data_5UHE
# 
_entry.id   5UHE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5UHE         
WWPDB D_1000225867 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5UH6 unspecified 
PDB . 5UH7 unspecified 
PDB . 5UH8 unspecified 
PDB . 5UH9 unspecified 
PDB . 5UHA unspecified 
PDB . 5UHB unspecified 
PDB . 5UHC unspecified 
PDB . 5UHD unspecified 
PDB . 5UHF unspecified 
PDB . 5UHG unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5UHE 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lin, W.'       1 ? 
'Das, K.'       2 ? 
'Feng, Y.'      3 ? 
'Ebright, R.H.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            66 
_citation.language                  ? 
_citation.page_first                169 
_citation.page_last                 179.e8 
_citation.title                     'Structural Basis of Mycobacterium tuberculosis Transcription and Transcription Inhibition.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2017.03.001 
_citation.pdbx_database_id_PubMed   28392175 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lin, W.'       1  
primary 'Mandal, S.'    2  
primary 'Degen, D.'     3  
primary 'Liu, Y.'       4  
primary 'Ebright, Y.W.' 5  
primary 'Li, S.'        6  
primary 'Feng, Y.'      7  
primary 'Zhang, Y.'     8  
primary 'Mandal, S.'    9  
primary 'Jiang, Y.'     10 
primary 'Liu, S.'       11 
primary 'Gigliotti, M.' 12 
primary 'Talaue, M.'    13 
primary 'Connell, N.'   14 
primary 'Das, K.'       15 
primary 'Arnold, E.'    16 
primary 'Ebright, R.H.' 17 
# 
_cell.length_a           151.531 
_cell.length_b           162.155 
_cell.length_c           195.681 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5UHE 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         5UHE 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed RNA polymerase subunit alpha'                                           37745.328  2 2.7.7.6 ? ? 
? 
2  polymer     man 'DNA-directed RNA polymerase subunit beta'                                            130018.828 1 2.7.7.6 ? ? 
? 
3  polymer     man 
;DNA-directed RNA polymerase subunit beta'
;
146968.969 1 2.7.7.6 ? ? ? 
4  polymer     man 'DNA-directed RNA polymerase subunit omega'                                           11851.140  1 2.7.7.6 ? ? 
? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                                    57877.160  1 ?       ? ? 
? 
6  polymer     syn 
;DNA (5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*G)-3')
;
7160.632   1 ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*CP*AP*GP*G)-3')
;
4939.204   1 ?       ? ? ? 
8  non-polymer syn 'ZINC ION'                                                                            65.409     2 ?       ? ? 
? 
9  non-polymer syn 'MAGNESIUM ION'                                                                       24.305     1 ?       ? ? 
? 
10 non-polymer syn 'Nalpha-(benzenecarbonyl)-N-(2-methylphenyl)-D-phenylalaninamide'                     358.433    1 ?       ? ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
5 Sigma-A                                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
A,B ? 
2 'polypeptide(L)'        no no 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
C   ? 
3 'polypeptide(L)'        no no 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
D   ? 
4 'polypeptide(L)'        no no 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
E   ? 
5 'polypeptide(L)'        no no 
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
F   ? 
6 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)
;
TATAATGGGAGCTGTCACGGATG H   ? 
7 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)' CATCCGTGAGTCGAGG G   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ILE n 
1 4    SER n 
1 5    GLN n 
1 6    ARG n 
1 7    PRO n 
1 8    THR n 
1 9    LEU n 
1 10   SER n 
1 11   GLU n 
1 12   ASP n 
1 13   VAL n 
1 14   LEU n 
1 15   THR n 
1 16   ASP n 
1 17   ASN n 
1 18   ARG n 
1 19   SER n 
1 20   GLN n 
1 21   PHE n 
1 22   VAL n 
1 23   ILE n 
1 24   GLU n 
1 25   PRO n 
1 26   LEU n 
1 27   GLU n 
1 28   PRO n 
1 29   GLY n 
1 30   PHE n 
1 31   GLY n 
1 32   TYR n 
1 33   THR n 
1 34   LEU n 
1 35   GLY n 
1 36   ASN n 
1 37   SER n 
1 38   LEU n 
1 39   ARG n 
1 40   ARG n 
1 41   THR n 
1 42   LEU n 
1 43   LEU n 
1 44   SER n 
1 45   SER n 
1 46   ILE n 
1 47   PRO n 
1 48   GLY n 
1 49   ALA n 
1 50   ALA n 
1 51   VAL n 
1 52   THR n 
1 53   SER n 
1 54   ILE n 
1 55   ARG n 
1 56   ILE n 
1 57   ASP n 
1 58   GLY n 
1 59   VAL n 
1 60   LEU n 
1 61   HIS n 
1 62   GLU n 
1 63   PHE n 
1 64   THR n 
1 65   THR n 
1 66   VAL n 
1 67   PRO n 
1 68   GLY n 
1 69   VAL n 
1 70   LYS n 
1 71   GLU n 
1 72   ASP n 
1 73   VAL n 
1 74   THR n 
1 75   GLU n 
1 76   ILE n 
1 77   ILE n 
1 78   LEU n 
1 79   ASN n 
1 80   LEU n 
1 81   LYS n 
1 82   SER n 
1 83   LEU n 
1 84   VAL n 
1 85   VAL n 
1 86   SER n 
1 87   SER n 
1 88   GLU n 
1 89   GLU n 
1 90   ASP n 
1 91   GLU n 
1 92   PRO n 
1 93   VAL n 
1 94   THR n 
1 95   MET n 
1 96   TYR n 
1 97   LEU n 
1 98   ARG n 
1 99   LYS n 
1 100  GLN n 
1 101  GLY n 
1 102  PRO n 
1 103  GLY n 
1 104  GLU n 
1 105  VAL n 
1 106  THR n 
1 107  ALA n 
1 108  GLY n 
1 109  ASP n 
1 110  ILE n 
1 111  VAL n 
1 112  PRO n 
1 113  PRO n 
1 114  ALA n 
1 115  GLY n 
1 116  VAL n 
1 117  THR n 
1 118  VAL n 
1 119  HIS n 
1 120  ASN n 
1 121  PRO n 
1 122  GLY n 
1 123  MET n 
1 124  HIS n 
1 125  ILE n 
1 126  ALA n 
1 127  THR n 
1 128  LEU n 
1 129  ASN n 
1 130  ASP n 
1 131  LYS n 
1 132  GLY n 
1 133  LYS n 
1 134  LEU n 
1 135  GLU n 
1 136  VAL n 
1 137  GLU n 
1 138  LEU n 
1 139  VAL n 
1 140  VAL n 
1 141  GLU n 
1 142  ARG n 
1 143  GLY n 
1 144  ARG n 
1 145  GLY n 
1 146  TYR n 
1 147  VAL n 
1 148  PRO n 
1 149  ALA n 
1 150  VAL n 
1 151  GLN n 
1 152  ASN n 
1 153  ARG n 
1 154  ALA n 
1 155  SER n 
1 156  GLY n 
1 157  ALA n 
1 158  GLU n 
1 159  ILE n 
1 160  GLY n 
1 161  ARG n 
1 162  ILE n 
1 163  PRO n 
1 164  VAL n 
1 165  ASP n 
1 166  SER n 
1 167  ILE n 
1 168  TYR n 
1 169  SER n 
1 170  PRO n 
1 171  VAL n 
1 172  LEU n 
1 173  LYS n 
1 174  VAL n 
1 175  THR n 
1 176  TYR n 
1 177  LYS n 
1 178  VAL n 
1 179  ASP n 
1 180  ALA n 
1 181  THR n 
1 182  ARG n 
1 183  VAL n 
1 184  GLU n 
1 185  GLN n 
1 186  ARG n 
1 187  THR n 
1 188  ASP n 
1 189  PHE n 
1 190  ASP n 
1 191  LYS n 
1 192  LEU n 
1 193  ILE n 
1 194  LEU n 
1 195  ASP n 
1 196  VAL n 
1 197  GLU n 
1 198  THR n 
1 199  LYS n 
1 200  ASN n 
1 201  SER n 
1 202  ILE n 
1 203  SER n 
1 204  PRO n 
1 205  ARG n 
1 206  ASP n 
1 207  ALA n 
1 208  LEU n 
1 209  ALA n 
1 210  SER n 
1 211  ALA n 
1 212  GLY n 
1 213  LYS n 
1 214  THR n 
1 215  LEU n 
1 216  VAL n 
1 217  GLU n 
1 218  LEU n 
1 219  PHE n 
1 220  GLY n 
1 221  LEU n 
1 222  ALA n 
1 223  ARG n 
1 224  GLU n 
1 225  LEU n 
1 226  ASN n 
1 227  VAL n 
1 228  GLU n 
1 229  ALA n 
1 230  GLU n 
1 231  GLY n 
1 232  ILE n 
1 233  GLU n 
1 234  ILE n 
1 235  GLY n 
1 236  PRO n 
1 237  SER n 
1 238  PRO n 
1 239  ALA n 
1 240  GLU n 
1 241  ALA n 
1 242  ASP n 
1 243  HIS n 
1 244  ILE n 
1 245  ALA n 
1 246  SER n 
1 247  PHE n 
1 248  ALA n 
1 249  LEU n 
1 250  PRO n 
1 251  ILE n 
1 252  ASP n 
1 253  ASP n 
1 254  LEU n 
1 255  ASP n 
1 256  LEU n 
1 257  THR n 
1 258  VAL n 
1 259  ARG n 
1 260  SER n 
1 261  TYR n 
1 262  ASN n 
1 263  CYS n 
1 264  LEU n 
1 265  LYS n 
1 266  ARG n 
1 267  GLU n 
1 268  GLY n 
1 269  VAL n 
1 270  HIS n 
1 271  THR n 
1 272  VAL n 
1 273  GLY n 
1 274  GLU n 
1 275  LEU n 
1 276  VAL n 
1 277  ALA n 
1 278  ARG n 
1 279  THR n 
1 280  GLU n 
1 281  SER n 
1 282  ASP n 
1 283  LEU n 
1 284  LEU n 
1 285  ASP n 
1 286  ILE n 
1 287  ARG n 
1 288  ASN n 
1 289  PHE n 
1 290  GLY n 
1 291  GLN n 
1 292  LYS n 
1 293  SER n 
1 294  ILE n 
1 295  ASP n 
1 296  GLU n 
1 297  VAL n 
1 298  LYS n 
1 299  ILE n 
1 300  LYS n 
1 301  LEU n 
1 302  HIS n 
1 303  GLN n 
1 304  LEU n 
1 305  GLY n 
1 306  LEU n 
1 307  SER n 
1 308  LEU n 
1 309  LYS n 
1 310  ASP n 
1 311  SER n 
1 312  PRO n 
1 313  PRO n 
1 314  SER n 
1 315  PHE n 
1 316  ASP n 
1 317  PRO n 
1 318  SER n 
1 319  GLU n 
1 320  VAL n 
1 321  ALA n 
1 322  GLY n 
1 323  TYR n 
1 324  ASP n 
1 325  VAL n 
1 326  ALA n 
1 327  THR n 
1 328  GLY n 
1 329  THR n 
1 330  TRP n 
1 331  SER n 
1 332  THR n 
1 333  GLU n 
1 334  GLY n 
1 335  ALA n 
1 336  TYR n 
1 337  ASP n 
1 338  GLU n 
1 339  GLN n 
1 340  ASP n 
1 341  TYR n 
1 342  ALA n 
1 343  GLU n 
1 344  THR n 
1 345  GLU n 
1 346  GLN n 
1 347  LEU n 
2 1    MET n 
2 2    LEU n 
2 3    GLU n 
2 4    GLY n 
2 5    CYS n 
2 6    ILE n 
2 7    LEU n 
2 8    ALA n 
2 9    ASP n 
2 10   SER n 
2 11   ARG n 
2 12   GLN n 
2 13   SER n 
2 14   LYS n 
2 15   THR n 
2 16   ALA n 
2 17   ALA n 
2 18   SER n 
2 19   PRO n 
2 20   SER n 
2 21   PRO n 
2 22   SER n 
2 23   ARG n 
2 24   PRO n 
2 25   GLN n 
2 26   SER n 
2 27   SER n 
2 28   SER n 
2 29   ASN n 
2 30   ASN n 
2 31   SER n 
2 32   VAL n 
2 33   PRO n 
2 34   GLY n 
2 35   ALA n 
2 36   PRO n 
2 37   ASN n 
2 38   ARG n 
2 39   VAL n 
2 40   SER n 
2 41   PHE n 
2 42   ALA n 
2 43   LYS n 
2 44   LEU n 
2 45   ARG n 
2 46   GLU n 
2 47   PRO n 
2 48   LEU n 
2 49   GLU n 
2 50   VAL n 
2 51   PRO n 
2 52   GLY n 
2 53   LEU n 
2 54   LEU n 
2 55   ASP n 
2 56   VAL n 
2 57   GLN n 
2 58   THR n 
2 59   ASP n 
2 60   SER n 
2 61   PHE n 
2 62   GLU n 
2 63   TRP n 
2 64   LEU n 
2 65   ILE n 
2 66   GLY n 
2 67   SER n 
2 68   PRO n 
2 69   ARG n 
2 70   TRP n 
2 71   ARG n 
2 72   GLU n 
2 73   SER n 
2 74   ALA n 
2 75   ALA n 
2 76   GLU n 
2 77   ARG n 
2 78   GLY n 
2 79   ASP n 
2 80   VAL n 
2 81   ASN n 
2 82   PRO n 
2 83   VAL n 
2 84   GLY n 
2 85   GLY n 
2 86   LEU n 
2 87   GLU n 
2 88   GLU n 
2 89   VAL n 
2 90   LEU n 
2 91   TYR n 
2 92   GLU n 
2 93   LEU n 
2 94   SER n 
2 95   PRO n 
2 96   ILE n 
2 97   GLU n 
2 98   ASP n 
2 99   PHE n 
2 100  SER n 
2 101  GLY n 
2 102  SER n 
2 103  MET n 
2 104  SER n 
2 105  LEU n 
2 106  SER n 
2 107  PHE n 
2 108  SER n 
2 109  ASP n 
2 110  PRO n 
2 111  ARG n 
2 112  PHE n 
2 113  ASP n 
2 114  ASP n 
2 115  VAL n 
2 116  LYS n 
2 117  ALA n 
2 118  PRO n 
2 119  VAL n 
2 120  ASP n 
2 121  GLU n 
2 122  CYS n 
2 123  LYS n 
2 124  ASP n 
2 125  LYS n 
2 126  ASP n 
2 127  MET n 
2 128  THR n 
2 129  TYR n 
2 130  ALA n 
2 131  ALA n 
2 132  PRO n 
2 133  LEU n 
2 134  PHE n 
2 135  VAL n 
2 136  THR n 
2 137  ALA n 
2 138  GLU n 
2 139  PHE n 
2 140  ILE n 
2 141  ASN n 
2 142  ASN n 
2 143  ASN n 
2 144  THR n 
2 145  GLY n 
2 146  GLU n 
2 147  ILE n 
2 148  LYS n 
2 149  SER n 
2 150  GLN n 
2 151  THR n 
2 152  VAL n 
2 153  PHE n 
2 154  MET n 
2 155  GLY n 
2 156  ASP n 
2 157  PHE n 
2 158  PRO n 
2 159  MET n 
2 160  MET n 
2 161  THR n 
2 162  GLU n 
2 163  LYS n 
2 164  GLY n 
2 165  THR n 
2 166  PHE n 
2 167  ILE n 
2 168  ILE n 
2 169  ASN n 
2 170  GLY n 
2 171  THR n 
2 172  GLU n 
2 173  ARG n 
2 174  VAL n 
2 175  VAL n 
2 176  VAL n 
2 177  SER n 
2 178  GLN n 
2 179  LEU n 
2 180  VAL n 
2 181  ARG n 
2 182  SER n 
2 183  PRO n 
2 184  GLY n 
2 185  VAL n 
2 186  TYR n 
2 187  PHE n 
2 188  ASP n 
2 189  GLU n 
2 190  THR n 
2 191  ILE n 
2 192  ASP n 
2 193  LYS n 
2 194  SER n 
2 195  THR n 
2 196  ASP n 
2 197  LYS n 
2 198  THR n 
2 199  LEU n 
2 200  HIS n 
2 201  SER n 
2 202  VAL n 
2 203  LYS n 
2 204  VAL n 
2 205  ILE n 
2 206  PRO n 
2 207  SER n 
2 208  ARG n 
2 209  GLY n 
2 210  ALA n 
2 211  TRP n 
2 212  LEU n 
2 213  GLU n 
2 214  PHE n 
2 215  ASP n 
2 216  VAL n 
2 217  ASP n 
2 218  LYS n 
2 219  ARG n 
2 220  ASP n 
2 221  THR n 
2 222  VAL n 
2 223  GLY n 
2 224  VAL n 
2 225  ARG n 
2 226  ILE n 
2 227  ASP n 
2 228  ARG n 
2 229  LYS n 
2 230  ARG n 
2 231  ARG n 
2 232  GLN n 
2 233  PRO n 
2 234  VAL n 
2 235  THR n 
2 236  VAL n 
2 237  LEU n 
2 238  LEU n 
2 239  LYS n 
2 240  ALA n 
2 241  LEU n 
2 242  GLY n 
2 243  TRP n 
2 244  THR n 
2 245  SER n 
2 246  GLU n 
2 247  GLN n 
2 248  ILE n 
2 249  VAL n 
2 250  GLU n 
2 251  ARG n 
2 252  PHE n 
2 253  GLY n 
2 254  PHE n 
2 255  SER n 
2 256  GLU n 
2 257  ILE n 
2 258  MET n 
2 259  ARG n 
2 260  SER n 
2 261  THR n 
2 262  LEU n 
2 263  GLU n 
2 264  LYS n 
2 265  ASP n 
2 266  ASN n 
2 267  THR n 
2 268  VAL n 
2 269  GLY n 
2 270  THR n 
2 271  ASP n 
2 272  GLU n 
2 273  ALA n 
2 274  LEU n 
2 275  LEU n 
2 276  ASP n 
2 277  ILE n 
2 278  TYR n 
2 279  ARG n 
2 280  LYS n 
2 281  LEU n 
2 282  ARG n 
2 283  PRO n 
2 284  GLY n 
2 285  GLU n 
2 286  PRO n 
2 287  PRO n 
2 288  THR n 
2 289  LYS n 
2 290  GLU n 
2 291  SER n 
2 292  ALA n 
2 293  GLN n 
2 294  THR n 
2 295  LEU n 
2 296  LEU n 
2 297  GLU n 
2 298  ASN n 
2 299  LEU n 
2 300  PHE n 
2 301  PHE n 
2 302  LYS n 
2 303  GLU n 
2 304  LYS n 
2 305  ARG n 
2 306  TYR n 
2 307  ASP n 
2 308  LEU n 
2 309  ALA n 
2 310  ARG n 
2 311  VAL n 
2 312  GLY n 
2 313  ARG n 
2 314  TYR n 
2 315  LYS n 
2 316  VAL n 
2 317  ASN n 
2 318  LYS n 
2 319  LYS n 
2 320  LEU n 
2 321  GLY n 
2 322  LEU n 
2 323  HIS n 
2 324  VAL n 
2 325  GLY n 
2 326  GLU n 
2 327  PRO n 
2 328  ILE n 
2 329  THR n 
2 330  SER n 
2 331  SER n 
2 332  THR n 
2 333  LEU n 
2 334  THR n 
2 335  GLU n 
2 336  GLU n 
2 337  ASP n 
2 338  VAL n 
2 339  VAL n 
2 340  ALA n 
2 341  THR n 
2 342  ILE n 
2 343  GLU n 
2 344  TYR n 
2 345  LEU n 
2 346  VAL n 
2 347  ARG n 
2 348  LEU n 
2 349  HIS n 
2 350  GLU n 
2 351  GLY n 
2 352  GLN n 
2 353  THR n 
2 354  THR n 
2 355  MET n 
2 356  THR n 
2 357  VAL n 
2 358  PRO n 
2 359  GLY n 
2 360  GLY n 
2 361  VAL n 
2 362  GLU n 
2 363  VAL n 
2 364  PRO n 
2 365  VAL n 
2 366  GLU n 
2 367  THR n 
2 368  ASP n 
2 369  ASP n 
2 370  ILE n 
2 371  ASP n 
2 372  HIS n 
2 373  PHE n 
2 374  GLY n 
2 375  ASN n 
2 376  ARG n 
2 377  ARG n 
2 378  LEU n 
2 379  ARG n 
2 380  THR n 
2 381  VAL n 
2 382  GLY n 
2 383  GLU n 
2 384  LEU n 
2 385  ILE n 
2 386  GLN n 
2 387  ASN n 
2 388  GLN n 
2 389  ILE n 
2 390  ARG n 
2 391  VAL n 
2 392  GLY n 
2 393  MET n 
2 394  SER n 
2 395  ARG n 
2 396  MET n 
2 397  GLU n 
2 398  ARG n 
2 399  VAL n 
2 400  VAL n 
2 401  ARG n 
2 402  GLU n 
2 403  ARG n 
2 404  MET n 
2 405  THR n 
2 406  THR n 
2 407  GLN n 
2 408  ASP n 
2 409  VAL n 
2 410  GLU n 
2 411  ALA n 
2 412  ILE n 
2 413  THR n 
2 414  PRO n 
2 415  GLN n 
2 416  THR n 
2 417  LEU n 
2 418  ILE n 
2 419  ASN n 
2 420  ILE n 
2 421  ARG n 
2 422  PRO n 
2 423  VAL n 
2 424  VAL n 
2 425  ALA n 
2 426  ALA n 
2 427  ILE n 
2 428  LYS n 
2 429  GLU n 
2 430  PHE n 
2 431  PHE n 
2 432  GLY n 
2 433  THR n 
2 434  SER n 
2 435  GLN n 
2 436  LEU n 
2 437  SER n 
2 438  GLN n 
2 439  PHE n 
2 440  MET n 
2 441  ASP n 
2 442  GLN n 
2 443  ASN n 
2 444  ASN n 
2 445  PRO n 
2 446  LEU n 
2 447  SER n 
2 448  GLY n 
2 449  LEU n 
2 450  THR n 
2 451  HIS n 
2 452  LYS n 
2 453  ARG n 
2 454  ARG n 
2 455  LEU n 
2 456  SER n 
2 457  ALA n 
2 458  LEU n 
2 459  GLY n 
2 460  PRO n 
2 461  GLY n 
2 462  GLY n 
2 463  LEU n 
2 464  SER n 
2 465  ARG n 
2 466  GLU n 
2 467  ARG n 
2 468  ALA n 
2 469  GLY n 
2 470  LEU n 
2 471  GLU n 
2 472  VAL n 
2 473  ARG n 
2 474  ASP n 
2 475  VAL n 
2 476  HIS n 
2 477  PRO n 
2 478  SER n 
2 479  HIS n 
2 480  TYR n 
2 481  GLY n 
2 482  ARG n 
2 483  MET n 
2 484  CYS n 
2 485  PRO n 
2 486  ILE n 
2 487  GLU n 
2 488  THR n 
2 489  PRO n 
2 490  GLU n 
2 491  GLY n 
2 492  PRO n 
2 493  ASN n 
2 494  ILE n 
2 495  GLY n 
2 496  LEU n 
2 497  ILE n 
2 498  GLY n 
2 499  SER n 
2 500  LEU n 
2 501  SER n 
2 502  VAL n 
2 503  TYR n 
2 504  ALA n 
2 505  ARG n 
2 506  VAL n 
2 507  ASN n 
2 508  PRO n 
2 509  PHE n 
2 510  GLY n 
2 511  PHE n 
2 512  ILE n 
2 513  GLU n 
2 514  THR n 
2 515  PRO n 
2 516  TYR n 
2 517  ARG n 
2 518  LYS n 
2 519  VAL n 
2 520  VAL n 
2 521  ASP n 
2 522  GLY n 
2 523  VAL n 
2 524  VAL n 
2 525  SER n 
2 526  ASP n 
2 527  GLU n 
2 528  ILE n 
2 529  VAL n 
2 530  TYR n 
2 531  LEU n 
2 532  THR n 
2 533  ALA n 
2 534  ASP n 
2 535  GLU n 
2 536  GLU n 
2 537  ASP n 
2 538  ARG n 
2 539  HIS n 
2 540  VAL n 
2 541  VAL n 
2 542  ALA n 
2 543  GLN n 
2 544  ALA n 
2 545  ASN n 
2 546  SER n 
2 547  PRO n 
2 548  ILE n 
2 549  ASP n 
2 550  ALA n 
2 551  ASP n 
2 552  GLY n 
2 553  ARG n 
2 554  PHE n 
2 555  VAL n 
2 556  GLU n 
2 557  PRO n 
2 558  ARG n 
2 559  VAL n 
2 560  LEU n 
2 561  VAL n 
2 562  ARG n 
2 563  ARG n 
2 564  LYS n 
2 565  ALA n 
2 566  GLY n 
2 567  GLU n 
2 568  VAL n 
2 569  GLU n 
2 570  TYR n 
2 571  VAL n 
2 572  PRO n 
2 573  SER n 
2 574  SER n 
2 575  GLU n 
2 576  VAL n 
2 577  ASP n 
2 578  TYR n 
2 579  MET n 
2 580  ASP n 
2 581  VAL n 
2 582  SER n 
2 583  PRO n 
2 584  ARG n 
2 585  GLN n 
2 586  MET n 
2 587  VAL n 
2 588  SER n 
2 589  VAL n 
2 590  ALA n 
2 591  THR n 
2 592  ALA n 
2 593  MET n 
2 594  ILE n 
2 595  PRO n 
2 596  PHE n 
2 597  LEU n 
2 598  GLU n 
2 599  HIS n 
2 600  ASP n 
2 601  ASP n 
2 602  ALA n 
2 603  ASN n 
2 604  ARG n 
2 605  ALA n 
2 606  LEU n 
2 607  MET n 
2 608  GLY n 
2 609  ALA n 
2 610  ASN n 
2 611  MET n 
2 612  GLN n 
2 613  ARG n 
2 614  GLN n 
2 615  ALA n 
2 616  VAL n 
2 617  PRO n 
2 618  LEU n 
2 619  VAL n 
2 620  ARG n 
2 621  SER n 
2 622  GLU n 
2 623  ALA n 
2 624  PRO n 
2 625  LEU n 
2 626  VAL n 
2 627  GLY n 
2 628  THR n 
2 629  GLY n 
2 630  MET n 
2 631  GLU n 
2 632  LEU n 
2 633  ARG n 
2 634  ALA n 
2 635  ALA n 
2 636  ILE n 
2 637  ASP n 
2 638  ALA n 
2 639  GLY n 
2 640  ASP n 
2 641  VAL n 
2 642  VAL n 
2 643  VAL n 
2 644  ALA n 
2 645  GLU n 
2 646  GLU n 
2 647  SER n 
2 648  GLY n 
2 649  VAL n 
2 650  ILE n 
2 651  GLU n 
2 652  GLU n 
2 653  VAL n 
2 654  SER n 
2 655  ALA n 
2 656  ASP n 
2 657  TYR n 
2 658  ILE n 
2 659  THR n 
2 660  VAL n 
2 661  MET n 
2 662  HIS n 
2 663  ASP n 
2 664  ASN n 
2 665  GLY n 
2 666  THR n 
2 667  ARG n 
2 668  ARG n 
2 669  THR n 
2 670  TYR n 
2 671  ARG n 
2 672  MET n 
2 673  ARG n 
2 674  LYS n 
2 675  PHE n 
2 676  ALA n 
2 677  ARG n 
2 678  SER n 
2 679  ASN n 
2 680  HIS n 
2 681  GLY n 
2 682  THR n 
2 683  CYS n 
2 684  ALA n 
2 685  ASN n 
2 686  GLN n 
2 687  CYS n 
2 688  PRO n 
2 689  ILE n 
2 690  VAL n 
2 691  ASP n 
2 692  ALA n 
2 693  GLY n 
2 694  ASP n 
2 695  ARG n 
2 696  VAL n 
2 697  GLU n 
2 698  ALA n 
2 699  GLY n 
2 700  GLN n 
2 701  VAL n 
2 702  ILE n 
2 703  ALA n 
2 704  ASP n 
2 705  GLY n 
2 706  PRO n 
2 707  CYS n 
2 708  THR n 
2 709  ASP n 
2 710  ASP n 
2 711  GLY n 
2 712  GLU n 
2 713  MET n 
2 714  ALA n 
2 715  LEU n 
2 716  GLY n 
2 717  LYS n 
2 718  ASN n 
2 719  LEU n 
2 720  LEU n 
2 721  VAL n 
2 722  ALA n 
2 723  ILE n 
2 724  MET n 
2 725  PRO n 
2 726  TRP n 
2 727  GLU n 
2 728  GLY n 
2 729  HIS n 
2 730  ASN n 
2 731  TYR n 
2 732  GLU n 
2 733  ASP n 
2 734  ALA n 
2 735  ILE n 
2 736  ILE n 
2 737  LEU n 
2 738  SER n 
2 739  ASN n 
2 740  ARG n 
2 741  LEU n 
2 742  VAL n 
2 743  GLU n 
2 744  GLU n 
2 745  ASP n 
2 746  VAL n 
2 747  LEU n 
2 748  THR n 
2 749  SER n 
2 750  ILE n 
2 751  HIS n 
2 752  ILE n 
2 753  GLU n 
2 754  GLU n 
2 755  HIS n 
2 756  GLU n 
2 757  ILE n 
2 758  ASP n 
2 759  ALA n 
2 760  ARG n 
2 761  ASP n 
2 762  THR n 
2 763  LYS n 
2 764  LEU n 
2 765  GLY n 
2 766  ALA n 
2 767  GLU n 
2 768  GLU n 
2 769  ILE n 
2 770  THR n 
2 771  ARG n 
2 772  ASP n 
2 773  ILE n 
2 774  PRO n 
2 775  ASN n 
2 776  ILE n 
2 777  SER n 
2 778  ASP n 
2 779  GLU n 
2 780  VAL n 
2 781  LEU n 
2 782  ALA n 
2 783  ASP n 
2 784  LEU n 
2 785  ASP n 
2 786  GLU n 
2 787  ARG n 
2 788  GLY n 
2 789  ILE n 
2 790  VAL n 
2 791  ARG n 
2 792  ILE n 
2 793  GLY n 
2 794  ALA n 
2 795  GLU n 
2 796  VAL n 
2 797  ARG n 
2 798  ASP n 
2 799  GLY n 
2 800  ASP n 
2 801  ILE n 
2 802  LEU n 
2 803  VAL n 
2 804  GLY n 
2 805  LYS n 
2 806  VAL n 
2 807  THR n 
2 808  PRO n 
2 809  LYS n 
2 810  GLY n 
2 811  GLU n 
2 812  THR n 
2 813  GLU n 
2 814  LEU n 
2 815  THR n 
2 816  PRO n 
2 817  GLU n 
2 818  GLU n 
2 819  ARG n 
2 820  LEU n 
2 821  LEU n 
2 822  ARG n 
2 823  ALA n 
2 824  ILE n 
2 825  PHE n 
2 826  GLY n 
2 827  GLU n 
2 828  LYS n 
2 829  ALA n 
2 830  ARG n 
2 831  GLU n 
2 832  VAL n 
2 833  ARG n 
2 834  ASP n 
2 835  THR n 
2 836  SER n 
2 837  LEU n 
2 838  LYS n 
2 839  VAL n 
2 840  PRO n 
2 841  HIS n 
2 842  GLY n 
2 843  GLU n 
2 844  SER n 
2 845  GLY n 
2 846  LYS n 
2 847  VAL n 
2 848  ILE n 
2 849  GLY n 
2 850  ILE n 
2 851  ARG n 
2 852  VAL n 
2 853  PHE n 
2 854  SER n 
2 855  ARG n 
2 856  GLU n 
2 857  ASP n 
2 858  GLU n 
2 859  ASP n 
2 860  GLU n 
2 861  LEU n 
2 862  PRO n 
2 863  ALA n 
2 864  GLY n 
2 865  VAL n 
2 866  ASN n 
2 867  GLU n 
2 868  LEU n 
2 869  VAL n 
2 870  ARG n 
2 871  VAL n 
2 872  TYR n 
2 873  VAL n 
2 874  ALA n 
2 875  GLN n 
2 876  LYS n 
2 877  ARG n 
2 878  LYS n 
2 879  ILE n 
2 880  SER n 
2 881  ASP n 
2 882  GLY n 
2 883  ASP n 
2 884  LYS n 
2 885  LEU n 
2 886  ALA n 
2 887  GLY n 
2 888  ARG n 
2 889  HIS n 
2 890  GLY n 
2 891  ASN n 
2 892  LYS n 
2 893  GLY n 
2 894  VAL n 
2 895  ILE n 
2 896  GLY n 
2 897  LYS n 
2 898  ILE n 
2 899  LEU n 
2 900  PRO n 
2 901  VAL n 
2 902  GLU n 
2 903  ASP n 
2 904  MET n 
2 905  PRO n 
2 906  PHE n 
2 907  LEU n 
2 908  ALA n 
2 909  ASP n 
2 910  GLY n 
2 911  THR n 
2 912  PRO n 
2 913  VAL n 
2 914  ASP n 
2 915  ILE n 
2 916  ILE n 
2 917  LEU n 
2 918  ASN n 
2 919  THR n 
2 920  HIS n 
2 921  GLY n 
2 922  VAL n 
2 923  PRO n 
2 924  ARG n 
2 925  ARG n 
2 926  MET n 
2 927  ASN n 
2 928  ILE n 
2 929  GLY n 
2 930  GLN n 
2 931  ILE n 
2 932  LEU n 
2 933  GLU n 
2 934  THR n 
2 935  HIS n 
2 936  LEU n 
2 937  GLY n 
2 938  TRP n 
2 939  CYS n 
2 940  ALA n 
2 941  HIS n 
2 942  SER n 
2 943  GLY n 
2 944  TRP n 
2 945  LYS n 
2 946  VAL n 
2 947  ASP n 
2 948  ALA n 
2 949  ALA n 
2 950  LYS n 
2 951  GLY n 
2 952  VAL n 
2 953  PRO n 
2 954  ASP n 
2 955  TRP n 
2 956  ALA n 
2 957  ALA n 
2 958  ARG n 
2 959  LEU n 
2 960  PRO n 
2 961  ASP n 
2 962  GLU n 
2 963  LEU n 
2 964  LEU n 
2 965  GLU n 
2 966  ALA n 
2 967  GLN n 
2 968  PRO n 
2 969  ASN n 
2 970  ALA n 
2 971  ILE n 
2 972  VAL n 
2 973  SER n 
2 974  THR n 
2 975  PRO n 
2 976  VAL n 
2 977  PHE n 
2 978  ASP n 
2 979  GLY n 
2 980  ALA n 
2 981  GLN n 
2 982  GLU n 
2 983  ALA n 
2 984  GLU n 
2 985  LEU n 
2 986  GLN n 
2 987  GLY n 
2 988  LEU n 
2 989  LEU n 
2 990  SER n 
2 991  CYS n 
2 992  THR n 
2 993  LEU n 
2 994  PRO n 
2 995  ASN n 
2 996  ARG n 
2 997  ASP n 
2 998  GLY n 
2 999  ASP n 
2 1000 VAL n 
2 1001 LEU n 
2 1002 VAL n 
2 1003 ASP n 
2 1004 ALA n 
2 1005 ASP n 
2 1006 GLY n 
2 1007 LYS n 
2 1008 ALA n 
2 1009 MET n 
2 1010 LEU n 
2 1011 PHE n 
2 1012 ASP n 
2 1013 GLY n 
2 1014 ARG n 
2 1015 SER n 
2 1016 GLY n 
2 1017 GLU n 
2 1018 PRO n 
2 1019 PHE n 
2 1020 PRO n 
2 1021 TYR n 
2 1022 PRO n 
2 1023 VAL n 
2 1024 THR n 
2 1025 VAL n 
2 1026 GLY n 
2 1027 TYR n 
2 1028 MET n 
2 1029 TYR n 
2 1030 ILE n 
2 1031 MET n 
2 1032 LYS n 
2 1033 LEU n 
2 1034 HIS n 
2 1035 HIS n 
2 1036 LEU n 
2 1037 VAL n 
2 1038 ASP n 
2 1039 ASP n 
2 1040 LYS n 
2 1041 ILE n 
2 1042 HIS n 
2 1043 ALA n 
2 1044 ARG n 
2 1045 SER n 
2 1046 THR n 
2 1047 GLY n 
2 1048 PRO n 
2 1049 TYR n 
2 1050 SER n 
2 1051 MET n 
2 1052 ILE n 
2 1053 THR n 
2 1054 GLN n 
2 1055 GLN n 
2 1056 PRO n 
2 1057 LEU n 
2 1058 GLY n 
2 1059 GLY n 
2 1060 LYS n 
2 1061 ALA n 
2 1062 GLN n 
2 1063 PHE n 
2 1064 GLY n 
2 1065 GLY n 
2 1066 GLN n 
2 1067 ARG n 
2 1068 PHE n 
2 1069 GLY n 
2 1070 GLU n 
2 1071 MET n 
2 1072 GLU n 
2 1073 CYS n 
2 1074 TRP n 
2 1075 ALA n 
2 1076 MET n 
2 1077 GLN n 
2 1078 ALA n 
2 1079 TYR n 
2 1080 GLY n 
2 1081 ALA n 
2 1082 ALA n 
2 1083 TYR n 
2 1084 THR n 
2 1085 LEU n 
2 1086 GLN n 
2 1087 GLU n 
2 1088 LEU n 
2 1089 LEU n 
2 1090 THR n 
2 1091 ILE n 
2 1092 LYS n 
2 1093 SER n 
2 1094 ASP n 
2 1095 ASP n 
2 1096 THR n 
2 1097 VAL n 
2 1098 GLY n 
2 1099 ARG n 
2 1100 VAL n 
2 1101 LYS n 
2 1102 VAL n 
2 1103 TYR n 
2 1104 GLU n 
2 1105 ALA n 
2 1106 ILE n 
2 1107 VAL n 
2 1108 LYS n 
2 1109 GLY n 
2 1110 GLU n 
2 1111 ASN n 
2 1112 ILE n 
2 1113 PRO n 
2 1114 GLU n 
2 1115 PRO n 
2 1116 GLY n 
2 1117 ILE n 
2 1118 PRO n 
2 1119 GLU n 
2 1120 SER n 
2 1121 PHE n 
2 1122 LYS n 
2 1123 VAL n 
2 1124 LEU n 
2 1125 LEU n 
2 1126 LYS n 
2 1127 GLU n 
2 1128 LEU n 
2 1129 GLN n 
2 1130 SER n 
2 1131 LEU n 
2 1132 CYS n 
2 1133 LEU n 
2 1134 ASN n 
2 1135 VAL n 
2 1136 GLU n 
2 1137 VAL n 
2 1138 LEU n 
2 1139 SER n 
2 1140 SER n 
2 1141 ASP n 
2 1142 GLY n 
2 1143 ALA n 
2 1144 ALA n 
2 1145 ILE n 
2 1146 GLU n 
2 1147 LEU n 
2 1148 ARG n 
2 1149 GLU n 
2 1150 GLY n 
2 1151 GLU n 
2 1152 ASP n 
2 1153 GLU n 
2 1154 ASP n 
2 1155 LEU n 
2 1156 GLU n 
2 1157 ARG n 
2 1158 ALA n 
2 1159 ALA n 
2 1160 ALA n 
2 1161 ASN n 
2 1162 LEU n 
2 1163 GLY n 
2 1164 ILE n 
2 1165 ASN n 
2 1166 LEU n 
2 1167 SER n 
2 1168 ARG n 
2 1169 ASN n 
2 1170 GLU n 
2 1171 SER n 
2 1172 ALA n 
2 1173 SER n 
2 1174 VAL n 
2 1175 GLU n 
2 1176 ASP n 
2 1177 LEU n 
2 1178 ALA n 
3 1    MET n 
3 2    LEU n 
3 3    ASP n 
3 4    VAL n 
3 5    ASN n 
3 6    PHE n 
3 7    PHE n 
3 8    ASP n 
3 9    GLU n 
3 10   LEU n 
3 11   ARG n 
3 12   ILE n 
3 13   GLY n 
3 14   LEU n 
3 15   ALA n 
3 16   THR n 
3 17   ALA n 
3 18   GLU n 
3 19   ASP n 
3 20   ILE n 
3 21   ARG n 
3 22   GLN n 
3 23   TRP n 
3 24   SER n 
3 25   TYR n 
3 26   GLY n 
3 27   GLU n 
3 28   VAL n 
3 29   LYS n 
3 30   LYS n 
3 31   PRO n 
3 32   GLU n 
3 33   THR n 
3 34   ILE n 
3 35   ASN n 
3 36   TYR n 
3 37   ARG n 
3 38   THR n 
3 39   LEU n 
3 40   LYS n 
3 41   PRO n 
3 42   GLU n 
3 43   LYS n 
3 44   ASP n 
3 45   GLY n 
3 46   LEU n 
3 47   PHE n 
3 48   CYS n 
3 49   GLU n 
3 50   LYS n 
3 51   ILE n 
3 52   PHE n 
3 53   GLY n 
3 54   PRO n 
3 55   THR n 
3 56   ARG n 
3 57   ASP n 
3 58   TRP n 
3 59   GLU n 
3 60   CYS n 
3 61   TYR n 
3 62   CYS n 
3 63   GLY n 
3 64   LYS n 
3 65   TYR n 
3 66   LYS n 
3 67   ARG n 
3 68   VAL n 
3 69   ARG n 
3 70   PHE n 
3 71   LYS n 
3 72   GLY n 
3 73   ILE n 
3 74   ILE n 
3 75   CYS n 
3 76   GLU n 
3 77   ARG n 
3 78   CYS n 
3 79   GLY n 
3 80   VAL n 
3 81   GLU n 
3 82   VAL n 
3 83   THR n 
3 84   ARG n 
3 85   ALA n 
3 86   LYS n 
3 87   VAL n 
3 88   ARG n 
3 89   ARG n 
3 90   GLU n 
3 91   ARG n 
3 92   MET n 
3 93   GLY n 
3 94   HIS n 
3 95   ILE n 
3 96   GLU n 
3 97   LEU n 
3 98   ALA n 
3 99   ALA n 
3 100  PRO n 
3 101  VAL n 
3 102  THR n 
3 103  HIS n 
3 104  ILE n 
3 105  TRP n 
3 106  TYR n 
3 107  PHE n 
3 108  LYS n 
3 109  GLY n 
3 110  VAL n 
3 111  PRO n 
3 112  SER n 
3 113  ARG n 
3 114  LEU n 
3 115  GLY n 
3 116  TYR n 
3 117  LEU n 
3 118  LEU n 
3 119  ASP n 
3 120  LEU n 
3 121  ALA n 
3 122  PRO n 
3 123  LYS n 
3 124  ASP n 
3 125  LEU n 
3 126  GLU n 
3 127  LYS n 
3 128  ILE n 
3 129  ILE n 
3 130  TYR n 
3 131  PHE n 
3 132  ALA n 
3 133  ALA n 
3 134  TYR n 
3 135  VAL n 
3 136  ILE n 
3 137  THR n 
3 138  SER n 
3 139  VAL n 
3 140  ASP n 
3 141  GLU n 
3 142  GLU n 
3 143  MET n 
3 144  ARG n 
3 145  HIS n 
3 146  ASN n 
3 147  GLU n 
3 148  LEU n 
3 149  SER n 
3 150  THR n 
3 151  LEU n 
3 152  GLU n 
3 153  ALA n 
3 154  GLU n 
3 155  MET n 
3 156  ALA n 
3 157  VAL n 
3 158  GLU n 
3 159  ARG n 
3 160  LYS n 
3 161  ALA n 
3 162  VAL n 
3 163  GLU n 
3 164  ASP n 
3 165  GLN n 
3 166  ARG n 
3 167  ASP n 
3 168  GLY n 
3 169  GLU n 
3 170  LEU n 
3 171  GLU n 
3 172  ALA n 
3 173  ARG n 
3 174  ALA n 
3 175  GLN n 
3 176  LYS n 
3 177  LEU n 
3 178  GLU n 
3 179  ALA n 
3 180  ASP n 
3 181  LEU n 
3 182  ALA n 
3 183  GLU n 
3 184  LEU n 
3 185  GLU n 
3 186  ALA n 
3 187  GLU n 
3 188  GLY n 
3 189  ALA n 
3 190  LYS n 
3 191  ALA n 
3 192  ASP n 
3 193  ALA n 
3 194  ARG n 
3 195  ARG n 
3 196  LYS n 
3 197  VAL n 
3 198  ARG n 
3 199  ASP n 
3 200  GLY n 
3 201  GLY n 
3 202  GLU n 
3 203  ARG n 
3 204  GLU n 
3 205  MET n 
3 206  ARG n 
3 207  GLN n 
3 208  ILE n 
3 209  ARG n 
3 210  ASP n 
3 211  ARG n 
3 212  ALA n 
3 213  GLN n 
3 214  ARG n 
3 215  GLU n 
3 216  LEU n 
3 217  ASP n 
3 218  ARG n 
3 219  LEU n 
3 220  GLU n 
3 221  ASP n 
3 222  ILE n 
3 223  TRP n 
3 224  SER n 
3 225  THR n 
3 226  PHE n 
3 227  THR n 
3 228  LYS n 
3 229  LEU n 
3 230  ALA n 
3 231  PRO n 
3 232  LYS n 
3 233  GLN n 
3 234  LEU n 
3 235  ILE n 
3 236  VAL n 
3 237  ASP n 
3 238  GLU n 
3 239  ASN n 
3 240  LEU n 
3 241  TYR n 
3 242  ARG n 
3 243  GLU n 
3 244  LEU n 
3 245  VAL n 
3 246  ASP n 
3 247  ARG n 
3 248  TYR n 
3 249  GLY n 
3 250  GLU n 
3 251  TYR n 
3 252  PHE n 
3 253  THR n 
3 254  GLY n 
3 255  ALA n 
3 256  MET n 
3 257  GLY n 
3 258  ALA n 
3 259  GLU n 
3 260  SER n 
3 261  ILE n 
3 262  GLN n 
3 263  LYS n 
3 264  LEU n 
3 265  ILE n 
3 266  GLU n 
3 267  ASN n 
3 268  PHE n 
3 269  ASP n 
3 270  ILE n 
3 271  ASP n 
3 272  ALA n 
3 273  GLU n 
3 274  ALA n 
3 275  GLU n 
3 276  SER n 
3 277  LEU n 
3 278  ARG n 
3 279  ASP n 
3 280  VAL n 
3 281  ILE n 
3 282  ARG n 
3 283  ASN n 
3 284  GLY n 
3 285  LYS n 
3 286  GLY n 
3 287  GLN n 
3 288  LYS n 
3 289  LYS n 
3 290  LEU n 
3 291  ARG n 
3 292  ALA n 
3 293  LEU n 
3 294  LYS n 
3 295  ARG n 
3 296  LEU n 
3 297  LYS n 
3 298  VAL n 
3 299  VAL n 
3 300  ALA n 
3 301  ALA n 
3 302  PHE n 
3 303  GLN n 
3 304  GLN n 
3 305  SER n 
3 306  GLY n 
3 307  ASN n 
3 308  SER n 
3 309  PRO n 
3 310  MET n 
3 311  GLY n 
3 312  MET n 
3 313  VAL n 
3 314  LEU n 
3 315  ASP n 
3 316  ALA n 
3 317  VAL n 
3 318  PRO n 
3 319  VAL n 
3 320  ILE n 
3 321  PRO n 
3 322  PRO n 
3 323  GLU n 
3 324  LEU n 
3 325  ARG n 
3 326  PRO n 
3 327  MET n 
3 328  VAL n 
3 329  GLN n 
3 330  LEU n 
3 331  ASP n 
3 332  GLY n 
3 333  GLY n 
3 334  ARG n 
3 335  PHE n 
3 336  ALA n 
3 337  THR n 
3 338  SER n 
3 339  ASP n 
3 340  LEU n 
3 341  ASN n 
3 342  ASP n 
3 343  LEU n 
3 344  TYR n 
3 345  ARG n 
3 346  ARG n 
3 347  VAL n 
3 348  ILE n 
3 349  ASN n 
3 350  ARG n 
3 351  ASN n 
3 352  ASN n 
3 353  ARG n 
3 354  LEU n 
3 355  LYS n 
3 356  ARG n 
3 357  LEU n 
3 358  ILE n 
3 359  ASP n 
3 360  LEU n 
3 361  GLY n 
3 362  ALA n 
3 363  PRO n 
3 364  GLU n 
3 365  ILE n 
3 366  ILE n 
3 367  VAL n 
3 368  ASN n 
3 369  ASN n 
3 370  GLU n 
3 371  LYS n 
3 372  ARG n 
3 373  MET n 
3 374  LEU n 
3 375  GLN n 
3 376  GLU n 
3 377  SER n 
3 378  VAL n 
3 379  ASP n 
3 380  ALA n 
3 381  LEU n 
3 382  PHE n 
3 383  ASP n 
3 384  ASN n 
3 385  GLY n 
3 386  ARG n 
3 387  ARG n 
3 388  GLY n 
3 389  ARG n 
3 390  PRO n 
3 391  VAL n 
3 392  THR n 
3 393  GLY n 
3 394  PRO n 
3 395  GLY n 
3 396  ASN n 
3 397  ARG n 
3 398  PRO n 
3 399  LEU n 
3 400  LYS n 
3 401  SER n 
3 402  LEU n 
3 403  SER n 
3 404  ASP n 
3 405  LEU n 
3 406  LEU n 
3 407  LYS n 
3 408  GLY n 
3 409  LYS n 
3 410  GLN n 
3 411  GLY n 
3 412  ARG n 
3 413  PHE n 
3 414  ARG n 
3 415  GLN n 
3 416  ASN n 
3 417  LEU n 
3 418  LEU n 
3 419  GLY n 
3 420  LYS n 
3 421  ARG n 
3 422  VAL n 
3 423  ASP n 
3 424  TYR n 
3 425  SER n 
3 426  GLY n 
3 427  ARG n 
3 428  SER n 
3 429  VAL n 
3 430  ILE n 
3 431  VAL n 
3 432  VAL n 
3 433  GLY n 
3 434  PRO n 
3 435  GLN n 
3 436  LEU n 
3 437  LYS n 
3 438  LEU n 
3 439  HIS n 
3 440  GLN n 
3 441  CYS n 
3 442  GLY n 
3 443  LEU n 
3 444  PRO n 
3 445  LYS n 
3 446  LEU n 
3 447  MET n 
3 448  ALA n 
3 449  LEU n 
3 450  GLU n 
3 451  LEU n 
3 452  PHE n 
3 453  LYS n 
3 454  PRO n 
3 455  PHE n 
3 456  VAL n 
3 457  MET n 
3 458  LYS n 
3 459  ARG n 
3 460  LEU n 
3 461  VAL n 
3 462  ASP n 
3 463  LEU n 
3 464  ASN n 
3 465  HIS n 
3 466  ALA n 
3 467  GLN n 
3 468  ASN n 
3 469  ILE n 
3 470  LYS n 
3 471  SER n 
3 472  ALA n 
3 473  LYS n 
3 474  ARG n 
3 475  MET n 
3 476  VAL n 
3 477  GLU n 
3 478  ARG n 
3 479  GLN n 
3 480  ARG n 
3 481  PRO n 
3 482  GLN n 
3 483  VAL n 
3 484  TRP n 
3 485  ASP n 
3 486  VAL n 
3 487  LEU n 
3 488  GLU n 
3 489  GLU n 
3 490  VAL n 
3 491  ILE n 
3 492  ALA n 
3 493  GLU n 
3 494  HIS n 
3 495  PRO n 
3 496  VAL n 
3 497  LEU n 
3 498  LEU n 
3 499  ASN n 
3 500  ARG n 
3 501  ALA n 
3 502  PRO n 
3 503  THR n 
3 504  LEU n 
3 505  HIS n 
3 506  ARG n 
3 507  LEU n 
3 508  GLY n 
3 509  ILE n 
3 510  GLN n 
3 511  ALA n 
3 512  PHE n 
3 513  GLU n 
3 514  PRO n 
3 515  MET n 
3 516  LEU n 
3 517  VAL n 
3 518  GLU n 
3 519  GLY n 
3 520  LYS n 
3 521  ALA n 
3 522  ILE n 
3 523  GLN n 
3 524  LEU n 
3 525  HIS n 
3 526  PRO n 
3 527  LEU n 
3 528  VAL n 
3 529  CYS n 
3 530  GLU n 
3 531  ALA n 
3 532  PHE n 
3 533  ASN n 
3 534  ALA n 
3 535  ASP n 
3 536  PHE n 
3 537  ASP n 
3 538  GLY n 
3 539  ASP n 
3 540  GLN n 
3 541  MET n 
3 542  ALA n 
3 543  VAL n 
3 544  HIS n 
3 545  LEU n 
3 546  PRO n 
3 547  LEU n 
3 548  SER n 
3 549  ALA n 
3 550  GLU n 
3 551  ALA n 
3 552  GLN n 
3 553  ALA n 
3 554  GLU n 
3 555  ALA n 
3 556  ARG n 
3 557  ILE n 
3 558  LEU n 
3 559  MET n 
3 560  LEU n 
3 561  SER n 
3 562  SER n 
3 563  ASN n 
3 564  ASN n 
3 565  ILE n 
3 566  LEU n 
3 567  SER n 
3 568  PRO n 
3 569  ALA n 
3 570  SER n 
3 571  GLY n 
3 572  ARG n 
3 573  PRO n 
3 574  LEU n 
3 575  ALA n 
3 576  MET n 
3 577  PRO n 
3 578  ARG n 
3 579  LEU n 
3 580  ASP n 
3 581  MET n 
3 582  VAL n 
3 583  THR n 
3 584  GLY n 
3 585  LEU n 
3 586  TYR n 
3 587  TYR n 
3 588  LEU n 
3 589  THR n 
3 590  THR n 
3 591  GLU n 
3 592  VAL n 
3 593  PRO n 
3 594  GLY n 
3 595  ASP n 
3 596  THR n 
3 597  GLY n 
3 598  GLU n 
3 599  TYR n 
3 600  GLN n 
3 601  PRO n 
3 602  ALA n 
3 603  SER n 
3 604  GLY n 
3 605  ASP n 
3 606  HIS n 
3 607  PRO n 
3 608  GLU n 
3 609  THR n 
3 610  GLY n 
3 611  VAL n 
3 612  TYR n 
3 613  SER n 
3 614  SER n 
3 615  PRO n 
3 616  ALA n 
3 617  GLU n 
3 618  ALA n 
3 619  ILE n 
3 620  MET n 
3 621  ALA n 
3 622  ALA n 
3 623  ASP n 
3 624  ARG n 
3 625  GLY n 
3 626  VAL n 
3 627  LEU n 
3 628  SER n 
3 629  VAL n 
3 630  ARG n 
3 631  ALA n 
3 632  LYS n 
3 633  ILE n 
3 634  LYS n 
3 635  VAL n 
3 636  ARG n 
3 637  LEU n 
3 638  THR n 
3 639  GLN n 
3 640  LEU n 
3 641  ARG n 
3 642  PRO n 
3 643  PRO n 
3 644  VAL n 
3 645  GLU n 
3 646  ILE n 
3 647  GLU n 
3 648  ALA n 
3 649  GLU n 
3 650  LEU n 
3 651  PHE n 
3 652  GLY n 
3 653  HIS n 
3 654  SER n 
3 655  GLY n 
3 656  TRP n 
3 657  GLN n 
3 658  PRO n 
3 659  GLY n 
3 660  ASP n 
3 661  ALA n 
3 662  TRP n 
3 663  MET n 
3 664  ALA n 
3 665  GLU n 
3 666  THR n 
3 667  THR n 
3 668  LEU n 
3 669  GLY n 
3 670  ARG n 
3 671  VAL n 
3 672  MET n 
3 673  PHE n 
3 674  ASN n 
3 675  GLU n 
3 676  LEU n 
3 677  LEU n 
3 678  PRO n 
3 679  LEU n 
3 680  GLY n 
3 681  TYR n 
3 682  PRO n 
3 683  PHE n 
3 684  VAL n 
3 685  ASN n 
3 686  LYS n 
3 687  GLN n 
3 688  MET n 
3 689  HIS n 
3 690  LYS n 
3 691  LYS n 
3 692  VAL n 
3 693  GLN n 
3 694  ALA n 
3 695  ALA n 
3 696  ILE n 
3 697  ILE n 
3 698  ASN n 
3 699  ASP n 
3 700  LEU n 
3 701  ALA n 
3 702  GLU n 
3 703  ARG n 
3 704  TYR n 
3 705  PRO n 
3 706  MET n 
3 707  ILE n 
3 708  VAL n 
3 709  VAL n 
3 710  ALA n 
3 711  GLN n 
3 712  THR n 
3 713  VAL n 
3 714  ASP n 
3 715  LYS n 
3 716  LEU n 
3 717  LYS n 
3 718  ASP n 
3 719  ALA n 
3 720  GLY n 
3 721  PHE n 
3 722  TYR n 
3 723  TRP n 
3 724  ALA n 
3 725  THR n 
3 726  ARG n 
3 727  SER n 
3 728  GLY n 
3 729  VAL n 
3 730  THR n 
3 731  VAL n 
3 732  SER n 
3 733  MET n 
3 734  ALA n 
3 735  ASP n 
3 736  VAL n 
3 737  LEU n 
3 738  VAL n 
3 739  PRO n 
3 740  PRO n 
3 741  ARG n 
3 742  LYS n 
3 743  LYS n 
3 744  GLU n 
3 745  ILE n 
3 746  LEU n 
3 747  ASP n 
3 748  HIS n 
3 749  TYR n 
3 750  GLU n 
3 751  GLU n 
3 752  ARG n 
3 753  ALA n 
3 754  ASP n 
3 755  LYS n 
3 756  VAL n 
3 757  GLU n 
3 758  LYS n 
3 759  GLN n 
3 760  PHE n 
3 761  GLN n 
3 762  ARG n 
3 763  GLY n 
3 764  ALA n 
3 765  LEU n 
3 766  ASN n 
3 767  HIS n 
3 768  ASP n 
3 769  GLU n 
3 770  ARG n 
3 771  ASN n 
3 772  GLU n 
3 773  ALA n 
3 774  LEU n 
3 775  VAL n 
3 776  GLU n 
3 777  ILE n 
3 778  TRP n 
3 779  LYS n 
3 780  GLU n 
3 781  ALA n 
3 782  THR n 
3 783  ASP n 
3 784  GLU n 
3 785  VAL n 
3 786  GLY n 
3 787  GLN n 
3 788  ALA n 
3 789  LEU n 
3 790  ARG n 
3 791  GLU n 
3 792  HIS n 
3 793  TYR n 
3 794  PRO n 
3 795  ASP n 
3 796  ASP n 
3 797  ASN n 
3 798  PRO n 
3 799  ILE n 
3 800  ILE n 
3 801  THR n 
3 802  ILE n 
3 803  VAL n 
3 804  ASP n 
3 805  SER n 
3 806  GLY n 
3 807  ALA n 
3 808  THR n 
3 809  GLY n 
3 810  ASN n 
3 811  PHE n 
3 812  THR n 
3 813  GLN n 
3 814  THR n 
3 815  ARG n 
3 816  THR n 
3 817  LEU n 
3 818  ALA n 
3 819  GLY n 
3 820  MET n 
3 821  LYS n 
3 822  GLY n 
3 823  LEU n 
3 824  VAL n 
3 825  THR n 
3 826  ASN n 
3 827  PRO n 
3 828  LYS n 
3 829  GLY n 
3 830  GLU n 
3 831  PHE n 
3 832  ILE n 
3 833  PRO n 
3 834  ARG n 
3 835  PRO n 
3 836  VAL n 
3 837  LYS n 
3 838  SER n 
3 839  SER n 
3 840  PHE n 
3 841  ARG n 
3 842  GLU n 
3 843  GLY n 
3 844  LEU n 
3 845  THR n 
3 846  VAL n 
3 847  LEU n 
3 848  GLU n 
3 849  TYR n 
3 850  PHE n 
3 851  ILE n 
3 852  ASN n 
3 853  THR n 
3 854  HIS n 
3 855  GLY n 
3 856  ALA n 
3 857  ARG n 
3 858  LYS n 
3 859  GLY n 
3 860  LEU n 
3 861  ALA n 
3 862  ASP n 
3 863  THR n 
3 864  ALA n 
3 865  LEU n 
3 866  ARG n 
3 867  THR n 
3 868  ALA n 
3 869  ASP n 
3 870  SER n 
3 871  GLY n 
3 872  TYR n 
3 873  LEU n 
3 874  THR n 
3 875  ARG n 
3 876  ARG n 
3 877  LEU n 
3 878  VAL n 
3 879  ASP n 
3 880  VAL n 
3 881  SER n 
3 882  GLN n 
3 883  ASP n 
3 884  VAL n 
3 885  ILE n 
3 886  VAL n 
3 887  ARG n 
3 888  GLU n 
3 889  HIS n 
3 890  ASP n 
3 891  CYS n 
3 892  GLN n 
3 893  THR n 
3 894  GLU n 
3 895  ARG n 
3 896  GLY n 
3 897  ILE n 
3 898  VAL n 
3 899  VAL n 
3 900  GLU n 
3 901  LEU n 
3 902  ALA n 
3 903  GLU n 
3 904  ARG n 
3 905  ALA n 
3 906  PRO n 
3 907  ASP n 
3 908  GLY n 
3 909  THR n 
3 910  LEU n 
3 911  ILE n 
3 912  ARG n 
3 913  ASP n 
3 914  PRO n 
3 915  TYR n 
3 916  ILE n 
3 917  GLU n 
3 918  THR n 
3 919  SER n 
3 920  ALA n 
3 921  TYR n 
3 922  ALA n 
3 923  ARG n 
3 924  THR n 
3 925  LEU n 
3 926  GLY n 
3 927  THR n 
3 928  ASP n 
3 929  ALA n 
3 930  VAL n 
3 931  ASP n 
3 932  GLU n 
3 933  ALA n 
3 934  GLY n 
3 935  ASN n 
3 936  VAL n 
3 937  ILE n 
3 938  VAL n 
3 939  GLU n 
3 940  ARG n 
3 941  GLY n 
3 942  GLN n 
3 943  ASP n 
3 944  LEU n 
3 945  GLY n 
3 946  ASP n 
3 947  PRO n 
3 948  GLU n 
3 949  ILE n 
3 950  ASP n 
3 951  ALA n 
3 952  LEU n 
3 953  LEU n 
3 954  ALA n 
3 955  ALA n 
3 956  GLY n 
3 957  ILE n 
3 958  THR n 
3 959  GLN n 
3 960  VAL n 
3 961  LYS n 
3 962  VAL n 
3 963  ARG n 
3 964  SER n 
3 965  VAL n 
3 966  LEU n 
3 967  THR n 
3 968  CYS n 
3 969  ALA n 
3 970  THR n 
3 971  SER n 
3 972  THR n 
3 973  GLY n 
3 974  VAL n 
3 975  CYS n 
3 976  ALA n 
3 977  THR n 
3 978  CYS n 
3 979  TYR n 
3 980  GLY n 
3 981  ARG n 
3 982  SER n 
3 983  MET n 
3 984  ALA n 
3 985  THR n 
3 986  GLY n 
3 987  LYS n 
3 988  LEU n 
3 989  VAL n 
3 990  ASP n 
3 991  ILE n 
3 992  GLY n 
3 993  GLU n 
3 994  ALA n 
3 995  VAL n 
3 996  GLY n 
3 997  ILE n 
3 998  VAL n 
3 999  ALA n 
3 1000 ALA n 
3 1001 GLN n 
3 1002 SER n 
3 1003 ILE n 
3 1004 GLY n 
3 1005 GLU n 
3 1006 PRO n 
3 1007 GLY n 
3 1008 THR n 
3 1009 GLN n 
3 1010 LEU n 
3 1011 THR n 
3 1012 MET n 
3 1013 ARG n 
3 1014 THR n 
3 1015 PHE n 
3 1016 HIS n 
3 1017 GLN n 
3 1018 GLY n 
3 1019 GLY n 
3 1020 VAL n 
3 1021 GLY n 
3 1022 GLU n 
3 1023 ASP n 
3 1024 ILE n 
3 1025 THR n 
3 1026 GLY n 
3 1027 GLY n 
3 1028 LEU n 
3 1029 PRO n 
3 1030 ARG n 
3 1031 VAL n 
3 1032 GLN n 
3 1033 GLU n 
3 1034 LEU n 
3 1035 PHE n 
3 1036 GLU n 
3 1037 ALA n 
3 1038 ARG n 
3 1039 VAL n 
3 1040 PRO n 
3 1041 ARG n 
3 1042 GLY n 
3 1043 LYS n 
3 1044 ALA n 
3 1045 PRO n 
3 1046 ILE n 
3 1047 ALA n 
3 1048 ASP n 
3 1049 VAL n 
3 1050 THR n 
3 1051 GLY n 
3 1052 ARG n 
3 1053 VAL n 
3 1054 ARG n 
3 1055 LEU n 
3 1056 GLU n 
3 1057 ASP n 
3 1058 GLY n 
3 1059 GLU n 
3 1060 ARG n 
3 1061 PHE n 
3 1062 TYR n 
3 1063 LYS n 
3 1064 ILE n 
3 1065 THR n 
3 1066 ILE n 
3 1067 VAL n 
3 1068 PRO n 
3 1069 ASP n 
3 1070 ASP n 
3 1071 GLY n 
3 1072 GLY n 
3 1073 GLU n 
3 1074 GLU n 
3 1075 VAL n 
3 1076 VAL n 
3 1077 TYR n 
3 1078 ASP n 
3 1079 LYS n 
3 1080 ILE n 
3 1081 SER n 
3 1082 LYS n 
3 1083 ARG n 
3 1084 GLN n 
3 1085 ARG n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 VAL n 
3 1089 PHE n 
3 1090 LYS n 
3 1091 HIS n 
3 1092 GLU n 
3 1093 ASP n 
3 1094 GLY n 
3 1095 SER n 
3 1096 GLU n 
3 1097 ARG n 
3 1098 VAL n 
3 1099 LEU n 
3 1100 SER n 
3 1101 ASP n 
3 1102 GLY n 
3 1103 ASP n 
3 1104 HIS n 
3 1105 VAL n 
3 1106 GLU n 
3 1107 VAL n 
3 1108 GLY n 
3 1109 GLN n 
3 1110 GLN n 
3 1111 LEU n 
3 1112 MET n 
3 1113 GLU n 
3 1114 GLY n 
3 1115 SER n 
3 1116 ALA n 
3 1117 ASP n 
3 1118 PRO n 
3 1119 HIS n 
3 1120 GLU n 
3 1121 VAL n 
3 1122 LEU n 
3 1123 ARG n 
3 1124 VAL n 
3 1125 GLN n 
3 1126 GLY n 
3 1127 PRO n 
3 1128 ARG n 
3 1129 GLU n 
3 1130 VAL n 
3 1131 GLN n 
3 1132 ILE n 
3 1133 HIS n 
3 1134 LEU n 
3 1135 VAL n 
3 1136 ARG n 
3 1137 GLU n 
3 1138 VAL n 
3 1139 GLN n 
3 1140 GLU n 
3 1141 VAL n 
3 1142 TYR n 
3 1143 ARG n 
3 1144 ALA n 
3 1145 GLN n 
3 1146 GLY n 
3 1147 VAL n 
3 1148 SER n 
3 1149 ILE n 
3 1150 HIS n 
3 1151 ASP n 
3 1152 LYS n 
3 1153 HIS n 
3 1154 ILE n 
3 1155 GLU n 
3 1156 VAL n 
3 1157 ILE n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 GLN n 
3 1161 MET n 
3 1162 LEU n 
3 1163 ARG n 
3 1164 ARG n 
3 1165 VAL n 
3 1166 THR n 
3 1167 ILE n 
3 1168 ILE n 
3 1169 ASP n 
3 1170 SER n 
3 1171 GLY n 
3 1172 SER n 
3 1173 THR n 
3 1174 GLU n 
3 1175 PHE n 
3 1176 LEU n 
3 1177 PRO n 
3 1178 GLY n 
3 1179 SER n 
3 1180 LEU n 
3 1181 ILE n 
3 1182 ASP n 
3 1183 ARG n 
3 1184 ALA n 
3 1185 GLU n 
3 1186 PHE n 
3 1187 GLU n 
3 1188 ALA n 
3 1189 GLU n 
3 1190 ASN n 
3 1191 ARG n 
3 1192 ARG n 
3 1193 VAL n 
3 1194 VAL n 
3 1195 ALA n 
3 1196 GLU n 
3 1197 GLY n 
3 1198 GLY n 
3 1199 GLU n 
3 1200 PRO n 
3 1201 ALA n 
3 1202 ALA n 
3 1203 GLY n 
3 1204 ARG n 
3 1205 PRO n 
3 1206 VAL n 
3 1207 LEU n 
3 1208 MET n 
3 1209 GLY n 
3 1210 ILE n 
3 1211 THR n 
3 1212 LYS n 
3 1213 ALA n 
3 1214 SER n 
3 1215 LEU n 
3 1216 ALA n 
3 1217 THR n 
3 1218 ASP n 
3 1219 SER n 
3 1220 TRP n 
3 1221 LEU n 
3 1222 SER n 
3 1223 ALA n 
3 1224 ALA n 
3 1225 SER n 
3 1226 PHE n 
3 1227 GLN n 
3 1228 GLU n 
3 1229 THR n 
3 1230 THR n 
3 1231 ARG n 
3 1232 VAL n 
3 1233 LEU n 
3 1234 THR n 
3 1235 ASP n 
3 1236 ALA n 
3 1237 ALA n 
3 1238 ILE n 
3 1239 ASN n 
3 1240 CYS n 
3 1241 ARG n 
3 1242 SER n 
3 1243 ASP n 
3 1244 LYS n 
3 1245 LEU n 
3 1246 ASN n 
3 1247 GLY n 
3 1248 LEU n 
3 1249 LYS n 
3 1250 GLU n 
3 1251 ASN n 
3 1252 VAL n 
3 1253 ILE n 
3 1254 ILE n 
3 1255 GLY n 
3 1256 LYS n 
3 1257 LEU n 
3 1258 ILE n 
3 1259 PRO n 
3 1260 ALA n 
3 1261 GLY n 
3 1262 THR n 
3 1263 GLY n 
3 1264 ILE n 
3 1265 ASN n 
3 1266 ARG n 
3 1267 TYR n 
3 1268 ARG n 
3 1269 ASN n 
3 1270 ILE n 
3 1271 ALA n 
3 1272 VAL n 
3 1273 GLN n 
3 1274 PRO n 
3 1275 THR n 
3 1276 GLU n 
3 1277 GLU n 
3 1278 ALA n 
3 1279 ARG n 
3 1280 ALA n 
3 1281 ALA n 
3 1282 ALA n 
3 1283 TYR n 
3 1284 THR n 
3 1285 ILE n 
3 1286 PRO n 
3 1287 SER n 
3 1288 TYR n 
3 1289 GLU n 
3 1290 ASP n 
3 1291 GLN n 
3 1292 TYR n 
3 1293 TYR n 
3 1294 SER n 
3 1295 PRO n 
3 1296 ASP n 
3 1297 PHE n 
3 1298 GLY n 
3 1299 ALA n 
3 1300 ALA n 
3 1301 THR n 
3 1302 GLY n 
3 1303 ALA n 
3 1304 ALA n 
3 1305 VAL n 
3 1306 PRO n 
3 1307 LEU n 
3 1308 ASP n 
3 1309 ASP n 
3 1310 TYR n 
3 1311 GLY n 
3 1312 TYR n 
3 1313 SER n 
3 1314 ASP n 
3 1315 TYR n 
3 1316 ARG n 
4 1    MET n 
4 2    SER n 
4 3    ILE n 
4 4    SER n 
4 5    GLN n 
4 6    SER n 
4 7    ASP n 
4 8    ALA n 
4 9    SER n 
4 10   LEU n 
4 11   ALA n 
4 12   ALA n 
4 13   VAL n 
4 14   PRO n 
4 15   ALA n 
4 16   VAL n 
4 17   ASP n 
4 18   GLN n 
4 19   PHE n 
4 20   ASP n 
4 21   PRO n 
4 22   SER n 
4 23   SER n 
4 24   GLY n 
4 25   ALA n 
4 26   SER n 
4 27   GLY n 
4 28   GLY n 
4 29   TYR n 
4 30   ASP n 
4 31   THR n 
4 32   PRO n 
4 33   LEU n 
4 34   GLY n 
4 35   ILE n 
4 36   THR n 
4 37   ASN n 
4 38   PRO n 
4 39   PRO n 
4 40   ILE n 
4 41   ASP n 
4 42   GLU n 
4 43   LEU n 
4 44   LEU n 
4 45   ASP n 
4 46   ARG n 
4 47   VAL n 
4 48   SER n 
4 49   SER n 
4 50   LYS n 
4 51   TYR n 
4 52   ALA n 
4 53   LEU n 
4 54   VAL n 
4 55   ILE n 
4 56   TYR n 
4 57   ALA n 
4 58   ALA n 
4 59   LYS n 
4 60   ARG n 
4 61   ALA n 
4 62   ARG n 
4 63   GLN n 
4 64   ILE n 
4 65   ASN n 
4 66   ASP n 
4 67   TYR n 
4 68   TYR n 
4 69   ASN n 
4 70   GLN n 
4 71   LEU n 
4 72   GLY n 
4 73   GLU n 
4 74   GLY n 
4 75   ILE n 
4 76   LEU n 
4 77   GLU n 
4 78   TYR n 
4 79   VAL n 
4 80   GLY n 
4 81   PRO n 
4 82   LEU n 
4 83   VAL n 
4 84   GLU n 
4 85   PRO n 
4 86   GLY n 
4 87   LEU n 
4 88   GLN n 
4 89   GLU n 
4 90   LYS n 
4 91   PRO n 
4 92   LEU n 
4 93   SER n 
4 94   ILE n 
4 95   ALA n 
4 96   LEU n 
4 97   ARG n 
4 98   GLU n 
4 99   ILE n 
4 100  HIS n 
4 101  ALA n 
4 102  ASP n 
4 103  LEU n 
4 104  LEU n 
4 105  GLU n 
4 106  HIS n 
4 107  THR n 
4 108  GLU n 
4 109  GLY n 
4 110  GLU n 
5 1    MET n 
5 2    ALA n 
5 3    ALA n 
5 4    THR n 
5 5    LYS n 
5 6    ALA n 
5 7    SER n 
5 8    THR n 
5 9    ALA n 
5 10   THR n 
5 11   ASP n 
5 12   GLU n 
5 13   PRO n 
5 14   VAL n 
5 15   LYS n 
5 16   ARG n 
5 17   THR n 
5 18   ALA n 
5 19   THR n 
5 20   LYS n 
5 21   SER n 
5 22   PRO n 
5 23   ALA n 
5 24   ALA n 
5 25   SER n 
5 26   ALA n 
5 27   SER n 
5 28   GLY n 
5 29   ALA n 
5 30   LYS n 
5 31   THR n 
5 32   GLY n 
5 33   ALA n 
5 34   LYS n 
5 35   ARG n 
5 36   THR n 
5 37   ALA n 
5 38   ALA n 
5 39   LYS n 
5 40   SER n 
5 41   ALA n 
5 42   SER n 
5 43   GLY n 
5 44   SER n 
5 45   PRO n 
5 46   PRO n 
5 47   ALA n 
5 48   LYS n 
5 49   ARG n 
5 50   ALA n 
5 51   THR n 
5 52   LYS n 
5 53   PRO n 
5 54   ALA n 
5 55   ALA n 
5 56   ARG n 
5 57   SER n 
5 58   VAL n 
5 59   LYS n 
5 60   PRO n 
5 61   ALA n 
5 62   SER n 
5 63   ALA n 
5 64   PRO n 
5 65   GLN n 
5 66   ASP n 
5 67   THR n 
5 68   THR n 
5 69   THR n 
5 70   SER n 
5 71   THR n 
5 72   ILE n 
5 73   PRO n 
5 74   LYS n 
5 75   ARG n 
5 76   LYS n 
5 77   THR n 
5 78   ARG n 
5 79   ALA n 
5 80   ALA n 
5 81   ALA n 
5 82   LYS n 
5 83   SER n 
5 84   ALA n 
5 85   ALA n 
5 86   ALA n 
5 87   LYS n 
5 88   ALA n 
5 89   PRO n 
5 90   SER n 
5 91   ALA n 
5 92   ARG n 
5 93   GLY n 
5 94   HIS n 
5 95   ALA n 
5 96   THR n 
5 97   LYS n 
5 98   PRO n 
5 99   ARG n 
5 100  ALA n 
5 101  PRO n 
5 102  LYS n 
5 103  ASP n 
5 104  ALA n 
5 105  GLN n 
5 106  HIS n 
5 107  GLU n 
5 108  ALA n 
5 109  ALA n 
5 110  THR n 
5 111  ASP n 
5 112  PRO n 
5 113  GLU n 
5 114  ASP n 
5 115  ALA n 
5 116  LEU n 
5 117  ASP n 
5 118  SER n 
5 119  VAL n 
5 120  GLU n 
5 121  GLU n 
5 122  LEU n 
5 123  ASP n 
5 124  ALA n 
5 125  GLU n 
5 126  PRO n 
5 127  ASP n 
5 128  LEU n 
5 129  ASP n 
5 130  VAL n 
5 131  GLU n 
5 132  PRO n 
5 133  GLY n 
5 134  GLU n 
5 135  ASP n 
5 136  LEU n 
5 137  ASP n 
5 138  LEU n 
5 139  ASP n 
5 140  ALA n 
5 141  ALA n 
5 142  ASP n 
5 143  LEU n 
5 144  ASN n 
5 145  LEU n 
5 146  ASP n 
5 147  ASP n 
5 148  LEU n 
5 149  GLU n 
5 150  ASP n 
5 151  ASP n 
5 152  VAL n 
5 153  ALA n 
5 154  PRO n 
5 155  ASP n 
5 156  ALA n 
5 157  ASP n 
5 158  ASP n 
5 159  ASP n 
5 160  LEU n 
5 161  ASP n 
5 162  SER n 
5 163  GLY n 
5 164  ASP n 
5 165  ASP n 
5 166  GLU n 
5 167  ASP n 
5 168  HIS n 
5 169  GLU n 
5 170  ASP n 
5 171  LEU n 
5 172  GLU n 
5 173  ALA n 
5 174  GLU n 
5 175  ALA n 
5 176  ALA n 
5 177  VAL n 
5 178  ALA n 
5 179  PRO n 
5 180  GLY n 
5 181  GLN n 
5 182  THR n 
5 183  ALA n 
5 184  ASP n 
5 185  ASP n 
5 186  ASP n 
5 187  GLU n 
5 188  GLU n 
5 189  ILE n 
5 190  ALA n 
5 191  GLU n 
5 192  PRO n 
5 193  THR n 
5 194  GLU n 
5 195  LYS n 
5 196  ASP n 
5 197  LYS n 
5 198  ALA n 
5 199  SER n 
5 200  GLY n 
5 201  ASP n 
5 202  PHE n 
5 203  VAL n 
5 204  TRP n 
5 205  ASP n 
5 206  GLU n 
5 207  ASP n 
5 208  GLU n 
5 209  SER n 
5 210  GLU n 
5 211  ALA n 
5 212  LEU n 
5 213  ARG n 
5 214  GLN n 
5 215  ALA n 
5 216  ARG n 
5 217  LYS n 
5 218  ASP n 
5 219  ALA n 
5 220  GLU n 
5 221  LEU n 
5 222  THR n 
5 223  ALA n 
5 224  SER n 
5 225  ALA n 
5 226  ASP n 
5 227  SER n 
5 228  VAL n 
5 229  ARG n 
5 230  ALA n 
5 231  TYR n 
5 232  LEU n 
5 233  LYS n 
5 234  GLN n 
5 235  ILE n 
5 236  GLY n 
5 237  LYS n 
5 238  VAL n 
5 239  ALA n 
5 240  LEU n 
5 241  LEU n 
5 242  ASN n 
5 243  ALA n 
5 244  GLU n 
5 245  GLU n 
5 246  GLU n 
5 247  VAL n 
5 248  GLU n 
5 249  LEU n 
5 250  ALA n 
5 251  LYS n 
5 252  ARG n 
5 253  ILE n 
5 254  GLU n 
5 255  ALA n 
5 256  GLY n 
5 257  LEU n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  GLN n 
5 262  LEU n 
5 263  MET n 
5 264  THR n 
5 265  GLU n 
5 266  LEU n 
5 267  SER n 
5 268  GLU n 
5 269  ARG n 
5 270  GLY n 
5 271  GLU n 
5 272  LYS n 
5 273  LEU n 
5 274  PRO n 
5 275  ALA n 
5 276  ALA n 
5 277  GLN n 
5 278  ARG n 
5 279  ARG n 
5 280  ASP n 
5 281  MET n 
5 282  MET n 
5 283  TRP n 
5 284  ILE n 
5 285  CYS n 
5 286  ARG n 
5 287  ASP n 
5 288  GLY n 
5 289  ASP n 
5 290  ARG n 
5 291  ALA n 
5 292  LYS n 
5 293  ASN n 
5 294  HIS n 
5 295  LEU n 
5 296  LEU n 
5 297  GLU n 
5 298  ALA n 
5 299  ASN n 
5 300  LEU n 
5 301  ARG n 
5 302  LEU n 
5 303  VAL n 
5 304  VAL n 
5 305  SER n 
5 306  LEU n 
5 307  ALA n 
5 308  LYS n 
5 309  ARG n 
5 310  TYR n 
5 311  THR n 
5 312  GLY n 
5 313  ARG n 
5 314  GLY n 
5 315  MET n 
5 316  ALA n 
5 317  PHE n 
5 318  LEU n 
5 319  ASP n 
5 320  LEU n 
5 321  ILE n 
5 322  GLN n 
5 323  GLU n 
5 324  GLY n 
5 325  ASN n 
5 326  LEU n 
5 327  GLY n 
5 328  LEU n 
5 329  ILE n 
5 330  ARG n 
5 331  ALA n 
5 332  VAL n 
5 333  GLU n 
5 334  LYS n 
5 335  PHE n 
5 336  ASP n 
5 337  TYR n 
5 338  THR n 
5 339  LYS n 
5 340  GLY n 
5 341  TYR n 
5 342  LYS n 
5 343  PHE n 
5 344  SER n 
5 345  THR n 
5 346  TYR n 
5 347  ALA n 
5 348  THR n 
5 349  TRP n 
5 350  TRP n 
5 351  ILE n 
5 352  ARG n 
5 353  GLN n 
5 354  ALA n 
5 355  ILE n 
5 356  THR n 
5 357  ARG n 
5 358  ALA n 
5 359  MET n 
5 360  ALA n 
5 361  ASP n 
5 362  GLN n 
5 363  ALA n 
5 364  ARG n 
5 365  THR n 
5 366  ILE n 
5 367  ARG n 
5 368  ILE n 
5 369  PRO n 
5 370  VAL n 
5 371  HIS n 
5 372  MET n 
5 373  VAL n 
5 374  GLU n 
5 375  VAL n 
5 376  ILE n 
5 377  ASN n 
5 378  LYS n 
5 379  LEU n 
5 380  GLY n 
5 381  ARG n 
5 382  ILE n 
5 383  GLN n 
5 384  ARG n 
5 385  GLU n 
5 386  LEU n 
5 387  LEU n 
5 388  GLN n 
5 389  ASP n 
5 390  LEU n 
5 391  GLY n 
5 392  ARG n 
5 393  GLU n 
5 394  PRO n 
5 395  THR n 
5 396  PRO n 
5 397  GLU n 
5 398  GLU n 
5 399  LEU n 
5 400  ALA n 
5 401  LYS n 
5 402  GLU n 
5 403  MET n 
5 404  ASP n 
5 405  ILE n 
5 406  THR n 
5 407  PRO n 
5 408  GLU n 
5 409  LYS n 
5 410  VAL n 
5 411  LEU n 
5 412  GLU n 
5 413  ILE n 
5 414  GLN n 
5 415  GLN n 
5 416  TYR n 
5 417  ALA n 
5 418  ARG n 
5 419  GLU n 
5 420  PRO n 
5 421  ILE n 
5 422  SER n 
5 423  LEU n 
5 424  ASP n 
5 425  GLN n 
5 426  THR n 
5 427  ILE n 
5 428  GLY n 
5 429  ASP n 
5 430  GLU n 
5 431  GLY n 
5 432  ASP n 
5 433  SER n 
5 434  GLN n 
5 435  LEU n 
5 436  GLY n 
5 437  ASP n 
5 438  PHE n 
5 439  ILE n 
5 440  GLU n 
5 441  ASP n 
5 442  SER n 
5 443  GLU n 
5 444  ALA n 
5 445  VAL n 
5 446  VAL n 
5 447  ALA n 
5 448  VAL n 
5 449  ASP n 
5 450  ALA n 
5 451  VAL n 
5 452  SER n 
5 453  PHE n 
5 454  THR n 
5 455  LEU n 
5 456  LEU n 
5 457  GLN n 
5 458  ASP n 
5 459  GLN n 
5 460  LEU n 
5 461  GLN n 
5 462  SER n 
5 463  VAL n 
5 464  LEU n 
5 465  ASP n 
5 466  THR n 
5 467  LEU n 
5 468  SER n 
5 469  GLU n 
5 470  ARG n 
5 471  GLU n 
5 472  ALA n 
5 473  GLY n 
5 474  VAL n 
5 475  VAL n 
5 476  ARG n 
5 477  LEU n 
5 478  ARG n 
5 479  PHE n 
5 480  GLY n 
5 481  LEU n 
5 482  THR n 
5 483  ASP n 
5 484  GLY n 
5 485  GLN n 
5 486  PRO n 
5 487  ARG n 
5 488  THR n 
5 489  LEU n 
5 490  ASP n 
5 491  GLU n 
5 492  ILE n 
5 493  GLY n 
5 494  GLN n 
5 495  VAL n 
5 496  TYR n 
5 497  GLY n 
5 498  VAL n 
5 499  THR n 
5 500  ARG n 
5 501  GLU n 
5 502  ARG n 
5 503  ILE n 
5 504  ARG n 
5 505  GLN n 
5 506  ILE n 
5 507  GLU n 
5 508  SER n 
5 509  LYS n 
5 510  THR n 
5 511  MET n 
5 512  SER n 
5 513  LYS n 
5 514  LEU n 
5 515  ARG n 
5 516  HIS n 
5 517  PRO n 
5 518  SER n 
5 519  ARG n 
5 520  SER n 
5 521  GLN n 
5 522  VAL n 
5 523  LEU n 
5 524  ARG n 
5 525  ASP n 
5 526  TYR n 
5 527  LEU n 
5 528  ASP n 
6 1    DT  n 
6 2    DA  n 
6 3    DT  n 
6 4    DA  n 
6 5    DA  n 
6 6    DT  n 
6 7    DG  n 
6 8    DG  n 
6 9    DG  n 
6 10   DA  n 
6 11   DG  n 
6 12   DC  n 
6 13   DT  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DA  n 
6 18   DC  n 
6 19   DG  n 
6 20   DG  n 
6 21   DA  n 
6 22   DT  n 
6 23   DG  n 
7 1    DC  n 
7 2    DA  n 
7 3    DT  n 
7 4    DC  n 
7 5    DC  n 
7 6    DG  n 
7 7    DT  n 
7 8    DG  n 
7 9    DA  n 
7 10   DG  n 
7 11   DT  n 
7 12   DC  n 
7 13   DG  n 
7 14   DA  n 
7 15   DG  n 
7 16   DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 347  ? ? 'rpoA, Rv3457c, MTCY13E12.10c'                ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1178 ? ? 'rpoB, Rv0667, MTCI376.08c'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 1316 ? ? 'rpoC, Rv0668, MTCI376.07c'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 110  ? ? 'rpoZ, Rv1390, MTCY21B4.07'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 528  ? ? 'sigA, mysA, rpoD, rpoV, Rv2703, MTCY05A6.24' ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 23 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' ? 83332 ? 
7 1 sample 1 16 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' ? 83332 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_MYCTU P9WGZ1 ? 1 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
1 
2 UNP RPOB_MYCTU P9WGY9 ? 2 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
1 
3 UNP RPOC_MYCTU P9WGY7 ? 3 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
1 
4 UNP RPOZ_MYCTU P9WGY5 ? 4 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
1 
5 UNP SIGA_MYCTU P9WGI1 ? 5 
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
1 
6 PDB 5UHE       5UHE   ? 6 ? 1 
7 PDB 5UHE       5UHE   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5UHE A 1 ? 347  ? P9WGZ1 1 ? 347  ? 1 347  
2 1 5UHE B 1 ? 347  ? P9WGZ1 1 ? 347  ? 1 347  
3 2 5UHE C 1 ? 1178 ? P9WGY9 1 ? 1178 ? 1 1178 
4 3 5UHE D 1 ? 1316 ? P9WGY7 1 ? 1316 ? 1 1316 
5 4 5UHE E 1 ? 110  ? P9WGY5 1 ? 110  ? 1 110  
6 5 5UHE F 1 ? 528  ? P9WGI1 1 ? 528  ? 1 528  
7 6 5UHE H 1 ? 23   ? 5UHE   1 ? 23   ? 1 23   
8 7 5UHE G 1 ? 16   ? 5UHE   5 ? 20   ? 5 20   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
88G non-polymer         . 'Nalpha-(benzenecarbonyl)-N-(2-methylphenyl)-D-phenylalaninamide' ? 'C23 H22 N2 O2'   358.433 
ALA 'L-peptide linking' y ALANINE                                                           ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                          ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                        ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                   ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                          ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                              ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                               ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                              ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                      ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                         ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                   ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                           ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                         ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                        ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                           ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                            ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                        ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                   ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                     ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                           ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                            ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                         ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                        ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                          ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                            ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                                                        ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5UHE 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.83 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.54 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.3 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM Tris-HCl, pH 8.3, 200 mM KCl, 50 mM MgCl2, and 10% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-08-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.033 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.entry_id                     5UHE 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            4.050 
_reflns.number_obs                   39805 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.200 
_reflns.pdbx_Rmerge_I_obs            0.216 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.900 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.400 
_reflns.pdbx_Rrim_I_all              0.230 
_reflns.pdbx_Rpim_I_all              0.076 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_netI_over_av_sigmaI     ? 
_reflns.pdbx_number_measured_all     295562 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_chi_squared             0.931 
_reflns.Rmerge_F_all                 ? 
_reflns.Rmerge_F_obs                 ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.observed_criterion_I_max     ? 
_reflns.observed_criterion_I_min     ? 
_reflns.pdbx_d_res_high_opt          ? 
_reflns.pdbx_d_res_low_opt           ? 
_reflns.details                      ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  4.050 4.190  ? ? ? ? 0.716 ? ? 0.820 6.000 ? ? ? 3807 ? ? ? ? 96.700 0.781 0.301 0.524 
1 2  4.190 4.360  ? ? ? ? 0.631 ? ? 0.873 6.200 ? ? ? 3934 ? ? ? ? 98.600 0.687 0.261 0.666 
1 3  4.360 4.560  ? ? ? ? 0.508 ? ? 0.897 6.200 ? ? ? 3885 ? ? ? ? 99.300 0.552 0.210 0.793 
1 4  4.560 4.800  ? ? ? ? 0.452 ? ? 0.940 7.400 ? ? ? 3952 ? ? ? ? 99.700 0.485 0.171 0.880 
1 5  4.800 5.100  ? ? ? ? 0.399 ? ? 0.946 7.500 ? ? ? 3984 ? ? ? ? 99.900 0.427 0.149 0.895 
1 6  5.100 5.500  ? ? ? ? 0.367 ? ? 0.953 7.600 ? ? ? 3966 ? ? ? ? 99.500 0.393 0.137 0.920 
1 7  5.500 6.050  ? ? ? ? 0.316 ? ? 0.967 7.100 ? ? ? 3988 ? ? ? ? 99.600 0.339 0.121 0.930 
1 8  6.050 6.920  ? ? ? ? 0.274 ? ? 1.027 8.500 ? ? ? 4015 ? ? ? ? 99.800 0.290 0.095 0.954 
1 9  6.920 8.710  ? ? ? ? 0.223 ? ? 1.032 8.400 ? ? ? 4033 ? ? ? ? 99.500 0.236 0.077 0.971 
1 10 8.710 50.000 ? ? ? ? 0.172 ? ? 0.812 9.000 ? ? ? 4241 ? ? ? ? 99.600 0.182 0.058 0.989 
# 
_refine.entry_id                                 5UHE 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            4.0390 
_refine.ls_d_res_low                             49.2700 
_refine.pdbx_ls_sigma_F                          1.490 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    86.1400 
_refine.ls_number_reflns_obs                     34622 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2130 
_refine.ls_R_factor_R_work                       0.2100 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2592 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.8000 
_refine.ls_number_reflns_R_free                  2007 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               71.3406 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.5300 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      4G7H 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                364.720 
_refine.B_iso_min                                17.480 
_refine.pdbx_overall_phase_error                 22.0800 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       4.0390 
_refine_hist.d_res_low                        49.2700 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               25967 
_refine_hist.pdbx_number_residues_total       3278 
_refine_hist.pdbx_B_iso_mean_ligand           58.79 
_refine_hist.pdbx_number_atoms_protein        25198 
_refine_hist.pdbx_number_atoms_nucleic_acid   739 
# 
_struct.entry_id                     5UHE 
_struct.title                        
'Crystal structure of Mycobacterium tuberculosis transcription initiation complex in complex with D-AAP1' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5UHE 
_struct_keywords.text            'RNA polymerase complex, transcription, DNA, RNA, TRANSCRIPTION-DNA-RNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 8  ? 
