   ? -24.030 5.687   32.148  1.00 5.73   ? 60   SER C OG    1 
ATOM   3662  N  N     . PHE C 2 61   ? -24.857 8.948   32.237  1.00 10.77  ? 61   PHE C N     1 
ATOM   3663  C  CA    . PHE C 2 61   ? -24.057 9.948   32.945  1.00 10.98  ? 61   PHE C CA    1 
ATOM   3664  C  C     . PHE C 2 61   ? -24.924 10.857  33.800  1.00 10.95  ? 61   PHE C C     1 
ATOM   3665  O  O     . PHE C 2 61   ? -24.430 11.515  34.713  1.00 10.74  ? 61   PHE C O     1 
ATOM   3666  C  CB    . PHE C 2 61   ? -23.236 10.790  31.966  1.00 3.99   ? 61   PHE C CB    1 
ATOM   3667  C  CG    . PHE C 2 61   ? -22.123 11.572  32.623  1.00 1.32   ? 61   PHE C CG    1 
ATOM   3668  C  CD1   . PHE C 2 61   ? -22.212 12.944  32.772  1.00 8.95   ? 61   PHE C CD1   1 
ATOM   3669  C  CD2   . PHE C 2 61   ? -20.993 10.931  33.094  1.00 0.51   ? 61   PHE C CD2   1 
ATOM   3670  C  CE1   . PHE C 2 61   ? -21.189 13.662  33.373  1.00 9.04   ? 61   PHE C CE1   1 
ATOM   3671  C  CE2   . PHE C 2 61   ? -19.976 11.640  33.695  1.00 1.07   ? 61   PHE C CE2   1 
ATOM   3672  C  CZ    . PHE C 2 61   ? -20.072 13.007  33.834  1.00 4.39   ? 61   PHE C CZ    1 
ATOM   3673  N  N     . GLU C 2 62   ? -26.217 10.897  33.509  1.00 7.88   ? 62   GLU C N     1 
ATOM   3674  C  CA    . GLU C 2 62   ? -27.119 11.702  34.314  1.00 12.00  ? 62   GLU C CA    1 
ATOM   3675  C  C     . GLU C 2 62   ? -27.370 10.998  35.643  1.00 14.80  ? 62   GLU C C     1 
ATOM   3676  O  O     . GLU C 2 62   ? -27.496 11.643  36.682  1.00 19.11  ? 62   GLU C O     1 
ATOM   3677  C  CB    . GLU C 2 62   ? -28.424 11.971  33.563  1.00 17.55  ? 62   GLU C CB    1 
ATOM   3678  C  CG    . GLU C 2 62   ? -28.195 12.627  32.205  1.00 20.10  ? 62   GLU C CG    1 
ATOM   3679  C  CD    . GLU C 2 62   ? -29.390 13.414  31.706  1.00 25.54  ? 62   GLU C CD    1 
ATOM   3680  O  OE1   . GLU C 2 62   ? -29.785 14.392  32.374  1.00 31.89  ? 62   GLU C OE1   1 
ATOM   3681  O  OE2   . GLU C 2 62   ? -29.929 13.056  30.639  1.00 27.32  ? 62   GLU C OE2   1 
ATOM   3682  N  N     . TRP C 2 63   ? -27.405 9.668   35.610  1.00 10.59  ? 63   TRP C N     1 
ATOM   3683  C  CA    . TRP C 2 63   ? -27.618 8.873   36.817  1.00 11.71  ? 63   TRP C CA    1 
ATOM   3684  C  C     . TRP C 2 63   ? -26.414 8.940   37.733  1.00 11.18  ? 63   TRP C C     1 
ATOM   3685  O  O     . TRP C 2 63   ? -26.513 8.766   38.947  1.00 14.29  ? 63   TRP C O     1 
ATOM   3686  C  CB    . TRP C 2 63   ? -27.906 7.419   36.462  1.00 13.41  ? 63   TRP C CB    1 
ATOM   3687  C  CG    . TRP C 2 63   ? -27.744 6.488   37.623  1.00 18.79  ? 63   TRP C CG    1 
ATOM   3688  C  CD1   . TRP C 2 63   ? -28.658 6.232   38.603  1.00 24.00  ? 63   TRP C CD1   1 
ATOM   3689  C  CD2   . TRP C 2 63   ? -26.594 5.693   37.934  1.00 20.44  ? 63   TRP C CD2   1 
ATOM   3690  N  NE1   . TRP C 2 63   ? -28.153 5.321   39.503  1.00 23.31  ? 63   TRP C NE1   1 
ATOM   3691  C  CE2   . TRP C 2 63   ? -26.886 4.975   39.113  1.00 20.17  ? 63   TRP C CE2   1 
ATOM   3692  C  CE3   . TRP C 2 63   ? -25.346 5.516   37.330  1.00 24.08  ? 63   TRP C CE3   1 
ATOM   3693  C  CZ2   . TRP C 2 63   ? -25.979 4.096   39.695  1.00 21.83  ? 63   TRP C CZ2   1 
ATOM   3694  C  CZ3   . TRP C 2 63   ? -24.445 4.638   37.913  1.00 23.17  ? 63   TRP C CZ3   1 
ATOM   3695  C  CH2   . TRP C 2 63   ? -24.767 3.942   39.081  1.00 21.19  ? 63   TRP C CH2   1 
ATOM   3696  N  N     . LEU C 2 64   ? -25.265 9.182   37.128  1.00 13.06  ? 64   LEU C N     1 
ATOM   3697  C  CA    . LEU C 2 64   ? -24.041 9.317   37.879  1.00 10.55  ? 64   LEU C CA    1 
ATOM   3698  C  C     . LEU C 2 64   ? -24.078 10.552  38.764  1.00 8.83   ? 64   LEU C C     1 
ATOM   3699  O  O     . LEU C 2 64   ? -23.673 10.505  39.921  1.00 11.41  ? 64   LEU C O     1 
ATOM   3700  C  CB    . LEU C 2 64   ? -22.852 9.386   36.936  1.00 6.74   ? 64   LEU C CB    1 
ATOM   3701  C  CG    . LEU C 2 64   ? -21.535 9.338   37.695  1.00 6.05   ? 64   LEU C CG    1 
ATOM   3702  C  CD1   . LEU C 2 64   ? -21.267 7.922   38.176  1.00 4.62   ? 64   LEU C CD1   1 
ATOM   3703  C  CD2   . LEU C 2 64   ? -20.430 9.842   36.808  1.00 7.59   ? 64   LEU C CD2   1 
ATOM   3704  N  N     . ILE C 2 65   ? -24.569 11.658  38.215  1.00 7.44   ? 65   ILE C N     1 
ATOM   3705  C  CA    . ILE C 2 65   ? -24.606 12.912  38.960  1.00 7.93   ? 65   ILE C CA    1 
ATOM   3706  C  C     . ILE C 2 65   ? -25.978 13.206  39.544  1.00 11.22  ? 65   ILE C C     1 
ATOM   3707  O  O     . ILE C 2 65   ? -26.135 14.133  40.334  1.00 16.71  ? 65   ILE C O     1 
ATOM   3708  C  CB    . ILE C 2 65   ? -24.193 14.113  38.086  1.00 7.27   ? 65   ILE C CB    1 
ATOM   3709  C  CG1   . ILE C 2 65   ? -25.188 14.312  36.945  1.00 13.59  ? 65   ILE C CG1   1 
ATOM   3710  C  CG2   . ILE C 2 65   ? -22.779 13.939  37.560  1.00 8.15   ? 65   ILE C CG2   1 
ATOM   3711  C  CD1   . ILE C 2 65   ? -24.874 15.511  36.081  1.00 13.59  ? 65   ILE C CD1   1 
ATOM   3712  N  N     . GLY C 2 66   ? -26.973 12.421  39.156  1.00 9.05   ? 66   GLY C N     1 
ATOM   3713  C  CA    . GLY C 2 66   ? -28.322 12.620  39.651  1.00 19.82  ? 66   GLY C CA    1 
ATOM   3714  C  C     . GLY C 2 66   ? -28.939 13.922  39.175  1.00 28.47  ? 66   GLY C C     1 
ATOM   3715  O  O     . GLY C 2 66   ? -29.592 14.627  39.945  1.00 34.72  ? 66   GLY C O     1 
ATOM   3716  N  N     . SER C 2 67   ? -28.733 14.231  37.897  1.00 25.49  ? 67   SER C N     1 
ATOM   3717  C  CA    . SER C 2 67   ? -29.238 15.457  37.288  1.00 26.60  ? 67   SER C CA    1 
ATOM   3718  C  C     . SER C 2 67   ? -30.755 15.570  37.425  1.00 31.27  ? 67   SER C C     1 
ATOM   3719  O  O     . SER C 2 67   ? -31.438 14.564  37.620  1.00 26.38  ? 67   SER C O     1 
ATOM   3720  C  CB    . SER C 2 67   ? -28.848 15.516  35.808  1.00 22.46  ? 67   SER C CB    1 
ATOM   3721  O  OG    . SER C 2 67   ? -29.679 14.669  35.038  1.00 23.86  ? 67   SER C OG    1 
ATOM   3722  N  N     . PRO C 2 68   ? -31.282 16.804  37.343  1.00 36.74  ? 68   PRO C N     1 
ATOM   3723  C  CA    . PRO C 2 68   ? -32.727 17.050  37.338  1.00 34.88  ? 68   PRO C CA    1 
ATOM   3724  C  C     . PRO C 2 68   ? -33.470 16.170  36.344  1.00 35.64  ? 68   PRO C C     1 
ATOM   3725  O  O     . PRO C 2 68   ? -34.466 15.550  36.709  1.00 40.60  ? 68   PRO C O     1 
ATOM   3726  C  CB    . PRO C 2 68   ? -32.823 18.521  36.933  1.00 37.40  ? 68   PRO C CB    1 
ATOM   3727  C  CG    . PRO C 2 68   ? -31.591 19.124  37.494  1.00 36.15  ? 68   PRO C CG    1 
ATOM   3728  C  CD    . PRO C 2 68   ? -30.519 18.066  37.379  1.00 43.14  ? 68   PRO C CD    1 
ATOM   3729  N  N     . ARG C 2 69   ? -32.980 16.109  35.110  1.00 34.13  ? 69   ARG C N     1 
ATOM   3730  C  CA    . ARG C 2 69   ? -33.625 15.308  34.078  1.00 39.85  ? 69   ARG C CA    1 
ATOM   3731  C  C     . ARG C 2 69   ? -33.707 13.839  34.475  1.00 41.82  ? 69   ARG C C     1 
ATOM   3732  O  O     . ARG C 2 69   ? -34.620 13.128  34.056  1.00 47.30  ? 69   ARG C O     1 
ATOM   3733  C  CB    . ARG C 2 69   ? -32.885 15.444  32.746  1.00 39.36  ? 69   ARG C CB    1 
ATOM   3734  C  CG    . ARG C 2 69   ? -32.935 16.832  32.142  1.00 31.83  ? 69   ARG C CG    1 
ATOM   3735  C  CD    . ARG C 2 69   ? -32.529 16.793  30.681  1.00 34.40  ? 69   ARG C CD    1 
ATOM   3736  N  NE    . ARG C 2 69   ? -31.143 16.370  30.509  1.00 36.67  ? 69   ARG C NE    1 
ATOM   3737  C  CZ    . ARG C 2 69   ? -30.120 17.207  30.377  1.00 35.26  ? 69   ARG C CZ    1 
ATOM   3738  N  NH1   . ARG C 2 69   ? -30.327 18.517  30.392  1.00 36.76  ? 69   ARG C NH1   1 
ATOM   3739  N  NH2   . ARG C 2 69   ? -28.892 16.736  30.225  1.00 40.87  ? 69   ARG C NH2   1 
ATOM   3740  N  N     . TRP C 2 70   ? -32.759 13.385  35.289  1.00 35.62  ? 70   TRP C N     1 
ATOM   3741  C  CA    . TRP C 2 70   ? -32.736 11.988  35.703  1.00 35.63  ? 70   TRP C CA    1 
ATOM   3742  C  C     . TRP C 2 70   ? -33.820 11.659  36.716  1.00 40.21  ? 70   TRP C C     1 
ATOM   3743  O  O     . TRP C 2 70   ? -34.549 10.684  36.553  1.00 44.27  ? 70   TRP C O     1 
ATOM   3744  C  CB    . TRP C 2 70   ? -31.380 11.618  36.288  1.00 29.18  ? 70   TRP C CB    1 
ATOM   3745  C  CG    . TRP C 2 70   ? -31.398 10.306  37.013  1.00 24.27  ? 70   TRP C CG    1 
ATOM   3746  C  CD1   . TRP C 2 70   ? -31.391 9.060   36.456  1.00 22.96  ? 70   TRP C CD1   1 
ATOM   3747  C  CD2   . TRP C 2 70   ? -31.421 10.111  38.431  1.00 23.64  ? 70   TRP C CD2   1 
ATOM   3748  N  NE1   . TRP C 2 70   ? -31.409 8.102   37.439  1.00 21.69  ? 70   TRP C NE1   1 
ATOM   3749  C  CE2   . TRP C 2 70   ? -31.426 8.721   38.660  1.00 21.39  ? 70   TRP C CE2   1 
ATOM   3750  C  CE3   . TRP C 2 70   ? -31.436 10.976  39.527  1.00 32.60  ? 70   TRP C CE3   1 
ATOM   3751  C  CZ2   . TRP C 2 70   ? -31.444 8.177   39.942  1.00 27.36  ? 70   TRP C CZ2   1 
ATOM   3752  C  CZ3   . TRP C 2 70   ? -31.454 10.434  40.799  1.00 38.42  ? 70   TRP C CZ3   1 
ATOM   3753  C  CH2   . TRP C 2 70   ? -31.457 9.047   40.996  1.00 33.64  ? 70   TRP C CH2   1 
ATOM   3754  N  N     . ARG C 2 71   ? -33.913 12.462  37.769  1.00 44.71  ? 71   ARG C N     1 
ATOM   3755  C  CA    . ARG C 2 71   ? -34.905 12.216  38.808  1.00 51.49  ? 71   ARG C CA    1 
ATOM   3756  C  C     . ARG C 2 71   ? -36.316 12.324  38.234  1.00 57.39  ? 71   ARG C C     1 
ATOM   3757  O  O     . ARG C 2 71   ? -37.247 11.682  38.724  1.00 52.40  ? 71   ARG C O     1 
ATOM   3758  C  CB    . ARG C 2 71   ? -34.723 13.191  39.969  1.00 59.92  ? 71   ARG C CB    1 
ATOM   3759  C  CG    . ARG C 2 71   ? -34.793 12.539  41.339  1.00 60.44  ? 71   ARG C CG    1 
ATOM   3760  C  CD    . ARG C 2 71   ? -34.540 13.559  42.436  1.00 65.21  ? 71   ARG C CD    1 
ATOM   3761  N  NE    . ARG C 2 71   ? -33.219 14.166  42.320  1.00 59.74  ? 71   ARG C NE    1 
ATOM   3762  C  CZ    . ARG C 2 71   ? -32.132 13.702  42.926  1.00 47.95  ? 71   ARG C CZ    1 
ATOM   3763  N  NH1   . ARG C 2 71   ? -32.211 12.624  43.695  1.00 39.15  ? 71   ARG C NH1   1 
ATOM   3764  N  NH2   . ARG C 2 71   ? -30.967 14.316  42.764  1.00 47.97  ? 71   ARG C NH2   1 
ATOM   3765  N  N     . GLU C 2 72   ? -36.461 13.135  37.188  1.00 59.26  ? 72   GLU C N     1 
ATOM   3766  C  CA    . GLU C 2 72   ? -37.720 13.236  36.456  1.00 57.19  ? 72   GLU C CA    1 
ATOM   3767  C  C     . GLU C 2 72   ? -37.950 11.978  35.630  1.00 59.98  ? 72   GLU C C     1 
ATOM   3768  O  O     . GLU C 2 72   ? -39.057 11.444  35.599  1.00 73.12  ? 72   GLU C O     1 
ATOM   3769  C  CB    . GLU C 2 72   ? -37.736 14.468  35.546  1.00 52.49  ? 72   GLU C CB    1 
ATOM   3770  C  CG    . GLU C 2 72   ? -37.804 15.800  36.284  1.00 62.14  ? 72   GLU C CG    1 
ATOM   3771  C  CD    . GLU C 2 72   ? -38.120 16.970  35.365  1.00 76.17  ? 72   GLU C CD    1 
ATOM   3772  O  OE1   . GLU C 2 72   ? -38.574 16.730  34.226  1.00 85.57  ? 72   GLU C OE1   1 
ATOM   3773  O  OE2   . GLU C 2 72   ? -37.915 18.131  35.783  1.00 77.51  ? 72   GLU C OE2   1 
ATOM   3774  N  N     . SER C 2 73   ? -36.899 11.508  34.961  1.00 54.33  ? 73   SER C N     1 
ATOM   3775  C  CA    . SER C 2 73   ? -36.977 10.279  34.177  1.00 52.39  ? 73   SER C CA    1 
ATOM   3776  C  C     . SER C 2 73   ? -37.224 9.087   35.091  1.00 56.21  ? 73   SER C C     1 
ATOM   3777  O  O     . SER C 2 73   ? -37.805 8.088   34.678  1.00 55.47  ? 73   SER C O     1 
ATOM   3778  C  CB    . SER C 2 73   ? -35.699 10.070  33.360  1.00 46.89  ? 73   SER C CB    1 
ATOM   3779  O  OG    . SER C 2 73   ? -35.820 8.954   32.498  1.00 47.44  ? 73   SER C OG    1 
ATOM   3780  N  N     . ALA C 2 74   ? -36.779 9.202   36.338  1.00 59.94  ? 74   ALA C N     1 
ATOM   3781  C  CA    . ALA C 2 74   ? -37.023 8.170   37.337  1.00 69.76  ? 74   ALA C CA    1 
ATOM   3782  C  C     . ALA C 2 74   ? -38.472 8.218   37.800  1.00 73.38  ? 74   ALA C C     1 
ATOM   3783  O  O     . ALA C 2 74   ? -39.049 7.206   38.197  1.00 75.69  ? 74   ALA C O     1 
ATOM   3784  C  CB    . ALA C 2 74   ? -36.083 8.338   38.516  1.00 70.64  ? 74   ALA C CB    1 
ATOM   3785  N  N     . ALA C 2 75   ? -39.054 9.411   37.746  1.00 77.27  ? 75   ALA C N     1 
ATOM   3786  C  CA    . ALA C 2 75   ? -40.444 9.607   38.133  1.00 89.14  ? 75   ALA C CA    1 
ATOM   3787  C  C     . ALA C 2 75   ? -41.394 9.107   37.046  1.00 92.62  ? 75   ALA C C     1 
ATOM   3788  O  O     . ALA C 2 75   ? -42.366 8.409   37.336  1.00 93.20  ? 75   ALA C O     1 
ATOM   3789  C  CB    . ALA C 2 75   ? -40.709 11.074  38.437  1.00 92.07  ? 75   ALA C CB    1 
ATOM   3790  N  N     . GLU C 2 76   ? -41.110 9.467   35.796  1.00 95.73  ? 76   GLU C N     1 
ATOM   3791  C  CA    . GLU C 2 76   ? -41.935 9.033   34.671  1.00 92.52  ? 76   GLU C CA    1 
ATOM   3792  C  C     . GLU C 2 76   ? -41.869 7.519   34.492  1.00 87.17  ? 76   GLU C C     1 
ATOM   3793  O  O     . GLU C 2 76   ? -42.842 6.897   34.069  1.00 86.37  ? 76   GLU C O     1 
ATOM   3794  C  CB    . GLU C 2 76   ? -41.509 9.733   33.375  1.00 98.29  ? 76   GLU C CB    1 
ATOM   3795  C  CG    . GLU C 2 76   ? -41.979 11.179  33.251  1.00 102.79 ? 76   GLU C CG    1 
ATOM   3796  C  CD    . GLU C 2 76   ? -41.670 11.785  31.889  1.00 101.32 ? 76   GLU C CD    1 
ATOM   3797  O  OE1   . GLU C 2 76   ? -41.791 13.020  31.743  1.00 105.84 ? 76   GLU C OE1   1 
ATOM   3798  O  OE2   . GLU C 2 76   ? -41.310 11.027  30.963  1.00 94.47  ? 76   GLU C OE2   1 
ATOM   3799  N  N     . ARG C 2 77   ? -40.719 6.932   34.815  1.00 86.02  ? 77   ARG C N     1 
ATOM   3800  C  CA    . ARG C 2 77   ? -40.568 5.480   34.778  1.00 90.03  ? 77   ARG C CA    1 
ATOM   3801  C  C     . ARG C 2 77   ? -41.181 4.853   36.027  1.00 81.73  ? 77   ARG C C     1 
ATOM   3802  O  O     . ARG C 2 77   ? -41.404 3.643   36.085  1.00 73.36  ? 77   ARG C O     1 
ATOM   3803  C  CB    . ARG C 2 77   ? -39.092 5.082   34.653  1.00 92.01  ? 77   ARG C CB    1 
ATOM   3804  C  CG    . ARG C 2 77   ? -38.460 5.378   33.293  1.00 87.18  ? 77   ARG C CG    1 
ATOM   3805  C  CD    . ARG C 2 77   ? -37.021 4.865   33.218  1.00 72.47  ? 77   ARG C CD    1 
ATOM   3806  N  NE    . ARG C 2 77   ? -36.397 5.150   31.927  1.00 66.49  ? 77   ARG C NE    1 
ATOM   3807  C  CZ    . ARG C 2 77   ? -35.195 4.715   31.561  1.00 57.82  ? 77   ARG C CZ    1 
ATOM   3808  N  NH1   . ARG C 2 77   ? -34.709 5.024   30.366  1.00 55.09  ? 77   ARG C NH1   1 
ATOM   3809  N  NH2   . ARG C 2 77   ? -34.478 3.970   32.390  1.00 51.48  ? 77   ARG C NH2   1 
ATOM   3810  N  N     . GLY C 2 78   ? -41.450 5.687   37.027  1.00 81.68  ? 78   GLY C N     1 
ATOM   3811  C  CA    . GLY C 2 78   ? -42.085 5.238   38.252  1.00 86.21  ? 78   GLY C CA    1 
ATOM   3812  C  C     . GLY C 2 78   ? -41.133 4.563   39.220  1.00 92.16  ? 78   GLY C C     1 
ATOM   3813  O  O     . GLY C 2 78   ? -41.527 3.662   39.961  1.00 98.94  ? 78   GLY C O     1 
ATOM   3814  N  N     . ASP C 2 79   ? -39.878 4.999   39.220  1.00 92.07  ? 79   ASP C N     1 
ATOM   3815  C  CA    . ASP C 2 79   ? -38.871 4.425   40.105  1.00 88.55  ? 79   ASP C CA    1 
ATOM   3816  C  C     . ASP C 2 79   ? -39.039 4.948   41.521  1.00 88.95  ? 79   ASP C C     1 
ATOM   3817  O  O     . ASP C 2 79   ? -38.907 6.146   41.769  1.00 89.71  ? 79   ASP C O     1 
ATOM   3818  C  CB    . ASP C 2 79   ? -37.466 4.732   39.593  1.00 94.99  ? 79   ASP C CB    1 
ATOM   3819  C  CG    . ASP C 2 79   ? -37.239 4.219   38.187  1.00 106.78 ? 79   ASP C CG    1 
ATOM   3820  O  OD1   . ASP C 2 79   ? -36.068 4.121   37.762  1.00 105.19 ? 79   ASP C OD1   1 
ATOM   3821  O  OD2   . ASP C 2 79   ? -38.238 3.905   37.508  1.00 108.41 ? 79   ASP C OD2   1 
ATOM   3822  N  N     . VAL C 2 80   ? -39.330 4.042   42.447  1.00 88.56  ? 80   VAL C N     1 
ATOM   3823  C  CA    . VAL C 2 80   ? -39.575 4.416   43.834  1.00 91.40  ? 80   VAL C CA    1 
ATOM   3824  C  C     . VAL C 2 80   ? -38.270 4.723   44.568  1.00 91.34  ? 80   VAL C C     1 
ATOM   3825  O  O     . VAL C 2 80   ? -37.378 3.877   44.651  1.00 96.83  ? 80   VAL C O     1 
ATOM   3826  C  CB    . VAL C 2 80   ? -40.351 3.307   44.579  1.00 82.69  ? 80   VAL C CB    1 
ATOM   3827  C  CG1   . VAL C 2 80   ? -39.794 1.926   44.233  1.00 79.53  ? 80   VAL C CG1   1 
ATOM   3828  C  CG2   . VAL C 2 80   ? -40.335 3.556   46.082  1.00 80.30  ? 80   VAL C CG2   1 
ATOM   3829  N  N     . ASN C 2 81   ? -38.170 5.944   45.092  1.00 73.85  ? 81   ASN C N     1 
ATOM   3830  C  CA    . ASN C 2 81   ? -36.981 6.407   45.807  1.00 65.77  ? 81   ASN C CA    1 
ATOM   3831  C  C     . ASN C 2 81   ? -35.692 6.190   45.021  1.00 64.96  ? 81   ASN C C     1 
ATOM   3832  O  O     . ASN C 2 81   ? -34.976 5.213   45.242  1.00 64.99  ? 81   ASN C O     1 
ATOM   3833  C  CB    . ASN C 2 81   ? -36.880 5.721   47.169  1.00 72.12  ? 81   ASN C CB    1 
ATOM   3834  C  CG    . ASN C 2 81   ? -37.749 6.382   48.214  1.00 72.63  ? 81   ASN C CG    1 
ATOM   3835  O  OD1   . ASN C 2 81   ? -37.774 7.606   48.331  1.00 75.41  ? 81   ASN C OD1   1 
ATOM   3836  N  ND2   . ASN C 2 81   ? -38.471 5.575   48.982  1.00 73.51  ? 81   ASN C ND2   1 
ATOM   3837  N  N     . PRO C 2 82   ? -35.399 7.108   44.094  1.00 58.25  ? 82   PRO C N     1 
ATOM   3838  C  CA    . PRO C 2 82   ? -34.219 7.032   43.229  1.00 56.15  ? 82   PRO C CA    1 
ATOM   3839  C  C     . PRO C 2 82   ? -32.935 7.490   43.923  1.00 47.85  ? 82   PRO C C     1 
ATOM   3840  O  O     . PRO C 2 82   ? -32.931 8.484   44.647  1.00 42.67  ? 82   PRO C O     1 
ATOM   3841  C  CB    . PRO C 2 82   ? -34.581 7.969   42.079  1.00 64.70  ? 82   PRO C CB    1 
ATOM   3842  C  CG    . PRO C 2 82   ? -35.482 8.976   42.698  1.00 61.56  ? 82   PRO C CG    1 
ATOM   3843  C  CD    . PRO C 2 82   ? -36.262 8.252   43.755  1.00 60.34  ? 82   PRO C CD    1 
ATOM   3844  N  N     . VAL C 2 83   ? -31.853 6.755   43.696  1.00 44.74  ? 83   VAL C N     1 
ATOM   3845  C  CA    . VAL C 2 83   ? -30.563 7.081   44.286  1.00 38.30  ? 83   VAL C CA    1 
ATOM   3846  C  C     . VAL C 2 83   ? -29.510 7.277   43.203  1.00 34.38  ? 83   VAL C C     1 
ATOM   3847  O  O     . VAL C 2 83   ? -29.353 6.441   42.316  1.00 32.99  ? 83   VAL C O     1 
ATOM   3848  C  CB    . VAL C 2 83   ? -30.100 5.985   45.265  1.00 44.60  ? 83   VAL C CB    1 
ATOM   3849  C  CG1   . VAL C 2 83   ? -28.724 6.314   45.819  1.00 46.26  ? 83   VAL C CG1   1 
ATOM   3850  C  CG2   . VAL C 2 83   ? -31.106 5.826   46.392  1.00 56.61  ? 83   VAL C CG2   1 
ATOM   3851  N  N     . GLY C 2 84   ? -28.799 8.396   43.279  1.00 32.32  ? 84   GLY C N     1 
ATOM   3852  C  CA    . GLY C 2 84   ? -27.771 8.713   42.307  1.00 31.89  ? 84   GLY C CA    1 
ATOM   3853  C  C     . GLY C 2 84   ? -26.536 7.860   42.499  1.00 25.09  ? 84   GLY C C     1 
ATOM   3854  O  O     . GLY C 2 84   ? -26.292 7.356   43.594  1.00 32.00  ? 84   GLY C O     1 
ATOM   3855  N  N     . GLY C 2 85   ? -25.764 7.694   41.430  1.00 21.15  ? 85   GLY C N     1 
ATOM   3856  C  CA    . GLY C 2 85   ? -24.545 6.909   41.479  1.00 21.98  ? 85   GLY C CA    1 
ATOM   3857  C  C     . GLY C 2 85   ? -23.605 7.403   42.559  1.00 20.23  ? 85   GLY C C     1 
ATOM   3858  O  O     . GLY C 2 85   ? -23.056 6.617   43.329  1.00 19.73  ? 85   GLY C O     1 
ATOM   3859  N  N     . LEU C 2 86   ? -23.425 8.717   42.619  1.00 17.10  ? 86   LEU C N     1 
ATOM   3860  C  CA    . LEU C 2 86   ? -22.619 9.314   43.671  1.00 16.59  ? 86   LEU C CA    1 
ATOM   3861  C  C     . LEU C 2 86   ? -23.266 9.090   45.022  1.00 26.81  ? 86   LEU C C     1 
ATOM   3862  O  O     . LEU C 2 86   ? -22.596 8.721   45.986  1.00 33.55  ? 86   LEU C O     1 
ATOM   3863  C  CB    . LEU C 2 86   ? -22.430 10.808  43.430  1.00 12.24  ? 86   LEU C CB    1 
ATOM   3864  C  CG    . LEU C 2 86   ? -21.502 11.167  42.277  1.00 8.63   ? 86   LEU C CG    1 
ATOM   3865  C  CD1   . LEU C 2 86   ? -21.308 12.668  42.211  1.00 9.47   ? 86   LEU C CD1   1 
ATOM   3866  C  CD2   . LEU C 2 86   ? -20.176 10.458  42.443  1.00 9.40   ? 86   LEU C CD2   1 
ATOM   3867  N  N     . GLU C 2 87   ? -24.575 9.320   45.080  1.00 28.83  ? 87   GLU C N     1 
ATOM   3868  C  CA    . GLU C 2 87   ? -25.337 9.154   46.313  1.00 37.90  ? 87   GLU C CA    1 
ATOM   3869  C  C     . GLU C 2 87   ? -25.136 7.758   46.886  1.00 38.57  ? 87   GLU C C     1 
ATOM   3870  O  O     . GLU C 2 87   ? -24.903 7.589   48.083  1.00 42.52  ? 87   GLU C O     1 
ATOM   3871  C  CB    . GLU C 2 87   ? -26.828 9.412   46.072  1.00 42.99  ? 87   GLU C CB    1 
ATOM   3872  C  CG    . GLU C 2 87   ? -27.191 10.870  45.821  1.00 44.69  ? 87   GLU C CG    1 
ATOM   3873  C  CD    . GLU C 2 87   ? -28.692 11.096  45.801  1.00 48.22  ? 87   GLU C CD    1 
ATOM   3874  O  OE1   . GLU C 2 87   ? -29.449 10.102  45.865  1.00 42.20  ? 87   GLU C OE1   1 
ATOM   3875  O  OE2   . GLU C 2 87   ? -29.115 12.270  45.725  1.00 55.04  ? 87   GLU C OE2   1 
ATOM   3876  N  N     . GLU C 2 88   ? -25.215 6.766   46.007  1.00 35.94  ? 88   GLU C N     1 
ATOM   3877  C  CA    . GLU C 2 88   ? -25.046 5.374   46.389  1.00 35.27  ? 88   GLU C CA    1 
ATOM   3878  C  C     . GLU C 2 88   ? -23.716 5.141   47.076  1.00 33.55  ? 88   GLU C C     1 
ATOM   3879  O  O     . GLU C 2 88   ? -23.661 4.530   48.142  1.00 41.05  ? 88   GLU C O     1 
ATOM   3880  C  CB    . GLU C 2 88   ? -25.153 4.471   45.165  1.00 38.74  ? 88   GLU C CB    1 
ATOM   3881  C  CG    . GLU C 2 88   ? -24.609 3.078   45.383  1.00 39.70  ? 88   GLU C CG    1 
ATOM   3882  C  CD    . GLU C 2 88   ? -24.781 2.206   44.163  1.00 40.24  ? 88   GLU C CD    1 
ATOM   3883  O  OE1   . GLU C 2 88   ? -25.768 2.414   43.423  1.00 38.64  ? 88   GLU C OE1   1 
ATOM   3884  O  OE2   . GLU C 2 88   ? -23.932 1.315   43.942  1.00 39.97  ? 88   GLU C OE2   1 
ATOM   3885  N  N     . VAL C 2 89   ? -22.648 5.636   46.461  1.00 30.60  ? 89   VAL C N     1 
ATOM   3886  C  CA    . VAL C 2 89   ? -21.306 5.416   46.974  1.00 31.33  ? 89   VAL C CA    1 
ATOM   3887  C  C     . VAL C 2 89   ? -21.182 5.950   48.391  1.00 35.78  ? 89   VAL C C     1 
ATOM   3888  O  O     . VAL C 2 89   ? -20.554 5.328   49.246  1.00 42.62  ? 89   VAL C O     1 
ATOM   3889  C  CB    . VAL C 2 89   ? -20.253 6.072   46.077  1.00 23.65  ? 89   VAL C CB    1 
ATOM   3890  C  CG1   . VAL C 2 89   ? -18.860 5.839   46.635  1.00 19.54  ? 89   VAL C CG1   1 
ATOM   3891  C  CG2   . VAL C 2 89   ? -20.359 5.515   44.674  1.00 25.07  ? 89   VAL C CG2   1 
ATOM   3892  N  N     . LEU C 2 90   ? -21.815 7.086   48.647  1.00 31.43  ? 90   LEU C N     1 
ATOM   3893  C  CA    . LEU C 2 90   ? -21.736 7.705   49.960  1.00 36.60  ? 90   LEU C CA    1 
ATOM   3894  C  C     . LEU C 2 90   ? -22.477 6.921   51.035  1.00 45.25  ? 90   LEU C C     1 
ATOM   3895  O  O     . LEU C 2 90   ? -21.985 6.782   52.153  1.00 54.42  ? 90   LEU C O     1 
ATOM   3896  C  CB    . LEU C 2 90   ? -22.272 9.128   49.900  1.00 36.13  ? 90   LEU C CB    1 
ATOM   3897  C  CG    . LEU C 2 90   ? -21.455 10.000  48.957  1.00 29.08  ? 90   LEU C CG    1 
ATOM   3898  C  CD1   . LEU C 2 90   ? -21.856 11.453  49.106  1.00 37.00  ? 90   LEU C CD1   1 
ATOM   3899  C  CD2   . LEU C 2 90   ? -19.967 9.805   49.219  1.00 23.05  ? 90   LEU C CD2   1 
ATOM   3900  N  N     . TYR C 2 91   ? -23.657 6.410   50.707  1.00 44.14  ? 91   TYR C N     1 
ATOM   3901  C  CA    . TYR C 2 91   ? -24.435 5.663   51.690  1.00 51.74  ? 91   TYR C CA    1 
ATOM   3902  C  C     . TYR C 2 91   ? -23.761 4.338   52.034  1.00 43.82  ? 91   TYR C C     1 
ATOM   3903  O  O     . TYR C 2 91   ? -23.804 3.896   53.184  1.00 39.15  ? 91   TYR C O     1 
ATOM   3904  C  CB    . TYR C 2 91   ? -25.859 5.420   51.188  1.00 68.22  ? 91   TYR C CB    1 
ATOM   3905  C  CG    . TYR C 2 91   ? -26.751 6.643   51.252  1.00 68.49  ? 91   TYR C CG    1 
ATOM   3906  C  CD1   . TYR C 2 91   ? -26.285 7.841   51.784  1.00 59.26  ? 91   TYR C CD1   1 
ATOM   3907  C  CD2   . TYR C 2 91   ? -28.062 6.597   50.790  1.00 61.16  ? 91   TYR C CD2   1 
ATOM   3908  C  CE1   . TYR C 2 91   ? -27.095 8.958   51.844  1.00 60.92  ? 91   TYR C CE1   1 
ATOM   3909  C  CE2   . TYR C 2 91   ? -28.879 7.707   50.848  1.00 54.63  ? 91   TYR C CE2   1 
ATOM   3910  C  CZ    . TYR C 2 91   ? -28.392 8.884   51.375  1.00 62.43  ? 91   TYR C CZ    1 
ATOM   3911  O  OH    . TYR C 2 91   ? -29.208 9.990   51.431  1.00 76.84  ? 91   TYR C OH    1 
ATOM   3912  N  N     . GLU C 2 92   ? -23.147 3.706   51.035  1.00 42.59  ? 92   GLU C N     1 
ATOM   3913  C  CA    . GLU C 2 92   ? -22.366 2.494   51.263  1.00 42.54  ? 92   GLU C CA    1 
ATOM   3914  C  C     . GLU C 2 92   ? -21.263 2.814   52.249  1.00 43.13  ? 92   GLU C C     1 
ATOM   3915  O  O     . GLU C 2 92   ? -21.098 2.148   53.272  1.00 50.83  ? 92   GLU C O     1 
ATOM   3916  C  CB    . GLU C 2 92   ? -21.760 1.957   49.959  1.00 39.68  ? 92   GLU C CB    1 
ATOM   3917  C  CG    . GLU C 2 92   ? -22.759 1.408   48.949  1.00 43.44  ? 92   GLU C CG    1 
ATOM   3918  C  CD    . GLU C 2 92   ? -22.084 0.826   47.715  1.00 39.48  ? 92   GLU C CD    1 
ATOM   3919  O  OE1   . GLU C 2 92   ? -20.883 0.493   47.795  1.00 37.11  ? 92   GLU C OE1   1 
ATOM   3920  O  OE2   . GLU C 2 92   ? -22.750 0.705   46.664  1.00 38.38  ? 92   GLU C OE2   1 
ATOM   3921  N  N     . LEU C 2 93   ? -20.523 3.866   51.924  1.00 37.66  ? 93   LEU C N     1 
ATOM   3922  C  CA    . LEU C 2 93   ? -19.387 4.303   52.714  1.00 41.03  ? 93   LEU C CA    1 
ATOM   3923  C  C     . LEU C 2 93   ? -19.795 4.740   54.116  1.00 42.72  ? 93   LEU C C     1 
ATOM   3924  O  O     . LEU C 2 93   ? -19.369 4.149   55.107  1.00 47.48  ? 93   LEU C O     1 
ATOM   3925  C  CB    . LEU C 2 93   ? -18.678 5.445   51.999  1.00 35.63  ? 93   LEU C CB    1 
ATOM   3926  C  CG    . LEU C 2 93   ? -17.400 5.947   52.654  1.00 34.68  ? 93   LEU C CG    1 
ATOM   3927  C  CD1   . LEU C 2 93   ? -16.332 4.867   52.609  1.00 41.10  ? 93   LEU C CD1   1 
ATOM   3928  C  CD2   . LEU C 2 93   ? -16.935 7.203   51.951  1.00 35.34  ? 93   LEU C CD2   1 
ATOM   3929  N  N     . SER C 2 94   ? -20.620 5.778   54.191  1.00 43.22  ? 94   SER C N     1 
ATOM   3930  C  CA    . SER C 2 94   ? -21.040 6.324   55.476  1.00 42.61  ? 94   SER C CA    1 
ATOM   3931  C  C     . SER C 2 94   ? -21.780 5.290   56.319  1.00 47.24  ? 94   SER C C     1 
ATOM   3932  O  O     . SER C 2 94   ? -22.565 4.497   55.797  1.00 51.69  ? 94   SER C O     1 
ATOM   3933  C  CB    . SER C 2 94   ? -21.918 7.563   55.276  1.00 42.28  ? 94   SER C CB    1 
ATOM   3934  O  OG    . SER C 2 94   ? -21.142 8.673   54.866  1.00 37.70  ? 94   SER C OG    1 
ATOM   3935  N  N     . PRO C 2 95   ? -21.504 5.284   57.630  1.00 45.70  ? 95   PRO C N     1 
ATOM   3936  C  CA    . PRO C 2 95   ? -20.461 6.146   58.185  1.00 46.40  ? 95   PRO C CA    1 
ATOM   3937  C  C     . PRO C 2 95   ? -19.145 5.396   58.383  1.00 49.91  ? 95   PRO C C     1 
ATOM   3938  O  O     . PRO C 2 95   ? -19.129 4.163   58.389  1.00 42.25  ? 95   PRO C O     1 
ATOM   3939  C  CB    . PRO C 2 95   ? -21.055 6.573   59.522  1.00 51.18  ? 95   PRO C CB    1 
ATOM   3940  C  CG    . PRO C 2 95   ? -21.825 5.363   59.957  1.00 56.26  ? 95   PRO C CG    1 
ATOM   3941  C  CD    . PRO C 2 95   ? -22.312 4.665   58.695  1.00 51.56  ? 95   PRO C CD    1 
ATOM   3942  N  N     . ILE C 2 96   ? -18.055 6.141   58.539  1.00 54.70  ? 96   ILE C N     1 
ATOM   3943  C  CA    . ILE C 2 96   ? -16.739 5.555   58.774  1.00 49.85  ? 96   ILE C CA    1 
ATOM   3944  C  C     . ILE C 2 96   ? -16.365 5.646   60.247  1.00 49.40  ? 96   ILE C C     1 
ATOM   3945  O  O     . ILE C 2 96   ? -15.941 6.697   60.724  1.00 48.57  ? 96   ILE C O     1 
ATOM   3946  C  CB    . ILE C 2 96   ? -15.644 6.250   57.940  1.00 45.76  ? 96   ILE C CB    1 
ATOM   3947  C  CG1   . ILE C 2 96   ? -15.996 6.225   56.454  1.00 48.20  ? 96   ILE C CG1   1 
ATOM   3948  C  CG2   . ILE C 2 96   ? -14.295 5.583   58.155  1.00 43.23  ? 96   ILE C CG2   1 
ATOM   3949  C  CD1   . ILE C 2 96   ? -14.930 6.838   55.582  1.00 41.22  ? 96   ILE C CD1   1 
ATOM   3950  N  N     . GLU C 2 97   ? -16.531 4.538   60.961  1.00 52.34  ? 97   GLU C N     1 
ATOM   3951  C  CA    . GLU C 2 97   ? -16.189 4.474   62.375  1.00 54.08  ? 97   GLU C CA    1 
ATOM   3952  C  C     . GLU C 2 97   ? -14.936 3.640   62.579  1.00 56.45  ? 97   GLU C C     1 
ATOM   3953  O  O     . GLU C 2 97   ? -14.676 2.715   61.815  1.00 64.07  ? 97   GLU C O     1 
ATOM   3954  C  CB    . GLU C 2 97   ? -17.344 3.880   63.186  1.00 54.84  ? 97   GLU C CB    1 
ATOM   3955  C  CG    . GLU C 2 97   ? -18.655 4.629   63.058  1.00 58.28  ? 97   GLU C CG    1 
ATOM   3956  C  CD    . GLU C 2 97   ? -19.807 3.898   63.720  1.00 54.95  ? 97   GLU C CD    1 
ATOM   3957  O  OE1   . GLU C 2 97   ? -19.614 2.734   64.131  1.00 55.49  ? 97   GLU C OE1   1 
ATOM   3958  O  OE2   . GLU C 2 97   ? -20.903 4.486   63.829  1.00 53.67  ? 97   GLU C OE2   1 
ATOM   3959  N  N     . ASP C 2 98   ? -14.160 3.962   63.607  1.00 61.65  ? 98   ASP C N     1 
ATOM   3960  C  CA    . ASP C 2 98   ? -13.029 3.120   63.972  1.00 67.67  ? 98   ASP C CA    1 
ATOM   3961  C  C     . ASP C 2 98   ? -13.540 1.897   64.727  1.00 76.75  ? 98   ASP C C     1 
ATOM   3962  O  O     . ASP C 2 98   ? -14.751 1.709   64.865  1.00 81.31  ? 98   ASP C O     1 
ATOM   3963  C  CB    . ASP C 2 98   ? -12.016 3.891   64.818  1.00 72.03  ? 98   ASP C CB    1 
ATOM   3964  C  CG    . ASP C 2 98   ? -12.621 4.444   66.093  1.00 77.09  ? 98   ASP C CG    1 
ATOM   3965  O  OD1   . ASP C 2 98   ? -13.814 4.813   66.078  1.00 77.43  ? 98   ASP C OD1   1 
ATOM   3966  O  OD2   . ASP C 2 98   ? -11.901 4.513   67.110  1.00 76.34  ? 98   ASP C OD2   1 
ATOM   3967  N  N     . PHE C 2 99   ? -12.624 1.067   65.214  1.00 80.33  ? 99   PHE C N     1 
ATOM   3968  C  CA    . PHE C 2 99   ? -13.009 -0.131  65.952  1.00 85.36  ? 99   PHE C CA    1 
ATOM   3969  C  C     . PHE C 2 99   ? -13.729 0.228   67.249  1.00 80.95  ? 99   PHE C C     1 
ATOM   3970  O  O     . PHE C 2 99   ? -14.616 -0.498  67.700  1.00 76.76  ? 99   PHE C O     1 
ATOM   3971  C  CB    . PHE C 2 99   ? -11.786 -0.999  66.255  1.00 92.19  ? 99   PHE C CB    1 
ATOM   3972  C  CG    . PHE C 2 99   ? -12.107 -2.246  67.034  1.00 96.46  ? 99   PHE C CG    1 
ATOM   3973  C  CD1   . PHE C 2 99   ? -12.812 -3.283  66.444  1.00 98.29  ? 99   PHE C CD1   1 
ATOM   3974  C  CD2   . PHE C 2 99   ? -11.704 -2.382  68.354  1.00 89.33  ? 99   PHE C CD2   1 
ATOM   3975  C  CE1   . PHE C 2 99   ? -13.111 -4.431  67.155  1.00 95.98  ? 99   PHE C CE1   1 
ATOM   3976  C  CE2   . PHE C 2 99   ? -12.000 -3.529  69.070  1.00 88.71  ? 99   PHE C CE2   1 
ATOM   3977  C  CZ    . PHE C 2 99   ? -12.704 -4.554  68.470  1.00 94.93  ? 99   PHE C CZ    1 
ATOM   3978  N  N     . SER C 2 100  ? -13.342 1.355   67.838  1.00 78.12  ? 100  SER C N     1 
ATOM   3979  C  CA    . SER C 2 100  ? -13.941 1.814   69.084  1.00 81.53  ? 100  SER C CA    1 
ATOM   3980  C  C     . SER C 2 100  ? -15.424 2.094   68.895  1.00 74.88  ? 100  SER C C     1 
ATOM   3981  O  O     . SER C 2 100  ? -16.265 1.624   69.661  1.00 72.50  ? 100  SER C O     1 
ATOM   3982  C  CB    . SER C 2 100  ? -13.232 3.074   69.595  1.00 81.91  ? 100  SER C CB    1 
ATOM   3983  O  OG    . SER C 2 100  ? -11.822 2.912   69.609  1.00 76.45  ? 100  SER C OG    1 
ATOM   3984  N  N     . GLY C 2 101  ? -15.736 2.847   67.848  1.00 77.64  ? 101  GLY C N     1 
ATOM   3985  C  CA    . GLY C 2 101  ? -17.072 3.373   67.662  1.00 81.54  ? 101  GLY C CA    1 
ATOM   3986  C  C     . GLY C 2 101  ? -17.080 4.773   68.235  1.00 72.24  ? 101  GLY C C     1 
ATOM   3987  O  O     . GLY C 2 101  ? -18.086 5.479   68.187  1.00 71.12  ? 101  GLY C O     1 
ATOM   3988  N  N     . SER C 2 102  ? -15.935 5.165   68.784  1.00 61.56  ? 102  SER C N     1 
ATOM   3989  C  CA    . SER C 2 102  ? -15.761 6.492   69.351  1.00 67.91  ? 102  SER C CA    1 
ATOM   3990  C  C     . SER C 2 102  ? -15.992 7.570   68.299  1.00 77.34  ? 102  SER C C     1 
ATOM   3991  O  O     . SER C 2 102  ? -16.729 8.528   68.534  1.00 83.56  ? 102  SER C O     1 
ATOM   3992  C  CB    . SER C 2 102  ? -14.363 6.639   69.948  1.00 70.49  ? 102  SER C CB    1 
ATOM   3993  O  OG    . SER C 2 102  ? -14.084 7.997   70.251  1.00 81.44  ? 102  SER C OG    1 
ATOM   3994  N  N     . MET C 2 103  ? -15.369 7.408   67.136  1.00 73.10  ? 103  MET C N     1 
ATOM   3995  C  CA    . MET C 2 103  ? -15.471 8.403   66.075  1.00 70.74  ? 103  MET C CA    1 
ATOM   3996  C  C     . MET C 2 103  ? -16.376 7.927   64.941  1.00 69.65  ? 103  MET C C     1 
ATOM   3997  O  O     . MET C 2 103  ? -16.620 6.728   64.790  1.00 67.66  ? 103  MET C O     1 
ATOM   3998  C  CB    . MET C 2 103  ? -14.078 8.741   65.548  1.00 62.44  ? 103  MET C CB    1 
ATOM   3999  C  CG    . MET C 2 103  ? -13.153 9.301   66.616  1.00 58.94  ? 103  MET C CG    1 
ATOM   4000  S  SD    . MET C 2 103  ? -11.424 9.308   66.122  1.00 58.13  ? 103  MET C SD    1 
ATOM   4001  C  CE    . MET C 2 103  ? -11.093 7.554   66.028  1.00 60.59  ? 103  MET C CE    1 
ATOM   4002  N  N     . SER C 2 104  ? -16.878 8.871   64.150  1.00 69.81  ? 104  SER C N     1 
ATOM   4003  C  CA    . SER C 2 104  ? -17.781 8.549   63.049  1.00 67.52  ? 104  SER C CA    1 
ATOM   4004  C  C     . SER C 2 104  ? -17.804 9.649   61.990  1.00 62.50  ? 104  SER C C     1 
ATOM   4005  O  O     . SER C 2 104  ? -18.289 10.753  62.237  1.00 69.13  ? 104  SER C O     1 
ATOM   4006  C  CB    . SER C 2 104  ? -19.199 8.305   63.577  1.00 65.73  ? 104  SER C CB    1 
ATOM   4007  O  OG    . SER C 2 104  ? -20.107 8.034   62.520  1.00 60.57  ? 104  SER C OG    1 
ATOM   4008  N  N     . LEU C 2 105  ? -17.275 9.341   60.812  1.00 45.06  ? 105  LEU C N     1 
ATOM   4009  C  CA    . LEU C 2 105  ? -17.300 10.282  59.704  1.00 40.04  ? 105  LEU C CA    1 
ATOM   4010  C  C     . LEU C 2 105  ? -18.368 9.858   58.716  1.00 39.19  ? 105  LEU C C     1 
ATOM   4011  O  O     . LEU C 2 105  ? -18.508 8.676   58.417  1.00 47.58  ? 105  LEU C O     1 
ATOM   4012  C  CB    . LEU C 2 105  ? -15.934 10.362  59.025  1.00 37.13  ? 105  LEU C CB    1 
ATOM   4013  C  CG    . LEU C 2 105  ? -15.806 11.368  57.879  1.00 35.19  ? 105  LEU C CG    1 
ATOM   4014  C  CD1   . LEU C 2 105  ? -16.283 12.745  58.308  1.00 38.52  ? 105  LEU C CD1   1 
ATOM   4015  C  CD2   . LEU C 2 105  ? -14.370 11.430  57.388  1.00 36.74  ? 105  LEU C CD2   1 
ATOM   4016  N  N     . SER C 2 106  ? -19.127 10.821  58.213  1.00 38.76  ? 106  SER C N     1 
ATOM   4017  C  CA    . SER C 2 106  ? -20.231 10.504  57.322  1.00 40.73  ? 106  SER C CA    1 
ATOM   4018  C  C     . SER C 2 106  ? -20.397 11.570  56.245  1.00 38.02  ? 106  SER C C     1 
ATOM   4019  O  O     . SER C 2 106  ? -20.135 12.749  56.479  1.00 43.03  ? 106  SER C O     1 
ATOM   4020  C  CB    . SER C 2 106  ? -21.520 10.340  58.127  1.00 46.65  ? 106  SER C CB    1 
ATOM   4021  O  OG    . SER C 2 106  ? -21.551 11.248  59.218  1.00 44.50  ? 106  SER C OG    1 
ATOM   4022  N  N     . PHE C 2 107  ? -20.829 11.147  55.063  1.00 32.92  ? 107  PHE C N     1 
ATOM   4023  C  CA    . PHE C 2 107  ? -20.916 12.049  53.921  1.00 34.25  ? 107  PHE C CA    1 
ATOM   4024  C  C     . PHE C 2 107  ? -22.338 12.128  53.362  1.00 33.62  ? 107  PHE C C     1 
ATOM   4025  O  O     . PHE C 2 107  ? -23.086 11.150  53.403  1.00 33.43  ? 107  PHE C O     1 
ATOM   4026  C  CB    . PHE C 2 107  ? -19.946 11.605  52.818  1.00 40.57  ? 107  PHE C CB    1 
ATOM   4027  C  CG    . PHE C 2 107  ? -18.515 11.439  53.278  1.00 37.27  ? 107  PHE C CG    1 
ATOM   4028  C  CD1   . PHE C 2 107  ? -17.668 12.530  53.374  1.00 35.84  ? 107  PHE C CD1   1 
ATOM   4029  C  CD2   . PHE C 2 107  ? -18.011 10.185  53.577  1.00 30.90  ? 107  PHE C CD2   1 
ATOM   4030  C  CE1   . PHE C 2 107  ? -16.353 12.375  53.781  1.00 32.99  ? 107  PHE C CE1   1 
ATOM   4031  C  CE2   . PHE C 2 107  ? -16.698 10.026  53.984  1.00 25.93  ? 107  PHE C CE2   1 
ATOM   4032  C  CZ    . PHE C 2 107  ? -15.870 11.121  54.084  1.00 24.27  ? 107  PHE C CZ    1 
ATOM   4033  N  N     . SER C 2 108  ? -22.699 13.293  52.830  1.00 34.93  ? 108  SER C N     1 
ATOM   4034  C  CA    . SER C 2 108  ? -24.030 13.498  52.266  1.00 37.09  ? 108  SER C CA    1 
ATOM   4035  C  C     . SER C 2 108  ? -24.101 14.721  51.356  1.00 33.37  ? 108  SER C C     1 
ATOM   4036  O  O     . SER C 2 108  ? -23.231 15.591  51.396  1.00 30.60  ? 108  SER C O     1 
ATOM   4037  C  CB    . SER C 2 108  ? -25.063 13.642  53.385  1.00 50.59  ? 108  SER C CB    1 
ATOM   4038  O  OG    . SER C 2 108  ? -24.790 14.785  54.184  1.00 51.16  ? 108  SER C OG    1 
ATOM   4039  N  N     . ASP C 2 109  ? -25.152 14.762  50.540  1.00 35.36  ? 109  ASP C N     1 
ATOM   4040  C  CA    . ASP C 2 109  ? -25.480 15.907  49.689  1.00 33.57  ? 109  ASP C CA    1 
ATOM   4041  C  C     . ASP C 2 109  ? -24.356 16.303  48.740  1.00 26.35  ? 109  ASP C C     1 
ATOM   4042  O  O     . ASP C 2 109  ? -23.556 17.182  49.053  1.00 29.41  ? 109  ASP C O     1 
ATOM   4043  C  CB    . ASP C 2 109  ? -25.868 17.114  50.547  1.00 40.62  ? 109  ASP C CB    1 
ATOM   4044  C  CG    . ASP C 2 109  ? -26.534 18.212  49.739  1.00 45.06  ? 109  ASP C CG    1 
ATOM   4045  O  OD1   . ASP C 2 109  ? -26.171 19.396  49.912  1.00 42.61  ? 109  ASP C OD1   1 
ATOM   4046  O  OD2   . ASP C 2 109  ? -27.430 17.886  48.933  1.00 47.43  ? 109  ASP C OD2   1 
ATOM   4047  N  N     . PRO C 2 110  ? -24.297 15.653  47.572  1.00 22.83  ? 110  PRO C N     1 
ATOM   4048  C  CA    . PRO C 2 110  ? -23.314 15.977  46.538  1.00 20.10  ? 110  PRO C CA    1 
ATOM   4049  C  C     . PRO C 2 110  ? -23.821 17.082  45.626  1.00 20.23  ? 110  PRO C C     1 
ATOM   4050  O  O     . PRO C 2 110  ? -25.002 17.108  45.291  1.00 27.08  ? 110  PRO C O     1 
ATOM   4051  C  CB    . PRO C 2 110  ? -23.171 14.661  45.780  1.00 21.04  ? 110  PRO C CB    1 
ATOM   4052  C  CG    . PRO C 2 110  ? -24.543 14.063  45.866  1.00 24.33  ? 110  PRO C CG    1 
ATOM   4053  C  CD    . PRO C 2 110  ? -25.121 14.491  47.196  1.00 26.28  ? 110  PRO C CD    1 
ATOM   4054  N  N     . ARG C 2 111  ? -22.936 17.986  45.229  1.00 18.49  ? 111  ARG C N     1 
ATOM   4055  C  CA    . ARG C 2 111  ? -23.341 19.118  44.409  1.00 16.31  ? 111  ARG C CA    1 
ATOM   4056  C  C     . ARG C 2 111  ? -22.155 19.683  43.645  1.00 12.16  ? 111  ARG C C     1 
ATOM   4057  O  O     . ARG C 2 111  ? -21.028 19.664  44.135  1.00 16.11  ? 111  ARG C O     1 
ATOM   4058  C  CB    . ARG C 2 111  ? -23.988 20.198  45.280  1.00 26.80  ? 111  ARG C CB    1 
ATOM   4059  C  CG    . ARG C 2 111  ? -23.143 20.640  46.470  1.00 33.62  ? 111  ARG C CG    1 
ATOM   4060  C  CD    . ARG C 2 111  ? -23.904 21.617  47.362  1.00 31.35  ? 111  ARG C CD    1 
ATOM   4061  N  NE    . ARG C 2 111  ? -23.059 22.186  48.409  1.00 30.75  ? 111  ARG C NE    1 
ATOM   4062  C  CZ    . ARG C 2 111  ? -22.870 21.629  49.600  1.00 29.02  ? 111  ARG C CZ    1 
ATOM   4063  N  NH1   . ARG C 2 111  ? -23.463 20.482  49.900  1.00 28.14  ? 111  ARG C NH1   1 
ATOM   4064  N  NH2   . ARG C 2 111  ? -22.085 22.219  50.489  1.00 32.96  ? 111  ARG C NH2   1 
ATOM   4065  N  N     . PHE C 2 112  ? -22.416 20.183  42.442  1.00 9.06   ? 112  PHE C N     1 
ATOM   4066  C  CA    . PHE C 2 112  ? -21.360 20.696  41.575  1.00 11.15  ? 112  PHE C CA    1 
ATOM   4067  C  C     . PHE C 2 112  ? -21.407 22.212  41.431  1.00 11.44  ? 112  PHE C C     1 
ATOM   4068  O  O     . PHE C 2 112  ? -22.457 22.831  41.598  1.00 7.32   ? 112  PHE C O     1 
ATOM   4069  C  CB    . PHE C 2 112  ? -21.453 20.066  40.180  1.00 12.75  ? 112  PHE C CB    1 
ATOM   4070  C  CG    . PHE C 2 112  ? -21.115 18.600  40.137  1.00 11.48  ? 112  PHE C CG    1 
ATOM   4071  C  CD1   . PHE C 2 112  ? -19.834 18.179  39.824  1.00 6.62   ? 112  PHE C CD1   1 
ATOM   4072  C  CD2   . PHE C 2 112  ? -22.084 17.644  40.385  1.00 15.77  ? 112  PHE C CD2   1 
ATOM   4073  C  CE1   . PHE C 2 112  ? -19.523 16.835  39.773  1.00 4.84   ? 112  PHE C CE1   1 
ATOM   4074  C  CE2   . PHE C 2 112  ? -21.778 16.295  40.334  1.00 13.81  ? 112  PHE C CE2   1 
ATOM   4075  C  CZ    . PHE C 2 112  ? -20.496 15.892  40.027  1.00 7.89   ? 112  PHE C CZ    1 
ATOM   4076  N  N     . ASP C 2 113  ? -20.254 22.798  41.121  1.00 9.23   ? 113  ASP C N     1 
ATOM   4077  C  CA    . ASP C 2 113  ? -20.172 24.179  40.656  1.00 15.52  ? 113  ASP C CA    1 
ATOM   4078  C  C     . ASP C 2 113  ? -20.204 24.184  39.135  1.00 15.72  ? 113  ASP C C     1 
ATOM   4079  O  O     . ASP C 2 113  ? -20.141 23.127  38.511  1.00 14.70  ? 113  ASP C O     1 
ATOM   4080  C  CB    . ASP C 2 113  ? -18.896 24.865  41.146  1.00 19.84  ? 113  ASP C CB    1 
ATOM   4081  C  CG    . ASP C 2 113  ? -19.032 25.443  42.540  1.00 28.06  ? 113  ASP C CG    1 
ATOM   4082  O  OD1   . ASP C 2 113  ? -20.140 25.390  43.114  1.00 36.75  ? 113  ASP C OD1   1 
ATOM   4083  O  OD2   . ASP C 2 113  ? -18.025 25.972  43.055  1.00 27.50  ? 113  ASP C OD2   1 
ATOM   4084  N  N     . ASP C 2 114  ? -20.292 25.367  38.537  1.00 16.17  ? 114  ASP C N     1 
ATOM   4085  C  CA    . ASP C 2 114  ? -20.260 25.469  37.084  1.00 13.97  ? 114  ASP C CA    1 
ATOM   4086  C  C     . ASP C 2 114  ? -18.904 25.032  36.569  1.00 8.79   ? 114  ASP C C     1 
ATOM   4087  O  O     . ASP C 2 114  ? -17.898 25.143  37.269  1.00 9.73   ? 114  ASP C O     1 
ATOM   4088  C  CB    . ASP C 2 114  ? -20.572 26.890  36.625  1.00 17.91  ? 114  ASP C CB    1 
ATOM   4089  C  CG    . ASP C 2 114  ? -21.994 27.290  36.927  1.00 24.61  ? 114  ASP C CG    1 
ATOM   4090  O  OD1   . ASP C 2 114  ? -22.849 26.385  37.037  1.00 20.49  ? 114  ASP C OD1   1 
ATOM   4091  O  OD2   . ASP C 2 114  ? -22.258 28.503  37.057  1.00 36.04  ? 114  ASP C OD2   1 
ATOM   4092  N  N     . VAL C 2 115  ? -18.892 24.521  35.345  1.00 8.73   ? 115  VAL C N     1 
ATOM   4093  C  CA    . VAL C 2 115  ? -17.684 23.977  34.750  1.00 9.06   ? 115  VAL C CA    1 
ATOM   4094  C  C     . VAL C 2 115  ? -16.581 25.029  34.738  1.00 9.84   ? 115  VAL C C     1 
ATOM   4095  O  O     . VAL C 2 115  ? -16.834 26.205  34.491  1.00 12.33  ? 115  VAL C O     1 
ATOM   4096  C  CB    . VAL C 2 115  ? -17.952 23.467  33.326  1.00 8.97   ? 115  VAL C CB    1 
ATOM   4097  C  CG1   . VAL C 2 115  ? -16.734 22.746  32.788  1.00 11.25  ? 115  VAL C CG1   1 
ATOM   4098  C  CG2   . VAL C 2 115  ? -19.168 22.547  33.318  1.00 3.19   ? 115  VAL C CG2   1 
ATOM   4099  N  N     . LYS C 2 116  ? -15.360 24.603  35.035  1.00 8.38   ? 116  LYS C N     1 
ATOM   4100  C  CA    . LYS C 2 116  ? -14.245 25.530  35.170  1.00 11.05  ? 116  LYS C CA    1 
ATOM   4101  C  C     . LYS C 2 116  ? -13.844 26.147  33.834  1.00 13.02  ? 116  LYS C C     1 
ATOM   4102  O  O     . LYS C 2 116  ? -13.133 27.151  33.801  1.00 20.31  ? 116  LYS C O     1 
ATOM   4103  C  CB    . LYS C 2 116  ? -13.041 24.828  35.805  1.00 17.98  ? 116  LYS C CB    1 
ATOM   4104  C  CG    . LYS C 2 116  ? -13.241 24.466  37.279  1.00 16.43  ? 116  LYS C CG    1 
ATOM   4105  C  CD    . LYS C 2 116  ? -12.018 23.786  37.876  1.00 12.71  ? 116  LYS C CD    1 
ATOM   4106  C  CE    . LYS C 2 116  ? -10.802 24.691  37.815  1.00 11.12  ? 116  LYS C CE    1 
ATOM   4107  N  NZ    . LYS C 2 116  ? -9.620  24.053  38.443  1.00 17.25  ? 116  LYS C NZ    1 
ATOM   4108  N  N     . ALA C 2 117  ? -14.311 25.561  32.736  1.00 11.26  ? 117  ALA C N     1 
ATOM   4109  C  CA    . ALA C 2 117  ? -13.963 26.068  31.417  1.00 9.94   ? 117  ALA C CA    1 
ATOM   4110  C  C     . ALA C 2 117  ? -14.858 25.496  30.324  1.00 12.33  ? 117  ALA C C     1 
ATOM   4111  O  O     . ALA C 2 117  ? -15.216 24.319  30.365  1.00 8.78   ? 117  ALA C O     1 
ATOM   4112  C  CB    . ALA C 2 117  ? -12.506 25.761  31.114  1.00 18.23  ? 117  ALA C CB    1 
ATOM   4113  N  N     . PRO C 2 118  ? -15.210 26.334  29.336  1.00 17.32  ? 118  PRO C N     1 
ATOM   4114  C  CA    . PRO C 2 118  ? -15.998 25.934  28.166  1.00 19.02  ? 118  PRO C CA    1 
ATOM   4115  C  C     . PRO C 2 118  ? -15.437 24.722  27.429  1.00 8.71   ? 118  PRO C C     1 
ATOM   4116  O  O     . PRO C 2 118  ? -14.285 24.336  27.615  1.00 7.78   ? 118  PRO C O     1 
ATOM   4117  C  CB    . PRO C 2 118  ? -15.940 27.173  27.271  1.00 11.72  ? 118  PRO C CB    1 
ATOM   4118  C  CG    . PRO C 2 118  ? -15.789 28.294  28.215  1.00 11.57  ? 118  PRO C CG    1 
ATOM   4119  C  CD    . PRO C 2 118  ? -14.930 27.781  29.334  1.00 10.16  ? 118  PRO C CD    1 
ATOM   4120  N  N     . VAL C 2 119  ? -16.273 24.128  26.591  1.00 7.00   ? 119  VAL C N     1 
ATOM   4121  C  CA    . VAL C 2 119  ? -15.864 22.998  25.785  1.00 6.03   ? 119  VAL C CA    1 
ATOM   4122  C  C     . VAL C 2 119  ? -14.721 23.358  24.839  1.00 11.90  ? 119  VAL C C     1 
ATOM   4123  O  O     . VAL C 2 119  ? -13.622 22.822  24.955  1.00 8.27   ? 119  VAL C O     1 
ATOM   4124  C  CB    . VAL C 2 119  ? -17.048 22.462  24.978  1.00 8.64   ? 119  VAL C CB    1 
ATOM   4125  C  CG1   . VAL C 2 119  ? -16.573 21.471  23.931  1.00 15.24  ? 119  VAL C CG1   1 
ATOM   4126  C  CG2   . VAL C 2 119  ? -18.067 21.835  25.910  1.00 14.29  ? 119  VAL C CG2   1 
ATOM   4127  N  N     . ASP C 2 120  ? -14.982 24.283  23.920  1.00 17.28  ? 120  ASP C N     1 
ATOM   4128  C  CA    . ASP C 2 120  ? -14.022 24.641  22.876  1.00 19.52  ? 120  ASP C CA    1 
ATOM   4129  C  C     . ASP C 2 120  ? -12.687 25.102  23.443  1.00 12.37  ? 120  ASP C C     1 
ATOM   4130  O  O     . ASP C 2 120  ? -11.632 24.855  22.859  1.00 8.62   ? 120  ASP C O     1 
ATOM   4131  C  CB    . ASP C 2 120  ? -14.598 25.735  21.966  1.00 31.54  ? 120  ASP C CB    1 
ATOM   4132  C  CG    . ASP C 2 120  ? -14.892 27.027  22.711  1.00 35.14  ? 120  ASP C CG    1 
ATOM   4133  O  OD1   . ASP C 2 120  ? -15.181 26.963  23.928  1.00 29.85  ? 120  ASP C OD1   1 
ATOM   4134  O  OD2   . ASP C 2 120  ? -14.831 28.104  22.075  1.00 29.95  ? 120  ASP C OD2   1 
ATOM   4135  N  N     . GLU C 2 121  ? -12.737 25.780  24.582  1.00 17.96  ? 121  GLU C N     1 
ATOM   4136  C  CA    . GLU C 2 121  ? -11.526 26.292  25.192  1.00 15.50  ? 121  GLU C CA    1 
ATOM   4137  C  C     . GLU C 2 121  ? -10.700 25.136  25.718  1.00 6.85   ? 121  GLU C C     1 
ATOM   4138  O  O     . GLU C 2 121  ? -9.473  25.197  25.736  1.00 10.54  ? 121  GLU C O     1 
ATOM   4139  C  CB    . GLU C 2 121  ? -11.855 27.275  26.312  1.00 14.34  ? 121  GLU C CB    1 
ATOM   4140  C  CG    . GLU C 2 121  ? -10.648 28.011  26.853  1.00 15.95  ? 121  GLU C CG    1 
ATOM   4141  C  CD    . GLU C 2 121  ? -11.023 28.990  27.939  1.00 20.81  ? 121  GLU C CD    1 
ATOM   4142  O  OE1   . GLU C 2 121  ? -12.229 29.275  28.084  1.00 16.02  ? 121  GLU C OE1   1 
ATOM   4143  O  OE2   . GLU C 2 121  ? -10.116 29.467  28.651  1.00 31.77  ? 121  GLU C OE2   1 
ATOM   4144  N  N     . CYS C 2 122  ? -11.379 24.073  26.132  1.00 6.41   ? 122  CYS C N     1 
ATOM   4145  C  CA    . CYS C 2 122  ? -10.682 22.916  26.660  1.00 6.39   ? 122  CYS C CA    1 
ATOM   4146  C  C     . CYS C 2 122  ? -9.903  22.195  25.567  1.00 9.05   ? 122  CYS C C     1 
ATOM   4147  O  O     . CYS C 2 122  ? -8.718  21.915  25.735  1.00 9.86   ? 122  CYS C O     1 
ATOM   4148  C  CB    . CYS C 2 122  ? -11.657 21.961  27.340  1.00 5.10   ? 122  CYS C CB    1 
ATOM   4149  S  SG    . CYS C 2 122  ? -11.634 22.080  29.140  1.00 2.18   ? 122  CYS C SG    1 
ATOM   4150  N  N     . LYS C 2 123  ? -10.555 21.912  24.442  1.00 8.18   ? 123  LYS C N     1 
ATOM   4151  C  CA    . LYS C 2 123  ? -9.883  21.237  23.332  1.00 6.89   ? 123  LYS C CA    1 
ATOM   4152  C  C     . LYS C 2 123  ? -8.645  22.007  22.889  1.00 9.66   ? 123  LYS C C     1 
ATOM   4153  O  O     . LYS C 2 123  ? -7.690  21.426  22.373  1.00 7.38   ? 123  LYS C O     1 
ATOM   4154  C  CB    . LYS C 2 123  ? -10.820 21.071  22.136  1.00 6.36   ? 123  LYS C CB    1 
ATOM   4155  C  CG    . LYS C 2 123  ? -12.023 20.178  22.351  1.00 3.70   ? 123  LYS C CG    1 
ATOM   4156  C  CD    . LYS C 2 123  ? -12.848 20.140  21.073  1.00 8.33   ? 123  LYS C CD    1 
ATOM   4157  C  CE    . LYS C 2 123  ? -13.973 19.121  21.114  1.00 6.49   ? 123  LYS C CE    1 
ATOM   4158  N  NZ    . LYS C 2 123  ? -14.706 19.087  19.813  1.00 3.67   ? 123  LYS C NZ    1 
ATOM   4159  N  N     . ASP C 2 124  ? -8.673  23.319  23.106  1.00 11.14  ? 124  ASP C N     1 
ATOM   4160  C  CA    . ASP C 2 124  ? -7.622  24.209  22.632  1.00 11.23  ? 124  ASP C CA    1 
ATOM   4161  C  C     . ASP C 2 124  ? -6.448  24.296  23.596  1.00 10.53  ? 124  ASP C C     1 
ATOM   4162  O  O     . ASP C 2 124  ? -5.295  24.246  23.175  1.00 11.83  ? 124  ASP C O     1 
ATOM   4163  C  CB    . ASP C 2 124  ? -8.181  25.611  22.389  1.00 13.55  ? 124  ASP C CB    1 
ATOM   4164  C  CG    . ASP C 2 124  ? -7.116  26.588  21.932  1.00 13.93  ? 124  ASP C CG    1 
ATOM   4165  O  OD1   . ASP C 2 124  ? -6.834  26.629  20.715  1.00 15.34  ? 124  ASP C OD1   1 
ATOM   4166  O  OD2   . ASP C 2 124  ? -6.557  27.311  22.786  1.00 12.26  ? 124  ASP C OD2   1 
ATOM   4167  N  N     . LYS C 2 125  ? -6.738  24.438  24.885  1.00 12.31  ? 125  LYS C N     1 
ATOM   4168  C  CA    . LYS C 2 125  ? -5.683  24.624  25.877  1.00 11.51  ? 125  LYS C CA    1 
ATOM   4169  C  C     . LYS C 2 125  ? -5.281  23.318  26.546  1.00 5.07   ? 125  LYS C C     1 
ATOM   4170  O  O     . LYS C 2 125  ? -4.616  23.323  27.579  1.00 4.38   ? 125  LYS C O     1 
ATOM   4171  C  CB    . LYS C 2 125  ? -6.117  25.639  26.933  1.00 13.88  ? 125  LYS C CB    1 
ATOM   4172  C  CG    . LYS C 2 125  ? -6.301  27.040  26.382  1.00 12.85  ? 125  LYS C CG    1 
ATOM   4173  C  CD    . LYS C 2 125  ? -6.600  28.031  27.486  1.00 19.28  ? 125  LYS C CD    1 
ATOM   4174  C  CE    . LYS C 2 125  ? -6.668  29.450  26.941  1.00 32.32  ? 125  LYS C CE    1 
ATOM   4175  N  NZ    . LYS C 2 125  ? -6.839  30.470  28.018  1.00 30.49  ? 125  LYS C NZ    1 
ATOM   4176  N  N     . ASP C 2 126  ? -5.694  22.206  25.947  1.00 5.64   ? 126  ASP C N     1 
ATOM   4177  C  CA    . ASP C 2 126  ? -5.290  20.873  26.390  1.00 9.72   ? 126  ASP C CA    1 
ATOM   4178  C  C     . ASP C 2 126  ? -5.614  20.602  27.866  1.00 6.40   ? 126  ASP C C     1 
ATOM   4179  O  O     . ASP C 2 126  ? -4.833  19.958  28.562  1.00 8.11   ? 126  ASP C O     1 
ATOM   4180  C  CB    . ASP C 2 126  ? -3.786  20.660  26.143  1.00 14.36  ? 126  ASP C CB    1 
ATOM   4181  C  CG    . ASP C 2 126  ? -3.477  20.125  24.740  1.00 15.72  ? 126  ASP C CG    1 
ATOM   4182  O  OD1   . ASP C 2 126  ? -4.245  20.405  23.794  1.00 20.26  ? 126  ASP C OD1   1 
ATOM   4183  O  OD2   . ASP C 2 126  ? -2.453  19.423  24.580  1.00 7.73   ? 126  ASP C OD2   1 
ATOM   4184  N  N     . MET C 2 127  ? -6.757  21.092  28.342  1.00 8.28   ? 127  MET C N     1 
ATOM   4185  C  CA    . MET C 2 127  ? -7.177  20.855  29.727  1.00 6.37   ? 127  MET C CA    1 
ATOM   4186  C  C     . MET C 2 127  ? -8.477  20.071  29.802  1.00 4.17   ? 127  MET C C     1 
ATOM   4187  O  O     . MET C 2 127  ? -9.285  20.119  28.886  1.00 4.97   ? 127  MET C O     1 
ATOM   4188  C  CB    . MET C 2 127  ? -7.328  22.181  30.477  1.00 10.03  ? 127  MET C CB    1 
ATOM   4189  C  CG    . MET C 2 127  ? -8.351  23.127  29.879  1.00 11.03  ? 127  MET C CG    1 
ATOM   4190  S  SD    . MET C 2 127  ? -8.384  24.700  30.756  1.00 20.76  ? 127  MET C SD    1 
ATOM   4191  C  CE    . MET C 2 127  ? -8.847  24.151  32.394  1.00 27.62  ? 127  MET C CE    1 
ATOM   4192  N  N     . THR C 2 128  ? -8.680  19.368  30.910  1.00 4.19   ? 128  THR C N     1 
ATOM   4193  C  CA    . THR C 2 128  ? -9.845  18.501  31.059  1.00 5.82   ? 128  THR C CA    1 
ATOM   4194  C  C     . THR C 2 128  ? -11.131 19.241  31.434  1.00 11.45  ? 128  THR C C     1 
ATOM   4195  O  O     . THR C 2 128  ? -11.208 19.910  32.465  1.00 14.50  ? 128  THR C O     1 
ATOM   4196  C  CB    . THR C 2 128  ? -9.597  17.410  32.114  1.00 4.08   ? 128  THR C CB    1 
ATOM   4197  O  OG1   . THR C 2 128  ? -8.599  16.505  31.631  1.00 2.82   ? 128  THR C OG1   1 
ATOM   4198  C  CG2   . THR C 2 128  ? -10.875 16.640  32.393  1.00 7.86   ? 128  THR C CG2   1 
ATOM   4199  N  N     . TYR C 2 129  ? -12.135 19.096  30.575  1.00 7.80   ? 129  TYR C N     1 
ATOM   4200  C  CA    . TYR C 2 129  ? -13.486 19.584  30.820  1.00 6.26   ? 129  TYR C CA    1 
ATOM   4201  C  C     . TYR C 2 129  ? -14.033 18.987  32.104  1.00 4.55   ? 129  TYR C C     1 
ATOM   4202  O  O     . TYR C 2 129  ? -14.321 17.793  32.163  1.00 3.25   ? 129  TYR C O     1 
ATOM   4203  C  CB    . TYR C 2 129  ? -14.386 19.227  29.638  1.00 7.34   ? 129  TYR C CB    1 
ATOM   4204  C  CG    . TYR C 2 129  ? -15.770 19.816  29.704  1.00 8.96   ? 129  TYR C CG    1 
ATOM   4205  C  CD1   . TYR C 2 129  ? -15.970 21.180  29.529  1.00 12.27  ? 129  TYR C CD1   1 
ATOM   4206  C  CD2   . TYR C 2 129  ? -16.881 19.008  29.916  1.00 6.87   ? 129  TYR C CD2   1 
ATOM   4207  C  CE1   . TYR C 2 129  ? -17.235 21.726  29.576  1.00 14.35  ? 129  TYR C CE1   1 
ATOM   4208  C  CE2   . TYR C 2 129  ? -18.152 19.544  29.967  1.00 6.50   ? 129  TYR C CE2   1 
ATOM   4209  C  CZ    . TYR C 2 129  ? -18.324 20.907  29.798  1.00 14.63  ? 129  TYR C CZ    1 
ATOM   4210  O  OH    . TYR C 2 129  ? -19.587 21.458  29.847  1.00 17.33  ? 129  TYR C OH    1 
ATOM   4211  N  N     . ALA C 2 130  ? -14.175 19.814  33.133  1.00 9.17   ? 130  ALA C N     1 
ATOM   4212  C  CA    . ALA C 2 130  ? -14.540 19.303  34.447  1.00 8.23   ? 130  ALA C CA    1 
ATOM   4213  C  C     . ALA C 2 130  ? -15.198 20.348  35.339  1.00 6.44   ? 130  ALA C C     1 
ATOM   4214  O  O     . ALA C 2 130  ? -14.751 21.488  35.404  1.00 11.55  ? 130  ALA C O     1 
ATOM   4215  C  CB    . ALA C 2 130  ? -13.308 18.743  35.136  1.00 10.93  ? 130  ALA C CB    1 
ATOM   4216  N  N     . ALA C 2 131  ? -16.259 19.952  36.032  1.00 3.82   ? 131  ALA C N     1 
ATOM   4217  C  CA    . ALA C 2 131  ? -16.872 20.815  37.035  1.00 11.16  ? 131  ALA C CA    1 
ATOM   4218  C  C     . ALA C 2 131  ? -16.523 20.310  38.434  1.00 12.36  ? 131  ALA C C     1 
ATOM   4219  O  O     . ALA C 2 131  ? -16.683 19.128  38.718  1.00 21.52  ? 131  ALA C O     1 
ATOM   4220  C  CB    . ALA C 2 131  ? -18.376 20.871  36.842  1.00 14.66  ? 131  ALA C CB    1 
ATOM   4221  N  N     . PRO C 2 132  ? -16.048 21.204  39.311  1.00 11.62  ? 132  PRO C N     1 
ATOM   4222  C  CA    . PRO C 2 132  ? -15.601 20.815  40.652  1.00 7.76   ? 132  PRO C CA    1 
ATOM   4223  C  C     . PRO C 2 132  ? -16.724 20.247  41.512  1.00 7.95   ? 132  PRO C C     1 
ATOM   4224  O  O     . PRO C 2 132  ? -17.859 20.711  41.428  1.00 9.42   ? 132  PRO C O     1 
ATOM   4225  C  CB    . PRO C 2 132  ? -15.083 22.125  41.233  1.00 17.18  ? 132  PRO C CB    1 
ATOM   4226  C  CG    . PRO C 2 132  ? -15.852 23.165  40.519  1.00 20.50  ? 132  PRO C CG    1 
ATOM   4227  C  CD    . PRO C 2 132  ? -15.989 22.661  39.120  1.00 16.67  ? 132  PRO C CD    1 
ATOM   4228  N  N     . LEU C 2 133  ? -16.391 19.258  42.335  1.00 11.95  ? 133  LEU C N     1 
ATOM   4229  C  CA    . LEU C 2 133  ? -17.372 18.531  43.142  1.00 14.80  ? 133  LEU C CA    1 
ATOM   4230  C  C     . LEU C 2 133  ? -17.237 18.805  44.637  1.00 16.78  ? 133  LEU C C     1 
ATOM   4231  O  O     . LEU C 2 133  ? -16.136 18.780  45.181  1.00 23.12  ? 133  LEU C O     1 
ATOM   4232  C  CB    . LEU C 2 133  ? -17.243 17.028  42.889  1.00 7.43   ? 133  LEU C CB    1 
ATOM   4233  C  CG    . LEU C 2 133  ? -17.816 16.072  43.937  1.00 5.96   ? 133  LEU C CG    1 
ATOM   4234  C  CD1   . LEU C 2 133  ? -19.335 16.126  43.960  1.00 10.40  ? 133  LEU C CD1   1 
ATOM   4235  C  CD2   . LEU C 2 133  ? -17.330 14.660  43.669  1.00 4.34   ? 133  LEU C CD2   1 
ATOM   4236  N  N     . PHE C 2 134  ? -18.366 19.047  45.298  1.00 13.92  ? 134  PHE C N     1 
ATOM   4237  C  CA    . PHE C 2 134  ? -18.377 19.289  46.737  1.00 14.16  ? 134  PHE C CA    1 
ATOM   4238  C  C     . PHE C 2 134  ? -19.262 18.295  47.486  1.00 15.95  ? 134  PHE C C     1 
ATOM   4239  O  O     . PHE C 2 134  ? -20.202 17.733  46.921  1.00 16.54  ? 134  PHE C O     1 
ATOM   4240  C  CB    . PHE C 2 134  ? -18.850 20.714  47.035  1.00 17.58  ? 134  PHE C CB    1 
ATOM   4241  C  CG    . PHE C 2 134  ? -17.948 21.781  46.488  1.00 17.56  ? 134  PHE C CG    1 
ATOM   4242  C  CD1   . PHE C 2 134  ? -16.574 21.648  46.558  1.00 18.54  ? 134  PHE C CD1   1 
ATOM   4243  C  CD2   . PHE C 2 134  ? -18.477 22.917  45.900  1.00 23.79  ? 134  PHE C CD2   1 
ATOM   4244  C  CE1   . PHE C 2 134  ? -15.745 22.630  46.054  1.00 21.63  ? 134  PHE C CE1   1 
ATOM   4245  C  CE2   . PHE C 2 134  ? -17.650 23.902  45.392  1.00 25.68  ? 134  PHE C CE2   1 
ATOM   4246  C  CZ    . PHE C 2 134  ? -16.281 23.756  45.469  1.00 21.82  ? 134  PHE C CZ    1 
ATOM   4247  N  N     . VAL C 2 135  ? -18.948 18.085  48.761  1.00 17.24  ? 135  VAL C N     1 
ATOM   4248  C  CA    . VAL C 2 135  ? -19.775 17.269  49.642  1.00 20.21  ? 135  VAL C CA    1 
ATOM   4249  C  C     . VAL C 2 135  ? -19.857 17.897  51.028  1.00 26.43  ? 135  VAL C C     1 
ATOM   4250  O  O     . VAL C 2 135  ? -19.056 18.763  51.372  1.00 27.21  ? 135  VAL C O     1 
ATOM   4251  C  CB    . VAL C 2 135  ? -19.231 15.836  49.780  1.00 13.15  ? 135  VAL C CB    1 
ATOM   4252  C  CG1   . VAL C 2 135  ? -19.348 15.080  48.472  1.00 17.48  ? 135  VAL C CG1   1 
ATOM   4253  C  CG2   . VAL C 2 135  ? -17.795 15.864  50.262  1.00 16.43  ? 135  VAL C CG2   1 
ATOM   4254  N  N     . THR C 2 136  ? -20.826 17.454  51.821  1.00 26.30  ? 136  THR C N     1 
ATOM   4255  C  CA    . THR C 2 136  ? -20.955 17.922  53.194  1.00 26.91  ? 136  THR C CA    1 
ATOM   4256  C  C     . THR C 2 136  ? -20.608 16.806  54.176  1.00 32.72  ? 136  THR C C     1 
ATOM   4257  O  O     . THR C 2 136  ? -21.388 15.875  54.380  1.00 29.81  ? 136  THR C O     1 
ATOM   4258  C  CB    . THR C 2 136  ? -22.368 18.435  53.483  1.00 27.03  ? 136  THR C CB    1 
ATOM   4259  O  OG1   . THR C 2 136  ? -22.714 19.438  52.523  1.00 26.16  ? 136  THR C OG1   1 
ATOM   4260  C  CG2   . THR C 2 136  ? -22.436 19.035  54.870  1.00 35.78  ? 136  THR C CG2   1 
ATOM   4261  N  N     . ALA C 2 137  ? -19.428 16.905  54.778  1.00 33.41  ? 137  ALA C N     1 
ATOM   4262  C  CA    . ALA C 2 137  ? -18.947 15.882  55.697  1.00 33.59  ? 137  ALA C CA    1 
ATOM   4263  C  C     . ALA C 2 137  ? -18.987 16.374  57.136  1.00 40.73  ? 137  ALA C C     1 
ATOM   4264  O  O     . ALA C 2 137  ? -18.620 17.510  57.424  1.00 45.17  ? 137  ALA C O     1 
ATOM   4265  C  CB    . ALA C 2 137  ? -17.538 15.456  55.323  1.00 31.01  ? 137  ALA C CB    1 
ATOM   4266  N  N     . GLU C 2 138  ? -19.435 15.511  58.038  1.00 42.56  ? 138  GLU C N     1 
ATOM   4267  C  CA    . GLU C 2 138  ? -19.517 15.868  59.445  1.00 42.69  ? 138  GLU C CA    1 
ATOM   4268  C  C     . GLU C 2 138  ? -18.810 14.838  60.306  1.00 46.24  ? 138  GLU C C     1 
ATOM   4269  O  O     . GLU C 2 138  ? -18.876 13.640  60.034  1.00 48.42  ? 138  GLU C O     1 
ATOM   4270  C  CB    . GLU C 2 138  ? -20.974 16.003  59.878  1.00 45.72  ? 138  GLU C CB    1 
ATOM   4271  C  CG    . GLU C 2 138  ? -21.782 14.735  59.713  1.00 47.35  ? 138  GLU C CG    1 
ATOM   4272  C  CD    . GLU C 2 138  ? -23.236 14.934  60.063  1.00 53.02  ? 138  GLU C CD    1 
ATOM   4273  O  OE1   . GLU C 2 138  ? -23.667 16.104  60.151  1.00 55.21  ? 138  GLU C OE1   1 
ATOM   4274  O  OE2   . GLU C 2 138  ? -23.946 13.924  60.254  1.00 51.11  ? 138  GLU C OE2   1 
ATOM   4275  N  N     . PHE C 2 139  ? -18.131 15.309  61.345  1.00 46.51  ? 139  PHE C N     1 
ATOM   4276  C  CA    . PHE C 2 139  ? -17.437 14.408  62.252  1.00 52.36  ? 139  PHE C CA    1 
ATOM   4277  C  C     . PHE C 2 139  ? -18.240 14.149  63.516  1.00 55.64  ? 139  PHE C C     1 
ATOM   4278  O  O     . PHE C 2 139  ? -18.288 14.981  64.419  1.00 56.01  ? 139  PHE C O     1 
ATOM   4279  C  CB    . PHE C 2 139  ? -16.065 14.957  62.623  1.00 52.28  ? 139  PHE C CB    1 
ATOM   4280  C  CG    . PHE C 2 139  ? -15.341 14.112  63.622  1.00 54.45  ? 139  PHE C CG    1 
ATOM   4281  C  CD1   . PHE C 2 139  ? -15.009 14.616  64.865  1.00 61.35  ? 139  PHE C CD1   1 
ATOM   4282  C  CD2   . PHE C 2 139  ? -15.021 12.798  63.327  1.00 54.33  ? 139  PHE C CD2   1 
ATOM   4283  C  CE1   . PHE C 2 139  ? -14.350 13.833  65.789  1.00 68.18  ? 139  PHE C CE1   1 
ATOM   4284  C  CE2   . PHE C 2 139  ? -14.364 12.009  64.245  1.00 59.37  ? 139  PHE C CE2   1 
ATOM   4285  C  CZ    . PHE C 2 139  ? -14.028 12.526  65.478  1.00 68.79  ? 139  PHE C CZ    1 
ATOM   4286  N  N     . ILE C 2 140  ? -18.866 12.980  63.570  1.00 60.90  ? 140  ILE C N     1 
ATOM   4287  C  CA    . ILE C 2 140  ? -19.652 12.581  64.726  1.00 60.70  ? 140  ILE C CA    1 
ATOM   4288  C  C     . ILE C 2 140  ? -18.760 11.935  65.769  1.00 61.97  ? 140  ILE C C     1 
ATOM   4289  O  O     . ILE C 2 140  ? -17.940 11.077  65.448  1.00 61.72  ? 140  ILE C O     1 
ATOM   4290  C  CB    . ILE C 2 140  ? -20.765 11.592  64.337  1.00 69.60  ? 140  ILE C CB    1 
ATOM   4291  C  CG1   . ILE C 2 140  ? -21.548 12.114  63.130  1.00 70.48  ? 140  ILE C CG1   1 
ATOM   4292  C  CG2   . ILE C 2 140  ? -21.683 11.323  65.522  1.00 68.30  ? 140  ILE C CG2   1 
ATOM   4293  C  CD1   . ILE C 2 140  ? -22.467 11.084  62.502  1.00 68.76  ? 140  ILE C CD1   1 
ATOM   4294  N  N     . ASN C 2 141  ? -18.916 12.351  67.019  1.00 67.83  ? 141  ASN C N     1 
ATOM   4295  C  CA    . ASN C 2 141  ? -18.187 11.720  68.106  1.00 75.24  ? 141  ASN C CA    1 
ATOM   4296  C  C     . ASN C 2 141  ? -19.138 11.254  69.196  1.00 69.32  ? 141  ASN C C     1 
ATOM   4297  O  O     . ASN C 2 141  ? -19.929 12.032  69.721  1.00 70.34  ? 141  ASN C O     1 
ATOM   4298  C  CB    . ASN C 2 141  ? -17.139 12.672  68.680  1.00 77.50  ? 141  ASN C CB    1 
ATOM   4299  C  CG    . ASN C 2 141  ? -16.182 11.974  69.624  1.00 79.33  ? 141  ASN C CG    1 
ATOM   4300  O  OD1   . ASN C 2 141  ? -15.806 12.519  70.660  1.00 83.46  ? 141  ASN C OD1   1 
ATOM   4301  N  ND2   . ASN C 2 141  ? -15.789 10.754  69.274  1.00 77.11  ? 141  ASN C ND2   1 
ATOM   4302  N  N     . ASN C 2 142  ? -19.057 9.972   69.527  1.00 62.47  ? 142  ASN C N     1 
ATOM   4303  C  CA    . ASN C 2 142  ? -19.978 9.386   70.483  1.00 65.63  ? 142  ASN C CA    1 
ATOM   4304  C  C     . ASN C 2 142  ? -19.618 9.716   71.922  1.00 73.41  ? 142  ASN C C     1 
ATOM   4305  O  O     . ASN C 2 142  ? -20.476 9.686   72.803  1.00 82.19  ? 142  ASN C O     1 
ATOM   4306  C  CB    . ASN C 2 142  ? -20.033 7.872   70.298  1.00 68.10  ? 142  ASN C CB    1 
ATOM   4307  C  CG    . ASN C 2 142  ? -20.450 7.475   68.899  1.00 62.69  ? 142  ASN C CG    1 
ATOM   4308  O  OD1   . ASN C 2 142  ? -20.993 8.283   68.148  1.00 62.77  ? 142  ASN C OD1   1 
ATOM   4309  N  ND2   . ASN C 2 142  ? -20.203 6.221   68.544  1.00 61.08  ? 142  ASN C ND2   1 
ATOM   4310  N  N     . ASN C 2 143  ? -18.352 10.037  72.162  1.00 76.35  ? 143  ASN C N     1 
ATOM   4311  C  CA    . ASN C 2 143  ? -17.888 10.294  73.520  1.00 83.17  ? 143  ASN C CA    1 
ATOM   4312  C  C     . ASN C 2 143  ? -18.056 11.748  73.939  1.00 80.34  ? 143  ASN C C     1 
ATOM   4313  O  O     . ASN C 2 143  ? -18.530 12.033  75.037  1.00 83.81  ? 143  ASN C O     1 
ATOM   4314  C  CB    . ASN C 2 143  ? -16.428 9.871   73.665  1.00 83.41  ? 143  ASN C CB    1 
ATOM   4315  C  CG    . ASN C 2 143  ? -16.234 8.385   73.439  1.00 94.35  ? 143  ASN C CG    1 
ATOM   4316  O  OD1   . ASN C 2 143  ? -15.330 7.967   72.719  1.00 106.35 ? 143  ASN C OD1   1 
ATOM   4317  N  ND2   . ASN C 2 143  ? -17.097 7.578   74.048  1.00 91.41  ? 143  ASN C ND2   1 
ATOM   4318  N  N     . THR C 2 144  ? -17.669 12.670  73.067  1.00 77.11  ? 144  THR C N     1 
ATOM   4319  C  CA    . THR C 2 144  ? -17.846 14.086  73.353  1.00 74.77  ? 144  THR C CA    1 
ATOM   4320  C  C     . THR C 2 144  ? -19.263 14.520  73.002  1.00 74.63  ? 144  THR C C     1 
ATOM   4321  O  O     . THR C 2 144  ? -19.771 15.505  73.532  1.00 76.35  ? 144  THR C O     1 
ATOM   4322  C  CB    . THR C 2 144  ? -16.834 14.953  72.587  1.00 80.17  ? 144  THR C CB    1 
ATOM   4323  O  OG1   . THR C 2 144  ? -16.944 14.691  71.182  1.00 79.30  ? 144  THR C OG1   1 
ATOM   4324  C  CG2   . THR C 2 144  ? -15.417 14.643  73.048  1.00 79.27  ? 144  THR C CG2   1 
ATOM   4325  N  N     . GLY C 2 145  ? -19.898 13.777  72.102  1.00 78.51  ? 145  GLY C N     1 
ATOM   4326  C  CA    . GLY C 2 145  ? -21.268 14.057  71.711  1.00 75.28  ? 145  GLY C CA    1 
ATOM   4327  C  C     . GLY C 2 145  ? -21.420 15.211  70.737  1.00 76.75  ? 145  GLY C C     1 
ATOM   4328  O  O     . GLY C 2 145  ? -22.513 15.457  70.229  1.00 70.90  ? 145  GLY C O     1 
ATOM   4329  N  N     . GLU C 2 146  ? -20.329 15.921  70.469  1.00 80.61  ? 146  GLU C N     1 
ATOM   4330  C  CA    . GLU C 2 146  ? -20.377 17.076  69.577  1.00 79.15  ? 146  GLU C CA    1 
ATOM   4331  C  C     . GLU C 2 146  ? -20.213 16.673  68.115  1.00 77.96  ? 146  GLU C C     1 
ATOM   4332  O  O     . GLU C 2 146  ? -19.669 15.612  67.809  1.00 80.60  ? 146  GLU C O     1 
ATOM   4333  C  CB    . GLU C 2 146  ? -19.299 18.087  69.958  1.00 73.42  ? 146  GLU C CB    1 
ATOM   4334  C  CG    . GLU C 2 146  ? -17.897 17.522  69.901  1.00 76.99  ? 146  GLU C CG    1 
ATOM   4335  C  CD    . GLU C 2 146  ? -16.847 18.541  70.279  1.00 79.09  ? 146  GLU C CD    1 
ATOM   4336  O  OE1   . GLU C 2 146  ? -17.166 19.749  70.295  1.00 65.69  ? 146  GLU C OE1   1 
ATOM   4337  O  OE2   . GLU C 2 146  ? -15.703 18.132  70.564  1.00 94.76  ? 146  GLU C OE2   1 
ATOM   4338  N  N     . ILE C 2 147  ? -20.686 17.531  67.217  1.00 65.14  ? 147  ILE C N     1 
ATOM   4339  C  CA    . ILE C 2 147  ? -20.610 17.263  65.786  1.00 60.46  ? 147  ILE C CA    1 
ATOM   4340  C  C     . ILE C 2 147  ? -20.090 18.472  65.020  1.00 55.91  ? 147  ILE C C     1 
ATOM   4341  O  O     . ILE C 2 147  ? -20.668 19.554  65.092  1.00 54.56  ? 147  ILE C O     1 
ATOM   4342  C  CB    . ILE C 2 147  ? -21.984 16.859  65.219  1.00 55.69  ? 147  ILE C CB    1 
ATOM   4343  C  CG1   . ILE C 2 147  ? -22.345 15.445  65.672  1.00 63.16  ? 147  ILE C CG1   1 
ATOM   4344  C  CG2   . ILE C 2 147  ? -21.987 16.937  63.700  1.00 54.30  ? 147  ILE C CG2   1 
ATOM   4345  C  CD1   . ILE C 2 147  ? -23.627 14.917  65.068  1.00 67.36  ? 147  ILE C CD1   1 
ATOM   4346  N  N     . LYS C 2 148  ? -18.993 18.282  64.292  1.00 49.57  ? 148  LYS C N     1 
ATOM   4347  C  CA    . LYS C 2 148  ? -18.449 19.332  63.436  1.00 47.62  ? 148  LYS C CA    1 
ATOM   4348  C  C     . LYS C 2 148  ? -18.760 19.033  61.975  1.00 48.23  ? 148  LYS C C     1 
ATOM   4349  O  O     . LYS C 2 148  ? -18.241 18.073  61.404  1.00 47.13  ? 148  LYS C O     1 
ATOM   4350  C  CB    . LYS C 2 148  ? -16.941 19.473  63.635  1.00 46.44  ? 148  LYS C CB    1 
ATOM   4351  C  CG    . LYS C 2 148  ? -16.518 19.653  65.081  1.00 56.00  ? 148  LYS C CG    1 
ATOM   4352  C  CD    . LYS C 2 148  ? -15.028 19.924  65.185  1.00 50.25  ? 148  LYS C CD    1 
ATOM   4353  C  CE    . LYS C 2 148  ? -14.588 20.055  66.632  1.00 49.63  ? 148  LYS C CE    1 
ATOM   4354  N  NZ    . LYS C 2 148  ? -13.157 20.449  66.734  1.00 55.83  ? 148  LYS C NZ    1 
ATOM   4355  N  N     . SER C 2 149  ? -19.609 19.862  61.376  1.00 49.46  ? 149  SER C N     1 
ATOM   4356  C  CA    . SER C 2 149  ? -20.081 19.628  60.017  1.00 39.69  ? 149  SER C CA    1 
ATOM   4357  C  C     . SER C 2 149  ? -19.662 20.756  59.087  1.00 39.18  ? 149  SER C C     1 
ATOM   4358  O  O     . SER C 2 149  ? -19.981 21.922  59.321  1.00 36.90  ? 149  SER C O     1 
ATOM   4359  C  CB    . SER C 2 149  ? -21.602 19.472  60.001  1.00 31.73  ? 149  SER C CB    1 
ATOM   4360  O  OG    . SER C 2 149  ? -22.042 18.908  58.783  1.00 28.03  ? 149  SER C OG    1 
ATOM   4361  N  N     . GLN C 2 150  ? -18.949 20.396  58.027  1.00 43.08  ? 150  GLN C N     1 
ATOM   4362  C  CA    . GLN C 2 150  ? -18.471 21.370  57.058  1.00 36.79  ? 150  GLN C CA    1 
ATOM   4363  C  C     . GLN C 2 150  ? -18.488 20.799  55.644  1.00 35.00  ? 150  GLN C C     1 
ATOM   4364  O  O     . GLN C 2 150  ? -18.790 19.624  55.437  1.00 38.39  ? 150  GLN C O     1 
ATOM   4365  C  CB    . GLN C 2 150  ? -17.062 21.825  57.420  1.00 28.73  ? 150  GLN C CB    1 
ATOM   4366  C  CG    . GLN C 2 150  ? -16.080 20.683  57.521  1.00 26.09  ? 150  GLN C CG    1 
ATOM   4367  C  CD    . GLN C 2 150  ? -14.759 21.103  58.122  1.00 31.59  ? 150  GLN C CD    1 
ATOM   4368  O  OE1   . GLN C 2 150  ? -13.947 20.269  58.510  1.00 33.31  ? 150  GLN C OE1   1 
ATOM   4369  N  NE2   . GLN C 2 150  ? -14.534 22.406  58.199  1.00 38.46  ? 150  GLN C NE2   1 
ATOM   4370  N  N     . THR C 2 151  ? -18.157 21.640  54.673  1.00 30.05  ? 151  THR C N     1 
ATOM   4371  C  CA    . THR C 2 151  ? -18.150 21.231  53.275  1.00 26.83  ? 151  THR C CA    1 
ATOM   4372  C  C     . THR C 2 151  ? -16.723 21.048  52.768  1.00 31.47  ? 151  THR C C     1 
ATOM   4373  O  O     . THR C 2 151  ? -15.883 21.930  52.936  1.00 33.36  ? 151  THR C O     1 
ATOM   4374  C  CB    . THR C 2 151  ? -18.885 22.255  52.400  1.00 25.71  ? 151  THR C CB    1 
ATOM   4375  O  OG1   . THR C 2 151  ? -20.292 22.160  52.648  1.00 30.32  ? 151  THR C OG1   1 
ATOM   4376  C  CG2   . THR C 2 151  ? -18.625 21.994  50.930  1.00 30.52  ? 151  THR C CG2   1 
ATOM   4377  N  N     . VAL C 2 152  ? -16.448 19.903  52.149  1.00 30.41  ? 152  VAL C N     1 
ATOM   4378  C  CA    . VAL C 2 152  ? -15.097 19.609  51.690  1.00 25.64  ? 152  VAL C CA    1 
ATOM   4379  C  C     . VAL C 2 152  ? -15.007 19.494  50.169  1.00 20.16  ? 152  VAL C C     1 
ATOM   4380  O  O     . VAL C 2 152  ? -15.910 18.964  49.521  1.00 20.80  ? 152  VAL C O     1 
ATOM   4381  C  CB    . VAL C 2 152  ? -14.567 18.309  52.319  1.00 26.79  ? 152  VAL C CB    1 
ATOM   4382  C  CG1   . VAL C 2 152  ? -13.055 18.257  52.208  1.00 28.63  ? 152  VAL C CG1   1 
ATOM   4383  C  CG2   . VAL C 2 152  ? -14.991 18.209  53.776  1.00 32.85  ? 152  VAL C CG2   1 
ATOM   4384  N  N     . PHE C 2 153  ? -13.908 20.003  49.614  1.00 20.22  ? 153  PHE C N     1 
ATOM   4385  C  CA    . PHE C 2 153  ? -13.624 19.928  48.179  1.00 24.37  ? 153  PHE C CA    1 
ATOM   4386  C  C     . PHE C 2 153  ? -13.157 18.524  47.800  1.00 25.69  ? 153  PHE C C     1 
ATOM   4387  O  O     . PHE C 2 153  ? -12.279 17.962  48.453  1.00 28.14  ? 153  PHE C O     1 
ATOM   4388  C  CB    . PHE C 2 153  ? -12.567 20.975  47.799  1.00 27.72  ? 153  PHE C CB    1 
ATOM   4389  C  CG    . PHE C 2 153  ? -12.154 20.943  46.349  1.00 23.53  ? 153  PHE C CG    1 
ATOM   4390  C  CD1   . PHE C 2 153  ? -13.096 20.825  45.346  1.00 19.92  ? 153  PHE C CD1   1 
ATOM   4391  C  CD2   . PHE C 2 153  ? -10.820 21.063  45.992  1.00 31.41  ? 153  PHE C CD2   1 
ATOM   4392  C  CE1   . PHE C 2 153  ? -12.719 20.806  44.017  1.00 21.51  ? 153  PHE C CE1   1 
ATOM   4393  C  CE2   . PHE C 2 153  ? -10.436 21.045  44.662  1.00 27.86  ? 153  PHE C CE2   1 