K N N 9  ? 
L N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? ILE A 46   ? GLY A 31   ILE A 46   1 ? 16 
HELX_P HELX_P2   AA2 ASP A 72   ? LYS A 81   ? ASP A 72   LYS A 81   1 ? 10 
HELX_P HELX_P3   AA3 PRO A 148  ? ASN A 152  ? PRO A 148  ASN A 152  5 ? 5  
HELX_P HELX_P4   AA4 SER A 203  ? GLY A 220  ? SER A 203  GLY A 220  1 ? 18 
HELX_P HELX_P5   AA5 LEU A 221  ? ARG A 223  ? LEU A 221  ARG A 223  5 ? 3  
HELX_P HELX_P6   AA6 PHE B 30   ? LEU B 43   ? PHE B 30   LEU B 43   1 ? 14 
HELX_P HELX_P7   AA7 ASP B 72   ? SER B 82   ? ASP B 72   SER B 82   1 ? 11 
HELX_P HELX_P8   AA8 ALA B 149  ? ARG B 153  ? ALA B 149  ARG B 153  5 ? 5  
HELX_P HELX_P9   AA9 SER B 203  ? GLU B 224  ? SER B 203  GLU B 224  1 ? 22 
HELX_P HELX_P10  AB1 LEU C 54   ? GLY C 66   ? LEU C 54   GLY C 66   1 ? 13 
HELX_P HELX_P11  AB2 SER C 67   ? ARG C 77   ? SER C 67   ARG C 77   1 ? 11 
HELX_P HELX_P12  AB3 GLY C 84   ? SER C 94   ? GLY C 84   SER C 94   1 ? 11 
HELX_P HELX_P13  AB4 PRO C 118  ? LYS C 125  ? PRO C 118  LYS C 125  1 ? 8  
HELX_P HELX_P14  AB5 VAL C 234  ? GLY C 242  ? VAL C 234  GLY C 242  1 ? 9  
HELX_P HELX_P15  AB6 THR C 244  ? PHE C 252  ? THR C 244  PHE C 252  1 ? 9  
HELX_P HELX_P16  AB7 SER C 255  ? ASP C 265  ? SER C 255  ASP C 265  1 ? 11 
HELX_P HELX_P17  AB8 GLY C 269  ? ARG C 282  ? GLY C 269  ARG C 282  1 ? 14 
HELX_P HELX_P18  AB9 SER C 291  ? LYS C 302  ? SER C 291  LYS C 302  1 ? 12 
HELX_P HELX_P19  AC1 ALA C 309  ? GLY C 321  ? ALA C 309  GLY C 321  1 ? 13 
HELX_P HELX_P20  AC2 THR C 334  ? GLU C 350  ? THR C 334  GLU C 350  1 ? 17 
HELX_P HELX_P21  AC3 THR C 380  ? GLN C 407  ? THR C 380  GLN C 407  1 ? 28 
HELX_P HELX_P22  AC4 THR C 413  ? ILE C 418  ? THR C 413  ILE C 418  1 ? 6  
HELX_P HELX_P23  AC5 ILE C 420  ? SER C 434  ? ILE C 420  SER C 434  1 ? 15 
HELX_P HELX_P24  AC6 ASN C 444  ? ARG C 453  ? ASN C 444  ARG C 453  1 ? 10 
HELX_P HELX_P25  AC7 HIS C 476  ? TYR C 480  ? HIS C 476  TYR C 480  5 ? 5  
HELX_P HELX_P26  AC8 THR C 532  ? ARG C 538  ? THR C 532  ARG C 538  1 ? 7  
HELX_P HELX_P27  AC9 SER C 574  ? VAL C 576  ? SER C 574  VAL C 576  5 ? 3  
HELX_P HELX_P28  AD1 SER C 582  ? MET C 586  ? SER C 582  MET C 586  5 ? 5  
HELX_P HELX_P29  AD2 ALA C 590  ? ILE C 594  ? ALA C 590  ILE C 594  5 ? 5  
HELX_P HELX_P30  AD3 PHE C 596  ? ASP C 600  ? PHE C 596  ASP C 600  5 ? 5  
HELX_P HELX_P31  AD4 ASP C 601  ? ARG C 613  ? ASP C 601  ARG C 613  1 ? 13 
HELX_P HELX_P32  AD5 GLY C 629  ? ALA C 638  ? GLY C 629  ALA C 638  1 ? 10 
HELX_P HELX_P33  AD6 ASN C 739  ? GLU C 744  ? ASN C 739  GLU C 744  1 ? 6  
HELX_P HELX_P34  AD7 THR C 815  ? PHE C 825  ? THR C 815  PHE C 825  1 ? 11 
HELX_P HELX_P35  AD8 ASN C 918  ? VAL C 922  ? ASN C 918  VAL C 922  5 ? 5  
HELX_P HELX_P36  AD9 ILE C 928  ? GLY C 943  ? ILE C 928  GLY C 943  1 ? 16 
HELX_P HELX_P37  AE1 ASP C 954  ? ARG C 958  ? ASP C 954  ARG C 958  5 ? 5  
HELX_P HELX_P38  AE2 PRO C 960  ? LEU C 963  ? PRO C 960  LEU C 963  5 ? 4  
HELX_P HELX_P39  AE3 GLN C 981  ? LEU C 989  ? GLN C 981  LEU C 989  1 ? 9  
HELX_P HELX_P40  AE4 LEU C 1036 ? ILE C 1041 ? LEU C 1036 ILE C 1041 1 ? 6  
HELX_P HELX_P41  AE5 GLY C 1069 ? GLY C 1080 ? GLY C 1069 GLY C 1080 1 ? 12 
HELX_P HELX_P42  AE6 ALA C 1081 ? LEU C 1089 ? ALA C 1081 LEU C 1089 1 ? 9  
HELX_P HELX_P43  AE7 ASP C 1095 ? GLY C 1109 ? ASP C 1095 GLY C 1109 1 ? 15 
HELX_P HELX_P44  AE8 PRO C 1118 ? SER C 1130 ? PRO C 1118 SER C 1130 1 ? 13 
HELX_P HELX_P45  AE9 THR D 16   ? SER D 24   ? THR D 16   SER D 24   1 ? 9  
HELX_P HELX_P46  AF1 ARG D 84   ? GLU D 90   ? ARG D 84   GLU D 90   5 ? 7  
HELX_P HELX_P47  AF2 HIS D 103  ? LYS D 108  ? HIS D 103  LYS D 108  1 ? 6  
HELX_P HELX_P48  AF3 SER D 112  ? LEU D 118  ? SER D 112  LEU D 118  1 ? 7  
HELX_P HELX_P49  AF4 ALA D 121  ? TYR D 130  ? ALA D 121  TYR D 130  1 ? 10 
HELX_P HELX_P50  AF5 ASP D 140  ? GLU D 187  ? ASP D 140  GLU D 187  1 ? 48 
HELX_P HELX_P51  AF6 ASP D 192  ? LYS D 228  ? ASP D 192  LYS D 228  1 ? 37 
HELX_P HELX_P52  AF7 ASP D 237  ? GLY D 249  ? ASP D 237  GLY D 249  1 ? 13 
HELX_P HELX_P53  AF8 GLY D 257  ? ASN D 267  ? GLY D 257  ASN D 267  1 ? 11 
HELX_P HELX_P54  AF9 ASP D 269  ? ARG D 282  ? ASP D 269  ARG D 282  1 ? 14 
HELX_P HELX_P55  AG1 LYS D 285  ? GLN D 304  ? LYS D 285  GLN D 304  1 ? 20 
HELX_P HELX_P56  AG2 SER D 308  ? GLY D 311  ? SER D 308  GLY D 311  5 ? 4  
HELX_P HELX_P57  AG3 PRO D 321  ? ARG D 325  ? PRO D 321  ARG D 325  5 ? 5  
HELX_P HELX_P58  AG4 ASP D 339  ? GLY D 361  ? ASP D 339  GLY D 361  1 ? 23 
HELX_P HELX_P59  AG5 PRO D 363  ? ASP D 383  ? PRO D 363  ASP D 383  1 ? 21 
HELX_P HELX_P60  AG6 GLY D 393  ? ARG D 397  ? GLY D 393  ARG D 397  5 ? 5  
HELX_P HELX_P61  AG7 LEU D 402  ? LEU D 406  ? LEU D 402  LEU D 406  5 ? 5  
HELX_P HELX_P62  AG8 LYS D 445  ? PHE D 452  ? LYS D 445  PHE D 452  1 ? 8  
HELX_P HELX_P63  AG9 PHE D 452  ? LEU D 463  ? PHE D 452  LEU D 463  1 ? 12 
HELX_P HELX_P64  AH1 ASN D 468  ? GLN D 479  ? ASN D 468  GLN D 479  1 ? 12 
HELX_P HELX_P65  AH2 PRO D 481  ? ILE D 491  ? PRO D 481  ILE D 491  1 ? 11 
HELX_P HELX_P66  AH3 HIS D 505  ? LEU D 507  ? HIS D 505  LEU D 507  5 ? 3  
HELX_P HELX_P67  AH4 HIS D 525  ? LEU D 527  ? HIS D 525  LEU D 527  5 ? 3  
HELX_P HELX_P68  AH5 VAL D 528  ? ASN D 533  ? VAL D 528  ASN D 533  1 ? 6  
HELX_P HELX_P69  AH6 SER D 548  ? MET D 559  ? SER D 548  MET D 559  1 ? 12 
HELX_P HELX_P70  AH7 LEU D 579  ? THR D 589  ? LEU D 579  THR D 589  1 ? 11 
HELX_P HELX_P71  AH8 SER D 614  ? GLY D 625  ? SER D 614  GLY D 625  1 ? 12 
HELX_P HELX_P72  AH9 PRO D 643  ? GLY D 652  ? PRO D 643  GLY D 652  1 ? 10 
HELX_P HELX_P73  AI1 LEU D 668  ? GLU D 675  ? LEU D 668  GLU D 675  1 ? 8  
HELX_P HELX_P74  AI2 HIS D 689  ? ARG D 703  ? HIS D 689  ARG D 703  1 ? 15 
HELX_P HELX_P75  AI3 PRO D 705  ? ARG D 726  ? PRO D 705  ARG D 726  1 ? 22 
HELX_P HELX_P76  AI4 ARG D 741  ? ARG D 762  ? ARG D 741  ARG D 762  1 ? 22 
HELX_P HELX_P77  AI5 ASN D 766  ? TYR D 793  ? ASN D 766  TYR D 793  1 ? 28 
HELX_P HELX_P78  AI6 ASN D 797  ? ASP D 804  ? ASN D 797  ASP D 804  1 ? 8  
HELX_P HELX_P79  AI7 ASN D 810  ? GLY D 819  ? ASN D 810  GLY D 819  1 ? 10 
HELX_P HELX_P80  AI8 THR D 845  ? SER D 881  ? THR D 845  SER D 881  1 ? 37 
HELX_P HELX_P81  AI9 TYR D 915  ? TYR D 921  ? TYR D 915  TYR D 921  1 ? 7  
HELX_P HELX_P82  AJ1 GLY D 945  ? GLY D 956  ? GLY D 945  GLY D 956  1 ? 12 
HELX_P HELX_P83  AJ2 ALA D 976  ? GLY D 980  ? ALA D 976  GLY D 980  1 ? 5  
HELX_P HELX_P84  AJ3 ALA D 994  ? GLU D 1005 ? ALA D 994  GLU D 1005 1 ? 12 
HELX_P HELX_P85  AJ4 PRO D 1006 ? GLN D 1009 ? PRO D 1006 GLN D 1009 5 ? 4  
HELX_P HELX_P86  AJ5 GLY D 1027 ? GLU D 1036 ? GLY D 1027 GLU D 1036 1 ? 10 
HELX_P HELX_P87  AJ6 ASP D 1117 ? GLN D 1145 ? ASP D 1117 GLN D 1145 1 ? 29 
HELX_P HELX_P88  AJ7 HIS D 1150 ? LEU D 1162 ? HIS D 1150 LEU D 1162 1 ? 13 
HELX_P HELX_P89  AJ8 ARG D 1183 ? ASN D 1190 ? ARG D 1183 ASN D 1190 1 ? 8  
HELX_P HELX_P90  AJ9 GLY D 1209 ? ALA D 1216 ? GLY D 1209 ALA D 1216 1 ? 8  
HELX_P HELX_P91  AK1 SER D 1219 ? SER D 1225 ? SER D 1219 SER D 1225 1 ? 7  
HELX_P HELX_P92  AK2 GLU D 1228 ? ALA D 1237 ? GLU D 1228 ALA D 1237 1 ? 10 
HELX_P HELX_P93  AK3 GLY D 1247 ? GLY D 1255 ? GLY D 1247 GLY D 1255 1 ? 9  
HELX_P HELX_P94  AK4 ILE D 1264 ? ASN D 1269 ? ILE D 1264 ASN D 1269 1 ? 6  
HELX_P HELX_P95  AK5 LEU E 33   ? ASN E 37   ? LEU E 33   ASN E 37   5 ? 5  
HELX_P HELX_P96  AK6 PRO E 39   ? ARG E 46   ? PRO E 39   ARG E 46   1 ? 8  
HELX_P HELX_P97  AK7 SER E 49   ? LEU E 71   ? SER E 49   LEU E 71   1 ? 23 
HELX_P HELX_P98  AK8 LYS E 90   ? ALA E 101  ? LYS E 90   ALA E 101  1 ? 12 
HELX_P HELX_P99  AK9 SER F 209  ? THR F 222  ? SER F 209  THR F 222  1 ? 14 
HELX_P HELX_P100 AL1 ASP F 226  ? GLY F 236  ? ASP F 226  GLY F 236  1 ? 11 
HELX_P HELX_P101 AL2 ASN F 242  ? GLY F 270  ? ASN F 242  GLY F 270  1 ? 29 
HELX_P HELX_P102 AL3 PRO F 274  ? ASN F 299  ? PRO F 274  ASN F 299  1 ? 26 
HELX_P HELX_P103 AL4 ASN F 299  ? LEU F 306  ? ASN F 299  LEU F 306  1 ? 8  
HELX_P HELX_P104 AL5 ALA F 307  ? THR F 311  ? ALA F 307  THR F 311  5 ? 5  
HELX_P HELX_P105 AL6 ALA F 316  ? LYS F 334  ? ALA F 316  LYS F 334  1 ? 19 
HELX_P HELX_P106 AL7 LYS F 342  ? ALA F 363  ? LYS F 342  ALA F 363  1 ? 22 
HELX_P HELX_P107 AL8 PRO F 369  ? GLY F 391  ? PRO F 369  GLY F 391  1 ? 23 
HELX_P HELX_P108 AL9 THR F 395  ? ASP F 404  ? THR F 395  ASP F 404  1 ? 10 
HELX_P HELX_P109 AM1 THR F 406  ? ALA F 417  ? THR F 406  ALA F 417  1 ? 12 
HELX_P HELX_P110 AM2 GLY F 436  ? ILE F 439  ? GLY F 436  ILE F 439  5 ? 4  
HELX_P HELX_P111 AM3 VAL F 446  ? GLN F 461  ? VAL F 446  GLN F 461  1 ? 16 
HELX_P HELX_P112 AM4 ARG F 470  ? PHE F 479  ? ARG F 470  PHE F 479  1 ? 10 
HELX_P HELX_P113 AM5 THR F 488  ? TYR F 496  ? THR F 488  TYR F 496  1 ? 9  
HELX_P HELX_P114 AM6 GLU F 501  ? SER F 512  ? GLU F 501  SER F 512  1 ? 12 
HELX_P HELX_P115 AM7 ARG F 515  ? SER F 520  ? ARG F 515  SER F 520  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? D CYS 62  SG  ? ? ? 1_555 D CYS 78  SG ? ? D CYS 62  D CYS 78   1_555 ? ? ? ? ? ? ?            2.894 ? 
disulf2  disulf ? ? D CYS 975 SG  ? ? ? 1_555 D CYS 978 SG ? ? D CYS 975 D CYS 978  1_555 ? ? ? ? ? ? ?            2.605 ? 
metalc1  metalc ? ? D CYS 60  SG  ? ? ? 1_555 J ZN  .   ZN ? ? D CYS 60  D ZN  1402 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc2  metalc ? ? D CYS 62  SG  ? ? ? 1_555 J ZN  .   ZN ? ? D CYS 62  D ZN  1402 1_555 ? ? ? ? ? ? ?            2.273 ? 
metalc3  metalc ? ? D CYS 75  SG  ? ? ? 1_555 J ZN  .   ZN ? ? D CYS 75  D ZN  1402 1_555 ? ? ? ? ? ? ?            2.317 ? 
metalc4  metalc ? ? D CYS 78  SG  ? ? ? 1_555 J ZN  .   ZN ? ? D CYS 78  D ZN  1402 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc5  metalc ? ? D ASP 535 OD1 ? ? ? 1_555 K MG  .   MG ? ? D ASP 535 D MG  1403 1_555 ? ? ? ? ? ? ?            2.368 ? 
metalc6  metalc ? ? D ASP 537 OD1 ? ? ? 1_555 K MG  .   MG ? ? D ASP 537 D MG  1403 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc7  metalc ? ? D ASP 539 OD1 ? ? ? 1_555 K MG  .   MG ? ? D ASP 539 D MG  1403 1_555 ? ? ? ? ? ? ?            2.432 ? 
metalc8  metalc ? ? D CYS 891 SG  ? ? ? 1_555 I ZN  .   ZN ? ? D CYS 891 D ZN  1401 1_555 ? ? ? ? ? ? ?            2.217 ? 
metalc9  metalc ? ? D CYS 968 SG  ? ? ? 1_555 I ZN  .   ZN ? ? D CYS 968 D ZN  1401 1_555 ? ? ? ? ? ? ?            2.289 ? 
metalc10 metalc ? ? D CYS 975 SG  ? ? ? 1_555 I ZN  .   ZN ? ? D CYS 975 D ZN  1401 1_555 ? ? ? ? ? ? ?            2.343 ? 
metalc11 metalc ? ? D CYS 978 SG  ? ? ? 1_555 I ZN  .   ZN ? ? D CYS 978 D ZN  1401 1_555 ? ? ? ? ? ? ?            2.144 ? 
hydrog1  hydrog ? ? G DT  15  N3  ? ? ? 1_555 H DA  9   N1 ? ? H DT  15  G DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G DT  15  O4  ? ? ? 1_555 H DA  9   N6 ? ? H DT  15  G DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DC  16  N3  ? ? ? 1_555 H DG  8   N1 ? ? H DC  16  G DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DC  16  N4  ? ? ? 1_555 H DG  8   O6 ? ? H DC  16  G DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DC  16  O2  ? ? ? 1_555 H DG  8   N2 ? ? H DC  16  G DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DA  17  N1  ? ? ? 1_555 H DT  7   N3 ? ? H DA  17  G DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DA  17  N6  ? ? ? 1_555 H DT  7   O4 ? ? H DA  17  G DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G DC  18  N3  ? ? ? 1_555 H DG  6   N1 ? ? H DC  18  G DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G DC  18  N4  ? ? ? 1_555 H DG  6   O6 ? ? H DC  18  G DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G DC  18  O2  ? ? ? 1_555 H DG  6   N2 ? ? H DC  18  G DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G DG  19  N1  ? ? ? 1_555 H DC  5   N3 ? ? H DG  19  G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G DG  19  N2  ? ? ? 1_555 H DC  5   O2 ? ? H DG  19  G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G DG  19  O6  ? ? ? 1_555 H DC  5   N4 ? ? H DG  19  G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G DG  20  N1  ? ? ? 1_555 H DC  4   N3 ? ? H DG  20  G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G DG  20  N2  ? ? ? 1_555 H DC  4   O2 ? ? H DG  20  G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? G DG  20  O6  ? ? ? 1_555 H DC  4   N4 ? ? H DG  20  G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G DA  21  N1  ? ? ? 1_555 H DT  3   N3 ? ? H DA  21  G DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G DA  21  N6  ? ? ? 1_555 H DT  3   O4 ? ? H DA  21  G DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G DT  22  N3  ? ? ? 1_555 H DA  2   N1 ? ? H DT  22  G DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G DT  22  O4  ? ? ? 1_555 H DA  2   N6 ? ? H DT  22  G DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G DG  23  N1  ? ? ? 1_555 H DC  1   N3 ? ? H DG  23  G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? G DG  23  N2  ? ? ? 1_555 H DC  1   O2 ? ? H DG  23  G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? G DG  23  O6  ? ? ? 1_555 H DC  1   N4 ? ? H DG  23  G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 24  A . ? GLU 24  A PRO 25  A ? PRO 25  A 1 -4.00 
2 GLU 24  B . ? GLU 24  B PRO 25  B ? PRO 25  B 1 -2.22 
3 SER 94  C . ? SER 94  C PRO 95  C ? PRO 95  C 1 -6.02 
4 VAL 110 D . ? VAL 110 D PRO 111 D ? PRO 111 D 1 0.47  
5 ALA 501 D . ? ALA 501 D PRO 502 D ? PRO 502 D 1 -5.49 
6 LEU 677 D . ? LEU 677 D PRO 678 D ? PRO 678 D 1 -8.04 
7 ASN 37  E . ? ASN 37  E PRO 38  E ? PRO 38  E 1 1.67  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 4 ? 
AB3 ? 3 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 3 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 5 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 6 ? 
AC7 ? 3 ? 
AC8 ? 4 ? 
AC9 ? 3 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 8 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 3 ? 
AD8 ? 3 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 3 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 4 ? 
AE6 ? 3 ? 
AE7 ? 2 ? 
AE8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? parallel      
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? parallel      
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? parallel      
AC6 4 5 ? anti-parallel 
AC6 5 6 ? parallel      
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
AD3 5 6 ? parallel      
AD3 6 7 ? anti-parallel 
AD3 7 8 ? parallel      
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? parallel      
AD9 1 2 ? parallel      
AD9 2 3 ? anti-parallel 
AE1 1 2 ? parallel      
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 11   ? VAL A 13   ? GLU A 11   VAL A 13   
AA1 2 ARG A 18   ? LEU A 26   ? ARG A 18   LEU A 26   
AA1 3 PHE A 189  ? THR A 198  ? PHE A 189  THR A 198  
AA1 4 VAL A 171  ? THR A 181  ? VAL A 171  THR A 181  
AA2 1 ILE A 110  ? VAL A 111  ? ILE A 110  VAL A 111  
AA2 2 VAL A 93   ? GLN A 100  ? VAL A 93   GLN A 100  
AA2 3 LYS A 133  ? ARG A 144  ? LYS A 133  ARG A 144  
AA2 4 PRO A 47   ? ILE A 56   ? PRO A 47   ILE A 56   
AA2 5 ILE A 162  ? PRO A 163  ? ILE A 162  PRO A 163  
AA3 1 VAL A 85   ? SER A 87   ? VAL A 85   SER A 87   
AA3 2 VAL A 116  ? VAL A 118  ? VAL A 116  VAL A 118  
AA4 1 GLY A 103  ? THR A 106  ? GLY A 103  THR A 106  
AA4 2 HIS A 124  ? LEU A 128  ? HIS A 124  LEU A 128  
AA5 1 TYR A 146  ? VAL A 147  ? TYR A 146  VAL A 147  
AA5 2 SER A 166  ? ILE A 167  ? SER A 166  ILE A 167  
AA6 1 LEU B 9    ? VAL B 13   ? LEU B 9    VAL B 13   
AA6 2 ARG B 18   ? LEU B 26   ? ARG B 18   LEU B 26   
AA6 3 ASP B 190  ? THR B 198  ? ASP B 190  THR B 198  
AA6 4 VAL B 171  ? ALA B 180  ? VAL B 171  ALA B 180  
AA7 1 VAL B 93   ? GLN B 100  ? VAL B 93   GLN B 100  
AA7 2 LYS B 133  ? ARG B 144  ? LYS B 133  ARG B 144  
AA7 3 PRO B 47   ? ILE B 56   ? PRO B 47   ILE B 56   
AA7 4 ARG B 161  ? PRO B 163  ? ARG B 161  PRO B 163  
AA8 1 VAL B 85   ? SER B 87   ? VAL B 85   SER B 87   
AA8 2 VAL B 116  ? VAL B 118  ? VAL B 116  VAL B 118  
AA9 1 GLY B 103  ? VAL B 105  ? GLY B 103  VAL B 105  
AA9 2 ALA B 126  ? LEU B 128  ? ALA B 126  LEU B 128  
AB1 1 VAL C 39   ? SER C 40   ? VAL C 39   SER C 40   
AB1 2 VAL C 972  ? SER C 973  ? VAL C 972  SER C 973  
AB1 3 VAL C 626  ? GLY C 627  ? VAL C 626  GLY C 627  
AB2 1 ILE C 96   ? GLU C 97   ? ILE C 96   GLU C 97   
AB2 2 MET C 103  ? PHE C 112  ? MET C 103  PHE C 112  
AB2 3 ALA C 130  ? ASN C 141  ? ALA C 130  ASN C 141  
AB2 4 ILE C 147  ? PRO C 158  ? ILE C 147  PRO C 158  
AB3 1 PHE C 166  ? ILE C 168  ? PHE C 166  ILE C 168  
AB3 2 THR C 171  ? VAL C 175  ? THR C 171  VAL C 175  
AB3 3 SER C 437  ? PHE C 439  ? SER C 437  PHE C 439  
AB4 1 ARG C 376  ? ARG C 379  ? ARG C 376  ARG C 379  
AB4 2 SER C 177  ? ARG C 181  ? SER C 177  ARG C 181  
AB4 3 ARG C 454  ? SER C 456  ? ARG C 454  SER C 456  
AB4 4 ILE C 497  ? SER C 499  ? ILE C 497  SER C 499  
AB5 1 GLY C 184  ? ILE C 191  ? GLY C 184  ILE C 191  
AB5 2 THR C 198  ? ILE C 205  ? THR C 198  ILE C 205  
AB6 1 LEU C 212  ? VAL C 216  ? LEU C 212  VAL C 216  
AB6 2 VAL C 222  ? ILE C 226  ? VAL C 222  ILE C 226  
AB6 3 GLN C 232  ? PRO C 233  ? GLN C 232  PRO C 233  
AB7 1 THR C 354  ? THR C 356  ? THR C 354  THR C 356  
AB7 2 GLU C 362  ? PRO C 364  ? GLU C 362  PRO C 364  
AB8 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AB8 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AB8 3 VAL C 524  ? LEU C 531  ? VAL C 524  LEU C 531  
AB9 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AB9 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AB9 3 TYR C 578  ? ASP C 580  ? TYR C 578  ASP C 580  
AB9 4 VAL C 541  ? ALA C 542  ? VAL C 541  ALA C 542  
AB9 5 VAL C 561  ? ARG C 562  ? VAL C 561  ARG C 562  
AC1 1 ARG C 558  ? VAL C 559  ? ARG C 558  VAL C 559  
AC1 2 VAL C 571  ? PRO C 572  ? VAL C 571  PRO C 572  
AC2 1 VAL C 642  ? VAL C 643  ? VAL C 642  VAL C 643  
AC2 2 VAL C 701  ? ASP C 704  ? VAL C 701  ASP C 704  
AC2 3 CYS C 687  ? PRO C 688  ? CYS C 687  PRO C 688  
AC3 1 ARG C 667  ? ARG C 671  ? ARG C 667  ARG C 671  
AC3 2 TYR C 657  ? HIS C 662  ? TYR C 657  HIS C 662  
AC3 3 GLY C 648  ? VAL C 653  ? GLY C 648  VAL C 653  
AC3 4 ARG C 695  ? VAL C 696  ? ARG C 695  VAL C 696  
AC4 1 ALA C 676  ? ARG C 677  ? ALA C 676  ARG C 677  
AC4 2 CYS C 683  ? ALA C 684  ? CYS C 683  ALA C 684  
AC5 1 THR C 708  ? ASP C 709  ? THR C 708  ASP C 709  
AC5 2 GLU C 712  ? MET C 713  ? GLU C 712  MET C 713  
AC6 1 LEU C 885  ? ALA C 886  ? LEU C 885  ALA C 886  
AC6 2 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC6 3 GLY C 716  ? ILE C 723  ? GLY C 716  ILE C 723  
AC6 4 ILE C 915  ? LEU C 917  ? ILE C 915  LEU C 917  
AC6 5 ILE C 735  ? SER C 738  ? ILE C 735  SER C 738  
AC6 6 ILE C 895  ? LEU C 899  ? ILE C 895  LEU C 899  
AC7 1 LEU C 885  ? ALA C 886  ? LEU C 885  ALA C 886  
AC7 2 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC7 3 LYS C 1007 ? ALA C 1008 ? LYS C 1007 ALA C 1008 
AC8 1 SER C 749  ? ARG C 760  ? SER C 749  ARG C 760  
AC8 2 VAL C 865  ? ARG C 877  ? VAL C 865  ARG C 877  
AC8 3 GLY C 845  ? SER C 854  ? GLY C 845  SER C 854  
AC8 4 GLU C 795  ? VAL C 796  ? GLU C 795  VAL C 796  
AC9 1 GLU C 768  ? ILE C 769  ? GLU C 768  ILE C 769  
AC9 2 LYS C 805  ? PRO C 808  ? LYS C 805  PRO C 808  
AC9 3 VAL C 832  ? ASP C 834  ? VAL C 832  ASP C 834  
AD1 1 ILE C 801  ? VAL C 803  ? ILE C 801  VAL C 803  
AD1 2 LEU C 837  ? LYS C 838  ? LEU C 837  LYS C 838  
AD2 1 TRP C 944  ? LYS C 945  ? TRP C 944  LYS C 945  
AD2 2 GLU C 965  ? ALA C 966  ? GLU C 965  ALA C 966  
AD3 1 HIS C 1042 ? ARG C 1044 ? HIS C 1042 ARG C 1044 
AD3 2 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD3 3 GLN D 540  ? HIS D 544  ? GLN D 540  HIS D 544  
AD3 4 VAL D 496  ? ASN D 499  ? VAL D 496  ASN D 499  
AD3 5 ILE D 509  ? VAL D 517  ? ILE D 509  VAL D 517  
AD3 6 GLN D 440  ? PRO D 444  ? GLN D 440  PRO D 444  
AD3 7 ILE D 522  ? LEU D 524  ? ILE D 522  LEU D 524  
AD3 8 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD4 1 GLN C 1066 ? PHE C 1068 ? GLN C 1066 PHE C 1068 
AD4 2 LYS D 420  ? VAL D 422  ? LYS D 420  VAL D 422  
AD5 1 LEU C 1133 ? LEU C 1138 ? LEU C 1133 LEU C 1138 
AD5 2 GLU D 9    ? LEU D 14   ? GLU D 9    LEU D 14   
AD5 3 SER D 1242 ? LYS D 1244 ? SER D 1242 LYS D 1244 
AD6 1 GLY D 93   ? THR D 102  ? GLY D 93   THR D 102  
AD6 2 VAL D 313  ? VAL D 319  ? VAL D 313  VAL D 319  
AD7 1 GLN D 233  ? ILE D 235  ? GLN D 233  ILE D 235  
AD7 2 TYR D 134  ? VAL D 139  ? TYR D 134  VAL D 139  
AD7 3 PHE D 252  ? ALA D 255  ? PHE D 252  ALA D 255  
AD8 1 MET D 327  ? GLN D 329  ? MET D 327  GLN D 329  
AD8 2 PHE D 335  ? THR D 337  ? PHE D 335  THR D 337  
AD8 3 ILE F 421  ? SER F 422  ? ILE F 421  SER F 422  
AD9 1 VAL D 611  ? TYR D 612  ? VAL D 611  TYR D 612  
AD9 2 LYS D 632  ? ARG D 636  ? LYS D 632  ARG D 636  
AD9 3 MET D 663  ? THR D 667  ? MET D 663  THR D 667  
AE1 1 VAL D 886  ? GLU D 888  ? VAL D 886  GLU D 888  
AE1 2 VAL D 974  ? CYS D 975  ? VAL D 974  CYS D 975  
AE2 1 ILE D 897  ? VAL D 899  ? ILE D 897  VAL D 899  
AE2 2 VAL D 960  ? ARG D 963  ? VAL D 960  ARG D 963  
AE2 3 THR D 924  ? LEU D 925  ? THR D 924  LEU D 925  
AE3 1 ALA D 902  ? ARG D 904  ? ALA D 902  ARG D 904  
AE3 2 LEU D 910  ? ARG D 912  ? LEU D 910  ARG D 912  
AE4 1 ALA D 929  ? VAL D 930  ? ALA D 929  VAL D 930  
AE4 2 VAL D 936  ? VAL D 938  ? VAL D 936  VAL D 938  
AE5 1 VAL D 1075 ? LYS D 1079 ? VAL D 1075 LYS D 1079 
AE5 2 TYR D 1062 ? PRO D 1068 ? TYR D 1062 PRO D 1068 
AE5 3 GLY D 1051 ? LEU D 1055 ? GLY D 1051 LEU D 1055 
AE5 4 HIS D 1104 ? VAL D 1105 ? HIS D 1104 VAL D 1105 
AE6 1 LEU D 1180 ? ASP D 1182 ? LEU D 1180 ASP D 1182 
AE6 2 ARG D 1164 ? ASP D 1169 ? ARG D 1164 ASP D 1169 
AE6 3 ALA D 1202 ? PRO D 1205 ? ALA D 1202 PRO D 1205 
AE7 1 ALA D 1271 ? PRO D 1274 ? ALA D 1271 PRO D 1274 
AE7 2 LEU E 104  ? THR E 107  ? LEU E 104  THR E 107  
AE8 1 THR F 426  ? ILE F 427  ? THR F 426  ILE F 427  
AE8 2 GLU F 430  ? GLN F 434  ? GLU F 430  GLN F 434  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 11   ? N GLU A 11   O VAL A 22   ? O VAL A 22   
AA1 2 3 N PHE A 21   ? N PHE A 21   O LEU A 194  ? O LEU A 194  
AA1 3 4 O ILE A 193  ? O ILE A 193  N LYS A 177  ? N LYS A 177  
AA2 1 2 O VAL A 111  ? O VAL A 111  N TYR A 96   ? N TYR A 96   
AA2 2 3 N MET A 95   ? N MET A 95   O LEU A 138  ? O LEU A 138  
AA2 3 4 O GLY A 143  ? O GLY A 143  N GLY A 48   ? N GLY A 48   
AA2 4 5 N ILE A 54   ? N ILE A 54   O ILE A 162  ? O ILE A 162  
AA3 1 2 N SER A 86   ? N SER A 86   O THR A 117  ? O THR A 117  
AA4 1 2 N VAL A 105  ? N VAL A 105  O ALA A 126  ? O ALA A 126  
AA5 1 2 N VAL A 147  ? N VAL A 147  O SER A 166  ? O SER A 166  
AA6 1 2 N LEU B 9    ? N LEU B 9    O GLU B 24   ? O GLU B 24   
AA6 2 3 N LEU B 26   ? N LEU B 26   O ASP B 190  ? O ASP B 190  
AA6 3 4 O ASP B 195  ? O ASP B 195  N THR B 175  ? N THR B 175  
AA7 1 2 N MET B 95   ? N MET B 95   O LEU B 138  ? O LEU B 138  
AA7 2 3 O VAL B 139  ? O VAL B 139  N THR B 52   ? N THR B 52   
AA7 3 4 N ILE B 54   ? N ILE B 54   O ILE B 162  ? O ILE B 162  
AA8 1 2 N SER B 86   ? N SER B 86   O THR B 117  ? O THR B 117  
AA9 1 2 N VAL B 105  ? N VAL B 105  O ALA B 126  ? O ALA B 126  
AB1 1 2 N VAL C 39   ? N VAL C 39   O SER C 973  ? O SER C 973  
AB1 2 3 O VAL C 972  ? O VAL C 972  N GLY C 627  ? N GLY C 627  
AB2 1 2 N ILE C 96   ? N ILE C 96   O LEU C 105  ? O LEU C 105  
AB2 2 3 N SER C 104  ? N SER C 104  O ILE C 140  ? O ILE C 140  
AB2 3 4 N LEU C 133  ? N LEU C 133  O MET C 154  ? O MET C 154  
AB3 1 2 N PHE C 166  ? N PHE C 166  O ARG C 173  ? O ARG C 173  
AB3 2 3 N VAL C 174  ? N VAL C 174  O GLN C 438  ? O GLN C 438  
AB4 1 2 O ARG C 377  ? O ARG C 377  N VAL C 180  ? N VAL C 180  
AB4 2 3 N LEU C 179  ? N LEU C 179  O SER C 456  ? O SER C 456  
AB4 3 4 N LEU C 455  ? N LEU C 455  O GLY C 498  ? O GLY C 498  
AB5 1 2 N ASP C 188  ? N ASP C 188  O SER C 201  ? O SER C 201  
AB6 1 2 N ASP C 215  ? N ASP C 215  O GLY C 223  ? O GLY C 223  
AB6 2 3 N VAL C 224  ? N VAL C 224  O GLN C 232  ? O GLN C 232  
AB7 1 2 N MET C 355  ? N MET C 355  O VAL C 363  ? O VAL C 363  
AB8 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AB8 2 3 N LYS C 518  ? N LYS C 518  O SER C 525  ? O SER C 525  
AB9 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AB9 2 3 N ARG C 517  ? N ARG C 517  O MET C 579  ? O MET C 579  
AB9 3 4 O ASP C 580  ? O ASP C 580  N ALA C 542  ? N ALA C 542  
AB9 4 5 N VAL C 541  ? N VAL C 541  O ARG C 562  ? O ARG C 562  
AC1 1 2 N VAL C 559  ? N VAL C 559  O VAL C 571  ? O VAL C 571  
AC2 1 2 N VAL C 642  ? N VAL C 642  O ALA C 703  ? O ALA C 703  
AC2 2 3 O ASP C 704  ? O ASP C 704  N CYS C 687  ? N CYS C 687  
AC3 1 2 O TYR C 670  ? O TYR C 670  N ILE C 658  ? N ILE C 658  
AC3 2 3 O MET C 661  ? O MET C 661  N VAL C 649  ? N VAL C 649  
AC3 3 4 N GLY C 648  ? N GLY C 648  O VAL C 696  ? O VAL C 696  
AC4 1 2 N ALA C 676  ? N ALA C 676  O ALA C 684  ? O ALA C 684  
AC5 1 2 N ASP C 709  ? N ASP C 709  O GLU C 712  ? O GLU C 712  
AC6 1 2 N ALA C 886  ? N ALA C 886  O MET C 1031 ? O MET C 1031 
AC6 2 3 O GLY C 1026 ? O GLY C 1026 N VAL C 721  ? N VAL C 721  
AC6 3 4 N LEU C 720  ? N LEU C 720  O ILE C 915  ? O ILE C 915  
AC6 4 5 O ILE C 916  ? O ILE C 916  N ILE C 736  ? N ILE C 736  
AC6 5 6 N ILE C 735  ? N ILE C 735  O GLY C 896  ? O GLY C 896  
AC7 1 2 N ALA C 886  ? N ALA C 886  O MET C 1031 ? O MET C 1031 
AC7 2 3 O VAL C 1023 ? O VAL C 1023 N ALA C 1008 ? N ALA C 1008 
AC8 1 2 N ALA C 759  ? N ALA C 759  O ASN C 866  ? O ASN C 866  
AC8 2 3 O ARG C 870  ? O ARG C 870  N ARG C 851  ? N ARG C 851  
AC8 3 4 O GLY C 845  ? O GLY C 845  N VAL C 796  ? N VAL C 796  
AC9 1 2 N GLU C 768  ? N GLU C 768  O VAL C 806  ? O VAL C 806  
AC9 2 3 N THR C 807  ? N THR C 807  O ARG C 833  ? O ARG C 833  
AD1 1 2 N LEU C 802  ? N LEU C 802  O LEU C 837  ? O LEU C 837  
AD2 1 2 N TRP C 944  ? N TRP C 944  O ALA C 966  ? O ALA C 966  
AD3 1 2 N HIS C 1042 ? N HIS C 1042 O ARG D 427  ? O ARG D 427  
AD3 2 3 N GLY D 426  ? N GLY D 426  O VAL D 543  ? O VAL D 543  
AD3 3 4 O HIS D 544  ? O HIS D 544  N LEU D 497  ? N LEU D 497  
AD3 4 5 N LEU D 498  ? N LEU D 498  O GLN D 510  ? O GLN D 510  
AD3 5 6 O MET D 515  ? O MET D 515  N CYS D 441  ? N CYS D 441  
AD3 6 7 N GLY D 442  ? N GLY D 442  O GLN D 523  ? O GLN D 523  
AD3 7 8 O ILE D 522  ? O ILE D 522  N VAL D 431  ? N VAL D 431  
AD4 1 2 N PHE C 1068 ? N PHE C 1068 O LYS D 420  ? O LYS D 420  
AD5 1 2 N LEU C 1138 ? N LEU C 1138 O GLU D 9    ? O GLU D 9    
AD5 2 3 N LEU D 10   ? N LEU D 10   O ASP D 1243 ? O ASP D 1243 
AD6 1 2 N GLY D 93   ? N GLY D 93   O VAL D 319  ? O VAL D 319  
AD7 1 2 O GLN D 233  ? O GLN D 233  N ILE D 136  ? N ILE D 136  
AD7 2 3 N SER D 138  ? N SER D 138  O THR D 253  ? O THR D 253  
AD8 1 2 N VAL D 328  ? N VAL D 328  O ALA D 336  ? O ALA D 336  
AD8 2 3 N PHE D 335  ? N PHE D 335  O ILE F 421  ? O ILE F 421  
AD9 1 2 N TYR D 612  ? N TYR D 612  O LYS D 634  ? O LYS D 634  
AD9 2 3 N ILE D 633  ? N ILE D 633  O THR D 666  ? O THR D 666  
AE1 1 2 N ARG D 887  ? N ARG D 887  O VAL D 974  ? O VAL D 974  
AE2 1 2 N VAL D 899  ? N VAL D 899  O VAL D 960  ? O VAL D 960  
AE2 2 3 O ARG D 963  ? O ARG D 963  N THR D 924  ? N THR D 924  
AE3 1 2 N GLU D 903  ? N GLU D 903  O ILE D 911  ? O ILE D 911  
AE4 1 2 N ALA D 929  ? N ALA D 929  O ILE D 937  ? O ILE D 937  
AE5 1 2 O TYR D 1077 ? O TYR D 1077 N ILE D 1064 ? N ILE D 1064 
AE5 2 3 O VAL D 1067 ? O VAL D 1067 N ARG D 1052 ? N ARG D 1052 
AE5 3 4 N GLY D 1051 ? N GLY D 1051 O VAL D 1105 ? O VAL D 1105 
AE6 1 2 O ILE D 1181 ? O ILE D 1181 N VAL D 1165 ? N VAL D 1165 
AE6 2 3 N THR D 1166 ? N THR D 1166 O ARG D 1204 ? O ARG D 1204 
AE7 1 2 N GLN D 1273 ? N GLN D 1273 O GLU E 105  ? O GLU E 105  
AE8 1 2 N ILE F 427  ? N ILE F 427  O SER F 433  ? O SER F 433  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D ZN  1401 ? 4  'binding site for residue ZN D 1401'  
AC2 Software D ZN  1402 ? 4  'binding site for residue ZN D 1402'  
AC3 Software D MG  1403 ? 3  'binding site for residue MG D 1403'  
AC4 Software D 88G 1404 ? 11 'binding site for residue 88G D 1404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS D 891 ? CYS D 891 . ? 1_555 ? 
2  AC1 4  CYS D 968 ? CYS D 968 . ? 1_555 ? 
3  AC1 4  CYS D 975 ? CYS D 975 . ? 1_555 ? 
4  AC1 4  CYS D 978 ? CYS D 978 . ? 1_555 ? 
5  AC2 4  CYS D 60  ? CYS D 60  . ? 1_555 ? 
6  AC2 4  CYS D 62  ? CYS D 62  . ? 1_555 ? 
7  AC2 4  CYS D 75  ? CYS D 75  . ? 1_555 ? 
8  AC2 4  CYS D 78  ? CYS D 78  . ? 1_555 ? 
9  AC3 3  ASP D 535 ? ASP D 535 . ? 1_555 ? 
10 AC3 3  ASP D 537 ? ASP D 537 . ? 1_555 ? 
11 AC3 3  ASP D 539 ? ASP D 539 . ? 1_555 ? 
12 AC4 11 VAL C 475 ? VAL C 475 . ? 1_555 ? 
13 AC4 11 PRO C 477 ? PRO C 477 . ? 1_555 ? 
14 AC4 11 GLY C 566 ? GLY C 566 . ? 1_555 ? 
15 AC4 11 VAL C 568 ? VAL C 568 . ? 1_555 ? 
16 AC4 11 ARG D 834 ? ARG D 834 . ? 1_555 ? 
17 AC4 11 PRO D 835 ? PRO D 835 . ? 1_555 ? 
18 AC4 11 LEU D 847 ? LEU D 847 . ? 1_555 ? 
19 AC4 11 GLU D 848 ? GLU D 848 . ? 1_555 ? 
20 AC4 11 PHE D 850 ? PHE D 850 . ? 1_555 ? 
21 AC4 11 ILE D 851 ? ILE D 851 . ? 1_555 ? 
22 AC4 11 HIS D 854 ? HIS D 854 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5UHE 
_atom_sites.fract_transf_matrix[1][1]   0.006599 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006167 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005110 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ILE A 1  3    ? -19.065 -1.404  -54.643 1.00 126.75 ? 3    ILE A N     1 
ATOM   2     C  CA    . ILE A 1  3    ? -18.712 -1.195  -56.041 1.00 130.30 ? 3    ILE A CA    1 
ATOM   3     C  C     . ILE A 1  3    ? -19.274 0.144   -56.533 1.00 130.16 ? 3    ILE A C     1 
ATOM   4     O  O     . ILE A 1  3    ? -19.953 0.214   -57.559 1.00 124.62 ? 3    ILE A O     1 
ATOM   5     C  CB    . ILE A 1  3    ? -19.224 -2.356  -56.929 1.00 126.09 ? 3    ILE A CB    1 
ATOM   6     C  CG1   . ILE A 1  3    ? -19.173 -3.679  -56.158 1.00 119.66 ? 3    ILE A CG1   1 
ATOM   7     C  CG2   . ILE A 1  3    ? -18.408 -2.457  -58.212 1.00 118.25 ? 3    ILE A CG2   1 
ATOM   8     C  CD1   . ILE A 1  3    ? -19.662 -4.879  -56.947 1.00 112.22 ? 3    ILE A CD1   1 
ATOM   9     N  N     . SER A 1  4    ? -18.987 1.206   -55.783 1.00 143.99 ? 4    SER A N     1 
ATOM   10    C  CA    . SER A 1  4    ? -19.413 2.556   -56.148 1.00 149.86 ? 4    SER A CA    1 
ATOM   11    C  C     . SER A 1  4    ? -18.482 3.616   -55.554 1.00 148.67 ? 4    SER A C     1 
ATOM   12    O  O     . SER A 1  4    ? -17.773 3.358   -54.581 1.00 146.55 ? 4    SER A O     1 
ATOM   13    C  CB    . SER A 1  4    ? -20.853 2.810   -55.692 1.00 149.26 ? 4    SER A CB    1 
ATOM   14    O  OG    . SER A 1  4    ? -20.957 2.805   -54.278 1.00 149.73 ? 4    SER A OG    1 
ATOM   15    N  N     . GLN A 1  5    ? -18.489 4.807   -56.146 1.00 143.01 ? 5    GLN A N     1 
ATOM   16    C  CA    . GLN A 1  5    ? -17.623 5.891   -55.691 1.00 139.65 ? 5    GLN A CA    1 
ATOM   17    C  C     . GLN A 1  5    ? -18.344 7.235   -55.636 1.00 135.41 ? 5    GLN A C     1 
ATOM   18    O  O     . GLN A 1  5    ? -18.873 7.711   -56.642 1.00 130.49 ? 5    GLN A O     1 
ATOM   19    C  CB    . GLN A 1  5    ? -16.394 6.007   -56.594 1.00 136.25 ? 5    GLN A CB    1 
ATOM   20    C  CG    . GLN A 1  5    ? -15.423 4.843   -56.485 1.00 131.11 ? 5    GLN A CG    1 
ATOM   21    C  CD    . GLN A 1  5    ? -14.204 5.023   -57.366 1.00 133.97 ? 5    GLN A CD    1 
ATOM   22    O  OE1   . GLN A 1  5    ? -14.244 5.756   -58.355 1.00 142.20 ? 5    GLN A OE1   1 
ATOM   23    N  NE2   . GLN A 1  5    ? -13.110 4.362   -57.007 1.00 127.61 ? 5    GLN A NE2   1 
ATOM   24    N  N     . ARG A 1  6    ? -18.345 7.841   -54.451 1.00 136.95 ? 6    ARG A N     1 
ATOM   25    C  CA    . ARG A 1  6    ? -18.956 9.149   -54.226 1.00 131.04 ? 6    ARG A CA    1 
ATOM   26    C  C     . ARG A 1  6    ? -18.253 9.910   -53.101 1.00 123.90 ? 6    ARG A C     1 
ATOM   27    O  O     . ARG A 1  6    ? -18.197 9.425   -51.970 1.00 121.22 ? 6    ARG A O     1 
ATOM   28    C  CB    . ARG A 1  6    ? -20.442 9.003   -53.882 1.00 126.63 ? 6    ARG A CB    1 
ATOM   29    C  CG    . ARG A 1  6    ? -21.372 8.797   -55.062 1.00 130.73 ? 6    ARG A CG    1 
ATOM   30    C  CD    . ARG A 1  6    ? -22.808 8.738   -54.581 1.00 125.84 ? 6    ARG A CD    1 
ATOM   31    N  NE    . ARG A 1  6    ? -22.955 7.803   -53.469 1.00 127.99 ? 6    ARG A NE    1 
ATOM   32    C  CZ    . ARG A 1  6    ? -23.144 6.496   -53.615 1.00 131.94 ? 6    ARG A CZ    1 
ATOM   33    N  NH1   . ARG A 1  6    ? -23.213 5.969   -54.829 1.00 136.79 ? 6    ARG A NH1   1 
ATOM   34    N  NH2   . ARG A 1  6    ? -23.266 5.715   -52.550 1.00 127.18 ? 6    ARG A NH2   1 
ATOM   35    N  N     . PRO A 1  7    ? -17.709 11.101  -53.409 1.00 123.65 ? 7    PRO A N     1 
ATOM   36    C  CA    . PRO A 1  7    ? -17.134 11.989  -52.388 1.00 120.39 ? 7    PRO A CA    1 
ATOM   37    C  C     . PRO A 1  7    ? -18.129 12.308  -51.272 1.00 114.87 ? 7    PRO A C     1 
ATOM   38    O  O     . PRO A 1  7    ? -19.295 12.599  -51.541 1.00 111.58 ? 7    PRO A O     1 
ATOM   39    C  CB    . PRO A 1  7    ? -16.770 13.243  -53.185 1.00 114.89 ? 7    PRO A CB    1 
ATOM   40    C  CG    . PRO A 1  7    ? -16.473 12.725  -54.550 1.00 115.80 ? 7    PRO A CG    1 
ATOM   41    C  CD    . PRO A 1  7    ? -17.459 11.603  -54.771 1.00 122.92 ? 7    PRO A CD    1 
ATOM   42    N  N     . THR A 1  8    ? -17.658 12.254  -50.031 1.00 108.39 ? 8    THR A N     1 
ATOM   43    C  CA    . THR A 1  8    ? -18.534 12.322  -48.868 1.00 101.32 ? 8    THR A CA    1 
ATOM   44    C  C     . THR A 1  8    ? -19.005 13.740  -48.541 1.00 104.68 ? 8    THR A C     1 
ATOM   45    O  O     . THR A 1  8    ? -18.374 14.727  -48.924 1.00 102.85 ? 8    THR A O     1 
ATOM   46    C  CB    . THR A 1  8    ? -17.835 11.729  -47.637 1.00 91.31  ? 8    THR A CB    1 
ATOM   47    O  OG1   . THR A 1  8    ? -16.615 12.438  -47.394 1.00 90.70  ? 8    THR A OG1   1 
ATOM   48    C  CG2   . THR A 1  8    ? -17.507 10.274  -47.882 1.00 77.45  ? 8    THR A CG2   1 
ATOM   49    N  N     . LEU A 1  9    ? -20.125 13.821  -47.825 1.00 102.13 ? 9    LEU A N     1 
ATOM   50    C  CA    . LEU A 1  9    ? -20.738 15.095  -47.464 1.00 99.44  ? 9    LEU A CA    1 
ATOM   51    C  C     . LEU A 1  9    ? -20.608 15.379  -45.972 1.00 99.38  ? 9    LEU A C     1 
ATOM   52    O  O     . LEU A 1  9    ? -20.240 14.499  -45.195 1.00 102.26 ? 9    LEU A O     1 
ATOM   53    C  CB    . LEU A 1  9    ? -22.217 15.106  -47.859 1.00 95.47  ? 9    LEU A CB    1 
ATOM   54    C  CG    . LEU A 1  9    ? -22.529 14.779  -49.318 1.00 95.84  ? 9    LEU A CG    1 
ATOM   55    C  CD1   . LEU A 1  9    ? -24.006 14.994  -49.612 1.00 98.95  ? 9    LEU A CD1   1 
ATOM   56    C  CD2   . LEU A 1  9    ? -21.663 15.621  -50.235 1.00 102.36 ? 9    LEU A CD2   1 
ATOM   57    N  N     . SER A 1  10   ? -20.924 16.609  -45.579 1.00 97.25  ? 10   SER A N     1 
ATOM   58    C  CA    . SER A 1  10   ? -20.883 17.010  -44.176 1.00 90.42  ? 10   SER A CA    1 
ATOM   59    C  C     . SER A 1  10   ? -22.032 17.967  -43.855 1.00 86.62  ? 10   SER A C     1 
ATOM   60    O  O     . SER A 1  10   ? -21.847 19.184  -43.844 1.00 83.32  ? 10   SER A O     1 
ATOM   61    C  CB    . SER A 1  10   ? -19.538 17.664  -43.850 1.00 82.65  ? 10   SER A CB    1 
ATOM   62    O  OG    . SER A 1  10   ? -19.403 17.885  -42.458 1.00 80.75  ? 10   SER A OG    1 
ATOM   63    N  N     . GLU A 1  11   ? -23.216 17.416  -43.594 1.00 87.92  ? 11   GLU A N     1 
ATOM   64    C  CA    . GLU A 1  11   ? -24.415 18.231  -43.375 1.00 93.48  ? 11   GLU A CA    1 
ATOM   65    C  C     . GLU A 1  11   ? -24.522 18.722  -41.923 1.00 86.53  ? 11   GLU A C     1 
ATOM   66    O  O     . GLU A 1  11   ? -23.612 18.506  -41.121 1.00 84.07  ? 11   GLU A O     1 
ATOM   67    C  CB    . GLU A 1  11   ? -25.675 17.443  -43.761 1.00 101.67 ? 11   GLU A CB    1 
ATOM   68    C  CG    . GLU A 1  11   ? -25.649 16.856  -45.174 1.00 102.82 ? 11   GLU A CG    1 
ATOM   69    C  CD    . GLU A 1  11   ? -26.915 16.086  -45.522 1.00 112.70 ? 11   GLU A CD    1 
ATOM   70    O  OE1   . GLU A 1  11   ? -27.984 16.388  -44.944 1.00 104.19 ? 11   GLU A OE1   1 
ATOM   71    O  OE2   . GLU A 1  11   ? -26.838 15.176  -46.374 1.00 115.89 ? 11   GLU A OE2   1 
ATOM   72    N  N     . ASP A 1  12   ? -25.634 19.382  -41.595 1.00 83.83  ? 12   ASP A N     1 
ATOM   73    C  CA    . ASP A 1  12   ? -25.827 19.968  -40.267 1.00 78.47  ? 12   ASP A CA    1 
ATOM   74    C  C     . ASP A 1  12   ? -27.308 20.176  -39.933 1.00 75.85  ? 12   ASP A C     1 
ATOM   75    O  O     . ASP A 1  12   ? -28.060 20.767  -40.707 1.00 76.58  ? 12   ASP A O     1 
ATOM   76    C  CB    . ASP A 1  12   ? -25.075 21.307  -40.163 1.00 73.80  ? 12   ASP A CB    1 
ATOM   77    C  CG    . ASP A 1  12   ? -24.925 21.802  -38.723 1.00 74.99  ? 12   ASP A CG    1 
ATOM   78    O  OD1   . ASP A 1  12   ? -25.784 21.493  -37.870 1.00 74.36  ? 12   ASP A OD1   1 
ATOM   79    O  OD2   . ASP A 1  12   ? -23.938 22.516  -38.442 1.00 75.53  ? 12   ASP A OD2   1 
ATOM   80    N  N     . VAL A 1  13   ? -27.715 19.673  -38.774 1.00 76.82  ? 13   VAL A N     1 
ATOM   81    C  CA    . VAL A 1  13   ? -29.005 20.017  -38.188 1.00 82.48  ? 13   VAL A CA    1 
ATOM   82    C  C     . VAL A 1  13   ? -28.703 20.636  -36.817 1.00 82.69  ? 13   VAL A C     1 
ATOM   83    O  O     . VAL A 1  13   ? -28.008 20.032  -36.000 1.00 84.15  ? 13   VAL A O     1 
ATOM   84    C  CB    . VAL A 1  13   ? -29.941 18.788  -38.061 1.00 82.67  ? 13   VAL A CB    1 
ATOM   85    C  CG1   . VAL A 1  13   ? -31.407 19.222  -38.040 1.00 78.02  ? 13   VAL A CG1   1 
ATOM   86    C  CG2   . VAL A 1  13   ? -29.698 17.807  -39.204 1.00 68.76  ? 13   VAL A CG2   1 
ATOM   87    N  N     . LEU A 1  14   ? -29.208 21.842  -36.569 1.00 78.71  ? 14   LEU A N     1 
ATOM   88    C  CA    . LEU A 1  14   ? -28.760 22.619  -35.414 1.00 74.06  ? 14   LEU A CA    1 
ATOM   89    C  C     . LEU A 1  14   ? -29.758 22.722  -34.261 1.00 75.05  ? 14   LEU A C     1 
ATOM   90    O  O     . LEU A 1  14   ? -30.967 22.566  -34.436 1.00 72.72  ? 14   LEU A O     1 
ATOM   91    C  CB    . LEU A 1  14   ? -28.391 24.039  -35.856 1.00 79.56  ? 14   LEU A CB    1 
ATOM   92    C  CG    . LEU A 1  14   ? -27.276 24.254  -36.883 1.00 80.75  ? 14   LEU A CG    1 
ATOM   93    C  CD1   . LEU A 1  14   ? -27.537 25.539  -37.650 1.00 84.65  ? 14   LEU A CD1   1 
ATOM   94    C  CD2   . LEU A 1  14   ? -25.909 24.314  -36.223 1.00 73.15  ? 14   LEU A CD2   1 
ATOM   95    N  N     . THR A 1  15   ? -29.211 22.977  -33.077 1.00 79.61  ? 15   THR A N     1 
ATOM   96    C  CA    . THR A 1  15   ? -29.951 23.518  -31.943 1.00 79.28  ? 15   THR A CA    1 
ATOM   97    C  C     . THR A 1  15   ? -28.953 24.433  -31.226 1.00 79.50  ? 15   THR A C     1 
ATOM   98    O  O     . THR A 1  15   ? -27.744 24.221  -31.330 1.00 79.34  ? 15   THR A O     1 
ATOM   99    C  CB    . THR A 1  15   ? -30.511 22.419  -31.010 1.00 71.07  ? 15   THR A CB    1 
ATOM   100   O  OG1   . THR A 1  15   ? -31.260 21.469  -31.780 1.00 57.52  ? 15   THR A OG1   1 
ATOM   101   C  CG2   . THR A 1  15   ? -31.416 23.022  -29.943 1.00 60.12  ? 15   THR A CG2   1 
ATOM   102   N  N     . ASP A 1  16   ? -29.455 25.453  -30.532 1.00 80.96  ? 16   ASP A N     1 
ATOM   103   C  CA    . ASP A 1  16   ? -28.629 26.557  -30.031 1.00 83.69  ? 16   ASP A CA    1 
ATOM   104   C  C     . ASP A 1  16   ? -27.324 26.118  -29.370 1.00 78.06  ? 16   ASP A C     1 
ATOM   105   O  O     . ASP A 1  16   ? -26.239 26.583  -29.731 1.00 69.00  ? 16   ASP A O     1 
ATOM   106   C  CB    . ASP A 1  16   ? -29.433 27.399  -29.041 1.00 78.80  ? 16   ASP A CB    1 
ATOM   107   C  CG    . ASP A 1  16   ? -28.856 28.791  -28.855 1.00 87.13  ? 16   ASP A CG    1 
ATOM   108   O  OD1   . ASP A 1  16   ? -27.641 28.982  -29.077 1.00 88.14  ? 16   ASP A OD1   1 
ATOM   109   O  OD2   . ASP A 1  16   ? -29.625 29.701  -28.487 1.00 98.12  ? 16   ASP A OD2   1 
ATOM   110   N  N     . ASN A 1  17   ? -27.431 25.222  -28.402 1.00 76.18  ? 17   ASN A N     1 
ATOM   111   C  CA    . ASN A 1  17   ? -26.253 24.810  -27.667 1.00 78.68  ? 17   ASN A CA    1 
ATOM   112   C  C     . ASN A 1  17   ? -25.581 23.613  -28.324 1.00 77.65  ? 17   ASN A C     1 
ATOM   113   O  O     . ASN A 1  17   ? -24.358 23.488  -28.293 1.00 76.02  ? 17   ASN A O     1 
ATOM   114   C  CB    . ASN A 1  17   ? -26.614 24.492  -26.216 1.00 84.01  ? 17   ASN A CB    1 
ATOM   115   C  CG    . ASN A 1  17   ? -25.426 24.615  -25.289 1.00 83.96  ? 17   ASN A CG    1 
ATOM   116   O  OD1   . ASN A 1  17   ? -24.367 25.101  -25.688 1.00 79.52  ? 17   ASN A OD1   1 
ATOM   117   N  ND2   . ASN A 1  17   ? -25.594 24.185  -24.044 1.00 84.79  ? 17   ASN A ND2   1 
ATOM   118   N  N     . ARG A 1  18   ? -26.383 22.745  -28.935 1.00 75.00  ? 18   ARG A N     1 
ATOM   119   C  CA    . ARG A 1  18   ? -25.865 21.516  -29.528 1.00 76.48  ? 18   ARG A CA    1 
ATOM   120   C  C     . ARG A 1  18   ? -26.369 21.289  -30.955 1.00 79.04  ? 18   ARG A C     1 
ATOM   121   O  O     . ARG A 1  18   ? -27.535 21.529  -31.254 1.00 82.23  ? 18   ARG A O     1 
ATOM   122   C  CB    . ARG A 1  18   ? -26.229 20.317  -28.645 1.00 72.17  ? 18   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1  18   ? -27.609 20.404  -28.020 1.00 68.79  ? 18   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1  18   ? -27.848 19.247  -27.076 1.00 61.09  ? 18   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1  18   ? -27.639 17.963  -27.736 1.00 56.10  ? 18   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1  18   ? -28.465 16.928  -27.629 1.00 60.19  ? 18   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1  18   ? -29.562 17.020  -26.888 1.00 59.27  ? 18   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1  18   ? -28.193 15.798  -28.264 1.00 61.41  ? 18   ARG A NH2   1 
ATOM   129   N  N     . SER A 1  19   ? -25.487 20.811  -31.830 1.00 81.40  ? 19   SER A N     1 
ATOM   130   C  CA    . SER A 1  19   ? -25.835 20.596  -33.234 1.00 79.68  ? 19   SER A CA    1 
ATOM   131   C  C     . SER A 1  19   ? -25.358 19.241  -33.763 1.00 78.72  ? 19   SER A C     1 
ATOM   132   O  O     . SER A 1  19   ? -24.181 18.899  -33.640 1.00 77.81  ? 19   SER A O     1 
ATOM   133   C  CB    . SER A 1  19   ? -25.250 21.718  -34.095 1.00 75.33  ? 19   SER A CB    1 
ATOM   134   O  OG    . SER A 1  19   ? -23.834 21.705  -34.079 1.00 67.07  ? 19   SER A OG    1 
ATOM   135   N  N     . GLN A 1  20   ? -26.270 18.475  -34.356 1.00 73.05  ? 20   GLN A N     1 
ATOM   136   C  CA    . GLN A 1  20   ? -25.907 17.194  -34.961 1.00 69.24  ? 20   GLN A CA    1 
ATOM   137   C  C     . GLN A 1  20   ? -25.200 17.389  -36.303 1.00 71.51  ? 20   GLN A C     1 
ATOM   138   O  O     . GLN A 1  20   ? -25.614 18.218  -37.111 1.00 77.18  ? 20   GLN A O     1 
ATOM   139   C  CB    . GLN A 1  20   ? -27.144 16.313  -35.164 1.00 67.72  ? 20   GLN A CB    1 
ATOM   140   C  CG    . GLN A 1  20   ? -27.812 15.808  -33.895 1.00 67.16  ? 20   GLN A CG    1 
ATOM   141   C  CD    . GLN A 1  20   ? -28.900 14.788  -34.194 1.00 69.74  ? 20   GLN A CD    1 
ATOM   142   O  OE1   . GLN A 1  20   ? -29.091 14.395  -35.345 1.00 72.15  ? 20   GLN A OE1   1 
ATOM   143   N  NE2   . GLN A 1  20   ? -29.616 14.355  -33.160 1.00 67.20  ? 20   GLN A NE2   1 
ATOM   144   N  N     . PHE A 1  21   ? -24.139 16.619  -36.540 1.00 70.60  ? 21   PHE A N     1 
ATOM   145   C  CA    . PHE A 1  21   ? -23.460 16.625  -37.838 1.00 73.72  ? 21   PHE A CA    1 
ATOM   146   C  C     . PHE A 1  21   ? -23.642 15.298  -38.575 1.00 78.83  ? 21   PHE A C     1 
ATOM   147   O  O     . PHE A 1  21   ? -23.381 14.231  -38.020 1.00 76.72  ? 21   PHE A O     1 
ATOM   148   C  CB    . PHE A 1  21   ? -21.967 16.912  -37.675 1.00 64.74  ? 21   PHE A CB    1 
ATOM   149   C  CG    . PHE A 1  21   ? -21.660 18.304  -37.216 1.00 62.96  ? 21   PHE A CG    1 
ATOM   150   C  CD1   . PHE A 1  21   ? -21.355 19.297  -38.130 1.00 66.51  ? 21   PHE A CD1   1 
ATOM   151   C  CD2   . PHE A 1  21   ? -21.665 18.617  -35.869 1.00 67.63  ? 21   PHE A CD2   1 
ATOM   152   C  CE1   . PHE A 1  21   ? -21.065 20.582  -37.708 1.00 69.99  ? 21   PHE A CE1   1 
ATOM   153   C  CE2   . PHE A 1  21   ? -21.376 19.899  -35.441 1.00 73.80  ? 21   PHE A CE2   1 
ATOM   154   C  CZ    . PHE A 1  21   ? -21.075 20.883  -36.362 1.00 72.49  ? 21   PHE A CZ    1 
ATOM   155   N  N     . VAL A 1  22   ? -24.076 15.372  -39.831 1.00 83.83  ? 22   VAL A N     1 
ATOM   156   C  CA    . VAL A 1  22   ? -24.288 14.174  -40.638 1.00 81.03  ? 22   VAL A CA    1 
ATOM   157   C  C     . VAL A 1  22   ? -23.221 14.065  -41.730 1.00 80.95  ? 22   VAL A C     1 
ATOM   158   O  O     . VAL A 1  22   ? -22.923 15.040  -42.423 1.00 79.52  ? 22   VAL A O     1 
ATOM   159   C  CB    . VAL A 1  22   ? -25.698 14.161  -41.273 1.00 79.90  ? 22   VAL A CB    1 
ATOM   160   C  CG1   . VAL A 1  22   ? -25.916 12.884  -42.072 1.00 74.29  ? 22   VAL A CG1   1 
ATOM   161   C  CG2   . VAL A 1  22   ? -26.770 14.307  -40.198 1.00 70.16  ? 22   VAL A CG2   1 
ATOM   162   N  N     . ILE A 1  23   ? -22.637 12.877  -41.860 1.00 84.57  ? 23   ILE A N     1 
ATOM   163   C  CA    . ILE A 1  23   ? -21.599 12.617  -42.856 1.00 86.99  ? 23   ILE A CA    1 
ATOM   164   C  C     . ILE A 1  23   ? -21.870 11.310  -43.596 1.00 91.46  ? 23   ILE A C     1 
ATOM   165   O  O     . ILE A 1  23   ? -21.932 10.239  -42.987 1.00 87.13  ? 23   ILE A O     1 
ATOM   166   C  CB    . ILE A 1  23   ? -20.195 12.553  -42.217 1.00 80.69  ? 23   ILE A CB    1 
ATOM   167   C  CG1   . ILE A 1  23   ? -19.760 13.940  -41.736 1.00 83.48  ? 23   ILE A CG1   1 
ATOM   168   C  CG2   . ILE A 1  23   ? -19.178 11.994  -43.203 1.00 74.53  ? 23   ILE A CG2   1 
ATOM   169   C  CD1   . ILE A 1  23   ? -18.350 13.974  -41.178 1.00 80.67  ? 23   ILE A CD1   1 
ATOM   170   N  N     . GLU A 1  24   ? -22.029 11.411  -44.913 1.00 97.09  ? 24   GLU A N     1 
ATOM   171   C  CA    . GLU A 1  24   ? -22.359 10.268  -45.758 1.00 99.37  ? 24   GLU A CA    1 
ATOM   172   C  C     . GLU A 1  24   ? -21.950 10.551  -47.205 1.00 95.61  ? 24   GLU A C     1 
ATOM   173   O  O     . GLU A 1  24   ? -21.835 11.712  -47.601 1.00 90.72  ? 24   GLU A O     1 
ATOM   174   C  CB    . GLU A 1  24   ? -23.861 9.944   -45.666 1.00 101.11 ? 24   GLU A CB    1 
ATOM   175   C  CG    . GLU A 1  24   ? -24.798 11.094  -46.038 1.00 102.45 ? 24   GLU A CG    1 
ATOM   176   C  CD    . GLU A 1  24   ? -26.270 10.706  -45.971 1.00 97.19  ? 24   GLU A CD    1 
ATOM   177   O  OE1   . GLU A 1  24   ? -26.581 9.499   -46.084 1.00 98.73  ? 24   GLU A OE1   1 
ATOM   178   O  OE2   . GLU A 1  24   ? -27.116 11.610  -45.803 1.00 89.89  ? 24   GLU A OE2   1 
ATOM   179   N  N     . PRO A 1  25   ? -21.710 9.493   -47.999 1.00 98.46  ? 25   PRO A N     1 
ATOM   180   C  CA    . PRO A 1  25   ? -21.716 8.077   -47.617 1.00 98.56  ? 25   PRO A CA    1 
ATOM   181   C  C     . PRO A 1  25   ? -20.316 7.553   -47.296 1.00 102.10 ? 25   PRO A C     1 
ATOM   182   O  O     . PRO A 1  25   ? -19.361 7.867   -48.006 1.00 97.47  ? 25   PRO A O     1 
ATOM   183   C  CB    . PRO A 1  25   ? -22.287 7.396   -48.858 1.00 94.73  ? 25   PRO A CB    1 
ATOM   184   C  CG    . PRO A 1  25   ? -21.788 8.243   -49.989 1.00 106.88 ? 25   PRO A CG    1 
ATOM   185   C  CD    . PRO A 1  25   ? -21.609 9.656   -49.460 1.00 105.19 ? 25   PRO A CD    1 
ATOM   186   N  N     . LEU A 1  26   ? -20.207 6.757   -46.237 1.00 104.20 ? 26   LEU A N     1 
ATOM   187   C  CA    . LEU A 1  26   ? -18.917 6.241   -45.788 1.00 100.73 ? 26   LEU A CA    1 
ATOM   188   C  C     . LEU A 1  26   ? -18.782 4.734   -45.999 1.00 103.65 ? 26   LEU A C     1 
ATOM   189   O  O     . LEU A 1  26   ? -19.753 4.049   -46.324 1.00 102.63 ? 26   LEU A O     1 
ATOM   190   C  CB    . LEU A 1  26   ? -18.700 6.580   -44.311 1.00 96.97  ? 26   LEU A CB    1 
ATOM   191   C  CG    . LEU A 1  26   ? -18.291 8.023   -44.014 1.00 91.65  ? 26   LEU A CG    1 
ATOM   192   C  CD1   . LEU A 1  26   ? -18.616 8.384   -42.578 1.00 88.57  ? 26   LEU A CD1   1 
ATOM   193   C  CD2   . LEU A 1  26   ? -16.809 8.223   -44.292 1.00 80.71  ? 26   LEU A CD2   1 
ATOM   194   N  N     . GLU A 1  27   ? -17.563 4.233   -45.814 1.00 104.98 ? 27   GLU A N     1 
ATOM   195   C  CA    . GLU A 1  27   ? -17.267 2.809   -45.928 1.00 100.19 ? 27   GLU A CA    1 
ATOM   196   C  C     . GLU A 1  27   ? -18.098 1.993   -44.947 1.00 97.78  ? 27   GLU A C     1 
ATOM   197   O  O     . GLU A 1  27   ? -18.420 2.468   -43.861 1.00 97.78  ? 27   GLU A O     1 
ATOM   198   C  CB    . GLU A 1  27   ? -15.776 2.553   -45.686 1.00 98.05  ? 27   GLU A CB    1 
ATOM   199   C  CG    . GLU A 1  27   ? -14.854 3.319   -46.617 1.00 106.04 ? 27   GLU A CG    1 
ATOM   200   C  CD    . GLU A 1  27   ? -15.020 2.906   -48.068 1.00 122.23 ? 27   GLU A CD    1 
ATOM   201   O  OE1   . GLU A 1  27   ? -15.363 1.730   -48.319 1.00 122.10 ? 27   GLU A OE1   1 
ATOM   202   O  OE2   . GLU A 1  27   ? -14.811 3.760   -48.956 1.00 130.75 ? 27   GLU A OE2   1 
ATOM   203   N  N     . PRO A 1  28   ? -18.455 0.760   -45.330 1.00 98.97  ? 28   PRO A N     1 
ATOM   204   C  CA    . PRO A 1  28   ? -19.214 -0.132  -44.444 1.00 106.13 ? 28   PRO A CA    1 
ATOM   205   C  C     . PRO A 1  28   ? -18.415 -0.552  -43.208 1.00 109.93 ? 28   PRO A C     1 
ATOM   206   O  O     . PRO A 1  28   ? -17.307 -1.078  -43.335 1.00 111.94 ? 28   PRO A O     1 
ATOM   207   C  CB    . PRO A 1  28   ? -19.516 -1.340  -45.338 1.00 108.89 ? 28   PRO A CB    1 
ATOM   208   C  CG    . PRO A 1  28   ? -18.457 -1.308  -46.388 1.00 113.73 ? 28   PRO A CG    1 
ATOM   209   C  CD    . PRO A 1  28   ? -18.199 0.145   -46.643 1.00 103.50 ? 28   PRO A CD    1 
ATOM   210   N  N     . GLY A 1  29   ? -18.981 -0.320  -42.027 1.00 113.60 ? 29   GLY A N     1 
ATOM   211   C  CA    . GLY A 1  29   ? -18.306 -0.635  -40.779 1.00 108.87 ? 29   GLY A CA    1 
ATOM   212   C  C     . GLY A 1  29   ? -17.155 0.317   -40.520 1.00 95.90  ? 29   GLY A C     1 
ATOM   213   O  O     . GLY A 1  29   ? -16.059 -0.100  -40.140 1.00 87.68  ? 29   GLY A O     1 
ATOM   214   N  N     . PHE A 1  30   ? -17.416 1.604   -40.727 1.00 86.13  ? 30   PHE A N     1 
ATOM   215   C  CA    . PHE A 1  30   ? -16.388 2.629   -40.631 1.00 78.37  ? 30   PHE A CA    1 
ATOM   216   C  C     . PHE A 1  30   ? -16.880 3.821   -39.822 1.00 66.42  ? 30   PHE A C     1 
ATOM   217   O  O     . PHE A 1  30   ? -16.094 4.521   -39.188 1.00 62.49  ? 30   PHE A O     1 
ATOM   218   C  CB    . PHE A 1  30   ? -15.966 3.082   -42.029 1.00 83.59  ? 30   PHE A CB    1 
ATOM   219   C  CG    . PHE A 1  30   ? -14.650 3.794   -42.064 1.00 81.22  ? 30   PHE A CG    1 
ATOM   220   C  CD1   . PHE A 1  30   ? -14.561 5.135   -41.730 1.00 74.84  ? 30   PHE A CD1   1 
ATOM   221   C  CD2   . PHE A 1  30   ? -13.501 3.123   -42.445 1.00 82.57  ? 30   PHE A CD2   1 
ATOM   222   C  CE1   . PHE A 1  30   ? -13.348 5.790   -41.762 1.00 80.21  ? 30   PHE A CE1   1 
ATOM   223   C  CE2   . PHE A 1  30   ? -12.285 3.771   -42.482 1.00 82.13  ? 30   PHE A CE2   1 
ATOM   224   C  CZ    . PHE A 1  30   ? -12.207 5.107   -42.140 1.00 84.96  ? 30   PHE A CZ    1 
ATOM   225   N  N     . GLY A 1  31   ? -18.189 4.045   -39.849 1.00 69.86  ? 31   GLY A N     1 
ATOM   226   C  CA    . GLY A 1  31   ? -18.775 5.207   -39.207 1.00 72.82  ? 31   GLY A CA    1 
ATOM   227   C  C     . GLY A 1  31   ? -18.561 5.227   -37.709 1.00 67.11  ? 31   GLY A C     1 
ATOM   228   O  O     . GLY A 1  31   ? -18.409 6.291   -37.106 1.00 63.46  ? 31   GLY A O     1 
ATOM   229   N  N     . TYR A 1  32   ? -18.549 4.041   -37.110 1.00 66.34  ? 32   TYR A N     1 
ATOM   230   C  CA    . TYR A 1  32   ? -18.333 3.905   -35.676 1.00 64.29  ? 32   TYR A CA    1 
ATOM   231   C  C     . TYR A 1  32   ? -16.933 4.358   -35.258 1.00 62.11  ? 32   TYR A C     1 
ATOM   232   O  O     . TYR A 1  32   ? -16.786 5.183   -34.357 1.00 59.61  ? 32   TYR A O     1 
ATOM   233   C  CB    . TYR A 1  32   ? -18.561 2.457   -35.238 1.00 59.52  ? 32   TYR A CB    1 
ATOM   234   C  CG    . TYR A 1  32   ? -20.010 2.093   -35.009 1.00 52.65  ? 32   TYR A CG    1 
ATOM   235   C  CD1   . TYR A 1  32   ? -20.943 3.059   -34.661 1.00 51.67  ? 32   TYR A CD1   1 
ATOM   236   C  CD2   . TYR A 1  32   ? -20.441 0.782   -35.135 1.00 49.39  ? 32   TYR A CD2   1 
ATOM   237   C  CE1   . TYR A 1  32   ? -22.263 2.728   -34.448 1.00 53.60  ? 32   TYR A CE1   1 
ATOM   238   C  CE2   . TYR A 1  32   ? -21.758 0.440   -34.921 1.00 46.88  ? 32   TYR A CE2   1 
ATOM   239   C  CZ    . TYR A 1  32   ? -22.665 1.418   -34.579 1.00 50.85  ? 32   TYR A CZ    1 
ATOM   240   O  OH    . TYR A 1  32   ? -23.983 1.090   -34.365 1.00 44.91  ? 32   TYR A OH    1 
ATOM   241   N  N     . THR A 1  33   ? -15.907 3.820   -35.910 1.00 60.98  ? 33   THR A N     1 
ATOM   242   C  CA    . THR A 1  33   ? -14.533 4.146   -35.543 1.00 62.28  ? 33   THR A CA    1 
ATOM   243   C  C     . THR A 1  33   ? -14.068 5.475   -36.140 1.00 60.40  ? 33   THR A C     1 
ATOM   244   O  O     . THR A 1  33   ? -12.901 5.850   -36.007 1.00 56.93  ? 33   THR A O     1 
ATOM   245   C  CB    . THR A 1  33   ? -13.554 3.036   -35.971 1.00 66.79  ? 33   THR A CB    1 
ATOM   246   O  OG1   . THR A 1  33   ? -12.208 3.459   -35.713 1.00 67.44  ? 33   THR A OG1   1 
ATOM   247   C  CG2   . THR A 1  33   ? -13.709 2.723   -37.452 1.00 71.49  ? 33   THR A CG2   1 
ATOM   248   N  N     . LEU A 1  34   ? -14.984 6.185   -36.792 1.00 61.53  ? 34   LEU A N     1 
ATOM   249   C  CA    . LEU A 1  34   ? -14.668 7.490   -37.363 1.00 64.52  ? 34   LEU A CA    1 
ATOM   250   C  C     . LEU A 1  34   ? -15.231 8.614   -36.501 1.00 61.39  ? 34   LEU A C     1 
ATOM   251   O  O     . LEU A 1  34   ? -14.588 9.647   -36.313 1.00 59.93  ? 34   LEU A O     1 
ATOM   252   C  CB    . LEU A 1  34   ? -15.203 7.602   -38.788 1.00 66.91  ? 34   LEU A CB    1 
ATOM   253   C  CG    . LEU A 1  34   ? -14.924 8.944   -39.469 1.00 71.90  ? 34   LEU A CG    1 
ATOM   254   C  CD1   . LEU A 1  34   ? -13.433 9.276   -39.455 1.00 61.03  ? 34   LEU A CD1   1 
ATOM   255   C  CD2   . LEU A 1  34   ? -15.460 8.932   -40.887 1.00 79.73  ? 34   LEU A CD2   1 
ATOM   256   N  N     . GLY A 1  35   ? -16.435 8.409   -35.981 1.00 60.07  ? 35   GLY A N     1 
ATOM   257   C  CA    . GLY A 1  35   ? -17.025 9.354   -35.054 1.00 62.88  ? 35   GLY A CA    1 
ATOM   258   C  C     . GLY A 1  35   ? -16.302 9.369   -33.718 1.00 58.69  ? 35   GLY A C     1 
ATOM   259   O  O     . GLY A 1  35   ? -16.155 10.418  -33.093 1.00 57.05  ? 35   GLY A O     1 
ATOM   260   N  N     . ASN A 1  36   ? -15.847 8.200   -33.278 1.00 56.98  ? 36   ASN A N     1 
ATOM   261   C  CA    . ASN A 1  36   ? -15.146 8.084   -32.003 1.00 55.01  ? 36   ASN A CA    1 
ATOM   262   C  C     . ASN A 1  36   ? -13.825 8.841   -32.042 1.00 52.03  ? 36   ASN A C     1 
ATOM   263   O  O     . ASN A 1  36   ? -13.418 9.455   -31.056 1.00 51.80  ? 36   ASN A O     1 
ATOM   264   C  CB    . ASN A 1  36   ? -14.918 6.610   -31.655 1.00 54.80  ? 36   ASN A CB    1 
ATOM   265   C  CG    . ASN A 1  36   ? -14.299 6.416   -30.278 1.00 52.44  ? 36   ASN A CG    1 
ATOM   266   O  OD1   . ASN A 1  36   ? -13.270 5.752   -30.138 1.00 51.86  ? 36   ASN A OD1   1 
ATOM   267   N  ND2   . ASN A 1  36   ? -14.926 6.988   -29.254 1.00 49.34  ? 36   ASN A ND2   1 
ATOM   268   N  N     . SER A 1  37   ? -13.175 8.806   -33.201 1.00 51.06  ? 37   SER A N     1 
ATOM   269   C  CA    . SER A 1  37   ? -11.932 9.530   -33.424 1.00 53.48  ? 37   SER A CA    1 
ATOM   270   C  C     . SER A 1  37   ? -12.132 11.040  -33.253 1.00 53.87  ? 37   SER A C     1 
ATOM   271   O  O     . SER A 1  37   ? -11.199 11.771  -32.915 1.00 55.08  ? 37   SER A O     1 
ATOM   272   C  CB    . SER A 1  37   ? -11.380 9.216   -34.820 1.00 55.99  ? 37   SER A CB    1 
ATOM   273   O  OG    . SER A 1  37   ? -11.269 7.815   -35.025 1.00 53.15  ? 37   SER A OG    1 
ATOM   274   N  N     . LEU A 1  38   ? -13.355 11.505  -33.478 1.00 53.50  ? 38   LEU A N     1 
ATOM   275   C  CA    . LEU A 1  38   ? -13.673 12.908  -33.254 1.00 56.75  ? 38   LEU A CA    1 
ATOM   276   C  C     . LEU A 1  38   ? -14.061 13.157  -31.805 1.00 57.36  ? 38   LEU A C     1 
ATOM   277   O  O     . LEU A 1  38   ? -13.751 14.208  -31.244 1.00 58.35  ? 38   LEU A O     1 
ATOM   278   C  CB    . LEU A 1  38   ? -14.797 13.357  -34.180 1.00 57.95  ? 38   LEU A CB    1 
ATOM   279   C  CG    . LEU A 1  38   ? -14.395 13.464  -35.645 1.00 58.69  ? 38   LEU A CG    1 
ATOM   280   C  CD1   . LEU A 1  38   ? -15.636 13.532  -36.508 1.00 60.23  ? 38   LEU A CD1   1 
ATOM   281   C  CD2   . LEU A 1  38   ? -13.510 14.686  -35.861 1.00 59.01  ? 38   LEU A CD2   1 
ATOM   282   N  N     . ARG A 1  39   ? -14.742 12.187  -31.203 1.00 54.80  ? 39   ARG A N     1 
ATOM   283   C  CA    . ARG A 1  39   ? -15.209 12.327  -29.829 1.00 53.77  ? 39   ARG A CA    1 
ATOM   284   C  C     . ARG A 1  39   ? -14.030 12.423  -28.869 1.00 54.23  ? 39   ARG A C     1 
ATOM   285   O  O     . ARG A 1  39   ? -14.082 13.148  -27.875 1.00 51.71  ? 39   ARG A O     1 
ATOM   286   C  CB    . ARG A 1  39   ? -16.113 11.155  -29.442 1.00 51.12  ? 39   ARG A CB    1 
ATOM   287   C  CG    . ARG A 1  39   ? -16.623 11.221  -28.013 1.00 48.55  ? 39   ARG A CG    1 
ATOM   288   C  CD    . ARG A 1  39   ? -17.383 9.963   -27.643 1.00 47.96  ? 39   ARG A CD    1 
ATOM   289   N  NE    . ARG A 1  39   ? -17.689 9.893   -26.216 1.00 47.02  ? 39   ARG A NE    1 
ATOM   290   C  CZ    . ARG A 1  39   ? -16.903 9.315   -25.312 1.00 47.42  ? 39   ARG A CZ    1 
ATOM   291   N  NH1   . ARG A 1  39   ? -15.757 8.761   -25.691 1.00 48.44  ? 39   ARG A NH1   1 
ATOM   292   N  NH2   . ARG A 1  39   ? -17.259 9.291   -24.032 1.00 43.84  ? 39   ARG A NH2   1 
ATOM   293   N  N     . ARG A 1  40   ? -12.964 11.695  -29.186 1.00 55.29  ? 40   ARG A N     1 
ATOM   294   C  CA    . ARG A 1  40   ? -11.769 11.670  -28.353 1.00 55.78  ? 40   ARG A CA    1 
ATOM   295   C  C     . ARG A 1  40   ? -10.914 12.907  -28.581 1.00 54.90  ? 40   ARG A C     1 
ATOM   296   O  O     . ARG A 1  40   ? -10.133 13.307  -27.720 1.00 57.26  ? 40   ARG A O     1 
ATOM   297   C  CB    . ARG A 1  40   ? -10.956 10.408  -28.632 1.00 52.62  ? 40   ARG A CB    1 
ATOM   298   C  CG    . ARG A 1  40   ? -11.710 9.126   -28.336 1.00 52.08  ? 40   ARG A CG    1 
ATOM   299   C  CD    . ARG A 1  40   ? -10.863 7.911   -28.639 1.00 52.46  ? 40   ARG A CD    1 
ATOM   300   N  NE    . ARG A 1  40   ? -9.626  7.910   -27.868 1.00 51.17  ? 40   ARG A NE    1 
ATOM   301   C  CZ    . ARG A 1  40   ? -9.512  7.410   -26.643 1.00 52.32  ? 40   ARG A CZ    1 
ATOM   302   N  NH1   . ARG A 1  40   ? -10.565 6.871   -26.045 1.00 47.81  ? 40   ARG A NH1   1 
ATOM   303   N  NH2   . ARG A 1  40   ? -8.344  7.451   -26.016 1.00 58.05  ? 40   ARG A NH2   1 
ATOM   304   N  N     . THR A 1  41   ? -11.069 13.513  -29.749 1.00 51.96  ? 41   THR A N     1 
ATOM   305   C  CA    . THR A 1  41   ? -10.345 14.731  -30.061 1.00 53.61  ? 41   THR A CA    1 
ATOM   306   C  C     . THR A 1  41   ? -10.993 15.906  -29.338 1.00 54.03  ? 41   THR A C     1 
ATOM   307   O  O     . THR A 1  41   ? -10.309 16.759  -28.771 1.00 52.33  ? 41   THR A O     1 
ATOM   308   C  CB    . THR A 1  41   ? -10.317 14.988  -31.574 1.00 58.71  ? 41   THR A CB    1 
ATOM   309   O  OG1   . THR A 1  41   ? -9.945  13.782  -32.255 1.00 52.83  ? 41   THR A OG1   1 
ATOM   310   C  CG2   . THR A 1  41   ? -9.324  16.087  -31.910 1.00 67.76  ? 41   THR A CG2   1 
ATOM   311   N  N     . LEU A 1  42   ? -12.322 15.925  -29.346 1.00 56.18  ? 42   LEU A N     1 
ATOM   312   C  CA    . LEU A 1  42   ? -13.097 16.996  -28.731 1.00 58.95  ? 42   LEU A CA    1 
ATOM   313   C  C     . LEU A 1  42   ? -12.939 17.046  -27.214 1.00 60.47  ? 42   LEU A C     1 
ATOM   314   O  O     . LEU A 1  42   ? -12.554 18.073  -26.651 1.00 64.57  ? 42   LEU A O     1 
ATOM   315   C  CB    . LEU A 1  42   ? -14.578 16.839  -29.083 1.00 54.92  ? 42   LEU A CB    1 
ATOM   316   C  CG    . LEU A 1  42   ? -14.971 17.058  -30.542 1.00 54.53  ? 42   LEU A CG    1 
ATOM   317   C  CD1   . LEU A 1  42   ? -16.370 16.519  -30.796 1.00 53.44  ? 42   LEU A CD1   1 
ATOM   318   C  CD2   . LEU A 1  42   ? -14.889 18.534  -30.888 1.00 60.92  ? 42   LEU A CD2   1 
ATOM   319   N  N     . LEU A 1  43   ? -13.234 15.925  -26.562 1.00 56.11  ? 43   LEU A N     1 
ATOM   320   C  CA    . LEU A 1  43   ? -13.287 15.852  -25.104 1.00 54.89  ? 43   LEU A CA    1 
ATOM   321   C  C     . LEU A 1  43   ? -11.956 16.153  -24.415 1.00 60.69  ? 43   LEU A C     1 
ATOM   322   O  O     . LEU A 1  43   ? -11.918 16.389  -23.206 1.00 64.46  ? 43   LEU A O     1 
ATOM   323   C  CB    . LEU A 1  43   ? -13.776 14.467  -24.676 1.00 46.44  ? 43   LEU A CB    1 
ATOM   324   C  CG    . LEU A 1  43   ? -15.212 14.114  -25.064 1.00 43.23  ? 43   LEU A CG    1 
ATOM   325   C  CD1   . LEU A 1  43   ? -15.432 12.626  -24.931 1.00 42.93  ? 43   LEU A CD1   1 
ATOM   326   C  CD2   . LEU A 1  43   ? -16.198 14.885  -24.202 1.00 46.72  ? 43   LEU A CD2   1 
ATOM   327   N  N     . SER A 1  44   ? -10.867 16.152  -25.175 1.00 60.57  ? 44   SER A N     1 
ATOM   328   C  CA    . SER A 1  44   ? -9.548  16.275  -24.572 1.00 59.34  ? 44   SER A CA    1 
ATOM   329   C  C     . SER A 1  44   ? -8.744  17.445  -25.119 1.00 63.29  ? 44   SER A C     1 
ATOM   330   O  O     . SER A 1  44   ? -8.085  18.155  -24.362 1.00 67.54  ? 44   SER A O     1 