ATOM   4394  C  CZ    . PHE C 2 153  ? -11.387 20.918  43.675  1.00 22.36  ? 153  PHE C CZ    1 
ATOM   4395  N  N     . MET C 2 154  ? -13.740 17.952  46.750  1.00 20.93  ? 154  MET C N     1 
ATOM   4396  C  CA    . MET C 2 154  ? -13.438 16.567  46.405  1.00 13.19  ? 154  MET C CA    1 
ATOM   4397  C  C     . MET C 2 154  ? -12.679 16.415  45.093  1.00 13.13  ? 154  MET C C     1 
ATOM   4398  O  O     . MET C 2 154  ? -12.235 15.322  44.752  1.00 8.82   ? 154  MET C O     1 
ATOM   4399  C  CB    . MET C 2 154  ? -14.724 15.751  46.355  1.00 12.63  ? 154  MET C CB    1 
ATOM   4400  C  CG    . MET C 2 154  ? -15.385 15.599  47.714  1.00 18.59  ? 154  MET C CG    1 
ATOM   4401  S  SD    . MET C 2 154  ? -14.303 14.871  48.961  1.00 21.43  ? 154  MET C SD    1 
ATOM   4402  C  CE    . MET C 2 154  ? -13.938 13.269  48.249  1.00 7.49   ? 154  MET C CE    1 
ATOM   4403  N  N     . GLY C 2 155  ? -12.524 17.510  44.361  1.00 21.52  ? 155  GLY C N     1 
ATOM   4404  C  CA    . GLY C 2 155  ? -11.725 17.490  43.149  1.00 21.31  ? 155  GLY C CA    1 
ATOM   4405  C  C     . GLY C 2 155  ? -12.513 17.819  41.900  1.00 12.78  ? 155  GLY C C     1 
ATOM   4406  O  O     . GLY C 2 155  ? -13.730 17.655  41.855  1.00 13.05  ? 155  GLY C O     1 
ATOM   4407  N  N     . ASP C 2 156  ? -11.820 18.292  40.876  1.00 9.61   ? 156  ASP C N     1 
ATOM   4408  C  CA    . ASP C 2 156  ? -12.488 18.601  39.629  1.00 9.37   ? 156  ASP C CA    1 
ATOM   4409  C  C     . ASP C 2 156  ? -12.963 17.299  38.966  1.00 5.88   ? 156  ASP C C     1 
ATOM   4410  O  O     . ASP C 2 156  ? -12.219 16.326  38.886  1.00 1.28   ? 156  ASP C O     1 
ATOM   4411  C  CB    . ASP C 2 156  ? -11.555 19.409  38.727  1.00 13.89  ? 156  ASP C CB    1 
ATOM   4412  C  CG    . ASP C 2 156  ? -11.116 20.721  39.371  1.00 15.57  ? 156  ASP C CG    1 
ATOM   4413  O  OD1   . ASP C 2 156  ? -11.942 21.359  40.055  1.00 16.01  ? 156  ASP C OD1   1 
ATOM   4414  O  OD2   . ASP C 2 156  ? -9.942  21.108  39.201  1.00 23.49  ? 156  ASP C OD2   1 
ATOM   4415  N  N     . PHE C 2 157  ? -14.220 17.298  38.522  1.00 9.98   ? 157  PHE C N     1 
ATOM   4416  C  CA    . PHE C 2 157  ? -14.918 16.102  38.036  1.00 4.22   ? 157  PHE C CA    1 
ATOM   4417  C  C     . PHE C 2 157  ? -15.271 16.186  36.549  1.00 2.07   ? 157  PHE C C     1 
ATOM   4418  O  O     . PHE C 2 157  ? -16.065 17.035  36.149  1.00 3.20   ? 157  PHE C O     1 
ATOM   4419  C  CB    . PHE C 2 157  ? -16.201 15.886  38.850  1.00 5.27   ? 157  PHE C CB    1 
ATOM   4420  C  CG    . PHE C 2 157  ? -16.868 14.557  38.614  1.00 3.87   ? 157  PHE C CG    1 
ATOM   4421  C  CD1   . PHE C 2 157  ? -17.686 14.354  37.517  1.00 4.42   ? 157  PHE C CD1   1 
ATOM   4422  C  CD2   . PHE C 2 157  ? -16.699 13.522  39.513  1.00 2.10   ? 157  PHE C CD2   1 
ATOM   4423  C  CE1   . PHE C 2 157  ? -18.301 13.137  37.314  1.00 1.41   ? 157  PHE C CE1   1 
ATOM   4424  C  CE2   . PHE C 2 157  ? -17.313 12.306  39.314  1.00 16.90  ? 157  PHE C CE2   1 
ATOM   4425  C  CZ    . PHE C 2 157  ? -18.114 12.114  38.213  1.00 0.63   ? 157  PHE C CZ    1 
ATOM   4426  N  N     . PRO C 2 158  ? -14.704 15.283  35.733  1.00 3.49   ? 158  PRO C N     1 
ATOM   4427  C  CA    . PRO C 2 158  ? -14.926 15.247  34.283  1.00 4.31   ? 158  PRO C CA    1 
ATOM   4428  C  C     . PRO C 2 158  ? -16.397 15.142  33.912  1.00 8.40   ? 158  PRO C C     1 
ATOM   4429  O  O     . PRO C 2 158  ? -17.053 14.168  34.264  1.00 12.19  ? 158  PRO C O     1 
ATOM   4430  C  CB    . PRO C 2 158  ? -14.180 13.987  33.844  1.00 14.56  ? 158  PRO C CB    1 
ATOM   4431  C  CG    . PRO C 2 158  ? -13.181 13.756  34.893  1.00 3.74   ? 158  PRO C CG    1 
ATOM   4432  C  CD    . PRO C 2 158  ? -13.807 14.202  36.169  1.00 3.72   ? 158  PRO C CD    1 
ATOM   4433  N  N     . MET C 2 159  ? -16.901 16.140  33.199  1.00 4.88   ? 159  MET C N     1 
ATOM   4434  C  CA    . MET C 2 159  ? -18.298 16.162  32.786  1.00 2.56   ? 159  MET C CA    1 
ATOM   4435  C  C     . MET C 2 159  ? -18.451 15.771  31.328  1.00 2.36   ? 159  MET C C     1 
ATOM   4436  O  O     . MET C 2 159  ? -17.556 15.990  30.516  1.00 3.12   ? 159  MET C O     1 
ATOM   4437  C  CB    . MET C 2 159  ? -18.894 17.544  33.021  1.00 6.92   ? 159  MET C CB    1 
ATOM   4438  C  CG    . MET C 2 159  ? -19.056 17.880  34.483  1.00 4.67   ? 159  MET C CG    1 
ATOM   4439  S  SD    . MET C 2 159  ? -20.410 16.929  35.175  1.00 3.43   ? 159  MET C SD    1 
ATOM   4440  C  CE    . MET C 2 159  ? -21.786 17.700  34.346  1.00 5.64   ? 159  MET C CE    1 
ATOM   4441  N  N     . MET C 2 160  ? -19.598 15.193  31.000  1.00 6.06   ? 160  MET C N     1 
ATOM   4442  C  CA    . MET C 2 160  ? -19.865 14.763  29.639  1.00 4.24   ? 160  MET C CA    1 
ATOM   4443  C  C     . MET C 2 160  ? -20.500 15.881  28.838  1.00 0.59   ? 160  MET C C     1 
ATOM   4444  O  O     . MET C 2 160  ? -21.419 16.543  29.302  1.00 1.17   ? 160  MET C O     1 
ATOM   4445  C  CB    . MET C 2 160  ? -20.774 13.536  29.635  1.00 6.17   ? 160  MET C CB    1 
ATOM   4446  C  CG    . MET C 2 160  ? -21.181 13.047  28.252  1.00 6.87   ? 160  MET C CG    1 
ATOM   4447  S  SD    . MET C 2 160  ? -22.320 11.650  28.326  1.00 4.42   ? 160  MET C SD    1 
ATOM   4448  C  CE    . MET C 2 160  ? -21.247 10.349  28.923  1.00 8.59   ? 160  MET C CE    1 
ATOM   4449  N  N     . THR C 2 161  ? -20.004 16.078  27.627  1.00 0.93   ? 161  THR C N     1 
ATOM   4450  C  CA    . THR C 2 161  ? -20.540 17.086  26.732  1.00 5.89   ? 161  THR C CA    1 
ATOM   4451  C  C     . THR C 2 161  ? -21.924 16.723  26.244  1.00 10.66  ? 161  THR C C     1 
ATOM   4452  O  O     . THR C 2 161  ? -22.461 15.672  26.581  1.00 11.67  ? 161  THR C O     1 
ATOM   4453  C  CB    . THR C 2 161  ? -19.669 17.258  25.505  1.00 12.76  ? 161  THR C CB    1 
ATOM   4454  O  OG1   . THR C 2 161  ? -19.963 16.200  24.584  1.00 10.80  ? 161  THR C OG1   1 
ATOM   4455  C  CG2   . THR C 2 161  ? -18.204 17.213  25.887  1.00 21.82  ? 161  THR C CG2   1 
ATOM   4456  N  N     . GLU C 2 162  ? -22.482 17.595  25.418  1.00 16.20  ? 162  GLU C N     1 
ATOM   4457  C  CA    . GLU C 2 162  ? -23.769 17.343  24.794  1.00 15.86  ? 162  GLU C CA    1 
ATOM   4458  C  C     . GLU C 2 162  ? -23.672 16.211  23.787  1.00 2.59   ? 162  GLU C C     1 
ATOM   4459  O  O     . GLU C 2 162  ? -24.620 15.464  23.596  1.00 2.95   ? 162  GLU C O     1 
ATOM   4460  C  CB    . GLU C 2 162  ? -24.289 18.613  24.109  1.00 35.76  ? 162  GLU C CB    1 
ATOM   4461  C  CG    . GLU C 2 162  ? -24.619 19.761  25.047  1.00 47.49  ? 162  GLU C CG    1 
ATOM   4462  C  CD    . GLU C 2 162  ? -25.284 20.928  24.332  1.00 55.56  ? 162  GLU C CD    1 
ATOM   4463  O  OE1   . GLU C 2 162  ? -25.186 20.997  23.090  1.00 47.11  ? 162  GLU C OE1   1 
ATOM   4464  O  OE2   . GLU C 2 162  ? -25.914 21.770  25.008  1.00 68.04  ? 162  GLU C OE2   1 
ATOM   4465  N  N     . LYS C 2 163  ? -22.515 16.094  23.148  1.00 3.59   ? 163  LYS C N     1 
ATOM   4466  C  CA    . LYS C 2 163  ? -22.297 15.086  22.115  1.00 3.85   ? 163  LYS C CA    1 
ATOM   4467  C  C     . LYS C 2 163  ? -21.933 13.734  22.722  1.00 2.37   ? 163  LYS C C     1 
ATOM   4468  O  O     . LYS C 2 163  ? -21.495 12.819  22.024  1.00 1.93   ? 163  LYS C O     1 
ATOM   4469  C  CB    . LYS C 2 163  ? -21.200 15.535  21.145  1.00 6.80   ? 163  LYS C CB    1 
ATOM   4470  C  CG    . LYS C 2 163  ? -21.595 16.691  20.226  1.00 5.52   ? 163  LYS C CG    1 
ATOM   4471  C  CD    . LYS C 2 163  ? -20.370 17.310  19.570  1.00 7.28   ? 163  LYS C CD    1 
ATOM   4472  C  CE    . LYS C 2 163  ? -19.415 17.858  20.622  1.00 14.02  ? 163  LYS C CE    1 
ATOM   4473  N  NZ    . LYS C 2 163  ? -18.188 18.452  20.028  1.00 10.62  ? 163  LYS C NZ    1 
ATOM   4474  N  N     . GLY C 2 164  ? -22.110 13.619  24.033  1.00 3.99   ? 164  GLY C N     1 
ATOM   4475  C  CA    . GLY C 2 164  ? -21.977 12.348  24.720  1.00 4.90   ? 164  GLY C CA    1 
ATOM   4476  C  C     . GLY C 2 164  ? -20.542 11.948  24.959  1.00 5.39   ? 164  GLY C C     1 
ATOM   4477  O  O     . GLY C 2 164  ? -20.266 10.869  25.471  1.00 11.10  ? 164  GLY C O     1 
ATOM   4478  N  N     . THR C 2 165  ? -19.620 12.821  24.586  1.00 3.66   ? 165  THR C N     1 
ATOM   4479  C  CA    . THR C 2 165  ? -18.210 12.524  24.749  1.00 2.07   ? 165  THR C CA    1 
ATOM   4480  C  C     . THR C 2 165  ? -17.664 13.186  25.991  1.00 1.48   ? 165  THR C C     1 
ATOM   4481  O  O     . THR C 2 165  ? -18.327 14.017  26.611  1.00 5.57   ? 165  THR C O     1 
ATOM   4482  C  CB    . THR C 2 165  ? -17.386 12.999  23.551  1.00 2.05   ? 165  THR C CB    1 
ATOM   4483  O  OG1   . THR C 2 165  ? -17.154 14.407  23.664  1.00 2.34   ? 165  THR C OG1   1 
ATOM   4484  C  CG2   . THR C 2 165  ? -18.115 12.708  22.257  1.00 4.03   ? 165  THR C CG2   1 
ATOM   4485  N  N     . PHE C 2 166  ? -16.448 12.801  26.348  1.00 10.23  ? 166  PHE C N     1 
ATOM   4486  C  CA    . PHE C 2 166  ? -15.694 13.506  27.363  1.00 11.37  ? 166  PHE C CA    1 
ATOM   4487  C  C     . PHE C 2 166  ? -14.571 14.280  26.701  1.00 6.93   ? 166  PHE C C     1 
ATOM   4488  O  O     . PHE C 2 166  ? -14.227 14.020  25.550  1.00 9.63   ? 166  PHE C O     1 
ATOM   4489  C  CB    . PHE C 2 166  ? -15.127 12.541  28.390  1.00 11.30  ? 166  PHE C CB    1 
ATOM   4490  C  CG    . PHE C 2 166  ? -16.159 11.933  29.271  1.00 9.62   ? 166  PHE C CG    1 
ATOM   4491  C  CD1   . PHE C 2 166  ? -16.725 10.718  28.951  1.00 1.15   ? 166  PHE C CD1   1 
ATOM   4492  C  CD2   . PHE C 2 166  ? -16.573 12.579  30.416  1.00 1.16   ? 166  PHE C CD2   1 
ATOM   4493  C  CE1   . PHE C 2 166  ? -17.679 10.151  29.759  1.00 2.76   ? 166  PHE C CE1   1 
ATOM   4494  C  CE2   . PHE C 2 166  ? -17.530 12.019  31.231  1.00 4.39   ? 166  PHE C CE2   1 
ATOM   4495  C  CZ    . PHE C 2 166  ? -18.085 10.801  30.901  1.00 4.54   ? 166  PHE C CZ    1 
ATOM   4496  N  N     . ILE C 2 167  ? -14.006 15.240  27.422  1.00 6.06   ? 167  ILE C N     1 
ATOM   4497  C  CA    . ILE C 2 167  ? -12.825 15.936  26.937  1.00 1.10   ? 167  ILE C CA    1 
ATOM   4498  C  C     . ILE C 2 167  ? -11.682 15.794  27.920  1.00 4.74   ? 167  ILE C C     1 
ATOM   4499  O  O     . ILE C 2 167  ? -11.638 16.473  28.942  1.00 7.53   ? 167  ILE C O     1 
ATOM   4500  C  CB    . ILE C 2 167  ? -13.087 17.408  26.704  1.00 11.61  ? 167  ILE C CB    1 
ATOM   4501  C  CG1   . ILE C 2 167  ? -14.161 17.579  25.640  1.00 0.32   ? 167  ILE C CG1   1 
ATOM   4502  C  CG2   . ILE C 2 167  ? -11.814 18.081  26.263  1.00 3.97   ? 167  ILE C CG2   1 
ATOM   4503  C  CD1   . ILE C 2 167  ? -14.249 18.971  25.113  1.00 7.41   ? 167  ILE C CD1   1 
ATOM   4504  N  N     . ILE C 2 168  ? -10.760 14.895  27.611  1.00 4.47   ? 168  ILE C N     1 
ATOM   4505  C  CA    . ILE C 2 168  ? -9.614  14.677  28.469  1.00 5.01   ? 168  ILE C CA    1 
ATOM   4506  C  C     . ILE C 2 168  ? -8.403  15.326  27.838  1.00 7.32   ? 168  ILE C C     1 
ATOM   4507  O  O     . ILE C 2 168  ? -8.071  15.052  26.685  1.00 8.76   ? 168  ILE C O     1 
ATOM   4508  C  CB    . ILE C 2 168  ? -9.349  13.182  28.710  1.00 5.03   ? 168  ILE C CB    1 
ATOM   4509  C  CG1   . ILE C 2 168  ? -10.207 12.674  29.867  1.00 3.37   ? 168  ILE C CG1   1 
ATOM   4510  C  CG2   . ILE C 2 168  ? -7.891  12.943  29.035  1.00 9.64   ? 168  ILE C CG2   1 
ATOM   4511  C  CD1   . ILE C 2 168  ? -11.679 12.554  29.545  1.00 7.06   ? 168  ILE C CD1   1 
ATOM   4512  N  N     . ASN C 2 169  ? -7.784  16.229  28.589  1.00 7.15   ? 169  ASN C N     1 
ATOM   4513  C  CA    . ASN C 2 169  ? -6.519  16.846  28.212  1.00 7.15   ? 169  ASN C CA    1 
ATOM   4514  C  C     . ASN C 2 169  ? -6.500  17.452  26.816  1.00 7.63   ? 169  ASN C C     1 
ATOM   4515  O  O     . ASN C 2 169  ? -5.435  17.704  26.266  1.00 13.54  ? 169  ASN C O     1 
ATOM   4516  C  CB    . ASN C 2 169  ? -5.391  15.820  28.326  1.00 4.41   ? 169  ASN C CB    1 
ATOM   4517  C  CG    . ASN C 2 169  ? -5.276  15.234  29.715  1.00 5.41   ? 169  ASN C CG    1 
ATOM   4518  O  OD1   . ASN C 2 169  ? -6.222  15.278  30.502  1.00 11.18  ? 169  ASN C OD1   1 
ATOM   4519  N  ND2   . ASN C 2 169  ? -4.110  14.682  30.025  1.00 0.36   ? 169  ASN C ND2   1 
ATOM   4520  N  N     . GLY C 2 170  ? -7.674  17.663  26.233  1.00 7.03   ? 170  GLY C N     1 
ATOM   4521  C  CA    . GLY C 2 170  ? -7.764  18.302  24.933  1.00 13.89  ? 170  GLY C CA    1 
ATOM   4522  C  C     . GLY C 2 170  ? -7.925  17.346  23.766  1.00 15.85  ? 170  GLY C C     1 
ATOM   4523  O  O     . GLY C 2 170  ? -7.769  17.737  22.607  1.00 19.18  ? 170  GLY C O     1 
ATOM   4524  N  N     . THR C 2 171  ? -8.226  16.089  24.075  1.00 15.06  ? 171  THR C N     1 
ATOM   4525  C  CA    . THR C 2 171  ? -8.535  15.092  23.058  1.00 12.42  ? 171  THR C CA    1 
ATOM   4526  C  C     . THR C 2 171  ? -9.902  14.509  23.356  1.00 0.73   ? 171  THR C C     1 
ATOM   4527  O  O     . THR C 2 171  ? -10.143 14.022  24.457  1.00 8.20   ? 171  THR C O     1 
ATOM   4528  C  CB    . THR C 2 171  ? -7.493  13.956  23.016  1.00 16.59  ? 171  THR C CB    1 
ATOM   4529  O  OG1   . THR C 2 171  ? -7.435  13.310  24.294  1.00 17.33  ? 171  THR C OG1   1 
ATOM   4530  C  CG2   . THR C 2 171  ? -6.117  14.497  22.663  1.00 16.48  ? 171  THR C CG2   1 
ATOM   4531  N  N     . GLU C 2 172  ? -10.807 14.570  22.391  1.00 0.16   ? 172  GLU C N     1 
ATOM   4532  C  CA    . GLU C 2 172  ? -12.147 14.081  22.642  1.00 0.52   ? 172  GLU C CA    1 
ATOM   4533  C  C     . GLU C 2 172  ? -12.116 12.567  22.808  1.00 5.83   ? 172  GLU C C     1 
ATOM   4534  O  O     . GLU C 2 172  ? -11.583 11.852  21.967  1.00 8.43   ? 172  GLU C O     1 
ATOM   4535  C  CB    . GLU C 2 172  ? -13.095 14.492  21.520  1.00 2.22   ? 172  GLU C CB    1 
ATOM   4536  C  CG    . GLU C 2 172  ? -14.483 14.864  22.012  1.00 1.79   ? 172  GLU C CG    1 
ATOM   4537  C  CD    . GLU C 2 172  ? -15.324 15.526  20.946  1.00 0.78   ? 172  GLU C CD    1 
ATOM   4538  O  OE1   . GLU C 2 172  ? -14.798 15.759  19.840  1.00 5.48   ? 172  GLU C OE1   1 
ATOM   4539  O  OE2   . GLU C 2 172  ? -16.508 15.815  21.213  1.00 3.87   ? 172  GLU C OE2   1 
ATOM   4540  N  N     . ARG C 2 173  ? -12.673 12.083  23.912  1.00 2.51   ? 173  ARG C N     1 
ATOM   4541  C  CA    . ARG C 2 173  ? -12.674 10.655  24.198  1.00 4.50   ? 173  ARG C CA    1 
ATOM   4542  C  C     . ARG C 2 173  ? -14.085 10.104  24.387  1.00 3.14   ? 173  ARG C C     1 
ATOM   4543  O  O     . ARG C 2 173  ? -15.033 10.856  24.602  1.00 1.07   ? 173  ARG C O     1 
ATOM   4544  C  CB    . ARG C 2 173  ? -11.832 10.366  25.438  1.00 8.48   ? 173  ARG C CB    1 
ATOM   4545  C  CG    . ARG C 2 173  ? -10.349 10.607  25.227  1.00 12.33  ? 173  ARG C CG    1 
ATOM   4546  C  CD    . ARG C 2 173  ? -9.525  10.115  26.402  1.00 14.71  ? 173  ARG C CD    1 
ATOM   4547  N  NE    . ARG C 2 173  ? -8.151  9.827   25.997  1.00 25.07  ? 173  ARG C NE    1 
ATOM   4548  C  CZ    . ARG C 2 173  ? -7.750  8.657   25.506  1.00 25.95  ? 173  ARG C CZ    1 
ATOM   4549  N  NH1   . ARG C 2 173  ? -8.615  7.663   25.365  1.00 19.28  ? 173  ARG C NH1   1 
ATOM   4550  N  NH2   . ARG C 2 173  ? -6.483  8.477   25.156  1.00 26.21  ? 173  ARG C NH2   1 
ATOM   4551  N  N     . VAL C 2 174  ? -14.219 8.785   24.291  1.00 8.10   ? 174  VAL C N     1 
ATOM   4552  C  CA    . VAL C 2 174  ? -15.510 8.122   24.466  1.00 0.70   ? 174  VAL C CA    1 
ATOM   4553  C  C     . VAL C 2 174  ? -15.383 6.914   25.385  1.00 0.89   ? 174  VAL C C     1 
ATOM   4554  O  O     . VAL C 2 174  ? -14.443 6.135   25.263  1.00 3.74   ? 174  VAL C O     1 
ATOM   4555  C  CB    . VAL C 2 174  ? -16.096 7.658   23.123  1.00 1.37   ? 174  VAL C CB    1 
ATOM   4556  C  CG1   . VAL C 2 174  ? -17.410 6.936   23.347  1.00 3.64   ? 174  VAL C CG1   1 
ATOM   4557  C  CG2   . VAL C 2 174  ? -16.289 8.841   22.183  1.00 3.79   ? 174  VAL C CG2   1 
ATOM   4558  N  N     . VAL C 2 175  ? -16.326 6.761   26.307  1.00 8.12   ? 175  VAL C N     1 
ATOM   4559  C  CA    . VAL C 2 175  ? -16.326 5.607   27.188  1.00 9.13   ? 175  VAL C CA    1 
ATOM   4560  C  C     . VAL C 2 175  ? -17.252 4.520   26.666  1.00 2.47   ? 175  VAL C C     1 
ATOM   4561  O  O     . VAL C 2 175  ? -18.470 4.666   26.693  1.00 6.68   ? 175  VAL C O     1 
ATOM   4562  C  CB    . VAL C 2 175  ? -16.751 5.978   28.604  1.00 8.22   ? 175  VAL C CB    1 
ATOM   4563  C  CG1   . VAL C 2 175  ? -16.749 4.744   29.473  1.00 0.58   ? 175  VAL C CG1   1 
ATOM   4564  C  CG2   . VAL C 2 175  ? -15.818 7.017   29.174  1.00 9.61   ? 175  VAL C CG2   1 
ATOM   4565  N  N     . VAL C 2 176  ? -16.660 3.429   26.197  1.00 4.00   ? 176  VAL C N     1 
ATOM   4566  C  CA    . VAL C 2 176  ? -17.405 2.322   25.606  1.00 2.33   ? 176  VAL C CA    1 
ATOM   4567  C  C     . VAL C 2 176  ? -18.050 1.444   26.674  1.00 1.19   ? 176  VAL C C     1 
ATOM   4568  O  O     . VAL C 2 176  ? -17.434 1.143   27.694  1.00 2.67   ? 176  VAL C O     1 
ATOM   4569  C  CB    . VAL C 2 176  ? -16.483 1.457   24.720  1.00 4.75   ? 176  VAL C CB    1 
ATOM   4570  C  CG1   . VAL C 2 176  ? -17.195 0.204   24.256  1.00 8.18   ? 176  VAL C CG1   1 
ATOM   4571  C  CG2   . VAL C 2 176  ? -15.982 2.256   23.527  1.00 4.10   ? 176  VAL C CG2   1 
ATOM   4572  N  N     . SER C 2 177  ? -19.290 1.036   26.442  1.00 8.92   ? 177  SER C N     1 
ATOM   4573  C  CA    . SER C 2 177  ? -19.975 0.176   27.389  1.00 10.27  ? 177  SER C CA    1 
ATOM   4574  C  C     . SER C 2 177  ? -19.390 -1.236  27.396  1.00 1.02   ? 177  SER C C     1 
ATOM   4575  O  O     . SER C 2 177  ? -19.218 -1.849  26.350  1.00 5.17   ? 177  SER C O     1 
ATOM   4576  C  CB    . SER C 2 177  ? -21.461 0.149   27.070  1.00 9.74   ? 177  SER C CB    1 
ATOM   4577  O  OG    . SER C 2 177  ? -21.983 1.461   27.146  1.00 2.17   ? 177  SER C OG    1 
ATOM   4578  N  N     . GLN C 2 178  ? -19.078 -1.735  28.587  1.00 12.39  ? 178  GLN C N     1 
ATOM   4579  C  CA    . GLN C 2 178  ? -18.447 -3.038  28.748  1.00 2.62   ? 178  GLN C CA    1 
ATOM   4580  C  C     . GLN C 2 178  ? -19.483 -4.130  28.949  1.00 7.17   ? 178  GLN C C     1 
ATOM   4581  O  O     . GLN C 2 178  ? -20.416 -3.972  29.725  1.00 11.41  ? 178  GLN C O     1 
ATOM   4582  C  CB    . GLN C 2 178  ? -17.464 -3.007  29.928  1.00 10.52  ? 178  GLN C CB    1 
ATOM   4583  C  CG    . GLN C 2 178  ? -16.870 -4.363  30.307  1.00 16.91  ? 178  GLN C CG    1 
ATOM   4584  C  CD    . GLN C 2 178  ? -15.799 -4.274  31.391  1.00 16.79  ? 178  GLN C CD    1 
ATOM   4585  O  OE1   . GLN C 2 178  ? -16.092 -4.355  32.583  1.00 17.29  ? 178  GLN C OE1   1 
ATOM   4586  N  NE2   . GLN C 2 178  ? -14.548 -4.138  30.974  1.00 16.08  ? 178  GLN C NE2   1 
ATOM   4587  N  N     . LEU C 2 179  ? -19.305 -5.240  28.242  1.00 4.53   ? 179  LEU C N     1 
ATOM   4588  C  CA    . LEU C 2 179  ? -20.170 -6.408  28.389  1.00 11.44  ? 179  LEU C CA    1 
ATOM   4589  C  C     . LEU C 2 179  ? -19.558 -7.421  29.354  1.00 16.07  ? 179  LEU C C     1 
ATOM   4590  O  O     . LEU C 2 179  ? -18.527 -8.016  29.058  1.00 20.58  ? 179  LEU C O     1 
ATOM   4591  C  CB    . LEU C 2 179  ? -20.420 -7.073  27.033  1.00 10.55  ? 179  LEU C CB    1 
ATOM   4592  C  CG    . LEU C 2 179  ? -21.565 -6.528  26.181  1.00 8.83   ? 179  LEU C CG    1 
ATOM   4593  C  CD1   . LEU C 2 179  ? -21.645 -7.267  24.855  1.00 8.74   ? 179  LEU C CD1   1 
ATOM   4594  C  CD2   . LEU C 2 179  ? -22.874 -6.651  26.927  1.00 13.97  ? 179  LEU C CD2   1 
ATOM   4595  N  N     . VAL C 2 180  ? -20.192 -7.625  30.503  1.00 13.68  ? 180  VAL C N     1 
ATOM   4596  C  CA    . VAL C 2 180  ? -19.622 -8.499  31.519  1.00 14.89  ? 180  VAL C CA    1 
ATOM   4597  C  C     . VAL C 2 180  ? -20.557 -9.600  31.995  1.00 21.63  ? 180  VAL C C     1 
ATOM   4598  O  O     . VAL C 2 180  ? -21.686 -9.743  31.521  1.00 22.86  ? 180  VAL C O     1 
ATOM   4599  C  CB    . VAL C 2 180  ? -19.172 -7.693  32.751  1.00 17.07  ? 180  VAL C CB    1 
ATOM   4600  C  CG1   . VAL C 2 180  ? -17.845 -7.011  32.482  1.00 15.36  ? 180  VAL C CG1   1 
ATOM   4601  C  CG2   . VAL C 2 180  ? -20.235 -6.684  33.148  1.00 16.58  ? 180  VAL C CG2   1 
ATOM   4602  N  N     . ARG C 2 181  ? -20.057 -10.380 32.945  1.00 24.29  ? 181  ARG C N     1 
ATOM   4603  C  CA    . ARG C 2 181  ? -20.797 -11.496 33.508  1.00 28.72  ? 181  ARG C CA    1 
ATOM   4604  C  C     . ARG C 2 181  ? -21.590 -11.045 34.725  1.00 30.43  ? 181  ARG C C     1 
ATOM   4605  O  O     . ARG C 2 181  ? -21.017 -10.684 35.753  1.00 29.15  ? 181  ARG C O     1 
ATOM   4606  C  CB    . ARG C 2 181  ? -19.841 -12.627 33.880  1.00 34.14  ? 181  ARG C CB    1 
ATOM   4607  C  CG    . ARG C 2 181  ? -20.511 -13.930 34.270  1.00 43.48  ? 181  ARG C CG    1 
ATOM   4608  C  CD    . ARG C 2 181  ? -19.470 -14.998 34.590  1.00 54.14  ? 181  ARG C CD    1 
ATOM   4609  N  NE    . ARG C 2 181  ? -20.053 -16.336 34.654  1.00 66.84  ? 181  ARG C NE    1 
ATOM   4610  C  CZ    . ARG C 2 181  ? -19.359 -17.442 34.904  1.00 73.31  ? 181  ARG C CZ    1 
ATOM   4611  N  NH1   . ARG C 2 181  ? -18.051 -17.373 35.118  1.00 85.90  ? 181  ARG C NH1   1 
ATOM   4612  N  NH2   . ARG C 2 181  ? -19.973 -18.619 34.939  1.00 73.33  ? 181  ARG C NH2   1 
ATOM   4613  N  N     . SER C 2 182  ? -22.912 -11.062 34.597  1.00 28.11  ? 182  SER C N     1 
ATOM   4614  C  CA    . SER C 2 182  ? -23.797 -10.625 35.668  1.00 34.13  ? 182  SER C CA    1 
ATOM   4615  C  C     . SER C 2 182  ? -23.682 -11.515 36.901  1.00 35.58  ? 182  SER C C     1 
ATOM   4616  O  O     . SER C 2 182  ? -23.594 -12.738 36.783  1.00 30.32  ? 182  SER C O     1 
ATOM   4617  C  CB    . SER C 2 182  ? -25.245 -10.600 35.177  1.00 33.33  ? 182  SER C CB    1 
ATOM   4618  O  OG    . SER C 2 182  ? -26.140 -10.234 36.213  1.00 34.55  ? 182  SER C OG    1 
ATOM   4619  N  N     . PRO C 2 183  ? -23.673 -10.897 38.092  1.00 37.52  ? 183  PRO C N     1 
ATOM   4620  C  CA    . PRO C 2 183  ? -23.660 -11.635 39.355  1.00 33.94  ? 183  PRO C CA    1 
ATOM   4621  C  C     . PRO C 2 183  ? -24.924 -12.453 39.495  1.00 36.63  ? 183  PRO C C     1 
ATOM   4622  O  O     . PRO C 2 183  ? -25.942 -12.103 38.905  1.00 39.00  ? 183  PRO C O     1 
ATOM   4623  C  CB    . PRO C 2 183  ? -23.604 -10.535 40.420  1.00 32.07  ? 183  PRO C CB    1 
ATOM   4624  C  CG    . PRO C 2 183  ? -23.156 -9.320  39.707  1.00 41.76  ? 183  PRO C CG    1 
ATOM   4625  C  CD    . PRO C 2 183  ? -23.662 -9.442  38.308  1.00 42.31  ? 183  PRO C CD    1 
ATOM   4626  N  N     . GLY C 2 184  ? -24.857 -13.530 40.264  1.00 48.03  ? 184  GLY C N     1 
ATOM   4627  C  CA    . GLY C 2 184  ? -26.010 -14.380 40.467  1.00 54.70  ? 184  GLY C CA    1 
ATOM   4628  C  C     . GLY C 2 184  ? -25.616 -15.834 40.579  1.00 59.07  ? 184  GLY C C     1 
ATOM   4629  O  O     . GLY C 2 184  ? -24.431 -16.170 40.604  1.00 64.75  ? 184  GLY C O     1 
ATOM   4630  N  N     . VAL C 2 185  ? -26.616 -16.702 40.642  1.00 51.39  ? 185  VAL C N     1 
ATOM   4631  C  CA    . VAL C 2 185  ? -26.369 -18.127 40.780  1.00 51.26  ? 185  VAL C CA    1 
ATOM   4632  C  C     . VAL C 2 185  ? -26.776 -18.856 39.496  1.00 53.78  ? 185  VAL C C     1 
ATOM   4633  O  O     . VAL C 2 185  ? -27.942 -18.835 39.093  1.00 57.63  ? 185  VAL C O     1 
ATOM   4634  C  CB    . VAL C 2 185  ? -27.118 -18.693 41.995  1.00 49.19  ? 185  VAL C CB    1 
ATOM   4635  C  CG1   . VAL C 2 185  ? -28.500 -18.060 42.114  1.00 54.05  ? 185  VAL C CG1   1 
ATOM   4636  C  CG2   . VAL C 2 185  ? -27.202 -20.202 41.924  1.00 64.01  ? 185  VAL C CG2   1 
ATOM   4637  N  N     . TYR C 2 186  ? -25.801 -19.486 38.847  1.00 45.71  ? 186  TYR C N     1 
ATOM   4638  C  CA    . TYR C 2 186  ? -26.020 -20.082 37.536  1.00 39.34  ? 186  TYR C CA    1 
ATOM   4639  C  C     . TYR C 2 186  ? -25.908 -21.600 37.572  1.00 51.20  ? 186  TYR C C     1 
ATOM   4640  O  O     . TYR C 2 186  ? -25.045 -22.158 38.247  1.00 55.58  ? 186  TYR C O     1 
ATOM   4641  C  CB    . TYR C 2 186  ? -25.030 -19.499 36.527  1.00 34.09  ? 186  TYR C CB    1 
ATOM   4642  C  CG    . TYR C 2 186  ? -25.179 -18.008 36.348  1.00 36.27  ? 186  TYR C CG    1 
ATOM   4643  C  CD1   . TYR C 2 186  ? -26.070 -17.490 35.419  1.00 36.81  ? 186  TYR C CD1   1 
ATOM   4644  C  CD2   . TYR C 2 186  ? -24.439 -17.116 37.115  1.00 39.85  ? 186  TYR C CD2   1 
ATOM   4645  C  CE1   . TYR C 2 186  ? -26.218 -16.128 35.256  1.00 34.06  ? 186  TYR C CE1   1 
ATOM   4646  C  CE2   . TYR C 2 186  ? -24.581 -15.750 36.958  1.00 40.40  ? 186  TYR C CE2   1 
ATOM   4647  C  CZ    . TYR C 2 186  ? -25.473 -15.261 36.025  1.00 34.37  ? 186  TYR C CZ    1 
ATOM   4648  O  OH    . TYR C 2 186  ? -25.625 -13.904 35.858  1.00 33.30  ? 186  TYR C OH    1 
ATOM   4649  N  N     . PHE C 2 187  ? -26.794 -22.260 36.835  1.00 56.54  ? 187  PHE C N     1 
ATOM   4650  C  CA    . PHE C 2 187  ? -26.850 -23.716 36.811  1.00 57.81  ? 187  PHE C CA    1 
ATOM   4651  C  C     . PHE C 2 187  ? -26.394 -24.249 35.459  1.00 53.41  ? 187  PHE C C     1 
ATOM   4652  O  O     . PHE C 2 187  ? -26.782 -23.725 34.418  1.00 55.22  ? 187  PHE C O     1 
ATOM   4653  C  CB    . PHE C 2 187  ? -28.270 -24.200 37.129  1.00 59.75  ? 187  PHE C CB    1 
ATOM   4654  C  CG    . PHE C 2 187  ? -28.776 -23.746 38.471  1.00 63.82  ? 187  PHE C CG    1 
ATOM   4655  C  CD1   . PHE C 2 187  ? -29.379 -22.509 38.619  1.00 65.89  ? 187  PHE C CD1   1 
ATOM   4656  C  CD2   . PHE C 2 187  ? -28.642 -24.554 39.586  1.00 64.92  ? 187  PHE C CD2   1 
ATOM   4657  C  CE1   . PHE C 2 187  ? -29.838 -22.088 39.855  1.00 62.48  ? 187  PHE C CE1   1 
ATOM   4658  C  CE2   . PHE C 2 187  ? -29.101 -24.139 40.823  1.00 60.30  ? 187  PHE C CE2   1 
ATOM   4659  C  CZ    . PHE C 2 187  ? -29.695 -22.903 40.957  1.00 56.92  ? 187  PHE C CZ    1 
ATOM   4660  N  N     . ASP C 2 188  ? -25.567 -25.288 35.479  1.00 52.62  ? 188  ASP C N     1 
ATOM   4661  C  CA    . ASP C 2 188  ? -25.031 -25.854 34.247  1.00 59.20  ? 188  ASP C CA    1 
ATOM   4662  C  C     . ASP C 2 188  ? -25.190 -27.373 34.202  1.00 71.25  ? 188  ASP C C     1 
ATOM   4663  O  O     . ASP C 2 188  ? -25.083 -28.044 35.229  1.00 73.19  ? 188  ASP C O     1 
ATOM   4664  C  CB    . ASP C 2 188  ? -23.559 -25.475 34.091  1.00 59.82  ? 188  ASP C CB    1 
ATOM   4665  C  CG    . ASP C 2 188  ? -22.961 -25.987 32.800  1.00 63.60  ? 188  ASP C CG    1 
ATOM   4666  O  OD1   . ASP C 2 188  ? -23.632 -25.877 31.753  1.00 59.38  ? 188  ASP C OD1   1 
ATOM   4667  O  OD2   . ASP C 2 188  ? -21.825 -26.505 32.836  1.00 65.46  ? 188  ASP C OD2   1 
ATOM   4668  N  N     . GLU C 2 189  ? -25.445 -27.908 33.010  1.00 74.98  ? 189  GLU C N     1 
ATOM   4669  C  CA    . GLU C 2 189  ? -25.617 -29.349 32.825  1.00 73.56  ? 189  GLU C CA    1 
ATOM   4670  C  C     . GLU C 2 189  ? -24.482 -29.943 32.004  1.00 72.08  ? 189  GLU C C     1 
ATOM   4671  O  O     . GLU C 2 189  ? -24.435 -29.778 30.786  1.00 74.43  ? 189  GLU C O     1 
ATOM   4672  C  CB    . GLU C 2 189  ? -26.956 -29.655 32.148  1.00 77.25  ? 189  GLU C CB    1 
ATOM   4673  C  CG    . GLU C 2 189  ? -27.233 -31.146 31.955  1.00 79.80  ? 189  GLU C CG    1 
ATOM   4674  C  CD    . GLU C 2 189  ? -28.515 -31.417 31.181  1.00 86.21  ? 189  GLU C CD    1 
ATOM   4675  O  OE1   . GLU C 2 189  ? -28.944 -32.590 31.125  1.00 83.66  ? 189  GLU C OE1   1 
ATOM   4676  O  OE2   . GLU C 2 189  ? -29.093 -30.460 30.624  1.00 89.78  ? 189  GLU C OE2   1 
ATOM   4677  N  N     . THR C 2 190  ? -23.568 -30.635 32.674  1.00 78.13  ? 190  THR C N     1 
ATOM   4678  C  CA    . THR C 2 190  ? -22.459 -31.292 31.994  1.00 83.55  ? 190  THR C CA    1 
ATOM   4679  C  C     . THR C 2 190  ? -22.735 -32.784 31.839  1.00 88.73  ? 190  THR C C     1 
ATOM   4680  O  O     . THR C 2 190  ? -23.294 -33.420 32.732  1.00 93.55  ? 190  THR C O     1 
ATOM   4681  C  CB    . THR C 2 190  ? -21.121 -31.083 32.746  1.00 84.40  ? 190  THR C CB    1 
ATOM   4682  O  OG1   . THR C 2 190  ? -20.103 -31.900 32.156  1.00 79.11  ? 190  THR C OG1   1 
ATOM   4683  C  CG2   . THR C 2 190  ? -21.262 -31.443 34.218  1.00 80.82  ? 190  THR C CG2   1 
ATOM   4684  N  N     . ILE C 2 191  ? -22.355 -33.334 30.691  1.00 98.09  ? 191  ILE C N     1 
ATOM   4685  C  CA    . ILE C 2 191  ? -22.525 -34.759 30.434  1.00 102.09 ? 191  ILE C CA    1 
ATOM   4686  C  C     . ILE C 2 191  ? -21.235 -35.506 30.741  1.00 110.75 ? 191  ILE C C     1 
ATOM   4687  O  O     . ILE C 2 191  ? -20.175 -35.168 30.214  1.00 117.01 ? 191  ILE C O     1 
ATOM   4688  C  CB    . ILE C 2 191  ? -22.935 -35.030 28.975  1.00 96.85  ? 191  ILE C CB    1 
ATOM   4689  C  CG1   . ILE C 2 191  ? -24.281 -34.373 28.667  1.00 98.27  ? 191  ILE C CG1   1 
ATOM   4690  C  CG2   . ILE C 2 191  ? -23.003 -36.524 28.710  1.00 93.63  ? 191  ILE C CG2   1 
ATOM   4691  C  CD1   . ILE C 2 191  ? -25.432 -34.930 29.475  1.00 103.42 ? 191  ILE C CD1   1 
ATOM   4692  N  N     . ASP C 2 192  ? -21.325 -36.519 31.597  1.00 110.63 ? 192  ASP C N     1 
ATOM   4693  C  CA    . ASP C 2 192  ? -20.143 -37.266 32.007  1.00 118.82 ? 192  ASP C CA    1 
ATOM   4694  C  C     . ASP C 2 192  ? -19.617 -38.116 30.852  1.00 120.39 ? 192  ASP C C     1 
ATOM   4695  O  O     . ASP C 2 192  ? -20.390 -38.675 30.073  1.00 115.35 ? 192  ASP C O     1 
ATOM   4696  C  CB    . ASP C 2 192  ? -20.453 -38.140 33.226  1.00 116.20 ? 192  ASP C CB    1 
ATOM   4697  C  CG    . ASP C 2 192  ? -19.206 -38.505 34.017  1.00 117.82 ? 192  ASP C CG    1 
ATOM   4698  O  OD1   . ASP C 2 192  ? -19.234 -39.519 34.744  1.00 117.82 ? 192  ASP C OD1   1 
ATOM   4699  O  OD2   . ASP C 2 192  ? -18.196 -37.775 33.911  1.00 114.33 ? 192  ASP C OD2   1 
ATOM   4700  N  N     . LYS C 2 193  ? -18.294 -38.197 30.747  1.00 128.66 ? 193  LYS C N     1 
ATOM   4701  C  CA    . LYS C 2 193  ? -17.638 -38.951 29.684  1.00 123.92 ? 193  LYS C CA    1 
ATOM   4702  C  C     . LYS C 2 193  ? -17.782 -40.454 29.897  1.00 122.00 ? 193  LYS C C     1 
ATOM   4703  O  O     . LYS C 2 193  ? -18.197 -41.187 28.998  1.00 114.97 ? 193  LYS C O     1 
ATOM   4704  C  CB    . LYS C 2 193  ? -16.158 -38.581 29.613  1.00 128.77 ? 193  LYS C CB    1 
ATOM   4705  C  CG    . LYS C 2 193  ? -15.893 -37.087 29.656  1.00 130.28 ? 193  LYS C CG    1 
ATOM   4706  C  CD    . LYS C 2 193  ? -14.412 -36.797 29.841  1.00 137.62 ? 193  LYS C CD    1 
ATOM   4707  C  CE    . LYS C 2 193  ? -14.145 -35.301 29.915  1.00 131.63 ? 193  LYS C CE    1 
ATOM   4708  N  NZ    . LYS C 2 193  ? -14.556 -34.598 28.668  1.00 123.59 ? 193  LYS C NZ    1 
ATOM   4709  N  N     . SER C 2 194  ? -17.430 -40.901 31.097  1.00 115.15 ? 194  SER C N     1 
ATOM   4710  C  CA    . SER C 2 194  ? -17.452 -42.317 31.437  1.00 104.81 ? 194  SER C CA    1 
ATOM   4711  C  C     . SER C 2 194  ? -18.868 -42.856 31.595  1.00 98.96  ? 194  SER C C     1 
ATOM   4712  O  O     . SER C 2 194  ? -19.333 -43.652 30.782  1.00 97.64  ? 194  SER C O     1 
ATOM   4713  C  CB    . SER C 2 194  ? -16.659 -42.559 32.723  1.00 103.17 ? 194  SER C CB    1 
ATOM   4714  O  OG    . SER C 2 194  ? -17.141 -41.748 33.780  1.00 99.29  ? 194  SER C OG    1 
ATOM   4715  N  N     . THR C 2 195  ? -19.549 -42.415 32.646  1.00 100.88 ? 195  THR C N     1 
ATOM   4716  C  CA    . THR C 2 195  ? -20.858 -42.958 32.995  1.00 104.53 ? 195  THR C CA    1 
ATOM   4717  C  C     . THR C 2 195  ? -21.956 -42.541 32.023  1.00 101.96 ? 195  THR C C     1 
ATOM   4718  O  O     . THR C 2 195  ? -23.024 -43.151 31.998  1.00 107.06 ? 195  THR C O     1 
ATOM   4719  C  CB    . THR C 2 195  ? -21.279 -42.533 34.415  1.00 111.08 ? 195  THR C CB    1 
ATOM   4720  O  OG1   . THR C 2 195  ? -21.315 -41.103 34.497  1.00 117.94 ? 195  THR C OG1   1 
ATOM   4721  C  CG2   . THR C 2 195  ? -20.299 -43.073 35.446  1.00 107.67 ? 195  THR C CG2   1 
ATOM   4722  N  N     . ASP C 2 196  ? -21.690 -41.505 31.232  1.00 95.67  ? 196  ASP C N     1 
ATOM   4723  C  CA    . ASP C 2 196  ? -22.667 -40.982 30.281  1.00 95.70  ? 196  ASP C CA    1 
ATOM   4724  C  C     . ASP C 2 196  ? -23.985 -40.637 30.970  1.00 94.23  ? 196  ASP C C     1 
ATOM   4725  O  O     . ASP C 2 196  ? -25.063 -40.854 30.417  1.00 82.25  ? 196  ASP C O     1 
ATOM   4726  C  CB    . ASP C 2 196  ? -22.909 -41.984 29.146  1.00 94.05  ? 196  ASP C CB    1 
ATOM   4727  C  CG    . ASP C 2 196  ? -21.707 -42.130 28.231  1.00 97.78  ? 196  ASP C CG    1 
ATOM   4728  O  OD1   . ASP C 2 196  ? -20.942 -41.153 28.094  1.00 98.27  ? 196  ASP C OD1   1 
ATOM   4729  O  OD2   . ASP C 2 196  ? -21.529 -43.218 27.644  1.00 98.37  ? 196  ASP C OD2   1 
ATOM   4730  N  N     . LYS C 2 197  ? -23.886 -40.110 32.187  1.00 106.37 ? 197  LYS C N     1 
ATOM   4731  C  CA    . LYS C 2 197  ? -25.060 -39.683 32.936  1.00 112.56 ? 197  LYS C CA    1 
ATOM   4732  C  C     . LYS C 2 197  ? -25.079 -38.167 33.075  1.00 105.54 ? 197  LYS C C     1 
ATOM   4733  O  O     . LYS C 2 197  ? -24.037 -37.512 33.019  1.00 100.64 ? 197  LYS C O     1 
ATOM   4734  C  CB    . LYS C 2 197  ? -25.099 -40.335 34.324  1.00 116.41 ? 197  LYS C CB    1 
ATOM   4735  C  CG    . LYS C 2 197  ? -24.091 -39.761 35.315  1.00 112.85 ? 197  LYS C CG    1 
ATOM   4736  C  CD    . LYS C 2 197  ? -24.360 -40.227 36.743  1.00 111.40 ? 197  LYS C CD    1 
ATOM   4737  C  CE    . LYS C 2 197  ? -24.119 -41.720 36.910  1.00 107.20 ? 197  LYS C CE    1 
ATOM   4738  N  NZ    . LYS C 2 197  ? -24.364 -42.167 38.312  1.00 104.45 ? 197  LYS C NZ    1 
ATOM   4739  N  N     . THR C 2 198  ? -26.272 -37.616 33.259  1.00 94.71  ? 198  THR C N     1 
ATOM   4740  C  CA    . THR C 2 198  ? -26.427 -36.184 33.438  1.00 92.38  ? 198  THR C CA    1 
ATOM   4741  C  C     . THR C 2 198  ? -25.946 -35.754 34.817  1.00 92.39  ? 198  THR C C     1 
ATOM   4742  O  O     . THR C 2 198  ? -26.478 -36.192 35.837  1.00 91.41  ? 198  THR C O     1 
ATOM   4743  C  CB    . THR C 2 198  ? -27.889 -35.756 33.251  1.00 96.95  ? 198  THR C CB    1 
ATOM   4744  O  OG1   . THR C 2 198  ? -28.712 -36.444 34.201  1.00 98.18  ? 198  THR C OG1   1 
ATOM   4745  C  CG2   . THR C 2 198  ? -28.363 -36.092 31.846  1.00 97.97  ? 198  THR C CG2   1 
ATOM   4746  N  N     . LEU C 2 199  ? -24.922 -34.908 34.836  1.00 92.12  ? 199  LEU C N     1 
ATOM   4747  C  CA    . LEU C 2 199  ? -24.440 -34.302 36.071  1.00 89.26  ? 199  LEU C CA    1 
ATOM   4748  C  C     . LEU C 2 199  ? -24.761 -32.817 36.069  1.00 88.98  ? 199  LEU C C     1 
ATOM   4749  O  O     . LEU C 2 199  ? -24.604 -32.141 35.052  1.00 93.67  ? 199  LEU C O     1 
ATOM   4750  C  CB    . LEU C 2 199  ? -22.938 -34.518 36.238  1.00 87.20  ? 199  LEU C CB    1 
ATOM   4751  C  CG    . LEU C 2 199  ? -22.506 -35.980 36.242  1.00 92.75  ? 199  LEU C CG    1 
ATOM   4752  C  CD1   . LEU C 2 199  ? -21.018 -36.090 36.520  1.00 96.31  ? 199  LEU C CD1   1 
ATOM   4753  C  CD2   . LEU C 2 199  ? -23.316 -36.759 37.263  1.00 93.33  ? 199  LEU C CD2   1 
ATOM   4754  N  N     . HIS C 2 200  ? -25.216 -32.310 37.207  1.00 82.68  ? 200  HIS C N     1 
ATOM   4755  C  CA    . HIS C 2 200  ? -25.622 -30.917 37.288  1.00 80.15  ? 200  HIS C CA    1 
ATOM   4756  C  C     . HIS C 2 200  ? -24.699 -30.133 38.212  1.00 74.34  ? 200  HIS C C     1 
ATOM   4757  O  O     . HIS C 2 200  ? -24.262 -30.639 39.247  1.00 74.51  ? 200  HIS C O     1 
ATOM   4758  C  CB    . HIS C 2 200  ? -27.077 -30.819 37.751  1.00 86.90  ? 200  HIS C CB    1 
ATOM   4759  C  CG    . HIS C 2 200  ? -28.073 -31.172 36.686  1.00 84.38  ? 200  HIS C CG    1 
ATOM   4760  N  ND1   . HIS C 2 200  ? -29.061 -30.304 36.272  1.00 80.10  ? 200  HIS C ND1   1 
ATOM   4761  C  CD2   . HIS C 2 200  ? -28.223 -32.294 35.942  1.00 83.37  ? 200  HIS C CD2   1 
ATOM   4762  C  CE1   . HIS C 2 200  ? -29.780 -30.879 35.324  1.00 75.19  ? 200  HIS C CE1   1 
ATOM   4763  N  NE2   . HIS C 2 200  ? -29.293 -32.086 35.105  1.00 73.06  ? 200  HIS C NE2   1 
ATOM   4764  N  N     . SER C 2 201  ? -24.399 -28.899 37.820  1.00 70.79  ? 201  SER C N     1 
ATOM   4765  C  CA    . SER C 2 201  ? -23.452 -28.069 38.553  1.00 75.68  ? 201  SER C CA    1 
ATOM   4766  C  C     . SER C 2 201  ? -23.990 -26.667 38.815  1.00 68.87  ? 201  SER C C     1 
ATOM   4767  O  O     . SER C 2 201  ? -24.683 -26.087 37.978  1.00 66.15  ? 201  SER C O     1 
ATOM   4768  C  CB    . SER C 2 201  ? -22.129 -27.982 37.788  1.00 83.02  ? 201  SER C CB    1 
ATOM   4769  O  OG    . SER C 2 201  ? -22.328 -27.468 36.482  1.00 82.07  ? 201  SER C OG    1 
ATOM   4770  N  N     . VAL C 2 202  ? -23.662 -26.127 39.984  1.00 63.75  ? 202  VAL C N     1 
ATOM   4771  C  CA    . VAL C 2 202  ? -24.085 -24.784 40.355  1.00 65.84  ? 202  VAL C CA    1 
ATOM   4772  C  C     . VAL C 2 202  ? -22.877 -23.912 40.668  1.00 70.98  ? 202  VAL C C     1 
ATOM   4773  O  O     . VAL C 2 202  ? -21.882 -24.401 41.198  1.00 78.44  ? 202  VAL C O     1 
ATOM   4774  C  CB    . VAL C 2 202  ? -25.019 -24.803 41.580  1.00 71.91  ? 202  VAL C CB    1 
ATOM   4775  C  CG1   . VAL C 2 202  ? -25.731 -23.472 41.726  1.00 67.90  ? 202  VAL C CG1   1 
ATOM   4776  C  CG2   . VAL C 2 202  ? -26.024 -25.929 41.463  1.00 78.27  ? 202  VAL C CG2   1 
ATOM   4777  N  N     . LYS C 2 203  ? -22.963 -22.627 40.336  1.00 64.19  ? 203  LYS C N     1 
ATOM   4778  C  CA    . LYS C 2 203  ? -21.906 -21.676 40.667  1.00 61.15  ? 203  LYS C CA    1 
ATOM   4779  C  C     . LYS C 2 203  ? -22.487 -20.330 41.105  1.00 58.26  ? 203  LYS C C     1 
ATOM   4780  O  O     . LYS C 2 203  ? -23.269 -19.717 40.378  1.00 57.92  ? 203  LYS C O     1 
ATOM   4781  C  CB    . LYS C 2 203  ? -20.963 -21.486 39.474  1.00 67.90  ? 203  LYS C CB    1 
ATOM   4782  C  CG    . LYS C 2 203  ? -20.084 -22.698 39.172  1.00 71.42  ? 203  LYS C CG    1 
ATOM   4783  C  CD    . LYS C 2 203  ? -19.441 -22.611 37.796  1.00 65.64  ? 203  LYS C CD    1 
ATOM   4784  C  CE    . LYS C 2 203  ? -18.681 -23.885 37.464  1.00 56.99  ? 203  LYS C CE    1 
ATOM   4785  N  NZ    . LYS C 2 203  ? -18.135 -23.863 36.082  1.00 53.03  ? 203  LYS C NZ    1 
ATOM   4786  N  N     . VAL C 2 204  ? -22.106 -19.882 42.301  1.00 62.53  ? 204  VAL C N     1 
ATOM   4787  C  CA    . VAL C 2 204  ? -22.536 -18.585 42.831  1.00 59.47  ? 204  VAL C CA    1 
ATOM   4788  C  C     . VAL C 2 204  ? -21.446 -17.526 42.685  1.00 62.16  ? 204  VAL C C     1 
ATOM   4789  O  O     . VAL C 2 204  ? -20.338 -17.677 43.205  1.00 64.00  ? 204  VAL C O     1 
ATOM   4790  C  CB    . VAL C 2 204  ? -22.938 -18.680 44.313  1.00 57.78  ? 204  VAL C CB    1 
ATOM   4791  C  CG1   . VAL C 2 204  ? -22.935 -17.302 44.965  1.00 54.60  ? 204  VAL C CG1   1 
ATOM   4792  C  CG2   . VAL C 2 204  ? -24.302 -19.333 44.443  1.00 58.94  ? 204  VAL C CG2   1 
ATOM   4793  N  N     . ILE C 2 205  ? -21.779 -16.445 41.988  1.00 62.20  ? 205  ILE C N     1 
ATOM   4794  C  CA    . ILE C 2 205  ? -20.806 -15.417 41.643  1.00 56.98  ? 205  ILE C CA    1 
ATOM   4795  C  C     . ILE C 2 205  ? -21.135 -14.064 42.264  1.00 53.04  ? 205  ILE C C     1 
ATOM   4796  O  O     . ILE C 2 205  ? -22.108 -13.419 41.879  1.00 52.46  ? 205  ILE C O     1 
ATOM   4797  C  CB    . ILE C 2 205  ? -20.712 -15.241 40.121  1.00 56.75  ? 205  ILE C CB    1 
ATOM   4798  C  CG1   . ILE C 2 205  ? -20.729 -16.606 39.429  1.00 55.51  ? 205  ILE C CG1   1 
ATOM   4799  C  CG2   . ILE C 2 205  ? -19.465 -14.450 39.758  1.00 62.69  ? 205  ILE C CG2   1 
ATOM   4800  C  CD1   . ILE C 2 205  ? -20.917 -16.530 37.933  1.00 57.55  ? 205  ILE C CD1   1 
ATOM   4801  N  N     . PRO C 2 206  ? -20.313 -13.627 43.226  1.00 56.40  ? 206  PRO C N     1 
ATOM   4802  C  CA    . PRO C 2 206  ? -20.483 -12.318 43.857  1.00 62.09  ? 206  PRO C CA    1 
ATOM   4803  C  C     . PRO C 2 206  ? -19.974 -11.197 42.968  1.00 54.13  ? 206  PRO C C     1 
ATOM   4804  O  O     . PRO C 2 206  ? -19.201 -11.450 42.047  1.00 53.49  ? 206  PRO C O     1 
ATOM   4805  C  CB    . PRO C 2 206  ? -19.632 -12.432 45.120  1.00 70.38  ? 206  PRO C CB    1 
ATOM   4806  C  CG    . PRO C 2 206  ? -18.530 -13.347 44.714  1.00 74.73  ? 206  PRO C CG    1 
ATOM   4807  C  CD    . PRO C 2 206  ? -19.163 -14.357 43.786  1.00 68.26  ? 206  PRO C CD    1 
ATOM   4808  N  N     . SER C 2 207  ? -20.407 -9.973  43.244  1.00 53.94  ? 207  SER C N     1 
ATOM   4809  C  CA    . SER C 2 207  ? -19.853 -8.804  42.579  1.00 56.16  ? 207  SER C CA    1 
ATOM   4810  C  C     . SER C 2 207  ? -18.375 -8.687  42.943  1.00 66.13  ? 207  SER C C     1 
ATOM   4811  O  O     . SER C 2 207  ? -17.551 -8.257  42.136  1.00 76.26  ? 207  SER C O     1 
ATOM   4812  C  CB    . SER C 2 207  ? -20.618 -7.542  42.978  1.00 54.32  ? 207  SER C CB    1 
ATOM   4813  O  OG    . SER C 2 207  ? -20.076 -6.390  42.364  1.00 49.44  ? 207  SER C OG    1 
ATOM   4814  N  N     . ARG C 2 208  ? -18.054 -9.092  44.168  1.00 66.92  ? 208  ARG C N     1 
ATOM   4815  C  CA    . ARG C 2 208  ? -16.685 -9.101  44.668  1.00 67.06  ? 208  ARG C CA    1 
ATOM   4816  C  C     . ARG C 2 208  ? -16.601 -9.981  45.908  1.00 66.33  ? 208  ARG C C     1 
ATOM   4817  O  O     . ARG C 2 208  ? -17.282 -9.731  46.900  1.00 73.92  ? 208  ARG C O     1 
ATOM   4818  C  CB    . ARG C 2 208  ? -16.210 -7.680  44.988  1.00 72.94  ? 208  ARG C CB    1 
ATOM   4819  C  CG    . ARG C 2 208  ? -17.214 -6.848  45.779  1.00 78.99  ? 208  ARG C CG    1 
ATOM   4820  C  CD    . ARG C 2 208  ? -16.600 -5.563  46.316  1.00 83.87  ? 208  ARG C CD    1 
ATOM   4821  N  NE    . ARG C 2 208  ? -17.549 -4.791  47.117  1.00 86.66  ? 208  ARG C NE    1 
ATOM   4822  C  CZ    . ARG C 2 208  ? -17.722 -4.943  48.427  1.00 79.77  ? 208  ARG C CZ    1 
ATOM   4823  N  NH1   . ARG C 2 208  ? -17.013 -5.843  49.094  1.00 77.13  ? 208  ARG C NH1   1 
ATOM   4824  N  NH2   . ARG C 2 208  ? -18.607 -4.194  49.073  1.00 75.69  ? 208  ARG C NH2   1 
ATOM   4825  N  N     . GLY C 2 209  ? -15.780 -11.022 45.855  1.00 65.87  ? 209  GLY C N     1 
ATOM   4826  C  CA    . GLY C 2 209  ? -15.613 -11.874 47.016  1.00 75.71  ? 209  GLY C CA    1 
ATOM   4827  C  C     . GLY C 2 209  ? -15.255 -13.316 46.728  1.00 83.84  ? 209  GLY C C     1 
ATOM   4828  O  O     . GLY C 2 209  ? -14.781 -13.654 45.641  1.00 87.54  ? 209  GLY C O     1 
ATOM   4829  N  N     . ALA C 2 210  ? -15.488 -14.169 47.719  1.00 76.99  ? 210  ALA C N     1 
ATOM   4830  C  CA    . ALA C 2 210  ? -15.091 -15.567 47.637  1.00 77.29  ? 210  ALA C CA    1 
ATOM   4831  C  C     . ALA C 2 210  ? -16.051 -16.379 46.781  1.00 81.87  ? 210  ALA C C     1 
ATOM   4832  O  O     . ALA C 2 210  ? -17.232 -16.052 46.665  1.00 81.03  ? 210  ALA C O     1 
ATOM   4833  C  CB    . ALA C 2 210  ? -14.989 -16.165 49.028  1.00 76.14  ? 210  ALA C CB    1 
ATOM   4834  N  N     . TRP C 2 211  ? -15.529 -17.444 46.182  1.00 82.51  ? 211  TRP C N     1 
ATOM   4835  C  CA    . TRP C 2 211  ? -16.316 -18.295 45.303  1.00 85.43  ? 211  TRP C CA    1 
ATOM   4836  C  C     . TRP C 2 211  ? -17.096 -19.354 46.076  1.00 82.21  ? 211  TRP C C     1 
ATOM   4837  O  O     . TRP C 2 211  ? -16.753 -19.691 47.209  1.00 84.15  ? 211  TRP C O     1 
ATOM   4838  C  CB    . TRP C 2 211  ? -15.412 -18.963 44.270  1.00 89.92  ? 211  TRP C CB    1 
ATOM   4839  C  CG    . TRP C 2 211  ? -15.254 -18.169 43.015  1.00 88.19  ? 211  TRP C CG    1 
ATOM   4840  C  CD1   . TRP C 2 211  ? -15.190 -16.810 42.900  1.00 86.45  ? 211  TRP C CD1   1 
ATOM   4841  C  CD2   . TRP C 2 211  ? -15.166 -18.689 41.689  1.00 85.68  ? 211  TRP C CD2   1 
ATOM   4842  N  NE1   . TRP C 2 211  ? -15.056 -16.454 41.581  1.00 97.91  ? 211  TRP C NE1   1 
ATOM   4843  C  CE2   . TRP C 2 211  ? -15.040 -17.591 40.818  1.00 92.30  ? 211  TRP C CE2   1 
ATOM   4844  C  CE3   . TRP C 2 211  ? -15.177 -19.979 41.154  1.00 92.00  ? 211  TRP C CE3   1 
ATOM   4845  C  CZ2   . TRP C 2 211  ? -14.926 -17.746 39.442  1.00 108.52 ? 211  TRP C CZ2   1 
ATOM   4846  C  CZ3   . TRP C 2 211  ? -15.064 -20.130 39.790  1.00 97.53  ? 211  TRP C CZ3   1 
ATOM   4847  C  CH2   . TRP C 2 211  ? -14.939 -19.022 38.949  1.00 100.29 ? 211  TRP C CH2   1 
ATOM   4848  N  N     . LEU C 2 212  ? -18.147 -19.877 45.453  1.00 89.11  ? 212  LEU C N     1 
ATOM   4849  C  CA    . LEU C 2 212  ? -19.008 -20.866 46.090  1.00 81.59  ? 212  LEU C CA    1 
ATOM   4850  C  C     . LEU C 2 212  ? -19.794 -21.649 45.046  1.00 79.55  ? 212  LEU C C     1 
ATOM   4851  O  O     . LEU C 2 212  ? -20.702 -21.112 44.411  1.00 75.48  ? 212  LEU C O     1 
ATOM   4852  C  CB    . LEU C 2 212  ? -19.961 -20.186 47.069  1.00 76.67  ? 212  LEU C CB    1 
ATOM   4853  C  CG    . LEU C 2 212  ? -20.853 -21.115 47.886  1.00 78.91  ? 212  LEU C CG    1 
ATOM   4854  C  CD1   . LEU C 2 212  ? -20.013 -22.066 48.727  1.00 83.92  ? 212  LEU C CD1   1 
ATOM   4855  C  CD2   . LEU C 2 212  ? -21.792 -20.301 48.757  1.00 80.95  ? 212  LEU C CD2   1 
ATOM   4856  N  N     . GLU C 2 213  ? -19.445 -22.920 44.868  1.00 87.31  ? 213  GLU C N     1 
ATOM   4857  C  CA    . GLU C 2 213  ? -20.060 -23.733 43.823  1.00 93.52  ? 213  GLU C CA    1 
ATOM   4858  C  C     . GLU C 2 213  ? -20.450 -25.139 44.293  1.00 97.71  ? 213  GLU C C     1 
ATOM   4859  O  O     . GLU C 2 213  ? -19.620 -25.891 44.803  1.00 98.96  ? 213  GLU C O     1 
ATOM   4860  C  CB    . GLU C 2 213  ? -19.120 -23.824 42.609  1.00 94.16  ? 213  GLU C CB    1 
ATOM   4861  C  CG    . GLU C 2 213  ? -17.636 -24.003 42.931  1.00 93.62  ? 213  GLU C CG    1 
ATOM   4862  C  CD    . GLU C 2 213  ? -16.758 -23.987 41.685  1.00 89.11  ? 213  GLU C CD    1 
ATOM   4863  O  OE1   . GLU C 2 213  ? -15.530 -23.798 41.820  1.00 82.94  ? 213  GLU C OE1   1 
ATOM   4864  O  OE2   . GLU C 2 213  ? -17.296 -24.165 40.570  1.00 87.75  ? 213  GLU C OE2   1 
ATOM   4865  N  N     . PHE C 2 214  ? -21.724 -25.483 44.118  1.00 92.96  ? 214  PHE C N     1 
ATOM   4866  C  CA    . PHE C 2 214  ? -22.221 -26.817 44.449  1.00 88.75  ? 214  PHE C CA    1 
ATOM   4867  C  C     . PHE C 2 214  ? -22.358 -27.672 43.194  1.00 90.46  ? 214  PHE C C     1 
ATOM   4868  O  O     . PHE C 2 214  ? -23.020 -27.275 42.235  1.00 87.31  ? 214  PHE C O     1 
ATOM   4869  C  CB    . PHE C 2 214  ? -23.571 -26.733 45.166  1.00 90.21  ? 214  PHE C CB    1 
ATOM   4870  C  CG    . PHE C 2 214  ? -23.541 -25.921 46.426  1.00 86.31  ? 214  PHE C CG    1 
ATOM   4871  C  CD1   . PHE C 2 214  ? -23.147 -26.491 47.622  1.00 90.05  ? 214  PHE C CD1   1 
ATOM   4872  C  CD2   . PHE C 2 214  ? -23.918 -24.591 46.416  1.00 83.03  ? 214  PHE C CD2   1 
ATOM   4873  C  CE1   . PHE C 2 214  ? -23.119 -25.748 48.784  1.00 89.20  ? 214  PHE C CE1   1 
ATOM   4874  C  CE2   . PHE C 2 214  ? -23.894 -23.843 47.575  1.00 89.41  ? 214  PHE C CE2   1 
ATOM   4875  C  CZ    . PHE C 2 214  ? -23.493 -24.423 48.761  1.00 86.72  ? 214  PHE C CZ    1 
ATOM   4876  N  N     . ASP C 2 215  ? -21.733 -28.845 43.201  1.00 96.66  ? 215  ASP C N     1 
ATOM   4877  C  CA    . ASP C 2 215  ? -21.806 -29.751 42.060  1.00 95.35  ? 215  ASP C CA    1 
ATOM   4878  C  C     . ASP C 2 215  ? -22.246 -31.147 42.488  1.00 91.44  ? 215  ASP C C     1 
ATOM   4879  O  O     . ASP C 2 215  ? -22.067 -31.541 43.640  1.00 96.05  ? 215  ASP C O     1 
ATOM   4880  C  CB    . ASP C 2 215  ? -20.457 -29.827 41.342  1.00 97.14  ? 215  ASP C CB    1 
ATOM   4881  C  CG    . ASP C 2 215  ? -19.961 -28.468 40.877  1.00 98.10  ? 215  ASP C CG    1 
ATOM   4882  O  OD1   . ASP C 2 215  ? -20.793 -27.569 40.633  1.00 88.94  ? 215  ASP C OD1   1 
ATOM   4883  O  OD2   . ASP C 2 215  ? -18.730 -28.299 40.749  1.00 101.53 ? 215  ASP C OD2   1 
ATOM   4884  N  N     . VAL C 2 216  ? -22.822 -31.892 41.552  1.00 89.61  ? 216  VAL C N     1 
ATOM   4885  C  CA    . VAL C 2 216  ? -23.294 -33.239 41.839  1.00 101.75 ? 216  VAL C CA    1 
ATOM   4886  C  C     . VAL C 2 216  ? -22.437 -34.284 41.142  1.00 107.51 ? 216  VAL C C     1 
ATOM   4887  O  O     . VAL C 2 216  ? -22.188 -34.197 39.940  1.00 105.09 ? 216  VAL C O     1 
ATOM   4888  C  CB    . VAL C 2 216  ? -24.761 -33.423 41.416  1.00 105.89 ? 216  VAL C CB    1 
ATOM   4889  C  CG1   . VAL C 2 216  ? -25.147 -34.895 41.438  1.00 106.21 ? 216  VAL C CG1   1 
ATOM   4890  C  CG2   . VAL C 2 216  ? -25.671 -32.623 42.323  1.00 100.72 ? 216  VAL C CG2   1 
ATOM   4891  N  N     . ASP C 2 217  ? -21.989 -35.273 41.908  1.00 114.45 ? 217  ASP C N     1 
ATOM   4892  C  CA    . ASP C 2 217  ? -21.168 -36.346 41.365  1.00 119.74 ? 217  ASP C CA    1 
ATOM   4893  C  C     . ASP C 2 217  ? -21.971 -37.359 40.559  1.00 119.20 ? 217  ASP C C     1 
ATOM   4894  O  O     . ASP C 2 217  ? -23.202 -37.304 40.499  1.00 114.05 ? 217  ASP C O     1 
ATOM   4895  C  CB    . ASP C 2 217  ? -20.427 -37.072 42.491  1.00 114.57 ? 217  ASP C CB    1 
ATOM   4896  C  CG    . ASP C 2 217  ? -19.190 -36.331 42.944  1.00 114.19 ? 217  ASP C CG    1 
ATOM   4897  O  OD1   . ASP C 2 217  ? -18.594 -35.610 42.116  1.00 117.19 ? 217  ASP C OD1   1 
ATOM   4898  O  OD2   . ASP C 2 217  ? -18.813 -36.468 44.126  1.00 109.82 ? 217  ASP C OD2   1 
ATOM   4899  N  N     . LYS C 2 218  ? -21.243 -38.278 39.934  1.00 121.54 ? 218  LYS C N     1 
ATOM   4900  C  CA    . LYS C 2 218  ? -21.827 -39.437 39.277  1.00 117.61 ? 218  LYS C CA    1 
ATOM   4901  C  C     . LYS C 2 218  ? -22.120 -40.490 40.334  1.00 116.35 ? 218  LYS C C     1 
ATOM   4902  O  O     . LYS C 2 218  ? -22.799 -41.484 40.076  1.00 117.45 ? 218  LYS C O     1 
ATOM   4903  C  CB    . LYS C 2 218  ? -20.884 -39.988 38.201  1.00 119.44 ? 218  LYS C CB    1 
ATOM   4904  C  CG    . LYS C 2 218  ? -19.491 -40.364 38.715  1.00 121.17 ? 218  LYS C CG    1 
ATOM   4905  C  CD    . LYS C 2 218  ? -18.535 -40.710 37.573  1.00 115.98 ? 218  LYS C CD    1 
ATOM   4906  C  CE    . LYS C 2 218  ? -17.105 -40.899 38.069  1.00 110.56 ? 218  LYS C CE    1 
ATOM   4907  N  NZ    . LYS C 2 218  ? -16.137 -41.139 36.957  1.00 99.53  ? 218  LYS C NZ    1 
ATOM   4908  N  N     . ARG C 2 219  ? -21.598 -40.250 41.533  1.00 110.00 ? 219  ARG C N     1 
ATOM   4909  C  CA    . ARG C 2 219  ? -21.779 -41.153 42.659  1.00 110.04 ? 219  ARG C CA    1 
ATOM   4910  C  C     . ARG C 2 219  ? -23.030 -40.787 43.456  1.00 118.41 ? 219  ARG C C     1 
ATOM   4911  O  O     . ARG C 2 219  ? -23.248 -41.305 44.553  1.00 115.07 ? 219  ARG C O     1 
ATOM   4912  C  CB    . ARG C 2 219  ? -20.548 -41.124 43.567  1.00 100.86 ? 219  ARG C CB    1 
ATOM   4913  C  CG    . ARG C 2 219  ? -19.221 -41.203 42.824  1.00 97.59  ? 219  ARG C CG    1 
ATOM   4914  C  CD    . ARG C 2 219  ? -19.131 -42.447 41.951  1.00 105.89 ? 219  ARG C CD    1 
ATOM   4915  N  NE    . ARG C 2 219  ? -17.783 -42.647 41.424  1.00 106.09 ? 219  ARG C NE    1 
ATOM   4916  C  CZ    . ARG C 2 219  ? -17.427 -43.653 40.630  1.00 101.58 ? 219  ARG C CZ    1 
ATOM   4917  N  NH1   . ARG C 2 219  ? -18.321 -44.561 40.262  1.00 101.58 ? 219  ARG C NH1   1 
ATOM   4918  N  NH2   . ARG C 2 219  ? -16.175 -43.753 40.203  1.00 97.93  ? 219  ARG C NH2   1 
ATOM   4919  N  N     . ASP C 2 220  ? -23.839 -39.893 42.891  1.00 126.03 ? 220  ASP C N     1 
ATOM   4920  C  CA    . ASP C 2 220  ? -25.065 -39.410 43.528  1.00 122.19 ? 220  ASP C CA    1 
ATOM   4921  C  C     . ASP C 2 220  ? -24.777 -38.786 44.894  1.00 118.49 ? 220  ASP C C     1 
ATOM   4922  O  O     . ASP C 2 220  ? -25.580 -38.896 45.821  1.00 112.71 ? 220  ASP C O     1 
ATOM   4923  C  CB    . ASP C 2 220  ? -26.089 -40.543 43.662  1.00 117.61 ? 220  ASP C CB    1 
ATOM   4924  C  CG    . ASP C 2 220  ? -26.609 -41.025 42.317  1.00 118.62 ? 220  ASP C CG    1 
ATOM   4925  O  OD1   . ASP C 2 220  ? -27.708 -41.618 42.283  1.00 115.52 ? 220  ASP C OD1   1 
ATOM   4926  O  OD2   . ASP C 2 220  ? -25.925 -40.809 41.293  1.00 117.73 ? 220  ASP C OD2   1 
ATOM   4927  N  N     . THR C 2 221  ? -23.620 -38.136 45.006  1.00 120.69 ? 221  THR C N     1 
ATOM   4928  C  CA    . THR C 2 221  ? -23.233 -37.427 46.222  1.00 112.95 ? 221  THR C CA    1 
ATOM   4929  C  C     . THR C 2 221  ? -22.933 -35.967 45.910  1.00 110.38 ? 221  THR C C     1 
ATOM   4930  O  O     . THR C 2 221  ? -22.104 -35.663 45.053  1.00 110.95 ? 221  THR C O     1 
ATOM   4931  C  CB    . THR C 2 221  ? -21.995 -38.053 46.890  1.00 106.78 ? 221  THR C CB    1 
ATOM   4932  O  OG1   . THR C 2 221  ? -20.851 -37.881 46.044  1.00 104.03 ? 221  THR C OG1   1 
ATOM   4933  C  CG2   . THR C 2 221  ? -22.213 -39.534 47.151  1.00 107.44 ? 221  THR C CG2   1 
ATOM   4934  N  N     . VAL C 2 222  ? -23.603 -35.065 46.617  1.00 106.26 ? 222  VAL C N     1 
ATOM   4935  C  CA    . VAL C 2 222  ? -23.454 -33.638 46.368  1.00 100.97 ? 222  VAL C CA    1 
ATOM   4936  C  C     . VAL C 2 222  ? -22.244 -33.065 47.101  1.00 104.30 ? 222  VAL C C     1 
ATOM   4937  O  O     . VAL C 2 222  ? -22.044 -33.320 48.288  1.00 104.40 ? 222  VAL C O     1 
ATOM   4938  C  CB    . VAL C 2 222  ? -24.717 -32.874 46.786  1.00 101.16 ? 222  VAL C CB    1 
ATOM   4939  C  CG1   . VAL C 2 222  ? -24.606 -31.413 46.396  1.00 102.36 ? 222  VAL C CG1   1 
ATOM   4940  C  CG2   . VAL C 2 222  ? -25.941 -33.508 46.145  1.00 106.82 ? 222  VAL C CG2   1 
ATOM   4941  N  N     . GLY C 2 223  ? -21.438 -32.289 46.384  1.00 110.30 ? 223  GLY C N     1 
ATOM   4942  C  CA    . GLY C 2 223  ? -20.234 -31.710 46.949  1.00 109.35 ? 223  GLY C CA    1 
ATOM   4943  C  C     . GLY C 2 223  ? -20.127 -30.224 46.682  1.00 109.75 ? 223  GLY C C     1 
ATOM   4944  O  O     . GLY C 2 223  ? -20.757 -29.701 45.763  1.00 107.60 ? 223  GLY C O     1 
ATOM   4945  N  N     . VAL C 2 224  ? -19.318 -29.544 47.488  1.00 113.76 ? 224  VAL C N     1 
ATOM   4946  C  CA    . VAL C 2 224  ? -19.172 -28.096 47.392  1.00 115.63 ? 224  VAL C CA    1 
ATOM   4947  C  C     . VAL C 2 224  ? -17.700 -27.683 47.389  1.00 112.70 ? 224  VAL C C     1 
ATOM   4948  O  O     . VAL C 2 224  ? -16.905 -28.177 48.189  1.00 108.80 ? 224  VAL C O     1 
ATOM   4949  C  CB    . VAL C 2 224  ? -19.911 -27.387 48.556  1.00 113.67 ? 224  VAL C CB    1 
ATOM   4950  C  CG1   . VAL C 2 224  ? -19.607 -28.071 49.882  1.00 113.28 ? 224  VAL C CG1   1 
ATOM   4951  C  CG2   . VAL C 2 224  ? -19.564 -25.901 48.609  1.00 104.08 ? 224  VAL C CG2   1 
ATOM   4952  N  N     . ARG C 2 225  ? -17.340 -26.789 46.471  1.00 107.23 ? 225  ARG C N     1 
ATOM   4953  C  CA    . ARG C 2 225  ? -15.995 -26.223 46.435  1.00 104.92 ? 225  ARG C CA    1 
ATOM   4954  C  C     . ARG C 2 225  ? -16.020 -24.745 46.819  1.00 100.65 ? 225  ARG C C     1 
ATOM   4955  O  O     . ARG C 2 225  ? -16.660 -23.929 46.154  1.00 99.86  ? 225  ARG C O     1 
ATOM   4956  C  CB    . ARG C 2 225  ? -15.367 -26.395 45.049  1.00 104.12 ? 225  ARG C CB    1 
ATOM   4957  C  CG    . ARG C 2 225  ? -14.988 -27.823 44.690  1.00 98.01  ? 225  ARG C CG    1 
ATOM   4958  C  CD    . ARG C 2 225  ? -14.111 -27.840 43.447  1.00 95.58  ? 225  ARG C CD    1 
ATOM   4959  N  NE    . ARG C 2 225  ? -13.042 -28.828 43.538  1.00 98.56  ? 225  ARG C NE    1 
ATOM   4960  C  CZ    . ARG C 2 225  ? -11.972 -28.842 42.750  1.00 105.37 ? 225  ARG C CZ    1 
ATOM   4961  N  NH1   . ARG C 2 225  ? -11.825 -27.916 41.812  1.00 103.69 ? 225  ARG C NH1   1 
ATOM   4962  N  NH2   . ARG C 2 225  ? -11.045 -29.778 42.902  1.00 118.87 ? 225  ARG C NH2   1 
ATOM   4963  N  N     . ILE C 2 226  ? -15.316 -24.411 47.895  1.00 93.05  ? 226  ILE C N     1 
ATOM   4964  C  CA    . ILE C 2 226  ? -15.267 -23.044 48.402  1.00 92.97  ? 226  ILE C CA    1 
ATOM   4965  C  C     . ILE C 2 226  ? -13.977 -22.352 47.979  1.00 103.38 ? 226  ILE C C     1 
ATOM   4966  O  O     . ILE C 2 226  ? -12.903 -22.705 48.460  1.00 102.61 ? 226  ILE C O     1 
ATOM   4967  C  CB    . ILE C 2 226  ? -15.387 -23.025 49.937  1.00 78.50  ? 226  ILE C CB    1 
ATOM   4968  C  CG1   . ILE C 2 226  ? -16.679 -23.722 50.363  1.00 73.93  ? 226  ILE C CG1   1 
ATOM   4969  C  CG2   . ILE C 2 226  ? -15.317 -21.600 50.475  1.00 80.55  ? 226  ILE C CG2   1 
ATOM   4970  C  CD1   . ILE C 2 226  ? -16.916 -23.718 51.849  1.00 80.45  ? 226  ILE C CD1   1 
ATOM   4971  N  N     . ASP C 2 227  ? -14.091 -21.371 47.085  1.00 106.18 ? 227  ASP C N     1 
ATOM   4972  C  CA    . ASP C 2 227  ? -12.931 -20.664 46.538  1.00 106.52 ? 227  ASP C CA    1 
ATOM   4973  C  C     . ASP C 2 227  ? -11.931 -21.656 45.946  1.00 103.23 ? 227  ASP C C     1 
ATOM   4974  O  O     . ASP C 2 227  ? -10.734 -21.587 46.225  1.00 104.95 ? 227  ASP C O     1 
ATOM   4975  C  CB    . ASP C 2 227  ? -12.258 -19.801 47.613  1.00 107.25 ? 227  ASP C CB    1 
ATOM   4976  C  CG    . ASP C 2 227  ? -11.691 -18.501 47.056  1.00 110.50 ? 227  ASP C CG    1 
ATOM   4977  O  OD1   . ASP C 2 227  ? -11.655 -18.334 45.817  1.00 113.20 ? 227  ASP C OD1   1 
ATOM   4978  O  OD2   . ASP C 2 227  ? -11.276 -17.646 47.867  1.00 110.97 ? 227  ASP C OD2   1 
ATOM   4979  N  N     . ARG C 2 228  ? -12.447 -22.588 45.149  1.00 94.39  ? 228  ARG C N     1 
ATOM   4980  C  CA    . ARG C 2 228  ? -11.631 -23.582 44.455  1.00 94.37  ? 228  ARG C CA    1 
ATOM   4981  C  C     . ARG C 2 228  ? -10.810 -24.455 45.403  1.00 90.54  ? 228  ARG C C     1 
ATOM   4982  O  O     . ARG C 2 228  ? -9.656  -24.768 45.125  1.00 91.70  ? 228  ARG C O     1 
ATOM   4983  C  CB    . ARG C 2 228  ? -10.705 -22.896 43.444  1.00 94.75  ? 228  ARG C CB    1 
ATOM   4984  N  N     . LYS C 2 229  ? -11.408 -24.844 46.524  1.00 88.37  ? 229  LYS C N     1 
ATOM   4985  C  CA    . LYS C 2 229  ? -10.796 -25.838 47.396  1.00 98.92  ? 229  LYS C CA    1 
ATOM   4986  C  C     . LYS C 2 229  ? -11.296 -27.230 47.002  1.00 96.89  ? 229  LYS C C     1 
ATOM   4987  O  O     . LYS C 2 229  ? -12.102 -27.365 46.085  1.00 91.79  ? 229  LYS C O     1 
ATOM   4988  C  CB    . LYS C 2 229  ? -11.097 -25.544 48.873  1.00 102.65 ? 229  LYS C CB    1 
ATOM   4989  C  CG    . LYS C 2 229  ? -10.487 -24.247 49.406  1.00 98.44  ? 229  LYS C CG    1 
ATOM   4990  C  CD    . LYS C 2 229  ? -8.996  -24.155 49.130  1.00 101.97 ? 229  LYS C CD    1 
ATOM   4991  C  CE    . LYS C 2 229  ? -8.463  -22.761 49.434  1.00 95.35  ? 229  LYS C CE    1 
ATOM   4992  N  NZ    . LYS C 2 229  ? -9.185  -21.710 48.661  1.00 96.34  ? 229  LYS C NZ    1 
ATOM   4993  N  N     . ARG C 2 230  ? -10.811 -28.258 47.694  1.00 105.28 ? 230  ARG C N     1 
ATOM   4994  C  CA    . ARG C 2 230  ? -11.185 -29.643 47.402  1.00 102.09 ? 230  ARG C CA    1 
ATOM   4995  C  C     . ARG C 2 230  ? -12.622 -29.944 47.829  1.00 110.58 ? 230  ARG C C     1 
ATOM   4996  O  O     . ARG C 2 230  ? -13.152 -29.309 48.739  1.00 118.84 ? 230  ARG C O     1 
ATOM   4997  C  CB    . ARG C 2 230  ? -10.226 -30.610 48.095  1.00 101.20 ? 230  ARG C CB    1 
ATOM   4998  C  CG    . ARG C 2 230  ? -8.771  -30.204 47.974  1.00 109.51 ? 230  ARG C CG    1 
ATOM   4999  C  CD    . ARG C 2 230  ? -8.276  -30.346 46.549  1.00 118.96 ? 230  ARG C CD    1 
ATOM   5000  N  NE    . ARG C 2 230  ? -7.846  -31.711 46.263  1.00 132.60 ? 230  ARG C NE    1 
ATOM   5001  C  CZ    . ARG C 2 230  ? -7.277  -32.091 45.124  1.00 133.07 ? 230  ARG C CZ    1 
ATOM   5002  N  NH1   . ARG C 2 230  ? -7.070  -31.206 44.157  1.00 129.16 ? 230  ARG C NH1   1 
ATOM   5003  N  NH2   . ARG C 2 230  ? -6.914  -33.355 44.952  1.00 135.81 ? 230  ARG C NH2   1 
ATOM   5004  N  N     . ARG C 2 231  ? -13.237 -30.927 47.177  1.00 105.35 ? 231  ARG C N     1 
ATOM   5005  C  CA    . ARG C 2 231  ? -14.657 -31.227 47.369  1.00 103.44 ? 231  ARG C CA    1 
ATOM   5006  C  C     . ARG C 2 231  ? -14.969 -31.928 48.690  1.00 100.78 ? 231  ARG C C     1 
ATOM   5007  O  O     . ARG C 2 231  ? -14.252 -32.833 49.115  1.00 98.04  ? 231  ARG C O     1 
ATOM   5008  C  CB    . ARG C 2 231  ? -15.167 -32.082 46.204  1.00 101.73 ? 231  ARG C CB    1 
ATOM   5009  C  CG    . ARG C 2 231  ? -16.541 -32.703 46.425  1.00 103.64 ? 231  ARG C CG    1 
ATOM   5010  C  CD    . ARG C 2 231  ? -16.895 -33.682 45.316  1.00 107.67 ? 231  ARG C CD    1 
ATOM   5011  N  NE    . ARG C 2 231  ? -17.484 -33.024 44.153  1.00 111.33 ? 231  ARG C NE    1 
ATOM   5012  C  CZ    . ARG C 2 231  ? -18.777 -33.068 43.846  1.00 108.68 ? 231  ARG C CZ    1 
ATOM   5013  N  NH1   . ARG C 2 231  ? -19.618 -33.750 44.611  1.00 113.20 ? 231  ARG C NH1   1 
ATOM   5014  N  NH2   . ARG C 2 231  ? -19.230 -32.443 42.769  1.00 97.64  ? 231  ARG C NH2   1 
ATOM   5015  N  N     . GLN C 2 232  ? -16.051 -31.494 49.330  1.00 104.93 ? 232  GLN C N     1 
ATOM   5016  C  CA    . GLN C 2 232  ? -16.572 -32.147 50.524  1.00 107.89 ? 232  GLN C CA    1 
ATOM   5017  C  C     . GLN C 2 232  ? -18.084 -32.328 50.414  1.00 110.99 ? 232  GLN C C     1 
ATOM   5018  O  O     . GLN C 2 232  ? -18.747 -31.569 49.709  1.00 113.02 ? 232  GLN C O     1 
ATOM   5019  C  CB    . GLN C 2 232  ? -16.230 -31.340 51.775  1.00 101.72 ? 232  GLN C CB    1 
ATOM   5020  C  CG    . GLN C 2 232  ? -14.813 -31.522 52.261  1.00 102.89 ? 232  GLN C CG    1 
ATOM   5021  C  CD    . GLN C 2 232  ? -14.654 -31.112 53.707  1.00 111.28 ? 232  GLN C CD    1 
ATOM   5022  O  OE1   . GLN C 2 232  ? -13.656 -31.435 54.348  1.00 117.63 ? 232  GLN C OE1   1 
ATOM   5023  N  NE2   . GLN C 2 232  ? -15.645 -30.400 54.233  1.00 111.01 ? 232  GLN C NE2   1 
ATOM   5024  N  N     . PRO C 2 233  ? -18.632 -33.341 51.106  1.00 101.25 ? 233  PRO C N     1 
ATOM   5025  C  CA    . PRO C 2 233  ? -20.081 -33.566 51.154  1.00 96.74  ? 233  PRO C CA    1 
ATOM   5026  C  C     . PRO C 2 233  ? -20.843 -32.327 51.607  1.00 98.88  ? 233  PRO C C     1 
ATOM   5027  O  O     . PRO C 2 233  ? -20.426 -31.646 52.542  1.00 95.89  ? 233  PRO C O     1 
ATOM   5028  C  CB    . PRO C 2 233  ? -20.222 -34.697 52.172  1.00 100.94 ? 233  PRO C CB    1 
ATOM   5029  C  CG    . PRO C 2 233  ? -18.944 -35.440 52.061  1.00 102.28 ? 233  PRO C CG    1 
ATOM   5030  C  CD    . PRO C 2 233  ? -17.892 -34.401 51.811  1.00 98.35  ? 233  PRO C CD    1 
ATOM   5031  N  N     . VAL C 2 234  ? -21.955 -32.047 50.938  1.00 103.77 ? 234  VAL C N     1 
ATOM   5032  C  CA    . VAL C 2 234  ? -22.707 -30.822 51.173  1.00 107.79 ? 234  VAL C CA    1 
ATOM   5033  C  C     . VAL C 2 234  ? -23.327 -30.805 52.568  1.00 108.87 ? 234  VAL C C     1 
ATOM   5034  O  O     . VAL C 2 234  ? -23.636 -29.744 53.109  1.00 107.88 ? 234  VAL C O     1 
ATOM   5035  C  CB    . VAL C 2 234  ? -23.812 -30.635 50.105  1.00 109.06 ? 234  VAL C CB    1 
ATOM   5036  C  CG1   . VAL C 2 234  ? -24.972 -31.594 50.346  1.00 114.81 ? 234  VAL C CG1   1 
ATOM   5037  C  CG2   . VAL C 2 234  ? -24.299 -29.195 50.084  1.00 105.66 ? 234  VAL C CG2   1 
ATOM   5038  N  N     . THR C 2 235  ? -23.493 -31.984 53.157  1.00 107.57 ? 235  THR C N     1 
ATOM   5039  C  CA    . THR C 2 235  ? -24.079 -32.084 54.483  1.00 113.73 ? 235  THR C CA    1 
ATOM   5040  C  C     . THR C 2 235  ? -23.141 -31.491 55.535  1.00 111.09 ? 235  THR C C     1 
ATOM   5041  O  O     . THR C 2 235  ? -23.594 -31.005 56.572  1.00 114.10 ? 235  THR C O     1 
ATOM   5042  C  CB    . THR C 2 235  ? -24.421 -33.546 54.836  1.00 119.50 ? 235  THR C CB    1 
ATOM   5043  O  OG1   . THR C 2 235  ? -23.331 -34.399 54.465  1.00 111.34 ? 235  THR C OG1   1 
ATOM   5044  C  CG2   . THR C 2 235  ? -25.671 -33.992 54.088  1.00 118.55 ? 235  THR C CG2   1 
ATOM   5045  N  N     . VAL C 2 236  ? -21.839 -31.516 55.251  1.00 103.25 ? 236  VAL C N     1 
ATOM   5046  C  CA    . VAL C 2 236  ? -20.833 -30.968 56.162  1.00 104.22 ? 236  VAL C CA    1 
ATOM   5047  C  C     . VAL C 2 236  ? -21.087 -29.487 56.411  1.00 105.56 ? 236  VAL C C     1 
ATOM   5048  O  O     . VAL C 2 236  ? -20.858 -28.969 57.508  1.00 100.83 ? 236  VAL C O     1 
ATOM   5049  C  CB    . VAL C 2 236  ? -19.406 -31.154 55.605  1.00 96.19  ? 236  VAL C CB    1 
ATOM   5050  C  CG1   . VAL C 2 236  ? -18.374 -30.575 56.561  1.00 98.59  ? 236  VAL C CG1   1 
ATOM   5051  C  CG2   . VAL C 2 236  ? -19.127 -32.625 55.343  1.00 99.87  ? 236  VAL C CG2   1 
ATOM   5052  N  N     . LEU C 2 237  ? -21.584 -28.820 55.378  1.00 111.58 ? 237  LEU C N     1 
ATOM   5053  C  CA    . LEU C 2 237  ? -21.887 -27.400 55.436  1.00 116.98 ? 237  LEU C CA    1 
ATOM   5054  C  C     . LEU C 2 237  ? -23.163 -27.122 56.227  1.00 114.52 ? 237  LEU C C     1 
ATOM   5055  O  O     . LEU C 2 237  ? -23.254 -26.124 56.942  1.00 117.67 ? 237  LEU C O     1 
ATOM   5056  C  CB    . LEU C 2 237  ? -22.015 -26.838 54.020  1.00 116.57 ? 237  LEU C CB    1 
ATOM   5057  C  CG    . LEU C 2 237  ? -22.161 -25.325 53.882  1.00 112.63 ? 237  LEU C CG    1 
ATOM   5058  C  CD1   . LEU C 2 237  ? -21.070 -24.619 54.668  1.00 105.81 ? 237  LEU C CD1   1 
ATOM   5059  C  CD2   . LEU C 2 237  ? -22.110 -24.930 52.415  1.00 112.32 ? 237  LEU C CD2   1 
ATOM   5060  N  N     . LEU C 2 238  ? -24.148 -28.005 56.097  1.00 106.67 ? 238  LEU C N     1 
ATOM   5061  C  CA    . LEU C 2 238  ? -25.424 -27.816 56.777  1.00 103.12 ? 238  LEU C CA    1 
ATOM   5062  C  C     . LEU C 2 238  ? -25.277 -27.994 58.281  1.00 105.15 ? 238  LEU C C     1 
ATOM   5063  O  O     . LEU C 2 238  ? -25.882 -27.261 59.063  1.00 105.84 ? 238  LEU C O     1 
ATOM   5064  C  CB    . LEU C 2 238  ? -26.471 -28.784 56.231  1.00 104.80 ? 238  LEU C CB    1 
ATOM   5065  C  CG    . LEU C 2 238  ? -27.054 -28.409 54.869  1.00 108.59 ? 238  LEU C CG    1 
ATOM   5066  C  CD1   . LEU C 2 238  ? -27.921 -29.533 54.329  1.00 112.18 ? 238  LEU C CD1   1 
ATOM   5067  C  CD2   . LEU C 2 238  ? -27.849 -27.114 54.969  1.00 108.04 ? 238  LEU C CD2   1 
ATOM   5068  N  N     . LYS C 2 239  ? -24.467 -28.969 58.679  1.00 106.37 ? 239  LYS C N     1 
ATOM   5069  C  CA    . LYS C 2 239  ? -24.208 -29.217 60.090  1.00 111.56 ? 239  LYS C CA    1 
ATOM   5070  C  C     . LYS C 2 239  ? -23.312 -28.128 60.665  1.00 112.79 ? 239  LYS C C     1 
ATOM   5071  O  O     . LYS C 2 239  ? -23.285 -27.904 61.875  1.00 117.68 ? 239  LYS C O     1 
ATOM   5072  C  CB    . LYS C 2 239  ? -23.571 -30.593 60.288  1.00 113.82 ? 239  LYS C CB    1 
ATOM   5073  C  CG    . LYS C 2 239  ? -24.466 -31.751 59.879  1.00 113.86 ? 239  LYS C CG    1 
ATOM   5074  C  CD    . LYS C 2 239  ? -23.775 -33.090 60.081  1.00 109.36 ? 239  LYS C CD    1 
ATOM   5075  C  CE    . LYS C 2 239  ? -24.690 -34.240 59.694  1.00 112.72 ? 239  LYS C CE    1 
ATOM   5076  N  NZ    . LYS C 2 239  ? -24.007 -35.557 59.797  1.00 111.56 ? 239  LYS C NZ    1 
ATOM   5077  N  N     . ALA C 2 240  ? -22.579 -27.453 59.787  1.00 108.39 ? 240  ALA C N     1 
ATOM   5078  C  CA    . ALA C 2 240  ? -21.749 -26.327 60.189  1.00 109.59 ? 240  ALA C CA    1 
ATOM   5079  C  C     . ALA C 2 240  ? -22.612 -25.094 60.442  1.00 114.63 ? 240  ALA C C     1 
ATOM   5080  O  O     . ALA C 2 240  ? -22.331 -24.299 61.339  1.00 111.26 ? 240  ALA C O     1 
ATOM   5081  C  CB    . ALA C 2 240  ? -20.700 -26.036 59.131  1.00 106.13 ? 240  ALA C CB    1 
ATOM   5082  N  N     . LEU C 2 241  ? -23.669 -24.948 59.649  1.00 115.15 ? 241  LEU C N     1 
ATOM   5083  C  CA    . LEU C 2 241  ? -24.584 -23.820 59.785  1.00 109.75 ? 241  LEU C CA    1 
ATOM   5084  C  C     . LEU C 2 241  ? -25.345 -23.871 61.101  1.00 110.14 ? 241  LEU C C     1 
ATOM   5085  O  O     . LEU C 2 241  ? -25.731 -22.838 61.648  1.00 113.67 ? 241  LEU C O     1 
ATOM   5086  C  CB    . LEU C 2 241  ? -25.573 -23.789 58.622  1.00 106.43 ? 241  LEU C CB    1 
ATOM   5087  C  CG    . LEU C 2 241  ? -25.006 -23.382 57.265  1.00 104.43 ? 241  LEU C CG    1 
ATOM   5088  C  CD1   . LEU C 2 241  ? -26.084 -23.472 56.203  1.00 107.00 ? 241  LEU C CD1   1 
ATOM   5089  C  CD2   . LEU C 2 241  ? -24.429 -21.977 57.333  1.00 98.85  ? 241  LEU C CD2   1 
ATOM   5090  N  N     . GLY C 2 242  ? -25.563 -25.081 61.601  1.00 108.16 ? 242  GLY C N     1 
ATOM   5091  C  CA    . GLY C 2 242  ? -26.308 -25.270 62.829  1.00 108.12 ? 242  GLY C CA    1 
ATOM   5092  C  C     . GLY C 2 242  ? -27.626 -25.976 62.590  1.00 108.60 ? 242  GLY C C     1 
ATOM   5093  O  O     . GLY C 2 242  ? -28.406 -26.178 63.519  1.00 110.83 ? 242  GLY C O     1 
ATOM   5094  N  N     . TRP C 2 243  ? -27.884 -26.345 61.340  1.00 105.37 ? 243  TRP C N     1 
ATOM   5095  C  CA    . TRP C 2 243  ? -29.081 -27.110 61.014  1.00 110.19 ? 243  TRP C CA    1 
ATOM   5096  C  C     . TRP C 2 243  ? -28.959 -28.526 61.565  1.00 114.40 ? 243  TRP C C     1 
ATOM   5097  O  O     . TRP C 2 243  ? -27.900 -29.146 61.471  1.00 115.41 ? 243  TRP C O     1 
ATOM   5098  C  CB    . TRP C 2 243  ? -29.316 -27.138 59.502  1.00 110.53 ? 243  TRP C CB    1 
ATOM   5099  C  CG    . TRP C 2 243  ? -29.641 -25.793 58.941  1.00 112.28 ? 243  TRP C CG    1 
ATOM   5100  C  CD1   . TRP C 2 243  ? -28.770 -24.905 58.384  1.00 111.89 ? 243  TRP C CD1   1 
ATOM   5101  C  CD2   . TRP C 2 243  ? -30.931 -25.171 58.897  1.00 109.24 ? 243  TRP C CD2   1 
ATOM   5102  N  NE1   . TRP C 2 243  ? -29.437 -23.770 57.990  1.00 113.25 ? 243  TRP C NE1   1 
ATOM   5103  C  CE2   . TRP C 2 243  ? -30.765 -23.908 58.294  1.00 108.23 ? 243  TRP C CE2   1 
ATOM   5104  C  CE3   . TRP C 2 243  ? -32.209 -25.560 59.306  1.00 107.07 ? 243  TRP C CE3   1 
ATOM   5105  C  CZ2   . TRP C 2 243  ? -31.829 -23.034 58.091  1.00 100.95 ? 243  TRP C CZ2   1 
ATOM   5106  C  CZ3   . TRP C 2 243  ? -33.264 -24.690 59.103  1.00 107.72 ? 243  TRP C CZ3   1 
ATOM   5107  C  CH2   . TRP C 2 243  ? -33.067 -23.442 58.501  1.00 103.76 ? 243  TRP C CH2   1 
ATOM   5108  N  N     . THR C 2 244  ? -30.043 -29.025 62.150  1.00 123.88 ? 244  THR C N     1 
ATOM   5109  C  CA    . THR C 2 244  ? -30.053 -30.353 62.757  1.00 124.45 ? 244  THR C CA    1 
ATOM   5110  C  C     . THR C 2 244  ? -29.958 -31.454 61.706  1.00 123.83 ? 244  THR C C     1 
ATOM   5111  O  O     . THR C 2 244  ? -30.380 -31.269 60.565  1.00 123.01 ? 244  THR C O     1 
ATOM   5112  C  CB    . THR C 2 244  ? -31.328 -30.578 63.595  1.00 120.15 ? 244  THR C CB    1 
ATOM   5113  O  OG1   . THR C 2 244  ? -32.448 -30.773 62.723  1.00 116.07 ? 244  THR C OG1   1 
ATOM   5114  C  CG2   . THR C 2 244  ? -31.592 -29.386 64.503  1.00 109.02 ? 244  THR C CG2   1 
ATOM   5115  N  N     . SER C 2 245  ? -29.413 -32.603 62.100  1.00 121.99 ? 245  SER C N     1 
ATOM   5116  C  CA    . SER C 2 245  ? -29.296 -33.751 61.203  1.00 118.78 ? 245  SER C CA    1 
ATOM   5117  C  C     . SER C 2 245  ? -30.666 -34.300 60.818  1.00 117.98 ? 245  SER C C     1 
ATOM   5118  O  O     . SER C 2 245  ? -30.788 -35.097 59.888  1.00 113.97 ? 245  SER C O     1 
ATOM   5119  C  CB    . SER C 2 245  ? -28.457 -34.858 61.847  1.00 115.98 ? 245  SER C CB    1 
ATOM   5120  O  OG    . SER C 2 245  ? -27.149 -34.408 62.152  1.00 115.28 ? 245  SER C OG    1 
ATOM   5121  N  N     . GLU C 2 246  ? -31.694 -33.878 61.548  1.00 122.77 ? 246  GLU C N     1 
ATOM   5122  C  CA    . GLU C 2 246  ? -33.063 -34.286 61.262  1.00 125.37 ? 246  GLU C CA    1 
ATOM   5123  C  C     . GLU C 2 246  ? -33.710 -33.360 60.236  1.00 120.34 ? 246  GLU C C     1 
ATOM   5124  O  O     . GLU C 2 246  ? -34.492 -33.803 59.395  1.00 116.65 ? 246  GLU C O     1 
ATOM   5125  C  CB    . GLU C 2 246  ? -33.893 -34.317 62.549  1.00 130.03 ? 246  GLU C CB    1 
ATOM   5126  C  CG    . GLU C 2 246  ? -33.961 -35.683 63.227  1.00 125.89 ? 246  GLU C CG    1 
ATOM   5127  C  CD    . GLU C 2 246  ? -32.607 -36.196 63.686  1.00 117.08 ? 246  GLU C CD    1 
ATOM   5128  O  OE1   . GLU C 2 246  ? -31.725 -35.368 63.998  1.00 120.26 ? 246  GLU C OE1   1 
ATOM   5129  O  OE2   . GLU C 2 246  ? -32.426 -37.431 63.736  1.00 108.16 ? 246  GLU C OE2   1 
ATOM   5130  N  N     . GLN C 2 247  ? -33.380 -32.074 60.311  1.00 118.97 ? 247  GLN C N     1 
ATOM   5131  C  CA    . GLN C 2 247  ? -33.903 -31.098 59.361  1.00 121.95 ? 247  GLN C CA    1 
ATOM   5132  C  C     . GLN C 2 247  ? -33.348 -31.359 57.968  1.00 123.46 ? 247  GLN C C     1 
ATOM   5133  O  O     . GLN C 2 247  ? -33.989 -31.045 56.962  1.00 115.18 ? 247  GLN C O     1 
ATOM   5134  C  CB    . GLN C 2 247  ? -33.573 -29.673 59.807  1.00 118.85 ? 247  GLN C CB    1 
ATOM   5135  C  CG    . GLN C 2 247  ? -34.497 -29.145 60.892  1.00 117.85 ? 247  GLN C CG    1 
ATOM   5136  C  CD    . GLN C 2 247  ? -34.233 -27.691 61.227  1.00 123.59 ? 247  GLN C CD    1 
ATOM   5137  O  OE1   . GLN C 2 247  ? -33.175 -27.345 61.752  1.00 129.52 ? 247  GLN C OE1   1 
ATOM   5138  N  NE2   . GLN C 2 247  ? -35.198 -26.830 60.923  1.00 118.66 ? 247  GLN C NE2   1 
ATOM   5139  N  N     . ILE C 2 248  ? -32.151 -31.935 57.922  1.00 130.78 ? 248  ILE C N     1 
ATOM   5140  C  CA    . ILE C 2 248  ? -31.557 -32.386 56.671  1.00 135.44 ? 248  ILE C CA    1 
ATOM   5141  C  C     . ILE C 2 248  ? -32.436 -33.466 56.045  1.00 134.04 ? 248  ILE C C     1 
ATOM   5142  O  O     . ILE C 2 248  ? -32.689 -33.459 54.840  1.00 128.68 ? 248  ILE C O     1 
ATOM   5143  C  CB    . ILE C 2 248  ? -30.127 -32.936 56.885  1.00 134.79 ? 248  ILE C CB    1 
ATOM   5144  C  CG1   . ILE C 2 248  ? -29.261 -31.911 57.622  1.00 127.17 ? 248  ILE C CG1   1 
ATOM   5145  C  CG2   . ILE C 2 248  ? -29.490 -33.325 55.555  1.00 128.66 ? 248  ILE C CG2   1 
ATOM   5146  C  CD1   . ILE C 2 248  ? -27.844 -32.379 57.885  1.00 118.03 ? 248  ILE C CD1   1 
ATOM   5147  N  N     . VAL C 2 249  ? -32.907 -34.389 56.880  1.00 133.95 ? 249  VAL C N     1 
ATOM   5148  C  CA    . VAL C 2 249  ? -33.781 -35.467 56.429  1.00 131.64 ? 249  VAL C CA    1 
ATOM   5149  C  C     . VAL C 2 249  ? -35.125 -34.907 55.973  1.00 129.05 ? 249  VAL C C     1 
ATOM   5150  O  O     . VAL C 2 249  ? -35.759 -35.438 55.059  1.00 131.76 ? 249  VAL C O     1 
ATOM   5151  C  CB    . VAL C 2 249  ? -34.006 -36.514 57.543  1.00 127.75 ? 249  VAL C CB    1 
ATOM   5152  C  CG1   . VAL C 2 249  ? -34.866 -37.663 57.044  1.00 124.78 ? 249  VAL C CG1   1 
ATOM   5153  C  CG2   . VAL C 2 249  ? -32.673 -37.035 58.055  1.00 124.75 ? 249  VAL C CG2   1 
ATOM   5154  N  N     . GLU C 2 250  ? -35.549 -33.820 56.606  1.00 120.09 ? 250  GLU C N     1 
ATOM   5155  C  CA    . GLU C 2 250  ? -36.830 -33.206 56.287  1.00 119.38 ? 250  GLU C CA    1 
ATOM   5156  C  C     . GLU C 2 250  ? -36.831 -32.513 54.930  1.00 120.28 ? 250  GLU C C     1 
ATOM   5157  O  O     . GLU C 2 250  ? -37.633 -32.841 54.054  1.00 118.71 ? 250  GLU C O     1 
ATOM   5158  C  CB    . GLU C 2 250  ? -37.216 -32.194 57.361  1.00 113.50 ? 250  GLU C CB    1 
ATOM   5159  C  CG    . GLU C 2 250  ? -38.476 -31.426 57.027  1.00 105.96 ? 250  GLU C CG    1 
ATOM   5160  C  CD    . GLU C 2 250  ? -38.694 -30.251 57.947  1.00 99.01  ? 250  GLU C CD    1 
ATOM   5161  O  OE1   . GLU C 2 250  ? -39.853 -29.812 58.089  1.00 97.79  ? 250  GLU C OE1   1 
ATOM   5162  O  OE2   . GLU C 2 250  ? -37.703 -29.763 58.528  1.00 100.30 ? 250  GLU C OE2   1 
ATOM   5163  N  N     . ARG C 2 251  ? -35.929 -31.551 54.769  1.00 125.23 ? 251  ARG C N     1 
ATOM   5164  C  CA    . ARG C 2 251  ? -35.928 -30.667 53.607  1.00 130.67 ? 251  ARG C CA    1 
ATOM   5165  C  C     . ARG C 2 251  ? -35.522 -31.361 52.308  1.00 130.03 ? 251  ARG C C     1 
ATOM   5166  O  O     . ARG C 2 251  ? -36.082 -31.081 51.249  1.00 126.37 ? 251  ARG C O     1 
ATOM   5167  C  CB    . ARG C 2 251  ? -35.000 -29.475 53.861  1.00 126.51 ? 251  ARG C CB    1 
ATOM   5168  C  CG    . ARG C 2 251  ? -34.994 -28.425 52.753  1.00 119.01 ? 251  ARG C CG    1 
ATOM   5169  C  CD    . ARG C 2 251  ? -36.350 -27.748 52.619  1.00 115.83 ? 251  ARG C CD    1 
ATOM   5170  N  NE    . ARG C 2 251  ? -36.343 -26.679 51.624  1.00 105.20 ? 251  ARG C NE    1 
ATOM   5171  C  CZ    . ARG C 2 251  ? -36.047 -25.410 51.891  1.00 103.62 ? 251  ARG C CZ    1 
ATOM   5172  N  NH1   . ARG C 2 251  ? -35.726 -25.044 53.125  1.00 101.25 ? 251  ARG C NH1   1 
ATOM   5173  N  NH2   . ARG C 2 251  ? -36.067 -24.507 50.921  1.00 101.50 ? 251  ARG C NH2   1 
ATOM   5174  N  N     . PHE C 2 252  ? -34.549 -32.263 52.390  1.00 130.20 ? 252  PHE C N     1 
ATOM   5175  C  CA    . PHE C 2 252  ? -33.979 -32.874 51.194  1.00 123.36 ? 252  PHE C CA    1 
ATOM   5176  C  C     . PHE C 2 252  ? -34.224 -34.382 51.154  1.00 117.67 ? 252  PHE C C     1 
ATOM   5177  O  O     . PHE C 2 252  ? -33.495 -35.123 50.496  1.00 112.57 ? 252  PHE C O     1 
ATOM   5178  C  CB    . PHE C 2 252  ? -32.475 -32.583 51.117  1.00 126.22 ? 252  PHE C CB    1 
ATOM   5179  C  CG    . PHE C 2 252  ? -32.120 -31.125 51.303  1.00 132.55 ? 252  PHE C CG    1 
ATOM   5180  C  CD1   . PHE C 2 252  ? -32.063 -30.263 50.218  1.00 125.46 ? 252  PHE C CD1   1 
ATOM   5181  C  CD2   . PHE C 2 252  ? -31.830 -30.622 52.563  1.00 136.76 ? 252  PHE C CD2   1 
ATOM   5182  C  CE1   . PHE C 2 252  ? -31.731 -28.925 50.388  1.00 121.47 ? 252  PHE C CE1   1 
ATOM   5183  C  CE2   . PHE C 2 252  ? -31.499 -29.286 52.739  1.00 128.72 ? 252  PHE C CE2   1 
ATOM   5184  C  CZ    . PHE C 2 252  ? -31.449 -28.439 51.650  1.00 116.91 ? 252  PHE C CZ    1 
ATOM   5185  N  N     . GLY C 2 253  ? -35.260 -34.827 51.855  1.00 120.64 ? 253  GLY C N     1 
ATOM   5186  C  CA    . GLY C 2 253  ? -35.562 -36.243 51.948  1.00 123.97 ? 253  GLY C CA    1 
ATOM   5187  C  C     . GLY C 2 253  ? -36.277 -36.805 50.736  1.00 120.76 ? 253  GLY C C     1 
ATOM   5188  O  O     . GLY C 2 253  ? -36.294 -38.018 50.524  1.00 121.59 ? 253  GLY C O     1 
ATOM   5189  N  N     . PHE C 2 254  ? -36.864 -35.923 49.934  1.00 111.31 ? 254  PHE C N     1 
ATOM   5190  C  CA    . PHE C 2 254  ? -37.624 -36.338 48.760  1.00 107.72 ? 254  PHE C CA    1 
ATOM   5191  C  C     . PHE C 2 254  ? -36.729 -36.920 47.669  1.00 109.32 ? 254  PHE C C     1 
ATOM   5192  O  O     . PHE C 2 254  ? -37.218 -37.484 46.691  1.00 107.74 ? 254  PHE C O     1 
ATOM   5193  C  CB    . PHE C 2 254  ? -38.428 -35.162 48.201  1.00 106.52 ? 254  PHE C CB    1 
ATOM   5194  C  CG    . PHE C 2 254  ? -37.584 -33.987 47.792  1.00 112.64 ? 254  PHE C CG    1 
ATOM   5195  C  CD1   . PHE C 2 254  ? -37.294 -32.979 48.694  1.00 117.63 ? 254  PHE C CD1   1 
ATOM   5196  C  CD2   . PHE C 2 254  ? -37.087 -33.887 46.502  1.00 110.45 ? 254  PHE C CD2   1 
ATOM   5197  C  CE1   . PHE C 2 254  ? -36.521 -31.895 48.320  1.00 117.46 ? 254  PHE C CE1   1 
ATOM   5198  C  CE2   . PHE C 2 254  ? -36.313 -32.808 46.123  1.00 108.69 ? 254  PHE C CE2   1 
ATOM   5199  C  CZ    . PHE C 2 254  ? -36.029 -31.810 47.034  1.00 111.96 ? 254  PHE C CZ    1 
ATOM   5200  N  N     . SER C 2 255  ? -35.420 -36.775 47.835  1.00 108.11 ? 255  SER C N     1 
ATOM   5201  C  CA    . SER C 2 255  ? -34.475 -37.318 46.871  1.00 106.07 ? 255  SER C CA    1 
ATOM   5202  C  C     . SER C 2 255  ? -33.569 -38.354 47.516  1.00 112.61 ? 255  SER C C     1 
ATOM   5203  O  O     . SER C 2 255  ? -33.210 -38.243 48.688  1.00 112.36 ? 255  SER C O     1 
ATOM   5204  C  CB    . SER C 2 255  ? -33.632 -36.208 46.260  1.00 100.26 ? 255  SER C CB    1 
ATOM   5205  O  OG    . SER C 2 255  ? -32.724 -35.684 47.211  1.00 104.79 ? 255  SER C OG    1 
ATOM   5206  N  N     . GLU C 2 256  ? -33.193 -39.359 46.736  1.00 115.14 ? 256  GLU C N     1 
ATOM   5207  C  CA    . GLU C 2 256  ? -32.357 -40.436 47.240  1.00 115.70 ? 256  GLU C CA    1 
ATOM   5208  C  C     . GLU C 2 256  ? -30.886 -40.040 47.217  1.00 114.71 ? 256  GLU C C     1 
ATOM   5209  O  O     . GLU C 2 256  ? -30.066 -40.625 47.923  1.00 116.26 ? 256  GLU C O     1 
ATOM   5210  C  CB    . GLU C 2 256  ? -32.581 -41.711 46.422  1.00 119.78 ? 256  GLU C CB    1 
ATOM   5211  C  CG    . GLU C 2 256  ? -32.004 -42.969 47.053  1.00 122.94 ? 256  GLU C CG    1 
ATOM   5212  C  CD    . GLU C 2 256  ? -32.667 -43.321 48.373  1.00 122.56 ? 256  GLU C CD    1 
ATOM   5213  O  OE1   . GLU C 2 256  ? -33.823 -42.904 48.594  1.00 125.67 ? 256  GLU C OE1   1 
ATOM   5214  O  OE2   . GLU C 2 256  ? -32.030 -44.015 49.193  1.00 120.92 ? 256  GLU C OE2   1 
ATOM   5215  N  N     . ILE C 2 257  ? -30.557 -39.037 46.410  1.00 115.54 ? 257  ILE C N     1 
ATOM   5216  C  CA    . ILE C 2 257  ? -29.172 -38.606 46.272  1.00 116.51 ? 257  ILE C CA    1 
ATOM   5217  C  C     . ILE C 2 257  ? -28.712 -37.799 47.484  1.00 111.16 ? 257  ILE C C     1 
ATOM   5218  O  O     . ILE C 2 257  ? -27.521 -37.745 47.787  1.00 108.85 ? 257  ILE C O     1 
ATOM   5219  C  CB    . ILE C 2 257  ? -28.966 -37.774 44.987  1.00 112.36 ? 257  ILE C CB    1 
ATOM   5220  C  CG1   . ILE C 2 257  ? -29.849 -36.525 44.998  1.00 103.93 ? 257  ILE C CG1   1 
ATOM   5221  C  CG2   . ILE C 2 257  ? -29.257 -38.620 43.758  1.00 107.86 ? 257  ILE C CG2   1 
ATOM   5222  C  CD1   . ILE C 2 257  ? -29.078 -35.239 45.191  1.00 97.73  ? 257  ILE C CD1   1 
ATOM   5223  N  N     . MET C 2 258  ? -29.656 -37.180 48.182  1.00 107.35 ? 258  MET C N     1 
ATOM   5224  C  CA    . MET C 2 258  ? -29.325 -36.434 49.388  1.00 109.06 ? 258  MET C CA    1 
ATOM   5225  C  C     . MET C 2 258  ? -29.302 -37.362 50.590  1.00 111.79 ? 258  MET C C     1 
ATOM   5226  O  O     . MET C 2 258  ? -28.499 -37.189 51.506  1.00 116.63 ? 258  MET C O     1 
ATOM   5227  C  CB    . MET C 2 258  ? -30.315 -35.294 49.613  1.00 119.21 ? 258  MET C CB    1 
ATOM   5228  C  CG    . MET C 2 258  ? -29.990 -34.048 48.807  1.00 121.61 ? 258  MET C CG    1 
ATOM   5229  S  SD    . MET C 2 258  ? -28.371 -33.371 49.227  1.00 120.14 ? 258  MET C SD    1 
ATOM   5230  C  CE    . MET C 2 258  ? -28.646 -32.839 50.915  1.00 106.30 ? 258  MET C CE    1 
ATOM   5231  N  N     . ARG C 2 259  ? -30.191 -38.349 50.579  1.00 116.30 ? 259  ARG C N     1 
ATOM   5232  C  CA    . ARG C 2 259  ? -30.206 -39.371 51.615  1.00 126.91 ? 259  ARG C CA    1 
ATOM   5233  C  C     . ARG C 2 259  ? -28.914 -40.172 51.564  1.00 119.73 ? 259  ARG C C     1 
ATOM   5234  O  O     . ARG C 2 259  ? -28.358 -40.551 52.596  1.00 114.19 ? 259  ARG C O     1 
ATOM   5235  C  CB    . ARG C 2 259  ? -31.415 -40.291 51.449  1.00 126.68 ? 259  ARG C CB    1 
ATOM   5236  C  CG    . ARG C 2 259  ? -32.737 -39.624 51.776  1.00 124.95 ? 259  ARG C CG    1 
ATOM   5237  C  CD    . ARG C 2 259  ? -32.776 -39.183 53.229  1.00 125.97 ? 259  ARG C CD    1 
ATOM   5238  N  NE    . ARG C 2 259  ? -34.069 -38.611 53.587  1.00 123.24 ? 259  ARG C NE    1 
ATOM   5239  C  CZ    . ARG C 2 259  ? -35.116 -39.327 53.980  1.00 126.63 ? 259  ARG C CZ    1 
ATOM   5240  N  NH1   . ARG C 2 259  ? -35.019 -40.647 54.067  1.00 131.17 ? 259  ARG C NH1   1 
ATOM   5241  N  NH2   . ARG C 2 259  ? -36.258 -38.726 54.284  1.00 126.54 ? 259  ARG C NH2   1 
ATOM   5242  N  N     . SER C 2 260  ? -28.435 -40.415 50.349  1.00 113.90 ? 260  SER C N     1 
ATOM   5243  C  CA    . SER C 2 260  ? -27.174 -41.112 50.149  1.00 109.08 ? 260  SER C CA    1 
ATOM   5244  C  C     . SER C 2 260  ? -26.000 -40.227 50.570  1.00 114.47 ? 260  SER C C     1 
ATOM   5245  O  O     . SER C 2 260  ? -24.897 -40.720 50.795  1.00 112.67 ? 260  SER C O     1 
ATOM   5246  C  CB    . SER C 2 260  ? -27.028 -41.538 48.687  1.00 104.30 ? 260  SER C CB    1 
ATOM   5247  O  OG    . SER C 2 260  ? -25.838 -42.273 48.479  1.00 95.91  ? 260  SER C OG    1 
ATOM   5248  N  N     . THR C 2 261  ? -26.250 -38.923 50.682  1.00 118.67 ? 261  THR C N     1 
ATOM   5249  C  CA    . THR C 2 261  ? -25.213 -37.958 51.049  1.00 115.72 ? 261  THR C CA    1 
ATOM   5250  C  C     . THR C 2 261  ? -25.059 -37.823 52.562  1.00 112.50 ? 261  THR C C     1 
ATOM   5251  O  O     . THR C 2 261  ? -23.944 -37.826 53.087  1.00 108.99 ? 261  THR C O     1 
ATOM   5252  C  CB    . THR C 2 261  ? -25.508 -36.563 50.467  1.00 103.19 ? 261  THR C CB    1 
ATOM   5253  O  OG1   . THR C 2 261  ? -25.804 -36.671 49.069  1.00 97.43  ? 261  THR C OG1   1 
ATOM   5254  C  CG2   . THR C 2 261  ? -24.314 -35.641 50.664  1.00 104.57 ? 261  THR C CG2   1 
ATOM   5255  N  N     . LEU C 2 262  ? -26.185 -37.691 53.256  1.00 111.18 ? 262  LEU C N     1 
ATOM   5256  C  CA    . LEU C 2 262  ? -26.180 -37.573 54.708  1.00 107.05 ? 262  LEU C CA    1 
ATOM   5257  C  C     . LEU C 2 262  ? -25.726 -38.878 55.347  1.00 109.02 ? 262  LEU C C     1 
ATOM   5258  O  O     . LEU C 2 262  ? -25.233 -38.894 56.474  1.00 110.90 ? 262  LEU C O     1 
ATOM   5259  C  CB    . LEU C 2 262  ? -27.567 -37.181 55.223  1.00 102.00 ? 262  LEU C CB    1 
ATOM   5260  C  CG    . LEU C 2 262  ? -27.690 -36.938 56.729  1.00 99.53  ? 262  LEU C CG    1 
ATOM   5261  C  CD1   . LEU C 2 262  ? -26.745 -35.836 57.176  1.00 99.02  ? 262  LEU C CD1   1 
ATOM   5262  C  CD2   . LEU C 2 262  ? -29.121 -36.606 57.107  1.00 107.09 ? 262  LEU C CD2   1 
ATOM   5263  N  N     . GLU C 2 263  ? -25.893 -39.975 54.616  1.00 112.15 ? 263  GLU C N     1 
ATOM   5264  C  CA    . GLU C 2 263  ? -25.486 -41.286 55.107  1.00 124.94 ? 263  GLU C CA    1 
ATOM   5265  C  C     . GLU C 2 263  ? -23.978 -41.470 54.956  1.00 124.18 ? 263  GLU C C     1 
ATOM   5266  O  O     . GLU C 2 263  ? -23.301 -41.895 55.893  1.00 128.26 ? 263  GLU C O     1 
ATOM   5267  C  CB    . GLU C 2 263  ? -26.239 -42.399 54.371  1.00 127.66 ? 263  GLU C CB    1 
ATOM   5268  C  CG    . GLU C 2 263  ? -26.343 -43.711 55.148  1.00 120.34 ? 263  GLU C CG    1 
ATOM   5269  C  CD    . GLU C 2 263  ? -25.151 -44.627 54.938  1.00 118.89 ? 263  GLU C CD    1 
ATOM   5270  O  OE1   . GLU C 2 263  ? -24.600 -44.643 53.817  1.00 124.51 ? 263  GLU C OE1   1 
ATOM   5271  O  OE2   . GLU C 2 263  ? -24.766 -45.335 55.894  1.00 114.67 ? 263  GLU C OE2   1 
ATOM   5272  N  N     . LYS C 2 264  ? -23.452 -41.136 53.780  1.00 114.93 ? 264  LYS C N     1 
ATOM   5273  C  CA    . LYS C 2 264  ? -22.019 -41.246 53.526  1.00 106.84 ? 264  LYS C CA    1 
ATOM   5274  C  C     . LYS C 2 264  ? -21.253 -40.144 54.250  1.00 101.07 ? 264  LYS C C     1 
ATOM   5275  O  O     . LYS C 2 264  ? -20.022 -40.105 54.214  1.00 97.48  ? 264  LYS C O     1 
ATOM   5276  C  CB    . LYS C 2 264  ? -21.732 -41.193 52.023  1.00 103.21 ? 264  LYS C CB    1 
ATOM   5277  C  CG    . LYS C 2 264  ? -22.277 -42.376 51.237  1.00 96.35  ? 264  LYS C CG    1 
ATOM   5278  C  CD    . LYS C 2 264  ? -22.180 -42.130 49.740  1.00 95.06  ? 264  LYS C CD    1 
ATOM   5279  C  CE    . LYS C 2 264  ? -22.851 -43.237 48.946  1.00 97.23  ? 264  LYS C CE    1 
ATOM   5280  N  NZ    . LYS C 2 264  ? -22.945 -42.899 47.498  1.00 104.52 ? 264  LYS C NZ    1 
ATOM   5281  N  N     . ASP C 2 265  ? -21.995 -39.251 54.899  1.00 98.03  ? 265  ASP C N     1 
ATOM   5282  C  CA    . ASP C 2 265  ? -21.415 -38.173 55.689  1.00 102.74 ? 265  ASP C CA    1 
ATOM   5283  C  C     . ASP C 2 265  ? -20.411 -38.696 56.704  1.00 104.88 ? 265  ASP C C     1 
ATOM   5284  O  O     . ASP C 2 265  ? -20.735 -39.551 57.527  1.00 105.29 ? 265  ASP C O     1 
ATOM   5285  C  CB    . ASP C 2 265  ? -22.510 -37.389 56.409  1.00 103.77 ? 265  ASP C CB    1 
ATOM   5286  C  CG    . ASP C 2 265  ? -21.981 -36.608 57.590  1.00 102.66 ? 265  ASP C CG    1 
ATOM   5287  O  OD1   . ASP C 2 265  ? -21.036 -35.814 57.402  1.00 102.25 ? 265  ASP C OD1   1 
ATOM   5288  O  OD2   . ASP C 2 265  ? -22.501 -36.800 58.709  1.00 99.91  ? 265  ASP C OD2   1 
ATOM   5289  N  N     . ASN C 2 266  ? -19.194 -38.165 56.641  1.00 106.86 ? 266  ASN C N     1 
ATOM   5290  C  CA    . ASN C 2 266  ? -18.106 -38.616 57.498  1.00 110.19 ? 266  ASN C CA    1 
ATOM   5291  C  C     . ASN C 2 266  ? -18.378 -38.355 58.979  1.00 113.13 ? 266  ASN C C     1 
ATOM   5292  O  O     . ASN C 2 266  ? -18.495 -39.293 59.766  1.00 112.70 ? 266  ASN C O     1 
ATOM   5293  C  CB    . ASN C 2 266  ? -16.796 -37.945 57.079  1.00 105.04 ? 266  ASN C CB    1 
ATOM   5294  C  CG    . ASN C 2 266  ? -15.571 -38.712 57.542  1.00 102.04 ? 266  ASN C CG    1 
ATOM   5295  O  OD1   . ASN C 2 266  ? -15.620 -39.451 58.524  1.00 99.74  ? 266  ASN C OD1   1 
ATOM   5296  N  ND2   . ASN C 2 266  ? -14.463 -38.539 56.832  1.00 96.57  ? 266  ASN C ND2   1 
ATOM   5297  N  N     . THR C 2 267  ? -18.486 -37.085 59.357  1.00 120.89 ? 267  THR C N     1 
ATOM   5298  C  CA    . THR C 2 267  ? -18.674 -36.733 60.762  1.00 120.73 ? 267  THR C CA    1 
ATOM   5299  C  C     . THR C 2 267  ? -19.985 -35.988 61.011  1.00 121.88 ? 267  THR C C     1 
ATOM   5300  O  O     . THR C 2 267  ? -20.562 -35.397 60.101  1.00 119.27 ? 267  THR C O     1 
ATOM   5301  C  CB    . THR C 2 267  ? -17.502 -35.872 61.285  1.00 116.48 ? 267  THR C CB    1 
ATOM   5302  O  OG1   . THR C 2 267  ? -17.486 -34.608 60.610  1.00 116.32 ? 267  THR C OG1   1 
ATOM   5303  C  CG2   . THR C 2 267  ? -16.177 -36.580 61.054  1.00 115.71 ? 267  THR C CG2   1 
ATOM   5304  N  N     . VAL C 2 268  ? -20.450 -36.030 62.256  1.00 126.26 ? 268  VAL C N     1 
ATOM   5305  C  CA    . VAL C 2 268  ? -21.641 -35.296 62.668  1.00 124.66 ? 268  VAL C CA    1 
ATOM   5306  C  C     . VAL C 2 268  ? -21.271 -34.388 63.843  1.00 125.89 ? 268  VAL C C     1 
ATOM   5307  O  O     . VAL C 2 268  ? -20.260 -34.610 64.511  1.00 123.88 ? 268  VAL C O     1 
ATOM   5308  C  CB    . VAL C 2 268  ? -22.796 -36.255 63.057  1.00 121.58 ? 268  VAL C CB    1 
ATOM   5309  C  CG1   . VAL C 2 268  ? -22.527 -36.896 64.406  1.00 128.42 ? 268  VAL C CG1   1 
ATOM   5310  C  CG2   . VAL C 2 268  ? -24.138 -35.531 63.065  1.00 115.16 ? 268  VAL C CG2   1 
ATOM   5311  N  N     . GLY C 2 269  ? -22.075 -33.358 64.085  1.00 128.56 ? 269  GLY C N     1 
ATOM   5312  C  CA    . GLY C 2 269  ? -21.804 -32.428 65.165  1.00 125.25 ? 269  GLY C CA    1 
ATOM   5313  C  C     . GLY C 2 269  ? -21.488 -31.042 64.644  1.00 126.82 ? 269  GLY C C     1 
ATOM   5314  O  O     . GLY C 2 269  ? -20.706 -30.885 63.706  1.00 124.49 ? 269  GLY C O     1 
ATOM   5315  N  N     . THR C 2 270  ? -22.100 -30.035 65.259  1.00 132.75 ? 270  THR C N     1 
ATOM   5316  C  CA    . THR C 2 270  ? -21.930 -28.649 64.836  1.00 134.89 ? 270  THR C CA    1 
ATOM   5317  C  C     . THR C 2 270  ? -20.483 -28.199 65.005  1.00 131.67 ? 270  THR C C     1 
ATOM   5318  O  O     . THR C 2 270  ? -19.957 -27.447 64.184  1.00 131.64 ? 270  THR C O     1 
ATOM   5319  C  CB    . THR C 2 270  ? -22.859 -27.702 65.624  1.00 132.41 ? 270  THR C CB    1 
ATOM   5320  O  OG1   . THR C 2 270  ? -24.205 -28.188 65.559  1.00 133.55 ? 270  THR C OG1   1 
ATOM   5321  C  CG2   . THR C 2 270  ? -22.805 -26.292 65.051  1.00 118.63 ? 270  THR C CG2   1 
ATOM   5322  N  N     . ASP C 2 271  ? -19.840 -28.668 66.069  1.00 124.91 ? 271  ASP C N     1 
ATOM   5323  C  CA    . ASP C 2 271  ? -18.434 -28.362 66.296  1.00 123.13 ? 271  ASP C CA    1 
ATOM   5324  C  C     . ASP C 2 271  ? -17.549 -29.042 65.260  1.00 125.55 ? 271  ASP C C     1 
ATOM   5325  O  O     . ASP C 2 271  ? -16.659 -28.417 64.688  1.00 124.62 ? 271  ASP C O     1 
ATOM   5326  C  CB    . ASP C 2 271  ? -18.006 -28.784 67.703  1.00 119.40 ? 271  ASP C CB    1 
ATOM   5327  C  CG    . ASP C 2 271  ? -18.370 -27.758 68.752  1.00 115.70 ? 271  ASP C CG    1 
ATOM   5328  O  OD1   . ASP C 2 271  ? -18.570 -28.144 69.922  1.00 118.80 ? 271  ASP C OD1   1 
ATOM   5329  O  OD2   . ASP C 2 271  ? -18.459 -26.562 68.403  1.00 110.23 ? 271  ASP C OD2   1 
ATOM   5330  N  N     . GLU C 2 272  ? -17.810 -30.320 65.011  1.00 130.42 ? 272  GLU C N     1 
ATOM   5331  C  CA    . GLU C 2 272  ? -16.952 -31.123 64.146  1.00 132.22 ? 272  GLU C CA    1 
ATOM   5332  C  C     . GLU C 2 272  ? -17.054 -30.727 62.673  1.00 128.57 ? 272  GLU C C     1 
ATOM   5333  O  O     . GLU C 2 272  ? -16.146 -31.003 61.888  1.00 121.91 ? 272  GLU C O     1 
ATOM   5334  C  CB    . GLU C 2 272  ? -17.287 -32.606 64.313  1.00 131.71 ? 272  GLU C CB    1 
ATOM   5335  C  CG    . GLU C 2 272  ? -17.353 -33.054 65.766  1.00 133.81 ? 272  GLU C CG    1 
ATOM   5336  C  CD    . GLU C 2 272  ? -16.067 -32.780 66.527  1.00 135.87 ? 272  GLU C CD    1 
ATOM   5337  O  OE1   . GLU C 2 272  ? -14.977 -33.009 65.962  1.00 133.09 ? 272  GLU C OE1   1 
ATOM   5338  O  OE2   . GLU C 2 272  ? -16.148 -32.332 67.691  1.00 137.15 ? 272  GLU C OE2   1 
ATOM   5339  N  N     . ALA C 2 273  ? -18.156 -30.081 62.301  1.00 128.48 ? 273  ALA C N     1 
ATOM   5340  C  CA    . ALA C 2 273  ? -18.347 -29.627 60.926  1.00 125.25 ? 273  ALA C CA    1 
ATOM   5341  C  C     . ALA C 2 273  ? -17.558 -28.349 60.661  1.00 125.61 ? 273  ALA C C     1 
ATOM   5342  O  O     . ALA C 2 273  ? -16.826 -28.254 59.674  1.00 123.96 ? 273  ALA C O     1 
ATOM   5343  C  CB    . ALA C 2 273  ? -19.823 -29.407 60.638  1.00 119.40 ? 273  ALA C CB    1 
ATOM   5344  N  N     . LEU C 2 274  ? -17.719 -27.371 61.549  1.00 124.18 ? 274  LEU C N     1 
ATOM   5345  C  CA    . LEU C 2 274  ? -16.982 -26.114 61.469  1.00 119.12 ? 274  LEU C CA    1 
ATOM   5346  C  C     . LEU C 2 274  ? -15.479 -26.368 61.469  1.00 115.25 ? 274  LEU C C     1 
ATOM   5347  O  O     . LEU C 2 274  ? -14.742 -25.794 60.666  1.00 109.40 ? 274  LEU C O     1 
ATOM   5348  C  CB    . LEU C 2 274  ? -17.358 -25.193 62.632  1.00 111.13 ? 274  LEU C CB    1 
ATOM   5349  C  CG    . LEU C 2 274  ? -18.798 -24.679 62.684  1.00 103.65 ? 274  LEU C CG    1 
ATOM   5350  C  CD1   . LEU C 2 274  ? -19.061 -23.959 63.994  1.00 100.15 ? 274  LEU C CD1   1 
ATOM   5351  C  CD2   . LEU C 2 274  ? -19.078 -23.762 61.511  1.00 103.52 ? 274  LEU C CD2   1 
ATOM   5352  N  N     . LEU C 2 275  ? -15.034 -27.234 62.375  1.00 116.04 ? 275  LEU C N     1 
ATOM   5353  C  CA    . LEU C 2 275  ? -13.629 -27.612 62.449  1.00 117.71 ? 275  LEU C CA    1 
ATOM   5354  C  C     . LEU C 2 275  ? -13.174 -28.250 61.143  1.00 120.86 ? 275  LEU C C     1 
ATOM   5355  O  O     . LEU C 2 275  ? -12.076 -27.977 60.659  1.00 130.58 ? 275  LEU C O     1 
ATOM   5356  C  CB    . LEU C 2 275  ? -13.387 -28.574 63.614  1.00 118.17 ? 275  LEU C CB    1 
ATOM   5357  C  CG    . LEU C 2 275  ? -13.548 -28.002 65.023  1.00 119.15 ? 275  LEU C CG    1 
ATOM   5358  C  CD1   . LEU C 2 275  ? -13.522 -29.116 66.059  1.00 127.81 ? 275  LEU C CD1   1 
ATOM   5359  C  CD2   . LEU C 2 275  ? -12.473 -26.967 65.316  1.00 112.55 ? 275  LEU C CD2   1 
ATOM   5360  N  N     . ASP C 2 276  ? -14.029 -29.095 60.575  1.00 113.65 ? 276  ASP C N     1 
ATOM   5361  C  CA    . ASP C 2 276  ? -13.696 -29.808 59.349  1.00 113.30 ? 276  ASP C CA    1 
ATOM   5362  C  C     . ASP C 2 276  ? -13.476 -28.854 58.184  1.00 112.21 ? 276  ASP C C     1 
ATOM   5363  O  O     . ASP C 2 276  ? -12.495 -28.967 57.449  1.00 111.18 ? 276  ASP C O     1 
ATOM   5364  C  CB    . ASP C 2 276  ? -14.795 -30.805 58.993  1.00 111.33 ? 276  ASP C CB    1 
ATOM   5365  C  CG    . ASP C 2 276  ? -14.494 -31.560 57.719  1.00 116.82 ? 276  ASP C CG    1 
ATOM   5366  O  OD1   . ASP C 2 276  ? -13.305 -31.853 57.474  1.00 116.14 ? 276  ASP C OD1   1 
ATOM   5367  O  OD2   . ASP C 2 276  ? -15.441 -31.853 56.961  1.00 122.41 ? 276  ASP C OD2   1 
ATOM   5368  N  N     . ILE C 2 277  ? -14.402 -27.919 58.021  1.00 110.56 ? 277  ILE C N     1 
ATOM   5369  C  CA    . ILE C 2 277  ? -14.322 -26.938 56.950  1.00 111.55 ? 277  ILE C CA    1 
ATOM   5370  C  C     . ILE C 2 277  ? -13.139 -26.000 57.160  1.00 108.75 ? 277  ILE C C     1 
ATOM   5371  O  O     . ILE C 2 277  ? -12.448 -25.636 56.209  1.00 107.48 ? 277  ILE C O     1 
ATOM   5372  C  CB    . ILE C 2 277  ? -15.621 -26.126 56.855  1.00 116.35 ? 277  ILE C CB    1 
ATOM   5373  C  CG1   . ILE C 2 277  ? -16.804 -27.067 56.624  1.00 120.79 ? 277  ILE C CG1   1 
ATOM   5374  C  CG2   . ILE C 2 277  ? -15.528 -25.087 55.749  1.00 108.22 ? 277  ILE C CG2   1 
ATOM   5375  C  CD1   . ILE C 2 277  ? -18.135 -26.364 56.501  1.00 125.11 ? 277  ILE C CD1   1 
ATOM   5376  N  N     . TYR C 2 278  ? -12.908 -25.622 58.412  1.00 103.41 ? 278  TYR C N     1 
ATOM   5377  C  CA    . TYR C 2 278  ? -11.778 -24.769 58.765  1.00 105.47 ? 278  TYR C CA    1 
ATOM   5378  C  C     . TYR C 2 278  ? -10.463 -25.445 58.380  1.00 103.79 ? 278  TYR C C     1 
ATOM   5379  O  O     . TYR C 2 278  ? -9.537  -24.794 57.898  1.00 99.06  ? 278  TYR C O     1 
ATOM   5380  C  CB    . TYR C 2 278  ? -11.806 -24.447 60.265  1.00 105.50 ? 278  TYR C CB    1 
ATOM   5381  C  CG    . TYR C 2 278  ? -10.755 -23.461 60.744  1.00 105.89 ? 278  TYR C CG    1 
ATOM   5382  C  CD1   . TYR C 2 278  ? -11.066 -22.120 60.935  1.00 98.18  ? 278  TYR C CD1   1 
ATOM   5383  C  CD2   . TYR C 2 278  ? -9.460  -23.876 61.029  1.00 112.09 ? 278  TYR C CD2   1 
ATOM   5384  C  CE1   . TYR C 2 278  ? -10.113 -21.220 61.382  1.00 100.42 ? 278  TYR C CE1   1 
ATOM   5385  C  CE2   . TYR C 2 278  ? -8.501  -22.984 61.474  1.00 108.81 ? 278  TYR C CE2   1 
ATOM   5386  C  CZ    . TYR C 2 278  ? -8.833  -21.658 61.649  1.00 103.40 ? 278  TYR C CZ    1 
ATOM   5387  O  OH    . TYR C 2 278  ? -7.881  -20.771 62.093  1.00 103.80 ? 278  TYR C OH    1 
ATOM   5388  N  N     . ARG C 2 279  ? -10.397 -26.757 58.582  1.00 108.89 ? 279  ARG C N     1 
ATOM   5389  C  CA    . ARG C 2 279  ? -9.179  -27.522 58.329  1.00 110.14 ? 279  ARG C CA    1 
ATOM   5390  C  C     . ARG C 2 279  ? -8.856  -27.662 56.849  1.00 104.95 ? 279  ARG C C     1 
ATOM   5391  O  O     . ARG C 2 279  ? -7.719  -27.955 56.480  1.00 112.25 ? 279  ARG C O     1 
ATOM   5392  C  CB    . ARG C 2 279  ? -9.290  -28.912 58.951  1.00 113.39 ? 279  ARG C CB    1 
ATOM   5393  C  CG    . ARG C 2 279  ? -8.906  -28.964 60.412  1.00 113.00 ? 279  ARG C CG    1 
ATOM   5394  C  CD    . ARG C 2 279  ? -9.189  -30.331 60.991  1.00 112.84 ? 279  ARG C CD    1 
ATOM   5395  N  NE    . ARG C 2 279  ? -10.610 -30.526 61.263  1.00 120.37 ? 279  ARG C NE    1 
ATOM   5396  C  CZ    . ARG C 2 279  ? -11.128 -31.645 61.757  1.00 121.71 ? 279  ARG C CZ    1 
ATOM   5397  N  NH1   . ARG C 2 279  ? -10.340 -32.675 62.029  1.00 122.80 ? 279  ARG C NH1   1 
ATOM   5398  N  NH2   . ARG C 2 279  ? -12.433 -31.734 61.976  1.00 120.78 ? 279  ARG C NH2   1 
ATOM   5399  N  N     . LYS C 2 280  ? -9.857  -27.460 56.004  1.00 91.90  ? 280  LYS C N     1 
ATOM   5400  C  CA    . LYS C 2 280  ? -9.671  -27.637 54.573  1.00 91.00  ? 280  LYS C CA    1 
ATOM   5401  C  C     . LYS C 2 280  ? -9.570  -26.295 53.861  1.00 97.34  ? 280  LYS C C     1 
ATOM   5402  O  O     . LYS C 2 280  ? -9.150  -26.223 52.706  1.00 87.65  ? 280  LYS C O     1 
ATOM   5403  C  CB    . LYS C 2 280  ? -10.816 -28.462 53.994  1.00 90.05  ? 280  LYS C CB    1 
ATOM   5404  C  CG    . LYS C 2 280  ? -10.970 -29.826 54.643  1.00 89.66  ? 280  LYS C CG    1 
ATOM   5405  C  CD    . LYS C 2 280  ? -9.891  -30.790 54.185  1.00 81.94  ? 280  LYS C CD    1 
ATOM   5406  C  CE    . LYS C 2 280  ? -10.179 -32.198 54.674  1.00 70.52  ? 280  LYS C CE    1 
ATOM   5407  N  NZ    . LYS C 2 280  ? -9.239  -33.190 54.092  1.00 57.12  ? 280  LYS C NZ    1 
ATOM   5408  N  N     . LEU C 2 281  ? -9.946  -25.230 54.563  1.00 109.82 ? 281  LEU C N     1 
ATOM   5409  C  CA    . LEU C 2 281  ? -9.923  -23.889 53.992  1.00 111.62 ? 281  LEU C CA    1 
ATOM   5410  C  C     . LEU C 2 281  ? -8.579  -23.208 54.237  1.00 113.57 ? 281  LEU C C     1 
ATOM   5411  O  O     . LEU C 2 281  ? -7.929  -22.739 53.301  1.00 111.05 ? 281  LEU C O     1 
ATOM   5412  C  CB    . LEU C 2 281  ? -11.058 -23.044 54.572  1.00 101.03 ? 281  LEU C CB    1 
ATOM   5413  C  CG    . LEU C 2 281  ? -11.692 -21.987 53.665  1.00 96.65  ? 281  LEU C CG    1 
ATOM   5414  C  CD1   . LEU C 2 281  ? -12.980 -21.489 54.288  1.00 93.61  ? 281  LEU C CD1   1 
ATOM   5415  C  CD2   . LEU C 2 281  ? -10.748 -20.823 53.397  1.00 104.98 ? 281  LEU C CD2   1 
ATOM   5416  N  N     . ARG C 2 282  ? -8.170  -23.147 55.501  1.00 108.92 ? 282  ARG C N     1 
ATOM   5417  C  CA    . ARG C 2 282  ? -6.908  -22.511 55.855  1.00 106.61 ? 282  ARG C CA    1 
ATOM   5418  C  C     . ARG C 2 282  ? -6.054  -23.399 56.752  1.00 107.33 ? 282  ARG C C     1 
ATOM   5419  O  O     . ARG C 2 282  ? -6.142  -23.320 57.978  1.00 103.00 ? 282  ARG C O     1 
ATOM   5420  C  CB    . ARG C 2 282  ? -7.163  -21.172 56.545  1.00 105.50 ? 282  ARG C CB    1 
ATOM   5421  C  CG    . ARG C 2 282  ? -7.803  -20.132 55.651  1.00 100.56 ? 282  ARG C CG    1 
ATOM   5422  C  CD    . ARG C 2 282  ? -8.044  -18.844 56.410  1.00 99.48  ? 282  ARG C CD    1 
ATOM   5423  N  NE    . ARG C 2 282  ? -8.768  -17.868 55.603  1.00 102.03 ? 282  ARG C NE    1 
ATOM   5424  C  CZ    . ARG C 2 282  ? -8.358  -16.622 55.392  1.00 95.26  ? 282  ARG C CZ    1 
ATOM   5425  N  NH1   . ARG C 2 282  ? -7.224  -16.198 55.931  1.00 90.27  ? 282  ARG C NH1   1 
ATOM   5426  N  NH2   . ARG C 2 282  ? -9.083  -15.802 54.644  1.00 89.73  ? 282  ARG C NH2   1 
ATOM   5427  N  N     . PRO C 2 283  ? -5.227  -24.257 56.138  1.00 116.47 ? 283  PRO C N     1 
ATOM   5428  C  CA    . PRO C 2 283  ? -4.259  -25.067 56.882  1.00 118.40 ? 283  PRO C CA    1 
ATOM   5429  C  C     . PRO C 2 283  ? -3.058  -24.232 57.311  1.00 113.14 ? 283  PRO C C     1 
ATOM   5430  O  O     . PRO C 2 283  ? -2.620  -23.359 56.561  1.00 105.07 ? 283  PRO C O     1 
ATOM   5431  C  CB    . PRO C 2 283  ? -3.843  -26.146 55.872  1.00 121.16 ? 283  PRO C CB    1 
ATOM   5432  C  CG    . PRO C 2 283  ? -4.848  -26.061 54.752  1.00 120.73 ? 283  PRO C CG    1 
ATOM   5433  C  CD    . PRO C 2 283  ? -5.266  -24.630 54.716  1.00 116.53 ? 283  PRO C CD    1 
ATOM   5434  N  N     . GLY C 2 284  ? -2.534  -24.499 58.501  1.00 113.25 ? 284  GLY C N     1 
ATOM   5435  C  CA    . GLY C 2 284  ? -1.396  -23.760 59.014  1.00 109.31 ? 284  GLY C CA    1 
ATOM   5436  C  C     . GLY C 2 284  ? -1.796  -22.879 60.176  1.00 112.56 ? 284  GLY C C     1 
ATOM   5437  O  O     . GLY C 2 284  ? -0.969  -22.180 60.761  1.00 110.41 ? 284  GLY C O     1 
ATOM   5438  N  N     . GLU C 2 285  ? -3.079  -22.917 60.511  1.00 111.22 ? 285  GLU C N     1 
ATOM   5439  C  CA    . GLU C 2 285  ? -3.615  -22.053 61.549  1.00 113.34 ? 285  GLU C CA    1 
ATOM   5440  C  C     . GLU C 2 285  ? -4.378  -22.863 62.594  1.00 108.27 ? 285  GLU C C     1 
ATOM   5441  O  O     . GLU C 2 285  ? -5.137  -23.770 62.251  1.00 107.39 ? 285  GLU C O     1 
ATOM   5442  C  CB    . GLU C 2 285  ? -4.515  -20.984 60.923  1.00 115.61 ? 285  GLU C CB    1 
ATOM   5443  C  CG    . GLU C 2 285  ? -3.829  -20.199 59.809  1.00 105.53 ? 285  GLU C CG    1 
ATOM   5444  C  CD    . GLU C 2 285  ? -4.807  -19.488 58.898  1.00 97.30  ? 285  GLU C CD    1 
ATOM   5445  O  OE1   . GLU C 2 285  ? -5.995  -19.382 59.265  1.00 101.35 ? 285  GLU C OE1   1 
ATOM   5446  O  OE2   . GLU C 2 285  ? -4.389  -19.040 57.810  1.00 89.22  ? 285  GLU C OE2   1 
ATOM   5447  N  N     . PRO C 2 286  ? -4.157  -22.547 63.878  1.00 103.95 ? 286  PRO C N     1 
ATOM   5448  C  CA    . PRO C 2 286  ? -4.824  -23.214 65.001  1.00 104.41 ? 286  PRO C CA    1 
ATOM   5449  C  C     . PRO C 2 286  ? -6.342  -23.062 64.946  1.00 110.11 ? 286  PRO C C     1 
ATOM   5450  O  O     . PRO C 2 286  ? -6.847  -21.943 64.870  1.00 104.74 ? 286  PRO C O     1 
ATOM   5451  C  CB    . PRO C 2 286  ? -4.242  -22.507 66.230  1.00 107.47 ? 286  PRO C CB    1 
ATOM   5452  C  CG    . PRO C 2 286  ? -3.678  -21.224 65.715  1.00 113.24 ? 286  PRO C CG    1 
ATOM   5453  C  CD    . PRO C 2 286  ? -3.206  -21.520 64.333  1.00 105.40 ? 286  PRO C CD    1 
ATOM   5454  N  N     . PRO C 2 287  ? -7.064  -24.191 64.979  1.00 120.67 ? 287  PRO C N     1 
ATOM   5455  C  CA    . PRO C 2 287  ? -8.524  -24.241 64.854  1.00 120.82 ? 287  PRO C CA    1 
ATOM   5456  C  C     . PRO C 2 287  ? -9.277  -24.069 66.176  1.00 119.64 ? 287  PRO C C     1 
ATOM   5457  O  O     . PRO C 2 287  ? -9.501  -25.047 66.890  1.00 121.71 ? 287  PRO C O     1 
ATOM   5458  C  CB    . PRO C 2 287  ? -8.767  -25.638 64.276  1.00 122.42 ? 287  PRO C CB    1 
ATOM   5459  C  CG    . PRO C 2 287  ? -7.649  -26.460 64.836  1.00 120.71 ? 287  PRO C CG    1 
ATOM   5460  C  CD    . PRO C 2 287  ? -6.466  -25.539 65.003  1.00 118.93 ? 287  PRO C CD    1 
ATOM   5461  N  N     . THR C 2 288  ? -9.662  -22.837 66.494  1.00 110.07 ? 288  THR C N     1 
ATOM   5462  C  CA    . THR C 2 288  ? -10.522 -22.581 67.646  1.00 111.00 ? 288  THR C CA    1 
ATOM   5463  C  C     . THR C 2 288  ? -11.973 -22.815 67.232  1.00 114.06 ? 288  THR C C     1 
ATOM   5464  O  O     . THR C 2 288  ? -12.309 -22.686 66.056  1.00 117.97 ? 288  THR C O     1 
ATOM   5465  C  CB    . THR C 2 288  ? -10.353 -21.139 68.186  1.00 105.67 ? 288  THR C CB    1 
ATOM   5466  O  OG1   . THR C 2 288  ? -8.962  -20.804 68.249  1.00 105.41 ? 288  THR C OG1   1 
ATOM   5467  C  CG2   . THR C 2 288  ? -10.968 -20.996 69.575  1.00 104.90 ? 288  THR C CG2   1 
ATOM   5468  N  N     . LYS C 2 289  ? -12.830 -23.170 68.186  1.00 114.65 ? 289  LYS C N     1 
ATOM   5469  C  CA    . LYS C 2 289  ? -14.255 -23.301 67.903  1.00 108.91 ? 289  LYS C CA    1 
ATOM   5470  C  C     . LYS C 2 289  ? -14.854 -21.920 67.651  1.00 103.74 ? 289  LYS C C     1 
ATOM   5471  O  O     . LYS C 2 289  ? -15.955 -21.795 67.118  1.00 105.80 ? 289  LYS C O     1 
ATOM   5472  C  CB    . LYS C 2 289  ? -14.989 -24.000 69.054  1.00 111.59 ? 289  LYS C CB    1 
ATOM   5473  C  CG    . LYS C 2 289  ? -14.459 -25.384 69.408  1.00 104.97 ? 289  LYS C CG    1 
ATOM   5474  C  CD    . LYS C 2 289  ? -15.431 -26.128 70.313  1.00 103.69 ? 289  LYS C CD    1 
ATOM   5475  C  CE    . LYS C 2 289  ? -14.801 -27.375 70.909  1.00 98.13  ? 289  LYS C CE    1 
ATOM   5476  N  NZ    . LYS C 2 289  ? -13.684 -27.035 71.831  1.00 98.54  ? 289  LYS C NZ    1 
ATOM   5477  N  N     . GLU C 2 290  ? -14.112 -20.888 68.041  1.00 99.98  ? 290  GLU C N     1 
ATOM   5478  C  CA    . GLU C 2 290  ? -14.530 -19.507 67.845  1.00 104.51 ? 290  GLU C CA    1 
ATOM   5479  C  C     . GLU C 2 290  ? -13.881 -18.883 66.613  1.00 110.92 ? 290  GLU C C     1 
ATOM   5480  O  O     . GLU C 2 290  ? -14.249 -17.781 66.198  1.00 110.62 ? 290  GLU C O     1 
ATOM   5481  C  CB    . GLU C 2 290  ? -14.203 -18.675 69.084  1.00 103.01 ? 290  GLU C CB    1 
ATOM   5482  C  CG    . GLU C 2 290  ? -15.106 -18.976 70.257  1.00 105.30 ? 290  GLU C CG    1 
ATOM   5483  C  CD    . GLU C 2 290  ? -16.564 -18.774 69.908  1.00 103.04 ? 290  GLU C CD    1 
ATOM   5484  O  OE1   . GLU C 2 290  ? -16.915 -17.665 69.454  1.00 98.31  ? 290  GLU C OE1   1 
ATOM   5485  O  OE2   . GLU C 2 290  ? -17.354 -19.727 70.074  1.00 106.28 ? 290  GLU C OE2   1 
ATOM   5486  N  N     . SER C 2 291  ? -12.915 -19.589 66.032  1.00 115.24 ? 291  SER C N     1 
ATOM   5487  C  CA    . SER C 2 291  ? -12.218 -19.101 64.845  1.00 112.59 ? 291  SER C CA    1 
ATOM   5488  C  C     . SER C 2 291  ? -12.767 -19.741 63.571  1.00 111.09 ? 291  SER C C     1 
ATOM   5489  O  O     . SER C 2 291  ? -12.495 -19.275 62.466  1.00 108.46 ? 291  SER C O     1 
ATOM   5490  C  CB    . SER C 2 291  ? -10.713 -19.363 64.958  1.00 111.38 ? 291  SER C CB    1 
ATOM   5491  O  OG    . SER C 2 291  ? -10.429 -20.753 64.948  1.00 116.05 ? 291  SER C OG    1 
ATOM   5492  N  N     . ALA C 2 292  ? -13.535 -20.814 63.730  1.00 114.45 ? 292  ALA C N     1 
ATOM   5493  C  CA    . ALA C 2 292  ? -14.177 -21.467 62.595  1.00 110.35 ? 292  ALA C CA    1 
ATOM   5494  C  C     . ALA C 2 292  ? -15.622 -21.004 62.469  1.00 111.63 ? 292  ALA C C     1 
ATOM   5495  O  O     . ALA C 2 292  ? -16.235 -21.121 61.410  1.00 115.17 ? 292  ALA C O     1 
ATOM   5496  C  CB    . ALA C 2 292  ? -14.110 -22.977 62.736  1.00 117.35 ? 292  ALA C CB    1 
ATOM   5497  N  N     . GLN C 2 293  ? -16.160 -20.482 63.566  1.00 111.61 ? 293  GLN C N     1 
ATOM   5498  C  CA    . GLN C 2 293  ? -17.499 -19.907 63.571  1.00 114.28 ? 293  GLN C CA    1 
ATOM   5499  C  C     . GLN C 2 293  ? -17.458 -18.507 62.975  1.00 109.92 ? 293  GLN C C     1 
ATOM   5500  O  O     . GLN C 2 293  ? -18.439 -18.026 62.407  1.00 111.62 ? 293  GLN C O     1 
ATOM   5501  C  CB    . GLN C 2 293  ? -18.063 -19.863 64.996  1.00 113.71 ? 293  GLN C CB    1 
ATOM   5502  C  CG    . GLN C 2 293  ? -19.444 -19.231 65.117  1.00 105.95 ? 293  GLN C CG    1 
ATOM   5503  C  CD    . GLN C 2 293  ? -20.565 -20.225 64.886  1.00 107.57 ? 293  GLN C CD    1 
ATOM   5504  O  OE1   . GLN C 2 293  ? -20.526 -21.347 65.388  1.00 109.60 ? 293  GLN C OE1   1 
ATOM   5505  N  NE2   . GLN C 2 293  ? -21.571 -19.815 64.123  1.00 111.59 ? 293  GLN C NE2   1 
ATOM   5506  N  N     . THR C 2 294  ? -16.302 -17.867 63.099  1.00 101.53 ? 294  THR C N     1 
ATOM   5507  C  CA    . THR C 2 294  ? -16.149 -16.468 62.725  1.00 102.75 ? 294  THR C CA    1 
ATOM   5508  C  C     . THR C 2 294  ? -16.038 -16.257 61.212  1.00 104.76 ? 294  THR C C     1 
ATOM   5509  O  O     . THR C 2 294  ? -16.742 -15.419 60.646  1.00 103.57 ? 294  THR C O     1 
ATOM   5510  C  CB    . THR C 2 294  ? -14.914 -15.855 63.413  1.00 97.93  ? 294  THR C CB    1 
ATOM   5511  O  OG1   . THR C 2 294  ? -15.012 -16.052 64.829  1.00 95.37  ? 294  THR C OG1   1 
ATOM   5512  C  CG2   . THR C 2 294  ? -14.814 -14.367 63.118  1.00 99.57  ? 294  THR C CG2   1 
ATOM   5513  N  N     . LEU C 2 295  ? -15.164 -17.018 60.558  1.00 106.33 ? 295  LEU C N     1 
ATOM   5514  C  CA    . LEU C 2 295  ? -14.882 -16.787 59.142  1.00 102.82 ? 295  LEU C CA    1 
ATOM   5515  C  C     . LEU C 2 295  ? -16.019 -17.256 58.238  1.00 95.60  ? 295  LEU C C     1 
ATOM   5516  O  O     . LEU C 2 295  ? -16.258 -16.665 57.183  1.00 94.70  ? 295  LEU C O     1 
ATOM   5517  C  CB    . LEU C 2 295  ? -13.565 -17.461 58.734  1.00 97.92  ? 295  LEU C CB    1 
ATOM   5518  C  CG    . LEU C 2 295  ? -13.390 -18.982 58.770  1.00 91.34  ? 295  LEU C CG    1 
ATOM   5519  C  CD1   . LEU C 2 295  ? -13.804 -19.624 57.455  1.00 88.37  ? 295  LEU C CD1   1 
ATOM   5520  C  CD2   . LEU C 2 295  ? -11.946 -19.311 59.085  1.00 96.09  ? 295  LEU C CD2   1 
ATOM   5521  N  N     . LEU C 2 296  ? -16.718 -18.312 58.645  1.00 88.89  ? 296  LEU C N     1 
ATOM   5522  C  CA    . LEU C 2 296  ? -17.872 -18.777 57.886  1.00 87.91  ? 296  LEU C CA    1 
ATOM   5523  C  C     . LEU C 2 296  ? -18.926 -17.674 57.810  1.00 85.25  ? 296  LEU C C     1 
ATOM   5524  O  O     . LEU C 2 296  ? -19.626 -17.544 56.806  1.00 80.22  ? 296  LEU C O     1 
ATOM   5525  C  CB    . LEU C 2 296  ? -18.461 -20.051 58.499  1.00 90.64  ? 296  LEU C CB    1 
ATOM   5526  C  CG    . LEU C 2 296  ? -18.022 -21.365 57.841  1.00 87.04  ? 296  LEU C CG    1 
ATOM   5527  C  CD1   . LEU C 2 296  ? -16.612 -21.763 58.256  1.00 90.06  ? 296  LEU C CD1   1 
ATOM   5528  C  CD2   . LEU C 2 296  ? -19.007 -22.488 58.127  1.00 92.90  ? 296  LEU C CD2   1 
ATOM   5529  N  N     . GLU C 2 297  ? -19.028 -16.871 58.866  1.00 83.54  ? 297  GLU C N     1 
ATOM   5530  C  CA    . GLU C 2 297  ? -19.873 -15.685 58.828  1.00 82.14  ? 297  GLU C CA    1 
ATOM   5531  C  C     . GLU C 2 297  ? -19.287 -14.665 57.857  1.00 80.46  ? 297  GLU C C     1 
ATOM   5532  O  O     . GLU C 2 297  ? -19.991 -14.122 57.008  1.00 80.80  ? 297  GLU C O     1 
ATOM   5533  C  CB    . GLU C 2 297  ? -20.015 -15.056 60.219  1.00 79.41  ? 297  GLU C CB    1 
ATOM   5534  C  CG    . GLU C 2 297  ? -20.720 -15.914 61.261  1.00 81.01  ? 297  GLU C CG    1 
ATOM   5535  C  CD    . GLU C 2 297  ? -20.914 -15.177 62.577  1.00 79.97  ? 297  GLU C CD    1 
ATOM   5536  O  OE1   . GLU C 2 297  ? -20.865 -13.930 62.570  1.00 79.57  ? 297  GLU C OE1   1 
ATOM   5537  O  OE2   . GLU C 2 297  ? -21.111 -15.840 63.618  1.00 80.37  ? 297  GLU C OE2   1 
ATOM   5538  N  N     . ASN C 2 298  ? -17.987 -14.420 57.984  1.00 78.79  ? 298  ASN C N     1 
ATOM   5539  C  CA    . ASN C 2 298  ? -17.319 -13.374 57.217  1.00 79.29  ? 298  ASN C CA    1 
ATOM   5540  C  C     . ASN C 2 298  ? -17.189 -13.667 55.726  1.00 74.25  ? 298  ASN C C     1 
ATOM   5541  O  O     . ASN C 2 298  ? -17.269 -12.754 54.906  1.00 81.36  ? 298  ASN C O     1 
ATOM   5542  C  CB    . ASN C 2 298  ? -15.927 -13.106 57.796  1.00 82.43  ? 298  ASN C CB    1 
ATOM   5543  C  CG    . ASN C 2 298  ? -15.971 -12.256 59.050  1.00 82.20  ? 298  ASN C CG    1 
ATOM   5544  O  OD1   . ASN C 2 298  ? -16.869 -11.433 59.224  1.00 81.64  ? 298  ASN C OD1   1 
ATOM   5545  N  ND2   . ASN C 2 298  ? -14.995 -12.449 59.930  1.00 79.00  ? 298  ASN C ND2   1 
ATOM   5546  N  N     . LEU C 2 299  ? -16.988 -14.931 55.370  1.00 65.16  ? 299  LEU C N     1 
ATOM   5547  C  CA    . LEU C 2 299  ? -16.715 -15.277 53.979  1.00 61.07  ? 299  LEU C CA    1 
ATOM   5548  C  C     . LEU C 2 299  ? -17.925 -15.173 53.059  1.00 67.56  ? 299  LEU C C     1 
ATOM   5549  O  O     . LEU C 2 299  ? -17.769 -15.152 51.839  1.00 70.49  ? 299  LEU C O     1 
ATOM   5550  C  CB    . LEU C 2 299  ? -16.141 -16.691 53.883  1.00 66.90  ? 299  LEU C CB    1 
ATOM   5551  C  CG    . LEU C 2 299  ? -14.632 -16.832 54.082  1.00 74.82  ? 299  LEU C CG    1 
ATOM   5552  C  CD1   . LEU C 2 299  ? -14.139 -18.151 53.510  1.00 73.04  ? 299  LEU C CD1   1 
ATOM   5553  C  CD2   . LEU C 2 299  ? -13.899 -15.663 53.449  1.00 82.71  ? 299  LEU C CD2   1 
ATOM   5554  N  N     . PHE C 2 300  ? -19.127 -15.117 53.624  1.00 73.52  ? 300  PHE C N     1 
ATOM   5555  C  CA    . PHE C 2 300  ? -20.329 -15.145 52.791  1.00 72.09  ? 300  PHE C CA    1 
ATOM   5556  C  C     . PHE C 2 300  ? -21.511 -14.329 53.319  1.00 70.35  ? 300  PHE C C     1 
ATOM   5557  O  O     . PHE C 2 300  ? -22.554 -14.279 52.671  1.00 68.03  ? 300  PHE C O     1 
ATOM   5558  C  CB    . PHE C 2 300  ? -20.796 -16.594 52.589  1.00 75.44  ? 300  PHE C CB    1 
ATOM   5559  C  CG    . PHE C 2 300  ? -19.799 -17.476 51.881  1.00 79.43  ? 300  PHE C CG    1 
ATOM   5560  C  CD1   . PHE C 2 300  ? -19.727 -17.496 50.498  1.00 78.83  ? 300  PHE C CD1   1 
ATOM   5561  C  CD2   . PHE C 2 300  ? -18.953 -18.308 52.602  1.00 78.63  ? 300  PHE C CD2   1 
ATOM   5562  C  CE1   . PHE C 2 300  ? -18.819 -18.316 49.848  1.00 81.10  ? 300  PHE C CE1   1 
ATOM   5563  C  CE2   . PHE C 2 300  ? -18.041 -19.128 51.958  1.00 69.56  ? 300  PHE C CE2   1 
ATOM   5564  C  CZ    . PHE C 2 300  ? -17.976 -19.133 50.580  1.00 75.68  ? 300  PHE C CZ    1 
ATOM   5565  N  N     . PHE C 2 301  ? -21.372 -13.699 54.482  1.00 73.91  ? 301  PHE C N     1 
ATOM   5566  C  CA    . PHE C 2 301  ? -22.527 -13.038 55.092  1.00 76.42  ? 301  PHE C CA    1 
ATOM   5567  C  C     . PHE C 2 301  ? -22.246 -11.647 55.661  1.00 73.49  ? 301  PHE C C     1 
ATOM   5568  O  O     . PHE C 2 301  ? -23.094 -11.064 56.339  1.00 64.18  ? 301  PHE C O     1 
ATOM   5569  C  CB    . PHE C 2 301  ? -23.110 -13.931 56.188  1.00 81.12  ? 301  PHE C CB    1 
ATOM   5570  C  CG    . PHE C 2 301  ? -23.497 -15.298 55.703  1.00 85.18  ? 301  PHE C CG    1 
ATOM   5571  C  CD1   . PHE C 2 301  ? -24.699 -15.499 55.043  1.00 83.60  ? 301  PHE C CD1   1 
ATOM   5572  C  CD2   . PHE C 2 301  ? -22.655 -16.380 55.895  1.00 86.87  ? 301  PHE C CD2   1 
ATOM   5573  C  CE1   . PHE C 2 301  ? -25.055 -16.754 54.589  1.00 81.07  ? 301  PHE C CE1   1 
ATOM   5574  C  CE2   . PHE C 2 301  ? -23.007 -17.639 55.444  1.00 90.35  ? 301  PHE C CE2   1 
ATOM   5575  C  CZ    . PHE C 2 301  ? -24.210 -17.825 54.790  1.00 86.26  ? 301  PHE C CZ    1 
ATOM   5576  N  N     . LYS C 2 302  ? -21.068 -11.110 55.369  1.00 81.06  ? 302  LYS C N     1 
ATOM   5577  C  CA    . LYS C 2 302  ? -20.719 -9.765  55.813  1.00 86.23  ? 302  LYS C CA    1 
ATOM   5578  C  C     . LYS C 2 302  ? -20.514 -8.824  54.634  1.00 83.94  ? 302  LYS C C     1 
ATOM   5579  O  O     . LYS C 2 302  ? -19.986 -9.223  53.595  1.00 81.74  ? 302  LYS C O     1 
ATOM   5580  C  CB    . LYS C 2 302  ? -19.461 -9.791  56.684  1.00 85.48  ? 302  LYS C CB    1 
ATOM   5581  C  CG    . LYS C 2 302  ? -19.729 -10.043 58.158  1.00 83.70  ? 302  LYS C CG    1 
ATOM   5582  C  CD    . LYS C 2 302  ? -20.513 -8.896  58.778  1.00 79.78  ? 302  LYS C CD    1 
ATOM   5583  C  CE    . LYS C 2 302  ? -19.749 -7.585  58.678  1.00 70.17  ? 302  LYS C CE    1 
ATOM   5584  N  NZ    . LYS C 2 302  ? -20.497 -6.460  59.302  1.00 63.85  ? 302  LYS C NZ    1 
ATOM   5585  N  N     . GLU C 2 303  ? -20.926 -7.572  54.807  1.00 81.16  ? 303  GLU C N     1 
ATOM   5586  C  CA    . GLU C 2 303  ? -20.780 -6.556  53.771  1.00 80.31  ? 303  GLU C CA    1 
ATOM   5587  C  C     . GLU C 2 303  ? -19.318 -6.271  53.444  1.00 81.35  ? 303  GLU C C     1 
ATOM   5588  O  O     . GLU C 2 303  ? -18.999 -5.762  52.371  1.00 82.51  ? 303  GLU C O     1 
ATOM   5589  C  CB    . GLU C 2 303  ? -21.467 -5.258  54.196  1.00 82.82  ? 303  GLU C CB    1 
ATOM   5590  C  CG    . GLU C 2 303  ? -22.972 -5.364  54.341  1.00 86.83  ? 303  GLU C CG    1 
ATOM   5591  C  CD    . GLU C 2 303  ? -23.620 -4.024  54.640  1.00 98.53  ? 303  GLU C CD    1 
ATOM   5592  O  OE1   . GLU C 2 303  ? -22.897 -3.089  55.045  1.00 92.92  ? 303  GLU C OE1   1 
ATOM   5593  O  OE2   . GLU C 2 303  ? -24.850 -3.904  54.462  1.00 100.49 ? 303  GLU C OE2   1 
ATOM   5594  N  N     . LYS C 2 304  ? -18.430 -6.605  54.372  1.00 82.03  ? 304  LYS C N     1 
ATOM   5595  C  CA    . LYS C 2 304  ? -17.020 -6.274  54.228  1.00 80.95  ? 304  LYS C CA    1 
ATOM   5596  C  C     . LYS C 2 304  ? -16.277 -7.192  53.258  1.00 81.28  ? 304  LYS C C     1 
ATOM   5597  O  O     . LYS C 2 304  ? -15.491 -6.724  52.434  1.00 80.09  ? 304  LYS C O     1 
ATOM   5598  C  CB    . LYS C 2 304  ? -16.340 -6.315  55.589  1.00 84.17  ? 304  LYS C CB    1 
ATOM   5599  C  CG    . LYS C 2 304  ? -17.042 -5.478  56.635  1.00 82.80  ? 304  LYS C CG    1 
ATOM   5600  C  CD    . LYS C 2 304  ? -16.338 -5.596  57.966  1.00 90.03  ? 304  LYS C CD    1 
ATOM   5601  C  CE    . LYS C 2 304  ? -17.044 -4.796  59.041  1.00 83.79  ? 304  LYS C CE    1 
ATOM   5602  N  NZ    . LYS C 2 304  ? -16.324 -4.906  60.338  1.00 68.03  ? 304  LYS C NZ    1 
ATOM   5603  N  N     . ARG C 2 305  ? -16.522 -8.496  53.357  1.00 80.65  ? 305  ARG C N     1 
ATOM   5604  C  CA    . ARG C 2 305  ? -15.764 -9.472  52.577  1.00 77.99  ? 305  ARG C CA    1 
ATOM   5605  C  C     . ARG C 2 305  ? -16.569 -10.057 51.425  1.00 75.20  ? 305  ARG C C     1 
ATOM   5606  O  O     . ARG C 2 305  ? -16.000 -10.586 50.471  1.00 75.87  ? 305  ARG C O     1 
ATOM   5607  C  CB    . ARG C 2 305  ? -15.271 -10.601 53.483  1.00 79.55  ? 305  ARG C CB    1 
ATOM   5608  C  CG    . ARG C 2 305  ? -14.321 -10.149 54.576  1.00 83.16  ? 305  ARG C CG    1 
ATOM   5609  C  CD    . ARG C 2 305  ? -12.869 -10.298 54.153  1.00 77.25  ? 305  ARG C CD    1 
ATOM   5610  N  NE    . ARG C 2 305  ? -12.432 -11.691 54.186  1.00 84.55  ? 305  ARG C NE    1 
ATOM   5611  C  CZ    . ARG C 2 305  ? -11.186 -12.089 53.949  1.00 88.45  ? 305  ARG C CZ    1 
ATOM   5612  N  NH1   . ARG C 2 305  ? -10.248 -11.197 53.660  1.00 87.18  ? 305  ARG C NH1   1 
ATOM   5613  N  NH2   . ARG C 2 305  ? -10.875 -13.377 54.004  1.00 89.30  ? 305  ARG C NH2   1 
ATOM   5614  N  N     . TYR C 2 306  ? -17.891 -9.971  51.522  1.00 72.88  ? 306  TYR C N     1 
ATOM   5615  C  CA    . TYR C 2 306  ? -18.767 -10.489 50.477  1.00 77.30  ? 306  TYR C CA    1 
ATOM   5616  C  C     . TYR C 2 306  ? -19.768 -9.423  50.062  1.00 76.96  ? 306  TYR C C     1 
ATOM   5617  O  O     . TYR C 2 306  ? -20.157 -8.587  50.877  1.00 81.31  ? 306  TYR C O     1 
ATOM   5618  C  CB    . TYR C 2 306  ? -19.497 -11.747 50.953  1.00 78.98  ? 306  TYR C CB    1 
ATOM   5619  C  CG    . TYR C 2 306  ? -19.895 -12.685 49.836  1.00 77.95  ? 306  TYR C CG    1 
ATOM   5620  C  CD1   . TYR C 2 306  ? -21.164 -12.634 49.275  1.00 80.14  ? 306  TYR C CD1   1 
ATOM   5621  C  CD2   . TYR C 2 306  ? -18.998 -13.624 49.342  1.00 77.13  ? 306  TYR C CD2   1 
ATOM   5622  C  CE1   . TYR C 2 306  ? -21.527 -13.496 48.251  1.00 83.34  ? 306  TYR C CE1   1 
ATOM   5623  C  CE2   . TYR C 2 306  ? -19.351 -14.487 48.323  1.00 71.12  ? 306  TYR C CE2   1 
ATOM   5624  C  CZ    . TYR C 2 306  ? -20.614 -14.421 47.780  1.00 71.89  ? 306  TYR C CZ    1 
ATOM   5625  O  OH    . TYR C 2 306  ? -20.958 -15.284 46.763  1.00 60.12  ? 306  TYR C OH    1 
ATOM   5626  N  N     . ASP C 2 307  ? -20.186 -9.452  48.799  1.00 70.85  ? 307  ASP C N     1 
ATOM   5627  C  CA    . ASP C 2 307  ? -21.147 -8.467  48.314  1.00 67.85  ? 307  ASP C CA    1 
ATOM   5628  C  C     . ASP C 2 307  ? -21.763 -8.828  46.966  1.00 61.27  ? 307  ASP C C     1 
ATOM   5629  O  O     . ASP C 2 307  ? -21.096 -8.796  45.932  1.00 59.88  ? 307  ASP C O     1 
ATOM   5630  C  CB    . ASP C 2 307  ? -20.487 -7.088  48.214  1.00 68.19  ? 307  ASP C CB    1 
ATOM   5631  C  CG    . ASP C 2 307  ? -21.471 -5.997  47.845  1.00 62.20  ? 307  ASP C CG    1 
ATOM   5632  O  OD1   . ASP C 2 307  ? -22.542 -5.914  48.483  1.00 59.68  ? 307  ASP C OD1   1 
ATOM   5633  O  OD2   . ASP C 2 307  ? -21.173 -5.225  46.911  1.00 62.35  ? 307  ASP C OD2   1 
ATOM   5634  N  N     . LEU C 2 308  ? -23.044 -9.177  46.994  1.00 63.02  ? 308  LEU C N     1 
ATOM   5635  C  CA    . LEU C 2 308  ? -23.853 -9.246  45.787  1.00 59.72  ? 308  LEU C CA    1 
ATOM   5636  C  C     . LEU C 2 308  ? -24.344 -7.838  45.503  1.00 58.97  ? 308  LEU C C     1 
ATOM   5637  O  O     . LEU C 2 308  ? -24.911 -7.202  46.385  1.00 71.11  ? 308  LEU C O     1 
ATOM   5638  C  CB    . LEU C 2 308  ? -25.039 -10.201 45.965  1.00 62.50  ? 308  LEU C CB    1 
ATOM   5639  C  CG    . LEU C 2 308  ? -24.759 -11.639 46.405  1.00 63.11  ? 308  LEU C CG    1 
ATOM   5640  C  CD1   . LEU C 2 308  ? -26.052 -12.425 46.577  1.00 55.96  ? 308  LEU C CD1   1 
ATOM   5641  C  CD2   . LEU C 2 308  ? -23.856 -12.320 45.398  1.00 72.50  ? 308  LEU C CD2   1 
ATOM   5642  N  N     . ALA C 2 309  ? -24.134 -7.333  44.293  1.00 56.22  ? 309  ALA C N     1 
ATOM   5643  C  CA    . ALA C 2 309  ? -24.621 -5.994  43.980  1.00 63.32  ? 309  ALA C CA    1 
ATOM   5644  C  C     . ALA C 2 309  ? -26.146 -5.990  43.970  1.00 62.65  ? 309  ALA C C     1 
ATOM   5645  O  O     . ALA C 2 309  ? -26.773 -7.023  44.212  1.00 60.86  ? 309  ALA C O     1 
ATOM   5646  C  CB    . ALA C 2 309  ? -24.073 -5.514  42.648  1.00 70.57  ? 309  ALA C CB    1 
ATOM   5647  N  N     . ARG C 2 310  ? -26.738 -4.826  43.713  1.00 62.82  ? 310  ARG C N     1 
ATOM   5648  C  CA    . ARG C 2 310  ? -28.184 -4.739  43.528  1.00 69.82  ? 310  ARG C CA    1 
ATOM   5649  C  C     . ARG C 2 310  ? -28.618 -5.768  42.495  1.00 72.11  ? 310  ARG C C     1 
ATOM   5650  O  O     . ARG C 2 310  ? -29.550 -6.542  42.723  1.00 70.49  ? 310  ARG C O     1 
ATOM   5651  C  CB    . ARG C 2 310  ? -28.610 -3.337  43.088  1.00 63.66  ? 310  ARG C CB    1 
ATOM   5652  C  CG    . ARG C 2 310  ? -28.806 -2.359  44.234  1.00 70.46  ? 310  ARG C CG    1 
ATOM   5653  C  CD    . ARG C 2 310  ? -29.330 -1.019  43.730  1.00 69.76  ? 310  ARG C CD    1 
ATOM   5654  N  NE    . ARG C 2 310  ? -29.030 0.071   44.655  1.00 74.42  ? 310  ARG C NE    1 
ATOM   5655  C  CZ    . ARG C 2 310  ? -27.818 0.591   44.817  1.00 63.29  ? 310  ARG C CZ    1 
ATOM   5656  N  NH1   . ARG C 2 310  ? -26.799 0.108   44.123  1.00 53.21  ? 310  ARG C NH1   1 
ATOM   5657  N  NH2   . ARG C 2 310  ? -27.621 1.583   45.675  1.00 65.55  ? 310  ARG C NH2   1 
ATOM   5658  N  N     . VAL C 2 311  ? -27.916 -5.782  41.366  1.00 66.01  ? 311  VAL C N     1 
ATOM   5659  C  CA    . VAL C 2 311  ? -28.141 -6.785  40.339  1.00 57.30  ? 311  VAL C CA    1 
ATOM   5660  C  C     . VAL C 2 311  ? -27.832 -8.170  40.902  1.00 53.89  ? 311  VAL C C     1 
ATOM   5661  O  O     . VAL C 2 311  ? -28.585 -9.118  40.683  1.00 52.82  ? 311  VAL C O     1 
ATOM   5662  C  CB    . VAL C 2 311  ? -27.289 -6.501  39.079  1.00 49.84  ? 311  VAL C CB    1 
ATOM   5663  C  CG1   . VAL C 2 311  ? -25.880 -6.059  39.465  1.00 52.68  ? 311  VAL C CG1   1 
ATOM   5664  C  CG2   . VAL C 2 311  ? -27.265 -7.713  38.155  1.00 52.65  ? 311  VAL C CG2   1 
ATOM   5665  N  N     . GLY C 2 312  ? -26.738 -8.269  41.651  1.00 53.99  ? 312  GLY C N     1 
ATOM   5666  C  CA    . GLY C 2 312  ? -26.370 -9.506  42.312  1.00 59.32  ? 312  GLY C CA    1 
ATOM   5667  C  C     . GLY C 2 312  ? -27.463 -10.029 43.225  1.00 62.79  ? 312  GLY C C     1 
ATOM   5668  O  O     . GLY C 2 312  ? -27.747 -11.225 43.244  1.00 63.59  ? 312  GLY C O     1 
ATOM   5669  N  N     . ARG C 2 313  ? -28.084 -9.135  43.986  1.00 54.26  ? 313  ARG C N     1 
ATOM   5670  C  CA    . ARG C 2 313  ? -29.198 -9.528  44.836  1.00 54.20  ? 313  ARG C CA    1 
ATOM   5671  C  C     . ARG C 2 313  ? -30.408 -9.849  43.975  1.00 49.93  ? 313  ARG C C     1 
ATOM   5672  O  O     . ARG C 2 313  ? -31.040 -10.890 44.140  1.00 54.45  ? 313  ARG C O     1 
ATOM   5673  C  CB    . ARG C 2 313  ? -29.541 -8.426  45.839  1.00 58.17  ? 313  ARG C CB    1 
ATOM   5674  C  CG    . ARG C 2 313  ? -30.703 -8.761  46.775  1.00 63.80  ? 313  ARG C CG    1 
ATOM   5675  C  CD    . ARG C 2 313  ? -30.317 -9.796  47.834  1.00 62.26  ? 313  ARG C CD    1 
ATOM   5676  N  NE    . ARG C 2 313  ? -30.575 -11.165 47.397  1.00 57.55  ? 313  ARG C NE    1 
ATOM   5677  C  CZ    . ARG C 2 313  ? -30.332 -12.243 48.135  1.00 56.34  ? 313  ARG C CZ    1 
ATOM   5678  N  NH1   . ARG C 2 313  ? -29.821 -12.117 49.353  1.00 61.20  ? 313  ARG C NH1   1 
ATOM   5679  N  NH2   . ARG C 2 313  ? -30.598 -13.451 47.654  1.00 53.76  ? 313  ARG C NH2   1 
ATOM   5680  N  N     . TYR C 2 314  ? -30.710 -8.950  43.045  1.00 47.47  ? 314  TYR C N     1 
ATOM   5681  C  CA    . TYR C 2 314  ? -31.893 -9.072  42.204  1.00 54.87  ? 314  TYR C CA    1 
ATOM   5682  C  C     . TYR C 2 314  ? -31.872 -10.325 41.330  1.00 59.84  ? 314  TYR C C     1 
ATOM   5683  O  O     . TYR C 2 314  ? -32.894 -10.996 41.177  1.00 63.39  ? 314  TYR C O     1 
ATOM   5684  C  CB    . TYR C 2 314  ? -32.041 -7.822  41.331  1.00 52.77  ? 314  TYR C CB    1 
ATOM   5685  C  CG    . TYR C 2 314  ? -33.084 -7.932  40.240  1.00 49.23  ? 314  TYR C CG    1 
ATOM   5686  C  CD1   . TYR C 2 314  ? -34.399 -8.261  40.540  1.00 53.47  ? 314  TYR C CD1   1 
ATOM   5687  C  CD2   . TYR C 2 314  ? -32.756 -7.689  38.913  1.00 46.55  ? 314  TYR C CD2   1 
ATOM   5688  C  CE1   . TYR C 2 314  ? -35.353 -8.360  39.548  1.00 53.98  ? 314  TYR C CE1   1 
ATOM   5689  C  CE2   . TYR C 2 314  ? -33.701 -7.783  37.915  1.00 46.62  ? 314  TYR C CE2   1 
ATOM   5690  C  CZ    . TYR C 2 314  ? -34.999 -8.119  38.236  1.00 51.51  ? 314  TYR C CZ    1 
ATOM   5691  O  OH    . TYR C 2 314  ? -35.942 -8.212  37.239  1.00 57.16  ? 314  TYR C OH    1 
ATOM   5692  N  N     . LYS C 2 315  ? -30.712 -10.649 40.767  1.00 59.74  ? 315  LYS C N     1 
ATOM   5693  C  CA    . LYS C 2 315  ? -30.621 -11.778 39.846  1.00 59.37  ? 315  LYS C CA    1 
ATOM   5694  C  C     . LYS C 2 315  ? -30.715 -13.111 40.580  1.00 58.31  ? 315  LYS C C     1 
ATOM   5695  O  O     . LYS C 2 315  ? -31.323 -14.059 40.086  1.00 59.91  ? 315  LYS C O     1 
ATOM   5696  C  CB    . LYS C 2 315  ? -29.325 -11.721 39.039  1.00 61.23  ? 315  LYS C CB    1 
ATOM   5697  C  CG    . LYS C 2 315  ? -29.368 -12.572 37.786  1.00 51.01  ? 315  LYS C CG    1 
ATOM   5698  C  CD    . LYS C 2 315  ? -30.517 -12.142 36.896  1.00 36.62  ? 315  LYS C CD    1 
ATOM   5699  C  CE    . LYS C 2 315  ? -30.749 -13.137 35.782  1.00 34.34  ? 315  LYS C CE    1 
ATOM   5700  N  NZ    . LYS C 2 315  ? -31.801 -12.672 34.839  1.00 30.20  ? 315  LYS C NZ    1 
ATOM   5701  N  N     . VAL C 2 316  ? -30.104 -13.182 41.756  1.00 52.22  ? 316  VAL C N     1 
ATOM   5702  C  CA    . VAL C 2 316  ? -30.234 -14.361 42.593  1.00 48.08  ? 316  VAL C CA    1 
ATOM   5703  C  C     . VAL C 2 316  ? -31.705 -14.580 42.930  1.00 56.21  ? 316  VAL C C     1 
ATOM   5704  O  O     . VAL C 2 316  ? -32.226 -15.687 42.787  1.00 56.00  ? 316  VAL C O     1 
ATOM   5705  C  CB    . VAL C 2 316  ? -29.408 -14.233 43.887  1.00 47.95  ? 316  VAL C CB    1 
ATOM   5706  C  CG1   . VAL C 2 316  ? -29.865 -15.254 44.914  1.00 58.89  ? 316  VAL C CG1   1 
ATOM   5707  C  CG2   . VAL C 2 316  ? -27.930 -14.397 43.586  1.00 49.41  ? 316  VAL C CG2   1 
ATOM   5708  N  N     . ASN C 2 317  ? -32.373 -13.506 43.344  1.00 59.61  ? 317  ASN C N     1 
ATOM   5709  C  CA    . ASN C 2 317  ? -33.771 -13.567 43.764  1.00 59.71  ? 317  ASN C CA    1 
ATOM   5710  C  C     . ASN C 2 317  ? -34.704 -14.084 42.683  1.00 60.57  ? 317  ASN C C     1 
ATOM   5711  O  O     . ASN C 2 317  ? -35.510 -14.976 42.934  1.00 67.80  ? 317  ASN C O     1 
ATOM   5712  C  CB    . ASN C 2 317  ? -34.245 -12.193 44.229  1.00 44.32  ? 317  ASN C CB    1 
ATOM   5713  C  CG    . ASN C 2 317  ? -33.590 -11.765 45.518  1.00 48.73  ? 317  ASN C CG    1 
ATOM   5714  O  OD1   . ASN C 2 317  ? -32.605 -12.361 45.951  1.00 50.89  ? 317  ASN C OD1   1 
ATOM   5715  N  ND2   . ASN C 2 317  ? -34.131 -10.729 46.141  1.00 54.19  ? 317  ASN C ND2   1 
ATOM   5716  N  N     . LYS C 2 318  ? -34.600 -13.522 41.484  1.00 57.60  ? 318  LYS C N     1 
ATOM   5717  C  CA    . LYS C 2 318  ? -35.418 -13.985 40.372  1.00 60.75  ? 318  LYS C CA    1 
ATOM   5718  C  C     . LYS C 2 318  ? -35.220 -15.477 40.143  1.00 57.31  ? 318  LYS C C     1 
ATOM   5719  O  O     . LYS C 2 318  ? -36.160 -16.192 39.806  1.00 57.34  ? 318  LYS C O     1 
ATOM   5720  C  CB    . LYS C 2 318  ? -35.093 -13.213 39.091  1.00 64.03  ? 318  LYS C CB    1 
ATOM   5721  C  CG    . LYS C 2 318  ? -35.694 -11.820 39.015  1.00 59.71  ? 318  LYS C CG    1 
ATOM   5722  C  CD    . LYS C 2 318  ? -35.922 -11.402 37.565  1.00 57.85  ? 318  LYS C CD    1 
ATOM   5723  C  CE    . LYS C 2 318  ? -34.658 -11.559 36.726  1.00 56.59  ? 318  LYS C CE    1 
ATOM   5724  N  NZ    . LYS C 2 318  ? -34.894 -11.270 35.280  1.00 45.72  ? 318  LYS C NZ    1 
ATOM   5725  N  N     . LYS C 2 319  ? -33.995 -15.947 40.340  1.00 58.07  ? 319  LYS C N     1 
ATOM   5726  C  CA    . LYS C 2 319  ? -33.688 -17.346 40.093  1.00 66.11  ? 319  LYS C CA    1 
ATOM   5727  C  C     . LYS C 2 319  ? -34.293 -18.232 41.172  1.00 62.33  ? 319  LYS C C     1 
ATOM   5728  O  O     . LYS C 2 319  ? -34.634 -19.384 40.918  1.00 68.00  ? 319  LYS C O     1 
ATOM   5729  C  CB    . LYS C 2 319  ? -32.175 -17.562 40.012  1.00 69.81  ? 319  LYS C CB    1 
ATOM   5730  C  CG    . LYS C 2 319  ? -31.781 -18.911 39.434  1.00 65.86  ? 319  LYS C CG    1 
ATOM   5731  C  CD    . LYS C 2 319  ? -32.544 -19.193 38.149  1.00 65.49  ? 319  LYS C CD    1 
ATOM   5732  C  CE    . LYS C 2 319  ? -32.190 -20.557 37.580  1.00 71.88  ? 319  LYS C CE    1 
ATOM   5733  N  NZ    . LYS C 2 319  ? -33.142 -20.991 36.515  1.00 73.86  ? 319  LYS C NZ    1 
ATOM   5734  N  N     . LEU C 2 320  ? -34.435 -17.685 42.373  1.00 55.45  ? 320  LEU C N     1 
ATOM   5735  C  CA    . LEU C 2 320  ? -34.967 -18.447 43.498  1.00 64.39  ? 320  LEU C CA    1 
ATOM   5736  C  C     . LEU C 2 320  ? -36.400 -18.049 43.830  1.00 70.09  ? 320  LEU C C     1 
ATOM   5737  O  O     . LEU C 2 320  ? -37.111 -18.776 44.527  1.00 75.77  ? 320  LEU C O     1 
ATOM   5738  C  CB    . LEU C 2 320  ? -34.078 -18.268 44.729  1.00 65.39  ? 320  LEU C CB    1 
ATOM   5739  C  CG    . LEU C 2 320  ? -32.679 -18.874 44.623  1.00 66.91  ? 320  LEU C CG    1 
ATOM   5740  C  CD1   . LEU C 2 320  ? -31.947 -18.761 45.949  1.00 66.50  ? 320  LEU C CD1   1 
ATOM   5741  C  CD2   . LEU C 2 320  ? -32.762 -20.325 44.171  1.00 78.27  ? 320  LEU C CD2   1 
ATOM   5742  N  N     . GLY C 2 321  ? -36.817 -16.891 43.330  1.00 70.84  ? 321  GLY C N     1 
ATOM   5743  C  CA    . GLY C 2 321  ? -38.167 -16.400 43.539  1.00 78.21  ? 321  GLY C CA    1 
ATOM   5744  C  C     . GLY C 2 321  ? -38.549 -16.198 44.991  1.00 77.00  ? 321  GLY C C     1 
ATOM   5745  O  O     . GLY C 2 321  ? -39.636 -16.588 45.413  1.00 81.62  ? 321  GLY C O     1 
ATOM   5746  N  N     . LEU C 2 322  ? -37.654 -15.592 45.760  1.00 64.57  ? 322  LEU C N     1 
ATOM   5747  C  CA    . LEU C 2 322  ? -37.955 -15.243 47.139  1.00 64.28  ? 322  LEU C CA    1 
ATOM   5748  C  C     . LEU C 2 322  ? -37.729 -13.754 47.344  1.00 64.75  ? 322  LEU C C     1 
ATOM   5749  O  O     . LEU C 2 322  ? -36.821 -13.177 46.749  1.00 63.58  ? 322  LEU C O     1 
ATOM   5750  C  CB    . LEU C 2 322  ? -37.104 -16.069 48.103  1.00 71.19  ? 322  LEU C CB    1 
ATOM   5751  C  CG    . LEU C 2 322  ? -35.638 -16.274 47.724  1.00 64.24  ? 322  LEU C CG    1 
ATOM   5752  C  CD1   . LEU C 2 322  ? -34.758 -15.196 48.334  1.00 69.91  ? 322  LEU C CD1   1 
ATOM   5753  C  CD2   . LEU C 2 322  ? -35.172 -17.658 48.144  1.00 65.65  ? 322  LEU C CD2   1 
ATOM   5754  N  N     . HIS C 2 323  ? -38.572 -13.141 48.175  1.00 68.61  ? 323  HIS C N     1 
ATOM   5755  C  CA    . HIS C 2 323  ? -38.551 -11.696 48.406  1.00 73.57  ? 323  HIS C CA    1 
ATOM   5756  C  C     . HIS C 2 323  ? -38.781 -10.933 47.108  1.00 78.21  ? 323  HIS C C     1 
ATOM   5757  O  O     . HIS C 2 323  ? -38.362 -9.784  46.975  1.00 81.16  ? 323  HIS C O     1 
ATOM   5758  C  CB    . HIS C 2 323  ? -37.224 -11.251 49.028  1.00 75.42  ? 323  HIS C CB    1 
ATOM   5759  C  CG    . HIS C 2 323  ? -36.872 -11.965 50.294  1.00 74.50  ? 323  HIS C CG    1 
ATOM   5760  N  ND1   . HIS C 2 323  ? -36.749 -11.313 51.502  1.00 84.35  ? 323  HIS C ND1   1 
ATOM   5761  C  CD2   . HIS C 2 323  ? -36.600 -13.268 50.539  1.00 71.94  ? 323  HIS C CD2   1 
ATOM   5762  C  CE1   . HIS C 2 323  ? -36.424 -12.186 52.439  1.00 89.21  ? 323  HIS C CE1   1 
ATOM   5763  N  NE2   . HIS C 2 323  ? -36.327 -13.380 51.880  1.00 78.31  ? 323  HIS C NE2   1 
ATOM   5764  N  N     . VAL C 2 324  ? -39.448 -11.581 46.158  1.00 79.31  ? 324  VAL C N     1 
ATOM   5765  C  CA    . VAL C 2 324  ? -39.591 -11.055 44.804  1.00 80.33  ? 324  VAL C CA    1 
ATOM   5766  C  C     . VAL C 2 324  ? -40.250 -9.675  44.783  1.00 79.95  ? 324  VAL C C     1 
ATOM   5767  O  O     . VAL C 2 324  ? -39.903 -8.823  43.963  1.00 74.19  ? 324  VAL C O     1 
ATOM   5768  C  CB    . VAL C 2 324  ? -40.397 -12.035 43.919  1.00 74.65  ? 324  VAL C CB    1 
ATOM   5769  C  CG1   . VAL C 2 324  ? -41.755 -12.330 44.539  1.00 80.51  ? 324  VAL C CG1   1 
ATOM   5770  C  CG2   . VAL C 2 324  ? -40.544 -11.498 42.503  1.00 73.35  ? 324  VAL C CG2   1 
ATOM   5771  N  N     . GLY C 2 325  ? -41.179 -9.448  45.705  1.00 88.54  ? 325  GLY C N     1 
ATOM   5772  C  CA    . GLY C 2 325  ? -41.891 -8.187  45.768  1.00 94.94  ? 325  GLY C CA    1 
ATOM   5773  C  C     . GLY C 2 325  ? -41.178 -7.171  46.635  1.00 98.99  ? 325  GLY C C     1 
ATOM   5774  O  O     . GLY C 2 325  ? -41.292 -5.965  46.418  1.00 101.05 ? 325  GLY C O     1 
ATOM   5775  N  N     . GLU C 2 326  ? -40.437 -7.664  47.621  1.00 97.95  ? 326  GLU C N     1 
ATOM   5776  C  CA    . GLU C 2 326  ? -39.728 -6.803  48.558  1.00 104.35 ? 326  GLU C CA    1 
ATOM   5777  C  C     . GLU C 2 326  ? -38.617 -6.010  47.867  1.00 103.65 ? 326  GLU C C     1 
ATOM   5778  O  O     . GLU C 2 326  ? -37.866 -6.565  47.066  1.00 101.43 ? 326  GLU C O     1 
ATOM   5779  C  CB    . GLU C 2 326  ? -39.153 -7.640  49.700  1.00 100.60 ? 326  GLU C CB    1 
ATOM   5780  C  CG    . GLU C 2 326  ? -38.457 -6.835  50.774  1.00 97.49  ? 326  GLU C CG    1 
ATOM   5781  C  CD    . GLU C 2 326  ? -37.961 -7.698  51.906  1.00 93.93  ? 326  GLU C CD    1 
ATOM   5782  O  OE1   . GLU C 2 326  ? -38.421 -8.853  52.021  1.00 92.95  ? 326  GLU C OE1   1 
ATOM   5783  O  OE2   . GLU C 2 326  ? -37.106 -7.222  52.679  1.00 99.75  ? 326  GLU C OE2   1 
ATOM   5784  N  N     . PRO C 2 327  ? -38.518 -4.703  48.173  1.00 107.28 ? 327  PRO C N     1 
ATOM   5785  C  CA    . PRO C 2 327  ? -37.498 -3.825  47.583  1.00 105.96 ? 327  PRO C CA    1 
ATOM   5786  C  C     . PRO C 2 327  ? -36.062 -4.276  47.857  1.00 107.31 ? 327  PRO C C     1 
ATOM   5787  O  O     . PRO C 2 327  ? -35.825 -5.124  48.719  1.00 108.11 ? 327  PRO C O     1 
ATOM   5788  C  CB    . PRO C 2 327  ? -37.775 -2.468  48.245  1.00 105.91 ? 327  PRO C CB    1 
ATOM   5789  C  CG    . PRO C 2 327  ? -38.624 -2.772  49.440  1.00 105.55 ? 327  PRO C CG    1 
ATOM   5790  C  CD    . PRO C 2 327  ? -39.437 -3.958  49.050  1.00 106.78 ? 327  PRO C CD    1 
ATOM   5791  N  N     . ILE C 2 328  ? -35.115 -3.697  47.122  1.00 109.40 ? 328  ILE C N     1 
ATOM   5792  C  CA    . ILE C 2 328  ? -33.717 -4.113  47.187  1.00 111.16 ? 328  ILE C CA    1 
ATOM   5793  C  C     . ILE C 2 328  ? -32.970 -3.448  48.338  1.00 110.10 ? 328  ILE C C     1 
ATOM   5794  O  O     . ILE C 2 328  ? -32.469 -2.328  48.206  1.00 99.02  ? 328  ILE C O     1 
ATOM   5795  C  CB    . ILE C 2 328  ? -32.969 -3.803  45.872  1.00 108.84 ? 328  ILE C CB    1 
ATOM   5796  C  CG1   . ILE C 2 328  ? -33.776 -4.276  44.658  1.00 110.18 ? 328  ILE C CG1   1 
ATOM   5797  C  CG2   . ILE C 2 328  ? -31.585 -4.442  45.887  1.00 101.21 ? 328  ILE C CG2   1 
ATOM   5798  C  CD1   . ILE C 2 328  ? -34.619 -3.190  44.003  1.00 95.21  ? 328  ILE C CD1   1 
ATOM   5799  N  N     . THR C 2 329  ? -32.893 -4.150  49.465  1.00 108.47 ? 329  THR C N     1 
ATOM   5800  C  CA    . THR C 2 329  ? -32.171 -3.651  50.628  1.00 103.31 ? 329  THR C CA    1 
ATOM   5801  C  C     . THR C 2 329  ? -30.992 -4.556  50.980  1.00 96.15  ? 329  THR C C     1 
ATOM   5802  O  O     . THR C 2 329  ? -29.973 -4.088  51.486  1.00 97.34  ? 329  THR C O     1 
ATOM   5803  C  CB    . THR C 2 329  ? -33.096 -3.517  51.855  1.00 101.98 ? 329  THR C CB    1 
ATOM   5804  O  OG1   . THR C 2 329  ? -32.323 -3.130  52.999  1.00 107.08 ? 329  THR C OG1   1 
ATOM   5805  C  CG2   . THR C 2 329  ? -33.809 -4.832  52.146  1.00 90.20  ? 329  THR C CG2   1 
ATOM   5806  N  N     . SER C 2 330  ? -31.130 -5.848  50.701  1.00 83.04  ? 330  SER C N     1 
ATOM   5807  C  CA    . SER C 2 330  ? -30.079 -6.811  51.010  1.00 82.40  ? 330  SER C CA    1 
ATOM   5808  C  C     . SER C 2 330  ? -28.939 -6.755  50.001  1.00 80.30  ? 330  SER C C     1 
ATOM   5809  O  O     . SER C 2 330  ? -29.149 -6.929  48.804  1.00 79.76  ? 330  SER C O     1 
ATOM   5810  C  CB    . SER C 2 330  ? -30.649 -8.229  51.060  1.00 79.77  ? 330  SER C CB    1 
ATOM   5811  O  OG    . SER C 2 330  ? -29.609 -9.192  50.999  1.00 77.21  ? 330  SER C OG    1 
ATOM   5812  N  N     . SER C 2 331  ? -27.729 -6.517  50.494  1.00 78.46  ? 331  SER C N     1 
ATOM   5813  C  CA    . SER C 2 331  ? -26.543 -6.514  49.647  1.00 75.75  ? 331  SER C CA    1 
ATOM   5814  C  C     . SER C 2 331  ? -25.729 -7.784  49.868  1.00 74.90  ? 331  SER C C     1 
ATOM   5815  O  O     . SER C 2 331  ? -24.653 -7.953  49.297  1.00 79.43  ? 331  SER C O     1 
ATOM   5816  C  CB    . SER C 2 331  ? -25.678 -5.281  49.927  1.00 72.19  ? 331  SER C CB    1 
ATOM   5817  O  OG    . SER C 2 331  ? -26.403 -4.082  49.718  1.00 70.94  ? 331  SER C OG    1 
ATOM   5818  N  N     . THR C 2 332  ? -26.253 -8.681  50.695  1.00 70.50  ? 332  THR C N     1 
ATOM   5819  C  CA    . THR C 2 332  ? -25.482 -9.832  51.139  1.00 65.08  ? 332  THR C CA    1 
ATOM   5820  C  C     . THR C 2 332  ? -26.202 -11.150 50.901  1.00 59.43  ? 332  THR C C     1 
ATOM   5821  O  O     . THR C 2 332  ? -27.426 -11.202 50.803  1.00 63.35  ? 332  THR C O     1 
ATOM   5822  C  CB    . THR C 2 332  ? -25.143 -9.723  52.642  1.00 73.24  ? 332  THR C CB    1 
ATOM   5823  O  OG1   . THR C 2 332  ? -24.938 -8.349  52.994  1.00 80.23  ? 332  THR C OG1   1 
ATOM   5824  C  CG2   . THR C 2 332  ? -23.891 -10.509 52.968  1.00 75.03  ? 332  THR C CG2   1 
ATOM   5825  N  N     . LEU C 2 333  ? -25.417 -12.214 50.803  1.00 59.72  ? 333  LEU C N     1 
ATOM   5826  C  CA    . LEU C 2 333  ? -25.939 -13.566 50.743  1.00 67.56  ? 333  LEU C CA    1 
ATOM   5827  C  C     . LEU C 2 333  ? -26.512 -13.963 52.100  1.00 68.37  ? 333  LEU C C     1 
ATOM   5828  O  O     . LEU C 2 333  ? -26.081 -13.451 53.132  1.00 68.68  ? 333  LEU C O     1 
ATOM   5829  C  CB    . LEU C 2 333  ? -24.831 -14.528 50.324  1.00 74.23  ? 333  LEU C CB    1 
ATOM   5830  C  CG    . LEU C 2 333  ? -25.229 -15.912 49.826  1.00 73.21  ? 333  LEU C CG    1 
ATOM   5831  C  CD1   . LEU C 2 333  ? -26.055 -15.797 48.556  1.00 66.89  ? 333  LEU C CD1   1 
ATOM   5832  C  CD2   . LEU C 2 333  ? -23.980 -16.743 49.591  1.00 72.80  ? 333  LEU C CD2   1 
ATOM   5833  N  N     . THR C 2 334  ? -27.487 -14.868 52.099  1.00 71.25  ? 334  THR C N     1 
ATOM   5834  C  CA    . THR C 2 334  ? -28.108 -15.322 53.343  1.00 78.48  ? 334  THR C CA    1 
ATOM   5835  C  C     . THR C 2 334  ? -28.134 -16.845 53.443  1.00 80.28  ? 334  THR C C     1 
ATOM   5836  O  O     . THR C 2 334  ? -27.940 -17.542 52.446  1.00 79.60  ? 334  THR C O     1 
ATOM   5837  C  CB    . THR C 2 334  ? -29.555 -14.798 53.485  1.00 79.58  ? 334  THR C CB    1 
ATOM   5838  O  OG1   . THR C 2 334  ? -30.404 -15.451 52.533  1.00 70.83  ? 334  THR C OG1   1 
ATOM   5839  C  CG2   . THR C 2 334  ? -29.611 -13.290 53.273  1.00 74.27  ? 334  THR C CG2   1 
ATOM   5840  N  N     . GLU C 2 335  ? -28.368 -17.349 54.654  1.00 81.46  ? 335  GLU C N     1 
ATOM   5841  C  CA    . GLU C 2 335  ? -28.544 -18.782 54.881  1.00 84.18  ? 335  GLU C CA    1 
ATOM   5842  C  C     . GLU C 2 335  ? -29.657 -19.327 53.998  1.00 84.21  ? 335  GLU C C     1 
ATOM   5843  O  O     . GLU C 2 335  ? -29.518 -20.385 53.381  1.00 77.60  ? 335  GLU C O     1 
ATOM   5844  C  CB    . GLU C 2 335  ? -28.870 -19.075 56.350  1.00 87.21  ? 335  GLU C CB    1 
ATOM   5845  C  CG    . GLU C 2 335  ? -27.731 -18.850 57.332  1.00 87.23  ? 335  GLU C CG    1 
ATOM   5846  C  CD    . GLU C 2 335  ? -28.008 -19.474 58.691  1.00 86.00  ? 335  GLU C CD    1 
ATOM   5847  O  OE1   . GLU C 2 335  ? -28.617 -20.564 58.732  1.00 89.22  ? 335  GLU C OE1   1 
ATOM   5848  O  OE2   . GLU C 2 335  ? -27.623 -18.876 59.717  1.00 82.51  ? 335  GLU C OE2   1 
ATOM   5849  N  N     . GLU C 2 336  ? -30.761 -18.588 53.954  1.00 85.05  ? 336  GLU C N     1 
ATOM   5850  C  CA    . GLU C 2 336  ? -31.921 -18.947 53.149  1.00 82.99  ? 336  GLU C CA    1 
ATOM   5851  C  C     . GLU C 2 336  ? -31.542 -19.150 51.687  1.00 84.46  ? 336  GLU C C     1 
ATOM   5852  O  O     . GLU C 2 336  ? -32.037 -20.063 51.025  1.00 82.71  ? 336  GLU C O     1 
ATOM   5853  C  CB    . GLU C 2 336  ? -32.996 -17.867 53.259  1.00 72.39  ? 336  GLU C CB    1 
ATOM   5854  C  CG    . GLU C 2 336  ? -34.233 -18.138 52.427  1.00 81.53  ? 336  GLU C CG    1 
ATOM   5855  C  CD    . GLU C 2 336  ? -35.109 -16.913 52.288  1.00 88.28  ? 336  GLU C CD    1 
ATOM   5856  O  OE1   . GLU C 2 336  ? -36.198 -17.023 51.687  1.00 93.01  ? 336  GLU C OE1   1 
ATOM   5857  O  OE2   . GLU C 2 336  ? -34.702 -15.838 52.776  1.00 85.94  ? 336  GLU C OE2   1 
ATOM   5858  N  N     . ASP C 2 337  ? -30.659 -18.291 51.193  1.00 75.89  ? 337  ASP C N     1 