ATOM   331   C  CB    . SER A 1  44   ? -8.760  14.984  -24.774 1.00 57.66  ? 44   SER A CB    1 
ATOM   332   O  OG    . SER A 1  44   ? -8.495  14.774  -26.150 1.00 57.99  ? 44   SER A OG    1 
ATOM   333   N  N     . SER A 1  45   ? -8.792  17.646  -26.431 1.00 61.57  ? 45   SER A N     1 
ATOM   334   C  CA    . SER A 1  45   ? -7.877  18.588  -27.060 1.00 67.59  ? 45   SER A CA    1 
ATOM   335   C  C     . SER A 1  45   ? -8.563  19.715  -27.833 1.00 68.70  ? 45   SER A C     1 
ATOM   336   O  O     . SER A 1  45   ? -8.148  20.047  -28.943 1.00 76.25  ? 45   SER A O     1 
ATOM   337   C  CB    . SER A 1  45   ? -6.918  17.831  -27.987 1.00 67.84  ? 45   SER A CB    1 
ATOM   338   O  OG    . SER A 1  45   ? -6.051  16.988  -27.244 1.00 66.30  ? 45   SER A OG    1 
ATOM   339   N  N     . ILE A 1  46   ? -9.600  20.309  -27.251 1.00 64.21  ? 46   ILE A N     1 
ATOM   340   C  CA    . ILE A 1  46   ? -10.158 21.541  -27.804 1.00 64.00  ? 46   ILE A CA    1 
ATOM   341   C  C     . ILE A 1  46   ? -9.798  22.713  -26.904 1.00 60.82  ? 46   ILE A C     1 
ATOM   342   O  O     . ILE A 1  46   ? -10.172 22.730  -25.734 1.00 60.91  ? 46   ILE A O     1 
ATOM   343   C  CB    . ILE A 1  46   ? -11.685 21.485  -27.964 1.00 65.07  ? 46   ILE A CB    1 
ATOM   344   C  CG1   . ILE A 1  46   ? -12.072 20.477  -29.045 1.00 66.46  ? 46   ILE A CG1   1 
ATOM   345   C  CG2   . ILE A 1  46   ? -12.219 22.858  -28.343 1.00 65.39  ? 46   ILE A CG2   1 
ATOM   346   C  CD1   . ILE A 1  46   ? -11.543 20.831  -30.415 1.00 70.21  ? 46   ILE A CD1   1 
ATOM   347   N  N     . PRO A 1  47   ? -9.069  23.700  -27.454 1.00 62.16  ? 47   PRO A N     1 
ATOM   348   C  CA    . PRO A 1  47   ? -8.530  24.816  -26.667 1.00 60.64  ? 47   PRO A CA    1 
ATOM   349   C  C     . PRO A 1  47   ? -9.608  25.738  -26.119 1.00 55.43  ? 47   PRO A C     1 
ATOM   350   O  O     . PRO A 1  47   ? -10.699 25.826  -26.678 1.00 55.83  ? 47   PRO A O     1 
ATOM   351   C  CB    . PRO A 1  47   ? -7.639  25.559  -27.670 1.00 61.55  ? 47   PRO A CB    1 
ATOM   352   C  CG    . PRO A 1  47   ? -8.212  25.230  -28.999 1.00 70.17  ? 47   PRO A CG    1 
ATOM   353   C  CD    . PRO A 1  47   ? -8.744  23.826  -28.885 1.00 69.46  ? 47   PRO A CD    1 
ATOM   354   N  N     . GLY A 1  48   ? -9.291  26.417  -25.023 1.00 55.46  ? 48   GLY A N     1 
ATOM   355   C  CA    . GLY A 1  48   ? -10.232 27.304  -24.366 1.00 55.10  ? 48   GLY A CA    1 
ATOM   356   C  C     . GLY A 1  48   ? -9.565  28.028  -23.217 1.00 56.14  ? 48   GLY A C     1 
ATOM   357   O  O     . GLY A 1  48   ? -8.338  28.058  -23.114 1.00 55.68  ? 48   GLY A O     1 
ATOM   358   N  N     . ALA A 1  49   ? -10.371 28.614  -22.342 1.00 54.60  ? 49   ALA A N     1 
ATOM   359   C  CA    . ALA A 1  49   ? -9.828  29.376  -21.229 1.00 52.98  ? 49   ALA A CA    1 
ATOM   360   C  C     . ALA A 1  49   ? -10.627 29.148  -19.956 1.00 53.53  ? 49   ALA A C     1 
ATOM   361   O  O     . ALA A 1  49   ? -11.816 28.828  -19.997 1.00 55.66  ? 49   ALA A O     1 
ATOM   362   C  CB    . ALA A 1  49   ? -9.789  30.857  -21.573 1.00 58.28  ? 49   ALA A CB    1 
ATOM   363   N  N     . ALA A 1  50   ? -9.951  29.311  -18.826 1.00 54.91  ? 50   ALA A N     1 
ATOM   364   C  CA    . ALA A 1  50   ? -10.566 29.162  -17.515 1.00 58.74  ? 50   ALA A CA    1 
ATOM   365   C  C     . ALA A 1  50   ? -9.686  29.831  -16.466 1.00 57.55  ? 50   ALA A C     1 
ATOM   366   O  O     . ALA A 1  50   ? -8.595  30.315  -16.777 1.00 55.88  ? 50   ALA A O     1 
ATOM   367   C  CB    . ALA A 1  50   ? -10.780 27.690  -17.181 1.00 59.20  ? 50   ALA A CB    1 
ATOM   368   N  N     . VAL A 1  51   ? -10.165 29.851  -15.227 1.00 53.70  ? 51   VAL A N     1 
ATOM   369   C  CA    . VAL A 1  51   ? -9.417  30.443  -14.127 1.00 50.06  ? 51   VAL A CA    1 
ATOM   370   C  C     . VAL A 1  51   ? -8.271  29.533  -13.702 1.00 47.60  ? 51   VAL A C     1 
ATOM   371   O  O     . VAL A 1  51   ? -8.443  28.320  -13.604 1.00 52.33  ? 51   VAL A O     1 
ATOM   372   C  CB    . VAL A 1  51   ? -10.318 30.706  -12.914 1.00 48.70  ? 51   VAL A CB    1 
ATOM   373   C  CG1   . VAL A 1  51   ? -9.588  31.574  -11.899 1.00 47.47  ? 51   VAL A CG1   1 
ATOM   374   C  CG2   . VAL A 1  51   ? -11.623 31.355  -13.355 1.00 47.34  ? 51   VAL A CG2   1 
ATOM   375   N  N     . THR A 1  52   ? -7.103  30.117  -13.451 1.00 45.15  ? 52   THR A N     1 
ATOM   376   C  CA    . THR A 1  52   ? -5.953  29.343  -12.999 1.00 45.90  ? 52   THR A CA    1 
ATOM   377   C  C     . THR A 1  52   ? -5.710  29.568  -11.510 1.00 46.29  ? 52   THR A C     1 
ATOM   378   O  O     . THR A 1  52   ? -5.671  28.619  -10.728 1.00 48.82  ? 52   THR A O     1 
ATOM   379   C  CB    . THR A 1  52   ? -4.682  29.696  -13.793 1.00 47.33  ? 52   THR A CB    1 
ATOM   380   O  OG1   . THR A 1  52   ? -4.196  30.981  -13.387 1.00 47.53  ? 52   THR A OG1   1 
ATOM   381   C  CG2   . THR A 1  52   ? -4.978  29.702  -15.285 1.00 48.68  ? 52   THR A CG2   1 
ATOM   382   N  N     . SER A 1  53   ? -5.550  30.825  -11.118 1.00 44.37  ? 53   SER A N     1 
ATOM   383   C  CA    . SER A 1  53   ? -5.433  31.157  -9.705  1.00 44.54  ? 53   SER A CA    1 
ATOM   384   C  C     . SER A 1  53   ? -6.321  32.351  -9.379  1.00 43.85  ? 53   SER A C     1 
ATOM   385   O  O     . SER A 1  53   ? -6.784  33.051  -10.279 1.00 45.22  ? 53   SER A O     1 
ATOM   386   C  CB    . SER A 1  53   ? -3.979  31.451  -9.329  1.00 44.73  ? 53   SER A CB    1 
ATOM   387   O  OG    . SER A 1  53   ? -3.590  32.743  -9.754  1.00 46.02  ? 53   SER A OG    1 
ATOM   388   N  N     . ILE A 1  54   ? -6.577  32.562  -8.090  1.00 44.63  ? 54   ILE A N     1 
ATOM   389   C  CA    . ILE A 1  54   ? -7.327  33.728  -7.620  1.00 45.12  ? 54   ILE A CA    1 
ATOM   390   C  C     . ILE A 1  54   ? -6.670  34.315  -6.369  1.00 47.10  ? 54   ILE A C     1 
ATOM   391   O  O     . ILE A 1  54   ? -5.601  33.864  -5.959  1.00 51.87  ? 54   ILE A O     1 
ATOM   392   C  CB    . ILE A 1  54   ? -8.803  33.387  -7.300  1.00 40.76  ? 54   ILE A CB    1 
ATOM   393   C  CG1   . ILE A 1  54   ? -8.897  32.494  -6.066  1.00 40.32  ? 54   ILE A CG1   1 
ATOM   394   C  CG2   . ILE A 1  54   ? -9.487  32.731  -8.488  1.00 39.55  ? 54   ILE A CG2   1 
ATOM   395   C  CD1   . ILE A 1  54   ? -10.303 32.333  -5.554  1.00 40.62  ? 54   ILE A CD1   1 
ATOM   396   N  N     . ARG A 1  55   ? -7.305  35.326  -5.779  1.00 45.31  ? 55   ARG A N     1 
ATOM   397   C  CA    . ARG A 1  55   ? -6.867  35.904  -4.507  1.00 45.03  ? 55   ARG A CA    1 
ATOM   398   C  C     . ARG A 1  55   ? -8.047  36.609  -3.848  1.00 46.01  ? 55   ARG A C     1 
ATOM   399   O  O     . ARG A 1  55   ? -8.886  37.191  -4.535  1.00 49.68  ? 55   ARG A O     1 
ATOM   400   C  CB    . ARG A 1  55   ? -5.695  36.879  -4.708  1.00 45.84  ? 55   ARG A CB    1 
ATOM   401   C  CG    . ARG A 1  55   ? -4.388  36.406  -4.085  1.00 48.11  ? 55   ARG A CG    1 
ATOM   402   C  CD    . ARG A 1  55   ? -3.199  37.251  -4.502  1.00 48.04  ? 55   ARG A CD    1 
ATOM   403   N  NE    . ARG A 1  55   ? -3.148  38.517  -3.781  1.00 51.62  ? 55   ARG A NE    1 
ATOM   404   C  CZ    . ARG A 1  55   ? -2.084  39.311  -3.760  1.00 70.25  ? 55   ARG A CZ    1 
ATOM   405   N  NH1   . ARG A 1  55   ? -0.987  38.959  -4.417  1.00 69.26  ? 55   ARG A NH1   1 
ATOM   406   N  NH2   . ARG A 1  55   ? -2.114  40.451  -3.081  1.00 80.75  ? 55   ARG A NH2   1 
ATOM   407   N  N     . ILE A 1  56   ? -8.129  36.546  -2.522  1.00 45.88  ? 56   ILE A N     1 
ATOM   408   C  CA    . ILE A 1  56   ? -9.241  37.173  -1.808  1.00 46.77  ? 56   ILE A CA    1 
ATOM   409   C  C     . ILE A 1  56   ? -8.757  38.031  -0.635  1.00 48.79  ? 56   ILE A C     1 
ATOM   410   O  O     . ILE A 1  56   ? -7.825  37.653  0.078   1.00 53.03  ? 56   ILE A O     1 
ATOM   411   C  CB    . ILE A 1  56   ? -10.243 36.116  -1.298  1.00 42.96  ? 56   ILE A CB    1 
ATOM   412   C  CG1   . ILE A 1  56   ? -10.689 35.216  -2.454  1.00 42.41  ? 56   ILE A CG1   1 
ATOM   413   C  CG2   . ILE A 1  56   ? -11.448 36.783  -0.650  1.00 41.55  ? 56   ILE A CG2   1 
ATOM   414   C  CD1   . ILE A 1  56   ? -11.660 34.134  -2.058  1.00 42.06  ? 56   ILE A CD1   1 
ATOM   415   N  N     . ASP A 1  57   ? -9.394  39.187  -0.453  1.00 46.92  ? 57   ASP A N     1 
ATOM   416   C  CA    . ASP A 1  57   ? -9.004  40.154  0.570   1.00 47.27  ? 57   ASP A CA    1 
ATOM   417   C  C     . ASP A 1  57   ? -8.992  39.531  1.964   1.00 45.08  ? 57   ASP A C     1 
ATOM   418   O  O     . ASP A 1  57   ? -10.001 39.005  2.431   1.00 44.33  ? 57   ASP A O     1 
ATOM   419   C  CB    . ASP A 1  57   ? -9.942  41.370  0.545   1.00 53.75  ? 57   ASP A CB    1 
ATOM   420   C  CG    . ASP A 1  57   ? -9.286  42.628  1.100   1.00 60.68  ? 57   ASP A CG    1 
ATOM   421   O  OD1   . ASP A 1  57   ? -8.311  42.499  1.866   1.00 66.32  ? 57   ASP A OD1   1 
ATOM   422   O  OD2   . ASP A 1  57   ? -9.739  43.746  0.771   1.00 57.43  ? 57   ASP A OD2   1 
ATOM   423   N  N     . GLY A 1  58   ? -7.833  39.585  2.614   1.00 45.31  ? 58   GLY A N     1 
ATOM   424   C  CA    . GLY A 1  58   ? -7.688  39.090  3.969   1.00 44.33  ? 58   GLY A CA    1 
ATOM   425   C  C     . GLY A 1  58   ? -7.598  37.580  4.048   1.00 44.93  ? 58   GLY A C     1 
ATOM   426   O  O     . GLY A 1  58   ? -7.675  37.003  5.132   1.00 45.91  ? 58   GLY A O     1 
ATOM   427   N  N     . VAL A 1  59   ? -7.429  36.939  2.897   1.00 44.99  ? 59   VAL A N     1 
ATOM   428   C  CA    . VAL A 1  59   ? -7.362  35.484  2.830   1.00 42.21  ? 59   VAL A CA    1 
ATOM   429   C  C     . VAL A 1  59   ? -5.978  35.014  2.396   1.00 41.22  ? 59   VAL A C     1 
ATOM   430   O  O     . VAL A 1  59   ? -5.450  35.462  1.378   1.00 40.19  ? 59   VAL A O     1 
ATOM   431   C  CB    . VAL A 1  59   ? -8.420  34.922  1.864   1.00 42.97  ? 59   VAL A CB    1 
ATOM   432   C  CG1   . VAL A 1  59   ? -8.277  33.412  1.732   1.00 43.88  ? 59   VAL A CG1   1 
ATOM   433   C  CG2   . VAL A 1  59   ? -9.822  35.305  2.333   1.00 41.22  ? 59   VAL A CG2   1 
ATOM   434   N  N     . LEU A 1  60   ? -5.400  34.101  3.173   1.00 41.92  ? 60   LEU A N     1 
ATOM   435   C  CA    . LEU A 1  60   ? -4.047  33.615  2.910   1.00 42.49  ? 60   LEU A CA    1 
ATOM   436   C  C     . LEU A 1  60   ? -4.012  32.197  2.317   1.00 42.77  ? 60   LEU A C     1 
ATOM   437   O  O     . LEU A 1  60   ? -3.014  31.801  1.708   1.00 44.41  ? 60   LEU A O     1 
ATOM   438   C  CB    . LEU A 1  60   ? -3.208  33.661  4.198   1.00 39.00  ? 60   LEU A CB    1 
ATOM   439   C  CG    . LEU A 1  60   ? -2.828  35.035  4.770   1.00 36.16  ? 60   LEU A CG    1 
ATOM   440   C  CD1   . LEU A 1  60   ? -3.921  35.615  5.672   1.00 36.34  ? 60   LEU A CD1   1 
ATOM   441   C  CD2   . LEU A 1  60   ? -1.494  34.957  5.505   1.00 33.92  ? 60   LEU A CD2   1 
ATOM   442   N  N     . HIS A 1  61   ? -5.091  31.437  2.491   1.00 38.58  ? 61   HIS A N     1 
ATOM   443   C  CA    . HIS A 1  61   ? -5.168  30.098  1.908   1.00 34.50  ? 61   HIS A CA    1 
ATOM   444   C  C     . HIS A 1  61   ? -6.604  29.638  1.657   1.00 35.12  ? 61   HIS A C     1 
ATOM   445   O  O     . HIS A 1  61   ? -7.563  30.314  2.025   1.00 35.62  ? 61   HIS A O     1 
ATOM   446   C  CB    . HIS A 1  61   ? -4.442  29.084  2.794   1.00 33.55  ? 61   HIS A CB    1 
ATOM   447   C  CG    . HIS A 1  61   ? -4.883  29.095  4.226   1.00 32.37  ? 61   HIS A CG    1 
ATOM   448   N  ND1   . HIS A 1  61   ? -5.936  28.337  4.690   1.00 32.21  ? 61   HIS A ND1   1 
ATOM   449   C  CD2   . HIS A 1  61   ? -4.400  29.763  5.300   1.00 31.56  ? 61   HIS A CD2   1 
ATOM   450   C  CE1   . HIS A 1  61   ? -6.087  28.540  5.987   1.00 30.68  ? 61   HIS A CE1   1 
ATOM   451   N  NE2   . HIS A 1  61   ? -5.166  29.401  6.382   1.00 29.66  ? 61   HIS A NE2   1 
ATOM   452   N  N     . GLU A 1  62   ? -6.727  28.470  1.034   1.00 35.75  ? 62   GLU A N     1 
ATOM   453   C  CA    . GLU A 1  62   ? -8.002  27.935  0.559   1.00 36.01  ? 62   GLU A CA    1 
ATOM   454   C  C     . GLU A 1  62   ? -9.005  27.607  1.671   1.00 33.24  ? 62   GLU A C     1 
ATOM   455   O  O     . GLU A 1  62   ? -10.216 27.699  1.478   1.00 32.53  ? 62   GLU A O     1 
ATOM   456   C  CB    . GLU A 1  62   ? -7.723  26.680  -0.276  1.00 37.41  ? 62   GLU A CB    1 
ATOM   457   C  CG    . GLU A 1  62   ? -8.938  25.993  -0.878  1.00 41.49  ? 62   GLU A CG    1 
ATOM   458   C  CD    . GLU A 1  62   ? -8.553  24.754  -1.676  1.00 45.43  ? 62   GLU A CD    1 
ATOM   459   O  OE1   . GLU A 1  62   ? -7.362  24.638  -2.045  1.00 41.39  ? 62   GLU A OE1   1 
ATOM   460   O  OE2   . GLU A 1  62   ? -9.433  23.899  -1.923  1.00 44.99  ? 62   GLU A OE2   1 
ATOM   461   N  N     . PHE A 1  63   ? -8.493  27.233  2.837   1.00 32.63  ? 63   PHE A N     1 
ATOM   462   C  CA    . PHE A 1  63   ? -9.337  26.720  3.906   1.00 31.36  ? 63   PHE A CA    1 
ATOM   463   C  C     . PHE A 1  63   ? -9.576  27.760  4.990   1.00 30.57  ? 63   PHE A C     1 
ATOM   464   O  O     . PHE A 1  63   ? -8.986  27.689  6.067   1.00 29.35  ? 63   PHE A O     1 
ATOM   465   C  CB    . PHE A 1  63   ? -8.709  25.470  4.527   1.00 33.59  ? 63   PHE A CB    1 
ATOM   466   C  CG    . PHE A 1  63   ? -7.975  24.599  3.541   1.00 33.11  ? 63   PHE A CG    1 
ATOM   467   C  CD1   . PHE A 1  63   ? -8.621  23.547  2.911   1.00 32.66  ? 63   PHE A CD1   1 
ATOM   468   C  CD2   . PHE A 1  63   ? -6.633  24.824  3.255   1.00 31.16  ? 63   PHE A CD2   1 
ATOM   469   C  CE1   . PHE A 1  63   ? -7.943  22.743  2.007   1.00 33.96  ? 63   PHE A CE1   1 
ATOM   470   C  CE2   . PHE A 1  63   ? -5.953  24.026  2.355   1.00 31.59  ? 63   PHE A CE2   1 
ATOM   471   C  CZ    . PHE A 1  63   ? -6.607  22.984  1.730   1.00 33.44  ? 63   PHE A CZ    1 
ATOM   472   N  N     . THR A 1  64   ? -10.441 28.725  4.702   1.00 31.18  ? 64   THR A N     1 
ATOM   473   C  CA    . THR A 1  64   ? -10.813 29.718  5.702   1.00 35.15  ? 64   THR A CA    1 
ATOM   474   C  C     . THR A 1  64   ? -12.164 30.369  5.369   1.00 34.39  ? 64   THR A C     1 
ATOM   475   O  O     . THR A 1  64   ? -12.836 29.964  4.417   1.00 32.73  ? 64   THR A O     1 
ATOM   476   C  CB    . THR A 1  64   ? -9.709  30.796  5.849   1.00 36.56  ? 64   THR A CB    1 
ATOM   477   O  OG1   . THR A 1  64   ? -10.021 31.673  6.941   1.00 38.26  ? 64   THR A OG1   1 
ATOM   478   C  CG2   . THR A 1  64   ? -9.548  31.593  4.564   1.00 36.87  ? 64   THR A CG2   1 
ATOM   479   N  N     . THR A 1  65   ? -12.566 31.352  6.176   1.00 33.87  ? 65   THR A N     1 
ATOM   480   C  CA    . THR A 1  65   ? -13.848 32.036  6.006   1.00 34.09  ? 65   THR A CA    1 
ATOM   481   C  C     . THR A 1  65   ? -13.705 33.545  5.948   1.00 34.59  ? 65   THR A C     1 
ATOM   482   O  O     . THR A 1  65   ? -12.925 34.137  6.692   1.00 33.44  ? 65   THR A O     1 
ATOM   483   C  CB    . THR A 1  65   ? -14.825 31.731  7.151   1.00 35.38  ? 65   THR A CB    1 
ATOM   484   O  OG1   . THR A 1  65   ? -14.256 32.171  8.391   1.00 33.74  ? 65   THR A OG1   1 
ATOM   485   C  CG2   . THR A 1  65   ? -15.129 30.250  7.225   1.00 37.58  ? 65   THR A CG2   1 
ATOM   486   N  N     . VAL A 1  66   ? -14.491 34.162  5.076   1.00 36.44  ? 66   VAL A N     1 
ATOM   487   C  CA    . VAL A 1  66   ? -14.576 35.612  5.008   1.00 39.94  ? 66   VAL A CA    1 
ATOM   488   C  C     . VAL A 1  66   ? -15.773 36.111  5.825   1.00 42.50  ? 66   VAL A C     1 
ATOM   489   O  O     . VAL A 1  66   ? -16.907 35.691  5.584   1.00 41.52  ? 66   VAL A O     1 
ATOM   490   C  CB    . VAL A 1  66   ? -14.696 36.086  3.552   1.00 39.09  ? 66   VAL A CB    1 
ATOM   491   C  CG1   . VAL A 1  66   ? -14.874 37.596  3.493   1.00 43.50  ? 66   VAL A CG1   1 
ATOM   492   C  CG2   . VAL A 1  66   ? -13.476 35.640  2.758   1.00 36.87  ? 66   VAL A CG2   1 
ATOM   493   N  N     . PRO A 1  67   ? -15.520 37.001  6.804   1.00 40.32  ? 67   PRO A N     1 
ATOM   494   C  CA    . PRO A 1  67   ? -16.563 37.513  7.702   1.00 37.46  ? 67   PRO A CA    1 
ATOM   495   C  C     . PRO A 1  67   ? -17.734 38.154  6.962   1.00 37.96  ? 67   PRO A C     1 
ATOM   496   O  O     . PRO A 1  67   ? -17.539 39.082  6.179   1.00 38.83  ? 67   PRO A O     1 
ATOM   497   C  CB    . PRO A 1  67   ? -15.821 38.561  8.541   1.00 38.52  ? 67   PRO A CB    1 
ATOM   498   C  CG    . PRO A 1  67   ? -14.402 38.135  8.506   1.00 39.44  ? 67   PRO A CG    1 
ATOM   499   C  CD    . PRO A 1  67   ? -14.195 37.556  7.134   1.00 40.39  ? 67   PRO A CD    1 
ATOM   500   N  N     . GLY A 1  68   ? -18.940 37.657  7.212   1.00 39.10  ? 68   GLY A N     1 
ATOM   501   C  CA    . GLY A 1  68   ? -20.129 38.224  6.605   1.00 42.90  ? 68   GLY A CA    1 
ATOM   502   C  C     . GLY A 1  68   ? -20.634 37.430  5.417   1.00 45.51  ? 68   GLY A C     1 
ATOM   503   O  O     . GLY A 1  68   ? -21.732 37.686  4.922   1.00 50.80  ? 68   GLY A O     1 
ATOM   504   N  N     . VAL A 1  69   ? -19.835 36.469  4.955   1.00 40.00  ? 69   VAL A N     1 
ATOM   505   C  CA    . VAL A 1  69   ? -20.214 35.628  3.819   1.00 36.82  ? 69   VAL A CA    1 
ATOM   506   C  C     . VAL A 1  69   ? -20.728 34.274  4.289   1.00 37.80  ? 69   VAL A C     1 
ATOM   507   O  O     . VAL A 1  69   ? -20.187 33.697  5.226   1.00 39.87  ? 69   VAL A O     1 
ATOM   508   C  CB    . VAL A 1  69   ? -19.038 35.387  2.854   1.00 33.99  ? 69   VAL A CB    1 
ATOM   509   C  CG1   . VAL A 1  69   ? -19.560 34.935  1.504   1.00 37.13  ? 69   VAL A CG1   1 
ATOM   510   C  CG2   . VAL A 1  69   ? -18.204 36.636  2.697   1.00 37.22  ? 69   VAL A CG2   1 
ATOM   511   N  N     . LYS A 1  70   ? -21.759 33.763  3.623   1.00 40.67  ? 70   LYS A N     1 
ATOM   512   C  CA    . LYS A 1  70   ? -22.377 32.485  3.987   1.00 40.50  ? 70   LYS A CA    1 
ATOM   513   C  C     . LYS A 1  70   ? -21.498 31.270  3.639   1.00 39.02  ? 70   LYS A C     1 
ATOM   514   O  O     . LYS A 1  70   ? -21.493 30.281  4.369   1.00 39.92  ? 70   LYS A O     1 
ATOM   515   C  CB    . LYS A 1  70   ? -23.751 32.363  3.303   1.00 43.50  ? 70   LYS A CB    1 
ATOM   516   C  CG    . LYS A 1  70   ? -24.661 31.227  3.799   1.00 39.96  ? 70   LYS A CG    1 
ATOM   517   C  CD    . LYS A 1  70   ? -25.964 31.154  2.980   1.00 41.06  ? 70   LYS A CD    1 
ATOM   518   C  CE    . LYS A 1  70   ? -26.797 29.917  3.329   1.00 41.76  ? 70   LYS A CE    1 
ATOM   519   N  NZ    . LYS A 1  70   ? -27.933 29.691  2.383   1.00 38.76  ? 70   LYS A NZ    1 
ATOM   520   N  N     . GLU A 1  71   ? -20.761 31.341  2.531   1.00 37.73  ? 71   GLU A N     1 
ATOM   521   C  CA    . GLU A 1  71   ? -19.888 30.236  2.118   1.00 35.83  ? 71   GLU A CA    1 
ATOM   522   C  C     . GLU A 1  71   ? -18.480 30.368  2.699   1.00 37.16  ? 71   GLU A C     1 
ATOM   523   O  O     . GLU A 1  71   ? -18.065 31.456  3.086   1.00 39.49  ? 71   GLU A O     1 
ATOM   524   C  CB    . GLU A 1  71   ? -19.796 30.157  0.589   1.00 35.23  ? 71   GLU A CB    1 
ATOM   525   C  CG    . GLU A 1  71   ? -21.101 29.828  -0.121  1.00 40.07  ? 71   GLU A CG    1 
ATOM   526   C  CD    . GLU A 1  71   ? -21.995 31.041  -0.306  1.00 42.22  ? 71   GLU A CD    1 
ATOM   527   O  OE1   . GLU A 1  71   ? -21.634 32.123  0.201   1.00 42.78  ? 71   GLU A OE1   1 
ATOM   528   O  OE2   . GLU A 1  71   ? -23.053 30.917  -0.961  1.00 40.87  ? 71   GLU A OE2   1 
ATOM   529   N  N     . ASP A 1  72   ? -17.746 29.260  2.764   1.00 38.40  ? 72   ASP A N     1 
ATOM   530   C  CA    . ASP A 1  72   ? -16.309 29.331  3.038   1.00 37.51  ? 72   ASP A CA    1 
ATOM   531   C  C     . ASP A 1  72   ? -15.561 29.501  1.719   1.00 35.36  ? 72   ASP A C     1 
ATOM   532   O  O     . ASP A 1  72   ? -16.169 29.447  0.651   1.00 39.20  ? 72   ASP A O     1 
ATOM   533   C  CB    . ASP A 1  72   ? -15.806 28.088  3.798   1.00 39.41  ? 72   ASP A CB    1 
ATOM   534   C  CG    . ASP A 1  72   ? -16.240 26.767  3.158   1.00 39.02  ? 72   ASP A CG    1 
ATOM   535   O  OD1   . ASP A 1  72   ? -16.101 26.598  1.926   1.00 37.52  ? 72   ASP A OD1   1 
ATOM   536   O  OD2   . ASP A 1  72   ? -16.718 25.886  3.907   1.00 37.32  ? 72   ASP A OD2   1 
ATOM   537   N  N     . VAL A 1  73   ? -14.250 29.714  1.791   1.00 30.98  ? 73   VAL A N     1 
ATOM   538   C  CA    . VAL A 1  73   ? -13.449 29.896  0.584   1.00 32.51  ? 73   VAL A CA    1 
ATOM   539   C  C     . VAL A 1  73   ? -13.460 28.640  -0.285  1.00 35.25  ? 73   VAL A C     1 
ATOM   540   O  O     . VAL A 1  73   ? -13.462 28.736  -1.511  1.00 37.69  ? 73   VAL A O     1 
ATOM   541   C  CB    . VAL A 1  73   ? -11.990 30.273  0.920   1.00 35.79  ? 73   VAL A CB    1 
ATOM   542   C  CG1   . VAL A 1  73   ? -11.172 30.491  -0.354  1.00 35.10  ? 73   VAL A CG1   1 
ATOM   543   C  CG2   . VAL A 1  73   ? -11.954 31.513  1.786   1.00 36.96  ? 73   VAL A CG2   1 
ATOM   544   N  N     . THR A 1  74   ? -13.478 27.465  0.341   1.00 34.59  ? 74   THR A N     1 
ATOM   545   C  CA    . THR A 1  74   ? -13.493 26.218  -0.423  1.00 34.71  ? 74   THR A CA    1 
ATOM   546   C  C     . THR A 1  74   ? -14.734 26.149  -1.304  1.00 36.56  ? 74   THR A C     1 
ATOM   547   O  O     . THR A 1  74   ? -14.641 25.835  -2.490  1.00 38.56  ? 74   THR A O     1 
ATOM   548   C  CB    . THR A 1  74   ? -13.446 24.970  0.487   1.00 33.79  ? 74   THR A CB    1 
ATOM   549   O  OG1   . THR A 1  74   ? -12.190 24.927  1.174   1.00 35.10  ? 74   THR A OG1   1 
ATOM   550   C  CG2   . THR A 1  74   ? -13.598 23.695  -0.339  1.00 30.96  ? 74   THR A CG2   1 
ATOM   551   N  N     . GLU A 1  75   ? -15.889 26.468  -0.726  1.00 36.01  ? 75   GLU A N     1 
ATOM   552   C  CA    . GLU A 1  75   ? -17.149 26.424  -1.460  1.00 37.40  ? 75   GLU A CA    1 
ATOM   553   C  C     . GLU A 1  75   ? -17.215 27.503  -2.538  1.00 37.95  ? 75   GLU A C     1 
ATOM   554   O  O     . GLU A 1  75   ? -17.876 27.335  -3.563  1.00 40.08  ? 75   GLU A O     1 
ATOM   555   C  CB    . GLU A 1  75   ? -18.331 26.571  -0.505  1.00 38.71  ? 75   GLU A CB    1 
ATOM   556   C  CG    . GLU A 1  75   ? -19.676 26.488  -1.204  1.00 44.41  ? 75   GLU A CG    1 
ATOM   557   C  CD    . GLU A 1  75   ? -20.825 26.258  -0.246  1.00 55.24  ? 75   GLU A CD    1 
ATOM   558   O  OE1   . GLU A 1  75   ? -20.614 26.404  0.976   1.00 60.45  ? 75   GLU A OE1   1 
ATOM   559   O  OE2   . GLU A 1  75   ? -21.937 25.928  -0.718  1.00 57.95  ? 75   GLU A OE2   1 
ATOM   560   N  N     . ILE A 1  76   ? -16.525 28.610  -2.298  1.00 38.69  ? 76   ILE A N     1 
ATOM   561   C  CA    . ILE A 1  76   ? -16.471 29.716  -3.246  1.00 35.22  ? 76   ILE A CA    1 
ATOM   562   C  C     . ILE A 1  76   ? -15.636 29.338  -4.468  1.00 34.19  ? 76   ILE A C     1 
ATOM   563   O  O     . ILE A 1  76   ? -16.037 29.578  -5.610  1.00 32.44  ? 76   ILE A O     1 
ATOM   564   C  CB    . ILE A 1  76   ? -15.898 30.979  -2.573  1.00 33.06  ? 76   ILE A CB    1 
ATOM   565   C  CG1   . ILE A 1  76   ? -16.930 31.569  -1.607  1.00 34.77  ? 76   ILE A CG1   1 
ATOM   566   C  CG2   . ILE A 1  76   ? -15.472 32.002  -3.610  1.00 34.52  ? 76   ILE A CG2   1 
ATOM   567   C  CD1   . ILE A 1  76   ? -16.485 32.841  -0.941  1.00 37.36  ? 76   ILE A CD1   1 
ATOM   568   N  N     . ILE A 1  77   ? -14.476 28.739  -4.207  1.00 35.92  ? 77   ILE A N     1 
ATOM   569   C  CA    . ILE A 1  77   ? -13.601 28.208  -5.247  1.00 36.48  ? 77   ILE A CA    1 
ATOM   570   C  C     . ILE A 1  77   ? -14.295 27.084  -6.004  1.00 37.98  ? 77   ILE A C     1 
ATOM   571   O  O     . ILE A 1  77   ? -14.135 26.937  -7.218  1.00 39.07  ? 77   ILE A O     1 
ATOM   572   C  CB    . ILE A 1  77   ? -12.274 27.677  -4.653  1.00 33.43  ? 77   ILE A CB    1 
ATOM   573   C  CG1   . ILE A 1  77   ? -11.507 28.805  -3.964  1.00 33.90  ? 77   ILE A CG1   1 
ATOM   574   C  CG2   . ILE A 1  77   ? -11.413 27.044  -5.733  1.00 36.35  ? 77   ILE A CG2   1 
ATOM   575   C  CD1   . ILE A 1  77   ? -10.207 28.374  -3.323  1.00 33.28  ? 77   ILE A CD1   1 
ATOM   576   N  N     . LEU A 1  78   ? -15.074 26.298  -5.271  1.00 39.19  ? 78   LEU A N     1 
ATOM   577   C  CA    . LEU A 1  78   ? -15.815 25.184  -5.846  1.00 43.31  ? 78   LEU A CA    1 
ATOM   578   C  C     . LEU A 1  78   ? -16.966 25.682  -6.723  1.00 40.42  ? 78   LEU A C     1 
ATOM   579   O  O     . LEU A 1  78   ? -17.400 24.990  -7.643  1.00 41.46  ? 78   LEU A O     1 
ATOM   580   C  CB    . LEU A 1  78   ? -16.335 24.267  -4.730  1.00 49.45  ? 78   LEU A CB    1 
ATOM   581   C  CG    . LEU A 1  78   ? -16.868 22.877  -5.093  1.00 57.34  ? 78   LEU A CG    1 
ATOM   582   C  CD1   . LEU A 1  78   ? -16.489 21.829  -4.036  1.00 53.39  ? 78   LEU A CD1   1 
ATOM   583   C  CD2   . LEU A 1  78   ? -18.371 22.936  -5.277  1.00 44.98  ? 78   LEU A CD2   1 
ATOM   584   N  N     . ASN A 1  79   ? -17.460 26.880  -6.437  1.00 38.84  ? 79   ASN A N     1 
ATOM   585   C  CA    . ASN A 1  79   ? -18.502 27.471  -7.266  1.00 37.18  ? 79   ASN A CA    1 
ATOM   586   C  C     . ASN A 1  79   ? -17.875 28.040  -8.523  1.00 37.04  ? 79   ASN A C     1 
ATOM   587   O  O     . ASN A 1  79   ? -18.457 28.002  -9.605  1.00 36.76  ? 79   ASN A O     1 
ATOM   588   C  CB    . ASN A 1  79   ? -19.263 28.556  -6.502  1.00 39.00  ? 79   ASN A CB    1 
ATOM   589   C  CG    . ASN A 1  79   ? -20.235 27.983  -5.486  1.00 39.84  ? 79   ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1  79   ? -20.919 26.995  -5.752  1.00 38.58  ? 79   ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1  79   ? -20.299 28.601  -4.311  1.00 40.50  ? 79   ASN A ND2   1 
ATOM   592   N  N     . LEU A 1  80   ? -16.661 28.549  -8.357  1.00 39.48  ? 80   LEU A N     1 
ATOM   593   C  CA    . LEU A 1  80   ? -15.896 29.164  -9.434  1.00 42.11  ? 80   LEU A CA    1 
ATOM   594   C  C     . LEU A 1  80   ? -15.433 28.182  -10.495 1.00 44.41  ? 80   LEU A C     1 
ATOM   595   O  O     . LEU A 1  80   ? -14.996 28.591  -11.570 1.00 47.73  ? 80   LEU A O     1 
ATOM   596   C  CB    . LEU A 1  80   ? -14.678 29.880  -8.859  1.00 40.12  ? 80   LEU A CB    1 
ATOM   597   C  CG    . LEU A 1  80   ? -14.931 31.304  -8.384  1.00 36.63  ? 80   LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1  80   ? -13.685 31.860  -7.719  1.00 32.37  ? 80   LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1  80   ? -15.343 32.148  -9.577  1.00 39.38  ? 80   LEU A CD2   1 
ATOM   600   N  N     . LYS A 1  81   ? -15.498 26.891  -10.187 1.00 45.42  ? 81   LYS A N     1 
ATOM   601   C  CA    . LYS A 1  81   ? -15.123 25.871  -11.157 1.00 48.72  ? 81   LYS A CA    1 
ATOM   602   C  C     . LYS A 1  81   ? -16.112 25.893  -12.320 1.00 49.49  ? 81   LYS A C     1 
ATOM   603   O  O     . LYS A 1  81   ? -15.744 25.623  -13.463 1.00 52.48  ? 81   LYS A O     1 
ATOM   604   C  CB    . LYS A 1  81   ? -15.086 24.477  -10.516 1.00 50.39  ? 81   LYS A CB    1 
ATOM   605   C  CG    . LYS A 1  81   ? -14.337 24.388  -9.187  1.00 49.73  ? 81   LYS A CG    1 
ATOM   606   C  CD    . LYS A 1  81   ? -12.868 24.005  -9.352  1.00 48.64  ? 81   LYS A CD    1 
ATOM   607   C  CE    . LYS A 1  81   ? -12.239 23.695  -7.994  1.00 46.26  ? 81   LYS A CE    1 
ATOM   608   N  NZ    . LYS A 1  81   ? -10.814 23.269  -8.079  1.00 43.79  ? 81   LYS A NZ    1 
ATOM   609   N  N     . SER A 1  82   ? -17.365 26.234  -12.018 1.00 46.57  ? 82   SER A N     1 
ATOM   610   C  CA    . SER A 1  82   ? -18.449 26.164  -12.997 1.00 48.01  ? 82   SER A CA    1 
ATOM   611   C  C     . SER A 1  82   ? -18.526 27.419  -13.855 1.00 44.23  ? 82   SER A C     1 
ATOM   612   O  O     . SER A 1  82   ? -19.355 27.520  -14.761 1.00 42.66  ? 82   SER A O     1 
ATOM   613   C  CB    . SER A 1  82   ? -19.788 25.921  -12.291 1.00 48.31  ? 82   SER A CB    1 
ATOM   614   O  OG    . SER A 1  82   ? -19.841 26.577  -11.036 1.00 45.71  ? 82   SER A OG    1 
ATOM   615   N  N     . LEU A 1  83   ? -17.643 28.363  -13.560 1.00 43.08  ? 83   LEU A N     1 
ATOM   616   C  CA    . LEU A 1  83   ? -17.549 29.618  -14.290 1.00 51.01  ? 83   LEU A CA    1 
ATOM   617   C  C     . LEU A 1  83   ? -17.075 29.418  -15.730 1.00 54.14  ? 83   LEU A C     1 
ATOM   618   O  O     . LEU A 1  83   ? -15.972 28.923  -15.967 1.00 57.29  ? 83   LEU A O     1 
ATOM   619   C  CB    . LEU A 1  83   ? -16.603 30.562  -13.548 1.00 49.58  ? 83   LEU A CB    1 
ATOM   620   C  CG    . LEU A 1  83   ? -16.280 31.913  -14.174 1.00 49.47  ? 83   LEU A CG    1 
ATOM   621   C  CD1   . LEU A 1  83   ? -17.539 32.755  -14.307 1.00 52.48  ? 83   LEU A CD1   1 
ATOM   622   C  CD2   . LEU A 1  83   ? -15.224 32.619  -13.337 1.00 48.96  ? 83   LEU A CD2   1 
ATOM   623   N  N     . VAL A 1  84   ? -17.908 29.811  -16.689 1.00 51.57  ? 84   VAL A N     1 
ATOM   624   C  CA    . VAL A 1  84   ? -17.577 29.635  -18.099 1.00 50.09  ? 84   VAL A CA    1 
ATOM   625   C  C     . VAL A 1  84   ? -16.947 30.895  -18.680 1.00 49.87  ? 84   VAL A C     1 
ATOM   626   O  O     . VAL A 1  84   ? -17.564 31.959  -18.707 1.00 53.01  ? 84   VAL A O     1 
ATOM   627   C  CB    . VAL A 1  84   ? -18.815 29.253  -18.917 1.00 51.61  ? 84   VAL A CB    1 
ATOM   628   C  CG1   . VAL A 1  84   ? -18.435 29.036  -20.371 1.00 55.32  ? 84   VAL A CG1   1 
ATOM   629   C  CG2   . VAL A 1  84   ? -19.459 28.002  -18.335 1.00 51.33  ? 84   VAL A CG2   1 
ATOM   630   N  N     . VAL A 1  85   ? -15.708 30.763  -19.141 1.00 51.77  ? 85   VAL A N     1 
ATOM   631   C  CA    . VAL A 1  85   ? -14.929 31.905  -19.607 1.00 57.70  ? 85   VAL A CA    1 
ATOM   632   C  C     . VAL A 1  85   ? -14.333 31.655  -20.990 1.00 64.14  ? 85   VAL A C     1 
ATOM   633   O  O     . VAL A 1  85   ? -13.959 30.528  -21.322 1.00 66.25  ? 85   VAL A O     1 
ATOM   634   C  CB    . VAL A 1  85   ? -13.777 32.241  -18.622 1.00 59.08  ? 85   VAL A CB    1 
ATOM   635   C  CG1   . VAL A 1  85   ? -13.051 33.515  -19.040 1.00 60.17  ? 85   VAL A CG1   1 
ATOM   636   C  CG2   . VAL A 1  85   ? -14.304 32.376  -17.205 1.00 59.50  ? 85   VAL A CG2   1 
ATOM   637   N  N     . SER A 1  86   ? -14.264 32.709  -21.798 1.00 66.45  ? 86   SER A N     1 
ATOM   638   C  CA    . SER A 1  86   ? -13.504 32.684  -23.041 1.00 67.97  ? 86   SER A CA    1 
ATOM   639   C  C     . SER A 1  86   ? -12.593 33.903  -23.085 1.00 66.68  ? 86   SER A C     1 
ATOM   640   O  O     . SER A 1  86   ? -13.054 35.036  -22.945 1.00 69.26  ? 86   SER A O     1 
ATOM   641   C  CB    . SER A 1  86   ? -14.430 32.653  -24.261 1.00 70.58  ? 86   SER A CB    1 
ATOM   642   O  OG    . SER A 1  86   ? -15.239 33.813  -24.331 1.00 73.62  ? 86   SER A OG    1 
ATOM   643   N  N     . SER A 1  87   ? -11.297 33.666  -23.254 1.00 63.33  ? 87   SER A N     1 
ATOM   644   C  CA    . SER A 1  87   ? -10.335 34.755  -23.349 1.00 67.37  ? 87   SER A CA    1 
ATOM   645   C  C     . SER A 1  87   ? -9.632  34.738  -24.703 1.00 68.14  ? 87   SER A C     1 
ATOM   646   O  O     . SER A 1  87   ? -9.490  33.686  -25.323 1.00 66.93  ? 87   SER A O     1 
ATOM   647   C  CB    . SER A 1  87   ? -9.309  34.668  -22.220 1.00 68.09  ? 87   SER A CB    1 
ATOM   648   O  OG    . SER A 1  87   ? -8.415  35.765  -22.265 1.00 73.08  ? 87   SER A OG    1 
ATOM   649   N  N     . GLU A 1  88   ? -9.196  35.906  -25.159 1.00 71.55  ? 88   GLU A N     1 
ATOM   650   C  CA    . GLU A 1  88   ? -8.521  36.007  -26.446 1.00 71.44  ? 88   GLU A CA    1 
ATOM   651   C  C     . GLU A 1  88   ? -7.036  36.248  -26.252 1.00 76.36  ? 88   GLU A C     1 
ATOM   652   O  O     . GLU A 1  88   ? -6.223  35.950  -27.128 1.00 78.64  ? 88   GLU A O     1 
ATOM   653   C  CB    . GLU A 1  88   ? -9.138  37.120  -27.278 1.00 68.28  ? 88   GLU A CB    1 
ATOM   654   C  CG    . GLU A 1  88   ? -10.622 36.929  -27.486 1.00 78.16  ? 88   GLU A CG    1 
ATOM   655   C  CD    . GLU A 1  88   ? -11.283 38.159  -28.049 1.00 94.43  ? 88   GLU A CD    1 
ATOM   656   O  OE1   . GLU A 1  88   ? -10.579 39.175  -28.231 1.00 103.89 ? 88   GLU A OE1   1 
ATOM   657   O  OE2   . GLU A 1  88   ? -12.506 38.110  -28.306 1.00 93.75  ? 88   GLU A OE2   1 
ATOM   658   N  N     . GLU A 1  89   ? -6.693  36.786  -25.089 1.00 80.17  ? 89   GLU A N     1 
ATOM   659   C  CA    . GLU A 1  89   ? -5.305  37.026  -24.728 1.00 83.37  ? 89   GLU A CA    1 
ATOM   660   C  C     . GLU A 1  89   ? -4.565  35.713  -24.528 1.00 82.50  ? 89   GLU A C     1 
ATOM   661   O  O     . GLU A 1  89   ? -4.880  34.949  -23.615 1.00 78.62  ? 89   GLU A O     1 
ATOM   662   C  CB    . GLU A 1  89   ? -5.234  37.868  -23.459 1.00 81.85  ? 89   GLU A CB    1 
ATOM   663   C  CG    . GLU A 1  89   ? -6.119  39.099  -23.498 1.00 83.46  ? 89   GLU A CG    1 
ATOM   664   C  CD    . GLU A 1  89   ? -5.430  40.289  -24.124 1.00 93.90  ? 89   GLU A CD    1 
ATOM   665   O  OE1   . GLU A 1  89   ? -4.219  40.190  -24.422 1.00 97.62  ? 89   GLU A OE1   1 
ATOM   666   O  OE2   . GLU A 1  89   ? -6.099  41.327  -24.312 1.00 89.23  ? 89   GLU A OE2   1 
ATOM   667   N  N     . ASP A 1  90   ? -3.585  35.452  -25.387 1.00 85.50  ? 90   ASP A N     1 
ATOM   668   C  CA    . ASP A 1  90   ? -2.775  34.244  -25.280 1.00 89.07  ? 90   ASP A CA    1 
ATOM   669   C  C     . ASP A 1  90   ? -2.069  34.218  -23.925 1.00 91.30  ? 90   ASP A C     1 
ATOM   670   O  O     . ASP A 1  90   ? -1.918  33.167  -23.297 1.00 87.18  ? 90   ASP A O     1 
ATOM   671   C  CB    . ASP A 1  90   ? -1.760  34.178  -26.423 1.00 92.06  ? 90   ASP A CB    1 
ATOM   672   C  CG    . ASP A 1  90   ? -1.383  32.757  -26.787 1.00 105.04 ? 90   ASP A CG    1 
ATOM   673   O  OD1   . ASP A 1  90   ? -1.299  31.909  -25.872 1.00 108.76 ? 90   ASP A OD1   1 
ATOM   674   O  OD2   . ASP A 1  90   ? -1.178  32.487  -27.990 1.00 104.64 ? 90   ASP A OD2   1 
ATOM   675   N  N     . GLU A 1  91   ? -1.657  35.404  -23.491 1.00 90.43  ? 91   GLU A N     1 
ATOM   676   C  CA    . GLU A 1  91   ? -1.028  35.622  -22.197 1.00 82.16  ? 91   GLU A CA    1 
ATOM   677   C  C     . GLU A 1  91   ? -2.077  35.721  -21.086 1.00 78.06  ? 91   GLU A C     1 
ATOM   678   O  O     . GLU A 1  91   ? -3.248  35.996  -21.359 1.00 76.05  ? 91   GLU A O     1 
ATOM   679   C  CB    . GLU A 1  91   ? -0.186  36.893  -22.257 1.00 78.27  ? 91   GLU A CB    1 
ATOM   680   C  CG    . GLU A 1  91   ? -0.844  37.989  -23.074 1.00 83.37  ? 91   GLU A CG    1 
ATOM   681   C  CD    . GLU A 1  91   ? -0.014  39.245  -23.128 1.00 92.06  ? 91   GLU A CD    1 
ATOM   682   O  OE1   . GLU A 1  91   ? 1.054   39.267  -22.484 1.00 108.94 ? 91   GLU A OE1   1 
ATOM   683   O  OE2   . GLU A 1  91   ? -0.427  40.207  -23.809 1.00 96.57  ? 91   GLU A OE2   1 
ATOM   684   N  N     . PRO A 1  92   ? -1.664  35.482  -19.830 1.00 70.46  ? 92   PRO A N     1 
ATOM   685   C  CA    . PRO A 1  92   ? -2.575  35.553  -18.681 1.00 65.63  ? 92   PRO A CA    1 
ATOM   686   C  C     . PRO A 1  92   ? -3.170  36.938  -18.457 1.00 65.36  ? 92   PRO A C     1 
ATOM   687   O  O     . PRO A 1  92   ? -2.487  37.946  -18.635 1.00 66.53  ? 92   PRO A O     1 
ATOM   688   C  CB    . PRO A 1  92   ? -1.680  35.169  -17.500 1.00 67.76  ? 92   PRO A CB    1 
ATOM   689   C  CG    . PRO A 1  92   ? -0.596  34.359  -18.099 1.00 73.75  ? 92   PRO A CG    1 
ATOM   690   C  CD    . PRO A 1  92   ? -0.342  34.959  -19.444 1.00 72.93  ? 92   PRO A CD    1 
ATOM   691   N  N     . VAL A 1  93   ? -4.436  36.976  -18.054 1.00 63.07  ? 93   VAL A N     1 
ATOM   692   C  CA    . VAL A 1  93   ? -5.101  38.233  -17.743 1.00 59.25  ? 93   VAL A CA    1 
ATOM   693   C  C     . VAL A 1  93   ? -5.776  38.176  -16.379 1.00 58.15  ? 93   VAL A C     1 
ATOM   694   O  O     . VAL A 1  93   ? -6.042  37.098  -15.853 1.00 58.46  ? 93   VAL A O     1 
ATOM   695   C  CB    . VAL A 1  93   ? -6.140  38.595  -18.808 1.00 61.21  ? 93   VAL A CB    1 
ATOM   696   C  CG1   . VAL A 1  93   ? -5.441  39.035  -20.072 1.00 68.59  ? 93   VAL A CG1   1 
ATOM   697   C  CG2   . VAL A 1  93   ? -7.062  37.414  -19.078 1.00 58.38  ? 93   VAL A CG2   1 
ATOM   698   N  N     . THR A 1  94   ? -6.055  39.350  -15.821 1.00 59.27  ? 94   THR A N     1 
ATOM   699   C  CA    . THR A 1  94   ? -6.613  39.465  -14.478 1.00 55.71  ? 94   THR A CA    1 
ATOM   700   C  C     . THR A 1  94   ? -7.999  40.101  -14.469 1.00 52.27  ? 94   THR A C     1 
ATOM   701   O  O     . THR A 1  94   ? -8.171  41.236  -14.909 1.00 55.19  ? 94   THR A O     1 
ATOM   702   C  CB    . THR A 1  94   ? -5.696  40.305  -13.571 1.00 57.98  ? 94   THR A CB    1 
ATOM   703   O  OG1   . THR A 1  94   ? -4.398  39.699  -13.501 1.00 56.18  ? 94   THR A OG1   1 
ATOM   704   C  CG2   . THR A 1  94   ? -6.291  40.420  -12.177 1.00 55.42  ? 94   THR A CG2   1 
ATOM   705   N  N     . MET A 1  95   ? -8.983  39.370  -13.960 1.00 52.15  ? 95   MET A N     1 
ATOM   706   C  CA    . MET A 1  95   ? -10.322 39.919  -13.773 1.00 57.10  ? 95   MET A CA    1 
ATOM   707   C  C     . MET A 1  95   ? -10.459 40.419  -12.333 1.00 60.71  ? 95   MET A C     1 
ATOM   708   O  O     . MET A 1  95   ? -9.525  40.271  -11.542 1.00 59.38  ? 95   MET A O     1 
ATOM   709   C  CB    . MET A 1  95   ? -11.386 38.866  -14.088 1.00 56.40  ? 95   MET A CB    1 
ATOM   710   C  CG    . MET A 1  95   ? -11.049 37.991  -15.284 1.00 53.94  ? 95   MET A CG    1 
ATOM   711   S  SD    . MET A 1  95   ? -12.351 36.805  -15.662 1.00 55.88  ? 95   MET A SD    1 
ATOM   712   C  CE    . MET A 1  95   ? -12.666 36.103  -14.048 1.00 50.51  ? 95   MET A CE    1 
ATOM   713   N  N     . TYR A 1  96   ? -11.606 41.014  -11.996 1.00 60.01  ? 96   TYR A N     1 
ATOM   714   C  CA    . TYR A 1  96   ? -11.852 41.514  -10.636 1.00 55.66  ? 96   TYR A CA    1 
ATOM   715   C  C     . TYR A 1  96   ? -13.304 41.352  -10.198 1.00 53.38  ? 96   TYR A C     1 
ATOM   716   O  O     . TYR A 1  96   ? -14.213 41.314  -11.024 1.00 54.26  ? 96   TYR A O     1 
ATOM   717   C  CB    . TYR A 1  96   ? -11.447 42.990  -10.517 1.00 55.31  ? 96   TYR A CB    1 
ATOM   718   C  CG    . TYR A 1  96   ? -9.953  43.185  -10.453 1.00 59.28  ? 96   TYR A CG    1 
ATOM   719   C  CD1   . TYR A 1  96   ? -9.290  43.232  -9.234  1.00 59.04  ? 96   TYR A CD1   1 
ATOM   720   C  CD2   . TYR A 1  96   ? -9.199  43.298  -11.615 1.00 63.87  ? 96   TYR A CD2   1 
ATOM   721   C  CE1   . TYR A 1  96   ? -7.915  43.394  -9.176  1.00 59.83  ? 96   TYR A CE1   1 
ATOM   722   C  CE2   . TYR A 1  96   ? -7.830  43.457  -11.569 1.00 61.72  ? 96   TYR A CE2   1 
ATOM   723   C  CZ    . TYR A 1  96   ? -7.191  43.505  -10.350 1.00 60.20  ? 96   TYR A CZ    1 
ATOM   724   O  OH    . TYR A 1  96   ? -5.824  43.668  -10.317 1.00 57.61  ? 96   TYR A OH    1 
ATOM   725   N  N     . LEU A 1  97   ? -13.508 41.254  -8.887  1.00 50.65  ? 97   LEU A N     1 
ATOM   726   C  CA    . LEU A 1  97   ? -14.849 41.238  -8.309  1.00 54.65  ? 97   LEU A CA    1 
ATOM   727   C  C     . LEU A 1  97   ? -14.843 41.902  -6.933  1.00 58.46  ? 97   LEU A C     1 
ATOM   728   O  O     . LEU A 1  97   ? -14.121 41.477  -6.029  1.00 57.99  ? 97   LEU A O     1 
ATOM   729   C  CB    . LEU A 1  97   ? -15.388 39.807  -8.208  1.00 51.06  ? 97   LEU A CB    1 
ATOM   730   C  CG    . LEU A 1  97   ? -16.800 39.627  -7.627  1.00 54.28  ? 97   LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1  97   ? -17.628 38.668  -8.469  1.00 57.44  ? 97   LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1  97   ? -16.747 39.139  -6.187  1.00 50.36  ? 97   LEU A CD2   1 
ATOM   733   N  N     . ARG A 1  98   ? -15.644 42.954  -6.787  1.00 58.39  ? 98   ARG A N     1 
ATOM   734   C  CA    . ARG A 1  98   ? -15.794 43.644  -5.513  1.00 53.97  ? 98   ARG A CA    1 
ATOM   735   C  C     . ARG A 1  98   ? -17.261 43.997  -5.293  1.00 54.04  ? 98   ARG A C     1 
ATOM   736   O  O     . ARG A 1  98   ? -17.873 44.683  -6.109  1.00 59.98  ? 98   ARG A O     1 
ATOM   737   C  CB    . ARG A 1  98   ? -14.917 44.900  -5.467  1.00 55.96  ? 98   ARG A CB    1 
ATOM   738   C  CG    . ARG A 1  98   ? -13.423 44.612  -5.523  1.00 59.75  ? 98   ARG A CG    1 
ATOM   739   C  CD    . ARG A 1  98   ? -12.600 45.885  -5.630  1.00 77.17  ? 98   ARG A CD    1 
ATOM   740   N  NE    . ARG A 1  98   ? -11.193 45.596  -5.905  1.00 90.42  ? 98   ARG A NE    1 
ATOM   741   C  CZ    . ARG A 1  98   ? -10.247 46.523  -6.024  1.00 85.42  ? 98   ARG A CZ    1 
ATOM   742   N  NH1   . ARG A 1  98   ? -10.555 47.807  -5.886  1.00 89.56  ? 98   ARG A NH1   1 
ATOM   743   N  NH2   . ARG A 1  98   ? -8.992  46.168  -6.276  1.00 72.17  ? 98   ARG A NH2   1 
ATOM   744   N  N     . LYS A 1  99   ? -17.827 43.504  -4.198  1.00 52.88  ? 99   LYS A N     1 
ATOM   745   C  CA    . LYS A 1  99   ? -19.220 43.777  -3.867  1.00 56.22  ? 99   LYS A CA    1 
ATOM   746   C  C     . LYS A 1  99   ? -19.407 43.715  -2.350  1.00 59.24  ? 99   LYS A C     1 
ATOM   747   O  O     . LYS A 1  99   ? -18.809 42.871  -1.679  1.00 59.91  ? 99   LYS A O     1 
ATOM   748   C  CB    . LYS A 1  99   ? -20.153 42.788  -4.580  1.00 53.49  ? 99   LYS A CB    1 
ATOM   749   C  CG    . LYS A 1  99   ? -21.612 43.253  -4.674  1.00 58.71  ? 99   LYS A CG    1 
ATOM   750   C  CD    . LYS A 1  99   ? -22.472 42.302  -5.510  1.00 60.91  ? 99   LYS A CD    1 
ATOM   751   C  CE    . LYS A 1  99   ? -23.881 42.861  -5.741  1.00 57.74  ? 99   LYS A CE    1 
ATOM   752   N  NZ    . LYS A 1  99   ? -24.645 43.102  -4.478  1.00 46.79  ? 99   LYS A NZ    1 
ATOM   753   N  N     . GLN A 1  100  ? -20.227 44.617  -1.814  1.00 56.97  ? 100  GLN A N     1 
ATOM   754   C  CA    . GLN A 1  100  ? -20.413 44.714  -0.370  1.00 55.19  ? 100  GLN A CA    1 
ATOM   755   C  C     . GLN A 1  100  ? -21.891 44.744  0.011   1.00 53.12  ? 100  GLN A C     1 
ATOM   756   O  O     . GLN A 1  100  ? -22.774 44.607  -0.841  1.00 48.32  ? 100  GLN A O     1 
ATOM   757   C  CB    . GLN A 1  100  ? -19.709 45.962  0.174   1.00 56.74  ? 100  GLN A CB    1 
ATOM   758   C  CG    . GLN A 1  100  ? -19.154 45.808  1.585   1.00 55.30  ? 100  GLN A CG    1 
ATOM   759   C  CD    . GLN A 1  100  ? -18.766 47.132  2.212   1.00 56.56  ? 100  GLN A CD    1 
ATOM   760   O  OE1   . GLN A 1  100  ? -19.307 48.181  1.861   1.00 68.39  ? 100  GLN A OE1   1 
ATOM   761   N  NE2   . GLN A 1  100  ? -17.820 47.090  3.144   1.00 49.39  ? 100  GLN A NE2   1 
ATOM   762   N  N     . GLY A 1  101  ? -22.144 44.918  1.305   1.00 54.52  ? 101  GLY A N     1 
ATOM   763   C  CA    . GLY A 1  101  ? -23.490 45.033  1.830   1.00 55.28  ? 101  GLY A CA    1 
ATOM   764   C  C     . GLY A 1  101  ? -24.289 43.758  1.680   1.00 57.04  ? 101  GLY A C     1 
ATOM   765   O  O     . GLY A 1  101  ? -23.770 42.739  1.220   1.00 59.41  ? 101  GLY A O     1 
ATOM   766   N  N     . PRO A 1  102  ? -25.565 43.801  2.084   1.00 56.51  ? 102  PRO A N     1 
ATOM   767   C  CA    . PRO A 1  102  ? -26.463 42.672  1.837   1.00 54.71  ? 102  PRO A CA    1 
ATOM   768   C  C     . PRO A 1  102  ? -26.622 42.423  0.339   1.00 54.24  ? 102  PRO A C     1 
ATOM   769   O  O     . PRO A 1  102  ? -26.312 43.300  -0.472  1.00 53.41  ? 102  PRO A O     1 
ATOM   770   C  CB    . PRO A 1  102  ? -27.782 43.124  2.471   1.00 54.14  ? 102  PRO A CB    1 
ATOM   771   C  CG    . PRO A 1  102  ? -27.381 44.131  3.498   1.00 55.60  ? 102  PRO A CG    1 
ATOM   772   C  CD    . PRO A 1  102  ? -26.201 44.845  2.906   1.00 59.77  ? 102  PRO A CD    1 
ATOM   773   N  N     . GLY A 1  103  ? -27.085 41.232  -0.023  1.00 58.26  ? 103  GLY A N     1 
ATOM   774   C  CA    . GLY A 1  103  ? -27.257 40.883  -1.419  1.00 63.64  ? 103  GLY A CA    1 
ATOM   775   C  C     . GLY A 1  103  ? -26.414 39.697  -1.855  1.00 63.81  ? 103  GLY A C     1 
ATOM   776   O  O     . GLY A 1  103  ? -25.468 39.300  -1.175  1.00 61.43  ? 103  GLY A O     1 
ATOM   777   N  N     . GLU A 1  104  ? -26.767 39.135  -3.004  1.00 61.13  ? 104  GLU A N     1 
ATOM   778   C  CA    . GLU A 1  104  ? -26.094 37.964  -3.544  1.00 54.77  ? 104  GLU A CA    1 
ATOM   779   C  C     . GLU A 1  104  ? -25.095 38.377  -4.623  1.00 55.82  ? 104  GLU A C     1 
ATOM   780   O  O     . GLU A 1  104  ? -25.413 39.214  -5.467  1.00 59.86  ? 104  GLU A O     1 
ATOM   781   C  CB    . GLU A 1  104  ? -27.131 36.996  -4.114  1.00 55.04  ? 104  GLU A CB    1 
ATOM   782   C  CG    . GLU A 1  104  ? -26.632 35.591  -4.376  1.00 62.19  ? 104  GLU A CG    1 
ATOM   783   C  CD    . GLU A 1  104  ? -27.688 34.725  -5.038  1.00 73.04  ? 104  GLU A CD    1 
ATOM   784   O  OE1   . GLU A 1  104  ? -28.440 35.257  -5.883  1.00 84.47  ? 104  GLU A OE1   1 
ATOM   785   O  OE2   . GLU A 1  104  ? -27.775 33.521  -4.708  1.00 68.91  ? 104  GLU A OE2   1 
ATOM   786   N  N     . VAL A 1  105  ? -23.891 37.806  -4.598  1.00 54.27  ? 105  VAL A N     1 
ATOM   787   C  CA    . VAL A 1  105  ? -22.905 38.091  -5.643  1.00 54.35  ? 105  VAL A CA    1 
ATOM   788   C  C     . VAL A 1  105  ? -22.932 37.002  -6.719  1.00 57.47  ? 105  VAL A C     1 
ATOM   789   O  O     . VAL A 1  105  ? -23.075 35.812  -6.422  1.00 56.41  ? 105  VAL A O     1 
ATOM   790   C  CB    . VAL A 1  105  ? -21.462 38.241  -5.072  1.00 50.76  ? 105  VAL A CB    1 
ATOM   791   C  CG1   . VAL A 1  105  ? -20.871 36.896  -4.678  1.00 49.39  ? 105  VAL A CG1   1 
ATOM   792   C  CG2   . VAL A 1  105  ? -20.556 38.937  -6.080  1.00 51.61  ? 105  VAL A CG2   1 
ATOM   793   N  N     . THR A 1  106  ? -22.822 37.425  -7.975  1.00 60.06  ? 106  THR A N     1 
ATOM   794   C  CA    . THR A 1  106  ? -22.868 36.505  -9.107  1.00 58.60  ? 106  THR A CA    1 
ATOM   795   C  C     . THR A 1  106  ? -21.632 36.665  -9.989  1.00 56.57  ? 106  THR A C     1 
ATOM   796   O  O     . THR A 1  106  ? -20.671 37.335  -9.609  1.00 54.94  ? 106  THR A O     1 
ATOM   797   C  CB    . THR A 1  106  ? -24.140 36.722  -9.958  1.00 57.61  ? 106  THR A CB    1 
ATOM   798   O  OG1   . THR A 1  106  ? -24.234 38.100  -10.340 1.00 58.00  ? 106  THR A OG1   1 
ATOM   799   C  CG2   . THR A 1  106  ? -25.384 36.339  -9.169  1.00 57.78  ? 106  THR A CG2   1 
ATOM   800   N  N     . ALA A 1  107  ? -21.652 36.043  -11.162 1.00 56.43  ? 107  ALA A N     1 
ATOM   801   C  CA    . ALA A 1  107  ? -20.555 36.198  -12.110 1.00 58.77  ? 107  ALA A CA    1 
ATOM   802   C  C     . ALA A 1  107  ? -20.757 37.455  -12.952 1.00 60.21  ? 107  ALA A C     1 
ATOM   803   O  O     . ALA A 1  107  ? -19.869 37.868  -13.698 1.00 58.66  ? 107  ALA A O     1 
ATOM   804   C  CB    . ALA A 1  107  ? -20.434 34.971  -12.999 1.00 64.28  ? 107  ALA A CB    1 
ATOM   805   N  N     . GLY A 1  108  ? -21.934 38.058  -12.828 1.00 60.28  ? 108  GLY A N     1 
ATOM   806   C  CA    . GLY A 1  108  ? -22.222 39.300  -13.518 1.00 59.80  ? 108  GLY A CA    1 
ATOM   807   C  C     . GLY A 1  108  ? -21.492 40.448  -12.855 1.00 59.38  ? 108  GLY A C     1 
ATOM   808   O  O     . GLY A 1  108  ? -21.280 41.501  -13.460 1.00 58.19  ? 108  GLY A O     1 
ATOM   809   N  N     . ASP A 1  109  ? -21.103 40.233  -11.601 1.00 62.22  ? 109  ASP A N     1 
ATOM   810   C  CA    . ASP A 1  109  ? -20.366 41.227  -10.825 1.00 64.29  ? 109  ASP A CA    1 
ATOM   811   C  C     . ASP A 1  109  ? -18.859 41.110  -11.067 1.00 56.19  ? 109  ASP A C     1 
ATOM   812   O  O     . ASP A 1  109  ? -18.055 41.709  -10.352 1.00 52.61  ? 109  ASP A O     1 
ATOM   813   C  CB    . ASP A 1  109  ? -20.676 41.083  -9.325  1.00 65.54  ? 109  ASP A CB    1 
ATOM   814   C  CG    . ASP A 1  109  ? -22.124 41.433  -8.979  1.00 63.15  ? 109  ASP A CG    1 
ATOM   815   O  OD1   . ASP A 1  109  ? -22.441 42.638  -8.902  1.00 68.44  ? 109  ASP A OD1   1 
ATOM   816   O  OD2   . ASP A 1  109  ? -22.938 40.506  -8.767  1.00 54.79  ? 109  ASP A OD2   1 
ATOM   817   N  N     . ILE A 1  110  ? -18.482 40.332  -12.076 1.00 51.85  ? 110  ILE A N     1 
ATOM   818   C  CA    . ILE A 1  110  ? -17.084 40.216  -12.470 1.00 54.54  ? 110  ILE A CA    1 
ATOM   819   C  C     . ILE A 1  110  ? -16.755 41.295  -13.503 1.00 58.27  ? 110  ILE A C     1 
ATOM   820   O  O     . ILE A 1  110  ? -17.592 41.623  -14.343 1.00 59.47  ? 110  ILE A O     1 
ATOM   821   C  CB    . ILE A 1  110  ? -16.774 38.817  -13.045 1.00 50.39  ? 110  ILE A CB    1 
ATOM   822   C  CG1   . ILE A 1  110  ? -17.190 37.731  -12.052 1.00 55.18  ? 110  ILE A CG1   1 
ATOM   823   C  CG2   . ILE A 1  110  ? -15.297 38.676  -13.381 1.00 48.95  ? 110  ILE A CG2   1 
ATOM   824   C  CD1   . ILE A 1  110  ? -16.866 36.325  -12.513 1.00 55.31  ? 110  ILE A CD1   1 
ATOM   825   N  N     . VAL A 1  111  ? -15.548 41.856  -13.426 1.00 57.38  ? 111  VAL A N     1 
ATOM   826   C  CA    . VAL A 1  111  ? -15.102 42.887  -14.365 1.00 57.02  ? 111  VAL A CA    1 
ATOM   827   C  C     . VAL A 1  111  ? -14.091 42.331  -15.364 1.00 57.06  ? 111  VAL A C     1 
ATOM   828   O  O     . VAL A 1  111  ? -12.887 42.344  -15.108 1.00 53.39  ? 111  VAL A O     1 
ATOM   829   C  CB    . VAL A 1  111  ? -14.463 44.081  -13.633 1.00 59.39  ? 111  VAL A CB    1 
ATOM   830   C  CG1   . VAL A 1  111  ? -14.208 45.225  -14.604 1.00 68.34  ? 111  VAL A CG1   1 
ATOM   831   C  CG2   . VAL A 1  111  ? -15.350 44.536  -12.488 1.00 59.34  ? 111  VAL A CG2   1 
ATOM   832   N  N     . PRO A 1  112  ? -14.579 41.847  -16.515 1.00 62.50  ? 112  PRO A N     1 
ATOM   833   C  CA    . PRO A 1  112  ? -13.694 41.199  -17.486 1.00 65.90  ? 112  PRO A CA    1 
ATOM   834   C  C     . PRO A 1  112  ? -12.929 42.200  -18.340 1.00 69.02  ? 112  PRO A C     1 
ATOM   835   O  O     . PRO A 1  112  ? -13.545 43.091  -18.930 1.00 74.55  ? 112  PRO A O     1 
ATOM   836   C  CB    . PRO A 1  112  ? -14.664 40.382  -18.341 1.00 70.08  ? 112  PRO A CB    1 
ATOM   837   C  CG    . PRO A 1  112  ? -15.925 41.182  -18.322 1.00 65.71  ? 112  PRO A CG    1 
ATOM   838   C  CD    . PRO A 1  112  ? -15.978 41.880  -16.980 1.00 62.06  ? 112  PRO A CD    1 
ATOM   839   N  N     . PRO A 1  113  ? -11.598 42.052  -18.416 1.00 66.12  ? 113  PRO A N     1 
ATOM   840   C  CA    . PRO A 1  113  ? -10.774 42.955  -19.228 1.00 68.46  ? 113  PRO A CA    1 
ATOM   841   C  C     . PRO A 1  113  ? -11.081 42.866  -20.723 1.00 68.44  ? 113  PRO A C     1 
ATOM   842   O  O     . PRO A 1  113  ? -12.045 42.220  -21.136 1.00 68.46  ? 113  PRO A O     1 
ATOM   843   C  CB    . PRO A 1  113  ? -9.345  42.482  -18.937 1.00 60.57  ? 113  PRO A CB    1 
ATOM   844   C  CG    . PRO A 1  113  ? -9.494  41.070  -18.487 1.00 60.14  ? 113  PRO A CG    1 
ATOM   845   C  CD    . PRO A 1  113  ? -10.791 41.021  -17.742 1.00 59.78  ? 113  PRO A CD    1 
ATOM   846   N  N     . ALA A 1  114  ? -10.260 43.525  -21.530 1.00 63.30  ? 114  ALA A N     1 
ATOM   847   C  CA    . ALA A 1  114  ? -10.434 43.477  -22.972 1.00 71.79  ? 114  ALA A CA    1 
ATOM   848   C  C     . ALA A 1  114  ? -10.156 42.071  -23.495 1.00 76.32  ? 114  ALA A C     1 
ATOM   849   O  O     . ALA A 1  114  ? -9.136  41.462  -23.163 1.00 74.75  ? 114  ALA A O     1 
ATOM   850   C  CB    . ALA A 1  114  ? -9.529  44.492  -23.651 1.00 82.99  ? 114  ALA A CB    1 
ATOM   851   N  N     . GLY A 1  115  ? -11.076 41.555  -24.304 1.00 77.16  ? 115  GLY A N     1 
ATOM   852   C  CA    . GLY A 1  115  ? -10.899 40.257  -24.927 1.00 81.74  ? 115  GLY A CA    1 
ATOM   853   C  C     . GLY A 1  115  ? -11.267 39.094  -24.027 1.00 83.45  ? 115  GLY A C     1 
ATOM   854   O  O     . GLY A 1  115  ? -10.882 37.954  -24.287 1.00 85.76  ? 115  GLY A O     1 
ATOM   855   N  N     . VAL A 1  116  ? -12.008 39.387  -22.962 1.00 81.63  ? 116  VAL A N     1 
ATOM   856   C  CA    . VAL A 1  116  ? -12.498 38.360  -22.048 1.00 77.11  ? 116  VAL A CA    1 
ATOM   857   C  C     . VAL A 1  116  ? -13.994 38.537  -21.813 1.00 82.05  ? 116  VAL A C     1 
ATOM   858   O  O     . VAL A 1  116  ? -14.437 39.607  -21.397 1.00 87.81  ? 116  VAL A O     1 
ATOM   859   C  CB    . VAL A 1  116  ? -11.767 38.401  -20.692 1.00 72.07  ? 116  VAL A CB    1 
ATOM   860   C  CG1   . VAL A 1  116  ? -12.408 37.424  -19.720 1.00 74.13  ? 116  VAL A CG1   1 
ATOM   861   C  CG2   . VAL A 1  116  ? -10.286 38.097  -20.871 1.00 69.97  ? 116  VAL A CG2   1 
ATOM   862   N  N     . THR A 1  117  ? -14.770 37.490  -22.085 1.00 78.99  ? 117  THR A N     1 
ATOM   863   C  CA    . THR A 1  117  ? -16.221 37.553  -21.928 1.00 80.08  ? 117  THR A CA    1 
ATOM   864   C  C     . THR A 1  117  ? -16.757 36.405  -21.075 1.00 73.27  ? 117  THR A C     1 
ATOM   865   O  O     . THR A 1  117  ? -16.427 35.241  -21.300 1.00 70.72  ? 117  THR A O     1 
ATOM   866   C  CB    . THR A 1  117  ? -16.948 37.535  -23.299 1.00 76.46  ? 117  THR A CB    1 
ATOM   867   O  OG1   . THR A 1  117  ? -16.546 36.381  -24.045 1.00 74.58  ? 117  THR A OG1   1 
ATOM   868   C  CG2   . THR A 1  117  ? -16.628 38.790  -24.104 1.00 73.05  ? 117  THR A CG2   1 
ATOM   869   N  N     . VAL A 1  118  ? -17.580 36.745  -20.088 1.00 75.21  ? 118  VAL A N     1 
ATOM   870   C  CA    . VAL A 1  118  ? -18.322 35.753  -19.316 1.00 72.16  ? 118  VAL A CA    1 
ATOM   871   C  C     . VAL A 1  118  ? -19.561 35.351  -20.117 1.00 67.96  ? 118  VAL A C     1 
ATOM   872   O  O     . VAL A 1  118  ? -20.122 36.171  -20.841 1.00 72.67  ? 118  VAL A O     1 
ATOM   873   C  CB    . VAL A 1  118  ? -18.732 36.306  -17.928 1.00 71.40  ? 118  VAL A CB    1 
ATOM   874   C  CG1   . VAL A 1  118  ? -19.299 35.198  -17.041 1.00 67.45  ? 118  VAL A CG1   1 
ATOM   875   C  CG2   . VAL A 1  118  ? -17.546 37.001  -17.256 1.00 61.33  ? 118  VAL A CG2   1 
ATOM   876   N  N     . HIS A 1  119  ? -19.991 34.100  -20.012 1.00 61.95  ? 119  HIS A N     1 
ATOM   877   C  CA    . HIS A 1  119  ? -21.161 33.672  -20.775 1.00 66.87  ? 119  HIS A CA    1 
ATOM   878   C  C     . HIS A 1  119  ? -22.302 33.208  -19.883 1.00 72.95  ? 119  HIS A C     1 
ATOM   879   O  O     . HIS A 1  119  ? -23.358 32.807  -20.373 1.00 69.84  ? 119  HIS A O     1 
ATOM   880   C  CB    . HIS A 1  119  ? -20.778 32.562  -21.749 1.00 67.64  ? 119  HIS A CB    1 
ATOM   881   C  CG    . HIS A 1  119  ? -19.646 32.928  -22.651 1.00 65.83  ? 119  HIS A CG    1 
ATOM   882   N  ND1   . HIS A 1  119  ? -19.827 33.612  -23.834 1.00 70.14  ? 119  HIS A ND1   1 
ATOM   883   C  CD2   . HIS A 1  119  ? -18.313 32.722  -22.538 1.00 67.12  ? 119  HIS A CD2   1 
ATOM   884   C  CE1   . HIS A 1  119  ? -18.657 33.804  -24.413 1.00 73.36  ? 119  HIS A CE1   1 
ATOM   885   N  NE2   . HIS A 1  119  ? -17.720 33.272  -23.646 1.00 72.18  ? 119  HIS A NE2   1 
ATOM   886   N  N     . ASN A 1  120  ? -22.088 33.273  -18.572 1.00 71.85  ? 120  ASN A N     1 
ATOM   887   C  CA    . ASN A 1  120  ? -23.084 32.818  -17.608 1.00 71.17  ? 120  ASN A CA    1 
ATOM   888   C  C     . ASN A 1  120  ? -23.137 33.687  -16.351 1.00 70.95  ? 120  ASN A C     1 
ATOM   889   O  O     . ASN A 1  120  ? -22.811 33.225  -15.258 1.00 75.35  ? 120  ASN A O     1 
ATOM   890   C  CB    . ASN A 1  120  ? -22.803 31.363  -17.227 1.00 67.39  ? 120  ASN A CB    1 
ATOM   891   C  CG    . ASN A 1  120  ? -21.386 31.158  -16.720 1.00 61.31  ? 120  ASN A CG    1 
ATOM   892   O  OD1   . ASN A 1  120  ? -20.528 32.031  -16.863 1.00 59.24  ? 120  ASN A OD1   1 
ATOM   893   N  ND2   . ASN A 1  120  ? -21.135 30.001  -16.123 1.00 58.24  ? 120  ASN A ND2   1 
ATOM   894   N  N     . PRO A 1  121  ? -23.563 34.952  -16.503 1.00 69.32  ? 121  PRO A N     1 
ATOM   895   C  CA    . PRO A 1  121  ? -23.555 35.925  -15.402 1.00 69.24  ? 121  PRO A CA    1 
ATOM   896   C  C     . PRO A 1  121  ? -24.520 35.577  -14.263 1.00 68.53  ? 121  PRO A C     1 
ATOM   897   O  O     . PRO A 1  121  ? -24.349 36.061  -13.142 1.00 62.48  ? 121  PRO A O     1 
ATOM   898   C  CB    . PRO A 1  121  ? -23.978 37.231  -16.089 1.00 71.37  ? 121  PRO A CB    1 
ATOM   899   C  CG    . PRO A 1  121  ? -23.727 37.003  -17.552 1.00 69.23  ? 121  PRO A CG    1 
ATOM   900   C  CD    . PRO A 1  121  ? -24.026 35.559  -17.761 1.00 72.30  ? 121  PRO A CD    1 
ATOM   901   N  N     . GLY A 1  122  ? -25.516 34.745  -14.542 1.00 68.03  ? 122  GLY A N     1 
ATOM   902   C  CA    . GLY A 1  122  ? -26.484 34.374  -13.528 1.00 70.30  ? 122  GLY A CA    1 
ATOM   903   C  C     . GLY A 1  122  ? -25.967 33.343  -12.540 1.00 71.05  ? 122  GLY A C     1 
ATOM   904   O  O     . GLY A 1  122  ? -26.707 32.884  -11.669 1.00 74.18  ? 122  GLY A O     1 
ATOM   905   N  N     . MET A 1  123  ? -24.695 32.978  -12.670 1.00 69.05  ? 123  MET A N     1 
ATOM   906   C  CA    . MET A 1  123  ? -24.108 31.945  -11.823 1.00 66.95  ? 123  MET A CA    1 
ATOM   907   C  C     . MET A 1  123  ? -23.888 32.446  -10.403 1.00 61.92  ? 123  MET A C     1 
ATOM   908   O  O     . MET A 1  123  ? -23.185 33.433  -10.182 1.00 59.76  ? 123  MET A O     1 
ATOM   909   C  CB    . MET A 1  123  ? -22.784 31.453  -12.410 1.00 65.93  ? 123  MET A CB    1 
ATOM   910   C  CG    . MET A 1  123  ? -22.092 30.388  -11.576 1.00 52.94  ? 123  MET A CG    1 
ATOM   911   S  SD    . MET A 1  123  ? -20.393 30.132  -12.112 1.00 58.13  ? 123  MET A SD    1 
ATOM   912   C  CE    . MET A 1  123  ? -19.636 31.659  -11.554 1.00 56.43  ? 123  MET A CE    1 
ATOM   913   N  N     . HIS A 1  124  ? -24.502 31.759  -9.446  1.00 60.80  ? 124  HIS A N     1 
ATOM   914   C  CA    . HIS A 1  124  ? -24.361 32.100  -8.036  1.00 59.42  ? 124  HIS A CA    1 
ATOM   915   C  C     . HIS A 1  124  ? -22.904 31.913  -7.619  1.00 54.92  ? 124  HIS A C     1 
ATOM   916   O  O     . HIS A 1  124  ? -22.233 30.989  -8.079  1.00 53.18  ? 124  HIS A O     1 
ATOM   917   C  CB    . HIS A 1  124  ? -25.307 31.234  -7.189  1.00 60.04  ? 124  HIS A CB    1 
ATOM   918   C  CG    . HIS A 1  124  ? -25.244 31.504  -5.708  1.00 61.86  ? 124  HIS A CG    1 
ATOM   919   N  ND1   . HIS A 1  124  ? -24.687 32.643  -5.185  1.00 59.59  ? 124  HIS A ND1   1 
ATOM   920   C  CD2   . HIS A 1  124  ? -25.684 30.768  -4.661  1.00 64.20  ? 124  HIS A CD2   1 
ATOM   921   C  CE1   . HIS A 1  124  ? -24.779 32.598  -3.853  1.00 59.24  ? 124  HIS A CE1   1 
ATOM   922   N  NE2   . HIS A 1  124  ? -25.379 31.480  -3.522  1.00 61.58  ? 124  HIS A NE2   1 
ATOM   923   N  N     . ILE A 1  125  ? -22.400 32.812  -6.784  1.00 49.10  ? 125  ILE A N     1 
ATOM   924   C  CA    . ILE A 1  125  ? -21.080 32.618  -6.216  1.00 43.70  ? 125  ILE A CA    1 
ATOM   925   C  C     . ILE A 1  125  ? -21.155 32.608  -4.696  1.00 46.02  ? 125  ILE A C     1 
ATOM   926   O  O     . ILE A 1  125  ? -20.837 31.601  -4.068  1.00 50.77  ? 125  ILE A O     1 
ATOM   927   C  CB    . ILE A 1  125  ? -20.091 33.688  -6.692  1.00 41.84  ? 125  ILE A CB    1 
ATOM   928   C  CG1   . ILE A 1  125  ? -19.822 33.511  -8.186  1.00 43.50  ? 125  ILE A CG1   1 
ATOM   929   C  CG2   . ILE A 1  125  ? -18.791 33.586  -5.914  1.00 38.76  ? 125  ILE A CG2   1 
ATOM   930   C  CD1   . ILE A 1  125  ? -18.741 34.411  -8.728  1.00 48.34  ? 125  ILE A CD1   1 
ATOM   931   N  N     . ALA A 1  126  ? -21.595 33.708  -4.100  1.00 43.72  ? 126  ALA A N     1 
ATOM   932   C  CA    . ALA A 1  126  ? -21.617 33.796  -2.645  1.00 43.89  ? 126  ALA A CA    1 
ATOM   933   C  C     . ALA A 1  126  ? -22.756 34.668  -2.144  1.00 46.74  ? 126  ALA A C     1 
ATOM   934   O  O     . ALA A 1  126  ? -23.045 35.709  -2.727  1.00 51.85  ? 126  ALA A O     1 
ATOM   935   C  CB    . ALA A 1  126  ? -20.289 34.328  -2.134  1.00 43.07  ? 126  ALA A CB    1 
ATOM   936   N  N     . THR A 1  127  ? -23.393 34.251  -1.054  1.00 46.00  ? 127  THR A N     1 
ATOM   937   C  CA    . THR A 1  127  ? -24.454 35.055  -0.453  1.00 51.03  ? 127  THR A CA    1 
ATOM   938   C  C     . THR A 1  127  ? -23.900 35.954  0.655   1.00 49.38  ? 127  THR A C     1 
ATOM   939   O  O     . THR A 1  127  ? -23.889 35.580  1.830   1.00 49.71  ? 127  THR A O     1 
ATOM   940   C  CB    . THR A 1  127  ? -25.590 34.179  0.123   1.00 51.33  ? 127  THR A CB    1 
ATOM   941   O  OG1   . THR A 1  127  ? -26.012 33.227  -0.860  1.00 52.80  ? 127  THR A OG1   1 
ATOM   942   C  CG2   . THR A 1  127  ? -26.781 35.042  0.524   1.00 51.46  ? 127  THR A CG2   1 
ATOM   943   N  N     . LEU A 1  128  ? -23.442 37.143  0.269   1.00 49.18  ? 128  LEU A N     1 
ATOM   944   C  CA    . LEU A 1  128  ? -22.913 38.111  1.226   1.00 47.86  ? 128  LEU A CA    1 
ATOM   945   C  C     . LEU A 1  128  ? -24.000 38.672  2.123   1.00 52.42  ? 128  LEU A C     1 
ATOM   946   O  O     . LEU A 1  128  ? -24.844 39.447  1.677   1.00 56.37  ? 128  LEU A O     1 
ATOM   947   C  CB    . LEU A 1  128  ? -22.210 39.263  0.510   1.00 44.02  ? 128  LEU A CB    1 
ATOM   948   C  CG    . LEU A 1  128  ? -20.757 39.006  0.127   1.00 45.82  ? 128  LEU A CG    1 
ATOM   949   C  CD1   . LEU A 1  128  ? -20.679 38.242  -1.181  1.00 48.04  ? 128  LEU A CD1   1 
ATOM   950   C  CD2   . LEU A 1  128  ? -20.003 40.316  0.050   1.00 47.97  ? 128  LEU A CD2   1 
ATOM   951   N  N     . ASN A 1  129  ? -23.971 38.284  3.392   1.00 51.97  ? 129  ASN A N     1 
ATOM   952   C  CA    . ASN A 1  129  ? -24.901 38.829  4.371   1.00 61.07  ? 129  ASN A CA    1 
ATOM   953   C  C     . ASN A 1  129  ? -24.498 40.253  4.753   1.00 58.17  ? 129  ASN A C     1 
ATOM   954   O  O     . ASN A 1  129  ? -23.496 40.777  4.257   1.00 53.07  ? 129  ASN A O     1 
ATOM   955   C  CB    . ASN A 1  129  ? -24.960 37.935  5.616   1.00 62.41  ? 129  ASN A CB    1 
ATOM   956   C  CG    . ASN A 1  129  ? -26.244 38.118  6.413   1.00 61.45  ? 129  ASN A CG    1 
ATOM   957   O  OD1   . ASN A 1  129  ? -27.275 38.523  5.871   1.00 66.39  ? 129  ASN A OD1   1 
ATOM   958   N  ND2   . ASN A 1  129  ? -26.186 37.820  7.703   1.00 53.18  ? 129  ASN A ND2   1 