ATOM   5859  C  CA    . ASP C 2 337  ? -30.179 -18.392 49.825  1.00 71.34  ? 337  ASP C CA    1 
ATOM   5860  C  C     . ASP C 2 337  ? -29.433 -19.700 49.615  1.00 71.00  ? 337  ASP C C     1 
ATOM   5861  O  O     . ASP C 2 337  ? -29.650 -20.399 48.625  1.00 69.33  ? 337  ASP C O     1 
ATOM   5862  C  CB    . ASP C 2 337  ? -29.277 -17.206 49.491  1.00 57.42  ? 337  ASP C CB    1 
ATOM   5863  C  CG    . ASP C 2 337  ? -29.969 -15.885 49.698  1.00 49.77  ? 337  ASP C CG    1 
ATOM   5864  O  OD1   . ASP C 2 337  ? -31.186 -15.812 49.444  1.00 52.66  ? 337  ASP C OD1   1 
ATOM   5865  O  OD2   . ASP C 2 337  ? -29.305 -14.924 50.132  1.00 53.67  ? 337  ASP C OD2   1 
ATOM   5866  N  N     . VAL C 2 338  ? -28.562 -20.025 50.563  1.00 69.57  ? 338  VAL C N     1 
ATOM   5867  C  CA    . VAL C 2 338  ? -27.742 -21.221 50.480  1.00 68.97  ? 338  VAL C CA    1 
ATOM   5868  C  C     . VAL C 2 338  ? -28.590 -22.470 50.312  1.00 77.56  ? 338  VAL C C     1 
ATOM   5869  O  O     . VAL C 2 338  ? -28.367 -23.270 49.406  1.00 78.95  ? 338  VAL C O     1 
ATOM   5870  C  CB    . VAL C 2 338  ? -26.871 -21.387 51.731  1.00 72.66  ? 338  VAL C CB    1 
ATOM   5871  C  CG1   . VAL C 2 338  ? -25.977 -22.606 51.588  1.00 79.99  ? 338  VAL C CG1   1 
ATOM   5872  C  CG2   . VAL C 2 338  ? -26.044 -20.137 51.972  1.00 72.33  ? 338  VAL C CG2   1 
ATOM   5873  N  N     . VAL C 2 339  ? -29.574 -22.619 51.188  1.00 85.71  ? 339  VAL C N     1 
ATOM   5874  C  CA    . VAL C 2 339  ? -30.418 -23.805 51.200  1.00 96.85  ? 339  VAL C CA    1 
ATOM   5875  C  C     . VAL C 2 339  ? -31.253 -23.907 49.926  1.00 92.33  ? 339  VAL C C     1 
ATOM   5876  O  O     . VAL C 2 339  ? -31.286 -24.953 49.273  1.00 84.18  ? 339  VAL C O     1 
ATOM   5877  C  CB    . VAL C 2 339  ? -31.349 -23.804 52.427  1.00 109.28 ? 339  VAL C CB    1 
ATOM   5878  C  CG1   . VAL C 2 339  ? -32.138 -25.102 52.504  1.00 110.84 ? 339  VAL C CG1   1 
ATOM   5879  C  CG2   . VAL C 2 339  ? -30.541 -23.588 53.701  1.00 105.33 ? 339  VAL C CG2   1 
ATOM   5880  N  N     . ALA C 2 340  ? -31.913 -22.805 49.577  1.00 90.57  ? 340  ALA C N     1 
ATOM   5881  C  CA    . ALA C 2 340  ? -32.806 -22.750 48.422  1.00 94.43  ? 340  ALA C CA    1 
ATOM   5882  C  C     . ALA C 2 340  ? -32.064 -23.047 47.126  1.00 89.15  ? 340  ALA C C     1 
ATOM   5883  O  O     . ALA C 2 340  ? -32.657 -23.498 46.143  1.00 83.94  ? 340  ALA C O     1 
ATOM   5884  C  CB    . ALA C 2 340  ? -33.480 -21.386 48.344  1.00 94.38  ? 340  ALA C CB    1 
ATOM   5885  N  N     . THR C 2 341  ? -30.763 -22.781 47.136  1.00 86.60  ? 341  THR C N     1 
ATOM   5886  C  CA    . THR C 2 341  ? -29.909 -23.068 45.996  1.00 89.84  ? 341  THR C CA    1 
ATOM   5887  C  C     . THR C 2 341  ? -29.687 -24.569 45.875  1.00 89.23  ? 341  THR C C     1 
ATOM   5888  O  O     . THR C 2 341  ? -29.829 -25.145 44.797  1.00 88.97  ? 341  THR C O     1 
ATOM   5889  C  CB    . THR C 2 341  ? -28.551 -22.358 46.118  1.00 84.85  ? 341  THR C CB    1 
ATOM   5890  O  OG1   . THR C 2 341  ? -28.760 -20.962 46.368  1.00 77.57  ? 341  THR C OG1   1 
ATOM   5891  C  CG2   . THR C 2 341  ? -27.740 -22.532 44.841  1.00 76.96  ? 341  THR C CG2   1 
ATOM   5892  N  N     . ILE C 2 342  ? -29.340 -25.196 46.994  1.00 85.36  ? 342  ILE C N     1 
ATOM   5893  C  CA    . ILE C 2 342  ? -29.106 -26.633 47.025  1.00 83.65  ? 342  ILE C CA    1 
ATOM   5894  C  C     . ILE C 2 342  ? -30.376 -27.376 46.625  1.00 82.01  ? 342  ILE C C     1 
ATOM   5895  O  O     . ILE C 2 342  ? -30.324 -28.390 45.928  1.00 74.92  ? 342  ILE C O     1 
ATOM   5896  C  CB    . ILE C 2 342  ? -28.642 -27.093 48.415  1.00 89.65  ? 342  ILE C CB    1 
ATOM   5897  C  CG1   . ILE C 2 342  ? -27.459 -26.242 48.882  1.00 80.65  ? 342  ILE C CG1   1 
ATOM   5898  C  CG2   . ILE C 2 342  ? -28.267 -28.567 48.391  1.00 102.05 ? 342  ILE C CG2   1 
ATOM   5899  C  CD1   . ILE C 2 342  ? -27.126 -26.402 50.344  1.00 80.88  ? 342  ILE C CD1   1 
ATOM   5900  N  N     . GLU C 2 343  ? -31.514 -26.847 47.061  1.00 86.24  ? 343  GLU C N     1 
ATOM   5901  C  CA    . GLU C 2 343  ? -32.814 -27.391 46.688  1.00 93.23  ? 343  GLU C CA    1 
ATOM   5902  C  C     . GLU C 2 343  ? -33.019 -27.277 45.179  1.00 91.77  ? 343  GLU C C     1 
ATOM   5903  O  O     . GLU C 2 343  ? -33.626 -28.149 44.560  1.00 93.92  ? 343  GLU C O     1 
ATOM   5904  C  CB    . GLU C 2 343  ? -33.937 -26.666 47.442  1.00 101.70 ? 343  GLU C CB    1 
ATOM   5905  C  CG    . GLU C 2 343  ? -35.329 -27.268 47.257  1.00 103.37 ? 343  GLU C CG    1 
ATOM   5906  C  CD    . GLU C 2 343  ? -36.407 -26.505 48.017  1.00 103.54 ? 343  GLU C CD    1 
ATOM   5907  O  OE1   . GLU C 2 343  ? -36.062 -25.573 48.774  1.00 97.29  ? 343  GLU C OE1   1 
ATOM   5908  O  OE2   . GLU C 2 343  ? -37.601 -26.836 47.856  1.00 104.18 ? 343  GLU C OE2   1 
ATOM   5909  N  N     . TYR C 2 344  ? -32.499 -26.202 44.595  1.00 84.14  ? 344  TYR C N     1 
ATOM   5910  C  CA    . TYR C 2 344  ? -32.621 -25.965 43.159  1.00 76.06  ? 344  TYR C CA    1 
ATOM   5911  C  C     . TYR C 2 344  ? -31.793 -26.978 42.378  1.00 68.25  ? 344  TYR C C     1 
ATOM   5912  O  O     . TYR C 2 344  ? -32.153 -27.373 41.270  1.00 64.30  ? 344  TYR C O     1 
ATOM   5913  C  CB    . TYR C 2 344  ? -32.181 -24.539 42.814  1.00 69.29  ? 344  TYR C CB    1 
ATOM   5914  C  CG    . TYR C 2 344  ? -32.849 -23.946 41.594  1.00 72.33  ? 344  TYR C CG    1 
ATOM   5915  C  CD1   . TYR C 2 344  ? -33.801 -22.945 41.723  1.00 71.41  ? 344  TYR C CD1   1 
ATOM   5916  C  CD2   . TYR C 2 344  ? -32.529 -24.384 40.313  1.00 78.66  ? 344  TYR C CD2   1 
ATOM   5917  C  CE1   . TYR C 2 344  ? -34.415 -22.394 40.614  1.00 74.20  ? 344  TYR C CE1   1 
ATOM   5918  C  CE2   . TYR C 2 344  ? -33.135 -23.835 39.196  1.00 79.86  ? 344  TYR C CE2   1 
ATOM   5919  C  CZ    . TYR C 2 344  ? -34.080 -22.841 39.354  1.00 77.80  ? 344  TYR C CZ    1 
ATOM   5920  O  OH    . TYR C 2 344  ? -34.694 -22.290 38.253  1.00 75.67  ? 344  TYR C OH    1 
ATOM   5921  N  N     . LEU C 2 345  ? -30.682 -27.395 42.974  1.00 67.46  ? 345  LEU C N     1 
ATOM   5922  C  CA    . LEU C 2 345  ? -29.746 -28.306 42.329  1.00 70.32  ? 345  LEU C CA    1 
ATOM   5923  C  C     . LEU C 2 345  ? -30.284 -29.725 42.238  1.00 75.66  ? 345  LEU C C     1 
ATOM   5924  O  O     . LEU C 2 345  ? -30.198 -30.370 41.193  1.00 77.83  ? 345  LEU C O     1 
ATOM   5925  C  CB    . LEU C 2 345  ? -28.415 -28.313 43.082  1.00 70.19  ? 345  LEU C CB    1 
ATOM   5926  C  CG    . LEU C 2 345  ? -27.408 -29.418 42.751  1.00 67.03  ? 345  LEU C CG    1 
ATOM   5927  C  CD1   . LEU C 2 345  ? -27.013 -29.395 41.281  1.00 68.80  ? 345  LEU C CD1   1 
ATOM   5928  C  CD2   . LEU C 2 345  ? -26.181 -29.286 43.637  1.00 75.95  ? 345  LEU C CD2   1 
ATOM   5929  N  N     . VAL C 2 346  ? -30.837 -30.210 43.341  1.00 77.54  ? 346  VAL C N     1 
ATOM   5930  C  CA    . VAL C 2 346  ? -31.250 -31.601 43.427  1.00 81.65  ? 346  VAL C CA    1 
ATOM   5931  C  C     . VAL C 2 346  ? -32.493 -31.900 42.585  1.00 77.87  ? 346  VAL C C     1 
ATOM   5932  O  O     . VAL C 2 346  ? -32.530 -32.889 41.856  1.00 74.65  ? 346  VAL C O     1 
ATOM   5933  C  CB    . VAL C 2 346  ? -31.501 -32.006 44.894  1.00 89.97  ? 346  VAL C CB    1 
ATOM   5934  C  CG1   . VAL C 2 346  ? -32.281 -30.927 45.631  1.00 86.84  ? 346  VAL C CG1   1 
ATOM   5935  C  CG2   . VAL C 2 346  ? -32.211 -33.339 44.961  1.00 98.37  ? 346  VAL C CG2   1 
ATOM   5936  N  N     . ARG C 2 347  ? -33.504 -31.041 42.675  1.00 79.39  ? 347  ARG C N     1 
ATOM   5937  C  CA    . ARG C 2 347  ? -34.735 -31.231 41.915  1.00 76.56  ? 347  ARG C CA    1 
ATOM   5938  C  C     . ARG C 2 347  ? -34.443 -31.217 40.420  1.00 75.37  ? 347  ARG C C     1 
ATOM   5939  O  O     . ARG C 2 347  ? -34.980 -32.023 39.661  1.00 76.28  ? 347  ARG C O     1 
ATOM   5940  C  CB    . ARG C 2 347  ? -35.758 -30.152 42.268  1.00 82.52  ? 347  ARG C CB    1 
ATOM   5941  C  CG    . ARG C 2 347  ? -36.162 -30.151 43.736  1.00 92.98  ? 347  ARG C CG    1 
ATOM   5942  C  CD    . ARG C 2 347  ? -37.295 -29.175 44.011  1.00 91.91  ? 347  ARG C CD    1 
ATOM   5943  N  NE    . ARG C 2 347  ? -37.628 -29.104 45.432  1.00 88.77  ? 347  ARG C NE    1 
ATOM   5944  C  CZ    . ARG C 2 347  ? -38.554 -29.852 46.025  1.00 90.07  ? 347  ARG C CZ    1 
ATOM   5945  N  NH1   . ARG C 2 347  ? -39.249 -30.737 45.324  1.00 88.43  ? 347  ARG C NH1   1 
ATOM   5946  N  NH2   . ARG C 2 347  ? -38.785 -29.716 47.324  1.00 91.00  ? 347  ARG C NH2   1 
ATOM   5947  N  N     . LEU C 2 348  ? -33.571 -30.304 40.011  1.00 81.83  ? 348  LEU C N     1 
ATOM   5948  C  CA    . LEU C 2 348  ? -33.136 -30.223 38.625  1.00 81.04  ? 348  LEU C CA    1 
ATOM   5949  C  C     . LEU C 2 348  ? -32.329 -31.462 38.237  1.00 80.78  ? 348  LEU C C     1 
ATOM   5950  O  O     . LEU C 2 348  ? -32.252 -31.822 37.062  1.00 78.29  ? 348  LEU C O     1 
ATOM   5951  C  CB    . LEU C 2 348  ? -32.309 -28.955 38.405  1.00 74.56  ? 348  LEU C CB    1 
ATOM   5952  C  CG    . LEU C 2 348  ? -31.960 -28.609 36.960  1.00 79.35  ? 348  LEU C CG    1 
ATOM   5953  C  CD1   . LEU C 2 348  ? -33.227 -28.524 36.126  1.00 83.05  ? 348  LEU C CD1   1 
ATOM   5954  C  CD2   . LEU C 2 348  ? -31.178 -27.306 36.894  1.00 79.76  ? 348  LEU C CD2   1 
ATOM   5955  N  N     . HIS C 2 349  ? -31.732 -32.113 39.231  1.00 80.46  ? 349  HIS C N     1 
ATOM   5956  C  CA    . HIS C 2 349  ? -30.920 -33.300 38.987  1.00 82.16  ? 349  HIS C CA    1 
ATOM   5957  C  C     . HIS C 2 349  ? -31.787 -34.527 38.714  1.00 82.31  ? 349  HIS C C     1 
ATOM   5958  O  O     . HIS C 2 349  ? -31.443 -35.365 37.878  1.00 74.42  ? 349  HIS C O     1 
ATOM   5959  C  CB    . HIS C 2 349  ? -29.989 -33.569 40.172  1.00 77.93  ? 349  HIS C CB    1 
ATOM   5960  C  CG    . HIS C 2 349  ? -29.130 -34.783 40.001  1.00 75.22  ? 349  HIS C CG    1 
ATOM   5961  N  ND1   . HIS C 2 349  ? -29.394 -35.977 40.633  1.00 79.49  ? 349  HIS C ND1   1 
ATOM   5962  C  CD2   . HIS C 2 349  ? -28.016 -34.986 39.258  1.00 80.91  ? 349  HIS C CD2   1 
ATOM   5963  C  CE1   . HIS C 2 349  ? -28.476 -36.865 40.292  1.00 81.81  ? 349  HIS C CE1   1 
ATOM   5964  N  NE2   . HIS C 2 349  ? -27.630 -36.290 39.458  1.00 78.16  ? 349  HIS C NE2   1 
ATOM   5965  N  N     . GLU C 2 350  ? -32.910 -34.628 39.420  1.00 88.39  ? 350  GLU C N     1 
ATOM   5966  C  CA    . GLU C 2 350  ? -33.808 -35.767 39.260  1.00 89.19  ? 350  GLU C CA    1 
ATOM   5967  C  C     . GLU C 2 350  ? -35.006 -35.421 38.376  1.00 85.28  ? 350  GLU C C     1 
ATOM   5968  O  O     . GLU C 2 350  ? -36.054 -36.059 38.455  1.00 88.29  ? 350  GLU C O     1 
ATOM   5969  C  CB    . GLU C 2 350  ? -34.277 -36.284 40.629  1.00 98.94  ? 350  GLU C CB    1 
ATOM   5970  C  CG    . GLU C 2 350  ? -34.915 -35.235 41.533  1.00 100.91 ? 350  GLU C CG    1 
ATOM   5971  C  CD    . GLU C 2 350  ? -35.238 -35.769 42.925  1.00 99.30  ? 350  GLU C CD    1 
ATOM   5972  O  OE1   . GLU C 2 350  ? -34.789 -36.886 43.263  1.00 97.05  ? 350  GLU C OE1   1 
ATOM   5973  O  OE2   . GLU C 2 350  ? -35.941 -35.068 43.683  1.00 97.53  ? 350  GLU C OE2   1 
ATOM   5974  N  N     . GLY C 2 351  ? -34.843 -34.402 37.539  1.00 80.45  ? 351  GLY C N     1 
ATOM   5975  C  CA    . GLY C 2 351  ? -35.792 -34.137 36.474  1.00 78.41  ? 351  GLY C CA    1 
ATOM   5976  C  C     . GLY C 2 351  ? -36.995 -33.273 36.799  1.00 81.89  ? 351  GLY C C     1 
ATOM   5977  O  O     . GLY C 2 351  ? -37.921 -33.185 35.995  1.00 90.93  ? 351  GLY C O     1 
ATOM   5978  N  N     . GLN C 2 352  ? -36.999 -32.634 37.964  1.00 82.08  ? 352  GLN C N     1 
ATOM   5979  C  CA    . GLN C 2 352  ? -38.074 -31.701 38.282  1.00 81.16  ? 352  GLN C CA    1 
ATOM   5980  C  C     . GLN C 2 352  ? -37.999 -30.491 37.370  1.00 73.80  ? 352  GLN C C     1 
ATOM   5981  O  O     . GLN C 2 352  ? -36.917 -30.060 36.980  1.00 76.61  ? 352  GLN C O     1 
ATOM   5982  C  CB    . GLN C 2 352  ? -38.018 -31.253 39.736  1.00 79.58  ? 352  GLN C CB    1 
ATOM   5983  C  CG    . GLN C 2 352  ? -38.241 -32.363 40.727  1.00 89.07  ? 352  GLN C CG    1 
ATOM   5984  C  CD    . GLN C 2 352  ? -38.735 -31.842 42.053  1.00 83.49  ? 352  GLN C CD    1 
ATOM   5985  O  OE1   . GLN C 2 352  ? -39.410 -30.815 42.115  1.00 75.86  ? 352  GLN C OE1   1 
ATOM   5986  N  NE2   . GLN C 2 352  ? -38.397 -32.542 43.127  1.00 89.83  ? 352  GLN C NE2   1 
ATOM   5987  N  N     . THR C 2 353  ? -39.156 -29.939 37.035  1.00 64.05  ? 353  THR C N     1 
ATOM   5988  C  CA    . THR C 2 353  ? -39.207 -28.843 36.086  1.00 70.43  ? 353  THR C CA    1 
ATOM   5989  C  C     . THR C 2 353  ? -39.633 -27.547 36.758  1.00 74.72  ? 353  THR C C     1 
ATOM   5990  O  O     . THR C 2 353  ? -39.408 -26.461 36.229  1.00 79.50  ? 353  THR C O     1 
ATOM   5991  C  CB    . THR C 2 353  ? -40.169 -29.159 34.933  1.00 79.76  ? 353  THR C CB    1 
ATOM   5992  O  OG1   . THR C 2 353  ? -41.482 -29.391 35.458  1.00 87.41  ? 353  THR C OG1   1 
ATOM   5993  C  CG2   . THR C 2 353  ? -39.706 -30.400 34.183  1.00 79.01  ? 353  THR C CG2   1 
ATOM   5994  N  N     . THR C 2 354  ? -40.248 -27.664 37.927  1.00 68.77  ? 354  THR C N     1 
ATOM   5995  C  CA    . THR C 2 354  ? -40.742 -26.491 38.630  1.00 67.96  ? 354  THR C CA    1 
ATOM   5996  C  C     . THR C 2 354  ? -40.577 -26.660 40.133  1.00 64.84  ? 354  THR C C     1 
ATOM   5997  O  O     . THR C 2 354  ? -40.533 -27.780 40.639  1.00 67.66  ? 354  THR C O     1 
ATOM   5998  C  CB    . THR C 2 354  ? -42.224 -26.221 38.301  1.00 67.74  ? 354  THR C CB    1 
ATOM   5999  O  OG1   . THR C 2 354  ? -42.508 -26.651 36.964  1.00 69.01  ? 354  THR C OG1   1 
ATOM   6000  C  CG2   . THR C 2 354  ? -42.536 -24.742 38.421  1.00 77.66  ? 354  THR C CG2   1 
ATOM   6001  N  N     . MET C 2 355  ? -40.482 -25.544 40.844  1.00 64.79  ? 355  MET C N     1 
ATOM   6002  C  CA    . MET C 2 355  ? -40.310 -25.584 42.286  1.00 63.21  ? 355  MET C CA    1 
ATOM   6003  C  C     . MET C 2 355  ? -40.750 -24.292 42.955  1.00 71.41  ? 355  MET C C     1 
ATOM   6004  O  O     . MET C 2 355  ? -40.498 -23.199 42.454  1.00 78.29  ? 355  MET C O     1 
ATOM   6005  C  CB    . MET C 2 355  ? -38.853 -25.863 42.641  1.00 65.23  ? 355  MET C CB    1 
ATOM   6006  C  CG    . MET C 2 355  ? -38.576 -25.826 44.131  1.00 75.16  ? 355  MET C CG    1 
ATOM   6007  S  SD    . MET C 2 355  ? -36.839 -25.558 44.516  1.00 89.93  ? 355  MET C SD    1 
ATOM   6008  C  CE    . MET C 2 355  ? -36.564 -23.962 43.753  1.00 83.66  ? 355  MET C CE    1 
ATOM   6009  N  N     . THR C 2 356  ? -41.409 -24.427 44.097  1.00 82.29  ? 356  THR C N     1 
ATOM   6010  C  CA    . THR C 2 356  ? -41.722 -23.278 44.927  1.00 88.50  ? 356  THR C CA    1 
ATOM   6011  C  C     . THR C 2 356  ? -40.838 -23.295 46.173  1.00 89.68  ? 356  THR C C     1 
ATOM   6012  O  O     . THR C 2 356  ? -40.854 -24.256 46.944  1.00 88.65  ? 356  THR C O     1 
ATOM   6013  C  CB    . THR C 2 356  ? -43.208 -23.260 45.338  1.00 95.04  ? 356  THR C CB    1 
ATOM   6014  O  OG1   . THR C 2 356  ? -43.509 -24.421 46.122  1.00 105.28 ? 356  THR C OG1   1 
ATOM   6015  C  CG2   . THR C 2 356  ? -44.101 -23.254 44.107  1.00 85.88  ? 356  THR C CG2   1 
ATOM   6016  N  N     . VAL C 2 357  ? -40.047 -22.243 46.355  1.00 86.60  ? 357  VAL C N     1 
ATOM   6017  C  CA    . VAL C 2 357  ? -39.268 -22.082 47.578  1.00 89.53  ? 357  VAL C CA    1 
ATOM   6018  C  C     . VAL C 2 357  ? -40.198 -21.687 48.720  1.00 94.22  ? 357  VAL C C     1 
ATOM   6019  O  O     . VAL C 2 357  ? -40.997 -20.761 48.571  1.00 95.79  ? 357  VAL C O     1 
ATOM   6020  C  CB    . VAL C 2 357  ? -38.161 -21.015 47.420  1.00 91.24  ? 357  VAL C CB    1 
ATOM   6021  C  CG1   . VAL C 2 357  ? -37.539 -20.672 48.771  1.00 93.77  ? 357  VAL C CG1   1 
ATOM   6022  C  CG2   . VAL C 2 357  ? -37.100 -21.490 46.444  1.00 87.59  ? 357  VAL C CG2   1 
ATOM   6023  N  N     . PRO C 2 358  ? -40.105 -22.394 49.859  1.00 88.58  ? 358  PRO C N     1 
ATOM   6024  C  CA    . PRO C 2 358  ? -40.935 -22.118 51.038  1.00 89.13  ? 358  PRO C CA    1 
ATOM   6025  C  C     . PRO C 2 358  ? -40.909 -20.648 51.453  1.00 91.18  ? 358  PRO C C     1 
ATOM   6026  O  O     . PRO C 2 358  ? -39.938 -20.182 52.050  1.00 92.41  ? 358  PRO C O     1 
ATOM   6027  C  CB    . PRO C 2 358  ? -40.313 -23.005 52.124  1.00 86.76  ? 358  PRO C CB    1 
ATOM   6028  C  CG    . PRO C 2 358  ? -38.984 -23.433 51.581  1.00 85.13  ? 358  PRO C CG    1 
ATOM   6029  C  CD    . PRO C 2 358  ? -39.165 -23.498 50.104  1.00 83.09  ? 358  PRO C CD    1 
ATOM   6030  N  N     . GLY C 2 359  ? -41.981 -19.932 51.127  1.00 95.37  ? 359  GLY C N     1 
ATOM   6031  C  CA    . GLY C 2 359  ? -42.071 -18.511 51.398  1.00 91.96  ? 359  GLY C CA    1 
ATOM   6032  C  C     . GLY C 2 359  ? -41.839 -17.693 50.143  1.00 86.45  ? 359  GLY C C     1 
ATOM   6033  O  O     . GLY C 2 359  ? -41.695 -16.473 50.208  1.00 86.11  ? 359  GLY C O     1 
ATOM   6034  N  N     . GLY C 2 360  ? -41.806 -18.366 48.996  1.00 80.79  ? 360  GLY C N     1 
ATOM   6035  C  CA    . GLY C 2 360  ? -41.548 -17.703 47.730  1.00 84.05  ? 360  GLY C CA    1 
ATOM   6036  C  C     . GLY C 2 360  ? -42.376 -18.215 46.564  1.00 89.31  ? 360  GLY C C     1 
ATOM   6037  O  O     . GLY C 2 360  ? -42.776 -19.379 46.531  1.00 91.51  ? 360  GLY C O     1 
ATOM   6038  N  N     . VAL C 2 361  ? -42.621 -17.333 45.597  1.00 85.65  ? 361  VAL C N     1 
ATOM   6039  C  CA    . VAL C 2 361  ? -43.443 -17.644 44.431  1.00 85.26  ? 361  VAL C CA    1 
ATOM   6040  C  C     . VAL C 2 361  ? -42.821 -18.757 43.582  1.00 89.15  ? 361  VAL C C     1 
ATOM   6041  O  O     . VAL C 2 361  ? -41.625 -19.036 43.681  1.00 86.75  ? 361  VAL C O     1 
ATOM   6042  C  CB    . VAL C 2 361  ? -43.661 -16.379 43.563  1.00 79.18  ? 361  VAL C CB    1 
ATOM   6043  C  CG1   . VAL C 2 361  ? -42.403 -16.050 42.772  1.00 84.53  ? 361  VAL C CG1   1 
ATOM   6044  C  CG2   . VAL C 2 361  ? -44.867 -16.539 42.637  1.00 77.18  ? 361  VAL C CG2   1 
ATOM   6045  N  N     . GLU C 2 362  ? -43.644 -19.400 42.760  1.00 91.75  ? 362  GLU C N     1 
ATOM   6046  C  CA    . GLU C 2 362  ? -43.193 -20.485 41.897  1.00 88.55  ? 362  GLU C CA    1 
ATOM   6047  C  C     . GLU C 2 362  ? -42.169 -19.998 40.876  1.00 85.69  ? 362  GLU C C     1 
ATOM   6048  O  O     . GLU C 2 362  ? -42.288 -18.895 40.345  1.00 85.58  ? 362  GLU C O     1 
ATOM   6049  C  CB    . GLU C 2 362  ? -44.385 -21.118 41.187  1.00 86.89  ? 362  GLU C CB    1 
ATOM   6050  C  CG    . GLU C 2 362  ? -44.116 -22.501 40.647  1.00 80.16  ? 362  GLU C CG    1 
ATOM   6051  C  CD    . GLU C 2 362  ? -45.371 -23.167 40.142  1.00 78.24  ? 362  GLU C CD    1 
ATOM   6052  O  OE1   . GLU C 2 362  ? -46.311 -22.437 39.765  1.00 85.49  ? 362  GLU C OE1   1 
ATOM   6053  O  OE2   . GLU C 2 362  ? -45.425 -24.414 40.130  1.00 74.44  ? 362  GLU C OE2   1 
ATOM   6054  N  N     . VAL C 2 363  ? -41.161 -20.825 40.610  1.00 85.86  ? 363  VAL C N     1 
ATOM   6055  C  CA    . VAL C 2 363  ? -40.060 -20.448 39.726  1.00 85.58  ? 363  VAL C CA    1 
ATOM   6056  C  C     . VAL C 2 363  ? -39.725 -21.546 38.716  1.00 90.93  ? 363  VAL C C     1 
ATOM   6057  O  O     . VAL C 2 363  ? -39.603 -22.714 39.085  1.00 93.23  ? 363  VAL C O     1 
ATOM   6058  C  CB    . VAL C 2 363  ? -38.787 -20.120 40.534  1.00 80.24  ? 363  VAL C CB    1 
ATOM   6059  C  CG1   . VAL C 2 363  ? -37.666 -19.650 39.619  1.00 78.90  ? 363  VAL C CG1   1 
ATOM   6060  C  CG2   . VAL C 2 363  ? -39.082 -19.075 41.585  1.00 77.49  ? 363  VAL C CG2   1 
ATOM   6061  N  N     . PRO C 2 364  ? -39.576 -21.175 37.433  1.00 91.77  ? 364  PRO C N     1 
ATOM   6062  C  CA    . PRO C 2 364  ? -39.133 -22.137 36.416  1.00 89.78  ? 364  PRO C CA    1 
ATOM   6063  C  C     . PRO C 2 364  ? -37.753 -22.710 36.735  1.00 88.92  ? 364  PRO C C     1 
ATOM   6064  O  O     . PRO C 2 364  ? -36.807 -21.954 36.967  1.00 85.06  ? 364  PRO C O     1 
ATOM   6065  C  CB    . PRO C 2 364  ? -39.097 -21.302 35.128  1.00 90.19  ? 364  PRO C CB    1 
ATOM   6066  C  CG    . PRO C 2 364  ? -39.053 -19.879 35.586  1.00 87.96  ? 364  PRO C CG    1 
ATOM   6067  C  CD    . PRO C 2 364  ? -39.845 -19.849 36.853  1.00 90.59  ? 364  PRO C CD    1 
ATOM   6068  N  N     . VAL C 2 365  ? -37.648 -24.035 36.746  1.00 82.63  ? 365  VAL C N     1 
ATOM   6069  C  CA    . VAL C 2 365  ? -36.407 -24.703 37.120  1.00 80.80  ? 365  VAL C CA    1 
ATOM   6070  C  C     . VAL C 2 365  ? -35.679 -25.299 35.917  1.00 75.05  ? 365  VAL C C     1 
ATOM   6071  O  O     . VAL C 2 365  ? -36.177 -26.221 35.271  1.00 73.80  ? 365  VAL C O     1 
ATOM   6072  C  CB    . VAL C 2 365  ? -36.669 -25.818 38.148  1.00 81.16  ? 365  VAL C CB    1 
ATOM   6073  C  CG1   . VAL C 2 365  ? -35.378 -26.557 38.476  1.00 80.44  ? 365  VAL C CG1   1 
ATOM   6074  C  CG2   . VAL C 2 365  ? -37.296 -25.237 39.405  1.00 78.51  ? 365  VAL C CG2   1 
ATOM   6075  N  N     . GLU C 2 366  ? -34.495 -24.768 35.626  1.00 69.82  ? 366  GLU C N     1 
ATOM   6076  C  CA    . GLU C 2 366  ? -33.695 -25.257 34.510  1.00 67.95  ? 366  GLU C CA    1 
ATOM   6077  C  C     . GLU C 2 366  ? -32.252 -24.765 34.585  1.00 67.96  ? 366  GLU C C     1 
ATOM   6078  O  O     . GLU C 2 366  ? -31.903 -23.928 35.421  1.00 56.90  ? 366  GLU C O     1 
ATOM   6079  C  CB    . GLU C 2 366  ? -34.318 -24.835 33.178  1.00 62.12  ? 366  GLU C CB    1 
ATOM   6080  C  CG    . GLU C 2 366  ? -34.503 -23.340 33.026  1.00 62.76  ? 366  GLU C CG    1 
ATOM   6081  C  CD    . GLU C 2 366  ? -35.160 -22.968 31.716  1.00 62.52  ? 366  GLU C CD    1 
ATOM   6082  O  OE1   . GLU C 2 366  ? -35.385 -23.872 30.884  1.00 63.52  ? 366  GLU C OE1   1 
ATOM   6083  O  OE2   . GLU C 2 366  ? -35.454 -21.771 31.519  1.00 63.75  ? 366  GLU C OE2   1 
ATOM   6084  N  N     . THR C 2 367  ? -31.419 -25.303 33.701  1.00 69.40  ? 367  THR C N     1 
ATOM   6085  C  CA    . THR C 2 367  ? -30.021 -24.912 33.615  1.00 58.76  ? 367  THR C CA    1 
ATOM   6086  C  C     . THR C 2 367  ? -29.904 -23.568 32.907  1.00 57.57  ? 367  THR C C     1 
ATOM   6087  O  O     . THR C 2 367  ? -30.660 -23.282 31.979  1.00 63.58  ? 367  THR C O     1 
ATOM   6088  C  CB    . THR C 2 367  ? -29.190 -25.978 32.877  1.00 56.86  ? 367  THR C CB    1 
ATOM   6089  O  OG1   . THR C 2 367  ? -29.632 -26.082 31.518  1.00 52.82  ? 367  THR C OG1   1 
ATOM   6090  C  CG2   . THR C 2 367  ? -29.358 -27.326 33.550  1.00 61.87  ? 367  THR C CG2   1 
ATOM   6091  N  N     . ASP C 2 368  ? -28.967 -22.740 33.350  1.00 49.38  ? 368  ASP C N     1 
ATOM   6092  C  CA    . ASP C 2 368  ? -28.827 -21.402 32.790  1.00 42.65  ? 368  ASP C CA    1 
ATOM   6093  C  C     . ASP C 2 368  ? -27.785 -21.325 31.685  1.00 37.94  ? 368  ASP C C     1 
ATOM   6094  O  O     . ASP C 2 368  ? -26.776 -22.027 31.710  1.00 41.71  ? 368  ASP C O     1 
ATOM   6095  C  CB    . ASP C 2 368  ? -28.476 -20.399 33.886  1.00 41.52  ? 368  ASP C CB    1 
ATOM   6096  C  CG    . ASP C 2 368  ? -29.696 -19.896 34.620  1.00 56.19  ? 368  ASP C CG    1 
ATOM   6097  O  OD1   . ASP C 2 368  ? -30.800 -19.938 34.035  1.00 64.41  ? 368  ASP C OD1   1 
ATOM   6098  O  OD2   . ASP C 2 368  ? -29.550 -19.453 35.777  1.00 63.14  ? 368  ASP C OD2   1 
ATOM   6099  N  N     . ASP C 2 369  ? -28.047 -20.461 30.714  1.00 28.83  ? 369  ASP C N     1 
ATOM   6100  C  CA    . ASP C 2 369  ? -27.090 -20.177 29.661  1.00 22.89  ? 369  ASP C CA    1 
ATOM   6101  C  C     . ASP C 2 369  ? -26.339 -18.894 30.002  1.00 27.21  ? 369  ASP C C     1 
ATOM   6102  O  O     . ASP C 2 369  ? -26.952 -17.867 30.277  1.00 35.76  ? 369  ASP C O     1 
ATOM   6103  C  CB    . ASP C 2 369  ? -27.799 -20.056 28.315  1.00 22.43  ? 369  ASP C CB    1 
ATOM   6104  C  CG    . ASP C 2 369  ? -26.862 -19.666 27.200  1.00 29.89  ? 369  ASP C CG    1 
ATOM   6105  O  OD1   . ASP C 2 369  ? -27.310 -18.961 26.271  1.00 33.03  ? 369  ASP C OD1   1 
ATOM   6106  O  OD2   . ASP C 2 369  ? -25.679 -20.062 27.252  1.00 34.96  ? 369  ASP C OD2   1 
ATOM   6107  N  N     . ILE C 2 370  ? -25.013 -18.954 29.986  1.00 22.66  ? 370  ILE C N     1 
ATOM   6108  C  CA    . ILE C 2 370  ? -24.191 -17.839 30.450  1.00 22.18  ? 370  ILE C CA    1 
ATOM   6109  C  C     . ILE C 2 370  ? -24.172 -16.668 29.470  1.00 25.00  ? 370  ILE C C     1 
ATOM   6110  O  O     . ILE C 2 370  ? -23.838 -15.544 29.835  1.00 28.40  ? 370  ILE C O     1 
ATOM   6111  C  CB    . ILE C 2 370  ? -22.741 -18.295 30.710  1.00 27.10  ? 370  ILE C CB    1 
ATOM   6112  C  CG1   . ILE C 2 370  ? -21.978 -17.238 31.508  1.00 36.56  ? 370  ILE C CG1   1 
ATOM   6113  C  CG2   . ILE C 2 370  ? -22.035 -18.617 29.400  1.00 46.53  ? 370  ILE C CG2   1 
ATOM   6114  C  CD1   . ILE C 2 370  ? -20.516 -17.539 31.656  1.00 61.92  ? 370  ILE C CD1   1 
ATOM   6115  N  N     . ASP C 2 371  ? -24.552 -16.931 28.226  1.00 26.31  ? 371  ASP C N     1 
ATOM   6116  C  CA    . ASP C 2 371  ? -24.456 -15.926 27.173  1.00 29.23  ? 371  ASP C CA    1 
ATOM   6117  C  C     . ASP C 2 371  ? -25.769 -15.190 26.925  1.00 26.99  ? 371  ASP C C     1 
ATOM   6118  O  O     . ASP C 2 371  ? -25.807 -14.214 26.176  1.00 23.61  ? 371  ASP C O     1 
ATOM   6119  C  CB    . ASP C 2 371  ? -23.977 -16.578 25.878  1.00 33.81  ? 371  ASP C CB    1 
ATOM   6120  C  CG    . ASP C 2 371  ? -22.495 -16.879 25.896  1.00 42.38  ? 371  ASP C CG    1 
ATOM   6121  O  OD1   . ASP C 2 371  ? -21.723 -15.965 26.244  1.00 52.86  ? 371  ASP C OD1   1 
ATOM   6122  O  OD2   . ASP C 2 371  ? -22.101 -18.021 25.575  1.00 43.67  ? 371  ASP C OD2   1 
ATOM   6123  N  N     . HIS C 2 372  ? -26.840 -15.669 27.551  1.00 28.51  ? 372  HIS C N     1 
ATOM   6124  C  CA    . HIS C 2 372  ? -28.155 -15.043 27.448  1.00 23.17  ? 372  HIS C CA    1 
ATOM   6125  C  C     . HIS C 2 372  ? -28.107 -13.617 27.978  1.00 20.02  ? 372  HIS C C     1 
ATOM   6126  O  O     . HIS C 2 372  ? -27.663 -13.382 29.100  1.00 20.83  ? 372  HIS C O     1 
ATOM   6127  C  CB    . HIS C 2 372  ? -29.193 -15.862 28.220  1.00 28.00  ? 372  HIS C CB    1 
ATOM   6128  C  CG    . HIS C 2 372  ? -30.601 -15.650 27.759  1.00 29.24  ? 372  HIS C CG    1 
ATOM   6129  N  ND1   . HIS C 2 372  ? -31.288 -14.476 27.976  1.00 31.89  ? 372  HIS C ND1   1 
ATOM   6130  C  CD2   . HIS C 2 372  ? -31.454 -16.472 27.102  1.00 32.57  ? 372  HIS C CD2   1 
ATOM   6131  C  CE1   . HIS C 2 372  ? -32.504 -14.581 27.467  1.00 35.57  ? 372  HIS C CE1   1 
ATOM   6132  N  NE2   . HIS C 2 372  ? -32.629 -15.781 26.932  1.00 36.57  ? 372  HIS C NE2   1 
ATOM   6133  N  N     . PHE C 2 373  ? -28.582 -12.666 27.180  1.00 17.81  ? 373  PHE C N     1 
ATOM   6134  C  CA    . PHE C 2 373  ? -28.497 -11.253 27.546  1.00 18.94  ? 373  PHE C CA    1 
ATOM   6135  C  C     . PHE C 2 373  ? -29.298 -10.899 28.795  1.00 17.96  ? 373  PHE C C     1 
ATOM   6136  O  O     . PHE C 2 373  ? -29.359 -9.737  29.196  1.00 15.82  ? 373  PHE C O     1 
ATOM   6137  C  CB    . PHE C 2 373  ? -28.956 -10.377 26.387  1.00 20.96  ? 373  PHE C CB    1 
ATOM   6138  C  CG    . PHE C 2 373  ? -27.831 -9.845  25.554  1.00 19.37  ? 373  PHE C CG    1 
ATOM   6139  C  CD1   . PHE C 2 373  ? -28.054 -8.856  24.615  1.00 16.72  ? 373  PHE C CD1   1 
ATOM   6140  C  CD2   . PHE C 2 373  ? -26.548 -10.334 25.712  1.00 20.47  ? 373  PHE C CD2   1 
ATOM   6141  C  CE1   . PHE C 2 373  ? -27.020 -8.363  23.853  1.00 16.07  ? 373  PHE C CE1   1 
ATOM   6142  C  CE2   . PHE C 2 373  ? -25.509 -9.847  24.952  1.00 21.27  ? 373  PHE C CE2   1 
ATOM   6143  C  CZ    . PHE C 2 373  ? -25.745 -8.858  24.020  1.00 15.99  ? 373  PHE C CZ    1 
ATOM   6144  N  N     . GLY C 2 374  ? -29.917 -11.905 29.400  1.00 18.91  ? 374  GLY C N     1 
ATOM   6145  C  CA    . GLY C 2 374  ? -30.565 -11.741 30.684  1.00 24.25  ? 374  GLY C CA    1 
ATOM   6146  C  C     . GLY C 2 374  ? -29.610 -12.177 31.774  1.00 21.82  ? 374  GLY C C     1 
ATOM   6147  O  O     . GLY C 2 374  ? -29.829 -11.914 32.952  1.00 26.26  ? 374  GLY C O     1 
ATOM   6148  N  N     . ASN C 2 375  ? -28.543 -12.856 31.373  1.00 18.98  ? 375  ASN C N     1 
ATOM   6149  C  CA    . ASN C 2 375  ? -27.513 -13.269 32.312  1.00 22.15  ? 375  ASN C CA    1 
ATOM   6150  C  C     . ASN C 2 375  ? -26.182 -12.618 31.964  1.00 24.42  ? 375  ASN C C     1 
ATOM   6151  O  O     . ASN C 2 375  ? -25.191 -12.770 32.679  1.00 29.41  ? 375  ASN C O     1 
ATOM   6152  C  CB    . ASN C 2 375  ? -27.391 -14.790 32.328  1.00 25.02  ? 375  ASN C CB    1 
ATOM   6153  C  CG    . ASN C 2 375  ? -28.685 -15.467 32.731  1.00 33.14  ? 375  ASN C CG    1 
ATOM   6154  O  OD1   . ASN C 2 375  ? -29.505 -14.881 33.434  1.00 35.63  ? 375  ASN C OD1   1 
ATOM   6155  N  ND2   . ASN C 2 375  ? -28.879 -16.702 32.282  1.00 40.17  ? 375  ASN C ND2   1 
ATOM   6156  N  N     . ARG C 2 376  ? -26.170 -11.882 30.860  1.00 21.80  ? 376  ARG C N     1 
ATOM   6157  C  CA    . ARG C 2 376  ? -24.998 -11.114 30.475  1.00 17.55  ? 376  ARG C CA    1 
ATOM   6158  C  C     . ARG C 2 376  ? -25.266 -9.636  30.678  1.00 20.95  ? 376  ARG C C     1 
ATOM   6159  O  O     . ARG C 2 376  ? -26.197 -9.076  30.100  1.00 21.78  ? 376  ARG C O     1 
ATOM   6160  C  CB    . ARG C 2 376  ? -24.625 -11.390 29.027  1.00 25.53  ? 376  ARG C CB    1 
ATOM   6161  C  CG    . ARG C 2 376  ? -23.314 -10.768 28.613  1.00 31.98  ? 376  ARG C CG    1 
ATOM   6162  C  CD    . ARG C 2 376  ? -22.610 -11.658 27.611  1.00 36.68  ? 376  ARG C CD    1 
ATOM   6163  N  NE    . ARG C 2 376  ? -21.245 -11.221 27.349  1.00 24.70  ? 376  ARG C NE    1 
ATOM   6164  C  CZ    . ARG C 2 376  ? -20.752 -11.044 26.131  1.00 16.48  ? 376  ARG C CZ    1 
ATOM   6165  N  NH1   . ARG C 2 376  ? -21.515 -11.270 25.073  1.00 24.66  ? 376  ARG C NH1   1 
ATOM   6166  N  NH2   . ARG C 2 376  ? -19.501 -10.643 25.973  1.00 6.63   ? 376  ARG C NH2   1 
ATOM   6167  N  N     . ARG C 2 377  ? -24.440 -9.002  31.496  1.00 21.46  ? 377  ARG C N     1 
ATOM   6168  C  CA    . ARG C 2 377  ? -24.740 -7.658  31.960  1.00 18.77  ? 377  ARG C CA    1 
ATOM   6169  C  C     . ARG C 2 377  ? -24.003 -6.571  31.188  1.00 10.71  ? 377  ARG C C     1 
ATOM   6170  O  O     . ARG C 2 377  ? -22.844 -6.739  30.808  1.00 17.00  ? 377  ARG C O     1 
ATOM   6171  C  CB    . ARG C 2 377  ? -24.417 -7.554  33.444  1.00 21.14  ? 377  ARG C CB    1 
ATOM   6172  C  CG    . ARG C 2 377  ? -24.968 -6.325  34.106  1.00 15.59  ? 377  ARG C CG    1 
ATOM   6173  C  CD    . ARG C 2 377  ? -24.906 -6.482  35.598  1.00 14.54  ? 377  ARG C CD    1 
ATOM   6174  N  NE    . ARG C 2 377  ? -25.128 -5.208  36.261  1.00 17.34  ? 377  ARG C NE    1 
ATOM   6175  C  CZ    . ARG C 2 377  ? -24.169 -4.326  36.509  1.00 16.65  ? 377  ARG C CZ    1 
ATOM   6176  N  NH1   . ARG C 2 377  ? -22.919 -4.584  36.150  1.00 16.42  ? 377  ARG C NH1   1 
ATOM   6177  N  NH2   . ARG C 2 377  ? -24.460 -3.187  37.119  1.00 17.99  ? 377  ARG C NH2   1 
ATOM   6178  N  N     . LEU C 2 378  ? -24.686 -5.454  30.974  1.00 8.97   ? 378  LEU C N     1 
ATOM   6179  C  CA    . LEU C 2 378  ? -24.126 -4.342  30.227  1.00 6.96   ? 378  LEU C CA    1 
ATOM   6180  C  C     . LEU C 2 378  ? -23.853 -3.153  31.156  1.00 9.96   ? 378  LEU C C     1 
ATOM   6181  O  O     . LEU C 2 378  ? -24.763 -2.386  31.481  1.00 15.89  ? 378  LEU C O     1 
ATOM   6182  C  CB    . LEU C 2 378  ? -25.082 -3.961  29.094  1.00 8.85   ? 378  LEU C CB    1 
ATOM   6183  C  CG    . LEU C 2 378  ? -24.628 -3.022  27.975  1.00 4.38   ? 378  LEU C CG    1 
ATOM   6184  C  CD1   . LEU C 2 378  ? -24.899 -1.590  28.364  1.00 3.25   ? 378  LEU C CD1   1 
ATOM   6185  C  CD2   . LEU C 2 378  ? -23.165 -3.227  27.626  1.00 7.91   ? 378  LEU C CD2   1 
ATOM   6186  N  N     . ARG C 2 379  ? -22.601 -3.012  31.587  1.00 7.81   ? 379  ARG C N     1 
ATOM   6187  C  CA    . ARG C 2 379  ? -22.227 -1.960  32.530  1.00 3.83   ? 379  ARG C CA    1 
ATOM   6188  C  C     . ARG C 2 379  ? -21.820 -0.661  31.825  1.00 2.52   ? 379  ARG C C     1 
ATOM   6189  O  O     . ARG C 2 379  ? -20.688 -0.509  31.373  1.00 1.31   ? 379  ARG C O     1 
ATOM   6190  C  CB    . ARG C 2 379  ? -21.099 -2.444  33.447  1.00 4.71   ? 379  ARG C CB    1 
ATOM   6191  C  CG    . ARG C 2 379  ? -19.906 -3.075  32.748  1.00 5.45   ? 379  ARG C CG    1 
ATOM   6192  C  CD    . ARG C 2 379  ? -18.638 -2.921  33.583  1.00 11.58  ? 379  ARG C CD    1 
ATOM   6193  N  NE    . ARG C 2 379  ? -18.447 -4.011  34.533  1.00 8.00   ? 379  ARG C NE    1 
ATOM   6194  C  CZ    . ARG C 2 379  ? -17.505 -4.028  35.473  1.00 8.35   ? 379  ARG C CZ    1 
ATOM   6195  N  NH1   . ARG C 2 379  ? -16.666 -3.007  35.603  1.00 7.53   ? 379  ARG C NH1   1 
ATOM   6196  N  NH2   . ARG C 2 379  ? -17.405 -5.067  36.290  1.00 10.42  ? 379  ARG C NH2   1 
ATOM   6197  N  N     . THR C 2 380  ? -22.752 0.284   31.758  1.00 8.31   ? 380  THR C N     1 
ATOM   6198  C  CA    . THR C 2 380  ? -22.570 1.517   30.996  1.00 1.76   ? 380  THR C CA    1 
ATOM   6199  C  C     . THR C 2 380  ? -21.516 2.459   31.561  1.00 0.63   ? 380  THR C C     1 
ATOM   6200  O  O     . THR C 2 380  ? -20.745 2.098   32.452  1.00 1.47   ? 380  THR C O     1 
ATOM   6201  C  CB    . THR C 2 380  ? -23.884 2.292   30.897  1.00 2.06   ? 380  THR C CB    1 
ATOM   6202  O  OG1   . THR C 2 380  ? -24.601 2.168   32.130  1.00 3.36   ? 380  THR C OG1   1 
ATOM   6203  C  CG2   . THR C 2 380  ? -24.736 1.725   29.790  1.00 9.25   ? 380  THR C CG2   1 
ATOM   6204  N  N     . VAL C 2 381  ? -21.500 3.677   31.028  1.00 0.84   ? 381  VAL C N     1 
ATOM   6205  C  CA    . VAL C 2 381  ? -20.504 4.679   31.403  1.00 5.48   ? 381  VAL C CA    1 
ATOM   6206  C  C     . VAL C 2 381  ? -20.597 5.061   32.874  1.00 4.65   ? 381  VAL C C     1 
ATOM   6207  O  O     . VAL C 2 381  ? -19.585 5.211   33.552  1.00 4.44   ? 381  VAL C O     1 
ATOM   6208  C  CB    . VAL C 2 381  ? -20.647 5.959   30.563  1.00 4.92   ? 381  VAL C CB    1 
ATOM   6209  C  CG1   . VAL C 2 381  ? -19.512 6.928   30.880  1.00 11.38  ? 381  VAL C CG1   1 
ATOM   6210  C  CG2   . VAL C 2 381  ? -20.671 5.621   29.082  1.00 6.80   ? 381  VAL C CG2   1 
ATOM   6211  N  N     . GLY C 2 382  ? -21.820 5.224   33.358  1.00 5.68   ? 382  GLY C N     1 
ATOM   6212  C  CA    . GLY C 2 382  ? -22.046 5.587   34.743  1.00 4.91   ? 382  GLY C CA    1 
ATOM   6213  C  C     . GLY C 2 382  ? -21.439 4.589   35.709  1.00 4.74   ? 382  GLY C C     1 
ATOM   6214  O  O     . GLY C 2 382  ? -20.824 4.972   36.702  1.00 8.18   ? 382  GLY C O     1 
ATOM   6215  N  N     . GLU C 2 383  ? -21.604 3.303   35.414  1.00 2.65   ? 383  GLU C N     1 
ATOM   6216  C  CA    . GLU C 2 383  ? -21.111 2.259   36.302  1.00 2.05   ? 383  GLU C CA    1 
ATOM   6217  C  C     . GLU C 2 383  ? -19.597 2.198   36.255  1.00 2.00   ? 383  GLU C C     1 
ATOM   6218  O  O     . GLU C 2 383  ? -18.943 2.161   37.295  1.00 5.02   ? 383  GLU C O     1 
ATOM   6219  C  CB    . GLU C 2 383  ? -21.704 0.896   35.934  1.00 6.14   ? 383  GLU C CB    1 
ATOM   6220  C  CG    . GLU C 2 383  ? -21.411 -0.208  36.958  1.00 20.19  ? 383  GLU C CG    1 
ATOM   6221  C  CD    . GLU C 2 383  ? -22.031 -1.551  36.584  1.00 20.61  ? 383  GLU C CD    1 
ATOM   6222  O  OE1   . GLU C 2 383  ? -23.055 -1.558  35.866  1.00 12.60  ? 383  GLU C OE1   1 
ATOM   6223  O  OE2   . GLU C 2 383  ? -21.495 -2.601  37.002  1.00 16.00  ? 383  GLU C OE2   1 
ATOM   6224  N  N     . LEU C 2 384  ? -19.048 2.197   35.043  1.00 2.82   ? 384  LEU C N     1 
ATOM   6225  C  CA    . LEU C 2 384  ? -17.602 2.140   34.840  1.00 3.94   ? 384  LEU C CA    1 
ATOM   6226  C  C     . LEU C 2 384  ? -16.878 3.201   35.650  1.00 4.88   ? 384  LEU C C     1 
ATOM   6227  O  O     . LEU C 2 384  ? -15.839 2.939   36.252  1.00 5.89   ? 384  LEU C O     1 
ATOM   6228  C  CB    . LEU C 2 384  ? -17.261 2.308   33.359  1.00 0.18   ? 384  LEU C CB    1 
ATOM   6229  C  CG    . LEU C 2 384  ? -17.449 1.085   32.465  1.00 0.58   ? 384  LEU C CG    1 
ATOM   6230  C  CD1   . LEU C 2 384  ? -17.153 1.443   31.022  1.00 2.97   ? 384  LEU C CD1   1 
ATOM   6231  C  CD2   . LEU C 2 384  ? -16.552 -0.047  32.937  1.00 9.08   ? 384  LEU C CD2   1 
ATOM   6232  N  N     . ILE C 2 385  ? -17.446 4.401   35.658  1.00 4.34   ? 385  ILE C N     1 
ATOM   6233  C  CA    . ILE C 2 385  ? -16.891 5.514   36.411  1.00 3.19   ? 385  ILE C CA    1 
ATOM   6234  C  C     . ILE C 2 385  ? -17.178 5.351   37.900  1.00 7.88   ? 385  ILE C C     1 
ATOM   6235  O  O     . ILE C 2 385  ? -16.320 5.631   38.735  1.00 12.83  ? 385  ILE C O     1 
ATOM   6236  C  CB    . ILE C 2 385  ? -17.454 6.855   35.920  1.00 8.00   ? 385  ILE C CB    1 
ATOM   6237  C  CG1   . ILE C 2 385  ? -17.035 7.100   34.477  1.00 0.34   ? 385  ILE C CG1   1 
ATOM   6238  C  CG2   . ILE C 2 385  ? -16.963 7.989   36.785  1.00 1.76   ? 385  ILE C CG2   1 
ATOM   6239  C  CD1   . ILE C 2 385  ? -17.544 8.398   33.919  1.00 3.05   ? 385  ILE C CD1   1 
ATOM   6240  N  N     . GLN C 2 386  ? -18.378 4.884   38.234  1.00 3.75   ? 386  GLN C N     1 
ATOM   6241  C  CA    . GLN C 2 386  ? -18.725 4.644   39.631  1.00 5.62   ? 386  GLN C CA    1 
ATOM   6242  C  C     . GLN C 2 386  ? -17.736 3.681   40.284  1.00 9.09   ? 386  GLN C C     1 
ATOM   6243  O  O     . GLN C 2 386  ? -17.180 3.980   41.339  1.00 10.61  ? 386  GLN C O     1 
ATOM   6244  C  CB    . GLN C 2 386  ? -20.141 4.087   39.762  1.00 12.47  ? 386  GLN C CB    1 
ATOM   6245  C  CG    . GLN C 2 386  ? -20.450 3.573   41.163  1.00 22.51  ? 386  GLN C CG    1 
ATOM   6246  C  CD    . GLN C 2 386  ? -21.820 2.935   41.280  1.00 23.84  ? 386  GLN C CD    1 
ATOM   6247  O  OE1   . GLN C 2 386  ? -21.975 1.729   41.084  1.00 23.68  ? 386  GLN C OE1   1 
ATOM   6248  N  NE2   . GLN C 2 386  ? -22.822 3.742   41.605  1.00 24.31  ? 386  GLN C NE2   1 
ATOM   6249  N  N     . ASN C 2 387  ? -17.515 2.533   39.647  1.00 9.63   ? 387  ASN C N     1 
ATOM   6250  C  CA    . ASN C 2 387  ? -16.611 1.517   40.182  1.00 7.13   ? 387  ASN C CA    1 
ATOM   6251  C  C     . ASN C 2 387  ? -15.219 2.053   40.479  1.00 10.43  ? 387  ASN C C     1 
ATOM   6252  O  O     . ASN C 2 387  ? -14.601 1.671   41.470  1.00 9.40   ? 387  ASN C O     1 
ATOM   6253  C  CB    . ASN C 2 387  ? -16.508 0.342   39.217  1.00 9.91   ? 387  ASN C CB    1 
ATOM   6254  C  CG    . ASN C 2 387  ? -17.416 -0.795  39.603  1.00 14.24  ? 387  ASN C CG    1 
ATOM   6255  O  OD1   . ASN C 2 387  ? -18.212 -0.670  40.530  1.00 15.73  ? 387  ASN C OD1   1 
ATOM   6256  N  ND2   . ASN C 2 387  ? -17.308 -1.913  38.895  1.00 19.53  ? 387  ASN C ND2   1 
ATOM   6257  N  N     . GLN C 2 388  ? -14.737 2.943   39.617  1.00 9.85   ? 388  GLN C N     1 
ATOM   6258  C  CA    . GLN C 2 388  ? -13.451 3.594   39.823  1.00 5.44   ? 388  GLN C CA    1 
ATOM   6259  C  C     . GLN C 2 388  ? -13.521 4.600   40.955  1.00 9.12   ? 388  GLN C C     1 
ATOM   6260  O  O     . GLN C 2 388  ? -12.541 4.814   41.662  1.00 15.66  ? 388  GLN C O     1 
ATOM   6261  C  CB    . GLN C 2 388  ? -12.982 4.284   38.547  1.00 2.04   ? 388  GLN C CB    1 
ATOM   6262  C  CG    . GLN C 2 388  ? -12.150 3.395   37.665  1.00 5.23   ? 388  GLN C CG    1 
ATOM   6263  C  CD    . GLN C 2 388  ? -10.938 2.856   38.389  1.00 6.76   ? 388  GLN C CD    1 
ATOM   6264  O  OE1   . GLN C 2 388  ? -10.953 1.736   38.899  1.00 7.91   ? 388  GLN C OE1   1 
ATOM   6265  N  NE2   . GLN C 2 388  ? -9.879  3.655   38.447  1.00 11.99  ? 388  GLN C NE2   1 
ATOM   6266  N  N     . ILE C 2 389  ? -14.677 5.228   41.121  1.00 6.71   ? 389  ILE C N     1 
ATOM   6267  C  CA    . ILE C 2 389  ? -14.865 6.129   42.241  1.00 3.17   ? 389  ILE C CA    1 
ATOM   6268  C  C     . ILE C 2 389  ? -14.822 5.338   43.538  1.00 10.10  ? 389  ILE C C     1 
ATOM   6269  O  O     . ILE C 2 389  ? -14.175 5.743   44.501  1.00 12.10  ? 389  ILE C O     1 
ATOM   6270  C  CB    . ILE C 2 389  ? -16.184 6.882   42.143  1.00 1.35   ? 389  ILE C CB    1 
ATOM   6271  C  CG1   . ILE C 2 389  ? -16.135 7.874   40.987  1.00 1.96   ? 389  ILE C CG1   1 
ATOM   6272  C  CG2   . ILE C 2 389  ? -16.461 7.615   43.432  1.00 11.74  ? 389  ILE C CG2   1 
ATOM   6273  C  CD1   . ILE C 2 389  ? -17.467 8.513   40.695  1.00 3.77   ? 389  ILE C CD1   1 
ATOM   6274  N  N     . ARG C 2 390  ? -15.489 4.188   43.541  1.00 8.63   ? 390  ARG C N     1 
ATOM   6275  C  CA    . ARG C 2 390  ? -15.545 3.334   44.724  1.00 15.56  ? 390  ARG C CA    1 
ATOM   6276  C  C     . ARG C 2 390  ? -14.143 2.890   45.148  1.00 14.66  ? 390  ARG C C     1 
ATOM   6277  O  O     . ARG C 2 390  ? -13.869 2.724   46.339  1.00 10.84  ? 390  ARG C O     1 
ATOM   6278  C  CB    . ARG C 2 390  ? -16.438 2.114   44.469  1.00 14.43  ? 390  ARG C CB    1 
ATOM   6279  C  CG    . ARG C 2 390  ? -16.686 1.252   45.700  1.00 14.64  ? 390  ARG C CG    1 
ATOM   6280  C  CD    . ARG C 2 390  ? -17.691 0.141   45.427  1.00 17.76  ? 390  ARG C CD    1 
ATOM   6281  N  NE    . ARG C 2 390  ? -19.067 0.625   45.338  1.00 25.81  ? 390  ARG C NE    1 
ATOM   6282  C  CZ    . ARG C 2 390  ? -19.707 0.867   44.198  1.00 27.72  ? 390  ARG C CZ    1 
ATOM   6283  N  NH1   . ARG C 2 390  ? -19.095 0.674   43.036  1.00 28.86  ? 390  ARG C NH1   1 
ATOM   6284  N  NH2   . ARG C 2 390  ? -20.961 1.301   44.217  1.00 27.31  ? 390  ARG C NH2   1 
ATOM   6285  N  N     . VAL C 2 391  ? -13.258 2.712   44.170  1.00 13.53  ? 391  VAL C N     1 
ATOM   6286  C  CA    . VAL C 2 391  ? -11.869 2.367   44.444  1.00 8.46   ? 391  VAL C CA    1 
ATOM   6287  C  C     . VAL C 2 391  ? -11.155 3.532   45.107  1.00 7.89   ? 391  VAL C C     1 
ATOM   6288  O  O     . VAL C 2 391  ? -10.404 3.355   46.063  1.00 12.66  ? 391  VAL C O     1 
ATOM   6289  C  CB    . VAL C 2 391  ? -11.110 1.981   43.162  1.00 5.76   ? 391  VAL C CB    1 
ATOM   6290  C  CG1   . VAL C 2 391  ? -9.639  1.763   43.466  1.00 10.06  ? 391  VAL C CG1   1 
ATOM   6291  C  CG2   . VAL C 2 391  ? -11.712 0.733   42.540  1.00 8.62   ? 391  VAL C CG2   1 
ATOM   6292  N  N     . GLY C 2 392  ? -11.401 4.727   44.592  1.00 6.31   ? 392  GLY C N     1 
ATOM   6293  C  CA    . GLY C 2 392  ? -10.787 5.923   45.130  1.00 12.42  ? 392  GLY C CA    1 
ATOM   6294  C  C     . GLY C 2 392  ? -11.180 6.140   46.576  1.00 20.02  ? 392  GLY C C     1 
ATOM   6295  O  O     . GLY C 2 392  ? -10.336 6.454   47.413  1.00 25.70  ? 392  GLY C O     1 
ATOM   6296  N  N     . MET C 2 393  ? -12.463 5.948   46.870  1.00 15.97  ? 393  MET C N     1 
ATOM   6297  C  CA    . MET C 2 393  ? -13.012 6.244   48.194  1.00 22.83  ? 393  MET C CA    1 
ATOM   6298  C  C     . MET C 2 393  ? -12.476 5.294   49.262  1.00 21.99  ? 393  MET C C     1 
ATOM   6299  O  O     . MET C 2 393  ? -12.123 5.712   50.365  1.00 17.39  ? 393  MET C O     1 
ATOM   6300  C  CB    . MET C 2 393  ? -14.546 6.183   48.166  1.00 23.44  ? 393  MET C CB    1 
ATOM   6301  C  CG    . MET C 2 393  ? -15.208 7.106   47.137  1.00 18.93  ? 393  MET C CG    1 
ATOM   6302  S  SD    . MET C 2 393  ? -15.056 8.875   47.483  1.00 24.01  ? 393  MET C SD    1 
ATOM   6303  C  CE    . MET C 2 393  ? -16.130 9.054   48.899  1.00 27.20  ? 393  MET C CE    1 
ATOM   6304  N  N     . SER C 2 394  ? -12.424 4.011   48.923  1.00 19.79  ? 394  SER C N     1 
ATOM   6305  C  CA    . SER C 2 394  ? -11.945 2.979   49.836  1.00 25.21  ? 394  SER C CA    1 
ATOM   6306  C  C     . SER C 2 394  ? -10.500 3.209   50.261  1.00 23.29  ? 394  SER C C     1 
ATOM   6307  O  O     . SER C 2 394  ? -10.104 2.855   51.372  1.00 27.73  ? 394  SER C O     1 
ATOM   6308  C  CB    . SER C 2 394  ? -12.072 1.611   49.179  1.00 29.46  ? 394  SER C CB    1 
ATOM   6309  O  OG    . SER C 2 394  ? -11.378 1.608   47.945  1.00 31.60  ? 394  SER C OG    1 
ATOM   6310  N  N     . ARG C 2 395  ? -9.711  3.792   49.366  1.00 23.28  ? 395  ARG C N     1 
ATOM   6311  C  CA    . ARG C 2 395  ? -8.322  4.099   49.674  1.00 24.97  ? 395  ARG C CA    1 
ATOM   6312  C  C     . ARG C 2 395  ? -8.238  5.307   50.594  1.00 27.27  ? 395  ARG C C     1 
ATOM   6313  O  O     . ARG C 2 395  ? -7.388  5.362   51.482  1.00 31.70  ? 395  ARG C O     1 
ATOM   6314  C  CB    . ARG C 2 395  ? -7.515  4.347   48.396  1.00 20.94  ? 395  ARG C CB    1 
ATOM   6315  C  CG    . ARG C 2 395  ? -7.350  3.110   47.536  1.00 13.85  ? 395  ARG C CG    1 
ATOM   6316  C  CD    . ARG C 2 395  ? -6.271  3.281   46.478  1.00 10.28  ? 395  ARG C CD    1 
ATOM   6317  N  NE    . ARG C 2 395  ? -6.160  2.081   45.655  1.00 9.39   ? 395  ARG C NE    1 
ATOM   6318  C  CZ    . ARG C 2 395  ? -6.288  2.056   44.332  1.00 8.04   ? 395  ARG C CZ    1 
ATOM   6319  N  NH1   . ARG C 2 395  ? -6.518  3.176   43.657  1.00 10.86  ? 395  ARG C NH1   1 
ATOM   6320  N  NH2   . ARG C 2 395  ? -6.176  0.906   43.679  1.00 4.89   ? 395  ARG C NH2   1 
ATOM   6321  N  N     . MET C 2 396  ? -9.129  6.270   50.388  1.00 18.83  ? 396  MET C N     1 
ATOM   6322  C  CA    . MET C 2 396  ? -9.140  7.462   51.221  1.00 20.70  ? 396  MET C CA    1 
ATOM   6323  C  C     . MET C 2 396  ? -9.804  7.145   52.549  1.00 28.03  ? 396  MET C C     1 
ATOM   6324  O  O     . MET C 2 396  ? -9.671  7.898   53.512  1.00 35.89  ? 396  MET C O     1 
ATOM   6325  C  CB    . MET C 2 396  ? -9.861  8.615   50.531  1.00 21.51  ? 396  MET C CB    1 
ATOM   6326  C  CG    . MET C 2 396  ? -11.346 8.646   50.803  1.00 21.67  ? 396  MET C CG    1 
ATOM   6327  S  SD    . MET C 2 396  ? -11.915 10.323  51.073  1.00 36.74  ? 396  MET C SD    1 
ATOM   6328  C  CE    . MET C 2 396  ? -10.770 10.828  52.347  1.00 31.03  ? 396  MET C CE    1 
ATOM   6329  N  N     . GLU C 2 397  ? -10.524 6.028   52.590  1.00 26.15  ? 397  GLU C N     1 
ATOM   6330  C  CA    . GLU C 2 397  ? -11.116 5.545   53.832  1.00 30.62  ? 397  GLU C CA    1 
ATOM   6331  C  C     . GLU C 2 397  ? -10.027 4.947   54.713  1.00 28.05  ? 397  GLU C C     1 
ATOM   6332  O  O     . GLU C 2 397  ? -10.070 5.053   55.941  1.00 26.09  ? 397  GLU C O     1 
ATOM   6333  C  CB    . GLU C 2 397  ? -12.199 4.505   53.554  1.00 27.15  ? 397  GLU C CB    1 
ATOM   6334  C  CG    . GLU C 2 397  ? -12.945 4.042   54.793  1.00 25.57  ? 397  GLU C CG    1 
ATOM   6335  C  CD    . GLU C 2 397  ? -13.866 2.872   54.514  1.00 33.89  ? 397  GLU C CD    1 
ATOM   6336  O  OE1   . GLU C 2 397  ? -14.995 2.860   55.050  1.00 40.18  ? 397  GLU C OE1   1 
ATOM   6337  O  OE2   . GLU C 2 397  ? -13.458 1.962   53.763  1.00 29.59  ? 397  GLU C OE2   1 
ATOM   6338  N  N     . ARG C 2 398  ? -9.048  4.319   54.069  1.00 24.20  ? 398  ARG C N     1 
ATOM   6339  C  CA    . ARG C 2 398  ? -7.911  3.750   54.771  1.00 17.86  ? 398  ARG C CA    1 
ATOM   6340  C  C     . ARG C 2 398  ? -7.101  4.859   55.421  1.00 24.98  ? 398  ARG C C     1 
ATOM   6341  O  O     . ARG C 2 398  ? -6.697  4.752   56.575  1.00 33.10  ? 398  ARG C O     1 
ATOM   6342  C  CB    . ARG C 2 398  ? -7.034  2.947   53.819  1.00 21.16  ? 398  ARG C CB    1 
ATOM   6343  C  CG    . ARG C 2 398  ? -6.414  1.714   54.452  1.00 23.26  ? 398  ARG C CG    1 
ATOM   6344  C  CD    . ARG C 2 398  ? -5.461  1.024   53.491  1.00 21.90  ? 398  ARG C CD    1 
ATOM   6345  N  NE    . ARG C 2 398  ? -4.215  1.766   53.349  1.00 11.30  ? 398  ARG C NE    1 
ATOM   6346  C  CZ    . ARG C 2 398  ? -3.140  1.549   54.096  1.00 8.36   ? 398  ARG C CZ    1 
ATOM   6347  N  NH1   . ARG C 2 398  ? -2.044  2.269   53.911  1.00 12.69  ? 398  ARG C NH1   1 
ATOM   6348  N  NH2   . ARG C 2 398  ? -3.164  0.608   55.029  1.00 9.48   ? 398  ARG C NH2   1 
ATOM   6349  N  N     . VAL C 2 399  ? -6.868  5.926   54.667  1.00 23.81  ? 399  VAL C N     1 
ATOM   6350  C  CA    . VAL C 2 399  ? -6.148  7.082   55.181  1.00 25.97  ? 399  VAL C CA    1 
ATOM   6351  C  C     . VAL C 2 399  ? -6.946  7.760   56.289  1.00 25.85  ? 399  VAL C C     1 
ATOM   6352  O  O     . VAL C 2 399  ? -6.384  8.188   57.295  1.00 28.46  ? 399  VAL C O     1 
ATOM   6353  C  CB    . VAL C 2 399  ? -5.843  8.092   54.061  1.00 29.90  ? 399  VAL C CB    1 
ATOM   6354  C  CG1   . VAL C 2 399  ? -5.308  9.396   54.640  1.00 35.63  ? 399  VAL C CG1   1 
ATOM   6355  C  CG2   . VAL C 2 399  ? -4.859  7.493   53.066  1.00 26.07  ? 399  VAL C CG2   1 
ATOM   6356  N  N     . VAL C 2 400  ? -8.259  7.840   56.105  1.00 22.69  ? 400  VAL C N     1 
ATOM   6357  C  CA    . VAL C 2 400  ? -9.128  8.408   57.124  1.00 21.65  ? 400  VAL C CA    1 
ATOM   6358  C  C     . VAL C 2 400  ? -9.042  7.609   58.425  1.00 34.30  ? 400  VAL C C     1 
ATOM   6359  O  O     . VAL C 2 400  ? -8.865  8.190   59.492  1.00 45.58  ? 400  VAL C O     1 
ATOM   6360  C  CB    . VAL C 2 400  ? -10.587 8.480   56.641  1.00 18.70  ? 400  VAL C CB    1 
ATOM   6361  C  CG1   . VAL C 2 400  ? -11.550 8.418   57.810  1.00 29.26  ? 400  VAL C CG1   1 
ATOM   6362  C  CG2   . VAL C 2 400  ? -10.803 9.750   55.845  1.00 24.57  ? 400  VAL C CG2   1 
ATOM   6363  N  N     . ARG C 2 401  ? -9.136  6.283   58.343  1.00 30.67  ? 401  ARG C N     1 
ATOM   6364  C  CA    . ARG C 2 401  ? -9.030  5.454   59.545  1.00 29.84  ? 401  ARG C CA    1 
ATOM   6365  C  C     . ARG C 2 401  ? -7.626  5.500   60.134  1.00 28.84  ? 401  ARG C C     1 
ATOM   6366  O  O     . ARG C 2 401  ? -7.434  5.285   61.330  1.00 28.33  ? 401  ARG C O     1 
ATOM   6367  C  CB    . ARG C 2 401  ? -9.427  4.007   59.247  1.00 22.41  ? 401  ARG C CB    1 
ATOM   6368  C  CG    . ARG C 2 401  ? -10.922 3.774   59.332  1.00 31.86  ? 401  ARG C CG    1 
ATOM   6369  C  CD    . ARG C 2 401  ? -11.318 2.366   58.921  1.00 34.07  ? 401  ARG C CD    1 
ATOM   6370  N  NE    . ARG C 2 401  ? -12.767 2.185   58.979  1.00 40.22  ? 401  ARG C NE    1 
ATOM   6371  C  CZ    . ARG C 2 401  ? -13.417 1.142   58.474  1.00 35.63  ? 401  ARG C CZ    1 
ATOM   6372  N  NH1   . ARG C 2 401  ? -12.749 0.175   57.863  1.00 42.49  ? 401  ARG C NH1   1 
ATOM   6373  N  NH2   . ARG C 2 401  ? -14.738 1.069   58.575  1.00 35.64  ? 401  ARG C NH2   1 
ATOM   6374  N  N     . GLU C 2 402  ? -6.650  5.786   59.281  1.00 32.77  ? 402  GLU C N     1 
ATOM   6375  C  CA    . GLU C 2 402  ? -5.276  5.960   59.723  1.00 35.78  ? 402  GLU C CA    1 
ATOM   6376  C  C     . GLU C 2 402  ? -5.111  7.322   60.391  1.00 43.55  ? 402  GLU C C     1 
ATOM   6377  O  O     . GLU C 2 402  ? -4.481  7.435   61.440  1.00 54.85  ? 402  GLU C O     1 
ATOM   6378  C  CB    . GLU C 2 402  ? -4.306  5.815   58.547  1.00 30.80  ? 402  GLU C CB    1 
ATOM   6379  C  CG    . GLU C 2 402  ? -2.837  5.885   58.932  1.00 28.71  ? 402  GLU C CG    1 
ATOM   6380  C  CD    . GLU C 2 402  ? -2.440  4.810   59.924  1.00 31.57  ? 402  GLU C CD    1 
ATOM   6381  O  OE1   . GLU C 2 402  ? -2.985  3.689   59.841  1.00 28.32  ? 402  GLU C OE1   1 
ATOM   6382  O  OE2   . GLU C 2 402  ? -1.586  5.092   60.793  1.00 37.55  ? 402  GLU C OE2   1 
ATOM   6383  N  N     . ARG C 2 403  ? -5.689  8.357   59.789  1.00 41.44  ? 403  ARG C N     1 
ATOM   6384  C  CA    . ARG C 2 403  ? -5.595  9.702   60.352  1.00 41.79  ? 403  ARG C CA    1 
ATOM   6385  C  C     . ARG C 2 403  ? -6.491  9.874   61.582  1.00 43.34  ? 403  ARG C C     1 
ATOM   6386  O  O     . ARG C 2 403  ? -6.388  10.871  62.295  1.00 50.38  ? 403  ARG C O     1 
ATOM   6387  C  CB    . ARG C 2 403  ? -5.944  10.756  59.296  1.00 36.02  ? 403  ARG C CB    1 
ATOM   6388  C  CG    . ARG C 2 403  ? -4.806  11.098  58.341  1.00 25.95  ? 403  ARG C CG    1 
ATOM   6389  C  CD    . ARG C 2 403  ? -5.195  12.262  57.439  1.00 31.76  ? 403  ARG C CD    1 
ATOM   6390  N  NE    . ARG C 2 403  ? -4.085  12.754  56.628  1.00 38.97  ? 403  ARG C NE    1 
ATOM   6391  C  CZ    . ARG C 2 403  ? -4.155  13.827  55.843  1.00 42.19  ? 403  ARG C CZ    1 
ATOM   6392  N  NH1   . ARG C 2 403  ? -5.283  14.524  55.766  1.00 40.72  ? 403  ARG C NH1   1 
ATOM   6393  N  NH2   . ARG C 2 403  ? -3.100  14.208  55.136  1.00 37.05  ? 403  ARG C NH2   1 
ATOM   6394  N  N     . MET C 2 404  ? -7.366  8.906   61.835  1.00 37.30  ? 404  MET C N     1 
ATOM   6395  C  CA    . MET C 2 404  ? -8.250  8.989   62.990  1.00 41.02  ? 404  MET C CA    1 
ATOM   6396  C  C     . MET C 2 404  ? -7.515  8.650   64.277  1.00 46.46  ? 404  MET C C     1 
ATOM   6397  O  O     . MET C 2 404  ? -7.664  9.333   65.292  1.00 48.85  ? 404  MET C O     1 
ATOM   6398  C  CB    . MET C 2 404  ? -9.453  8.062   62.824  1.00 45.68  ? 404  MET C CB    1 
ATOM   6399  C  CG    . MET C 2 404  ? -10.637 8.704   62.122  1.00 47.62  ? 404  MET C CG    1 
ATOM   6400  S  SD    . MET C 2 404  ? -12.192 7.890   62.536  1.00 52.18  ? 404  MET C SD    1 
ATOM   6401  C  CE    . MET C 2 404  ? -11.851 6.221   61.991  1.00 48.13  ? 404  MET C CE    1 
ATOM   6402  N  N     . THR C 2 405  ? -6.714  7.594   64.226  1.00 51.60  ? 405  THR C N     1 
ATOM   6403  C  CA    . THR C 2 405  ? -6.043  7.091   65.416  1.00 60.65  ? 405  THR C CA    1 
ATOM   6404  C  C     . THR C 2 405  ? -4.802  7.905   65.783  1.00 59.44  ? 405  THR C C     1 
ATOM   6405  O  O     . THR C 2 405  ? -4.294  7.796   66.899  1.00 61.50  ? 405  THR C O     1 
ATOM   6406  C  CB    . THR C 2 405  ? -5.642  5.611   65.238  1.00 55.80  ? 405  THR C CB    1 
ATOM   6407  O  OG1   . THR C 2 405  ? -4.664  5.501   64.199  1.00 57.10  ? 405  THR C OG1   1 
ATOM   6408  C  CG2   . THR C 2 405  ? -6.855  4.769   64.875  1.00 42.42  ? 405  THR C CG2   1 
ATOM   6409  N  N     . THR C 2 406  ? -4.316  8.723   64.853  1.00 55.16  ? 406  THR C N     1 
ATOM   6410  C  CA    . THR C 2 406  ? -3.106  9.503   65.102  1.00 51.51  ? 406  THR C CA    1 
ATOM   6411  C  C     . THR C 2 406  ? -3.401  10.808  65.827  1.00 55.92  ? 406  THR C C     1 
ATOM   6412  O  O     . THR C 2 406  ? -2.815  11.094  66.869  1.00 61.59  ? 406  THR C O     1 
ATOM   6413  C  CB    . THR C 2 406  ? -2.354  9.831   63.800  1.00 46.41  ? 406  THR C CB    1 
ATOM   6414  O  OG1   . THR C 2 406  ? -1.814  8.629   63.241  1.00 44.04  ? 406  THR C OG1   1 
ATOM   6415  C  CG2   . THR C 2 406  ? -1.215  10.798  64.081  1.00 39.08  ? 406  THR C CG2   1 
ATOM   6416  N  N     . GLN C 2 407  ? -4.309  11.600  65.269  1.00 56.61  ? 407  GLN C N     1 
ATOM   6417  C  CA    . GLN C 2 407  ? -4.643  12.900  65.837  1.00 61.28  ? 407  GLN C CA    1 
ATOM   6418  C  C     . GLN C 2 407  ? -5.516  12.748  67.081  1.00 64.08  ? 407  GLN C C     1 
ATOM   6419  O  O     . GLN C 2 407  ? -6.139  11.707  67.286  1.00 61.58  ? 407  GLN C O     1 
ATOM   6420  C  CB    . GLN C 2 407  ? -5.349  13.766  64.792  1.00 64.81  ? 407  GLN C CB    1 
ATOM   6421  C  CG    . GLN C 2 407  ? -4.615  13.829  63.458  1.00 63.74  ? 407  GLN C CG    1 
ATOM   6422  C  CD    . GLN C 2 407  ? -5.542  14.121  62.291  1.00 63.86  ? 407  GLN C CD    1 
ATOM   6423  O  OE1   . GLN C 2 407  ? -6.711  14.463  62.479  1.00 60.01  ? 407  GLN C OE1   1 
ATOM   6424  N  NE2   . GLN C 2 407  ? -5.023  13.981  61.074  1.00 58.44  ? 407  GLN C NE2   1 
ATOM   6425  N  N     . ASP C 2 408  ? -5.550  13.788  67.908  1.00 68.81  ? 408  ASP C N     1 
ATOM   6426  C  CA    . ASP C 2 408  ? -6.377  13.796  69.111  1.00 65.63  ? 408  ASP C CA    1 
ATOM   6427  C  C     . ASP C 2 408  ? -7.838  14.088  68.777  1.00 69.90  ? 408  ASP C C     1 
ATOM   6428  O  O     . ASP C 2 408  ? -8.135  14.734  67.774  1.00 76.41  ? 408  ASP C O     1 
ATOM   6429  C  CB    . ASP C 2 408  ? -5.845  14.821  70.111  1.00 67.49  ? 408  ASP C CB    1 
ATOM   6430  C  CG    . ASP C 2 408  ? -5.353  16.085  69.438  1.00 75.24  ? 408  ASP C CG    1 
ATOM   6431  O  OD1   . ASP C 2 408  ? -4.779  15.986  68.333  1.00 69.53  ? 408  ASP C OD1   1 
ATOM   6432  O  OD2   . ASP C 2 408  ? -5.545  17.179  70.010  1.00 85.89  ? 408  ASP C OD2   1 
ATOM   6433  N  N     . VAL C 2 409  ? -8.741  13.617  69.633  1.00 67.62  ? 409  VAL C N     1 
ATOM   6434  C  CA    . VAL C 2 409  ? -10.183 13.674  69.388  1.00 73.67  ? 409  VAL C CA    1 
ATOM   6435  C  C     . VAL C 2 409  ? -10.736 15.096  69.231  1.00 77.07  ? 409  VAL C C     1 
ATOM   6436  O  O     . VAL C 2 409  ? -11.616 15.340  68.402  1.00 82.63  ? 409  VAL C O     1 
ATOM   6437  C  CB    . VAL C 2 409  ? -10.953 12.961  70.530  1.00 79.13  ? 409  VAL C CB    1 
ATOM   6438  C  CG1   . VAL C 2 409  ? -12.459 13.171  70.401  1.00 78.11  ? 409  VAL C CG1   1 
ATOM   6439  C  CG2   . VAL C 2 409  ? -10.619 11.474  70.548  1.00 79.87  ? 409  VAL C CG2   1 
ATOM   6440  N  N     . GLU C 2 410  ? -10.211 16.032  70.014  1.00 70.45  ? 410  GLU C N     1 
ATOM   6441  C  CA    . GLU C 2 410  ? -10.758 17.388  70.055  1.00 71.58  ? 410  GLU C CA    1 
ATOM   6442  C  C     . GLU C 2 410  ? -10.406 18.250  68.844  1.00 75.17  ? 410  GLU C C     1 
ATOM   6443  O  O     . GLU C 2 410  ? -11.101 19.224  68.551  1.00 76.36  ? 410  GLU C O     1 
ATOM   6444  C  CB    . GLU C 2 410  ? -10.294 18.099  71.324  1.00 78.11  ? 410  GLU C CB    1 
ATOM   6445  C  CG    . GLU C 2 410  ? -11.162 17.802  72.526  1.00 82.93  ? 410  GLU C CG    1 
ATOM   6446  C  CD    . GLU C 2 410  ? -12.616 18.126  72.267  1.00 76.81  ? 410  GLU C CD    1 
ATOM   6447  O  OE1   . GLU C 2 410  ? -13.468 17.237  72.475  1.00 72.17  ? 410  GLU C OE1   1 
ATOM   6448  O  OE2   . GLU C 2 410  ? -12.905 19.269  71.851  1.00 79.96  ? 410  GLU C OE2   1 
ATOM   6449  N  N     . ALA C 2 411  ? -9.331  17.899  68.147  1.00 80.23  ? 411  ALA C N     1 
ATOM   6450  C  CA    . ALA C 2 411  ? -8.863  18.704  67.022  1.00 83.39  ? 411  ALA C CA    1 
ATOM   6451  C  C     . ALA C 2 411  ? -9.143  18.033  65.681  1.00 77.26  ? 411  ALA C C     1 
ATOM   6452  O  O     . ALA C 2 411  ? -8.461  18.301  64.691  1.00 73.33  ? 411  ALA C O     1 
ATOM   6453  C  CB    . ALA C 2 411  ? -7.374  18.991  67.165  1.00 82.42  ? 411  ALA C CB    1 
ATOM   6454  N  N     . ILE C 2 412  ? -10.148 17.164  65.649  1.00 68.65  ? 412  ILE C N     1 
ATOM   6455  C  CA    . ILE C 2 412  ? -10.479 16.452  64.422  1.00 56.78  ? 412  ILE C CA    1 
ATOM   6456  C  C     . ILE C 2 412  ? -11.598 17.124  63.639  1.00 52.59  ? 412  ILE C C     1 
ATOM   6457  O  O     . ILE C 2 412  ? -12.754 17.155  64.063  1.00 50.86  ? 412  ILE C O     1 
ATOM   6458  C  CB    . ILE C 2 412  ? -10.880 14.995  64.698  1.00 55.26  ? 412  ILE C CB    1 
ATOM   6459  C  CG1   . ILE C 2 412  ? -9.642  14.163  65.025  1.00 57.47  ? 412  ILE C CG1   1 
ATOM   6460  C  CG2   . ILE C 2 412  ? -11.566 14.396  63.485  1.00 54.99  ? 412  ILE C CG2   1 
ATOM   6461  C  CD1   . ILE C 2 412  ? -9.922  12.683  65.152  1.00 62.25  ? 412  ILE C CD1   1 
ATOM   6462  N  N     . THR C 2 413  ? -11.227 17.676  62.492  1.00 43.89  ? 413  THR C N     1 
ATOM   6463  C  CA    . THR C 2 413  ? -12.186 18.145  61.510  1.00 37.33  ? 413  THR C CA    1 
ATOM   6464  C  C     . THR C 2 413  ? -12.134 17.194  60.338  1.00 33.07  ? 413  THR C C     1 
ATOM   6465  O  O     . THR C 2 413  ? -11.093 16.589  60.086  1.00 40.76  ? 413  THR C O     1 
ATOM   6466  C  CB    . THR C 2 413  ? -11.871 19.559  61.017  1.00 39.71  ? 413  THR C CB    1 
ATOM   6467  O  OG1   . THR C 2 413  ? -10.771 19.505  60.101  1.00 39.99  ? 413  THR C OG1   1 
ATOM   6468  C  CG2   . THR C 2 413  ? -11.519 20.465  62.182  1.00 47.63  ? 413  THR C CG2   1 
ATOM   6469  N  N     . PRO C 2 414  ? -13.246 17.056  59.608  1.00 33.02  ? 414  PRO C N     1 
ATOM   6470  C  CA    . PRO C 2 414  ? -13.155 16.233  58.403  1.00 37.00  ? 414  PRO C CA    1 
ATOM   6471  C  C     . PRO C 2 414  ? -12.082 16.752  57.451  1.00 38.28  ? 414  PRO C C     1 
ATOM   6472  O  O     . PRO C 2 414  ? -11.527 15.959  56.699  1.00 47.48  ? 414  PRO C O     1 
ATOM   6473  C  CB    . PRO C 2 414  ? -14.553 16.345  57.782  1.00 42.00  ? 414  PRO C CB    1 
ATOM   6474  C  CG    . PRO C 2 414  ? -15.205 17.489  58.466  1.00 40.26  ? 414  PRO C CG    1 
ATOM   6475  C  CD    . PRO C 2 414  ? -14.607 17.566  59.828  1.00 41.46  ? 414  PRO C CD    1 
ATOM   6476  N  N     . GLN C 2 415  ? -11.773 18.046  57.506  1.00 37.63  ? 415  GLN C N     1 
ATOM   6477  C  CA    . GLN C 2 415  ? -10.726 18.609  56.656  1.00 40.94  ? 415  GLN C CA    1 
ATOM   6478  C  C     . GLN C 2 415  ? -9.376  17.959  56.921  1.00 39.22  ? 415  GLN C C     1 
ATOM   6479  O  O     . GLN C 2 415  ? -8.549  17.825  56.018  1.00 39.83  ? 415  GLN C O     1 
ATOM   6480  C  CB    . GLN C 2 415  ? -10.612 20.124  56.855  1.00 47.25  ? 415  GLN C CB    1 
ATOM   6481  C  CG    . GLN C 2 415  ? -11.782 20.931  56.305  1.00 53.36  ? 415  GLN C CG    1 
ATOM   6482  C  CD    . GLN C 2 415  ? -11.867 20.911  54.785  1.00 52.79  ? 415  GLN C CD    1 
ATOM   6483  O  OE1   . GLN C 2 415  ? -11.063 20.269  54.112  1.00 53.85  ? 415  GLN C OE1   1 
ATOM   6484  N  NE2   . GLN C 2 415  ? -12.849 21.621  54.239  1.00 48.97  ? 415  GLN C NE2   1 
ATOM   6485  N  N     . THR C 2 416  ? -9.158  17.555  58.165  1.00 37.29  ? 416  THR C N     1 
ATOM   6486  C  CA    . THR C 2 416  ? -7.902  16.930  58.541  1.00 37.17  ? 416  THR C CA    1 
ATOM   6487  C  C     . THR C 2 416  ? -7.928  15.433  58.244  1.00 35.26  ? 416  THR C C     1 
ATOM   6488  O  O     . THR C 2 416  ? -6.919  14.859  57.843  1.00 35.66  ? 416  THR C O     1 
ATOM   6489  C  CB    . THR C 2 416  ? -7.586  17.169  60.028  1.00 39.22  ? 416  THR C CB    1 
ATOM   6490  O  OG1   . THR C 2 416  ? -8.742  16.869  60.819  1.00 47.74  ? 416  THR C OG1   1 
ATOM   6491  C  CG2   . THR C 2 416  ? -7.204  18.623  60.254  1.00 39.12  ? 416  THR C CG2   1 
ATOM   6492  N  N     . LEU C 2 417  ? -9.088  14.811  58.424  1.00 37.60  ? 417  LEU C N     1 
ATOM   6493  C  CA    . LEU C 2 417  ? -9.233  13.379  58.177  1.00 39.11  ? 417  LEU C CA    1 
ATOM   6494  C  C     . LEU C 2 417  ? -9.170  13.053  56.693  1.00 39.77  ? 417  LEU C C     1 
ATOM   6495  O  O     . LEU C 2 417  ? -8.644  12.014  56.293  1.00 41.03  ? 417  LEU C O     1 
ATOM   6496  C  CB    . LEU C 2 417  ? -10.555 12.860  58.746  1.00 36.95  ? 417  LEU C CB    1 
ATOM   6497  C  CG    . LEU C 2 417  ? -10.765 12.914  60.256  1.00 36.97  ? 417  LEU C CG    1 
ATOM   6498  C  CD1   . LEU C 2 417  ? -12.110 12.311  60.603  1.00 41.60  ? 417  LEU C CD1   1 
ATOM   6499  C  CD2   . LEU C 2 417  ? -9.647  12.188  60.979  1.00 41.26  ? 417  LEU C CD2   1 
ATOM   6500  N  N     . ILE C 2 418  ? -9.711  13.953  55.883  1.00 35.80  ? 418  ILE C N     1 
ATOM   6501  C  CA    . ILE C 2 418  ? -9.920  13.684  54.470  1.00 28.99  ? 418  ILE C CA    1 
ATOM   6502  C  C     . ILE C 2 418  ? -8.708  14.012  53.612  1.00 27.60  ? 418  ILE C C     1 
ATOM   6503  O  O     . ILE C 2 418  ? -8.174  15.118  53.660  1.00 26.69  ? 418  ILE C O     1 
ATOM   6504  C  CB    . ILE C 2 418  ? -11.135 14.469  53.944  1.00 22.76  ? 418  ILE C CB    1 
ATOM   6505  C  CG1   . ILE C 2 418  ? -12.427 13.893  54.525  1.00 20.98  ? 418  ILE C CG1   1 
ATOM   6506  C  CG2   . ILE C 2 418  ? -11.188 14.434  52.433  1.00 23.93  ? 418  ILE C CG2   1 
ATOM   6507  C  CD1   . ILE C 2 418  ? -13.660 14.675  54.155  1.00 20.80  ? 418  ILE C CD1   1 
ATOM   6508  N  N     . ASN C 2 419  ? -8.271  13.024  52.839  1.00 23.49  ? 419  ASN C N     1 
ATOM   6509  C  CA    . ASN C 2 419  ? -7.291  13.244  51.791  1.00 19.72  ? 419  ASN C CA    1 
ATOM   6510  C  C     . ASN C 2 419  ? -7.888  12.791  50.468  1.00 16.94  ? 419  ASN C C     1 
ATOM   6511  O  O     . ASN C 2 419  ? -8.188  11.613  50.274  1.00 19.82  ? 419  ASN C O     1 
ATOM   6512  C  CB    . ASN C 2 419  ? -5.994  12.503  52.086  1.00 21.46  ? 419  ASN C CB    1 
ATOM   6513  C  CG    . ASN C 2 419  ? -4.891  12.856  51.114  1.00 19.42  ? 419  ASN C CG    1 
ATOM   6514  O  OD1   . ASN C 2 419  ? -4.833  13.970  50.598  1.00 19.24  ? 419  ASN C OD1   1 
ATOM   6515  N  ND2   . ASN C 2 419  ? -4.008  11.901  50.853  1.00 16.47  ? 419  ASN C ND2   1 
ATOM   6516  N  N     . ILE C 2 420  ? -8.082  13.740  49.566  1.00 17.68  ? 420  ILE C N     1 
ATOM   6517  C  CA    . ILE C 2 420  ? -8.814  13.479  48.341  1.00 14.35  ? 420  ILE C CA    1 
ATOM   6518  C  C     . ILE C 2 420  ? -7.901  13.018  47.222  1.00 13.81  ? 420  ILE C C     1 
ATOM   6519  O  O     . ILE C 2 420  ? -8.367  12.611  46.162  1.00 13.21  ? 420  ILE C O     1 
ATOM   6520  C  CB    . ILE C 2 420  ? -9.565  14.728  47.887  1.00 14.63  ? 420  ILE C CB    1 
ATOM   6521  C  CG1   . ILE C 2 420  ? -8.598  15.905  47.775  1.00 12.44  ? 420  ILE C CG1   1 
ATOM   6522  C  CG2   . ILE C 2 420  ? -10.659 15.068  48.873  1.00 19.16  ? 420  ILE C CG2   1 
ATOM   6523  C  CD1   . ILE C 2 420  ? -9.280  17.195  47.439  1.00 21.11  ? 420  ILE C CD1   1 
ATOM   6524  N  N     . ARG C 2 421  ? -6.598  13.084  47.467  1.00 17.11  ? 421  ARG C N     1 
ATOM   6525  C  CA    . ARG C 2 421  ? -5.607  12.776  46.444  1.00 14.54  ? 421  ARG C CA    1 
ATOM   6526  C  C     . ARG C 2 421  ? -5.804  11.402  45.783  1.00 9.68   ? 421  ARG C C     1 
ATOM   6527  O  O     . ARG C 2 421  ? -5.653  11.297  44.567  1.00 9.82   ? 421  ARG C O     1 
ATOM   6528  C  CB    . ARG C 2 421  ? -4.196  12.888  47.029  1.00 23.56  ? 421  ARG C CB    1 
ATOM   6529  C  CG    . ARG C 2 421  ? -3.091  12.825  45.990  1.00 28.75  ? 421  ARG C CG    1 
ATOM   6530  C  CD    . ARG C 2 421  ? -1.931  13.755  46.344  1.00 43.85  ? 421  ARG C CD    1 
ATOM   6531  N  NE    . ARG C 2 421  ? -1.646  13.783  47.777  1.00 54.67  ? 421  ARG C NE    1 
ATOM   6532  C  CZ    . ARG C 2 421  ? -1.590  14.896  48.504  1.00 48.60  ? 421  ARG C CZ    1 
ATOM   6533  N  NH1   . ARG C 2 421  ? -1.798  16.077  47.932  1.00 44.72  ? 421  ARG C NH1   1 
ATOM   6534  N  NH2   . ARG C 2 421  ? -1.322  14.831  49.802  1.00 43.70  ? 421  ARG C NH2   1 
ATOM   6535  N  N     . PRO C 2 422  ? -6.148  10.351  46.561  1.00 12.04  ? 422  PRO C N     1 
ATOM   6536  C  CA    . PRO C 2 422  ? -6.431  9.086   45.870  1.00 14.65  ? 422  PRO C CA    1 
ATOM   6537  C  C     . PRO C 2 422  ? -7.735  9.108   45.075  1.00 16.25  ? 422  PRO C C     1 
ATOM   6538  O  O     . PRO C 2 422  ? -7.875  8.314   44.144  1.00 20.93  ? 422  PRO C O     1 
ATOM   6539  C  CB    . PRO C 2 422  ? -6.523  8.066   47.013  1.00 11.30  ? 422  PRO C CB    1 
ATOM   6540  C  CG    . PRO C 2 422  ? -5.814  8.688   48.144  1.00 19.69  ? 422  PRO C CG    1 
ATOM   6541  C  CD    . PRO C 2 422  ? -6.093  10.153  48.019  1.00 21.16  ? 422  PRO C CD    1 
ATOM   6542  N  N     . VAL C 2 423  ? -8.674  9.981   45.433  1.00 19.58  ? 423  VAL C N     1 
ATOM   6543  C  CA    . VAL C 2 423  ? -9.905  10.106  44.655  1.00 10.90  ? 423  VAL C CA    1 
ATOM   6544  C  C     . VAL C 2 423  ? -9.605  10.744  43.312  1.00 10.45  ? 423  VAL C C     1 
ATOM   6545  O  O     . VAL C 2 423  ? -10.056 10.275  42.270  1.00 12.30  ? 423  VAL C O     1 
ATOM   6546  C  CB    . VAL C 2 423  ? -10.971 10.947  45.371  1.00 5.50   ? 423  VAL C CB    1 
ATOM   6547  C  CG1   . VAL C 2 423  ? -12.040 11.390  44.387  1.00 1.07   ? 423  VAL C CG1   1 
ATOM   6548  C  CG2   . VAL C 2 423  ? -11.590 10.161  46.504  1.00 13.21  ? 423  VAL C CG2   1 
ATOM   6549  N  N     . VAL C 2 424  ? -8.831  11.820  43.343  1.00 12.45  ? 424  VAL C N     1 
ATOM   6550  C  CA    . VAL C 2 424  ? -8.498  12.542  42.125  1.00 11.83  ? 424  VAL C CA    1 
ATOM   6551  C  C     . VAL C 2 424  ? -7.651  11.669  41.206  1.00 10.88  ? 424  VAL C C     1 
ATOM   6552  O  O     . VAL C 2 424  ? -7.743  11.757  39.983  1.00 10.77  ? 424  VAL C O     1 
ATOM   6553  C  CB    . VAL C 2 424  ? -7.749  13.851  42.435  1.00 11.48  ? 424  VAL C CB    1 
ATOM   6554  C  CG1   . VAL C 2 424  ? -7.563  14.664  41.165  1.00 16.01  ? 424  VAL C CG1   1 
ATOM   6555  C  CG2   . VAL C 2 424  ? -8.509  14.658  43.479  1.00 10.46  ? 424  VAL C CG2   1 
ATOM   6556  N  N     . ALA C 2 425  ? -6.833  10.812  41.802  1.00 11.31  ? 425  ALA C N     1 
ATOM   6557  C  CA    . ALA C 2 425  ? -5.939  9.969   41.026  1.00 9.75   ? 425  ALA C CA    1 
ATOM   6558  C  C     . ALA C 2 425  ? -6.697  8.826   40.364  1.00 6.69   ? 425  ALA C C     1 
ATOM   6559  O  O     . ALA C 2 425  ? -6.430  8.481   39.218  1.00 11.19  ? 425  ALA C O     1 
ATOM   6560  C  CB    . ALA C 2 425  ? -4.825  9.431   41.905  1.00 16.58  ? 425  ALA C CB    1 
ATOM   6561  N  N     . ALA C 2 426  ? -7.654  8.254   41.086  1.00 6.08   ? 426  ALA C N     1 
ATOM   6562  C  CA    . ALA C 2 426  ? -8.386  7.086   40.605  1.00 9.73   ? 426  ALA C CA    1 
ATOM   6563  C  C     . ALA C 2 426  ? -9.221  7.386   39.361  1.00 9.26   ? 426  ALA C C     1 
ATOM   6564  O  O     . ALA C 2 426  ? -9.344  6.548   38.465  1.00 6.62   ? 426  ALA C O     1 
ATOM   6565  C  CB    . ALA C 2 426  ? -9.268  6.538   41.707  1.00 11.31  ? 426  ALA C CB    1 
ATOM   6566  N  N     . ILE C 2 427  ? -9.801  8.578   39.302  1.00 9.96   ? 427  ILE C N     1 
ATOM   6567  C  CA    . ILE C 2 427  ? -10.551 8.965   38.119  1.00 5.52   ? 427  ILE C CA    1 
ATOM   6568  C  C     . ILE C 2 427  ? -9.591  9.256   36.974  1.00 6.18   ? 427  ILE C C     1 
ATOM   6569  O  O     . ILE C 2 427  ? -9.724  8.692   35.888  1.00 4.60   ? 427  ILE C O     1 
ATOM   6570  C  CB    . ILE C 2 427  ? -11.448 10.195  38.381  1.00 1.07   ? 427  ILE C CB    1 
ATOM   6571  C  CG1   . ILE C 2 427  ? -10.738 11.211  39.279  1.00 4.94   ? 427  ILE C CG1   1 
ATOM   6572  C  CG2   . ILE C 2 427  ? -12.751 9.767   39.028  1.00 3.50   ? 427  ILE C CG2   1 
ATOM   6573  C  CD1   . ILE C 2 427  ? -10.492 12.556  38.623  1.00 2.86   ? 427  ILE C CD1   1 
ATOM   6574  N  N     . LYS C 2 428  ? -8.609  10.115  37.239  1.00 5.58   ? 428  LYS C N     1 
ATOM   6575  C  CA    . LYS C 2 428  ? -7.651  10.566  36.233  1.00 4.90   ? 428  LYS C CA    1 
ATOM   6576  C  C     . LYS C 2 428  ? -6.925  9.384   35.618  1.00 7.63   ? 428  LYS C C     1 
ATOM   6577  O  O     . LYS C 2 428  ? -6.538  9.414   34.452  1.00 10.68  ? 428  LYS C O     1 
ATOM   6578  C  CB    . LYS C 2 428  ? -6.646  11.548  36.853  1.00 9.11   ? 428  LYS C CB    1 
ATOM   6579  C  CG    . LYS C 2 428  ? -5.595  12.107  35.886  1.00 13.82  ? 428  LYS C CG    1 
ATOM   6580  C  CD    . LYS C 2 428  ? -4.449  12.803  36.627  1.00 16.66  ? 428  LYS C CD    1 
ATOM   6581  C  CE    . LYS C 2 428  ? -3.279  13.104  35.698  1.00 22.32  ? 428  LYS C CE    1 
ATOM   6582  N  NZ    . LYS C 2 428  ? -2.025  13.386  36.453  1.00 28.68  ? 428  LYS C NZ    1 
ATOM   6583  N  N     . GLU C 2 429  ? -6.748  8.336   36.412  1.00 9.23   ? 429  GLU C N     1 
ATOM   6584  C  CA    . GLU C 2 429  ? -6.081  7.138   35.935  1.00 13.70  ? 429  GLU C CA    1 
ATOM   6585  C  C     . GLU C 2 429  ? -6.981  6.360   34.991  1.00 11.52  ? 429  GLU C C     1 
ATOM   6586  O  O     . GLU C 2 429  ? -6.515  5.767   34.017  1.00 15.08  ? 429  GLU C O     1 
ATOM   6587  C  CB    . GLU C 2 429  ? -5.670  6.246   37.097  1.00 15.18  ? 429  GLU C CB    1 
ATOM   6588  C  CG    . GLU C 2 429  ? -4.837  5.075   36.657  1.00 17.51  ? 429  GLU C CG    1 
ATOM   6589  C  CD    . GLU C 2 429  ? -5.135  3.819   37.437  1.00 23.03  ? 429  GLU C CD    1 
ATOM   6590  O  OE1   . GLU C 2 429  ? -6.175  3.769   38.129  1.00 15.70  ? 429  GLU C OE1   1 
ATOM   6591  O  OE2   . GLU C 2 429  ? -4.318  2.879   37.354  1.00 35.67  ? 429  GLU C OE2   1 
ATOM   6592  N  N     . PHE C 2 430  ? -8.275  6.364   35.285  1.00 10.97  ? 430  PHE C N     1 
ATOM   6593  C  CA    . PHE C 2 430  ? -9.221  5.642   34.457  1.00 10.13  ? 430  PHE C CA    1 
ATOM   6594  C  C     . PHE C 2 430  ? -9.239  6.214   33.049  1.00 8.62   ? 430  PHE C C     1 
ATOM   6595  O  O     . PHE C 2 430  ? -8.875  5.536   32.092  1.00 10.85  ? 430  PHE C O     1 
ATOM   6596  C  CB    . PHE C 2 430  ? -10.619 5.689   35.062  1.00 9.13   ? 430  PHE C CB    1 
ATOM   6597  C  CG    . PHE C 2 430  ? -11.657 5.023   34.214  1.00 6.21   ? 430  PHE C CG    1 
ATOM   6598  C  CD1   . PHE C 2 430  ? -11.792 3.648   34.216  1.00 4.81   ? 430  PHE C CD1   1 
ATOM   6599  C  CD2   . PHE C 2 430  ? -12.488 5.771   33.405  1.00 14.96  ? 430  PHE C CD2   1 
ATOM   6600  C  CE1   . PHE C 2 430  ? -12.738 3.036   33.439  1.00 0.61   ? 430  PHE C CE1   1 
ATOM   6601  C  CE2   . PHE C 2 430  ? -13.436 5.163   32.624  1.00 13.10  ? 430  PHE C CE2   1 
ATOM   6602  C  CZ    . PHE C 2 430  ? -13.563 3.795   32.640  1.00 14.36  ? 430  PHE C CZ    1 
ATOM   6603  N  N     . PHE C 2 431  ? -9.640  7.476   32.937  1.00 6.59   ? 431  PHE C N     1 
ATOM   6604  C  CA    . PHE C 2 431  ? -9.780  8.133   31.641  1.00 6.16   ? 431  PHE C CA    1 
ATOM   6605  C  C     . PHE C 2 431  ? -8.494  8.084   30.803  1.00 8.42   ? 431  PHE C C     1 
ATOM   6606  O  O     . PHE C 2 431  ? -8.543  8.179   29.581  1.00 11.17  ? 431  PHE C O     1 
ATOM   6607  C  CB    . PHE C 2 431  ? -10.219 9.596   31.826  1.00 7.99   ? 431  PHE C CB    1 
ATOM   6608  C  CG    . PHE C 2 431  ? -11.684 9.775   32.154  1.00 2.58   ? 431  PHE C CG    1 
ATOM   6609  C  CD1   . PHE C 2 431  ? -12.665 9.432   31.242  1.00 16.73  ? 431  PHE C CD1   1 
ATOM   6610  C  CD2   . PHE C 2 431  ? -12.072 10.334  33.359  1.00 1.72   ? 431  PHE C CD2   1 
ATOM   6611  C  CE1   . PHE C 2 431  ? -14.001 9.616   31.540  1.00 15.53  ? 431  PHE C CE1   1 
ATOM   6612  C  CE2   . PHE C 2 431  ? -13.405 10.519  33.661  1.00 14.73  ? 431  PHE C CE2   1 
ATOM   6613  C  CZ    . PHE C 2 431  ? -14.370 10.160  32.750  1.00 15.18  ? 431  PHE C CZ    1 
ATOM   6614  N  N     . GLY C 2 432  ? -7.349  7.928   31.456  1.00 5.62   ? 432  GLY C N     1 
ATOM   6615  C  CA    . GLY C 2 432  ? -6.077  7.968   30.759  1.00 9.27   ? 432  GLY C CA    1 
ATOM   6616  C  C     . GLY C 2 432  ? -5.432  6.620   30.500  1.00 12.02  ? 432  GLY C C     1 
ATOM   6617  O  O     . GLY C 2 432  ? -4.491  6.515   29.713  1.00 14.87  ? 432  GLY C O     1 
ATOM   6618  N  N     . THR C 2 433  ? -5.927  5.575   31.148  1.00 7.04   ? 433  THR C N     1 
ATOM   6619  C  CA    . THR C 2 433  ? -5.253  4.292   31.045  1.00 9.62   ? 433  THR C CA    1 
ATOM   6620  C  C     . THR C 2 433  ? -6.195  3.155   30.669  1.00 13.55  ? 433  THR C C     1 
ATOM   6621  O  O     . THR C 2 433  ? -5.794  2.219   29.979  1.00 20.66  ? 433  THR C O     1 
ATOM   6622  C  CB    . THR C 2 433  ? -4.537  3.952   32.361  1.00 10.89  ? 433  THR C CB    1 
ATOM   6623  O  OG1   . THR C 2 433  ? -3.829  5.108   32.825  1.00 8.24   ? 433  THR C OG1   1 
ATOM   6624  C  CG2   . THR C 2 433  ? -3.550  2.815   32.163  1.00 21.95  ? 433  THR C CG2   1 
ATOM   6625  N  N     . SER C 2 434  ? -7.445  3.241   31.107  1.00 12.57  ? 434  SER C N     1 
ATOM   6626  C  CA    . SER C 2 434  ? -8.392  2.155   30.881  1.00 15.51  ? 434  SER C CA    1 
ATOM   6627  C  C     . SER C 2 434  ? -8.570  1.876   29.399  1.00 11.27  ? 434  SER C C     1 
ATOM   6628  O  O     . SER C 2 434  ? -8.565  2.789   28.577  1.00 9.98   ? 434  SER C O     1 
ATOM   6629  C  CB    . SER C 2 434  ? -9.750  2.467   31.520  1.00 12.47  ? 434  SER C CB    1 
ATOM   6630  O  OG    . SER C 2 434  ? -10.603 1.330   31.492  1.00 5.75   ? 434  SER C OG    1 
ATOM   6631  N  N     . GLN C 2 435  ? -8.733  0.598   29.073  1.00 11.55  ? 435  GLN C N     1 
ATOM   6632  C  CA    . GLN C 2 435  ? -8.957  0.152   27.704  1.00 16.85  ? 435  GLN C CA    1 
ATOM   6633  C  C     . GLN C 2 435  ? -10.380 0.458   27.255  1.00 12.24  ? 435  GLN C C     1 
ATOM   6634  O  O     . GLN C 2 435  ? -10.861 -0.093  26.259  1.00 12.29  ? 435  GLN C O     1 
ATOM   6635  C  CB    . GLN C 2 435  ? -8.696  -1.345  27.587  1.00 20.84  ? 435  GLN C CB    1 
ATOM   6636  C  CG    . GLN C 2 435  ? -7.426  -1.797  28.272  1.00 30.29  ? 435  GLN C CG    1 
ATOM   6637  C  CD    . GLN C 2 435  ? -7.399  -3.291  28.511  1.00 41.23  ? 435  GLN C CD    1 
ATOM   6638  O  OE1   . GLN C 2 435  ? -8.442  -3.924  28.671  1.00 33.17  ? 435  GLN C OE1   1 
ATOM   6639  N  NE2   . GLN C 2 435  ? -6.202  -3.866  28.532  1.00 62.71  ? 435  GLN C NE2   1 
ATOM   6640  N  N     . LEU C 2 436  ? -11.054 1.329   27.998  1.00 13.65  ? 436  LEU C N     1 
ATOM   6641  C  CA    . LEU C 2 436  ? -12.429 1.680   27.696  1.00 7.25   ? 436  LEU C CA    1 
ATOM   6642  C  C     . LEU C 2 436  ? -12.575 3.180   27.461  1.00 4.40   ? 436  LEU C C     1 
ATOM   6643  O  O     . LEU C 2 436  ? -13.588 3.629   26.931  1.00 4.05   ? 436  LEU C O     1 
ATOM   6644  C  CB    . LEU C 2 436  ? -13.346 1.204   28.824  1.00 3.76   ? 436  LEU C CB    1 
ATOM   6645  C  CG    . LEU C 2 436  ? -13.365 -0.317  29.005  1.00 2.89   ? 436  LEU C CG    1 
ATOM   6646  C  CD1   . LEU C 2 436  ? -14.194 -0.731  30.209  1.00 3.94   ? 436  LEU C CD1   1 
ATOM   6647  C  CD2   . LEU C 2 436  ? -13.879 -0.983  27.741  1.00 6.47   ? 436  LEU C CD2   1 
ATOM   6648  N  N     . SER C 2 437  ? -11.565 3.955   27.846  1.00 5.39   ? 437  SER C N     1 
ATOM   6649  C  CA    . SER C 2 437  ? -11.553 5.382   27.532  1.00 4.69   ? 437  SER C CA    1 
ATOM   6650  C  C     . SER C 2 437  ? -10.830 5.615   26.225  1.00 5.78   ? 437  SER C C     1 
ATOM   6651  O  O     . SER C 2 437  ? -9.630  5.883   26.203  1.00 9.27   ? 437  SER C O     1 
ATOM   6652  C  CB    . SER C 2 437  ? -10.888 6.195   28.633  1.00 9.07   ? 437  SER C CB    1 
ATOM   6653  O  OG    . SER C 2 437  ? -10.478 7.452   28.127  1.00 5.86   ? 437  SER C OG    1 
ATOM   6654  N  N     . GLN C 2 438  ? -11.582 5.533   25.137  1.00 8.41   ? 438  GLN C N     1 
ATOM   6655  C  CA    . GLN C 2 438  ? -11.008 5.438   23.806  1.00 9.95   ? 438  GLN C CA    1 
ATOM   6656  C  C     . GLN C 2 438  ? -10.938 6.780   23.083  1.00 6.48   ? 438  GLN C C     1 
ATOM   6657  O  O     . GLN C 2 438  ? -11.838 7.611   23.180  1.00 8.44   ? 438  GLN C O     1 
ATOM   6658  C  CB    . GLN C 2 438  ? -11.812 4.431   22.968  1.00 11.14  ? 438  GLN C CB    1 
ATOM   6659  C  CG    . GLN C 2 438  ? -11.943 3.044   23.621  1.00 9.12   ? 438  GLN C CG    1 
ATOM   6660  C  CD    . GLN C 2 438  ? -12.624 2.001   22.733  1.00 2.47   ? 438  GLN C CD    1 
ATOM   6661  O  OE1   . GLN C 2 438  ? -13.280 2.331   21.747  1.00 2.15   ? 438  GLN C OE1   1 
ATOM   6662  N  NE2   . GLN C 2 438  ? -12.463 0.732   23.090  1.00 4.09   ? 438  GLN C NE2   1 
ATOM   6663  N  N     . PHE C 2 439  ? -9.827  6.981   22.388  1.00 6.71   ? 439  PHE C N     1 
ATOM   6664  C  CA    . PHE C 2 439  ? -9.674  8.044   21.409  1.00 8.64   ? 439  PHE C CA    1 
ATOM   6665  C  C     . PHE C 2 439  ? -10.872 8.020   20.468  1.00 15.05  ? 439  PHE C C     1 
ATOM   6666  O  O     . PHE C 2 439  ? -11.163 6.976   19.898  1.00 26.53  ? 439  PHE C O     1 
ATOM   6667  C  CB    . PHE C 2 439  ? -8.377  7.833   20.635  1.00 18.33  ? 439  PHE C CB    1 
ATOM   6668  C  CG    . PHE C 2 439  ? -7.679  9.095   20.276  1.00 23.66  ? 439  PHE C CG    1 
ATOM   6669  C  CD1   . PHE C 2 439  ? -7.170  9.912   21.265  1.00 29.13  ? 439  PHE C CD1   1 
ATOM   6670  C  CD2   . PHE C 2 439  ? -7.508  9.457   18.950  1.00 23.77  ? 439  PHE C CD2   1 
ATOM   6671  C  CE1   . PHE C 2 439  ? -6.516  11.079  20.944  1.00 33.16  ? 439  PHE C CE1   1 
ATOM   6672  C  CE2   . PHE C 2 439  ? -6.854  10.624  18.619  1.00 26.11  ? 439  PHE C CE2   1 
ATOM   6673  C  CZ    . PHE C 2 439  ? -6.357  11.438  19.619  1.00 29.41  ? 439  PHE C CZ    1 
ATOM   6674  N  N     . MET C 2 440  ? -11.575 9.137   20.294  1.00 10.04  ? 440  MET C N     1 
ATOM   6675  C  CA    . MET C 2 440  ? -12.835 9.085   19.541  1.00 6.96   ? 440  MET C CA    1 
ATOM   6676  C  C     . MET C 2 440  ? -12.665 8.849   18.046  1.00 5.80   ? 440  MET C C     1 
ATOM   6677  O  O     . MET C 2 440  ? -12.066 9.661   17.345  1.00 7.79   ? 440  MET C O     1 
ATOM   6678  C  CB    . MET C 2 440  ? -13.653 10.360  19.745  1.00 4.19   ? 440  MET C CB    1 
ATOM   6679  C  CG    . MET C 2 440  ? -14.985 10.309  19.014  1.00 5.59   ? 440  MET C CG    1 
ATOM   6680  S  SD    . MET C 2 440  ? -16.006 11.752  19.317  1.00 2.08   ? 440  MET C SD    1 
ATOM   6681  C  CE    . MET C 2 440  ? -17.412 11.417  18.270  1.00 2.90   ? 440  MET C CE    1 
ATOM   6682  N  N     . ASP C 2 441  ? -13.223 7.737   17.573  1.00 4.20   ? 441  ASP C N     1 
ATOM   6683  C  CA    . ASP C 2 441  ? -13.192 7.393   16.160  1.00 5.19   ? 441  ASP C CA    1 
ATOM   6684  C  C     . ASP C 2 441  ? -13.987 8.426   15.367  1.00 8.60   ? 441  ASP C C     1 
ATOM   6685  O  O     . ASP C 2 441  ? -15.197 8.300   15.180  1.00 11.36  ? 441  ASP C O     1 
ATOM   6686  C  CB    . ASP C 2 441  ? -13.744 5.982   15.942  1.00 9.23   ? 441  ASP C CB    1 
ATOM   6687  C  CG    . ASP C 2 441  ? -13.784 5.578   14.473  1.00 14.32  ? 441  ASP C CG    1 
ATOM   6688  O  OD1   . ASP C 2 441  ? -14.428 4.552   14.153  1.00 13.63  ? 441  ASP C OD1   1 
ATOM   6689  O  OD2   . ASP C 2 441  ? -13.185 6.282   13.634  1.00 17.44  ? 441  ASP C OD2   1 
ATOM   6690  N  N     . GLN C 2 442  ? -13.281 9.444   14.890  1.00 9.65   ? 442  GLN C N     1 
ATOM   6691  C  CA    . GLN C 2 442  ? -13.891 10.577  14.210  1.00 5.10   ? 442  GLN C CA    1 
ATOM   6692  C  C     . GLN C 2 442  ? -13.646 10.578  12.712  1.00 4.33   ? 442  GLN C C     1 
ATOM   6693  O  O     . GLN C 2 442  ? -13.400 11.634  12.138  1.00 8.31   ? 442  GLN C O     1 
ATOM   6694  C  CB    . GLN C 2 442  ? -13.354 11.889  14.786  1.00 8.71   ? 442  GLN C CB    1 
ATOM   6695  C  CG    . GLN C 2 442  ? -13.835 12.223  16.187  1.00 11.89  ? 442  GLN C CG    1 
ATOM   6696  C  CD    . GLN C 2 442  ? -13.252 13.531  16.701  1.00 12.62  ? 442  GLN C CD    1 
ATOM   6697  O  OE1   . GLN C 2 442  ? -12.218 13.998  16.214  1.00 10.87  ? 442  GLN C OE1   1 
ATOM   6698  N  NE2   . GLN C 2 442  ? -13.909 14.126  17.694  1.00 12.00  ? 442  GLN C NE2   1 
ATOM   6699  N  N     . ASN C 2 443  ? -13.694 9.417   12.070  1.00 1.83   ? 443  ASN C N     1 
ATOM   6700  C  CA    . ASN C 2 443  ? -13.448 9.389   10.634  1.00 4.57   ? 443  ASN C CA    1 
ATOM   6701  C  C     . ASN C 2 443  ? -14.513 10.230  9.923   1.00 7.98   ? 443  ASN C C     1 
ATOM   6702  O  O     . ASN C 2 443  ? -14.194 11.154  9.174   1.00 4.49   ? 443  ASN C O     1 
ATOM   6703  C  CB    . ASN C 2 443  ? -13.416 7.949   10.109  1.00 5.29   ? 443  ASN C CB    1 
ATOM   6704  C  CG    . ASN C 2 443  ? -12.135 7.206   10.494  1.00 3.77   ? 443  ASN C CG    1 
ATOM   6705  O  OD1   . ASN C 2 443  ? -11.070 7.434   9.919   1.00 3.24   ? 443  ASN C OD1   1 
ATOM   6706  N  ND2   . ASN C 2 443  ? -12.243 6.301   11.457  1.00 3.99   ? 443  ASN C ND2   1 
ATOM   6707  N  N     . ASN C 2 444  ? -15.775 9.929   10.207  1.00 9.64   ? 444  ASN C N     1 
ATOM   6708  C  CA    . ASN C 2 444  ? -16.919 10.714  9.744   1.00 3.48   ? 444  ASN C CA    1 
ATOM   6709  C  C     . ASN C 2 444  ? -17.917 10.793  10.901  1.00 2.60   ? 444  ASN C C     1 
ATOM   6710  O  O     . ASN C 2 444  ? -17.703 10.133  11.913  1.00 7.35   ? 444  ASN C O     1 
ATOM   6711  C  CB    . ASN C 2 444  ? -17.538 10.070  8.511   1.00 9.58   ? 444  ASN C CB    1 
ATOM   6712  C  CG    . ASN C 2 444  ? -17.996 8.664   8.778   1.00 2.21   ? 444  ASN C CG    1 
ATOM   6713  O  OD1   . ASN C 2 444  ? -18.798 8.421   9.678   1.00 3.90   ? 444  ASN C OD1   1 
ATOM   6714  N  ND2   . ASN C 2 444  ? -17.489 7.721   7.999   1.00 3.43   ? 444  ASN C ND2   1 
ATOM   6715  N  N     . PRO C 2 445  ? -19.001 11.584  10.771  1.00 1.52   ? 445  PRO C N     1 
ATOM   6716  C  CA    . PRO C 2 445  ? -19.952 11.673  11.887  1.00 5.60   ? 445  PRO C CA    1 
ATOM   6717  C  C     . PRO C 2 445  ? -20.443 10.325  12.399  1.00 2.99   ? 445  PRO C C     1 
ATOM   6718  O  O     . PRO C 2 445  ? -20.414 10.087  13.608  1.00 5.07   ? 445  PRO C O     1 
ATOM   6719  C  CB    . PRO C 2 445  ? -21.110 12.465  11.284  1.00 11.99  ? 445  PRO C CB    1 
ATOM   6720  C  CG    . PRO C 2 445  ? -20.458 13.350  10.297  1.00 7.43   ? 445  PRO C CG    1 
ATOM   6721  C  CD    . PRO C 2 445  ? -19.331 12.550  9.706   1.00 4.50   ? 445  PRO C CD    1 
ATOM   6722  N  N     . LEU C 2 446  ? -20.868 9.459   11.485  1.00 3.75   ? 446  LEU C N     1 
ATOM   6723  C  CA    . LEU C 2 446  ? -21.375 8.136   11.841  1.00 3.74   ? 446  LEU C CA    1 
ATOM   6724  C  C     . LEU C 2 446  ? -20.380 7.336   12.654  1.00 2.73   ? 446  LEU C C     1 
ATOM   6725  O  O     . LEU C 2 446  ? -20.740 6.683   13.628  1.00 2.99   ? 446  LEU C O     1 
ATOM   6726  C  CB    . LEU C 2 446  ? -21.733 7.338   10.591  1.00 1.83   ? 446  LEU C CB    1 
ATOM   6727  C  CG    . LEU C 2 446  ? -22.125 5.883   10.849  1.00 8.90   ? 446  LEU C CG    1 
ATOM   6728  C  CD1   . LEU C 2 446  ? -23.419 5.809   11.632  1.00 1.44   ? 446  LEU C CD1   1 
ATOM   6729  C  CD2   . LEU C 2 446  ? -22.246 5.136   9.546   1.00 4.12   ? 446  LEU C CD2   1 
ATOM   6730  N  N     . SER C 2 447  ? -19.122 7.388   12.236  1.00 3.47   ? 447  SER C N     1 
ATOM   6731  C  CA    . SER C 2 447  ? -18.067 6.639   12.902  1.00 5.59   ? 447  SER C CA    1 
ATOM   6732  C  C     . SER C 2 447  ? -18.070 6.945   14.384  1.00 3.81   ? 447  SER C C     1 
ATOM   6733  O  O     . SER C 2 447  ? -17.900 6.063   15.213  1.00 2.71   ? 447  SER C O     1 
ATOM   6734  C  CB    . SER C 2 447  ? -16.702 6.977   12.310  1.00 7.17   ? 447  SER C CB    1 
ATOM   6735  O  OG    . SER C 2 447  ? -15.816 7.392   13.330  1.00 8.23   ? 447  SER C OG    1 
ATOM   6736  N  N     . GLY C 2 448  ? -18.281 8.212   14.705  1.00 6.82   ? 448  GLY C N     1 
ATOM   6737  C  CA    . GLY C 2 448  ? -18.312 8.650   16.081  1.00 6.98   ? 448  GLY C CA    1 
ATOM   6738  C  C     . GLY C 2 448  ? -19.551 8.118   16.755  1.00 4.05   ? 448  GLY C C     1 
ATOM   6739  O  O     . GLY C 2 448  ? -19.505 7.653   17.890  1.00 7.58   ? 448  GLY C O     1 
ATOM   6740  N  N     . LEU C 2 449  ? -20.665 8.189   16.042  1.00 1.66   ? 449  LEU C N     1 
ATOM   6741  C  CA    . LEU C 2 449  ? -21.940 7.740   16.572  1.00 2.90   ? 449  LEU C CA    1 
ATOM   6742  C  C     . LEU C 2 449  ? -21.869 6.273   16.988  1.00 2.60   ? 449  LEU C C     1 
ATOM   6743  O  O     . LEU C 2 449  ? -22.207 5.916   18.119  1.00 2.50   ? 449  LEU C O     1 
ATOM   6744  C  CB    . LEU C 2 449  ? -23.036 7.938   15.537  1.00 1.61   ? 449  LEU C CB    1 
ATOM   6745  C  CG    . LEU C 2 449  ? -24.405 7.497   16.025  1.00 1.09   ? 449  LEU C CG    1 
ATOM   6746  C  CD1   . LEU C 2 449  ? -24.826 8.392   17.164  1.00 1.03   ? 449  LEU C CD1   1 
ATOM   6747  C  CD2   . LEU C 2 449  ? -25.407 7.538   14.893  1.00 2.38   ? 449  LEU C CD2   1 
ATOM   6748  N  N     . THR C 2 450  ? -21.407 5.432   16.067  1.00 2.22   ? 450  THR C N     1 
ATOM   6749  C  CA    . THR C 2 450  ? -21.268 4.003   16.319  1.00 2.21   ? 450  THR C CA    1 
ATOM   6750  C  C     . THR C 2 450  ? -20.270 3.747   17.426  1.00 1.95   ? 450  THR C C     1 
ATOM   6751  O  O     . THR C 2 450  ? -20.365 2.755   18.139  1.00 4.67   ? 450  THR C O     1 
ATOM   6752  C  CB    . THR C 2 450  ? -20.803 3.244   15.069  1.00 6.80   ? 450  THR C CB    1 
ATOM   6753  O  OG1   . THR C 2 450  ? -21.419 3.807   13.909  1.00 8.24   ? 450  THR C OG1   1 
ATOM   6754  C  CG2   . THR C 2 450  ? -21.173 1.778   15.164  1.00 8.38   ? 450  THR C CG2   1 
ATOM   6755  N  N     . HIS C 2 451  ? -19.298 4.641   17.555  1.00 1.47   ? 451  HIS C N     1 
ATOM   6756  C  CA    . HIS C 2 451  ? -18.273 4.478   18.571  1.00 2.36   ? 451  HIS C CA    1 
ATOM   6757  C  C     . HIS C 2 451  ? -18.914 4.574   19.941  1.00 1.03   ? 451  HIS C C     1 
ATOM   6758  O  O     . HIS C 2 451  ? -18.451 3.955   20.891  1.00 6.89   ? 451  HIS C O     1 
ATOM   6759  C  CB    . HIS C 2 451  ? -17.166 5.527   18.425  1.00 5.07   ? 451  HIS C CB    1 
ATOM   6760  C  CG    . HIS C 2 451  ? -15.995 5.307   19.333  1.00 1.88   ? 451  HIS C CG    1 
ATOM   6761  N  ND1   . HIS C 2 451  ? -16.130 5.112   20.692  1.00 1.08   ? 451  HIS C ND1   1 
ATOM   6762  C  CD2   . HIS C 2 451  ? -14.666 5.267   19.080  1.00 2.38   ? 451  HIS C CD2   1 
ATOM   6763  C  CE1   . HIS C 2 451  ? -14.936 4.951   21.232  1.00 1.52   ? 451  HIS C CE1   1 
ATOM   6764  N  NE2   . HIS C 2 451  ? -14.031 5.041   20.276  1.00 4.33   ? 451  HIS C NE2   1 
ATOM   6765  N  N     . LYS C 2 452  ? -19.985 5.349   20.039  1.00 0.61   ? 452  LYS C N     1 
ATOM   6766  C  CA    . LYS C 2 452  ? -20.635 5.557   21.320  1.00 0.24   ? 452  LYS C CA    1 
ATOM   6767  C  C     . LYS C 2 452  ? -21.631 4.441   21.594  1.00 1.33   ? 452  LYS C C     1 
ATOM   6768  O  O     . LYS C 2 452  ? -22.108 4.283   22.713  1.00 2.53   ? 452  LYS C O     1 
ATOM   6769  C  CB    . LYS C 2 452  ? -21.324 6.914   21.351  1.00 1.88   ? 452  LYS C CB    1 
ATOM   6770  C  CG    . LYS C 2 452  ? -20.363 8.084   21.231  1.00 3.18   ? 452  LYS C CG    1 
ATOM   6771  C  CD    . LYS C 2 452  ? -20.988 9.253   20.493  1.00 2.80   ? 452  LYS C CD    1 
ATOM   6772  C  CE    . LYS C 2 452  ? -19.996 10.381  20.339  1.00 3.84   ? 452  LYS C CE    1 
ATOM   6773  N  NZ    . LYS C 2 452  ? -20.480 11.430  19.412  1.00 0.29   ? 452  LYS C NZ    1 
ATOM   6774  N  N     . ARG C 2 453  ? -21.927 3.648   20.575  1.00 0.20   ? 453  ARG C N     1 
ATOM   6775  C  CA    . ARG C 2 453  ? -22.886 2.569   20.734  1.00 1.64   ? 453  ARG C CA    1 
ATOM   6776  C  C     . ARG C 2 453  ? -22.216 1.204   20.674  1.00 5.35   ? 453  ARG C C     1 
ATOM   6777  O  O     . ARG C 2 453  ? -22.894 0.178   20.629  1.00 8.20   ? 453  ARG C O     1 
ATOM   6778  C  CB    . ARG C 2 453  ? -23.973 2.689   19.668  1.00 0.75   ? 453  ARG C CB    1 
ATOM   6779  C  CG    . ARG C 2 453  ? -24.440 4.118   19.500  1.00 2.40   ? 453  ARG C CG    1 
ATOM   6780  C  CD    . ARG C 2 453  ? -25.562 4.252   18.500  1.00 2.38   ? 453  ARG C CD    1 
ATOM   6781  N  NE    . ARG C 2 453  ? -26.866 4.121   19.130  1.00 9.17   ? 453  ARG C NE    1 
ATOM   6782  C  CZ    . ARG C 2 453  ? -27.524 2.977   19.226  1.00 0.37   ? 453  ARG C CZ    1 
ATOM   6783  N  NH1   . ARG C 2 453  ? -26.996 1.870   18.729  1.00 2.76   ? 453  ARG C NH1   1 
ATOM   6784  N  NH2   . ARG C 2 453  ? -28.709 2.943   19.816  1.00 4.59   ? 453  ARG C NH2   1 
ATOM   6785  N  N     . ARG C 2 454  ? -20.887 1.193   20.682  1.00 1.58   ? 454  ARG C N     1 
ATOM   6786  C  CA    . ARG C 2 454  ? -20.156 -0.064  20.652  1.00 0.03   ? 454  ARG C CA    1 
ATOM   6787  C  C     . ARG C 2 454  ? -20.385 -0.808  21.953  1.00 2.89   ? 454  ARG C C     1 
ATOM   6788  O  O     . ARG C 2 454  ? -20.623 -0.200  22.998  1.00 4.35   ? 454  ARG C O     1 
ATOM   6789  C  CB    . ARG C 2 454  ? -18.661 0.161   20.435  1.00 12.00  ? 454  ARG C CB    1 
ATOM   6790  C  CG    . ARG C 2 454  ? -18.247 0.373   18.987  1.00 0.74   ? 454  ARG C CG    1 
ATOM   6791  C  CD    . ARG C 2 454  ? -16.742 0.561   18.890  1.00 7.36   ? 454  ARG C CD    1 
ATOM   6792  N  NE    . ARG C 2 454  ? -16.325 1.165   17.629  1.00 13.65  ? 454  ARG C NE    1 
ATOM   6793  C  CZ    . ARG C 2 454  ? -15.123 1.696   17.423  1.00 13.66  ? 454  ARG C CZ    1 
ATOM   6794  N  NH1   . ARG C 2 454  ? -14.224 1.701   18.399  1.00 13.84  ? 454  ARG C NH1   1 
ATOM   6795  N  NH2   . ARG C 2 454  ? -14.819 2.227   16.245  1.00 12.86  ? 454  ARG C NH2   1 
ATOM   6796  N  N     . LEU C 2 455  ? -20.335 -2.130  21.873  1.00 6.13   ? 455  LEU C N     1 
ATOM   6797  C  CA    . LEU C 2 455  ? -20.390 -2.976  23.050  1.00 6.38   ? 455  LEU C CA    1 
ATOM   6798  C  C     . LEU C 2 455  ? -19.166 -3.881  23.039  1.00 2.22   ? 455  LEU C C     1 
ATOM   6799  O  O     . LEU C 2 455  ? -19.050 -4.778  22.209  1.00 3.06   ? 455  LEU C O     1 
ATOM   6800  C  CB    . LEU C 2 455  ? -21.691 -3.786  23.083  1.00 6.19   ? 455  LEU C CB    1 
ATOM   6801  C  CG    . LEU C 2 455  ? -22.971 -2.943  23.093  1.00 1.70   ? 455  LEU C CG    1 
ATOM   6802  C  CD1   . LEU C 2 455  ? -24.210 -3.810  23.190  1.00 4.62   ? 455  LEU C CD1   1 
ATOM   6803  C  CD2   . LEU C 2 455  ? -22.930 -1.938  24.232  1.00 0.84   ? 455  LEU C CD2   1 
ATOM   6804  N  N     . SER C 2 456  ? -18.236 -3.625  23.949  1.00 3.26   ? 456  SER C N     1 
ATOM   6805  C  CA    . SER C 2 456  ? -17.013 -4.415  24.013  1.00 5.77   ? 456  SER C CA    1 
ATOM   6806  C  C     . SER C 2 456  ? -17.015 -5.347  25.212  1.00 5.60   ? 456  SER C C     1 
ATOM   6807  O  O     . SER C 2 456  ? -17.405 -4.968  26.317  1.00 6.02   ? 456  SER C O     1 
ATOM   6808  C  CB    . SER C 2 456  ? -15.778 -3.516  24.069  1.00 5.16   ? 456  SER C CB    1 
ATOM   6809  O  OG    . SER C 2 456  ? -14.594 -4.293  24.157  1.00 6.29   ? 456  SER C OG    1 
ATOM   6810  N  N     . ALA C 2 457  ? -16.575 -6.574  24.976  1.00 4.53   ? 457  ALA C N     1 
ATOM   6811  C  CA    . ALA C 2 457  ? -16.493 -7.573  26.021  1.00 4.63   ? 457  ALA C CA    1 
ATOM   6812  C  C     . ALA C 2 457  ? -15.116 -7.540  26.649  1.00 4.69   ? 457  ALA C C     1 
ATOM   6813  O  O     . ALA C 2 457  ? -14.845 -8.250  27.611  1.00 15.54  ? 457  ALA C O     1 
ATOM   6814  C  CB    . ALA C 2 457  ? -16.789 -8.945  25.462  1.00 11.83  ? 457  ALA C CB    1 
ATOM   6815  N  N     . LEU C 2 458  ? -14.245 -6.709  26.095  1.00 2.03   ? 458  LEU C N     1 
ATOM   6816  C  CA    . LEU C 2 458  ? -12.870 -6.646  26.556  1.00 8.17   ? 458  LEU C CA    1 
ATOM   6817  C  C     . LEU C 2 458  ? -12.762 -5.738  27.773  1.00 8.49   ? 458  LEU C C     1 
ATOM   6818  O  O     . LEU C 2 458  ? -13.711 -5.038  28.108  1.00 8.23   ? 458  LEU C O     1 
ATOM   6819  C  CB    . LEU C 2 458  ? -11.959 -6.155  25.429  1.00 15.05  ? 458  LEU C CB    1 
ATOM   6820  C  CG    . LEU C 2 458  ? -12.088 -6.883  24.085  1.00 13.86  ? 458  LEU C CG    1 
ATOM   6821  C  CD1   . LEU C 2 458  ? -11.340 -6.151  22.974  1.00 11.13  ? 458  LEU C CD1   1 
ATOM   6822  C  CD2   . LEU C 2 458  ? -11.607 -8.324  24.195  1.00 21.37  ? 458  LEU C CD2   1 
ATOM   6823  N  N     . GLY C 2 459  ? -11.612 -5.762  28.441  1.00 6.39   ? 459  GLY C N     1 
ATOM   6824  C  CA    . GLY C 2 459  ? -11.340 -4.830  29.525  1.00 11.90  ? 459  GLY C CA    1 
ATOM   6825  C  C     . GLY C 2 459  ? -11.478 -5.373  30.936  1.00 15.52  ? 459  GLY C C     1 
ATOM   6826  O  O     . GLY C 2 459  ? -12.162 -6.374  31.148  1.00 22.83  ? 459  GLY C O     1 
ATOM   6827  N  N     . PRO C 2 460  ? -10.829 -4.706  31.910  1.00 14.31  ? 460  PRO C N     1 
ATOM   6828  C  CA    . PRO C 2 460  ? -10.852 -5.042  33.339  1.00 10.79  ? 460  PRO C CA    1 
ATOM   6829  C  C     . PRO C 2 460  ? -12.250 -5.352  33.865  1.00 12.26  ? 460  PRO C C     1 
ATOM   6830  O  O     . PRO C 2 460  ? -13.178 -4.583  33.637  1.00 14.95  ? 460  PRO C O     1 
ATOM   6831  C  CB    . PRO C 2 460  ? -10.298 -3.780  33.993  1.00 5.34   ? 460  PRO C CB    1 
ATOM   6832  C  CG    . PRO C 2 460  ? -9.376  -3.229  32.982  1.00 3.57   ? 460  PRO C CG    1 
ATOM   6833  C  CD    . PRO C 2 460  ? -9.975  -3.536  31.641  1.00 7.60   ? 460  PRO C CD    1 
ATOM   6834  N  N     . GLY C 2 461  ? -12.394 -6.475  34.558  1.00 10.25  ? 461  GLY C N     1 
ATOM   6835  C  CA    . GLY C 2 461  ? -13.701 -6.933  34.987  1.00 13.44  ? 461  GLY C CA    1 
ATOM   6836  C  C     . GLY C 2 461  ? -14.291 -7.879  33.961  1.00 23.20  ? 461  GLY C C     1 
ATOM   6837  O  O     . GLY C 2 461  ? -15.094 -8.743  34.289  1.00 32.39  ? 461  GLY C O     1 
ATOM   6838  N  N     . GLY C 2 462  ? -13.885 -7.714  32.707  1.00 16.37  ? 462  GLY C N     1 
ATOM   6839  C  CA    . GLY C 2 462  ? -14.325 -8.591  31.638  1.00 17.41  ? 462  GLY C CA    1 
ATOM   6840  C  C     . GLY C 2 462  ? -13.293 -9.666  31.360  1.00 24.60  ? 462  GLY C C     1 
ATOM   6841  O  O     . GLY C 2 462  ? -12.653 -10.163 32.285  1.00 31.67  ? 462  GLY C O     1 
ATOM   6842  N  N     . LEU C 2 463  ? -13.115 -10.012 30.088  1.00 21.07  ? 463  LEU C N     1 
ATOM   6843  C  CA    . LEU C 2 463  ? -12.207 -11.093 29.698  1.00 31.52  ? 463  LEU C CA    1 
ATOM   6844  C  C     . LEU C 2 463  ? -11.064 -10.620 28.788  1.00 33.14  ? 463  LEU C C     1 
ATOM   6845  O  O     . LEU C 2 463  ? -11.021 -9.459  28.388  1.00 31.51  ? 463  LEU C O     1 
ATOM   6846  C  CB    . LEU C 2 463  ? -13.003 -12.209 29.010  1.00 31.88  ? 463  LEU C CB    1 
ATOM   6847  C  CG    . LEU C 2 463  ? -14.054 -11.767 27.985  1.00 18.23  ? 463  LEU C CG    1 
ATOM   6848  C  CD1   . LEU C 2 463  ? -13.425 -11.509 26.625  1.00 16.91  ? 463  LEU C CD1   1 
ATOM   6849  C  CD2   . LEU C 2 463  ? -15.171 -12.790 27.877  1.00 42.68  ? 463  LEU C CD2   1 
ATOM   6850  N  N     . SER C 2 464  ? -10.141 -11.523 28.464  1.00 31.53  ? 464  SER C N     1 
ATOM   6851  C  CA    . SER C 2 464  ? -9.058  -11.216 27.532  1.00 28.25  ? 464  SER C CA    1 
ATOM   6852  C  C     . SER C 2 464  ? -9.362  -11.786 26.150  1.00 33.28  ? 464  SER C C     1 
ATOM   6853  O  O     . SER C 2 464  ? -10.298 -12.565 25.995  1.00 39.90  ? 464  SER C O     1 
ATOM   6854  C  CB    . SER C 2 464  ? -7.731  -11.771 28.044  1.00 36.38  ? 464  SER C CB    1 
ATOM   6855  O  OG    . SER C 2 464  ? -6.751  -11.762 27.021  1.00 40.46  ? 464  SER C OG    1 
ATOM   6856  N  N     . ARG C 2 465  ? -8.573  -11.402 25.148  1.00 32.27  ? 465  ARG C N     1 
ATOM   6857  C  CA    . ARG C 2 465  ? -8.815  -11.853 23.777  1.00 31.65  ? 465  ARG C CA    1 
ATOM   6858  C  C     . ARG C 2 465  ? -8.474  -13.325 23.621  1.00 34.81  ? 465  ARG C C     1 
ATOM   6859  O  O     . ARG C 2 465  ? -9.097  -14.042 22.839  1.00 32.65  ? 465  ARG C O     1 
ATOM   6860  C  CB    . ARG C 2 465  ? -8.010  -11.028 22.769  1.00 31.05  ? 465  ARG C CB    1 
ATOM   6861  C  CG    . ARG C 2 465  ? -8.306  -11.388 21.314  1.00 24.89  ? 465  ARG C CG    1 
ATOM   6862  C  CD    . ARG C 2 465  ? -7.637  -10.435 20.328  1.00 24.08  ? 465  ARG C CD    1 
ATOM   6863  N  NE    . ARG C 2 465  ? -8.020  -9.045  20.554  1.00 18.78  ? 465  ARG C NE    1 
ATOM   6864  C  CZ    . ARG C 2 465  ? -7.182  -8.097  20.961  1.00 25.10  ? 465  ARG C CZ    1 
ATOM   6865  N  NH1   . ARG C 2 465  ? -5.904  -8.385  21.178  1.00 32.30  ? 465  ARG C NH1   1 
ATOM   6866  N  NH2   . ARG C 2 465  ? -7.617  -6.857  21.143  1.00 26.26  ? 465  ARG C NH2   1 
ATOM   6867  N  N     . GLU C 2 466  ? -7.475  -13.773 24.370  1.00 41.11  ? 466  GLU C N     1 
ATOM   6868  C  CA    . GLU C 2 466  ? -7.084  -15.172 24.335  1.00 50.80  ? 466  GLU C CA    1 
ATOM   6869  C  C     . GLU C 2 466  ? -8.047  -16.021 25.150  1.00 53.00  ? 466  GLU C C     1 
ATOM   6870  O  O     . GLU C 2 466  ? -8.285  -17.182 24.828  1.00 66.93  ? 466  GLU C O     1 
ATOM   6871  C  CB    . GLU C 2 466  ? -5.657  -15.349 24.850  1.00 65.45  ? 466  GLU C CB    1 
ATOM   6872  C  CG    . GLU C 2 466  ? -4.599  -14.830 23.893  1.00 82.75  ? 466  GLU C CG    1 
ATOM   6873  C  CD    . GLU C 2 466  ? -3.203  -15.304 24.249  1.00 90.53  ? 466  GLU C CD    1 
ATOM   6874  O  OE1   . GLU C 2 466  ? -3.031  -15.889 25.340  1.00 93.63  ? 466  GLU C OE1   1 
ATOM   6875  O  OE2   . GLU C 2 466  ? -2.280  -15.095 23.432  1.00 86.16  ? 466  GLU C OE2   1 
ATOM   6876  N  N     . ARG C 2 467  ? -8.609  -15.431 26.199  1.00 43.53  ? 467  ARG C N     1 
ATOM   6877  C  CA    . ARG C 2 467  ? -9.511  -16.158 27.084  1.00 49.42  ? 467  ARG C CA    1 
ATOM   6878  C  C     . ARG C 2 467  ? -10.862 -16.469 26.440  1.00 53.73  ? 467  ARG C C     1 
ATOM   6879  O  O     . ARG C 2 467  ? -11.606 -17.317 26.932  1.00 64.94  ? 467  ARG C O     1 
ATOM   6880  C  CB    . ARG C 2 467  ? -9.734  -15.375 28.378  1.00 44.36  ? 467  ARG C CB    1 
ATOM   6881  C  CG    . ARG C 2 467  ? -8.506  -15.287 29.264  1.00 56.81  ? 467  ARG C CG    1 
ATOM   6882  C  CD    . ARG C 2 467  ? -8.887  -15.016 30.712  1.00 71.41  ? 467  ARG C CD    1 
ATOM   6883  N  NE    . ARG C 2 467  ? -8.661  -16.181 31.566  1.00 88.86  ? 467  ARG C NE    1 
ATOM   6884  C  CZ    . ARG C 2 467  ? -7.517  -16.437 32.193  1.00 84.11  ? 467  ARG C CZ    1 
ATOM   6885  N  NH1   . ARG C 2 467  ? -6.489  -15.610 32.063  1.00 86.97  ? 467  ARG C NH1   1 
ATOM   6886  N  NH2   . ARG C 2 467  ? -7.398  -17.519 32.952  1.00 71.70  ? 467  ARG C NH2   1 
ATOM   6887  N  N     . ALA C 2 468  ? -11.178 -15.794 25.341  1.00 53.41  ? 468  ALA C N     1 
ATOM   6888  C  CA    . ALA C 2 468  ? -12.483 -15.958 24.706  1.00 49.14  ? 468  ALA C CA    1 
ATOM   6889  C  C     . ALA C 2 468  ? -12.529 -17.168 23.777  1.00 47.01  ? 468  ALA C C     1 
ATOM   6890  O  O     . ALA C 2 468  ? -11.712 -17.296 22.864  1.00 44.14  ? 468  ALA C O     1 
ATOM   6891  C  CB    . ALA C 2 468  ? -12.859 -14.695 23.942  1.00 44.50  ? 468  ALA C CB    1 
ATOM   6892  N  N     . GLY C 2 469  ? -13.491 -18.053 24.023  1.00 46.55  ? 469  GLY C N     1 
ATOM   6893  C  CA    . GLY C 2 469  ? -13.731 -19.192 23.157  1.00 44.37  ? 469  GLY C CA    1 
ATOM   6894  C  C     . GLY C 2 469  ? -14.526 -18.762 21.941  1.00 44.26  ? 469  GLY C C     1 
ATOM   6895  O  O     . GLY C 2 469  ? -14.639 -17.571 21.663  1.00 42.07  ? 469  GLY C O     1 
ATOM   6896  N  N     . LEU C 2 470  ? -15.080 -19.725 21.213  1.00 50.50  ? 470  LEU C N     1 
ATOM   6897  C  CA    . LEU C 2 470  ? -15.849 -19.410 20.011  1.00 48.57  ? 470  LEU C CA    1 
ATOM   6898  C  C     . LEU C 2 470  ? -17.319 -19.169 20.344  1.00 46.66  ? 470  LEU C C     1 
ATOM   6899  O  O     . LEU C 2 470  ? -18.080 -18.651 19.527  1.00 42.42  ? 470  LEU C O     1 
ATOM   6900  C  CB    . LEU C 2 470  ? -15.724 -20.534 18.979  1.00 49.30  ? 470  LEU C CB    1 
ATOM   6901  C  CG    . LEU C 2 470  ? -14.328 -20.879 18.452  1.00 44.55  ? 470  LEU C CG    1 
ATOM   6902  C  CD1   . LEU C 2 470  ? -14.431 -21.962 17.397  1.00 41.08  ? 470  LEU C CD1   1 
ATOM   6903  C  CD2   . LEU C 2 470  ? -13.629 -19.653 17.889  1.00 42.58  ? 470  LEU C CD2   1 
ATOM   6904  N  N     . GLU C 2 471  ? -17.704 -19.548 21.558  1.00 55.08  ? 471  GLU C N     1 
ATOM   6905  C  CA    . GLU C 2 471  ? -19.090 -19.464 22.008  1.00 56.24  ? 471  GLU C CA    1 
ATOM   6906  C  C     . GLU C 2 471  ? -19.502 -18.029 22.302  1.00 49.02  ? 471  GLU C C     1 
ATOM   6907  O  O     . GLU C 2 471  ? -20.601 -17.598 21.960  1.00 43.66  ? 471  GLU C O     1 
ATOM   6908  C  CB    . GLU C 2 471  ? -19.296 -20.318 23.261  1.00 65.21  ? 471  GLU C CB    1 
ATOM   6909  C  CG    . GLU C 2 471  ? -18.483 -21.609 23.295  1.00 75.35  ? 471  GLU C CG    1 
ATOM   6910  C  CD    . GLU C 2 471  ? -17.074 -21.416 23.841  1.00 77.85  ? 471  GLU C CD    1 
ATOM   6911  O  OE1   . GLU C 2 471  ? -16.611 -20.257 23.926  1.00 67.38  ? 471  GLU C OE1   1 
ATOM   6912  O  OE2   . GLU C 2 471  ? -16.430 -22.429 24.188  1.00 88.10  ? 471  GLU C OE2   1 
ATOM   6913  N  N     . VAL C 2 472  ? -18.613 -17.300 22.964  1.00 49.20  ? 472  VAL C N     1 
ATOM   6914  C  CA    . VAL C 2 472  ? -18.872 -15.914 23.311  1.00 38.08  ? 472  VAL C CA    1 
ATOM   6915  C  C     . VAL C 2 472  ? -19.126 -15.105 22.060  1.00 28.62  ? 472  VAL C C     1 
ATOM   6916  O  O     . VAL C 2 472  ? -20.004 -14.249 22.022  1.00 26.50  ? 472  VAL C O     1 
ATOM   6917  C  CB    . VAL C 2 472  ? -17.691 -15.283 24.054  1.00 45.13  ? 472  VAL C CB    1 
ATOM   6918  C  CG1   . VAL C 2 472  ? -18.168 -14.101 24.880  1.00 52.29  ? 472  VAL C CG1   1 
ATOM   6919  C  CG2   . VAL C 2 472  ? -16.990 -16.315 24.921  1.00 57.07  ? 472  VAL C CG2   1 
ATOM   6920  N  N     . ARG C 2 473  ? -18.346 -15.405 21.031  1.00 36.79  ? 473  ARG C N     1 
ATOM   6921  C  CA    . ARG C 2 473  ? -18.251 -14.554 19.857  1.00 34.42  ? 473  ARG C CA    1 
ATOM   6922  C  C     . ARG C 2 473  ? -19.470 -14.656 18.944  1.00 34.53  ? 473  ARG C C     1 
ATOM   6923  O  O     . ARG C 2 473  ? -19.920 -13.648 18.404  1.00 36.81  ? 473  ARG C O     1 
ATOM   6924  C  CB    . ARG C 2 473  ? -16.978 -14.888 19.067  1.00 31.44  ? 473  ARG C CB    1 
ATOM   6925  C  CG    . ARG C 2 473  ? -15.669 -14.654 19.829  1.00 30.08  ? 473  ARG C CG    1 
ATOM   6926  C  CD    . ARG C 2 473  ? -14.483 -15.310 19.122  1.00 18.52  ? 473  ARG C CD    1 
ATOM   6927  N  NE    . ARG C 2 473  ? -13.415 -14.366 18.805  1.00 8.10   ? 473  ARG C NE    1 
ATOM   6928  C  CZ    . ARG C 2 473  ? -12.313 -14.210 19.531  1.00 11.83  ? 473  ARG C CZ    1 
ATOM   6929  N  NH1   . ARG C 2 473  ? -12.128 -14.935 20.625  1.00 19.25  ? 473  ARG C NH1   1 
ATOM   6930  N  NH2   . ARG C 2 473  ? -11.393 -13.329 19.161  1.00 12.80  ? 473  ARG C NH2   1 
ATOM   6931  N  N     . ASP C 2 474  ? -20.014 -15.857 18.770  1.00 35.39  ? 474  ASP C N     1 
ATOM   6932  C  CA    . ASP C 2 474  ? -21.049 -16.036 17.755  1.00 36.80  ? 474  ASP C CA    1 
ATOM   6933  C  C     . ASP C 2 474  ? -22.390 -15.420 18.152  1.00 29.91  ? 474  ASP C C     1 
ATOM   6934  O  O     . ASP C 2 474  ? -22.569 -14.934 19.267  1.00 26.43  ? 474  ASP C O     1 
ATOM   6935  C  CB    . ASP C 2 474  ? -21.228 -17.522 17.407  1.00 43.11  ? 474  ASP C CB    1 
ATOM   6936  C  CG    . ASP C 2 474  ? -21.471 -18.397 18.623  1.00 47.49  ? 474  ASP C CG    1 
ATOM   6937  O  OD1   . ASP C 2 474  ? -21.868 -17.868 19.682  1.00 43.77  ? 474  ASP C OD1   1 
ATOM   6938  O  OD2   . ASP C 2 474  ? -21.273 -19.627 18.509  1.00 49.28  ? 474  ASP C OD2   1 
ATOM   6939  N  N     . VAL C 2 475  ? -23.325 -15.452 17.210  1.00 23.20  ? 475  VAL C N     1 
ATOM   6940  C  CA    . VAL C 2 475  ? -24.616 -14.787 17.339  1.00 16.78  ? 475  VAL C CA    1 
ATOM   6941  C  C     . VAL C 2 475  ? -25.621 -15.538 18.217  1.00 21.41  ? 475  VAL C C     1 
ATOM   6942  O  O     . VAL C 2 475  ? -26.189 -16.548 17.796  1.00 27.31  ? 475  VAL C O     1 
ATOM   6943  C  CB    . VAL C 2 475  ? -25.248 -14.583 15.956  1.00 12.88  ? 475  VAL C CB    1 
ATOM   6944  C  CG1   . VAL C 2 475  ? -26.533 -13.798 16.078  1.00 21.30  ? 475  VAL C CG1   1 
ATOM   6945  C  CG2   . VAL C 2 475  ? -24.269 -13.868 15.038  1.00 17.89  ? 475  VAL C CG2   1 
ATOM   6946  N  N     . HIS C 2 476  ? -25.854 -15.023 19.422  1.00 19.70  ? 476  HIS C N     1 
ATOM   6947  C  CA    . HIS C 2 476  ? -26.824 -15.590 20.362  1.00 19.32  ? 476  HIS C CA    1 
ATOM   6948  C  C     . HIS C 2 476  ? -28.256 -15.136 20.039  1.00 15.04  ? 476  HIS C C     1 
ATOM   6949  O  O     . HIS C 2 476  ? -28.468 -14.004 19.610  1.00 20.74  ? 476  HIS C O     1 
ATOM   6950  C  CB    . HIS C 2 476  ? -26.451 -15.185 21.794  1.00 23.60  ? 476  HIS C CB    1 
ATOM   6951  C  CG    . HIS C 2 476  ? -27.198 -15.931 22.864  1.00 22.31  ? 476  HIS C CG    1 
ATOM   6952  N  ND1   . HIS C 2 476  ? -28.452 -15.557 23.295  1.00 19.44  ? 476  HIS C ND1   1 
ATOM   6953  C  CD2   . HIS C 2 476  ? -26.864 -17.023 23.592  1.00 24.86  ? 476  HIS C CD2   1 
ATOM   6954  C  CE1   . HIS C 2 476  ? -28.862 -16.388 24.238  1.00 19.56  ? 476  HIS C CE1   1 
ATOM   6955  N  NE2   . HIS C 2 476  ? -27.915 -17.287 24.438  1.00 20.34  ? 476  HIS C NE2   1 
ATOM   6956  N  N     . PRO C 2 477  ? -29.246 -16.020 20.242  1.00 13.75  ? 477  PRO C N     1 
ATOM   6957  C  CA    . PRO C 2 477  ? -30.663 -15.720 20.004  1.00 13.89  ? 477  PRO C CA    1 
ATOM   6958  C  C     . PRO C 2 477  ? -31.227 -14.588 20.855  1.00 16.28  ? 477  PRO C C     1 
ATOM   6959  O  O     . PRO C 2 477  ? -32.252 -14.023 20.488  1.00 23.73  ? 477  PRO C O     1 
ATOM   6960  C  CB    . PRO C 2 477  ? -31.361 -17.038 20.361  1.00 18.81  ? 477  PRO C CB    1 
ATOM   6961  C  CG    . PRO C 2 477  ? -30.403 -17.728 21.266  1.00 21.88  ? 477  PRO C CG    1 
ATOM   6962  C  CD    . PRO C 2 477  ? -29.070 -17.411 20.682  1.00 19.85  ? 477  PRO C CD    1 
ATOM   6963  N  N     . SER C 2 478  ? -30.590 -14.264 21.974  1.00 15.92  ? 478  SER C N     1 
ATOM   6964  C  CA    . SER C 2 478  ? -31.091 -13.182 22.816  1.00 17.61  ? 478  SER C CA    1 
ATOM   6965  C  C     . SER C 2 478  ? -30.714 -11.823 22.235  1.00 16.30  ? 478  SER C C     1 
ATOM   6966  O  O     . SER C 2 478  ? -31.228 -10.794 22.665  1.00 17.03  ? 478  SER C O     1 
ATOM   6967  C  CB    . SER C 2 478  ? -30.570 -13.304 24.252  1.00 23.20  ? 478  SER C CB    1 
ATOM   6968  O  OG    . SER C 2 478  ? -29.220 -12.894 24.362  1.00 23.54  ? 478  SER C OG    1 
ATOM   6969  N  N     . HIS C 2 479  ? -29.828 -11.823 21.243  1.00 18.72  ? 479  HIS C N     1 
ATOM   6970  C  CA    . HIS C 2 479  ? -29.351 -10.580 20.631  1.00 20.01  ? 479  HIS C CA    1 
ATOM   6971  C  C     . HIS C 2 479  ? -30.420 -9.884  19.799  1.00 17.94  ? 479  HIS C C     1 
ATOM   6972  O  O     . HIS C 2 479  ? -30.274 -8.710  19.449  1.00 18.97  ? 479  HIS C O     1 
ATOM   6973  C  CB    . HIS C 2 479  ? -28.128 -10.841 19.748  1.00 16.92  ? 479  HIS C CB    1 
ATOM   6974  C  CG    . HIS C 2 479  ? -26.864 -11.069 20.512  1.00 14.64  ? 479  HIS C CG    1 
ATOM   6975  N  ND1   . HIS C 2 479  ? -26.837 -11.724 21.723  1.00 17.60  ? 479  HIS C ND1   1 
ATOM   6976  C  CD2   . HIS C 2 479  ? -25.583 -10.740 20.231  1.00 15.39  ? 479  HIS C CD2   1 
ATOM   6977  C  CE1   . HIS C 2 479  ? -25.585 -11.784 22.161  1.00 18.11  ? 479  HIS C CE1   1 
ATOM   6978  N  NE2   . HIS C 2 479  ? -24.811 -11.192 21.266  1.00 23.03  ? 479  HIS C NE2   1 
ATOM   6979  N  N     . TYR C 2 480  ? -31.480 -10.615 19.470  1.00 10.96  ? 480  TYR C N     1 
ATOM   6980  C  CA    . TYR C 2 480  ? -32.529 -10.086 18.613  1.00 5.85   ? 480  TYR C CA    1 
ATOM   6981  C  C     . TYR C 2 480  ? -33.132 -8.800  19.158  1.00 8.56   ? 480  TYR C C     1 
ATOM   6982  O  O     . TYR C 2 480  ? -33.790 -8.811  20.192  1.00 9.92   ? 480  TYR C O     1 
ATOM   6983  C  CB    . TYR C 2 480  ? -33.630 -11.122 18.419  1.00 8.30   ? 480  TYR C CB    1 
ATOM   6984  C  CG    . TYR C 2 480  ? -34.635 -10.701 17.381  1.00 11.61  ? 480  TYR C CG    1 
ATOM   6985  C  CD1   . TYR C 2 480  ? -35.863 -10.170 17.748  1.00 18.43  ? 480  TYR C CD1   1 
ATOM   6986  C  CD2   . TYR C 2 480  ? -34.345 -10.812 16.028  1.00 8.92   ? 480  TYR C CD2   1 
ATOM   6987  C  CE1   . TYR C 2 480  ? -36.781 -9.777  16.795  1.00 19.26  ? 480  TYR C CE1   1 
ATOM   6988  C  CE2   . TYR C 2 480  ? -35.252 -10.423 15.071  1.00 8.50   ? 480  TYR C CE2   1 
ATOM   6989  C  CZ    . TYR C 2 480  ? -36.468 -9.907  15.458  1.00 15.29  ? 480  TYR C CZ    1 
ATOM   6990  O  OH    . TYR C 2 480  ? -37.373 -9.517  14.502  1.00 24.94  ? 480  TYR C OH    1 
ATOM   6991  N  N     . GLY C 2 481  ? -32.892 -7.697  18.454  1.00 10.85  ? 481  GLY C N     1 
ATOM   6992  C  CA    . GLY C 2 481  ? -33.461 -6.411  18.820  1.00 14.95  ? 481  GLY C CA    1 
ATOM   6993  C  C     . GLY C 2 481  ? -32.715 -5.734  19.952  1.00 13.53  ? 481  GLY C C     1 
ATOM   6994  O  O     . GLY C 2 481  ? -33.134 -4.685  20.446  1.00 13.62  ? 481  GLY C O     1 
ATOM   6995  N  N     . ARG C 2 482  ? -31.608 -6.339  20.367  1.00 9.06   ? 482  ARG C N     1 
ATOM   6996  C  CA    . ARG C 2 482  ? -30.803 -5.791  21.444  1.00 6.29   ? 482  ARG C CA    1 
ATOM   6997  C  C     . ARG C 2 482  ? -29.392 -5.513  20.972  1.00 7.28   ? 482  ARG C C     1 
ATOM   6998  O  O     . ARG C 2 482  ? -28.855 -4.437  21.203  1.00 12.39  ? 482  ARG C O     1 
ATOM   6999  C  CB    . ARG C 2 482  ? -30.788 -6.744  22.634  1.00 6.74   ? 482  ARG C CB    1 
ATOM   7000  C  CG    . ARG C 2 482  ? -32.140 -6.904  23.296  1.00 9.22   ? 482  ARG C CG    1 
ATOM   7001  C  CD    . ARG C 2 482  ? -32.093 -7.990  24.344  1.00 11.94  ? 482  ARG C CD    1 
ATOM   7002  N  NE    . ARG C 2 482  ? -33.385 -8.219  24.987  1.00 15.50  ? 482  ARG C NE    1 
ATOM   7003  C  CZ    . ARG C 2 482  ? -34.309 -9.059  24.530  1.00 21.96  ? 482  ARG C CZ    1 
ATOM   7004  N  NH1   . ARG C 2 482  ? -34.092 -9.742  23.414  1.00 26.50  ? 482  ARG C NH1   1 
ATOM   7005  N  NH2   . ARG C 2 482  ? -35.453 -9.213  25.182  1.00 23.54  ? 482  ARG C NH2   1 
ATOM   7006  N  N     . MET C 2 483  ? -28.798 -6.480  20.289  1.00 8.41   ? 483  MET C N     1 
ATOM   7007  C  CA    . MET C 2 483  ? -27.458 -6.294  19.755  1.00 9.15   ? 483  MET C CA    1 
ATOM   7008  C  C     . MET C 2 483  ? -27.362 -6.811  18.328  1.00 8.50   ? 483  MET C C     1 
ATOM   7009  O  O     . MET C 2 483  ? -27.819 -7.906  18.009  1.00 7.41   ? 483  MET C O     1 
ATOM   7010  C  CB    . MET C 2 483  ? -26.427 -6.978  20.651  1.00 9.38   ? 483  MET C CB    1 
ATOM   7011  C  CG    . MET C 2 483  ? -24.998 -6.874  20.170  1.00 6.81   ? 483  MET C CG    1 
ATOM   7012  S  SD    . MET C 2 483  ? -23.866 -7.430  21.454  1.00 7.90   ? 483  MET C SD    1 
ATOM   7013  C  CE    . MET C 2 483  ? -22.464 -7.948  20.473  1.00 10.51  ? 483  MET C CE    1 
ATOM   7014  N  N     . CYS C 2 484  ? -26.768 -5.995  17.472  1.00 9.07   ? 484  CYS C N     1 
ATOM   7015  C  CA    . CYS C 2 484  ? -26.694 -6.291  16.057  1.00 5.83   ? 484  CYS C CA    1 
ATOM   7016  C  C     . CYS C 2 484  ? -25.856 -7.525  15.795  1.00 9.02   ? 484  CYS C C     1 
ATOM   7017  O  O     . CYS C 2 484  ? -24.779 -7.673  16.365  1.00 7.49   ? 484  CYS C O     1 
ATOM   7018  C  CB    . CYS C 2 484  ? -26.114 -5.100  15.313  1.00 5.92   ? 484  CYS C CB    1 
ATOM   7019  S  SG    . CYS C 2 484  ? -26.184 -5.224  13.531  1.00 4.42   ? 484  CYS C SG    1 
ATOM   7020  N  N     . PRO C 2 485  ? -26.359 -8.423  14.941  1.00 11.27  ? 485  PRO C N     1 
ATOM   7021  C  CA    . PRO C 2 485  ? -25.613 -9.601  14.505  1.00 7.16   ? 485  PRO C CA    1 
ATOM   7022  C  C     . PRO C 2 485  ? -24.721 -9.322  13.299  1.00 6.68   ? 485  PRO C C     1 
ATOM   7023  O  O     . PRO C 2 485  ? -23.935 -10.189 12.943  1.00 11.09  ? 485  PRO C O     1 
ATOM   7024  C  CB    . PRO C 2 485  ? -26.720 -10.586 14.140  1.00 5.08   ? 485  PRO C CB    1 
ATOM   7025  C  CG    . PRO C 2 485  ? -27.794 -9.712  13.616  1.00 5.81   ? 485  PRO C CG    1 
ATOM   7026  C  CD    . PRO C 2 485  ? -27.748 -8.454  14.453  1.00 10.97  ? 485  PRO C CD    1 
ATOM   7027  N  N     . ILE C 2 486  ? -24.829 -8.144  12.688  1.00 8.69   ? 486  ILE C N     1 
ATOM   7028  C  CA    . ILE C 2 486  ? -24.028 -7.840  11.501  1.00 5.32   ? 486  ILE C CA    1 
ATOM   7029  C  C     . ILE C 2 486  ? -22.779 -7.021  11.814  1.00 6.39   ? 486  ILE C C     1 
ATOM   7030  O  O     . ILE C 2 486  ? -21.717 -7.252  11.237  1.00 6.50   ? 486  ILE C O     1 
ATOM   7031  C  CB    . ILE C 2 486  ? -24.842 -7.079  10.444  1.00 0.54   ? 486  ILE C CB    1 
ATOM   7032  C  CG1   . ILE C 2 486  ? -25.989 -7.942  9.949   1.00 3.91   ? 486  ILE C CG1   1 
ATOM   7033  C  CG2   . ILE C 2 486  ? -23.974 -6.730  9.255   1.00 1.78   ? 486  ILE C CG2   1 
ATOM   7034  C  CD1   . ILE C 2 486  ? -25.519 -9.211  9.308   1.00 5.85   ? 486  ILE C CD1   1 
ATOM   7035  N  N     . GLU C 2 487  ? -22.905 -6.063  12.725  1.00 6.49   ? 487  GLU C N     1 
ATOM   7036  C  CA    . GLU C 2 487  ? -21.800 -5.157  13.010  1.00 5.83   ? 487  GLU C CA    1 
ATOM   7037  C  C     . GLU C 2 487  ? -20.854 -5.747  14.042  1.00 4.45   ? 487  GLU C C     1 
ATOM   7038  O  O     . GLU C 2 487  ? -21.235 -6.024  15.175  1.00 3.13   ? 487  GLU C O     1 
ATOM   7039  C  CB    . GLU C 2 487  ? -22.322 -3.795  13.478  1.00 7.94   ? 487  GLU C CB    1 
ATOM   7040  C  CG    . GLU C 2 487  ? -21.256 -2.716  13.554  1.00 2.73   ? 487  GLU C CG    1 
ATOM   7041  C  CD    . GLU C 2 487  ? -21.819 -1.333  13.308  1.00 5.25   ? 487  GLU C CD    1 
ATOM   7042  O  OE1   . GLU C 2 487  ? -23.033 -1.134  13.534  1.00 4.02   ? 487  GLU C OE1   1 
ATOM   7043  O  OE2   . GLU C 2 487  ? -21.050 -0.451  12.876  1.00 6.32   ? 487  GLU C OE2   1 
ATOM   7044  N  N     . THR C 2 488  ? -19.614 -5.944  13.617  1.00 4.71   ? 488  THR C N     1 
ATOM   7045  C  CA    . THR C 2 488  ? -18.554 -6.483  14.455  1.00 2.78   ? 488  THR C CA    1 
ATOM   7046  C  C     . THR C 2 488  ? -17.268 -6.489  13.635  1.00 2.58   ? 488  THR C C     1 
ATOM   7047  O  O     . THR C 2 488  ? -17.309 -6.613  12.417  1.00 6.10   ? 488  THR C O     1 
ATOM   7048  C  CB    . THR C 2 488  ? -18.871 -7.905  14.959  1.00 5.21   ? 488  THR C CB    1 
ATOM   7049  O  OG1   . THR C 2 488  ? -17.709 -8.466  15.577  1.00 9.11   ? 488  THR C OG1   1 
ATOM   7050  C  CG2   . THR C 2 488  ? -19.297 -8.801  13.821  1.00 6.58   ? 488  THR C CG2   1 
ATOM   7051  N  N     . PRO C 2 489  ? -16.117 -6.327  14.293  1.00 2.13   ? 489  PRO C N     1 
ATOM   7052  C  CA    . PRO C 2 489  ? -14.846 -6.283  13.565  1.00 2.94   ? 489  PRO C CA    1 
ATOM   7053  C  C     . PRO C 2 489  ? -14.507 -7.580  12.856  1.00 1.18   ? 489  PRO C C     1 
ATOM   7054  O  O     . PRO C 2 489  ? -14.961 -8.654  13.240  1.00 4.63   ? 489  PRO C O     1 
ATOM   7055  C  CB    . PRO C 2 489  ? -13.822 -5.997  14.665  1.00 17.56  ? 489  PRO C CB    1 
ATOM   7056  C  CG    . PRO C 2 489  ? -14.499 -6.410  15.923  1.00 18.41  ? 489  PRO C CG    1 
ATOM   7057  C  CD    . PRO C 2 489  ? -15.927 -6.064  15.725  1.00 9.84   ? 489  PRO C CD    1 
ATOM   7058  N  N     . GLU C 2 490  ? -13.697 -7.458  11.814  1.00 0.42   ? 490  GLU C N     1 
ATOM   7059  C  CA    . GLU C 2 490  ? -13.368 -8.578  10.953  1.00 3.69   ? 490  GLU C CA    1 
ATOM   7060  C  C     . GLU C 2 490  ? -12.201 -9.380  11.491  1.00 5.01   ? 490  GLU C C     1 
ATOM   7061  O  O     . GLU C 2 490  ? -12.062 -10.559 11.184  1.00 5.49   ? 490  GLU C O     1 
ATOM   7062  C  CB    . GLU C 2 490  ? -13.039 -8.079  9.548   1.00 9.29   ? 490  GLU C CB    1 
ATOM   7063  C  CG    . GLU C 2 490  ? -13.839 -8.745  8.449   1.00 10.50  ? 490  GLU C CG    1 
ATOM   7064  C  CD    . GLU C 2 490  ? -13.358 -8.346  7.070   1.00 11.98  ? 490  GLU C CD    1 
ATOM   7065  O  OE1   . GLU C 2 490  ? -13.092 -9.253  6.256   1.00 13.51  ? 490  GLU C OE1   1 
ATOM   7066  O  OE2   . GLU C 2 490  ? -13.241 -7.130  6.801   1.00 13.97  ? 490  GLU C OE2   1 
ATOM   7067  N  N     . GLY C 2 491  ? -11.364 -8.737  12.298  1.00 7.24   ? 491  GLY C N     1 
ATOM   7068  C  CA    . GLY C 2 491  ? -10.103 -9.328  12.707  1.00 16.58  ? 491  GLY C CA    1 
ATOM   7069  C  C     . GLY C 2 491  ? -10.163 -10.300 13.869  1.00 10.77  ? 491  GLY C C     1 
ATOM   7070  O  O     . GLY C 2 491  ? -11.098 -11.087 13.997  1.00 8.04   ? 491  GLY C O     1 
ATOM   7071  N  N     . PRO C 2 492  ? -9.143  -10.252 14.733  1.00 7.28   ? 492  PRO C N     1 
ATOM   7072  C  CA    . PRO C 2 492  ? -9.086  -11.078 15.937  1.00 7.84   ? 492  PRO C CA    1 
ATOM   7073  C  C     . PRO C 2 492  ? -10.031 -10.556 17.001  1.00 9.26   ? 492  PRO C C     1 
ATOM   7074  O  O     . PRO C 2 492  ? -10.136 -11.136 18.074  1.00 14.96  ? 492  PRO C O     1 
ATOM   7075  C  CB    . PRO C 2 492  ? -7.630  -10.940 16.383  1.00 16.03  ? 492  PRO C CB    1 
ATOM   7076  C  CG    . PRO C 2 492  ? -7.257  -9.577  15.934  1.00 18.58  ? 492  PRO C CG    1 
ATOM   7077  C  CD    . PRO C 2 492  ? -7.971  -9.368  14.623  1.00 13.10  ? 492  PRO C CD    1 
ATOM   7078  N  N     . ASN C 2 493  ? -10.703 -9.453  16.706  1.00 6.38   ? 493  ASN C N     1 
ATOM   7079  C  CA    . ASN C 2 493  ? -11.643 -8.890  17.651  1.00 9.35   ? 493  ASN C CA    1 
ATOM   7080  C  C     . ASN C 2 493  ? -13.060 -9.363  17.396  1.00 11.22  ? 493  ASN C C     1 
ATOM   7081  O  O     . ASN C 2 493  ? -13.984 -9.009  18.132  1.00 9.66   ? 493  ASN C O     1 
ATOM   7082  C  CB    . ASN C 2 493  ? -11.590 -7.368  17.613  1.00 6.00   ? 493  ASN C CB    1 
ATOM   7083  C  CG    . ASN C 2 493  ? -10.560 -6.811  18.559  1.00 14.10  ? 493  ASN C CG    1 
ATOM   7084  O  OD1   . ASN C 2 493  ? -9.987  -7.542  19.367  1.00 18.74  ? 493  ASN C OD1   1 
ATOM   7085  N  ND2   . ASN C 2 493  ? -10.320 -5.510  18.473  1.00 19.40  ? 493  ASN C ND2   1 
ATOM   7086  N  N     . ILE C 2 494  ? -13.217 -10.180 16.361  1.00 10.88  ? 494  ILE C N     1 
ATOM   7087  C  CA    . ILE C 2 494  ? -14.533 -10.606 15.914  1.00 9.05   ? 494  ILE C CA    1 
ATOM   7088  C  C     . ILE C 2 494  ? -15.346 -11.212 17.054  1.00 7.09   ? 494  ILE C C     1 
ATOM   7089  O  O     . ILE C 2 494  ? -14.828 -11.941 17.896  1.00 7.61   ? 494  ILE C O     1 
ATOM   7090  C  CB    . ILE C 2 494  ? -14.432 -11.616 14.740  1.00 9.14   ? 494  ILE C CB    1 
ATOM   7091  C  CG1   . ILE C 2 494  ? -15.826 -12.037 14.263  1.00 7.49   ? 494  ILE C CG1   1 
ATOM   7092  C  CG2   . ILE C 2 494  ? -13.592 -12.824 15.139  1.00 10.99  ? 494  ILE C CG2   1 
ATOM   7093  C  CD1   . ILE C 2 494  ? -15.815 -12.941 13.048  1.00 3.09   ? 494  ILE C CD1   1 
ATOM   7094  N  N     . GLY C 2 495  ? -16.622 -10.857 17.092  1.00 9.72   ? 495  GLY C N     1 
ATOM   7095  C  CA    . GLY C 2 495  ? -17.541 -11.393 18.072  1.00 9.74   ? 495  GLY C CA    1 
ATOM   7096  C  C     . GLY C 2 495  ? -17.460 -10.709 19.419  1.00 10.12  ? 495  GLY C C     1 
ATOM   7097  O  O     . GLY C 2 495  ? -18.434 -10.696 20.166  1.00 13.24  ? 495  GLY C O     1 
ATOM   7098  N  N     . LEU C 2 496  ? -16.304 -10.134 19.732  1.00 9.53   ? 496  LEU C N     1 
ATOM   7099  C  CA    . LEU C 2 496  ? -16.093 -9.526  21.040  1.00 10.79  ? 496  LEU C CA    1 
ATOM   7100  C  C     . LEU C 2 496  ? -16.489 -8.051  21.087  1.00 7.56   ? 496  LEU C C     1 
ATOM   7101  O  O     . LEU C 2 496  ? -16.538 -7.446  22.155  1.00 6.97   ? 496  LEU C O     1 
ATOM   7102  C  CB    . LEU C 2 496  ? -14.636 -9.693  21.462  1.00 10.31  ? 496  LEU C CB    1 
ATOM   7103  C  CG    . LEU C 2 496  ? -14.221 -11.155 21.627  1.00 14.74  ? 496  LEU C CG    1 
ATOM   7104  C  CD1   . LEU C 2 496  ? -12.809 -11.266 22.180  1.00 22.75  ? 496  LEU C CD1   1 
ATOM   7105  C  CD2   . LEU C 2 496  ? -15.212 -11.895 22.516  1.00 18.62  ? 496  LEU C CD2   1 
ATOM   7106  N  N     . ILE C 2 497  ? -16.783 -7.472  19.932  1.00 5.78   ? 497  ILE C N     1 
ATOM   7107  C  CA    . ILE C 2 497  ? -17.256 -6.097  19.895  1.00 2.92   ? 497  ILE C CA    1 
ATOM   7108  C  C     . ILE C 2 497  ? -18.499 -5.971  19.025  1.00 5.75   ? 497  ILE C C     1 
ATOM   7109  O  O     . ILE C 2 497  ? -18.473 -6.283  17.839  1.00 6.39   ? 497  ILE C O     1 
ATOM   7110  C  CB    . ILE C 2 497  ? -16.164 -5.146  19.382  1.00 6.95   ? 497  ILE C CB    1 
ATOM   7111  C  CG1   . ILE C 2 497  ? -15.034 -5.036  20.410  1.00 4.59   ? 497  ILE C CG1   1 
ATOM   7112  C  CG2   . ILE C 2 497  ? -16.738 -3.768  19.096  1.00 6.87   ? 497  ILE C CG2   1 
ATOM   7113  C  CD1   . ILE C 2 497  ? -13.877 -4.159  19.960  1.00 10.22  ? 497  ILE C CD1   1 
ATOM   7114  N  N     . GLY C 2 498  ? -19.596 -5.524  19.625  1.00 8.17   ? 498  GLY C N     1 
ATOM   7115  C  CA    . GLY C 2 498  ? -20.832 -5.338  18.889  1.00 4.39   ? 498  GLY C CA    1 
ATOM   7116  C  C     . GLY C 2 498  ? -21.400 -3.934  18.997  1.00 5.04   ? 498  GLY C C     1 
ATOM   7117  O  O     . GLY C 2 498  ? -21.032 -3.161  19.879  1.00 6.50   ? 498  GLY C O     1 
ATOM   7118  N  N     . SER C 2 499  ? -22.293 -3.598  18.079  1.00 1.57   ? 499  SER C N     1 
ATOM   7119  C  CA    . SER C 2 499  ? -23.035 -2.357  18.160  1.00 2.63   ? 499  SER C CA    1 
ATOM   7120  C  C     . SER C 2 499  ? -24.381 -2.634  18.829  1.00 6.88   ? 499  SER C C     1 
ATOM   7121  O  O     . SER C 2 499  ? -24.877 -3.756  18.770  1.00 11.68  ? 499  SER C O     1 
ATOM   7122  C  CB    . SER C 2 499  ? -23.222 -1.758  16.764  1.00 5.57   ? 499  SER C CB    1 
ATOM   7123  O  OG    . SER C 2 499  ? -24.077 -0.620  16.790  1.00 8.68   ? 499  SER C OG    1 
ATOM   7124  N  N     . LEU C 2 500  ? -24.961 -1.624  19.473  1.00 5.20   ? 500  LEU C N     1 
ATOM   7125  C  CA    . LEU C 2 500  ? -26.274 -1.761  20.106  1.00 2.30   ? 500  LEU C CA    1 
ATOM   7126  C  C     . LEU C 2 500  ? -27.392 -1.584  19.093  1.00 5.00   ? 500  LEU C C     1 
ATOM   7127  O  O     . LEU C 2 500  ? -27.367 -0.644  18.303  1.00 9.87   ? 500  LEU C O     1 
ATOM   7128  C  CB    . LEU C 2 500  ? -26.448 -0.741  21.226  1.00 1.57   ? 500  LEU C CB    1 
ATOM   7129  C  CG    . LEU C 2 500  ? -27.882 -0.651  21.753  1.00 4.27   ? 500  LEU C CG    1 
ATOM   7130  C  CD1   . LEU C 2 500  ? -28.166 -1.697  22.826  1.00 9.49   ? 500  LEU C CD1   1 
ATOM   7131  C  CD2   . LEU C 2 500  ? -28.222 0.743   22.253  1.00 9.74   ? 500  LEU C CD2   1 
ATOM   7132  N  N     . SER C 2 501  ? -28.376 -2.478  19.120  1.00 5.71   ? 501  SER C N     1 
ATOM   7133  C  CA    . SER C 2 501  ? -29.492 -2.392  18.182  1.00 7.71   ? 501  SER C CA    1 
ATOM   7134  C  C     . SER C 2 501  ? -30.211 -1.067  18.345  1.00 5.13   ? 501  SER C C     1 
ATOM   7135  O  O     . SER C 2 501  ? -30.346 -0.554  19.453  1.00 7.68   ? 501  SER C O     1 
ATOM   7136  C  CB    . SER C 2 501  ? -30.471 -3.555  18.369  1.00 15.60  ? 501  SER C CB    1 
ATOM   7137  O  OG    . SER C 2 501  ? -29.865 -4.791  18.028  1.00 19.77  ? 501  SER C OG    1 
ATOM   7138  N  N     . VAL C 2 502  ? -30.661 -0.525  17.220  1.00 4.61   ? 502  VAL C N     1 
ATOM   7139  C  CA    . VAL C 2 502  ? -31.218 0.818   17.157  1.00 4.18   ? 502  VAL C CA    1 
ATOM   7140  C  C     . VAL C 2 502  ? -32.275 1.077   18.221  1.00 3.58   ? 502  VAL C C     1 
ATOM   7141  O  O     . VAL C 2 502  ? -32.166 2.025   18.990  1.00 6.36   ? 502  VAL C O     1 
ATOM   7142  C  CB    . VAL C 2 502  ? -31.828 1.097   15.772  1.00 3.20   ? 502  VAL C CB    1 
ATOM   7143  C  CG1   . VAL C 2 502  ? -32.520 2.434   15.770  1.00 7.60   ? 502  VAL C CG1   1 
ATOM   7144  C  CG2   . VAL C 2 502  ? -30.748 1.053   14.705  1.00 5.51   ? 502  VAL C CG2   1 
ATOM   7145  N  N     . TYR C 2 503  ? -33.281 0.220   18.297  1.00 1.15   ? 503  TYR C N     1 
ATOM   7146  C  CA    . TYR C 2 503  ? -34.396 0.492   19.195  1.00 6.52   ? 503  TYR C CA    1 
ATOM   7147  C  C     . TYR C 2 503  ? -34.160 0.077   20.647  1.00 11.69  ? 503  TYR C C     1 
ATOM   7148  O  O     . TYR C 2 503  ? -35.006 0.331   21.501  1.00 15.54  ? 503  TYR C O     1 
ATOM   7149  C  CB    . TYR C 2 503  ? -35.662 -0.191  18.679  1.00 9.07   ? 503  TYR C CB    1 
ATOM   7150  C  CG    . TYR C 2 503  ? -36.176 0.394   17.387  1.00 11.43  ? 503  TYR C CG    1 
ATOM   7151  C  CD1   . TYR C 2 503  ? -36.980 1.528   17.386  1.00 15.55  ? 503  TYR C CD1   1 
ATOM   7152  C  CD2   . TYR C 2 503  ? -35.850 -0.180  16.167  1.00 15.60  ? 503  TYR C CD2   1 
ATOM   7153  C  CE1   . TYR C 2 503  ? -37.448 2.070   16.204  1.00 18.06  ? 503  TYR C CE1   1 
ATOM   7154  C  CE2   . TYR C 2 503  ? -36.312 0.354   14.980  1.00 17.81  ? 503  TYR C CE2   1 
ATOM   7155  C  CZ    . TYR C 2 503  ? -37.110 1.478   15.004  1.00 17.63  ? 503  TYR C CZ    1 
ATOM   7156  O  OH    . TYR C 2 503  ? -37.570 2.010   13.823  1.00 20.07  ? 503  TYR C OH    1 
ATOM   7157  N  N     . ALA C 2 504  ? -33.024 -0.540  20.949  1.00 15.02  ? 504  ALA C N     1 
ATOM   7158  C  CA    . ALA C 2 504  ? -32.823 -1.039  22.306  1.00 12.60  ? 504  ALA C CA    1 
ATOM   7159  C  C     . ALA C 2 504  ? -32.396 0.065   23.260  1.00 7.83   ? 504  ALA C C     1 
ATOM   7160  O  O     . ALA C 2 504  ? -31.992 1.147   22.840  1.00 3.93   ? 504  ALA C O     1 
ATOM   7161  C  CB    . ALA C 2 504  ? -31.807 -2.166  22.318  1.00 14.34  ? 504  ALA C CB    1 
ATOM   7162  N  N     . ARG C 2 505  ? -32.501 -0.222  24.550  1.00 4.63   ? 505  ARG C N     1 
ATOM   7163  C  CA    . ARG C 2 505  ? -32.109 0.724   25.581  1.00 9.85   ? 505  ARG C CA    1 
ATOM   7164  C  C     . ARG C 2 505  ? -31.671 -0.042  26.815  1.00 14.01  ? 505  ARG C C     1 
ATOM   7165  O  O     . ARG C 2 505  ? -31.907 -1.243  26.924  1.00 15.02  ? 505  ARG C O     1 
ATOM   7166  C  CB    . ARG C 2 505  ? -33.257 1.670   25.930  1.00 19.42  ? 505  ARG C CB    1 
ATOM   7167  C  CG    . ARG C 2 505  ? -34.262 1.069   26.903  1.00 33.05  ? 505  ARG C CG    1 
ATOM   7168  C  CD    . ARG C 2 505  ? -35.313 2.077   27.362  1.00 40.71  ? 505  ARG C CD    1 
ATOM   7169  N  NE    . ARG C 2 505  ? -36.220 1.481   28.340  1.00 40.38  ? 505  ARG C NE    1 
ATOM   7170  C  CZ    . ARG C 2 505  ? -37.257 2.108   28.886  1.00 40.86  ? 505  ARG C CZ    1 
ATOM   7171  N  NH1   . ARG C 2 505  ? -37.533 3.361   28.547  1.00 50.36  ? 505  ARG C NH1   1 
ATOM   7172  N  NH2   . ARG C 2 505  ? -38.024 1.477   29.766  1.00 37.29  ? 505  ARG C NH2   1 
ATOM   7173  N  N     . VAL C 2 506  ? -31.046 0.656   27.754  1.00 17.44  ? 506  VAL C N     1 
ATOM   7174  C  CA    . VAL C 2 506  ? -30.514 0.008   28.939  1.00 14.16  ? 506  VAL C CA    1 
ATOM   7175  C  C     . VAL C 2 506  ? -31.348 0.349   30.162  1.00 11.48  ? 506  VAL C C     1 
ATOM   7176  O  O     . VAL C 2 506  ? -31.609 1.515   30.446  1.00 8.67   ? 506  VAL C O     1 
ATOM   7177  C  CB    . VAL C 2 506  ? -29.052 0.411   29.192  1.00 16.66  ? 506  VAL C CB    1 
ATOM   7178  C  CG1   . VAL C 2 506  ? -28.379 -0.599  30.107  1.00 17.02  ? 506  VAL C CG1   1 
ATOM   7179  C  CG2   . VAL C 2 506  ? -28.297 0.521   27.875  1.00 13.60  ? 506  VAL C CG2   1 
ATOM   7180  N  N     . ASN C 2 507  ? -31.774 -0.684  30.876  1.00 11.22  ? 507  ASN C N     1 
ATOM   7181  C  CA    . ASN C 2 507  ? -32.535 -0.504  32.100  1.00 14.12  ? 507  ASN C CA    1 
ATOM   7182  C  C     . ASN C 2 507  ? -31.585 -0.342  33.285  1.00 11.25  ? 507  ASN C C     1 
ATOM   7183  O  O     . ASN C 2 507  ? -30.435 -0.775  33.219  1.00 16.17  ? 507  ASN C O     1 
ATOM   7184  C  CB    . ASN C 2 507  ? -33.493 -1.683  32.305  1.00 13.13  ? 507  ASN C CB    1 
ATOM   7185  C  CG    . ASN C 2 507  ? -32.777 -2.965  32.661  1.00 14.78  ? 507  ASN C CG    1 
ATOM   7186  O  OD1   . ASN C 2 507  ? -31.602 -3.152  32.342  1.00 18.97  ? 507  ASN C OD1   1 
ATOM   7187  N  ND2   . ASN C 2 507  ? -33.489 -3.865  33.325  1.00 14.43  ? 507  ASN C ND2   1 
ATOM   7188  N  N     . PRO C 2 508  ? -32.057 0.289   34.371  1.00 12.83  ? 508  PRO C N     1 
ATOM   7189  C  CA    . PRO C 2 508  ? -31.207 0.607   35.526  1.00 9.03   ? 508  PRO C CA    1 
ATOM   7190  C  C     . PRO C 2 508  ? -30.477 -0.577  36.162  1.00 10.05  ? 508  PRO C C     1 
ATOM   7191  O  O     . PRO C 2 508  ? -29.711 -0.367  37.096  1.00 11.43  ? 508  PRO C O     1 
ATOM   7192  C  CB    . PRO C 2 508  ? -32.200 1.205   36.524  1.00 14.39  ? 508  PRO C CB    1 
ATOM   7193  C  CG    . PRO C 2 508  ? -33.260 1.790   35.681  1.00 18.67  ? 508  PRO C CG    1 
ATOM   7194  C  CD    . PRO C 2 508  ? -33.407 0.862   34.518  1.00 17.38  ? 508  PRO C CD    1 
ATOM   7195  N  N     . PHE C 2 509  ? -30.701 -1.792  35.681  1.00 11.01  ? 509  PHE C N     1 
ATOM   7196  C  CA    . PHE C 2 509  ? -30.011 -2.946  36.243  1.00 19.17  ? 509  PHE C CA    1 
ATOM   7197  C  C     . PHE C 2 509  ? -28.955 -3.498  35.280  1.00 17.99  ? 509  PHE C C     1 
ATOM   7198  O  O     . PHE C 2 509  ? -28.461 -4.614  35.453  1.00 22.75  ? 509  PHE C O     1 
ATOM   7199  C  CB    . PHE C 2 509  ? -31.014 -4.042  36.628  1.00 31.06  ? 509  PHE C CB    1 
ATOM   7200  C  CG    . PHE C 2 509  ? -31.476 -3.974  38.066  1.00 34.82  ? 509  PHE C CG    1 
ATOM   7201  C  CD1   . PHE C 2 509  ? -32.737 -3.501  38.384  1.00 35.43  ? 509  PHE C CD1   1 
ATOM   7202  C  CD2   . PHE C 2 509  ? -30.649 -4.395  39.095  1.00 40.26  ? 509  PHE C CD2   1 
ATOM   7203  C  CE1   . PHE C 2 509  ? -33.160 -3.445  39.701  1.00 40.88  ? 509  PHE C CE1   1 
ATOM   7204  C  CE2   . PHE C 2 509  ? -31.069 -4.340  40.412  1.00 40.12  ? 509  PHE C CE2   1 
ATOM   7205  C  CZ    . PHE C 2 509  ? -32.324 -3.865  40.713  1.00 37.77  ? 509  PHE C CZ    1 
ATOM   7206  N  N     . GLY C 2 510  ? -28.606 -2.707  34.272  1.00 14.28  ? 510  GLY C N     1 
ATOM   7207  C  CA    . GLY C 2 510  ? -27.540 -3.074  33.359  1.00 13.68  ? 510  GLY C CA    1 
ATOM   7208  C  C     . GLY C 2 510  ? -27.871 -4.213  32.412  1.00 17.71  ? 510  GLY C C     1 
ATOM   7209  O  O     . GLY C 2 510  ? -26.974 -4.908  31.934  1.00 17.06  ? 510  GLY C O     1 
ATOM   7210  N  N     . PHE C 2 511  ? -29.158 -4.414  32.145  1.00 16.25  ? 511  PHE C N     1 
ATOM   7211  C  CA    . PHE C 2 511  ? -29.586 -5.373  31.131  1.00 16.19  ? 511  PHE C CA    1 
ATOM   7212  C  C     . PHE C 2 511  ? -30.058 -4.611  29.894  1.00 10.81  ? 511  PHE C C     1 
ATOM   7213  O  O     . PHE C 2 511  ? -30.051 -3.382  29.880  1.00 9.11   ? 511  PHE C O     1 
ATOM   7214  C  CB    . PHE C 2 511  ? -30.697 -6.288  31.662  1.00 22.40  ? 511  PHE C CB    1 
ATOM   7215  C  CG    . PHE C 2 511  ? -30.296 -7.110  32.862  1.00 22.33  ? 511  PHE C CG    1 
ATOM   7216  C  CD1   . PHE C 2 511  ? -29.636 -8.319  32.708  1.00 23.26  ? 511  PHE C CD1   1 
ATOM   7217  C  CD2   . PHE C 2 511  ? -30.592 -6.679  34.144  1.00 22.01  ? 511  PHE C CD2   1 
ATOM   7218  C  CE1   . PHE C 2 511  ? -29.272 -9.072  33.812  1.00 24.21  ? 511  PHE C CE1   1 
ATOM   7219  C  CE2   . PHE C 2 511  ? -30.232 -7.429  35.247  1.00 22.58  ? 511  PHE C CE2   1 
ATOM   7220  C  CZ    . PHE C 2 511  ? -29.572 -8.627  35.080  1.00 23.05  ? 511  PHE C CZ    1 
ATOM   7221  N  N     . ILE C 2 512  ? -30.466 -5.332  28.857  1.00 12.66  ? 512  ILE C N     1 
ATOM   7222  C  CA    . ILE C 2 512  ? -30.857 -4.689  27.608  1.00 12.94  ? 512  ILE C CA    1 
ATOM   7223  C  C     . ILE C 2 512  ? -32.303 -4.997  27.212  1.00 12.26  ? 512  ILE C C     1 
ATOM   7224  O  O     . ILE C 2 512  ? -32.628 -6.117  26.832  1.00 12.36  ? 512  ILE C O     1 
ATOM   7225  C  CB    . ILE C 2 512  ? -29.919 -5.101  26.460  1.00 7.46   ? 512  ILE C CB    1 
ATOM   7226  C  CG1   . ILE C 2 512  ? -28.461 -4.909  26.874  1.00 3.42   ? 512  ILE C CG1   1 
ATOM   7227  C  CG2   . ILE C 2 512  ? -30.219 -4.295  25.213  1.00 11.86  ? 512  ILE C CG2   1 
ATOM   7228  C  CD1   . ILE C 2 512  ? -27.487 -4.980  25.720  1.00 3.19   ? 512  ILE C CD1   1 
ATOM   7229  N  N     . GLU C 2 513  ? -33.166 -3.990  27.302  1.00 11.45  ? 513  GLU C N     1 
ATOM   7230  C  CA    . GLU C 2 513  ? -34.561 -4.129  26.901  1.00 9.71   ? 513  GLU C CA    1 
ATOM   7231  C  C     . GLU C 2 513  ? -34.733 -3.784  25.426  1.00 16.38  ? 513  GLU C C     1 
ATOM   7232  O  O     . GLU C 2 513  ? -33.828 -3.237  24.800  1.00 18.80  ? 513  GLU C O     1 
ATOM   7233  C  CB    . GLU C 2 513  ? -35.459 -3.235  27.757  1.00 17.98  ? 513  GLU C CB    1 
ATOM   7234  C  CG    . GLU C 2 513  ? -35.450 -3.583  29.244  1.00 25.78  ? 513  GLU C CG    1 
ATOM   7235  C  CD    . GLU C 2 513  ? -36.308 -2.648  30.092  1.00 27.64  ? 513  GLU C CD    1 
ATOM   7236  O  OE1   . GLU C 2 513  ? -36.655 -1.547  29.615  1.00 24.03  ? 513  GLU C OE1   1 
ATOM   7237  O  OE2   . GLU C 2 513  ? -36.635 -3.019  31.240  1.00 26.24  ? 513  GLU C OE2   1 
ATOM   7238  N  N     . THR C 2 514  ? -35.896 -4.109  24.873  1.00 18.06  ? 514  THR C N     1 
ATOM   7239  C  CA    . THR C 2 514  ? -36.203 -3.808  23.476  1.00 16.79  ? 514  THR C CA    1 
ATOM   7240  C  C     . THR C 2 514  ? -37.716 -3.624  23.303  1.00 23.83  ? 514  THR C C     1 
ATOM   7241  O  O     . THR C 2 514  ? -38.507 -4.359  23.898  1.00 26.11  ? 514  THR C O     1 
ATOM   7242  C  CB    . THR C 2 514  ? -35.678 -4.918  22.536  1.00 13.89  ? 514  THR C CB    1 
ATOM   7243  O  OG1   . THR C 2 514  ? -35.992 -4.600  21.175  1.00 13.81  ? 514  THR C OG1   1 
ATOM   7244  C  CG2   . THR C 2 514  ? -36.279 -6.265  22.893  1.00 21.19  ? 514  THR C CG2   1 
ATOM   7245  N  N     . PRO C 2 515  ? -38.129 -2.626  22.505  1.00 23.08  ? 515  PRO C N     1 
ATOM   7246  C  CA    . PRO C 2 515  ? -39.556 -2.307  22.397  1.00 22.44  ? 515  PRO C CA    1 
ATOM   7247  C  C     . PRO C 2 515  ? -40.362 -3.355  21.639  1.00 24.23  ? 515  PRO C C     1 
ATOM   7248  O  O     . PRO C 2 515  ? -39.898 -3.902  20.642  1.00 24.30  ? 515  PRO C O     1 
ATOM   7249  C  CB    . PRO C 2 515  ? -39.556 -0.974  21.644  1.00 19.62  ? 515  PRO C CB    1 
ATOM   7250  C  CG    . PRO C 2 515  ? -38.321 -0.998  20.849  1.00 17.82  ? 515  PRO C CG    1 
ATOM   7251  C  CD    . PRO C 2 515  ? -37.304 -1.729  21.679  1.00 20.14  ? 515  PRO C CD    1 
ATOM   7252  N  N     . TYR C 2 516  ? -41.567 -3.624  22.124  1.00 30.02  ? 516  TYR C N     1 
ATOM   7253  C  CA    . TYR C 2 516  ? -42.480 -4.552  21.471  1.00 35.50  ? 516  TYR C CA    1 
ATOM   7254  C  C     . TYR C 2 516  ? -43.908 -4.005  21.529  1.00 43.95  ? 516  TYR C C     1 
ATOM   7255  O  O     . TYR C 2 516  ? -44.359 -3.536  22.576  1.00 48.83  ? 516  TYR C O     1 
ATOM   7256  C  CB    . TYR C 2 516  ? -42.416 -5.936  22.127  1.00 39.11  ? 516  TYR C CB    1 
ATOM   7257  C  CG    . TYR C 2 516  ? -41.181 -6.766  21.794  1.00 39.66  ? 516  TYR C CG    1 
ATOM   7258  C  CD1   . TYR C 2 516  ? -40.723 -6.890  20.486  1.00 38.32  ? 516  TYR C CD1   1 
ATOM   7259  C  CD2   . TYR C 2 516  ? -40.486 -7.441  22.794  1.00 39.39  ? 516  TYR C CD2   1 
ATOM   7260  C  CE1   . TYR C 2 516  ? -39.602 -7.656  20.190  1.00 34.18  ? 516  TYR C CE1   1 
ATOM   7261  C  CE2   . TYR C 2 516  ? -39.368 -8.206  22.504  1.00 31.47  ? 516  TYR C CE2   1 
ATOM   7262  C  CZ    . TYR C 2 516  ? -38.930 -8.309  21.203  1.00 27.69  ? 516  TYR C CZ    1 
ATOM   7263  O  OH    . TYR C 2 516  ? -37.818 -9.071  20.916  1.00 24.81  ? 516  TYR C OH    1 
ATOM   7264  N  N     . ARG C 2 517  ? -44.613 -4.047  20.403  1.00 45.80  ? 517  ARG C N     1 
ATOM   7265  C  CA    . ARG C 2 517  ? -46.019 -3.664  20.386  1.00 44.96  ? 517  ARG C CA    1 
ATOM   7266  C  C     . ARG C 2 517  ? -46.845 -4.700  21.126  1.00 53.19  ? 517  ARG C C     1 
ATOM   7267  O  O     . ARG C 2 517  ? -46.539 -5.890  21.101  1.00 53.48  ? 517  ARG C O     1 
ATOM   7268  C  CB    . ARG C 2 517  ? -46.533 -3.506  18.959  1.00 46.80  ? 517  ARG C CB    1 
ATOM   7269  C  CG    . ARG C 2 517  ? -46.252 -2.153  18.359  1.00 48.90  ? 517  ARG C CG    1 
ATOM   7270  C  CD    . ARG C 2 517  ? -47.166 -1.888  17.184  1.00 51.18  ? 517  ARG C CD    1 
ATOM   7271  N  NE    . ARG C 2 517  ? -46.884 -2.771  16.059  1.00 49.39  ? 517  ARG C NE    1 
ATOM   7272  C  CZ    . ARG C 2 517  ? -47.465 -2.661  14.870  1.00 56.67  ? 517  ARG C CZ    1 
ATOM   7273  N  NH1   . ARG C 2 517  ? -48.362 -1.706  14.659  1.00 64.23  ? 517  ARG C NH1   1 
ATOM   7274  N  NH2   . ARG C 2 517  ? -47.151 -3.501  13.892  1.00 54.63  ? 517  ARG C NH2   1 
ATOM   7275  N  N     . LYS C 2 518  ? -47.899 -4.239  21.783  1.00 64.91  ? 518  LYS C N     1 
ATOM   7276  C  CA    . LYS C 2 518  ? -48.710 -5.108  22.619  1.00 72.60  ? 518  LYS C CA    1 
ATOM   7277  C  C     . LYS C 2 518  ? -49.929 -5.627  21.873  1.00 74.95  ? 518  LYS C C     1 
ATOM   7278  O  O     . LYS C 2 518  ? -50.619 -4.873  21.192  1.00 73.06  ? 518  LYS C O     1 
ATOM   7279  C  CB    . LYS C 2 518  ? -49.137 -4.363  23.885  1.00 76.89  ? 518  LYS C CB    1 
ATOM   7280  C  CG    . LYS C 2 518  ? -49.834 -5.226  24.914  1.00 70.84  ? 518  LYS C CG    1 
ATOM   7281  C  CD    . LYS C 2 518  ? -50.144 -4.419  26.160  1.00 70.22  ? 518  LYS C CD    1 
ATOM   7282  C  CE    . LYS C 2 518  ? -50.875 -5.258  27.191  1.00 74.27  ? 518  LYS C CE    1 
ATOM   7283  N  NZ    . LYS C 2 518  ? -51.253 -4.444  28.379  1.00 79.22  ? 518  LYS C NZ    1 
ATOM   7284  N  N     . VAL C 2 519  ? -50.186 -6.922  22.001  1.00 75.05  ? 519  VAL C N     1 
ATOM   7285  C  CA    . VAL C 2 519  ? -51.372 -7.517  21.398  1.00 83.22  ? 519  VAL C CA    1 
ATOM   7286  C  C     . VAL C 2 519  ? -52.268 -8.099  22.487  1.00 87.58  ? 519  VAL C C     1 
ATOM   7287  O  O     . VAL C 2 519  ? -51.893 -9.050  23.174  1.00 82.94  ? 519  VAL C O     1 
ATOM   7288  C  CB    . VAL C 2 519  ? -51.004 -8.605  20.365  1.00 79.71  ? 519  VAL C CB    1 
ATOM   7289  C  CG1   . VAL C 2 519  ? -52.219 -9.429  19.990  1.00 80.79  ? 519  VAL C CG1   1 
ATOM   7290  C  CG2   . VAL C 2 519  ? -50.391 -7.965  19.129  1.00 80.81  ? 519  VAL C CG2   1 
ATOM   7291  N  N     . VAL C 2 520  ? -53.444 -7.501  22.652  1.00 90.34  ? 520  VAL C N     1 
ATOM   7292  C  CA    . VAL C 2 520  ? -54.408 -7.949  23.649  1.00 85.47  ? 520  VAL C CA    1 
ATOM   7293  C  C     . VAL C 2 520  ? -54.956 -9.315  23.253  1.00 89.04  ? 520  VAL C C     1 
ATOM   7294  O  O     . VAL C 2 520  ? -54.614 -10.332 23.858  1.00 85.58  ? 520  VAL C O     1 
ATOM   7295  C  CB    . VAL C 2 520  ? -55.569 -6.952  23.810  1.00 83.80  ? 520  VAL C CB    1 
ATOM   7296  C  CG1   . VAL C 2 520  ? -56.394 -7.299  25.038  1.00 84.48  ? 520  VAL C CG1   1 
ATOM   7297  C  CG2   . VAL C 2 520  ? -55.039 -5.526  23.910  1.00 91.17  ? 520  VAL C CG2   1 
ATOM   7298  N  N     . ASP C 2 521  ? -55.803 -9.328  22.228  1.00 91.44  ? 521  ASP C N     1 
ATOM   7299  C  CA    . ASP C 2 521  ? -56.334 -10.569 21.677  1.00 92.66  ? 521  ASP C CA    1 
ATOM   7300  C  C     . ASP C 2 521  ? -56.383 -10.506 20.158  1.00 87.12  ? 521  ASP C C     1 
ATOM   7301  O  O     . ASP C 2 521  ? -57.433 -10.248 19.572  1.00 91.94  ? 521  ASP C O     1 
ATOM   7302  C  CB    . ASP C 2 521  ? -57.729 -10.859 22.229  1.00 94.72  ? 521  ASP C CB    1 
ATOM   7303  C  CG    . ASP C 2 521  ? -57.691 -11.508 23.595  1.00 100.09 ? 521  ASP C CG    1 
ATOM   7304  O  OD1   . ASP C 2 521  ? -56.725 -12.249 23.875  1.00 99.54  ? 521  ASP C OD1   1 
ATOM   7305  O  OD2   . ASP C 2 521  ? -58.627 -11.277 24.389  1.00 103.93 ? 521  ASP C OD2   1 
ATOM   7306  N  N     . GLY C 2 522  ? -55.242 -10.738 19.522  1.00 75.51  ? 522  GLY C N     1 
ATOM   7307  C  CA    . GLY C 2 522  ? -55.158 -10.664 18.078  1.00 77.10  ? 522  GLY C CA    1 
ATOM   7308  C  C     . GLY C 2 522  ? -55.347 -9.254  17.546  1.00 80.66  ? 522  GLY C C     1 
ATOM   7309  O  O     . GLY C 2 522  ? -55.525 -9.067  16.348  1.00 83.67  ? 522  GLY C O     1 
ATOM   7310  N  N     . VAL C 2 523  ? -55.311 -8.258  18.427  1.00 76.97  ? 523  VAL C N     1 
ATOM   7311  C  CA    . VAL C 2 523  ? -55.464 -6.867  18.005  1.00 71.67  ? 523  VAL C CA    1 
ATOM   7312  C  C     . VAL C 2 523  ? -54.257 -6.024  18.416  1.00 74.11  ? 523  VAL C C     1 
ATOM   7313  O  O     . VAL C 2 523  ? -54.010 -5.821  19.604  1.00 73.00  ? 523  VAL C O     1 
ATOM   7314  C  CB    . VAL C 2 523  ? -56.740 -6.229  18.591  1.00 60.07  ? 523  VAL C CB    1 
ATOM   7315  C  CG1   . VAL C 2 523  ? -56.999 -4.882  17.938  1.00 61.80  ? 523  VAL C CG1   1 
ATOM   7316  C  CG2   . VAL C 2 523  ? -57.934 -7.148  18.403  1.00 63.86  ? 523  VAL C CG2   1 
ATOM   7317  N  N     . VAL C 2 524  ? -53.513 -5.530  17.429  1.00 73.56  ? 524  VAL C N     1 
ATOM   7318  C  CA    . VAL C 2 524  ? -52.297 -4.762  17.691  1.00 65.02  ? 524  VAL C CA    1 
ATOM   7319  C  C     . VAL C 2 524  ? -52.578 -3.421  18.361  1.00 74.36  ? 524  VAL C C     1 
ATOM   7320  O  O     . VAL C 2 524  ? -53.275 -2.567  17.810  1.00 73.41  ? 524  VAL C O     1 
ATOM   7321  C  CB    . VAL C 2 524  ? -51.507 -4.500  16.401  1.00 61.54  ? 524  VAL C CB    1 
ATOM   7322  C  CG1   . VAL C 2 524  ? -50.346 -3.555  16.678  1.00 57.84  ? 524  VAL C CG1   1 
ATOM   7323  C  CG2   . VAL C 2 524  ? -51.014 -5.807  15.806  1.00 62.55  ? 524  VAL C CG2   1 