ATOM   959   N  N     . ASP A 1  130  ? -25.289 40.873  5.625   1.00 59.94  ? 130  ASP A N     1 
ATOM   960   C  CA    . ASP A 1  130  ? -24.991 42.202  6.139   1.00 57.32  ? 130  ASP A CA    1 
ATOM   961   C  C     . ASP A 1  130  ? -23.589 42.209  6.729   1.00 55.31  ? 130  ASP A C     1 
ATOM   962   O  O     . ASP A 1  130  ? -23.143 41.194  7.265   1.00 54.15  ? 130  ASP A O     1 
ATOM   963   C  CB    . ASP A 1  130  ? -26.019 42.618  7.192   1.00 59.69  ? 130  ASP A CB    1 
ATOM   964   C  CG    . ASP A 1  130  ? -26.216 44.113  7.250   1.00 55.07  ? 130  ASP A CG    1 
ATOM   965   O  OD1   . ASP A 1  130  ? -25.295 44.849  6.838   1.00 58.06  ? 130  ASP A OD1   1 
ATOM   966   O  OD2   . ASP A 1  130  ? -27.295 44.548  7.706   1.00 56.84  ? 130  ASP A OD2   1 
ATOM   967   N  N     . LYS A 1  131  ? -22.905 43.343  6.593   1.00 53.87  ? 131  LYS A N     1 
ATOM   968   C  CA    . LYS A 1  131  ? -21.516 43.533  7.031   1.00 60.87  ? 131  LYS A CA    1 
ATOM   969   C  C     . LYS A 1  131  ? -20.548 42.621  6.260   1.00 56.78  ? 131  LYS A C     1 
ATOM   970   O  O     . LYS A 1  131  ? -19.367 42.507  6.599   1.00 50.15  ? 131  LYS A O     1 
ATOM   971   C  CB    . LYS A 1  131  ? -21.395 43.339  8.559   1.00 62.23  ? 131  LYS A CB    1 
ATOM   972   C  CG    . LYS A 1  131  ? -20.919 41.974  9.061   1.00 58.61  ? 131  LYS A CG    1 
ATOM   973   C  CD    . LYS A 1  131  ? -21.291 41.770  10.522  1.00 61.15  ? 131  LYS A CD    1 
ATOM   974   C  CE    . LYS A 1  131  ? -22.805 41.746  10.697  1.00 61.68  ? 131  LYS A CE    1 
ATOM   975   N  NZ    . LYS A 1  131  ? -23.214 41.543  12.115  1.00 63.26  ? 131  LYS A NZ    1 
ATOM   976   N  N     . GLY A 1  132  ? -21.047 42.016  5.186   1.00 53.90  ? 132  GLY A N     1 
ATOM   977   C  CA    . GLY A 1  132  ? -20.236 41.169  4.330   1.00 50.09  ? 132  GLY A CA    1 
ATOM   978   C  C     . GLY A 1  132  ? -19.590 41.916  3.175   1.00 50.03  ? 132  GLY A C     1 
ATOM   979   O  O     . GLY A 1  132  ? -20.258 42.607  2.407   1.00 52.71  ? 132  GLY A O     1 
ATOM   980   N  N     . LYS A 1  133  ? -18.276 41.774  3.059   1.00 49.42  ? 133  LYS A N     1 
ATOM   981   C  CA    . LYS A 1  133  ? -17.518 42.385  1.975   1.00 49.44  ? 133  LYS A CA    1 
ATOM   982   C  C     . LYS A 1  133  ? -16.647 41.327  1.317   1.00 50.97  ? 133  LYS A C     1 
ATOM   983   O  O     . LYS A 1  133  ? -16.038 40.506  2.004   1.00 54.73  ? 133  LYS A O     1 
ATOM   984   C  CB    . LYS A 1  133  ? -16.654 43.540  2.494   1.00 54.19  ? 133  LYS A CB    1 
ATOM   985   C  CG    . LYS A 1  133  ? -15.645 44.071  1.486   1.00 53.35  ? 133  LYS A CG    1 
ATOM   986   C  CD    . LYS A 1  133  ? -14.715 45.091  2.120   1.00 48.66  ? 133  LYS A CD    1 
ATOM   987   C  CE    . LYS A 1  133  ? -13.523 45.384  1.224   1.00 51.10  ? 133  LYS A CE    1 
ATOM   988   N  NZ    . LYS A 1  133  ? -13.932 45.938  -0.094  1.00 61.81  ? 133  LYS A NZ    1 
ATOM   989   N  N     . LEU A 1  134  ? -16.587 41.340  -0.010  1.00 49.43  ? 134  LEU A N     1 
ATOM   990   C  CA    . LEU A 1  134  ? -15.818 40.337  -0.734  1.00 47.81  ? 134  LEU A CA    1 
ATOM   991   C  C     . LEU A 1  134  ? -15.036 40.947  -1.891  1.00 49.02  ? 134  LEU A C     1 
ATOM   992   O  O     . LEU A 1  134  ? -15.616 41.368  -2.889  1.00 53.35  ? 134  LEU A O     1 
ATOM   993   C  CB    . LEU A 1  134  ? -16.745 39.237  -1.251  1.00 44.53  ? 134  LEU A CB    1 
ATOM   994   C  CG    . LEU A 1  134  ? -16.062 37.994  -1.814  1.00 44.09  ? 134  LEU A CG    1 
ATOM   995   C  CD1   . LEU A 1  134  ? -15.122 37.403  -0.781  1.00 42.80  ? 134  LEU A CD1   1 
ATOM   996   C  CD2   . LEU A 1  134  ? -17.096 36.968  -2.250  1.00 43.89  ? 134  LEU A CD2   1 
ATOM   997   N  N     . GLU A 1  135  ? -13.716 40.987  -1.751  1.00 47.07  ? 135  GLU A N     1 
ATOM   998   C  CA    . GLU A 1  135  ? -12.856 41.546  -2.785  1.00 50.71  ? 135  GLU A CA    1 
ATOM   999   C  C     . GLU A 1  135  ? -11.995 40.449  -3.411  1.00 51.20  ? 135  GLU A C     1 
ATOM   1000  O  O     . GLU A 1  135  ? -11.065 39.951  -2.777  1.00 53.79  ? 135  GLU A O     1 
ATOM   1001  C  CB    . GLU A 1  135  ? -11.988 42.656  -2.193  1.00 56.44  ? 135  GLU A CB    1 
ATOM   1002  C  CG    . GLU A 1  135  ? -10.937 43.222  -3.127  1.00 69.75  ? 135  GLU A CG    1 
ATOM   1003  C  CD    . GLU A 1  135  ? -10.090 44.296  -2.457  1.00 84.49  ? 135  GLU A CD    1 
ATOM   1004  O  OE1   . GLU A 1  135  ? -8.902  44.434  -2.821  1.00 92.77  ? 135  GLU A OE1   1 
ATOM   1005  O  OE2   . GLU A 1  135  ? -10.614 45.004  -1.567  1.00 81.95  ? 135  GLU A OE2   1 
ATOM   1006  N  N     . VAL A 1  136  ? -12.313 40.069  -4.649  1.00 50.24  ? 136  VAL A N     1 
ATOM   1007  C  CA    . VAL A 1  136  ? -11.642 38.947  -5.312  1.00 47.36  ? 136  VAL A CA    1 
ATOM   1008  C  C     . VAL A 1  136  ? -10.927 39.344  -6.604  1.00 48.05  ? 136  VAL A C     1 
ATOM   1009  O  O     . VAL A 1  136  ? -11.288 40.328  -7.247  1.00 54.49  ? 136  VAL A O     1 
ATOM   1010  C  CB    . VAL A 1  136  ? -12.632 37.820  -5.647  1.00 46.44  ? 136  VAL A CB    1 
ATOM   1011  C  CG1   . VAL A 1  136  ? -11.907 36.487  -5.697  1.00 45.93  ? 136  VAL A CG1   1 
ATOM   1012  C  CG2   . VAL A 1  136  ? -13.742 37.770  -4.619  1.00 50.60  ? 136  VAL A CG2   1 
ATOM   1013  N  N     . GLU A 1  137  ? -9.926  38.552  -6.983  1.00 43.91  ? 137  GLU A N     1 
ATOM   1014  C  CA    . GLU A 1  137  ? -9.046  38.849  -8.110  1.00 44.82  ? 137  GLU A CA    1 
ATOM   1015  C  C     . GLU A 1  137  ? -8.719  37.569  -8.870  1.00 43.33  ? 137  GLU A C     1 
ATOM   1016  O  O     . GLU A 1  137  ? -7.948  36.746  -8.385  1.00 47.96  ? 137  GLU A O     1 
ATOM   1017  C  CB    . GLU A 1  137  ? -7.762  39.519  -7.604  1.00 47.88  ? 137  GLU A CB    1 
ATOM   1018  C  CG    . GLU A 1  137  ? -6.584  39.519  -8.575  1.00 50.08  ? 137  GLU A CG    1 
ATOM   1019  C  CD    . GLU A 1  137  ? -5.282  39.912  -7.894  1.00 53.50  ? 137  GLU A CD    1 
ATOM   1020  O  OE1   . GLU A 1  137  ? -5.287  40.908  -7.139  1.00 59.86  ? 137  GLU A OE1   1 
ATOM   1021  O  OE2   . GLU A 1  137  ? -4.260  39.220  -8.101  1.00 49.27  ? 137  GLU A OE2   1 
ATOM   1022  N  N     . LEU A 1  138  ? -9.296  37.399  -10.058 1.00 43.17  ? 138  LEU A N     1 
ATOM   1023  C  CA    . LEU A 1  138  ? -9.152  36.144  -10.802 1.00 44.22  ? 138  LEU A CA    1 
ATOM   1024  C  C     . LEU A 1  138  ? -8.250  36.260  -12.028 1.00 49.78  ? 138  LEU A C     1 
ATOM   1025  O  O     . LEU A 1  138  ? -8.376  37.191  -12.824 1.00 56.34  ? 138  LEU A O     1 
ATOM   1026  C  CB    . LEU A 1  138  ? -10.517 35.618  -11.249 1.00 40.49  ? 138  LEU A CB    1 
ATOM   1027  C  CG    . LEU A 1  138  ? -11.534 35.192  -10.190 1.00 40.40  ? 138  LEU A CG    1 
ATOM   1028  C  CD1   . LEU A 1  138  ? -12.205 36.394  -9.544  1.00 42.55  ? 138  LEU A CD1   1 
ATOM   1029  C  CD2   . LEU A 1  138  ? -12.572 34.261  -10.799 1.00 41.45  ? 138  LEU A CD2   1 
ATOM   1030  N  N     . VAL A 1  139  ? -7.348  35.298  -12.181 1.00 46.26  ? 139  VAL A N     1 
ATOM   1031  C  CA    . VAL A 1  139  ? -6.477  35.249  -13.345 1.00 45.29  ? 139  VAL A CA    1 
ATOM   1032  C  C     . VAL A 1  139  ? -7.019  34.214  -14.320 1.00 49.75  ? 139  VAL A C     1 
ATOM   1033  O  O     . VAL A 1  139  ? -7.427  33.128  -13.913 1.00 54.27  ? 139  VAL A O     1 
ATOM   1034  C  CB    . VAL A 1  139  ? -5.024  34.921  -12.949 1.00 44.18  ? 139  VAL A CB    1 
ATOM   1035  C  CG1   . VAL A 1  139  ? -4.164  34.653  -14.179 1.00 46.69  ? 139  VAL A CG1   1 
ATOM   1036  C  CG2   . VAL A 1  139  ? -4.440  36.057  -12.122 1.00 46.81  ? 139  VAL A CG2   1 
ATOM   1037  N  N     . VAL A 1  140  ? -7.052  34.566  -15.603 1.00 53.33  ? 140  VAL A N     1 
ATOM   1038  C  CA    . VAL A 1  140  ? -7.562  33.660  -16.627 1.00 54.39  ? 140  VAL A CA    1 
ATOM   1039  C  C     . VAL A 1  140  ? -6.556  33.482  -17.761 1.00 55.47  ? 140  VAL A C     1 
ATOM   1040  O  O     . VAL A 1  140  ? -6.120  34.452  -18.385 1.00 56.50  ? 140  VAL A O     1 
ATOM   1041  C  CB    . VAL A 1  140  ? -8.904  34.158  -17.209 1.00 52.31  ? 140  VAL A CB    1 
ATOM   1042  C  CG1   . VAL A 1  140  ? -9.414  33.192  -18.266 1.00 56.42  ? 140  VAL A CG1   1 
ATOM   1043  C  CG2   . VAL A 1  140  ? -9.934  34.314  -16.104 1.00 49.66  ? 140  VAL A CG2   1 
ATOM   1044  N  N     . GLU A 1  141  ? -6.189  32.232  -18.017 1.00 55.32  ? 141  GLU A N     1 
ATOM   1045  C  CA    . GLU A 1  141  ? -5.275  31.908  -19.102 1.00 59.60  ? 141  GLU A CA    1 
ATOM   1046  C  C     . GLU A 1  141  ? -5.955  31.056  -20.167 1.00 57.74  ? 141  GLU A C     1 
ATOM   1047  O  O     . GLU A 1  141  ? -7.100  30.630  -20.004 1.00 52.43  ? 141  GLU A O     1 
ATOM   1048  C  CB    . GLU A 1  141  ? -4.044  31.172  -18.568 1.00 64.00  ? 141  GLU A CB    1 
ATOM   1049  C  CG    . GLU A 1  141  ? -3.255  31.939  -17.521 1.00 65.53  ? 141  GLU A CG    1 
ATOM   1050  C  CD    . GLU A 1  141  ? -2.021  31.181  -17.052 1.00 71.76  ? 141  GLU A CD    1 
ATOM   1051  O  OE1   . GLU A 1  141  ? -1.541  30.300  -17.798 1.00 69.65  ? 141  GLU A OE1   1 
ATOM   1052  O  OE2   . GLU A 1  141  ? -1.538  31.463  -15.934 1.00 73.07  ? 141  GLU A OE2   1 
ATOM   1053  N  N     . ARG A 1  142  ? -5.237  30.814  -21.259 1.00 57.61  ? 142  ARG A N     1 
ATOM   1054  C  CA    . ARG A 1  142  ? -5.695  29.898  -22.294 1.00 57.08  ? 142  ARG A CA    1 
ATOM   1055  C  C     . ARG A 1  142  ? -4.968  28.559  -22.177 1.00 59.57  ? 142  ARG A C     1 
ATOM   1056  O  O     . ARG A 1  142  ? -3.816  28.501  -21.733 1.00 57.50  ? 142  ARG A O     1 
ATOM   1057  C  CB    . ARG A 1  142  ? -5.483  30.498  -23.688 1.00 61.21  ? 142  ARG A CB    1 
ATOM   1058  C  CG    . ARG A 1  142  ? -6.338  31.719  -23.992 1.00 58.70  ? 142  ARG A CG    1 
ATOM   1059  C  CD    . ARG A 1  142  ? -6.186  32.147  -25.445 1.00 57.14  ? 142  ARG A CD    1 
ATOM   1060  N  NE    . ARG A 1  142  ? -6.467  31.049  -26.367 1.00 51.69  ? 142  ARG A NE    1 
ATOM   1061  C  CZ    . ARG A 1  142  ? -7.688  30.677  -26.739 1.00 55.37  ? 142  ARG A CZ    1 
ATOM   1062  N  NH1   . ARG A 1  142  ? -8.752  31.310  -26.265 1.00 63.09  ? 142  ARG A NH1   1 
ATOM   1063  N  NH2   . ARG A 1  142  ? -7.848  29.667  -27.582 1.00 52.18  ? 142  ARG A NH2   1 
ATOM   1064  N  N     . GLY A 1  143  ? -5.656  27.489  -22.573 1.00 60.82  ? 143  GLY A N     1 
ATOM   1065  C  CA    . GLY A 1  143  ? -5.105  26.142  -22.550 1.00 62.25  ? 143  GLY A CA    1 
ATOM   1066  C  C     . GLY A 1  143  ? -6.095  25.101  -23.057 1.00 62.83  ? 143  GLY A C     1 
ATOM   1067  O  O     . GLY A 1  143  ? -7.182  25.451  -23.521 1.00 61.89  ? 143  GLY A O     1 
ATOM   1068  N  N     . ARG A 1  144  ? -5.722  23.823  -22.966 1.00 65.37  ? 144  ARG A N     1 
ATOM   1069  C  CA    . ARG A 1  144  ? -6.574  22.722  -23.427 1.00 64.89  ? 144  ARG A CA    1 
ATOM   1070  C  C     . ARG A 1  144  ? -6.601  21.560  -22.433 1.00 64.07  ? 144  ARG A C     1 
ATOM   1071  O  O     . ARG A 1  144  ? -5.641  21.341  -21.693 1.00 65.26  ? 144  ARG A O     1 
ATOM   1072  C  CB    . ARG A 1  144  ? -6.103  22.211  -24.795 1.00 63.45  ? 144  ARG A CB    1 
ATOM   1073  C  CG    . ARG A 1  144  ? -4.756  21.484  -24.768 1.00 64.76  ? 144  ARG A CG    1 
ATOM   1074  C  CD    . ARG A 1  144  ? -4.311  21.058  -26.164 1.00 65.77  ? 144  ARG A CD    1 
ATOM   1075  N  NE    . ARG A 1  144  ? -3.001  20.404  -26.171 1.00 72.03  ? 144  ARG A NE    1 
ATOM   1076  C  CZ    . ARG A 1  144  ? -1.834  21.046  -26.170 1.00 80.90  ? 144  ARG A CZ    1 
ATOM   1077  N  NH1   . ARG A 1  144  ? -1.793  22.373  -26.149 1.00 83.04  ? 144  ARG A NH1   1 
ATOM   1078  N  NH2   . ARG A 1  144  ? -0.699  20.358  -26.183 1.00 81.69  ? 144  ARG A NH2   1 
ATOM   1079  N  N     . GLY A 1  145  ? -7.700  20.812  -22.426 1.00 62.70  ? 145  GLY A N     1 
ATOM   1080  C  CA    . GLY A 1  145  ? -7.815  19.639  -21.575 1.00 64.28  ? 145  GLY A CA    1 
ATOM   1081  C  C     . GLY A 1  145  ? -8.031  19.969  -20.110 1.00 60.99  ? 145  GLY A C     1 
ATOM   1082  O  O     . GLY A 1  145  ? -8.826  20.845  -19.770 1.00 62.39  ? 145  GLY A O     1 
ATOM   1083  N  N     . TYR A 1  146  ? -7.321  19.263  -19.238 1.00 55.58  ? 146  TYR A N     1 
ATOM   1084  C  CA    . TYR A 1  146  ? -7.422  19.508  -17.806 1.00 52.91  ? 146  TYR A CA    1 
ATOM   1085  C  C     . TYR A 1  146  ? -6.034  19.698  -17.199 1.00 50.93  ? 146  TYR A C     1 
ATOM   1086  O  O     . TYR A 1  146  ? -5.114  18.930  -17.472 1.00 49.75  ? 146  TYR A O     1 
ATOM   1087  C  CB    . TYR A 1  146  ? -8.172  18.360  -17.123 1.00 50.56  ? 146  TYR A CB    1 
ATOM   1088  C  CG    . TYR A 1  146  ? -7.966  18.288  -15.629 1.00 52.86  ? 146  TYR A CG    1 
ATOM   1089  C  CD1   . TYR A 1  146  ? -8.678  19.113  -14.767 1.00 53.64  ? 146  TYR A CD1   1 
ATOM   1090  C  CD2   . TYR A 1  146  ? -7.063  17.387  -15.077 1.00 54.32  ? 146  TYR A CD2   1 
ATOM   1091  C  CE1   . TYR A 1  146  ? -8.489  19.048  -13.397 1.00 52.90  ? 146  TYR A CE1   1 
ATOM   1092  C  CE2   . TYR A 1  146  ? -6.867  17.316  -13.711 1.00 55.15  ? 146  TYR A CE2   1 
ATOM   1093  C  CZ    . TYR A 1  146  ? -7.583  18.148  -12.874 1.00 52.15  ? 146  TYR A CZ    1 
ATOM   1094  O  OH    . TYR A 1  146  ? -7.391  18.080  -11.514 1.00 48.10  ? 146  TYR A OH    1 
ATOM   1095  N  N     . VAL A 1  147  ? -5.877  20.742  -16.394 1.00 50.47  ? 147  VAL A N     1 
ATOM   1096  C  CA    . VAL A 1  147  ? -4.599  21.008  -15.748 1.00 53.14  ? 147  VAL A CA    1 
ATOM   1097  C  C     . VAL A 1  147  ? -4.805  21.336  -14.275 1.00 58.76  ? 147  VAL A C     1 
ATOM   1098  O  O     . VAL A 1  147  ? -5.533  22.274  -13.944 1.00 60.50  ? 147  VAL A O     1 
ATOM   1099  C  CB    . VAL A 1  147  ? -3.848  22.160  -16.432 1.00 52.35  ? 147  VAL A CB    1 
ATOM   1100  C  CG1   . VAL A 1  147  ? -2.558  22.461  -15.687 1.00 58.01  ? 147  VAL A CG1   1 
ATOM   1101  C  CG2   . VAL A 1  147  ? -3.561  21.814  -17.887 1.00 52.18  ? 147  VAL A CG2   1 
ATOM   1102  N  N     . PRO A 1  148  ? -4.165  20.557  -13.385 1.00 62.71  ? 148  PRO A N     1 
ATOM   1103  C  CA    . PRO A 1  148  ? -4.363  20.657  -11.933 1.00 64.08  ? 148  PRO A CA    1 
ATOM   1104  C  C     . PRO A 1  148  ? -3.839  21.952  -11.324 1.00 63.90  ? 148  PRO A C     1 
ATOM   1105  O  O     . PRO A 1  148  ? -2.904  22.567  -11.842 1.00 62.64  ? 148  PRO A O     1 
ATOM   1106  C  CB    . PRO A 1  148  ? -3.580  19.455  -11.385 1.00 63.57  ? 148  PRO A CB    1 
ATOM   1107  C  CG    . PRO A 1  148  ? -3.415  18.534  -12.546 1.00 67.13  ? 148  PRO A CG    1 
ATOM   1108  C  CD    . PRO A 1  148  ? -3.277  19.437  -13.732 1.00 63.48  ? 148  PRO A CD    1 
ATOM   1109  N  N     . ALA A 1  149  ? -4.453  22.346  -10.214 1.00 62.19  ? 149  ALA A N     1 
ATOM   1110  C  CA    . ALA A 1  149  ? -4.071  23.545  -9.476  1.00 65.56  ? 149  ALA A CA    1 
ATOM   1111  C  C     . ALA A 1  149  ? -2.636  23.482  -8.992  1.00 74.78  ? 149  ALA A C     1 
ATOM   1112  O  O     . ALA A 1  149  ? -1.842  24.406  -9.208  1.00 69.86  ? 149  ALA A O     1 
ATOM   1113  C  CB    . ALA A 1  149  ? -4.987  23.733  -8.291  1.00 67.12  ? 149  ALA A CB    1 
ATOM   1114  N  N     . VAL A 1  150  ? -2.333  22.366  -8.334  1.00 78.07  ? 150  VAL A N     1 
ATOM   1115  C  CA    . VAL A 1  150  ? -1.096  22.148  -7.594  1.00 85.76  ? 150  VAL A CA    1 
ATOM   1116  C  C     . VAL A 1  150  ? 0.173   22.592  -8.325  1.00 86.85  ? 150  VAL A C     1 
ATOM   1117  O  O     . VAL A 1  150  ? 1.201   22.862  -7.698  1.00 76.41  ? 150  VAL A O     1 
ATOM   1118  C  CB    . VAL A 1  150  ? -0.965  20.649  -7.222  1.00 86.81  ? 150  VAL A CB    1 
ATOM   1119  C  CG1   . VAL A 1  150  ? -2.135  20.223  -6.346  1.00 73.96  ? 150  VAL A CG1   1 
ATOM   1120  C  CG2   . VAL A 1  150  ? -0.909  19.787  -8.478  1.00 82.61  ? 150  VAL A CG2   1 
ATOM   1121  N  N     . GLN A 1  151  ? 0.084   22.687  -9.649  1.00 87.71  ? 151  GLN A N     1 
ATOM   1122  C  CA    . GLN A 1  151  ? 1.224   23.028  -10.489 1.00 89.44  ? 151  GLN A CA    1 
ATOM   1123  C  C     . GLN A 1  151  ? 1.607   24.510  -10.384 1.00 84.66  ? 151  GLN A C     1 
ATOM   1124  O  O     . GLN A 1  151  ? 2.725   24.890  -10.728 1.00 98.47  ? 151  GLN A O     1 
ATOM   1125  C  CB    . GLN A 1  151  ? 0.927   22.651  -11.955 1.00 87.80  ? 151  GLN A CB    1 
ATOM   1126  C  CG    . GLN A 1  151  ? 0.437   21.208  -12.168 1.00 76.05  ? 151  GLN A CG    1 
ATOM   1127  C  CD    . GLN A 1  151  ? 0.433   20.781  -13.634 1.00 71.98  ? 151  GLN A CD    1 
ATOM   1128  O  OE1   . GLN A 1  151  ? 0.956   21.483  -14.497 1.00 87.98  ? 151  GLN A OE1   1 
ATOM   1129  N  NE2   . GLN A 1  151  ? -0.151  19.623  -13.915 1.00 61.89  ? 151  GLN A NE2   1 
ATOM   1130  N  N     . ASN A 1  152  ? 0.687   25.341  -9.905  1.00 68.82  ? 152  ASN A N     1 
ATOM   1131  C  CA    . ASN A 1  152  ? 0.916   26.786  -9.860  1.00 80.19  ? 152  ASN A CA    1 
ATOM   1132  C  C     . ASN A 1  152  ? 1.860   27.236  -8.741  1.00 82.23  ? 152  ASN A C     1 
ATOM   1133  O  O     . ASN A 1  152  ? 2.696   28.126  -8.925  1.00 82.94  ? 152  ASN A O     1 
ATOM   1134  C  CB    . ASN A 1  152  ? -0.428  27.518  -9.722  1.00 87.51  ? 152  ASN A CB    1 
ATOM   1135  C  CG    . ASN A 1  152  ? -0.282  29.035  -9.726  1.00 95.30  ? 152  ASN A CG    1 
ATOM   1136  O  OD1   . ASN A 1  152  ? 0.045   29.646  -8.704  1.00 92.97  ? 152  ASN A OD1   1 
ATOM   1137  N  ND2   . ASN A 1  152  ? -0.552  29.652  -10.875 1.00 89.94  ? 152  ASN A ND2   1 
ATOM   1138  N  N     . ARG A 1  153  ? 1.719   26.597  -7.586  1.00 74.81  ? 153  ARG A N     1 
ATOM   1139  C  CA    . ARG A 1  153  ? 2.377   27.023  -6.356  1.00 74.46  ? 153  ARG A CA    1 
ATOM   1140  C  C     . ARG A 1  153  ? 3.901   26.895  -6.389  1.00 75.75  ? 153  ARG A C     1 
ATOM   1141  O  O     . ARG A 1  153  ? 4.610   27.677  -5.756  1.00 72.20  ? 153  ARG A O     1 
ATOM   1142  C  CB    . ARG A 1  153  ? 1.793   26.222  -5.185  1.00 74.59  ? 153  ARG A CB    1 
ATOM   1143  C  CG    . ARG A 1  153  ? 2.796   25.736  -4.155  1.00 81.90  ? 153  ARG A CG    1 
ATOM   1144  C  CD    . ARG A 1  153  ? 2.277   24.481  -3.479  1.00 80.72  ? 153  ARG A CD    1 
ATOM   1145  N  NE    . ARG A 1  153  ? 0.858   24.604  -3.151  1.00 79.90  ? 153  ARG A NE    1 
ATOM   1146  C  CZ    . ARG A 1  153  ? -0.087  23.801  -3.628  1.00 75.89  ? 153  ARG A CZ    1 
ATOM   1147  N  NH1   . ARG A 1  153  ? 0.244   22.804  -4.438  1.00 75.60  ? 153  ARG A NH1   1 
ATOM   1148  N  NH2   . ARG A 1  153  ? -1.355  23.982  -3.285  1.00 64.08  ? 153  ARG A NH2   1 
ATOM   1149  N  N     . ALA A 1  154  ? 4.395   25.915  -7.138  1.00 79.35  ? 154  ALA A N     1 
ATOM   1150  C  CA    . ALA A 1  154  ? 5.829   25.632  -7.220  1.00 81.47  ? 154  ALA A CA    1 
ATOM   1151  C  C     . ALA A 1  154  ? 6.593   26.648  -8.065  1.00 84.39  ? 154  ALA A C     1 
ATOM   1152  O  O     . ALA A 1  154  ? 7.816   26.761  -7.956  1.00 89.14  ? 154  ALA A O     1 
ATOM   1153  C  CB    . ALA A 1  154  ? 6.057   24.237  -7.783  1.00 78.33  ? 154  ALA A CB    1 
ATOM   1154  N  N     . SER A 1  155  ? 5.862   27.370  -8.909  1.00 81.29  ? 155  SER A N     1 
ATOM   1155  C  CA    . SER A 1  155  ? 6.444   28.302  -9.870  1.00 78.19  ? 155  SER A CA    1 
ATOM   1156  C  C     . SER A 1  155  ? 7.230   29.420  -9.198  1.00 79.65  ? 155  SER A C     1 
ATOM   1157  O  O     . SER A 1  155  ? 8.318   29.790  -9.645  1.00 78.05  ? 155  SER A O     1 
ATOM   1158  C  CB    . SER A 1  155  ? 5.345   28.913  -10.741 1.00 72.38  ? 155  SER A CB    1 
ATOM   1159  O  OG    . SER A 1  155  ? 4.385   27.943  -11.110 1.00 67.63  ? 155  SER A OG    1 
ATOM   1160  N  N     . GLY A 1  156  ? 6.658   29.955  -8.124  1.00 78.96  ? 156  GLY A N     1 
ATOM   1161  C  CA    . GLY A 1  156  ? 7.242   31.069  -7.405  1.00 82.14  ? 156  GLY A CA    1 
ATOM   1162  C  C     . GLY A 1  156  ? 6.146   31.981  -6.897  1.00 80.92  ? 156  GLY A C     1 
ATOM   1163  O  O     . GLY A 1  156  ? 6.413   33.085  -6.420  1.00 86.37  ? 156  GLY A O     1 
ATOM   1164  N  N     . ALA A 1  157  ? 4.906   31.510  -7.003  1.00 77.88  ? 157  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  157  ? 3.745   32.298  -6.614  1.00 81.59  ? 157  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  157  ? 3.852   32.747  -5.160  1.00 83.07  ? 157  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  157  ? 4.309   31.994  -4.299  1.00 84.96  ? 157  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  157  ? 2.463   31.503  -6.840  1.00 79.04  ? 157  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  158  ? 3.454   33.984  -4.891  1.00 90.65  ? 158  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  158  ? 3.524   34.506  -3.534  1.00 85.62  ? 158  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  158  ? 2.421   33.891  -2.686  1.00 76.69  ? 158  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  158  ? 1.436   33.375  -3.212  1.00 77.51  ? 158  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  158  ? 3.425   36.029  -3.525  1.00 69.84  ? 158  GLU A CB    1 
ATOM   1174  N  N     . ILE A 1  159  ? 2.592   33.972  -1.372  1.00 65.37  ? 159  ILE A N     1 
ATOM   1175  C  CA    . ILE A 1  159  ? 1.748   33.267  -0.410  1.00 56.79  ? 159  ILE A CA    1 
ATOM   1176  C  C     . ILE A 1  159  ? 0.267   33.640  -0.481  1.00 54.07  ? 159  ILE A C     1 
ATOM   1177  O  O     . ILE A 1  159  ? -0.594  32.895  -0.005  1.00 49.90  ? 159  ILE A O     1 
ATOM   1178  C  CB    . ILE A 1  159  ? 2.263   33.521  1.015   1.00 49.96  ? 159  ILE A CB    1 
ATOM   1179  C  CG1   . ILE A 1  159  ? 3.797   33.489  1.019   1.00 50.12  ? 159  ILE A CG1   1 
ATOM   1180  C  CG2   . ILE A 1  159  ? 1.658   32.528  1.998   1.00 45.40  ? 159  ILE A CG2   1 
ATOM   1181  C  CD1   . ILE A 1  159  ? 4.409   32.815  2.227   1.00 49.27  ? 159  ILE A CD1   1 
ATOM   1182  N  N     . GLY A 1  160  ? -0.031  34.784  -1.087  1.00 57.06  ? 160  GLY A N     1 
ATOM   1183  C  CA    . GLY A 1  160  ? -1.402  35.259  -1.179  1.00 58.14  ? 160  GLY A CA    1 
ATOM   1184  C  C     . GLY A 1  160  ? -2.281  34.468  -2.133  1.00 55.92  ? 160  GLY A C     1 
ATOM   1185  O  O     . GLY A 1  160  ? -3.462  34.237  -1.856  1.00 48.81  ? 160  GLY A O     1 
ATOM   1186  N  N     . ARG A 1  161  ? -1.697  34.047  -3.253  1.00 58.08  ? 161  ARG A N     1 
ATOM   1187  C  CA    . ARG A 1  161  ? -2.445  33.405  -4.334  1.00 54.39  ? 161  ARG A CA    1 
ATOM   1188  C  C     . ARG A 1  161  ? -2.948  32.015  -3.976  1.00 42.87  ? 161  ARG A C     1 
ATOM   1189  O  O     . ARG A 1  161  ? -2.327  31.293  -3.197  1.00 40.05  ? 161  ARG A O     1 
ATOM   1190  C  CB    . ARG A 1  161  ? -1.588  33.332  -5.599  1.00 57.92  ? 161  ARG A CB    1 
ATOM   1191  C  CG    . ARG A 1  161  ? -1.243  34.696  -6.175  1.00 65.95  ? 161  ARG A CG    1 
ATOM   1192  C  CD    . ARG A 1  161  ? -0.279  34.585  -7.336  1.00 74.10  ? 161  ARG A CD    1 
ATOM   1193  N  NE    . ARG A 1  161  ? 0.819   35.538  -7.204  1.00 81.86  ? 161  ARG A NE    1 
ATOM   1194  C  CZ    . ARG A 1  161  ? 1.883   35.563  -7.999  1.00 90.30  ? 161  ARG A CZ    1 
ATOM   1195  N  NH1   . ARG A 1  161  ? 2.837   36.463  -7.805  1.00 95.02  ? 161  ARG A NH1   1 
ATOM   1196  N  NH2   . ARG A 1  161  ? 1.996   34.685  -8.987  1.00 87.43  ? 161  ARG A NH2   1 
ATOM   1197  N  N     . ILE A 1  162  ? -4.085  31.658  -4.561  1.00 39.62  ? 162  ILE A N     1 
ATOM   1198  C  CA    . ILE A 1  162  ? -4.714  30.367  -4.329  1.00 40.12  ? 162  ILE A CA    1 
ATOM   1199  C  C     . ILE A 1  162  ? -4.940  29.642  -5.650  1.00 41.67  ? 162  ILE A C     1 
ATOM   1200  O  O     . ILE A 1  162  ? -5.962  29.845  -6.301  1.00 43.13  ? 162  ILE A O     1 
ATOM   1201  C  CB    . ILE A 1  162  ? -6.068  30.510  -3.601  1.00 38.42  ? 162  ILE A CB    1 
ATOM   1202  C  CG1   . ILE A 1  162  ? -5.919  31.363  -2.337  1.00 41.54  ? 162  ILE A CG1   1 
ATOM   1203  C  CG2   . ILE A 1  162  ? -6.643  29.140  -3.271  1.00 37.30  ? 162  ILE A CG2   1 
ATOM   1204  C  CD1   . ILE A 1  162  ? -7.200  31.499  -1.534  1.00 41.39  ? 162  ILE A CD1   1 
ATOM   1205  N  N     . PRO A 1  163  ? -3.979  28.795  -6.052  1.00 42.51  ? 163  PRO A N     1 
ATOM   1206  C  CA    . PRO A 1  163  ? -4.062  28.023  -7.298  1.00 41.21  ? 163  PRO A CA    1 
ATOM   1207  C  C     . PRO A 1  163  ? -5.341  27.200  -7.407  1.00 39.63  ? 163  PRO A C     1 
ATOM   1208  O  O     . PRO A 1  163  ? -5.728  26.527  -6.453  1.00 39.90  ? 163  PRO A O     1 
ATOM   1209  C  CB    . PRO A 1  163  ? -2.834  27.107  -7.229  1.00 51.12  ? 163  PRO A CB    1 
ATOM   1210  C  CG    . PRO A 1  163  ? -2.357  27.175  -5.806  1.00 53.59  ? 163  PRO A CG    1 
ATOM   1211  C  CD    . PRO A 1  163  ? -2.716  28.542  -5.341  1.00 48.85  ? 163  PRO A CD    1 
ATOM   1212  N  N     . VAL A 1  164  ? -5.990  27.267  -8.565  1.00 40.00  ? 164  VAL A N     1 
ATOM   1213  C  CA    . VAL A 1  164  ? -7.228  26.535  -8.792  1.00 40.93  ? 164  VAL A CA    1 
ATOM   1214  C  C     . VAL A 1  164  ? -7.084  25.613  -10.000 1.00 45.26  ? 164  VAL A C     1 
ATOM   1215  O  O     . VAL A 1  164  ? -6.378  25.926  -10.960 1.00 44.40  ? 164  VAL A O     1 
ATOM   1216  C  CB    . VAL A 1  164  ? -8.421  27.493  -8.995  1.00 41.97  ? 164  VAL A CB    1 
ATOM   1217  C  CG1   . VAL A 1  164  ? -9.741  26.730  -8.964  1.00 40.35  ? 164  VAL A CG1   1 
ATOM   1218  C  CG2   . VAL A 1  164  ? -8.413  28.568  -7.921  1.00 45.21  ? 164  VAL A CG2   1 
ATOM   1219  N  N     . ASP A 1  165  ? -7.730  24.454  -9.919  1.00 50.16  ? 165  ASP A N     1 
ATOM   1220  C  CA    . ASP A 1  165  ? -7.720  23.474  -10.998 1.00 53.25  ? 165  ASP A CA    1 
ATOM   1221  C  C     . ASP A 1  165  ? -8.385  24.051  -12.238 1.00 50.04  ? 165  ASP A C     1 
ATOM   1222  O  O     . ASP A 1  165  ? -9.404  24.734  -12.143 1.00 52.88  ? 165  ASP A O     1 
ATOM   1223  C  CB    . ASP A 1  165  ? -8.439  22.190  -10.568 1.00 59.29  ? 165  ASP A CB    1 
ATOM   1224  C  CG    . ASP A 1  165  ? -7.763  21.498  -9.393  1.00 60.42  ? 165  ASP A CG    1 
ATOM   1225  O  OD1   . ASP A 1  165  ? -8.431  21.296  -8.352  1.00 56.81  ? 165  ASP A OD1   1 
ATOM   1226  O  OD2   . ASP A 1  165  ? -6.570  21.140  -9.516  1.00 58.71  ? 165  ASP A OD2   1 
ATOM   1227  N  N     . SER A 1  166  ? -7.824  23.766  -13.404 1.00 49.74  ? 166  SER A N     1 
ATOM   1228  C  CA    . SER A 1  166  ? -8.360  24.332  -14.632 1.00 50.47  ? 166  SER A CA    1 
ATOM   1229  C  C     . SER A 1  166  ? -8.971  23.274  -15.542 1.00 53.25  ? 166  SER A C     1 
ATOM   1230  O  O     . SER A 1  166  ? -8.341  22.263  -15.858 1.00 54.65  ? 166  SER A O     1 
ATOM   1231  C  CB    . SER A 1  166  ? -7.260  25.094  -15.362 1.00 54.09  ? 166  SER A CB    1 
ATOM   1232  O  OG    . SER A 1  166  ? -6.471  25.808  -14.427 1.00 54.14  ? 166  SER A OG    1 
ATOM   1233  N  N     . ILE A 1  167  ? -10.214 23.509  -15.949 1.00 53.32  ? 167  ILE A N     1 
ATOM   1234  C  CA    . ILE A 1  167  ? -10.873 22.649  -16.921 1.00 57.40  ? 167  ILE A CA    1 
ATOM   1235  C  C     . ILE A 1  167  ? -11.119 23.439  -18.197 1.00 60.67  ? 167  ILE A C     1 
ATOM   1236  O  O     . ILE A 1  167  ? -12.209 23.970  -18.417 1.00 59.77  ? 167  ILE A O     1 
ATOM   1237  C  CB    . ILE A 1  167  ? -12.203 22.093  -16.397 1.00 56.37  ? 167  ILE A CB    1 
ATOM   1238  C  CG1   . ILE A 1  167  ? -12.072 21.719  -14.919 1.00 57.29  ? 167  ILE A CG1   1 
ATOM   1239  C  CG2   . ILE A 1  167  ? -12.640 20.897  -17.236 1.00 53.93  ? 167  ILE A CG2   1 
ATOM   1240  C  CD1   . ILE A 1  167  ? -13.394 21.429  -14.245 1.00 58.12  ? 167  ILE A CD1   1 
ATOM   1241  N  N     . TYR A 1  168  ? -10.087 23.509  -19.030 1.00 60.84  ? 168  TYR A N     1 
ATOM   1242  C  CA    . TYR A 1  168  ? -10.105 24.329  -20.231 1.00 57.70  ? 168  TYR A CA    1 
ATOM   1243  C  C     . TYR A 1  168  ? -11.145 23.887  -21.258 1.00 58.86  ? 168  TYR A C     1 
ATOM   1244  O  O     . TYR A 1  168  ? -11.768 24.736  -21.901 1.00 59.06  ? 168  TYR A O     1 
ATOM   1245  C  CB    . TYR A 1  168  ? -8.724  24.329  -20.888 1.00 54.85  ? 168  TYR A CB    1 
ATOM   1246  C  CG    . TYR A 1  168  ? -7.632  24.945  -20.043 1.00 56.24  ? 168  TYR A CG    1 
ATOM   1247  C  CD1   . TYR A 1  168  ? -7.551  26.319  -19.877 1.00 58.42  ? 168  TYR A CD1   1 
ATOM   1248  C  CD2   . TYR A 1  168  ? -6.673  24.153  -19.430 1.00 58.42  ? 168  TYR A CD2   1 
ATOM   1249  C  CE1   . TYR A 1  168  ? -6.551  26.888  -19.113 1.00 59.89  ? 168  TYR A CE1   1 
ATOM   1250  C  CE2   . TYR A 1  168  ? -5.667  24.710  -18.663 1.00 57.89  ? 168  TYR A CE2   1 
ATOM   1251  C  CZ    . TYR A 1  168  ? -5.611  26.079  -18.509 1.00 56.57  ? 168  TYR A CZ    1 
ATOM   1252  O  OH    . TYR A 1  168  ? -4.614  26.645  -17.749 1.00 53.84  ? 168  TYR A OH    1 
ATOM   1253  N  N     . SER A 1  169  ? -11.325 22.572  -21.410 1.00 61.03  ? 169  SER A N     1 
ATOM   1254  C  CA    . SER A 1  169  ? -12.166 22.015  -22.475 1.00 60.46  ? 169  SER A CA    1 
ATOM   1255  C  C     . SER A 1  169  ? -13.562 22.617  -22.469 1.00 59.36  ? 169  SER A C     1 
ATOM   1256  O  O     . SER A 1  169  ? -14.310 22.474  -21.502 1.00 61.97  ? 169  SER A O     1 
ATOM   1257  C  CB    . SER A 1  169  ? -12.264 20.487  -22.367 1.00 57.96  ? 169  SER A CB    1 
ATOM   1258  O  OG    . SER A 1  169  ? -12.878 19.939  -23.522 1.00 51.15  ? 169  SER A OG    1 
ATOM   1259  N  N     . PRO A 1  170  ? -13.910 23.316  -23.556 1.00 54.17  ? 170  PRO A N     1 
ATOM   1260  C  CA    . PRO A 1  170  ? -15.200 23.989  -23.700 1.00 54.32  ? 170  PRO A CA    1 
ATOM   1261  C  C     . PRO A 1  170  ? -16.266 23.045  -24.243 1.00 55.78  ? 170  PRO A C     1 
ATOM   1262  O  O     . PRO A 1  170  ? -17.352 23.489  -24.614 1.00 58.25  ? 170  PRO A O     1 
ATOM   1263  C  CB    . PRO A 1  170  ? -14.892 25.105  -24.690 1.00 59.51  ? 170  PRO A CB    1 
ATOM   1264  C  CG    . PRO A 1  170  ? -13.820 24.533  -25.552 1.00 57.95  ? 170  PRO A CG    1 
ATOM   1265  C  CD    . PRO A 1  170  ? -13.028 23.565  -24.707 1.00 55.05  ? 170  PRO A CD    1 
ATOM   1266  N  N     . VAL A 1  171  ? -15.947 21.755  -24.278 1.00 56.49  ? 171  VAL A N     1 
ATOM   1267  C  CA    . VAL A 1  171  ? -16.857 20.734  -24.785 1.00 60.86  ? 171  VAL A CA    1 
ATOM   1268  C  C     . VAL A 1  171  ? -17.655 20.085  -23.648 1.00 58.91  ? 171  VAL A C     1 
ATOM   1269  O  O     . VAL A 1  171  ? -17.121 19.828  -22.570 1.00 59.31  ? 171  VAL A O     1 
ATOM   1270  C  CB    . VAL A 1  171  ? -16.079 19.652  -25.562 1.00 60.44  ? 171  VAL A CB    1 
ATOM   1271  C  CG1   . VAL A 1  171  ? -17.038 18.666  -26.215 1.00 59.00  ? 171  VAL A CG1   1 
ATOM   1272  C  CG2   . VAL A 1  171  ? -15.177 20.305  -26.604 1.00 57.27  ? 171  VAL A CG2   1 
ATOM   1273  N  N     . LEU A 1  172  ? -18.936 19.827  -23.885 1.00 54.80  ? 172  LEU A N     1 
ATOM   1274  C  CA    . LEU A 1  172  ? -19.783 19.269  -22.843 1.00 56.18  ? 172  LEU A CA    1 
ATOM   1275  C  C     . LEU A 1  172  ? -19.977 17.765  -23.025 1.00 56.91  ? 172  LEU A C     1 
ATOM   1276  O  O     . LEU A 1  172  ? -19.401 16.968  -22.284 1.00 55.72  ? 172  LEU A O     1 
ATOM   1277  C  CB    . LEU A 1  172  ? -21.136 19.989  -22.812 1.00 64.21  ? 172  LEU A CB    1 
ATOM   1278  C  CG    . LEU A 1  172  ? -21.946 19.959  -21.510 1.00 70.13  ? 172  LEU A CG    1 
ATOM   1279  C  CD1   . LEU A 1  172  ? -22.823 21.200  -21.406 1.00 69.61  ? 172  LEU A CD1   1 
ATOM   1280  C  CD2   . LEU A 1  172  ? -22.799 18.698  -21.397 1.00 67.94  ? 172  LEU A CD2   1 
ATOM   1281  N  N     . LYS A 1  173  ? -20.777 17.377  -24.013 1.00 60.62  ? 173  LYS A N     1 
ATOM   1282  C  CA    . LYS A 1  173  ? -21.149 15.972  -24.185 1.00 63.91  ? 173  LYS A CA    1 
ATOM   1283  C  C     . LYS A 1  173  ? -21.252 15.556  -25.652 1.00 64.31  ? 173  LYS A C     1 
ATOM   1284  O  O     . LYS A 1  173  ? -22.044 16.117  -26.414 1.00 65.83  ? 173  LYS A O     1 
ATOM   1285  C  CB    . LYS A 1  173  ? -22.477 15.696  -23.479 1.00 59.98  ? 173  LYS A CB    1 
ATOM   1286  C  CG    . LYS A 1  173  ? -22.962 14.269  -23.613 1.00 53.81  ? 173  LYS A CG    1 
ATOM   1287  C  CD    . LYS A 1  173  ? -24.267 14.085  -22.868 1.00 56.44  ? 173  LYS A CD    1 
ATOM   1288  C  CE    . LYS A 1  173  ? -24.126 14.523  -21.420 1.00 56.91  ? 173  LYS A CE    1 
ATOM   1289  N  NZ    . LYS A 1  173  ? -25.393 14.332  -20.660 1.00 62.81  ? 173  LYS A NZ    1 
ATOM   1290  N  N     . VAL A 1  174  ? -20.462 14.557  -26.035 1.00 59.95  ? 174  VAL A N     1 
ATOM   1291  C  CA    . VAL A 1  174  ? -20.373 14.146  -27.433 1.00 56.53  ? 174  VAL A CA    1 
ATOM   1292  C  C     . VAL A 1  174  ? -20.748 12.676  -27.639 1.00 52.58  ? 174  VAL A C     1 
ATOM   1293  O  O     . VAL A 1  174  ? -20.293 11.796  -26.908 1.00 49.95  ? 174  VAL A O     1 
ATOM   1294  C  CB    . VAL A 1  174  ? -18.951 14.391  -27.994 1.00 54.13  ? 174  VAL A CB    1 
ATOM   1295  C  CG1   . VAL A 1  174  ? -18.863 13.955  -29.447 1.00 54.33  ? 174  VAL A CG1   1 
ATOM   1296  C  CG2   . VAL A 1  174  ? -18.564 15.859  -27.858 1.00 56.27  ? 174  VAL A CG2   1 
ATOM   1297  N  N     . THR A 1  175  ? -21.593 12.430  -28.639 1.00 56.53  ? 175  THR A N     1 
ATOM   1298  C  CA    . THR A 1  175  ? -21.991 11.080  -29.037 1.00 57.63  ? 175  THR A CA    1 
ATOM   1299  C  C     . THR A 1  175  ? -22.132 10.982  -30.556 1.00 61.63  ? 175  THR A C     1 
ATOM   1300  O  O     . THR A 1  175  ? -21.832 11.936  -31.276 1.00 63.36  ? 175  THR A O     1 
ATOM   1301  C  CB    . THR A 1  175  ? -23.326 10.656  -28.388 1.00 54.82  ? 175  THR A CB    1 
ATOM   1302  O  OG1   . THR A 1  175  ? -23.767 9.416   -28.958 1.00 51.19  ? 175  THR A OG1   1 
ATOM   1303  C  CG2   . THR A 1  175  ? -24.392 11.709  -28.623 1.00 53.38  ? 175  THR A CG2   1 
ATOM   1304  N  N     . TYR A 1  176  ? -22.595 9.827   -31.032 1.00 59.81  ? 176  TYR A N     1 
ATOM   1305  C  CA    . TYR A 1  176  ? -22.817 9.605   -32.459 1.00 62.36  ? 176  TYR A CA    1 
ATOM   1306  C  C     . TYR A 1  176  ? -23.667 8.360   -32.717 1.00 68.21  ? 176  TYR A C     1 
ATOM   1307  O  O     . TYR A 1  176  ? -23.723 7.454   -31.884 1.00 68.41  ? 176  TYR A O     1 
ATOM   1308  C  CB    . TYR A 1  176  ? -21.479 9.486   -33.203 1.00 60.21  ? 176  TYR A CB    1 
ATOM   1309  C  CG    . TYR A 1  176  ? -20.537 8.438   -32.641 1.00 61.57  ? 176  TYR A CG    1 
ATOM   1310  C  CD1   . TYR A 1  176  ? -20.698 7.090   -32.946 1.00 65.70  ? 176  TYR A CD1   1 
ATOM   1311  C  CD2   . TYR A 1  176  ? -19.477 8.797   -31.817 1.00 60.49  ? 176  TYR A CD2   1 
ATOM   1312  C  CE1   . TYR A 1  176  ? -19.840 6.126   -32.437 1.00 61.74  ? 176  TYR A CE1   1 
ATOM   1313  C  CE2   . TYR A 1  176  ? -18.610 7.837   -31.304 1.00 60.22  ? 176  TYR A CE2   1 
ATOM   1314  C  CZ    . TYR A 1  176  ? -18.798 6.503   -31.620 1.00 58.35  ? 176  TYR A CZ    1 
ATOM   1315  O  OH    . TYR A 1  176  ? -17.949 5.541   -31.120 1.00 52.82  ? 176  TYR A OH    1 
ATOM   1316  N  N     . LYS A 1  177  ? -24.327 8.325   -33.875 1.00 72.43  ? 177  LYS A N     1 
ATOM   1317  C  CA    . LYS A 1  177  ? -25.067 7.143   -34.317 1.00 74.88  ? 177  LYS A CA    1 
ATOM   1318  C  C     . LYS A 1  177  ? -24.848 6.896   -35.811 1.00 75.24  ? 177  LYS A C     1 
ATOM   1319  O  O     . LYS A 1  177  ? -24.510 7.816   -36.560 1.00 70.54  ? 177  LYS A O     1 
ATOM   1320  C  CB    . LYS A 1  177  ? -26.565 7.276   -33.998 1.00 70.70  ? 177  LYS A CB    1 
ATOM   1321  C  CG    . LYS A 1  177  ? -27.221 8.586   -34.422 1.00 74.51  ? 177  LYS A CG    1 
ATOM   1322  C  CD    . LYS A 1  177  ? -28.658 8.666   -33.909 1.00 75.64  ? 177  LYS A CD    1 
ATOM   1323  C  CE    . LYS A 1  177  ? -29.332 9.972   -34.304 1.00 77.42  ? 177  LYS A CE    1 
ATOM   1324  N  NZ    . LYS A 1  177  ? -30.729 10.039  -33.790 1.00 72.69  ? 177  LYS A NZ    1 
ATOM   1325  N  N     . VAL A 1  178  ? -25.030 5.647   -36.235 1.00 81.38  ? 178  VAL A N     1 
ATOM   1326  C  CA    . VAL A 1  178  ? -24.701 5.238   -37.600 1.00 86.88  ? 178  VAL A CA    1 
ATOM   1327  C  C     . VAL A 1  178  ? -25.833 4.473   -38.297 1.00 87.06  ? 178  VAL A C     1 
ATOM   1328  O  O     . VAL A 1  178  ? -26.298 3.443   -37.805 1.00 79.30  ? 178  VAL A O     1 
ATOM   1329  C  CB    . VAL A 1  178  ? -23.426 4.362   -37.612 1.00 81.06  ? 178  VAL A CB    1 
ATOM   1330  C  CG1   . VAL A 1  178  ? -23.225 3.713   -38.976 1.00 89.78  ? 178  VAL A CG1   1 
ATOM   1331  C  CG2   . VAL A 1  178  ? -22.206 5.188   -37.208 1.00 71.27  ? 178  VAL A CG2   1 
ATOM   1332  N  N     . ASP A 1  179  ? -26.268 4.986   -39.447 1.00 89.58  ? 179  ASP A N     1 
ATOM   1333  C  CA    . ASP A 1  179  ? -27.270 4.314   -40.271 1.00 95.00  ? 179  ASP A CA    1 
ATOM   1334  C  C     . ASP A 1  179  ? -26.604 3.574   -41.429 1.00 100.83 ? 179  ASP A C     1 
ATOM   1335  O  O     . ASP A 1  179  ? -26.346 4.154   -42.485 1.00 102.74 ? 179  ASP A O     1 
ATOM   1336  C  CB    . ASP A 1  179  ? -28.300 5.313   -40.813 1.00 100.70 ? 179  ASP A CB    1 
ATOM   1337  C  CG    . ASP A 1  179  ? -29.343 5.706   -39.780 1.00 101.39 ? 179  ASP A CG    1 
ATOM   1338  O  OD1   . ASP A 1  179  ? -29.803 6.868   -39.808 1.00 95.06  ? 179  ASP A OD1   1 
ATOM   1339  O  OD2   . ASP A 1  179  ? -29.712 4.851   -38.946 1.00 102.85 ? 179  ASP A OD2   1 
ATOM   1340  N  N     . ALA A 1  180  ? -26.330 2.290   -41.228 1.00 103.89 ? 180  ALA A N     1 
ATOM   1341  C  CA    . ALA A 1  180  ? -25.655 1.492   -42.243 1.00 107.88 ? 180  ALA A CA    1 
ATOM   1342  C  C     . ALA A 1  180  ? -26.651 0.731   -43.111 1.00 111.27 ? 180  ALA A C     1 
ATOM   1343  O  O     . ALA A 1  180  ? -27.364 -0.147  -42.626 1.00 111.84 ? 180  ALA A O     1 
ATOM   1344  C  CB    . ALA A 1  180  ? -24.677 0.525   -41.589 1.00 107.90 ? 180  ALA A CB    1 
ATOM   1345  N  N     . THR A 1  181  ? -26.705 1.073   -44.393 1.00 110.46 ? 181  THR A N     1 
ATOM   1346  C  CA    . THR A 1  181  ? -27.528 0.320   -45.328 1.00 118.47 ? 181  THR A CA    1 
ATOM   1347  C  C     . THR A 1  181  ? -26.833 -1.000  -45.646 1.00 123.31 ? 181  THR A C     1 
ATOM   1348  O  O     . THR A 1  181  ? -25.760 -1.017  -46.245 1.00 119.92 ? 181  THR A O     1 
ATOM   1349  C  CB    . THR A 1  181  ? -27.792 1.108   -46.625 1.00 119.75 ? 181  THR A CB    1 
ATOM   1350  O  OG1   . THR A 1  181  ? -28.399 2.366   -46.303 1.00 115.85 ? 181  THR A OG1   1 
ATOM   1351  C  CG2   . THR A 1  181  ? -28.721 0.326   -47.547 1.00 120.71 ? 181  THR A CG2   1 
ATOM   1352  N  N     . ARG A 1  182  ? -27.436 -2.104  -45.221 1.00 129.62 ? 182  ARG A N     1 
ATOM   1353  C  CA    . ARG A 1  182  ? -26.834 -3.416  -45.426 1.00 133.97 ? 182  ARG A CA    1 
ATOM   1354  C  C     . ARG A 1  182  ? -27.631 -4.250  -46.424 1.00 141.50 ? 182  ARG A C     1 
ATOM   1355  O  O     . ARG A 1  182  ? -27.491 -5.471  -46.469 1.00 146.97 ? 182  ARG A O     1 
ATOM   1356  C  CB    . ARG A 1  182  ? -26.709 -4.165  -44.095 1.00 130.40 ? 182  ARG A CB    1 
ATOM   1357  C  CG    . ARG A 1  182  ? -25.300 -4.662  -43.800 1.00 124.46 ? 182  ARG A CG    1 
ATOM   1358  C  CD    . ARG A 1  182  ? -24.315 -3.499  -43.764 1.00 128.34 ? 182  ARG A CD    1 
ATOM   1359  N  NE    . ARG A 1  182  ? -22.932 -3.932  -43.586 1.00 120.39 ? 182  ARG A NE    1 
ATOM   1360  C  CZ    . ARG A 1  182  ? -21.909 -3.101  -43.403 1.00 112.46 ? 182  ARG A CZ    1 
ATOM   1361  N  NH1   . ARG A 1  182  ? -20.682 -3.581  -43.250 1.00 106.98 ? 182  ARG A NH1   1 
ATOM   1362  N  NH2   . ARG A 1  182  ? -22.114 -1.791  -43.368 1.00 111.04 ? 182  ARG A NH2   1 
ATOM   1363  N  N     . VAL A 1  183  ? -28.462 -3.586  -47.223 1.00 139.27 ? 183  VAL A N     1 
ATOM   1364  C  CA    . VAL A 1  183  ? -29.248 -4.267  -48.247 1.00 139.35 ? 183  VAL A CA    1 
ATOM   1365  C  C     . VAL A 1  183  ? -28.327 -4.922  -49.276 1.00 143.20 ? 183  VAL A C     1 
ATOM   1366  O  O     . VAL A 1  183  ? -27.415 -4.276  -49.799 1.00 137.77 ? 183  VAL A O     1 
ATOM   1367  C  CB    . VAL A 1  183  ? -30.214 -3.298  -48.961 1.00 133.55 ? 183  VAL A CB    1 
ATOM   1368  C  CG1   . VAL A 1  183  ? -31.065 -4.045  -49.981 1.00 130.63 ? 183  VAL A CG1   1 
ATOM   1369  C  CG2   . VAL A 1  183  ? -31.096 -2.585  -47.945 1.00 123.34 ? 183  VAL A CG2   1 
ATOM   1370  N  N     . GLU A 1  184  ? -28.565 -6.204  -49.551 1.00 140.72 ? 184  GLU A N     1 
ATOM   1371  C  CA    . GLU A 1  184  ? -27.717 -6.969  -50.463 1.00 137.97 ? 184  GLU A CA    1 
ATOM   1372  C  C     . GLU A 1  184  ? -27.688 -6.369  -51.861 1.00 136.43 ? 184  GLU A C     1 
ATOM   1373  O  O     . GLU A 1  184  ? -28.513 -6.699  -52.717 1.00 123.66 ? 184  GLU A O     1 
ATOM   1374  C  CB    . GLU A 1  184  ? -28.172 -8.427  -50.538 1.00 135.05 ? 184  GLU A CB    1 
ATOM   1375  C  CG    . GLU A 1  184  ? -27.629 -9.299  -49.416 1.00 133.63 ? 184  GLU A CG    1 
ATOM   1376  C  CD    . GLU A 1  184  ? -27.691 -10.779 -49.745 1.00 134.29 ? 184  GLU A CD    1 
ATOM   1377  O  OE1   . GLU A 1  184  ? -27.914 -11.119 -50.926 1.00 132.45 ? 184  GLU A OE1   1 
ATOM   1378  O  OE2   . GLU A 1  184  ? -27.515 -11.604 -48.823 1.00 133.63 ? 184  GLU A OE2   1 
ATOM   1379  N  N     . GLN A 1  185  ? -26.716 -5.489  -52.070 1.00 142.70 ? 185  GLN A N     1 
ATOM   1380  C  CA    . GLN A 1  185  ? -26.516 -4.809  -53.339 1.00 142.50 ? 185  GLN A CA    1 
ATOM   1381  C  C     . GLN A 1  185  ? -25.243 -3.975  -53.236 1.00 143.43 ? 185  GLN A C     1 
ATOM   1382  O  O     . GLN A 1  185  ? -24.540 -4.030  -52.225 1.00 137.04 ? 185  GLN A O     1 
ATOM   1383  C  CB    . GLN A 1  185  ? -27.720 -3.928  -53.680 1.00 134.90 ? 185  GLN A CB    1 
ATOM   1384  C  CG    . GLN A 1  185  ? -27.922 -3.673  -55.161 1.00 132.80 ? 185  GLN A CG    1 
ATOM   1385  C  CD    . GLN A 1  185  ? -29.074 -2.732  -55.419 1.00 131.97 ? 185  GLN A CD    1 
ATOM   1386  O  OE1   . GLN A 1  185  ? -30.010 -2.654  -54.625 1.00 137.06 ? 185  GLN A OE1   1 
ATOM   1387  N  NE2   . GLN A 1  185  ? -29.008 -2.002  -56.525 1.00 129.19 ? 185  GLN A NE2   1 
ATOM   1388  N  N     . ARG A 1  186  ? -24.950 -3.203  -54.279 1.00 143.83 ? 186  ARG A N     1 
ATOM   1389  C  CA    . ARG A 1  186  ? -23.866 -2.231  -54.234 1.00 137.73 ? 186  ARG A CA    1 
ATOM   1390  C  C     . ARG A 1  186  ? -24.395 -0.924  -53.644 1.00 136.06 ? 186  ARG A C     1 
ATOM   1391  O  O     . ARG A 1  186  ? -23.863 0.159   -53.896 1.00 130.14 ? 186  ARG A O     1 
ATOM   1392  C  CB    . ARG A 1  186  ? -23.273 -2.018  -55.630 1.00 131.64 ? 186  ARG A CB    1 
ATOM   1393  C  CG    . ARG A 1  186  ? -24.305 -1.978  -56.747 1.00 127.15 ? 186  ARG A CG    1 
ATOM   1394  C  CD    . ARG A 1  186  ? -23.707 -2.422  -58.077 1.00 120.38 ? 186  ARG A CD    1 
ATOM   1395  N  NE    . ARG A 1  186  ? -22.683 -1.503  -58.568 1.00 125.60 ? 186  ARG A NE    1 
ATOM   1396  C  CZ    . ARG A 1  186  ? -21.976 -1.696  -59.677 1.00 113.85 ? 186  ARG A CZ    1 
ATOM   1397  N  NH1   . ARG A 1  186  ? -22.178 -2.780  -60.412 1.00 106.01 ? 186  ARG A NH1   1 
ATOM   1398  N  NH2   . ARG A 1  186  ? -21.066 -0.806  -60.050 1.00 111.85 ? 186  ARG A NH2   1 
ATOM   1399  N  N     . THR A 1  187  ? -25.455 -1.058  -52.850 1.00 137.23 ? 187  THR A N     1 
ATOM   1400  C  CA    . THR A 1  187  ? -26.082 0.052   -52.146 1.00 136.39 ? 187  THR A CA    1 
ATOM   1401  C  C     . THR A 1  187  ? -25.731 0.027   -50.661 1.00 142.15 ? 187  THR A C     1 
ATOM   1402  O  O     . THR A 1  187  ? -26.419 0.641   -49.844 1.00 141.67 ? 187  THR A O     1 
ATOM   1403  C  CB    . THR A 1  187  ? -27.614 0.012   -52.289 1.00 130.31 ? 187  THR A CB    1 
ATOM   1404  O  OG1   . THR A 1  187  ? -28.107 -1.235  -51.781 1.00 126.40 ? 187  THR A OG1   1 
ATOM   1405  C  CG2   . THR A 1  187  ? -28.020 0.160   -53.746 1.00 122.50 ? 187  THR A CG2   1 
ATOM   1406  N  N     . ASP A 1  188  ? -24.664 -0.689  -50.314 1.00 144.43 ? 188  ASP A N     1 
ATOM   1407  C  CA    . ASP A 1  188  ? -24.249 -0.821  -48.919 1.00 133.52 ? 188  ASP A CA    1 
ATOM   1408  C  C     . ASP A 1  188  ? -23.268 0.279   -48.502 1.00 124.66 ? 188  ASP A C     1 
ATOM   1409  O  O     . ASP A 1  188  ? -22.152 0.362   -49.016 1.00 124.97 ? 188  ASP A O     1 
ATOM   1410  C  CB    . ASP A 1  188  ? -23.638 -2.208  -48.675 1.00 125.81 ? 188  ASP A CB    1 
ATOM   1411  C  CG    . ASP A 1  188  ? -22.598 -2.582  -49.715 1.00 127.51 ? 188  ASP A CG    1 
ATOM   1412  O  OD1   . ASP A 1  188  ? -22.578 -1.950  -50.792 1.00 134.19 ? 188  ASP A OD1   1 
ATOM   1413  O  OD2   . ASP A 1  188  ? -21.806 -3.513  -49.459 1.00 124.73 ? 188  ASP A OD2   1 
ATOM   1414  N  N     . PHE A 1  189  ? -23.698 1.126   -47.570 1.00 112.32 ? 189  PHE A N     1 
ATOM   1415  C  CA    . PHE A 1  189  ? -22.876 2.238   -47.101 1.00 109.47 ? 189  PHE A CA    1 
ATOM   1416  C  C     . PHE A 1  189  ? -23.194 2.585   -45.649 1.00 107.80 ? 189  PHE A C     1 
ATOM   1417  O  O     . PHE A 1  189  ? -24.095 2.000   -45.049 1.00 104.06 ? 189  PHE A O     1 
ATOM   1418  C  CB    . PHE A 1  189  ? -23.075 3.470   -47.993 1.00 113.76 ? 189  PHE A CB    1 
ATOM   1419  C  CG    . PHE A 1  189  ? -24.415 4.138   -47.826 1.00 114.50 ? 189  PHE A CG    1 
ATOM   1420  C  CD1   . PHE A 1  189  ? -24.531 5.320   -47.111 1.00 109.55 ? 189  PHE A CD1   1 
ATOM   1421  C  CD2   . PHE A 1  189  ? -25.557 3.587   -48.386 1.00 115.42 ? 189  PHE A CD2   1 
ATOM   1422  C  CE1   . PHE A 1  189  ? -25.758 5.939   -46.956 1.00 104.76 ? 189  PHE A CE1   1 
ATOM   1423  C  CE2   . PHE A 1  189  ? -26.786 4.201   -48.235 1.00 111.90 ? 189  PHE A CE2   1 
ATOM   1424  C  CZ    . PHE A 1  189  ? -26.887 5.378   -47.519 1.00 106.85 ? 189  PHE A CZ    1 
ATOM   1425  N  N     . ASP A 1  190  ? -22.448 3.537   -45.092 1.00 108.33 ? 190  ASP A N     1 
ATOM   1426  C  CA    . ASP A 1  190  ? -22.666 3.989   -43.718 1.00 104.96 ? 190  ASP A CA    1 
ATOM   1427  C  C     . ASP A 1  190  ? -22.860 5.511   -43.630 1.00 102.03 ? 190  ASP A C     1 
ATOM   1428  O  O     . ASP A 1  190  ? -22.057 6.280   -44.161 1.00 98.14  ? 190  ASP A O     1 
ATOM   1429  C  CB    . ASP A 1  190  ? -21.499 3.556   -42.822 1.00 98.21  ? 190  ASP A CB    1 
ATOM   1430  C  CG    . ASP A 1  190  ? -21.599 2.101   -42.389 1.00 102.10 ? 190  ASP A CG    1 
ATOM   1431  O  OD1   . ASP A 1  190  ? -21.327 1.812   -41.203 1.00 94.33  ? 190  ASP A OD1   1 
ATOM   1432  O  OD2   . ASP A 1  190  ? -21.946 1.244   -43.230 1.00 108.08 ? 190  ASP A OD2   1 
ATOM   1433  N  N     . LYS A 1  191  ? -23.935 5.928   -42.958 1.00 99.98  ? 191  LYS A N     1 
ATOM   1434  C  CA    . LYS A 1  191  ? -24.262 7.343   -42.752 1.00 93.73  ? 191  LYS A CA    1 
ATOM   1435  C  C     . LYS A 1  191  ? -24.012 7.746   -41.300 1.00 91.38  ? 191  LYS A C     1 
ATOM   1436  O  O     . LYS A 1  191  ? -24.669 7.242   -40.388 1.00 91.89  ? 191  LYS A O     1 
ATOM   1437  C  CB    . LYS A 1  191  ? -25.722 7.620   -43.136 1.00 93.74  ? 191  LYS A CB    1 
ATOM   1438  C  CG    . LYS A 1  191  ? -26.291 8.958   -42.649 1.00 92.40  ? 191  LYS A CG    1 
ATOM   1439  C  CD    . LYS A 1  191  ? -27.810 9.000   -42.832 1.00 92.93  ? 191  LYS A CD    1 
ATOM   1440  C  CE    . LYS A 1  191  ? -28.443 10.242  -42.212 1.00 84.94  ? 191  LYS A CE    1 
ATOM   1441  N  NZ    . LYS A 1  191  ? -29.934 10.170  -42.244 1.00 72.11  ? 191  LYS A NZ    1 
ATOM   1442  N  N     . LEU A 1  192  ? -23.067 8.657   -41.088 1.00 84.18  ? 192  LEU A N     1 
ATOM   1443  C  CA    . LEU A 1  192  ? -22.634 9.007   -39.739 1.00 77.54  ? 192  LEU A CA    1 
ATOM   1444  C  C     . LEU A 1  192  ? -23.280 10.284  -39.211 1.00 77.96  ? 192  LEU A C     1 
ATOM   1445  O  O     . LEU A 1  192  ? -23.187 11.339  -39.837 1.00 76.50  ? 192  LEU A O     1 
ATOM   1446  C  CB    . LEU A 1  192  ? -21.113 9.152   -39.702 1.00 71.83  ? 192  LEU A CB    1 
ATOM   1447  C  CG    . LEU A 1  192  ? -20.514 9.605   -38.371 1.00 70.16  ? 192  LEU A CG    1 
ATOM   1448  C  CD1   . LEU A 1  192  ? -20.888 8.641   -37.254 1.00 69.56  ? 192  LEU A CD1   1 
ATOM   1449  C  CD2   . LEU A 1  192  ? -19.006 9.734   -38.495 1.00 68.54  ? 192  LEU A CD2   1 
ATOM   1450  N  N     . ILE A 1  193  ? -23.926 10.180  -38.052 1.00 79.20  ? 193  ILE A N     1 
ATOM   1451  C  CA    . ILE A 1  193  ? -24.526 11.338  -37.395 1.00 77.62  ? 193  ILE A CA    1 
ATOM   1452  C  C     . ILE A 1  193  ? -23.801 11.671  -36.097 1.00 75.15  ? 193  ILE A C     1 
ATOM   1453  O  O     . ILE A 1  193  ? -24.042 11.050  -35.062 1.00 76.39  ? 193  ILE A O     1 
ATOM   1454  C  CB    . ILE A 1  193  ? -26.019 11.118  -37.077 1.00 76.33  ? 193  ILE A CB    1 
ATOM   1455  C  CG1   . ILE A 1  193  ? -26.790 10.735  -38.339 1.00 79.70  ? 193  ILE A CG1   1 
ATOM   1456  C  CG2   . ILE A 1  193  ? -26.620 12.372  -36.453 1.00 73.88  ? 193  ILE A CG2   1 
ATOM   1457  C  CD1   . ILE A 1  193  ? -28.274 10.551  -38.107 1.00 80.08  ? 193  ILE A CD1   1 
ATOM   1458  N  N     . LEU A 1  194  ? -22.913 12.655  -36.156 1.00 69.93  ? 194  LEU A N     1 
ATOM   1459  C  CA    . LEU A 1  194  ? -22.197 13.095  -34.968 1.00 66.48  ? 194  LEU A CA    1 
ATOM   1460  C  C     . LEU A 1  194  ? -23.031 14.102  -34.178 1.00 68.08  ? 194  LEU A C     1 
ATOM   1461  O  O     . LEU A 1  194  ? -23.774 14.892  -34.758 1.00 70.76  ? 194  LEU A O     1 
ATOM   1462  C  CB    . LEU A 1  194  ? -20.850 13.706  -35.352 1.00 63.59  ? 194  LEU A CB    1 
ATOM   1463  C  CG    . LEU A 1  194  ? -20.008 14.232  -34.189 1.00 61.06  ? 194  LEU A CG    1 
ATOM   1464  C  CD1   . LEU A 1  194  ? -19.580 13.089  -33.285 1.00 62.15  ? 194  LEU A CD1   1 
ATOM   1465  C  CD2   . LEU A 1  194  ? -18.806 15.010  -34.691 1.00 62.26  ? 194  LEU A CD2   1 
ATOM   1466  N  N     . ASP A 1  195  ? -22.911 14.062  -32.853 1.00 66.88  ? 195  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  195  ? -23.609 15.003  -31.983 1.00 68.28  ? 195  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  195  ? -22.619 15.726  -31.067 1.00 67.21  ? 195  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  195  ? -21.806 15.093  -30.394 1.00 67.99  ? 195  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  195  ? -24.677 14.275  -31.155 1.00 65.83  ? 195  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  195  ? -25.696 15.225  -30.538 1.00 71.04  ? 195  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  195  ? -26.904 15.023  -30.778 1.00 72.68  ? 195  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  195  ? -25.296 16.162  -29.809 1.00 68.55  ? 195  ASP A OD2   1 
ATOM   1474  N  N     . VAL A 1  196  ? -22.688 17.054  -31.048 1.00 64.48  ? 196  VAL A N     1 
ATOM   1475  C  CA    . VAL A 1  196  ? -21.793 17.852  -30.219 1.00 62.83  ? 196  VAL A CA    1 
ATOM   1476  C  C     . VAL A 1  196  ? -22.571 18.863  -29.392 1.00 65.71  ? 196  VAL A C     1 
ATOM   1477  O  O     . VAL A 1  196  ? -23.348 19.640  -29.936 1.00 74.56  ? 196  VAL A O     1 
ATOM   1478  C  CB    . VAL A 1  196  ? -20.747 18.606  -31.070 1.00 62.65  ? 196  VAL A CB    1 
ATOM   1479  C  CG1   . VAL A 1  196  ? -19.853 19.465  -30.181 1.00 63.88  ? 196  VAL A CG1   1 
ATOM   1480  C  CG2   . VAL A 1  196  ? -19.914 17.633  -31.893 1.00 63.21  ? 196  VAL A CG2   1 
ATOM   1481  N  N     . GLU A 1  197  ? -22.362 18.849  -28.080 1.00 68.35  ? 197  GLU A N     1 
ATOM   1482  C  CA    . GLU A 1  197  ? -22.924 19.875  -27.205 1.00 71.65  ? 197  GLU A CA    1 
ATOM   1483  C  C     . GLU A 1  197  ? -21.802 20.678  -26.548 1.00 68.11  ? 197  GLU A C     1 
ATOM   1484  O  O     . GLU A 1  197  ? -20.876 20.105  -25.975 1.00 69.84  ? 197  GLU A O     1 
ATOM   1485  C  CB    . GLU A 1  197  ? -23.828 19.254  -26.136 1.00 67.84  ? 197  GLU A CB    1 
ATOM   1486  C  CG    . GLU A 1  197  ? -24.535 20.282  -25.259 1.00 68.03  ? 197  GLU A CG    1 
ATOM   1487  C  CD    . GLU A 1  197  ? -25.317 19.649  -24.124 1.00 67.60  ? 197  GLU A CD    1 
ATOM   1488  O  OE1   . GLU A 1  197  ? -25.116 18.444  -23.863 1.00 64.01  ? 197  GLU A OE1   1 
ATOM   1489  O  OE2   . GLU A 1  197  ? -26.132 20.353  -23.493 1.00 69.34  ? 197  GLU A OE2   1 
ATOM   1490  N  N     . THR A 1  198  ? -21.884 22.003  -26.631 1.00 65.68  ? 198  THR A N     1 
ATOM   1491  C  CA    . THR A 1  198  ? -20.815 22.856  -26.114 1.00 69.75  ? 198  THR A CA    1 
ATOM   1492  C  C     . THR A 1  198  ? -21.190 23.579  -24.822 1.00 71.52  ? 198  THR A C     1 
ATOM   1493  O  O     . THR A 1  198  ? -22.246 23.332  -24.237 1.00 65.82  ? 198  THR A O     1 
ATOM   1494  C  CB    . THR A 1  198  ? -20.379 23.908  -27.156 1.00 72.79  ? 198  THR A CB    1 
ATOM   1495  O  OG1   . THR A 1  198  ? -21.535 24.550  -27.710 1.00 77.24  ? 198  THR A OG1   1 
ATOM   1496  C  CG2   . THR A 1  198  ? -19.577 23.254  -28.272 1.00 68.69  ? 198  THR A CG2   1 
ATOM   1497  N  N     . LYS A 1  199  ? -20.308 24.479  -24.394 1.00 66.55  ? 199  LYS A N     1 
ATOM   1498  C  CA    . LYS A 1  199  ? -20.447 25.166  -23.115 1.00 66.55  ? 199  LYS A CA    1 
ATOM   1499  C  C     . LYS A 1  199  ? -20.878 26.627  -23.258 1.00 69.00  ? 199  LYS A C     1 
ATOM   1500  O  O     . LYS A 1  199  ? -20.693 27.424  -22.335 1.00 70.94  ? 199  LYS A O     1 
ATOM   1501  C  CB    . LYS A 1  199  ? -19.124 25.108  -22.343 1.00 62.16  ? 199  LYS A CB    1 
ATOM   1502  C  CG    . LYS A 1  199  ? -18.748 23.743  -21.783 1.00 55.33  ? 199  LYS A CG    1 
ATOM   1503  C  CD    . LYS A 1  199  ? -17.537 23.884  -20.868 1.00 49.56  ? 199  LYS A CD    1 
ATOM   1504  C  CE    . LYS A 1  199  ? -17.316 22.664  -19.995 1.00 44.76  ? 199  LYS A CE    1 
ATOM   1505  N  NZ    . LYS A 1  199  ? -16.237 22.923  -19.001 1.00 41.41  ? 199  LYS A NZ    1 
ATOM   1506  N  N     . ASN A 1  200  ? -21.446 26.972  -24.413 1.00 75.15  ? 200  ASN A N     1 
ATOM   1507  C  CA    . ASN A 1  200  ? -21.763 28.361  -24.769 1.00 75.99  ? 200  ASN A CA    1 
ATOM   1508  C  C     . ASN A 1  200  ? -20.531 29.262  -24.701 1.00 67.99  ? 200  ASN A C     1 
ATOM   1509  O  O     . ASN A 1  200  ? -20.647 30.487  -24.628 1.00 62.54  ? 200  ASN A O     1 
ATOM   1510  C  CB    . ASN A 1  200  ? -22.878 28.928  -23.877 1.00 74.62  ? 200  ASN A CB    1 
ATOM   1511  C  CG    . ASN A 1  200  ? -24.272 28.601  -24.397 1.00 73.78  ? 200  ASN A CG    1 
ATOM   1512  O  OD1   . ASN A 1  200  ? -24.440 28.194  -25.547 1.00 78.38  ? 200  ASN A OD1   1 
ATOM   1513  N  ND2   . ASN A 1  200  ? -25.280 28.790  -23.551 1.00 63.06  ? 200  ASN A ND2   1 
ATOM   1514  N  N     . SER A 1  201  ? -19.355 28.643  -24.723 1.00 66.20  ? 201  SER A N     1 
ATOM   1515  C  CA    . SER A 1  201  ? -18.096 29.369  -24.778 1.00 71.66  ? 201  SER A CA    1 
ATOM   1516  C  C     . SER A 1  201  ? -17.652 29.456  -26.229 1.00 75.12  ? 201  SER A C     1 
ATOM   1517  O  O     . SER A 1  201  ? -17.191 30.502  -26.688 1.00 77.73  ? 201  SER A O     1 
ATOM   1518  C  CB    . SER A 1  201  ? -17.025 28.687  -23.924 1.00 73.99  ? 201  SER A CB    1 
ATOM   1519  O  OG    . SER A 1  201  ? -15.809 29.418  -23.943 1.00 75.01  ? 201  SER A OG    1 
ATOM   1520  N  N     . ILE A 1  202  ? -17.786 28.341  -26.942 1.00 71.77  ? 202  ILE A N     1 
ATOM   1521  C  CA    . ILE A 1  202  ? -17.601 28.326  -28.389 1.00 73.37  ? 202  ILE A CA    1 
ATOM   1522  C  C     . ILE A 1  202  ? -18.746 27.562  -29.046 1.00 73.26  ? 202  ILE A C     1 
ATOM   1523  O  O     . ILE A 1  202  ? -19.467 26.814  -28.384 1.00 71.89  ? 202  ILE A O     1 
ATOM   1524  C  CB    . ILE A 1  202  ? -16.257 27.687  -28.812 1.00 70.22  ? 202  ILE A CB    1 
ATOM   1525  C  CG1   . ILE A 1  202  ? -16.247 26.193  -28.491 1.00 70.53  ? 202  ILE A CG1   1 
ATOM   1526  C  CG2   . ILE A 1  202  ? -15.075 28.397  -28.162 1.00 65.49  ? 202  ILE A CG2   1 
ATOM   1527  C  CD1   . ILE A 1  202  ? -15.007 25.491  -28.979 1.00 71.09  ? 202  ILE A CD1   1 
ATOM   1528  N  N     . SER A 1  203  ? -18.907 27.763  -30.350 1.00 73.84  ? 203  SER A N     1 
ATOM   1529  C  CA    . SER A 1  203  ? -19.950 27.093  -31.118 1.00 74.35  ? 203  SER A CA    1 
ATOM   1530  C  C     . SER A 1  203  ? -19.607 25.623  -31.323 1.00 76.26  ? 203  SER A C     1 
ATOM   1531  O  O     . SER A 1  203  ? -18.429 25.266  -31.375 1.00 75.87  ? 203  SER A O     1 
ATOM   1532  C  CB    . SER A 1  203  ? -20.141 27.790  -32.468 1.00 76.34  ? 203  SER A CB    1 
ATOM   1533  O  OG    . SER A 1  203  ? -21.018 27.063  -33.313 1.00 77.59  ? 203  SER A OG    1 
ATOM   1534  N  N     . PRO A 1  204  ? -20.636 24.762  -31.426 1.00 77.88  ? 204  PRO A N     1 
ATOM   1535  C  CA    . PRO A 1  204  ? -20.425 23.343  -31.732 1.00 76.02  ? 204  PRO A CA    1 
ATOM   1536  C  C     . PRO A 1  204  ? -19.619 23.150  -33.013 1.00 77.60  ? 204  PRO A C     1 
ATOM   1537  O  O     . PRO A 1  204  ? -18.771 22.258  -33.075 1.00 74.60  ? 204  PRO A O     1 
ATOM   1538  C  CB    . PRO A 1  204  ? -21.848 22.803  -31.893 1.00 71.75  ? 204  PRO A CB    1 
ATOM   1539  C  CG    . PRO A 1  204  ? -22.678 23.693  -31.058 1.00 73.71  ? 204  PRO A CG    1 
ATOM   1540  C  CD    . PRO A 1  204  ? -22.057 25.057  -31.165 1.00 78.61  ? 204  PRO A CD    1 
ATOM   1541  N  N     . ARG A 1  205  ? -19.879 23.987  -34.013 1.00 82.91  ? 205  ARG A N     1 
ATOM   1542  C  CA    . ARG A 1  205  ? -19.126 23.955  -35.263 1.00 83.44  ? 205  ARG A CA    1 
ATOM   1543  C  C     . ARG A 1  205  ? -17.656 24.281  -35.042 1.00 81.56  ? 205  ARG A C     1 
ATOM   1544  O  O     . ARG A 1  205  ? -16.779 23.541  -35.484 1.00 82.92  ? 205  ARG A O     1 
ATOM   1545  C  CB    . ARG A 1  205  ? -19.716 24.935  -36.274 1.00 83.38  ? 205  ARG A CB    1 
ATOM   1546  C  CG    . ARG A 1  205  ? -21.088 24.557  -36.769 1.00 79.87  ? 205  ARG A CG    1 
ATOM   1547  C  CD    . ARG A 1  205  ? -21.658 25.663  -37.616 1.00 85.11  ? 205  ARG A CD    1 
ATOM   1548  N  NE    . ARG A 1  205  ? -22.625 25.154  -38.578 1.00 94.64  ? 205  ARG A NE    1 
ATOM   1549  C  CZ    . ARG A 1  205  ? -22.727 25.598  -39.825 1.00 105.31 ? 205  ARG A CZ    1 
ATOM   1550  N  NH1   . ARG A 1  205  ? -21.919 26.560  -40.250 1.00 104.61 ? 205  ARG A NH1   1 
ATOM   1551  N  NH2   . ARG A 1  205  ? -23.632 25.082  -40.645 1.00 109.11 ? 205  ARG A NH2   1 
ATOM   1552  N  N     . ASP A 1  206  ? -17.396 25.395  -34.363 1.00 82.10  ? 206  ASP A N     1 
ATOM   1553  C  CA    . ASP A 1  206  ? -16.028 25.842  -34.115 1.00 84.31  ? 206  ASP A CA    1 
ATOM   1554  C  C     . ASP A 1  206  ? -15.231 24.793  -33.351 1.00 85.72  ? 206  ASP A C     1 
ATOM   1555  O  O     . ASP A 1  206  ? -14.016 24.687  -33.519 1.00 91.68  ? 206  ASP A O     1 
ATOM   1556  C  CB    . ASP A 1  206  ? -16.021 27.160  -33.343 1.00 86.38  ? 206  ASP A CB    1 
ATOM   1557  C  CG    . ASP A 1  206  ? -16.677 28.289  -34.112 1.00 93.71  ? 206  ASP A CG    1 
ATOM   1558  O  OD1   . ASP A 1  206  ? -16.519 28.339  -35.354 1.00 93.95  ? 206  ASP A OD1   1 
ATOM   1559  O  OD2   . ASP A 1  206  ? -17.355 29.123  -33.471 1.00 98.35  ? 206  ASP A OD2   1 
ATOM   1560  N  N     . ALA A 1  207  ? -15.924 24.027  -32.512 1.00 81.15  ? 207  ALA A N     1 
ATOM   1561  C  CA    . ALA A 1  207  ? -15.310 22.936  -31.760 1.00 80.32  ? 207  ALA A CA    1 
ATOM   1562  C  C     . ALA A 1  207  ? -14.855 21.834  -32.704 1.00 78.13  ? 207  ALA A C     1 
ATOM   1563  O  O     . ALA A 1  207  ? -13.724 21.353  -32.628 1.00 70.93  ? 207  ALA A O     1 
ATOM   1564  C  CB    . ALA A 1  207  ? -16.288 22.383  -30.730 1.00 78.60  ? 207  ALA A CB    1 
ATOM   1565  N  N     . LEU A 1  208  ? -15.757 21.445  -33.597 1.00 78.60  ? 208  LEU A N     1 
ATOM   1566  C  CA    . LEU A 1  208  ? -15.470 20.434  -34.602 1.00 76.51  ? 208  LEU A CA    1 
ATOM   1567  C  C     . LEU A 1  208  ? -14.435 20.938  -35.599 1.00 75.25  ? 208  LEU A C     1 
ATOM   1568  O  O     . LEU A 1  208  ? -13.689 20.155  -36.187 1.00 75.02  ? 208  LEU A O     1 
ATOM   1569  C  CB    . LEU A 1  208  ? -16.751 20.035  -35.330 1.00 68.89  ? 208  LEU A CB    1 
ATOM   1570  C  CG    . LEU A 1  208  ? -16.620 18.832  -36.254 1.00 59.93  ? 208  LEU A CG    1 
ATOM   1571  C  CD1   . LEU A 1  208  ? -16.245 17.608  -35.439 1.00 52.21  ? 208  LEU A CD1   1 
ATOM   1572  C  CD2   . LEU A 1  208  ? -17.916 18.618  -37.000 1.00 62.25  ? 208  LEU A CD2   1 
ATOM   1573  N  N     . ALA A 1  209  ? -14.402 22.252  -35.788 1.00 75.66  ? 209  ALA A N     1 
ATOM   1574  C  CA    . ALA A 1  209  ? -13.446 22.871  -36.693 1.00 81.50  ? 209  ALA A CA    1 
ATOM   1575  C  C     . ALA A 1  209  ? -12.030 22.712  -36.160 1.00 86.48  ? 209  ALA A C     1 
ATOM   1576  O  O     . ALA A 1  209  ? -11.119 22.343  -36.901 1.00 92.93  ? 209  ALA A O     1 
ATOM   1577  C  CB    . ALA A 1  209  ? -13.777 24.339  -36.900 1.00 86.42  ? 209  ALA A CB    1 
ATOM   1578  N  N     . SER A 1  210  ? -11.848 22.989  -34.872 1.00 87.68  ? 210  SER A N     1 
ATOM   1579  C  CA    . SER A 1  210  ? -10.535 22.860  -34.246 1.00 89.49  ? 210  SER A CA    1 
ATOM   1580  C  C     . SER A 1  210  ? -10.179 21.388  -34.089 1.00 84.78  ? 210  SER A C     1 
ATOM   1581  O  O     . SER A 1  210  ? -9.003  21.030  -33.997 1.00 84.40  ? 210  SER A O     1 
ATOM   1582  C  CB    . SER A 1  210  ? -10.498 23.567  -32.888 1.00 85.16  ? 210  SER A CB    1 
ATOM   1583  O  OG    . SER A 1  210  ? -9.169  23.672  -32.402 1.00 78.60  ? 210  SER A OG    1 
ATOM   1584  N  N     . ALA A 1  211  ? -11.203 20.540  -34.062 1.00 80.03  ? 211  ALA A N     1 
ATOM   1585  C  CA    . ALA A 1  211  ? -11.006 19.098  -34.022 1.00 80.55  ? 211  ALA A CA    1 
ATOM   1586  C  C     . ALA A 1  211  ? -10.389 18.626  -35.330 1.00 79.90  ? 211  ALA A C     1 
ATOM   1587  O  O     . ALA A 1  211  ? -9.490  17.789  -35.339 1.00 81.03  ? 211  ALA A O     1 
ATOM   1588  C  CB    . ALA A 1  211  ? -12.325 18.380  -33.760 1.00 78.12  ? 211  ALA A CB    1 
ATOM   1589  N  N     . GLY A 1  212  ? -10.874 19.180  -36.435 1.00 81.61  ? 212  GLY A N     1 
ATOM   1590  C  CA    . GLY A 1  212  ? -10.364 18.835  -37.748 1.00 85.59  ? 212  GLY A CA    1 
ATOM   1591  C  C     . GLY A 1  212  ? -8.964  19.361  -37.999 1.00 87.02  ? 212  GLY A C     1 
ATOM   1592  O  O     . GLY A 1  212  ? -8.149  18.685  -38.624 1.00 86.73  ? 212  GLY A O     1 
ATOM   1593  N  N     . LYS A 1  213  ? -8.684  20.569  -37.516 1.00 89.71  ? 213  LYS A N     1 
ATOM   1594  C  CA    . LYS A 1  213  ? -7.375  21.194  -37.705 1.00 96.12  ? 213  LYS A CA    1 
ATOM   1595  C  C     . LYS A 1  213  ? -6.283  20.380  -37.008 1.00 94.82  ? 213  LYS A C     1 
ATOM   1596  O  O     . LYS A 1  213  ? -5.168  20.240  -37.519 1.00 92.04  ? 213  LYS A O     1 
ATOM   1597  C  CB    . LYS A 1  213  ? -7.391  22.640  -37.187 1.00 95.99  ? 213  LYS A CB    1 
ATOM   1598  C  CG    . LYS A 1  213  ? -6.034  23.348  -37.177 1.00 100.65 ? 213  LYS A CG    1 
ATOM   1599  C  CD    . LYS A 1  213  ? -5.449  23.502  -38.575 1.00 99.26  ? 213  LYS A CD    1 
ATOM   1600  C  CE    . LYS A 1  213  ? -4.059  24.130  -38.537 1.00 87.99  ? 213  LYS A CE    1 
ATOM   1601  N  NZ    . LYS A 1  213  ? -4.076  25.498  -37.948 1.00 90.26  ? 213  LYS A NZ    1 
ATOM   1602  N  N     . THR A 1  214  ? -6.625  19.832  -35.845 1.00 94.79  ? 214  THR A N     1 
ATOM   1603  C  CA    . THR A 1  214  ? -5.713  18.994  -35.074 1.00 93.81  ? 214  THR A CA    1 
ATOM   1604  C  C     . THR A 1  214  ? -5.423  17.671  -35.782 1.00 89.05  ? 214  THR A C     1 
ATOM   1605  O  O     . THR A 1  214  ? -4.266  17.316  -36.001 1.00 88.42  ? 214  THR A O     1 
ATOM   1606  C  CB    . THR A 1  214  ? -6.280  18.697  -33.668 1.00 89.10  ? 214  THR A CB    1 
ATOM   1607  O  OG1   . THR A 1  214  ? -6.384  19.916  -32.921 1.00 87.45  ? 214  THR A OG1   1 
ATOM   1608  C  CG2   . THR A 1  214  ? -5.379  17.729  -32.921 1.00 86.33  ? 214  THR A CG2   1 
ATOM   1609  N  N     . LEU A 1  215  ? -6.483  16.953  -36.143 1.00 87.71  ? 215  LEU A N     1 
ATOM   1610  C  CA    . LEU A 1  215  ? -6.359  15.631  -36.755 1.00 86.18  ? 215  LEU A CA    1 
ATOM   1611  C  C     . LEU A 1  215  ? -5.666  15.671  -38.121 1.00 90.57  ? 215  LEU A C     1 
ATOM   1612  O  O     . LEU A 1  215  ? -4.853  14.802  -38.430 1.00 89.72  ? 215  LEU A O     1 
ATOM   1613  C  CB    . LEU A 1  215  ? -7.741  14.983  -36.885 1.00 79.88  ? 215  LEU A CB    1 
ATOM   1614  C  CG    . LEU A 1  215  ? -8.515  14.760  -35.580 1.00 74.80  ? 215  LEU A CG    1 
ATOM   1615  C  CD1   . LEU A 1  215  ? -9.909  14.227  -35.857 1.00 71.90  ? 215  LEU A CD1   1 
ATOM   1616  C  CD2   . LEU A 1  215  ? -7.763  13.821  -34.657 1.00 71.25  ? 215  LEU A CD2   1 
ATOM   1617  N  N     . VAL A 1  216  ? -5.989  16.679  -38.930 1.00 94.50  ? 216  VAL A N     1 
ATOM   1618  C  CA    . VAL A 1  216  ? -5.366  16.861  -40.243 1.00 95.22  ? 216  VAL A CA    1 
ATOM   1619  C  C     . VAL A 1  216  ? -3.848  16.990  -40.129 1.00 95.14  ? 216  VAL A C     1 
ATOM   1620  O  O     . VAL A 1  216  ? -3.095  16.421  -40.926 1.00 94.83  ? 216  VAL A O     1 
ATOM   1621  C  CB    . VAL A 1  216  ? -5.936  18.108  -40.963 1.00 90.94  ? 216  VAL A CB    1 
ATOM   1622  C  CG1   . VAL A 1  216  ? -4.944  18.666  -41.980 1.00 90.38  ? 216  VAL A CG1   1 
ATOM   1623  C  CG2   . VAL A 1  216  ? -7.270  17.779  -41.621 1.00 85.90  ? 216  VAL A CG2   1 
ATOM   1624  N  N     . GLU A 1  217  ? -3.405  17.730  -39.121 1.00 93.06  ? 217  GLU A N     1 
ATOM   1625  C  CA    . GLU A 1  217  ? -1.982  17.920  -38.885 1.00 98.23  ? 217  GLU A CA    1 
ATOM   1626  C  C     . GLU A 1  217  ? -1.311  16.614  -38.433 1.00 99.34  ? 217  GLU A C     1 
ATOM   1627  O  O     . GLU A 1  217  ? -0.101  16.446  -38.591 1.00 98.12  ? 217  GLU A O     1 
ATOM   1628  C  CB    . GLU A 1  217  ? -1.770  19.030  -37.849 1.00 100.15 ? 217  GLU A CB    1 
ATOM   1629  C  CG    . GLU A 1  217  ? -0.430  19.741  -37.947 1.00 106.06 ? 217  GLU A CG    1 
ATOM   1630  C  CD    . GLU A 1  217  ? -0.455  21.116  -37.298 1.00 106.86 ? 217  GLU A CD    1 
ATOM   1631  O  OE1   . GLU A 1  217  ? 0.618   21.751  -37.201 1.00 109.23 ? 217  GLU A OE1   1 
ATOM   1632  O  OE2   . GLU A 1  217  ? -1.548  21.564  -36.893 1.00 99.61  ? 217  GLU A OE2   1 
ATOM   1633  N  N     . LEU A 1  218  ? -2.102  15.688  -37.892 1.00 93.48  ? 218  LEU A N     1 
ATOM   1634  C  CA    . LEU A 1  218  ? -1.575  14.418  -37.386 1.00 86.76  ? 218  LEU A CA    1 
ATOM   1635  C  C     . LEU A 1  218  ? -1.437  13.362  -38.479 1.00 88.27  ? 218  LEU A C     1 
ATOM   1636  O  O     . LEU A 1  218  ? -0.397  12.716  -38.606 1.00 87.18  ? 218  LEU A O     1 
ATOM   1637  C  CB    . LEU A 1  218  ? -2.467  13.877  -36.266 1.00 82.72  ? 218  LEU A CB    1 
ATOM   1638  C  CG    . LEU A 1  218  ? -2.049  14.181  -34.825 1.00 86.16  ? 218  LEU A CG    1 
ATOM   1639  C  CD1   . LEU A 1  218  ? -0.727  13.507  -34.496 1.00 86.88  ? 218  LEU A CD1   1 
ATOM   1640  C  CD2   . LEU A 1  218  ? -1.961  15.678  -34.576 1.00 86.95  ? 218  LEU A CD2   1 
ATOM   1641  N  N     . PHE A 1  219  ? -2.497  13.193  -39.263 1.00 90.60  ? 219  PHE A N     1 
ATOM   1642  C  CA    . PHE A 1  219  ? -2.533  12.200  -40.333 1.00 91.78  ? 219  PHE A CA    1 
ATOM   1643  C  C     . PHE A 1  219  ? -1.642  12.587  -41.508 1.00 97.09  ? 219  PHE A C     1 
ATOM   1644  O  O     . PHE A 1  219  ? -1.434  11.793  -42.426 1.00 96.90  ? 219  PHE A O     1 
ATOM   1645  C  CB    . PHE A 1  219  ? -3.968  12.007  -40.830 1.00 88.44  ? 219  PHE A CB    1 
ATOM   1646  C  CG    . PHE A 1  219  ? -4.861  11.297  -39.856 1.00 77.19  ? 219  PHE A CG    1 
ATOM   1647  C  CD1   . PHE A 1  219  ? -5.337  10.031  -40.136 1.00 75.23  ? 219  PHE A CD1   1 
ATOM   1648  C  CD2   . PHE A 1  219  ? -5.225  11.893  -38.662 1.00 72.14  ? 219  PHE A CD2   1 
ATOM   1649  C  CE1   . PHE A 1  219  ? -6.158  9.378   -39.246 1.00 76.40  ? 219  PHE A CE1   1 
ATOM   1650  C  CE2   . PHE A 1  219  ? -6.041  11.245  -37.769 1.00 71.43  ? 219  PHE A CE2   1 
ATOM   1651  C  CZ    . PHE A 1  219  ? -6.513  9.987   -38.061 1.00 73.29  ? 219  PHE A CZ    1 
ATOM   1652  N  N     . GLY A 1  220  ? -1.131  13.814  -41.477 1.00 101.50 ? 220  GLY A N     1 
ATOM   1653  C  CA    . GLY A 1  220  ? -0.306  14.336  -42.552 1.00 109.18 ? 220  GLY A CA    1 
ATOM   1654  C  C     . GLY A 1  220  ? 1.107   13.783  -42.555 1.00 115.19 ? 220  GLY A C     1 
ATOM   1655  O  O     . GLY A 1  220  ? 1.808   13.851  -43.566 1.00 116.91 ? 220  GLY A O     1 
ATOM   1656  N  N     . LEU A 1  221  ? 1.534   13.241  -41.420 1.00 111.70 ? 221  LEU A N     1 
ATOM   1657  C  CA    . LEU A 1  221  ? 2.842   12.605  -41.334 1.00 111.15 ? 221  LEU A CA    1 
ATOM   1658  C  C     . LEU A 1  221  ? 2.779   11.217  -41.948 1.00 111.35 ? 221  LEU A C     1 
ATOM   1659  O  O     . LEU A 1  221  ? 3.803   10.626  -42.283 1.00 116.00 ? 221  LEU A O     1 
ATOM   1660  C  CB    . LEU A 1  221  ? 3.311   12.523  -39.884 1.00 112.53 ? 221  LEU A CB    1 
ATOM   1661  C  CG    . LEU A 1  221  ? 3.502   13.863  -39.178 1.00 115.25 ? 221  LEU A CG    1 
ATOM   1662  C  CD1   . LEU A 1  221  ? 3.125   13.732  -37.718 1.00 109.51 ? 221  LEU A CD1   1 
ATOM   1663  C  CD2   . LEU A 1  221  ? 4.934   14.357  -39.325 1.00 106.68 ? 221  LEU A CD2   1 
ATOM   1664  N  N     . ALA A 1  222  ? 1.562   10.703  -42.095 1.00 109.97 ? 222  ALA A N     1 
ATOM   1665  C  CA    . ALA A 1  222  ? 1.345   9.398   -42.706 1.00 112.21 ? 222  ALA A CA    1 
ATOM   1666  C  C     . ALA A 1  222  ? 1.493   9.475   -44.221 1.00 116.99 ? 222  ALA A C     1 
ATOM   1667  O  O     . ALA A 1  222  ? 1.459   8.456   -44.909 1.00 113.24 ? 222  ALA A O     1 
ATOM   1668  C  CB    . ALA A 1  222  ? -0.029  8.859   -42.335 1.00 97.51  ? 222  ALA A CB    1 
ATOM   1669  N  N     . ARG A 1  223  ? 1.664   10.690  -44.732 1.00 123.23 ? 223  ARG A N     1 
ATOM   1670  C  CA    . ARG A 1  223  ? 1.764   10.915  -46.168 1.00 123.46 ? 223  ARG A CA    1 
ATOM   1671  C  C     . ARG A 1  223  ? 3.174   11.352  -46.574 1.00 129.16 ? 223  ARG A C     1 
ATOM   1672  O  O     . ARG A 1  223  ? 3.561   11.220  -47.737 1.00 135.74 ? 223  ARG A O     1 
ATOM   1673  C  CB    . ARG A 1  223  ? 0.726   11.955  -46.604 1.00 117.88 ? 223  ARG A CB    1 
ATOM   1674  C  CG    . ARG A 1  223  ? 0.675   12.217  -48.097 1.00 118.01 ? 223  ARG A CG    1 
ATOM   1675  C  CD    . ARG A 1  223  ? -0.628  12.884  -48.490 1.00 116.71 ? 223  ARG A CD    1 
ATOM   1676  N  NE    . ARG A 1  223  ? -0.981  13.981  -47.595 1.00 119.75 ? 223  ARG A NE    1 
ATOM   1677  C  CZ    . ARG A 1  223  ? -0.561  15.234  -47.744 1.00 125.67 ? 223  ARG A CZ    1 
ATOM   1678  N  NH1   . ARG A 1  223  ? 0.236   15.556  -48.754 1.00 127.80 ? 223  ARG A NH1   1 
ATOM   1679  N  NH2   . ARG A 1  223  ? -0.938  16.165  -46.878 1.00 116.44 ? 223  ARG A NH2   1 
ATOM   1680  N  N     . GLU A 1  224  ? 3.949   11.858  -45.619 1.00 127.61 ? 224  GLU A N     1 
ATOM   1681  C  CA    . GLU A 1  224  ? 5.317   12.273  -45.918 1.00 134.62 ? 224  GLU A CA    1 
ATOM   1682  C  C     . GLU A 1  224  ? 6.206   11.058  -46.176 1.00 140.50 ? 224  GLU A C     1 
ATOM   1683  O  O     . GLU A 1  224  ? 6.081   10.025  -45.514 1.00 133.14 ? 224  GLU A O     1 
ATOM   1684  C  CB    . GLU A 1  224  ? 5.894   13.133  -44.787 1.00 131.79 ? 224  GLU A CB    1 
ATOM   1685  C  CG    . GLU A 1  224  ? 6.102   12.408  -43.470 1.00 129.64 ? 224  GLU A CG    1 
ATOM   1686  C  CD    . GLU A 1  224  ? 6.758   13.286  -42.422 1.00 129.10 ? 224  GLU A CD    1 
ATOM   1687  O  OE1   . GLU A 1  224  ? 7.106   14.440  -42.748 1.00 146.04 ? 224  GLU A OE1   1 
ATOM   1688  O  OE2   . GLU A 1  224  ? 6.928   12.821  -41.275 1.00 119.12 ? 224  GLU A OE2   1 
ATOM   1689  N  N     . LEU A 1  225  ? 7.094   11.187  -47.155 1.00 150.24 ? 225  LEU A N     1 
ATOM   1690  C  CA    . LEU A 1  225  ? 7.961   10.085  -47.555 1.00 152.53 ? 225  LEU A CA    1 
ATOM   1691  C  C     . LEU A 1  225  ? 9.155   9.950   -46.617 1.00 158.83 ? 225  LEU A C     1 
ATOM   1692  O  O     . LEU A 1  225  ? 9.491   10.877  -45.877 1.00 161.27 ? 225  LEU A O     1 
ATOM   1693  C  CB    . LEU A 1  225  ? 8.432   10.258  -49.013 1.00 149.43 ? 225  LEU A CB    1 
ATOM   1694  C  CG    . LEU A 1  225  ? 9.293   11.416  -49.565 1.00 147.31 ? 225  LEU A CG    1 
ATOM   1695  C  CD1   . LEU A 1  225  ? 8.704   12.799  -49.276 1.00 145.41 ? 225  LEU A CD1   1 
ATOM   1696  C  CD2   . LEU A 1  225  ? 10.759  11.350  -49.124 1.00 137.41 ? 225  LEU A CD2   1 
ATOM   1697  N  N     . ASN A 1  226  ? 9.790   8.785   -46.651 1.00 155.32 ? 226  ASN A N     1 
ATOM   1698  C  CA    . ASN A 1  226  ? 10.975  8.537   -45.844 1.00 153.76 ? 226  ASN A CA    1 
ATOM   1699  C  C     . ASN A 1  226  ? 12.225  9.122   -46.498 1.00 164.22 ? 226  ASN A C     1 
ATOM   1700  O  O     . ASN A 1  226  ? 12.445  10.334  -46.472 1.00 162.05 ? 226  ASN A O     1 
ATOM   1701  C  CB    . ASN A 1  226  ? 11.147  7.035   -45.610 1.00 143.55 ? 226  ASN A CB    1 
ATOM   1702  C  CG    . ASN A 1  226  ? 12.411  6.703   -44.841 1.00 148.55 ? 226  ASN A CG    1 
ATOM   1703  O  OD1   . ASN A 1  226  ? 12.955  7.541   -44.120 1.00 157.12 ? 226  ASN A OD1   1 
ATOM   1704  N  ND2   . ASN A 1  226  ? 12.884  5.471   -44.990 1.00 138.75 ? 226  ASN A ND2   1 
ATOM   1705  N  N     . ARG B 1  6    ? 7.183   18.206  -28.338 1.00 112.90 ? 6    ARG B N     1 
ATOM   1706  C  CA    . ARG B 1  6    ? 8.025   17.732  -29.431 1.00 108.41 ? 6    ARG B CA    1 
ATOM   1707  C  C     . ARG B 1  6    ? 7.180   17.106  -30.538 1.00 111.07 ? 6    ARG B C     1 
ATOM   1708  O  O     . ARG B 1  6    ? 6.368   16.218  -30.266 1.00 95.59  ? 6    ARG B O     1 
ATOM   1709  C  CB    . ARG B 1  6    ? 9.055   16.723  -28.915 1.00 92.07  ? 6    ARG B CB    1 
ATOM   1710  N  N     . PRO B 1  7    ? 7.361   17.577  -31.788 1.00 123.44 ? 7    PRO B N     1 
ATOM   1711  C  CA    . PRO B 1  7    ? 6.684   17.001  -32.959 1.00 109.76 ? 7    PRO B CA    1 
ATOM   1712  C  C     . PRO B 1  7    ? 6.901   15.489  -33.061 1.00 92.93  ? 7    PRO B C     1 
ATOM   1713  O  O     . PRO B 1  7    ? 7.950   14.983  -32.660 1.00 91.94  ? 7    PRO B O     1 
ATOM   1714  C  CB    . PRO B 1  7    ? 7.333   17.738  -34.138 1.00 111.56 ? 7    PRO B CB    1 
ATOM   1715  C  CG    . PRO B 1  7    ? 7.759   19.054  -33.561 1.00 114.99 ? 7    PRO B CG    1 
ATOM   1716  C  CD    . PRO B 1  7    ? 8.194   18.740  -32.151 1.00 121.26 ? 7    PRO B CD    1 
ATOM   1717  N  N     . THR B 1  8    ? 5.910   14.780  -33.588 1.00 84.04  ? 8    THR B N     1 
ATOM   1718  C  CA    . THR B 1  8    ? 5.912   13.321  -33.565 1.00 86.07  ? 8    THR B CA    1 
ATOM   1719  C  C     . THR B 1  8    ? 6.696   12.714  -34.732 1.00 87.83  ? 8    THR B C     1 
ATOM   1720  O  O     . THR B 1  8    ? 6.748   13.288  -35.820 1.00 90.29  ? 8    THR B O     1 
ATOM   1721  C  CB    . THR B 1  8    ? 4.474   12.775  -33.584 1.00 83.42  ? 8    THR B CB    1 
ATOM   1722  O  OG1   . THR B 1  8    ? 3.969   12.806  -34.921 1.00 73.83  ? 8    THR B OG1   1 
ATOM   1723  C  CG2   . THR B 1  8    ? 3.572   13.616  -32.688 1.00 78.58  ? 8    THR B CG2   1 
ATOM   1724  N  N     . LEU B 1  9    ? 7.294   11.547  -34.497 1.00 90.01  ? 9    LEU B N     1 
ATOM   1725  C  CA    . LEU B 1  9    ? 8.135   10.880  -35.493 1.00 89.76  ? 9    LEU B CA    1 
ATOM   1726  C  C     . LEU B 1  9    ? 7.389   9.790   -36.268 1.00 84.23  ? 9    LEU B C     1 
ATOM   1727  O  O     . LEU B 1  9    ? 6.287   9.389   -35.895 1.00 80.68  ? 9    LEU B O     1 
ATOM   1728  C  CB    . LEU B 1  9    ? 9.370   10.266  -34.820 1.00 87.39  ? 9    LEU B CB    1 
ATOM   1729  C  CG    . LEU B 1  9    ? 10.150  11.130  -33.823 1.00 83.15  ? 9    LEU B CG    1 
ATOM   1730  C  CD1   . LEU B 1  9    ? 11.288  10.335  -33.197 1.00 69.72  ? 9    LEU B CD1   1 
ATOM   1731  C  CD2   . LEU B 1  9    ? 10.674  12.395  -34.488 1.00 84.86  ? 9    LEU B CD2   1 
ATOM   1732  N  N     . SER B 1  10   ? 8.005   9.320   -37.350 1.00 84.45  ? 10   SER B N     1 
ATOM   1733  C  CA    . SER B 1  10   ? 7.497   8.178   -38.107 1.00 82.75  ? 10   SER B CA    1 
ATOM   1734  C  C     . SER B 1  10   ? 8.647   7.230   -38.439 1.00 92.81  ? 10   SER B C     1 
ATOM   1735  O  O     . SER B 1  10   ? 9.673   7.652   -38.977 1.00 93.02  ? 10   SER B O     1 
ATOM   1736  C  CB    . SER B 1  10   ? 6.794   8.634   -39.385 1.00 75.07  ? 10   SER B CB    1 
ATOM   1737  O  OG    . SER B 1  10   ? 6.192   7.536   -40.048 1.00 63.91  ? 10   SER B OG    1 
ATOM   1738  N  N     . GLU B 1  11   ? 8.474   5.951   -38.111 1.00 97.63  ? 11   GLU B N     1 
ATOM   1739  C  CA    . GLU B 1  11   ? 9.548   4.965   -38.238 1.00 94.98  ? 11   GLU B CA    1 
ATOM   1740  C  C     . GLU B 1  11   ? 9.074   3.697   -38.947 1.00 85.56  ? 11   GLU B C     1 
ATOM   1741  O  O     . GLU B 1  11   ? 7.877   3.513   -39.170 1.00 84.99  ? 11   GLU B O     1 
ATOM   1742  C  CB    . GLU B 1  11   ? 10.111  4.619   -36.855 1.00 106.17 ? 11   GLU B CB    1 
ATOM   1743  C  CG    . GLU B 1  11   ? 10.592  5.834   -36.057 1.00 115.30 ? 11   GLU B CG    1 
ATOM   1744  C  CD    . GLU B 1  11   ? 11.036  5.489   -34.643 1.00 118.71 ? 11   GLU B CD    1 
ATOM   1745  O  OE1   . GLU B 1  11   ? 11.244  4.290   -34.356 1.00 129.48 ? 11   GLU B OE1   1 
ATOM   1746  O  OE2   . GLU B 1  11   ? 11.175  6.423   -33.821 1.00 100.15 ? 11   GLU B OE2   1 
ATOM   1747  N  N     . ASP B 1  12   ? 10.013  2.822   -39.295 1.00 90.10  ? 12   ASP B N     1 
ATOM   1748  C  CA    . ASP B 1  12   ? 9.682   1.630   -40.071 1.00 95.33  ? 12   ASP B CA    1 
ATOM   1749  C  C     . ASP B 1  12   ? 10.701  0.502   -39.897 1.00 96.09  ? 12   ASP B C     1 
ATOM   1750  O  O     . ASP B 1  12   ? 11.894  0.670   -40.152 1.00 97.11  ? 12   ASP B O     1 
ATOM   1751  C  CB    . ASP B 1  12   ? 9.560   1.992   -41.557 1.00 96.09  ? 12   ASP B CB    1 
ATOM   1752  C  CG    . ASP B 1  12   ? 8.863   0.912   -42.377 1.00 95.55  ? 12   ASP B CG    1 
ATOM   1753  O  OD1   . ASP B 1  12   ? 8.671   -0.213  -41.866 1.00 91.20  ? 12   ASP B OD1   1 
ATOM   1754  O  OD2   . ASP B 1  12   ? 8.509   1.191   -43.543 1.00 99.33  ? 12   ASP B OD2   1 
ATOM   1755  N  N     . VAL B 1  13   ? 10.213  -0.653  -39.462 1.00 91.02  ? 13   VAL B N     1 
ATOM   1756  C  CA    . VAL B 1  13   ? 11.012  -1.867  -39.477 1.00 95.82  ? 13   VAL B CA    1 
ATOM   1757  C  C     . VAL B 1  13   ? 10.400  -2.772  -40.553 1.00 97.90  ? 13   VAL B C     1 
ATOM   1758  O  O     . VAL B 1  13   ? 9.180   -2.806  -40.714 1.00 95.16  ? 13   VAL B O     1 
ATOM   1759  C  CB    . VAL B 1  13   ? 11.046  -2.537  -38.096 1.00 102.91 ? 13   VAL B CB    1 
ATOM   1760  C  CG1   . VAL B 1  13   ? 12.314  -3.368  -37.943 1.00 101.47 ? 13   VAL B CG1   1 
ATOM   1761  C  CG2   . VAL B 1  13   ? 10.986  -1.471  -37.005 1.00 92.47  ? 13   VAL B CG2   1 
ATOM   1762  N  N     . LEU B 1  14   ? 11.240  -3.484  -41.300 1.00 103.00 ? 14   LEU B N     1 
ATOM   1763  C  CA    . LEU B 1  14   ? 10.820  -3.997  -42.605 1.00 99.46  ? 14   LEU B CA    1 
ATOM   1764  C  C     . LEU B 1  14   ? 10.703  -5.514  -42.778 1.00 91.60  ? 14   LEU B C     1 
ATOM   1765  O  O     . LEU B 1  14   ? 11.185  -6.303  -41.965 1.00 87.08  ? 14   LEU B O     1 
ATOM   1766  C  CB    . LEU B 1  14   ? 11.779  -3.470  -43.678 1.00 99.95  ? 14   LEU B CB    1 
ATOM   1767  C  CG    . LEU B 1  14   ? 11.730  -1.967  -43.964 1.00 100.21 ? 14   LEU B CG    1 
ATOM   1768  C  CD1   . LEU B 1  14   ? 12.817  -1.570  -44.952 1.00 99.87  ? 14   LEU B CD1   1 
ATOM   1769  C  CD2   . LEU B 1  14   ? 10.355  -1.567  -44.483 1.00 99.13  ? 14   LEU B CD2   1 
ATOM   1770  N  N     . THR B 1  15   ? 10.022  -5.880  -43.863 1.00 94.76  ? 15   THR B N     1 
ATOM   1771  C  CA    . THR B 1  15   ? 9.982   -7.228  -44.430 1.00 95.99  ? 15   THR B CA    1 
ATOM   1772  C  C     . THR B 1  15   ? 9.440   -7.030  -45.854 1.00 98.58  ? 15   THR B C     1 
ATOM   1773  O  O     . THR B 1  15   ? 8.858   -5.985  -46.147 1.00 97.85  ? 15   THR B O     1 
ATOM   1774  C  CB    . THR B 1  15   ? 9.099   -8.211  -43.613 1.00 90.85  ? 15   THR B CB    1 
ATOM   1775  O  OG1   . THR B 1  15   ? 9.415   -8.110  -42.219 1.00 80.97  ? 15   THR B OG1   1 
ATOM   1776  C  CG2   . THR B 1  15   ? 9.310   -9.653  -44.069 1.00 81.16  ? 15   THR B CG2   1 
ATOM   1777  N  N     . ASP B 1  16   ? 9.637   -8.004  -46.738 1.00 95.55  ? 16   ASP B N     1 
ATOM   1778  C  CA    . ASP B 1  16   ? 9.300   -7.825  -48.151 1.00 88.43  ? 16   ASP B CA    1 
ATOM   1779  C  C     . ASP B 1  16   ? 7.821   -7.564  -48.410 1.00 83.09  ? 16   ASP B C     1 
ATOM   1780  O  O     . ASP B 1  16   ? 7.473   -6.684  -49.196 1.00 80.19  ? 16   ASP B O     1 
ATOM   1781  C  CB    . ASP B 1  16   ? 9.748   -9.042  -48.955 1.00 91.57  ? 16   ASP B CB    1 
ATOM   1782  C  CG    . ASP B 1  16   ? 11.251  -9.103  -49.120 1.00 104.26 ? 16   ASP B CG    1 
ATOM   1783  O  OD1   . ASP B 1  16   ? 11.885  -8.029  -49.204 1.00 92.24  ? 16   ASP B OD1   1 
ATOM   1784  O  OD2   . ASP B 1  16   ? 11.797  -10.225 -49.161 1.00 116.70 ? 16   ASP B OD2   1 
ATOM   1785  N  N     . ASN B 1  17   ? 6.951   -8.323  -47.754 1.00 86.63  ? 17   ASN B N     1 
ATOM   1786  C  CA    . ASN B 1  17   ? 5.517   -8.190  -47.991 1.00 98.74  ? 17   ASN B CA    1 
ATOM   1787  C  C     . ASN B 1  17   ? 4.811   -7.349  -46.930 1.00 99.98  ? 17   ASN B C     1 
ATOM   1788  O  O     . ASN B 1  17   ? 3.744   -6.785  -47.184 1.00 95.67  ? 17   ASN B O     1 
ATOM   1789  C  CB    . ASN B 1  17   ? 4.862   -9.572  -48.072 1.00 104.91 ? 17   ASN B CB    1 
ATOM   1790  C  CG    . ASN B 1  17   ? 3.954   -9.719  -49.281 1.00 104.70 ? 17   ASN B CG    1 
ATOM   1791  O  OD1   . ASN B 1  17   ? 4.057   -8.961  -50.246 1.00 110.32 ? 17   ASN B OD1   1 
ATOM   1792  N  ND2   . ASN B 1  17   ? 3.062   -10.704 -49.236 1.00 91.73  ? 17   ASN B ND2   1 
ATOM   1793  N  N     . ARG B 1  18   ? 5.407   -7.266  -45.744 1.00 97.11  ? 18   ARG B N     1 
ATOM   1794  C  CA    . ARG B 1  18   ? 4.795   -6.533  -44.640 1.00 97.74  ? 18   ARG B CA    1 
ATOM   1795  C  C     . ARG B 1  18   ? 5.820   -5.755  -43.818 1.00 98.13  ? 18   ARG B C     1 
ATOM   1796  O  O     . ARG B 1  18   ? 7.023   -5.941  -43.981 1.00 100.05 ? 18   ARG B O     1 
ATOM   1797  C  CB    . ARG B 1  18   ? 4.019   -7.493  -43.736 1.00 96.44  ? 18   ARG B CB    1 
ATOM   1798  C  CG    . ARG B 1  18   ? 4.852   -8.338  -42.789 1.00 94.95  ? 18   ARG B CG    1 
ATOM   1799  C  CD    . ARG B 1  18   ? 3.916   -9.122  -41.873 1.00 101.00 ? 18   ARG B CD    1 
ATOM   1800  N  NE    . ARG B 1  18   ? 4.547   -9.571  -40.634 1.00 99.50  ? 18   ARG B NE    1 
ATOM   1801  C  CZ    . ARG B 1  18   ? 3.893   -10.166 -39.640 1.00 94.36  ? 18   ARG B CZ    1 
ATOM   1802  N  NH1   . ARG B 1  18   ? 2.587   -10.383 -39.735 1.00 95.44  ? 18   ARG B NH1   1 
ATOM   1803  N  NH2   . ARG B 1  18   ? 4.544   -10.544 -38.548 1.00 86.68  ? 18   ARG B NH2   1 
ATOM   1804  N  N     . SER B 1  19   ? 5.340   -4.877  -42.940 1.00 96.79  ? 19   SER B N     1 
ATOM   1805  C  CA    . SER B 1  19   ? 6.234   -4.071  -42.113 1.00 98.25  ? 19   SER B CA    1 
ATOM   1806  C  C     . SER B 1  19   ? 5.520   -3.409  -40.931 1.00 94.28  ? 19   SER B C     1 
ATOM   1807  O  O     . SER B 1  19   ? 4.292   -3.306  -40.905 1.00 82.54  ? 19   SER B O     1 
ATOM   1808  C  CB    . SER B 1  19   ? 6.927   -3.004  -42.970 1.00 97.28  ? 19   SER B CB    1 
ATOM   1809  O  OG    . SER B 1  19   ? 6.001   -2.328  -43.802 1.00 99.73  ? 19   SER B OG    1 
ATOM   1810  N  N     . GLN B 1  20   ? 6.312   -2.970  -39.954 1.00 98.63  ? 20   GLN B N     1 
ATOM   1811  C  CA    . GLN B 1  20   ? 5.800   -2.306  -38.757 1.00 90.27  ? 20   GLN B CA    1 
ATOM   1812  C  C     . GLN B 1  20   ? 6.113   -0.817  -38.766 1.00 90.08  ? 20   GLN B C     1 
ATOM   1813  O  O     . GLN B 1  20   ? 7.229   -0.412  -39.097 1.00 89.29  ? 20   GLN B O     1 
ATOM   1814  C  CB    . GLN B 1  20   ? 6.383   -2.939  -37.492 1.00 87.51  ? 20   GLN B CB    1 
ATOM   1815  C  CG    . GLN B 1  20   ? 5.734   -4.246  -37.087 1.00 90.04  ? 20   GLN B CG    1 
ATOM   1816  C  CD    . GLN B 1  20   ? 6.277   -4.781  -35.776 1.00 86.84  ? 20   GLN B CD    1 
ATOM   1817  O  OE1   . GLN B 1  20   ? 7.259   -4.264  -35.241 1.00 73.75  ? 20   GLN B OE1   1 
ATOM   1818  N  NE2   . GLN B 1  20   ? 5.637   -5.821  -35.249 1.00 100.87 ? 20   GLN B NE2   1 
ATOM   1819  N  N     . PHE B 1  21   ? 5.127   -0.008  -38.390 1.00 89.17  ? 21   PHE B N     1 
ATOM   1820  C  CA    . PHE B 1  21   ? 5.304   1.438   -38.315 1.00 90.63  ? 21   PHE B CA    1 
ATOM   1821  C  C     . PHE B 1  21   ? 5.189   1.928   -36.875 1.00 86.23  ? 21   PHE B C     1 
ATOM   1822  O  O     . PHE B 1  21   ? 4.357   1.445   -36.105 1.00 82.60  ? 21   PHE B O     1 
ATOM   1823  C  CB    . PHE B 1  21   ? 4.281   2.154   -39.199 1.00 91.26  ? 21   PHE B CB    1 
ATOM   1824  C  CG    . PHE B 1  21   ? 4.355   1.765   -40.648 1.00 88.59  ? 21   PHE B CG    1 
ATOM   1825  C  CD1   . PHE B 1  21   ? 5.233   2.405   -41.506 1.00 84.85  ? 21   PHE B CD1   1 
ATOM   1826  C  CD2   . PHE B 1  21   ? 3.546   0.760   -41.150 1.00 89.52  ? 21   PHE B CD2   1 
ATOM   1827  C  CE1   . PHE B 1  21   ? 5.304   2.049   -42.838 1.00 89.29  ? 21   PHE B CE1   1 
ATOM   1828  C  CE2   . PHE B 1  21   ? 3.613   0.398   -42.480 1.00 93.95  ? 21   PHE B CE2   1 
ATOM   1829  C  CZ    . PHE B 1  21   ? 4.493   1.044   -43.326 1.00 95.51  ? 21   PHE B CZ    1 
ATOM   1830  N  N     . VAL B 1  22   ? 6.034   2.890   -36.518 1.00 85.14  ? 22   VAL B N     1 
ATOM   1831  C  CA    . VAL B 1  22   ? 6.049   3.426   -35.164 1.00 85.49  ? 22   VAL B CA    1 
ATOM   1832  C  C     . VAL B 1  22   ? 5.798   4.928   -35.162 1.00 85.26  ? 22   VAL B C     1 
ATOM   1833  O  O     . VAL B 1  22   ? 6.544   5.696   -35.770 1.00 83.55  ? 22   VAL B O     1 
ATOM   1834  C  CB    . VAL B 1  22   ? 7.384   3.141   -34.456 1.00 89.97  ? 22   VAL B CB    1 
ATOM   1835  C  CG1   . VAL B 1  22   ? 7.345   3.654   -33.025 1.00 86.17  ? 22   VAL B CG1   1 
ATOM   1836  C  CG2   . VAL B 1  22   ? 7.686   1.653   -34.480 1.00 97.31  ? 22   VAL B CG2   1 
ATOM   1837  N  N     . ILE B 1  23   ? 4.740   5.336   -34.470 1.00 84.42  ? 23   ILE B N     1 
ATOM   1838  C  CA    . ILE B 1  23   ? 4.371   6.741   -34.366 1.00 78.82  ? 23   ILE B CA    1 
ATOM   1839  C  C     . ILE B 1  23   ? 4.458   7.221   -32.926 1.00 82.44  ? 23   ILE B C     1 
ATOM   1840  O  O     . ILE B 1  23   ? 3.689   6.777   -32.072 1.00 83.09  ? 23   ILE B O     1 
ATOM   1841  C  CB    . ILE B 1  23   ? 2.951   6.983   -34.873 1.00 69.60  ? 23   ILE B CB    1 
ATOM   1842  C  CG1   . ILE B 1  23   ? 2.749   6.298   -36.222 1.00 65.39  ? 23   ILE B CG1   1 
ATOM   1843  C  CG2   . ILE B 1  23   ? 2.668   8.471   -34.956 1.00 69.57  ? 23   ILE B CG2   1 
ATOM   1844  C  CD1   . ILE B 1  23   ? 1.310   6.252   -36.654 1.00 65.05  ? 23   ILE B CD1   1 
ATOM   1845  N  N     . GLU B 1  24   ? 5.381   8.137   -32.659 1.00 83.76  ? 24   GLU B N     1 
ATOM   1846  C  CA    . GLU B 1  24   ? 5.595   8.610   -31.300 1.00 83.45  ? 24   GLU B CA    1 
ATOM   1847  C  C     . GLU B 1  24   ? 6.369   9.920   -31.281 1.00 77.89  ? 24   GLU B C     1 
ATOM   1848  O  O     . GLU B 1  24   ? 7.171   10.182  -32.177 1.00 81.96  ? 24   GLU B O     1 
ATOM   1849  C  CB    . GLU B 1  24   ? 6.337   7.549   -30.486 1.00 87.48  ? 24   GLU B CB    1 
ATOM   1850  C  CG    . GLU B 1  24   ? 7.641   7.097   -31.108 1.00 91.91  ? 24   GLU B CG    1 
ATOM   1851  C  CD    . GLU B 1  24   ? 8.390   6.120   -30.226 1.00 97.80  ? 24   GLU B CD    1 
ATOM   1852  O  OE1   . GLU B 1  24   ? 8.108   6.081   -29.007 1.00 98.57  ? 24   GLU B OE1   1 
ATOM   1853  O  OE2   . GLU B 1  24   ? 9.255   5.389   -30.751 1.00 102.30 ? 24   GLU B OE2   1 
ATOM   1854  N  N     . PRO B 1  25   ? 6.137   10.748  -30.252 1.00 76.11  ? 25   PRO B N     1 
ATOM   1855  C  CA    . PRO B 1  25   ? 5.172   10.525  -29.169 1.00 76.78  ? 25   PRO B CA    1 
ATOM   1856  C  C     . PRO B 1  25   ? 3.823   11.215  -29.386 1.00 73.63  ? 25   PRO B C     1 
ATOM   1857  O  O     . PRO B 1  25   ? 3.769   12.405  -29.689 1.00 80.66  ? 25   PRO B O     1 
ATOM   1858  C  CB    . PRO B 1  25   ? 5.889   11.113  -27.955 1.00 85.99  ? 25   PRO B CB    1 
ATOM   1859  C  CG    . PRO B 1  25   ? 6.707   12.236  -28.525 1.00 88.80  ? 25   PRO B CG    1 
ATOM   1860  C  CD    . PRO B 1  25   ? 7.050   11.866  -29.951 1.00 80.87  ? 25   PRO B CD    1 
ATOM   1861  N  N     . LEU B 1  26   ? 2.737   10.470  -29.225 1.00 66.63  ? 26   LEU B N     1 
ATOM   1862  C  CA    . LEU B 1  26   ? 1.415   11.068  -29.326 1.00 67.15  ? 26   LEU B CA    1 
ATOM   1863  C  C     . LEU B 1  26   ? 0.982   11.662  -27.994 1.00 71.84  ? 26   LEU B C     1 
ATOM   1864  O  O     . LEU B 1  26   ? 1.364   11.169  -26.932 1.00 73.98  ? 26   LEU B O     1 
ATOM   1865  C  CB    . LEU B 1  26   ? 0.387   10.042  -29.793 1.00 67.58  ? 26   LEU B CB    1 
ATOM   1866  C  CG    . LEU B 1  26   ? 0.601   9.458   -31.185 1.00 63.64  ? 26   LEU B CG    1 
ATOM   1867  C  CD1   . LEU B 1  26   ? -0.606  8.632   -31.590 1.00 63.82  ? 26   LEU B CD1   1 
ATOM   1868  C  CD2   . LEU B 1  26   ? 0.857   10.570  -32.181 1.00 63.89  ? 26   LEU B CD2   1 
ATOM   1869  N  N     . GLU B 1  27   ? 0.190   12.728  -28.066 1.00 71.53  ? 27   GLU B N     1 
ATOM   1870  C  CA    . GLU B 1  27   ? -0.418  13.328  -26.887 1.00 71.61  ? 27   GLU B CA    1 
ATOM   1871  C  C     . GLU B 1  27   ? -1.245  12.262  -26.168 1.00 67.71  ? 27   GLU B C     1 
ATOM   1872  O  O     . GLU B 1  27   ? -1.903  11.449  -26.814 1.00 58.14  ? 27   GLU B O     1 
ATOM   1873  C  CB    . GLU B 1  27   ? -1.273  14.541  -27.286 1.00 69.41  ? 27   GLU B CB    1 
ATOM   1874  C  CG    . GLU B 1  27   ? -1.898  15.319  -26.129 1.00 75.69  ? 27   GLU B CG    1 
ATOM   1875  C  CD    . GLU B 1  27   ? -1.919  16.824  -26.365 1.00 75.05  ? 27   GLU B CD    1 
ATOM   1876  O  OE1   . GLU B 1  27   ? -0.861  17.385  -26.726 1.00 76.13  ? 27   GLU B OE1   1 
ATOM   1877  O  OE2   . GLU B 1  27   ? -2.993  17.443  -26.189 1.00 68.35  ? 27   GLU B OE2   1 
ATOM   1878  N  N     . PRO B 1  28   ? -1.167  12.234  -24.827 1.00 75.40  ? 28   PRO B N     1 
ATOM   1879  C  CA    . PRO B 1  28   ? -1.854  11.229  -24.006 1.00 74.77  ? 28   PRO B CA    1 
ATOM   1880  C  C     . PRO B 1  28   ? -3.337  11.092  -24.332 1.00 68.71  ? 28   PRO B C     1 
ATOM   1881  O  O     . PRO B 1  28   ? -4.099  12.050  -24.196 1.00 66.37  ? 28   PRO B O     1 
ATOM   1882  C  CB    . PRO B 1  28   ? -1.656  11.749  -22.572 1.00 83.61  ? 28   PRO B CB    1 
ATOM   1883  C  CG    . PRO B 1  28   ? -1.093  13.144  -22.714 1.00 85.57  ? 28   PRO B CG    1 
ATOM   1884  C  CD    . PRO B 1  28   ? -0.340  13.124  -23.998 1.00 83.02  ? 28   PRO B CD    1 
ATOM   1885  N  N     . GLY B 1  29   ? -3.729  9.897   -24.762 1.00 67.78  ? 29   GLY B N     1 
ATOM   1886  C  CA    . GLY B 1  29   ? -5.103  9.627   -25.136 1.00 62.32  ? 29   GLY B CA    1 
ATOM   1887  C  C     . GLY B 1  29   ? -5.313  9.599   -26.640 1.00 64.68  ? 29   GLY B C     1 
ATOM   1888  O  O     . GLY B 1  29   ? -6.425  9.341   -27.104 1.00 60.78  ? 29   GLY B O     1 
ATOM   1889  N  N     . PHE B 1  30   ? -4.250  9.859   -27.403 1.00 66.13  ? 30   PHE B N     1 
ATOM   1890  C  CA    . PHE B 1  30   ? -4.348  9.922   -28.865 1.00 61.80  ? 30   PHE B CA    1 
ATOM   1891  C  C     . PHE B 1  30   ? -3.815  8.681   -29.567 1.00 55.50  ? 30   PHE B C     1 
ATOM   1892  O  O     . PHE B 1  30   ? -3.927  8.555   -30.788 1.00 52.38  ? 30   PHE B O     1 
ATOM   1893  C  CB    . PHE B 1  30   ? -3.614  11.150  -29.406 1.00 60.97  ? 30   PHE B CB    1 
ATOM   1894  C  CG    . PHE B 1  30   ? -4.486  12.363  -29.545 1.00 55.94  ? 30   PHE B CG    1 
ATOM   1895  C  CD1   . PHE B 1  30   ? -5.579  12.352  -30.397 1.00 47.98  ? 30   PHE B CD1   1 
ATOM   1896  C  CD2   . PHE B 1  30   ? -4.208  13.516  -28.833 1.00 56.73  ? 30   PHE B CD2   1 
ATOM   1897  C  CE1   . PHE B 1  30   ? -6.382  13.463  -30.528 1.00 49.84  ? 30   PHE B CE1   1 
ATOM   1898  C  CE2   . PHE B 1  30   ? -5.007  14.632  -28.961 1.00 53.58  ? 30   PHE B CE2   1 
ATOM   1899  C  CZ    . PHE B 1  30   ? -6.096  14.606  -29.809 1.00 53.86  ? 30   PHE B CZ    1 
ATOM   1900  N  N     . GLY B 1  31   ? -3.221  7.775   -28.803 1.00 56.46  ? 31   GLY B N     1 
ATOM   1901  C  CA    . GLY B 1  31   ? -2.787  6.511   -29.360 1.00 59.66  ? 31   GLY B CA    1 
ATOM   1902  C  C     . GLY B 1  31   ? -3.993  5.775   -29.905 1.00 60.72  ? 31   GLY B C     1 
ATOM   1903  O  O     . GLY B 1  31   ? -4.023  5.398   -31.077 1.00 62.99  ? 31   GLY B O     1 
ATOM   1904  N  N     . TYR B 1  32   ? -4.998  5.598   -29.048 1.00 59.16  ? 32   TYR B N     1 
ATOM   1905  C  CA    . TYR B 1  32   ? -6.215  4.861   -29.393 1.00 57.24  ? 32   TYR B CA    1 
ATOM   1906  C  C     . TYR B 1  32   ? -7.118  5.675   -30.308 1.00 58.05  ? 32   TYR B C     1 
ATOM   1907  O  O     . TYR B 1  32   ? -7.868  5.122   -31.116 1.00 56.66  ? 32   TYR B O     1 
ATOM   1908  C  CB    . TYR B 1  32   ? -6.977  4.466   -28.127 1.00 52.41  ? 32   TYR B CB    1 
ATOM   1909  C  CG    . TYR B 1  32   ? -6.289  3.405   -27.305 1.00 51.16  ? 32   TYR B CG    1 
ATOM   1910  C  CD1   . TYR B 1  32   ? -6.703  2.083   -27.362 1.00 52.02  ? 32   TYR B CD1   1 
ATOM   1911  C  CD2   . TYR B 1  32   ? -5.222  3.723   -26.474 1.00 54.66  ? 32   TYR B CD2   1 
ATOM   1912  C  CE1   . TYR B 1  32   ? -6.076  1.107   -26.613 1.00 56.88  ? 32   TYR B CE1   1 
ATOM   1913  C  CE2   . TYR B 1  32   ? -4.589  2.753   -25.722 1.00 57.46  ? 32   TYR B CE2   1 
ATOM   1914  C  CZ    . TYR B 1  32   ? -5.019  1.446   -25.796 1.00 56.77  ? 32   TYR B CZ    1 
ATOM   1915  O  OH    . TYR B 1  32   ? -4.394  0.472   -25.052 1.00 57.24  ? 32   TYR B OH    1 
ATOM   1916  N  N     . THR B 1  33   ? -7.038  6.994   -30.157 1.00 59.26  ? 33   THR B N     1 
ATOM   1917  C  CA    . THR B 1  33   ? -7.772  7.944   -30.986 1.00 58.80  ? 33   THR B CA    1 
ATOM   1918  C  C     . THR B 1  33   ? -7.362  7.821   -32.454 1.00 58.98  ? 33   THR B C     1 
ATOM   1919  O  O     . THR B 1  33   ? -8.156  8.057   -33.364 1.00 57.10  ? 33   THR B O     1 
ATOM   1920  C  CB    . THR B 1  33   ? -7.530  9.391   -30.499 1.00 57.01  ? 33   THR B CB    1 
ATOM   1921  O  OG1   . THR B 1  33   ? -7.812  9.476   -29.096 1.00 53.97  ? 33   THR B OG1   1 
ATOM   1922  C  CG2   . THR B 1  33   ? -8.401  10.384  -31.254 1.00 55.89  ? 33   THR B CG2   1 
ATOM   1923  N  N     . LEU B 1  34   ? -6.110  7.440   -32.670 1.00 58.77  ? 34   LEU B N     1 
ATOM   1924  C  CA    . LEU B 1  34   ? -5.581  7.259   -34.011 1.00 58.42  ? 34   LEU B CA    1 
ATOM   1925  C  C     . LEU B 1  34   ? -5.586  5.778   -34.391 1.00 61.18  ? 34   LEU B C     1 
ATOM   1926  O  O     . LEU B 1  34   ? -5.480  5.423   -35.566 1.00 62.20  ? 34   LEU B O     1 
ATOM   1927  C  CB    . LEU B 1  34   ? -4.170  7.845   -34.092 1.00 61.39  ? 34   LEU B CB    1 
ATOM   1928  C  CG    . LEU B 1  34   ? -3.348  7.681   -35.370 1.00 68.33  ? 34   LEU B CG    1 
ATOM   1929  C  CD1   . LEU B 1  34   ? -4.147  8.132   -36.567 1.00 65.64  ? 34   LEU B CD1   1 
ATOM   1930  C  CD2   . LEU B 1  34   ? -2.042  8.458   -35.272 1.00 72.26  ? 34   LEU B CD2   1 
ATOM   1931  N  N     . GLY B 1  35   ? -5.742  4.922   -33.384 1.00 61.91  ? 35   GLY B N     1 
ATOM   1932  C  CA    . GLY B 1  35   ? -5.613  3.484   -33.551 1.00 65.17  ? 35   GLY B CA    1 
ATOM   1933  C  C     . GLY B 1  35   ? -6.584  2.813   -34.505 1.00 65.88  ? 35   GLY B C     1 
ATOM   1934  O  O     . GLY B 1  35   ? -6.268  2.610   -35.677 1.00 67.71  ? 35   GLY B O     1 
ATOM   1935  N  N     . ASN B 1  36   ? -7.766  2.467   -34.000 1.00 66.50  ? 36   ASN B N     1 
ATOM   1936  C  CA    . ASN B 1  36   ? -8.745  1.676   -34.752 1.00 69.68  ? 36   ASN B CA    1 
ATOM   1937  C  C     . ASN B 1  36   ? -9.244  2.352   -36.035 1.00 69.52  ? 36   ASN B C     1 
ATOM   1938  O  O     . ASN B 1  36   ? -9.766  1.688   -36.934 1.00 71.93  ? 36   ASN B O     1 
ATOM   1939  C  CB    . ASN B 1  36   ? -9.940  1.338   -33.852 1.00 64.53  ? 36   ASN B CB    1 
ATOM   1940  C  CG    . ASN B 1  36   ? -10.858 0.285   -34.457 1.00 59.56  ? 36   ASN B CG    1 
ATOM   1941  O  OD1   . ASN B 1  36   ? -10.409 -0.637  -35.141 1.00 59.43  ? 36   ASN B OD1   1 
ATOM   1942  N  ND2   . ASN B 1  36   ? -12.154 0.421   -34.204 1.00 56.28  ? 36   ASN B ND2   1 
ATOM   1943  N  N     . SER B 1  37   ? -9.082  3.669   -36.120 1.00 65.56  ? 37   SER B N     1 
ATOM   1944  C  CA    . SER B 1  37   ? -9.512  4.406   -37.301 1.00 63.98  ? 37   SER B CA    1 
ATOM   1945  C  C     . SER B 1  37   ? -8.532  4.238   -38.461 1.00 62.26  ? 37   SER B C     1 
ATOM   1946  O  O     . SER B 1  37   ? -8.930  4.224   -39.624 1.00 62.81  ? 37   SER B O     1 
ATOM   1947  C  CB    . SER B 1  37   ? -9.687  5.889   -36.968 1.00 62.94  ? 37   SER B CB    1 
ATOM   1948  O  OG    . SER B 1  37   ? -8.491  6.441   -36.446 1.00 68.19  ? 37   SER B OG    1 
ATOM   1949  N  N     . LEU B 1  38   ? -7.251  4.103   -38.144 1.00 57.40  ? 38   LEU B N     1 
ATOM   1950  C  CA    . LEU B 1  38   ? -6.233  3.990   -39.179 1.00 60.02  ? 38   LEU B CA    1 
ATOM   1951  C  C     . LEU B 1  38   ? -6.175  2.569   -39.742 1.00 63.68  ? 38   LEU B C     1 
ATOM   1952  O  O     . LEU B 1  38   ? -5.672  2.347   -40.845 1.00 63.84  ? 38   LEU B O     1 
ATOM   1953  C  CB    . LEU B 1  38   ? -4.870  4.412   -38.626 1.00 58.90  ? 38   LEU B CB    1 
ATOM   1954  C  CG    . LEU B 1  38   ? -3.714  4.555   -39.615 1.00 62.47  ? 38   LEU B CG    1 
ATOM   1955  C  CD1   . LEU B 1  38   ? -4.140  5.389   -40.807 1.00 70.08  ? 38   LEU B CD1   1 
ATOM   1956  C  CD2   . LEU B 1  38   ? -2.512  5.179   -38.930 1.00 59.42  ? 38   LEU B CD2   1 
ATOM   1957  N  N     . ARG B 1  39   ? -6.706  1.614   -38.984 1.00 67.67  ? 39   ARG B N     1 
ATOM   1958  C  CA    . ARG B 1  39   ? -6.757  0.219   -39.418 1.00 75.40  ? 39   ARG B CA    1 
ATOM   1959  C  C     . ARG B 1  39   ? -7.960  -0.051  -40.326 1.00 80.55  ? 39   ARG B C     1 
ATOM   1960  O  O     . ARG B 1  39   ? -7.839  -0.734  -41.346 1.00 83.62  ? 39   ARG B O     1 
ATOM   1961  C  CB    . ARG B 1  39   ? -6.801  -0.717  -38.206 1.00 76.07  ? 39   ARG B CB    1 
ATOM   1962  C  CG    . ARG B 1  39   ? -7.124  -2.160  -38.552 1.00 70.72  ? 39   ARG B CG    1 
ATOM   1963  C  CD    . ARG B 1  39   ? -7.228  -3.029  -37.317 1.00 64.68  ? 39   ARG B CD    1 
ATOM   1964  N  NE    . ARG B 1  39   ? -7.597  -4.394  -37.675 1.00 68.08  ? 39   ARG B NE    1 
ATOM   1965  C  CZ    . ARG B 1  39   ? -8.848  -4.837  -37.715 1.00 68.10  ? 39   ARG B CZ    1 
ATOM   1966  N  NH1   . ARG B 1  39   ? -9.848  -4.023  -37.405 1.00 63.67  ? 39   ARG B NH1   1 
ATOM   1967  N  NH2   . ARG B 1  39   ? -9.100  -6.094  -38.057 1.00 65.21  ? 39   ARG B NH2   1 
ATOM   1968  N  N     . ARG B 1  40   ? -9.115  0.496   -39.953 1.00 78.12  ? 40   ARG B N     1 
ATOM   1969  C  CA    . ARG B 1  40   ? -10.342 0.334   -40.730 1.00 74.95  ? 40   ARG B CA    1 
ATOM   1970  C  C     . ARG B 1  40   ? -10.250 1.048   -42.082 1.00 78.87  ? 40   ARG B C     1 
ATOM   1971  O  O     . ARG B 1  40   ? -11.067 0.819   -42.974 1.00 82.93  ? 40   ARG B O     1 
ATOM   1972  C  CB    . ARG B 1  40   ? -11.543 0.856   -39.938 1.00 67.63  ? 40   ARG B CB    1 
ATOM   1973  C  CG    . ARG B 1  40   ? -12.882 0.338   -40.427 1.00 70.73  ? 40   ARG B CG    1 
ATOM   1974  C  CD    . ARG B 1  40   ? -12.930 -1.176  -40.374 1.00 73.45  ? 40   ARG B CD    1 
ATOM   1975  N  NE    . ARG B 1  40   ? -12.711 -1.685  -39.022 1.00 78.73  ? 40   ARG B NE    1 
ATOM   1976  C  CZ    . ARG B 1  40   ? -13.685 -2.054  -38.195 1.00 75.27  ? 40   ARG B CZ    1 
ATOM   1977  N  NH1   . ARG B 1  40   ? -14.950 -1.973  -38.584 1.00 74.96  ? 40   ARG B NH1   1 
ATOM   1978  N  NH2   . ARG B 1  40   ? -13.395 -2.509  -36.982 1.00 69.27  ? 40   ARG B NH2   1 
ATOM   1979  N  N     . THR B 1  41   ? -9.248  1.913   -42.223 1.00 78.23  ? 41   THR B N     1 
ATOM   1980  C  CA    . THR B 1  41   ? -9.002  2.638   -43.467 1.00 78.94  ? 41   THR B CA    1 
ATOM   1981  C  C     . THR B 1  41   ? -8.230  1.788   -44.469 1.00 83.85  ? 41   THR B C     1 
ATOM   1982  O  O     . THR B 1  41   ? -8.634  1.645   -45.623 1.00 85.45  ? 41   THR B O     1 
ATOM   1983  C  CB    . THR B 1  41   ? -8.213  3.931   -43.210 1.00 73.54  ? 41   THR B CB    1 
ATOM   1984  O  OG1   . THR B 1  41   ? -8.922  4.741   -42.266 1.00 67.85  ? 41   THR B OG1   1 
ATOM   1985  C  CG2   . THR B 1  41   ? -8.011  4.705   -44.507 1.00 75.58  ? 41   THR B CG2   1 
ATOM   1986  N  N     . LEU B 1  42   ? -7.113  1.232   -44.014 1.00 82.60  ? 42   LEU B N     1 
ATOM   1987  C  CA    . LEU B 1  42   ? -6.263  0.393   -44.850 1.00 82.44  ? 42   LEU B CA    1 
ATOM   1988  C  C     . LEU B 1  42   ? -6.995  -0.862  -45.326 1.00 81.65  ? 42   LEU B C     1 
ATOM   1989  O  O     . LEU B 1  42   ? -6.770  -1.342  -46.437 1.00 81.83  ? 42   LEU B O     1 
ATOM   1990  C  CB    . LEU B 1  42   ? -4.997  0.005   -44.083 1.00 81.11  ? 42   LEU B CB    1 
ATOM   1991  C  CG    . LEU B 1  42   ? -3.971  1.123   -43.883 1.00 73.37  ? 42   LEU B CG    1 
ATOM   1992  C  CD1   . LEU B 1  42   ? -3.208  0.922   -42.587 1.00 67.34  ? 42   LEU B CD1   1 
ATOM   1993  C  CD2   . LEU B 1  42   ? -3.019  1.184   -45.062 1.00 80.37  ? 42   LEU B CD2   1 
ATOM   1994  N  N     . LEU B 1  43   ? -7.880  -1.381  -44.481 1.00 82.77  ? 43   LEU B N     1 
ATOM   1995  C  CA    . LEU B 1  43   ? -8.606  -2.611  -44.781 1.00 85.29  ? 43   LEU B CA    1 
ATOM   1996  C  C     . LEU B 1  43   ? -9.836  -2.373  -45.649 1.00 90.42  ? 43   LEU B C     1 
ATOM   1997  O  O     . LEU B 1  43   ? -10.329 -3.297  -46.299 1.00 91.00  ? 43   LEU B O     1 
ATOM   1998  C  CB    . LEU B 1  43   ? -9.028  -3.306  -43.486 1.00 83.52  ? 43   LEU B CB    1 
ATOM   1999  C  CG    . LEU B 1  43   ? -7.905  -3.779  -42.563 1.00 86.60  ? 43   LEU B CG    1 
ATOM   2000  C  CD1   . LEU B 1  43   ? -8.487  -4.467  -41.340 1.00 87.00  ? 43   LEU B CD1   1 
ATOM   2001  C  CD2   . LEU B 1  43   ? -6.953  -4.704  -43.302 1.00 83.08  ? 43   LEU B CD2   1 
ATOM   2002  N  N     . SER B 1  44   ? -10.332 -1.139  -45.659 1.00 92.20  ? 44   SER B N     1 
ATOM   2003  C  CA    . SER B 1  44   ? -11.582 -0.843  -46.352 1.00 95.68  ? 44   SER B CA    1 
ATOM   2004  C  C     . SER B 1  44   ? -11.482 0.296   -47.373 1.00 99.20  ? 44   SER B C     1 
ATOM   2005  O  O     . SER B 1  44   ? -12.100 0.227   -48.432 1.00 104.14 ? 44   SER B O     1 
ATOM   2006  C  CB    . SER B 1  44   ? -12.683 -0.520  -45.333 1.00 87.83  ? 44   SER B CB    1 
ATOM   2007  O  OG    . SER B 1  44   ? -12.925 -1.617  -44.466 1.00 79.32  ? 44   SER B OG    1 
ATOM   2008  N  N     . SER B 1  45   ? -10.711 1.336   -47.070 1.00 96.09  ? 45   SER B N     1 
ATOM   2009  C  CA    . SER B 1  45   ? -10.755 2.546   -47.891 1.00 100.25 ? 45   SER B CA    1 
ATOM   2010  C  C     . SER B 1  45   ? -9.609  2.659   -48.895 1.00 99.12  ? 45   SER B C     1 
ATOM   2011  O  O     . SER B 1  45   ? -9.108  3.755   -49.155 1.00 92.84  ? 45   SER B O     1 
ATOM   2012  C  CB    . SER B 1  45   ? -10.771 3.790   -46.998 1.00 97.56  ? 45   SER B CB    1 
ATOM   2013  O  OG    . SER B 1  45   ? -11.121 4.943   -47.742 1.00 92.10  ? 45   SER B OG    1 
ATOM   2014  N  N     . ILE B 1  46   ? -9.200  1.527   -49.460 1.00 98.60  ? 46   ILE B N     1 
ATOM   2015  C  CA    . ILE B 1  46   ? -8.242  1.528   -50.558 1.00 99.78  ? 46   ILE B CA    1 
ATOM   2016  C  C     . ILE B 1  46   ? -8.766  0.644   -51.688 1.00 102.67 ? 46   ILE B C     1 
ATOM   2017  O  O     . ILE B 1  46   ? -9.141  -0.506  -51.454 1.00 95.69  ? 46   ILE B O     1 
ATOM   2018  C  CB    . ILE B 1  46   ? -6.850  1.041   -50.116 1.00 91.27  ? 46   ILE B CB    1 
ATOM   2019  C  CG1   . ILE B 1  46   ? -6.321  1.901   -48.966 1.00 94.67  ? 46   ILE B CG1   1 
ATOM   2020  C  CG2   . ILE B 1  46   ? -5.876  1.110   -51.271 1.00 87.83  ? 46   ILE B CG2   1 
ATOM   2021  C  CD1   . ILE B 1  46   ? -6.012  3.330   -49.368 1.00 89.21  ? 46   ILE B CD1   1 
ATOM   2022  N  N     . PRO B 1  47   ? -8.816  1.190   -52.919 1.00 108.69 ? 47   PRO B N     1 
ATOM   2023  C  CA    . PRO B 1  47   ? -9.367  0.485   -54.083 1.00 103.58 ? 47   PRO B CA    1 
ATOM   2024  C  C     . PRO B 1  47   ? -8.330  -0.342  -54.849 1.00 105.75 ? 47   PRO B C     1 
ATOM   2025  O  O     . PRO B 1  47   ? -7.175  0.065   -54.986 1.00 102.72 ? 47   PRO B O     1 
ATOM   2026  C  CB    . PRO B 1  47   ? -9.896  1.624   -54.950 1.00 98.59  ? 47   PRO B CB    1 
ATOM   2027  C  CG    . PRO B 1  47   ? -8.967  2.762   -54.662 1.00 103.68 ? 47   PRO B CG    1 
ATOM   2028  C  CD    . PRO B 1  47   ? -8.483  2.591   -53.236 1.00 107.25 ? 47   PRO B CD    1 
ATOM   2029  N  N     . GLY B 1  48   ? -8.752  -1.497  -55.354 1.00 107.55 ? 48   GLY B N     1 
ATOM   2030  C  CA    . GLY B 1  48   ? -7.876  -2.370  -56.116 1.00 113.31 ? 48   GLY B CA    1 
ATOM   2031  C  C     . GLY B 1  48   ? -8.683  -3.174  -57.121 1.00 117.79 ? 48   GLY B C     1 
ATOM   2032  O  O     . GLY B 1  48   ? -9.667  -2.679  -57.686 1.00 121.43 ? 48   GLY B O     1 
ATOM   2033  N  N     . ALA B 1  49   ? -8.281  -4.423  -57.340 1.00 112.88 ? 49   ALA B N     1 
ATOM   2034  C  CA    . ALA B 1  49   ? -8.992  -5.299  -58.276 1.00 113.35 ? 49   ALA B CA    1 
ATOM   2035  C  C     . ALA B 1  49   ? -8.898  -6.762  -57.848 1.00 113.90 ? 49   ALA B C     1 
ATOM   2036  O  O     . ALA B 1  49   ? -7.829  -7.245  -57.471 1.00 110.79 ? 49   ALA B O     1 
ATOM   2037  C  CB    . ALA B 1  49   ? -8.455  -5.125  -59.682 1.00 113.25 ? 49   ALA B CB    1 
ATOM   2038  N  N     . ALA B 1  50   ? -10.030 -7.456  -57.902 1.00 116.37 ? 50   ALA B N     1 
ATOM   2039  C  CA    . ALA B 1  50   ? -10.093 -8.875  -57.579 1.00 110.56 ? 50   ALA B CA    1 
ATOM   2040  C  C     . ALA B 1  50   ? -11.214 -9.543  -58.362 1.00 112.04 ? 50   ALA B C     1 
ATOM   2041  O  O     . ALA B 1  50   ? -11.860 -8.911  -59.197 1.00 117.31 ? 50   ALA B O     1 
ATOM   2042  C  CB    . ALA B 1  50   ? -10.293 -9.075  -56.086 1.00 112.19 ? 50   ALA B CB    1 
ATOM   2043  N  N     . VAL B 1  51   ? -11.452 -10.819 -58.081 1.00 111.74 ? 51   VAL B N     1 
ATOM   2044  C  CA    . VAL B 1  51   ? -12.419 -11.600 -58.843 1.00 117.18 ? 51   VAL B CA    1 
ATOM   2045  C  C     . VAL B 1  51   ? -13.822 -11.556 -58.237 1.00 115.85 ? 51   VAL B C     1 
ATOM   2046  O  O     . VAL B 1  51   ? -14.010 -11.840 -57.053 1.00 116.48 ? 51   VAL B O     1 
ATOM   2047  C  CB    . VAL B 1  51   ? -11.973 -13.071 -58.962 1.00 112.43 ? 51   VAL B CB    1 
ATOM   2048  C  CG1   . VAL B 1  51   ? -12.972 -13.867 -59.783 1.00 114.99 ? 51   VAL B CG1   1 
ATOM   2049  C  CG2   . VAL B 1  51   ? -10.585 -13.150 -59.584 1.00 111.42 ? 51   VAL B CG2   1 
ATOM   2050  N  N     . THR B 1  52   ? -14.800 -11.200 -59.064 1.00 117.35 ? 52   THR B N     1 
ATOM   2051  C  CA    . THR B 1  52   ? -16.201 -11.153 -58.657 1.00 118.94 ? 52   THR B CA    1 
ATOM   2052  C  C     . THR B 1  52   ? -16.895 -12.497 -58.872 1.00 118.46 ? 52   THR B C     1 
ATOM   2053  O  O     . THR B 1  52   ? -17.565 -13.012 -57.976 1.00 114.58 ? 52   THR B O     1 
ATOM   2054  C  CB    . THR B 1  52   ? -16.968 -10.064 -59.432 1.00 127.80 ? 52   THR B CB    1 
ATOM   2055  O  OG1   . THR B 1  52   ? -16.434 -8.774  -59.105 1.00 125.48 ? 52   THR B OG1   1 
ATOM   2056  C  CG2   . THR B 1  52   ? -18.451 -10.102 -59.089 1.00 134.43 ? 52   THR B CG2   1 
ATOM   2057  N  N     . SER B 1  53   ? -16.729 -13.056 -60.068 1.00 125.65 ? 53   SER B N     1 
ATOM   2058  C  CA    . SER B 1  53   ? -17.364 -14.322 -60.424 1.00 127.74 ? 53   SER B CA    1 
ATOM   2059  C  C     . SER B 1  53   ? -16.550 -15.112 -61.453 1.00 129.66 ? 53   SER B C     1 
ATOM   2060  O  O     . SER B 1  53   ? -15.770 -14.536 -62.214 1.00 125.36 ? 53   SER B O     1 
ATOM   2061  C  CB    . SER B 1  53   ? -18.772 -14.071 -60.960 1.00 129.85 ? 53   SER B CB    1 
ATOM   2062  O  OG    . SER B 1  53   ? -18.739 -13.207 -62.083 1.00 135.56 ? 53   SER B OG    1 
ATOM   2063  N  N     . ILE B 1  54   ? -16.734 -16.432 -61.469 1.00 128.88 ? 54   ILE B N     1 
ATOM   2064  C  CA    . ILE B 1  54   ? -16.053 -17.304 -62.430 1.00 130.51 ? 54   ILE B CA    1 
ATOM   2065  C  C     . ILE B 1  54   ? -17.018 -18.261 -63.127 1.00 135.06 ? 54   ILE B C     1 
ATOM   2066  O  O     . ILE B 1  54   ? -18.189 -18.356 -62.760 1.00 134.16 ? 54   ILE B O     1 
ATOM   2067  C  CB    . ILE B 1  54   ? -14.944 -18.154 -61.765 1.00 125.13 ? 54   ILE B CB    1 
ATOM   2068  C  CG1   . ILE B 1  54   ? -15.554 -19.185 -60.811 1.00 125.67 ? 54   ILE B CG1   1 
ATOM   2069  C  CG2   . ILE B 1  54   ? -13.938 -17.272 -61.050 1.00 127.84 ? 54   ILE B CG2   1 
ATOM   2070  C  CD1   . ILE B 1  54   ? -14.541 -20.137 -60.207 1.00 115.51 ? 54   ILE B CD1   1 
ATOM   2071  N  N     . ARG B 1  55   ? -16.507 -18.973 -64.130 1.00 133.24 ? 55   ARG B N     1 
ATOM   2072  C  CA    . ARG B 1  55   ? -17.282 -19.968 -64.866 1.00 131.94 ? 55   ARG B CA    1 
ATOM   2073  C  C     . ARG B 1  55   ? -16.401 -21.149 -65.277 1.00 130.85 ? 55   ARG B C     1 
ATOM   2074  O  O     . ARG B 1  55   ? -15.312 -20.964 -65.823 1.00 124.59 ? 55   ARG B O     1 
ATOM   2075  C  CB    . ARG B 1  55   ? -17.937 -19.337 -66.102 1.00 137.24 ? 55   ARG B CB    1 
ATOM   2076  C  CG    . ARG B 1  55   ? -19.133 -18.437 -65.789 1.00 146.66 ? 55   ARG B CG    1 
ATOM   2077  C  CD    . ARG B 1  55   ? -19.622 -17.677 -67.017 1.00 143.83 ? 55   ARG B CD    1 
ATOM   2078  N  NE    . ARG B 1  55   ? -20.128 -18.566 -68.059 1.00 142.57 ? 55   ARG B NE    1 
ATOM   2079  C  CZ    . ARG B 1  55   ? -20.550 -18.154 -69.250 1.00 137.79 ? 55   ARG B CZ    1 
ATOM   2080  N  NH1   . ARG B 1  55   ? -20.528 -16.863 -69.552 1.00 129.92 ? 55   ARG B NH1   1 
ATOM   2081  N  NH2   . ARG B 1  55   ? -20.994 -19.033 -70.139 1.00 143.69 ? 55   ARG B NH2   1 
ATOM   2082  N  N     . ILE B 1  56   ? -16.874 -22.361 -65.002 1.00 138.79 ? 56   ILE B N     1 
ATOM   2083  C  CA    . ILE B 1  56   ? -16.146 -23.574 -65.364 1.00 141.33 ? 56   ILE B CA    1 
ATOM   2084  C  C     . ILE B 1  56   ? -16.935 -24.383 -66.389 1.00 154.57 ? 56   ILE B C     1 
ATOM   2085  O  O     . ILE B 1  56   ? -18.157 -24.497 -66.292 1.00 160.98 ? 56   ILE B O     1 
ATOM   2086  C  CB    . ILE B 1  56   ? -15.861 -24.451 -64.135 1.00 134.42 ? 56   ILE B CB    1 
ATOM   2087  C  CG1   . ILE B 1  56   ? -15.349 -23.591 -62.981 1.00 135.24 ? 56   ILE B CG1   1 
ATOM   2088  C  CG2   . ILE B 1  56   ? -14.859 -25.543 -64.480 1.00 137.38 ? 56   ILE B CG2   1 
ATOM   2089  C  CD1   . ILE B 1  56   ? -15.185 -24.348 -61.688 1.00 148.06 ? 56   ILE B CD1   1 
ATOM   2090  N  N     . ASP B 1  57   ? -16.229 -24.949 -67.364 1.00 150.84 ? 57   ASP B N     1 
ATOM   2091  C  CA    . ASP B 1  57   ? -16.871 -25.622 -68.489 1.00 148.36 ? 57   ASP B CA    1 
ATOM   2092  C  C     . ASP B 1  57   ? -17.559 -26.928 -68.088 1.00 149.18 ? 57   ASP B C     1 
ATOM   2093  O  O     . ASP B 1  57   ? -18.736 -27.133 -68.387 1.00 145.53 ? 57   ASP B O     1 
ATOM   2094  C  CB    . ASP B 1  57   ? -15.846 -25.895 -69.592 1.00 138.99 ? 57   ASP B CB    1 
ATOM   2095  C  CG    . ASP B 1  57   ? -16.483 -26.017 -70.963 1.00 138.23 ? 57   ASP B CG    1 
ATOM   2096  O  OD1   . ASP B 1  57   ? -17.730 -26.045 -71.042 1.00 135.49 ? 57   ASP B OD1   1 
ATOM   2097  O  OD2   . ASP B 1  57   ? -15.737 -26.090 -71.962 1.00 138.98 ? 57   ASP B OD2   1 
ATOM   2098  N  N     . GLY B 1  58   ? -16.826 -27.809 -67.413 1.00 149.83 ? 58   GLY B N     1 
ATOM   2099  C  CA    . GLY B 1  58   ? -17.356 -29.109 -67.040 1.00 147.07 ? 58   GLY B CA    1 
ATOM   2100  C  C     . GLY B 1  58   ? -18.016 -29.142 -65.674 1.00 152.90 ? 58   GLY B C     1 
ATOM   2101  O  O     . GLY B 1  58   ? -17.822 -30.086 -64.907 1.00 151.86 ? 58   GLY B O     1 
ATOM   2102  N  N     . VAL B 1  59   ? -18.802 -28.111 -65.371 1.00 158.89 ? 59   VAL B N     1 
ATOM   2103  C  CA    . VAL B 1  59   ? -19.503 -28.020 -64.091 1.00 165.91 ? 59   VAL B CA    1 
ATOM   2104  C  C     . VAL B 1  59   ? -20.966 -27.607 -64.270 1.00 163.03 ? 59   VAL B C     1 
ATOM   2105  O  O     . VAL B 1  59   ? -21.254 -26.518 -64.769 1.00 156.49 ? 59   VAL B O     1 
ATOM   2106  C  CB    . VAL B 1  59   ? -18.812 -27.013 -63.136 1.00 160.05 ? 59   VAL B CB    1 
ATOM   2107  C  CG1   . VAL B 1  59   ? -19.706 -26.696 -61.944 1.00 156.18 ? 59   VAL B CG1   1 
ATOM   2108  C  CG2   . VAL B 1  59   ? -17.466 -27.550 -62.668 1.00 154.43 ? 59   VAL B CG2   1 
ATOM   2109  N  N     . LEU B 1  60   ? -21.884 -28.483 -63.866 1.00 162.02 ? 60   LEU B N     1 
ATOM   2110  C  CA    . LEU B 1  60   ? -23.310 -28.156 -63.852 1.00 158.70 ? 60   LEU B CA    1 
ATOM   2111  C  C     . LEU B 1  60   ? -23.817 -28.091 -62.415 1.00 157.47 ? 60   LEU B C     1 
ATOM   2112  O  O     . LEU B 1  60   ? -24.916 -27.599 -62.151 1.00 153.88 ? 60   LEU B O     1 
ATOM   2113  C  CB    . LEU B 1  60   ? -24.122 -29.172 -64.661 1.00 154.08 ? 60   LEU B CB    1 
ATOM   2114  C  CG    . LEU B 1  60   ? -24.145 -28.980 -66.181 1.00 153.05 ? 60   LEU B CG    1 
ATOM   2115  C  CD1   . LEU B 1  60   ? -22.862 -29.485 -66.827 1.00 161.39 ? 60   LEU B CD1   1 
ATOM   2116  C  CD2   . LEU B 1  60   ? -25.363 -29.653 -66.798 1.00 144.73 ? 60   LEU B CD2   1 
ATOM   2117  N  N     . HIS B 1  61   ? -23.008 -28.602 -61.492 1.00 160.13 ? 61   HIS B N     1 
ATOM   2118  C  CA    . HIS B 1  61   ? -23.241 -28.419 -60.064 1.00 166.11 ? 61   HIS B CA    1 
ATOM   2119  C  C     . HIS B 1  61   ? -21.909 -28.504 -59.311 1.00 169.88 ? 61   HIS B C     1 
ATOM   2120  O  O     . HIS B 1  61   ? -20.914 -28.994 -59.849 1.00 169.24 ? 61   HIS B O     1 
ATOM   2121  C  CB    . HIS B 1  61   ? -24.257 -29.438 -59.529 1.00 165.57 ? 61   HIS B CB    1 
ATOM   2122  C  CG    . HIS B 1  61   ? -23.868 -30.868 -59.742 1.00 164.30 ? 61   HIS B CG    1 
ATOM   2123  N  ND1   . HIS B 1  61   ? -23.760 -31.434 -60.994 1.00 167.68 ? 61   HIS B ND1   1 
ATOM   2124  C  CD2   . HIS B 1  61   ? -23.590 -31.855 -58.858 1.00 159.16 ? 61   HIS B CD2   1 
ATOM   2125  C  CE1   . HIS B 1  61   ? -23.416 -32.704 -60.872 1.00 168.77 ? 61   HIS B CE1   1 
ATOM   2126  N  NE2   . HIS B 1  61   ? -23.308 -32.985 -59.586 1.00 159.97 ? 61   HIS B NE2   1 
ATOM   2127  N  N     . GLU B 1  62   ? -21.900 -28.019 -58.072 1.00 171.54 ? 62   GLU B N     1 
ATOM   2128  C  CA    . GLU B 1  62   ? -20.657 -27.742 -57.349 1.00 173.58 ? 62   GLU B CA    1 
ATOM   2129  C  C     . GLU B 1  62   ? -19.986 -28.942 -56.681 1.00 173.99 ? 62   GLU B C     1 
ATOM   2130  O  O     . GLU B 1  62   ? -18.758 -28.978 -56.563 1.00 167.60 ? 62   GLU B O     1 
ATOM   2131  C  CB    . GLU B 1  62   ? -20.910 -26.673 -56.282 1.00 169.89 ? 62   GLU B CB    1 
ATOM   2132  C  CG    . GLU B 1  62   ? -20.642 -25.253 -56.747 1.00 168.83 ? 62   GLU B CG    1 
ATOM   2133  C  CD    . GLU B 1  62   ? -21.555 -24.828 -57.877 1.00 175.93 ? 62   GLU B CD    1 
ATOM   2134  O  OE1   . GLU B 1  62   ? -21.074 -24.140 -58.802 1.00 178.62 ? 62   GLU B OE1   1 
ATOM   2135  O  OE2   . GLU B 1  62   ? -22.754 -25.177 -57.838 1.00 174.42 ? 62   GLU B OE2   1 
ATOM   2136  N  N     . PHE B 1  63   ? -20.780 -29.910 -56.233 1.00 168.69 ? 63   PHE B N     1 
ATOM   2137  C  CA    . PHE B 1  63   ? -20.249 -31.007 -55.429 1.00 167.41 ? 63   PHE B CA    1 
ATOM   2138  C  C     . PHE B 1  63   ? -19.236 -31.851 -56.205 1.00 172.69 ? 63   PHE B C     1 
ATOM   2139  O  O     . PHE B 1  63   ? -18.201 -32.242 -55.662 1.00 170.09 ? 63   PHE B O     1 
ATOM   2140  C  CB    . PHE B 1  63   ? -21.385 -31.889 -54.907 1.00 158.86 ? 63   PHE B CB    1 
ATOM   2141  C  CG    . PHE B 1  63   ? -21.033 -32.648 -53.658 1.00 165.07 ? 63   PHE B CG    1 
ATOM   2142  C  CD1   . PHE B 1  63   ? -20.921 -31.991 -52.442 1.00 161.73 ? 63   PHE B CD1   1 
ATOM   2143  C  CD2   . PHE B 1  63   ? -20.813 -34.015 -53.697 1.00 165.43 ? 63   PHE B CD2   1 
ATOM   2144  C  CE1   . PHE B 1  63   ? -20.594 -32.682 -51.289 1.00 153.73 ? 63   PHE B CE1   1 
ATOM   2145  C  CE2   . PHE B 1  63   ? -20.487 -34.712 -52.547 1.00 161.58 ? 63   PHE B CE2   1 
ATOM   2146  C  CZ    . PHE B 1  63   ? -20.377 -34.044 -51.342 1.00 156.96 ? 63   PHE B CZ    1 
ATOM   2147  N  N     . THR B 1  64   ? -19.527 -32.117 -57.476 1.00 175.09 ? 64   THR B N     1 
ATOM   2148  C  CA    . THR B 1  64   ? -18.601 -32.869 -58.318 1.00 170.53 ? 64   THR B CA    1 
ATOM   2149  C  C     . THR B 1  64   ? -17.389 -32.024 -58.703 1.00 167.61 ? 64   THR B C     1 
ATOM   2150  O  O     . THR B 1  64   ? -17.526 -30.871 -59.115 1.00 167.81 ? 64   THR B O     1 
ATOM   2151  C  CB    . THR B 1  64   ? -19.282 -33.386 -59.606 1.00 160.76 ? 64   THR B CB    1 
ATOM   2152  O  OG1   . THR B 1  64   ? -19.835 -32.285 -60.341 1.00 162.32 ? 64   THR B OG1   1 
ATOM   2153  C  CG2   . THR B 1  64   ? -20.385 -34.376 -59.268 1.00 155.15 ? 64   THR B CG2   1 
ATOM   2154  N  N     . THR B 1  65   ? -16.202 -32.606 -58.559 1.00 162.69 ? 65   THR B N     1 
ATOM   2155  C  CA    . THR B 1  65   ? -14.966 -31.944 -58.959 1.00 159.77 ? 65   THR B CA    1 
ATOM   2156  C  C     . THR B 1  65   ? -14.859 -31.881 -60.478 1.00 167.48 ? 65   THR B C     1 
ATOM   2157  O  O     . THR B 1  65   ? -15.470 -32.684 -61.185 1.00 169.91 ? 65   THR B O     1 
ATOM   2158  C  CB    . THR B 1  65   ? -13.726 -32.664 -58.404 1.00 150.93 ? 65   THR B CB    1 
ATOM   2159  O  OG1   . THR B 1  65   ? -13.569 -33.925 -59.067 1.00 149.53 ? 65   THR B OG1   1 
ATOM   2160  C  CG2   . THR B 1  65   ? -13.863 -32.891 -56.907 1.00 148.92 ? 65   THR B CG2   1 
ATOM   2161  N  N     . VAL B 1  66   ? -14.076 -30.930 -60.974 1.00 166.99 ? 66   VAL B N     1 
ATOM   2162  C  CA    . VAL B 1  66   ? -13.904 -30.749 -62.411 1.00 160.26 ? 66   VAL B CA    1 
ATOM   2163  C  C     . VAL B 1  66   ? -13.142 -31.923 -63.021 1.00 156.41 ? 66   VAL B C     1 
ATOM   2164  O  O     . VAL B 1  66   ? -12.094 -32.317 -62.508 1.00 156.73 ? 66   VAL B O     1 
ATOM   2165  C  CB    . VAL B 1  66   ? -13.167 -29.433 -62.719 1.00 153.62 ? 66   VAL B CB    1 
ATOM   2166  C  CG1   . VAL B 1  66   ? -13.018 -29.236 -64.221 1.00 149.49 ? 66   VAL B CG1   1 
ATOM   2167  C  CG2   . VAL B 1  66   ? -13.906 -28.263 -62.093 1.00 153.32 ? 66   VAL B CG2   1 
ATOM   2168  N  N     . PRO B 1  67   ? -13.682 -32.496 -64.109 1.00 150.54 ? 67   PRO B N     1 
ATOM   2169  C  CA    . PRO B 1  67   ? -13.068 -33.629 -64.810 1.00 145.97 ? 67   PRO B CA    1 
ATOM   2170  C  C     . PRO B 1  67   ? -11.607 -33.389 -65.195 1.00 142.25 ? 67   PRO B C     1 
ATOM   2171  O  O     . PRO B 1  67   ? -11.319 -32.554 -66.053 1.00 138.42 ? 67   PRO B O     1 
ATOM   2172  C  CB    . PRO B 1  67   ? -13.940 -33.772 -66.060 1.00 148.61 ? 67   PRO B CB    1 
ATOM   2173  C  CG    . PRO B 1  67   ? -15.273 -33.270 -65.633 1.00 141.75 ? 67   PRO B CG    1 
ATOM   2174  C  CD    . PRO B 1  67   ? -14.990 -32.137 -64.686 1.00 145.93 ? 67   PRO B CD    1 
ATOM   2175  N  N     . GLY B 1  68   ? -10.698 -34.117 -64.552 1.00 142.32 ? 68   GLY B N     1 
ATOM   2176  C  CA    . GLY B 1  68   ? -9.285  -34.036 -64.877 1.00 147.68 ? 68   GLY B CA    1 
ATOM   2177  C  C     . GLY B 1  68   ? -8.455  -33.196 -63.920 1.00 148.73 ? 68   GLY B C     1 
ATOM   2178  O  O     . GLY B 1  68   ? -7.264  -32.981 -64.150 1.00 139.15 ? 68   GLY B O     1 
ATOM   2179  N  N     . VAL B 1  69   ? -9.079  -32.727 -62.843 1.00 154.99 ? 69   VAL B N     1 
ATOM   2180  C  CA    . VAL B 1  69   ? -8.405  -31.864 -61.874 1.00 145.34 ? 69   VAL B CA    1 
ATOM   2181  C  C     . VAL B 1  69   ? -8.278  -32.534 -60.506 1.00 142.18 ? 69   VAL B C     1 
ATOM   2182  O  O     . VAL B 1  69   ? -9.212  -33.184 -60.035 1.00 143.38 ? 69   VAL B O     1 
ATOM   2183  C  CB    . VAL B 1  69   ? -9.154  -30.527 -61.701 1.00 143.59 ? 69   VAL B CB    1 
ATOM   2184  C  CG1   . VAL B 1  69   ? -8.276  -29.512 -60.988 1.00 135.60 ? 69   VAL B CG1   1 
ATOM   2185  C  CG2   . VAL B 1  69   ? -9.600  -29.991 -63.049 1.00 140.40 ? 69   VAL B CG2   1 
ATOM   2186  N  N     . LYS B 1  70   ? -7.123  -32.365 -59.869 1.00 135.08 ? 70   LYS B N     1 
ATOM   2187  C  CA    . LYS B 1  70   ? -6.892  -32.928 -58.542 1.00 136.11 ? 70   LYS B CA    1 
ATOM   2188  C  C     . LYS B 1  70   ? -7.796  -32.283 -57.493 1.00 140.62 ? 70   LYS B C     1 
ATOM   2189  O  O     . LYS B 1  70   ? -8.485  -32.973 -56.738 1.00 139.77 ? 70   LYS B O     1 
ATOM   2190  C  CB    . LYS B 1  70   ? -5.425  -32.761 -58.137 1.00 128.95 ? 70   LYS B CB    1 
ATOM   2191  C  CG    . LYS B 1  70   ? -5.099  -33.313 -56.756 1.00 126.38 ? 70   LYS B CG    1 
ATOM   2192  C  CD    . LYS B 1  70   ? -3.658  -33.031 -56.358 1.00 121.32 ? 70   LYS B CD    1 
ATOM   2193  C  CE    . LYS B 1  70   ? -3.346  -33.598 -54.982 1.00 110.69 ? 70   LYS B CE    1 
ATOM   2194  N  NZ    . LYS B 1  70   ? -1.955  -33.293 -54.551 1.00 103.90 ? 70   LYS B NZ    1 
ATOM   2195  N  N     . GLU B 1  71   ? -7.790  -30.955 -57.464 1.00 141.53 ? 71   GLU B N     1 
ATOM   2196  C  CA    . GLU B 1  71   ? -8.486  -30.192 -56.433 1.00 138.33 ? 71   GLU B CA    1 
ATOM   2197  C  C     . GLU B 1  71   ? -9.999  -30.198 -56.625 1.00 137.82 ? 71   GLU B C     1 
ATOM   2198  O  O     . GLU B 1  71   ? -10.495 -30.314 -57.747 1.00 135.25 ? 71   GLU B O     1 
ATOM   2199  C  CB    . GLU B 1  71   ? -7.978  -28.746 -56.408 1.00 132.49 ? 71   GLU B CB    1 
ATOM   2200  C  CG    . GLU B 1  71   ? -6.499  -28.594 -56.071 1.00 129.56 ? 71   GLU B CG    1 
ATOM   2201  C  CD    . GLU B 1  71   ? -5.585  -28.959 -57.227 1.00 127.54 ? 71   GLU B CD    1 
ATOM   2202  O  OE1   . GLU B 1  71   ? -6.094  -29.206 -58.341 1.00 125.41 ? 71   GLU B OE1   1 
ATOM   2203  O  OE2   . GLU B 1  71   ? -4.355  -29.002 -57.018 1.00 129.87 ? 71   GLU B OE2   1 
ATOM   2204  N  N     . ASP B 1  72   ? -10.724 -30.072 -55.518 1.00 135.34 ? 72   ASP B N     1 
ATOM   2205  C  CA    . ASP B 1  72   ? -12.175 -29.951 -55.561 1.00 136.95 ? 72   ASP B CA    1 
ATOM   2206  C  C     . ASP B 1  72   ? -12.548 -28.560 -56.057 1.00 129.75 ? 72   ASP B C     1 
ATOM   2207  O  O     . ASP B 1  72   ? -11.695 -27.680 -56.142 1.00 121.18 ? 72   ASP B O     1 
ATOM   2208  C  CB    . ASP B 1  72   ? -12.786 -30.212 -54.179 1.00 135.28 ? 72   ASP B CB    1 
ATOM   2209  C  CG    . ASP B 1  72   ? -14.284 -30.479 -54.237 1.00 135.52 ? 72   ASP B CG    1 
ATOM   2210  O  OD1   . ASP B 1  72   ? -14.928 -30.096 -55.238 1.00 129.86 ? 72   ASP B OD1   1 
ATOM   2211  O  OD2   . ASP B 1  72   ? -14.819 -31.069 -53.277 1.00 138.22 ? 72   ASP B OD2   1 
ATOM   2212  N  N     . VAL B 1  73   ? -13.823 -28.371 -56.383 1.00 131.26 ? 73   VAL B N     1 
ATOM   2213  C  CA    . VAL B 1  73   ? -14.332 -27.072 -56.809 1.00 129.07 ? 73   VAL B CA    1 
ATOM   2214  C  C     . VAL B 1  73   ? -14.020 -26.008 -55.763 1.00 119.97 ? 73   VAL B C     1 