ATOM   7324  N  N     . SER C 2 525  ? -52.014 -3.246  19.552  1.00 81.52  ? 525  SER C N     1 
ATOM   7325  C  CA    . SER C 2 525  ? -52.163 -2.014  20.318  1.00 83.05  ? 525  SER C CA    1 
ATOM   7326  C  C     . SER C 2 525  ? -50.930 -1.118  20.222  1.00 81.84  ? 525  SER C C     1 
ATOM   7327  O  O     . SER C 2 525  ? -49.797 -1.601  20.263  1.00 84.01  ? 525  SER C O     1 
ATOM   7328  C  CB    . SER C 2 525  ? -52.449 -2.338  21.784  1.00 77.42  ? 525  SER C CB    1 
ATOM   7329  O  OG    . SER C 2 525  ? -52.212 -1.209  22.604  1.00 81.50  ? 525  SER C OG    1 
ATOM   7330  N  N     . ASP C 2 526  ? -51.158 0.188   20.114  1.00 75.70  ? 526  ASP C N     1 
ATOM   7331  C  CA    . ASP C 2 526  ? -50.069 1.160   20.038  1.00 77.95  ? 526  ASP C CA    1 
ATOM   7332  C  C     . ASP C 2 526  ? -49.347 1.318   21.374  1.00 70.66  ? 526  ASP C C     1 
ATOM   7333  O  O     . ASP C 2 526  ? -48.332 2.008   21.464  1.00 67.00  ? 526  ASP C O     1 
ATOM   7334  C  CB    . ASP C 2 526  ? -50.597 2.514   19.561  1.00 87.64  ? 526  ASP C CB    1 
ATOM   7335  C  CG    . ASP C 2 526  ? -50.814 2.561   18.057  1.00 91.04  ? 526  ASP C CG    1 
ATOM   7336  O  OD1   . ASP C 2 526  ? -51.052 1.492   17.454  1.00 83.37  ? 526  ASP C OD1   1 
ATOM   7337  O  OD2   . ASP C 2 526  ? -50.742 3.668   17.481  1.00 94.75  ? 526  ASP C OD2   1 
ATOM   7338  N  N     . GLU C 2 527  ? -49.880 0.680   22.411  1.00 70.42  ? 527  GLU C N     1 
ATOM   7339  C  CA    . GLU C 2 527  ? -49.205 0.617   23.702  1.00 76.35  ? 527  GLU C CA    1 
ATOM   7340  C  C     . GLU C 2 527  ? -47.938 -0.225  23.598  1.00 76.77  ? 527  GLU C C     1 
ATOM   7341  O  O     . GLU C 2 527  ? -47.976 -1.359  23.119  1.00 74.93  ? 527  GLU C O     1 
ATOM   7342  C  CB    . GLU C 2 527  ? -50.136 0.044   24.775  1.00 78.86  ? 527  GLU C CB    1 
ATOM   7343  C  CG    . GLU C 2 527  ? -49.427 -0.331  26.069  1.00 78.27  ? 527  GLU C CG    1 
ATOM   7344  C  CD    . GLU C 2 527  ? -50.379 -0.836  27.136  1.00 73.73  ? 527  GLU C CD    1 
ATOM   7345  O  OE1   . GLU C 2 527  ? -51.557 -0.421  27.132  1.00 69.47  ? 527  GLU C OE1   1 
ATOM   7346  O  OE2   . GLU C 2 527  ? -49.949 -1.650  27.980  1.00 72.66  ? 527  GLU C OE2   1 
ATOM   7347  N  N     . ILE C 2 528  ? -46.822 0.335   24.057  1.00 69.43  ? 528  ILE C N     1 
ATOM   7348  C  CA    . ILE C 2 528  ? -45.522 -0.317  23.948  1.00 54.69  ? 528  ILE C CA    1 
ATOM   7349  C  C     . ILE C 2 528  ? -44.897 -0.553  25.315  1.00 47.41  ? 528  ILE C C     1 
ATOM   7350  O  O     . ILE C 2 528  ? -44.885 0.337   26.163  1.00 48.85  ? 528  ILE C O     1 
ATOM   7351  C  CB    . ILE C 2 528  ? -44.554 0.521   23.095  1.00 46.28  ? 528  ILE C CB    1 
ATOM   7352  C  CG1   . ILE C 2 528  ? -45.182 0.831   21.739  1.00 51.06  ? 528  ILE C CG1   1 
ATOM   7353  C  CG2   . ILE C 2 528  ? -43.223 -0.195  22.918  1.00 45.62  ? 528  ILE C CG2   1 
ATOM   7354  C  CD1   . ILE C 2 528  ? -44.528 1.964   21.025  1.00 42.67  ? 528  ILE C CD1   1 
ATOM   7355  N  N     . VAL C 2 529  ? -44.383 -1.759  25.527  1.00 41.07  ? 529  VAL C N     1 
ATOM   7356  C  CA    . VAL C 2 529  ? -43.643 -2.067  26.742  1.00 44.85  ? 529  VAL C CA    1 
ATOM   7357  C  C     . VAL C 2 529  ? -42.292 -2.685  26.372  1.00 41.33  ? 529  VAL C C     1 
ATOM   7358  O  O     . VAL C 2 529  ? -42.204 -3.519  25.469  1.00 40.65  ? 529  VAL C O     1 
ATOM   7359  C  CB    . VAL C 2 529  ? -44.439 -3.016  27.668  1.00 49.30  ? 529  VAL C CB    1 
ATOM   7360  C  CG1   . VAL C 2 529  ? -44.874 -4.276  26.920  1.00 42.88  ? 529  VAL C CG1   1 
ATOM   7361  C  CG2   . VAL C 2 529  ? -43.635 -3.361  28.921  1.00 49.97  ? 529  VAL C CG2   1 
ATOM   7362  N  N     . TYR C 2 530  ? -41.232 -2.254  27.047  1.00 34.78  ? 530  TYR C N     1 
ATOM   7363  C  CA    . TYR C 2 530  ? -39.913 -2.827  26.816  1.00 27.53  ? 530  TYR C CA    1 
ATOM   7364  C  C     . TYR C 2 530  ? -39.794 -4.155  27.561  1.00 28.00  ? 530  TYR C C     1 
ATOM   7365  O  O     . TYR C 2 530  ? -40.293 -4.293  28.676  1.00 33.31  ? 530  TYR C O     1 
ATOM   7366  C  CB    . TYR C 2 530  ? -38.815 -1.858  27.260  1.00 28.94  ? 530  TYR C CB    1 
ATOM   7367  C  CG    . TYR C 2 530  ? -38.633 -0.647  26.361  1.00 29.66  ? 530  TYR C CG    1 
ATOM   7368  C  CD1   . TYR C 2 530  ? -39.138 0.596   26.719  1.00 27.13  ? 530  TYR C CD1   1 
ATOM   7369  C  CD2   . TYR C 2 530  ? -37.950 -0.749  25.157  1.00 28.56  ? 530  TYR C CD2   1 
ATOM   7370  C  CE1   . TYR C 2 530  ? -38.966 1.702   25.901  1.00 21.19  ? 530  TYR C CE1   1 
ATOM   7371  C  CE2   . TYR C 2 530  ? -37.776 0.349   24.336  1.00 21.59  ? 530  TYR C CE2   1 
ATOM   7372  C  CZ    . TYR C 2 530  ? -38.285 1.569   24.711  1.00 19.32  ? 530  TYR C CZ    1 
ATOM   7373  O  OH    . TYR C 2 530  ? -38.110 2.657   23.890  1.00 19.63  ? 530  TYR C OH    1 
ATOM   7374  N  N     . LEU C 2 531  ? -39.156 -5.140  26.938  1.00 28.81  ? 531  LEU C N     1 
ATOM   7375  C  CA    . LEU C 2 531  ? -38.949 -6.436  27.581  1.00 27.81  ? 531  LEU C CA    1 
ATOM   7376  C  C     . LEU C 2 531  ? -37.481 -6.773  27.698  1.00 30.63  ? 531  LEU C C     1 
ATOM   7377  O  O     . LEU C 2 531  ? -36.713 -6.559  26.765  1.00 33.58  ? 531  LEU C O     1 
ATOM   7378  C  CB    . LEU C 2 531  ? -39.638 -7.560  26.813  1.00 30.86  ? 531  LEU C CB    1 
ATOM   7379  C  CG    . LEU C 2 531  ? -41.142 -7.734  26.974  1.00 44.37  ? 531  LEU C CG    1 
ATOM   7380  C  CD1   . LEU C 2 531  ? -41.889 -6.648  26.215  1.00 48.50  ? 531  LEU C CD1   1 
ATOM   7381  C  CD2   . LEU C 2 531  ? -41.550 -9.122  26.500  1.00 46.83  ? 531  LEU C CD2   1 
ATOM   7382  N  N     . THR C 2 532  ? -37.089 -7.329  28.836  1.00 30.71  ? 532  THR C N     1 
ATOM   7383  C  CA    . THR C 2 532  ? -35.715 -7.767  28.983  1.00 29.80  ? 532  THR C CA    1 
ATOM   7384  C  C     . THR C 2 532  ? -35.546 -9.095  28.253  1.00 26.87  ? 532  THR C C     1 
ATOM   7385  O  O     . THR C 2 532  ? -36.486 -9.602  27.635  1.00 28.74  ? 532  THR C O     1 
ATOM   7386  C  CB    . THR C 2 532  ? -35.302 -7.902  30.459  1.00 27.30  ? 532  THR C CB    1 
ATOM   7387  O  OG1   . THR C 2 532  ? -35.889 -9.079  31.024  1.00 34.39  ? 532  THR C OG1   1 
ATOM   7388  C  CG2   . THR C 2 532  ? -35.746 -6.677  31.248  1.00 22.48  ? 532  THR C CG2   1 
ATOM   7389  N  N     . ALA C 2 533  ? -34.339 -9.642  28.308  1.00 24.78  ? 533  ALA C N     1 
ATOM   7390  C  CA    . ALA C 2 533  ? -34.029 -10.858 27.578  1.00 21.66  ? 533  ALA C CA    1 
ATOM   7391  C  C     . ALA C 2 533  ? -34.843 -12.034 28.094  1.00 25.94  ? 533  ALA C C     1 
ATOM   7392  O  O     . ALA C 2 533  ? -35.562 -12.680 27.333  1.00 31.60  ? 533  ALA C O     1 
ATOM   7393  C  CB    . ALA C 2 533  ? -32.549 -11.157 27.667  1.00 22.48  ? 533  ALA C CB    1 
ATOM   7394  N  N     . ASP C 2 534  ? -34.743 -12.300 29.392  1.00 25.30  ? 534  ASP C N     1 
ATOM   7395  C  CA    . ASP C 2 534  ? -35.411 -13.460 29.972  1.00 29.61  ? 534  ASP C CA    1 
ATOM   7396  C  C     . ASP C 2 534  ? -36.927 -13.289 30.030  1.00 33.16  ? 534  ASP C C     1 
ATOM   7397  O  O     . ASP C 2 534  ? -37.667 -14.264 29.909  1.00 40.83  ? 534  ASP C O     1 
ATOM   7398  C  CB    . ASP C 2 534  ? -34.858 -13.759 31.371  1.00 23.80  ? 534  ASP C CB    1 
ATOM   7399  C  CG    . ASP C 2 534  ? -34.639 -12.512 32.194  1.00 19.62  ? 534  ASP C CG    1 
ATOM   7400  O  OD1   . ASP C 2 534  ? -35.248 -11.473 31.875  1.00 28.78  ? 534  ASP C OD1   1 
ATOM   7401  O  OD2   . ASP C 2 534  ? -33.858 -12.575 33.166  1.00 21.12  ? 534  ASP C OD2   1 
ATOM   7402  N  N     . GLU C 2 535  ? -37.392 -12.057 30.208  1.00 33.92  ? 535  GLU C N     1 
ATOM   7403  C  CA    . GLU C 2 535  ? -38.827 -11.800 30.245  1.00 35.64  ? 535  GLU C CA    1 
ATOM   7404  C  C     . GLU C 2 535  ? -39.463 -12.154 28.911  1.00 31.90  ? 535  GLU C C     1 
ATOM   7405  O  O     . GLU C 2 535  ? -40.585 -12.648 28.857  1.00 37.75  ? 535  GLU C O     1 
ATOM   7406  C  CB    . GLU C 2 535  ? -39.111 -10.342 30.587  1.00 42.35  ? 535  GLU C CB    1 
ATOM   7407  C  CG    . GLU C 2 535  ? -38.715 -9.946  31.995  1.00 45.50  ? 535  GLU C CG    1 
ATOM   7408  C  CD    . GLU C 2 535  ? -38.659 -8.440  32.176  1.00 56.25  ? 535  GLU C CD    1 
ATOM   7409  O  OE1   . GLU C 2 535  ? -39.053 -7.712  31.239  1.00 53.04  ? 535  GLU C OE1   1 
ATOM   7410  O  OE2   . GLU C 2 535  ? -38.213 -7.986  33.250  1.00 64.16  ? 535  GLU C OE2   1 
ATOM   7411  N  N     . GLU C 2 536  ? -38.732 -11.909 27.833  1.00 28.73  ? 536  GLU C N     1 
ATOM   7412  C  CA    . GLU C 2 536  ? -39.235 -12.203 26.504  1.00 27.62  ? 536  GLU C CA    1 
ATOM   7413  C  C     . GLU C 2 536  ? -39.356 -13.707 26.293  1.00 31.49  ? 536  GLU C C     1 
ATOM   7414  O  O     . GLU C 2 536  ? -40.212 -14.171 25.535  1.00 37.10  ? 536  GLU C O     1 
ATOM   7415  C  CB    . GLU C 2 536  ? -38.325 -11.595 25.446  1.00 30.27  ? 536  GLU C CB    1 
ATOM   7416  C  CG    . GLU C 2 536  ? -38.812 -11.795 24.032  1.00 30.96  ? 536  GLU C CG    1 
ATOM   7417  C  CD    . GLU C 2 536  ? -37.796 -11.348 23.012  1.00 34.21  ? 536  GLU C CD    1 
ATOM   7418  O  OE1   . GLU C 2 536  ? -36.967 -10.478 23.347  1.00 35.56  ? 536  GLU C OE1   1 
ATOM   7419  O  OE2   . GLU C 2 536  ? -37.818 -11.876 21.882  1.00 34.29  ? 536  GLU C OE2   1 
ATOM   7420  N  N     . ASP C 2 537  ? -38.507 -14.468 26.979  1.00 32.05  ? 537  ASP C N     1 
ATOM   7421  C  CA    . ASP C 2 537  ? -38.506 -15.921 26.850  1.00 33.46  ? 537  ASP C CA    1 
ATOM   7422  C  C     . ASP C 2 537  ? -39.795 -16.548 27.383  1.00 35.90  ? 537  ASP C C     1 
ATOM   7423  O  O     . ASP C 2 537  ? -40.181 -17.640 26.968  1.00 29.89  ? 537  ASP C O     1 
ATOM   7424  C  CB    . ASP C 2 537  ? -37.293 -16.519 27.568  1.00 28.27  ? 537  ASP C CB    1 
ATOM   7425  C  CG    . ASP C 2 537  ? -36.024 -16.437 26.738  1.00 30.70  ? 537  ASP C CG    1 
ATOM   7426  O  OD1   . ASP C 2 537  ? -36.117 -16.099 25.540  1.00 27.68  ? 537  ASP C OD1   1 
ATOM   7427  O  OD2   . ASP C 2 537  ? -34.935 -16.724 27.280  1.00 30.17  ? 537  ASP C OD2   1 
ATOM   7428  N  N     . ARG C 2 538  ? -40.461 -15.847 28.295  1.00 42.39  ? 538  ARG C N     1 
ATOM   7429  C  CA    . ARG C 2 538  ? -41.709 -16.331 28.878  1.00 42.92  ? 538  ARG C CA    1 
ATOM   7430  C  C     . ARG C 2 538  ? -42.915 -15.966 28.020  1.00 44.04  ? 538  ARG C C     1 
ATOM   7431  O  O     . ARG C 2 538  ? -44.038 -16.375 28.315  1.00 55.24  ? 538  ARG C O     1 
ATOM   7432  C  CB    . ARG C 2 538  ? -41.901 -15.774 30.292  1.00 39.26  ? 538  ARG C CB    1 
ATOM   7433  C  CG    . ARG C 2 538  ? -40.800 -16.146 31.268  1.00 43.28  ? 538  ARG C CG    1 
ATOM   7434  C  CD    . ARG C 2 538  ? -41.165 -15.776 32.696  1.00 45.16  ? 538  ARG C CD    1 
ATOM   7435  N  NE    . ARG C 2 538  ? -41.273 -14.334 32.898  1.00 47.67  ? 538  ARG C NE    1 
ATOM   7436  C  CZ    . ARG C 2 538  ? -42.418 -13.656 32.886  1.00 56.09  ? 538  ARG C CZ    1 
ATOM   7437  N  NH1   . ARG C 2 538  ? -42.412 -12.345 33.086  1.00 63.91  ? 538  ARG C NH1   1 
ATOM   7438  N  NH2   . ARG C 2 538  ? -43.567 -14.286 32.675  1.00 49.64  ? 538  ARG C NH2   1 
ATOM   7439  N  N     . HIS C 2 539  ? -42.688 -15.191 26.966  1.00 37.69  ? 539  HIS C N     1 
ATOM   7440  C  CA    . HIS C 2 539  ? -43.780 -14.764 26.106  1.00 36.38  ? 539  HIS C CA    1 
ATOM   7441  C  C     . HIS C 2 539  ? -43.632 -15.295 24.690  1.00 35.59  ? 539  HIS C C     1 
ATOM   7442  O  O     . HIS C 2 539  ? -42.790 -16.145 24.417  1.00 33.75  ? 539  HIS C O     1 
ATOM   7443  C  CB    . HIS C 2 539  ? -43.870 -13.240 26.076  1.00 42.71  ? 539  HIS C CB    1 
ATOM   7444  C  CG    . HIS C 2 539  ? -44.590 -12.653 27.250  1.00 45.97  ? 539  HIS C CG    1 
ATOM   7445  N  ND1   . HIS C 2 539  ? -45.881 -12.180 27.172  1.00 53.73  ? 539  HIS C ND1   1 
ATOM   7446  C  CD2   . HIS C 2 539  ? -44.199 -12.468 28.534  1.00 48.68  ? 539  HIS C CD2   1 
ATOM   7447  C  CE1   . HIS C 2 539  ? -46.255 -11.724 28.355  1.00 57.49  ? 539  HIS C CE1   1 
ATOM   7448  N  NE2   . HIS C 2 539  ? -45.252 -11.888 29.198  1.00 54.71  ? 539  HIS C NE2   1 
ATOM   7449  N  N     . VAL C 2 540  ? -44.460 -14.771 23.795  1.00 38.52  ? 540  VAL C N     1 
ATOM   7450  C  CA    . VAL C 2 540  ? -44.503 -15.215 22.410  1.00 41.68  ? 540  VAL C CA    1 
ATOM   7451  C  C     . VAL C 2 540  ? -44.705 -14.011 21.496  1.00 40.47  ? 540  VAL C C     1 
ATOM   7452  O  O     . VAL C 2 540  ? -45.663 -13.256 21.647  1.00 51.60  ? 540  VAL C O     1 
ATOM   7453  C  CB    . VAL C 2 540  ? -45.622 -16.266 22.204  1.00 50.02  ? 540  VAL C CB    1 
ATOM   7454  C  CG1   . VAL C 2 540  ? -46.228 -16.178 20.808  1.00 49.18  ? 540  VAL C CG1   1 
ATOM   7455  C  CG2   . VAL C 2 540  ? -45.092 -17.667 22.508  1.00 52.42  ? 540  VAL C CG2   1 
ATOM   7456  N  N     . VAL C 2 541  ? -43.783 -13.824 20.559  1.00 35.49  ? 541  VAL C N     1 
ATOM   7457  C  CA    . VAL C 2 541  ? -43.763 -12.611 19.750  1.00 40.49  ? 541  VAL C CA    1 
ATOM   7458  C  C     . VAL C 2 541  ? -43.912 -12.900 18.264  1.00 44.98  ? 541  VAL C C     1 
ATOM   7459  O  O     . VAL C 2 541  ? -43.311 -13.835 17.739  1.00 51.90  ? 541  VAL C O     1 
ATOM   7460  C  CB    . VAL C 2 541  ? -42.463 -11.814 19.970  1.00 42.24  ? 541  VAL C CB    1 
ATOM   7461  C  CG1   . VAL C 2 541  ? -42.487 -10.520 19.176  1.00 39.82  ? 541  VAL C CG1   1 
ATOM   7462  C  CG2   . VAL C 2 541  ? -42.263 -11.527 21.447  1.00 47.92  ? 541  VAL C CG2   1 
ATOM   7463  N  N     . ALA C 2 542  ? -44.720 -12.085 17.594  1.00 45.51  ? 542  ALA C N     1 
ATOM   7464  C  CA    . ALA C 2 542  ? -44.909 -12.197 16.157  1.00 49.85  ? 542  ALA C CA    1 
ATOM   7465  C  C     . ALA C 2 542  ? -43.940 -11.297 15.401  1.00 42.88  ? 542  ALA C C     1 
ATOM   7466  O  O     . ALA C 2 542  ? -43.454 -10.298 15.932  1.00 43.95  ? 542  ALA C O     1 
ATOM   7467  C  CB    . ALA C 2 542  ? -46.341 -11.857 15.785  1.00 60.40  ? 542  ALA C CB    1 
ATOM   7468  N  N     . GLN C 2 543  ? -43.665 -11.662 14.154  1.00 39.04  ? 543  GLN C N     1 
ATOM   7469  C  CA    . GLN C 2 543  ? -42.783 -10.876 13.306  1.00 37.04  ? 543  GLN C CA    1 
ATOM   7470  C  C     . GLN C 2 543  ? -43.427 -9.549  12.925  1.00 37.82  ? 543  GLN C C     1 
ATOM   7471  O  O     . GLN C 2 543  ? -44.644 -9.456  12.788  1.00 40.59  ? 543  GLN C O     1 
ATOM   7472  C  CB    . GLN C 2 543  ? -42.408 -11.667 12.055  1.00 42.22  ? 543  GLN C CB    1 
ATOM   7473  C  CG    . GLN C 2 543  ? -41.599 -12.909 12.351  1.00 47.15  ? 543  GLN C CG    1 
ATOM   7474  C  CD    . GLN C 2 543  ? -40.215 -12.582 12.866  1.00 37.57  ? 543  GLN C CD    1 
ATOM   7475  O  OE1   . GLN C 2 543  ? -39.708 -11.478 12.664  1.00 51.48  ? 543  GLN C OE1   1 
ATOM   7476  N  NE2   . GLN C 2 543  ? -39.593 -13.544 13.533  1.00 32.92  ? 543  GLN C NE2   1 
ATOM   7477  N  N     . ALA C 2 544  ? -42.595 -8.527  12.758  1.00 38.02  ? 544  ALA C N     1 
ATOM   7478  C  CA    . ALA C 2 544  ? -43.069 -7.177  12.478  1.00 40.82  ? 544  ALA C CA    1 
ATOM   7479  C  C     . ALA C 2 544  ? -43.874 -7.096  11.184  1.00 47.59  ? 544  ALA C C     1 
ATOM   7480  O  O     . ALA C 2 544  ? -44.799 -6.294  11.073  1.00 52.34  ? 544  ALA C O     1 
ATOM   7481  C  CB    . ALA C 2 544  ? -41.894 -6.217  12.419  1.00 39.17  ? 544  ALA C CB    1 
ATOM   7482  N  N     . ASN C 2 545  ? -43.527 -7.937  10.215  1.00 46.02  ? 545  ASN C N     1 
ATOM   7483  C  CA    . ASN C 2 545  ? -44.118 -7.850  8.884   1.00 46.98  ? 545  ASN C CA    1 
ATOM   7484  C  C     . ASN C 2 545  ? -45.374 -8.700  8.697   1.00 47.98  ? 545  ASN C C     1 
ATOM   7485  O  O     . ASN C 2 545  ? -45.876 -8.834  7.580   1.00 49.21  ? 545  ASN C O     1 
ATOM   7486  C  CB    . ASN C 2 545  ? -43.085 -8.245  7.836   1.00 45.21  ? 545  ASN C CB    1 
ATOM   7487  C  CG    . ASN C 2 545  ? -42.670 -9.690  7.958   1.00 51.15  ? 545  ASN C CG    1 
ATOM   7488  O  OD1   . ASN C 2 545  ? -42.781 -10.290 9.026   1.00 52.13  ? 545  ASN C OD1   1 
ATOM   7489  N  ND2   . ASN C 2 545  ? -42.192 -10.262 6.861   1.00 58.13  ? 545  ASN C ND2   1 
ATOM   7490  N  N     . SER C 2 546  ? -45.869 -9.281  9.785   1.00 49.32  ? 546  SER C N     1 
ATOM   7491  C  CA    . SER C 2 546  ? -47.131 -10.013 9.748   1.00 52.48  ? 546  SER C CA    1 
ATOM   7492  C  C     . SER C 2 546  ? -48.279 -9.055  9.444   1.00 59.81  ? 546  SER C C     1 
ATOM   7493  O  O     . SER C 2 546  ? -48.536 -8.137  10.220  1.00 65.37  ? 546  SER C O     1 
ATOM   7494  C  CB    . SER C 2 546  ? -47.382 -10.737 11.073  1.00 56.12  ? 546  SER C CB    1 
ATOM   7495  O  OG    . SER C 2 546  ? -46.396 -11.726 11.313  1.00 62.44  ? 546  SER C OG    1 
ATOM   7496  N  N     . PRO C 2 547  ? -48.964 -9.269  8.307   1.00 57.24  ? 547  PRO C N     1 
ATOM   7497  C  CA    . PRO C 2 547  ? -50.054 -8.424  7.802   1.00 57.76  ? 547  PRO C CA    1 
ATOM   7498  C  C     . PRO C 2 547  ? -51.100 -8.111  8.868   1.00 61.19  ? 547  PRO C C     1 
ATOM   7499  O  O     . PRO C 2 547  ? -51.452 -8.983  9.661   1.00 61.14  ? 547  PRO C O     1 
ATOM   7500  C  CB    . PRO C 2 547  ? -50.654 -9.268  6.678   1.00 56.17  ? 547  PRO C CB    1 
ATOM   7501  C  CG    . PRO C 2 547  ? -49.529 -10.117 6.214   1.00 51.42  ? 547  PRO C CG    1 
ATOM   7502  C  CD    . PRO C 2 547  ? -48.722 -10.431 7.435   1.00 52.63  ? 547  PRO C CD    1 
ATOM   7503  N  N     . ILE C 2 548  ? -51.583 -6.872  8.877   1.00 58.09  ? 548  ILE C N     1 
ATOM   7504  C  CA    . ILE C 2 548  ? -52.464 -6.387  9.933   1.00 62.34  ? 548  ILE C CA    1 
ATOM   7505  C  C     . ILE C 2 548  ? -53.705 -5.686  9.375   1.00 68.22  ? 548  ILE C C     1 
ATOM   7506  O  O     . ILE C 2 548  ? -53.619 -4.923  8.413   1.00 64.38  ? 548  ILE C O     1 
ATOM   7507  C  CB    . ILE C 2 548  ? -51.708 -5.419  10.868  1.00 61.15  ? 548  ILE C CB    1 
ATOM   7508  C  CG1   . ILE C 2 548  ? -50.515 -6.125  11.510  1.00 63.74  ? 548  ILE C CG1   1 
ATOM   7509  C  CG2   . ILE C 2 548  ? -52.623 -4.878  11.948  1.00 67.90  ? 548  ILE C CG2   1 
ATOM   7510  C  CD1   . ILE C 2 548  ? -49.544 -5.192  12.190  1.00 66.19  ? 548  ILE C CD1   1 
ATOM   7511  N  N     . ASP C 2 549  ? -54.857 -5.963  9.980   1.00 70.38  ? 549  ASP C N     1 
ATOM   7512  C  CA    . ASP C 2 549  ? -56.106 -5.287  9.639   1.00 67.51  ? 549  ASP C CA    1 
ATOM   7513  C  C     . ASP C 2 549  ? -56.049 -3.795  9.976   1.00 70.46  ? 549  ASP C C     1 
ATOM   7514  O  O     . ASP C 2 549  ? -55.347 -3.386  10.902  1.00 72.18  ? 549  ASP C O     1 
ATOM   7515  C  CB    . ASP C 2 549  ? -57.276 -5.952  10.372  1.00 63.30  ? 549  ASP C CB    1 
ATOM   7516  C  CG    . ASP C 2 549  ? -58.561 -5.159  10.271  1.00 67.99  ? 549  ASP C CG    1 
ATOM   7517  O  OD1   . ASP C 2 549  ? -59.318 -5.135  11.263  1.00 73.59  ? 549  ASP C OD1   1 
ATOM   7518  O  OD2   . ASP C 2 549  ? -58.816 -4.564  9.203   1.00 68.69  ? 549  ASP C OD2   1 
ATOM   7519  N  N     . ALA C 2 550  ? -56.796 -2.995  9.216   1.00 68.27  ? 550  ALA C N     1 
ATOM   7520  C  CA    . ALA C 2 550  ? -56.881 -1.551  9.426   1.00 58.62  ? 550  ALA C CA    1 
ATOM   7521  C  C     . ALA C 2 550  ? -57.255 -1.202  10.863  1.00 62.77  ? 550  ALA C C     1 
ATOM   7522  O  O     . ALA C 2 550  ? -56.820 -0.182  11.393  1.00 64.87  ? 550  ALA C O     1 
ATOM   7523  C  CB    . ALA C 2 550  ? -57.884 -0.937  8.458   1.00 47.08  ? 550  ALA C CB    1 
ATOM   7524  N  N     . ASP C 2 551  ? -58.063 -2.052  11.489  1.00 66.42  ? 551  ASP C N     1 
ATOM   7525  C  CA    . ASP C 2 551  ? -58.374 -1.889  12.903  1.00 67.46  ? 551  ASP C CA    1 
ATOM   7526  C  C     . ASP C 2 551  ? -57.183 -2.334  13.734  1.00 63.23  ? 551  ASP C C     1 
ATOM   7527  O  O     . ASP C 2 551  ? -56.693 -1.590  14.582  1.00 70.31  ? 551  ASP C O     1 
ATOM   7528  C  CB    . ASP C 2 551  ? -59.623 -2.682  13.291  1.00 73.64  ? 551  ASP C CB    1 
ATOM   7529  C  CG    . ASP C 2 551  ? -60.893 -2.093  12.702  1.00 80.37  ? 551  ASP C CG    1 
ATOM   7530  O  OD1   . ASP C 2 551  ? -60.908 -0.873  12.423  1.00 75.55  ? 551  ASP C OD1   1 
ATOM   7531  O  OD2   . ASP C 2 551  ? -61.874 -2.849  12.522  1.00 79.19  ? 551  ASP C OD2   1 
ATOM   7532  N  N     . GLY C 2 552  ? -56.714 -3.551  13.481  1.00 58.76  ? 552  GLY C N     1 
ATOM   7533  C  CA    . GLY C 2 552  ? -55.529 -4.047  14.153  1.00 68.26  ? 552  GLY C CA    1 
ATOM   7534  C  C     . GLY C 2 552  ? -55.470 -5.555  14.285  1.00 70.80  ? 552  GLY C C     1 
ATOM   7535  O  O     . GLY C 2 552  ? -54.601 -6.087  14.973  1.00 74.58  ? 552  GLY C O     1 
ATOM   7536  N  N     . ARG C 2 553  ? -56.385 -6.253  13.624  1.00 66.32  ? 553  ARG C N     1 
ATOM   7537  C  CA    . ARG C 2 553  ? -56.423 -7.705  13.735  1.00 68.28  ? 553  ARG C CA    1 
ATOM   7538  C  C     . ARG C 2 553  ? -55.506 -8.390  12.721  1.00 63.95  ? 553  ARG C C     1 
ATOM   7539  O  O     . ARG C 2 553  ? -55.200 -7.838  11.667  1.00 64.75  ? 553  ARG C O     1 
ATOM   7540  C  CB    . ARG C 2 553  ? -57.862 -8.207  13.591  1.00 73.28  ? 553  ARG C CB    1 
ATOM   7541  C  CG    . ARG C 2 553  ? -58.700 -7.987  14.847  1.00 70.84  ? 553  ARG C CG    1 
ATOM   7542  C  CD    . ARG C 2 553  ? -60.154 -8.399  14.662  1.00 71.74  ? 553  ARG C CD    1 
ATOM   7543  N  NE    . ARG C 2 553  ? -60.918 -7.421  13.890  1.00 81.17  ? 553  ARG C NE    1 
ATOM   7544  C  CZ    . ARG C 2 553  ? -61.515 -6.353  14.413  1.00 77.68  ? 553  ARG C CZ    1 
ATOM   7545  N  NH1   . ARG C 2 553  ? -61.434 -6.116  15.716  1.00 76.86  ? 553  ARG C NH1   1 
ATOM   7546  N  NH2   . ARG C 2 553  ? -62.192 -5.518  13.634  1.00 62.92  ? 553  ARG C NH2   1 
ATOM   7547  N  N     . PHE C 2 554  ? -55.055 -9.592  13.063  1.00 59.27  ? 554  PHE C N     1 
ATOM   7548  C  CA    . PHE C 2 554  ? -54.191 -10.370 12.183  1.00 59.94  ? 554  PHE C CA    1 
ATOM   7549  C  C     . PHE C 2 554  ? -54.976 -10.903 10.995  1.00 68.51  ? 554  PHE C C     1 
ATOM   7550  O  O     . PHE C 2 554  ? -56.202 -10.928 11.022  1.00 87.38  ? 554  PHE C O     1 
ATOM   7551  C  CB    . PHE C 2 554  ? -53.542 -11.526 12.944  1.00 60.43  ? 554  PHE C CB    1 
ATOM   7552  C  CG    . PHE C 2 554  ? -52.336 -11.123 13.737  1.00 69.65  ? 554  PHE C CG    1 
ATOM   7553  C  CD1   . PHE C 2 554  ? -51.441 -12.076 14.191  1.00 70.24  ? 554  PHE C CD1   1 
ATOM   7554  C  CD2   . PHE C 2 554  ? -52.095 -9.790  14.026  1.00 71.73  ? 554  PHE C CD2   1 
ATOM   7555  C  CE1   . PHE C 2 554  ? -50.327 -11.707 14.917  1.00 68.17  ? 554  PHE C CE1   1 
ATOM   7556  C  CE2   . PHE C 2 554  ? -50.985 -9.415  14.753  1.00 71.60  ? 554  PHE C CE2   1 
ATOM   7557  C  CZ    . PHE C 2 554  ? -50.099 -10.373 15.199  1.00 67.97  ? 554  PHE C CZ    1 
ATOM   7558  N  N     . VAL C 2 555  ? -54.267 -11.335 9.957   1.00 66.56  ? 555  VAL C N     1 
ATOM   7559  C  CA    . VAL C 2 555  ? -54.909 -11.831 8.740   1.00 69.08  ? 555  VAL C CA    1 
ATOM   7560  C  C     . VAL C 2 555  ? -55.138 -13.338 8.770   1.00 63.44  ? 555  VAL C C     1 
ATOM   7561  O  O     . VAL C 2 555  ? -56.256 -13.816 8.574   1.00 57.28  ? 555  VAL C O     1 
ATOM   7562  C  CB    . VAL C 2 555  ? -54.077 -11.490 7.497   1.00 65.31  ? 555  VAL C CB    1 
ATOM   7563  C  CG1   . VAL C 2 555  ? -54.555 -12.297 6.294   1.00 60.84  ? 555  VAL C CG1   1 
ATOM   7564  C  CG2   . VAL C 2 555  ? -54.143 -9.997  7.219   1.00 67.65  ? 555  VAL C CG2   1 
ATOM   7565  N  N     . GLU C 2 556  ? -54.063 -14.081 9.001   1.00 65.12  ? 556  GLU C N     1 
ATOM   7566  C  CA    . GLU C 2 556  ? -54.132 -15.530 9.083   1.00 65.66  ? 556  GLU C CA    1 
ATOM   7567  C  C     . GLU C 2 556  ? -54.136 -15.954 10.543  1.00 66.85  ? 556  GLU C C     1 
ATOM   7568  O  O     . GLU C 2 556  ? -53.521 -15.295 11.380  1.00 74.84  ? 556  GLU C O     1 
ATOM   7569  C  CB    . GLU C 2 556  ? -52.955 -16.165 8.339   1.00 71.16  ? 556  GLU C CB    1 
ATOM   7570  C  CG    . GLU C 2 556  ? -52.784 -15.672 6.909   1.00 73.78  ? 556  GLU C CG    1 
ATOM   7571  C  CD    . GLU C 2 556  ? -51.605 -16.319 6.200   1.00 77.06  ? 556  GLU C CD    1 
ATOM   7572  O  OE1   . GLU C 2 556  ? -51.151 -17.393 6.648   1.00 69.18  ? 556  GLU C OE1   1 
ATOM   7573  O  OE2   . GLU C 2 556  ? -51.130 -15.750 5.195   1.00 86.19  ? 556  GLU C OE2   1 
ATOM   7574  N  N     . PRO C 2 557  ? -54.841 -17.049 10.859  1.00 63.86  ? 557  PRO C N     1 
ATOM   7575  C  CA    . PRO C 2 557  ? -54.889 -17.562 12.231  1.00 72.92  ? 557  PRO C CA    1 
ATOM   7576  C  C     . PRO C 2 557  ? -53.501 -17.919 12.732  1.00 74.48  ? 557  PRO C C     1 
ATOM   7577  O  O     . PRO C 2 557  ? -53.076 -17.459 13.792  1.00 72.88  ? 557  PRO C O     1 
ATOM   7578  C  CB    . PRO C 2 557  ? -55.760 -18.816 12.111  1.00 78.07  ? 557  PRO C CB    1 
ATOM   7579  C  CG    . PRO C 2 557  ? -56.559 -18.604 10.872  1.00 75.69  ? 557  PRO C CG    1 
ATOM   7580  C  CD    . PRO C 2 557  ? -55.673 -17.844 9.942   1.00 62.19  ? 557  PRO C CD    1 
ATOM   7581  N  N     . ARG C 2 558  ? -52.802 -18.735 11.955  1.00 79.81  ? 558  ARG C N     1 
ATOM   7582  C  CA    . ARG C 2 558  ? -51.443 -19.124 12.284  1.00 82.32  ? 558  ARG C CA    1 
ATOM   7583  C  C     . ARG C 2 558  ? -50.475 -18.107 11.702  1.00 86.70  ? 558  ARG C C     1 
ATOM   7584  O  O     . ARG C 2 558  ? -50.549 -17.769 10.522  1.00 93.55  ? 558  ARG C O     1 
ATOM   7585  C  CB    . ARG C 2 558  ? -51.144 -20.528 11.758  1.00 80.10  ? 558  ARG C CB    1 
ATOM   7586  C  CG    . ARG C 2 558  ? -52.101 -21.593 12.276  1.00 83.92  ? 558  ARG C CG    1 
ATOM   7587  C  CD    . ARG C 2 558  ? -51.948 -22.887 11.497  1.00 83.30  ? 558  ARG C CD    1 
ATOM   7588  N  NE    . ARG C 2 558  ? -52.942 -23.891 11.865  1.00 81.77  ? 558  ARG C NE    1 
ATOM   7589  C  CZ    . ARG C 2 558  ? -53.094 -25.047 11.227  1.00 87.66  ? 558  ARG C CZ    1 
ATOM   7590  N  NH1   . ARG C 2 558  ? -52.318 -25.336 10.192  1.00 96.30  ? 558  ARG C NH1   1 
ATOM   7591  N  NH2   . ARG C 2 558  ? -54.020 -25.913 11.618  1.00 82.00  ? 558  ARG C NH2   1 
ATOM   7592  N  N     . VAL C 2 559  ? -49.580 -17.602 12.537  1.00 85.39  ? 559  VAL C N     1 
ATOM   7593  C  CA    . VAL C 2 559  ? -48.611 -16.617 12.082  1.00 84.22  ? 559  VAL C CA    1 
ATOM   7594  C  C     . VAL C 2 559  ? -47.201 -17.011 12.486  1.00 79.17  ? 559  VAL C C     1 
ATOM   7595  O  O     . VAL C 2 559  ? -47.005 -17.891 13.323  1.00 77.79  ? 559  VAL C O     1 
ATOM   7596  C  CB    . VAL C 2 559  ? -48.925 -15.211 12.634  1.00 78.86  ? 559  VAL C CB    1 
ATOM   7597  C  CG1   . VAL C 2 559  ? -49.970 -14.521 11.772  1.00 72.31  ? 559  VAL C CG1   1 
ATOM   7598  C  CG2   . VAL C 2 559  ? -49.380 -15.296 14.083  1.00 80.24  ? 559  VAL C CG2   1 
ATOM   7599  N  N     . LEU C 2 560  ? -46.220 -16.366 11.870  1.00 75.43  ? 560  LEU C N     1 
ATOM   7600  C  CA    . LEU C 2 560  ? -44.832 -16.586 12.229  1.00 72.53  ? 560  LEU C CA    1 
ATOM   7601  C  C     . LEU C 2 560  ? -44.622 -16.105 13.655  1.00 62.24  ? 560  LEU C C     1 
ATOM   7602  O  O     . LEU C 2 560  ? -45.085 -15.029 14.021  1.00 62.55  ? 560  LEU C O     1 
ATOM   7603  C  CB    . LEU C 2 560  ? -43.901 -15.859 11.260  1.00 91.92  ? 560  LEU C CB    1 
ATOM   7604  C  CG    . LEU C 2 560  ? -43.927 -16.323 9.801   1.00 98.14  ? 560  LEU C CG    1 
ATOM   7605  C  CD1   . LEU C 2 560  ? -42.992 -15.468 8.958   1.00 79.52  ? 560  LEU C CD1   1 
ATOM   7606  C  CD2   . LEU C 2 560  ? -43.554 -17.799 9.693   1.00 95.08  ? 560  LEU C CD2   1 
ATOM   7607  N  N     . VAL C 2 561  ? -43.935 -16.906 14.460  1.00 49.92  ? 561  VAL C N     1 
ATOM   7608  C  CA    . VAL C 2 561  ? -43.825 -16.624 15.887  1.00 52.74  ? 561  VAL C CA    1 
ATOM   7609  C  C     . VAL C 2 561  ? -42.428 -16.901 16.429  1.00 52.08  ? 561  VAL C C     1 
ATOM   7610  O  O     . VAL C 2 561  ? -41.819 -17.917 16.106  1.00 56.36  ? 561  VAL C O     1 
ATOM   7611  C  CB    . VAL C 2 561  ? -44.858 -17.450 16.691  1.00 60.69  ? 561  VAL C CB    1 
ATOM   7612  C  CG1   . VAL C 2 561  ? -44.419 -17.631 18.137  1.00 59.21  ? 561  VAL C CG1   1 
ATOM   7613  C  CG2   . VAL C 2 561  ? -46.240 -16.809 16.597  1.00 69.50  ? 561  VAL C CG2   1 
ATOM   7614  N  N     . ARG C 2 562  ? -41.927 -15.985 17.252  1.00 50.01  ? 562  ARG C N     1 
ATOM   7615  C  CA    . ARG C 2 562  ? -40.647 -16.172 17.920  1.00 47.15  ? 562  ARG C CA    1 
ATOM   7616  C  C     . ARG C 2 562  ? -40.838 -16.797 19.306  1.00 49.37  ? 562  ARG C C     1 
ATOM   7617  O  O     . ARG C 2 562  ? -41.691 -16.367 20.087  1.00 48.09  ? 562  ARG C O     1 
ATOM   7618  C  CB    . ARG C 2 562  ? -39.910 -14.839 18.029  1.00 37.03  ? 562  ARG C CB    1 
ATOM   7619  C  CG    . ARG C 2 562  ? -39.887 -14.048 16.725  1.00 29.50  ? 562  ARG C CG    1 
ATOM   7620  C  CD    . ARG C 2 562  ? -38.816 -12.973 16.735  1.00 26.91  ? 562  ARG C CD    1 
ATOM   7621  N  NE    . ARG C 2 562  ? -39.004 -11.993 17.803  1.00 26.34  ? 562  ARG C NE    1 
ATOM   7622  C  CZ    . ARG C 2 562  ? -38.324 -11.987 18.945  1.00 25.62  ? 562  ARG C CZ    1 
ATOM   7623  N  NH1   . ARG C 2 562  ? -38.558 -11.051 19.853  1.00 26.17  ? 562  ARG C NH1   1 
ATOM   7624  N  NH2   . ARG C 2 562  ? -37.403 -12.911 19.181  1.00 22.82  ? 562  ARG C NH2   1 
ATOM   7625  N  N     . ARG C 2 563  ? -40.027 -17.812 19.597  1.00 47.77  ? 563  ARG C N     1 
ATOM   7626  C  CA    . ARG C 2 563  ? -40.134 -18.584 20.830  1.00 39.15  ? 563  ARG C CA    1 
ATOM   7627  C  C     . ARG C 2 563  ? -38.765 -18.824 21.453  1.00 35.15  ? 563  ARG C C     1 
ATOM   7628  O  O     . ARG C 2 563  ? -37.760 -18.850 20.747  1.00 43.94  ? 563  ARG C O     1 
ATOM   7629  C  CB    . ARG C 2 563  ? -40.828 -19.922 20.552  1.00 58.01  ? 563  ARG C CB    1 
ATOM   7630  C  CG    . ARG C 2 563  ? -41.030 -20.815 21.772  1.00 67.33  ? 563  ARG C CG    1 
ATOM   7631  C  CD    . ARG C 2 563  ? -41.858 -22.045 21.427  1.00 67.74  ? 563  ARG C CD    1 
ATOM   7632  N  NE    . ARG C 2 563  ? -43.194 -21.702 20.947  1.00 66.31  ? 563  ARG C NE    1 
ATOM   7633  C  CZ    . ARG C 2 563  ? -44.213 -21.378 21.738  1.00 65.72  ? 563  ARG C CZ    1 
ATOM   7634  N  NH1   . ARG C 2 563  ? -44.049 -21.342 23.053  1.00 63.26  ? 563  ARG C NH1   1 
ATOM   7635  N  NH2   . ARG C 2 563  ? -45.396 -21.085 21.214  1.00 65.23  ? 563  ARG C NH2   1 
ATOM   7636  N  N     . LYS C 2 564  ? -38.747 -18.990 22.775  1.00 29.21  ? 564  LYS C N     1 
ATOM   7637  C  CA    . LYS C 2 564  ? -37.552 -19.333 23.546  1.00 34.63  ? 564  LYS C CA    1 
ATOM   7638  C  C     . LYS C 2 564  ? -36.606 -20.297 22.835  1.00 37.77  ? 564  LYS C C     1 
ATOM   7639  O  O     . LYS C 2 564  ? -37.049 -21.165 22.084  1.00 41.94  ? 564  LYS C O     1 
ATOM   7640  C  CB    . LYS C 2 564  ? -37.970 -19.933 24.895  1.00 43.26  ? 564  LYS C CB    1 
ATOM   7641  C  CG    . LYS C 2 564  ? -36.820 -20.339 25.810  1.00 41.03  ? 564  LYS C CG    1 
ATOM   7642  C  CD    . LYS C 2 564  ? -37.338 -20.866 27.137  1.00 36.33  ? 564  LYS C CD    1 
ATOM   7643  C  CE    . LYS C 2 564  ? -36.216 -21.351 28.038  1.00 46.95  ? 564  LYS C CE    1 
ATOM   7644  N  NZ    . LYS C 2 564  ? -36.757 -21.800 29.349  1.00 53.22  ? 564  LYS C NZ    1 
ATOM   7645  N  N     . ALA C 2 565  ? -35.308 -20.116 23.083  1.00 41.98  ? 565  ALA C N     1 
ATOM   7646  C  CA    . ALA C 2 565  ? -34.237 -20.938 22.517  1.00 47.94  ? 565  ALA C CA    1 
ATOM   7647  C  C     . ALA C 2 565  ? -34.092 -20.707 21.016  1.00 49.84  ? 565  ALA C C     1 
ATOM   7648  O  O     . ALA C 2 565  ? -33.534 -21.538 20.296  1.00 48.53  ? 565  ALA C O     1 
ATOM   7649  C  CB    . ALA C 2 565  ? -34.470 -22.419 22.817  1.00 56.23  ? 565  ALA C CB    1 
ATOM   7650  N  N     . GLY C 2 566  ? -34.589 -19.563 20.555  1.00 55.59  ? 566  GLY C N     1 
ATOM   7651  C  CA    . GLY C 2 566  ? -34.460 -19.171 19.163  1.00 64.94  ? 566  GLY C CA    1 
ATOM   7652  C  C     . GLY C 2 566  ? -35.284 -20.053 18.249  1.00 68.36  ? 566  GLY C C     1 
ATOM   7653  O  O     . GLY C 2 566  ? -35.050 -20.105 17.041  1.00 79.08  ? 566  GLY C O     1 
ATOM   7654  N  N     . GLU C 2 567  ? -36.254 -20.743 18.841  1.00 61.33  ? 567  GLU C N     1 
ATOM   7655  C  CA    . GLU C 2 567  ? -37.115 -21.677 18.127  1.00 68.29  ? 567  GLU C CA    1 
ATOM   7656  C  C     . GLU C 2 567  ? -38.300 -20.955 17.498  1.00 58.00  ? 567  GLU C C     1 
ATOM   7657  O  O     . GLU C 2 567  ? -38.769 -19.943 18.017  1.00 50.25  ? 567  GLU C O     1 
ATOM   7658  C  CB    . GLU C 2 567  ? -37.605 -22.777 19.076  1.00 75.31  ? 567  GLU C CB    1 
ATOM   7659  C  CG    . GLU C 2 567  ? -38.476 -23.844 18.423  1.00 83.06  ? 567  GLU C CG    1 
ATOM   7660  C  CD    . GLU C 2 567  ? -39.557 -24.364 19.355  1.00 82.92  ? 567  GLU C CD    1 
ATOM   7661  O  OE1   . GLU C 2 567  ? -39.507 -24.050 20.563  1.00 80.08  ? 567  GLU C OE1   1 
ATOM   7662  O  OE2   . GLU C 2 567  ? -40.462 -25.081 18.876  1.00 86.30  ? 567  GLU C OE2   1 
ATOM   7663  N  N     . VAL C 2 568  ? -38.775 -21.478 16.371  1.00 60.12  ? 568  VAL C N     1 
ATOM   7664  C  CA    . VAL C 2 568  ? -39.862 -20.848 15.632  1.00 66.86  ? 568  VAL C CA    1 
ATOM   7665  C  C     . VAL C 2 568  ? -40.903 -21.881 15.183  1.00 75.17  ? 568  VAL C C     1 
ATOM   7666  O  O     . VAL C 2 568  ? -40.556 -23.002 14.804  1.00 70.48  ? 568  VAL C O     1 
ATOM   7667  C  CB    . VAL C 2 568  ? -39.316 -20.078 14.406  1.00 65.17  ? 568  VAL C CB    1 
ATOM   7668  C  CG1   . VAL C 2 568  ? -40.447 -19.421 13.617  1.00 62.68  ? 568  VAL C CG1   1 
ATOM   7669  C  CG2   . VAL C 2 568  ? -38.283 -19.043 14.847  1.00 62.71  ? 568  VAL C CG2   1 
ATOM   7670  N  N     . GLU C 2 569  ? -42.176 -21.496 15.248  1.00 73.19  ? 569  GLU C N     1 
ATOM   7671  C  CA    . GLU C 2 569  ? -43.275 -22.337 14.787  1.00 61.54  ? 569  GLU C CA    1 
ATOM   7672  C  C     . GLU C 2 569  ? -44.497 -21.488 14.437  1.00 61.31  ? 569  GLU C C     1 
ATOM   7673  O  O     . GLU C 2 569  ? -44.569 -20.312 14.797  1.00 63.67  ? 569  GLU C O     1 
ATOM   7674  C  CB    . GLU C 2 569  ? -43.640 -23.373 15.850  1.00 62.76  ? 569  GLU C CB    1 
ATOM   7675  C  CG    . GLU C 2 569  ? -43.971 -22.775 17.205  1.00 66.52  ? 569  GLU C CG    1 
ATOM   7676  C  CD    . GLU C 2 569  ? -44.183 -23.826 18.276  1.00 68.82  ? 569  GLU C CD    1 
ATOM   7677  O  OE1   . GLU C 2 569  ? -44.196 -25.029 17.941  1.00 73.34  ? 569  GLU C OE1   1 
ATOM   7678  O  OE2   . GLU C 2 569  ? -44.333 -23.448 19.456  1.00 63.91  ? 569  GLU C OE2   1 
ATOM   7679  N  N     . TYR C 2 570  ? -45.450 -22.082 13.725  1.00 69.39  ? 570  TYR C N     1 
ATOM   7680  C  CA    . TYR C 2 570  ? -46.707 -21.407 13.413  1.00 77.53  ? 570  TYR C CA    1 
ATOM   7681  C  C     . TYR C 2 570  ? -47.659 -21.523 14.593  1.00 70.71  ? 570  TYR C C     1 
ATOM   7682  O  O     . TYR C 2 570  ? -47.831 -22.601 15.157  1.00 73.40  ? 570  TYR C O     1 
ATOM   7683  C  CB    . TYR C 2 570  ? -47.344 -21.992 12.147  1.00 87.71  ? 570  TYR C CB    1 
ATOM   7684  C  CG    . TYR C 2 570  ? -46.665 -21.559 10.867  1.00 89.19  ? 570  TYR C CG    1 
ATOM   7685  C  CD1   . TYR C 2 570  ? -47.030 -20.377 10.235  1.00 86.82  ? 570  TYR C CD1   1 
ATOM   7686  C  CD2   . TYR C 2 570  ? -45.656 -22.326 10.294  1.00 88.29  ? 570  TYR C CD2   1 
ATOM   7687  C  CE1   . TYR C 2 570  ? -46.411 -19.969 9.068   1.00 87.24  ? 570  TYR C CE1   1 
ATOM   7688  C  CE2   . TYR C 2 570  ? -45.031 -21.927 9.124   1.00 85.86  ? 570  TYR C CE2   1 
ATOM   7689  C  CZ    . TYR C 2 570  ? -45.413 -20.746 8.516   1.00 85.25  ? 570  TYR C CZ    1 
ATOM   7690  O  OH    . TYR C 2 570  ? -44.798 -20.338 7.354   1.00 73.63  ? 570  TYR C OH    1 
ATOM   7691  N  N     . VAL C 2 571  ? -48.270 -20.408 14.973  1.00 67.24  ? 571  VAL C N     1 
ATOM   7692  C  CA    . VAL C 2 571  ? -49.121 -20.378 16.157  1.00 70.03  ? 571  VAL C CA    1 
ATOM   7693  C  C     . VAL C 2 571  ? -50.404 -19.588 15.906  1.00 76.64  ? 571  VAL C C     1 
ATOM   7694  O  O     . VAL C 2 571  ? -50.360 -18.493 15.341  1.00 73.14  ? 571  VAL C O     1 
ATOM   7695  C  CB    . VAL C 2 571  ? -48.367 -19.771 17.367  1.00 73.43  ? 571  VAL C CB    1 
ATOM   7696  C  CG1   . VAL C 2 571  ? -49.312 -19.502 18.525  1.00 75.70  ? 571  VAL C CG1   1 
ATOM   7697  C  CG2   . VAL C 2 571  ? -47.231 -20.686 17.807  1.00 71.55  ? 571  VAL C CG2   1 
ATOM   7698  N  N     . PRO C 2 572  ? -51.553 -20.154 16.317  1.00 82.35  ? 572  PRO C N     1 
ATOM   7699  C  CA    . PRO C 2 572  ? -52.847 -19.469 16.236  1.00 81.34  ? 572  PRO C CA    1 
ATOM   7700  C  C     . PRO C 2 572  ? -52.803 -18.066 16.838  1.00 74.99  ? 572  PRO C C     1 
ATOM   7701  O  O     . PRO C 2 572  ? -52.088 -17.824 17.812  1.00 70.78  ? 572  PRO C O     1 
ATOM   7702  C  CB    . PRO C 2 572  ? -53.786 -20.383 17.041  1.00 79.43  ? 572  PRO C CB    1 
ATOM   7703  C  CG    . PRO C 2 572  ? -52.889 -21.349 17.771  1.00 70.35  ? 572  PRO C CG    1 
ATOM   7704  C  CD    . PRO C 2 572  ? -51.691 -21.500 16.895  1.00 77.84  ? 572  PRO C CD    1 
ATOM   7705  N  N     . SER C 2 573  ? -53.572 -17.154 16.257  1.00 69.17  ? 573  SER C N     1 
ATOM   7706  C  CA    . SER C 2 573  ? -53.560 -15.760 16.676  1.00 68.05  ? 573  SER C CA    1 
ATOM   7707  C  C     . SER C 2 573  ? -54.155 -15.552 18.069  1.00 73.28  ? 573  SER C C     1 
ATOM   7708  O  O     . SER C 2 573  ? -54.208 -14.423 18.561  1.00 72.80  ? 573  SER C O     1 
ATOM   7709  C  CB    . SER C 2 573  ? -54.318 -14.902 15.667  1.00 69.34  ? 573  SER C CB    1 
ATOM   7710  O  OG    . SER C 2 573  ? -54.264 -13.530 16.027  1.00 71.71  ? 573  SER C OG    1 
ATOM   7711  N  N     . SER C 2 574  ? -54.606 -16.629 18.704  1.00 78.57  ? 574  SER C N     1 
ATOM   7712  C  CA    . SER C 2 574  ? -55.153 -16.529 20.051  1.00 78.77  ? 574  SER C CA    1 
ATOM   7713  C  C     . SER C 2 574  ? -54.032 -16.478 21.078  1.00 77.84  ? 574  SER C C     1 
ATOM   7714  O  O     . SER C 2 574  ? -54.251 -16.113 22.233  1.00 82.36  ? 574  SER C O     1 
ATOM   7715  C  CB    . SER C 2 574  ? -56.089 -17.703 20.353  1.00 79.09  ? 574  SER C CB    1 
ATOM   7716  O  OG    . SER C 2 574  ? -57.319 -17.582 19.658  1.00 82.99  ? 574  SER C OG    1 
ATOM   7717  N  N     . GLU C 2 575  ? -52.828 -16.833 20.645  1.00 72.67  ? 575  GLU C N     1 
ATOM   7718  C  CA    . GLU C 2 575  ? -51.707 -16.991 21.563  1.00 78.09  ? 575  GLU C CA    1 
ATOM   7719  C  C     . GLU C 2 575  ? -50.616 -15.931 21.387  1.00 74.33  ? 575  GLU C C     1 
ATOM   7720  O  O     . GLU C 2 575  ? -49.666 -15.878 22.168  1.00 71.17  ? 575  GLU C O     1 
ATOM   7721  C  CB    . GLU C 2 575  ? -51.109 -18.385 21.394  1.00 75.82  ? 575  GLU C CB    1 
ATOM   7722  C  CG    . GLU C 2 575  ? -50.962 -19.171 22.680  1.00 68.48  ? 575  GLU C CG    1 
ATOM   7723  C  CD    . GLU C 2 575  ? -50.721 -20.640 22.414  1.00 66.73  ? 575  GLU C CD    1 
ATOM   7724  O  OE1   . GLU C 2 575  ? -51.407 -21.199 21.532  1.00 71.19  ? 575  GLU C OE1   1 
ATOM   7725  O  OE2   . GLU C 2 575  ? -49.842 -21.231 23.074  1.00 60.70  ? 575  GLU C OE2   1 
ATOM   7726  N  N     . VAL C 2 576  ? -50.753 -15.091 20.365  1.00 69.65  ? 576  VAL C N     1 
ATOM   7727  C  CA    . VAL C 2 576  ? -49.778 -14.032 20.108  1.00 57.55  ? 576  VAL C CA    1 
ATOM   7728  C  C     . VAL C 2 576  ? -49.818 -12.937 21.170  1.00 54.45  ? 576  VAL C C     1 
ATOM   7729  O  O     . VAL C 2 576  ? -50.771 -12.163 21.240  1.00 57.95  ? 576  VAL C O     1 
ATOM   7730  C  CB    . VAL C 2 576  ? -50.003 -13.378 18.737  1.00 58.85  ? 576  VAL C CB    1 
ATOM   7731  C  CG1   . VAL C 2 576  ? -49.122 -12.143 18.584  1.00 51.77  ? 576  VAL C CG1   1 
ATOM   7732  C  CG2   . VAL C 2 576  ? -49.744 -14.379 17.621  1.00 60.76  ? 576  VAL C CG2   1 
ATOM   7733  N  N     . ASP C 2 577  ? -48.771 -12.867 21.985  1.00 52.95  ? 577  ASP C N     1 
ATOM   7734  C  CA    . ASP C 2 577  ? -48.692 -11.867 23.046  1.00 55.89  ? 577  ASP C CA    1 
ATOM   7735  C  C     . ASP C 2 577  ? -48.214 -10.511 22.523  1.00 55.32  ? 577  ASP C C     1 
ATOM   7736  O  O     . ASP C 2 577  ? -48.909 -9.503  22.659  1.00 53.06  ? 577  ASP C O     1 
ATOM   7737  C  CB    . ASP C 2 577  ? -47.769 -12.355 24.165  1.00 52.58  ? 577  ASP C CB    1 
ATOM   7738  C  CG    . ASP C 2 577  ? -48.301 -13.598 24.859  1.00 49.71  ? 577  ASP C CG    1 
ATOM   7739  O  OD1   . ASP C 2 577  ? -49.529 -13.687 25.071  1.00 56.19  ? 577  ASP C OD1   1 
ATOM   7740  O  OD2   . ASP C 2 577  ? -47.493 -14.490 25.191  1.00 44.87  ? 577  ASP C OD2   1 
ATOM   7741  N  N     . TYR C 2 578  ? -47.023 -10.496 21.929  1.00 58.63  ? 578  TYR C N     1 
ATOM   7742  C  CA    . TYR C 2 578  ? -46.432 -9.272  21.391  1.00 53.89  ? 578  TYR C CA    1 
ATOM   7743  C  C     . TYR C 2 578  ? -46.030 -9.426  19.928  1.00 49.96  ? 578  TYR C C     1 
ATOM   7744  O  O     . TYR C 2 578  ? -46.005 -10.530 19.394  1.00 53.13  ? 578  TYR C O     1 
ATOM   7745  C  CB    . TYR C 2 578  ? -45.207 -8.864  22.209  1.00 48.23  ? 578  TYR C CB    1 
ATOM   7746  C  CG    . TYR C 2 578  ? -45.502 -8.578  23.657  1.00 48.33  ? 578  TYR C CG    1 
ATOM   7747  C  CD1   . TYR C 2 578  ? -46.074 -7.373  24.040  1.00 56.67  ? 578  TYR C CD1   1 
ATOM   7748  C  CD2   . TYR C 2 578  ? -45.202 -9.507  24.644  1.00 46.32  ? 578  TYR C CD2   1 
ATOM   7749  C  CE1   . TYR C 2 578  ? -46.345 -7.100  25.365  1.00 58.88  ? 578  TYR C CE1   1 
ATOM   7750  C  CE2   . TYR C 2 578  ? -45.468 -9.243  25.974  1.00 53.82  ? 578  TYR C CE2   1 
ATOM   7751  C  CZ    . TYR C 2 578  ? -46.040 -8.036  26.329  1.00 58.00  ? 578  TYR C CZ    1 
ATOM   7752  O  OH    . TYR C 2 578  ? -46.312 -7.759  27.651  1.00 52.60  ? 578  TYR C OH    1 
ATOM   7753  N  N     . MET C 2 579  ? -45.718 -8.311  19.281  1.00 41.30  ? 579  MET C N     1 
ATOM   7754  C  CA    . MET C 2 579  ? -45.159 -8.350  17.938  1.00 40.21  ? 579  MET C CA    1 
ATOM   7755  C  C     . MET C 2 579  ? -43.984 -7.387  17.883  1.00 43.14  ? 579  MET C C     1 
ATOM   7756  O  O     . MET C 2 579  ? -43.850 -6.524  18.747  1.00 48.21  ? 579  MET C O     1 
ATOM   7757  C  CB    . MET C 2 579  ? -46.205 -7.987  16.886  1.00 44.54  ? 579  MET C CB    1 
ATOM   7758  C  CG    . MET C 2 579  ? -46.281 -6.505  16.565  1.00 47.18  ? 579  MET C CG    1 
ATOM   7759  S  SD    . MET C 2 579  ? -47.337 -6.186  15.143  1.00 55.18  ? 579  MET C SD    1 
ATOM   7760  C  CE    . MET C 2 579  ? -46.550 -7.197  13.894  1.00 44.46  ? 579  MET C CE    1 
ATOM   7761  N  N     . ASP C 2 580  ? -43.128 -7.528  16.880  1.00 39.23  ? 580  ASP C N     1 
ATOM   7762  C  CA    . ASP C 2 580  ? -41.971 -6.651  16.782  1.00 30.81  ? 580  ASP C CA    1 
ATOM   7763  C  C     . ASP C 2 580  ? -42.394 -5.229  16.434  1.00 31.50  ? 580  ASP C C     1 
ATOM   7764  O  O     . ASP C 2 580  ? -43.482 -4.997  15.904  1.00 37.56  ? 580  ASP C O     1 
ATOM   7765  C  CB    . ASP C 2 580  ? -40.975 -7.181  15.755  1.00 28.27  ? 580  ASP C CB    1 
ATOM   7766  C  CG    . ASP C 2 580  ? -40.335 -8.478  16.193  1.00 32.58  ? 580  ASP C CG    1 
ATOM   7767  O  OD1   . ASP C 2 580  ? -40.356 -8.766  17.409  1.00 33.03  ? 580  ASP C OD1   1 
ATOM   7768  O  OD2   . ASP C 2 580  ? -39.811 -9.213  15.330  1.00 39.91  ? 580  ASP C OD2   1 
ATOM   7769  N  N     . VAL C 2 581  ? -41.533 -4.278  16.768  1.00 21.98  ? 581  VAL C N     1 
ATOM   7770  C  CA    . VAL C 2 581  ? -41.773 -2.879  16.460  1.00 17.28  ? 581  VAL C CA    1 
ATOM   7771  C  C     . VAL C 2 581  ? -41.594 -2.632  14.974  1.00 16.95  ? 581  VAL C C     1 
ATOM   7772  O  O     . VAL C 2 581  ? -42.526 -2.238  14.285  1.00 20.42  ? 581  VAL C O     1 
ATOM   7773  C  CB    . VAL C 2 581  ? -40.828 -1.964  17.249  1.00 18.26  ? 581  VAL C CB    1 
ATOM   7774  C  CG1   . VAL C 2 581  ? -40.734 -0.596  16.592  1.00 29.19  ? 581  VAL C CG1   1 
ATOM   7775  C  CG2   . VAL C 2 581  ? -41.299 -1.844  18.681  1.00 22.15  ? 581  VAL C CG2   1 
ATOM   7776  N  N     . SER C 2 582  ? -40.391 -2.887  14.481  1.00 17.01  ? 582  SER C N     1 
ATOM   7777  C  CA    . SER C 2 582  ? -40.069 -2.610  13.093  1.00 15.00  ? 582  SER C CA    1 
ATOM   7778  C  C     . SER C 2 582  ? -39.337 -3.802  12.485  1.00 19.40  ? 582  SER C C     1 
ATOM   7779  O  O     . SER C 2 582  ? -38.671 -4.549  13.202  1.00 18.23  ? 582  SER C O     1 
ATOM   7780  C  CB    . SER C 2 582  ? -39.219 -1.345  12.995  1.00 14.25  ? 582  SER C CB    1 
ATOM   7781  O  OG    . SER C 2 582  ? -39.061 -0.926  11.652  1.00 17.30  ? 582  SER C OG    1 
ATOM   7782  N  N     . PRO C 2 583  ? -39.477 -4.008  11.165  1.00 23.19  ? 583  PRO C N     1 
ATOM   7783  C  CA    . PRO C 2 583  ? -38.683 -5.068  10.535  1.00 19.23  ? 583  PRO C CA    1 
ATOM   7784  C  C     . PRO C 2 583  ? -37.196 -4.859  10.804  1.00 17.21  ? 583  PRO C C     1 
ATOM   7785  O  O     . PRO C 2 583  ? -36.473 -5.803  11.108  1.00 10.00  ? 583  PRO C O     1 
ATOM   7786  C  CB    . PRO C 2 583  ? -39.005 -4.909  9.047   1.00 24.78  ? 583  PRO C CB    1 
ATOM   7787  C  CG    . PRO C 2 583  ? -40.355 -4.264  9.021   1.00 23.02  ? 583  PRO C CG    1 
ATOM   7788  C  CD    . PRO C 2 583  ? -40.380 -3.346  10.207  1.00 21.56  ? 583  PRO C CD    1 
ATOM   7789  N  N     . ARG C 2 584  ? -36.766 -3.606  10.731  1.00 23.28  ? 584  ARG C N     1 
ATOM   7790  C  CA    . ARG C 2 584  ? -35.369 -3.242  10.919  1.00 20.16  ? 584  ARG C CA    1 
ATOM   7791  C  C     . ARG C 2 584  ? -34.966 -3.155  12.394  1.00 20.84  ? 584  ARG C C     1 
ATOM   7792  O  O     . ARG C 2 584  ? -34.180 -2.287  12.770  1.00 26.75  ? 584  ARG C O     1 
ATOM   7793  C  CB    . ARG C 2 584  ? -35.094 -1.902  10.231  1.00 16.45  ? 584  ARG C CB    1 
ATOM   7794  C  CG    . ARG C 2 584  ? -36.030 -0.778  10.662  1.00 16.35  ? 584  ARG C CG    1 
ATOM   7795  C  CD    . ARG C 2 584  ? -35.756 0.502   9.897   1.00 16.52  ? 584  ARG C CD    1 
ATOM   7796  N  NE    . ARG C 2 584  ? -36.102 1.694   10.665  1.00 14.06  ? 584  ARG C NE    1 
ATOM   7797  C  CZ    . ARG C 2 584  ? -36.061 2.931   10.181  1.00 14.33  ? 584  ARG C CZ    1 
ATOM   7798  N  NH1   . ARG C 2 584  ? -35.698 3.140   8.926   1.00 7.48   ? 584  ARG C NH1   1 
ATOM   7799  N  NH2   . ARG C 2 584  ? -36.388 3.959   10.949  1.00 18.53  ? 584  ARG C NH2   1 
ATOM   7800  N  N     . GLN C 2 585  ? -35.479 -4.060  13.224  1.00 23.24  ? 585  GLN C N     1 
ATOM   7801  C  CA    . GLN C 2 585  ? -35.300 -3.945  14.675  1.00 20.07  ? 585  GLN C CA    1 
ATOM   7802  C  C     . GLN C 2 585  ? -34.015 -4.578  15.209  1.00 12.79  ? 585  GLN C C     1 
ATOM   7803  O  O     . GLN C 2 585  ? -33.399 -4.063  16.142  1.00 6.58   ? 585  GLN C O     1 
ATOM   7804  C  CB    . GLN C 2 585  ? -36.487 -4.569  15.399  1.00 13.38  ? 585  GLN C CB    1 
ATOM   7805  C  CG    . GLN C 2 585  ? -36.335 -4.602  16.901  1.00 6.25   ? 585  GLN C CG    1 
ATOM   7806  C  CD    . GLN C 2 585  ? -37.563 -5.140  17.576  1.00 18.27  ? 585  GLN C CD    1 
ATOM   7807  O  OE1   . GLN C 2 585  ? -38.617 -5.269  16.954  1.00 22.52  ? 585  GLN C OE1   1 
ATOM   7808  N  NE2   . GLN C 2 585  ? -37.440 -5.466  18.856  1.00 23.95  ? 585  GLN C NE2   1 
ATOM   7809  N  N     . MET C 2 586  ? -33.616 -5.697  14.620  1.00 13.41  ? 586  MET C N     1 
ATOM   7810  C  CA    . MET C 2 586  ? -32.494 -6.470  15.131  1.00 8.40   ? 586  MET C CA    1 
ATOM   7811  C  C     . MET C 2 586  ? -31.159 -5.845  14.777  1.00 4.96   ? 586  MET C C     1 
ATOM   7812  O  O     . MET C 2 586  ? -30.126 -6.238  15.310  1.00 7.73   ? 586  MET C O     1 
ATOM   7813  C  CB    . MET C 2 586  ? -32.540 -7.885  14.580  1.00 9.84   ? 586  MET C CB    1 
ATOM   7814  C  CG    . MET C 2 586  ? -32.525 -7.918  13.074  1.00 11.96  ? 586  MET C CG    1 
ATOM   7815  S  SD    . MET C 2 586  ? -32.354 -9.580  12.428  1.00 19.07  ? 586  MET C SD    1 
ATOM   7816  C  CE    . MET C 2 586  ? -30.850 -9.415  11.480  1.00 15.47  ? 586  MET C CE    1 
ATOM   7817  N  N     . VAL C 2 587  ? -31.183 -4.872  13.875  1.00 8.08   ? 587  VAL C N     1 
ATOM   7818  C  CA    . VAL C 2 587  ? -29.950 -4.328  13.318  1.00 9.71   ? 587  VAL C CA    1 
ATOM   7819  C  C     . VAL C 2 587  ? -29.421 -3.139  14.106  1.00 8.82   ? 587  VAL C C     1 
ATOM   7820  O  O     . VAL C 2 587  ? -30.102 -2.605  14.982  1.00 8.36   ? 587  VAL C O     1 
ATOM   7821  C  CB    . VAL C 2 587  ? -30.148 -3.901  11.861  1.00 5.47   ? 587  VAL C CB    1 
ATOM   7822  C  CG1   . VAL C 2 587  ? -30.859 -4.999  11.093  1.00 10.22  ? 587  VAL C CG1   1 
ATOM   7823  C  CG2   . VAL C 2 587  ? -30.937 -2.608  11.785  1.00 8.27   ? 587  VAL C CG2   1 
ATOM   7824  N  N     . SER C 2 588  ? -28.195 -2.735  13.790  1.00 9.56   ? 588  SER C N     1 
ATOM   7825  C  CA    . SER C 2 588  ? -27.611 -1.548  14.397  1.00 9.33   ? 588  SER C CA    1 
ATOM   7826  C  C     . SER C 2 588  ? -27.831 -0.350  13.488  1.00 10.05  ? 588  SER C C     1 
ATOM   7827  O  O     . SER C 2 588  ? -28.431 -0.474  12.410  1.00 9.09   ? 588  SER C O     1 
ATOM   7828  C  CB    . SER C 2 588  ? -26.119 -1.735  14.668  1.00 6.60   ? 588  SER C CB    1 
ATOM   7829  O  OG    . SER C 2 588  ? -25.330 -1.368  13.551  1.00 4.57   ? 588  SER C OG    1 
ATOM   7830  N  N     . VAL C 2 589  ? -27.347 0.808   13.927  1.00 8.94   ? 589  VAL C N     1 
ATOM   7831  C  CA    . VAL C 2 589  ? -27.517 2.033   13.166  1.00 5.98   ? 589  VAL C CA    1 
ATOM   7832  C  C     . VAL C 2 589  ? -26.864 1.919   11.809  1.00 5.53   ? 589  VAL C C     1 
ATOM   7833  O  O     . VAL C 2 589  ? -27.452 2.272   10.791  1.00 8.53   ? 589  VAL C O     1 
ATOM   7834  C  CB    . VAL C 2 589  ? -26.913 3.229   13.880  1.00 7.72   ? 589  VAL C CB    1 
ATOM   7835  C  CG1   . VAL C 2 589  ? -27.412 4.516   13.237  1.00 6.33   ? 589  VAL C CG1   1 
ATOM   7836  C  CG2   . VAL C 2 589  ? -27.244 3.188   15.366  1.00 10.11  ? 589  VAL C CG2   1 
ATOM   7837  N  N     . ALA C 2 590  ? -25.633 1.424   11.815  1.00 8.40   ? 590  ALA C N     1 
ATOM   7838  C  CA    . ALA C 2 590  ? -24.856 1.271   10.596  1.00 9.63   ? 590  ALA C CA    1 
ATOM   7839  C  C     . ALA C 2 590  ? -25.507 0.249   9.689   1.00 4.74   ? 590  ALA C C     1 
ATOM   7840  O  O     . ALA C 2 590  ? -25.678 0.478   8.491   1.00 2.01   ? 590  ALA C O     1 
ATOM   7841  C  CB    . ALA C 2 590  ? -23.428 0.855   10.918  1.00 12.22  ? 590  ALA C CB    1 
ATOM   7842  N  N     . THR C 2 591  ? -25.871 -0.880  10.282  1.00 4.75   ? 591  THR C N     1 
ATOM   7843  C  CA    . THR C 2 591  ? -26.414 -1.996  9.534   1.00 2.18   ? 591  THR C CA    1 
ATOM   7844  C  C     . THR C 2 591  ? -27.566 -1.539  8.666   1.00 2.34   ? 591  THR C C     1 
ATOM   7845  O  O     . THR C 2 591  ? -27.622 -1.851  7.485   1.00 8.38   ? 591  THR C O     1 
ATOM   7846  C  CB    . THR C 2 591  ? -26.899 -3.121  10.461  1.00 7.71   ? 591  THR C CB    1 
ATOM   7847  O  OG1   . THR C 2 591  ? -25.889 -3.417  11.434  1.00 11.01  ? 591  THR C OG1   1 
ATOM   7848  C  CG2   . THR C 2 591  ? -27.191 -4.370  9.654   1.00 7.27   ? 591  THR C CG2   1 
ATOM   7849  N  N     . ALA C 2 592  ? -28.457 -0.752  9.253   1.00 1.09   ? 592  ALA C N     1 
ATOM   7850  C  CA    . ALA C 2 592  ? -29.692 -0.361  8.583   1.00 6.36   ? 592  ALA C CA    1 
ATOM   7851  C  C     . ALA C 2 592  ? -29.481 0.607   7.415   1.00 7.32   ? 592  ALA C C     1 
ATOM   7852  O  O     . ALA C 2 592  ? -30.437 0.960   6.722   1.00 6.39   ? 592  ALA C O     1 
ATOM   7853  C  CB    . ALA C 2 592  ? -30.648 0.247   9.582   1.00 4.28   ? 592  ALA C CB    1 
ATOM   7854  N  N     . MET C 2 593  ? -28.242 1.028   7.190   1.00 5.40   ? 593  MET C N     1 
ATOM   7855  C  CA    . MET C 2 593  ? -27.959 1.986   6.129   1.00 1.74   ? 593  MET C CA    1 
ATOM   7856  C  C     . MET C 2 593  ? -27.542 1.314   4.832   1.00 1.99   ? 593  MET C C     1 
ATOM   7857  O  O     . MET C 2 593  ? -27.121 1.980   3.882   1.00 13.92  ? 593  MET C O     1 
ATOM   7858  C  CB    . MET C 2 593  ? -26.873 2.947   6.565   1.00 1.02   ? 593  MET C CB    1 
ATOM   7859  C  CG    . MET C 2 593  ? -27.376 4.331   6.835   1.00 13.54  ? 593  MET C CG    1 
ATOM   7860  S  SD    . MET C 2 593  ? -26.024 5.261   7.512   1.00 3.62   ? 593  MET C SD    1 
ATOM   7861  C  CE    . MET C 2 593  ? -25.800 4.417   9.069   1.00 2.38   ? 593  MET C CE    1 
ATOM   7862  N  N     . ILE C 2 594  ? -27.662 -0.006  4.797   1.00 3.57   ? 594  ILE C N     1 
ATOM   7863  C  CA    . ILE C 2 594  ? -27.318 -0.770  3.613   1.00 0.78   ? 594  ILE C CA    1 
ATOM   7864  C  C     . ILE C 2 594  ? -28.568 -1.130  2.842   1.00 0.03   ? 594  ILE C C     1 
ATOM   7865  O  O     . ILE C 2 594  ? -29.251 -2.084  3.198   1.00 3.34   ? 594  ILE C O     1 
ATOM   7866  C  CB    . ILE C 2 594  ? -26.578 -2.059  3.972   1.00 2.69   ? 594  ILE C CB    1 
ATOM   7867  C  CG1   . ILE C 2 594  ? -25.561 -1.810  5.090   1.00 3.64   ? 594  ILE C CG1   1 
ATOM   7868  C  CG2   . ILE C 2 594  ? -25.911 -2.639  2.740   1.00 3.36   ? 594  ILE C CG2   1 
ATOM   7869  C  CD1   . ILE C 2 594  ? -24.925 -3.077  5.621   1.00 5.24   ? 594  ILE C CD1   1 
ATOM   7870  N  N     . PRO C 2 595  ? -28.872 -0.372  1.784   1.00 0.13   ? 595  PRO C N     1 
ATOM   7871  C  CA    . PRO C 2 595  ? -30.062 -0.651  0.980   1.00 1.74   ? 595  PRO C CA    1 
ATOM   7872  C  C     . PRO C 2 595  ? -30.032 -2.073  0.470   1.00 5.54   ? 595  PRO C C     1 
ATOM   7873  O  O     . PRO C 2 595  ? -28.968 -2.546  0.089   1.00 8.73   ? 595  PRO C O     1 
ATOM   7874  C  CB    . PRO C 2 595  ? -29.956 0.351   -0.168  1.00 6.01   ? 595  PRO C CB    1 
ATOM   7875  C  CG    . PRO C 2 595  ? -28.511 0.680   -0.236  1.00 7.62   ? 595  PRO C CG    1 
ATOM   7876  C  CD    . PRO C 2 595  ? -28.030 0.662   1.169   1.00 0.46   ? 595  PRO C CD    1 
ATOM   7877  N  N     . PHE C 2 596  ? -31.177 -2.744  0.499   1.00 4.99   ? 596  PHE C N     1 
ATOM   7878  C  CA    . PHE C 2 596  ? -31.281 -4.142  0.087   1.00 4.63   ? 596  PHE C CA    1 
ATOM   7879  C  C     . PHE C 2 596  ? -30.324 -5.041  0.867   1.00 4.30   ? 596  PHE C C     1 
ATOM   7880  O  O     . PHE C 2 596  ? -29.620 -5.866  0.290   1.00 8.04   ? 596  PHE C O     1 
ATOM   7881  C  CB    . PHE C 2 596  ? -31.027 -4.279  -1.416  1.00 8.58   ? 596  PHE C CB    1 
ATOM   7882  C  CG    . PHE C 2 596  ? -31.848 -3.347  -2.259  1.00 9.88   ? 596  PHE C CG    1 
ATOM   7883  C  CD1   . PHE C 2 596  ? -33.169 -3.635  -2.553  1.00 13.70  ? 596  PHE C CD1   1 
ATOM   7884  C  CD2   . PHE C 2 596  ? -31.289 -2.193  -2.775  1.00 9.21   ? 596  PHE C CD2   1 
ATOM   7885  C  CE1   . PHE C 2 596  ? -33.918 -2.783  -3.337  1.00 14.36  ? 596  PHE C CE1   1 
ATOM   7886  C  CE2   . PHE C 2 596  ? -32.034 -1.339  -3.559  1.00 10.71  ? 596  PHE C CE2   1 
ATOM   7887  C  CZ    . PHE C 2 596  ? -33.349 -1.635  -3.840  1.00 13.23  ? 596  PHE C CZ    1 
ATOM   7888  N  N     . LEU C 2 597  ? -30.304 -4.861  2.183   1.00 6.66   ? 597  LEU C N     1 
ATOM   7889  C  CA    . LEU C 2 597  ? -29.492 -5.682  3.073   1.00 4.14   ? 597  LEU C CA    1 
ATOM   7890  C  C     . LEU C 2 597  ? -29.874 -7.150  2.983   1.00 7.61   ? 597  LEU C C     1 
ATOM   7891  O  O     . LEU C 2 597  ? -29.027 -8.036  3.078   1.00 10.30  ? 597  LEU C O     1 
ATOM   7892  C  CB    . LEU C 2 597  ? -29.637 -5.200  4.516   1.00 0.69   ? 597  LEU C CB    1 
ATOM   7893  C  CG    . LEU C 2 597  ? -28.901 -6.036  5.560   1.00 0.53   ? 597  LEU C CG    1 
ATOM   7894  C  CD1   . LEU C 2 597  ? -27.422 -6.055  5.245   1.00 4.91   ? 597  LEU C CD1   1 
ATOM   7895  C  CD2   . LEU C 2 597  ? -29.143 -5.487  6.942   1.00 1.33   ? 597  LEU C CD2   1 
ATOM   7896  N  N     . GLU C 2 598  ? -31.162 -7.400  2.787   1.00 7.46   ? 598  GLU C N     1 
ATOM   7897  C  CA    . GLU C 2 598  ? -31.683 -8.758  2.752   1.00 8.64   ? 598  GLU C CA    1 
ATOM   7898  C  C     . GLU C 2 598  ? -31.275 -9.492  1.476   1.00 13.98  ? 598  GLU C C     1 
ATOM   7899  O  O     . GLU C 2 598  ? -31.617 -10.655 1.289   1.00 22.62  ? 598  GLU C O     1 
ATOM   7900  C  CB    . GLU C 2 598  ? -33.209 -8.749  2.888   1.00 15.07  ? 598  GLU C CB    1 
ATOM   7901  C  CG    . GLU C 2 598  ? -33.956 -8.154  1.698   1.00 22.26  ? 598  GLU C CG    1 
ATOM   7902  C  CD    . GLU C 2 598  ? -34.647 -6.831  2.015   1.00 27.25  ? 598  GLU C CD    1 
ATOM   7903  O  OE1   . GLU C 2 598  ? -34.240 -6.156  2.981   1.00 24.44  ? 598  GLU C OE1   1 
ATOM   7904  O  OE2   . GLU C 2 598  ? -35.605 -6.471  1.296   1.00 33.16  ? 598  GLU C OE2   1 
ATOM   7905  N  N     . HIS C 2 599  ? -30.540 -8.812  0.602   1.00 13.98  ? 599  HIS C N     1 
ATOM   7906  C  CA    . HIS C 2 599  ? -30.043 -9.424  -0.628  1.00 13.85  ? 599  HIS C CA    1 
ATOM   7907  C  C     . HIS C 2 599  ? -28.551 -9.745  -0.541  1.00 10.38  ? 599  HIS C C     1 
ATOM   7908  O  O     . HIS C 2 599  ? -27.998 -10.380 -1.435  1.00 12.12  ? 599  HIS C O     1 
ATOM   7909  C  CB    . HIS C 2 599  ? -30.299 -8.509  -1.832  1.00 14.48  ? 599  HIS C CB    1 
ATOM   7910  C  CG    . HIS C 2 599  ? -31.746 -8.332  -2.169  1.00 15.75  ? 599  HIS C CG    1 
ATOM   7911  N  ND1   . HIS C 2 599  ? -32.410 -9.148  -3.060  1.00 17.39  ? 599  HIS C ND1   1 
ATOM   7912  C  CD2   . HIS C 2 599  ? -32.654 -7.418  -1.750  1.00 15.43  ? 599  HIS C CD2   1 
ATOM   7913  C  CE1   . HIS C 2 599  ? -33.665 -8.751  -3.166  1.00 16.55  ? 599  HIS C CE1   1 
ATOM   7914  N  NE2   . HIS C 2 599  ? -33.839 -7.703  -2.384  1.00 13.30  ? 599  HIS C NE2   1 
ATOM   7915  N  N     . ASP C 2 600  ? -27.901 -9.302  0.530   1.00 11.78  ? 600  ASP C N     1 
ATOM   7916  C  CA    . ASP C 2 600  ? -26.465 -9.505  0.670   1.00 6.79   ? 600  ASP C CA    1 
ATOM   7917  C  C     . ASP C 2 600  ? -26.147 -10.460 1.803   1.00 5.92   ? 600  ASP C C     1 
ATOM   7918  O  O     . ASP C 2 600  ? -26.764 -10.407 2.861   1.00 6.70   ? 600  ASP C O     1 
ATOM   7919  C  CB    . ASP C 2 600  ? -25.755 -8.171  0.892   1.00 4.73   ? 600  ASP C CB    1 
ATOM   7920  C  CG    . ASP C 2 600  ? -25.967 -7.209  -0.253  1.00 7.51   ? 600  ASP C CG    1 
ATOM   7921  O  OD1   . ASP C 2 600  ? -26.274 -7.682  -1.364  1.00 11.67  ? 600  ASP C OD1   1 
ATOM   7922  O  OD2   . ASP C 2 600  ? -25.830 -5.985  -0.045  1.00 3.72   ? 600  ASP C OD2   1 
ATOM   7923  N  N     . ASP C 2 601  ? -25.177 -11.335 1.569   1.00 8.78   ? 601  ASP C N     1 
ATOM   7924  C  CA    . ASP C 2 601  ? -24.817 -12.353 2.544   1.00 10.31  ? 601  ASP C CA    1 
ATOM   7925  C  C     . ASP C 2 601  ? -24.103 -11.714 3.719   1.00 4.92   ? 601  ASP C C     1 
ATOM   7926  O  O     . ASP C 2 601  ? -23.437 -10.693 3.562   1.00 4.68   ? 601  ASP C O     1 
ATOM   7927  C  CB    . ASP C 2 601  ? -23.945 -13.433 1.900   1.00 19.40  ? 601  ASP C CB    1 
ATOM   7928  C  CG    . ASP C 2 601  ? -24.009 -14.753 2.644   1.00 24.35  ? 601  ASP C CG    1 
ATOM   7929  O  OD1   . ASP C 2 601  ? -24.221 -15.797 1.988   1.00 22.85  ? 601  ASP C OD1   1 
ATOM   7930  O  OD2   . ASP C 2 601  ? -23.844 -14.744 3.881   1.00 21.59  ? 601  ASP C OD2   1 
ATOM   7931  N  N     . ALA C 2 602  ? -24.239 -12.326 4.889   1.00 6.43   ? 602  ALA C N     1 
ATOM   7932  C  CA    . ALA C 2 602  ? -23.764 -11.721 6.125   1.00 7.82   ? 602  ALA C CA    1 
ATOM   7933  C  C     . ALA C 2 602  ? -22.297 -11.343 6.066   1.00 4.41   ? 602  ALA C C     1 
ATOM   7934  O  O     . ALA C 2 602  ? -21.889 -10.347 6.649   1.00 5.77   ? 602  ALA C O     1 
ATOM   7935  C  CB    . ALA C 2 602  ? -24.014 -12.649 7.290   1.00 13.93  ? 602  ALA C CB    1 
ATOM   7936  N  N     . ASN C 2 603  ? -21.507 -12.129 5.353   1.00 4.32   ? 603  ASN C N     1 
ATOM   7937  C  CA    . ASN C 2 603  ? -20.088 -11.837 5.251   1.00 10.24  ? 603  ASN C CA    1 
ATOM   7938  C  C     . ASN C 2 603  ? -19.839 -10.425 4.745   1.00 7.04   ? 603  ASN C C     1 
ATOM   7939  O  O     . ASN C 2 603  ? -19.346 -9.583  5.485   1.00 9.49   ? 603  ASN C O     1 
ATOM   7940  C  CB    . ASN C 2 603  ? -19.389 -12.858 4.355   1.00 21.46  ? 603  ASN C CB    1 
ATOM   7941  C  CG    . ASN C 2 603  ? -19.382 -14.242 4.960   1.00 27.08  ? 603  ASN C CG    1 
ATOM   7942  O  OD1   . ASN C 2 603  ? -18.566 -14.544 5.828   1.00 26.47  ? 603  ASN C OD1   1 
ATOM   7943  N  ND2   . ASN C 2 603  ? -20.301 -15.090 4.515   1.00 32.31  ? 603  ASN C ND2   1 
ATOM   7944  N  N     . ARG C 2 604  ? -20.211 -10.141 3.508   1.00 7.35   ? 604  ARG C N     1 
ATOM   7945  C  CA    . ARG C 2 604  ? -19.904 -8.830  2.965   1.00 5.68   ? 604  ARG C CA    1 
ATOM   7946  C  C     . ARG C 2 604  ? -20.748 -7.761  3.624   1.00 1.31   ? 604  ARG C C     1 
ATOM   7947  O  O     . ARG C 2 604  ? -20.325 -6.615  3.726   1.00 2.61   ? 604  ARG C O     1 
ATOM   7948  C  CB    . ARG C 2 604  ? -20.098 -8.817  1.453   1.00 5.36   ? 604  ARG C CB    1 
ATOM   7949  C  CG    . ARG C 2 604  ? -19.349 -9.936  0.774   1.00 11.25  ? 604  ARG C CG    1 
ATOM   7950  C  CD    . ARG C 2 604  ? -17.889 -9.933  1.187   1.00 10.00  ? 604  ARG C CD    1 
ATOM   7951  N  NE    . ARG C 2 604  ? -17.100 -9.069  0.319   1.00 8.57   ? 604  ARG C NE    1 
ATOM   7952  C  CZ    . ARG C 2 604  ? -16.144 -9.506  -0.493  1.00 14.00  ? 604  ARG C CZ    1 
ATOM   7953  N  NH1   . ARG C 2 604  ? -15.846 -10.798 -0.535  1.00 15.92  ? 604  ARG C NH1   1 
ATOM   7954  N  NH2   . ARG C 2 604  ? -15.479 -8.649  -1.255  1.00 16.68  ? 604  ARG C NH2   1 
ATOM   7955  N  N     . ALA C 2 605  ? -21.933 -8.136  4.087   1.00 2.62   ? 605  ALA C N     1 
ATOM   7956  C  CA    . ALA C 2 605  ? -22.792 -7.177  4.764   1.00 3.01   ? 605  ALA C CA    1 
ATOM   7957  C  C     . ALA C 2 605  ? -22.060 -6.627  5.970   1.00 1.52   ? 605  ALA C C     1 
ATOM   7958  O  O     . ALA C 2 605  ? -22.079 -5.431  6.236   1.00 2.93   ? 605  ALA C O     1 
ATOM   7959  C  CB    . ALA C 2 605  ? -24.095 -7.813  5.177   1.00 5.29   ? 605  ALA C CB    1 
ATOM   7960  N  N     . LEU C 2 606  ? -21.390 -7.524  6.678   1.00 3.47   ? 606  LEU C N     1 
ATOM   7961  C  CA    . LEU C 2 606  ? -20.554 -7.168  7.814   1.00 3.50   ? 606  LEU C CA    1 
ATOM   7962  C  C     . LEU C 2 606  ? -19.454 -6.180  7.413   1.00 6.41   ? 606  LEU C C     1 
ATOM   7963  O  O     . LEU C 2 606  ? -19.274 -5.154  8.066   1.00 6.75   ? 606  LEU C O     1 
ATOM   7964  C  CB    . LEU C 2 606  ? -19.957 -8.436  8.422   1.00 1.15   ? 606  LEU C CB    1 
ATOM   7965  C  CG    . LEU C 2 606  ? -18.931 -8.388  9.545   1.00 0.48   ? 606  LEU C CG    1 
ATOM   7966  C  CD1   . LEU C 2 606  ? -19.056 -9.652  10.364  1.00 2.61   ? 606  LEU C CD1   1 
ATOM   7967  C  CD2   . LEU C 2 606  ? -17.521 -8.271  8.990   1.00 6.00   ? 606  LEU C CD2   1 
ATOM   7968  N  N     . MET C 2 607  ? -18.712 -6.490  6.351   1.00 7.38   ? 607  MET C N     1 
ATOM   7969  C  CA    . MET C 2 607  ? -17.710 -5.557  5.847   1.00 4.24   ? 607  MET C CA    1 
ATOM   7970  C  C     . MET C 2 607  ? -18.406 -4.253  5.473   1.00 3.71   ? 607  MET C C     1 
ATOM   7971  O  O     . MET C 2 607  ? -17.976 -3.170  5.870   1.00 4.44   ? 607  MET C O     1 
ATOM   7972  C  CB    . MET C 2 607  ? -16.964 -6.127  4.632   1.00 10.61  ? 607  MET C CB    1 
ATOM   7973  C  CG    . MET C 2 607  ? -16.346 -7.520  4.821   1.00 21.27  ? 607  MET C CG    1 
ATOM   7974  S  SD    . MET C 2 607  ? -15.570 -8.189  3.318   1.00 26.36  ? 607  MET C SD    1 
ATOM   7975  C  CE    . MET C 2 607  ? -15.159 -9.856  3.821   1.00 12.34  ? 607  MET C CE    1 
ATOM   7976  N  N     . GLY C 2 608  ? -19.501 -4.379  4.726   1.00 5.96   ? 608  GLY C N     1 
ATOM   7977  C  CA    . GLY C 2 608  ? -20.242 -3.235  4.221   1.00 6.01   ? 608  GLY C CA    1 
ATOM   7978  C  C     . GLY C 2 608  ? -20.635 -2.272  5.319   1.00 4.94   ? 608  GLY C C     1 
ATOM   7979  O  O     . GLY C 2 608  ? -20.618 -1.055  5.139   1.00 6.62   ? 608  GLY C O     1 
ATOM   7980  N  N     . ALA C 2 609  ? -20.995 -2.828  6.467   1.00 4.60   ? 609  ALA C N     1 
ATOM   7981  C  CA    . ALA C 2 609  ? -21.208 -2.019  7.649   1.00 7.78   ? 609  ALA C CA    1 
ATOM   7982  C  C     . ALA C 2 609  ? -19.882 -1.441  8.092   1.00 3.40   ? 609  ALA C C     1 
ATOM   7983  O  O     . ALA C 2 609  ? -19.745 -0.230  8.227   1.00 5.96   ? 609  ALA C O     1 
ATOM   7984  C  CB    . ALA C 2 609  ? -21.831 -2.837  8.763   1.00 14.96  ? 609  ALA C CB    1 
ATOM   7985  N  N     . ASN C 2 610  ? -18.898 -2.312  8.289   1.00 1.75   ? 610  ASN C N     1 
ATOM   7986  C  CA    . ASN C 2 610  ? -17.625 -1.898  8.863   1.00 2.53   ? 610  ASN C CA    1 
ATOM   7987  C  C     . ASN C 2 610  ? -16.925 -0.833  8.044   1.00 4.40   ? 610  ASN C C     1 
ATOM   7988  O  O     . ASN C 2 610  ? -16.140 -0.047  8.570   1.00 6.93   ? 610  ASN C O     1 
ATOM   7989  C  CB    . ASN C 2 610  ? -16.702 -3.106  9.039   1.00 5.60   ? 610  ASN C CB    1 
ATOM   7990  C  CG    . ASN C 2 610  ? -16.880 -3.778  10.379  1.00 4.75   ? 610  ASN C CG    1 
ATOM   7991  O  OD1   . ASN C 2 610  ? -17.427 -3.186  11.308  1.00 8.78   ? 610  ASN C OD1   1 
ATOM   7992  N  ND2   . ASN C 2 610  ? -16.418 -5.017  10.492  1.00 5.03   ? 610  ASN C ND2   1 
ATOM   7993  N  N     . MET C 2 611  ? -17.229 -0.786  6.757   1.00 2.92   ? 611  MET C N     1 
ATOM   7994  C  CA    . MET C 2 611  ? -16.506 0.113   5.882   1.00 1.79   ? 611  MET C CA    1 
ATOM   7995  C  C     . MET C 2 611  ? -17.075 1.528   5.870   1.00 2.92   ? 611  MET C C     1 
ATOM   7996  O  O     . MET C 2 611  ? -16.338 2.484   5.649   1.00 3.65   ? 611  MET C O     1 
ATOM   7997  C  CB    . MET C 2 611  ? -16.471 -0.444  4.471   1.00 3.71   ? 611  MET C CB    1 
ATOM   7998  C  CG    . MET C 2 611  ? -15.565 -1.652  4.338   1.00 6.28   ? 611  MET C CG    1 
ATOM   7999  S  SD    . MET C 2 611  ? -15.411 -2.132  2.617   1.00 8.30   ? 611  MET C SD    1 
ATOM   8000  C  CE    . MET C 2 611  ? -17.121 -2.043  2.115   1.00 3.50   ? 611  MET C CE    1 
ATOM   8001  N  N     . GLN C 2 612  ? -18.372 1.678   6.112   1.00 5.96   ? 612  GLN C N     1 
ATOM   8002  C  CA    . GLN C 2 612  ? -18.946 3.016   6.144   1.00 2.72   ? 612  GLN C CA    1 
ATOM   8003  C  C     . GLN C 2 612  ? -18.275 3.867   7.202   1.00 2.33   ? 612  GLN C C     1 
ATOM   8004  O  O     . GLN C 2 612  ? -17.980 5.034   6.967   1.00 0.25   ? 612  GLN C O     1 
ATOM   8005  C  CB    . GLN C 2 612  ? -20.435 2.962   6.400   1.00 0.07   ? 612  GLN C CB    1 
ATOM   8006  C  CG    . GLN C 2 612  ? -21.199 2.314   5.311   1.00 7.67   ? 612  GLN C CG    1 
ATOM   8007  C  CD    . GLN C 2 612  ? -22.574 1.969   5.772   1.00 2.98   ? 612  GLN C CD    1 
ATOM   8008  O  OE1   . GLN C 2 612  ? -22.767 0.991   6.492   1.00 5.79   ? 612  GLN C OE1   1 
ATOM   8009  N  NE2   . GLN C 2 612  ? -23.544 2.789   5.399   1.00 7.39   ? 612  GLN C NE2   1 
ATOM   8010  N  N     . ARG C 2 613  ? -17.994 3.281   8.356   1.00 0.05   ? 613  ARG C N     1 
ATOM   8011  C  CA    . ARG C 2 613  ? -17.319 4.029   9.394   1.00 7.88   ? 613  ARG C CA    1 
ATOM   8012  C  C     . ARG C 2 613  ? -15.901 4.386   8.977   1.00 0.22   ? 613  ARG C C     1 
ATOM   8013  O  O     . ARG C 2 613  ? -15.191 5.047   9.719   1.00 8.40   ? 613  ARG C O     1 
ATOM   8014  C  CB    . ARG C 2 613  ? -17.289 3.243   10.695  1.00 3.76   ? 613  ARG C CB    1 
ATOM   8015  C  CG    . ARG C 2 613  ? -18.622 2.690   11.131  1.00 5.63   ? 613  ARG C CG    1 
ATOM   8016  C  CD    . ARG C 2 613  ? -18.477 2.004   12.482  1.00 16.91  ? 613  ARG C CD    1 
ATOM   8017  N  NE    . ARG C 2 613  ? -17.210 1.282   12.586  1.00 22.71  ? 613  ARG C NE    1 
ATOM   8018  C  CZ    . ARG C 2 613  ? -17.104 -0.029  12.784  1.00 21.57  ? 613  ARG C CZ    1 
ATOM   8019  N  NH1   . ARG C 2 613  ? -18.198 -0.772  12.912  1.00 17.10  ? 613  ARG C NH1   1 
ATOM   8020  N  NH2   . ARG C 2 613  ? -15.905 -0.596  12.861  1.00 15.98  ? 613  ARG C NH2   1 
ATOM   8021  N  N     . GLN C 2 614  ? -15.485 3.953   7.794   1.00 0.18   ? 614  GLN C N     1 
ATOM   8022  C  CA    . GLN C 2 614  ? -14.155 4.283   7.308   1.00 2.14   ? 614  GLN C CA    1 
ATOM   8023  C  C     . GLN C 2 614  ? -14.193 5.408   6.282   1.00 0.33   ? 614  GLN C C     1 
ATOM   8024  O  O     . GLN C 2 614  ? -13.166 5.782   5.727   1.00 0.66   ? 614  GLN C O     1 
ATOM   8025  C  CB    . GLN C 2 614  ? -13.487 3.048   6.705   1.00 4.67   ? 614  GLN C CB    1 
ATOM   8026  C  CG    . GLN C 2 614  ? -13.421 1.866   7.647   1.00 5.11   ? 614  GLN C CG    1 
ATOM   8027  C  CD    . GLN C 2 614  ? -12.797 0.649   6.998   1.00 14.38  ? 614  GLN C CD    1 
ATOM   8028  O  OE1   . GLN C 2 614  ? -12.698 0.567   5.774   1.00 13.64  ? 614  GLN C OE1   1 
ATOM   8029  N  NE2   . GLN C 2 614  ? -12.365 -0.304  7.817   1.00 18.53  ? 614  GLN C NE2   1 
ATOM   8030  N  N     . ALA C 2 615  ? -15.374 5.962   6.045   1.00 7.06   ? 615  ALA C N     1 
ATOM   8031  C  CA    . ALA C 2 615  ? -15.529 6.969   5.003   1.00 0.94   ? 615  ALA C CA    1 
ATOM   8032  C  C     . ALA C 2 615  ? -14.718 8.217   5.295   1.00 1.43   ? 615  ALA C C     1 
ATOM   8033  O  O     . ALA C 2 615  ? -14.313 8.452   6.424   1.00 4.00   ? 615  ALA C O     1 
ATOM   8034  C  CB    . ALA C 2 615  ? -16.988 7.328   4.828   1.00 2.93   ? 615  ALA C CB    1 
ATOM   8035  N  N     . VAL C 2 616  ? -14.478 9.013   4.263   1.00 0.16   ? 616  VAL C N     1 
ATOM   8036  C  CA    . VAL C 2 616  ? -13.733 10.253  4.414   1.00 1.67   ? 616  VAL C CA    1 
ATOM   8037  C  C     . VAL C 2 616  ? -14.510 11.428  3.846   1.00 5.03   ? 616  VAL C C     1 
ATOM   8038  O  O     . VAL C 2 616  ? -14.917 11.400  2.688   1.00 6.04   ? 616  VAL C O     1 
ATOM   8039  C  CB    . VAL C 2 616  ? -12.369 10.171  3.722   1.00 1.11   ? 616  VAL C CB    1 
ATOM   8040  C  CG1   . VAL C 2 616  ? -11.738 11.546  3.612   1.00 1.80   ? 616  VAL C CG1   1 
ATOM   8041  C  CG2   . VAL C 2 616  ? -11.465 9.235   4.481   1.00 4.42   ? 616  VAL C CG2   1 
ATOM   8042  N  N     . PRO C 2 617  ? -14.715 12.469  4.664   1.00 4.99   ? 617  PRO C N     1 
ATOM   8043  C  CA    . PRO C 2 617  ? -15.442 13.670  4.247   1.00 0.19   ? 617  PRO C CA    1 
ATOM   8044  C  C     . PRO C 2 617  ? -14.775 14.333  3.064   1.00 0.39   ? 617  PRO C C     1 
ATOM   8045  O  O     . PRO C 2 617  ? -13.578 14.597  3.090   1.00 1.60   ? 617  PRO C O     1 
ATOM   8046  C  CB    . PRO C 2 617  ? -15.382 14.558  5.483   1.00 4.24   ? 617  PRO C CB    1 
ATOM   8047  C  CG    . PRO C 2 617  ? -14.154 14.101  6.200   1.00 4.68   ? 617  PRO C CG    1 
ATOM   8048  C  CD    . PRO C 2 617  ? -14.117 12.625  5.999   1.00 5.35   ? 617  PRO C CD    1 
ATOM   8049  N  N     . LEU C 2 618  ? -15.554 14.582  2.025   1.00 8.61   ? 618  LEU C N     1 
ATOM   8050  C  CA    . LEU C 2 618  ? -15.023 15.137  0.796   1.00 2.39   ? 618  LEU C CA    1 
ATOM   8051  C  C     . LEU C 2 618  ? -15.066 16.652  0.858   1.00 5.62   ? 618  LEU C C     1 
ATOM   8052  O  O     . LEU C 2 618  ? -15.475 17.218  1.870   1.00 8.45   ? 618  LEU C O     1 
ATOM   8053  C  CB    . LEU C 2 618  ? -15.818 14.616  -0.394  1.00 1.93   ? 618  LEU C CB    1 
ATOM   8054  C  CG    . LEU C 2 618  ? -16.128 13.127  -0.272  1.00 1.57   ? 618  LEU C CG    1 
ATOM   8055  C  CD1   . LEU C 2 618  ? -17.110 12.711  -1.340  1.00 8.99   ? 618  LEU C CD1   1 