ATOM   2215  O  O     . VAL B 1  73   ? -13.691 -24.869 -56.091 1.00 112.11 ? 73   VAL B O     1 
ATOM   2216  C  CB    . VAL B 1  73   ? -15.853 -27.131 -57.063 1.00 132.43 ? 73   VAL B CB    1 
ATOM   2217  C  CG1   . VAL B 1  73   ? -16.420 -25.740 -57.326 1.00 136.32 ? 73   VAL B CG1   1 
ATOM   2218  C  CG2   . VAL B 1  73   ? -16.155 -28.069 -58.221 1.00 133.62 ? 73   VAL B CG2   1 
ATOM   2219  N  N     . THR B 1  74   ? -14.098 -26.408 -54.499 1.00 120.98 ? 74   THR B N     1 
ATOM   2220  C  CA    . THR B 1  74   ? -13.869 -25.510 -53.376 1.00 118.93 ? 74   THR B CA    1 
ATOM   2221  C  C     . THR B 1  74   ? -12.452 -24.934 -53.340 1.00 118.96 ? 74   THR B C     1 
ATOM   2222  O  O     . THR B 1  74   ? -12.271 -23.717 -53.355 1.00 114.21 ? 74   THR B O     1 
ATOM   2223  C  CB    . THR B 1  74   ? -14.140 -26.230 -52.045 1.00 115.41 ? 74   THR B CB    1 
ATOM   2224  O  OG1   . THR B 1  74   ? -13.216 -27.314 -51.894 1.00 116.70 ? 74   THR B OG1   1 
ATOM   2225  C  CG2   . THR B 1  74   ? -15.557 -26.778 -52.022 1.00 110.68 ? 74   THR B CG2   1 
ATOM   2226  N  N     . GLU B 1  75   ? -11.455 -25.814 -53.294 1.00 119.23 ? 75   GLU B N     1 
ATOM   2227  C  CA    . GLU B 1  75   ? -10.063 -25.405 -53.102 1.00 113.32 ? 75   GLU B CA    1 
ATOM   2228  C  C     . GLU B 1  75   ? -9.507  -24.574 -54.254 1.00 113.79 ? 75   GLU B C     1 
ATOM   2229  O  O     . GLU B 1  75   ? -8.526  -23.849 -54.086 1.00 108.69 ? 75   GLU B O     1 
ATOM   2230  C  CB    . GLU B 1  75   ? -9.185  -26.634 -52.887 1.00 111.54 ? 75   GLU B CB    1 
ATOM   2231  C  CG    . GLU B 1  75   ? -9.498  -27.368 -51.603 1.00 114.52 ? 75   GLU B CG    1 
ATOM   2232  C  CD    . GLU B 1  75   ? -8.781  -28.692 -51.502 1.00 118.11 ? 75   GLU B CD    1 
ATOM   2233  O  OE1   . GLU B 1  75   ? -8.449  -29.271 -52.557 1.00 121.38 ? 75   GLU B OE1   1 
ATOM   2234  O  OE2   . GLU B 1  75   ? -8.549  -29.152 -50.365 1.00 117.20 ? 75   GLU B OE2   1 
ATOM   2235  N  N     . ILE B 1  76   ? -10.134 -24.686 -55.421 1.00 119.34 ? 76   ILE B N     1 
ATOM   2236  C  CA    . ILE B 1  76   ? -9.738  -23.899 -56.583 1.00 116.51 ? 76   ILE B CA    1 
ATOM   2237  C  C     . ILE B 1  76   ? -10.166 -22.450 -56.400 1.00 107.75 ? 76   ILE B C     1 
ATOM   2238  O  O     . ILE B 1  76   ? -9.423  -21.521 -56.724 1.00 101.69 ? 76   ILE B O     1 
ATOM   2239  C  CB    . ILE B 1  76   ? -10.352 -24.458 -57.877 1.00 110.33 ? 76   ILE B CB    1 
ATOM   2240  C  CG1   . ILE B 1  76   ? -9.993  -25.935 -58.035 1.00 114.58 ? 76   ILE B CG1   1 
ATOM   2241  C  CG2   . ILE B 1  76   ? -9.867  -23.665 -59.077 1.00 107.95 ? 76   ILE B CG2   1 
ATOM   2242  C  CD1   . ILE B 1  76   ? -10.750 -26.635 -59.135 1.00 116.32 ? 76   ILE B CD1   1 
ATOM   2243  N  N     . ILE B 1  77   ? -11.375 -22.274 -55.876 1.00 107.66 ? 77   ILE B N     1 
ATOM   2244  C  CA    . ILE B 1  77   ? -11.910 -20.956 -55.566 1.00 103.88 ? 77   ILE B CA    1 
ATOM   2245  C  C     . ILE B 1  77   ? -10.984 -20.213 -54.609 1.00 102.59 ? 77   ILE B C     1 
ATOM   2246  O  O     . ILE B 1  77   ? -10.720 -19.022 -54.776 1.00 101.43 ? 77   ILE B O     1 
ATOM   2247  C  CB    . ILE B 1  77   ? -13.318 -21.064 -54.947 1.00 95.74  ? 77   ILE B CB    1 
ATOM   2248  C  CG1   . ILE B 1  77   ? -14.252 -21.811 -55.896 1.00 95.91  ? 77   ILE B CG1   1 
ATOM   2249  C  CG2   . ILE B 1  77   ? -13.878 -19.691 -54.637 1.00 94.39  ? 77   ILE B CG2   1 
ATOM   2250  C  CD1   . ILE B 1  77   ? -15.549 -22.231 -55.262 1.00 104.78 ? 77   ILE B CD1   1 
ATOM   2251  N  N     . LEU B 1  78   ? -10.472 -20.936 -53.619 1.00 101.10 ? 78   LEU B N     1 
ATOM   2252  C  CA    . LEU B 1  78   ? -9.646  -20.341 -52.574 1.00 98.94  ? 78   LEU B CA    1 
ATOM   2253  C  C     . LEU B 1  78   ? -8.305  -19.869 -53.117 1.00 99.12  ? 78   LEU B C     1 
ATOM   2254  O  O     . LEU B 1  78   ? -7.824  -18.795 -52.756 1.00 97.50  ? 78   LEU B O     1 
ATOM   2255  C  CB    . LEU B 1  78   ? -9.432  -21.338 -51.435 1.00 98.73  ? 78   LEU B CB    1 
ATOM   2256  C  CG    . LEU B 1  78   ? -10.493 -21.365 -50.331 1.00 99.00  ? 78   LEU B CG    1 
ATOM   2257  C  CD1   . LEU B 1  78   ? -11.896 -21.550 -50.897 1.00 100.74 ? 78   LEU B CD1   1 
ATOM   2258  C  CD2   . LEU B 1  78   ? -10.171 -22.461 -49.329 1.00 96.85  ? 78   LEU B CD2   1 
ATOM   2259  N  N     . ASN B 1  79   ? -7.706  -20.679 -53.983 1.00 103.66 ? 79   ASN B N     1 
ATOM   2260  C  CA    . ASN B 1  79   ? -6.465  -20.307 -54.651 1.00 108.63 ? 79   ASN B CA    1 
ATOM   2261  C  C     . ASN B 1  79   ? -6.661  -19.091 -55.549 1.00 106.49 ? 79   ASN B C     1 
ATOM   2262  O  O     . ASN B 1  79   ? -5.750  -18.285 -55.736 1.00 103.81 ? 79   ASN B O     1 
ATOM   2263  C  CB    . ASN B 1  79   ? -5.925  -21.480 -55.472 1.00 114.23 ? 79   ASN B CB    1 
ATOM   2264  C  CG    . ASN B 1  79   ? -5.342  -22.581 -54.605 1.00 111.91 ? 79   ASN B CG    1 
ATOM   2265  O  OD1   . ASN B 1  79   ? -4.278  -22.415 -54.009 1.00 107.64 ? 79   ASN B OD1   1 
ATOM   2266  N  ND2   . ASN B 1  79   ? -6.030  -23.717 -54.541 1.00 109.55 ? 79   ASN B ND2   1 
ATOM   2267  N  N     . LEU B 1  80   ? -7.865  -18.966 -56.094 1.00 103.69 ? 80   LEU B N     1 
ATOM   2268  C  CA    . LEU B 1  80   ? -8.192  -17.874 -57.000 1.00 103.27 ? 80   LEU B CA    1 
ATOM   2269  C  C     . LEU B 1  80   ? -8.450  -16.559 -56.273 1.00 104.32 ? 80   LEU B C     1 
ATOM   2270  O  O     . LEU B 1  80   ? -8.149  -15.488 -56.798 1.00 106.17 ? 80   LEU B O     1 
ATOM   2271  C  CB    . LEU B 1  80   ? -9.409  -18.240 -57.846 1.00 107.86 ? 80   LEU B CB    1 
ATOM   2272  C  CG    . LEU B 1  80   ? -9.096  -18.986 -59.139 1.00 115.22 ? 80   LEU B CG    1 
ATOM   2273  C  CD1   . LEU B 1  80   ? -10.358 -19.149 -59.974 1.00 118.68 ? 80   LEU B CD1   1 
ATOM   2274  C  CD2   . LEU B 1  80   ? -8.013  -18.243 -59.912 1.00 115.51 ? 80   LEU B CD2   1 
ATOM   2275  N  N     . LYS B 1  81   ? -9.017  -16.639 -55.072 1.00 99.62  ? 81   LYS B N     1 
ATOM   2276  C  CA    . LYS B 1  81   ? -9.256  -15.443 -54.275 1.00 96.16  ? 81   LYS B CA    1 
ATOM   2277  C  C     . LYS B 1  81   ? -7.928  -14.767 -53.952 1.00 100.15 ? 81   LYS B C     1 
ATOM   2278  O  O     . LYS B 1  81   ? -7.853  -13.544 -53.829 1.00 101.22 ? 81   LYS B O     1 
ATOM   2279  C  CB    . LYS B 1  81   ? -10.007 -15.782 -52.984 1.00 91.18  ? 81   LYS B CB    1 
ATOM   2280  C  CG    . LYS B 1  81   ? -11.426 -16.297 -53.171 1.00 91.71  ? 81   LYS B CG    1 
ATOM   2281  C  CD    . LYS B 1  81   ? -12.041 -16.651 -51.821 1.00 93.87  ? 81   LYS B CD    1 
ATOM   2282  C  CE    . LYS B 1  81   ? -13.429 -17.261 -51.961 1.00 95.25  ? 81   LYS B CE    1 
ATOM   2283  N  NZ    . LYS B 1  81   ? -13.985 -17.696 -50.646 1.00 84.12  ? 81   LYS B NZ    1 
ATOM   2284  N  N     . SER B 1  82   ? -6.882  -15.582 -53.838 1.00 100.41 ? 82   SER B N     1 
ATOM   2285  C  CA    . SER B 1  82   ? -5.554  -15.114 -53.453 1.00 103.92 ? 82   SER B CA    1 
ATOM   2286  C  C     . SER B 1  82   ? -4.773  -14.504 -54.623 1.00 104.04 ? 82   SER B C     1 
ATOM   2287  O  O     . SER B 1  82   ? -3.658  -14.013 -54.446 1.00 103.84 ? 82   SER B O     1 
ATOM   2288  C  CB    . SER B 1  82   ? -4.759  -16.269 -52.838 1.00 104.56 ? 82   SER B CB    1 
ATOM   2289  O  OG    . SER B 1  82   ? -3.522  -15.824 -52.311 1.00 110.64 ? 82   SER B OG    1 
ATOM   2290  N  N     . LEU B 1  83   ? -5.362  -14.535 -55.814 1.00 103.00 ? 83   LEU B N     1 
ATOM   2291  C  CA    . LEU B 1  83   ? -4.724  -13.974 -57.000 1.00 99.84  ? 83   LEU B CA    1 
ATOM   2292  C  C     . LEU B 1  83   ? -4.722  -12.448 -56.956 1.00 96.79  ? 83   LEU B C     1 
ATOM   2293  O  O     . LEU B 1  83   ? -5.750  -11.826 -56.695 1.00 97.78  ? 83   LEU B O     1 
ATOM   2294  C  CB    . LEU B 1  83   ? -5.429  -14.464 -58.265 1.00 103.34 ? 83   LEU B CB    1 
ATOM   2295  C  CG    . LEU B 1  83   ? -4.897  -13.943 -59.600 1.00 104.56 ? 83   LEU B CG    1 
ATOM   2296  C  CD1   . LEU B 1  83   ? -3.472  -14.413 -59.825 1.00 103.75 ? 83   LEU B CD1   1 
ATOM   2297  C  CD2   . LEU B 1  83   ? -5.800  -14.384 -60.740 1.00 106.50 ? 83   LEU B CD2   1 
ATOM   2298  N  N     . VAL B 1  84   ? -3.565  -11.847 -57.213 1.00 96.64  ? 84   VAL B N     1 
ATOM   2299  C  CA    . VAL B 1  84   ? -3.441  -10.394 -57.152 1.00 103.98 ? 84   VAL B CA    1 
ATOM   2300  C  C     . VAL B 1  84   ? -3.424  -9.768  -58.549 1.00 109.42 ? 84   VAL B C     1 
ATOM   2301  O  O     . VAL B 1  84   ? -2.575  -10.089 -59.380 1.00 110.98 ? 84   VAL B O     1 
ATOM   2302  C  CB    . VAL B 1  84   ? -2.179  -9.978  -56.367 1.00 110.86 ? 84   VAL B CB    1 
ATOM   2303  C  CG1   . VAL B 1  84   ? -2.385  -10.223 -54.886 1.00 118.29 ? 84   VAL B CG1   1 
ATOM   2304  C  CG2   . VAL B 1  84   ? -0.970  -10.750 -56.845 1.00 106.83 ? 84   VAL B CG2   1 
ATOM   2305  N  N     . VAL B 1  85   ? -4.382  -8.875  -58.795 1.00 118.76 ? 85   VAL B N     1 
ATOM   2306  C  CA    . VAL B 1  85   ? -4.594  -8.282  -60.118 1.00 122.85 ? 85   VAL B CA    1 
ATOM   2307  C  C     . VAL B 1  85   ? -4.852  -6.771  -60.033 1.00 127.85 ? 85   VAL B C     1 
ATOM   2308  O  O     . VAL B 1  85   ? -5.556  -6.309  -59.134 1.00 130.92 ? 85   VAL B O     1 
ATOM   2309  C  CB    . VAL B 1  85   ? -5.788  -8.962  -60.845 1.00 117.96 ? 85   VAL B CB    1 
ATOM   2310  C  CG1   . VAL B 1  85   ? -6.143  -8.235  -62.135 1.00 117.71 ? 85   VAL B CG1   1 
ATOM   2311  C  CG2   . VAL B 1  85   ? -5.483  -10.425 -61.124 1.00 117.74 ? 85   VAL B CG2   1 
ATOM   2312  N  N     . SER B 1  86   ? -4.277  -6.005  -60.961 1.00 127.86 ? 86   SER B N     1 
ATOM   2313  C  CA    . SER B 1  86   ? -4.550  -4.568  -61.054 1.00 128.86 ? 86   SER B CA    1 
ATOM   2314  C  C     . SER B 1  86   ? -5.172  -4.186  -62.396 1.00 132.68 ? 86   SER B C     1 
ATOM   2315  O  O     . SER B 1  86   ? -4.487  -4.161  -63.419 1.00 129.18 ? 86   SER B O     1 
ATOM   2316  C  CB    . SER B 1  86   ? -3.272  -3.758  -60.837 1.00 123.68 ? 86   SER B CB    1 
ATOM   2317  O  OG    . SER B 1  86   ? -2.781  -3.928  -59.521 1.00 131.57 ? 86   SER B OG    1 
ATOM   2318  N  N     . SER B 1  87   ? -6.470  -3.883  -62.381 1.00 134.92 ? 87   SER B N     1 
ATOM   2319  C  CA    . SER B 1  87   ? -7.176  -3.444  -63.584 1.00 134.52 ? 87   SER B CA    1 
ATOM   2320  C  C     . SER B 1  87   ? -7.083  -1.933  -63.715 1.00 134.84 ? 87   SER B C     1 
ATOM   2321  O  O     . SER B 1  87   ? -7.091  -1.219  -62.712 1.00 134.33 ? 87   SER B O     1 
ATOM   2322  C  CB    . SER B 1  87   ? -8.642  -3.887  -63.552 1.00 124.83 ? 87   SER B CB    1 
ATOM   2323  O  OG    . SER B 1  87   ? -9.333  -3.473  -64.721 1.00 119.18 ? 87   SER B OG    1 
ATOM   2324  N  N     . GLU B 1  88   ? -6.988  -1.445  -64.948 1.00 134.17 ? 88   GLU B N     1 
ATOM   2325  C  CA    . GLU B 1  88   ? -6.839  -0.012  -65.182 1.00 127.58 ? 88   GLU B CA    1 
ATOM   2326  C  C     . GLU B 1  88   ? -8.184  0.668   -65.421 1.00 127.86 ? 88   GLU B C     1 
ATOM   2327  O  O     . GLU B 1  88   ? -8.320  1.875   -65.221 1.00 129.51 ? 88   GLU B O     1 
ATOM   2328  C  CB    . GLU B 1  88   ? -5.902  0.244   -66.366 1.00 128.20 ? 88   GLU B CB    1 
ATOM   2329  C  CG    . GLU B 1  88   ? -5.453  1.695   -66.488 1.00 131.73 ? 88   GLU B CG    1 
ATOM   2330  C  CD    . GLU B 1  88   ? -4.248  1.859   -67.392 1.00 140.37 ? 88   GLU B CD    1 
ATOM   2331  O  OE1   . GLU B 1  88   ? -3.817  0.853   -67.997 1.00 141.60 ? 88   GLU B OE1   1 
ATOM   2332  O  OE2   . GLU B 1  88   ? -3.729  2.991   -67.495 1.00 140.87 ? 88   GLU B OE2   1 
ATOM   2333  N  N     . GLU B 1  89   ? -9.173  -0.111  -65.849 1.00 125.02 ? 89   GLU B N     1 
ATOM   2334  C  CA    . GLU B 1  89   ? -10.511 0.422   -66.070 1.00 121.42 ? 89   GLU B CA    1 
ATOM   2335  C  C     . GLU B 1  89   ? -11.504 -0.071  -65.027 1.00 125.91 ? 89   GLU B C     1 
ATOM   2336  O  O     . GLU B 1  89   ? -11.555 -1.264  -64.716 1.00 124.14 ? 89   GLU B O     1 
ATOM   2337  C  CB    . GLU B 1  89   ? -11.007 0.072   -67.475 1.00 123.29 ? 89   GLU B CB    1 
ATOM   2338  C  CG    . GLU B 1  89   ? -10.496 1.014   -68.555 1.00 133.08 ? 89   GLU B CG    1 
ATOM   2339  C  CD    . GLU B 1  89   ? -10.932 2.454   -68.330 1.00 136.45 ? 89   GLU B CD    1 
ATOM   2340  O  OE1   . GLU B 1  89   ? -11.945 2.672   -67.629 1.00 137.45 ? 89   GLU B OE1   1 
ATOM   2341  O  OE2   . GLU B 1  89   ? -10.261 3.370   -68.851 1.00 130.65 ? 89   GLU B OE2   1 
ATOM   2342  N  N     . ASP B 1  90   ? -12.286 0.869   -64.499 1.00 128.44 ? 90   ASP B N     1 
ATOM   2343  C  CA    . ASP B 1  90   ? -13.278 0.594   -63.463 1.00 135.00 ? 90   ASP B CA    1 
ATOM   2344  C  C     . ASP B 1  90   ? -14.250 -0.484  -63.920 1.00 136.64 ? 90   ASP B C     1 
ATOM   2345  O  O     . ASP B 1  90   ? -14.559 -1.412  -63.174 1.00 135.66 ? 90   ASP B O     1 
ATOM   2346  C  CB    . ASP B 1  90   ? -14.047 1.869   -63.105 1.00 132.22 ? 90   ASP B CB    1 
ATOM   2347  C  CG    . ASP B 1  90   ? -14.801 1.755   -61.786 1.00 129.68 ? 90   ASP B CG    1 
ATOM   2348  O  OD1   . ASP B 1  90   ? -15.304 0.658   -61.463 1.00 124.07 ? 90   ASP B OD1   1 
ATOM   2349  O  OD2   . ASP B 1  90   ? -14.887 2.771   -61.065 1.00 134.59 ? 90   ASP B OD2   1 
ATOM   2350  N  N     . GLU B 1  91   ? -14.717 -0.345  -65.156 1.00 137.94 ? 91   GLU B N     1 
ATOM   2351  C  CA    . GLU B 1  91   ? -15.696 -1.253  -65.727 1.00 133.21 ? 91   GLU B CA    1 
ATOM   2352  C  C     . GLU B 1  91   ? -15.172 -2.694  -65.753 1.00 125.43 ? 91   GLU B C     1 
ATOM   2353  O  O     . GLU B 1  91   ? -13.976 -2.919  -65.957 1.00 123.91 ? 91   GLU B O     1 
ATOM   2354  C  CB    . GLU B 1  91   ? -16.085 -0.774  -67.133 1.00 132.75 ? 91   GLU B CB    1 
ATOM   2355  C  CG    . GLU B 1  91   ? -17.169 0.315   -67.149 1.00 126.08 ? 91   GLU B CG    1 
ATOM   2356  C  CD    . GLU B 1  91   ? -16.832 1.526   -66.287 1.00 124.37 ? 91   GLU B CD    1 
ATOM   2357  O  OE1   . GLU B 1  91   ? -15.667 1.980   -66.309 1.00 122.49 ? 91   GLU B OE1   1 
ATOM   2358  O  OE2   . GLU B 1  91   ? -17.737 2.021   -65.580 1.00 121.96 ? 91   GLU B OE2   1 
ATOM   2359  N  N     . PRO B 1  92   ? -16.069 -3.675  -65.524 1.00 118.40 ? 92   PRO B N     1 
ATOM   2360  C  CA    . PRO B 1  92   ? -15.679 -5.087  -65.385 1.00 122.30 ? 92   PRO B CA    1 
ATOM   2361  C  C     . PRO B 1  92   ? -15.083 -5.692  -66.659 1.00 131.48 ? 92   PRO B C     1 
ATOM   2362  O  O     . PRO B 1  92   ? -15.729 -5.659  -67.706 1.00 136.61 ? 92   PRO B O     1 
ATOM   2363  C  CB    . PRO B 1  92   ? -16.999 -5.789  -65.025 1.00 114.46 ? 92   PRO B CB    1 
ATOM   2364  C  CG    . PRO B 1  92   ? -18.065 -4.866  -65.496 1.00 111.08 ? 92   PRO B CG    1 
ATOM   2365  C  CD    . PRO B 1  92   ? -17.523 -3.488  -65.382 1.00 113.41 ? 92   PRO B CD    1 
ATOM   2366  N  N     . VAL B 1  93   ? -13.865 -6.224  -66.570 1.00 136.68 ? 93   VAL B N     1 
ATOM   2367  C  CA    . VAL B 1  93   ? -13.231 -6.882  -67.711 1.00 135.81 ? 93   VAL B CA    1 
ATOM   2368  C  C     . VAL B 1  93   ? -13.391 -8.395  -67.584 1.00 129.49 ? 93   VAL B C     1 
ATOM   2369  O  O     . VAL B 1  93   ? -14.012 -8.881  -66.639 1.00 124.53 ? 93   VAL B O     1 
ATOM   2370  C  CB    . VAL B 1  93   ? -11.720 -6.521  -67.837 1.00 136.99 ? 93   VAL B CB    1 
ATOM   2371  C  CG1   . VAL B 1  93   ? -11.524 -5.006  -67.854 1.00 133.23 ? 93   VAL B CG1   1 
ATOM   2372  C  CG2   . VAL B 1  93   ? -10.897 -7.168  -66.723 1.00 132.41 ? 93   VAL B CG2   1 
ATOM   2373  N  N     . THR B 1  94   ? -12.848 -9.138  -68.543 1.00 133.87 ? 94   THR B N     1 
ATOM   2374  C  CA    . THR B 1  94   ? -12.895 -10.595 -68.487 1.00 128.47 ? 94   THR B CA    1 
ATOM   2375  C  C     . THR B 1  94   ? -11.607 -11.199 -69.032 1.00 119.69 ? 94   THR B C     1 
ATOM   2376  O  O     . THR B 1  94   ? -11.162 -10.868 -70.131 1.00 119.49 ? 94   THR B O     1 
ATOM   2377  C  CB    . THR B 1  94   ? -14.105 -11.164 -69.270 1.00 127.38 ? 94   THR B CB    1 
ATOM   2378  O  OG1   . THR B 1  94   ? -15.319 -10.838 -68.581 1.00 123.58 ? 94   THR B OG1   1 
ATOM   2379  C  CG2   . THR B 1  94   ? -14.002 -12.677 -69.396 1.00 120.19 ? 94   THR B CG2   1 
ATOM   2380  N  N     . MET B 1  95   ? -11.003 -12.078 -68.243 1.00 115.47 ? 95   MET B N     1 
ATOM   2381  C  CA    . MET B 1  95   ? -9.798  -12.772 -68.661 1.00 124.12 ? 95   MET B CA    1 
ATOM   2382  C  C     . MET B 1  95   ? -10.048 -14.273 -68.704 1.00 127.85 ? 95   MET B C     1 
ATOM   2383  O  O     . MET B 1  95   ? -10.817 -14.810 -67.904 1.00 122.72 ? 95   MET B O     1 
ATOM   2384  C  CB    . MET B 1  95   ? -8.638  -12.451 -67.722 1.00 131.00 ? 95   MET B CB    1 
ATOM   2385  C  CG    . MET B 1  95   ? -8.899  -12.839 -66.280 1.00 133.48 ? 95   MET B CG    1 
ATOM   2386  S  SD    . MET B 1  95   ? -7.497  -12.535 -65.192 1.00 158.95 ? 95   MET B SD    1 
ATOM   2387  C  CE    . MET B 1  95   ? -7.314  -10.764 -65.368 1.00 138.76 ? 95   MET B CE    1 
ATOM   2388  N  N     . TYR B 1  96   ? -9.398  -14.944 -69.648 1.00 132.40 ? 96   TYR B N     1 
ATOM   2389  C  CA    . TYR B 1  96   ? -9.571  -16.378 -69.818 1.00 126.83 ? 96   TYR B CA    1 
ATOM   2390  C  C     . TYR B 1  96   ? -8.309  -17.129 -69.412 1.00 121.25 ? 96   TYR B C     1 
ATOM   2391  O  O     . TYR B 1  96   ? -7.198  -16.608 -69.516 1.00 117.19 ? 96   TYR B O     1 
ATOM   2392  C  CB    . TYR B 1  96   ? -9.942  -16.711 -71.268 1.00 127.62 ? 96   TYR B CB    1 
ATOM   2393  C  CG    . TYR B 1  96   ? -11.304 -16.204 -71.701 1.00 126.16 ? 96   TYR B CG    1 
ATOM   2394  C  CD1   . TYR B 1  96   ? -12.464 -16.877 -71.339 1.00 121.42 ? 96   TYR B CD1   1 
ATOM   2395  C  CD2   . TYR B 1  96   ? -11.429 -15.058 -72.481 1.00 126.16 ? 96   TYR B CD2   1 
ATOM   2396  C  CE1   . TYR B 1  96   ? -13.711 -16.419 -71.733 1.00 120.20 ? 96   TYR B CE1   1 
ATOM   2397  C  CE2   . TYR B 1  96   ? -12.671 -14.594 -72.880 1.00 120.52 ? 96   TYR B CE2   1 
ATOM   2398  C  CZ    . TYR B 1  96   ? -13.808 -15.277 -72.504 1.00 118.98 ? 96   TYR B CZ    1 
ATOM   2399  O  OH    . TYR B 1  96   ? -15.042 -14.816 -72.901 1.00 116.28 ? 96   TYR B OH    1 
ATOM   2400  N  N     . LEU B 1  97   ? -8.494  -18.355 -68.939 1.00 116.16 ? 97   LEU B N     1 
ATOM   2401  C  CA    . LEU B 1  97   ? -7.374  -19.225 -68.620 1.00 119.10 ? 97   LEU B CA    1 
ATOM   2402  C  C     . LEU B 1  97   ? -7.679  -20.649 -69.071 1.00 125.06 ? 97   LEU B C     1 
ATOM   2403  O  O     . LEU B 1  97   ? -8.548  -21.315 -68.508 1.00 122.70 ? 97   LEU B O     1 
ATOM   2404  C  CB    . LEU B 1  97   ? -7.066  -19.188 -67.124 1.00 119.16 ? 97   LEU B CB    1 
ATOM   2405  C  CG    . LEU B 1  97   ? -6.019  -20.192 -66.641 1.00 124.51 ? 97   LEU B CG    1 
ATOM   2406  C  CD1   . LEU B 1  97   ? -4.762  -20.078 -67.469 1.00 123.18 ? 97   LEU B CD1   1 
ATOM   2407  C  CD2   . LEU B 1  97   ? -5.704  -19.989 -65.169 1.00 126.69 ? 97   LEU B CD2   1 
ATOM   2408  N  N     . ARG B 1  98   ? -6.960  -21.106 -70.093 1.00 126.97 ? 98   ARG B N     1 
ATOM   2409  C  CA    . ARG B 1  98   ? -7.162  -22.443 -70.644 1.00 121.65 ? 98   ARG B CA    1 
ATOM   2410  C  C     . ARG B 1  98   ? -5.861  -23.240 -70.646 1.00 114.65 ? 98   ARG B C     1 
ATOM   2411  O  O     . ARG B 1  98   ? -4.810  -22.717 -71.015 1.00 109.87 ? 98   ARG B O     1 
ATOM   2412  C  CB    . ARG B 1  98   ? -7.720  -22.361 -72.068 1.00 123.60 ? 98   ARG B CB    1 
ATOM   2413  C  CG    . ARG B 1  98   ? -8.889  -21.404 -72.240 1.00 122.59 ? 98   ARG B CG    1 
ATOM   2414  C  CD    . ARG B 1  98   ? -9.321  -21.314 -73.696 1.00 115.70 ? 98   ARG B CD    1 
ATOM   2415  N  NE    . ARG B 1  98   ? -10.306 -20.257 -73.907 1.00 119.34 ? 98   ARG B NE    1 
ATOM   2416  C  CZ    . ARG B 1  98   ? -10.011 -19.027 -74.318 1.00 119.53 ? 98   ARG B CZ    1 
ATOM   2417  N  NH1   . ARG B 1  98   ? -8.752  -18.692 -74.572 1.00 102.32 ? 98   ARG B NH1   1 
ATOM   2418  N  NH2   . ARG B 1  98   ? -10.975 -18.132 -74.479 1.00 124.58 ? 98   ARG B NH2   1 
ATOM   2419  N  N     . LYS B 1  99   ? -5.938  -24.504 -70.237 1.00 116.43 ? 99   LYS B N     1 
ATOM   2420  C  CA    . LYS B 1  99   ? -4.781  -25.398 -70.283 1.00 119.16 ? 99   LYS B CA    1 
ATOM   2421  C  C     . LYS B 1  99   ? -5.216  -26.862 -70.222 1.00 116.39 ? 99   LYS B C     1 
ATOM   2422  O  O     . LYS B 1  99   ? -6.164  -27.214 -69.518 1.00 113.15 ? 99   LYS B O     1 
ATOM   2423  C  CB    . LYS B 1  99   ? -3.808  -25.082 -69.142 1.00 124.01 ? 99   LYS B CB    1 
ATOM   2424  C  CG    . LYS B 1  99   ? -2.364  -25.506 -69.406 1.00 119.87 ? 99   LYS B CG    1 
ATOM   2425  C  CD    . LYS B 1  99   ? -1.421  -24.922 -68.360 1.00 120.18 ? 99   LYS B CD    1 
ATOM   2426  C  CE    . LYS B 1  99   ? 0.036   -25.239 -68.668 1.00 117.45 ? 99   LYS B CE    1 
ATOM   2427  N  NZ    . LYS B 1  99   ? 0.268   -26.701 -68.824 1.00 123.44 ? 99   LYS B NZ    1 
ATOM   2428  N  N     . GLN B 1  100  ? -4.514  -27.710 -70.968 1.00 119.45 ? 100  GLN B N     1 
ATOM   2429  C  CA    . GLN B 1  100  ? -4.857  -29.123 -71.071 1.00 125.87 ? 100  GLN B CA    1 
ATOM   2430  C  C     . GLN B 1  100  ? -3.598  -29.988 -70.978 1.00 131.62 ? 100  GLN B C     1 
ATOM   2431  O  O     . GLN B 1  100  ? -2.480  -29.482 -71.092 1.00 125.94 ? 100  GLN B O     1 
ATOM   2432  C  CB    . GLN B 1  100  ? -5.604  -29.390 -72.383 1.00 126.27 ? 100  GLN B CB    1 
ATOM   2433  C  CG    . GLN B 1  100  ? -6.393  -30.689 -72.417 1.00 130.20 ? 100  GLN B CG    1 
ATOM   2434  C  CD    . GLN B 1  100  ? -7.181  -30.859 -73.699 1.00 130.63 ? 100  GLN B CD    1 
ATOM   2435  O  OE1   . GLN B 1  100  ? -7.576  -29.880 -74.333 1.00 123.01 ? 100  GLN B OE1   1 
ATOM   2436  N  NE2   . GLN B 1  100  ? -7.411  -32.107 -74.091 1.00 134.40 ? 100  GLN B NE2   1 
ATOM   2437  N  N     . GLY B 1  101  ? -3.783  -31.287 -70.763 1.00 136.80 ? 101  GLY B N     1 
ATOM   2438  C  CA    . GLY B 1  101  ? -2.670  -32.209 -70.641 1.00 138.08 ? 101  GLY B CA    1 
ATOM   2439  C  C     . GLY B 1  101  ? -2.218  -32.370 -69.202 1.00 142.54 ? 101  GLY B C     1 
ATOM   2440  O  O     . GLY B 1  101  ? -2.866  -31.865 -68.286 1.00 146.67 ? 101  GLY B O     1 
ATOM   2441  N  N     . PRO B 1  102  ? -1.102  -33.085 -68.994 1.00 140.76 ? 102  PRO B N     1 
ATOM   2442  C  CA    . PRO B 1  102  ? -0.539  -33.286 -67.656 1.00 141.36 ? 102  PRO B CA    1 
ATOM   2443  C  C     . PRO B 1  102  ? 0.319   -32.110 -67.194 1.00 139.79 ? 102  PRO B C     1 
ATOM   2444  O  O     . PRO B 1  102  ? 1.074   -31.543 -67.988 1.00 132.76 ? 102  PRO B O     1 
ATOM   2445  C  CB    . PRO B 1  102  ? 0.310   -34.545 -67.827 1.00 142.27 ? 102  PRO B CB    1 
ATOM   2446  C  CG    . PRO B 1  102  ? 0.759   -34.483 -69.248 1.00 142.89 ? 102  PRO B CG    1 
ATOM   2447  C  CD    . PRO B 1  102  ? -0.373  -33.850 -70.021 1.00 140.92 ? 102  PRO B CD    1 
ATOM   2448  N  N     . GLY B 1  103  ? 0.200   -31.750 -65.920 1.00 143.33 ? 103  GLY B N     1 
ATOM   2449  C  CA    . GLY B 1  103  ? 1.007   -30.685 -65.356 1.00 142.95 ? 103  GLY B CA    1 
ATOM   2450  C  C     . GLY B 1  103  ? 0.308   -29.880 -64.277 1.00 135.21 ? 103  GLY B C     1 
ATOM   2451  O  O     . GLY B 1  103  ? -0.658  -30.336 -63.663 1.00 124.96 ? 103  GLY B O     1 
ATOM   2452  N  N     . GLU B 1  104  ? 0.811   -28.670 -64.051 1.00 136.31 ? 104  GLU B N     1 
ATOM   2453  C  CA    . GLU B 1  104  ? 0.269   -27.776 -63.036 1.00 132.43 ? 104  GLU B CA    1 
ATOM   2454  C  C     . GLU B 1  104  ? -0.050  -26.404 -63.620 1.00 139.50 ? 104  GLU B C     1 
ATOM   2455  O  O     . GLU B 1  104  ? 0.791   -25.794 -64.282 1.00 138.64 ? 104  GLU B O     1 
ATOM   2456  C  CB    . GLU B 1  104  ? 1.253   -27.629 -61.878 1.00 120.98 ? 104  GLU B CB    1 
ATOM   2457  C  CG    . GLU B 1  104  ? 1.509   -28.908 -61.114 1.00 118.18 ? 104  GLU B CG    1 
ATOM   2458  C  CD    . GLU B 1  104  ? 2.414   -28.683 -59.928 1.00 120.82 ? 104  GLU B CD    1 
ATOM   2459  O  OE1   . GLU B 1  104  ? 2.901   -27.545 -59.768 1.00 123.16 ? 104  GLU B OE1   1 
ATOM   2460  O  OE2   . GLU B 1  104  ? 2.637   -29.638 -59.155 1.00 123.47 ? 104  GLU B OE2   1 
ATOM   2461  N  N     . VAL B 1  105  ? -1.265  -25.923 -63.368 1.00 138.48 ? 105  VAL B N     1 
ATOM   2462  C  CA    . VAL B 1  105  ? -1.690  -24.612 -63.852 1.00 135.51 ? 105  VAL B CA    1 
ATOM   2463  C  C     . VAL B 1  105  ? -1.359  -23.523 -62.840 1.00 133.85 ? 105  VAL B C     1 
ATOM   2464  O  O     . VAL B 1  105  ? -1.607  -23.681 -61.645 1.00 130.52 ? 105  VAL B O     1 
ATOM   2465  C  CB    . VAL B 1  105  ? -3.200  -24.575 -64.145 1.00 127.48 ? 105  VAL B CB    1 
ATOM   2466  C  CG1   . VAL B 1  105  ? -3.576  -23.264 -64.824 1.00 119.12 ? 105  VAL B CG1   1 
ATOM   2467  C  CG2   . VAL B 1  105  ? -3.599  -25.756 -65.008 1.00 130.47 ? 105  VAL B CG2   1 
ATOM   2468  N  N     . THR B 1  106  ? -0.803  -22.416 -63.323 1.00 137.59 ? 106  THR B N     1 
ATOM   2469  C  CA    . THR B 1  106  ? -0.413  -21.316 -62.449 1.00 134.74 ? 106  THR B CA    1 
ATOM   2470  C  C     . THR B 1  106  ? -1.036  -19.989 -62.877 1.00 134.73 ? 106  THR B C     1 
ATOM   2471  O  O     . THR B 1  106  ? -1.938  -19.953 -63.718 1.00 131.43 ? 106  THR B O     1 
ATOM   2472  C  CB    . THR B 1  106  ? 1.119   -21.150 -62.404 1.00 133.29 ? 106  THR B CB    1 
ATOM   2473  O  OG1   . THR B 1  106  ? 1.612   -20.875 -63.721 1.00 139.14 ? 106  THR B OG1   1 
ATOM   2474  C  CG2   . THR B 1  106  ? 1.779   -22.414 -61.873 1.00 133.27 ? 106  THR B CG2   1 
ATOM   2475  N  N     . ALA B 1  107  ? -0.543  -18.902 -62.290 1.00 131.21 ? 107  ALA B N     1 
ATOM   2476  C  CA    . ALA B 1  107  ? -1.051  -17.566 -62.578 1.00 130.92 ? 107  ALA B CA    1 
ATOM   2477  C  C     . ALA B 1  107  ? -0.305  -16.921 -63.741 1.00 135.12 ? 107  ALA B C     1 
ATOM   2478  O  O     . ALA B 1  107  ? -0.640  -15.816 -64.170 1.00 135.64 ? 107  ALA B O     1 
ATOM   2479  C  CB    . ALA B 1  107  ? -0.957  -16.692 -61.342 1.00 123.86 ? 107  ALA B CB    1 
ATOM   2480  N  N     . GLY B 1  108  ? 0.714   -17.614 -64.240 1.00 135.77 ? 108  GLY B N     1 
ATOM   2481  C  CA    . GLY B 1  108  ? 1.449   -17.158 -65.404 1.00 140.86 ? 108  GLY B CA    1 
ATOM   2482  C  C     . GLY B 1  108  ? 0.785   -17.635 -66.682 1.00 146.46 ? 108  GLY B C     1 
ATOM   2483  O  O     . GLY B 1  108  ? 1.034   -17.097 -67.763 1.00 144.66 ? 108  GLY B O     1 
ATOM   2484  N  N     . ASP B 1  109  ? -0.065  -18.650 -66.550 1.00 146.87 ? 109  ASP B N     1 
ATOM   2485  C  CA    . ASP B 1  109  ? -0.796  -19.214 -67.682 1.00 148.65 ? 109  ASP B CA    1 
ATOM   2486  C  C     . ASP B 1  109  ? -1.973  -18.323 -68.086 1.00 143.62 ? 109  ASP B C     1 
ATOM   2487  O  O     . ASP B 1  109  ? -2.498  -18.431 -69.197 1.00 144.16 ? 109  ASP B O     1 
ATOM   2488  C  CB    . ASP B 1  109  ? -1.303  -20.625 -67.351 1.00 138.46 ? 109  ASP B CB    1 
ATOM   2489  C  CG    . ASP B 1  109  ? -0.178  -21.621 -67.119 1.00 137.02 ? 109  ASP B CG    1 
ATOM   2490  O  OD1   . ASP B 1  109  ? -0.386  -22.578 -66.343 1.00 128.89 ? 109  ASP B OD1   1 
ATOM   2491  O  OD2   . ASP B 1  109  ? 0.908   -21.455 -67.712 1.00 143.37 ? 109  ASP B OD2   1 
ATOM   2492  N  N     . ILE B 1  110  ? -2.388  -17.449 -67.174 1.00 140.71 ? 110  ILE B N     1 
ATOM   2493  C  CA    . ILE B 1  110  ? -3.539  -16.579 -67.394 1.00 139.57 ? 110  ILE B CA    1 
ATOM   2494  C  C     . ILE B 1  110  ? -3.316  -15.597 -68.540 1.00 139.04 ? 110  ILE B C     1 
ATOM   2495  O  O     . ILE B 1  110  ? -2.254  -14.982 -68.645 1.00 134.71 ? 110  ILE B O     1 
ATOM   2496  C  CB    . ILE B 1  110  ? -3.883  -15.782 -66.119 1.00 148.82 ? 110  ILE B CB    1 
ATOM   2497  C  CG1   . ILE B 1  110  ? -4.112  -16.731 -64.941 1.00 149.17 ? 110  ILE B CG1   1 
ATOM   2498  C  CG2   . ILE B 1  110  ? -5.105  -14.908 -66.344 1.00 143.45 ? 110  ILE B CG2   1 
ATOM   2499  C  CD1   . ILE B 1  110  ? -4.494  -16.030 -63.652 1.00 139.13 ? 110  ILE B CD1   1 
ATOM   2500  N  N     . VAL B 1  111  ? -4.326  -15.464 -69.396 1.00 138.00 ? 111  VAL B N     1 
ATOM   2501  C  CA    . VAL B 1  111  ? -4.307  -14.493 -70.485 1.00 142.22 ? 111  VAL B CA    1 
ATOM   2502  C  C     . VAL B 1  111  ? -5.044  -13.216 -70.058 1.00 134.21 ? 111  VAL B C     1 
ATOM   2503  O  O     . VAL B 1  111  ? -6.275  -13.196 -70.000 1.00 128.57 ? 111  VAL B O     1 
ATOM   2504  C  CB    . VAL B 1  111  ? -4.949  -15.077 -71.769 1.00 140.93 ? 111  VAL B CB    1 
ATOM   2505  C  CG1   . VAL B 1  111  ? -4.848  -14.091 -72.923 1.00 140.42 ? 111  VAL B CG1   1 
ATOM   2506  C  CG2   . VAL B 1  111  ? -4.291  -16.405 -72.139 1.00 131.93 ? 111  VAL B CG2   1 
ATOM   2507  N  N     . PRO B 1  112  ? -4.288  -12.149 -69.741 1.00 127.52 ? 112  PRO B N     1 
ATOM   2508  C  CA    . PRO B 1  112  ? -4.858  -10.897 -69.232 1.00 128.08 ? 112  PRO B CA    1 
ATOM   2509  C  C     . PRO B 1  112  ? -5.145  -9.856  -70.320 1.00 131.41 ? 112  PRO B C     1 
ATOM   2510  O  O     . PRO B 1  112  ? -4.360  -9.728  -71.261 1.00 126.15 ? 112  PRO B O     1 
ATOM   2511  C  CB    . PRO B 1  112  ? -3.764  -10.395 -68.291 1.00 123.67 ? 112  PRO B CB    1 
ATOM   2512  C  CG    . PRO B 1  112  ? -2.499  -10.831 -68.968 1.00 122.15 ? 112  PRO B CG    1 
ATOM   2513  C  CD    . PRO B 1  112  ? -2.814  -12.127 -69.697 1.00 122.22 ? 112  PRO B CD    1 
ATOM   2514  N  N     . PRO B 1  113  ? -6.262  -9.115  -70.189 1.00 135.53 ? 113  PRO B N     1 
ATOM   2515  C  CA    . PRO B 1  113  ? -6.589  -7.996  -71.085 1.00 128.98 ? 113  PRO B CA    1 
ATOM   2516  C  C     . PRO B 1  113  ? -5.568  -6.859  -70.987 1.00 126.42 ? 113  PRO B C     1 
ATOM   2517  O  O     . PRO B 1  113  ? -4.698  -6.893  -70.116 1.00 127.00 ? 113  PRO B O     1 
ATOM   2518  C  CB    . PRO B 1  113  ? -7.968  -7.537  -70.589 1.00 121.83 ? 113  PRO B CB    1 
ATOM   2519  C  CG    . PRO B 1  113  ? -8.534  -8.720  -69.873 1.00 120.01 ? 113  PRO B CG    1 
ATOM   2520  C  CD    . PRO B 1  113  ? -7.352  -9.388  -69.234 1.00 131.81 ? 113  PRO B CD    1 
ATOM   2521  N  N     . ALA B 1  114  ? -5.672  -5.866  -71.866 1.00 127.12 ? 114  ALA B N     1 
ATOM   2522  C  CA    . ALA B 1  114  ? -4.735  -4.743  -71.856 1.00 131.51 ? 114  ALA B CA    1 
ATOM   2523  C  C     . ALA B 1  114  ? -4.948  -3.864  -70.627 1.00 135.11 ? 114  ALA B C     1 
ATOM   2524  O  O     . ALA B 1  114  ? -6.083  -3.590  -70.238 1.00 141.63 ? 114  ALA B O     1 
ATOM   2525  C  CB    . ALA B 1  114  ? -4.873  -3.920  -73.129 1.00 127.16 ? 114  ALA B CB    1 
ATOM   2526  N  N     . GLY B 1  115  ? -3.853  -3.428  -70.013 1.00 126.32 ? 115  GLY B N     1 
ATOM   2527  C  CA    . GLY B 1  115  ? -3.933  -2.625  -68.808 1.00 123.04 ? 115  GLY B CA    1 
ATOM   2528  C  C     . GLY B 1  115  ? -4.376  -3.430  -67.599 1.00 127.28 ? 115  GLY B C     1 
ATOM   2529  O  O     . GLY B 1  115  ? -4.776  -2.864  -66.582 1.00 129.49 ? 115  GLY B O     1 
ATOM   2530  N  N     . VAL B 1  116  ? -4.313  -4.755  -67.714 1.00 127.63 ? 116  VAL B N     1 
ATOM   2531  C  CA    . VAL B 1  116  ? -4.626  -5.648  -66.600 1.00 123.20 ? 116  VAL B CA    1 
ATOM   2532  C  C     . VAL B 1  116  ? -3.441  -6.579  -66.326 1.00 119.27 ? 116  VAL B C     1 
ATOM   2533  O  O     . VAL B 1  116  ? -3.033  -7.356  -67.192 1.00 113.07 ? 116  VAL B O     1 
ATOM   2534  C  CB    . VAL B 1  116  ? -5.899  -6.485  -66.870 1.00 120.86 ? 116  VAL B CB    1 
ATOM   2535  C  CG1   . VAL B 1  116  ? -6.186  -7.404  -65.697 1.00 117.92 ? 116  VAL B CG1   1 
ATOM   2536  C  CG2   . VAL B 1  116  ? -7.095  -5.579  -67.138 1.00 118.13 ? 116  VAL B CG2   1 
ATOM   2537  N  N     . THR B 1  117  ? -2.891  -6.492  -65.117 1.00 119.74 ? 117  THR B N     1 
ATOM   2538  C  CA    . THR B 1  117  ? -1.656  -7.196  -64.779 1.00 118.79 ? 117  THR B CA    1 
ATOM   2539  C  C     . THR B 1  117  ? -1.825  -8.203  -63.641 1.00 122.02 ? 117  THR B C     1 
ATOM   2540  O  O     . THR B 1  117  ? -2.497  -7.925  -62.647 1.00 123.59 ? 117  THR B O     1 
ATOM   2541  C  CB    . THR B 1  117  ? -0.540  -6.203  -64.376 1.00 118.50 ? 117  THR B CB    1 
ATOM   2542  O  OG1   . THR B 1  117  ? -0.608  -5.030  -65.198 1.00 118.49 ? 117  THR B OG1   1 
ATOM   2543  C  CG2   . THR B 1  117  ? 0.833   -6.846  -64.518 1.00 114.76 ? 117  THR B CG2   1 
ATOM   2544  N  N     . VAL B 1  118  ? -1.202  -9.369  -63.793 1.00 121.45 ? 118  VAL B N     1 
ATOM   2545  C  CA    . VAL B 1  118  ? -1.141  -10.370 -62.730 1.00 117.44 ? 118  VAL B CA    1 
ATOM   2546  C  C     . VAL B 1  118  ? 0.192   -10.231 -61.982 1.00 115.04 ? 118  VAL B C     1 
ATOM   2547  O  O     . VAL B 1  118  ? 1.249   -10.155 -62.608 1.00 111.28 ? 118  VAL B O     1 
ATOM   2548  C  CB    . VAL B 1  118  ? -1.296  -11.799 -63.297 1.00 107.84 ? 118  VAL B CB    1 
ATOM   2549  C  CG1   . VAL B 1  118  ? -1.199  -12.827 -62.190 1.00 114.27 ? 118  VAL B CG1   1 
ATOM   2550  C  CG2   . VAL B 1  118  ? -2.620  -11.938 -64.036 1.00 102.10 ? 118  VAL B CG2   1 
ATOM   2551  N  N     . HIS B 1  119  ? 0.148   -10.192 -60.650 1.00 109.06 ? 119  HIS B N     1 
ATOM   2552  C  CA    . HIS B 1  119  ? 1.339   -9.842  -59.872 1.00 104.09 ? 119  HIS B CA    1 
ATOM   2553  C  C     . HIS B 1  119  ? 2.008   -11.014 -59.143 1.00 112.62 ? 119  HIS B C     1 
ATOM   2554  O  O     . HIS B 1  119  ? 3.008   -10.820 -58.451 1.00 114.56 ? 119  HIS B O     1 
ATOM   2555  C  CB    . HIS B 1  119  ? 0.996   -8.755  -58.852 1.00 100.36 ? 119  HIS B CB    1 
ATOM   2556  C  CG    . HIS B 1  119  ? 0.351   -7.545  -59.448 1.00 108.08 ? 119  HIS B CG    1 
ATOM   2557  N  ND1   . HIS B 1  119  ? 1.075   -6.501  -59.980 1.00 112.27 ? 119  HIS B ND1   1 
ATOM   2558  C  CD2   . HIS B 1  119  ? -0.954  -7.210  -59.591 1.00 109.14 ? 119  HIS B CD2   1 
ATOM   2559  C  CE1   . HIS B 1  119  ? 0.245   -5.575  -60.428 1.00 117.28 ? 119  HIS B CE1   1 
ATOM   2560  N  NE2   . HIS B 1  119  ? -0.991  -5.982  -60.205 1.00 113.57 ? 119  HIS B NE2   1 
ATOM   2561  N  N     . ASN B 1  120  ? 1.469   -12.220 -59.293 1.00 121.39 ? 120  ASN B N     1 
ATOM   2562  C  CA    . ASN B 1  120  ? 2.110   -13.412 -58.731 1.00 121.85 ? 120  ASN B CA    1 
ATOM   2563  C  C     . ASN B 1  120  ? 2.015   -14.634 -59.658 1.00 125.43 ? 120  ASN B C     1 
ATOM   2564  O  O     . ASN B 1  120  ? 1.344   -15.615 -59.335 1.00 122.21 ? 120  ASN B O     1 
ATOM   2565  C  CB    . ASN B 1  120  ? 1.508   -13.738 -57.359 1.00 117.18 ? 120  ASN B CB    1 
ATOM   2566  C  CG    . ASN B 1  120  ? 0.003   -13.950 -57.410 1.00 112.24 ? 120  ASN B CG    1 
ATOM   2567  O  OD1   . ASN B 1  120  ? -0.663  -13.535 -58.358 1.00 113.29 ? 120  ASN B OD1   1 
ATOM   2568  N  ND2   . ASN B 1  120  ? -0.538  -14.601 -56.387 1.00 108.83 ? 120  ASN B ND2   1 
ATOM   2569  N  N     . PRO B 1  121  ? 2.717   -14.589 -60.806 1.00 127.87 ? 121  PRO B N     1 
ATOM   2570  C  CA    . PRO B 1  121  ? 2.568   -15.589 -61.876 1.00 126.98 ? 121  PRO B CA    1 
ATOM   2571  C  C     . PRO B 1  121  ? 2.999   -16.999 -61.475 1.00 124.43 ? 121  PRO B C     1 
ATOM   2572  O  O     . PRO B 1  121  ? 2.847   -17.932 -62.265 1.00 122.71 ? 121  PRO B O     1 
ATOM   2573  C  CB    . PRO B 1  121  ? 3.479   -15.053 -62.992 1.00 126.29 ? 121  PRO B CB    1 
ATOM   2574  C  CG    . PRO B 1  121  ? 3.749   -13.623 -62.636 1.00 123.94 ? 121  PRO B CG    1 
ATOM   2575  C  CD    . PRO B 1  121  ? 3.735   -13.580 -61.144 1.00 121.16 ? 121  PRO B CD    1 
ATOM   2576  N  N     . GLY B 1  122  ? 3.528   -17.148 -60.266 1.00 121.43 ? 122  GLY B N     1 
ATOM   2577  C  CA    . GLY B 1  122  ? 4.000   -18.437 -59.801 1.00 117.61 ? 122  GLY B CA    1 
ATOM   2578  C  C     . GLY B 1  122  ? 3.079   -19.078 -58.785 1.00 115.74 ? 122  GLY B C     1 
ATOM   2579  O  O     . GLY B 1  122  ? 3.461   -20.038 -58.116 1.00 115.48 ? 122  GLY B O     1 
ATOM   2580  N  N     . MET B 1  123  ? 1.863   -18.553 -58.665 1.00 114.24 ? 123  MET B N     1 
ATOM   2581  C  CA    . MET B 1  123  ? 0.910   -19.086 -57.700 1.00 113.24 ? 123  MET B CA    1 
ATOM   2582  C  C     . MET B 1  123  ? 0.240   -20.352 -58.215 1.00 110.99 ? 123  MET B C     1 
ATOM   2583  O  O     . MET B 1  123  ? -0.372  -20.352 -59.282 1.00 109.16 ? 123  MET B O     1 
ATOM   2584  C  CB    . MET B 1  123  ? -0.159  -18.050 -57.355 1.00 111.90 ? 123  MET B CB    1 
ATOM   2585  C  CG    . MET B 1  123  ? -1.137  -18.538 -56.296 1.00 112.04 ? 123  MET B CG    1 
ATOM   2586  S  SD    . MET B 1  123  ? -2.590  -17.488 -56.118 1.00 115.34 ? 123  MET B SD    1 
ATOM   2587  C  CE    . MET B 1  123  ? -3.325  -17.670 -57.742 1.00 122.02 ? 123  MET B CE    1 
ATOM   2588  N  N     . HIS B 1  124  ? 0.361   -21.427 -57.443 1.00 111.33 ? 124  HIS B N     1 
ATOM   2589  C  CA    . HIS B 1  124  ? -0.279  -22.691 -57.776 1.00 114.67 ? 124  HIS B CA    1 
ATOM   2590  C  C     . HIS B 1  124  ? -1.793  -22.518 -57.799 1.00 117.93 ? 124  HIS B C     1 
ATOM   2591  O  O     . HIS B 1  124  ? -2.345  -21.732 -57.029 1.00 117.98 ? 124  HIS B O     1 
ATOM   2592  C  CB    . HIS B 1  124  ? 0.128   -23.774 -56.773 1.00 114.28 ? 124  HIS B CB    1 
ATOM   2593  C  CG    . HIS B 1  124  ? -0.491  -25.110 -57.036 1.00 115.71 ? 124  HIS B CG    1 
ATOM   2594  N  ND1   . HIS B 1  124  ? 0.055   -26.026 -57.913 1.00 116.06 ? 124  HIS B ND1   1 
ATOM   2595  C  CD2   . HIS B 1  124  ? -1.606  -25.692 -56.536 1.00 116.75 ? 124  HIS B CD2   1 
ATOM   2596  C  CE1   . HIS B 1  124  ? -0.698  -27.108 -57.940 1.00 120.39 ? 124  HIS B CE1   1 
ATOM   2597  N  NE2   . HIS B 1  124  ? -1.714  -26.932 -57.113 1.00 118.57 ? 124  HIS B NE2   1 
ATOM   2598  N  N     . ILE B 1  125  ? -2.461  -23.236 -58.696 1.00 122.64 ? 125  ILE B N     1 
ATOM   2599  C  CA    . ILE B 1  125  ? -3.913  -23.149 -58.807 1.00 121.10 ? 125  ILE B CA    1 
ATOM   2600  C  C     . ILE B 1  125  ? -4.553  -24.531 -58.795 1.00 116.46 ? 125  ILE B C     1 
ATOM   2601  O  O     . ILE B 1  125  ? -5.369  -24.839 -57.927 1.00 111.50 ? 125  ILE B O     1 
ATOM   2602  C  CB    . ILE B 1  125  ? -4.345  -22.410 -60.089 1.00 118.43 ? 125  ILE B CB    1 
ATOM   2603  C  CG1   . ILE B 1  125  ? -3.822  -20.972 -60.082 1.00 113.68 ? 125  ILE B CG1   1 
ATOM   2604  C  CG2   . ILE B 1  125  ? -5.858  -22.421 -60.218 1.00 107.79 ? 125  ILE B CG2   1 
ATOM   2605  C  CD1   . ILE B 1  125  ? -4.192  -20.182 -61.316 1.00 112.68 ? 125  ILE B CD1   1 
ATOM   2606  N  N     . ALA B 1  126  ? -4.176  -25.360 -59.763 1.00 121.16 ? 126  ALA B N     1 
ATOM   2607  C  CA    . ALA B 1  126  ? -4.747  -26.695 -59.882 1.00 126.98 ? 126  ALA B CA    1 
ATOM   2608  C  C     . ALA B 1  126  ? -3.813  -27.645 -60.621 1.00 132.18 ? 126  ALA B C     1 
ATOM   2609  O  O     . ALA B 1  126  ? -3.144  -27.257 -61.580 1.00 129.13 ? 126  ALA B O     1 
ATOM   2610  C  CB    . ALA B 1  126  ? -6.093  -26.630 -60.583 1.00 124.17 ? 126  ALA B CB    1 
ATOM   2611  N  N     . THR B 1  127  ? -3.774  -28.893 -60.167 1.00 136.97 ? 127  THR B N     1 
ATOM   2612  C  CA    . THR B 1  127  ? -2.944  -29.908 -60.799 1.00 134.45 ? 127  THR B CA    1 
ATOM   2613  C  C     . THR B 1  127  ? -3.783  -30.759 -61.745 1.00 135.35 ? 127  THR B C     1 
ATOM   2614  O  O     . THR B 1  127  ? -4.652  -31.521 -61.315 1.00 131.13 ? 127  THR B O     1 
ATOM   2615  C  CB    . THR B 1  127  ? -2.257  -30.814 -59.757 1.00 129.95 ? 127  THR B CB    1 
ATOM   2616  O  OG1   . THR B 1  127  ? -1.519  -30.008 -58.831 1.00 126.05 ? 127  THR B OG1   1 
ATOM   2617  C  CG2   . THR B 1  127  ? -1.306  -31.783 -60.440 1.00 124.39 ? 127  THR B CG2   1 
ATOM   2618  N  N     . LEU B 1  128  ? -3.521  -30.608 -63.039 1.00 134.51 ? 128  LEU B N     1 
ATOM   2619  C  CA    . LEU B 1  128  ? -4.215  -31.369 -64.069 1.00 135.60 ? 128  LEU B CA    1 
ATOM   2620  C  C     . LEU B 1  128  ? -3.484  -32.665 -64.384 1.00 138.45 ? 128  LEU B C     1 
ATOM   2621  O  O     . LEU B 1  128  ? -2.257  -32.685 -64.479 1.00 138.42 ? 128  LEU B O     1 
ATOM   2622  C  CB    . LEU B 1  128  ? -4.359  -30.538 -65.347 1.00 138.95 ? 128  LEU B CB    1 
ATOM   2623  C  CG    . LEU B 1  128  ? -5.424  -29.442 -65.372 1.00 142.60 ? 128  LEU B CG    1 
ATOM   2624  C  CD1   . LEU B 1  128  ? -5.272  -28.579 -66.615 1.00 134.53 ? 128  LEU B CD1   1 
ATOM   2625  C  CD2   . LEU B 1  128  ? -6.811  -30.052 -65.318 1.00 145.60 ? 128  LEU B CD2   1 
ATOM   2626  N  N     . ASN B 1  129  ? -4.240  -33.746 -64.544 1.00 141.03 ? 129  ASN B N     1 
ATOM   2627  C  CA    . ASN B 1  129  ? -3.666  -35.012 -64.987 1.00 149.19 ? 129  ASN B CA    1 
ATOM   2628  C  C     . ASN B 1  129  ? -3.859  -35.175 -66.492 1.00 149.78 ? 129  ASN B C     1 
ATOM   2629  O  O     . ASN B 1  129  ? -4.359  -34.266 -67.154 1.00 146.48 ? 129  ASN B O     1 
ATOM   2630  C  CB    . ASN B 1  129  ? -4.288  -36.189 -64.229 1.00 147.15 ? 129  ASN B CB    1 
ATOM   2631  C  CG    . ASN B 1  129  ? -5.730  -36.449 -64.628 1.00 140.53 ? 129  ASN B CG    1 
ATOM   2632  O  OD1   . ASN B 1  129  ? -6.445  -35.541 -65.049 1.00 142.69 ? 129  ASN B OD1   1 
ATOM   2633  N  ND2   . ASN B 1  129  ? -6.163  -37.697 -64.491 1.00 132.47 ? 129  ASN B ND2   1 
ATOM   2634  N  N     . ASP B 1  130  ? -3.465  -36.325 -67.032 1.00 153.98 ? 130  ASP B N     1 
ATOM   2635  C  CA    . ASP B 1  130  ? -3.612  -36.567 -68.465 1.00 156.67 ? 130  ASP B CA    1 
ATOM   2636  C  C     . ASP B 1  130  ? -5.093  -36.691 -68.841 1.00 161.68 ? 130  ASP B C     1 
ATOM   2637  O  O     . ASP B 1  130  ? -5.923  -37.085 -68.016 1.00 155.34 ? 130  ASP B O     1 
ATOM   2638  C  CB    . ASP B 1  130  ? -2.827  -37.816 -68.895 1.00 152.44 ? 130  ASP B CB    1 
ATOM   2639  C  CG    . ASP B 1  130  ? -3.435  -39.110 -68.381 1.00 151.31 ? 130  ASP B CG    1 
ATOM   2640  O  OD1   . ASP B 1  130  ? -4.061  -39.099 -67.300 1.00 155.57 ? 130  ASP B OD1   1 
ATOM   2641  O  OD2   . ASP B 1  130  ? -3.276  -40.145 -69.064 1.00 141.65 ? 130  ASP B OD2   1 
ATOM   2642  N  N     . LYS B 1  131  ? -5.408  -36.335 -70.086 1.00 160.42 ? 131  LYS B N     1 
ATOM   2643  C  CA    . LYS B 1  131  ? -6.789  -36.224 -70.561 1.00 146.94 ? 131  LYS B CA    1 
ATOM   2644  C  C     . LYS B 1  131  ? -7.589  -35.273 -69.676 1.00 147.11 ? 131  LYS B C     1 
ATOM   2645  O  O     . LYS B 1  131  ? -8.799  -35.433 -69.506 1.00 146.65 ? 131  LYS B O     1 
ATOM   2646  C  CB    . LYS B 1  131  ? -7.467  -37.595 -70.617 1.00 136.66 ? 131  LYS B CB    1 
ATOM   2647  C  CG    . LYS B 1  131  ? -6.884  -38.528 -71.662 1.00 135.10 ? 131  LYS B CG    1 
ATOM   2648  C  CD    . LYS B 1  131  ? -7.668  -39.822 -71.736 1.00 129.82 ? 131  LYS B CD    1 
ATOM   2649  C  CE    . LYS B 1  131  ? -7.719  -40.507 -70.384 1.00 137.92 ? 131  LYS B CE    1 
ATOM   2650  N  NZ    . LYS B 1  131  ? -8.474  -41.788 -70.452 1.00 137.91 ? 131  LYS B NZ    1 
ATOM   2651  N  N     . GLY B 1  132  ? -6.901  -34.283 -69.117 1.00 146.72 ? 132  GLY B N     1 
ATOM   2652  C  CA    . GLY B 1  132  ? -7.520  -33.316 -68.232 1.00 146.61 ? 132  GLY B CA    1 
ATOM   2653  C  C     . GLY B 1  132  ? -7.729  -31.981 -68.915 1.00 145.35 ? 132  GLY B C     1 
ATOM   2654  O  O     . GLY B 1  132  ? -6.770  -31.300 -69.280 1.00 138.44 ? 132  GLY B O     1 
ATOM   2655  N  N     . LYS B 1  133  ? -8.992  -31.606 -69.086 1.00 144.84 ? 133  LYS B N     1 
ATOM   2656  C  CA    . LYS B 1  133  ? -9.342  -30.377 -69.784 1.00 135.67 ? 133  LYS B CA    1 
ATOM   2657  C  C     . LYS B 1  133  ? -9.799  -29.304 -68.799 1.00 131.15 ? 133  LYS B C     1 
ATOM   2658  O  O     . LYS B 1  133  ? -10.494 -29.601 -67.827 1.00 128.74 ? 133  LYS B O     1 
ATOM   2659  C  CB    . LYS B 1  133  ? -10.430 -30.658 -70.823 1.00 129.84 ? 133  LYS B CB    1 
ATOM   2660  C  CG    . LYS B 1  133  ? -10.672 -29.522 -71.791 1.00 130.46 ? 133  LYS B CG    1 
ATOM   2661  C  CD    . LYS B 1  133  ? -11.531 -29.974 -72.956 1.00 122.36 ? 133  LYS B CD    1 
ATOM   2662  C  CE    . LYS B 1  133  ? -11.931 -28.796 -73.825 1.00 132.55 ? 133  LYS B CE    1 
ATOM   2663  N  NZ    . LYS B 1  133  ? -10.746 -28.086 -74.382 1.00 127.34 ? 133  LYS B NZ    1 
ATOM   2664  N  N     . LEU B 1  134  ? -9.407  -28.057 -69.048 1.00 128.69 ? 134  LEU B N     1 
ATOM   2665  C  CA    . LEU B 1  134  ? -9.711  -26.980 -68.112 1.00 127.10 ? 134  LEU B CA    1 
ATOM   2666  C  C     . LEU B 1  134  ? -9.816  -25.609 -68.781 1.00 126.91 ? 134  LEU B C     1 
ATOM   2667  O  O     . LEU B 1  134  ? -8.822  -25.057 -69.254 1.00 118.84 ? 134  LEU B O     1 
ATOM   2668  C  CB    . LEU B 1  134  ? -8.651  -26.941 -67.012 1.00 126.59 ? 134  LEU B CB    1 
ATOM   2669  C  CG    . LEU B 1  134  ? -9.074  -26.313 -65.687 1.00 125.46 ? 134  LEU B CG    1 
ATOM   2670  C  CD1   . LEU B 1  134  ? -10.336 -26.982 -65.172 1.00 121.65 ? 134  LEU B CD1   1 
ATOM   2671  C  CD2   . LEU B 1  134  ? -7.948  -26.431 -64.672 1.00 126.48 ? 134  LEU B CD2   1 
ATOM   2672  N  N     . GLU B 1  135  ? -11.032 -25.068 -68.808 1.00 135.46 ? 135  GLU B N     1 
ATOM   2673  C  CA    . GLU B 1  135  ? -11.291 -23.739 -69.357 1.00 133.28 ? 135  GLU B CA    1 
ATOM   2674  C  C     . GLU B 1  135  ? -12.065 -22.903 -68.348 1.00 128.68 ? 135  GLU B C     1 
ATOM   2675  O  O     . GLU B 1  135  ? -13.128 -23.310 -67.876 1.00 128.81 ? 135  GLU B O     1 
ATOM   2676  C  CB    . GLU B 1  135  ? -12.072 -23.828 -70.670 1.00 135.48 ? 135  GLU B CB    1 
ATOM   2677  C  CG    . GLU B 1  135  ? -11.311 -24.475 -71.815 1.00 131.99 ? 135  GLU B CG    1 
ATOM   2678  C  CD    . GLU B 1  135  ? -12.190 -24.739 -73.023 1.00 131.86 ? 135  GLU B CD    1 
ATOM   2679  O  OE1   . GLU B 1  135  ? -13.404 -24.450 -72.957 1.00 138.04 ? 135  GLU B OE1   1 
ATOM   2680  O  OE2   . GLU B 1  135  ? -11.667 -25.242 -74.039 1.00 129.82 ? 135  GLU B OE2   1 
ATOM   2681  N  N     . VAL B 1  136  ? -11.528 -21.737 -68.006 1.00 124.59 ? 136  VAL B N     1 
ATOM   2682  C  CA    . VAL B 1  136  ? -12.158 -20.896 -66.999 1.00 123.40 ? 136  VAL B CA    1 
ATOM   2683  C  C     . VAL B 1  136  ? -12.258 -19.443 -67.444 1.00 118.84 ? 136  VAL B C     1 
ATOM   2684  O  O     . VAL B 1  136  ? -11.279 -18.840 -67.884 1.00 111.00 ? 136  VAL B O     1 
ATOM   2685  C  CB    . VAL B 1  136  ? -11.397 -20.950 -65.661 1.00 123.88 ? 136  VAL B CB    1 
ATOM   2686  C  CG1   . VAL B 1  136  ? -12.150 -20.171 -64.598 1.00 130.59 ? 136  VAL B CG1   1 
ATOM   2687  C  CG2   . VAL B 1  136  ? -11.196 -22.392 -65.215 1.00 119.50 ? 136  VAL B CG2   1 
ATOM   2688  N  N     . GLU B 1  137  ? -13.458 -18.892 -67.327 1.00 120.52 ? 137  GLU B N     1 
ATOM   2689  C  CA    . GLU B 1  137  ? -13.687 -17.488 -67.611 1.00 121.65 ? 137  GLU B CA    1 
ATOM   2690  C  C     . GLU B 1  137  ? -13.724 -16.700 -66.310 1.00 129.03 ? 137  GLU B C     1 
ATOM   2691  O  O     . GLU B 1  137  ? -14.488 -17.028 -65.404 1.00 135.89 ? 137  GLU B O     1 
ATOM   2692  C  CB    . GLU B 1  137  ? -14.987 -17.305 -68.386 1.00 117.82 ? 137  GLU B CB    1 
ATOM   2693  C  CG    . GLU B 1  137  ? -15.473 -15.879 -68.426 1.00 120.53 ? 137  GLU B CG    1 
ATOM   2694  C  CD    . GLU B 1  137  ? -16.814 -15.760 -69.100 1.00 124.14 ? 137  GLU B CD    1 
ATOM   2695  O  OE1   . GLU B 1  137  ? -17.126 -16.623 -69.947 1.00 125.00 ? 137  GLU B OE1   1 
ATOM   2696  O  OE2   . GLU B 1  137  ? -17.559 -14.812 -68.778 1.00 128.94 ? 137  GLU B OE2   1 
ATOM   2697  N  N     . LEU B 1  138  ? -12.896 -15.665 -66.217 1.00 124.22 ? 138  LEU B N     1 
ATOM   2698  C  CA    . LEU B 1  138  ? -12.803 -14.876 -64.994 1.00 121.40 ? 138  LEU B CA    1 
ATOM   2699  C  C     . LEU B 1  138  ? -13.436 -13.496 -65.162 1.00 123.84 ? 138  LEU B C     1 
ATOM   2700  O  O     . LEU B 1  138  ? -13.299 -12.871 -66.212 1.00 127.10 ? 138  LEU B O     1 
ATOM   2701  C  CB    . LEU B 1  138  ? -11.340 -14.734 -64.567 1.00 121.26 ? 138  LEU B CB    1 
ATOM   2702  C  CG    . LEU B 1  138  ? -10.537 -16.022 -64.369 1.00 121.68 ? 138  LEU B CG    1 
ATOM   2703  C  CD1   . LEU B 1  138  ? -9.093  -15.708 -63.997 1.00 117.96 ? 138  LEU B CD1   1 
ATOM   2704  C  CD2   . LEU B 1  138  ? -11.182 -16.905 -63.315 1.00 113.83 ? 138  LEU B CD2   1 
ATOM   2705  N  N     . VAL B 1  139  ? -14.127 -13.029 -64.124 1.00 122.25 ? 139  VAL B N     1 
ATOM   2706  C  CA    . VAL B 1  139  ? -14.738 -11.699 -64.138 1.00 127.62 ? 139  VAL B CA    1 
ATOM   2707  C  C     . VAL B 1  139  ? -14.079 -10.776 -63.112 1.00 125.95 ? 139  VAL B C     1 
ATOM   2708  O  O     . VAL B 1  139  ? -14.287 -10.925 -61.908 1.00 124.09 ? 139  VAL B O     1 
ATOM   2709  C  CB    . VAL B 1  139  ? -16.253 -11.761 -63.853 1.00 123.85 ? 139  VAL B CB    1 
ATOM   2710  C  CG1   . VAL B 1  139  ? -16.847 -10.357 -63.828 1.00 125.89 ? 139  VAL B CG1   1 
ATOM   2711  C  CG2   . VAL B 1  139  ? -16.959 -12.630 -64.885 1.00 119.73 ? 139  VAL B CG2   1 
ATOM   2712  N  N     . VAL B 1  140  ? -13.294 -9.819  -63.599 1.00 127.22 ? 140  VAL B N     1 
ATOM   2713  C  CA    . VAL B 1  140  ? -12.552 -8.904  -62.733 1.00 124.10 ? 140  VAL B CA    1 
ATOM   2714  C  C     . VAL B 1  140  ? -13.251 -7.555  -62.586 1.00 127.86 ? 140  VAL B C     1 
ATOM   2715  O  O     . VAL B 1  140  ? -13.584 -6.907  -63.578 1.00 135.29 ? 140  VAL B O     1 
ATOM   2716  C  CB    . VAL B 1  140  ? -11.120 -8.662  -63.268 1.00 121.52 ? 140  VAL B CB    1 
ATOM   2717  C  CG1   . VAL B 1  140  ? -10.414 -7.582  -62.459 1.00 119.71 ? 140  VAL B CG1   1 
ATOM   2718  C  CG2   . VAL B 1  140  ? -10.321 -9.953  -63.257 1.00 124.16 ? 140  VAL B CG2   1 
ATOM   2719  N  N     . GLU B 1  141  ? -13.473 -7.134  -61.345 1.00 125.24 ? 141  GLU B N     1 
ATOM   2720  C  CA    . GLU B 1  141  ? -14.026 -5.809  -61.084 1.00 127.89 ? 141  GLU B CA    1 
ATOM   2721  C  C     . GLU B 1  141  ? -13.094 -4.973  -60.217 1.00 126.27 ? 141  GLU B C     1 
ATOM   2722  O  O     . GLU B 1  141  ? -12.030 -5.433  -59.801 1.00 121.83 ? 141  GLU B O     1 
ATOM   2723  C  CB    . GLU B 1  141  ? -15.398 -5.911  -60.411 1.00 123.62 ? 141  GLU B CB    1 
ATOM   2724  C  CG    . GLU B 1  141  ? -16.520 -6.361  -61.327 1.00 124.62 ? 141  GLU B CG    1 
ATOM   2725  C  CD    . GLU B 1  141  ? -17.886 -6.163  -60.700 1.00 125.91 ? 141  GLU B CD    1 
ATOM   2726  O  OE1   . GLU B 1  141  ? -17.997 -5.336  -59.770 1.00 117.33 ? 141  GLU B OE1   1 
ATOM   2727  O  OE2   . GLU B 1  141  ? -18.845 -6.834  -61.133 1.00 133.62 ? 141  GLU B OE2   1 
ATOM   2728  N  N     . ARG B 1  142  ? -13.504 -3.737  -59.954 1.00 125.50 ? 142  ARG B N     1 
ATOM   2729  C  CA    . ARG B 1  142  ? -12.786 -2.872  -59.032 1.00 118.36 ? 142  ARG B CA    1 
ATOM   2730  C  C     . ARG B 1  142  ? -13.712 -2.436  -57.902 1.00 113.90 ? 142  ARG B C     1 
ATOM   2731  O  O     . ARG B 1  142  ? -14.902 -2.199  -58.115 1.00 113.19 ? 142  ARG B O     1 
ATOM   2732  C  CB    . ARG B 1  142  ? -12.212 -1.658  -59.762 1.00 117.33 ? 142  ARG B CB    1 
ATOM   2733  C  CG    . ARG B 1  142  ? -11.057 -1.998  -60.689 1.00 120.70 ? 142  ARG B CG    1 
ATOM   2734  C  CD    . ARG B 1  142  ? -10.571 -0.772  -61.436 1.00 124.33 ? 142  ARG B CD    1 
ATOM   2735  N  NE    . ARG B 1  142  ? -10.217 0.314   -60.529 1.00 118.83 ? 142  ARG B NE    1 
ATOM   2736  C  CZ    . ARG B 1  142  ? -9.021  0.455   -59.970 1.00 123.40 ? 142  ARG B CZ    1 
ATOM   2737  N  NH1   . ARG B 1  142  ? -8.063  -0.426  -60.223 1.00 129.24 ? 142  ARG B NH1   1 
ATOM   2738  N  NH2   . ARG B 1  142  ? -8.782  1.475   -59.157 1.00 123.37 ? 142  ARG B NH2   1 
ATOM   2739  N  N     . GLY B 1  143  ? -13.158 -2.349  -56.698 1.00 112.89 ? 143  GLY B N     1 
ATOM   2740  C  CA    . GLY B 1  143  ? -13.925 -1.978  -55.525 1.00 114.17 ? 143  GLY B CA    1 
ATOM   2741  C  C     . GLY B 1  143  ? -13.017 -1.726  -54.339 1.00 114.72 ? 143  GLY B C     1 
ATOM   2742  O  O     . GLY B 1  143  ? -11.812 -1.533  -54.505 1.00 112.77 ? 143  GLY B O     1 
ATOM   2743  N  N     . ARG B 1  144  ? -13.592 -1.735  -53.140 1.00 112.56 ? 144  ARG B N     1 
ATOM   2744  C  CA    . ARG B 1  144  ? -12.828 -1.497  -51.920 1.00 105.03 ? 144  ARG B CA    1 
ATOM   2745  C  C     . ARG B 1  144  ? -13.168 -2.530  -50.847 1.00 100.48 ? 144  ARG B C     1 
ATOM   2746  O  O     . ARG B 1  144  ? -14.310 -2.979  -50.742 1.00 100.06 ? 144  ARG B O     1 
ATOM   2747  C  CB    . ARG B 1  144  ? -13.093 -0.082  -51.389 1.00 101.82 ? 144  ARG B CB    1 
ATOM   2748  C  CG    . ARG B 1  144  ? -12.690 1.040   -52.336 1.00 101.11 ? 144  ARG B CG    1 
ATOM   2749  C  CD    . ARG B 1  144  ? -13.232 2.383   -51.868 1.00 100.90 ? 144  ARG B CD    1 
ATOM   2750  N  NE    . ARG B 1  144  ? -13.198 3.388   -52.928 1.00 105.47 ? 144  ARG B NE    1 
ATOM   2751  C  CZ    . ARG B 1  144  ? -12.185 4.223   -53.137 1.00 103.83 ? 144  ARG B CZ    1 
ATOM   2752  N  NH1   . ARG B 1  144  ? -11.118 4.177   -52.354 1.00 104.66 ? 144  ARG B NH1   1 
ATOM   2753  N  NH2   . ARG B 1  144  ? -12.240 5.105   -54.126 1.00 102.43 ? 144  ARG B NH2   1 
ATOM   2754  N  N     . GLY B 1  145  ? -12.166 -2.909  -50.061 1.00 93.21  ? 145  GLY B N     1 
ATOM   2755  C  CA    . GLY B 1  145  ? -12.377 -3.792  -48.928 1.00 89.49  ? 145  GLY B CA    1 
ATOM   2756  C  C     . GLY B 1  145  ? -12.752 -5.221  -49.274 1.00 86.91  ? 145  GLY B C     1 
ATOM   2757  O  O     . GLY B 1  145  ? -11.979 -5.950  -49.893 1.00 89.40  ? 145  GLY B O     1 
ATOM   2758  N  N     . TYR B 1  146  ? -13.952 -5.621  -48.870 1.00 83.88  ? 146  TYR B N     1 
ATOM   2759  C  CA    . TYR B 1  146  ? -14.365 -7.014  -48.965 1.00 89.04  ? 146  TYR B CA    1 
ATOM   2760  C  C     . TYR B 1  146  ? -15.865 -7.103  -49.243 1.00 95.53  ? 146  TYR B C     1 
ATOM   2761  O  O     . TYR B 1  146  ? -16.668 -6.449  -48.577 1.00 92.62  ? 146  TYR B O     1 
ATOM   2762  C  CB    . TYR B 1  146  ? -13.994 -7.753  -47.671 1.00 92.15  ? 146  TYR B CB    1 
ATOM   2763  C  CG    . TYR B 1  146  ? -14.292 -9.240  -47.642 1.00 93.27  ? 146  TYR B CG    1 
ATOM   2764  C  CD1   . TYR B 1  146  ? -15.536 -9.711  -47.240 1.00 94.80  ? 146  TYR B CD1   1 
ATOM   2765  C  CD2   . TYR B 1  146  ? -13.319 -10.173 -47.982 1.00 90.67  ? 146  TYR B CD2   1 
ATOM   2766  C  CE1   . TYR B 1  146  ? -15.813 -11.066 -47.199 1.00 91.04  ? 146  TYR B CE1   1 
ATOM   2767  C  CE2   . TYR B 1  146  ? -13.587 -11.532 -47.944 1.00 90.15  ? 146  TYR B CE2   1 
ATOM   2768  C  CZ    . TYR B 1  146  ? -14.836 -11.972 -47.551 1.00 89.93  ? 146  TYR B CZ    1 
ATOM   2769  O  OH    . TYR B 1  146  ? -15.112 -13.321 -47.508 1.00 87.88  ? 146  TYR B OH    1 
ATOM   2770  N  N     . VAL B 1  147  ? -16.232 -7.903  -50.241 1.00 97.77  ? 147  VAL B N     1 
ATOM   2771  C  CA    . VAL B 1  147  ? -17.629 -8.063  -50.635 1.00 98.93  ? 147  VAL B CA    1 
ATOM   2772  C  C     . VAL B 1  147  ? -18.014 -9.542  -50.691 1.00 100.80 ? 147  VAL B C     1 
ATOM   2773  O  O     . VAL B 1  147  ? -17.342 -10.336 -51.349 1.00 102.84 ? 147  VAL B O     1 
ATOM   2774  C  CB    . VAL B 1  147  ? -17.904 -7.402  -52.006 1.00 104.00 ? 147  VAL B CB    1 
ATOM   2775  C  CG1   . VAL B 1  147  ? -19.296 -7.754  -52.507 1.00 110.89 ? 147  VAL B CG1   1 
ATOM   2776  C  CG2   . VAL B 1  147  ? -17.736 -5.891  -51.911 1.00 107.14 ? 147  VAL B CG2   1 
ATOM   2777  N  N     . PRO B 1  148  ? -19.099 -9.914  -49.989 1.00 99.70  ? 148  PRO B N     1 
ATOM   2778  C  CA    . PRO B 1  148  ? -19.607 -11.291 -49.907 1.00 101.89 ? 148  PRO B CA    1 
ATOM   2779  C  C     . PRO B 1  148  ? -19.948 -11.900 -51.268 1.00 108.57 ? 148  PRO B C     1 
ATOM   2780  O  O     . PRO B 1  148  ? -19.872 -11.217 -52.288 1.00 113.79 ? 148  PRO B O     1 
ATOM   2781  C  CB    . PRO B 1  148  ? -20.869 -11.145 -49.052 1.00 100.14 ? 148  PRO B CB    1 
ATOM   2782  C  CG    . PRO B 1  148  ? -20.630 -9.927  -48.237 1.00 95.98  ? 148  PRO B CG    1 
ATOM   2783  C  CD    . PRO B 1  148  ? -19.870 -8.997  -49.132 1.00 100.60 ? 148  PRO B CD    1 
ATOM   2784  N  N     . ALA B 1  149  ? -20.330 -13.174 -51.274 1.00 109.10 ? 149  ALA B N     1 
ATOM   2785  C  CA    . ALA B 1  149  ? -20.620 -13.881 -52.518 1.00 119.79 ? 149  ALA B CA    1 
ATOM   2786  C  C     . ALA B 1  149  ? -22.076 -13.721 -52.968 1.00 127.25 ? 149  ALA B C     1 
ATOM   2787  O  O     . ALA B 1  149  ? -22.350 -13.629 -54.165 1.00 130.40 ? 149  ALA B O     1 
ATOM   2788  C  CB    . ALA B 1  149  ? -20.277 -15.359 -52.373 1.00 119.77 ? 149  ALA B CB    1 
ATOM   2789  N  N     . VAL B 1  150  ? -23.006 -13.684 -52.016 1.00 128.03 ? 150  VAL B N     1 
ATOM   2790  C  CA    . VAL B 1  150  ? -24.433 -13.626 -52.340 1.00 133.50 ? 150  VAL B CA    1 
ATOM   2791  C  C     . VAL B 1  150  ? -24.796 -12.321 -53.050 1.00 130.88 ? 150  VAL B C     1 
ATOM   2792  O  O     . VAL B 1  150  ? -25.795 -12.248 -53.769 1.00 130.19 ? 150  VAL B O     1 
ATOM   2793  C  CB    . VAL B 1  150  ? -25.311 -13.777 -51.075 1.00 138.00 ? 150  VAL B CB    1 
ATOM   2794  C  CG1   . VAL B 1  150  ? -26.753 -14.125 -51.453 1.00 125.09 ? 150  VAL B CG1   1 
ATOM   2795  C  CG2   . VAL B 1  150  ? -24.735 -14.841 -50.155 1.00 136.17 ? 150  VAL B CG2   1 
ATOM   2796  N  N     . GLN B 1  151  ? -23.974 -11.296 -52.849 1.00 129.13 ? 151  GLN B N     1 
ATOM   2797  C  CA    . GLN B 1  151  ? -24.177 -10.011 -53.509 1.00 138.19 ? 151  GLN B CA    1 
ATOM   2798  C  C     . GLN B 1  151  ? -23.684 -10.049 -54.957 1.00 140.16 ? 151  GLN B C     1 
ATOM   2799  O  O     . GLN B 1  151  ? -23.916 -9.115  -55.726 1.00 143.94 ? 151  GLN B O     1 
ATOM   2800  C  CB    . GLN B 1  151  ? -23.470 -8.887  -52.738 1.00 139.78 ? 151  GLN B CB    1 
ATOM   2801  C  CG    . GLN B 1  151  ? -24.045 -8.601  -51.351 1.00 131.78 ? 151  GLN B CG    1 
ATOM   2802  C  CD    . GLN B 1  151  ? -23.557 -7.281  -50.770 1.00 122.68 ? 151  GLN B CD    1 
ATOM   2803  O  OE1   . GLN B 1  151  ? -22.890 -6.499  -51.448 1.00 115.44 ? 151  GLN B OE1   1 
ATOM   2804  N  NE2   . GLN B 1  151  ? -23.892 -7.029  -49.510 1.00 124.99 ? 151  GLN B NE2   1 
ATOM   2805  N  N     . ASN B 1  152  ? -23.001 -11.130 -55.324 1.00 137.50 ? 152  ASN B N     1 
ATOM   2806  C  CA    . ASN B 1  152  ? -22.522 -11.302 -56.691 1.00 141.49 ? 152  ASN B CA    1 
ATOM   2807  C  C     . ASN B 1  152  ? -23.099 -12.565 -57.331 1.00 143.70 ? 152  ASN B C     1 
ATOM   2808  O  O     . ASN B 1  152  ? -22.431 -13.232 -58.122 1.00 146.05 ? 152  ASN B O     1 
ATOM   2809  C  CB    . ASN B 1  152  ? -20.989 -11.351 -56.727 1.00 137.55 ? 152  ASN B CB    1 
ATOM   2810  C  CG    . ASN B 1  152  ? -20.345 -10.131 -56.085 1.00 128.57 ? 152  ASN B CG    1 
ATOM   2811  O  OD1   . ASN B 1  152  ? -20.345 -9.039  -56.656 1.00 122.84 ? 152  ASN B OD1   1 
ATOM   2812  N  ND2   . ASN B 1  152  ? -19.780 -10.318 -54.898 1.00 122.25 ? 152  ASN B ND2   1 
ATOM   2813  N  N     . ARG B 1  153  ? -24.347 -12.880 -56.989 1.00 142.34 ? 153  ARG B N     1 
ATOM   2814  C  CA    . ARG B 1  153  ? -25.009 -14.087 -57.485 1.00 144.43 ? 153  ARG B CA    1 
ATOM   2815  C  C     . ARG B 1  153  ? -25.699 -13.861 -58.834 1.00 148.68 ? 153  ARG B C     1 
ATOM   2816  O  O     . ARG B 1  153  ? -26.464 -14.707 -59.301 1.00 144.96 ? 153  ARG B O     1 
ATOM   2817  C  CB    . ARG B 1  153  ? -26.032 -14.590 -56.463 1.00 138.73 ? 153  ARG B CB    1 
ATOM   2818  C  CG    . ARG B 1  153  ? -27.287 -13.741 -56.389 1.00 136.63 ? 153  ARG B CG    1 
ATOM   2819  C  CD    . ARG B 1  153  ? -28.294 -14.303 -55.407 1.00 130.29 ? 153  ARG B CD    1 
ATOM   2820  N  NE    . ARG B 1  153  ? -29.566 -13.592 -55.489 1.00 136.16 ? 153  ARG B NE    1 
ATOM   2821  C  CZ    . ARG B 1  153  ? -30.584 -13.789 -54.661 1.00 130.15 ? 153  ARG B CZ    1 
ATOM   2822  N  NH1   . ARG B 1  153  ? -31.708 -13.098 -54.808 1.00 125.10 ? 153  ARG B NH1   1 
ATOM   2823  N  NH2   . ARG B 1  153  ? -30.476 -14.675 -53.682 1.00 120.36 ? 153  ARG B NH2   1 
ATOM   2824  N  N     . ALA B 1  157  ? -23.239 -15.749 -66.741 1.00 165.22 ? 157  ALA B N     1 
ATOM   2825  C  CA    . ALA B 1  157  ? -24.275 -16.506 -67.444 1.00 158.04 ? 157  ALA B CA    1 
ATOM   2826  C  C     . ALA B 1  157  ? -24.719 -17.709 -66.617 1.00 152.78 ? 157  ALA B C     1 
ATOM   2827  O  O     . ALA B 1  157  ? -23.886 -18.468 -66.124 1.00 151.88 ? 157  ALA B O     1 
ATOM   2828  C  CB    . ALA B 1  157  ? -23.778 -16.953 -68.810 1.00 150.83 ? 157  ALA B CB    1 
ATOM   2829  N  N     . GLU B 1  158  ? -26.032 -17.896 -66.490 1.00 148.05 ? 158  GLU B N     1 
ATOM   2830  C  CA    . GLU B 1  158  ? -26.590 -18.911 -65.593 1.00 146.86 ? 158  GLU B CA    1 
ATOM   2831  C  C     . GLU B 1  158  ? -26.347 -20.346 -66.084 1.00 147.83 ? 158  GLU B C     1 
ATOM   2832  O  O     . GLU B 1  158  ? -27.023 -21.285 -65.661 1.00 137.80 ? 158  GLU B O     1 
ATOM   2833  C  CB    . GLU B 1  158  ? -28.091 -18.663 -65.394 1.00 135.33 ? 158  GLU B CB    1 
ATOM   2834  C  CG    . GLU B 1  158  ? -28.647 -19.188 -64.072 1.00 129.83 ? 158  GLU B CG    1 
ATOM   2835  C  CD    . GLU B 1  158  ? -29.992 -18.583 -63.716 1.00 129.35 ? 158  GLU B CD    1 
ATOM   2836  O  OE1   . GLU B 1  158  ? -30.226 -17.406 -64.067 1.00 133.39 ? 158  GLU B OE1   1 
ATOM   2837  O  OE2   . GLU B 1  158  ? -30.813 -19.284 -63.086 1.00 121.42 ? 158  GLU B OE2   1 
ATOM   2838  N  N     . ILE B 1  159  ? -25.369 -20.504 -66.972 1.00 153.57 ? 159  ILE B N     1 
ATOM   2839  C  CA    . ILE B 1  159  ? -24.940 -21.815 -67.439 1.00 150.88 ? 159  ILE B CA    1 
ATOM   2840  C  C     . ILE B 1  159  ? -23.642 -22.208 -66.733 1.00 148.34 ? 159  ILE B C     1 
ATOM   2841  O  O     . ILE B 1  159  ? -22.711 -22.719 -67.356 1.00 150.04 ? 159  ILE B O     1 
ATOM   2842  C  CB    . ILE B 1  159  ? -24.728 -21.833 -68.971 1.00 157.49 ? 159  ILE B CB    1 
ATOM   2843  C  CG1   . ILE B 1  159  ? -25.618 -20.792 -69.654 1.00 152.09 ? 159  ILE B CG1   1 
ATOM   2844  C  CG2   . ILE B 1  159  ? -24.985 -23.225 -69.535 1.00 157.34 ? 159  ILE B CG2   1 
ATOM   2845  C  CD1   . ILE B 1  159  ? -25.420 -20.702 -71.155 1.00 138.32 ? 159  ILE B CD1   1 
ATOM   2846  N  N     . GLY B 1  160  ? -23.582 -21.950 -65.430 1.00 148.55 ? 160  GLY B N     1 
ATOM   2847  C  CA    . GLY B 1  160  ? -22.408 -22.279 -64.641 1.00 150.19 ? 160  GLY B CA    1 
ATOM   2848  C  C     . GLY B 1  160  ? -21.648 -21.072 -64.118 1.00 149.50 ? 160  GLY B C     1 
ATOM   2849  O  O     . GLY B 1  160  ? -20.417 -21.054 -64.136 1.00 143.78 ? 160  GLY B O     1 
ATOM   2850  N  N     . ARG B 1  161  ? -22.380 -20.064 -63.649 1.00 152.35 ? 161  ARG B N     1 
ATOM   2851  C  CA    . ARG B 1  161  ? -21.770 -18.870 -63.065 1.00 144.58 ? 161  ARG B CA    1 
ATOM   2852  C  C     . ARG B 1  161  ? -21.591 -19.026 -61.559 1.00 139.92 ? 161  ARG B C     1 
ATOM   2853  O  O     . ARG B 1  161  ? -22.530 -19.386 -60.851 1.00 144.84 ? 161  ARG B O     1 
ATOM   2854  C  CB    . ARG B 1  161  ? -22.616 -17.630 -63.360 1.00 146.91 ? 161  ARG B CB    1 
ATOM   2855  N  N     . ILE B 1  162  ? -20.388 -18.745 -61.068 1.00 133.80 ? 162  ILE B N     1 
ATOM   2856  C  CA    . ILE B 1  162  ? -20.101 -18.915 -59.648 1.00 136.78 ? 162  ILE B CA    1 
ATOM   2857  C  C     . ILE B 1  162  ? -19.765 -17.590 -58.966 1.00 130.07 ? 162  ILE B C     1 
ATOM   2858  O  O     . ILE B 1  162  ? -18.808 -16.917 -59.344 1.00 116.45 ? 162  ILE B O     1 
ATOM   2859  C  CB    . ILE B 1  162  ? -18.941 -19.908 -59.425 1.00 135.23 ? 162  ILE B CB    1 
ATOM   2860  C  CG1   . ILE B 1  162  ? -19.225 -21.230 -60.145 1.00 139.97 ? 162  ILE B CG1   1 
ATOM   2861  C  CG2   . ILE B 1  162  ? -18.723 -20.147 -57.939 1.00 133.46 ? 162  ILE B CG2   1 
ATOM   2862  C  CD1   . ILE B 1  162  ? -18.161 -22.292 -59.937 1.00 137.64 ? 162  ILE B CD1   1 
ATOM   2863  N  N     . PRO B 1  163  ? -20.564 -17.211 -57.956 1.00 135.64 ? 163  PRO B N     1 
ATOM   2864  C  CA    . PRO B 1  163  ? -20.317 -15.998 -57.170 1.00 129.37 ? 163  PRO B CA    1 
ATOM   2865  C  C     . PRO B 1  163  ? -19.126 -16.159 -56.228 1.00 133.00 ? 163  PRO B C     1 
ATOM   2866  O  O     . PRO B 1  163  ? -19.081 -17.115 -55.451 1.00 131.55 ? 163  PRO B O     1 
ATOM   2867  C  CB    . PRO B 1  163  ? -21.620 -15.819 -56.385 1.00 128.14 ? 163  PRO B CB    1 
ATOM   2868  C  CG    . PRO B 1  163  ? -22.170 -17.194 -56.259 1.00 127.41 ? 163  PRO B CG    1 
ATOM   2869  C  CD    . PRO B 1  163  ? -21.801 -17.896 -57.536 1.00 139.06 ? 163  PRO B CD    1 
ATOM   2870  N  N     . VAL B 1  164  ? -18.177 -15.229 -56.297 1.00 132.68 ? 164  VAL B N     1 
ATOM   2871  C  CA    . VAL B 1  164  ? -16.947 -15.330 -55.516 1.00 125.29 ? 164  VAL B CA    1 
ATOM   2872  C  C     . VAL B 1  164  ? -16.792 -14.182 -54.519 1.00 114.82 ? 164  VAL B C     1 
ATOM   2873  O  O     . VAL B 1  164  ? -17.207 -13.054 -54.785 1.00 109.91 ? 164  VAL B O     1 
ATOM   2874  C  CB    . VAL B 1  164  ? -15.708 -15.360 -56.434 1.00 117.33 ? 164  VAL B CB    1 
ATOM   2875  C  CG1   . VAL B 1  164  ? -14.487 -15.860 -55.672 1.00 106.89 ? 164  VAL B CG1   1 
ATOM   2876  C  CG2   . VAL B 1  164  ? -15.974 -16.237 -57.645 1.00 125.52 ? 164  VAL B CG2   1 
ATOM   2877  N  N     . ASP B 1  165  ? -16.194 -14.484 -53.371 1.00 105.44 ? 165  ASP B N     1 
ATOM   2878  C  CA    . ASP B 1  165  ? -15.879 -13.476 -52.366 1.00 106.95 ? 165  ASP B CA    1 
ATOM   2879  C  C     . ASP B 1  165  ? -14.816 -12.506 -52.881 1.00 107.61 ? 165  ASP B C     1 
ATOM   2880  O  O     . ASP B 1  165  ? -13.681 -12.902 -53.160 1.00 101.67 ? 165  ASP B O     1 
ATOM   2881  C  CB    . ASP B 1  165  ? -15.408 -14.145 -51.075 1.00 107.36 ? 165  ASP B CB    1 
ATOM   2882  C  CG    . ASP B 1  165  ? -16.365 -15.216 -50.593 1.00 103.10 ? 165  ASP B CG    1 
ATOM   2883  O  OD1   . ASP B 1  165  ? -17.589 -15.035 -50.760 1.00 95.11  ? 165  ASP B OD1   1 
ATOM   2884  O  OD2   . ASP B 1  165  ? -15.895 -16.239 -50.050 1.00 99.39  ? 165  ASP B OD2   1 
ATOM   2885  N  N     . SER B 1  166  ? -15.192 -11.234 -52.994 1.00 110.42 ? 166  SER B N     1 
ATOM   2886  C  CA    . SER B 1  166  ? -14.337 -10.215 -53.599 1.00 106.37 ? 166  SER B CA    1 
ATOM   2887  C  C     . SER B 1  166  ? -13.429 -9.524  -52.591 1.00 97.95  ? 166  SER B C     1 
ATOM   2888  O  O     . SER B 1  166  ? -13.891 -8.757  -51.745 1.00 91.13  ? 166  SER B O     1 
ATOM   2889  C  CB    . SER B 1  166  ? -15.191 -9.163  -54.313 1.00 112.43 ? 166  SER B CB    1 
ATOM   2890  O  OG    . SER B 1  166  ? -16.059 -9.757  -55.261 1.00 127.33 ? 166  SER B OG    1 
ATOM   2891  N  N     . ILE B 1  167  ? -12.132 -9.787  -52.700 1.00 103.33 ? 167  ILE B N     1 
ATOM   2892  C  CA    . ILE B 1  167  ? -11.146 -9.154  -51.835 1.00 99.93  ? 167  ILE B CA    1 
ATOM   2893  C  C     . ILE B 1  167  ? -10.430 -8.039  -52.593 1.00 92.54  ? 167  ILE B C     1 
ATOM   2894  O  O     . ILE B 1  167  ? -9.235  -8.135  -52.883 1.00 83.94  ? 167  ILE B O     1 
ATOM   2895  C  CB    . ILE B 1  167  ? -10.121 -10.175 -51.310 1.00 99.13  ? 167  ILE B CB    1 
ATOM   2896  C  CG1   . ILE B 1  167  ? -10.832 -11.475 -50.923 1.00 99.86  ? 167  ILE B CG1   1 
ATOM   2897  C  CG2   . ILE B 1  167  ? -9.350  -9.601  -50.130 1.00 95.66  ? 167  ILE B CG2   1 
ATOM   2898  C  CD1   . ILE B 1  167  ? -9.932  -12.515 -50.302 1.00 94.48  ? 167  ILE B CD1   1 
ATOM   2899  N  N     . TYR B 1  168  ? -11.179 -6.989  -52.917 1.00 95.97  ? 168  TYR B N     1 
ATOM   2900  C  CA    . TYR B 1  168  ? -10.637 -5.862  -53.659 1.00 101.21 ? 168  TYR B CA    1 
ATOM   2901  C  C     . TYR B 1  168  ? -9.431  -5.255  -52.948 1.00 96.26  ? 168  TYR B C     1 
ATOM   2902  O  O     . TYR B 1  168  ? -8.470  -4.832  -53.589 1.00 95.04  ? 168  TYR B O     1 
ATOM   2903  C  CB    . TYR B 1  168  ? -11.691 -4.769  -53.860 1.00 104.44 ? 168  TYR B CB    1 
ATOM   2904  C  CG    . TYR B 1  168  ? -12.975 -5.185  -54.542 1.00 99.73  ? 168  TYR B CG    1 
ATOM   2905  C  CD1   . TYR B 1  168  ? -13.008 -5.473  -55.900 1.00 102.02 ? 168  TYR B CD1   1 
ATOM   2906  C  CD2   . TYR B 1  168  ? -14.167 -5.238  -53.833 1.00 99.66  ? 168  TYR B CD2   1 
ATOM   2907  C  CE1   . TYR B 1  168  ? -14.188 -5.832  -56.523 1.00 107.35 ? 168  TYR B CE1   1 
ATOM   2908  C  CE2   . TYR B 1  168  ? -15.348 -5.593  -54.446 1.00 99.91  ? 168  TYR B CE2   1 
ATOM   2909  C  CZ    . TYR B 1  168  ? -15.355 -5.890  -55.789 1.00 107.24 ? 168  TYR B CZ    1 
ATOM   2910  O  OH    . TYR B 1  168  ? -16.540 -6.245  -56.394 1.00 113.24 ? 168  TYR B OH    1 
ATOM   2911  N  N     . SER B 1  169  ? -9.496  -5.227  -51.620 1.00 96.11  ? 169  SER B N     1 
ATOM   2912  C  CA    . SER B 1  169  ? -8.503  -4.546  -50.793 1.00 94.26  ? 169  SER B CA    1 
ATOM   2913  C  C     . SER B 1  169  ? -7.091  -5.088  -51.009 1.00 91.03  ? 169  SER B C     1 
ATOM   2914  O  O     . SER B 1  169  ? -6.869  -6.291  -50.967 1.00 93.32  ? 169  SER B O     1 
ATOM   2915  C  CB    . SER B 1  169  ? -8.884  -4.663  -49.316 1.00 91.39  ? 169  SER B CB    1 
ATOM   2916  O  OG    . SER B 1  169  ? -8.042  -3.872  -48.494 1.00 91.96  ? 169  SER B OG    1 
ATOM   2917  N  N     . PRO B 1  170  ? -6.131  -4.188  -51.251 1.00 87.80  ? 170  PRO B N     1 
ATOM   2918  C  CA    . PRO B 1  170  ? -4.723  -4.541  -51.434 1.00 87.08  ? 170  PRO B CA    1 
ATOM   2919  C  C     . PRO B 1  170  ? -3.970  -4.622  -50.121 1.00 92.61  ? 170  PRO B C     1 
ATOM   2920  O  O     . PRO B 1  170  ? -2.745  -4.757  -50.131 1.00 93.34  ? 170  PRO B O     1 
ATOM   2921  C  CB    . PRO B 1  170  ? -4.190  -3.391  -52.282 1.00 81.12  ? 170  PRO B CB    1 
ATOM   2922  C  CG    . PRO B 1  170  ? -4.930  -2.218  -51.767 1.00 83.17  ? 170  PRO B CG    1 
ATOM   2923  C  CD    . PRO B 1  170  ? -6.353  -2.753  -51.485 1.00 88.65  ? 170  PRO B CD    1 
ATOM   2924  N  N     . VAL B 1  171  ? -4.693  -4.501  -49.011 1.00 99.46  ? 171  VAL B N     1 
ATOM   2925  C  CA    . VAL B 1  171  ? -4.121  -4.705  -47.683 1.00 97.42  ? 171  VAL B CA    1 
ATOM   2926  C  C     . VAL B 1  171  ? -4.751  -5.945  -47.044 1.00 93.50  ? 171  VAL B C     1 
ATOM   2927  O  O     . VAL B 1  171  ? -5.974  -6.035  -46.911 1.00 93.96  ? 171  VAL B O     1 
ATOM   2928  C  CB    . VAL B 1  171  ? -4.334  -3.479  -46.768 1.00 93.94  ? 171  VAL B CB    1 
ATOM   2929  C  CG1   . VAL B 1  171  ? -3.706  -3.724  -45.407 1.00 87.84  ? 171  VAL B CG1   1 
ATOM   2930  C  CG2   . VAL B 1  171  ? -3.744  -2.227  -47.403 1.00 92.38  ? 171  VAL B CG2   1 
ATOM   2931  N  N     . LEU B 1  172  ? -3.909  -6.891  -46.641 1.00 87.21  ? 172  LEU B N     1 
ATOM   2932  C  CA    . LEU B 1  172  ? -4.374  -8.209  -46.215 1.00 84.11  ? 172  LEU B CA    1 
ATOM   2933  C  C     . LEU B 1  172  ? -4.785  -8.279  -44.739 1.00 88.19  ? 172  LEU B C     1 
ATOM   2934  O  O     . LEU B 1  172  ? -5.907  -8.686  -44.426 1.00 80.56  ? 172  LEU B O     1 
ATOM   2935  C  CB    . LEU B 1  172  ? -3.290  -9.248  -46.507 1.00 85.45  ? 172  LEU B CB    1 
ATOM   2936  C  CG    . LEU B 1  172  ? -2.970  -9.409  -47.994 1.00 86.73  ? 172  LEU B CG    1 
ATOM   2937  C  CD1   . LEU B 1  172  ? -1.678  -10.183 -48.211 1.00 94.57  ? 172  LEU B CD1   1 
ATOM   2938  C  CD2   . LEU B 1  172  ? -4.129  -10.096 -48.695 1.00 86.43  ? 172  LEU B CD2   1 
ATOM   2939  N  N     . LYS B 1  173  ? -3.878  -7.889  -43.843 1.00 95.01  ? 173  LYS B N     1 
ATOM   2940  C  CA    . LYS B 1  173  ? -4.142  -7.933  -42.400 1.00 94.63  ? 173  LYS B CA    1 
ATOM   2941  C  C     . LYS B 1  173  ? -3.342  -6.877  -41.616 1.00 86.89  ? 173  LYS B C     1 
ATOM   2942  O  O     . LYS B 1  173  ? -2.136  -6.710  -41.820 1.00 80.95  ? 173  LYS B O     1 
ATOM   2943  C  CB    . LYS B 1  173  ? -3.845  -9.338  -41.854 1.00 93.14  ? 173  LYS B CB    1 
ATOM   2944  C  CG    . LYS B 1  173  ? -4.060  -9.493  -40.354 1.00 88.40  ? 173  LYS B CG    1 
ATOM   2945  C  CD    . LYS B 1  173  ? -5.442  -9.009  -39.941 1.00 88.31  ? 173  LYS B CD    1 
ATOM   2946  C  CE    . LYS B 1  173  ? -5.490  -8.677  -38.456 1.00 86.15  ? 173  LYS B CE    1 
ATOM   2947  N  NZ    . LYS B 1  173  ? -6.709  -7.901  -38.089 1.00 81.13  ? 173  LYS B NZ    1 
ATOM   2948  N  N     . VAL B 1  174  ? -4.027  -6.174  -40.714 1.00 82.17  ? 174  VAL B N     1 
ATOM   2949  C  CA    . VAL B 1  174  ? -3.420  -5.096  -39.936 1.00 78.45  ? 174  VAL B CA    1 
ATOM   2950  C  C     . VAL B 1  174  ? -3.753  -5.193  -38.445 1.00 79.30  ? 174  VAL B C     1 
ATOM   2951  O  O     . VAL B 1  174  ? -4.924  -5.270  -38.067 1.00 75.60  ? 174  VAL B O     1 
ATOM   2952  C  CB    . VAL B 1  174  ? -3.869  -3.712  -40.464 1.00 76.29  ? 174  VAL B CB    1 
ATOM   2953  C  CG1   . VAL B 1  174  ? -3.517  -2.610  -39.479 1.00 75.77  ? 174  VAL B CG1   1 
ATOM   2954  C  CG2   . VAL B 1  174  ? -3.247  -3.434  -41.818 1.00 78.94  ? 174  VAL B CG2   1 
ATOM   2955  N  N     . THR B 1  175  ? -2.716  -5.198  -37.607 1.00 82.93  ? 175  THR B N     1 
ATOM   2956  C  CA    . THR B 1  175  ? -2.885  -5.130  -36.154 1.00 82.63  ? 175  THR B CA    1 
ATOM   2957  C  C     . THR B 1  175  ? -2.171  -3.904  -35.578 1.00 83.03  ? 175  THR B C     1 
ATOM   2958  O  O     . THR B 1  175  ? -1.290  -3.326  -36.221 1.00 74.92  ? 175  THR B O     1 
ATOM   2959  C  CB    . THR B 1  175  ? -2.360  -6.403  -35.446 1.00 79.35  ? 175  THR B CB    1 
ATOM   2960  O  OG1   . THR B 1  175  ? -0.962  -6.572  -35.716 1.00 77.31  ? 175  THR B OG1   1 
ATOM   2961  C  CG2   . THR B 1  175  ? -3.121  -7.631  -35.919 1.00 71.36  ? 175  THR B CG2   1 
ATOM   2962  N  N     . TYR B 1  176  ? -2.557  -3.511  -34.367 1.00 88.24  ? 176  TYR B N     1 
ATOM   2963  C  CA    . TYR B 1  176  ? -1.990  -2.323  -33.734 1.00 86.01  ? 176  TYR B CA    1 
ATOM   2964  C  C     . TYR B 1  176  ? -1.961  -2.439  -32.215 1.00 81.98  ? 176  TYR B C     1 
ATOM   2965  O  O     . TYR B 1  176  ? -2.848  -3.038  -31.603 1.00 81.20  ? 176  TYR B O     1 
ATOM   2966  C  CB    . TYR B 1  176  ? -2.770  -1.067  -34.148 1.00 84.16  ? 176  TYR B CB    1 
ATOM   2967  C  CG    . TYR B 1  176  ? -4.179  -0.962  -33.585 1.00 88.12  ? 176  TYR B CG    1 
ATOM   2968  C  CD1   . TYR B 1  176  ? -4.504  0.017   -32.651 1.00 87.93  ? 176  TYR B CD1   1 
ATOM   2969  C  CD2   . TYR B 1  176  ? -5.187  -1.834  -33.993 1.00 86.75  ? 176  TYR B CD2   1 
ATOM   2970  C  CE1   . TYR B 1  176  ? -5.792  0.124   -32.134 1.00 84.33  ? 176  TYR B CE1   1 
ATOM   2971  C  CE2   . TYR B 1  176  ? -6.479  -1.736  -33.479 1.00 80.09  ? 176  TYR B CE2   1 
ATOM   2972  C  CZ    . TYR B 1  176  ? -6.774  -0.754  -32.550 1.00 78.05  ? 176  TYR B CZ    1 
ATOM   2973  O  OH    . TYR B 1  176  ? -8.047  -0.642  -32.032 1.00 63.44  ? 176  TYR B OH    1 
ATOM   2974  N  N     . LYS B 1  177  ? -0.927  -1.862  -31.614 1.00 77.67  ? 177  LYS B N     1 
ATOM   2975  C  CA    . LYS B 1  177  ? -0.804  -1.825  -30.165 1.00 85.93  ? 177  LYS B CA    1 
ATOM   2976  C  C     . LYS B 1  177  ? -0.440  -0.407  -29.742 1.00 87.30  ? 177  LYS B C     1 
ATOM   2977  O  O     . LYS B 1  177  ? 0.197   0.325   -30.501 1.00 81.40  ? 177  LYS B O     1 
ATOM   2978  C  CB    . LYS B 1  177  ? 0.245   -2.831  -29.680 1.00 87.55  ? 177  LYS B CB    1 
ATOM   2979  C  CG    . LYS B 1  177  ? 0.261   -3.057  -28.171 1.00 83.38  ? 177  LYS B CG    1 
ATOM   2980  C  CD    . LYS B 1  177  ? 1.265   -4.136  -27.795 1.00 81.45  ? 177  LYS B CD    1 
ATOM   2981  C  CE    . LYS B 1  177  ? 1.294   -4.386  -26.297 1.00 68.97  ? 177  LYS B CE    1 
ATOM   2982  N  NZ    . LYS B 1  177  ? 2.252   -5.474  -25.954 1.00 63.23  ? 177  LYS B NZ    1 
ATOM   2983  N  N     . VAL B 1  178  ? -0.863  -0.017  -28.543 1.00 90.88  ? 178  VAL B N     1 
ATOM   2984  C  CA    . VAL B 1  178  ? -0.587  1.322   -28.035 1.00 81.26  ? 178  VAL B CA    1 
ATOM   2985  C  C     . VAL B 1  178  ? 0.124   1.275   -26.684 1.00 82.30  ? 178  VAL B C     1 
ATOM   2986  O  O     . VAL B 1  178  ? -0.517  1.109   -25.645 1.00 81.52  ? 178  VAL B O     1 
ATOM   2987  C  CB    . VAL B 1  178  ? -1.883  2.150   -27.893 1.00 71.22  ? 178  VAL B CB    1 
ATOM   2988  C  CG1   . VAL B 1  178  ? -1.565  3.564   -27.428 1.00 71.90  ? 178  VAL B CG1   1 
ATOM   2989  C  CG2   . VAL B 1  178  ? -2.639  2.184   -29.209 1.00 69.95  ? 178  VAL B CG2   1 
ATOM   2990  N  N     . ASP B 1  179  ? 1.448   1.414   -26.705 1.00 82.61  ? 179  ASP B N     1 
ATOM   2991  C  CA    . ASP B 1  179  ? 2.238   1.494   -25.477 1.00 88.89  ? 179  ASP B CA    1 
ATOM   2992  C  C     . ASP B 1  179  ? 2.315   2.948   -24.990 1.00 83.80  ? 179  ASP B C     1 
ATOM   2993  O  O     . ASP B 1  179  ? 1.683   3.835   -25.565 1.00 81.12  ? 179  ASP B O     1 
ATOM   2994  C  CB    . ASP B 1  179  ? 3.646   0.917   -25.695 1.00 89.33  ? 179  ASP B CB    1 
ATOM   2995  C  CG    . ASP B 1  179  ? 3.656   -0.611  -25.782 1.00 81.03  ? 179  ASP B CG    1 
ATOM   2996  O  OD1   . ASP B 1  179  ? 2.758   -1.256  -25.196 1.00 76.27  ? 179  ASP B OD1   1 
ATOM   2997  O  OD2   . ASP B 1  179  ? 4.570   -1.165  -26.430 1.00 80.90  ? 179  ASP B OD2   1 
ATOM   2998  N  N     . ALA B 1  180  ? 3.075   3.189   -23.926 1.00 82.96  ? 180  ALA B N     1 
ATOM   2999  C  CA    . ALA B 1  180  ? 3.238   4.544   -23.405 1.00 87.07  ? 180  ALA B CA    1 
ATOM   3000  C  C     . ALA B 1  180  ? 4.705   4.964   -23.399 1.00 92.98  ? 180  ALA B C     1 
ATOM   3001  O  O     . ALA B 1  180  ? 5.557   4.246   -22.877 1.00 99.57  ? 180  ALA B O     1 
ATOM   3002  C  CB    . ALA B 1  180  ? 2.652   4.651   -22.003 1.00 87.54  ? 180  ALA B CB    1 
ATOM   3003  N  N     . THR B 1  181  ? 4.996   6.127   -23.978 1.00 90.77  ? 181  THR B N     1 
ATOM   3004  C  CA    . THR B 1  181  ? 6.360   6.654   -23.997 1.00 95.63  ? 181  THR B CA    1 
ATOM   3005  C  C     . THR B 1  181  ? 6.572   7.737   -22.934 1.00 102.34 ? 181  THR B C     1 
ATOM   3006  O  O     . THR B 1  181  ? 5.661   8.511   -22.631 1.00 98.09  ? 181  THR B O     1 
ATOM   3007  C  CB    . THR B 1  181  ? 6.726   7.228   -25.381 1.00 92.06  ? 181  THR B CB    1 
ATOM   3008  O  OG1   . THR B 1  181  ? 7.958   7.956   -25.291 1.00 98.72  ? 181  THR B OG1   1 
ATOM   3009  C  CG2   . THR B 1  181  ? 5.633   8.154   -25.885 1.00 85.08  ? 181  THR B CG2   1 
ATOM   3010  N  N     . ARG B 1  182  ? 7.780   7.785   -22.373 1.00 110.89 ? 182  ARG B N     1 
ATOM   3011  C  CA    . ARG B 1  182  ? 8.094   8.725   -21.298 1.00 110.86 ? 182  ARG B CA    1 
ATOM   3012  C  C     . ARG B 1  182  ? 8.755   9.994   -21.829 1.00 109.39 ? 182  ARG B C     1 
ATOM   3013  O  O     . ARG B 1  182  ? 9.977   10.055  -21.992 1.00 101.38 ? 182  ARG B O     1 
ATOM   3014  C  CB    . ARG B 1  182  ? 8.998   8.068   -20.250 1.00 109.69 ? 182  ARG B CB    1 
ATOM   3015  C  CG    . ARG B 1  182  ? 8.474   6.741   -19.719 1.00 107.84 ? 182  ARG B CG    1 
ATOM   3016  C  CD    . ARG B 1  182  ? 9.332   6.218   -18.575 1.00 106.20 ? 182  ARG B CD    1 
ATOM   3017  N  NE    . ARG B 1  182  ? 10.755  6.483   -18.782 1.00 107.99 ? 182  ARG B NE    1 
ATOM   3018  C  CZ    . ARG B 1  182  ? 11.562  5.734   -19.528 1.00 105.08 ? 182  ARG B CZ    1 
ATOM   3019  N  NH1   . ARG B 1  182  ? 11.091  4.663   -20.156 1.00 109.95 ? 182  ARG B NH1   1 
ATOM   3020  N  NH2   . ARG B 1  182  ? 12.843  6.059   -19.649 1.00 89.30  ? 182  ARG B NH2   1 
ATOM   3021  N  N     . VAL B 1  183  ? 7.930   11.002  -22.094 1.00 108.96 ? 183  VAL B N     1 
ATOM   3022  C  CA    . VAL B 1  183  ? 8.405   12.301  -22.552 1.00 108.50 ? 183  VAL B CA    1 
ATOM   3023  C  C     . VAL B 1  183  ? 8.482   13.266  -21.373 1.00 105.21 ? 183  VAL B C     1 
ATOM   3024  O  O     . VAL B 1  183  ? 7.517   13.415  -20.620 1.00 99.95  ? 183  VAL B O     1 
ATOM   3025  C  CB    . VAL B 1  183  ? 7.492   12.880  -23.653 1.00 98.79  ? 183  VAL B CB    1 
ATOM   3026  C  CG1   . VAL B 1  183  ? 7.819   14.342  -23.915 1.00 98.35  ? 183  VAL B CG1   1 
ATOM   3027  C  CG2   . VAL B 1  183  ? 7.617   12.060  -24.926 1.00 94.14  ? 183  VAL B CG2   1 
ATOM   3028  N  N     . GLU B 1  184  ? 9.638   13.909  -21.222 1.00 101.73 ? 184  GLU B N     1 
ATOM   3029  C  CA    . GLU B 1  184  ? 9.922   14.752  -20.066 1.00 99.68  ? 184  GLU B CA    1 
ATOM   3030  C  C     . GLU B 1  184  ? 9.802   13.920  -18.793 1.00 105.97 ? 184  GLU B C     1 
ATOM   3031  O  O     . GLU B 1  184  ? 10.398  12.847  -18.682 1.00 104.56 ? 184  GLU B O     1 
ATOM   3032  C  CB    . GLU B 1  184  ? 8.983   15.962  -20.021 1.00 93.20  ? 184  GLU B CB    1 
ATOM   3033  C  CG    . GLU B 1  184  ? 9.122   16.902  -21.207 1.00 98.76  ? 184  GLU B CG    1 
ATOM   3034  C  CD    . GLU B 1  184  ? 10.333  17.806  -21.091 1.00 99.59  ? 184  GLU B CD    1 
ATOM   3035  O  OE1   . GLU B 1  184  ? 10.955  17.829  -20.007 1.00 90.85  ? 184  GLU B OE1   1 
ATOM   3036  O  OE2   . GLU B 1  184  ? 10.661  18.497  -22.079 1.00 101.83 ? 184  GLU B OE2   1 
ATOM   3037  N  N     . GLN B 1  185  ? 9.031   14.413  -17.834 1.00 108.83 ? 185  GLN B N     1 
ATOM   3038  C  CA    . GLN B 1  185  ? 8.792   13.665  -16.611 1.00 105.55 ? 185  GLN B CA    1 
ATOM   3039  C  C     . GLN B 1  185  ? 7.533   12.832  -16.786 1.00 104.99 ? 185  GLN B C     1 
ATOM   3040  O  O     . GLN B 1  185  ? 7.290   11.878  -16.046 1.00 103.02 ? 185  GLN B O     1 
ATOM   3041  C  CB    . GLN B 1  185  ? 8.660   14.607  -15.420 1.00 104.56 ? 185  GLN B CB    1 
ATOM   3042  C  CG    . GLN B 1  185  ? 8.582   13.915  -14.081 1.00 90.61  ? 185  GLN B CG    1 
ATOM   3043  C  CD    . GLN B 1  185  ? 8.455   14.903  -12.953 1.00 105.05 ? 185  GLN B CD    1 
ATOM   3044  O  OE1   . GLN B 1  185  ? 8.928   16.036  -13.052 1.00 123.47 ? 185  GLN B OE1   1 
ATOM   3045  N  NE2   . GLN B 1  185  ? 7.804   14.489  -11.874 1.00 105.26 ? 185  GLN B NE2   1 
ATOM   3046  N  N     . ARG B 1  186  ? 6.746   13.203  -17.792 1.00 108.80 ? 186  ARG B N     1 
ATOM   3047  C  CA    . ARG B 1  186  ? 5.474   12.551  -18.076 1.00 98.58  ? 186  ARG B CA    1 
ATOM   3048  C  C     . ARG B 1  186  ? 5.660   11.172  -18.700 1.00 89.68  ? 186  ARG B C     1 
ATOM   3049  O  O     . ARG B 1  186  ? 6.333   11.024  -19.719 1.00 88.22  ? 186  ARG B O     1 
ATOM   3050  C  CB    . ARG B 1  186  ? 4.625   13.418  -19.008 1.00 93.31  ? 186  ARG B CB    1 
ATOM   3051  C  CG    . ARG B 1  186  ? 4.471   14.872  -18.591 1.00 86.82  ? 186  ARG B CG    1 
ATOM   3052  C  CD    . ARG B 1  186  ? 3.391   15.535  -19.431 1.00 86.66  ? 186  ARG B CD    1 
ATOM   3053  N  NE    . ARG B 1  186  ? 2.138   14.787  -19.346 1.00 98.80  ? 186  ARG B NE    1 
ATOM   3054  C  CZ    . ARG B 1  186  ? 1.044   15.044  -20.060 1.00 99.86  ? 186  ARG B CZ    1 
ATOM   3055  N  NH1   . ARG B 1  186  ? -0.039  14.296  -19.894 1.00 92.11  ? 186  ARG B NH1   1 
ATOM   3056  N  NH2   . ARG B 1  186  ? 1.027   16.041  -20.936 1.00 97.40  ? 186  ARG B NH2   1 
ATOM   3057  N  N     . THR B 1  187  ? 5.048   10.167  -18.085 1.00 87.82  ? 187  THR B N     1 
ATOM   3058  C  CA    . THR B 1  187  ? 5.061   8.811   -18.619 1.00 94.35  ? 187  THR B CA    1 
ATOM   3059  C  C     . THR B 1  187  ? 3.707   8.488   -19.245 1.00 98.21  ? 187  THR B C     1 
ATOM   3060  O  O     . THR B 1  187  ? 3.322   7.322   -19.364 1.00 91.45  ? 187  THR B O     1 
ATOM   3061  C  CB    . THR B 1  187  ? 5.384   7.782   -17.526 1.00 92.76  ? 187  THR B CB    1 
ATOM   3062  O  OG1   . THR B 1  187  ? 4.337   7.778   -16.548 1.00 86.38  ? 187  THR B OG1   1 
ATOM   3063  C  CG2   . THR B 1  187  ? 6.696   8.132   -16.845 1.00 91.02  ? 187  THR B CG2   1 
ATOM   3064  N  N     . ASP B 1  188  ? 2.996   9.537   -19.650 1.00 102.30 ? 188  ASP B N     1 
ATOM   3065  C  CA    . ASP B 1  188  ? 1.615   9.421   -20.114 1.00 100.25 ? 188  ASP B CA    1 
ATOM   3066  C  C     . ASP B 1  188  ? 1.494   9.314   -21.635 1.00 94.41  ? 188  ASP B C     1 
ATOM   3067  O  O     . ASP B 1  188  ? 0.551   8.704   -22.145 1.00 87.17  ? 188  ASP B O     1 
ATOM   3068  C  CB    . ASP B 1  188  ? 0.797   10.622  -19.625 1.00 97.62  ? 188  ASP B CB    1 
ATOM   3069  C  CG    . ASP B 1  188  ? 1.009   10.918  -18.150 1.00 96.10  ? 188  ASP B CG    1 
ATOM   3070  O  OD1   . ASP B 1  188  ? 1.263   9.971   -17.376 1.00 96.23  ? 188  ASP B OD1   1 
ATOM   3071  O  OD2   . ASP B 1  188  ? 0.922   12.103  -17.764 1.00 88.26  ? 188  ASP B OD2   1 
ATOM   3072  N  N     . PHE B 1  189  ? 2.447   9.919   -22.345 1.00 98.20  ? 189  PHE B N     1 
ATOM   3073  C  CA    . PHE B 1  189  ? 2.424   10.010  -23.808 1.00 91.63  ? 189  PHE B CA    1 
ATOM   3074  C  C     . PHE B 1  189  ? 2.285   8.653   -24.487 1.00 85.61  ? 189  PHE B C     1 
ATOM   3075  O  O     . PHE B 1  189  ? 2.954   7.691   -24.114 1.00 86.92  ? 189  PHE B O     1 
ATOM   3076  C  CB    . PHE B 1  189  ? 3.691   10.706  -24.314 1.00 91.85  ? 189  PHE B CB    1 
ATOM   3077  C  CG    . PHE B 1  189  ? 3.738   12.174  -24.009 1.00 94.71  ? 189  PHE B CG    1 
ATOM   3078  C  CD1   . PHE B 1  189  ? 4.166   12.623  -22.771 1.00 99.18  ? 189  PHE B CD1   1 
ATOM   3079  C  CD2   . PHE B 1  189  ? 3.353   13.105  -24.960 1.00 92.54  ? 189  PHE B CD2   1 
ATOM   3080  C  CE1   . PHE B 1  189  ? 4.212   13.977  -22.487 1.00 103.72 ? 189  PHE B CE1   1 
ATOM   3081  C  CE2   . PHE B 1  189  ? 3.395   14.460  -24.681 1.00 101.57 ? 189  PHE B CE2   1 
ATOM   3082  C  CZ    . PHE B 1  189  ? 3.825   14.896  -23.443 1.00 106.12 ? 189  PHE B CZ    1 
ATOM   3083  N  N     . ASP B 1  190  ? 1.418   8.587   -25.494 1.00 78.16  ? 190  ASP B N     1 
ATOM   3084  C  CA    . ASP B 1  190  ? 1.124   7.331   -26.174 1.00 78.28  ? 190  ASP B CA    1 
ATOM   3085  C  C     . ASP B 1  190  ? 2.052   7.075   -27.366 1.00 78.85  ? 190  ASP B C     1 
ATOM   3086  O  O     . ASP B 1  190  ? 2.317   7.975   -28.165 1.00 79.53  ? 190  ASP B O     1 
ATOM   3087  C  CB    . ASP B 1  190  ? -0.339  7.309   -26.632 1.00 71.50  ? 190  ASP B CB    1 
ATOM   3088  C  CG    . ASP B 1  190  ? -1.315  7.245   -25.469 1.00 70.38  ? 190  ASP B CG    1 
ATOM   3089  O  OD1   . ASP B 1  190  ? -0.868  7.035   -24.322 1.00 76.04  ? 190  ASP B OD1   1 
ATOM   3090  O  OD2   . ASP B 1  190  ? -2.534  7.390   -25.703 1.00 66.65  ? 190  ASP B OD2   1 
ATOM   3091  N  N     . LYS B 1  191  ? 2.543   5.840   -27.465 1.00 82.13  ? 191  LYS B N     1 
ATOM   3092  C  CA    . LYS B 1  191  ? 3.387   5.392   -28.576 1.00 80.46  ? 191  LYS B CA    1 
ATOM   3093  C  C     . LYS B 1  191  ? 2.647   4.338   -29.400 1.00 80.23  ? 191  LYS B C     1 
ATOM   3094  O  O     . LYS B 1  191  ? 2.347   3.253   -28.899 1.00 82.24  ? 191  LYS B O     1 
ATOM   3095  C  CB    . LYS B 1  191  ? 4.716   4.823   -28.055 1.00 83.61  ? 191  LYS B CB    1 
ATOM   3096  C  CG    . LYS B 1  191  ? 5.536   4.032   -29.085 1.00 84.41  ? 191  LYS B CG    1 
ATOM   3097  C  CD    . LYS B 1  191  ? 6.633   3.199   -28.408 1.00 86.35  ? 191  LYS B CD    1 
ATOM   3098  C  CE    . LYS B 1  191  ? 7.299   2.218   -29.372 1.00 80.48  ? 191  LYS B CE    1 
ATOM   3099  N  NZ    . LYS B 1  191  ? 8.262   1.310   -28.680 1.00 70.85  ? 191  LYS B NZ    1 
ATOM   3100  N  N     . LEU B 1  192  ? 2.353   4.650   -30.658 1.00 76.72  ? 192  LEU B N     1 
ATOM   3101  C  CA    . LEU B 1  192  ? 1.543   3.755   -31.480 1.00 79.20  ? 192  LEU B CA    1 
ATOM   3102  C  C     . LEU B 1  192  ? 2.382   2.890   -32.416 1.00 80.99  ? 192  LEU B C     1 
ATOM   3103  O  O     . LEU B 1  192  ? 3.066   3.396   -33.306 1.00 81.09  ? 192  LEU B O     1 
ATOM   3104  C  CB    . LEU B 1  192  ? 0.521   4.554   -32.291 1.00 75.19  ? 192  LEU B CB    1 
ATOM   3105  C  CG    . LEU B 1  192  ? -0.402  3.746   -33.208 1.00 75.07  ? 192  LEU B CG    1 
ATOM   3106  C  CD1   . LEU B 1  192  ? -1.166  2.683   -32.436 1.00 70.38  ? 192  LEU B CD1   1 
ATOM   3107  C  CD2   . LEU B 1  192  ? -1.367  4.671   -33.925 1.00 71.16  ? 192  LEU B CD2   1 
ATOM   3108  N  N     . ILE B 1  193  ? 2.320   1.579   -32.199 1.00 82.51  ? 193  ILE B N     1 
ATOM   3109  C  CA    . ILE B 1  193  ? 2.963   0.611   -33.079 1.00 81.73  ? 193  ILE B CA    1 
ATOM   3110  C  C     . ILE B 1  193  ? 1.894   -0.044  -33.954 1.00 83.48  ? 193  ILE B C     1 
ATOM   3111  O  O     . ILE B 1  193  ? 0.814   -0.392  -33.470 1.00 81.53  ? 193  ILE B O     1 
ATOM   3112  C  CB    . ILE B 1  193  ? 3.744   -0.462  -32.281 1.00 85.46  ? 193  ILE B CB    1 
ATOM   3113  C  CG1   . ILE B 1  193  ? 4.858   0.192   -31.455 1.00 85.14  ? 193  ILE B CG1   1 
ATOM   3114  C  CG2   . ILE B 1  193  ? 4.326   -1.520  -33.210 1.00 87.20  ? 193  ILE B CG2   1 
ATOM   3115  C  CD1   . ILE B 1  193  ? 5.725   -0.796  -30.686 1.00 80.83  ? 193  ILE B CD1   1 
ATOM   3116  N  N     . LEU B 1  194  ? 2.200   -0.197  -35.240 1.00 84.18  ? 194  LEU B N     1 
ATOM   3117  C  CA    . LEU B 1  194  ? 1.227   -0.666  -36.222 1.00 82.04  ? 194  LEU B CA    1 
ATOM   3118  C  C     . LEU B 1  194  ? 1.814   -1.710  -37.167 1.00 83.37  ? 194  LEU B C     1 
ATOM   3119  O  O     . LEU B 1  194  ? 2.850   -1.476  -37.789 1.00 83.95  ? 194  LEU B O     1 
ATOM   3120  C  CB    . LEU B 1  194  ? 0.695   0.515   -37.034 1.00 81.19  ? 194  LEU B CB    1 
ATOM   3121  C  CG    . LEU B 1  194  ? -0.331  0.187   -38.118 1.00 84.74  ? 194  LEU B CG    1 
ATOM   3122  C  CD1   . LEU B 1  194  ? -1.639  -0.287  -37.495 1.00 85.08  ? 194  LEU B CD1   1 
ATOM   3123  C  CD2   . LEU B 1  194  ? -0.556  1.388   -39.031 1.00 79.86  ? 194  LEU B CD2   1 
ATOM   3124  N  N     . ASP B 1  195  ? 1.147   -2.854  -37.282 1.00 81.63  ? 195  ASP B N     1 
ATOM   3125  C  CA    . ASP B 1  195  ? 1.590   -3.904  -38.196 1.00 88.04  ? 195  ASP B CA    1 
ATOM   3126  C  C     . ASP B 1  195  ? 0.701   -3.933  -39.439 1.00 89.78  ? 195  ASP B C     1 
ATOM   3127  O  O     . ASP B 1  195  ? -0.525  -3.967  -39.329 1.00 84.37  ? 195  ASP B O     1 
ATOM   3128  C  CB    . ASP B 1  195  ? 1.583   -5.269  -37.495 1.00 89.21  ? 195  ASP B CB    1 
ATOM   3129  C  CG    . ASP B 1  195  ? 2.275   -6.355  -38.311 1.00 95.05  ? 195  ASP B CG    1 
ATOM   3130  O  OD1   . ASP B 1  195  ? 1.638   -6.907  -39.233 1.00 98.37  ? 195  ASP B OD1   1 
ATOM   3131  O  OD2   . ASP B 1  195  ? 3.452   -6.664  -38.024 1.00 91.18  ? 195  ASP B OD2   1 
ATOM   3132  N  N     . VAL B 1  196  ? 1.323   -3.910  -40.617 1.00 91.27  ? 196  VAL B N     1 
ATOM   3133  C  CA    . VAL B 1  196  ? 0.586   -3.891  -41.881 1.00 87.08  ? 196  VAL B CA    1 
ATOM   3134  C  C     . VAL B 1  196  ? 1.125   -4.911  -42.875 1.00 85.34  ? 196  VAL B C     1 
ATOM   3135  O  O     . VAL B 1  196  ? 2.294   -4.855  -43.252 1.00 84.91  ? 196  VAL B O     1 
ATOM   3136  C  CB    . VAL B 1  196  ? 0.635   -2.501  -42.554 1.00 84.14  ? 196  VAL B CB    1 
ATOM   3137  C  CG1   . VAL B 1  196  ? 0.039   -2.565  -43.953 1.00 81.57  ? 196  VAL B CG1   1 
ATOM   3138  C  CG2   . VAL B 1  196  ? -0.091  -1.467  -41.712 1.00 89.99  ? 196  VAL B CG2   1 
ATOM   3139  N  N     . GLU B 1  197  ? 0.271   -5.836  -43.303 1.00 88.13  ? 197  GLU B N     1 
ATOM   3140  C  CA    . GLU B 1  197  ? 0.642   -6.769  -44.360 1.00 93.20  ? 197  GLU B CA    1 
ATOM   3141  C  C     . GLU B 1  197  ? -0.167  -6.515  -45.631 1.00 94.22  ? 197  GLU B C     1 
ATOM   3142  O  O     . GLU B 1  197  ? -1.398  -6.512  -45.606 1.00 92.08  ? 197  GLU B O     1 
ATOM   3143  C  CB    . GLU B 1  197  ? 0.464   -8.218  -43.899 1.00 90.57  ? 197  GLU B CB    1 
ATOM   3144  C  CG    . GLU B 1  197  ? 0.998   -9.237  -44.899 1.00 104.16 ? 197  GLU B CG    1 
ATOM   3145  C  CD    . GLU B 1  197  ? 1.250   -10.604 -44.282 1.00 115.20 ? 197  GLU B CD    1 
ATOM   3146  O  OE1   . GLU B 1  197  ? 0.785   -10.840 -43.147 1.00 120.18 ? 197  GLU B OE1   1 
ATOM   3147  O  OE2   . GLU B 1  197  ? 1.918   -11.439 -44.933 1.00 110.54 ? 197  GLU B OE2   1 
ATOM   3148  N  N     . THR B 1  198  ? 0.535   -6.300  -46.739 1.00 93.50  ? 198  THR B N     1 
ATOM   3149  C  CA    . THR B 1  198  ? -0.112  -6.009  -48.014 1.00 97.89  ? 198  THR B CA    1 
ATOM   3150  C  C     . THR B 1  198  ? 0.106   -7.131  -49.028 1.00 101.97 ? 198  THR B C     1 
ATOM   3151  O  O     . THR B 1  198  ? 0.972   -7.986  -48.842 1.00 98.94  ? 198  THR B O     1 
ATOM   3152  C  CB    . THR B 1  198  ? 0.403   -4.687  -48.622 1.00 94.21  ? 198  THR B CB    1 
ATOM   3153  O  OG1   . THR B 1  198  ? 1.827   -4.751  -48.775 1.00 90.69  ? 198  THR B OG1   1 
ATOM   3154  C  CG2   . THR B 1  198  ? 0.042   -3.506  -47.732 1.00 88.29  ? 198  THR B CG2   1 
ATOM   3155  N  N     . LYS B 1  199  ? -0.686  -7.113  -50.100 1.00 106.65 ? 199  LYS B N     1 
ATOM   3156  C  CA    . LYS B 1  199  ? -0.535  -8.055  -51.208 1.00 100.93 ? 199  LYS B CA    1 
ATOM   3157  C  C     . LYS B 1  199  ? 0.780   -7.810  -51.945 1.00 104.66 ? 199  LYS B C     1 
ATOM   3158  O  O     . LYS B 1  199  ? 1.579   -6.964  -51.542 1.00 107.82 ? 199  LYS B O     1 
ATOM   3159  C  CB    . LYS B 1  199  ? -1.713  -7.936  -52.185 1.00 95.45  ? 199  LYS B CB    1 
ATOM   3160  C  CG    . LYS B 1  199  ? -3.048  -8.460  -51.658 1.00 94.53  ? 199  LYS B CG    1 
ATOM   3161  C  CD    . LYS B 1  199  ? -4.205  -8.133  -52.610 1.00 98.33  ? 199  LYS B CD    1 
ATOM   3162  C  CE    . LYS B 1  199  ? -5.470  -8.923  -52.268 1.00 91.09  ? 199  LYS B CE    1 
ATOM   3163  N  NZ    . LYS B 1  199  ? -6.616  -8.614  -53.177 1.00 84.12  ? 199  LYS B NZ    1 
ATOM   3164  N  N     . ASN B 1  200  ? 1.003   -8.541  -53.033 1.00 103.97 ? 200  ASN B N     1 
ATOM   3165  C  CA    . ASN B 1  200  ? 2.199   -8.330  -53.843 1.00 111.62 ? 200  ASN B CA    1 
ATOM   3166  C  C     . ASN B 1  200  ? 1.964   -7.196  -54.838 1.00 112.26 ? 200  ASN B C     1 
ATOM   3167  O  O     . ASN B 1  200  ? 2.802   -6.924  -55.701 1.00 113.23 ? 200  ASN B O     1 
ATOM   3168  C  CB    . ASN B 1  200  ? 2.598   -9.618  -54.572 1.00 114.21 ? 200  ASN B CB    1 
ATOM   3169  C  CG    . ASN B 1  200  ? 4.075   -9.652  -54.939 1.00 102.74 ? 200  ASN B CG    1 
ATOM   3170  O  OD1   . ASN B 1  200  ? 4.470   -9.228  -56.026 1.00 102.20 ? 200  ASN B OD1   1 
ATOM   3171  N  ND2   . ASN B 1  200  ? 4.897   -10.165 -54.030 1.00 96.46  ? 200  ASN B ND2   1 
ATOM   3172  N  N     . SER B 1  201  ? 0.817   -6.534  -54.696 1.00 110.11 ? 201  SER B N     1 
ATOM   3173  C  CA    . SER B 1  201  ? 0.423   -5.434  -55.572 1.00 113.62 ? 201  SER B CA    1 
ATOM   3174  C  C     . SER B 1  201  ? 1.041   -4.094  -55.166 1.00 111.46 ? 201  SER B C     1 
ATOM   3175  O  O     . SER B 1  201  ? 1.511   -3.340  -56.019 1.00 107.31 ? 201  SER B O     1 
ATOM   3176  C  CB    . SER B 1  201  ? -1.103  -5.306  -55.600 1.00 109.27 ? 201  SER B CB    1 
ATOM   3177  O  OG    . SER B 1  201  ? -1.504  -4.150  -56.316 1.00 113.25 ? 201  SER B OG    1 
ATOM   3178  N  N     . ILE B 1  202  ? 1.031   -3.796  -53.869 1.00 111.76 ? 202  ILE B N     1 
ATOM   3179  C  CA    . ILE B 1  202  ? 1.547   -2.518  -53.386 1.00 104.18 ? 202  ILE B CA    1 
ATOM   3180  C  C     . ILE B 1  202  ? 2.365   -2.668  -52.103 1.00 100.71 ? 202  ILE B C     1 
ATOM   3181  O  O     . ILE B 1  202  ? 2.030   -3.464  -51.224 1.00 100.00 ? 202  ILE B O     1 
ATOM   3182  C  CB    . ILE B 1  202  ? 0.399   -1.505  -53.146 1.00 99.76  ? 202  ILE B CB    1 
ATOM   3183  C  CG1   . ILE B 1  202  ? 0.966   -0.109  -52.877 1.00 100.17 ? 202  ILE B CG1   1 
ATOM   3184  C  CG2   . ILE B 1  202  ? -0.528  -1.972  -52.019 1.00 93.11  ? 202  ILE B CG2   1 
ATOM   3185  C  CD1   . ILE B 1  202  ? 1.847   0.412   -53.994 1.00 94.78  ? 202  ILE B CD1   1 
ATOM   3186  N  N     . SER B 1  203  ? 3.449   -1.904  -52.013 1.00 97.09  ? 203  SER B N     1 
ATOM   3187  C  CA    . SER B 1  203  ? 4.286   -1.904  -50.821 1.00 97.56  ? 203  SER B CA    1 
ATOM   3188  C  C     . SER B 1  203  ? 3.527   -1.312  -49.641 1.00 96.16  ? 203  SER B C     1 
ATOM   3189  O  O     . SER B 1  203  ? 2.741   -0.379  -49.812 1.00 96.48  ? 203  SER B O     1 
ATOM   3190  C  CB    . SER B 1  203  ? 5.577   -1.123  -51.070 1.00 98.62  ? 203  SER B CB    1 
ATOM   3191  O  OG    . SER B 1  203  ? 6.424   -1.160  -49.935 1.00 99.80  ? 203  SER B OG    1 
ATOM   3192  N  N     . PRO B 1  204  ? 3.755   -1.862  -48.439 1.00 96.71  ? 204  PRO B N     1 
ATOM   3193  C  CA    . PRO B 1  204  ? 3.097   -1.382  -47.220 1.00 95.05  ? 204  PRO B CA    1 
ATOM   3194  C  C     . PRO B 1  204  ? 3.353   0.100   -46.981 1.00 90.60  ? 204  PRO B C     1 
ATOM   3195  O  O     . PRO B 1  204  ? 2.442   0.830   -46.595 1.00 88.74  ? 204  PRO B O     1 
ATOM   3196  C  CB    . PRO B 1  204  ? 3.737   -2.231  -46.118 1.00 96.01  ? 204  PRO B CB    1 
ATOM   3197  C  CG    . PRO B 1  204  ? 4.215   -3.459  -46.816 1.00 99.10  ? 204  PRO B CG    1 
ATOM   3198  C  CD    . PRO B 1  204  ? 4.642   -3.008  -48.174 1.00 95.46  ? 204  PRO B CD    1 
ATOM   3199  N  N     . ARG B 1  205  ? 4.585   0.533   -47.223 1.00 89.87  ? 205  ARG B N     1 
ATOM   3200  C  CA    . ARG B 1  205  ? 4.965   1.925   -47.026 1.00 90.18  ? 205  ARG B CA    1 
ATOM   3201  C  C     . ARG B 1  205  ? 4.130   2.847   -47.904 1.00 93.25  ? 205  ARG B C     1 
ATOM   3202  O  O     . ARG B 1  205  ? 3.819   3.975   -47.520 1.00 92.48  ? 205  ARG B O     1 
ATOM   3203  C  CB    . ARG B 1  205  ? 6.448   2.107   -47.320 1.00 87.20  ? 205  ARG B CB    1 
ATOM   3204  C  CG    . ARG B 1  205  ? 7.314   1.067   -46.646 1.00 88.84  ? 205  ARG B CG    1 
ATOM   3205  C  CD    . ARG B 1  205  ? 8.733   1.175   -47.127 1.00 91.14  ? 205  ARG B CD    1 
ATOM   3206  N  NE    . ARG B 1  205  ? 9.217   2.543   -47.004 1.00 97.19  ? 205  ARG B NE    1 
ATOM   3207  C  CZ    . ARG B 1  205  ? 10.413  2.945   -47.411 1.00 111.70 ? 205  ARG B CZ    1 
ATOM   3208  N  NH1   . ARG B 1  205  ? 10.774  4.211   -47.260 1.00 117.19 ? 205  ARG B NH1   1 
ATOM   3209  N  NH2   . ARG B 1  205  ? 11.248  2.079   -47.970 1.00 108.69 ? 205  ARG B NH2   1 
ATOM   3210  N  N     . ASP B 1  206  ? 3.764   2.354   -49.083 1.00 97.37  ? 206  ASP B N     1 
ATOM   3211  C  CA    . ASP B 1  206  ? 2.897   3.094   -49.991 1.00 98.70  ? 206  ASP B CA    1 
ATOM   3212  C  C     . ASP B 1  206  ? 1.434   2.977   -49.584 1.00 100.46 ? 206  ASP B C     1 
ATOM   3213  O  O     . ASP B 1  206  ? 0.650   3.900   -49.800 1.00 105.51 ? 206  ASP B O     1 
ATOM   3214  C  CB    . ASP B 1  206  ? 3.064   2.602   -51.430 1.00 97.29  ? 206  ASP B CB    1 
ATOM   3215  C  CG    . ASP B 1  206  ? 4.366   3.052   -52.054 1.00 104.82 ? 206  ASP B CG    1 
ATOM   3216  O  OD1   . ASP B 1  206  ? 4.476   4.248   -52.401 1.00 111.00 ? 206  ASP B OD1   1 
ATOM   3217  O  OD2   . ASP B 1  206  ? 5.272   2.207   -52.210 1.00 103.49 ? 206  ASP B OD2   1 
ATOM   3218  N  N     . ALA B 1  207  ? 1.069   1.836   -49.006 1.00 98.84  ? 207  ALA B N     1 
ATOM   3219  C  CA    . ALA B 1  207  ? -0.311  1.587   -48.596 1.00 97.21  ? 207  ALA B CA    1 
ATOM   3220  C  C     . ALA B 1  207  ? -0.723  2.526   -47.471 1.00 93.24  ? 207  ALA B C     1 
ATOM   3221  O  O     . ALA B 1  207  ? -1.886  2.921   -47.365 1.00 83.39  ? 207  ALA B O     1 
ATOM   3222  C  CB    . ALA B 1  207  ? -0.484  0.138   -48.166 1.00 98.86  ? 207  ALA B CB    1 
ATOM   3223  N  N     . LEU B 1  208  ? 0.247   2.876   -46.633 1.00 93.12  ? 208  LEU B N     1 
ATOM   3224  C  CA    . LEU B 1  208  ? 0.018   3.787   -45.522 1.00 91.50  ? 208  LEU B CA    1 
ATOM   3225  C  C     . LEU B 1  208  ? -0.106  5.220   -46.015 1.00 95.74  ? 208  LEU B C     1 
ATOM   3226  O  O     . LEU B 1  208  ? -0.949  5.980   -45.539 1.00 98.97  ? 208  LEU B O     1 
ATOM   3227  C  CB    . LEU B 1  208  ? 1.149   3.685   -44.503 1.00 84.24  ? 208  LEU B CB    1 
ATOM   3228  C  CG    . LEU B 1  208  ? 0.921   4.493   -43.229 1.00 82.24  ? 208  LEU B CG    1 
ATOM   3229  C  CD1   . LEU B 1  208  ? -0.302  3.974   -42.493 1.00 82.84  ? 208  LEU B CD1   1 
ATOM   3230  C  CD2   . LEU B 1  208  ? 2.147   4.437   -42.345 1.00 86.47  ? 208  LEU B CD2   1 
ATOM   3231  N  N     . ALA B 1  209  ? 0.744   5.580   -46.972 1.00 95.39  ? 209  ALA B N     1 
ATOM   3232  C  CA    . ALA B 1  209  ? 0.732   6.916   -47.556 1.00 97.48  ? 209  ALA B CA    1 
ATOM   3233  C  C     . ALA B 1  209  ? -0.586  7.205   -48.271 1.00 102.17 ? 209  ALA B C     1 
ATOM   3234  O  O     . ALA B 1  209  ? -0.989  8.363   -48.399 1.00 106.82 ? 209  ALA B O     1 
ATOM   3235  C  CB    . ALA B 1  209  ? 1.901   7.084   -48.513 1.00 94.97  ? 209  ALA B CB    1 
ATOM   3236  N  N     . SER B 1  210  ? -1.249  6.147   -48.736 1.00 103.04 ? 210  SER B N     1 
ATOM   3237  C  CA    . SER B 1  210  ? -2.532  6.266   -49.421 1.00 96.51  ? 210  SER B CA    1 
ATOM   3238  C  C     . SER B 1  210  ? -3.680  6.217   -48.418 1.00 91.51  ? 210  SER B C     1 
ATOM   3239  O  O     . SER B 1  210  ? -4.653  6.960   -48.536 1.00 92.67  ? 210  SER B O     1 
ATOM   3240  C  CB    . SER B 1  210  ? -2.695  5.159   -50.467 1.00 91.88  ? 210  SER B CB    1 
ATOM   3241  O  OG    . SER B 1  210  ? -3.934  5.273   -51.149 1.00 85.43  ? 210  SER B OG    1 
ATOM   3242  N  N     . ALA B 1  211  ? -3.559  5.340   -47.429 1.00 89.07  ? 211  ALA B N     1 
ATOM   3243  C  CA    . ALA B 1  211  ? -4.540  5.273   -46.363 1.00 91.57  ? 211  ALA B CA    1 
ATOM   3244  C  C     . ALA B 1  211  ? -4.565  6.552   -45.547 1.00 86.74  ? 211  ALA B C     1 
ATOM   3245  O  O     . ALA B 1  211  ? -5.615  6.965   -45.059 1.00 82.96  ? 211  ALA B O     1 
ATOM   3246  C  CB    . ALA B 1  211  ? -4.262  4.077   -45.465 1.00 86.48  ? 211  ALA B CB    1 
ATOM   3247  N  N     . GLY B 1  212  ? -3.402  7.184   -45.408 1.00 90.88  ? 212  GLY B N     1 
ATOM   3248  C  CA    . GLY B 1  212  ? -3.267  8.394   -44.615 1.00 91.09  ? 212  GLY B CA    1 
ATOM   3249  C  C     . GLY B 1  212  ? -3.768  9.623   -45.343 1.00 85.46  ? 212  GLY B C     1 
ATOM   3250  O  O     . GLY B 1  212  ? -4.414  10.487  -44.753 1.00 80.84  ? 212  GLY B O     1 
ATOM   3251  N  N     . LYS B 1  213  ? -3.457  9.699   -46.632 1.00 88.39  ? 213  LYS B N     1 
ATOM   3252  C  CA    . LYS B 1  213  ? -3.984  10.749  -47.491 1.00 89.61  ? 213  LYS B CA    1 
ATOM   3253  C  C     . LYS B 1  213  ? -5.505  10.657  -47.565 1.00 86.11  ? 213  LYS B C     1 
ATOM   3254  O  O     . LYS B 1  213  ? -6.190  11.675  -47.665 1.00 90.59  ? 213  LYS B O     1 
ATOM   3255  C  CB    . LYS B 1  213  ? -3.376  10.652  -48.892 1.00 96.43  ? 213  LYS B CB    1 
ATOM   3256  C  CG    . LYS B 1  213  ? -3.843  11.731  -49.857 1.00 97.26  ? 213  LYS B CG    1 
ATOM   3257  C  CD    . LYS B 1  213  ? -3.175  11.587  -51.215 1.00 95.92  ? 213  LYS B CD    1 
ATOM   3258  C  CE    . LYS B 1  213  ? -3.583  12.716  -52.147 1.00 90.86  ? 213  LYS B CE    1 
ATOM   3259  N  NZ    . LYS B 1  213  ? -2.899  12.622  -53.465 1.00 88.18  ? 213  LYS B NZ    1 
ATOM   3260  N  N     . THR B 1  214  ? -6.025  9.432   -47.514 1.00 82.36  ? 214  THR B N     1 
ATOM   3261  C  CA    . THR B 1  214  ? -7.469  9.202   -47.526 1.00 82.15  ? 214  THR B CA    1 
ATOM   3262  C  C     . THR B 1  214  ? -8.157  9.909   -46.359 1.00 81.01  ? 214  THR B C     1 
ATOM   3263  O  O     . THR B 1  214  ? -9.184  10.566  -46.529 1.00 78.93  ? 214  THR B O     1 
ATOM   3264  C  CB    . THR B 1  214  ? -7.812  7.693   -47.458 1.00 79.17  ? 214  THR B CB    1 
ATOM   3265  O  OG1   . THR B 1  214  ? -7.387  7.038   -48.659 1.00 79.03  ? 214  THR B OG1   1 
ATOM   3266  C  CG2   . THR B 1  214  ? -9.307  7.497   -47.296 1.00 74.73  ? 214  THR B CG2   1 
ATOM   3267  N  N     . LEU B 1  215  ? -7.572  9.777   -45.176 1.00 78.22  ? 215  LEU B N     1 
ATOM   3268  C  CA    . LEU B 1  215  ? -8.172  10.304  -43.960 1.00 72.45  ? 215  LEU B CA    1 
ATOM   3269  C  C     . LEU B 1  215  ? -7.971  11.801  -43.813 1.00 73.56  ? 215  LEU B C     1 
ATOM   3270  O  O     . LEU B 1  215  ? -8.820  12.491  -43.253 1.00 76.67  ? 215  LEU B O     1 
ATOM   3271  C  CB    . LEU B 1  215  ? -7.604  9.575   -42.754 1.00 69.65  ? 215  LEU B CB    1 
ATOM   3272  C  CG    . LEU B 1  215  ? -7.856  8.082   -42.929 1.00 71.12  ? 215  LEU B CG    1 
ATOM   3273  C  CD1   . LEU B 1  215  ? -7.229  7.300   -41.798 1.00 68.36  ? 215  LEU B CD1   1 
ATOM   3274  C  CD2   . LEU B 1  215  ? -9.353  7.810   -43.037 1.00 68.49  ? 215  LEU B CD2   1 
ATOM   3275  N  N     . VAL B 1  216  ? -6.846  12.297  -44.318 1.00 72.76  ? 216  VAL B N     1 
ATOM   3276  C  CA    . VAL B 1  216  ? -6.580  13.728  -44.318 1.00 72.39  ? 216  VAL B CA    1 
ATOM   3277  C  C     . VAL B 1  216  ? -7.734  14.460  -45.000 1.00 72.76  ? 216  VAL B C     1 
ATOM   3278  O  O     . VAL B 1  216  ? -8.157  15.528  -44.554 1.00 70.38  ? 216  VAL B O     1 
ATOM   3279  C  CB    . VAL B 1  216  ? -5.249  14.063  -45.026 1.00 76.02  ? 216  VAL B CB    1 
ATOM   3280  C  CG1   . VAL B 1  216  ? -5.116  15.560  -45.237 1.00 78.64  ? 216  VAL B CG1   1 
ATOM   3281  C  CG2   . VAL B 1  216  ? -4.065  13.531  -44.228 1.00 77.78  ? 216  VAL B CG2   1 
ATOM   3282  N  N     . GLU B 1  217  ? -8.257  13.853  -46.063 1.00 76.63  ? 217  GLU B N     1 
ATOM   3283  C  CA    . GLU B 1  217  ? -9.365  14.422  -46.827 1.00 82.51  ? 217  GLU B CA    1 
ATOM   3284  C  C     . GLU B 1  217  ? -10.652 14.534  -45.999 1.00 80.68  ? 217  GLU B C     1 
ATOM   3285  O  O     . GLU B 1  217  ? -11.372 15.529  -46.096 1.00 88.56  ? 217  GLU B O     1 
ATOM   3286  C  CB    . GLU B 1  217  ? -9.631  13.586  -48.091 1.00 84.27  ? 217  GLU B CB    1 
ATOM   3287  C  CG    . GLU B 1  217  ? -8.456  13.511  -49.074 1.00 81.21  ? 217  GLU B CG    1 
ATOM   3288  C  CD    . GLU B 1  217  ? -8.800  12.779  -50.369 1.00 79.01  ? 217  GLU B CD    1 
ATOM   3289  O  OE1   . GLU B 1  217  ? -9.978  12.410  -50.560 1.00 87.90  ? 217  GLU B OE1   1 
ATOM   3290  O  OE2   . GLU B 1  217  ? -7.890  12.575  -51.201 1.00 68.92  ? 217  GLU B OE2   1 
ATOM   3291  N  N     . LEU B 1  218  ? -10.943 13.517  -45.194 1.00 67.63  ? 218  LEU B N     1 
ATOM   3292  C  CA    . LEU B 1  218  ? -12.151 13.526  -44.376 1.00 64.69  ? 218  LEU B CA    1 
ATOM   3293  C  C     . LEU B 1  218  ? -12.155 14.685  -43.393 1.00 76.18  ? 218  LEU B C     1 
ATOM   3294  O  O     . LEU B 1  218  ? -13.098 15.478  -43.353 1.00 81.40  ? 218  LEU B O     1 
ATOM   3295  C  CB    . LEU B 1  218  ? -12.297 12.212  -43.615 1.00 66.43  ? 218  LEU B CB    1 
ATOM   3296  C  CG    . LEU B 1  218  ? -12.863 11.046  -44.418 1.00 71.59  ? 218  LEU B CG    1 
ATOM   3297  C  CD1   . LEU B 1  218  ? -13.118 9.856   -43.511 1.00 73.13  ? 218  LEU B CD1   1 
ATOM   3298  C  CD2   . LEU B 1  218  ? -14.139 11.469  -45.128 1.00 73.83  ? 218  LEU B CD2   1 
ATOM   3299  N  N     . PHE B 1  219  ? -11.084 14.780  -42.610 1.00 79.70  ? 219  PHE B N     1 
ATOM   3300  C  CA    . PHE B 1  219  ? -10.976 15.783  -41.556 1.00 86.95  ? 219  PHE B CA    1 
ATOM   3301  C  C     . PHE B 1  219  ? -10.830 17.191  -42.120 1.00 91.86  ? 219  PHE B C     1 
ATOM   3302  O  O     . PHE B 1  219  ? -10.902 18.174  -41.382 1.00 94.10  ? 219  PHE B O     1 
ATOM   3303  C  CB    . PHE B 1  219  ? -9.798  15.457  -40.634 1.00 84.48  ? 219  PHE B CB    1 
ATOM   3304  C  CG    . PHE B 1  219  ? -9.949  14.157  -39.896 1.00 83.22  ? 219  PHE B CG    1 
ATOM   3305  C  CD1   . PHE B 1  219  ? -11.185 13.762  -39.406 1.00 79.15  ? 219  PHE B CD1   1 
ATOM   3306  C  CD2   . PHE B 1  219  ? -8.861  13.322  -39.706 1.00 82.15  ? 219  PHE B CD2   1 
ATOM   3307  C  CE1   . PHE B 1  219  ? -11.331 12.563  -38.730 1.00 73.20  ? 219  PHE B CE1   1 
ATOM   3308  C  CE2   . PHE B 1  219  ? -9.002  12.125  -39.033 1.00 79.26  ? 219  PHE B CE2   1 
ATOM   3309  C  CZ    . PHE B 1  219  ? -10.238 11.744  -38.545 1.00 75.57  ? 219  PHE B CZ    1 
ATOM   3310  N  N     . GLY B 1  220  ? -10.619 17.285  -43.429 1.00 91.02  ? 220  GLY B N     1 
ATOM   3311  C  CA    . GLY B 1  220  ? -10.633 18.570  -44.096 1.00 94.97  ? 220  GLY B CA    1 
ATOM   3312  C  C     . GLY B 1  220  ? -11.986 19.237  -43.922 1.00 98.44  ? 220  GLY B C     1 
ATOM   3313  O  O     . GLY B 1  220  ? -12.057 20.433  -43.646 1.00 100.60 ? 220  GLY B O     1 
ATOM   3314  N  N     . LEU B 1  221  ? -13.054 18.453  -44.068 1.00 93.15  ? 221  LEU B N     1 
ATOM   3315  C  CA    . LEU B 1  221  ? -14.422 18.961  -43.950 1.00 96.43  ? 221  LEU B CA    1 
ATOM   3316  C  C     . LEU B 1  221  ? -14.623 19.741  -42.660 1.00 96.31  ? 221  LEU B C     1 
ATOM   3317  O  O     . LEU B 1  221  ? -15.189 20.837  -42.658 1.00 98.79  ? 221  LEU B O     1 
ATOM   3318  C  CB    . LEU B 1  221  ? -15.436 17.818  -44.020 1.00 92.85  ? 221  LEU B CB    1 
ATOM   3319  C  CG    . LEU B 1  221  ? -15.949 17.367  -45.391 1.00 97.08  ? 221  LEU B CG    1 
ATOM   3320  C  CD1   . LEU B 1  221  ? -16.598 18.530  -46.143 1.00 102.50 ? 221  LEU B CD1   1 
ATOM   3321  C  CD2   . LEU B 1  221  ? -14.846 16.719  -46.222 1.00 87.76  ? 221  LEU B CD2   1 
ATOM   3322  N  N     . ALA B 1  222  ? -14.150 19.164  -41.564 1.00 87.63  ? 222  ALA B N     1 
ATOM   3323  C  CA    . ALA B 1  222  ? -14.205 19.822  -40.270 1.00 92.65  ? 222  ALA B CA    1 
ATOM   3324  C  C     . ALA B 1  222  ? -13.358 21.095  -40.260 1.00 96.74  ? 222  ALA B C     1 
ATOM   3325  O  O     . ALA B 1  222  ? -13.833 22.159  -39.858 1.00 98.51  ? 222  ALA B O     1 
ATOM   3326  C  CB    . ALA B 1  222  ? -13.750 18.871  -39.178 1.00 83.02  ? 222  ALA B CB    1 
ATOM   3327  N  N     . ARG B 1  223  ? -12.111 20.984  -40.714 1.00 94.47  ? 223  ARG B N     1 
ATOM   3328  C  CA    . ARG B 1  223  ? -11.152 22.085  -40.619 1.00 95.13  ? 223  ARG B CA    1 
ATOM   3329  C  C     . ARG B 1  223  ? -11.537 23.298  -41.454 1.00 101.58 ? 223  ARG B C     1 
ATOM   3330  O  O     . ARG B 1  223  ? -11.213 24.434  -41.099 1.00 103.31 ? 223  ARG B O     1 
ATOM   3331  C  CB    . ARG B 1  223  ? -9.757  21.622  -41.042 1.00 88.37  ? 223  ARG B CB    1 
ATOM   3332  C  CG    . ARG B 1  223  ? -8.694  22.688  -40.853 1.00 88.46  ? 223  ARG B CG    1 
ATOM   3333  C  CD    . ARG B 1  223  ? -7.560  22.525  -41.841 1.00 95.14  ? 223  ARG B CD    1 
ATOM   3334  N  NE    . ARG B 1  223  ? -6.533  23.542  -41.645 1.00 102.04 ? 223  ARG B NE    1 
ATOM   3335  C  CZ    . ARG B 1  223  ? -5.378  23.575  -42.302 1.00 101.73 ? 223  ARG B CZ    1 
ATOM   3336  N  NH1   . ARG B 1  223  ? -4.501  24.539  -42.054 1.00 95.12  ? 223  ARG B NH1   1 
ATOM   3337  N  NH2   . ARG B 1  223  ? -5.100  22.645  -43.206 1.00 102.51 ? 223  ARG B NH2   1 
ATOM   3338  N  N     . GLU B 1  224  ? -12.225 23.047  -42.564 1.00 101.91 ? 224  GLU B N     1 
ATOM   3339  C  CA    . GLU B 1  224  ? -12.593 24.098  -43.510 1.00 105.91 ? 224  GLU B CA    1 
ATOM   3340  C  C     . GLU B 1  224  ? -13.374 25.238  -42.862 1.00 108.39 ? 224  GLU B C     1 
ATOM   3341  O  O     . GLU B 1  224  ? -13.346 26.370  -43.343 1.00 115.15 ? 224  GLU B O     1 
ATOM   3342  C  CB    . GLU B 1  224  ? -13.415 23.512  -44.665 1.00 100.91 ? 224  GLU B CB    1 
ATOM   3343  C  CG    . GLU B 1  224  ? -12.621 22.694  -45.676 1.00 103.63 ? 224  GLU B CG    1 
ATOM   3344  C  CD    . GLU B 1  224  ? -13.517 21.961  -46.665 1.00 110.63 ? 224  GLU B CD    1 
ATOM   3345  O  OE1   . GLU B 1  224  ? -14.728 22.267  -46.710 1.00 109.42 ? 224  GLU B OE1   1 
ATOM   3346  O  OE2   . GLU B 1  224  ? -13.016 21.074  -47.389 1.00 113.67 ? 224  GLU B OE2   1 
ATOM   3347  N  N     . LEU B 1  225  ? -14.054 24.939  -41.761 1.00 97.99  ? 225  LEU B N     1 
ATOM   3348  C  CA    . LEU B 1  225  ? -14.973 25.891  -41.148 1.00 96.46  ? 225  LEU B CA    1 
ATOM   3349  C  C     . LEU B 1  225  ? -14.317 27.130  -40.506 1.00 92.33  ? 225  LEU B C     1 
ATOM   3350  O  O     . LEU B 1  225  ? -14.921 28.201  -40.496 1.00 94.61  ? 225  LEU B O     1 
ATOM   3351  C  CB    . LEU B 1  225  ? -15.838 25.164  -40.111 1.00 88.09  ? 225  LEU B CB    1 
ATOM   3352  C  CG    . LEU B 1  225  ? -16.946 24.282  -40.699 1.00 75.93  ? 225  LEU B CG    1 
ATOM   3353  C  CD1   . LEU B 1  225  ? -17.595 23.420  -39.632 1.00 70.57  ? 225  LEU B CD1   1 
ATOM   3354  C  CD2   . LEU B 1  225  ? -17.986 25.154  -41.371 1.00 82.58  ? 225  LEU B CD2   1 
ATOM   3355  N  N     . ASN B 1  226  ? -13.097 27.015  -39.985 1.00 84.54  ? 226  ASN B N     1 
ATOM   3356  C  CA    . ASN B 1  226  ? -12.530 28.143  -39.250 1.00 88.78  ? 226  ASN B CA    1 
ATOM   3357  C  C     . ASN B 1  226  ? -11.004 28.184  -39.147 1.00 100.45 ? 226  ASN B C     1 
ATOM   3358  O  O     . ASN B 1  226  ? -10.429 29.263  -38.962 1.00 97.22  ? 226  ASN B O     1 
ATOM   3359  C  CB    . ASN B 1  226  ? -13.127 28.164  -37.836 1.00 89.81  ? 226  ASN B CB    1 
ATOM   3360  C  CG    . ASN B 1  226  ? -13.030 29.525  -37.181 1.00 102.05 ? 226  ASN B CG    1 
ATOM   3361  O  OD1   . ASN B 1  226  ? -12.574 30.490  -37.796 1.00 102.50 ? 226  ASN B OD1   1 
ATOM   3362  N  ND2   . ASN B 1  226  ? -13.476 29.617  -35.935 1.00 105.34 ? 226  ASN B ND2   1 
ATOM   3363  N  N     . VAL B 1  227  ? -10.367 27.018  -39.293 1.00 109.22 ? 227  VAL B N     1 
ATOM   3364  C  CA    . VAL B 1  227  ? -8.930  26.805  -39.023 1.00 117.87 ? 227  VAL B CA    1 
ATOM   3365  C  C     . VAL B 1  227  ? -8.446  27.654  -37.829 1.00 117.20 ? 227  VAL B C     1 
ATOM   3366  O  O     . VAL B 1  227  ? -7.557  28.502  -37.941 1.00 109.63 ? 227  VAL B O     1 
ATOM   3367  C  CB    . VAL B 1  227  ? -8.056  27.049  -40.321 1.00 111.76 ? 227  VAL B CB    1 
ATOM   3368  C  CG1   . VAL B 1  227  ? -8.149  28.481  -40.839 1.00 102.27 ? 227  VAL B CG1   1 
ATOM   3369  C  CG2   . VAL B 1  227  ? -6.596  26.625  -40.097 1.00 101.95 ? 227  VAL B CG2   1 
ATOM   3370  N  N     . GLU B 1  228  ? -9.052  27.391  -36.671 1.00 116.24 ? 228  GLU B N     1 
ATOM   3371  C  CA    . GLU B 1  228  ? -8.845  28.197  -35.462 1.00 108.97 ? 228  GLU B CA    1 
ATOM   3372  C  C     . GLU B 1  228  ? -7.461  28.069  -34.831 1.00 111.15 ? 228  GLU B C     1 
ATOM   3373  O  O     . GLU B 1  228  ? -6.650  28.987  -34.933 1.00 119.01 ? 228  GLU B O     1 
ATOM   3374  C  CB    . GLU B 1  228  ? -9.907  27.852  -34.400 1.00 103.74 ? 228  GLU B CB    1 
ATOM   3375  C  CG    . GLU B 1  228  ? -9.805  28.719  -33.133 1.00 106.78 ? 228  GLU B CG    1 
ATOM   3376  C  CD    . GLU B 1  228  ? -10.937 28.478  -32.134 1.00 102.89 ? 228  GLU B CD    1 
ATOM   3377  O  OE1   . GLU B 1  228  ? -11.854 27.676  -32.433 1.00 90.70  ? 228  GLU B OE1   1 
ATOM   3378  O  OE2   . GLU B 1  228  ? -10.912 29.093  -31.046 1.00 100.45 ? 228  GLU B OE2   1 
ATOM   3379  N  N     . ALA B 1  229  ? -7.199  26.946  -34.168 1.00 104.87 ? 229  ALA B N     1 
ATOM   3380  C  CA    . ALA B 1  229  ? -5.973  26.813  -33.381 1.00 110.94 ? 229  ALA B CA    1 
ATOM   3381  C  C     . ALA B 1  229  ? -5.447  25.377  -33.264 1.00 113.67 ? 229  ALA B C     1 
ATOM   3382  O  O     . ALA B 1  229  ? -6.218  24.433  -33.070 1.00 99.91  ? 229  ALA B O     1 
ATOM   3383  C  CB    . ALA B 1  229  ? -6.195  27.393  -31.985 1.00 101.27 ? 229  ALA B CB    1 
ATOM   3384  N  N     . GLU B 1  230  ? -4.123  25.243  -33.379 1.00 122.04 ? 230  GLU B N     1 
ATOM   3385  C  CA    . GLU B 1  230  ? -3.380  23.997  -33.150 1.00 115.52 ? 230  GLU B CA    1 
ATOM   3386  C  C     . GLU B 1  230  ? -1.879  24.322  -33.214 1.00 116.49 ? 230  GLU B C     1 
ATOM   3387  O  O     . GLU B 1  230  ? -1.488  25.315  -33.830 1.00 121.98 ? 230  GLU B O     1 
ATOM   3388  C  CB    . GLU B 1  230  ? -3.752  22.916  -34.174 1.00 105.40 ? 230  GLU B CB    1 
ATOM   3389  C  CG    . GLU B 1  230  ? -2.995  21.588  -34.025 1.00 98.55  ? 230  GLU B CG    1 
ATOM   3390  C  CD    . GLU B 1  230  ? -3.024  21.043  -32.607 1.00 89.50  ? 230  GLU B CD    1 
ATOM   3391  O  OE1   . GLU B 1  230  ? -4.092  21.109  -31.961 1.00 83.64  ? 230  GLU B OE1   1 
ATOM   3392  O  OE2   . GLU B 1  230  ? -1.978  20.549  -32.137 1.00 83.92  ? 230  GLU B OE2   1 
ATOM   3393  N  N     . GLY B 1  231  ? -1.041  23.500  -32.581 1.00 110.48 ? 231  GLY B N     1 
ATOM   3394  C  CA    . GLY B 1  231  ? 0.396   23.734  -32.585 1.00 108.26 ? 231  GLY B CA    1 
ATOM   3395  C  C     . GLY B 1  231  ? 1.288   22.504  -32.664 1.00 101.17 ? 231  GLY B C     1 
ATOM   3396  O  O     . GLY B 1  231  ? 1.179   21.590  -31.847 1.00 98.40  ? 231  GLY B O     1 
ATOM   3397  N  N     . ILE B 1  232  ? 2.187   22.487  -33.647 1.00 100.54 ? 232  ILE B N     1 
ATOM   3398  C  CA    . ILE B 1  232  ? 3.163   21.406  -33.778 1.00 102.63 ? 232  ILE B CA    1 
ATOM   3399  C  C     . ILE B 1  232  ? 4.592   21.937  -33.790 1.00 103.14 ? 232  ILE B C     1 
ATOM   3400  O  O     . ILE B 1  232  ? 4.978   22.691  -34.684 1.00 102.28 ? 232  ILE B O     1 
ATOM   3401  C  CB    . ILE B 1  232  ? 2.925   20.580  -35.055 1.00 98.35  ? 232  ILE B CB    1 
ATOM   3402  C  CG1   . ILE B 1  232  ? 1.673   19.723  -34.890 1.00 96.93  ? 232  ILE B CG1   1 
ATOM   3403  C  CG2   . ILE B 1  232  ? 4.134   19.698  -35.362 1.00 86.91  ? 232  ILE B CG2   1 
ATOM   3404  C  CD1   . ILE B 1  232  ? 1.814   18.644  -33.850 1.00 100.42 ? 232  ILE B CD1   1 
ATOM   3405  N  N     . SER C 2  28   ? -43.930 9.346   2.384   1.00 86.95  ? 28   SER C N     1 
ATOM   3406  C  CA    . SER C 2  28   ? -42.784 9.782   3.176   1.00 91.35  ? 28   SER C CA    1 
ATOM   3407  C  C     . SER C 2  28   ? -42.332 8.708   4.170   1.00 100.17 ? 28   SER C C     1 
ATOM   3408  O  O     . SER C 2  28   ? -43.020 7.701   4.375   1.00 92.92  ? 28   SER C O     1 
ATOM   3409  C  CB    . SER C 2  28   ? -43.116 11.081  3.919   1.00 86.09  ? 28   SER C CB    1 
ATOM   3410  N  N     . ASN C 2  29   ? -41.168 8.933   4.777   1.00 104.40 ? 29   ASN C N     1 
ATOM   3411  C  CA    . ASN C 2  29   ? -40.615 8.027   5.780   1.00 98.72  ? 29   ASN C CA    1 
ATOM   3412  C  C     . ASN C 2  29   ? -40.665 8.647   7.177   1.00 101.52 ? 29   ASN C C     1 
ATOM   3413  O  O     . ASN C 2  29   ? -41.485 8.258   8.012   1.00 92.09  ? 29   ASN C O     1 
ATOM   3414  C  CB    . ASN C 2  29   ? -39.175 7.645   5.422   1.00 76.68  ? 29   ASN C CB    1 
ATOM   3415  N  N     . ASN C 2  30   ? -39.789 9.620   7.419   1.00 106.44 ? 30   ASN C N     1 
ATOM   3416  C  CA    . ASN C 2  30   ? -39.719 10.300  8.711   1.00 99.28  ? 30   ASN C CA    1 
ATOM   3417  C  C     . ASN C 2  30   ? -40.229 11.736  8.637   1.00 90.49  ? 30   ASN C C     1 
ATOM   3418  O  O     . ASN C 2  30   ? -39.440 12.681  8.598   1.00 84.61  ? 30   ASN C O     1 
ATOM   3419  C  CB    . ASN C 2  30   ? -38.283 10.298  9.242   1.00 92.55  ? 30   ASN C CB    1 
ATOM   3420  C  CG    . ASN C 2  30   ? -37.672 8.910   9.270   1.00 96.85  ? 30   ASN C CG    1 
ATOM   3421  O  OD1   . ASN C 2  30   ? -37.286 8.368   8.234   1.00 91.34  ? 30   ASN C OD1   1 
ATOM   3422  N  ND2   . ASN C 2  30   ? -37.573 8.331   10.462  1.00 98.86  ? 30   ASN C ND2   1 
ATOM   3423  N  N     . SER C 2  31   ? -41.549 11.895  8.629   1.00 87.35  ? 31   SER C N     1 
ATOM   3424  C  CA    . SER C 2  31   ? -42.163 13.217  8.549   1.00 88.76  ? 31   SER C CA    1 
ATOM   3425  C  C     . SER C 2  31   ? -42.163 13.918  9.915   1.00 83.78  ? 31   SER C C     1 
ATOM   3426  O  O     . SER C 2  31   ? -43.173 14.500  10.321  1.00 76.72  ? 31   SER C O     1 
ATOM   3427  C  CB    . SER C 2  31   ? -43.592 13.106  8.003   1.00 79.97  ? 31   SER C CB    1 
ATOM   3428  O  OG    . SER C 2  31   ? -43.620 12.424  6.758   1.00 71.28  ? 31   SER C OG    1 
ATOM   3429  N  N     . VAL C 2  32   ? -41.018 13.873  10.602  1.00 79.06  ? 32   VAL C N     1 
ATOM   3430  C  CA    . VAL C 2  32   ? -40.908 14.347  11.987  1.00 70.70  ? 32   VAL C CA    1 
ATOM   3431  C  C     . VAL C 2  32   ? -40.039 15.604  12.226  1.00 68.60  ? 32   VAL C C     1 
ATOM   3432  O  O     . VAL C 2  32   ? -40.454 16.497  12.964  1.00 70.33  ? 32   VAL C O     1 
ATOM   3433  C  CB    . VAL C 2  32   ? -40.361 13.225  12.909  1.00 63.34  ? 32   VAL C CB    1 
ATOM   3434  C  CG1   . VAL C 2  32   ? -40.555 13.599  14.376  1.00 59.15  ? 32   VAL C CG1   1 
ATOM   3435  C  CG2   . VAL C 2  32   ? -41.035 11.899  12.596  1.00 65.34  ? 32   VAL C CG2   1 
ATOM   3436  N  N     . PRO C 2  33   ? -38.829 15.682  11.632  1.00 59.88  ? 33   PRO C N     1 
ATOM   3437  C  CA    . PRO C 2  33   ? -37.986 16.812  12.054  1.00 52.24  ? 33   PRO C CA    1 
ATOM   3438  C  C     . PRO C 2  33   ? -38.039 18.062  11.159  1.00 39.98  ? 33   PRO C C     1 
ATOM   3439  O  O     . PRO C 2  33   ? -37.961 19.183  11.663  1.00 32.28  ? 33   PRO C O     1 
ATOM   3440  C  CB    . PRO C 2  33   ? -36.569 16.208  12.032  1.00 51.06  ? 33   PRO C CB    1 
ATOM   3441  C  CG    . PRO C 2  33   ? -36.705 14.809  11.382  1.00 50.58  ? 33   PRO C CG    1 
ATOM   3442  C  CD    . PRO C 2  33   ? -38.075 14.743  10.786  1.00 56.37  ? 33   PRO C CD    1 
ATOM   3443  N  N     . GLY C 2  34   ? -38.157 17.867  9.850   1.00 39.42  ? 34   GLY C N     1 
ATOM   3444  C  CA    . GLY C 2  34   ? -38.014 18.954  8.894   1.00 37.86  ? 34   GLY C CA    1 
ATOM   3445  C  C     . GLY C 2  34   ? -37.029 18.534  7.820   1.00 42.52  ? 34   GLY C C     1 
ATOM   3446  O  O     . GLY C 2  34   ? -36.258 19.342  7.299   1.00 39.71  ? 34   GLY C O     1 
ATOM   3447  N  N     . ALA C 2  35   ? -37.076 17.245  7.494   1.00 45.50  ? 35   ALA C N     1 
ATOM   3448  C  CA    . ALA C 2  35   ? -36.130 16.601  6.590   1.00 45.56  ? 35   ALA C CA    1 
ATOM   3449  C  C     . ALA C 2  35   ? -36.614 16.569  5.147   1.00 48.84  ? 35   ALA C C     1 
ATOM   3450  O  O     . ALA C 2  35   ? -37.787 16.811  4.870   1.00 56.32  ? 35   ALA C O     1 
ATOM   3451  C  CB    . ALA C 2  35   ? -35.859 15.187  7.073   1.00 46.46  ? 35   ALA C CB    1 
ATOM   3452  N  N     . PRO C 2  36   ? -35.711 16.244  4.216   1.00 47.68  ? 36   PRO C N     1 
ATOM   3453  C  CA    . PRO C 2  36   ? -36.162 16.005  2.846   1.00 49.85  ? 36   PRO C CA    1 
ATOM   3454  C  C     . PRO C 2  36   ? -37.062 14.775  2.736   1.00 49.84  ? 36   PRO C C     1 
ATOM   3455  O  O     . PRO C 2  36   ? -36.874 13.791  3.457   1.00 49.23  ? 36   PRO C O     1 
ATOM   3456  C  CB    . PRO C 2  36   ? -34.852 15.795  2.079   1.00 46.52  ? 36   PRO C CB    1 
ATOM   3457  C  CG    . PRO C 2  36   ? -33.871 15.341  3.119   1.00 45.57  ? 36   PRO C CG    1 
ATOM   3458  C  CD    . PRO C 2  36   ? -34.247 16.148  4.334   1.00 46.97  ? 36   PRO C CD    1 
ATOM   3459  N  N     . ASN C 2  37   ? -38.031 14.832  1.831   1.00 47.82  ? 37   ASN C N     1 
ATOM   3460  C  CA    . ASN C 2  37   ? -38.927 13.706  1.624   1.00 48.67  ? 37   ASN C CA    1 
ATOM   3461  C  C     . ASN C 2  37   ? -38.229 12.553  0.908   1.00 47.66  ? 37   ASN C C     1 
ATOM   3462  O  O     . ASN C 2  37   ? -37.843 12.670  -0.256  1.00 44.95  ? 37   ASN C O     1 
ATOM   3463  C  CB    . ASN C 2  37   ? -40.160 14.149  0.835   1.00 47.70  ? 37   ASN C CB    1 
ATOM   3464  C  CG    . ASN C 2  37   ? -41.162 13.022  0.628   1.00 50.64  ? 37   ASN C CG    1 
ATOM   3465  O  OD1   . ASN C 2  37   ? -41.239 12.079  1.420   1.00 49.12  ? 37   ASN C OD1   1 
ATOM   3466  N  ND2   . ASN C 2  37   ? -41.937 13.118  -0.447  1.00 48.01  ? 37   ASN C ND2   1 
ATOM   3467  N  N     . ARG C 2  38   ? -38.067 11.440  1.615   1.00 46.91  ? 38   ARG C N     1 
ATOM   3468  C  CA    . ARG C 2  38   ? -37.503 10.232  1.028   1.00 42.89  ? 38   ARG C CA    1 
ATOM   3469  C  C     . ARG C 2  38   ? -38.590 9.155   0.967   1.00 45.82  ? 38   ARG C C     1 
ATOM   3470  O  O     . ARG C 2  38   ? -38.940 8.553   1.986   1.00 49.77  ? 38   ARG C O     1 
ATOM   3471  C  CB    . ARG C 2  38   ? -36.290 9.757   1.838   1.00 43.41  ? 38   ARG C CB    1 
ATOM   3472  C  CG    . ARG C 2  38   ? -35.420 8.740   1.123   1.00 40.13  ? 38   ARG C CG    1 