ATOM   8056  C  CD2   . LEU C 2 618  ? -14.856 12.299  -0.362  1.00 2.60   ? 618  LEU C CD2   1 
ATOM   8057  N  N     . VAL C 2 619  ? -14.639 17.309  -0.216  1.00 3.87   ? 619  VAL C N     1 
ATOM   8058  C  CA    . VAL C 2 619  ? -14.672 18.767  -0.261  1.00 5.86   ? 619  VAL C CA    1 
ATOM   8059  C  C     . VAL C 2 619  ? -16.104 19.259  -0.094  1.00 8.13   ? 619  VAL C C     1 
ATOM   8060  O  O     . VAL C 2 619  ? -16.359 20.209  0.642   1.00 15.01  ? 619  VAL C O     1 
ATOM   8061  C  CB    . VAL C 2 619  ? -14.092 19.321  -1.567  1.00 2.65   ? 619  VAL C CB    1 
ATOM   8062  C  CG1   . VAL C 2 619  ? -14.154 20.841  -1.564  1.00 4.10   ? 619  VAL C CG1   1 
ATOM   8063  C  CG2   . VAL C 2 619  ? -12.662 18.852  -1.743  1.00 2.77   ? 619  VAL C CG2   1 
ATOM   8064  N  N     . ARG C 2 620  ? -17.039 18.606  -0.775  1.00 4.06   ? 620  ARG C N     1 
ATOM   8065  C  CA    . ARG C 2 620  ? -18.454 18.836  -0.519  1.00 9.58   ? 620  ARG C CA    1 
ATOM   8066  C  C     . ARG C 2 620  ? -19.217 17.543  -0.731  1.00 5.12   ? 620  ARG C C     1 
ATOM   8067  O  O     . ARG C 2 620  ? -18.853 16.737  -1.581  1.00 3.96   ? 620  ARG C O     1 
ATOM   8068  C  CB    . ARG C 2 620  ? -19.004 19.956  -1.402  1.00 18.98  ? 620  ARG C CB    1 
ATOM   8069  C  CG    . ARG C 2 620  ? -19.124 19.656  -2.885  1.00 30.65  ? 620  ARG C CG    1 
ATOM   8070  C  CD    . ARG C 2 620  ? -19.753 20.861  -3.579  1.00 46.31  ? 620  ARG C CD    1 
ATOM   8071  N  NE    . ARG C 2 620  ? -20.054 20.638  -4.989  1.00 54.30  ? 620  ARG C NE    1 
ATOM   8072  C  CZ    . ARG C 2 620  ? -20.644 21.542  -5.767  1.00 47.70  ? 620  ARG C CZ    1 
ATOM   8073  N  NH1   . ARG C 2 620  ? -20.887 21.269  -7.042  1.00 61.81  ? 620  ARG C NH1   1 
ATOM   8074  N  NH2   . ARG C 2 620  ? -20.991 22.722  -5.267  1.00 36.11  ? 620  ARG C NH2   1 
ATOM   8075  N  N     . SER C 2 621  ? -20.272 17.347  0.051   1.00 0.83   ? 621  SER C N     1 
ATOM   8076  C  CA    . SER C 2 621  ? -20.906 16.040  0.159   1.00 5.04   ? 621  SER C CA    1 
ATOM   8077  C  C     . SER C 2 621  ? -22.302 15.976  -0.443  1.00 4.17   ? 621  SER C C     1 
ATOM   8078  O  O     . SER C 2 621  ? -23.115 16.869  -0.240  1.00 5.17   ? 621  SER C O     1 
ATOM   8079  C  CB    . SER C 2 621  ? -20.959 15.626  1.629   1.00 6.69   ? 621  SER C CB    1 
ATOM   8080  O  OG    . SER C 2 621  ? -21.022 16.771  2.464   1.00 4.18   ? 621  SER C OG    1 
ATOM   8081  N  N     . GLU C 2 622  ? -22.567 14.907  -1.185  1.00 4.95   ? 622  GLU C N     1 
ATOM   8082  C  CA    . GLU C 2 622  ? -23.885 14.675  -1.767  1.00 13.01  ? 622  GLU C CA    1 
ATOM   8083  C  C     . GLU C 2 622  ? -24.635 13.606  -0.995  1.00 10.52  ? 622  GLU C C     1 
ATOM   8084  O  O     . GLU C 2 622  ? -24.047 12.615  -0.570  1.00 6.74   ? 622  GLU C O     1 
ATOM   8085  C  CB    . GLU C 2 622  ? -23.787 14.223  -3.224  1.00 23.94  ? 622  GLU C CB    1 
ATOM   8086  C  CG    . GLU C 2 622  ? -22.968 15.094  -4.160  1.00 31.28  ? 622  GLU C CG    1 
ATOM   8087  C  CD    . GLU C 2 622  ? -22.765 14.425  -5.519  1.00 29.49  ? 622  GLU C CD    1 
ATOM   8088  O  OE1   . GLU C 2 622  ? -23.049 13.209  -5.631  1.00 11.80  ? 622  GLU C OE1   1 
ATOM   8089  O  OE2   . GLU C 2 622  ? -22.321 15.109  -6.467  1.00 41.09  ? 622  GLU C OE2   1 
ATOM   8090  N  N     . ALA C 2 623  ? -25.938 13.787  -0.832  1.00 9.37   ? 623  ALA C N     1 
ATOM   8091  C  CA    . ALA C 2 623  ? -26.770 12.714  -0.313  1.00 5.11   ? 623  ALA C CA    1 
ATOM   8092  C  C     . ALA C 2 623  ? -26.926 11.652  -1.397  1.00 3.17   ? 623  ALA C C     1 
ATOM   8093  O  O     . ALA C 2 623  ? -26.915 11.977  -2.580  1.00 4.16   ? 623  ALA C O     1 
ATOM   8094  C  CB    . ALA C 2 623  ? -28.120 13.248  0.131   1.00 8.67   ? 623  ALA C CB    1 
ATOM   8095  N  N     . PRO C 2 624  ? -27.047 10.376  -1.000  1.00 2.89   ? 624  PRO C N     1 
ATOM   8096  C  CA    . PRO C 2 624  ? -27.174 9.287   -1.974  1.00 2.92   ? 624  PRO C CA    1 
ATOM   8097  C  C     . PRO C 2 624  ? -28.517 9.306   -2.678  1.00 3.00   ? 624  PRO C C     1 
ATOM   8098  O  O     . PRO C 2 624  ? -29.498 9.734   -2.081  1.00 8.07   ? 624  PRO C O     1 
ATOM   8099  C  CB    . PRO C 2 624  ? -27.038 8.033   -1.115  1.00 6.75   ? 624  PRO C CB    1 
ATOM   8100  C  CG    . PRO C 2 624  ? -27.500 8.453   0.233   1.00 7.21   ? 624  PRO C CG    1 
ATOM   8101  C  CD    . PRO C 2 624  ? -27.055 9.878   0.386   1.00 6.49   ? 624  PRO C CD    1 
ATOM   8102  N  N     . LEU C 2 625  ? -28.570 8.849   -3.922  1.00 1.07   ? 625  LEU C N     1 
ATOM   8103  C  CA    . LEU C 2 625  ? -29.844 8.806   -4.623  1.00 1.52   ? 625  LEU C CA    1 
ATOM   8104  C  C     . LEU C 2 625  ? -30.697 7.697   -4.054  1.00 5.46   ? 625  LEU C C     1 
ATOM   8105  O  O     . LEU C 2 625  ? -31.921 7.744   -4.115  1.00 9.92   ? 625  LEU C O     1 
ATOM   8106  C  CB    . LEU C 2 625  ? -29.643 8.613   -6.118  1.00 1.74   ? 625  LEU C CB    1 
ATOM   8107  C  CG    . LEU C 2 625  ? -29.480 9.936   -6.862  1.00 9.14   ? 625  LEU C CG    1 
ATOM   8108  C  CD1   . LEU C 2 625  ? -28.856 9.698   -8.218  1.00 16.11  ? 625  LEU C CD1   1 
ATOM   8109  C  CD2   . LEU C 2 625  ? -30.820 10.651  -6.999  1.00 10.58  ? 625  LEU C CD2   1 
ATOM   8110  N  N     . VAL C 2 626  ? -30.037 6.700   -3.485  1.00 1.82   ? 626  VAL C N     1 
ATOM   8111  C  CA    . VAL C 2 626  ? -30.735 5.587   -2.860  1.00 9.12   ? 626  VAL C CA    1 
ATOM   8112  C  C     . VAL C 2 626  ? -30.493 5.567   -1.355  1.00 10.24  ? 626  VAL C C     1 
ATOM   8113  O  O     . VAL C 2 626  ? -29.351 5.600   -0.904  1.00 13.95  ? 626  VAL C O     1 
ATOM   8114  C  CB    . VAL C 2 626  ? -30.296 4.241   -3.457  1.00 10.43  ? 626  VAL C CB    1 
ATOM   8115  C  CG1   . VAL C 2 626  ? -30.987 3.093   -2.739  1.00 16.34  ? 626  VAL C CG1   1 
ATOM   8116  C  CG2   . VAL C 2 626  ? -30.589 4.200   -4.950  1.00 10.39  ? 626  VAL C CG2   1 
ATOM   8117  N  N     . GLY C 2 627  ? -31.568 5.510   -0.577  1.00 9.43   ? 627  GLY C N     1 
ATOM   8118  C  CA    . GLY C 2 627  ? -31.447 5.510   0.869   1.00 9.73   ? 627  GLY C CA    1 
ATOM   8119  C  C     . GLY C 2 627  ? -32.335 4.495   1.562   1.00 8.97   ? 627  GLY C C     1 
ATOM   8120  O  O     . GLY C 2 627  ? -33.072 3.753   0.911   1.00 13.28  ? 627  GLY C O     1 
ATOM   8121  N  N     . THR C 2 628  ? -32.257 4.461   2.890   1.00 6.98   ? 628  THR C N     1 
ATOM   8122  C  CA    . THR C 2 628  ? -33.073 3.552   3.687   1.00 7.42   ? 628  THR C CA    1 
ATOM   8123  C  C     . THR C 2 628  ? -33.887 4.287   4.741   1.00 12.60  ? 628  THR C C     1 
ATOM   8124  O  O     . THR C 2 628  ? -34.739 3.687   5.395   1.00 15.63  ? 628  THR C O     1 
ATOM   8125  C  CB    . THR C 2 628  ? -32.227 2.500   4.412   1.00 4.59   ? 628  THR C CB    1 
ATOM   8126  O  OG1   . THR C 2 628  ? -31.620 3.091   5.565   1.00 2.23   ? 628  THR C OG1   1 
ATOM   8127  C  CG2   . THR C 2 628  ? -31.148 1.952   3.501   1.00 10.98  ? 628  THR C CG2   1 
ATOM   8128  N  N     . GLY C 2 629  ? -33.611 5.576   4.921   1.00 12.13  ? 629  GLY C N     1 
ATOM   8129  C  CA    . GLY C 2 629  ? -34.351 6.393   5.874   1.00 15.08  ? 629  GLY C CA    1 
ATOM   8130  C  C     . GLY C 2 629  ? -33.566 6.693   7.139   1.00 9.83   ? 629  GLY C C     1 
ATOM   8131  O  O     . GLY C 2 629  ? -33.835 7.659   7.850   1.00 10.11  ? 629  GLY C O     1 
ATOM   8132  N  N     . MET C 2 630  ? -32.582 5.846   7.411   1.00 10.96  ? 630  MET C N     1 
ATOM   8133  C  CA    . MET C 2 630  ? -31.729 5.975   8.585   1.00 3.92   ? 630  MET C CA    1 
ATOM   8134  C  C     . MET C 2 630  ? -30.866 7.224   8.494   1.00 2.31   ? 630  MET C C     1 
ATOM   8135  O  O     . MET C 2 630  ? -30.453 7.783   9.509   1.00 3.87   ? 630  MET C O     1 
ATOM   8136  C  CB    . MET C 2 630  ? -30.842 4.734   8.725   1.00 3.77   ? 630  MET C CB    1 
ATOM   8137  C  CG    . MET C 2 630  ? -29.902 4.750   9.913   1.00 15.67  ? 630  MET C CG    1 
ATOM   8138  S  SD    . MET C 2 630  ? -30.826 4.871   11.432  1.00 7.86   ? 630  MET C SD    1 
ATOM   8139  C  CE    . MET C 2 630  ? -31.748 3.351   11.369  1.00 16.12  ? 630  MET C CE    1 
ATOM   8140  N  N     . GLU C 2 631  ? -30.612 7.658   7.264   1.00 5.19   ? 631  GLU C N     1 
ATOM   8141  C  CA    . GLU C 2 631  ? -29.637 8.707   6.983   1.00 4.27   ? 631  GLU C CA    1 
ATOM   8142  C  C     . GLU C 2 631  ? -29.965 10.022  7.666   1.00 5.02   ? 631  GLU C C     1 
ATOM   8143  O  O     . GLU C 2 631  ? -29.072 10.779  8.043   1.00 3.87   ? 631  GLU C O     1 
ATOM   8144  C  CB    . GLU C 2 631  ? -29.528 8.945   5.479   1.00 5.69   ? 631  GLU C CB    1 
ATOM   8145  C  CG    . GLU C 2 631  ? -29.404 7.690   4.647   1.00 7.08   ? 631  GLU C CG    1 
ATOM   8146  C  CD    . GLU C 2 631  ? -30.733 7.001   4.453   1.00 9.59   ? 631  GLU C CD    1 
ATOM   8147  O  OE1   . GLU C 2 631  ? -31.762 7.608   4.814   1.00 9.93   ? 631  GLU C OE1   1 
ATOM   8148  O  OE2   . GLU C 2 631  ? -30.748 5.856   3.958   1.00 11.17  ? 631  GLU C OE2   1 
ATOM   8149  N  N     . LEU C 2 632  ? -31.249 10.305  7.807   1.00 6.53   ? 632  LEU C N     1 
ATOM   8150  C  CA    . LEU C 2 632  ? -31.651 11.535  8.456   1.00 6.02   ? 632  LEU C CA    1 
ATOM   8151  C  C     . LEU C 2 632  ? -31.325 11.496  9.945   1.00 6.59   ? 632  LEU C C     1 
ATOM   8152  O  O     . LEU C 2 632  ? -30.530 12.296  10.429  1.00 5.09   ? 632  LEU C O     1 
ATOM   8153  C  CB    . LEU C 2 632  ? -33.137 11.783  8.248   1.00 10.55  ? 632  LEU C CB    1 
ATOM   8154  C  CG    . LEU C 2 632  ? -33.708 12.890  9.130   1.00 26.59  ? 632  LEU C CG    1 
ATOM   8155  C  CD1   . LEU C 2 632  ? -33.077 14.249  8.821   1.00 21.05  ? 632  LEU C CD1   1 
ATOM   8156  C  CD2   . LEU C 2 632  ? -35.214 12.931  8.976   1.00 48.96  ? 632  LEU C CD2   1 
ATOM   8157  N  N     . ARG C 2 633  ? -31.939 10.555  10.660  1.00 8.60   ? 633  ARG C N     1 
ATOM   8158  C  CA    . ARG C 2 633  ? -31.811 10.455  12.118  1.00 9.08   ? 633  ARG C CA    1 
ATOM   8159  C  C     . ARG C 2 633  ? -30.385 10.226  12.596  1.00 7.43   ? 633  ARG C C     1 
ATOM   8160  O  O     . ARG C 2 633  ? -30.011 10.644  13.695  1.00 6.17   ? 633  ARG C O     1 
ATOM   8161  C  CB    . ARG C 2 633  ? -32.691 9.327   12.653  1.00 17.98  ? 633  ARG C CB    1 
ATOM   8162  C  CG    . ARG C 2 633  ? -34.131 9.718   12.845  1.00 3.38   ? 633  ARG C CG    1 
ATOM   8163  C  CD    . ARG C 2 633  ? -34.243 10.860  13.830  1.00 6.79   ? 633  ARG C CD    1 
ATOM   8164  N  NE    . ARG C 2 633  ? -33.733 10.507  15.150  1.00 3.50   ? 633  ARG C NE    1 
ATOM   8165  C  CZ    . ARG C 2 633  ? -34.499 10.201  16.192  1.00 0.28   ? 633  ARG C CZ    1 
ATOM   8166  N  NH1   . ARG C 2 633  ? -35.819 10.196  16.079  1.00 1.95   ? 633  ARG C NH1   1 
ATOM   8167  N  NH2   . ARG C 2 633  ? -33.943 9.896   17.355  1.00 2.78   ? 633  ARG C NH2   1 
ATOM   8168  N  N     . ALA C 2 634  ? -29.603 9.540   11.775  1.00 8.31   ? 634  ALA C N     1 
ATOM   8169  C  CA    . ALA C 2 634  ? -28.213 9.268   12.089  1.00 2.96   ? 634  ALA C CA    1 
ATOM   8170  C  C     . ALA C 2 634  ? -27.429 10.566  12.146  1.00 3.43   ? 634  ALA C C     1 
ATOM   8171  O  O     . ALA C 2 634  ? -26.693 10.812  13.096  1.00 3.11   ? 634  ALA C O     1 
ATOM   8172  C  CB    . ALA C 2 634  ? -27.620 8.337   11.067  1.00 4.25   ? 634  ALA C CB    1 
ATOM   8173  N  N     . ALA C 2 635  ? -27.603 11.397  11.125  1.00 3.57   ? 635  ALA C N     1 
ATOM   8174  C  CA    . ALA C 2 635  ? -26.874 12.654  11.025  1.00 5.85   ? 635  ALA C CA    1 
ATOM   8175  C  C     . ALA C 2 635  ? -27.224 13.582  12.174  1.00 5.67   ? 635  ALA C C     1 
ATOM   8176  O  O     . ALA C 2 635  ? -26.347 14.215  12.763  1.00 6.17   ? 635  ALA C O     1 
ATOM   8177  C  CB    . ALA C 2 635  ? -27.166 13.332  9.695   1.00 8.66   ? 635  ALA C CB    1 
ATOM   8178  N  N     . ILE C 2 636  ? -28.512 13.660  12.485  1.00 3.29   ? 636  ILE C N     1 
ATOM   8179  C  CA    . ILE C 2 636  ? -28.982 14.525  13.553  1.00 3.28   ? 636  ILE C CA    1 
ATOM   8180  C  C     . ILE C 2 636  ? -28.407 14.100  14.880  1.00 3.53   ? 636  ILE C C     1 
ATOM   8181  O  O     . ILE C 2 636  ? -27.708 14.861  15.535  1.00 7.80   ? 636  ILE C O     1 
ATOM   8182  C  CB    . ILE C 2 636  ? -30.503 14.525  13.663  1.00 1.53   ? 636  ILE C CB    1 
ATOM   8183  C  CG1   . ILE C 2 636  ? -31.115 15.205  12.442  1.00 8.43   ? 636  ILE C CG1   1 
ATOM   8184  C  CG2   . ILE C 2 636  ? -30.933 15.248  14.927  1.00 2.24   ? 636  ILE C CG2   1 
ATOM   8185  C  CD1   . ILE C 2 636  ? -32.611 15.327  12.518  1.00 13.82  ? 636  ILE C CD1   1 
ATOM   8186  N  N     . ASP C 2 637  ? -28.690 12.867  15.271  1.00 1.51   ? 637  ASP C N     1 
ATOM   8187  C  CA    . ASP C 2 637  ? -28.228 12.379  16.558  1.00 7.92   ? 637  ASP C CA    1 
ATOM   8188  C  C     . ASP C 2 637  ? -26.700 12.311  16.622  1.00 9.77   ? 637  ASP C C     1 
ATOM   8189  O  O     . ASP C 2 637  ? -26.130 12.256  17.706  1.00 12.48  ? 637  ASP C O     1 
ATOM   8190  C  CB    . ASP C 2 637  ? -28.839 11.007  16.863  1.00 9.79   ? 637  ASP C CB    1 
ATOM   8191  C  CG    . ASP C 2 637  ? -30.357 11.052  16.959  1.00 5.76   ? 637  ASP C CG    1 
ATOM   8192  O  OD1   . ASP C 2 637  ? -30.978 11.845  16.214  1.00 3.57   ? 637  ASP C OD1   1 
ATOM   8193  O  OD2   . ASP C 2 637  ? -30.924 10.298  17.783  1.00 1.92   ? 637  ASP C OD2   1 
ATOM   8194  N  N     . ALA C 2 638  ? -26.033 12.336  15.472  1.00 6.25   ? 638  ALA C N     1 
ATOM   8195  C  CA    . ALA C 2 638  ? -24.576 12.255  15.461  1.00 6.33   ? 638  ALA C CA    1 
ATOM   8196  C  C     . ALA C 2 638  ? -23.948 13.469  16.140  1.00 12.05  ? 638  ALA C C     1 
ATOM   8197  O  O     . ALA C 2 638  ? -22.808 13.408  16.593  1.00 24.18  ? 638  ALA C O     1 
ATOM   8198  C  CB    . ALA C 2 638  ? -24.056 12.117  14.047  1.00 8.21   ? 638  ALA C CB    1 
ATOM   8199  N  N     . GLY C 2 639  ? -24.688 14.571  16.206  1.00 8.37   ? 639  GLY C N     1 
ATOM   8200  C  CA    . GLY C 2 639  ? -24.238 15.735  16.949  1.00 8.71   ? 639  GLY C CA    1 
ATOM   8201  C  C     . GLY C 2 639  ? -23.063 16.417  16.283  1.00 12.56  ? 639  GLY C C     1 
ATOM   8202  O  O     . GLY C 2 639  ? -22.337 17.191  16.910  1.00 12.01  ? 639  GLY C O     1 
ATOM   8203  N  N     . ASP C 2 640  ? -22.880 16.112  15.003  1.00 10.07  ? 640  ASP C N     1 
ATOM   8204  C  CA    . ASP C 2 640  ? -21.838 16.719  14.194  1.00 11.40  ? 640  ASP C CA    1 
ATOM   8205  C  C     . ASP C 2 640  ? -22.469 17.585  13.114  1.00 4.76   ? 640  ASP C C     1 
ATOM   8206  O  O     . ASP C 2 640  ? -21.807 17.990  12.163  1.00 2.09   ? 640  ASP C O     1 
ATOM   8207  C  CB    . ASP C 2 640  ? -20.935 15.646  13.585  1.00 9.28   ? 640  ASP C CB    1 
ATOM   8208  C  CG    . ASP C 2 640  ? -20.015 15.011  14.613  1.00 15.41  ? 640  ASP C CG    1 
ATOM   8209  O  OD1   . ASP C 2 640  ? -20.378 15.004  15.807  1.00 14.84  ? 640  ASP C OD1   1 
ATOM   8210  O  OD2   . ASP C 2 640  ? -18.928 14.529  14.232  1.00 21.32  ? 640  ASP C OD2   1 
ATOM   8211  N  N     . VAL C 2 641  ? -23.763 17.848  13.272  1.00 5.96   ? 641  VAL C N     1 
ATOM   8212  C  CA    . VAL C 2 641  ? -24.446 18.877  12.501  1.00 3.48   ? 641  VAL C CA    1 
ATOM   8213  C  C     . VAL C 2 641  ? -24.762 20.014  13.461  1.00 3.41   ? 641  VAL C C     1 
ATOM   8214  O  O     . VAL C 2 641  ? -24.216 20.051  14.560  1.00 8.02   ? 641  VAL C O     1 
ATOM   8215  C  CB    . VAL C 2 641  ? -25.733 18.352  11.828  1.00 1.19   ? 641  VAL C CB    1 
ATOM   8216  C  CG1   . VAL C 2 641  ? -25.391 17.347  10.742  1.00 5.67   ? 641  VAL C CG1   1 
ATOM   8217  C  CG2   . VAL C 2 641  ? -26.660 17.734  12.855  1.00 2.76   ? 641  VAL C CG2   1 
ATOM   8218  N  N     . VAL C 2 642  ? -25.620 20.946  13.056  1.00 3.97   ? 642  VAL C N     1 
ATOM   8219  C  CA    . VAL C 2 642  ? -26.013 22.043  13.942  1.00 3.60   ? 642  VAL C CA    1 
ATOM   8220  C  C     . VAL C 2 642  ? -27.528 22.197  14.001  1.00 2.39   ? 642  VAL C C     1 
ATOM   8221  O  O     . VAL C 2 642  ? -28.156 22.653  13.045  1.00 5.65   ? 642  VAL C O     1 
ATOM   8222  C  CB    . VAL C 2 642  ? -25.407 23.390  13.511  1.00 4.27   ? 642  VAL C CB    1 
ATOM   8223  C  CG1   . VAL C 2 642  ? -25.882 24.484  14.436  1.00 6.16   ? 642  VAL C CG1   1 
ATOM   8224  C  CG2   . VAL C 2 642  ? -23.889 23.326  13.520  1.00 9.30   ? 642  VAL C CG2   1 
ATOM   8225  N  N     . VAL C 2 643  ? -28.105 21.821  15.137  1.00 2.07   ? 643  VAL C N     1 
ATOM   8226  C  CA    . VAL C 2 643  ? -29.547 21.852  15.328  1.00 2.36   ? 643  VAL C CA    1 
ATOM   8227  C  C     . VAL C 2 643  ? -29.941 23.094  16.117  1.00 7.34   ? 643  VAL C C     1 
ATOM   8228  O  O     . VAL C 2 643  ? -29.197 23.533  16.987  1.00 12.40  ? 643  VAL C O     1 
ATOM   8229  C  CB    . VAL C 2 643  ? -30.031 20.594  16.068  1.00 1.80   ? 643  VAL C CB    1 
ATOM   8230  C  CG1   . VAL C 2 643  ? -31.537 20.487  16.006  1.00 12.10  ? 643  VAL C CG1   1 
ATOM   8231  C  CG2   . VAL C 2 643  ? -29.386 19.349  15.475  1.00 2.51   ? 643  VAL C CG2   1 
ATOM   8232  N  N     . ALA C 2 644  ? -31.101 23.669  15.814  1.00 6.16   ? 644  ALA C N     1 
ATOM   8233  C  CA    . ALA C 2 644  ? -31.564 24.844  16.547  1.00 6.86   ? 644  ALA C CA    1 
ATOM   8234  C  C     . ALA C 2 644  ? -32.322 24.454  17.815  1.00 8.54   ? 644  ALA C C     1 
ATOM   8235  O  O     . ALA C 2 644  ? -33.144 23.537  17.807  1.00 6.99   ? 644  ALA C O     1 
ATOM   8236  C  CB    . ALA C 2 644  ? -32.429 25.710  15.663  1.00 6.96   ? 644  ALA C CB    1 
ATOM   8237  N  N     . GLU C 2 645  ? -32.039 25.156  18.905  1.00 4.41   ? 645  GLU C N     1 
ATOM   8238  C  CA    . GLU C 2 645  ? -32.655 24.840  20.186  1.00 6.36   ? 645  GLU C CA    1 
ATOM   8239  C  C     . GLU C 2 645  ? -34.114 25.259  20.215  1.00 7.61   ? 645  GLU C C     1 
ATOM   8240  O  O     . GLU C 2 645  ? -34.997 24.429  20.390  1.00 10.37  ? 645  GLU C O     1 
ATOM   8241  C  CB    . GLU C 2 645  ? -31.894 25.511  21.327  1.00 15.54  ? 645  GLU C CB    1 
ATOM   8242  C  CG    . GLU C 2 645  ? -30.443 25.097  21.421  1.00 22.30  ? 645  GLU C CG    1 
ATOM   8243  C  CD    . GLU C 2 645  ? -29.825 25.457  22.753  1.00 28.40  ? 645  GLU C CD    1 
ATOM   8244  O  OE1   . GLU C 2 645  ? -30.549 25.994  23.615  1.00 26.81  ? 645  GLU C OE1   1 
ATOM   8245  O  OE2   . GLU C 2 645  ? -28.619 25.201  22.941  1.00 34.74  ? 645  GLU C OE2   1 
ATOM   8246  N  N     . GLU C 2 646  ? -34.360 26.552  20.041  1.00 9.03   ? 646  GLU C N     1 
ATOM   8247  C  CA    . GLU C 2 646  ? -35.722 27.080  20.033  1.00 16.08  ? 646  GLU C CA    1 
ATOM   8248  C  C     . GLU C 2 646  ? -36.087 27.654  18.666  1.00 15.28  ? 646  GLU C C     1 
ATOM   8249  O  O     . GLU C 2 646  ? -35.224 28.153  17.942  1.00 11.12  ? 646  GLU C O     1 
ATOM   8250  C  CB    . GLU C 2 646  ? -35.893 28.157  21.109  1.00 17.47  ? 646  GLU C CB    1 
ATOM   8251  C  CG    . GLU C 2 646  ? -35.772 27.652  22.541  1.00 21.86  ? 646  GLU C CG    1 
ATOM   8252  C  CD    . GLU C 2 646  ? -35.601 28.786  23.533  1.00 34.86  ? 646  GLU C CD    1 
ATOM   8253  O  OE1   . GLU C 2 646  ? -35.776 29.955  23.129  1.00 27.67  ? 646  GLU C OE1   1 
ATOM   8254  O  OE2   . GLU C 2 646  ? -35.282 28.515  24.710  1.00 48.40  ? 646  GLU C OE2   1 
ATOM   8255  N  N     . SER C 2 647  ? -37.369 27.579  18.319  1.00 16.53  ? 647  SER C N     1 
ATOM   8256  C  CA    . SER C 2 647  ? -37.863 28.095  17.045  1.00 9.93   ? 647  SER C CA    1 
ATOM   8257  C  C     . SER C 2 647  ? -37.560 29.582  16.913  1.00 15.51  ? 647  SER C C     1 
ATOM   8258  O  O     . SER C 2 647  ? -37.336 30.260  17.911  1.00 23.60  ? 647  SER C O     1 
ATOM   8259  C  CB    . SER C 2 647  ? -39.369 27.859  16.919  1.00 15.71  ? 647  SER C CB    1 
ATOM   8260  O  OG    . SER C 2 647  ? -39.713 26.527  17.252  1.00 19.38  ? 647  SER C OG    1 
ATOM   8261  N  N     . GLY C 2 648  ? -37.552 30.092  15.686  1.00 16.59  ? 648  GLY C N     1 
ATOM   8262  C  CA    . GLY C 2 648  ? -37.316 31.509  15.484  1.00 12.14  ? 648  GLY C CA    1 
ATOM   8263  C  C     . GLY C 2 648  ? -37.113 31.901  14.041  1.00 7.56   ? 648  GLY C C     1 
ATOM   8264  O  O     . GLY C 2 648  ? -37.620 31.252  13.130  1.00 11.66  ? 648  GLY C O     1 
ATOM   8265  N  N     . VAL C 2 649  ? -36.370 32.978  13.833  1.00 3.07   ? 649  VAL C N     1 
ATOM   8266  C  CA    . VAL C 2 649  ? -36.080 33.436  12.488  1.00 7.84   ? 649  VAL C CA    1 
ATOM   8267  C  C     . VAL C 2 649  ? -34.600 33.771  12.380  1.00 8.69   ? 649  VAL C C     1 
ATOM   8268  O  O     . VAL C 2 649  ? -33.988 34.239  13.336  1.00 11.05  ? 649  VAL C O     1 
ATOM   8269  C  CB    . VAL C 2 649  ? -36.940 34.656  12.107  1.00 11.58  ? 649  VAL C CB    1 
ATOM   8270  C  CG1   . VAL C 2 649  ? -36.645 35.834  13.024  1.00 14.62  ? 649  VAL C CG1   1 
ATOM   8271  C  CG2   . VAL C 2 649  ? -36.721 35.032  10.649  1.00 15.83  ? 649  VAL C CG2   1 
ATOM   8272  N  N     . ILE C 2 650  ? -34.021 33.507  11.216  1.00 5.47   ? 650  ILE C N     1 
ATOM   8273  C  CA    . ILE C 2 650  ? -32.602 33.733  11.013  1.00 7.26   ? 650  ILE C CA    1 
ATOM   8274  C  C     . ILE C 2 650  ? -32.278 35.216  10.974  1.00 8.07   ? 650  ILE C C     1 
ATOM   8275  O  O     . ILE C 2 650  ? -32.421 35.865  9.940   1.00 10.90  ? 650  ILE C O     1 
ATOM   8276  C  CB    . ILE C 2 650  ? -32.118 33.081  9.722   1.00 10.21  ? 650  ILE C CB    1 
ATOM   8277  C  CG1   . ILE C 2 650  ? -32.429 31.586  9.750   1.00 16.28  ? 650  ILE C CG1   1 
ATOM   8278  C  CG2   . ILE C 2 650  ? -30.630 33.304  9.543   1.00 12.66  ? 650  ILE C CG2   1 
ATOM   8279  C  CD1   . ILE C 2 650  ? -31.950 30.885  11.010  1.00 10.39  ? 650  ILE C CD1   1 
ATOM   8280  N  N     . GLU C 2 651  ? -31.835 35.745  12.109  1.00 8.94   ? 651  GLU C N     1 
ATOM   8281  C  CA    . GLU C 2 651  ? -31.487 37.154  12.209  1.00 5.43   ? 651  GLU C CA    1 
ATOM   8282  C  C     . GLU C 2 651  ? -30.290 37.487  11.326  1.00 3.86   ? 651  GLU C C     1 
ATOM   8283  O  O     . GLU C 2 651  ? -30.308 38.469  10.595  1.00 6.44   ? 651  GLU C O     1 
ATOM   8284  C  CB    . GLU C 2 651  ? -31.202 37.531  13.665  1.00 7.79   ? 651  GLU C CB    1 
ATOM   8285  C  CG    . GLU C 2 651  ? -30.988 39.016  13.882  1.00 9.97   ? 651  GLU C CG    1 
ATOM   8286  C  CD    . GLU C 2 651  ? -31.017 39.404  15.345  1.00 7.10   ? 651  GLU C CD    1 
ATOM   8287  O  OE1   . GLU C 2 651  ? -31.983 39.036  16.047  1.00 6.21   ? 651  GLU C OE1   1 
ATOM   8288  O  OE2   . GLU C 2 651  ? -30.069 40.081  15.792  1.00 9.07   ? 651  GLU C OE2   1 
ATOM   8289  N  N     . GLU C 2 652  ? -29.256 36.659  11.386  1.00 5.86   ? 652  GLU C N     1 
ATOM   8290  C  CA    . GLU C 2 652  ? -28.063 36.886  10.584  1.00 6.75   ? 652  GLU C CA    1 
ATOM   8291  C  C     . GLU C 2 652  ? -27.346 35.571  10.310  1.00 8.39   ? 652  GLU C C     1 
ATOM   8292  O  O     . GLU C 2 652  ? -27.342 34.669  11.140  1.00 8.87   ? 652  GLU C O     1 
ATOM   8293  C  CB    . GLU C 2 652  ? -27.127 37.875  11.289  1.00 12.91  ? 652  GLU C CB    1 
ATOM   8294  C  CG    . GLU C 2 652  ? -25.855 38.208  10.516  1.00 17.78  ? 652  GLU C CG    1 
ATOM   8295  C  CD    . GLU C 2 652  ? -25.097 39.388  11.098  1.00 27.65  ? 652  GLU C CD    1 
ATOM   8296  O  OE1   . GLU C 2 652  ? -25.319 40.522  10.624  1.00 28.96  ? 652  GLU C OE1   1 
ATOM   8297  O  OE2   . GLU C 2 652  ? -24.279 39.183  12.022  1.00 31.12  ? 652  GLU C OE2   1 
ATOM   8298  N  N     . VAL C 2 653  ? -26.748 35.456  9.133   1.00 10.52  ? 653  VAL C N     1 
ATOM   8299  C  CA    . VAL C 2 653  ? -26.005 34.256  8.800   1.00 3.82   ? 653  VAL C CA    1 
ATOM   8300  C  C     . VAL C 2 653  ? -24.667 34.619  8.183   1.00 6.41   ? 653  VAL C C     1 
ATOM   8301  O  O     . VAL C 2 653  ? -24.572 35.505  7.334   1.00 8.41   ? 653  VAL C O     1 
ATOM   8302  C  CB    . VAL C 2 653  ? -26.794 33.352  7.843   1.00 4.33   ? 653  VAL C CB    1 
ATOM   8303  C  CG1   . VAL C 2 653  ? -27.233 34.127  6.608   1.00 14.91  ? 653  VAL C CG1   1 
ATOM   8304  C  CG2   . VAL C 2 653  ? -25.965 32.144  7.456   1.00 8.71   ? 653  VAL C CG2   1 
ATOM   8305  N  N     . SER C 2 654  ? -23.624 33.939  8.632   1.00 5.44   ? 654  SER C N     1 
ATOM   8306  C  CA    . SER C 2 654  ? -22.296 34.170  8.102   1.00 9.95   ? 654  SER C CA    1 
ATOM   8307  C  C     . SER C 2 654  ? -21.614 32.835  7.852   1.00 9.00   ? 654  SER C C     1 
ATOM   8308  O  O     . SER C 2 654  ? -22.153 31.784  8.193   1.00 12.88  ? 654  SER C O     1 
ATOM   8309  C  CB    . SER C 2 654  ? -21.478 35.031  9.069   1.00 7.31   ? 654  SER C CB    1 
ATOM   8310  O  OG    . SER C 2 654  ? -20.184 35.298  8.559   1.00 10.06  ? 654  SER C OG    1 
ATOM   8311  N  N     . ALA C 2 655  ? -20.435 32.870  7.244   1.00 12.54  ? 655  ALA C N     1 
ATOM   8312  C  CA    . ALA C 2 655  ? -19.634 31.663  7.116   1.00 5.81   ? 655  ALA C CA    1 
ATOM   8313  C  C     . ALA C 2 655  ? -19.124 31.289  8.487   1.00 3.12   ? 655  ALA C C     1 
ATOM   8314  O  O     . ALA C 2 655  ? -18.830 30.134  8.763   1.00 3.64   ? 655  ALA C O     1 
ATOM   8315  C  CB    . ALA C 2 655  ? -18.483 31.868  6.157   1.00 7.81   ? 655  ALA C CB    1 
ATOM   8316  N  N     . ASP C 2 656  ? -19.044 32.293  9.348   1.00 2.82   ? 656  ASP C N     1 
ATOM   8317  C  CA    . ASP C 2 656  ? -18.512 32.131  10.691  1.00 7.05   ? 656  ASP C CA    1 
ATOM   8318  C  C     . ASP C 2 656  ? -19.566 31.680  11.692  1.00 6.70   ? 656  ASP C C     1 
ATOM   8319  O  O     . ASP C 2 656  ? -19.367 30.695  12.400  1.00 6.53   ? 656  ASP C O     1 
ATOM   8320  C  CB    . ASP C 2 656  ? -17.873 33.436  11.149  1.00 7.73   ? 656  ASP C CB    1 
ATOM   8321  C  CG    . ASP C 2 656  ? -16.661 33.790  10.326  1.00 11.82  ? 656  ASP C CG    1 
ATOM   8322  O  OD1   . ASP C 2 656  ? -15.822 32.889  10.108  1.00 8.83   ? 656  ASP C OD1   1 
ATOM   8323  O  OD2   . ASP C 2 656  ? -16.557 34.951  9.879   1.00 10.24  ? 656  ASP C OD2   1 
ATOM   8324  N  N     . TYR C 2 657  ? -20.688 32.383  11.765  1.00 3.81   ? 657  TYR C N     1 
ATOM   8325  C  CA    . TYR C 2 657  ? -21.706 31.961  12.711  1.00 2.60   ? 657  TYR C CA    1 
ATOM   8326  C  C     . TYR C 2 657  ? -23.127 32.223  12.235  1.00 6.29   ? 657  TYR C C     1 
ATOM   8327  O  O     . TYR C 2 657  ? -23.362 32.994  11.304  1.00 7.03   ? 657  TYR C O     1 
ATOM   8328  C  CB    . TYR C 2 657  ? -21.474 32.639  14.062  1.00 5.11   ? 657  TYR C CB    1 
ATOM   8329  C  CG    . TYR C 2 657  ? -21.604 34.142  14.029  1.00 13.78  ? 657  TYR C CG    1 
ATOM   8330  C  CD1   . TYR C 2 657  ? -22.849 34.755  14.142  1.00 20.12  ? 657  TYR C CD1   1 
ATOM   8331  C  CD2   . TYR C 2 657  ? -20.486 34.953  13.897  1.00 14.93  ? 657  TYR C CD2   1 
ATOM   8332  C  CE1   . TYR C 2 657  ? -22.981 36.132  14.113  1.00 15.83  ? 657  TYR C CE1   1 
ATOM   8333  C  CE2   . TYR C 2 657  ? -20.610 36.336  13.868  1.00 27.58  ? 657  TYR C CE2   1 
ATOM   8334  C  CZ    . TYR C 2 657  ? -21.862 36.918  13.977  1.00 21.52  ? 657  TYR C CZ    1 
ATOM   8335  O  OH    . TYR C 2 657  ? -21.996 38.290  13.949  1.00 13.20  ? 657  TYR C OH    1 
ATOM   8336  N  N     . ILE C 2 658  ? -24.067 31.558  12.896  1.00 6.40   ? 658  ILE C N     1 
ATOM   8337  C  CA    . ILE C 2 658  ? -25.486 31.755  12.660  1.00 5.78   ? 658  ILE C CA    1 
ATOM   8338  C  C     . ILE C 2 658  ? -26.124 32.323  13.924  1.00 10.81  ? 658  ILE C C     1 
ATOM   8339  O  O     . ILE C 2 658  ? -25.895 31.823  15.026  1.00 8.77   ? 658  ILE C O     1 
ATOM   8340  C  CB    . ILE C 2 658  ? -26.185 30.441  12.255  1.00 3.05   ? 658  ILE C CB    1 
ATOM   8341  C  CG1   . ILE C 2 658  ? -25.932 30.129  10.781  1.00 5.72   ? 658  ILE C CG1   1 
ATOM   8342  C  CG2   . ILE C 2 658  ? -27.672 30.531  12.489  1.00 8.93   ? 658  ILE C CG2   1 
ATOM   8343  C  CD1   . ILE C 2 658  ? -26.638 28.881  10.294  1.00 2.95   ? 658  ILE C CD1   1 
ATOM   8344  N  N     . THR C 2 659  ? -26.894 33.393  13.755  1.00 14.43  ? 659  THR C N     1 
ATOM   8345  C  CA    . THR C 2 659  ? -27.626 34.011  14.851  1.00 8.39   ? 659  THR C CA    1 
ATOM   8346  C  C     . THR C 2 659  ? -29.118 33.775  14.672  1.00 4.81   ? 659  THR C C     1 
ATOM   8347  O  O     . THR C 2 659  ? -29.641 33.852  13.563  1.00 8.65   ? 659  THR C O     1 
ATOM   8348  C  CB    . THR C 2 659  ? -27.363 35.525  14.934  1.00 10.46  ? 659  THR C CB    1 
ATOM   8349  O  OG1   . THR C 2 659  ? -25.954 35.782  14.900  1.00 6.91   ? 659  THR C OG1   1 
ATOM   8350  C  CG2   . THR C 2 659  ? -27.948 36.094  16.211  1.00 18.44  ? 659  THR C CG2   1 
ATOM   8351  N  N     . VAL C 2 660  ? -29.809 33.485  15.764  1.00 3.85   ? 660  VAL C N     1 
ATOM   8352  C  CA    . VAL C 2 660  ? -31.233 33.203  15.677  1.00 9.31   ? 660  VAL C CA    1 
ATOM   8353  C  C     . VAL C 2 660  ? -32.076 34.018  16.651  1.00 20.48  ? 660  VAL C C     1 
ATOM   8354  O  O     . VAL C 2 660  ? -31.906 33.928  17.867  1.00 21.14  ? 660  VAL C O     1 
ATOM   8355  C  CB    . VAL C 2 660  ? -31.510 31.725  15.922  1.00 9.07   ? 660  VAL C CB    1 
ATOM   8356  C  CG1   . VAL C 2 660  ? -33.006 31.482  15.997  1.00 14.99  ? 660  VAL C CG1   1 
ATOM   8357  C  CG2   . VAL C 2 660  ? -30.877 30.889  14.828  1.00 11.92  ? 660  VAL C CG2   1 
ATOM   8358  N  N     . MET C 2 661  ? -32.996 34.807  16.106  1.00 20.43  ? 661  MET C N     1 
ATOM   8359  C  CA    . MET C 2 661  ? -33.931 35.569  16.924  1.00 17.21  ? 661  MET C CA    1 
ATOM   8360  C  C     . MET C 2 661  ? -35.108 34.690  17.354  1.00 14.82  ? 661  MET C C     1 
ATOM   8361  O  O     . MET C 2 661  ? -35.859 34.192  16.514  1.00 15.89  ? 661  MET C O     1 
ATOM   8362  C  CB    . MET C 2 661  ? -34.425 36.796  16.157  1.00 12.62  ? 661  MET C CB    1 
ATOM   8363  C  CG    . MET C 2 661  ? -35.371 37.689  16.936  1.00 12.97  ? 661  MET C CG    1 
ATOM   8364  S  SD    . MET C 2 661  ? -34.588 38.542  18.315  1.00 16.42  ? 661  MET C SD    1 
ATOM   8365  C  CE    . MET C 2 661  ? -35.970 39.482  18.955  1.00 17.54  ? 661  MET C CE    1 
ATOM   8366  N  N     . HIS C 2 662  ? -35.255 34.496  18.662  1.00 15.45  ? 662  HIS C N     1 
ATOM   8367  C  CA    . HIS C 2 662  ? -36.312 33.647  19.199  1.00 16.55  ? 662  HIS C CA    1 
ATOM   8368  C  C     . HIS C 2 662  ? -37.632 34.398  19.268  1.00 10.44  ? 662  HIS C C     1 
ATOM   8369  O  O     . HIS C 2 662  ? -37.686 35.601  19.025  1.00 11.68  ? 662  HIS C O     1 
ATOM   8370  C  CB    . HIS C 2 662  ? -35.936 33.125  20.590  1.00 19.51  ? 662  HIS C CB    1 
ATOM   8371  C  CG    . HIS C 2 662  ? -34.738 32.226  20.598  1.00 18.17  ? 662  HIS C CG    1 
ATOM   8372  N  ND1   . HIS C 2 662  ? -33.639 32.459  21.398  1.00 21.45  ? 662  HIS C ND1   1 
ATOM   8373  C  CD2   . HIS C 2 662  ? -34.465 31.094  19.909  1.00 16.01  ? 662  HIS C CD2   1 
ATOM   8374  C  CE1   . HIS C 2 662  ? -32.741 31.512  21.198  1.00 17.70  ? 662  HIS C CE1   1 
ATOM   8375  N  NE2   . HIS C 2 662  ? -33.219 30.670  20.298  1.00 15.56  ? 662  HIS C NE2   1 
ATOM   8376  N  N     . ASP C 2 663  ? -38.699 33.684  19.596  1.00 10.06  ? 663  ASP C N     1 
ATOM   8377  C  CA    . ASP C 2 663  ? -39.998 34.319  19.713  1.00 12.59  ? 663  ASP C CA    1 
ATOM   8378  C  C     . ASP C 2 663  ? -40.058 35.190  20.962  1.00 12.97  ? 663  ASP C C     1 
ATOM   8379  O  O     . ASP C 2 663  ? -40.572 36.305  20.917  1.00 20.66  ? 663  ASP C O     1 
ATOM   8380  C  CB    . ASP C 2 663  ? -41.114 33.276  19.731  1.00 14.59  ? 663  ASP C CB    1 
ATOM   8381  C  CG    . ASP C 2 663  ? -41.376 32.682  18.360  1.00 9.81   ? 663  ASP C CG    1 
ATOM   8382  O  OD1   . ASP C 2 663  ? -41.031 33.334  17.350  1.00 5.22   ? 663  ASP C OD1   1 
ATOM   8383  O  OD2   . ASP C 2 663  ? -41.929 31.565  18.295  1.00 10.39  ? 663  ASP C OD2   1 
ATOM   8384  N  N     . ASN C 2 664  ? -39.513 34.695  22.070  1.00 8.13   ? 664  ASN C N     1 
ATOM   8385  C  CA    . ASN C 2 664  ? -39.570 35.438  23.323  1.00 8.67   ? 664  ASN C CA    1 
ATOM   8386  C  C     . ASN C 2 664  ? -38.684 36.682  23.305  1.00 13.42  ? 664  ASN C C     1 
ATOM   8387  O  O     . ASN C 2 664  ? -38.792 37.545  24.176  1.00 14.36  ? 664  ASN C O     1 
ATOM   8388  C  CB    . ASN C 2 664  ? -39.190 34.540  24.506  1.00 12.05  ? 664  ASN C CB    1 
ATOM   8389  C  CG    . ASN C 2 664  ? -37.749 34.054  24.452  1.00 14.75  ? 664  ASN C CG    1 
ATOM   8390  O  OD1   . ASN C 2 664  ? -36.975 34.439  23.578  1.00 16.23  ? 664  ASN C OD1   1 
ATOM   8391  N  ND2   . ASN C 2 664  ? -37.383 33.199  25.404  1.00 16.55  ? 664  ASN C ND2   1 
ATOM   8392  N  N     . GLY C 2 665  ? -37.803 36.762  22.314  1.00 16.04  ? 665  GLY C N     1 
ATOM   8393  C  CA    . GLY C 2 665  ? -36.937 37.915  22.156  1.00 10.54  ? 665  GLY C CA    1 
ATOM   8394  C  C     . GLY C 2 665  ? -35.466 37.577  22.283  1.00 8.23   ? 665  GLY C C     1 
ATOM   8395  O  O     . GLY C 2 665  ? -34.627 38.210  21.645  1.00 8.05   ? 665  GLY C O     1 
ATOM   8396  N  N     . THR C 2 666  ? -35.157 36.579  23.109  1.00 10.18  ? 666  THR C N     1 
ATOM   8397  C  CA    . THR C 2 666  ? -33.776 36.170  23.350  1.00 5.57   ? 666  THR C CA    1 
ATOM   8398  C  C     . THR C 2 666  ? -33.062 35.779  22.069  1.00 8.19   ? 666  THR C C     1 
ATOM   8399  O  O     . THR C 2 666  ? -33.689 35.414  21.076  1.00 11.13  ? 666  THR C O     1 
ATOM   8400  C  CB    . THR C 2 666  ? -33.689 34.983  24.322  1.00 6.69   ? 666  THR C CB    1 
ATOM   8401  O  OG1   . THR C 2 666  ? -34.531 33.921  23.862  1.00 12.24  ? 666  THR C OG1   1 
ATOM   8402  C  CG2   . THR C 2 666  ? -34.128 35.396  25.709  1.00 14.94  ? 666  THR C CG2   1 
ATOM   8403  N  N     . ARG C 2 667  ? -31.739 35.858  22.106  1.00 10.96  ? 667  ARG C N     1 
ATOM   8404  C  CA    . ARG C 2 667  ? -30.919 35.549  20.946  1.00 11.44  ? 667  ARG C CA    1 
ATOM   8405  C  C     . ARG C 2 667  ? -29.878 34.487  21.263  1.00 14.32  ? 667  ARG C C     1 
ATOM   8406  O  O     . ARG C 2 667  ? -29.080 34.638  22.184  1.00 11.90  ? 667  ARG C O     1 
ATOM   8407  C  CB    . ARG C 2 667  ? -30.223 36.807  20.431  1.00 10.29  ? 667  ARG C CB    1 
ATOM   8408  C  CG    . ARG C 2 667  ? -31.168 37.905  20.006  1.00 12.71  ? 667  ARG C CG    1 
ATOM   8409  C  CD    . ARG C 2 667  ? -30.460 38.895  19.108  1.00 8.04   ? 667  ARG C CD    1 
ATOM   8410  N  NE    . ARG C 2 667  ? -29.287 39.464  19.758  1.00 11.33  ? 667  ARG C NE    1 
ATOM   8411  C  CZ    . ARG C 2 667  ? -28.434 40.285  19.157  1.00 20.54  ? 667  ARG C CZ    1 
ATOM   8412  N  NH1   . ARG C 2 667  ? -28.624 40.628  17.888  1.00 24.10  ? 667  ARG C NH1   1 
ATOM   8413  N  NH2   . ARG C 2 667  ? -27.389 40.763  19.821  1.00 23.52  ? 667  ARG C NH2   1 
ATOM   8414  N  N     . ARG C 2 668  ? -29.891 33.406  20.499  1.00 14.43  ? 668  ARG C N     1 
ATOM   8415  C  CA    . ARG C 2 668  ? -28.826 32.419  20.579  1.00 14.96  ? 668  ARG C CA    1 
ATOM   8416  C  C     . ARG C 2 668  ? -27.964 32.530  19.328  1.00 11.16  ? 668  ARG C C     1 
ATOM   8417  O  O     . ARG C 2 668  ? -28.444 32.924  18.264  1.00 11.20  ? 668  ARG C O     1 
ATOM   8418  C  CB    . ARG C 2 668  ? -29.399 31.002  20.740  1.00 21.27  ? 668  ARG C CB    1 
ATOM   8419  C  CG    . ARG C 2 668  ? -28.400 29.969  21.264  1.00 24.39  ? 668  ARG C CG    1 
ATOM   8420  C  CD    . ARG C 2 668  ? -29.096 28.697  21.756  1.00 28.49  ? 668  ARG C CD    1 
ATOM   8421  N  NE    . ARG C 2 668  ? -30.238 28.993  22.620  1.00 36.26  ? 668  ARG C NE    1 
ATOM   8422  C  CZ    . ARG C 2 668  ? -30.162 29.179  23.935  1.00 42.69  ? 668  ARG C CZ    1 
ATOM   8423  N  NH1   . ARG C 2 668  ? -28.991 29.096  24.554  1.00 48.51  ? 668  ARG C NH1   1 
ATOM   8424  N  NH2   . ARG C 2 668  ? -31.259 29.450  24.634  1.00 40.95  ? 668  ARG C NH2   1 
ATOM   8425  N  N     . THR C 2 669  ? -26.685 32.208  19.456  1.00 12.08  ? 669  THR C N     1 
ATOM   8426  C  CA    . THR C 2 669  ? -25.805 32.232  18.298  1.00 7.89   ? 669  THR C CA    1 
ATOM   8427  C  C     . THR C 2 669  ? -24.929 30.994  18.259  1.00 12.83  ? 669  THR C C     1 
ATOM   8428  O  O     . THR C 2 669  ? -24.113 30.760  19.151  1.00 17.29  ? 669  THR C O     1 
ATOM   8429  C  CB    . THR C 2 669  ? -24.919 33.474  18.281  1.00 6.63   ? 669  THR C CB    1 
ATOM   8430  O  OG1   . THR C 2 669  ? -25.733 34.622  18.033  1.00 8.09   ? 669  THR C OG1   1 
ATOM   8431  C  CG2   . THR C 2 669  ? -23.883 33.360  17.190  1.00 12.12  ? 669  THR C CG2   1 
ATOM   8432  N  N     . TYR C 2 670  ? -25.112 30.197  17.219  1.00 7.10   ? 670  TYR C N     1 
ATOM   8433  C  CA    . TYR C 2 670  ? -24.319 29.002  17.048  1.00 2.70   ? 670  TYR C CA    1 
ATOM   8434  C  C     . TYR C 2 670  ? -23.077 29.349  16.249  1.00 2.64   ? 670  TYR C C     1 
ATOM   8435  O  O     . TYR C 2 670  ? -23.155 30.047  15.240  1.00 5.41   ? 670  TYR C O     1 
ATOM   8436  C  CB    . TYR C 2 670  ? -25.140 27.929  16.354  1.00 1.25   ? 670  TYR C CB    1 
ATOM   8437  C  CG    . TYR C 2 670  ? -26.539 27.825  16.908  1.00 6.10   ? 670  TYR C CG    1 
ATOM   8438  C  CD1   . TYR C 2 670  ? -26.764 27.317  18.181  1.00 15.54  ? 670  TYR C CD1   1 
ATOM   8439  C  CD2   . TYR C 2 670  ? -27.635 28.246  16.168  1.00 3.83   ? 670  TYR C CD2   1 
ATOM   8440  C  CE1   . TYR C 2 670  ? -28.040 27.224  18.698  1.00 18.49  ? 670  TYR C CE1   1 
ATOM   8441  C  CE2   . TYR C 2 670  ? -28.915 28.156  16.674  1.00 6.70   ? 670  TYR C CE2   1 
ATOM   8442  C  CZ    . TYR C 2 670  ? -29.112 27.644  17.940  1.00 13.09  ? 670  TYR C CZ    1 
ATOM   8443  O  OH    . TYR C 2 670  ? -30.384 27.551  18.452  1.00 13.43  ? 670  TYR C OH    1 
ATOM   8444  N  N     . ARG C 2 671  ? -21.925 28.893  16.719  1.00 18.64  ? 671  ARG C N     1 
ATOM   8445  C  CA    . ARG C 2 671  ? -20.682 29.130  16.001  1.00 5.50   ? 671  ARG C CA    1 
ATOM   8446  C  C     . ARG C 2 671  ? -20.311 27.914  15.159  1.00 3.65   ? 671  ARG C C     1 
ATOM   8447  O  O     . ARG C 2 671  ? -20.294 26.787  15.645  1.00 5.38   ? 671  ARG C O     1 
ATOM   8448  C  CB    . ARG C 2 671  ? -19.553 29.478  16.973  1.00 11.26  ? 671  ARG C CB    1 
ATOM   8449  C  CG    . ARG C 2 671  ? -19.748 30.793  17.712  1.00 12.26  ? 671  ARG C CG    1 
ATOM   8450  C  CD    . ARG C 2 671  ? -18.528 31.127  18.562  1.00 13.72  ? 671  ARG C CD    1 
ATOM   8451  N  NE    . ARG C 2 671  ? -17.328 31.299  17.748  1.00 8.61   ? 671  ARG C NE    1 
ATOM   8452  C  CZ    . ARG C 2 671  ? -16.090 31.281  18.229  1.00 14.18  ? 671  ARG C CZ    1 
ATOM   8453  N  NH1   . ARG C 2 671  ? -15.879 31.091  19.525  1.00 23.32  ? 671  ARG C NH1   1 
ATOM   8454  N  NH2   . ARG C 2 671  ? -15.059 31.447  17.413  1.00 7.61   ? 671  ARG C NH2   1 
ATOM   8455  N  N     . MET C 2 672  ? -20.020 28.149  13.888  1.00 0.63   ? 672  MET C N     1 
ATOM   8456  C  CA    . MET C 2 672  ? -19.739 27.060  12.969  1.00 1.74   ? 672  MET C CA    1 
ATOM   8457  C  C     . MET C 2 672  ? -18.310 26.554  13.121  1.00 6.32   ? 672  MET C C     1 
ATOM   8458  O  O     . MET C 2 672  ? -17.369 27.344  13.084  1.00 9.29   ? 672  MET C O     1 
ATOM   8459  C  CB    . MET C 2 672  ? -19.978 27.520  11.534  1.00 6.12   ? 672  MET C CB    1 
ATOM   8460  C  CG    . MET C 2 672  ? -21.336 28.148  11.302  1.00 5.96   ? 672  MET C CG    1 
ATOM   8461  S  SD    . MET C 2 672  ? -22.545 26.965  10.707  1.00 9.72   ? 672  MET C SD    1 
ATOM   8462  C  CE    . MET C 2 672  ? -23.882 27.273  11.838  1.00 8.58   ? 672  MET C CE    1 
ATOM   8463  N  N     . ARG C 2 673  ? -18.145 25.244  13.297  1.00 9.33   ? 673  ARG C N     1 
ATOM   8464  C  CA    . ARG C 2 673  ? -16.810 24.653  13.251  1.00 8.86   ? 673  ARG C CA    1 
ATOM   8465  C  C     . ARG C 2 673  ? -16.259 24.830  11.840  1.00 4.25   ? 673  ARG C C     1 
ATOM   8466  O  O     . ARG C 2 673  ? -16.916 24.459  10.868  1.00 7.24   ? 673  ARG C O     1 
ATOM   8467  C  CB    . ARG C 2 673  ? -16.829 23.167  13.644  1.00 7.00   ? 673  ARG C CB    1 
ATOM   8468  C  CG    . ARG C 2 673  ? -16.140 22.865  14.972  1.00 11.54  ? 673  ARG C CG    1 
ATOM   8469  C  CD    . ARG C 2 673  ? -15.696 21.402  15.094  1.00 14.40  ? 673  ARG C CD    1 
ATOM   8470  N  NE    . ARG C 2 673  ? -16.811 20.461  15.192  1.00 30.79  ? 673  ARG C NE    1 
ATOM   8471  C  CZ    . ARG C 2 673  ? -16.764 19.308  15.859  1.00 29.49  ? 673  ARG C CZ    1 
ATOM   8472  N  NH1   . ARG C 2 673  ? -15.656 18.956  16.502  1.00 24.18  ? 673  ARG C NH1   1 
ATOM   8473  N  NH2   . ARG C 2 673  ? -17.826 18.510  15.891  1.00 20.87  ? 673  ARG C NH2   1 
ATOM   8474  N  N     . LYS C 2 674  ? -15.071 25.414  11.715  1.00 1.98   ? 674  LYS C N     1 
ATOM   8475  C  CA    . LYS C 2 674  ? -14.519 25.647  10.388  1.00 3.33   ? 674  LYS C CA    1 
ATOM   8476  C  C     . LYS C 2 674  ? -13.107 25.099  10.215  1.00 7.88   ? 674  LYS C C     1 
ATOM   8477  O  O     . LYS C 2 674  ? -12.158 25.587  10.825  1.00 10.75  ? 674  LYS C O     1 
ATOM   8478  C  CB    . LYS C 2 674  ? -14.545 27.137  10.064  1.00 0.24   ? 674  LYS C CB    1 
ATOM   8479  C  CG    . LYS C 2 674  ? -15.948 27.698  9.956   1.00 4.17   ? 674  LYS C CG    1 
ATOM   8480  C  CD    . LYS C 2 674  ? -16.774 26.964  8.905   1.00 4.03   ? 674  LYS C CD    1 
ATOM   8481  C  CE    . LYS C 2 674  ? -16.274 27.256  7.503   1.00 2.05   ? 674  LYS C CE    1 
ATOM   8482  N  NZ    . LYS C 2 674  ? -17.250 26.817  6.471   1.00 3.50   ? 674  LYS C NZ    1 
ATOM   8483  N  N     . PHE C 2 675  ? -12.997 24.075  9.371   1.00 3.94   ? 675  PHE C N     1 
ATOM   8484  C  CA    . PHE C 2 675  ? -11.719 23.503  8.957   1.00 1.53   ? 675  PHE C CA    1 
ATOM   8485  C  C     . PHE C 2 675  ? -10.855 23.085  10.138  1.00 1.61   ? 675  PHE C C     1 
ATOM   8486  O  O     . PHE C 2 675  ? -9.691  23.461  10.232  1.00 1.56   ? 675  PHE C O     1 
ATOM   8487  C  CB    . PHE C 2 675  ? -10.949 24.493  8.081   1.00 6.36   ? 675  PHE C CB    1 
ATOM   8488  C  CG    . PHE C 2 675  ? -11.630 24.818  6.778   1.00 9.92   ? 675  PHE C CG    1 
ATOM   8489  C  CD1   . PHE C 2 675  ? -11.905 23.823  5.857   1.00 9.57   ? 675  PHE C CD1   1 
ATOM   8490  C  CD2   . PHE C 2 675  ? -11.971 26.123  6.464   1.00 8.64   ? 675  PHE C CD2   1 
ATOM   8491  C  CE1   . PHE C 2 675  ? -12.517 24.120  4.657   1.00 6.17   ? 675  PHE C CE1   1 
ATOM   8492  C  CE2   . PHE C 2 675  ? -12.583 26.422  5.266   1.00 8.99   ? 675  PHE C CE2   1 
ATOM   8493  C  CZ    . PHE C 2 675  ? -12.858 25.419  4.363   1.00 7.12   ? 675  PHE C CZ    1 
ATOM   8494  N  N     . ALA C 2 676  ? -11.433 22.312  11.045  1.00 3.93   ? 676  ALA C N     1 
ATOM   8495  C  CA    . ALA C 2 676  ? -10.693 21.825  12.197  1.00 2.62   ? 676  ALA C CA    1 
ATOM   8496  C  C     . ALA C 2 676  ? -10.242 20.387  11.988  1.00 4.64   ? 676  ALA C C     1 
ATOM   8497  O  O     . ALA C 2 676  ? -10.913 19.602  11.325  1.00 3.84   ? 676  ALA C O     1 
ATOM   8498  C  CB    . ALA C 2 676  ? -11.536 21.942  13.450  1.00 7.43   ? 676  ALA C CB    1 
ATOM   8499  N  N     . ARG C 2 677  ? -9.093  20.051  12.555  1.00 4.23   ? 677  ARG C N     1 
ATOM   8500  C  CA    . ARG C 2 677  ? -8.558  18.702  12.451  1.00 4.05   ? 677  ARG C CA    1 
ATOM   8501  C  C     . ARG C 2 677  ? -9.318  17.748  13.349  1.00 0.60   ? 677  ARG C C     1 
ATOM   8502  O  O     . ARG C 2 677  ? -9.419  17.969  14.550  1.00 6.28   ? 677  ARG C O     1 
ATOM   8503  C  CB    . ARG C 2 677  ? -7.076  18.693  12.818  1.00 8.73   ? 677  ARG C CB    1 
ATOM   8504  C  CG    . ARG C 2 677  ? -6.385  17.351  12.696  1.00 7.43   ? 677  ARG C CG    1 
ATOM   8505  C  CD    . ARG C 2 677  ? -4.969  17.452  13.237  1.00 6.42   ? 677  ARG C CD    1 
ATOM   8506  N  NE    . ARG C 2 677  ? -4.132  16.323  12.848  1.00 12.81  ? 677  ARG C NE    1 
ATOM   8507  C  CZ    . ARG C 2 677  ? -4.052  15.184  13.526  1.00 18.00  ? 677  ARG C CZ    1 
ATOM   8508  N  NH1   . ARG C 2 677  ? -4.768  15.016  14.630  1.00 14.98  ? 677  ARG C NH1   1 
ATOM   8509  N  NH2   . ARG C 2 677  ? -3.257  14.210  13.097  1.00 22.37  ? 677  ARG C NH2   1 
ATOM   8510  N  N     . SER C 2 678  ? -9.853  16.685  12.769  1.00 1.90   ? 678  SER C N     1 
ATOM   8511  C  CA    . SER C 2 678  ? -10.490 15.648  13.563  1.00 6.57   ? 678  SER C CA    1 
ATOM   8512  C  C     . SER C 2 678  ? -9.431  14.832  14.283  1.00 9.45   ? 678  SER C C     1 
ATOM   8513  O  O     . SER C 2 678  ? -8.238  15.137  14.207  1.00 14.78  ? 678  SER C O     1 
ATOM   8514  C  CB    . SER C 2 678  ? -11.334 14.732  12.688  1.00 10.28  ? 678  SER C CB    1 
ATOM   8515  O  OG    . SER C 2 678  ? -10.519 14.090  11.717  1.00 11.72  ? 678  SER C OG    1 
ATOM   8516  N  N     . ASN C 2 679  ? -9.866  13.790  14.978  1.00 5.09   ? 679  ASN C N     1 
ATOM   8517  C  CA    . ASN C 2 679  ? -8.926  12.869  15.586  1.00 7.71   ? 679  ASN C CA    1 
ATOM   8518  C  C     . ASN C 2 679  ? -8.145  12.111  14.521  1.00 8.13   ? 679  ASN C C     1 
ATOM   8519  O  O     . ASN C 2 679  ? -6.939  11.912  14.649  1.00 9.70   ? 679  ASN C O     1 
ATOM   8520  C  CB    . ASN C 2 679  ? -9.651  11.892  16.504  1.00 11.68  ? 679  ASN C CB    1 
ATOM   8521  C  CG    . ASN C 2 679  ? -10.175 12.556  17.754  1.00 12.31  ? 679  ASN C CG    1 
ATOM   8522  O  OD1   . ASN C 2 679  ? -11.241 12.205  18.256  1.00 11.39  ? 679  ASN C OD1   1 
ATOM   8523  N  ND2   . ASN C 2 679  ? -9.429  13.530  18.263  1.00 12.10  ? 679  ASN C ND2   1 
ATOM   8524  N  N     . HIS C 2 680  ? -8.835  11.704  13.461  1.00 5.97   ? 680  HIS C N     1 
ATOM   8525  C  CA    . HIS C 2 680  ? -8.220  10.884  12.428  1.00 6.35   ? 680  HIS C CA    1 
ATOM   8526  C  C     . HIS C 2 680  ? -7.866  11.679  11.180  1.00 5.81   ? 680  HIS C C     1 
ATOM   8527  O  O     . HIS C 2 680  ? -7.972  11.177  10.061  1.00 6.16   ? 680  HIS C O     1 
ATOM   8528  C  CB    . HIS C 2 680  ? -9.143  9.727   12.059  1.00 5.10   ? 680  HIS C CB    1 
ATOM   8529  C  CG    . HIS C 2 680  ? -9.333  8.739   13.163  1.00 5.55   ? 680  HIS C CG    1 
ATOM   8530  N  ND1   . HIS C 2 680  ? -9.821  9.097   14.399  1.00 6.08   ? 680  HIS C ND1   1 
ATOM   8531  C  CD2   . HIS C 2 680  ? -9.089  7.409   13.224  1.00 9.33   ? 680  HIS C CD2   1 
ATOM   8532  C  CE1   . HIS C 2 680  ? -9.877  8.030   15.175  1.00 8.29   ? 680  HIS C CE1   1 
ATOM   8533  N  NE2   . HIS C 2 680  ? -9.439  6.992   14.485  1.00 12.07  ? 680  HIS C NE2   1 
ATOM   8534  N  N     . GLY C 2 681  ? -7.444  12.922  11.376  1.00 7.04   ? 681  GLY C N     1 
ATOM   8535  C  CA    . GLY C 2 681  ? -6.998  13.753  10.276  1.00 4.23   ? 681  GLY C CA    1 
ATOM   8536  C  C     . GLY C 2 681  ? -8.059  14.151  9.264   1.00 3.18   ? 681  GLY C C     1 
ATOM   8537  O  O     . GLY C 2 681  ? -7.753  14.871  8.320   1.00 4.95   ? 681  GLY C O     1 
ATOM   8538  N  N     . THR C 2 682  ? -9.299  13.700  9.433   1.00 4.33   ? 682  THR C N     1 
ATOM   8539  C  CA    . THR C 2 682  ? -10.345 14.101  8.494   1.00 2.54   ? 682  THR C CA    1 
ATOM   8540  C  C     . THR C 2 682  ? -10.738 15.542  8.763   1.00 2.08   ? 682  THR C C     1 
ATOM   8541  O  O     . THR C 2 682  ? -10.312 16.133  9.752   1.00 3.10   ? 682  THR C O     1 
ATOM   8542  C  CB    . THR C 2 682  ? -11.594 13.204  8.563   1.00 0.55   ? 682  THR C CB    1 
ATOM   8543  O  OG1   . THR C 2 682  ? -12.215 13.318  9.845   1.00 2.50   ? 682  THR C OG1   1 
ATOM   8544  C  CG2   . THR C 2 682  ? -11.224 11.758  8.304   1.00 3.03   ? 682  THR C CG2   1 
ATOM   8545  N  N     . CYS C 2 683  ? -11.560 16.104  7.888   1.00 8.41   ? 683  CYS C N     1 
ATOM   8546  C  CA    . CYS C 2 683  ? -11.802 17.540  7.898   1.00 9.09   ? 683  CYS C CA    1 
ATOM   8547  C  C     . CYS C 2 683  ? -13.215 17.933  8.322   1.00 10.38  ? 683  CYS C C     1 
ATOM   8548  O  O     . CYS C 2 683  ? -14.088 18.132  7.480   1.00 10.91  ? 683  CYS C O     1 
ATOM   8549  C  CB    . CYS C 2 683  ? -11.519 18.099  6.516   1.00 8.05   ? 683  CYS C CB    1 
ATOM   8550  S  SG    . CYS C 2 683  ? -11.792 19.845  6.391   1.00 9.16   ? 683  CYS C SG    1 
ATOM   8551  N  N     . ALA C 2 684  ? -13.434 18.067  9.626   1.00 1.51   ? 684  ALA C N     1 
ATOM   8552  C  CA    . ALA C 2 684  ? -14.762 18.377  10.148  1.00 0.52   ? 684  ALA C CA    1 
ATOM   8553  C  C     . ALA C 2 684  ? -15.129 19.831  9.895   1.00 3.69   ? 684  ALA C C     1 
ATOM   8554  O  O     . ALA C 2 684  ? -14.832 20.705  10.702  1.00 8.36   ? 684  ALA C O     1 
ATOM   8555  C  CB    . ALA C 2 684  ? -14.831 18.064  11.630  1.00 3.93   ? 684  ALA C CB    1 
ATOM   8556  N  N     . ASN C 2 685  ? -15.781 20.078  8.767   1.00 1.69   ? 685  ASN C N     1 
ATOM   8557  C  CA    . ASN C 2 685  ? -16.121 21.432  8.352   1.00 2.98   ? 685  ASN C CA    1 
ATOM   8558  C  C     . ASN C 2 685  ? -17.625 21.607  8.234   1.00 3.92   ? 685  ASN C C     1 
ATOM   8559  O  O     . ASN C 2 685  ? -18.280 20.855  7.521   1.00 10.53  ? 685  ASN C O     1 
ATOM   8560  C  CB    . ASN C 2 685  ? -15.459 21.750  7.016   1.00 4.32   ? 685  ASN C CB    1 
ATOM   8561  C  CG    . ASN C 2 685  ? -15.186 23.223  6.838   1.00 8.42   ? 685  ASN C CG    1 
ATOM   8562  O  OD1   . ASN C 2 685  ? -14.714 23.889  7.754   1.00 8.87   ? 685  ASN C OD1   1 
ATOM   8563  N  ND2   . ASN C 2 685  ? -15.483 23.743  5.653   1.00 17.64  ? 685  ASN C ND2   1 
ATOM   8564  N  N     . GLN C 2 686  ? -18.179 22.593  8.929   1.00 1.16   ? 686  GLN C N     1 
ATOM   8565  C  CA    . GLN C 2 686  ? -19.620 22.810  8.887   1.00 2.39   ? 686  GLN C CA    1 
ATOM   8566  C  C     . GLN C 2 686  ? -19.986 24.000  8.018   1.00 4.06   ? 686  GLN C C     1 
ATOM   8567  O  O     . GLN C 2 686  ? -19.188 24.915  7.831   1.00 5.32   ? 686  GLN C O     1 
ATOM   8568  C  CB    . GLN C 2 686  ? -20.172 23.009  10.293  1.00 2.15   ? 686  GLN C CB    1 
ATOM   8569  C  CG    . GLN C 2 686  ? -20.171 21.758  11.135  1.00 2.79   ? 686  GLN C CG    1 
ATOM   8570  C  CD    . GLN C 2 686  ? -20.264 22.065  12.613  1.00 9.34   ? 686  GLN C CD    1 
ATOM   8571  O  OE1   . GLN C 2 686  ? -20.076 23.207  13.029  1.00 9.23   ? 686  GLN C OE1   1 
ATOM   8572  N  NE2   . GLN C 2 686  ? -20.556 21.049  13.418  1.00 9.46   ? 686  GLN C NE2   1 
ATOM   8573  N  N     . CYS C 2 687  ? -21.200 23.978  7.482   1.00 4.36   ? 687  CYS C N     1 
ATOM   8574  C  CA    . CYS C 2 687  ? -21.666 25.058  6.622   1.00 12.38  ? 687  CYS C CA    1 
ATOM   8575  C  C     . CYS C 2 687  ? -23.152 25.337  6.823   1.00 14.32  ? 687  CYS C C     1 
ATOM   8576  O  O     . CYS C 2 687  ? -23.967 24.414  6.880   1.00 7.24   ? 687  CYS C O     1 
ATOM   8577  C  CB    . CYS C 2 687  ? -21.380 24.739  5.153   1.00 21.00  ? 687  CYS C CB    1 
ATOM   8578  S  SG    . CYS C 2 687  ? -19.629 24.877  4.695   1.00 39.74  ? 687  CYS C SG    1 
ATOM   8579  N  N     . PRO C 2 688  ? -23.504 26.625  6.935   1.00 13.60  ? 688  PRO C N     1 
ATOM   8580  C  CA    . PRO C 2 688  ? -24.870 27.090  7.190   1.00 10.16  ? 688  PRO C CA    1 
ATOM   8581  C  C     . PRO C 2 688  ? -25.820 26.786  6.037   1.00 8.86   ? 688  PRO C C     1 
ATOM   8582  O  O     . PRO C 2 688  ? -25.559 27.171  4.899   1.00 7.17   ? 688  PRO C O     1 
ATOM   8583  C  CB    . PRO C 2 688  ? -24.698 28.602  7.363   1.00 7.16   ? 688  PRO C CB    1 
ATOM   8584  C  CG    . PRO C 2 688  ? -23.242 28.803  7.641   1.00 6.95   ? 688  PRO C CG    1 
ATOM   8585  C  CD    . PRO C 2 688  ? -22.552 27.744  6.863   1.00 10.43  ? 688  PRO C CD    1 
ATOM   8586  N  N     . ILE C 2 689  ? -26.912 26.095  6.338   1.00 6.99   ? 689  ILE C N     1 
ATOM   8587  C  CA    . ILE C 2 689  ? -27.922 25.799  5.336   1.00 5.05   ? 689  ILE C CA    1 
ATOM   8588  C  C     . ILE C 2 689  ? -28.846 26.983  5.104   1.00 10.65  ? 689  ILE C C     1 
ATOM   8589  O  O     . ILE C 2 689  ? -29.008 27.449  3.978   1.00 20.03  ? 689  ILE C O     1 
ATOM   8590  C  CB    . ILE C 2 689  ? -28.777 24.596  5.737   1.00 4.40   ? 689  ILE C CB    1 
ATOM   8591  C  CG1   . ILE C 2 689  ? -27.908 23.347  5.852   1.00 11.45  ? 689  ILE C CG1   1 
ATOM   8592  C  CG2   . ILE C 2 689  ? -29.897 24.390  4.730   1.00 4.94   ? 689  ILE C CG2   1 
ATOM   8593  C  CD1   . ILE C 2 689  ? -28.694 22.094  6.166   1.00 14.27  ? 689  ILE C CD1   1 
ATOM   8594  N  N     . VAL C 2 690  ? -29.446 27.467  6.183   1.00 7.94   ? 690  VAL C N     1 
ATOM   8595  C  CA    . VAL C 2 690  ? -30.477 28.489  6.092   1.00 6.85   ? 690  VAL C CA    1 
ATOM   8596  C  C     . VAL C 2 690  ? -29.968 29.800  5.527   1.00 6.81   ? 690  VAL C C     1 
ATOM   8597  O  O     . VAL C 2 690  ? -28.870 30.248  5.849   1.00 7.52   ? 690  VAL C O     1 
ATOM   8598  C  CB    . VAL C 2 690  ? -31.099 28.765  7.458   1.00 5.84   ? 690  VAL C CB    1 
ATOM   8599  C  CG1   . VAL C 2 690  ? -31.951 27.591  7.881   1.00 13.23  ? 690  VAL C CG1   1 
ATOM   8600  C  CG2   . VAL C 2 690  ? -30.017 29.044  8.484   1.00 6.36   ? 690  VAL C CG2   1 
ATOM   8601  N  N     . ASP C 2 691  ? -30.780 30.407  4.674   1.00 7.35   ? 691  ASP C N     1 
ATOM   8602  C  CA    . ASP C 2 691  ? -30.481 31.730  4.162   1.00 12.51  ? 691  ASP C CA    1 
ATOM   8603  C  C     . ASP C 2 691  ? -31.042 32.758  5.139   1.00 16.03  ? 691  ASP C C     1 
ATOM   8604  O  O     . ASP C 2 691  ? -31.911 32.437  5.951   1.00 17.79  ? 691  ASP C O     1 
ATOM   8605  C  CB    . ASP C 2 691  ? -31.062 31.917  2.761   1.00 12.98  ? 691  ASP C CB    1 
ATOM   8606  C  CG    . ASP C 2 691  ? -30.115 32.654  1.839   1.00 20.10  ? 691  ASP C CG    1 
ATOM   8607  O  OD1   . ASP C 2 691  ? -29.324 33.475  2.347   1.00 23.73  ? 691  ASP C OD1   1 
ATOM   8608  O  OD2   . ASP C 2 691  ? -30.154 32.408  0.615   1.00 24.21  ? 691  ASP C OD2   1 
ATOM   8609  N  N     . ALA C 2 692  ? -30.535 33.984  5.076   1.00 16.86  ? 692  ALA C N     1 
ATOM   8610  C  CA    . ALA C 2 692  ? -30.929 35.013  6.028   1.00 10.57  ? 692  ALA C CA    1 
ATOM   8611  C  C     . ALA C 2 692  ? -32.420 35.296  5.962   1.00 5.14   ? 692  ALA C C     1 
ATOM   8612  O  O     . ALA C 2 692  ? -32.968 35.547  4.894   1.00 8.14   ? 692  ALA C O     1 
ATOM   8613  C  CB    . ALA C 2 692  ? -30.142 36.283  5.784   1.00 13.36  ? 692  ALA C CB    1 
ATOM   8614  N  N     . GLY C 2 693  ? -33.072 35.237  7.115   1.00 6.70   ? 693  GLY C N     1 
ATOM   8615  C  CA    . GLY C 2 693  ? -34.466 35.613  7.214   1.00 8.73   ? 693  GLY C CA    1 
ATOM   8616  C  C     . GLY C 2 693  ? -35.421 34.474  6.953   1.00 10.78  ? 693  GLY C C     1 
ATOM   8617  O  O     . GLY C 2 693  ? -36.616 34.687  6.763   1.00 18.52  ? 693  GLY C O     1 
ATOM   8618  N  N     . ASP C 2 694  ? -34.901 33.256  6.938   1.00 7.80   ? 694  ASP C N     1 
ATOM   8619  C  CA    . ASP C 2 694  ? -35.762 32.099  6.766   1.00 12.59  ? 694  ASP C CA    1 
ATOM   8620  C  C     . ASP C 2 694  ? -36.501 31.835  8.063   1.00 8.47   ? 694  ASP C C     1 
ATOM   8621  O  O     . ASP C 2 694  ? -36.036 32.210  9.137   1.00 13.49  ? 694  ASP C O     1 
ATOM   8622  C  CB    . ASP C 2 694  ? -34.953 30.878  6.329   1.00 16.38  ? 694  ASP C CB    1 
ATOM   8623  C  CG    . ASP C 2 694  ? -34.387 31.034  4.929   1.00 21.90  ? 694  ASP C CG    1 
ATOM   8624  O  OD1   . ASP C 2 694  ? -34.980 31.801  4.142   1.00 27.57  ? 694  ASP C OD1   1 
ATOM   8625  O  OD2   . ASP C 2 694  ? -33.356 30.402  4.613   1.00 19.82  ? 694  ASP C OD2   1 
ATOM   8626  N  N     . ARG C 2 695  ? -37.674 31.227  7.963   1.00 8.97   ? 695  ARG C N     1 
ATOM   8627  C  CA    . ARG C 2 695  ? -38.404 30.845  9.156   1.00 13.41  ? 695  ARG C CA    1 
ATOM   8628  C  C     . ARG C 2 695  ? -38.001 29.436  9.522   1.00 12.69  ? 695  ARG C C     1 
ATOM   8629  O  O     . ARG C 2 695  ? -38.176 28.507  8.738   1.00 15.79  ? 695  ARG C O     1 
ATOM   8630  C  CB    . ARG C 2 695  ? -39.912 30.933  8.951   1.00 19.78  ? 695  ARG C CB    1 
ATOM   8631  C  CG    . ARG C 2 695  ? -40.711 30.279  10.076  1.00 24.35  ? 695  ARG C CG    1 
ATOM   8632  C  CD    . ARG C 2 695  ? -40.503 30.998  11.414  1.00 20.79  ? 695  ARG C CD    1 
ATOM   8633  N  NE    . ARG C 2 695  ? -40.962 30.194  12.543  1.00 20.00  ? 695  ARG C NE    1 
ATOM   8634  C  CZ    . ARG C 2 695  ? -41.154 30.666  13.772  1.00 18.03  ? 695  ARG C CZ    1 
ATOM   8635  N  NH1   . ARG C 2 695  ? -40.939 31.951  14.040  1.00 9.33   ? 695  ARG C NH1   1 
ATOM   8636  N  NH2   . ARG C 2 695  ? -41.572 29.856  14.738  1.00 17.85  ? 695  ARG C NH2   1 
ATOM   8637  N  N     . VAL C 2 696  ? -37.454 29.285  10.719  1.00 12.84  ? 696  VAL C N     1 
ATOM   8638  C  CA    . VAL C 2 696  ? -36.947 28.002  11.163  1.00 11.90  ? 696  VAL C CA    1 
ATOM   8639  C  C     . VAL C 2 696  ? -37.652 27.533  12.433  1.00 18.47  ? 696  VAL C C     1 
ATOM   8640  O  O     . VAL C 2 696  ? -37.973 28.335  13.312  1.00 20.55  ? 696  VAL C O     1 
ATOM   8641  C  CB    . VAL C 2 696  ? -35.433 28.077  11.395  1.00 6.95   ? 696  VAL C CB    1 
ATOM   8642  C  CG1   . VAL C 2 696  ? -34.729 28.369  10.090  1.00 9.72   ? 696  VAL C CG1   1 
ATOM   8643  C  CG2   . VAL C 2 696  ? -35.101 29.155  12.405  1.00 7.49   ? 696  VAL C CG2   1 
ATOM   8644  N  N     . GLU C 2 697  ? -37.910 26.231  12.514  1.00 18.94  ? 697  GLU C N     1 
ATOM   8645  C  CA    . GLU C 2 697  ? -38.567 25.659  13.684  1.00 23.05  ? 697  GLU C CA    1 
ATOM   8646  C  C     . GLU C 2 697  ? -37.572 24.854  14.517  1.00 13.73  ? 697  GLU C C     1 
ATOM   8647  O  O     . GLU C 2 697  ? -36.554 24.394  14.008  1.00 5.03   ? 697  GLU C O     1 
ATOM   8648  C  CB    . GLU C 2 697  ? -39.756 24.784  13.266  1.00 30.25  ? 697  GLU C CB    1 
ATOM   8649  C  CG    . GLU C 2 697  ? -40.871 25.547  12.544  1.00 36.97  ? 697  GLU C CG    1 
ATOM   8650  C  CD    . GLU C 2 697  ? -41.994 24.642  12.059  1.00 49.00  ? 697  GLU C CD    1 
ATOM   8651  O  OE1   . GLU C 2 697  ? -42.218 23.581  12.678  1.00 44.04  ? 697  GLU C OE1   1 
ATOM   8652  O  OE2   . GLU C 2 697  ? -42.651 24.992  11.054  1.00 65.80  ? 697  GLU C OE2   1 
ATOM   8653  N  N     . ALA C 2 698  ? -37.877 24.698  15.802  1.00 15.63  ? 698  ALA C N     1 
ATOM   8654  C  CA    . ALA C 2 698  ? -36.993 24.027  16.751  1.00 10.76  ? 698  ALA C CA    1 
ATOM   8655  C  C     . ALA C 2 698  ? -36.782 22.554  16.429  1.00 7.10   ? 698  ALA C C     1 
ATOM   8656  O  O     . ALA C 2 698  ? -37.729 21.835  16.130  1.00 13.72  ? 698  ALA C O     1 
ATOM   8657  C  CB    . ALA C 2 698  ? -37.544 24.172  18.161  1.00 15.76  ? 698  ALA C CB    1 
ATOM   8658  N  N     . GLY C 2 699  ? -35.533 22.108  16.512  1.00 6.40   ? 699  GLY C N     1 
ATOM   8659  C  CA    . GLY C 2 699  ? -35.196 20.725  16.230  1.00 5.92   ? 699  GLY C CA    1 
ATOM   8660  C  C     . GLY C 2 699  ? -34.892 20.509  14.760  1.00 5.86   ? 699  GLY C C     1 
ATOM   8661  O  O     . GLY C 2 699  ? -34.876 19.379  14.279  1.00 4.32   ? 699  GLY C O     1 
ATOM   8662  N  N     . GLN C 2 700  ? -34.647 21.605  14.050  1.00 5.09   ? 700  GLN C N     1 
ATOM   8663  C  CA    . GLN C 2 700  ? -34.377 21.565  12.617  1.00 5.30   ? 700  GLN C CA    1 
ATOM   8664  C  C     . GLN C 2 700  ? -32.884 21.678  12.321  1.00 2.69   ? 700  GLN C C     1 
ATOM   8665  O  O     . GLN C 2 700  ? -32.156 22.395  13.005  1.00 1.58   ? 700  GLN C O     1 
ATOM   8666  C  CB    . GLN C 2 700  ? -35.151 22.687  11.915  1.00 9.50   ? 700  GLN C CB    1 
ATOM   8667  C  CG    . GLN C 2 700  ? -34.877 22.855  10.431  1.00 13.80  ? 700  GLN C CG    1 
ATOM   8668  C  CD    . GLN C 2 700  ? -35.551 24.093  9.864   1.00 16.62  ? 700  GLN C CD    1 
ATOM   8669  O  OE1   . GLN C 2 700  ? -36.357 24.741  10.536  1.00 8.93   ? 700  GLN C OE1   1 
ATOM   8670  N  NE2   . GLN C 2 700  ? -35.220 24.429  8.623   1.00 21.08  ? 700  GLN C NE2   1 
ATOM   8671  N  N     . VAL C 2 701  ? -32.429 20.956  11.304  1.00 1.76   ? 701  VAL C N     1 
ATOM   8672  C  CA    . VAL C 2 701  ? -31.045 21.058  10.866  1.00 1.53   ? 701  VAL C CA    1 
ATOM   8673  C  C     . VAL C 2 701  ? -30.837 22.370  10.129  1.00 2.74   ? 701  VAL C C     1 
ATOM   8674  O  O     . VAL C 2 701  ? -31.317 22.546  9.012   1.00 0.95   ? 701  VAL C O     1 
ATOM   8675  C  CB    . VAL C 2 701  ? -30.645 19.894  9.946   1.00 2.08   ? 701  VAL C CB    1 
ATOM   8676  C  CG1   . VAL C 2 701  ? -29.230 20.090  9.437   1.00 4.99   ? 701  VAL C CG1   1 
ATOM   8677  C  CG2   . VAL C 2 701  ? -30.770 18.571  10.677  1.00 3.18   ? 701  VAL C CG2   1 
ATOM   8678  N  N     . ILE C 2 702  ? -30.120 23.291  10.758  1.00 3.58   ? 702  ILE C N     1 
ATOM   8679  C  CA    . ILE C 2 702  ? -29.912 24.604  10.175  1.00 2.36   ? 702  ILE C CA    1 
ATOM   8680  C  C     . ILE C 2 702  ? -28.546 24.689  9.507   1.00 5.19   ? 702  ILE C C     1 
ATOM   8681  O  O     . ILE C 2 702  ? -28.278 25.601  8.730   1.00 10.85  ? 702  ILE C O     1 
ATOM   8682  C  CB    . ILE C 2 702  ? -30.028 25.705  11.237  1.00 2.10   ? 702  ILE C CB    1 
ATOM   8683  C  CG1   . ILE C 2 702  ? -28.718 25.836  12.012  1.00 5.61   ? 702  ILE C CG1   1 
ATOM   8684  C  CG2   . ILE C 2 702  ? -31.173 25.404  12.186  1.00 3.67   ? 702  ILE C CG2   1 
ATOM   8685  C  CD1   . ILE C 2 702  ? -28.729 26.962  13.007  1.00 12.93  ? 702  ILE C CD1   1 
ATOM   8686  N  N     . ALA C 2 703  ? -27.686 23.727  9.813   1.00 4.91   ? 703  ALA C N     1 
ATOM   8687  C  CA    . ALA C 2 703  ? -26.348 23.683  9.241   1.00 8.39   ? 703  ALA C CA    1 
ATOM   8688  C  C     . ALA C 2 703  ? -25.758 22.295  9.429   1.00 11.34  ? 703  ALA C C     1 
ATOM   8689  O  O     . ALA C 2 703  ? -25.529 21.863  10.559  1.00 12.63  ? 703  ALA C O     1 
ATOM   8690  C  CB    . ALA C 2 703  ? -25.457 24.737  9.880   1.00 12.29  ? 703  ALA C CB    1 
ATOM   8691  N  N     . ASP C 2 704  ? -25.536 21.589  8.323   1.00 17.90  ? 704  ASP C N     1 
ATOM   8692  C  CA    . ASP C 2 704  ? -24.962 20.248  8.384   1.00 9.69   ? 704  ASP C CA    1 
ATOM   8693  C  C     . ASP C 2 704  ? -23.449 20.331  8.395   1.00 3.06   ? 704  ASP C C     1 
ATOM   8694  O  O     . ASP C 2 704  ? -22.880 21.414  8.275   1.00 4.58   ? 704  ASP C O     1 
ATOM   8695  C  CB    . ASP C 2 704  ? -25.454 19.379  7.213   1.00 8.10   ? 704  ASP C CB    1 
ATOM   8696  C  CG    . ASP C 2 704  ? -25.241 20.031  5.858   1.00 9.29   ? 704  ASP C CG    1 
ATOM   8697  O  OD1   . ASP C 2 704  ? -24.262 20.793  5.696   1.00 12.33  ? 704  ASP C OD1   1 
ATOM   8698  O  OD2   . ASP C 2 704  ? -26.064 19.780  4.951   1.00 2.60   ? 704  ASP C OD2   1 
ATOM   8699  N  N     . GLY C 2 705  ? -22.804 19.178  8.522   1.00 6.82   ? 705  GLY C N     1 
ATOM   8700  C  CA    . GLY C 2 705  ? -21.360 19.127  8.622   1.00 9.41   ? 705  GLY C CA    1 
ATOM   8701  C  C     . GLY C 2 705  ? -20.711 18.251  7.570   1.00 4.46   ? 705  GLY C C     1 
ATOM   8702  O  O     . GLY C 2 705  ? -21.206 18.143  6.448   1.00 5.84   ? 705  GLY C O     1 
ATOM   8703  N  N     . PRO C 2 706  ? -19.591 17.614  7.930   1.00 2.69   ? 706  PRO C N     1 
ATOM   8704  C  CA    . PRO C 2 706  ? -18.908 16.775  6.954   1.00 0.52   ? 706  PRO C CA    1 
ATOM   8705  C  C     . PRO C 2 706  ? -19.754 15.552  6.672   1.00 2.54   ? 706  PRO C C     1 
ATOM   8706  O  O     . PRO C 2 706  ? -20.411 15.050  7.583   1.00 2.15   ? 706  PRO C O     1 
ATOM   8707  C  CB    . PRO C 2 706  ? -17.605 16.416  7.659   1.00 1.63   ? 706  PRO C CB    1 
ATOM   8708  C  CG    . PRO C 2 706  ? -17.977 16.395  9.098   1.00 3.02   ? 706  PRO C CG    1 
ATOM   8709  C  CD    . PRO C 2 706  ? -19.028 17.456  9.282   1.00 1.85   ? 706  PRO C CD    1 
ATOM   8710  N  N     . CYS C 2 707  ? -19.761 15.107  5.423   1.00 2.07   ? 707  CYS C N     1 
ATOM   8711  C  CA    . CYS C 2 707  ? -20.561 13.963  5.017   1.00 2.68   ? 707  CYS C CA    1 
ATOM   8712  C  C     . CYS C 2 707  ? -22.022 14.129  5.371   1.00 1.66   ? 707  CYS C C     1 
ATOM   8713  O  O     . CYS C 2 707  ? -22.639 13.210  5.890   1.00 3.01   ? 707  CYS C O     1 
ATOM   8714  C  CB    . CYS C 2 707  ? -20.043 12.682  5.665   1.00 5.85   ? 707  CYS C CB    1 
ATOM   8715  S  SG    . CYS C 2 707  ? -18.296 12.408  5.469   1.00 4.89   ? 707  CYS C SG    1 
ATOM   8716  N  N     . THR C 2 708  ? -22.571 15.307  5.126   1.00 1.86   ? 708  THR C N     1 
ATOM   8717  C  CA    . THR C 2 708  ? -23.978 15.534  5.418   1.00 5.48   ? 708  THR C CA    1 
ATOM   8718  C  C     . THR C 2 708  ? -24.553 16.590  4.488   1.00 10.29  ? 708  THR C C     1 
ATOM   8719  O  O     . THR C 2 708  ? -24.023 17.694  4.370   1.00 15.34  ? 708  THR C O     1 
ATOM   8720  C  CB    . THR C 2 708  ? -24.198 15.967  6.878   1.00 5.57   ? 708  THR C CB    1 
ATOM   8721  O  OG1   . THR C 2 708  ? -23.319 15.231  7.733   1.00 4.98   ? 708  THR C OG1   1 
ATOM   8722  C  CG2   . THR C 2 708  ? -25.639 15.721  7.306   1.00 4.21   ? 708  THR C CG2   1 
ATOM   8723  N  N     . ASP C 2 709  ? -25.638 16.235  3.819   1.00 5.05   ? 709  ASP C N     1 
ATOM   8724  C  CA    . ASP C 2 709  ? -26.287 17.142  2.903   1.00 3.03   ? 709  ASP C CA    1 
ATOM   8725  C  C     . ASP C 2 709  ? -27.712 17.334  3.357   1.00 5.46   ? 709  ASP C C     1 
ATOM   8726  O  O     . ASP C 2 709  ? -28.481 16.375  3.434   1.00 5.71   ? 709  ASP C O     1 
ATOM   8727  C  CB    . ASP C 2 709  ? -26.232 16.602  1.477   1.00 8.89   ? 709  ASP C CB    1 
ATOM   8728  C  CG    . ASP C 2 709  ? -26.920 17.510  0.488   1.00 18.49  ? 709  ASP C CG    1 
ATOM   8729  O  OD1   . ASP C 2 709  ? -27.008 18.726  0.763   1.00 17.10  ? 709  ASP C OD1   1 
ATOM   8730  O  OD2   . ASP C 2 709  ? -27.364 17.005  -0.564  1.00 23.44  ? 709  ASP C OD2   1 
ATOM   8731  N  N     . ASP C 2 710  ? -28.042 18.577  3.684   1.00 6.90   ? 710  ASP C N     1 
ATOM   8732  C  CA    . ASP C 2 710  ? -29.384 18.953  4.106   1.00 9.59   ? 710  ASP C CA    1 
ATOM   8733  C  C     . ASP C 2 710  ? -29.894 18.127  5.281   1.00 2.64   ? 710  ASP C C     1 
ATOM   8734  O  O     . ASP C 2 710  ? -31.093 17.936  5.435   1.00 2.16   ? 710  ASP C O     1 
ATOM   8735  C  CB    . ASP C 2 710  ? -30.359 18.837  2.931   1.00 21.14  ? 710  ASP C CB    1 
ATOM   8736  C  CG    . ASP C 2 710  ? -31.538 19.777  3.066   1.00 23.17  ? 710  ASP C CG    1 
ATOM   8737  O  OD1   . ASP C 2 710  ? -32.624 19.456  2.544   1.00 20.68  ? 710  ASP C OD1   1 
ATOM   8738  O  OD2   . ASP C 2 710  ? -31.368 20.841  3.697   1.00 29.59  ? 710  ASP C OD2   1 
ATOM   8739  N  N     . GLY C 2 711  ? -28.975 17.625  6.093   1.00 4.79   ? 711  GLY C N     1 
ATOM   8740  C  CA    . GLY C 2 711  ? -29.339 16.881  7.281   1.00 7.09   ? 711  GLY C CA    1 
ATOM   8741  C  C     . GLY C 2 711  ? -29.328 15.372  7.134   1.00 6.01   ? 711  GLY C C     1 
ATOM   8742  O  O     . GLY C 2 711  ? -29.873 14.658  7.975   1.00 12.06  ? 711  GLY C O     1 
ATOM   8743  N  N     . GLU C 2 712  ? -28.706 14.865  6.080   1.00 3.06   ? 712  GLU C N     1 
ATOM   8744  C  CA    . GLU C 2 712  ? -28.673 13.421  5.895   1.00 2.92   ? 712  GLU C CA    1 
ATOM   8745  C  C     . GLU C 2 712  ? -27.250 12.902  5.790   1.00 1.06   ? 712  GLU C C     1 
ATOM   8746  O  O     . GLU C 2 712  ? -26.382 13.586  5.270   1.00 3.96   ? 712  GLU C O     1 
ATOM   8747  C  CB    . GLU C 2 712  ? -29.491 13.035  4.664   1.00 6.53   ? 712  GLU C CB    1 
ATOM   8748  C  CG    . GLU C 2 712  ? -30.986 13.191  4.896   1.00 12.23  ? 712  GLU C CG    1 
ATOM   8749  C  CD    . GLU C 2 712  ? -31.832 12.614  3.780   1.00 10.70  ? 712  GLU C CD    1 
ATOM   8750  O  OE1   . GLU C 2 712  ? -31.534 12.899  2.602   1.00 9.65   ? 712  GLU C OE1   1 
ATOM   8751  O  OE2   . GLU C 2 712  ? -32.794 11.876  4.085   1.00 6.64   ? 712  GLU C OE2   1 
ATOM   8752  N  N     . MET C 2 713  ? -27.010 11.701  6.307   1.00 14.17  ? 713  MET C N     1 
ATOM   8753  C  CA    . MET C 2 713  ? -25.666 11.139  6.295   1.00 12.74  ? 713  MET C CA    1 
ATOM   8754  C  C     . MET C 2 713  ? -25.220 10.932  4.863   1.00 11.40  ? 713  MET C C     1 
ATOM   8755  O  O     . MET C 2 713  ? -25.899 10.286  4.084   1.00 12.44  ? 713  MET C O     1 
ATOM   8756  C  CB    . MET C 2 713  ? -25.607 9.826   7.073   1.00 12.91  ? 713  MET C CB    1 
ATOM   8757  C  CG    . MET C 2 713  ? -25.658 10.003  8.585   1.00 11.91  ? 713  MET C CG    1 
ATOM   8758  S  SD    . MET C 2 713  ? -24.129 10.667  9.257   1.00 6.82   ? 713  MET C SD    1 
ATOM   8759  C  CE    . MET C 2 713  ? -22.943 9.683   8.366   1.00 10.75  ? 713  MET C CE    1 
ATOM   8760  N  N     . ALA C 2 714  ? -24.080 11.506  4.512   1.00 2.71   ? 714  ALA C N     1 
ATOM   8761  C  CA    . ALA C 2 714  ? -23.630 11.483  3.128   1.00 4.11   ? 714  ALA C CA    1 
ATOM   8762  C  C     . ALA C 2 714  ? -22.186 11.031  3.033   1.00 4.39   ? 714  ALA C C     1 
ATOM   8763  O  O     . ALA C 2 714  ? -21.275 11.843  2.919   1.00 7.93   ? 714  ALA C O     1 
ATOM   8764  C  CB    . ALA C 2 714  ? -23.797 12.846  2.503   1.00 9.33   ? 714  ALA C CB    1 
ATOM   8765  N  N     . LEU C 2 715  ? -21.978 9.725   3.061   1.00 2.22   ? 715  LEU C N     1 
ATOM   8766  C  CA    . LEU C 2 715  ? -20.631 9.193   3.142   1.00 0.46   ? 715  LEU C CA    1 
ATOM   8767  C  C     . LEU C 2 715  ? -19.935 9.061   1.791   1.00 0.58   ? 715  LEU C C     1 
ATOM   8768  O  O     . LEU C 2 715  ? -18.877 8.442   1.704   1.00 6.89   ? 715  LEU C O     1 
ATOM   8769  C  CB    . LEU C 2 715  ? -20.665 7.842   3.845   1.00 3.75   ? 715  LEU C CB    1 
ATOM   8770  C  CG    . LEU C 2 715  ? -21.104 7.980   5.301   1.00 3.79   ? 715  LEU C CG    1 
ATOM   8771  C  CD1   . LEU C 2 715  ? -21.285 6.624   5.952   1.00 2.85   ? 715  LEU C CD1   1 
ATOM   8772  C  CD2   . LEU C 2 715  ? -20.077 8.802   6.044   1.00 2.92   ? 715  LEU C CD2   1 
ATOM   8773  N  N     . GLY C 2 716  ? -20.504 9.647   0.741   1.00 2.47   ? 716  GLY C N     1 
ATOM   8774  C  CA    . GLY C 2 716  ? -19.876 9.573   -0.570  1.00 4.48   ? 716  GLY C CA    1 
ATOM   8775  C  C     . GLY C 2 716  ? -20.570 10.251  -1.740  1.00 4.13   ? 716  GLY C C     1 
ATOM   8776  O  O     . GLY C 2 716  ? -21.277 11.243  -1.576  1.00 4.69   ? 716  GLY C O     1 
ATOM   8777  N  N     . LYS C 2 717  ? -20.352 9.708   -2.934  1.00 9.41   ? 717  LYS C N     1 
ATOM   8778  C  CA    . LYS C 2 717  ? -20.885 10.290  -4.157  1.00 12.01  ? 717  LYS C CA    1 
ATOM   8779  C  C     . LYS C 2 717  ? -21.695 9.267   -4.950  1.00 1.73   ? 717  LYS C C     1 
ATOM   8780  O  O     . LYS C 2 717  ? -21.487 8.062   -4.807  1.00 2.39   ? 717  LYS C O     1 
ATOM   8781  C  CB    . LYS C 2 717  ? -19.752 10.836  -5.028  1.00 12.56  ? 717  LYS C CB    1 
ATOM   8782  C  CG    . LYS C 2 717  ? -18.999 12.023  -4.442  1.00 1.27   ? 717  LYS C CG    1 
ATOM   8783  C  CD    . LYS C 2 717  ? -19.857 13.278  -4.430  1.00 3.96   ? 717  LYS C CD    1 
ATOM   8784  C  CE    . LYS C 2 717  ? -19.089 14.512  -3.963  1.00 4.27   ? 717  LYS C CE    1 
ATOM   8785  N  NZ    . LYS C 2 717  ? -18.345 15.201  -5.051  1.00 4.81   ? 717  LYS C NZ    1 
ATOM   8786  N  N     . ASN C 2 718  ? -22.622 9.750   -5.776  1.00 7.67   ? 718  ASN C N     1 
ATOM   8787  C  CA    . ASN C 2 718  ? -23.343 8.889   -6.712  1.00 1.68   ? 718  ASN C CA    1 
ATOM   8788  C  C     . ASN C 2 718  ? -22.591 8.789   -8.020  1.00 1.22   ? 718  ASN C C     1 
ATOM   8789  O  O     . ASN C 2 718  ? -22.520 9.753   -8.779  1.00 3.61   ? 718  ASN C O     1 
ATOM   8790  C  CB    . ASN C 2 718  ? -24.752 9.407   -6.971  1.00 11.54  ? 718  ASN C CB    1 
ATOM   8791  C  CG    . ASN C 2 718  ? -25.561 9.535   -5.707  1.00 8.35   ? 718  ASN C CG    1 
ATOM   8792  O  OD1   . ASN C 2 718  ? -26.306 8.628   -5.337  1.00 6.30   ? 718  ASN C OD1   1 
ATOM   8793  N  ND2   . ASN C 2 718  ? -25.416 10.665  -5.027  1.00 11.56  ? 718  ASN C ND2   1 
ATOM   8794  N  N     . LEU C 2 719  ? -22.039 7.613   -8.281  1.00 1.02   ? 719  LEU C N     1 
ATOM   8795  C  CA    . LEU C 2 719  ? -21.211 7.402   -9.455  1.00 2.32   ? 719  LEU C CA    1 
ATOM   8796  C  C     . LEU C 2 719  ? -21.961 6.712   -10.575 1.00 6.77   ? 719  LEU C C     1 
ATOM   8797  O  O     . LEU C 2 719  ? -22.823 5.873   -10.337 1.00 8.84   ? 719  LEU C O     1 
ATOM   8798  C  CB    . LEU C 2 719  ? -19.981 6.585   -9.092  1.00 0.83   ? 719  LEU C CB    1 
ATOM   8799  C  CG    . LEU C 2 719  ? -18.705 7.398   -8.940  1.00 0.15   ? 719  LEU C CG    1 
ATOM   8800  C  CD1   . LEU C 2 719  ? -18.968 8.604   -8.069  1.00 5.63   ? 719  LEU C CD1   1 
ATOM   8801  C  CD2   . LEU C 2 719  ? -17.627 6.535   -8.336  1.00 2.44   ? 719  LEU C CD2   1 
ATOM   8802  N  N     . LEU C 2 720  ? -21.612 7.069   -11.803 1.00 6.24   ? 720  LEU C N     1 
ATOM   8803  C  CA    . LEU C 2 720  ? -22.216 6.470   -12.981 1.00 9.48   ? 720  LEU C CA    1 
ATOM   8804  C  C     . LEU C 2 720  ? -21.502 5.171   -13.308 1.00 6.63   ? 720  LEU C C     1 
ATOM   8805  O  O     . LEU C 2 720  ? -20.388 5.176   -13.829 1.00 8.12   ? 720  LEU C O     1 
ATOM   8806  C  CB    . LEU C 2 720  ? -22.158 7.438   -14.158 1.00 9.60   ? 720  LEU C CB    1 
ATOM   8807  C  CG    . LEU C 2 720  ? -22.775 6.946   -15.464 1.00 15.21  ? 720  LEU C CG    1 
ATOM   8808  C  CD1   . LEU C 2 720  ? -24.165 6.378   -15.224 1.00 17.63  ? 720  LEU C CD1   1 
ATOM   8809  C  CD2   . LEU C 2 720  ? -22.814 8.089   -16.459 1.00 13.07  ? 720  LEU C CD2   1 
ATOM   8810  N  N     . VAL C 2 721  ? -22.155 4.058   -12.995 1.00 5.14   ? 721  VAL C N     1 
ATOM   8811  C  CA    . VAL C 2 721  ? -21.496 2.760   -12.977 1.00 6.94   ? 721  VAL C CA    1 
ATOM   8812  C  C     . VAL C 2 721  ? -21.793 1.952   -14.243 1.00 9.07   ? 721  VAL C C     1 
ATOM   8813  O  O     . VAL C 2 721  ? -22.818 2.154   -14.891 1.00 10.95  ? 721  VAL C O     1 
ATOM   8814  C  CB    . VAL C 2 721  ? -21.918 1.961   -11.708 1.00 4.49   ? 721  VAL C CB    1 
ATOM   8815  C  CG1   . VAL C 2 721  ? -23.337 1.447   -11.827 1.00 6.43   ? 721  VAL C CG1   1 
ATOM   8816  C  CG2   . VAL C 2 721  ? -20.960 0.819   -11.426 1.00 5.31   ? 721  VAL C CG2   1 
ATOM   8817  N  N     . ALA C 2 722  ? -20.876 1.060   -14.609 1.00 8.66   ? 722  ALA C N     1 
ATOM   8818  C  CA    . ALA C 2 722  ? -21.110 0.118   -15.695 1.00 3.71   ? 722  ALA C CA    1 
ATOM   8819  C  C     . ALA C 2 722  ? -20.493 -1.224  -15.339 1.00 2.97   ? 722  ALA C C     1 
ATOM   8820  O  O     . ALA C 2 722  ? -19.301 -1.306  -15.068 1.00 4.11   ? 722  ALA C O     1 
ATOM   8821  C  CB    . ALA C 2 722  ? -20.541 0.643   -16.994 1.00 9.50   ? 722  ALA C CB    1 
ATOM   8822  N  N     . ILE C 2 723  ? -21.305 -2.275  -15.333 1.00 3.07   ? 723  ILE C N     1 
ATOM   8823  C  CA    . ILE C 2 723  ? -20.845 -3.587  -14.881 1.00 7.80   ? 723  ILE C CA    1 
ATOM   8824  C  C     . ILE C 2 723  ? -20.181 -4.395  -15.988 1.00 7.48   ? 723  ILE C C     1 
ATOM   8825  O  O     . ILE C 2 723  ? -20.841 -5.164  -16.682 1.00 9.27   ? 723  ILE C O     1 
ATOM   8826  C  CB    . ILE C 2 723  ? -21.997 -4.427  -14.310 1.00 7.88   ? 723  ILE C CB    1 
ATOM   8827  C  CG1   . ILE C 2 723  ? -22.874 -3.583  -13.395 1.00 1.89   ? 723  ILE C CG1   1 
ATOM   8828  C  CG2   . ILE C 2 723  ? -21.443 -5.610  -13.543 1.00 8.48   ? 723  ILE C CG2   1 
ATOM   8829  C  CD1   . ILE C 2 723  ? -22.182 -3.175  -12.128 1.00 3.78   ? 723  ILE C CD1   1 
ATOM   8830  N  N     . MET C 2 724  ? -18.871 -4.244  -16.138 1.00 6.62   ? 724  MET C N     1 
ATOM   8831  C  CA    . MET C 2 724  ? -18.185 -4.897  -17.239 1.00 4.68   ? 724  MET C CA    1 
ATOM   8832  C  C     . MET C 2 724  ? -16.679 -4.987  -17.052 1.00 5.34   ? 724  MET C C     1 
ATOM   8833  O  O     . MET C 2 724  ? -16.042 -4.044  -16.586 1.00 5.07   ? 724  MET C O     1 
ATOM   8834  C  CB    . MET C 2 724  ? -18.480 -4.160  -18.543 1.00 4.65   ? 724  MET C CB    1 
ATOM   8835  C  CG    . MET C 2 724  ? -17.887 -2.770  -18.610 1.00 0.52   ? 724  MET C CG    1 
ATOM   8836  S  SD    . MET C 2 724  ? -18.002 -2.065  -20.255 1.00 8.36   ? 724  MET C SD    1 
ATOM   8837  C  CE    . MET C 2 724  ? -16.854 -3.102  -21.151 1.00 10.94  ? 724  MET C CE    1 
ATOM   8838  N  N     . PRO C 2 725  ? -16.099 -6.131  -17.429 1.00 5.55   ? 725  PRO C N     1 
ATOM   8839  C  CA    . PRO C 2 725  ? -14.639 -6.181  -17.483 1.00 6.03   ? 725  PRO C CA    1 
ATOM   8840  C  C     . PRO C 2 725  ? -14.141 -5.144  -18.480 1.00 4.61   ? 725  PRO C C     1 
ATOM   8841  O  O     . PRO C 2 725  ? -14.835 -4.886  -19.459 1.00 5.27   ? 725  PRO C O     1 
ATOM   8842  C  CB    . PRO C 2 725  ? -14.346 -7.606  -17.965 1.00 8.56   ? 725  PRO C CB    1 
ATOM   8843  C  CG    . PRO C 2 725  ? -15.610 -8.376  -17.710 1.00 6.76   ? 725  PRO C CG    1 
ATOM   8844  C  CD    . PRO C 2 725  ? -16.717 -7.392  -17.870 1.00 4.78   ? 725  PRO C CD    1 
ATOM   8845  N  N     . TRP C 2 726  ? -12.986 -4.537  -18.237 1.00 2.07   ? 726  TRP C N     1 
ATOM   8846  C  CA    . TRP C 2 726  ? -12.469 -3.540  -19.171 1.00 2.84   ? 726  TRP C CA    1 
ATOM   8847  C  C     . TRP C 2 726  ? -10.968 -3.638  -19.362 1.00 2.96   ? 726  TRP C C     1 
ATOM   8848  O  O     . TRP C 2 726  ? -10.208 -3.023  -18.627 1.00 4.80   ? 726  TRP C O     1 
ATOM   8849  C  CB    . TRP C 2 726  ? -12.814 -2.126  -18.709 1.00 2.50   ? 726  TRP C CB    1 
ATOM   8850  C  CG    . TRP C 2 726  ? -12.708 -1.126  -19.818 1.00 1.86   ? 726  TRP C CG    1 
ATOM   8851  C  CD1   . TRP C 2 726  ? -13.674 -0.820  -20.724 1.00 8.97   ? 726  TRP C CD1   1 
ATOM   8852  C  CD2   . TRP C 2 726  ? -11.573 -0.316  -20.156 1.00 0.72   ? 726  TRP C CD2   1 
ATOM   8853  N  NE1   . TRP C 2 726  ? -13.220 0.132   -21.602 1.00 10.24  ? 726  TRP C NE1   1 
ATOM   8854  C  CE2   . TRP C 2 726  ? -11.934 0.457   -21.274 1.00 1.81   ? 726  TRP C CE2   1 
ATOM   8855  C  CE3   . TRP C 2 726  ? -10.295 -0.167  -19.620 1.00 2.08   ? 726  TRP C CE3   1 
ATOM   8856  C  CZ2   . TRP C 2 726  ? -11.065 1.363   -21.864 1.00 2.45   ? 726  TRP C CZ2   1 
ATOM   8857  C  CZ3   . TRP C 2 726  ? -9.434  0.736   -20.210 1.00 4.49   ? 726  TRP C CZ3   1 
ATOM   8858  C  CH2   . TRP C 2 726  ? -9.822  1.488   -21.320 1.00 3.62   ? 726  TRP C CH2   1 
ATOM   8859  N  N     . GLU C 2 727  ? -10.551 -4.412  -20.357 1.00 4.45   ? 727  GLU C N     1 
ATOM   8860  C  CA    . GLU C 2 727  ? -9.147  -4.502  -20.748 1.00 2.73   ? 727  GLU C CA    1 
ATOM   8861  C  C     . GLU C 2 727  ? -8.226  -4.882  -19.579 1.00 3.71   ? 727  GLU C C     1 
ATOM   8862  O  O     . GLU C 2 727  ? -7.033  -4.574  -19.595 1.00 2.27   ? 727  GLU C O     1 
ATOM   8863  C  CB    . GLU C 2 727  ? -8.684  -3.179  -21.359 1.00 8.08   ? 727  GLU C CB    1 
ATOM   8864  C  CG    . GLU C 2 727  ? -9.692  -2.505  -22.305 1.00 11.23  ? 727  GLU C CG    1 
ATOM   8865  C  CD    . GLU C 2 727  ? -9.588  -2.985  -23.745 1.00 10.05  ? 727  GLU C CD    1 
ATOM   8866  O  OE1   . GLU C 2 727  ? -8.907  -2.323  -24.561 1.00 10.72  ? 727  GLU C OE1   1 
ATOM   8867  O  OE2   . GLU C 2 727  ? -10.207 -4.017  -24.065 1.00 11.73  ? 727  GLU C OE2   1 
ATOM   8868  N  N     . GLY C 2 728  ? -8.792  -5.531  -18.562 1.00 11.09  ? 728  GLY C N     1 
ATOM   8869  C  CA    . GLY C 2 728  ? -8.025  -6.108  -17.466 1.00 6.87   ? 728  GLY C CA    1 
ATOM   8870  C  C     . GLY C 2 728  ? -7.795  -5.222  -16.255 1.00 7.25   ? 728  GLY C C     1 
ATOM   8871  O  O     . GLY C 2 728  ? -7.409  -5.706  -15.192 1.00 9.14   ? 728  GLY C O     1 
ATOM   8872  N  N     . HIS C 2 729  ? -8.046  -3.927  -16.414 1.00 14.68  ? 729  HIS C N     1 
ATOM   8873  C  CA    . HIS C 2 729  ? -7.701  -2.928  -15.406 1.00 3.94   ? 729  HIS C CA    1 
ATOM   8874  C  C     . HIS C 2 729  ? -8.587  -2.910  -14.177 1.00 0.79   ? 729  HIS C C     1 
ATOM   8875  O  O     . HIS C 2 729  ? -8.374  -2.109  -13.278 1.00 5.28   ? 729  HIS C O     1 
ATOM   8876  C  CB    . HIS C 2 729  ? -7.719  -1.542  -16.031 1.00 3.97   ? 729  HIS C CB    1 
ATOM   8877  C  CG    . HIS C 2 729  ? -6.460  -1.199  -16.753 1.00 4.74   ? 729  HIS C CG    1 
ATOM   8878  N  ND1   . HIS C 2 729  ? -5.343  -0.723  -16.103 1.00 11.71  ? 729  HIS C ND1   1 
ATOM   8879  C  CD2   . HIS C 2 729  ? -6.135  -1.273  -18.064 1.00 0.73   ? 729  HIS C CD2   1 
ATOM   8880  C  CE1   . HIS C 2 729  ? -4.383  -0.512  -16.986 1.00 14.87  ? 729  HIS C CE1   1 
ATOM   8881  N  NE2   . HIS C 2 729  ? -4.838  -0.838  -18.182 1.00 11.14  ? 729  HIS C NE2   1 
ATOM   8882  N  N     . ASN C 2 730  ? -9.591  -3.772  -14.141 1.00 3.69   ? 730  ASN C N     1 
ATOM   8883  C  CA    . ASN C 2 730  ? -10.429 -3.890  -12.959 1.00 4.77   ? 730  ASN C CA    1 
ATOM   8884  C  C     . ASN C 2 730  ? -10.341 -5.289  -12.367 1.00 6.48   ? 730  ASN C C     1 
ATOM   8885  O  O     . ASN C 2 730  ? -11.093 -5.635  -11.457 1.00 7.14   ? 730  ASN C O     1 
ATOM   8886  C  CB    . ASN C 2 730  ? -11.874 -3.541  -13.300 1.00 4.54   ? 730  ASN C CB    1 
ATOM   8887  C  CG    . ASN C 2 730  ? -12.315 -4.146  -14.607 1.00 6.93   ? 730  ASN C CG    1 
ATOM   8888  O  OD1   . ASN C 2 730  ? -11.502 -4.697  -15.346 1.00 8.11   ? 730  ASN C OD1   1 
ATOM   8889  N  ND2   . ASN C 2 730  ? -13.597 -4.022  -14.919 1.00 6.90   ? 730  ASN C ND2   1 
ATOM   8890  N  N     . TYR C 2 731  ? -9.399  -6.075  -12.884 1.00 7.19   ? 731  TYR C N     1 
ATOM   8891  C  CA    . TYR C 2 731  ? -9.263  -7.488  -12.534 1.00 6.63   ? 731  TYR C CA    1 
ATOM   8892  C  C     . TYR C 2 731  ? -8.951  -7.711  -11.056 1.00 3.73   ? 731  TYR C C     1 
ATOM   8893  O  O     . TYR C 2 731  ? -8.124  -7.017  -10.472 1.00 2.68   ? 731  TYR C O     1 
ATOM   8894  C  CB    . TYR C 2 731  ? -8.187  -8.137  -13.415 1.00 8.94   ? 731  TYR C CB    1 
ATOM   8895  C  CG    . TYR C 2 731  ? -7.580  -9.419  -12.875 1.00 16.34  ? 731  TYR C CG    1 
ATOM   8896  C  CD1   . TYR C 2 731  ? -8.303  -10.602 -12.846 1.00 12.60  ? 731  TYR C CD1   1 
ATOM   8897  C  CD2   . TYR C 2 731  ? -6.266  -9.448  -12.426 1.00 16.00  ? 731  TYR C CD2   1 
ATOM   8898  C  CE1   . TYR C 2 731  ? -7.739  -11.768 -12.364 1.00 13.89  ? 731  TYR C CE1   1 
ATOM   8899  C  CE2   . TYR C 2 731  ? -5.696  -10.612 -11.944 1.00 10.68  ? 731  TYR C CE2   1 
ATOM   8900  C  CZ    . TYR C 2 731  ? -6.437  -11.767 -11.914 1.00 12.52  ? 731  TYR C CZ    1 
ATOM   8901  O  OH    . TYR C 2 731  ? -5.866  -12.922 -11.431 1.00 16.27  ? 731  TYR C OH    1 
ATOM   8902  N  N     . GLU C 2 732  ? -9.629  -8.700  -10.478 1.00 7.18   ? 732  GLU C N     1 
ATOM   8903  C  CA    . GLU C 2 732  ? -9.571  -9.007  -9.049  1.00 8.48   ? 732  GLU C CA    1 
ATOM   8904  C  C     . GLU C 2 732  ? -9.927  -7.791  -8.195  1.00 9.14   ? 732  GLU C C     1 
ATOM   8905  O  O     . GLU C 2 732  ? -9.091  -7.264  -7.464  1.00 7.97   ? 732  GLU C O     1 
ATOM   8906  C  CB    . GLU C 2 732  ? -8.191  -9.547  -8.659  1.00 10.66  ? 732  GLU C CB    1 
ATOM   8907  C  CG    . GLU C 2 732  ? -8.091  -11.080 -8.587  1.00 15.26  ? 732  GLU C CG    1 
ATOM   8908  C  CD    . GLU C 2 732  ? -8.584  -11.656 -7.263  1.00 14.86  ? 732  GLU C CD    1 
ATOM   8909  O  OE1   . GLU C 2 732  ? -9.638  -11.207 -6.769  1.00 15.83  ? 732  GLU C OE1   1 
ATOM   8910  O  OE2   . GLU C 2 732  ? -7.914  -12.560 -6.715  1.00 10.68  ? 732  GLU C OE2   1 
ATOM   8911  N  N     . ASP C 2 733  ? -11.177 -7.352  -8.320  1.00 13.26  ? 733  ASP C N     1 
ATOM   8912  C  CA    . ASP C 2 733  ? -11.762 -6.304  -7.483  1.00 6.03   ? 733  ASP C CA    1 
ATOM   8913  C  C     . ASP C 2 733  ? -11.090 -4.937  -7.602  1.00 4.66   ? 733  ASP C C     1 
ATOM   8914  O  O     . ASP C 2 733  ? -11.341 -4.061  -6.781  1.00 7.42   ? 733  ASP C O     1 
ATOM   8915  C  CB    . ASP C 2 733  ? -11.748 -6.736  -6.017  1.00 5.64   ? 733  ASP C CB    1 
ATOM   8916  C  CG    . ASP C 2 733  ? -12.455 -8.057  -5.796  1.00 14.33  ? 733  ASP C CG    1 
ATOM   8917  O  OD1   . ASP C 2 733  ? -13.540 -8.260  -6.380  1.00 21.51  ? 733  ASP C OD1   1 
ATOM   8918  O  OD2   . ASP C 2 733  ? -11.927 -8.903  -5.043  1.00 13.56  ? 733  ASP C OD2   1 
ATOM   8919  N  N     . ALA C 2 734  ? -10.238 -4.754  -8.608  1.00 7.09   ? 734  ALA C N     1 
ATOM   8920  C  CA    . ALA C 2 734  ? -9.612  -3.455  -8.853  1.00 2.44   ? 734  ALA C CA    1 
ATOM   8921  C  C     . ALA C 2 734  ? -10.652 -2.505  -9.422  1.00 6.13   ? 734  ALA C C     1 
ATOM   8922  O  O     . ALA C 2 734  ? -11.690 -2.952  -9.894  1.00 14.83  ? 734  ALA C O     1 
ATOM   8923  C  CB    . ALA C 2 734  ? -8.443  -3.597  -9.795  1.00 6.32   ? 734  ALA C CB    1 
ATOM   8924  N  N     . ILE C 2 735  ? -10.399 -1.201  -9.382  1.00 4.49   ? 735  ILE C N     1 
ATOM   8925  C  CA    . ILE C 2 735  ? -11.435 -0.253  -9.788  1.00 6.67   ? 735  ILE C CA    1 
ATOM   8926  C  C     . ILE C 2 735  ? -10.945 0.786   -10.802 1.00 10.41  ? 735  ILE C C     1 
ATOM   8927  O  O     . ILE C 2 735  ? -9.809  1.259   -10.730 1.00 10.72  ? 735  ILE C O     1 
ATOM   8928  C  CB    . ILE C 2 735  ? -12.021 0.460   -8.555  1.00 3.75   ? 735  ILE C CB    1 
ATOM   8929  C  CG1   . ILE C 2 735  ? -12.588 -0.570  -7.578  1.00 1.63   ? 735  ILE C CG1   1 
ATOM   8930  C  CG2   . ILE C 2 735  ? -13.118 1.421   -8.955  1.00 9.19   ? 735  ILE C CG2   1 
ATOM   8931  C  CD1   . ILE C 2 735  ? -13.215 0.023   -6.341  1.00 1.74   ? 735  ILE C CD1   1 
ATOM   8932  N  N     . ILE C 2 736  ? -11.814 1.128   -11.750 1.00 4.84   ? 736  ILE C N     1 
ATOM   8933  C  CA    . ILE C 2 736  ? -11.478 2.042   -12.835 1.00 4.53   ? 736  ILE C CA    1 
ATOM   8934  C  C     . ILE C 2 736  ? -12.311 3.334   -12.782 1.00 6.88   ? 736  ILE C C     1 
ATOM   8935  O  O     . ILE C 2 736  ? -13.532 3.287   -12.639 1.00 7.13   ? 736  ILE C O     1 
ATOM   8936  C  CB    . ILE C 2 736  ? -11.679 1.346   -14.181 1.00 2.30   ? 736  ILE C CB    1 
ATOM   8937  C  CG1   . ILE C 2 736  ? -11.005 -0.027  -14.151 1.00 3.31   ? 736  ILE C CG1   1 
ATOM   8938  C  CG2   . ILE C 2 736  ? -11.135 2.194   -15.306 1.00 10.97  ? 736  ILE C CG2   1 
ATOM   8939  C  CD1   . ILE C 2 736  ? -11.119 -0.803  -15.442 1.00 9.37   ? 736  ILE C CD1   1 
ATOM   8940  N  N     . LEU C 2 737  ? -11.650 4.484   -12.894 1.00 5.58   ? 737  LEU C N     1 
ATOM   8941  C  CA    . LEU C 2 737  ? -12.320 5.768   -12.721 1.00 2.29   ? 737  LEU C CA    1 
ATOM   8942  C  C     . LEU C 2 737  ? -12.246 6.666   -13.946 1.00 6.55   ? 737  LEU C C     1 
ATOM   8943  O  O     . LEU C 2 737  ? -11.334 6.551   -14.759 1.00 12.03  ? 737  LEU C O     1 
ATOM   8944  C  CB    . LEU C 2 737  ? -11.725 6.513   -11.528 1.00 5.00   ? 737  LEU C CB    1 
ATOM   8945  C  CG    . LEU C 2 737  ? -11.996 5.936   -10.142 1.00 0.77   ? 737  LEU C CG    1 
ATOM   8946  C  CD1   . LEU C 2 737  ? -11.605 6.947   -9.086  1.00 10.54  ? 737  LEU C CD1   1 
ATOM   8947  C  CD2   . LEU C 2 737  ? -13.455 5.536   -10.005 1.00 4.18   ? 737  LEU C CD2   1 
ATOM   8948  N  N     . SER C 2 738  ? -13.216 7.570   -14.062 1.00 8.11   ? 738  SER C N     1 
ATOM   8949  C  CA    . SER C 2 738  ? -13.184 8.613   -15.088 1.00 10.14  ? 738  SER C CA    1 
ATOM   8950  C  C     . SER C 2 738  ? -12.514 9.855   -14.535 1.00 3.57   ? 738  SER C C     1 
ATOM   8951  O  O     . SER C 2 738  ? -12.867 10.328  -13.458 1.00 3.74   ? 738  SER C O     1 
ATOM   8952  C  CB    . SER C 2 738  ? -14.593 8.953   -15.588 1.00 8.56   ? 738  SER C CB    1 
ATOM   8953  O  OG    . SER C 2 738  ? -14.563 10.006  -16.527 1.00 14.76  ? 738  SER C OG    1 
ATOM   8954  N  N     . ASN C 2 739  ? -11.564 10.396  -15.290 1.00 4.47   ? 739  ASN C N     1 
ATOM   8955  C  CA    . ASN C 2 739  ? -10.791 11.552  -14.841 1.00 8.79   ? 739  ASN C CA    1 
ATOM   8956  C  C     . ASN C 2 739  ? -11.653 12.723  -14.386 1.00 6.29   ? 739  ASN C C     1 
ATOM   8957  O  O     . ASN C 2 739  ? -11.153 13.647  -13.746 1.00 6.51   ? 739  ASN C O     1 
ATOM   8958  C  CB    . ASN C 2 739  ? -9.846  12.029  -15.944 1.00 17.08  ? 739  ASN C CB    1 
ATOM   8959  C  CG    . ASN C 2 739  ? -8.648  12.775  -15.396 1.00 16.25  ? 739  ASN C CG    1 
ATOM   8960  O  OD1   . ASN C 2 739  ? -8.137  12.444  -14.328 1.00 13.25  ? 739  ASN C OD1   1 
ATOM   8961  N  ND2   . ASN C 2 739  ? -8.199  13.792  -16.120 1.00 20.41  ? 739  ASN C ND2   1 
ATOM   8962  N  N     . ARG C 2 740  ? -12.940 12.682  -14.727 1.00 6.00   ? 740  ARG C N     1 
ATOM   8963  C  CA    . ARG C 2 740  ? -13.901 13.670  -14.252 1.00 6.52   ? 740  ARG C CA    1 
ATOM   8964  C  C     . ARG C 2 740  ? -13.815 13.808  -12.742 1.00 8.49   ? 740  ARG C C     1 
ATOM   8965  O  O     . ARG C 2 740  ? -13.741 14.916  -12.217 1.00 13.79  ? 740  ARG C O     1 
ATOM   8966  C  CB    . ARG C 2 740  ? -15.329 13.287  -14.663 1.00 9.69   ? 740  ARG C CB    1 
ATOM   8967  C  CG    . ARG C 2 740  ? -16.405 14.220  -14.115 1.00 11.42  ? 740  ARG C CG    1 
ATOM   8968  C  CD    . ARG C 2 740  ? -17.812 13.761  -14.501 1.00 15.06  ? 740  ARG C CD    1 
ATOM   8969  N  NE    . ARG C 2 740  ? -18.325 12.704  -13.632 1.00 4.57   ? 740  ARG C NE    1 
ATOM   8970  C  CZ    . ARG C 2 740  ? -19.006 12.927  -12.513 1.00 2.60   ? 740  ARG C CZ    1 
ATOM   8971  N  NH1   . ARG C 2 740  ? -19.253 14.171  -12.127 1.00 6.27   ? 740  ARG C NH1   1 
ATOM   8972  N  NH2   . ARG C 2 740  ? -19.438 11.913  -11.779 1.00 1.18   ? 740  ARG C NH2   1 
ATOM   8973  N  N     . LEU C 2 741  ? -13.794 12.669  -12.058 1.00 7.09   ? 741  LEU C N     1 
ATOM   8974  C  CA    . LEU C 2 741  ? -13.765 12.624  -10.597 1.00 5.96   ? 741  LEU C CA    1 
ATOM   8975  C  C     . LEU C 2 741  ? -12.524 13.287  -10.005 1.00 5.34   ? 741  LEU C C     1 
ATOM   8976  O  O     . LEU C 2 741  ? -12.491 13.627  -8.824  1.00 4.78   ? 741  LEU C O     1 
ATOM   8977  C  CB    . LEU C 2 741  ? -13.844 11.178  -10.122 1.00 4.85   ? 741  LEU C CB    1 
ATOM   8978  C  CG    . LEU C 2 741  ? -14.944 10.378  -10.805 1.00 0.72   ? 741  LEU C CG    1 
ATOM   8979  C  CD1   . LEU C 2 741  ? -15.014 8.981   -10.228 1.00 1.22   ? 741  LEU C CD1   1 
ATOM   8980  C  CD2   . LEU C 2 741  ? -16.279 11.096  -10.669 1.00 4.81   ? 741  LEU C CD2   1 
ATOM   8981  N  N     . VAL C 2 742  ? -11.501 13.455  -10.830 1.00 4.99   ? 742  VAL C N     1 
ATOM   8982  C  CA    . VAL C 2 742  ? -10.306 14.173  -10.428 1.00 4.30   ? 742  VAL C CA    1 
ATOM   8983  C  C     . VAL C 2 742  ? -10.459 15.655  -10.740 1.00 9.65   ? 742  VAL C C     1 
ATOM   8984  O  O     . VAL C 2 742  ? -10.231 16.511  -9.888  1.00 8.38   ? 742  VAL C O     1 
ATOM   8985  C  CB    . VAL C 2 742  ? -9.059  13.635  -11.145 1.00 4.41   ? 742  VAL C CB    1 
ATOM   8986  C  CG1   . VAL C 2 742  ? -7.875  14.545  -10.882 1.00 11.56  ? 742  VAL C CG1   1 
ATOM   8987  C  CG2   . VAL C 2 742  ? -8.758  12.216  -10.702 1.00 4.48   ? 742  VAL C CG2   1 
ATOM   8988  N  N     . GLU C 2 743  ? -10.863 15.935  -11.975 1.00 8.07   ? 743  GLU C N     1 
ATOM   8989  C  CA    . GLU C 2 743  ? -10.941 17.296  -12.502 1.00 12.77  ? 743  GLU C CA    1 
ATOM   8990  C  C     . GLU C 2 743  ? -12.053 18.109  -11.838 1.00 6.31   ? 743  GLU C C     1 
ATOM   8991  O  O     . GLU C 2 743  ? -11.966 19.332  -11.743 1.00 4.97   ? 743  GLU C O     1 
ATOM   8992  C  CB    . GLU C 2 743  ? -11.150 17.269  -14.032 1.00 18.73  ? 743  GLU C CB    1 
ATOM   8993  C  CG    . GLU C 2 743  ? -10.067 16.512  -14.829 1.00 18.19  ? 743  GLU C CG    1 
ATOM   8994  C  CD    . GLU C 2 743  ? -10.367 16.393  -16.329 1.00 18.58  ? 743  GLU C CD    1 
ATOM   8995  O  OE1   . GLU C 2 743  ? -11.166 17.194  -16.862 1.00 26.13  ? 743  GLU C OE1   1 
ATOM   8996  O  OE2   . GLU C 2 743  ? -9.797  15.487  -16.977 1.00 19.59  ? 743  GLU C OE2   1 
ATOM   8997  N  N     . GLU C 2 744  ? -13.096 17.422  -11.382 1.00 8.95   ? 744  GLU C N     1 
ATOM   8998  C  CA    . GLU C 2 744  ? -14.246 18.079  -10.768 1.00 8.45   ? 744  GLU C CA    1 
ATOM   8999  C  C     . GLU C 2 744  ? -14.260 17.860  -9.260  1.00 5.33   ? 744  GLU C C     1 
ATOM   9000  O  O     . GLU C 2 744  ? -15.282 18.062  -8.598  1.00 2.55   ? 744  GLU C O     1 
ATOM   9001  C  CB    . GLU C 2 744  ? -15.554 17.577  -11.394 1.00 13.15  ? 744  GLU C CB    1 
ATOM   9002  C  CG    . GLU C 2 744  ? -15.781 18.038  -12.834 1.00 16.41  ? 744  GLU C CG    1 
ATOM   9003  C  CD    . GLU C 2 744  ? -17.155 17.666  -13.371 1.00 18.50  ? 744  GLU C CD    1 
ATOM   9004  O  OE1   . GLU C 2 744  ? -17.854 16.862  -12.719 1.00 13.74  ? 744  GLU C OE1   1 
ATOM   9005  O  OE2   . GLU C 2 744  ? -17.535 18.185  -14.443 1.00 17.72  ? 744  GLU C OE2   1 
ATOM   9006  N  N     . ASP C 2 745  ? -13.114 17.443  -8.731  1.00 7.54   ? 745  ASP C N     1 
ATOM   9007  C  CA    . ASP C 2 745  ? -12.917 17.296  -7.289  1.00 9.12   ? 745  ASP C CA    1 
ATOM   9008  C  C     . ASP C 2 745  ? -13.970 16.400  -6.637  1.00 5.78   ? 745  ASP C C     1 
ATOM   9009  O  O     . ASP C 2 745  ? -14.216 16.505  -5.438  1.00 6.41   ? 745  ASP C O     1 
ATOM   9010  C  CB    . ASP C 2 745  ? -12.917 18.672  -6.603  1.00 11.03  ? 745  ASP C CB    1 
ATOM   9011  C  CG    . ASP C 2 745  ? -11.516 19.271  -6.466  1.00 14.49  ? 745  ASP C CG    1 
ATOM   9012  O  OD1   . ASP C 2 745  ? -10.539 18.495  -6.379  1.00 14.57  ? 745  ASP C OD1   1 
ATOM   9013  O  OD2   . ASP C 2 745  ? -11.390 20.520  -6.427  1.00 7.73   ? 745  ASP C OD2   1 
ATOM   9014  N  N     . VAL C 2 746  ? -14.587 15.525  -7.428  1.00 6.59   ? 746  VAL C N     1 
ATOM   9015  C  CA    . VAL C 2 746  ? -15.705 14.714  -6.953  1.00 7.05   ? 746  VAL C CA    1 
ATOM   9016  C  C     . VAL C 2 746  ? -15.284 13.808  -5.802  1.00 2.73   ? 746  VAL C C     1 
ATOM   9017  O  O     . VAL C 2 746  ? -15.980 13.704  -4.793  1.00 4.74   ? 746  VAL C O     1 
ATOM   9018  C  CB    . VAL C 2 746  ? -16.303 13.853  -8.075  1.00 5.81   ? 746  VAL C CB    1 
ATOM   9019  C  CG1   . VAL C 2 746  ? -17.433 12.992  -7.527  1.00 3.17   ? 746  VAL C CG1   1 
ATOM   9020  C  CG2   . VAL C 2 746  ? -16.806 14.732  -9.209  1.00 7.36   ? 746  VAL C CG2   1 
ATOM   9021  N  N     . LEU C 2 747  ? -14.145 13.147  -5.958  1.00 4.03   ? 747  LEU C N     1 
ATOM   9022  C  CA    . LEU C 2 747  ? -13.573 12.376  -4.869  1.00 1.80   ? 747  LEU C CA    1 
ATOM   9023  C  C     . LEU C 2 747  ? -12.303 13.037  -4.410  1.00 3.42   ? 747  LEU C C     1 
ATOM   9024  O  O     . LEU C 2 747  ? -11.207 12.546  -4.661  1.00 6.24   ? 747  LEU C O     1 
ATOM   9025  C  CB    . LEU C 2 747  ? -13.304 10.945  -5.294  1.00 0.59   ? 747  LEU C CB    1 
ATOM   9026  C  CG    . LEU C 2 747  ? -14.578 10.122  -5.252  1.00 0.18   ? 747  LEU C CG    1 
ATOM   9027  C  CD1   . LEU C 2 747  ? -14.410 8.905   -6.111  1.00 2.05   ? 747  LEU C CD1   1 
ATOM   9028  C  CD2   . LEU C 2 747  ? -14.876 9.734   -3.826  1.00 1.01   ? 747  LEU C CD2   1 
ATOM   9029  N  N     . THR C 2 748  ? -12.452 14.167  -3.743  1.00 2.41   ? 748  THR C N     1 
ATOM   9030  C  CA    . THR C 2 748  ? -11.297 14.896  -3.266  1.00 1.70   ? 748  THR C CA    1 
ATOM   9031  C  C     . THR C 2 748  ? -11.532 15.304  -1.823  1.00 1.35   ? 748  THR C C     1 
ATOM   9032  O  O     . THR C 2 748  ? -12.630 15.712  -1.454  1.00 1.62   ? 748  THR C O     1 
ATOM   9033  C  CB    . THR C 2 748  ? -11.017 16.116  -4.144  1.00 5.77   ? 748  THR C CB    1 
ATOM   9034  O  OG1   . THR C 2 748  ? -10.880 15.691  -5.504  1.00 4.53   ? 748  THR C OG1   1 
ATOM   9035  C  CG2   . THR C 2 748  ? -9.739  16.800  -3.721  1.00 8.73   ? 748  THR C CG2   1 
ATOM   9036  N  N     . SER C 2 749  ? -10.504 15.175  -0.998  1.00 0.90   ? 749  SER C N     1 
ATOM   9037  C  CA    . SER C 2 749  ? -10.682 15.387  0.425   1.00 0.93   ? 749  SER C CA    1 
ATOM   9038  C  C     . SER C 2 749  ? -9.677  16.349  1.025   1.00 0.26   ? 749  SER C C     1 
ATOM   9039  O  O     . SER C 2 749  ? -8.647  16.646  0.425   1.00 2.93   ? 749  SER C O     1 
ATOM   9040  C  CB    . SER C 2 749  ? -10.599 14.052  1.147   1.00 2.15   ? 749  SER C CB    1 
ATOM   9041  O  OG    . SER C 2 749  ? -9.517  13.300  0.642   1.00 8.32   ? 749  SER C OG    1 
ATOM   9042  N  N     . ILE C 2 750  ? -9.989  16.824  2.225   1.00 0.84   ? 750  ILE C N     1 
ATOM   9043  C  CA    . ILE C 2 750  ? -9.084  17.675  2.980   1.00 0.75   ? 750  ILE C CA    1 
ATOM   9044  C  C     . ILE C 2 750  ? -8.561  16.953  4.208   1.00 1.93   ? 750  ILE C C     1 
ATOM   9045  O  O     . ILE C 2 750  ? -9.339  16.468  5.024   1.00 1.97   ? 750  ILE C O     1 
ATOM   9046  C  CB    . ILE C 2 750  ? -9.759  18.966  3.447   1.00 0.12   ? 750  ILE C CB    1 
ATOM   9047  C  CG1   . ILE C 2 750  ? -10.278 19.776  2.264   1.00 4.74   ? 750  ILE C CG1   1 
ATOM   9048  C  CG2   . ILE C 2 750  ? -8.788  19.795  4.258   1.00 1.81   ? 750  ILE C CG2   1 
ATOM   9049  C  CD1   . ILE C 2 750  ? -10.825 21.133  2.666   1.00 3.28   ? 750  ILE C CD1   1 
ATOM   9050  N  N     . HIS C 2 751  ? -7.243  16.893  4.344   1.00 2.81   ? 751  HIS C N     1 
ATOM   9051  C  CA    . HIS C 2 751  ? -6.620  16.241  5.489   1.00 1.69   ? 751  HIS C CA    1 
ATOM   9052  C  C     . HIS C 2 751  ? -5.718  17.201  6.251   1.00 0.79   ? 751  HIS C C     1 
ATOM   9053  O  O     . HIS C 2 751  ? -4.928  17.922  5.653   1.00 3.13   ? 751  HIS C O     1 
ATOM   9054  C  CB    . HIS C 2 751  ? -5.816  15.027  5.036   1.00 2.98   ? 751  HIS C CB    1 
ATOM   9055  C  CG    . HIS C 2 751  ? -6.631  13.999  4.317   1.00 0.86   ? 751  HIS C CG    1 
ATOM   9056  N  ND1   . HIS C 2 751  ? -7.359  13.033  4.978   1.00 8.14   ? 751  HIS C ND1   1 
ATOM   9057  C  CD2   . HIS C 2 751  ? -6.833  13.784  2.997   1.00 0.87   ? 751  HIS C CD2   1 
ATOM   9058  C  CE1   . HIS C 2 751  ? -7.974  12.269  4.096   1.00 0.53   ? 751  HIS C CE1   1 
ATOM   9059  N  NE2   . HIS C 2 751  ? -7.672  12.704  2.886   1.00 1.16   ? 751  HIS C NE2   1 
ATOM   9060  N  N     . ILE C 2 752  ? -5.835  17.200  7.573   1.00 10.17  ? 752  ILE C N     1 
ATOM   9061  C  CA    . ILE C 2 752  ? -5.021  18.071  8.410   1.00 4.48   ? 752  ILE C CA    1 
ATOM   9062  C  C     . ILE C 2 752  ? -4.099  17.254  9.314   1.00 8.61   ? 752  ILE C C     1 
ATOM   9063  O  O     . ILE C 2 752  ? -4.499  16.225  9.849   1.00 9.36   ? 752  ILE C O     1 
ATOM   9064  C  CB    . ILE C 2 752  ? -5.900  18.997  9.279   1.00 0.56   ? 752  ILE C CB    1 
ATOM   9065  C  CG1   . ILE C 2 752  ? -6.930  19.725  8.420   1.00 1.64   ? 752  ILE C CG1   1 
ATOM   9066  C  CG2   . ILE C 2 752  ? -5.052  20.007  10.021  1.00 3.30   ? 752  ILE C CG2   1 
ATOM   9067  C  CD1   . ILE C 2 752  ? -7.761  20.724  9.195   1.00 5.41   ? 752  ILE C CD1   1 
ATOM   9068  N  N     . GLU C 2 753  ? -2.859  17.710  9.465   1.00 6.67   ? 753  GLU C N     1 
ATOM   9069  C  CA    . GLU C 2 753  ? -1.928  17.127  10.427  1.00 7.70   ? 753  GLU C CA    1 
ATOM   9070  C  C     . GLU C 2 753  ? -1.426  18.198  11.379  1.00 3.00   ? 753  GLU C C     1 
ATOM   9071  O  O     . GLU C 2 753  ? -1.248  19.346  10.986  1.00 3.17   ? 753  GLU C O     1 
ATOM   9072  C  CB    . GLU C 2 753  ? -0.741  16.466  9.723   1.00 16.10  ? 753  GLU C CB    1 
ATOM   9073  C  CG    . GLU C 2 753  ? -1.097  15.272  8.844   1.00 21.69  ? 753  GLU C CG    1 
ATOM   9074  C  CD    . GLU C 2 753  ? -1.166  13.956  9.609   1.00 15.98  ? 753  GLU C CD    1 
ATOM   9075  O  OE1   . GLU C 2 753  ? -0.834  13.940  10.813  1.00 13.50  ? 753  GLU C OE1   1 
ATOM   9076  O  OE2   . GLU C 2 753  ? -1.547  12.932  9.001   1.00 20.99  ? 753  GLU C OE2   1 
ATOM   9077  N  N     . GLU C 2 754  ? -1.191  17.822  12.630  1.00 3.26   ? 754  GLU C N     1 
ATOM   9078  C  CA    . GLU C 2 754  ? -0.677  18.766  13.614  1.00 2.56   ? 754  GLU C CA    1 
ATOM   9079  C  C     . GLU C 2 754  ? 0.780   18.498  13.948  1.00 2.11   ? 754  GLU C C     1 
ATOM   9080  O  O     . GLU C 2 754  ? 1.138   17.413  14.392  1.00 5.73   ? 754  GLU C O     1 
ATOM   9081  C  CB    . GLU C 2 754  ? -1.506  18.718  14.890  1.00 4.59   ? 754  GLU C CB    1 
ATOM   9082  C  CG    . GLU C 2 754  ? -0.949  19.591  15.989  1.00 2.11   ? 754  GLU C CG    1 
ATOM   9083  C  CD    . GLU C 2 754  ? -1.718  19.457  17.281  1.00 7.31   ? 754  GLU C CD    1 
ATOM   9084  O  OE1   . GLU C 2 754  ? -1.385  18.554  18.076  1.00 20.37  ? 754  GLU C OE1   1 
ATOM   9085  O  OE2   . GLU C 2 754  ? -2.652  20.256  17.502  1.00 2.72   ? 754  GLU C OE2   1 
ATOM   9086  N  N     . HIS C 2 755  ? 1.617   19.503  13.745  1.00 0.60   ? 755  HIS C N     1 
ATOM   9087  C  CA    . HIS C 2 755  ? 3.036   19.356  13.984  1.00 1.49   ? 755  HIS C CA    1 
ATOM   9088  C  C     . HIS C 2 755  ? 3.467   20.219  15.154  1.00 3.99   ? 755  HIS C C     1 
ATOM   9089  O  O     . HIS C 2 755  ? 3.200   21.416  15.190  1.00 4.54   ? 755  HIS C O     1 
ATOM   9090  C  CB    . HIS C 2 755  ? 3.801   19.703  12.720  1.00 12.13  ? 755  HIS C CB    1 
ATOM   9091  C  CG    . HIS C 2 755  ? 3.406   18.862  11.553  1.00 1.41   ? 755  HIS C CG    1 
ATOM   9092  N  ND1   . HIS C 2 755  ? 3.778   17.541  11.434  1.00 11.11  ? 755  HIS C ND1   1 
ATOM   9093  C  CD2   . HIS C 2 755  ? 2.636   19.135  10.474  1.00 4.34   ? 755  HIS C CD2   1 
ATOM   9094  C  CE1   . HIS C 2 755  ? 3.274   17.043  10.319  1.00 15.79  ? 755  HIS C CE1   1 
ATOM   9095  N  NE2   . HIS C 2 755  ? 2.578   17.989  9.718   1.00 13.21  ? 755  HIS C NE2   1 
ATOM   9096  N  N     . GLU C 2 756  ? 4.123   19.592  16.120  1.00 13.26  ? 756  GLU C N     1 
ATOM   9097  C  CA    . GLU C 2 756  ? 4.432   20.241  17.382  1.00 13.18  ? 756  GLU C CA    1 
ATOM   9098  C  C     . GLU C 2 756  ? 5.931   20.287  17.615  1.00 10.67  ? 756  GLU C C     1 
ATOM   9099  O  O     . GLU C 2 756  ? 6.665   19.439  17.122  1.00 0.20   ? 756  GLU C O     1 
ATOM   9100  C  CB    . GLU C 2 756  ? 3.736   19.501  18.525  1.00 6.19   ? 756  GLU C CB    1 
ATOM   9101  C  CG    . GLU C 2 756  ? 3.211   20.388  19.633  1.00 9.02   ? 756  GLU C CG    1 
ATOM   9102  C  CD    . GLU C 2 756  ? 2.179   19.682  20.496  1.00 11.31  ? 756  GLU C CD    1 
ATOM   9103  O  OE1   . GLU C 2 756  ? 2.159   18.431  20.510  1.00 13.76  ? 756  GLU C OE1   1 
ATOM   9104  O  OE2   . GLU C 2 756  ? 1.380   20.379  21.154  1.00 7.48   ? 756  GLU C OE2   1 
ATOM   9105  N  N     . ILE C 2 757  ? 6.381   21.292  18.353  1.00 10.50  ? 757  ILE C N     1 
ATOM   9106  C  CA    . ILE C 2 757  ? 7.754   21.330  18.828  1.00 4.23   ? 757  ILE C CA    1 
ATOM   9107  C  C     . ILE C 2 757  ? 7.886   22.344  19.953  1.00 7.31   ? 757  ILE C C     1 
ATOM   9108  O  O     . ILE C 2 757  ? 7.153   23.326  20.003  1.00 8.04   ? 757  ILE C O     1 
ATOM   9109  C  CB    . ILE C 2 757  ? 8.749   21.669  17.709  1.00 6.92   ? 757  ILE C CB    1 
ATOM   9110  C  CG1   . ILE C 2 757  ? 10.170  21.319  18.161  1.00 16.05  ? 757  ILE C CG1   1 
ATOM   9111  C  CG2   . ILE C 2 757  ? 8.629   23.126  17.309  1.00 3.84   ? 757  ILE C CG2   1 
ATOM   9112  C  CD1   . ILE C 2 757  ? 11.223  21.487  17.101  1.00 30.57  ? 757  ILE C CD1   1 
ATOM   9113  N  N     . ASP C 2 758  ? 8.818   22.095  20.864  1.00 8.79   ? 758  ASP C N     1 
ATOM   9114  C  CA    . ASP C 2 758  ? 8.986   22.953  22.023  1.00 8.34   ? 758  ASP C CA    1 
ATOM   9115  C  C     . ASP C 2 758  ? 10.449  23.264  22.287  1.00 15.11  ? 758  ASP C C     1 
ATOM   9116  O  O     . ASP C 2 758  ? 11.345  22.596  21.777  1.00 19.56  ? 758  ASP C O     1 
ATOM   9117  C  CB    . ASP C 2 758  ? 8.360   22.303  23.253  1.00 9.27   ? 758  ASP C CB    1 
ATOM   9118  C  CG    . ASP C 2 758  ? 8.989   20.967  23.589  1.00 28.07  ? 758  ASP C CG    1 
ATOM   9119  O  OD1   . ASP C 2 758  ? 9.720   20.416  22.736  1.00 33.21  ? 758  ASP C OD1   1 
ATOM   9120  O  OD2   . ASP C 2 758  ? 8.741   20.467  24.707  1.00 38.27  ? 758  ASP C OD2   1 
ATOM   9121  N  N     . ALA C 2 759  ? 10.674  24.289  23.096  1.00 15.30  ? 759  ALA C N     1 
ATOM   9122  C  CA    . ALA C 2 759  ? 12.019  24.714  23.444  1.00 21.34  ? 759  ALA C CA    1 
ATOM   9123  C  C     . ALA C 2 759  ? 12.265  24.515  24.937  1.00 27.95  ? 759  ALA C C     1 
ATOM   9124  O  O     . ALA C 2 759  ? 11.632  25.161  25.773  1.00 28.67  ? 759  ALA C O     1 
ATOM   9125  C  CB    . ALA C 2 759  ? 12.227  26.165  23.053  1.00 21.73  ? 759  ALA C CB    1 
ATOM   9126  N  N     . ARG C 2 760  ? 13.190  23.621  25.268  1.00 25.28  ? 760  ARG C N     1 
ATOM   9127  C  CA    . ARG C 2 760  ? 13.409  23.246  26.658  1.00 23.27  ? 760  ARG C CA    1 
ATOM   9128  C  C     . ARG C 2 760  ? 14.619  23.909  27.302  1.00 26.28  ? 760  ARG C C     1 
ATOM   9129  O  O     . ARG C 2 760  ? 15.372  24.642  26.661  1.00 26.11  ? 760  ARG C O     1 
ATOM   9130  C  CB    . ARG C 2 760  ? 13.564  21.730  26.776  1.00 25.93  ? 760  ARG C CB    1 
ATOM   9131  C  CG    . ARG C 2 760  ? 12.503  20.942  26.046  1.00 30.31  ? 760  ARG C CG    1 
ATOM   9132  C  CD    . ARG C 2 760  ? 12.742  19.446  26.160  1.00 39.46  ? 760  ARG C CD    1 
ATOM   9133  N  NE    . ARG C 2 760  ? 12.028  18.724  25.111  1.00 45.53  ? 760  ARG C NE    1 
ATOM   9134  C  CZ    . ARG C 2 760  ? 12.502  18.532  23.884  1.00 37.11  ? 760  ARG C CZ    1 
ATOM   9135  N  NH1   . ARG C 2 760  ? 13.697  19.001  23.551  1.00 33.92  ? 760  ARG C NH1   1 
ATOM   9136  N  NH2   . ARG C 2 760  ? 11.783  17.870  22.988  1.00 39.70  ? 760  ARG C NH2   1 
ATOM   9137  N  N     . ASP C 2 761  ? 14.781  23.632  28.591  1.00 27.91  ? 761  ASP C N     1 
ATOM   9138  C  CA    . ASP C 2 761  ? 15.984  23.980  29.331  1.00 31.19  ? 761  ASP C CA    1 
ATOM   9139  C  C     . ASP C 2 761  ? 16.931  22.785  29.362  1.00 34.91  ? 761  ASP C C     1 
ATOM   9140  O  O     . ASP C 2 761  ? 16.608  21.743  29.932  1.00 30.81  ? 761  ASP C O     1 
ATOM   9141  C  CB    . ASP C 2 761  ? 15.645  24.414  30.761  1.00 32.04  ? 761  ASP C CB    1 
ATOM   9142  C  CG    . ASP C 2 761  ? 15.050  25.808  30.829  1.00 26.24  ? 761  ASP C CG    1 
ATOM   9143  O  OD1   . ASP C 2 761  ? 15.311  26.614  29.913  1.00 31.14  ? 761  ASP C OD1   1 
ATOM   9144  O  OD2   . ASP C 2 761  ? 14.328  26.101  31.806  1.00 16.75  ? 761  ASP C OD2   1 
ATOM   9145  N  N     . THR C 2 762  ? 18.097  22.935  28.748  1.00 38.49  ? 762  THR C N     1 
ATOM   9146  C  CA    . THR C 2 762  ? 19.095  21.876  28.748  1.00 43.04  ? 762  THR C CA    1 
ATOM   9147  C  C     . THR C 2 762  ? 20.195  22.188  29.760  1.00 45.32  ? 762  THR C C     1 
ATOM   9148  O  O     . THR C 2 762  ? 20.088  23.139  30.528  1.00 46.25  ? 762  THR C O     1 
ATOM   9149  C  CB    . THR C 2 762  ? 19.705  21.680  27.344  1.00 42.51  ? 762  THR C CB    1 
ATOM   9150  O  OG1   . THR C 2 762  ? 20.566  20.536  27.349  1.00 45.47  ? 762  THR C OG1   1 
ATOM   9151  C  CG2   . THR C 2 762  ? 20.492  22.910  26.927  1.00 48.88  ? 762  THR C CG2   1 
ATOM   9152  N  N     . LYS C 2 763  ? 21.247  21.379  29.769  1.00 53.97  ? 763  LYS C N     1 
ATOM   9153  C  CA    . LYS C 2 763  ? 22.353  21.587  30.700  1.00 52.55  ? 763  LYS C CA    1 
ATOM   9154  C  C     . LYS C 2 763  ? 23.447  22.445  30.079  1.00 51.35  ? 763  LYS C C     1 
ATOM   9155  O  O     . LYS C 2 763  ? 24.446  22.763  30.724  1.00 53.10  ? 763  LYS C O     1 
ATOM   9156  C  CB    . LYS C 2 763  ? 22.935  20.249  31.148  1.00 61.43  ? 763  LYS C CB    1 
ATOM   9157  C  CG    . LYS C 2 763  ? 21.987  19.430  31.998  1.00 57.44  ? 763  LYS C CG    1 
ATOM   9158  C  CD    . LYS C 2 763  ? 21.770  20.086  33.346  1.00 44.44  ? 763  LYS C CD    1 
ATOM   9159  C  CE    . LYS C 2 763  ? 20.760  19.309  34.164  1.00 44.15  ? 763  LYS C CE    1 
ATOM   9160  N  NZ    . LYS C 2 763  ? 19.418  19.335  33.521  1.00 45.10  ? 763  LYS C NZ    1 
ATOM   9161  N  N     . LEU C 2 764  ? 23.252  22.817  28.820  1.00 53.42  ? 764  LEU C N     1 
ATOM   9162  C  CA    . LEU C 2 764  ? 24.222  23.630  28.100  1.00 57.65  ? 764  LEU C CA    1 
ATOM   9163  C  C     . LEU C 2 764  ? 23.643  25.010  27.822  1.00 57.18  ? 764  LEU C C     1 
ATOM   9164  O  O     . LEU C 2 764  ? 24.178  25.776  27.022  1.00 61.41  ? 764  LEU C O     1 
ATOM   9165  C  CB    . LEU C 2 764  ? 24.624  22.938  26.799  1.00 63.13  ? 764  LEU C CB    1 
ATOM   9166  C  CG    . LEU C 2 764  ? 25.210  21.540  27.003  1.00 64.62  ? 764  LEU C CG    1 
ATOM   9167  C  CD1   . LEU C 2 764  ? 24.937  20.655  25.805  1.00 66.27  ? 764  LEU C CD1   1 
ATOM   9168  C  CD2   . LEU C 2 764  ? 26.704  21.623  27.276  1.00 73.11  ? 764  LEU C CD2   1 
ATOM   9169  N  N     . GLY C 2 765  ? 22.549  25.320  28.506  1.00 51.91  ? 765  GLY C N     1 
ATOM   9170  C  CA    . GLY C 2 765  ? 21.815  26.547  28.275  1.00 46.84  ? 765  GLY C CA    1 
ATOM   9171  C  C     . GLY C 2 765  ? 20.350  26.217  28.096  1.00 46.07  ? 765  GLY C C     1 
ATOM   9172  O  O     . GLY C 2 765  ? 19.757  25.530  28.924  1.00 50.62  ? 765  GLY C O     1 
ATOM   9173  N  N     . ALA C 2 766  ? 19.766  26.692  27.006  1.00 45.33  ? 766  ALA C N     1 
ATOM   9174  C  CA    . ALA C 2 766  ? 18.372  26.397  26.718  1.00 38.59  ? 766  ALA C CA    1 
ATOM   9175  C  C     . ALA C 2 766  ? 18.098  26.538  25.233  1.00 40.96  ? 766  ALA C C     1 
ATOM   9176  O  O     . ALA C 2 766  ? 18.734  27.334  24.544  1.00 41.52  ? 766  ALA C O     1 
ATOM   9177  C  CB    . ALA C 2 766  ? 17.457  27.306  27.515  1.00 38.80  ? 766  ALA C CB    1 
ATOM   9178  N  N     . GLU C 2 767  ? 17.148  25.753  24.746  1.00 38.32  ? 767  GLU C N     1 
ATOM   9179  C  CA    . GLU C 2 767  ? 16.784  25.778  23.342  1.00 36.30  ? 767  GLU C CA    1 
ATOM   9180  C  C     . GLU C 2 767  ? 16.057  27.080  23.024  1.00 28.42  ? 767  GLU C C     1 
ATOM   9181  O  O     . GLU C 2 767  ? 15.127  27.460  23.729  1.00 26.44  ? 767  GLU C O     1 
ATOM   9182  C  CB    . GLU C 2 767  ? 15.914  24.561  23.002  1.00 36.48  ? 767  GLU C CB    1 
ATOM   9183  C  CG    . GLU C 2 767  ? 16.277  23.310  23.799  1.00 31.47  ? 767  GLU C CG    1 
ATOM   9184  C  CD    . GLU C 2 767  ? 15.544  22.068  23.330  1.00 28.30  ? 767  GLU C CD    1 
ATOM   9185  O  OE1   . GLU C 2 767  ? 14.327  22.154  23.068  1.00 32.76  ? 767  GLU C OE1   1 
ATOM   9186  O  OE2   . GLU C 2 767  ? 16.191  21.005  23.219  1.00 25.33  ? 767  GLU C OE2   1 
ATOM   9187  N  N     . GLU C 2 768  ? 16.489  27.779  21.980  1.00 25.06  ? 768  GLU C N     1 
ATOM   9188  C  CA    . GLU C 2 768  ? 15.749  28.953  21.534  1.00 23.55  ? 768  GLU C CA    1 
ATOM   9189  C  C     . GLU C 2 768  ? 15.288  28.789  20.090  1.00 18.54  ? 768  GLU C C     1 
ATOM   9190  O  O     . GLU C 2 768  ? 15.986  28.217  19.250  1.00 21.42  ? 768  GLU C O     1 
ATOM   9191  C  CB    . GLU C 2 768  ? 16.577  30.236  21.682  1.00 34.72  ? 768  GLU C CB    1 
ATOM   9192  C  CG    . GLU C 2 768  ? 17.679  30.429  20.647  1.00 37.28  ? 768  GLU C CG    1 
ATOM   9193  C  CD    . GLU C 2 768  ? 17.950  31.898  20.336  1.00 25.90  ? 768  GLU C CD    1 
ATOM   9194  O  OE1   . GLU C 2 768  ? 16.983  32.646  20.082  1.00 17.88  ? 768  GLU C OE1   1 
ATOM   9195  O  OE2   . GLU C 2 768  ? 19.132  32.303  20.345  1.00 32.26  ? 768  GLU C OE2   1 
ATOM   9196  N  N     . ILE C 2 769  ? 14.085  29.278  19.823  1.00 19.66  ? 769  ILE C N     1 
ATOM   9197  C  CA    . ILE C 2 769  ? 13.498  29.215  18.498  1.00 11.78  ? 769  ILE C CA    1 
ATOM   9198  C  C     . ILE C 2 769  ? 13.803  30.490  17.751  1.00 15.54  ? 769  ILE C C     1 
ATOM   9199  O  O     . ILE C 2 769  ? 13.332  31.557  18.127  1.00 25.72  ? 769  ILE C O     1 
ATOM   9200  C  CB    . ILE C 2 769  ? 11.985  29.025  18.564  1.00 12.23  ? 769  ILE C CB    1 
ATOM   9201  C  CG1   . ILE C 2 769  ? 11.644  27.734  19.308  1.00 13.32  ? 769  ILE C CG1   1 
ATOM   9202  C  CG2   . ILE C 2 769  ? 11.398  29.024  17.172  1.00 11.85  ? 769  ILE C CG2   1 
ATOM   9203  C  CD1   . ILE C 2 769  ? 10.178  27.567  19.567  1.00 10.38  ? 769  ILE C CD1   1 
ATOM   9204  N  N     . THR C 2 770  ? 14.590  30.382  16.690  1.00 11.19  ? 770  THR C N     1 
ATOM   9205  C  CA    . THR C 2 770  ? 15.013  31.568  15.966  1.00 14.95  ? 770  THR C CA    1 
ATOM   9206  C  C     . THR C 2 770  ? 15.095  31.371  14.464  1.00 13.75  ? 770  THR C C     1 
ATOM   9207  O  O     . THR C 2 770  ? 15.140  30.249  13.971  1.00 15.44  ? 770  THR C O     1 
ATOM   9208  C  CB    . THR C 2 770  ? 16.383  32.050  16.439  1.00 22.46  ? 770  THR C CB    1 
ATOM   9209  O  OG1   . THR C 2 770  ? 16.690  33.293  15.798  1.00 27.00  ? 770  THR C OG1   1 
ATOM   9210  C  CG2   . THR C 2 770  ? 17.444  31.032  16.080  1.00 29.33  ? 770  THR C CG2   1 
ATOM   9211  N  N     . ARG C 2 771  ? 15.125  32.484  13.742  1.00 16.91  ? 771  ARG C N     1 
ATOM   9212  C  CA    . ARG C 2 771  ? 15.274  32.463  12.293  1.00 22.79  ? 771  ARG C CA    1 
ATOM   9213  C  C     . ARG C 2 771  ? 16.740  32.274  11.908  1.00 30.62  ? 771  ARG C C     1 
ATOM   9214  O  O     . ARG C 2 771  ? 17.086  32.243  10.728  1.00 32.90  ? 771  ARG C O     1 
ATOM   9215  C  CB    . ARG C 2 771  ? 14.728  33.755  11.674  1.00 21.28  ? 771  ARG C CB    1 
ATOM   9216  C  CG    . ARG C 2 771  ? 14.537  33.691  10.167  1.00 22.13  ? 771  ARG C CG    1 
ATOM   9217  C  CD    . ARG C 2 771  ? 14.382  35.071  9.561   1.00 28.43  ? 771  ARG C CD    1 
ATOM   9218  N  NE    . ARG C 2 771  ? 14.154  35.002  8.120   1.00 36.63  ? 771  ARG C NE    1 
ATOM   9219  C  CZ    . ARG C 2 771  ? 15.122  34.944  7.211   1.00 36.67  ? 771  ARG C CZ    1 
ATOM   9220  N  NH1   . ARG C 2 771  ? 16.392  34.949  7.592   1.00 34.91  ? 771  ARG C NH1   1 
ATOM   9221  N  NH2   . ARG C 2 771  ? 14.821  34.884  5.919   1.00 36.27  ? 771  ARG C NH2   1 
ATOM   9222  N  N     . ASP C 2 772  ? 17.604  32.146  12.908  1.00 30.80  ? 772  ASP C N     1 
ATOM   9223  C  CA    . ASP C 2 772  ? 19.033  32.011  12.646  1.00 38.93  ? 772  ASP C CA    1 
ATOM   9224  C  C     . ASP C 2 772  ? 19.492  30.560  12.841  1.00 37.24  ? 772  ASP C C     1 
ATOM   9225  O  O     . ASP C 2 772  ? 19.718  30.102  13.963  1.00 26.21  ? 772  ASP C O     1 
ATOM   9226  C  CB    . ASP C 2 772  ? 19.826  32.970  13.541  1.00 41.73  ? 772  ASP C CB    1 
ATOM   9227  C  CG    . ASP C 2 772  ? 21.239  33.213  13.037  1.00 42.57  ? 772  ASP C CG    1 
ATOM   9228  O  OD1   . ASP C 2 772  ? 22.178  32.602  13.586  1.00 55.25  ? 772  ASP C OD1   1 
ATOM   9229  O  OD2   . ASP C 2 772  ? 21.410  34.020  12.098  1.00 33.04  ? 772  ASP C OD2   1 
ATOM   9230  N  N     . ILE C 2 773  ? 19.616  29.846  11.728  1.00 38.46  ? 773  ILE C N     1 
ATOM   9231  C  CA    . ILE C 2 773  ? 20.008  28.444  11.734  1.00 34.58  ? 773  ILE C CA    1 
ATOM   9232  C  C     . ILE C 2 773  ? 21.346  28.269  11.032  1.00 41.76  ? 773  ILE C C     1 
ATOM   9233  O  O     . ILE C 2 773  ? 21.526  28.747  9.914   1.00 42.46  ? 773  ILE C O     1 
ATOM   9234  C  CB    . ILE C 2 773  ? 18.947  27.564  11.046  1.00 40.89  ? 773  ILE C CB    1 
ATOM   9235  C  CG1   . ILE C 2 773  ? 17.598  27.708  11.752  1.00 44.38  ? 773  ILE C CG1   1 
ATOM   9236  C  CG2   . ILE C 2 773  ? 19.378  26.109  11.029  1.00 45.57  ? 773  ILE C CG2   1 
ATOM   9237  C  CD1   . ILE C 2 773  ? 16.514  26.806  11.195  1.00 36.48  ? 773  ILE C CD1   1 
ATOM   9238  N  N     . PRO C 2 774  ? 22.294  27.590  11.697  1.00 55.51  ? 774  PRO C N     1 
ATOM   9239  C  CA    . PRO C 2 774  ? 23.654  27.335  11.204  1.00 64.85  ? 774  PRO C CA    1 
ATOM   9240  C  C     . PRO C 2 774  ? 23.729  26.797  9.775   1.00 66.18  ? 774  PRO C C     1 
ATOM   9241  O  O     . PRO C 2 774  ? 23.126  25.767  9.471   1.00 63.52  ? 774  PRO C O     1 
ATOM   9242  C  CB    . PRO C 2 774  ? 24.182  26.289  12.189  1.00 59.50  ? 774  PRO C CB    1 
ATOM   9243  C  CG    . PRO C 2 774  ? 23.476  26.598  13.453  1.00 58.77  ? 774  PRO C CG    1 
ATOM   9244  C  CD    . PRO C 2 774  ? 22.104  27.070  13.063  1.00 56.68  ? 774  PRO C CD    1 
ATOM   9245  N  N     . ASN C 2 775  ? 24.467  27.504  8.920   1.00 70.25  ? 775  ASN C N     1 
ATOM   9246  C  CA    . ASN C 2 775  ? 24.794  27.040  7.570   1.00 69.45  ? 775  ASN C CA    1 
ATOM   9247  C  C     . ASN C 2 775  ? 23.575  26.721  6.703   1.00 53.64  ? 775  ASN C C     1 
ATOM   9248  O  O     . ASN C 2 775  ? 23.513  25.675  6.060   1.00 44.52  ? 775  ASN C O     1 
ATOM   9249  C  CB    . ASN C 2 775  ? 25.713  25.813  7.654   1.00 82.73  ? 775  ASN C CB    1 
ATOM   9250  C  CG    . ASN C 2 775  ? 27.064  26.133  8.282   1.00 82.91  ? 775  ASN C CG    1 
ATOM   9251  O  OD1   . ASN C 2 775  ? 27.614  27.217  8.080   1.00 79.34  ? 775  ASN C OD1   1 
ATOM   9252  N  ND2   . ASN C 2 775  ? 27.603  25.187  9.044   1.00 76.84  ? 775  ASN C ND2   1 
ATOM   9253  N  N     . ILE C 2 776  ? 22.610  27.635  6.690   1.00 45.52  ? 776  ILE C N     1 
ATOM   9254  C  CA    . ILE C 2 776  ? 21.410  27.481  5.878   1.00 38.07  ? 776  ILE C CA    1 
ATOM   9255  C  C     . ILE C 2 776  ? 21.157  28.744  5.068   1.00 42.75  ? 776  ILE C C     1 
ATOM   9256  O  O     . ILE C 2 776  ? 21.200  29.850  5.606   1.00 48.96  ? 776  ILE C O     1 
ATOM   9257  C  CB    . ILE C 2 776  ? 20.176  27.184  6.741   1.00 42.46  ? 776  ILE C CB    1 
ATOM   9258  C  CG1   . ILE C 2 776  ? 20.415  25.949  7.602   1.00 50.84  ? 776  ILE C CG1   1 
ATOM   9259  C  CG2   . ILE C 2 776  ? 18.960  26.975  5.871   1.00 40.51  ? 776  ILE C CG2   1 
ATOM   9260  C  CD1   . ILE C 2 776  ? 20.640  24.692  6.801   1.00 59.68  ? 776  ILE C CD1   1 
ATOM   9261  N  N     . SER C 2 777  ? 20.885  28.577  3.777   1.00 42.36  ? 777  SER C N     1 
ATOM   9262  C  CA    . SER C 2 777  ? 20.691  29.716  2.884   1.00 48.19  ? 777  SER C CA    1 
ATOM   9263  C  C     . SER C 2 777  ? 19.459  30.525  3.267   1.00 46.06  ? 777  SER C C     1 
ATOM   9264  O  O     . SER C 2 777  ? 18.553  30.014  3.921   1.00 48.17  ? 777  SER C O     1 
ATOM   9265  C  CB    . SER C 2 777  ? 20.569  29.248  1.433   1.00 40.22  ? 777  SER C CB    1 
ATOM   9266  O  OG    . SER C 2 777  ? 19.294  28.688  1.187   1.00 33.78  ? 777  SER C OG    1 
ATOM   9267  N  N     . ASP C 2 778  ? 19.428  31.788  2.854   1.00 49.46  ? 778  ASP C N     1 
ATOM   9268  C  CA    . ASP C 2 778  ? 18.262  32.630  3.094   1.00 54.12  ? 778  ASP C CA    1 
ATOM   9269  C  C     . ASP C 2 778  ? 17.070  32.119  2.296   1.00 50.82  ? 778  ASP C C     1 
ATOM   9270  O  O     . ASP C 2 778  ? 15.917  32.376  2.643   1.00 45.81  ? 778  ASP C O     1 
ATOM   9271  C  CB    . ASP C 2 778  ? 18.559  34.087  2.734   1.00 55.40  ? 778  ASP C CB    1 
ATOM   9272  C  CG    . ASP C 2 778  ? 19.517  34.739  3.705   1.00 56.78  ? 778  ASP C CG    1 
ATOM   9273  O  OD1   . ASP C 2 778  ? 19.631  34.245  4.846   1.00 56.13  ? 778  ASP C OD1   1 
ATOM   9274  O  OD2   . ASP C 2 778  ? 20.150  35.747  3.329   1.00 61.44  ? 778  ASP C OD2   1 
ATOM   9275  N  N     . GLU C 2 779  ? 17.363  31.387  1.228   1.00 45.70  ? 779  GLU C N     1 
ATOM   9276  C  CA    . GLU C 2 779  ? 16.328  30.833  0.370   1.00 42.13  ? 779  GLU C CA    1 
ATOM   9277  C  C     . GLU C 2 779  ? 15.465  29.841  1.133   1.00 41.19  ? 779  GLU C C     1 
ATOM   9278  O  O     . GLU C 2 779  ? 14.241  29.844  1.012   1.00 36.33  ? 779  GLU C O     1 
ATOM   9279  C  CB    . GLU C 2 779  ? 16.956  30.161  -0.845  1.00 46.75  ? 779  GLU C CB    1 
ATOM   9280  C  CG    . GLU C 2 779  ? 18.005  31.015  -1.518  1.00 46.99  ? 779  GLU C CG    1 
ATOM   9281  C  CD    . GLU C 2 779  ? 18.585  30.354  -2.744  1.00 58.19  ? 779  GLU C CD    1 
ATOM   9282  O  OE1   . GLU C 2 779  ? 17.995  29.360  -3.217  1.00 70.11  ? 779  GLU C OE1   1 
ATOM   9283  O  OE2   . GLU C 2 779  ? 19.633  30.826  -3.232  1.00 58.60  ? 779  GLU C OE2   1 
ATOM   9284  N  N     . VAL C 2 780  ? 16.114  28.994  1.924   1.00 46.24  ? 780  VAL C N     1 
ATOM   9285  C  CA    . VAL C 2 780  ? 15.408  28.021  2.743   1.00 42.07  ? 780  VAL C CA    1 
ATOM   9286  C  C     . VAL C 2 780  ? 14.600  28.734  3.821   1.00 42.08  ? 780  VAL C C     1 
ATOM   9287  O  O     . VAL C 2 780  ? 13.492  28.319  4.163   1.00 45.77  ? 780  VAL C O     1 
ATOM   9288  C  CB    . VAL C 2 780  ? 16.383  27.027  3.399   1.00 35.78  ? 780  VAL C CB    1 
ATOM   9289  C  CG1   . VAL C 2 780  ? 15.622  25.904  4.081   1.00 33.69  ? 780  VAL C CG1   1 
ATOM   9290  C  CG2   . VAL C 2 780  ? 17.341  26.466  2.363   1.00 39.93  ? 780  VAL C CG2   1 
ATOM   9291  N  N     . LEU C 2 781  ? 15.159  29.824  4.338   1.00 38.75  ? 781  LEU C N     1 
ATOM   9292  C  CA    . LEU C 2 781  ? 14.539  30.572  5.426   1.00 33.64  ? 781  LEU C CA    1 
ATOM   9293  C  C     . LEU C 2 781  ? 13.588  31.639  4.897   1.00 30.18  ? 781  LEU C C     1 
ATOM   9294  O  O     . LEU C 2 781  ? 13.007  32.406  5.664   1.00 27.82  ? 781  LEU C O     1 
ATOM   9295  C  CB    . LEU C 2 781  ? 15.613  31.217  6.301   1.00 34.84  ? 781  LEU C CB    1 
ATOM   9296  C  CG    . LEU C 2 781  ? 16.751  30.312  6.773   1.00 35.15  ? 781  LEU C CG    1 
ATOM   9297  C  CD1   . LEU C 2 781  ? 17.826  31.141  7.440   1.00 43.73  ? 781  LEU C CD1   1 
ATOM   9298  C  CD2   . LEU C 2 781  ? 16.239  29.249  7.724   1.00 31.67  ? 781  LEU C CD2   1 
ATOM   9299  N  N     . ALA C 2 782  ? 13.431  31.677  3.579   1.00 33.87  ? 782  ALA C N     1 
ATOM   9300  C  CA    . ALA C 2 782  ? 12.617  32.699  2.931   1.00 37.99  ? 782  ALA C CA    1 
ATOM   9301  C  C     . ALA C 2 782  ? 11.129  32.575  3.258   1.00 28.89  ? 782  ALA C C     1 
ATOM   9302  O  O     . ALA C 2 782  ? 10.366  33.518  3.047   1.00 26.78  ? 782  ALA C O     1 
ATOM   9303  C  CB    . ALA C 2 782  ? 12.821  32.648  1.428   1.00 47.64  ? 782  ALA C CB    1 
ATOM   9304  N  N     . ASP C 2 783  ? 10.714  31.418  3.763   1.00 24.60  ? 783  ASP C N     1 
ATOM   9305  C  CA    . ASP C 2 783  ? 9.303   31.195  4.060   1.00 17.97  ? 783  ASP C CA    1 
ATOM   9306  C  C     . ASP C 2 783  ? 8.994   31.396  5.535   1.00 17.22  ? 783  ASP C C     1 
ATOM   9307  O  O     . ASP C 2 783  ? 7.890   31.098  5.990   1.00 16.91  ? 783  ASP C O     1 
ATOM   9308  C  CB    . ASP C 2 783  ? 8.877   29.791  3.630   1.00 17.54  ? 783  ASP C CB    1 
ATOM   9309  C  CG    . ASP C 2 783  ? 8.333   29.756  2.217   1.00 21.45  ? 783  ASP C CG    1 
ATOM   9310  O  OD1   . ASP C 2 783  ? 8.568   28.753  1.512   1.00 27.43  ? 783  ASP C OD1   1 
ATOM   9311  O  OD2   . ASP C 2 783  ? 7.669   30.734  1.814   1.00 23.02  ? 783  ASP C OD2   1 
ATOM   9312  N  N     . LEU C 2 784  ? 9.967   31.913  6.277   1.00 18.02  ? 784  LEU C N     1 
ATOM   9313  C  CA    . LEU C 2 784  ? 9.809   32.100  7.715   1.00 17.08  ? 784  LEU C CA    1 
ATOM   9314  C  C     . LEU C 2 784  ? 9.566   33.557  8.102   1.00 15.30  ? 784  LEU C C     1 
ATOM   9315  O  O     . LEU C 2 784  ? 9.813   34.473  7.318   1.00 16.06  ? 784  LEU C O     1 
ATOM   9316  C  CB    . LEU C 2 784  ? 11.042  31.579  8.452   1.00 16.02  ? 784  LEU C CB    1 
ATOM   9317  C  CG    . LEU C 2 784  ? 11.400  30.107  8.259   1.00 16.52  ? 784  LEU C CG    1 
ATOM   9318  C  CD1   . LEU C 2 784  ? 12.547  29.727  9.172   1.00 24.11  ? 784  LEU C CD1   1 
ATOM   9319  C  CD2   . LEU C 2 784  ? 10.199  29.224  8.521   1.00 13.38  ? 784  LEU C CD2   1 
ATOM   9320  N  N     . ASP C 2 785  ? 9.082   33.760  9.323   1.00 11.73  ? 785  ASP C N     1 
ATOM   9321  C  CA    . ASP C 2 785  ? 8.946   35.099  9.869   1.00 11.11  ? 785  ASP C CA    1 
ATOM   9322  C  C     . ASP C 2 785  ? 10.194  35.448  10.663  1.00 11.47  ? 785  ASP C C     1 
ATOM   9323  O  O     . ASP C 2 785  ? 11.165  34.691  10.668  1.00 13.90  ? 785  ASP C O     1 
ATOM   9324  C  CB    . ASP C 2 785  ? 7.695   35.218  10.744  1.00 13.69  ? 785  ASP C CB    1 
ATOM   9325  C  CG    . ASP C 2 785  ? 7.627   34.158  11.832  1.00 13.79  ? 785  ASP C CG    1 
ATOM   9326  O  OD1   . ASP C 2 785  ? 8.685   33.697  12.308  1.00 17.84  ? 785  ASP C OD1   1 
ATOM   9327  O  OD2   . ASP C 2 785  ? 6.497   33.784  12.213  1.00 10.84  ? 785  ASP C OD2   1 
ATOM   9328  N  N     . GLU C 2 786  ? 10.169  36.581  11.352  1.00 13.06  ? 786  GLU C N     1 
ATOM   9329  C  CA    . GLU C 2 786  ? 11.349  37.008  12.089  1.00 20.10  ? 786  GLU C CA    1 
ATOM   9330  C  C     . GLU C 2 786  ? 11.578  36.125  13.314  1.00 14.08  ? 786  GLU C C     1 
ATOM   9331  O  O     . GLU C 2 786  ? 12.716  35.907  13.721  1.00 12.83  ? 786  GLU C O     1 
ATOM   9332  C  CB    . GLU C 2 786  ? 11.235  38.484  12.494  1.00 29.60  ? 786  GLU C CB    1 
ATOM   9333  C  CG    . GLU C 2 786  ? 10.503  38.744  13.800  1.00 22.96  ? 786  GLU C CG    1 
ATOM   9334  C  CD    . GLU C 2 786  ? 9.019   38.477  13.708  1.00 13.80  ? 786  GLU C CD    1 
ATOM   9335  O  OE1   . GLU C 2 786  ? 8.509   38.285  12.583  1.00 12.37  ? 786  GLU C OE1   1 
ATOM   9336  O  OE2   . GLU C 2 786  ? 8.364   38.461  14.769  1.00 15.30  ? 786  GLU C OE2   1 
ATOM   9337  N  N     . ARG C 2 787  ? 10.502  35.603  13.888  1.00 13.30  ? 787  ARG C N     1 
ATOM   9338  C  CA    . ARG C 2 787  ? 10.631  34.740  15.052  1.00 11.38  ? 787  ARG C CA    1 
ATOM   9339  C  C     . ARG C 2 787  ? 11.388  33.471  14.706  1.00 11.40  ? 787  ARG C C     1 
ATOM   9340  O  O     . ARG C 2 787  ? 12.358  33.118  15.368  1.00 14.71  ? 787  ARG C O     1 
ATOM   9341  C  CB    . ARG C 2 787  ? 9.260   34.385  15.611  1.00 10.48  ? 787  ARG C CB    1 
ATOM   9342  C  CG    . ARG C 2 787  ? 8.462   35.580  16.050  1.00 11.30  ? 787  ARG C CG    1 
ATOM   9343  C  CD    . ARG C 2 787  ? 7.071   35.161  16.437  1.00 9.21   ? 787  ARG C CD    1 
ATOM   9344  N  NE    . ARG C 2 787  ? 6.357   34.594  15.303  1.00 5.09   ? 787  ARG C NE    1 
ATOM   9345  C  CZ    . ARG C 2 787  ? 5.115   34.134  15.377  1.00 3.84   ? 787  ARG C CZ    1 
ATOM   9346  N  NH1   . ARG C 2 787  ? 4.464   34.180  16.532  1.00 4.23   ? 787  ARG C NH1   1 
ATOM   9347  N  NH2   . ARG C 2 787  ? 4.523   33.634  14.303  1.00 8.62   ? 787  ARG C NH2   1 
ATOM   9348  N  N     . GLY C 2 788  ? 10.936  32.797  13.656  1.00 13.42  ? 788  GLY C N     1 
ATOM   9349  C  CA    . GLY C 2 788  ? 11.521  31.539  13.239  1.00 13.51  ? 788  GLY C CA    1 
ATOM   9350  C  C     . GLY C 2 788  ? 10.416  30.582  12.854  1.00 9.93   ? 788  GLY C C     1 
ATOM   9351  O  O     . GLY C 2 788  ? 10.648  29.395  12.645  1.00 12.86  ? 788  GLY C O     1 
ATOM   9352  N  N     . ILE C 2 789  ? 9.204   31.116  12.763  1.00 11.64  ? 789  ILE C N     1 
ATOM   9353  C  CA    . ILE C 2 789  ? 8.025   30.329  12.419  1.00 15.12  ? 789  ILE C CA    1 
ATOM   9354  C  C     . ILE C 2 789  ? 7.652   30.501  10.946  1.00 11.74  ? 789  ILE C C     1 
ATOM   9355  O  O     . ILE C 2 789  ? 7.817   31.581  10.378  1.00 14.23  ? 789  ILE C O     1 
ATOM   9356  C  CB    . ILE C 2 789  ? 6.816   30.728  13.298  1.00 9.35   ? 789  ILE C CB    1 
ATOM   9357  C  CG1   . ILE C 2 789  ? 7.234   30.858  14.763  1.00 8.50   ? 789  ILE C CG1   1 
ATOM   9358  C  CG2   . ILE C 2 789  ? 5.686   29.726  13.162  1.00 2.79   ? 789  ILE C CG2   1 
ATOM   9359  C  CD1   . ILE C 2 789  ? 7.699   29.559  15.380  1.00 7.17   ? 789  ILE C CD1   1 
ATOM   9360  N  N     . VAL C 2 790  ? 7.153   29.434  10.330  1.00 12.12  ? 790  VAL C N     1 
ATOM   9361  C  CA    . VAL C 2 790  ? 6.657   29.521  8.968   1.00 8.51   ? 790  VAL C CA    1 
ATOM   9362  C  C     . VAL C 2 790  ? 5.489   30.497  8.948   1.00 3.27   ? 790  VAL C C     1 
ATOM   9363  O  O     . VAL C 2 790  ? 4.830   30.710  9.962   1.00 3.53   ? 790  VAL C O     1 
ATOM   9364  C  CB    . VAL C 2 790  ? 6.230   28.137  8.424   1.00 5.33   ? 790  VAL C CB    1 
ATOM   9365  C  CG1   . VAL C 2 790  ? 4.969   27.657  9.120   1.00 6.53   ? 790  VAL C CG1   1 
ATOM   9366  C  CG2   . VAL C 2 790  ? 6.020   28.188  6.921   1.00 8.38   ? 790  VAL C CG2   1 
ATOM   9367  N  N     . ARG C 2 791  ? 5.251   31.112  7.801   1.00 2.15   ? 791  ARG C N     1 
ATOM   9368  C  CA    . ARG C 2 791  ? 4.175   32.073  7.693   1.00 3.32   ? 791  ARG C CA    1 
ATOM   9369  C  C     . ARG C 2 791  ? 2.912   31.405  7.187   1.00 0.81   ? 791  ARG C C     1 
ATOM   9370  O  O     . ARG C 2 791  ? 2.954   30.573  6.284   1.00 1.94   ? 791  ARG C O     1 
ATOM   9371  C  CB    . ARG C 2 791  ? 4.577   33.212  6.774   1.00 10.51  ? 791  ARG C CB    1 
ATOM   9372  C  CG    . ARG C 2 791  ? 6.043   33.568  6.906   1.00 13.63  ? 791  ARG C CG    1 
ATOM   9373  C  CD    . ARG C 2 791  ? 6.283   35.023  6.578   1.00 17.74  ? 791  ARG C CD    1 
ATOM   9374  N  NE    . ARG C 2 791  ? 6.114   35.314  5.161   1.00 11.63  ? 791  ARG C NE    1 
ATOM   9375  C  CZ    . ARG C 2 791  ? 7.111   35.304  4.288   1.00 13.96  ? 791  ARG C CZ    1 
ATOM   9376  N  NH1   . ARG C 2 791  ? 8.337   35.013  4.697   1.00 20.82  ? 791  ARG C NH1   1 
ATOM   9377  N  NH2   . ARG C 2 791  ? 6.886   35.587  3.015   1.00 19.39  ? 791  ARG C NH2   1 
ATOM   9378  N  N     . ILE C 2 792  ? 1.789   31.766  7.792   1.00 2.91   ? 792  ILE C N     1 
ATOM   9379  C  CA    . ILE C 2 792  ? 0.500   31.240  7.389   1.00 10.41  ? 792  ILE C CA    1 
ATOM   9380  C  C     . ILE C 2 792  ? 0.250   31.492  5.921   1.00 4.17   ? 792  ILE C C     1 
ATOM   9381  O  O     . ILE C 2 792  ? 0.455   32.598  5.425   1.00 9.21   ? 792  ILE C O     1 
ATOM   9382  C  CB    . ILE C 2 792  ? -0.636  31.870  8.183   1.00 9.02   ? 792  ILE C CB    1 
ATOM   9383  C  CG1   . ILE C 2 792  ? -0.376  31.749  9.683   1.00 1.08   ? 792  ILE C CG1   1 
ATOM   9384  C  CG2   . ILE C 2 792  ? -1.953  31.233  7.798   1.00 8.88   ? 792  ILE C CG2   1 
ATOM   9385  C  CD1   . ILE C 2 792  ? -1.499  32.310  10.533  1.00 1.86   ? 792  ILE C CD1   1 
ATOM   9386  N  N     . GLY C 2 793  ? -0.195  30.451  5.233   1.00 5.03   ? 793  GLY C N     1 
ATOM   9387  C  CA    . GLY C 2 793  ? -0.560  30.551  3.838   1.00 9.87   ? 793  GLY C CA    1 
ATOM   9388  C  C     . GLY C 2 793  ? 0.540   30.053  2.932   1.00 11.43  ? 793  GLY C C     1 
ATOM   9389  O  O     . GLY C 2 793  ? 0.312   29.792  1.752   1.00 12.83  ? 793  GLY C O     1 
ATOM   9390  N  N     . ALA C 2 794  ? 1.739   29.923  3.484   1.00 9.27   ? 794  ALA C N     1 
ATOM   9391  C  CA    . ALA C 2 794  ? 2.871   29.462  2.702   1.00 10.60  ? 794  ALA C CA    1 
ATOM   9392  C  C     . ALA C 2 794  ? 2.679   28.016  2.295   1.00 5.61   ? 794  ALA C C     1 
ATOM   9393  O  O     . ALA C 2 794  ? 1.808   27.316  2.816   1.00 6.05   ? 794  ALA C O     1 
ATOM   9394  C  CB    . ALA C 2 794  ? 4.167   29.632  3.478   1.00 13.26  ? 794  ALA C CB    1 
ATOM   9395  N  N     . GLU C 2 795  ? 3.493   27.581  1.345   1.00 6.79   ? 795  GLU C N     1 
ATOM   9396  C  CA    . GLU C 2 795  ? 3.441   26.215  0.868   1.00 6.56   ? 795  GLU C CA    1 
ATOM   9397  C  C     . GLU C 2 795  ? 4.618   25.466  1.458   1.00 8.85   ? 795  GLU C C     1 
ATOM   9398  O  O     . GLU C 2 795  ? 5.726   25.995  1.509   1.00 15.13  ? 795  GLU C O     1 
ATOM   9399  C  CB    . GLU C 2 795  ? 3.480   26.169  -0.654  1.00 5.20   ? 795  GLU C CB    1 
ATOM   9400  N  N     . VAL C 2 796  ? 4.384   24.245  1.919   1.00 6.24   ? 796  VAL C N     1 
ATOM   9401  C  CA    . VAL C 2 796  ? 5.456   23.454  2.495   1.00 8.09   ? 796  VAL C CA    1 
ATOM   9402  C  C     . VAL C 2 796  ? 5.641   22.133  1.758   1.00 10.81  ? 796  VAL C C     1 
ATOM   9403  O  O     . VAL C 2 796  ? 4.676   21.435  1.438   1.00 15.19  ? 796  VAL C O     1 
ATOM   9404  C  CB    . VAL C 2 796  ? 5.209   23.189  3.991   1.00 9.20   ? 796  VAL C CB    1 
ATOM   9405  C  CG1   . VAL C 2 796  ? 5.422   24.465  4.782   1.00 10.67  ? 796  VAL C CG1   1 
ATOM   9406  C  CG2   . VAL C 2 796  ? 3.809   22.654  4.221   1.00 6.94   ? 796  VAL C CG2   1 
ATOM   9407  N  N     . ARG C 2 797  ? 6.895   21.819  1.462   1.00 10.31  ? 797  ARG C N     1 
ATOM   9408  C  CA    . ARG C 2 797  ? 7.255   20.531  0.898   1.00 15.27  ? 797  ARG C CA    1 
ATOM   9409  C  C     . ARG C 2 797  ? 7.997   19.753  1.975   1.00 18.49  ? 797  ARG C C     1 
ATOM   9410  O  O     . ARG C 2 797  ? 8.366   20.324  2.998   1.00 18.11  ? 797  ARG C O     1 
ATOM   9411  C  CB    . ARG C 2 797  ? 8.113   20.702  -0.353  1.00 18.74  ? 797  ARG C CB    1 
ATOM   9412  C  CG    . ARG C 2 797  ? 7.509   20.075  -1.599  1.00 26.65  ? 797  ARG C CG    1 
ATOM   9413  C  CD    . ARG C 2 797  ? 8.441   20.205  -2.793  1.00 32.15  ? 797  ARG C CD    1 
ATOM   9414  N  NE    . ARG C 2 797  ? 8.302   19.079  -3.713  1.00 40.43  ? 797  ARG C NE    1 
ATOM   9415  C  CZ    . ARG C 2 797  ? 8.871   17.891  -3.527  1.00 41.25  ? 797  ARG C CZ    1 
ATOM   9416  N  NH1   . ARG C 2 797  ? 9.613   17.670  -2.449  1.00 39.54  ? 797  ARG C NH1   1 
ATOM   9417  N  NH2   . ARG C 2 797  ? 8.697   16.920  -4.415  1.00 39.21  ? 797  ARG C NH2   1 
ATOM   9418  N  N     . ASP C 2 798  ? 8.209   18.459  1.764   1.00 16.30  ? 798  ASP C N     1 
ATOM   9419  C  CA    . ASP C 2 798  ? 8.878   17.650  2.775   1.00 15.73  ? 798  ASP C CA    1 
ATOM   9420  C  C     . ASP C 2 798  ? 10.347  18.029  2.852   1.00 14.82  ? 798  ASP C C     1 
ATOM   9421  O  O     . ASP C 2 798  ? 10.976  18.324  1.838   1.00 14.17  ? 798  ASP C O     1 
ATOM   9422  C  CB    . ASP C 2 798  ? 8.720   16.155  2.481   1.00 22.65  ? 798  ASP C CB    1 
ATOM   9423  C  CG    . ASP C 2 798  ? 9.438   15.729  1.219   1.00 28.50  ? 798  ASP C CG    1 
ATOM   9424  O  OD1   . ASP C 2 798  ? 9.570   16.568  0.303   1.00 27.41  ? 798  ASP C OD1   1 
ATOM   9425  O  OD2   . ASP C 2 798  ? 9.874   14.559  1.147   1.00 30.97  ? 798  ASP C OD2   1 
ATOM   9426  N  N     . GLY C 2 799  ? 10.883  18.032  4.066   1.00 16.63  ? 799  GLY C N     1 
ATOM   9427  C  CA    . GLY C 2 799  ? 12.269  18.393  4.289   1.00 19.59  ? 799  GLY C CA    1 
ATOM   9428  C  C     . GLY C 2 799  ? 12.425  19.855  4.651   1.00 15.97  ? 799  GLY C C     1 
ATOM   9429  O  O     . GLY C 2 799  ? 13.440  20.264  5.210   1.00 15.89  ? 799  GLY C O     1 
ATOM   9430  N  N     . ASP C 2 800  ? 11.415  20.649  4.320   1.00 16.37  ? 800  ASP C N     1 
ATOM   9431  C  CA    . ASP C 2 800  ? 11.451  22.079  4.598   1.00 19.23  ? 800  ASP C CA    1 
ATOM   9432  C  C     . ASP C 2 800  ? 11.442  22.359  6.094   1.00 18.65  ? 800  ASP C C     1 
ATOM   9433  O  O     . ASP C 2 800  ? 11.351  21.447  6.913   1.00 13.79  ? 800  ASP C O     1 
ATOM   9434  C  CB    . ASP C 2 800  ? 10.271  22.792  3.939   1.00 23.32  ? 800  ASP C CB    1 
ATOM   9435  C  CG    . ASP C 2 800  ? 10.409  22.885  2.435   1.00 26.31  ? 800  ASP C CG    1 
ATOM   9436  O  OD1   . ASP C 2 800  ? 11.554  22.987  1.940   1.00 27.59  ? 800  ASP C OD1   1 
ATOM   9437  O  OD2   . ASP C 2 800  ? 9.367   22.858  1.747   1.00 29.25  ? 800  ASP C OD2   1 
ATOM   9438  N  N     . ILE C 2 801  ? 11.528  23.637  6.438   1.00 21.54  ? 801  ILE C N     1 
ATOM   9439  C  CA    . ILE C 2 801  ? 11.564  24.058  7.828   1.00 16.30  ? 801  ILE C CA    1 
ATOM   9440  C  C     . ILE C 2 801  ? 10.235  24.657  8.262   1.00 16.15  ? 801  ILE C C     1 
ATOM   9441  O  O     . ILE C 2 801  ? 9.709   25.562  7.616   1.00 18.11  ? 801  ILE C O     1 
ATOM   9442  C  CB    . ILE C 2 801  ? 12.675  25.087  8.062   1.00 17.99  ? 801  ILE C CB    1 
ATOM   9443  C  CG1   . ILE C 2 801  ? 14.015  24.537  7.573   1.00 29.86  ? 801  ILE C CG1   1 
ATOM   9444  C  CG2   . ILE C 2 801  ? 12.742  25.471  9.527   1.00 17.41  ? 801  ILE C CG2   1 
ATOM   9445  C  CD1   . ILE C 2 801  ? 15.172  25.503  7.735   1.00 39.47  ? 801  ILE C CD1   1 
ATOM   9446  N  N     . LEU C 2 802  ? 9.699   24.150  9.365   1.00 18.63  ? 802  LEU C N     1 
ATOM   9447  C  CA    . LEU C 2 802  ? 8.451   24.667  9.908   1.00 14.29  ? 802  LEU C CA    1 
ATOM   9448  C  C     . LEU C 2 802  ? 8.696   25.625  11.064  1.00 9.13   ? 802  LEU C C     1 
ATOM   9449  O  O     . LEU C 2 802  ? 8.147   26.722  11.096  1.00 9.74   ? 802  LEU C O     1 
ATOM   9450  C  CB    . LEU C 2 802  ? 7.554   23.524  10.367  1.00 9.85   ? 802  LEU C CB    1 
ATOM   9451  C  CG    . LEU C 2 802  ? 7.086   22.592  9.253   1.00 8.01   ? 802  LEU C CG    1 
ATOM   9452  C  CD1   . LEU C 2 802  ? 6.137   21.563  9.824   1.00 6.80   ? 802  LEU C CD1   1 
ATOM   9453  C  CD2   . LEU C 2 802  ? 6.430   23.385  8.131   1.00 6.97   ? 802  LEU C CD2   1 
ATOM   9454  N  N     . VAL C 2 803  ? 9.512   25.199  12.020  1.00 8.16   ? 803  VAL C N     1 
ATOM   9455  C  CA    . VAL C 2 803  ? 9.857   26.031  13.166  1.00 5.58   ? 803  VAL C CA    1 
ATOM   9456  C  C     . VAL C 2 803  ? 11.344  25.906  13.481  1.00 12.33  ? 803  VAL C C     1 
ATOM   9457  O  O     . VAL C 2 803  ? 11.813  24.863  13.931  1.00 15.48  ? 803  VAL C O     1 
ATOM   9458  C  CB    . VAL C 2 803  ? 9.033   25.657  14.404  1.00 4.95   ? 803  VAL C CB    1 
ATOM   9459  C  CG1   . VAL C 2 803  ? 9.563   26.369  15.628  1.00 7.89   ? 803  VAL C CG1   1 
ATOM   9460  C  CG2   . VAL C 2 803  ? 7.573   26.004  14.190  1.00 4.76   ? 803  VAL C CG2   1 
ATOM   9461  N  N     . GLY C 2 804  ? 12.083  26.981  13.234  1.00 14.36  ? 804  GLY C N     1 
ATOM   9462  C  CA    . GLY C 2 804  ? 13.527  26.981  13.387  1.00 13.88  ? 804  GLY C CA    1 
ATOM   9463  C  C     . GLY C 2 804  ? 13.998  27.013  14.826  1.00 16.73  ? 804  GLY C C     1 
ATOM   9464  O  O     . GLY C 2 804  ? 13.987  28.061  15.472  1.00 19.62  ? 804  GLY C O     1 
ATOM   9465  N  N     . LYS C 2 805  ? 14.422  25.860  15.329  1.00 14.13  ? 805  LYS C N     1 
ATOM   9466  C  CA    . LYS C 2 805  ? 14.925  25.769  16.693  1.00 18.18  ? 805  LYS C CA    1 
ATOM   9467  C  C     . LYS C 2 805  ? 16.385  25.350  16.706  1.00 22.35  ? 805  LYS C C     1 
ATOM   9468  O  O     . LYS C 2 805  ? 16.802  24.513  15.908  1.00 25.62  ? 805  LYS C O     1 
ATOM   9469  C  CB    . LYS C 2 805  ? 14.094  24.778  17.511  1.00 25.77  ? 805  LYS C CB    1 
ATOM   9470  C  CG    . LYS C 2 805  ? 14.418  24.764  19.003  1.00 31.52  ? 805  LYS C CG    1 
ATOM   9471  C  CD    . LYS C 2 805  ? 13.740  23.603  19.717  1.00 26.03  ? 805  LYS C CD    1 
ATOM   9472  C  CE    . LYS C 2 805  ? 14.447  22.289  19.424  1.00 24.29  ? 805  LYS C CE    1 
ATOM   9473  N  NZ    . LYS C 2 805  ? 13.742  21.121  20.019  1.00 28.11  ? 805  LYS C NZ    1 
ATOM   9474  N  N     . VAL C 2 806  ? 17.159  25.934  17.614  1.00 23.92  ? 806  VAL C N     1 
ATOM   9475  C  CA    . VAL C 2 806  ? 18.554  25.554  17.774  1.00 33.67  ? 806  VAL C CA    1 
ATOM   9476  C  C     . VAL C 2 806  ? 18.873  25.289  19.241  1.00 33.86  ? 806  VAL C C     1 
ATOM   9477  O  O     . VAL C 2 806  ? 18.295  25.908  20.135  1.00 26.90  ? 806  VAL C O     1 
ATOM   9478  C  CB    . VAL C 2 806  ? 19.509  26.635  17.224  1.00 42.44  ? 806  VAL C CB    1 
ATOM   9479  C  CG1   . VAL C 2 806  ? 19.369  26.758  15.708  1.00 41.94  ? 806  VAL C CG1   1 
ATOM   9480  C  CG2   . VAL C 2 806  ? 19.255  27.970  17.904  1.00 46.45  ? 806  VAL C CG2   1 
ATOM   9481  N  N     . THR C 2 807  ? 19.790  24.353  19.475  1.00 44.61  ? 807  THR C N     1 
ATOM   9482  C  CA    . THR C 2 807  ? 20.165  23.944  20.824  1.00 48.34  ? 807  THR C CA    1 
ATOM   9483  C  C     . THR C 2 807  ? 21.683  23.962  21.019  1.00 53.26  ? 807  THR C C     1 
ATOM   9484  O  O     . THR C 2 807  ? 22.432  23.584  20.117  1.00 49.67  ? 807  THR C O     1 
ATOM   9485  C  CB    . THR C 2 807  ? 19.640  22.531  21.146  1.00 43.02  ? 807  THR C CB    1 
ATOM   9486  O  OG1   . THR C 2 807  ? 20.291  21.576  20.301  1.00 47.89  ? 807  THR C OG1   1 
ATOM   9487  C  CG2   . THR C 2 807  ? 18.138  22.448  20.928  1.00 33.77  ? 807  THR C CG2   1 
ATOM   9488  N  N     . PRO C 2 808  ? 22.141  24.400  22.205  1.00 65.30  ? 808  PRO C N     1 
ATOM   9489  C  CA    . PRO C 2 808  ? 23.578  24.433  22.499  1.00 58.60  ? 808  PRO C CA    1 
ATOM   9490  C  C     . PRO C 2 808  ? 24.157  23.032  22.601  1.00 52.90  ? 808  PRO C C     1 
ATOM   9491  O  O     . PRO C 2 808  ? 23.699  22.247  23.425  1.00 52.63  ? 808  PRO C O     1 
ATOM   9492  C  CB    . PRO C 2 808  ? 23.648  25.155  23.848  1.00 63.22  ? 808  PRO C CB    1 
ATOM   9493  C  CG    . PRO C 2 808  ? 22.314  24.919  24.471  1.00 63.14  ? 808  PRO C CG    1 
ATOM   9494  C  CD    . PRO C 2 808  ? 21.333  24.884  23.338  1.00 66.19  ? 808  PRO C CD    1 
ATOM   9495  N  N     . LYS C 2 809  ? 25.142  22.719  21.766  1.00 63.97  ? 809  LYS C N     1 
ATOM   9496  C  CA    . LYS C 2 809  ? 25.718  21.379  21.751  1.00 77.61  ? 809  LYS C CA    1 
ATOM   9497  C  C     . LYS C 2 809  ? 26.819  21.254  22.798  1.00 79.14  ? 809  LYS C C     1 
ATOM   9498  O  O     . LYS C 2 809  ? 27.431  22.250  23.186  1.00 82.88  ? 809  LYS C O     1 
ATOM   9499  C  CB    . LYS C 2 809  ? 26.257  21.043  20.357  1.00 75.05  ? 809  LYS C CB    1 
ATOM   9500  C  CG    . LYS C 2 809  ? 26.499  19.560  20.114  1.00 63.92  ? 809  LYS C CG    1 
ATOM   9501  C  CD    . LYS C 2 809  ? 26.676  19.284  18.632  1.00 63.48  ? 809  LYS C CD    1 
ATOM   9502  C  CE    . LYS C 2 809  ? 26.878  17.807  18.345  1.00 61.82  ? 809  LYS C CE    1 
ATOM   9503  N  NZ    . LYS C 2 809  ? 26.951  17.547  16.878  1.00 48.51  ? 809  LYS C NZ    1 
ATOM   9504  N  N     . GLY C 2 810  ? 27.056  20.028  23.259  1.00 68.84  ? 810  GLY C N     1 
ATOM   9505  C  CA    . GLY C 2 810  ? 28.073  19.769  24.260  1.00 69.95  ? 810  GLY C CA    1 
ATOM   9506  C  C     . GLY C 2 810  ? 29.448  20.203  23.799  1.00 80.22  ? 810  GLY C C     1 
ATOM   9507  O  O     . GLY C 2 810  ? 29.874  19.869  22.693  1.00 81.61  ? 810  GLY C O     1 
ATOM   9508  N  N     . GLU C 2 811  ? 30.145  20.953  24.646  1.00 82.77  ? 811  GLU C N     1 
ATOM   9509  C  CA    . GLU C 2 811  ? 31.463  21.469  24.298  1.00 84.63  ? 811  GLU C CA    1 
ATOM   9510  C  C     . GLU C 2 811  ? 32.508  20.355  24.273  1.00 80.32  ? 811  GLU C C     1 
ATOM   9511  O  O     . GLU C 2 811  ? 33.452  20.353  25.065  1.00 76.99  ? 811  GLU C O     1 
ATOM   9512  C  CB    . GLU C 2 811  ? 31.887  22.568  25.276  1.00 91.53  ? 811  GLU C CB    1 
ATOM   9513  C  CG    . GLU C 2 811  ? 33.079  23.397  24.808  1.00 98.56  ? 811  GLU C CG    1 
ATOM   9514  C  CD    . GLU C 2 811  ? 33.591  24.339  25.880  1.00 106.29 ? 811  GLU C CD    1 
ATOM   9515  O  OE1   . GLU C 2 811  ? 33.064  24.296  27.013  1.00 106.58 ? 811  GLU C OE1   1 
ATOM   9516  O  OE2   . GLU C 2 811  ? 34.521  25.122  25.591  1.00 105.82 ? 811  GLU C OE2   1 
ATOM   9517  N  N     . THR C 2 812  ? 32.326  19.399  23.368  1.00 69.62  ? 812  THR C N     1 
ATOM   9518  C  CA    . THR C 2 812  ? 33.325  18.365  23.149  1.00 61.67  ? 812  THR C CA    1 
ATOM   9519  C  C     . THR C 2 812  ? 34.346  18.884  22.157  1.00 62.97  ? 812  THR C C     1 
ATOM   9520  O  O     . THR C 2 812  ? 34.005  19.646  21.254  1.00 66.06  ? 812  THR C O     1 
ATOM   9521  C  CB    . THR C 2 812  ? 32.71