ATOM   3473  C  CD    . ARG C 2  38   ? -34.207 8.326   1.951   1.00 34.51  ? 38   ARG C CD    1 
ATOM   3474  N  NE    . ARG C 2  38   ? -33.182 9.361   1.973   1.00 34.82  ? 38   ARG C NE    1 
ATOM   3475  C  CZ    . ARG C 2  38   ? -32.172 9.434   1.113   1.00 34.58  ? 38   ARG C CZ    1 
ATOM   3476  N  NH1   . ARG C 2  38   ? -31.287 10.418  1.212   1.00 32.70  ? 38   ARG C NH1   1 
ATOM   3477  N  NH2   . ARG C 2  38   ? -32.042 8.524   0.155   1.00 34.88  ? 38   ARG C NH2   1 
ATOM   3478  N  N     . VAL C 2  39   ? -39.129 8.930   -0.231  1.00 41.83  ? 39   VAL C N     1 
ATOM   3479  C  CA    . VAL C 2  39   ? -40.283 8.049   -0.423  1.00 42.27  ? 39   VAL C CA    1 
ATOM   3480  C  C     . VAL C 2  39   ? -39.920 6.590   -0.192  1.00 39.25  ? 39   VAL C C     1 
ATOM   3481  O  O     . VAL C 2  39   ? -38.962 6.088   -0.769  1.00 40.01  ? 39   VAL C O     1 
ATOM   3482  C  CB    . VAL C 2  39   ? -40.866 8.198   -1.841  1.00 41.98  ? 39   VAL C CB    1 
ATOM   3483  C  CG1   . VAL C 2  39   ? -42.380 8.061   -1.813  1.00 51.96  ? 39   VAL C CG1   1 
ATOM   3484  C  CG2   . VAL C 2  39   ? -40.467 9.538   -2.429  1.00 39.75  ? 39   VAL C CG2   1 
ATOM   3485  N  N     . SER C 2  40   ? -40.697 5.898   0.633   1.00 37.15  ? 40   SER C N     1 
ATOM   3486  C  CA    . SER C 2  40   ? -40.320 4.551   1.049   1.00 35.78  ? 40   SER C CA    1 
ATOM   3487  C  C     . SER C 2  40   ? -41.258 3.428   0.598   1.00 35.87  ? 40   SER C C     1 
ATOM   3488  O  O     . SER C 2  40   ? -42.455 3.466   0.872   1.00 37.93  ? 40   SER C O     1 
ATOM   3489  C  CB    . SER C 2  40   ? -40.209 4.506   2.571   1.00 39.76  ? 40   SER C CB    1 
ATOM   3490  O  OG    . SER C 2  40   ? -40.004 3.176   3.003   1.00 38.11  ? 40   SER C OG    1 
ATOM   3491  N  N     . PHE C 2  41   ? -40.708 2.423   -0.084  1.00 34.55  ? 41   PHE C N     1 
ATOM   3492  C  CA    . PHE C 2  41   ? -41.413 1.154   -0.262  1.00 35.99  ? 41   PHE C CA    1 
ATOM   3493  C  C     . PHE C 2  41   ? -41.540 0.558   1.143   1.00 35.26  ? 41   PHE C C     1 
ATOM   3494  O  O     . PHE C 2  41   ? -40.537 0.474   1.849   1.00 37.57  ? 41   PHE C O     1 
ATOM   3495  C  CB    . PHE C 2  41   ? -40.660 0.167   -1.187  1.00 39.45  ? 41   PHE C CB    1 
ATOM   3496  C  CG    . PHE C 2  41   ? -40.067 0.777   -2.453  1.00 38.25  ? 41   PHE C CG    1 
ATOM   3497  C  CD1   . PHE C 2  41   ? -40.630 0.526   -3.696  1.00 41.14  ? 41   PHE C CD1   1 
ATOM   3498  C  CD2   . PHE C 2  41   ? -38.910 1.541   -2.404  1.00 39.57  ? 41   PHE C CD2   1 
ATOM   3499  C  CE1   . PHE C 2  41   ? -40.075 1.063   -4.856  1.00 38.52  ? 41   PHE C CE1   1 
ATOM   3500  C  CE2   . PHE C 2  41   ? -38.356 2.080   -3.561  1.00 36.61  ? 41   PHE C CE2   1 
ATOM   3501  C  CZ    . PHE C 2  41   ? -38.938 1.839   -4.784  1.00 33.12  ? 41   PHE C CZ    1 
ATOM   3502  N  N     . ALA C 2  42   ? -42.740 0.150   1.559   1.00 34.43  ? 42   ALA C N     1 
ATOM   3503  C  CA    . ALA C 2  42   ? -42.923 -0.361  2.925   1.00 35.95  ? 42   ALA C CA    1 
ATOM   3504  C  C     . ALA C 2  42   ? -44.313 -0.925  3.224   1.00 37.76  ? 42   ALA C C     1 
ATOM   3505  O  O     . ALA C 2  42   ? -45.280 -0.642  2.522   1.00 38.45  ? 42   ALA C O     1 
ATOM   3506  C  CB    . ALA C 2  42   ? -42.608 0.748   3.946   1.00 34.60  ? 42   ALA C CB    1 
ATOM   3507  N  N     . LYS C 2  43   ? -44.392 -1.738  4.273   1.00 36.91  ? 43   LYS C N     1 
ATOM   3508  C  CA    . LYS C 2  43   ? -45.632 -1.906  5.014   1.00 37.45  ? 43   LYS C CA    1 
ATOM   3509  C  C     . LYS C 2  43   ? -45.579 -0.839  6.094   1.00 43.80  ? 43   LYS C C     1 
ATOM   3510  O  O     . LYS C 2  43   ? -44.502 -0.551  6.609   1.00 51.39  ? 43   LYS C O     1 
ATOM   3511  C  CB    . LYS C 2  43   ? -45.752 -3.295  5.620   1.00 40.50  ? 43   LYS C CB    1 
ATOM   3512  C  CG    . LYS C 2  43   ? -44.706 -3.584  6.671   1.00 39.89  ? 43   LYS C CG    1 
ATOM   3513  C  CD    . LYS C 2  43   ? -45.252 -4.519  7.724   1.00 53.13  ? 43   LYS C CD    1 
ATOM   3514  C  CE    . LYS C 2  43   ? -44.305 -4.649  8.904   1.00 60.50  ? 43   LYS C CE    1 
ATOM   3515  N  NZ    . LYS C 2  43   ? -44.884 -5.496  9.990   1.00 61.43  ? 43   LYS C NZ    1 
ATOM   3516  N  N     . LEU C 2  44   ? -46.713 -0.237  6.435   1.00 53.08  ? 44   LEU C N     1 
ATOM   3517  C  CA    . LEU C 2  44   ? -46.672 0.978   7.251   1.00 56.95  ? 44   LEU C CA    1 
ATOM   3518  C  C     . LEU C 2  44   ? -46.100 0.693   8.637   1.00 51.42  ? 44   LEU C C     1 
ATOM   3519  O  O     . LEU C 2  44   ? -46.550 -0.203  9.351   1.00 48.75  ? 44   LEU C O     1 
ATOM   3520  C  CB    . LEU C 2  44   ? -48.060 1.624   7.352   1.00 61.14  ? 44   LEU C CB    1 
ATOM   3521  C  CG    . LEU C 2  44   ? -48.082 3.159   7.429   1.00 52.82  ? 44   LEU C CG    1 
ATOM   3522  C  CD1   . LEU C 2  44   ? -49.432 3.713   6.985   1.00 58.51  ? 44   LEU C CD1   1 
ATOM   3523  C  CD2   . LEU C 2  44   ? -47.741 3.653   8.828   1.00 53.38  ? 44   LEU C CD2   1 
ATOM   3524  N  N     . ARG C 2  45   ? -45.080 1.465   8.993   1.00 55.63  ? 45   ARG C N     1 
ATOM   3525  C  CA    . ARG C 2  45   ? -44.351 1.260   10.233  1.00 62.09  ? 45   ARG C CA    1 
ATOM   3526  C  C     . ARG C 2  45   ? -44.650 2.373   11.219  1.00 66.07  ? 45   ARG C C     1 
ATOM   3527  O  O     . ARG C 2  45   ? -43.958 3.390   11.268  1.00 64.95  ? 45   ARG C O     1 
ATOM   3528  C  CB    . ARG C 2  45   ? -42.848 1.183   9.962   1.00 74.55  ? 45   ARG C CB    1 
ATOM   3529  C  CG    . ARG C 2  45   ? -41.990 0.982   11.201  1.00 76.04  ? 45   ARG C CG    1 
ATOM   3530  C  CD    . ARG C 2  45   ? -40.512 1.135   10.876  1.00 68.94  ? 45   ARG C CD    1 
ATOM   3531  N  NE    . ARG C 2  45   ? -40.207 2.437   10.286  1.00 67.49  ? 45   ARG C NE    1 
ATOM   3532  C  CZ    . ARG C 2  45   ? -39.956 3.539   10.988  1.00 72.78  ? 45   ARG C CZ    1 
ATOM   3533  N  NH1   . ARG C 2  45   ? -39.686 4.679   10.363  1.00 77.17  ? 45   ARG C NH1   1 
ATOM   3534  N  NH2   . ARG C 2  45   ? -39.977 3.504   12.315  1.00 71.44  ? 45   ARG C NH2   1 
ATOM   3535  N  N     . GLU C 2  46   ? -45.691 2.175   12.011  1.00 74.43  ? 46   GLU C N     1 
ATOM   3536  C  CA    . GLU C 2  46   ? -46.030 3.146   13.034  1.00 86.68  ? 46   GLU C CA    1 
ATOM   3537  C  C     . GLU C 2  46   ? -45.851 2.692   14.496  1.00 86.49  ? 46   GLU C C     1 
ATOM   3538  O  O     . GLU C 2  46   ? -46.471 3.286   15.380  1.00 97.89  ? 46   GLU C O     1 
ATOM   3539  C  CB    . GLU C 2  46   ? -47.480 3.588   12.833  1.00 95.67  ? 46   GLU C CB    1 
ATOM   3540  C  CG    . GLU C 2  46   ? -48.492 2.459   12.978  1.00 82.94  ? 46   GLU C CG    1 
ATOM   3541  C  CD    . GLU C 2  46   ? -49.919 2.960   12.990  1.00 77.37  ? 46   GLU C CD    1 
ATOM   3542  O  OE1   . GLU C 2  46   ? -50.709 2.485   13.834  1.00 75.77  ? 46   GLU C OE1   1 
ATOM   3543  O  OE2   . GLU C 2  46   ? -50.246 3.831   12.159  1.00 82.20  ? 46   GLU C OE2   1 
ATOM   3544  N  N     . PRO C 2  47   ? -45.017 1.663   14.776  1.00 76.09  ? 47   PRO C N     1 
ATOM   3545  C  CA    . PRO C 2  47   ? -45.000 1.300   16.200  1.00 80.90  ? 47   PRO C CA    1 
ATOM   3546  C  C     . PRO C 2  47   ? -44.336 2.365   17.080  1.00 82.35  ? 47   PRO C C     1 
ATOM   3547  O  O     . PRO C 2  47   ? -44.992 2.908   17.977  1.00 81.53  ? 47   PRO C O     1 
ATOM   3548  C  CB    . PRO C 2  47   ? -44.199 -0.007  16.215  1.00 72.33  ? 47   PRO C CB    1 
ATOM   3549  C  CG    . PRO C 2  47   ? -44.263 -0.510  14.815  1.00 64.16  ? 47   PRO C CG    1 
ATOM   3550  C  CD    . PRO C 2  47   ? -44.204 0.718   13.991  1.00 63.60  ? 47   PRO C CD    1 
ATOM   3551  N  N     . LEU C 2  48   ? -43.059 2.647   16.833  1.00 77.50  ? 48   LEU C N     1 
ATOM   3552  C  CA    . LEU C 2  48   ? -42.405 3.802   17.443  1.00 71.58  ? 48   LEU C CA    1 
ATOM   3553  C  C     . LEU C 2  48   ? -41.176 4.222   16.649  1.00 66.58  ? 48   LEU C C     1 
ATOM   3554  O  O     . LEU C 2  48   ? -40.514 3.397   16.010  1.00 57.28  ? 48   LEU C O     1 
ATOM   3555  C  CB    . LEU C 2  48   ? -42.032 3.534   18.918  1.00 63.49  ? 48   LEU C CB    1 
ATOM   3556  C  CG    . LEU C 2  48   ? -41.150 2.407   19.495  1.00 53.25  ? 48   LEU C CG    1 
ATOM   3557  C  CD1   . LEU C 2  48   ? -41.760 1.031   19.322  1.00 49.98  ? 48   LEU C CD1   1 
ATOM   3558  C  CD2   . LEU C 2  48   ? -39.720 2.420   18.979  1.00 55.41  ? 48   LEU C CD2   1 
ATOM   3559  N  N     . GLU C 2  49   ? -40.897 5.522   16.687  1.00 71.30  ? 49   GLU C N     1 
ATOM   3560  C  CA    . GLU C 2  49   ? -39.679 6.077   16.115  1.00 64.85  ? 49   GLU C CA    1 
ATOM   3561  C  C     . GLU C 2  49   ? -38.466 5.499   16.836  1.00 51.78  ? 49   GLU C C     1 
ATOM   3562  O  O     . GLU C 2  49   ? -38.531 5.164   18.024  1.00 49.31  ? 49   GLU C O     1 
ATOM   3563  C  CB    . GLU C 2  49   ? -39.675 7.610   16.220  1.00 73.17  ? 49   GLU C CB    1 
ATOM   3564  C  CG    . GLU C 2  49   ? -41.044 8.279   16.034  1.00 84.97  ? 49   GLU C CG    1 
ATOM   3565  C  CD    . GLU C 2  49   ? -41.064 9.734   16.505  1.00 95.49  ? 49   GLU C CD    1 
ATOM   3566  O  OE1   . GLU C 2  49   ? -40.252 10.091  17.387  1.00 87.45  ? 49   GLU C OE1   1 
ATOM   3567  O  OE2   . GLU C 2  49   ? -41.895 10.518  15.993  1.00 102.46 ? 49   GLU C OE2   1 
ATOM   3568  N  N     . VAL C 2  50   ? -37.367 5.371   16.106  1.00 42.96  ? 50   VAL C N     1 
ATOM   3569  C  CA    . VAL C 2  50   ? -36.087 5.013   16.696  1.00 37.19  ? 50   VAL C CA    1 
ATOM   3570  C  C     . VAL C 2  50   ? -35.785 5.917   17.895  1.00 35.18  ? 50   VAL C C     1 
ATOM   3571  O  O     . VAL C 2  50   ? -35.689 7.130   17.733  1.00 36.48  ? 50   VAL C O     1 
ATOM   3572  C  CB    . VAL C 2  50   ? -34.966 5.133   15.655  1.00 34.33  ? 50   VAL C CB    1 
ATOM   3573  C  CG1   . VAL C 2  50   ? -33.599 5.097   16.322  1.00 31.69  ? 50   VAL C CG1   1 
ATOM   3574  C  CG2   . VAL C 2  50   ? -35.123 4.055   14.581  1.00 35.77  ? 50   VAL C CG2   1 
ATOM   3575  N  N     . PRO C 2  51   ? -35.650 5.332   19.102  1.00 29.77  ? 51   PRO C N     1 
ATOM   3576  C  CA    . PRO C 2  51   ? -35.380 6.109   20.321  1.00 28.91  ? 51   PRO C CA    1 
ATOM   3577  C  C     . PRO C 2  51   ? -34.085 6.915   20.217  1.00 28.59  ? 51   PRO C C     1 
ATOM   3578  O  O     . PRO C 2  51   ? -33.349 6.736   19.249  1.00 29.45  ? 51   PRO C O     1 
ATOM   3579  C  CB    . PRO C 2  51   ? -35.264 5.033   21.407  1.00 29.77  ? 51   PRO C CB    1 
ATOM   3580  C  CG    . PRO C 2  51   ? -34.889 3.796   20.673  1.00 29.71  ? 51   PRO C CG    1 
ATOM   3581  C  CD    . PRO C 2  51   ? -35.626 3.884   19.368  1.00 31.44  ? 51   PRO C CD    1 
ATOM   3582  N  N     . GLY C 2  52   ? -33.809 7.785   21.184  1.00 27.40  ? 52   GLY C N     1 
ATOM   3583  C  CA    . GLY C 2  52   ? -32.583 8.563   21.152  1.00 27.76  ? 52   GLY C CA    1 
ATOM   3584  C  C     . GLY C 2  52   ? -31.366 7.660   21.116  1.00 26.23  ? 52   GLY C C     1 
ATOM   3585  O  O     . GLY C 2  52   ? -31.098 6.945   22.080  1.00 28.58  ? 52   GLY C O     1 
ATOM   3586  N  N     . LEU C 2  53   ? -30.628 7.691   20.009  1.00 25.60  ? 53   LEU C N     1 
ATOM   3587  C  CA    . LEU C 2  53   ? -29.564 6.708   19.763  1.00 27.81  ? 53   LEU C CA    1 
ATOM   3588  C  C     . LEU C 2  53   ? -28.433 6.770   20.802  1.00 26.92  ? 53   LEU C C     1 
ATOM   3589  O  O     . LEU C 2  53   ? -27.847 5.741   21.168  1.00 22.57  ? 53   LEU C O     1 
ATOM   3590  C  CB    . LEU C 2  53   ? -28.987 6.890   18.347  1.00 24.85  ? 53   LEU C CB    1 
ATOM   3591  C  CG    . LEU C 2  53   ? -29.841 6.435   17.153  1.00 22.29  ? 53   LEU C CG    1 
ATOM   3592  C  CD1   . LEU C 2  53   ? -29.164 6.776   15.835  1.00 22.52  ? 53   LEU C CD1   1 
ATOM   3593  C  CD2   . LEU C 2  53   ? -30.118 4.948   17.221  1.00 22.61  ? 53   LEU C CD2   1 
ATOM   3594  N  N     . LEU C 2  54   ? -28.148 7.980   21.277  1.00 28.78  ? 54   LEU C N     1 
ATOM   3595  C  CA    . LEU C 2  54   ? -27.075 8.220   22.238  1.00 27.96  ? 54   LEU C CA    1 
ATOM   3596  C  C     . LEU C 2  54   ? -27.509 8.039   23.682  1.00 30.24  ? 54   LEU C C     1 
ATOM   3597  O  O     . LEU C 2  54   ? -26.722 8.266   24.602  1.00 30.71  ? 54   LEU C O     1 
ATOM   3598  C  CB    . LEU C 2  54   ? -26.522 9.633   22.074  1.00 26.01  ? 54   LEU C CB    1 
ATOM   3599  C  CG    . LEU C 2  54   ? -25.737 9.903   20.798  1.00 24.68  ? 54   LEU C CG    1 
ATOM   3600  C  CD1   . LEU C 2  54   ? -25.181 11.313  20.829  1.00 28.31  ? 54   LEU C CD1   1 
ATOM   3601  C  CD2   . LEU C 2  54   ? -24.630 8.879   20.649  1.00 26.86  ? 54   LEU C CD2   1 
ATOM   3602  N  N     . ASP C 2  55   ? -28.759 7.641   23.887  1.00 31.14  ? 55   ASP C N     1 
ATOM   3603  C  CA    . ASP C 2  55   ? -29.300 7.561   25.237  1.00 32.78  ? 55   ASP C CA    1 
ATOM   3604  C  C     . ASP C 2  55   ? -28.577 6.510   26.072  1.00 33.17  ? 55   ASP C C     1 
ATOM   3605  O  O     . ASP C 2  55   ? -28.646 6.534   27.302  1.00 34.75  ? 55   ASP C O     1 
ATOM   3606  C  CB    . ASP C 2  55   ? -30.802 7.271   25.194  1.00 34.13  ? 55   ASP C CB    1 
ATOM   3607  C  CG    . ASP C 2  55   ? -31.616 8.475   24.748  1.00 39.09  ? 55   ASP C CG    1 
ATOM   3608  O  OD1   . ASP C 2  55   ? -31.037 9.399   24.129  1.00 36.42  ? 55   ASP C OD1   1 
ATOM   3609  O  OD2   . ASP C 2  55   ? -32.836 8.496   25.019  1.00 45.08  ? 55   ASP C OD2   1 
ATOM   3610  N  N     . VAL C 2  56   ? -27.873 5.602   25.399  1.00 30.88  ? 56   VAL C N     1 
ATOM   3611  C  CA    . VAL C 2  56   ? -27.130 4.540   26.071  1.00 29.88  ? 56   VAL C CA    1 
ATOM   3612  C  C     . VAL C 2  56   ? -26.092 5.134   27.013  1.00 28.66  ? 56   VAL C C     1 
ATOM   3613  O  O     . VAL C 2  56   ? -25.965 4.719   28.168  1.00 28.58  ? 56   VAL C O     1 
ATOM   3614  C  CB    . VAL C 2  56   ? -26.428 3.619   25.057  1.00 29.01  ? 56   VAL C CB    1 
ATOM   3615  C  CG1   . VAL C 2  56   ? -26.112 2.276   25.696  1.00 27.20  ? 56   VAL C CG1   1 
ATOM   3616  C  CG2   . VAL C 2  56   ? -27.303 3.434   23.828  1.00 32.10  ? 56   VAL C CG2   1 
ATOM   3617  N  N     . GLN C 2  57   ? -25.365 6.120   26.501  1.00 27.63  ? 57   GLN C N     1 
ATOM   3618  C  CA    . GLN C 2  57   ? -24.365 6.843   27.272  1.00 28.28  ? 57   GLN C CA    1 
ATOM   3619  C  C     . GLN C 2  57   ? -24.990 7.944   28.121  1.00 31.39  ? 57   GLN C C     1 
ATOM   3620  O  O     . GLN C 2  57   ? -24.563 8.185   29.251  1.00 33.17  ? 57   GLN C O     1 
ATOM   3621  C  CB    . GLN C 2  57   ? -23.325 7.449   26.336  1.00 27.75  ? 57   GLN C CB    1 
ATOM   3622  C  CG    . GLN C 2  57   ? -22.563 6.435   25.525  1.00 26.39  ? 57   GLN C CG    1 
ATOM   3623  C  CD    . GLN C 2  57   ? -21.222 6.121   26.138  1.00 26.46  ? 57   GLN C CD    1 
ATOM   3624  O  OE1   . GLN C 2  57   ? -20.673 6.921   26.898  1.00 26.46  ? 57   GLN C OE1   1 
ATOM   3625  N  NE2   . GLN C 2  57   ? -20.684 4.948   25.820  1.00 27.43  ? 57   GLN C NE2   1 
ATOM   3626  N  N     . THR C 2  58   ? -25.991 8.620   27.567  1.00 29.76  ? 58   THR C N     1 
ATOM   3627  C  CA    . THR C 2  58   ? -26.600 9.754   28.250  1.00 28.66  ? 58   THR C CA    1 
ATOM   3628  C  C     . THR C 2  58   ? -27.257 9.321   29.550  1.00 31.80  ? 58   THR C C     1 
ATOM   3629  O  O     . THR C 2  58   ? -26.808 9.708   30.626  1.00 34.16  ? 58   THR C O     1 
ATOM   3630  C  CB    . THR C 2  58   ? -27.644 10.461  27.374  1.00 30.66  ? 58   THR C CB    1 
ATOM   3631  O  OG1   . THR C 2  58   ? -27.064 10.800  26.109  1.00 31.42  ? 58   THR C OG1   1 
ATOM   3632  C  CG2   . THR C 2  58   ? -28.136 11.732  28.056  1.00 37.69  ? 58   THR C CG2   1 
ATOM   3633  N  N     . ASP C 2  59   ? -28.301 8.501   29.439  1.00 34.23  ? 59   ASP C N     1 
ATOM   3634  C  CA    . ASP C 2  59   ? -29.113 8.073   30.586  1.00 38.13  ? 59   ASP C CA    1 
ATOM   3635  C  C     . ASP C 2  59   ? -28.292 7.461   31.726  1.00 36.63  ? 59   ASP C C     1 
ATOM   3636  O  O     . ASP C 2  59   ? -28.654 7.591   32.900  1.00 33.31  ? 59   ASP C O     1 
ATOM   3637  C  CB    . ASP C 2  59   ? -30.183 7.067   30.131  1.00 39.96  ? 59   ASP C CB    1 
ATOM   3638  C  CG    . ASP C 2  59   ? -31.229 7.693   29.218  1.00 40.47  ? 59   ASP C CG    1 
ATOM   3639  O  OD1   . ASP C 2  59   ? -30.970 8.793   28.687  1.00 41.04  ? 59   ASP C OD1   1 
ATOM   3640  O  OD2   . ASP C 2  59   ? -32.307 7.086   29.025  1.00 39.69  ? 59   ASP C OD2   1 
ATOM   3641  N  N     . SER C 2  60   ? -27.190 6.803   31.366  1.00 36.10  ? 60   SER C N     1 
ATOM   3642  C  CA    . SER C 2  60   ? -26.304 6.139   32.323  1.00 32.55  ? 60   SER C CA    1 
ATOM   3643  C  C     . SER C 2  60   ? -25.524 7.141   33.171  1.00 31.03  ? 60   SER C C     1 
ATOM   3644  O  O     . SER C 2  60   ? -25.520 7.059   34.398  1.00 32.58  ? 60   SER C O     1 
ATOM   3645  C  CB    . SER C 2  60   ? -25.333 5.208   31.583  1.00 30.13  ? 60   SER C CB    1 
ATOM   3646  O  OG    . SER C 2  60   ? -24.520 4.478   32.485  1.00 30.63  ? 60   SER C OG    1 
ATOM   3647  N  N     . PHE C 2  61   ? -24.866 8.087   32.507  1.00 30.39  ? 61   PHE C N     1 
ATOM   3648  C  CA    . PHE C 2  61   ? -24.112 9.132   33.193  1.00 32.22  ? 61   PHE C CA    1 
ATOM   3649  C  C     . PHE C 2  61   ? -25.014 10.014  34.058  1.00 37.55  ? 61   PHE C C     1 
ATOM   3650  O  O     . PHE C 2  61   ? -24.560 10.614  35.035  1.00 37.47  ? 61   PHE C O     1 
ATOM   3651  C  CB    . PHE C 2  61   ? -23.358 9.993   32.176  1.00 29.78  ? 61   PHE C CB    1 
ATOM   3652  C  CG    . PHE C 2  61   ? -22.352 10.929  32.794  1.00 30.92  ? 61   PHE C CG    1 
ATOM   3653  C  CD1   . PHE C 2  61   ? -22.599 12.292  32.864  1.00 32.97  ? 61   PHE C CD1   1 
ATOM   3654  C  CD2   . PHE C 2  61   ? -21.157 10.443  33.303  1.00 32.67  ? 61   PHE C CD2   1 
ATOM   3655  C  CE1   . PHE C 2  61   ? -21.670 13.153  33.428  1.00 34.60  ? 61   PHE C CE1   1 
ATOM   3656  C  CE2   . PHE C 2  61   ? -20.226 11.298  33.871  1.00 33.56  ? 61   PHE C CE2   1 
ATOM   3657  C  CZ    . PHE C 2  61   ? -20.483 12.654  33.934  1.00 34.55  ? 61   PHE C CZ    1 
ATOM   3658  N  N     . GLU C 2  62   ? -26.291 10.097  33.694  1.00 38.85  ? 62   GLU C N     1 
ATOM   3659  C  CA    . GLU C 2  62   ? -27.239 10.897  34.456  1.00 38.29  ? 62   GLU C CA    1 
ATOM   3660  C  C     . GLU C 2  62   ? -27.590 10.163  35.743  1.00 36.95  ? 62   GLU C C     1 
ATOM   3661  O  O     . GLU C 2  62   ? -27.787 10.783  36.786  1.00 40.29  ? 62   GLU C O     1 
ATOM   3662  C  CB    . GLU C 2  62   ? -28.491 11.203  33.626  1.00 40.28  ? 62   GLU C CB    1 
ATOM   3663  C  CG    . GLU C 2  62   ? -28.190 11.987  32.344  1.00 44.32  ? 62   GLU C CG    1 
ATOM   3664  C  CD    . GLU C 2  62   ? -29.413 12.665  31.744  1.00 57.86  ? 62   GLU C CD    1 
ATOM   3665  O  OE1   . GLU C 2  62   ? -29.767 13.765  32.217  1.00 70.48  ? 62   GLU C OE1   1 
ATOM   3666  O  OE2   . GLU C 2  62   ? -30.011 12.108  30.796  1.00 54.75  ? 62   GLU C OE2   1 
ATOM   3667  N  N     . TRP C 2  63   ? -27.643 8.837   35.665  1.00 34.13  ? 63   TRP C N     1 
ATOM   3668  C  CA    . TRP C 2  63   ? -27.837 8.007   36.849  1.00 38.09  ? 63   TRP C CA    1 
ATOM   3669  C  C     . TRP C 2  63   ? -26.668 8.160   37.813  1.00 36.55  ? 63   TRP C C     1 
ATOM   3670  O  O     . TRP C 2  63   ? -26.838 8.116   39.033  1.00 38.51  ? 63   TRP C O     1 
ATOM   3671  C  CB    . TRP C 2  63   ? -27.995 6.536   36.461  1.00 38.81  ? 63   TRP C CB    1 
ATOM   3672  C  CG    . TRP C 2  63   ? -27.890 5.589   37.626  1.00 37.33  ? 63   TRP C CG    1 
ATOM   3673  C  CD1   . TRP C 2  63   ? -28.866 5.291   38.532  1.00 38.64  ? 63   TRP C CD1   1 
ATOM   3674  C  CD2   . TRP C 2  63   ? -26.741 4.820   38.007  1.00 35.06  ? 63   TRP C CD2   1 
ATOM   3675  N  NE1   . TRP C 2  63   ? -28.396 4.386   39.453  1.00 38.35  ? 63   TRP C NE1   1 
ATOM   3676  C  CE2   . TRP C 2  63   ? -27.097 4.080   39.153  1.00 36.14  ? 63   TRP C CE2   1 
ATOM   3677  C  CE3   . TRP C 2  63   ? -25.451 4.683   37.490  1.00 35.69  ? 63   TRP C CE3   1 
ATOM   3678  C  CZ2   . TRP C 2  63   ? -26.205 3.218   39.790  1.00 38.51  ? 63   TRP C CZ2   1 
ATOM   3679  C  CZ3   . TRP C 2  63   ? -24.569 3.829   38.123  1.00 37.90  ? 63   TRP C CZ3   1 
ATOM   3680  C  CH2   . TRP C 2  63   ? -24.951 3.105   39.261  1.00 38.56  ? 63   TRP C CH2   1 
ATOM   3681  N  N     . LEU C 2  64   ? -25.479 8.334   37.251  1.00 35.64  ? 64   LEU C N     1 
ATOM   3682  C  CA    . LEU C 2  64   ? -24.272 8.479   38.046  1.00 35.67  ? 64   LEU C CA    1 
ATOM   3683  C  C     . LEU C 2  64   ? -24.381 9.704   38.935  1.00 33.65  ? 64   LEU C C     1 
ATOM   3684  O  O     . LEU C 2  64   ? -24.347 9.601   40.160  1.00 32.68  ? 64   LEU C O     1 
ATOM   3685  C  CB    . LEU C 2  64   ? -23.042 8.581   37.139  1.00 35.13  ? 64   LEU C CB    1 
ATOM   3686  C  CG    . LEU C 2  64   ? -21.659 8.548   37.795  1.00 32.45  ? 64   LEU C CG    1 
ATOM   3687  C  CD1   . LEU C 2  64   ? -21.329 7.160   38.341  1.00 32.33  ? 64   LEU C CD1   1 
ATOM   3688  C  CD2   . LEU C 2  64   ? -20.592 9.013   36.815  1.00 30.87  ? 64   LEU C CD2   1 
ATOM   3689  N  N     . ILE C 2  65   ? -24.538 10.863  38.305  1.00 33.42  ? 65   ILE C N     1 
ATOM   3690  C  CA    . ILE C 2  65   ? -24.544 12.122  39.031  1.00 37.57  ? 65   ILE C CA    1 
ATOM   3691  C  C     . ILE C 2  65   ? -25.902 12.394  39.685  1.00 40.35  ? 65   ILE C C     1 
ATOM   3692  O  O     . ILE C 2  65   ? -26.004 13.204  40.609  1.00 42.75  ? 65   ILE C O     1 
ATOM   3693  C  CB    . ILE C 2  65   ? -24.161 13.302  38.109  1.00 34.62  ? 65   ILE C CB    1 
ATOM   3694  C  CG1   . ILE C 2  65   ? -25.140 13.424  36.949  1.00 36.38  ? 65   ILE C CG1   1 
ATOM   3695  C  CG2   . ILE C 2  65   ? -22.754 13.125  37.558  1.00 33.25  ? 65   ILE C CG2   1 
ATOM   3696  C  CD1   . ILE C 2  65   ? -24.874 14.624  36.082  1.00 37.84  ? 65   ILE C CD1   1 
ATOM   3697  N  N     . GLY C 2  66   ? -26.938 11.706  39.216  1.00 40.72  ? 66   GLY C N     1 
ATOM   3698  C  CA    . GLY C 2  66   ? -28.275 11.893  39.752  1.00 46.34  ? 66   GLY C CA    1 
ATOM   3699  C  C     . GLY C 2  66   ? -28.913 13.190  39.288  1.00 48.86  ? 66   GLY C C     1 
ATOM   3700  O  O     . GLY C 2  66   ? -29.553 13.892  40.073  1.00 51.82  ? 66   GLY C O     1 
ATOM   3701  N  N     . SER C 2  67   ? -28.739 13.502  38.006  1.00 48.14  ? 67   SER C N     1 
ATOM   3702  C  CA    . SER C 2  67   ? -29.257 14.737  37.424  1.00 52.55  ? 67   SER C CA    1 
ATOM   3703  C  C     . SER C 2  67   ? -30.777 14.797  37.551  1.00 59.18  ? 67   SER C C     1 
ATOM   3704  O  O     . SER C 2  67   ? -31.428 13.759  37.673  1.00 56.71  ? 67   SER C O     1 
ATOM   3705  C  CB    . SER C 2  67   ? -28.840 14.854  35.955  1.00 52.32  ? 67   SER C CB    1 
ATOM   3706  O  OG    . SER C 2  67   ? -29.517 13.901  35.158  1.00 50.58  ? 67   SER C OG    1 
ATOM   3707  N  N     . PRO C 2  68   ? -31.343 16.017  37.549  1.00 68.49  ? 68   PRO C N     1 
ATOM   3708  C  CA    . PRO C 2  68   ? -32.798 16.181  37.631  1.00 68.51  ? 68   PRO C CA    1 
ATOM   3709  C  C     . PRO C 2  68   ? -33.536 15.340  36.605  1.00 64.72  ? 68   PRO C C     1 
ATOM   3710  O  O     . PRO C 2  68   ? -34.552 14.733  36.935  1.00 70.15  ? 68   PRO C O     1 
ATOM   3711  C  CB    . PRO C 2  68   ? -32.997 17.672  37.346  1.00 76.21  ? 68   PRO C CB    1 
ATOM   3712  C  CG    . PRO C 2  68   ? -31.749 18.308  37.838  1.00 77.00  ? 68   PRO C CG    1 
ATOM   3713  C  CD    . PRO C 2  68   ? -30.643 17.316  37.568  1.00 74.59  ? 68   PRO C CD    1 
ATOM   3714  N  N     . ARG C 2  69   ? -33.012 15.296  35.384  1.00 63.43  ? 69   ARG C N     1 
ATOM   3715  C  CA    . ARG C 2  69   ? -33.658 14.575  34.291  1.00 69.35  ? 69   ARG C CA    1 
ATOM   3716  C  C     . ARG C 2  69   ? -33.769 13.078  34.572  1.00 66.79  ? 69   ARG C C     1 
ATOM   3717  O  O     . ARG C 2  69   ? -34.631 12.397  34.014  1.00 68.02  ? 69   ARG C O     1 
ATOM   3718  C  CB    . ARG C 2  69   ? -32.903 14.807  32.980  1.00 71.33  ? 69   ARG C CB    1 
ATOM   3719  C  CG    . ARG C 2  69   ? -32.986 16.233  32.453  1.00 73.00  ? 69   ARG C CG    1 
ATOM   3720  C  CD    . ARG C 2  69   ? -32.649 16.286  30.970  1.00 75.99  ? 69   ARG C CD    1 
ATOM   3721  N  NE    . ARG C 2  69   ? -31.294 15.817  30.699  1.00 81.81  ? 69   ARG C NE    1 
ATOM   3722  C  CZ    . ARG C 2  69   ? -30.231 16.611  30.633  1.00 88.47  ? 69   ARG C CZ    1 
ATOM   3723  N  NH1   . ARG C 2  69   ? -30.369 17.918  30.817  1.00 91.15  ? 69   ARG C NH1   1 
ATOM   3724  N  NH2   . ARG C 2  69   ? -29.032 16.101  30.382  1.00 88.61  ? 69   ARG C NH2   1 
ATOM   3725  N  N     . TRP C 2  70   ? -32.898 12.570  35.439  1.00 62.03  ? 70   TRP C N     1 
ATOM   3726  C  CA    . TRP C 2  70   ? -32.937 11.164  35.823  1.00 60.76  ? 70   TRP C CA    1 
ATOM   3727  C  C     . TRP C 2  70   ? -34.006 10.887  36.867  1.00 69.03  ? 70   TRP C C     1 
ATOM   3728  O  O     . TRP C 2  70   ? -34.687 9.865   36.809  1.00 75.45  ? 70   TRP C O     1 
ATOM   3729  C  CB    . TRP C 2  70   ? -31.582 10.712  36.359  1.00 52.87  ? 70   TRP C CB    1 
ATOM   3730  C  CG    . TRP C 2  70   ? -31.648 9.427   37.131  1.00 48.47  ? 70   TRP C CG    1 
ATOM   3731  C  CD1   . TRP C 2  70   ? -31.800 8.172   36.621  1.00 48.30  ? 70   TRP C CD1   1 
ATOM   3732  C  CD2   . TRP C 2  70   ? -31.553 9.273   38.552  1.00 47.27  ? 70   TRP C CD2   1 
ATOM   3733  N  NE1   . TRP C 2  70   ? -31.807 7.246   37.634  1.00 43.13  ? 70   TRP C NE1   1 
ATOM   3734  C  CE2   . TRP C 2  70   ? -31.656 7.896   38.829  1.00 42.64  ? 70   TRP C CE2   1 
ATOM   3735  C  CE3   . TRP C 2  70   ? -31.391 10.164  39.615  1.00 54.96  ? 70   TRP C CE3   1 
ATOM   3736  C  CZ2   . TRP C 2  70   ? -31.603 7.391   40.123  1.00 46.02  ? 70   TRP C CZ2   1 
ATOM   3737  C  CZ3   . TRP C 2  70   ? -31.339 9.661   40.899  1.00 59.17  ? 70   TRP C CZ3   1 
ATOM   3738  C  CH2   . TRP C 2  70   ? -31.445 8.288   41.142  1.00 54.76  ? 70   TRP C CH2   1 
ATOM   3739  N  N     . ARG C 2  71   ? -34.143 11.790  37.833  1.00 72.79  ? 71   ARG C N     1 
ATOM   3740  C  CA    . ARG C 2  71   ? -35.104 11.585  38.910  1.00 78.64  ? 71   ARG C CA    1 
ATOM   3741  C  C     . ARG C 2  71   ? -36.530 11.675  38.372  1.00 86.06  ? 71   ARG C C     1 
ATOM   3742  O  O     . ARG C 2  71   ? -37.435 10.998  38.867  1.00 82.57  ? 71   ARG C O     1 
ATOM   3743  C  CB    . ARG C 2  71   ? -34.883 12.596  40.032  1.00 76.03  ? 71   ARG C CB    1 
ATOM   3744  C  CG    . ARG C 2  71   ? -35.130 12.018  41.414  1.00 77.81  ? 71   ARG C CG    1 
ATOM   3745  C  CD    . ARG C 2  71   ? -34.728 12.999  42.495  1.00 83.51  ? 71   ARG C CD    1 
ATOM   3746  N  NE    . ARG C 2  71   ? -33.325 13.385  42.380  1.00 83.67  ? 71   ARG C NE    1 
ATOM   3747  C  CZ    . ARG C 2  71   ? -32.329 12.779  43.017  1.00 72.34  ? 71   ARG C CZ    1 
ATOM   3748  N  NH1   . ARG C 2  71   ? -32.580 11.754  43.821  1.00 58.44  ? 71   ARG C NH1   1 
ATOM   3749  N  NH2   . ARG C 2  71   ? -31.082 13.201  42.853  1.00 68.72  ? 71   ARG C NH2   1 
ATOM   3750  N  N     . GLU C 2  72   ? -36.712 12.513  37.352  1.00 87.29  ? 72   GLU C N     1 
ATOM   3751  C  CA    . GLU C 2  72   ? -37.971 12.600  36.617  1.00 83.81  ? 72   GLU C CA    1 
ATOM   3752  C  C     . GLU C 2  72   ? -38.187 11.331  35.803  1.00 86.27  ? 72   GLU C C     1 
ATOM   3753  O  O     . GLU C 2  72   ? -39.305 10.829  35.703  1.00 95.52  ? 72   GLU C O     1 
ATOM   3754  C  CB    . GLU C 2  72   ? -37.987 13.820  35.691  1.00 79.48  ? 72   GLU C CB    1 
ATOM   3755  C  CG    . GLU C 2  72   ? -37.910 15.167  36.397  1.00 86.38  ? 72   GLU C CG    1 
ATOM   3756  C  CD    . GLU C 2  72   ? -38.020 16.335  35.430  1.00 87.09  ? 72   GLU C CD    1 
ATOM   3757  O  OE1   . GLU C 2  72   ? -38.497 16.121  34.296  1.00 94.77  ? 72   GLU C OE1   1 
ATOM   3758  O  OE2   . GLU C 2  72   ? -37.626 17.463  35.799  1.00 82.34  ? 72   GLU C OE2   1 
ATOM   3759  N  N     . SER C 2  73   ? -37.105 10.829  35.215  1.00 83.90  ? 73   SER C N     1 
ATOM   3760  C  CA    . SER C 2  73   ? -37.129 9.570   34.476  1.00 88.76  ? 73   SER C CA    1 
ATOM   3761  C  C     . SER C 2  73   ? -37.343 8.401   35.439  1.00 90.24  ? 73   SER C C     1 
ATOM   3762  O  O     . SER C 2  73   ? -37.883 7.361   35.063  1.00 89.31  ? 73   SER C O     1 
ATOM   3763  C  CB    . SER C 2  73   ? -35.830 9.386   33.682  1.00 90.21  ? 73   SER C CB    1 
ATOM   3764  O  OG    . SER C 2  73   ? -35.961 8.386   32.683  1.00 90.30  ? 73   SER C OG    1 
ATOM   3765  N  N     . ALA C 2  74   ? -36.914 8.585   36.685  1.00 85.52  ? 74   ALA C N     1 
ATOM   3766  C  CA    . ALA C 2  74   ? -37.154 7.604   37.737  1.00 85.21  ? 74   ALA C CA    1 
ATOM   3767  C  C     . ALA C 2  74   ? -38.609 7.665   38.170  1.00 93.58  ? 74   ALA C C     1 
ATOM   3768  O  O     . ALA C 2  74   ? -39.211 6.654   38.525  1.00 97.96  ? 74   ALA C O     1 
ATOM   3769  C  CB    . ALA C 2  74   ? -36.240 7.854   38.917  1.00 76.08  ? 74   ALA C CB    1 
ATOM   3770  N  N     . ALA C 2  75   ? -39.166 8.870   38.137  1.00 95.32  ? 75   ALA C N     1 
ATOM   3771  C  CA    . ALA C 2  75   ? -40.566 9.083   38.475  1.00 100.89 ? 75   ALA C CA    1 
ATOM   3772  C  C     . ALA C 2  75   ? -41.487 8.529   37.391  1.00 103.83 ? 75   ALA C C     1 
ATOM   3773  O  O     . ALA C 2  75   ? -42.437 7.802   37.687  1.00 100.11 ? 75   ALA C O     1 
ATOM   3774  C  CB    . ALA C 2  75   ? -40.834 10.566  38.696  1.00 99.39  ? 75   ALA C CB    1 
ATOM   3775  N  N     . GLU C 2  76   ? -41.199 8.875   36.137  1.00 109.78 ? 76   GLU C N     1 
ATOM   3776  C  CA    . GLU C 2  76   ? -42.018 8.446   35.003  1.00 113.32 ? 76   GLU C CA    1 
ATOM   3777  C  C     . GLU C 2  76   ? -41.987 6.928   34.815  1.00 110.62 ? 76   GLU C C     1 
ATOM   3778  O  O     . GLU C 2  76   ? -43.006 6.322   34.483  1.00 119.06 ? 76   GLU C O     1 
ATOM   3779  C  CB    . GLU C 2  76   ? -41.570 9.146   33.710  1.00 121.80 ? 76   GLU C CB    1 
ATOM   3780  C  CG    . GLU C 2  76   ? -42.023 10.606  33.580  1.00 121.54 ? 76   GLU C CG    1 
ATOM   3781  C  CD    . GLU C 2  76   ? -41.776 11.185  32.191  1.00 127.60 ? 76   GLU C CD    1 
ATOM   3782  O  OE1   . GLU C 2  76   ? -41.967 12.408  32.009  1.00 128.83 ? 76   GLU C OE1   1 
ATOM   3783  O  OE2   . GLU C 2  76   ? -41.397 10.420  31.279  1.00 136.22 ? 76   GLU C OE2   1 
ATOM   3784  N  N     . ARG C 2  77   ? -40.825 6.313   35.026  1.00 106.79 ? 77   ARG C N     1 
ATOM   3785  C  CA    . ARG C 2  77   ? -40.724 4.855   34.970  1.00 111.92 ? 77   ARG C CA    1 
ATOM   3786  C  C     . ARG C 2  77   ? -41.372 4.240   36.212  1.00 108.47 ? 77   ARG C C     1 
ATOM   3787  O  O     . ARG C 2  77   ? -41.648 3.041   36.254  1.00 106.52 ? 77   ARG C O     1 
ATOM   3788  C  CB    . ARG C 2  77   ? -39.260 4.400   34.846  1.00 106.12 ? 77   ARG C CB    1 
ATOM   3789  C  CG    . ARG C 2  77   ? -38.601 4.660   33.486  1.00 103.03 ? 77   ARG C CG    1 
ATOM   3790  C  CD    . ARG C 2  77   ? -37.217 3.994   33.397  1.00 102.98 ? 77   ARG C CD    1 
ATOM   3791  N  NE    . ARG C 2  77   ? -36.491 4.342   32.173  1.00 106.62 ? 77   ARG C NE    1 
ATOM   3792  C  CZ    . ARG C 2  77   ? -35.257 3.930   31.881  1.00 93.82  ? 77   ARG C CZ    1 
ATOM   3793  N  NH1   . ARG C 2  77   ? -34.682 4.303   30.744  1.00 91.02  ? 77   ARG C NH1   1 
ATOM   3794  N  NH2   . ARG C 2  77   ? -34.594 3.146   32.722  1.00 79.42  ? 77   ARG C NH2   1 
ATOM   3795  N  N     . GLY C 2  78   ? -41.618 5.072   37.220  1.00 102.88 ? 78   GLY C N     1 
ATOM   3796  C  CA    . GLY C 2  78   ? -42.236 4.618   38.450  1.00 101.88 ? 78   GLY C CA    1 
ATOM   3797  C  C     . GLY C 2  78   ? -41.242 3.975   39.398  1.00 106.94 ? 78   GLY C C     1 
ATOM   3798  O  O     . GLY C 2  78   ? -41.606 3.109   40.196  1.00 105.93 ? 78   GLY C O     1 
ATOM   3799  N  N     . ASP C 2  79   ? -39.982 4.394   39.307  1.00 109.99 ? 79   ASP C N     1 
ATOM   3800  C  CA    . ASP C 2  79   ? -38.943 3.882   40.196  1.00 108.68 ? 79   ASP C CA    1 
ATOM   3801  C  C     . ASP C 2  79   ? -39.174 4.379   41.621  1.00 102.26 ? 79   ASP C C     1 
ATOM   3802  O  O     . ASP C 2  79   ? -39.050 5.572   41.903  1.00 100.85 ? 79   ASP C O     1 
ATOM   3803  C  CB    . ASP C 2  79   ? -37.544 4.293   39.709  1.00 102.44 ? 79   ASP C CB    1 
ATOM   3804  C  CG    . ASP C 2  79   ? -37.141 3.599   38.412  1.00 99.75  ? 79   ASP C CG    1 
ATOM   3805  O  OD1   . ASP C 2  79   ? -35.937 3.311   38.234  1.00 85.55  ? 79   ASP C OD1   1 
ATOM   3806  O  OD2   . ASP C 2  79   ? -38.025 3.345   37.569  1.00 104.86 ? 79   ASP C OD2   1 
ATOM   3807  N  N     . VAL C 2  80   ? -39.517 3.458   42.514  1.00 93.04  ? 80   VAL C N     1 
ATOM   3808  C  CA    . VAL C 2  80   ? -39.751 3.803   43.909  1.00 96.84  ? 80   VAL C CA    1 
ATOM   3809  C  C     . VAL C 2  80   ? -38.429 4.079   44.636  1.00 107.14 ? 80   VAL C C     1 
ATOM   3810  O  O     . VAL C 2  80   ? -37.559 3.209   44.712  1.00 109.35 ? 80   VAL C O     1 
ATOM   3811  C  CB    . VAL C 2  80   ? -40.531 2.686   44.631  1.00 90.67  ? 80   VAL C CB    1 
ATOM   3812  C  CG1   . VAL C 2  80   ? -39.999 1.310   44.234  1.00 86.61  ? 80   VAL C CG1   1 
ATOM   3813  C  CG2   . VAL C 2  80   ? -40.492 2.890   46.140  1.00 94.95  ? 80   VAL C CG2   1 
ATOM   3814  N  N     . ASN C 2  81   ? -38.289 5.300   45.153  1.00 108.98 ? 81   ASN C N     1 
ATOM   3815  C  CA    . ASN C 2  81   ? -37.083 5.740   45.865  1.00 102.23 ? 81   ASN C CA    1 
ATOM   3816  C  C     . ASN C 2  81   ? -35.795 5.551   45.064  1.00 97.24  ? 81   ASN C C     1 
ATOM   3817  O  O     . ASN C 2  81   ? -35.074 4.568   45.252  1.00 91.85  ? 81   ASN C O     1 
ATOM   3818  C  CB    . ASN C 2  81   ? -36.964 5.017   47.209  1.00 103.88 ? 81   ASN C CB    1 
ATOM   3819  C  CG    . ASN C 2  81   ? -37.797 5.666   48.295  1.00 102.13 ? 81   ASN C CG    1 
ATOM   3820  O  OD1   . ASN C 2  81   ? -37.795 6.889   48.448  1.00 94.01  ? 81   ASN C OD1   1 
ATOM   3821  N  ND2   . ASN C 2  81   ? -38.519 4.850   49.054  1.00 102.65 ? 81   ASN C ND2   1 
ATOM   3822  N  N     . PRO C 2  82   ? -35.501 6.505   44.168  1.00 94.37  ? 82   PRO C N     1 
ATOM   3823  C  CA    . PRO C 2  82   ? -34.309 6.466   43.317  1.00 83.80  ? 82   PRO C CA    1 
ATOM   3824  C  C     . PRO C 2  82   ? -33.055 6.978   44.020  1.00 72.38  ? 82   PRO C C     1 
ATOM   3825  O  O     . PRO C 2  82   ? -33.067 8.065   44.603  1.00 67.15  ? 82   PRO C O     1 
ATOM   3826  C  CB    . PRO C 2  82   ? -34.689 7.383   42.155  1.00 88.57  ? 82   PRO C CB    1 
ATOM   3827  C  CG    . PRO C 2  82   ? -35.608 8.382   42.765  1.00 87.70  ? 82   PRO C CG    1 
ATOM   3828  C  CD    . PRO C 2  82   ? -36.372 7.650   43.844  1.00 95.32  ? 82   PRO C CD    1 
ATOM   3829  N  N     . VAL C 2  83   ? -31.986 6.192   43.954  1.00 64.90  ? 83   VAL C N     1 
ATOM   3830  C  CA    . VAL C 2  83   ? -30.699 6.580   44.514  1.00 61.07  ? 83   VAL C CA    1 
ATOM   3831  C  C     . VAL C 2  83   ? -29.666 6.712   43.399  1.00 57.57  ? 83   VAL C C     1 
ATOM   3832  O  O     . VAL C 2  83   ? -29.510 5.806   42.583  1.00 59.25  ? 83   VAL C O     1 
ATOM   3833  C  CB    . VAL C 2  83   ? -30.210 5.558   45.558  1.00 63.78  ? 83   VAL C CB    1 
ATOM   3834  C  CG1   . VAL C 2  83   ? -28.821 5.919   46.059  1.00 60.55  ? 83   VAL C CG1   1 
ATOM   3835  C  CG2   . VAL C 2  83   ? -31.197 5.471   46.713  1.00 72.01  ? 83   VAL C CG2   1 
ATOM   3836  N  N     . GLY C 2  84   ? -28.974 7.846   43.356  1.00 53.27  ? 84   GLY C N     1 
ATOM   3837  C  CA    . GLY C 2  84   ? -27.973 8.081   42.332  1.00 49.64  ? 84   GLY C CA    1 
ATOM   3838  C  C     . GLY C 2  84   ? -26.806 7.123   42.463  1.00 47.88  ? 84   GLY C C     1 
ATOM   3839  O  O     . GLY C 2  84   ? -26.649 6.465   43.492  1.00 52.40  ? 84   GLY C O     1 
ATOM   3840  N  N     . GLY C 2  85   ? -25.991 7.036   41.419  1.00 41.58  ? 85   GLY C N     1 
ATOM   3841  C  CA    . GLY C 2  85   ? -24.816 6.189   41.453  1.00 41.17  ? 85   GLY C CA    1 
ATOM   3842  C  C     . GLY C 2  85   ? -23.848 6.657   42.523  1.00 42.70  ? 85   GLY C C     1 
ATOM   3843  O  O     . GLY C 2  85   ? -23.252 5.847   43.233  1.00 42.79  ? 85   GLY C O     1 
ATOM   3844  N  N     . LEU C 2  86   ? -23.703 7.973   42.644  1.00 39.93  ? 86   LEU C N     1 
ATOM   3845  C  CA    . LEU C 2  86   ? -22.820 8.553   43.647  1.00 40.58  ? 86   LEU C CA    1 
ATOM   3846  C  C     . LEU C 2  86   ? -23.417 8.459   45.047  1.00 47.95  ? 86   LEU C C     1 
ATOM   3847  O  O     . LEU C 2  86   ? -22.718 8.107   45.999  1.00 52.49  ? 86   LEU C O     1 
ATOM   3848  C  CB    . LEU C 2  86   ? -22.503 10.009  43.308  1.00 38.06  ? 86   LEU C CB    1 
ATOM   3849  C  CG    . LEU C 2  86   ? -21.489 10.227  42.184  1.00 33.30  ? 86   LEU C CG    1 
ATOM   3850  C  CD1   . LEU C 2  86   ? -21.111 11.693  42.067  1.00 37.69  ? 86   LEU C CD1   1 
ATOM   3851  C  CD2   . LEU C 2  86   ? -20.256 9.386   42.420  1.00 34.65  ? 86   LEU C CD2   1 
ATOM   3852  N  N     . GLU C 2  87   ? -24.704 8.775   45.170  1.00 50.25  ? 87   GLU C N     1 
ATOM   3853  C  CA    . GLU C 2  87   ? -25.401 8.668   46.450  1.00 54.03  ? 87   GLU C CA    1 
ATOM   3854  C  C     . GLU C 2  87   ? -25.254 7.269   47.025  1.00 55.70  ? 87   GLU C C     1 
ATOM   3855  O  O     . GLU C 2  87   ? -25.060 7.094   48.228  1.00 60.63  ? 87   GLU C O     1 
ATOM   3856  C  CB    . GLU C 2  87   ? -26.887 9.002   46.298  1.00 57.08  ? 87   GLU C CB    1 
ATOM   3857  C  CG    . GLU C 2  87   ? -27.189 10.415  45.825  1.00 65.68  ? 87   GLU C CG    1 
ATOM   3858  C  CD    . GLU C 2  87   ? -28.682 10.670  45.689  1.00 71.36  ? 87   GLU C CD    1 
ATOM   3859  O  OE1   . GLU C 2  87   ? -29.457 9.688   45.706  1.00 68.71  ? 87   GLU C OE1   1 
ATOM   3860  O  OE2   . GLU C 2  87   ? -29.080 11.849  45.571  1.00 75.05  ? 87   GLU C OE2   1 
ATOM   3861  N  N     . GLU C 2  88   ? -25.348 6.280   46.142  1.00 55.65  ? 88   GLU C N     1 
ATOM   3862  C  CA    . GLU C 2  88   ? -25.244 4.876   46.515  1.00 58.88  ? 88   GLU C CA    1 
ATOM   3863  C  C     . GLU C 2  88   ? -23.899 4.560   47.154  1.00 62.11  ? 88   GLU C C     1 
ATOM   3864  O  O     . GLU C 2  88   ? -23.835 3.942   48.219  1.00 65.86  ? 88   GLU C O     1 
ATOM   3865  C  CB    . GLU C 2  88   ? -25.455 3.987   45.290  1.00 57.52  ? 88   GLU C CB    1 
ATOM   3866  C  CG    . GLU C 2  88   ? -24.993 2.556   45.472  1.00 64.71  ? 88   GLU C CG    1 
ATOM   3867  C  CD    . GLU C 2  88   ? -25.070 1.764   44.186  1.00 63.80  ? 88   GLU C CD    1 
ATOM   3868  O  OE1   . GLU C 2  88   ? -25.729 2.240   43.237  1.00 59.97  ? 88   GLU C OE1   1 
ATOM   3869  O  OE2   . GLU C 2  88   ? -24.462 0.674   44.123  1.00 63.70  ? 88   GLU C OE2   1 
ATOM   3870  N  N     . VAL C 2  89   ? -22.828 4.992   46.496  1.00 55.80  ? 89   VAL C N     1 
ATOM   3871  C  CA    . VAL C 2  89   ? -21.479 4.740   46.974  1.00 55.99  ? 89   VAL C CA    1 
ATOM   3872  C  C     . VAL C 2  89   ? -21.287 5.286   48.388  1.00 58.26  ? 89   VAL C C     1 
ATOM   3873  O  O     . VAL C 2  89   ? -20.597 4.680   49.206  1.00 63.78  ? 89   VAL C O     1 
ATOM   3874  C  CB    . VAL C 2  89   ? -20.440 5.346   46.013  1.00 49.89  ? 89   VAL C CB    1 
ATOM   3875  C  CG1   . VAL C 2  89   ? -19.042 5.288   46.607  1.00 51.57  ? 89   VAL C CG1   1 
ATOM   3876  C  CG2   . VAL C 2  89   ? -20.486 4.613   44.683  1.00 46.64  ? 89   VAL C CG2   1 
ATOM   3877  N  N     . LEU C 2  90   ? -21.937 6.401   48.695  1.00 54.44  ? 90   LEU C N     1 
ATOM   3878  C  CA    . LEU C 2  90   ? -21.802 6.995   50.018  1.00 58.90  ? 90   LEU C CA    1 
ATOM   3879  C  C     . LEU C 2  90   ? -22.609 6.276   51.098  1.00 67.61  ? 90   LEU C C     1 
ATOM   3880  O  O     . LEU C 2  90   ? -22.266 6.353   52.274  1.00 71.61  ? 90   LEU C O     1 
ATOM   3881  C  CB    . LEU C 2  90   ? -22.202 8.465   49.976  1.00 59.08  ? 90   LEU C CB    1 
ATOM   3882  C  CG    . LEU C 2  90   ? -21.395 9.262   48.954  1.00 56.83  ? 90   LEU C CG    1 
ATOM   3883  C  CD1   . LEU C 2  90   ? -21.669 10.754  49.095  1.00 65.05  ? 90   LEU C CD1   1 
ATOM   3884  C  CD2   . LEU C 2  90   ? -19.906 8.957   49.080  1.00 50.45  ? 90   LEU C CD2   1 
ATOM   3885  N  N     . TYR C 2  91   ? -23.674 5.579   50.711  1.00 70.85  ? 91   TYR C N     1 
ATOM   3886  C  CA    . TYR C 2  91   ? -24.502 4.879   51.695  1.00 77.26  ? 91   TYR C CA    1 
ATOM   3887  C  C     . TYR C 2  91   ? -23.902 3.526   52.089  1.00 80.10  ? 91   TYR C C     1 
ATOM   3888  O  O     . TYR C 2  91   ? -23.969 3.132   53.257  1.00 84.43  ? 91   TYR C O     1 
ATOM   3889  C  CB    . TYR C 2  91   ? -25.929 4.684   51.174  1.00 76.31  ? 91   TYR C CB    1 
ATOM   3890  C  CG    . TYR C 2  91   ? -26.793 5.931   51.222  1.00 88.37  ? 91   TYR C CG    1 
ATOM   3891  C  CD1   . TYR C 2  91   ? -26.266 7.159   51.612  1.00 87.01  ? 91   TYR C CD1   1 
ATOM   3892  C  CD2   . TYR C 2  91   ? -28.141 5.874   50.887  1.00 92.61  ? 91   TYR C CD2   1 
ATOM   3893  C  CE1   . TYR C 2  91   ? -27.058 8.296   51.656  1.00 92.31  ? 91   TYR C CE1   1 
ATOM   3894  C  CE2   . TYR C 2  91   ? -28.940 7.004   50.930  1.00 93.23  ? 91   TYR C CE2   1 
ATOM   3895  C  CZ    . TYR C 2  91   ? -28.394 8.210   51.314  1.00 98.37  ? 91   TYR C CZ    1 
ATOM   3896  O  OH    . TYR C 2  91   ? -29.190 9.333   51.356  1.00 101.00 ? 91   TYR C OH    1 
ATOM   3897  N  N     . GLU C 2  92   ? -23.331 2.816   51.114  1.00 75.83  ? 92   GLU C N     1 
ATOM   3898  C  CA    . GLU C 2  92   ? -22.609 1.568   51.374  1.00 75.19  ? 92   GLU C CA    1 
ATOM   3899  C  C     . GLU C 2  92   ? -21.472 1.842   52.338  1.00 70.93  ? 92   GLU C C     1 
ATOM   3900  O  O     . GLU C 2  92   ? -21.320 1.182   53.370  1.00 65.69  ? 92   GLU C O     1 
ATOM   3901  C  CB    . GLU C 2  92   ? -22.051 0.968   50.078  1.00 74.07  ? 92   GLU C CB    1 
ATOM   3902  C  CG    . GLU C 2  92   ? -23.088 0.693   49.000  1.00 78.95  ? 92   GLU C CG    1 
ATOM   3903  C  CD    . GLU C 2  92   ? -22.488 0.069   47.747  1.00 76.13  ? 92   GLU C CD    1 
ATOM   3904  O  OE1   . GLU C 2  92   ? -21.261 -0.176  47.726  1.00 75.00  ? 92   GLU C OE1   1 
ATOM   3905  O  OE2   . GLU C 2  92   ? -23.249 -0.177  46.784  1.00 67.22  ? 92   GLU C OE2   1 
ATOM   3906  N  N     . LEU C 2  93   ? -20.679 2.837   51.962  1.00 65.71  ? 93   LEU C N     1 
ATOM   3907  C  CA    . LEU C 2  93   ? -19.562 3.320   52.748  1.00 65.02  ? 93   LEU C CA    1 
ATOM   3908  C  C     . LEU C 2  93   ? -19.985 3.679   54.168  1.00 70.59  ? 93   LEU C C     1 
ATOM   3909  O  O     . LEU C 2  93   ? -19.556 3.041   55.129  1.00 76.16  ? 93   LEU C O     1 
ATOM   3910  C  CB    . LEU C 2  93   ? -18.944 4.534   52.058  1.00 56.83  ? 93   LEU C CB    1 
ATOM   3911  C  CG    . LEU C 2  93   ? -17.631 5.079   52.599  1.00 54.11  ? 93   LEU C CG    1 
ATOM   3912  C  CD1   . LEU C 2  93   ? -16.527 4.067   52.387  1.00 59.32  ? 93   LEU C CD1   1 
ATOM   3913  C  CD2   . LEU C 2  93   ? -17.304 6.378   51.903  1.00 53.50  ? 93   LEU C CD2   1 
ATOM   3914  N  N     . SER C 2  94   ? -20.838 4.693   54.292  1.00 71.26  ? 94   SER C N     1 
ATOM   3915  C  CA    . SER C 2  94   ? -21.243 5.199   55.601  1.00 77.68  ? 94   SER C CA    1 
ATOM   3916  C  C     . SER C 2  94   ? -21.945 4.144   56.457  1.00 81.47  ? 94   SER C C     1 
ATOM   3917  O  O     . SER C 2  94   ? -22.689 3.305   55.941  1.00 75.11  ? 94   SER C O     1 
ATOM   3918  C  CB    . SER C 2  94   ? -22.149 6.423   55.442  1.00 77.19  ? 94   SER C CB    1 
ATOM   3919  O  OG    . SER C 2  94   ? -21.396 7.563   55.071  1.00 70.98  ? 94   SER C OG    1 
ATOM   3920  N  N     . PRO C 2  95   ? -21.684 4.176   57.775  1.00 89.25  ? 95   PRO C N     1 
ATOM   3921  C  CA    . PRO C 2  95   ? -20.680 5.080   58.347  1.00 85.75  ? 95   PRO C CA    1 
ATOM   3922  C  C     . PRO C 2  95   ? -19.329 4.398   58.570  1.00 86.60  ? 95   PRO C C     1 
ATOM   3923  O  O     . PRO C 2  95   ? -19.261 3.175   58.709  1.00 83.04  ? 95   PRO C O     1 
ATOM   3924  C  CB    . PRO C 2  95   ? -21.312 5.488   59.676  1.00 86.19  ? 95   PRO C CB    1 
ATOM   3925  C  CG    . PRO C 2  95   ? -22.059 4.260   60.096  1.00 93.11  ? 95   PRO C CG    1 
ATOM   3926  C  CD    . PRO C 2  95   ? -22.523 3.566   58.823  1.00 91.56  ? 95   PRO C CD    1 
ATOM   3927  N  N     . ILE C 2  96   ? -18.263 5.193   58.596  1.00 87.16  ? 96   ILE C N     1 
ATOM   3928  C  CA    . ILE C 2  96   ? -16.933 4.675   58.887  1.00 86.60  ? 96   ILE C CA    1 
ATOM   3929  C  C     . ILE C 2  96   ? -16.622 4.794   60.374  1.00 97.72  ? 96   ILE C C     1 
ATOM   3930  O  O     . ILE C 2  96   ? -16.335 5.885   60.874  1.00 93.30  ? 96   ILE C O     1 
ATOM   3931  C  CB    . ILE C 2  96   ? -15.843 5.414   58.099  1.00 82.98  ? 96   ILE C CB    1 
ATOM   3932  C  CG1   . ILE C 2  96   ? -16.216 5.515   56.624  1.00 81.40  ? 96   ILE C CG1   1 
ATOM   3933  C  CG2   . ILE C 2  96   ? -14.501 4.716   58.262  1.00 87.02  ? 96   ILE C CG2   1 
ATOM   3934  C  CD1   . ILE C 2  96   ? -15.163 6.217   55.794  1.00 79.65  ? 96   ILE C CD1   1 
ATOM   3935  N  N     . GLU C 2  97   ? -16.678 3.665   61.072  1.00 104.77 ? 97   GLU C N     1 
ATOM   3936  C  CA    . GLU C 2  97   ? -16.373 3.617   62.496  1.00 100.68 ? 97   GLU C CA    1 
ATOM   3937  C  C     . GLU C 2  97   ? -15.162 2.736   62.760  1.00 99.62  ? 97   GLU C C     1 
ATOM   3938  O  O     . GLU C 2  97   ? -14.930 1.762   62.045  1.00 103.58 ? 97   GLU C O     1 
ATOM   3939  C  CB    . GLU C 2  97   ? -17.576 3.100   63.281  1.00 97.10  ? 97   GLU C CB    1 
ATOM   3940  C  CG    . GLU C 2  97   ? -18.860 3.847   62.995  1.00 101.00 ? 97   GLU C CG    1 
ATOM   3941  C  CD    . GLU C 2  97   ? -20.039 3.280   63.756  1.00 111.94 ? 97   GLU C CD    1 
ATOM   3942  O  OE1   . GLU C 2  97   ? -19.905 2.170   64.317  1.00 108.66 ? 97   GLU C OE1   1 
ATOM   3943  O  OE2   . GLU C 2  97   ? -21.094 3.947   63.796  1.00 118.82 ? 97   GLU C OE2   1 
ATOM   3944  N  N     . ASP C 2  98   ? -14.389 3.075   63.786  1.00 97.57  ? 98   ASP C N     1 
ATOM   3945  C  CA    . ASP C 2  98   ? -13.259 2.241   64.179  1.00 102.92 ? 98   ASP C CA    1 
ATOM   3946  C  C     . ASP C 2  98   ? -13.754 1.041   64.985  1.00 105.56 ? 98   ASP C C     1 
ATOM   3947  O  O     . ASP C 2  98   ? -14.957 0.889   65.203  1.00 107.34 ? 98   ASP C O     1 
ATOM   3948  C  CB    . ASP C 2  98   ? -12.234 3.051   64.978  1.00 107.48 ? 98   ASP C CB    1 
ATOM   3949  C  CG    . ASP C 2  98   ? -12.811 3.634   66.256  1.00 110.60 ? 98   ASP C CG    1 
ATOM   3950  O  OD1   . ASP C 2  98   ? -14.015 3.968   66.270  1.00 108.99 ? 98   ASP C OD1   1 
ATOM   3951  O  OD2   . ASP C 2  98   ? -12.058 3.762   67.245  1.00 107.62 ? 98   ASP C OD2   1 
ATOM   3952  N  N     . PHE C 2  99   ? -12.828 0.191   65.419  1.00 101.51 ? 99   PHE C N     1 
ATOM   3953  C  CA    . PHE C 2  99   ? -13.170 -1.008  66.182  1.00 98.36  ? 99   PHE C CA    1 
ATOM   3954  C  C     . PHE C 2  99   ? -13.877 -0.654  67.487  1.00 99.54  ? 99   PHE C C     1 
ATOM   3955  O  O     . PHE C 2  99   ? -14.759 -1.380  67.947  1.00 92.02  ? 99   PHE C O     1 
ATOM   3956  C  CB    . PHE C 2  99   ? -11.910 -1.831  66.467  1.00 102.16 ? 99   PHE C CB    1 
ATOM   3957  C  CG    . PHE C 2  99   ? -12.175 -3.136  67.171  1.00 117.57 ? 99   PHE C CG    1 
ATOM   3958  C  CD1   . PHE C 2  99   ? -12.846 -4.165  66.528  1.00 123.90 ? 99   PHE C CD1   1 
ATOM   3959  C  CD2   . PHE C 2  99   ? -11.734 -3.341  68.470  1.00 120.24 ? 99   PHE C CD2   1 
ATOM   3960  C  CE1   . PHE C 2  99   ? -13.084 -5.370  67.172  1.00 120.98 ? 99   PHE C CE1   1 
ATOM   3961  C  CE2   . PHE C 2  99   ? -11.968 -4.544  69.119  1.00 112.47 ? 99   PHE C CE2   1 
ATOM   3962  C  CZ    . PHE C 2  99   ? -12.643 -5.559  68.469  1.00 112.53 ? 99   PHE C CZ    1 
ATOM   3963  N  N     . SER C 2  100  ? -13.487 0.474   68.071  1.00 105.23 ? 100  SER C N     1 
ATOM   3964  C  CA    . SER C 2  100  ? -14.066 0.940   69.325  1.00 104.65 ? 100  SER C CA    1 
ATOM   3965  C  C     . SER C 2  100  ? -15.549 1.266   69.175  1.00 103.42 ? 100  SER C C     1 
ATOM   3966  O  O     . SER C 2  100  ? -16.367 0.885   70.012  1.00 99.61  ? 100  SER C O     1 
ATOM   3967  C  CB    . SER C 2  100  ? -13.317 2.176   69.833  1.00 102.34 ? 100  SER C CB    1 
ATOM   3968  O  OG    . SER C 2  100  ? -11.913 1.984   69.801  1.00 93.46  ? 100  SER C OG    1 
ATOM   3969  N  N     . GLY C 2  101  ? -15.885 1.970   68.100  1.00 107.98 ? 101  GLY C N     1 
ATOM   3970  C  CA    . GLY C 2  101  ? -17.223 2.500   67.919  1.00 108.02 ? 101  GLY C CA    1 
ATOM   3971  C  C     . GLY C 2  101  ? -17.265 3.928   68.427  1.00 108.21 ? 101  GLY C C     1 
ATOM   3972  O  O     . GLY C 2  101  ? -18.298 4.595   68.374  1.00 105.90 ? 101  GLY C O     1 
ATOM   3973  N  N     . SER C 2  102  ? -16.121 4.390   68.924  1.00 104.64 ? 102  SER C N     1 
ATOM   3974  C  CA    . SER C 2  102  ? -15.987 5.737   69.464  1.00 103.44 ? 102  SER C CA    1 
ATOM   3975  C  C     . SER C 2  102  ? -16.202 6.796   68.396  1.00 105.26 ? 102  SER C C     1 
ATOM   3976  O  O     . SER C 2  102  ? -16.977 7.733   68.584  1.00 105.48 ? 102  SER C O     1 
ATOM   3977  C  CB    . SER C 2  102  ? -14.607 5.918   70.098  1.00 102.33 ? 102  SER C CB    1 
ATOM   3978  O  OG    . SER C 2  102  ? -14.385 7.273   70.441  1.00 113.07 ? 102  SER C OG    1 
ATOM   3979  N  N     . MET C 2  103  ? -15.510 6.632   67.273  1.00 109.42 ? 103  MET C N     1 
ATOM   3980  C  CA    . MET C 2  103  ? -15.552 7.598   66.179  1.00 115.98 ? 103  MET C CA    1 
ATOM   3981  C  C     . MET C 2  103  ? -16.381 7.097   64.991  1.00 115.89 ? 103  MET C C     1 
ATOM   3982  O  O     . MET C 2  103  ? -16.472 5.894   64.748  1.00 112.41 ? 103  MET C O     1 
ATOM   3983  C  CB    . MET C 2  103  ? -14.129 7.928   65.723  1.00 107.55 ? 103  MET C CB    1 
ATOM   3984  C  CG    . MET C 2  103  ? -13.266 8.549   66.807  1.00 102.94 ? 103  MET C CG    1 
ATOM   3985  S  SD    . MET C 2  103  ? -11.520 8.536   66.373  1.00 100.56 ? 103  MET C SD    1 
ATOM   3986  C  CE    . MET C 2  103  ? -11.198 6.774   66.329  1.00 101.16 ? 103  MET C CE    1 
ATOM   3987  N  N     . SER C 2  104  ? -16.978 8.029   64.252  1.00 111.56 ? 104  SER C N     1 
ATOM   3988  C  CA    . SER C 2  104  ? -17.845 7.681   63.130  1.00 103.18 ? 104  SER C CA    1 
ATOM   3989  C  C     . SER C 2  104  ? -17.889 8.799   62.090  1.00 102.79 ? 104  SER C C     1 
ATOM   3990  O  O     . SER C 2  104  ? -18.350 9.904   62.378  1.00 105.49 ? 104  SER C O     1 
ATOM   3991  C  CB    . SER C 2  104  ? -19.261 7.372   63.632  1.00 102.89 ? 104  SER C CB    1 
ATOM   3992  O  OG    . SER C 2  104  ? -20.119 6.984   62.572  1.00 96.46  ? 104  SER C OG    1 
ATOM   3993  N  N     . LEU C 2  105  ? -17.405 8.514   60.883  1.00 95.19  ? 105  LEU C N     1 
ATOM   3994  C  CA    . LEU C 2  105  ? -17.458 9.488   59.793  1.00 90.73  ? 105  LEU C CA    1 
ATOM   3995  C  C     . LEU C 2  105  ? -18.530 9.103   58.775  1.00 86.19  ? 105  LEU C C     1 
ATOM   3996  O  O     . LEU C 2  105  ? -18.653 7.936   58.399  1.00 89.10  ? 105  LEU C O     1 
ATOM   3997  C  CB    . LEU C 2  105  ? -16.090 9.613   59.113  1.00 86.11  ? 105  LEU C CB    1 
ATOM   3998  C  CG    . LEU C 2  105  ? -15.947 10.657  57.999  1.00 80.69  ? 105  LEU C CG    1 
ATOM   3999  C  CD1   . LEU C 2  105  ? -16.439 12.028  58.447  1.00 80.88  ? 105  LEU C CD1   1 
ATOM   4000  C  CD2   . LEU C 2  105  ? -14.502 10.740  57.527  1.00 80.08  ? 105  LEU C CD2   1 
ATOM   4001  N  N     . SER C 2  106  ? -19.309 10.085  58.334  1.00 75.95  ? 106  SER C N     1 
ATOM   4002  C  CA    . SER C 2  106  ? -20.410 9.813   57.417  1.00 73.62  ? 106  SER C CA    1 
ATOM   4003  C  C     . SER C 2  106  ? -20.578 10.907  56.364  1.00 72.46  ? 106  SER C C     1 
ATOM   4004  O  O     . SER C 2  106  ? -20.425 12.096  56.652  1.00 72.32  ? 106  SER C O     1 
ATOM   4005  C  CB    . SER C 2  106  ? -21.711 9.628   58.202  1.00 78.49  ? 106  SER C CB    1 
ATOM   4006  O  OG    . SER C 2  106  ? -21.761 10.499  59.319  1.00 87.08  ? 106  SER C OG    1 
ATOM   4007  N  N     . PHE C 2  107  ? -20.902 10.487  55.143  1.00 67.26  ? 107  PHE C N     1 
ATOM   4008  C  CA    . PHE C 2  107  ? -21.019 11.396  54.006  1.00 63.82  ? 107  PHE C CA    1 
ATOM   4009  C  C     . PHE C 2  107  ? -22.429 11.426  53.434  1.00 65.15  ? 107  PHE C C     1 
ATOM   4010  O  O     . PHE C 2  107  ? -23.122 10.409  53.417  1.00 67.39  ? 107  PHE C O     1 
ATOM   4011  C  CB    . PHE C 2  107  ? -20.046 10.993  52.902  1.00 60.91  ? 107  PHE C CB    1 
ATOM   4012  C  CG    . PHE C 2  107  ? -18.645 10.775  53.379  1.00 62.01  ? 107  PHE C CG    1 
ATOM   4013  C  CD1   . PHE C 2  107  ? -17.818 11.850  53.643  1.00 66.81  ? 107  PHE C CD1   1 
ATOM   4014  C  CD2   . PHE C 2  107  ? -18.149 9.496   53.551  1.00 59.78  ? 107  PHE C CD2   1 
ATOM   4015  C  CE1   . PHE C 2  107  ? -16.523 11.657  54.078  1.00 61.91  ? 107  PHE C CE1   1 
ATOM   4016  C  CE2   . PHE C 2  107  ? -16.855 9.296   53.984  1.00 60.63  ? 107  PHE C CE2   1 
ATOM   4017  C  CZ    . PHE C 2  107  ? -16.040 10.380  54.249  1.00 58.58  ? 107  PHE C CZ    1 
ATOM   4018  N  N     . SER C 2  108  ? -22.841 12.591  52.944  1.00 65.08  ? 108  SER C N     1 
ATOM   4019  C  CA    . SER C 2  108  ? -24.162 12.736  52.341  1.00 66.20  ? 108  SER C CA    1 
ATOM   4020  C  C     . SER C 2  108  ? -24.230 13.945  51.415  1.00 64.91  ? 108  SER C C     1 
ATOM   4021  O  O     . SER C 2  108  ? -23.346 14.801  51.430  1.00 66.95  ? 108  SER C O     1 
ATOM   4022  C  CB    . SER C 2  108  ? -25.239 12.852  53.424  1.00 71.81  ? 108  SER C CB    1 
ATOM   4023  O  OG    . SER C 2  108  ? -25.199 14.121  54.057  1.00 76.91  ? 108  SER C OG    1 
ATOM   4024  N  N     . ASP C 2  109  ? -25.293 13.992  50.615  1.00 61.36  ? 109  ASP C N     1 
ATOM   4025  C  CA    . ASP C 2  109  ? -25.577 15.094  49.695  1.00 67.74  ? 109  ASP C CA    1 
ATOM   4026  C  C     . ASP C 2  109  ? -24.399 15.501  48.809  1.00 69.22  ? 109  ASP C C     1 
ATOM   4027  O  O     . ASP C 2  109  ? -23.744 16.516  49.059  1.00 70.00  ? 109  ASP C O     1 
ATOM   4028  C  CB    . ASP C 2  109  ? -26.059 16.323  50.466  1.00 77.94  ? 109  ASP C CB    1 
ATOM   4029  C  CG    . ASP C 2  109  ? -26.536 17.432  49.546  1.00 82.82  ? 109  ASP C CG    1 
ATOM   4030  O  OD1   . ASP C 2  109  ? -26.163 18.604  49.769  1.00 86.32  ? 109  ASP C OD1   1 
ATOM   4031  O  OD2   . ASP C 2  109  ? -27.282 17.126  48.591  1.00 81.15  ? 109  ASP C OD2   1 
ATOM   4032  N  N     . PRO C 2  110  ? -24.131 14.713  47.761  1.00 69.94  ? 110  PRO C N     1 
ATOM   4033  C  CA    . PRO C 2  110  ? -23.101 15.095  46.787  1.00 68.12  ? 110  PRO C CA    1 
ATOM   4034  C  C     . PRO C 2  110  ? -23.628 16.148  45.811  1.00 67.12  ? 110  PRO C C     1 
ATOM   4035  O  O     . PRO C 2  110  ? -24.754 16.019  45.328  1.00 71.33  ? 110  PRO C O     1 
ATOM   4036  C  CB    . PRO C 2  110  ? -22.788 13.775  46.078  1.00 63.45  ? 110  PRO C CB    1 
ATOM   4037  C  CG    . PRO C 2  110  ? -24.059 12.986  46.179  1.00 62.23  ? 110  PRO C CG    1 
ATOM   4038  C  CD    . PRO C 2  110  ? -24.717 13.390  47.473  1.00 66.79  ? 110  PRO C CD    1 
ATOM   4039  N  N     . ARG C 2  111  ? -22.835 17.178  45.533  1.00 59.83  ? 111  ARG C N     1 
ATOM   4040  C  CA    . ARG C 2  111  ? -23.287 18.265  44.666  1.00 59.41  ? 111  ARG C CA    1 
ATOM   4041  C  C     . ARG C 2  111  ? -22.166 18.815  43.789  1.00 58.16  ? 111  ARG C C     1 
ATOM   4042  O  O     . ARG C 2  111  ? -20.993 18.727  44.146  1.00 61.81  ? 111  ARG C O     1 
ATOM   4043  C  CB    . ARG C 2  111  ? -23.893 19.387  45.509  1.00 68.47  ? 111  ARG C CB    1 
ATOM   4044  C  CG    . ARG C 2  111  ? -23.051 19.802  46.711  1.00 74.24  ? 111  ARG C CG    1 
ATOM   4045  C  CD    . ARG C 2  111  ? -23.832 20.738  47.630  1.00 86.17  ? 111  ARG C CD    1 
ATOM   4046  N  NE    . ARG C 2  111  ? -23.018 21.259  48.727  1.00 88.91  ? 111  ARG C NE    1 
ATOM   4047  C  CZ    . ARG C 2  111  ? -22.843 20.638  49.890  1.00 85.75  ? 111  ARG C CZ    1 
ATOM   4048  N  NH1   . ARG C 2  111  ? -23.420 19.465  50.112  1.00 78.35  ? 111  ARG C NH1   1 
ATOM   4049  N  NH2   . ARG C 2  111  ? -22.088 21.189  50.831  1.00 87.78  ? 111  ARG C NH2   1 
ATOM   4050  N  N     . PHE C 2  112  ? -22.528 19.386  42.643  1.00 51.32  ? 112  PHE C N     1 
ATOM   4051  C  CA    . PHE C 2  112  ? -21.528 19.876  41.697  1.00 51.25  ? 112  PHE C CA    1 
ATOM   4052  C  C     . PHE C 2  112  ? -21.561 21.389  41.526  1.00 51.07  ? 112  PHE C C     1 
ATOM   4053  O  O     . PHE C 2  112  ? -22.606 22.022  41.693  1.00 54.15  ? 112  PHE C O     1 
ATOM   4054  C  CB    . PHE C 2  112  ? -21.716 19.220  40.327  1.00 51.62  ? 112  PHE C CB    1 
ATOM   4055  C  CG    . PHE C 2  112  ? -21.356 17.760  40.291  1.00 53.25  ? 112  PHE C CG    1 
ATOM   4056  C  CD1   . PHE C 2  112  ? -20.113 17.348  39.830  1.00 48.44  ? 112  PHE C CD1   1 
ATOM   4057  C  CD2   . PHE C 2  112  ? -22.265 16.797  40.706  1.00 54.74  ? 112  PHE C CD2   1 
ATOM   4058  C  CE1   . PHE C 2  112  ? -19.783 16.003  39.788  1.00 47.15  ? 112  PHE C CE1   1 
ATOM   4059  C  CE2   . PHE C 2  112  ? -21.941 15.451  40.669  1.00 49.43  ? 112  PHE C CE2   1 
ATOM   4060  C  CZ    . PHE C 2  112  ? -20.699 15.054  40.210  1.00 46.12  ? 112  PHE C CZ    1 
ATOM   4061  N  N     . ASP C 2  113  ? -20.406 21.958  41.188  1.00 49.83  ? 113  ASP C N     1 
ATOM   4062  C  CA    . ASP C 2  113  ? -20.319 23.356  40.786  1.00 53.49  ? 113  ASP C CA    1 
ATOM   4063  C  C     . ASP C 2  113  ? -20.354 23.440  39.271  1.00 52.53  ? 113  ASP C C     1 
ATOM   4064  O  O     . ASP C 2  113  ? -20.372 22.417  38.588  1.00 51.00  ? 113  ASP C O     1 
ATOM   4065  C  CB    . ASP C 2  113  ? -19.044 24.010  41.319  1.00 58.11  ? 113  ASP C CB    1 
ATOM   4066  C  CG    . ASP C 2  113  ? -19.304 24.926  42.499  1.00 73.04  ? 113  ASP C CG    1 
ATOM   4067  O  OD1   . ASP C 2  113  ? -20.483 25.241  42.770  1.00 74.56  ? 113  ASP C OD1   1 
ATOM   4068  O  OD2   . ASP C 2  113  ? -18.321 25.344  43.149  1.00 80.58  ? 113  ASP C OD2   1 
ATOM   4069  N  N     . ASP C 2  114  ? -20.364 24.657  38.741  1.00 57.23  ? 114  ASP C N     1 
ATOM   4070  C  CA    . ASP C 2  114  ? -20.333 24.830  37.297  1.00 56.80  ? 114  ASP C CA    1 
ATOM   4071  C  C     . ASP C 2  114  ? -19.021 24.305  36.744  1.00 51.51  ? 114  ASP C C     1 
ATOM   4072  O  O     . ASP C 2  114  ? -18.027 24.192  37.465  1.00 48.52  ? 114  ASP C O     1 
ATOM   4073  C  CB    . ASP C 2  114  ? -20.526 26.296  36.911  1.00 66.24  ? 114  ASP C CB    1 
ATOM   4074  C  CG    . ASP C 2  114  ? -21.947 26.769  37.127  1.00 77.96  ? 114  ASP C CG    1 
ATOM   4075  O  OD1   . ASP C 2  114  ? -22.866 25.923  37.090  1.00 77.83  ? 114  ASP C OD1   1 
ATOM   4076  O  OD2   . ASP C 2  114  ? -22.147 27.986  37.331  1.00 86.87  ? 114  ASP C OD2   1 
ATOM   4077  N  N     . VAL C 2  115  ? -19.031 23.971  35.462  1.00 48.64  ? 115  VAL C N     1 
ATOM   4078  C  CA    . VAL C 2  115  ? -17.838 23.472  34.808  1.00 49.70  ? 115  VAL C CA    1 
ATOM   4079  C  C     . VAL C 2  115  ? -16.749 24.543  34.819  1.00 51.41  ? 115  VAL C C     1 
ATOM   4080  O  O     . VAL C 2  115  ? -17.006 25.715  34.534  1.00 49.15  ? 115  VAL C O     1 
ATOM   4081  C  CB    . VAL C 2  115  ? -18.142 23.029  33.370  1.00 47.44  ? 115  VAL C CB    1 
ATOM   4082  C  CG1   . VAL C 2  115  ? -16.933 22.331  32.762  1.00 48.92  ? 115  VAL C CG1   1 
ATOM   4083  C  CG2   . VAL C 2  115  ? -19.353 22.109  33.363  1.00 44.40  ? 115  VAL C CG2   1 
ATOM   4084  N  N     . LYS C 2  116  ? -15.537 24.129  35.172  1.00 52.69  ? 116  LYS C N     1 
ATOM   4085  C  CA    . LYS C 2  116  ? -14.403 25.038  35.291  1.00 54.63  ? 116  LYS C CA    1 
ATOM   4086  C  C     . LYS C 2  116  ? -14.011 25.673  33.948  1.00 57.32  ? 116  LYS C C     1 
ATOM   4087  O  O     . LYS C 2  116  ? -13.412 26.748  33.925  1.00 61.96  ? 116  LYS C O     1 
ATOM   4088  C  CB    . LYS C 2  116  ? -13.197 24.302  35.900  1.00 53.40  ? 116  LYS C CB    1 
ATOM   4089  C  CG    . LYS C 2  116  ? -13.446 23.683  37.283  1.00 51.49  ? 116  LYS C CG    1 
ATOM   4090  C  CD    . LYS C 2  116  ? -12.191 23.000  37.850  1.00 52.90  ? 116  LYS C CD    1 
ATOM   4091  C  CE    . LYS C 2  116  ? -11.073 23.999  38.151  1.00 56.67  ? 116  LYS C CE    1 
ATOM   4092  N  NZ    . LYS C 2  116  ? -9.882  23.363  38.795  1.00 59.20  ? 116  LYS C NZ    1 
ATOM   4093  N  N     . ALA C 2  117  ? -14.346 25.016  32.837  1.00 55.02  ? 117  ALA C N     1 
ATOM   4094  C  CA    . ALA C 2  117  ? -14.052 25.556  31.506  1.00 56.79  ? 117  ALA C CA    1 
ATOM   4095  C  C     . ALA C 2  117  ? -14.895 24.886  30.415  1.00 58.41  ? 117  ALA C C     1 
ATOM   4096  O  O     . ALA C 2  117  ? -15.127 23.677  30.468  1.00 56.96  ? 117  ALA C O     1 
ATOM   4097  C  CB    . ALA C 2  117  ? -12.564 25.406  31.188  1.00 58.25  ? 117  ALA C CB    1 
ATOM   4098  N  N     . PRO C 2  118  ? -15.353 25.673  29.419  1.00 57.32  ? 118  PRO C N     1 
ATOM   4099  C  CA    . PRO C 2  118  ? -16.206 25.196  28.317  1.00 52.86  ? 118  PRO C CA    1 
ATOM   4100  C  C     . PRO C 2  118  ? -15.577 24.065  27.511  1.00 51.87  ? 118  PRO C C     1 
ATOM   4101  O  O     . PRO C 2  118  ? -14.356 23.918  27.538  1.00 53.85  ? 118  PRO C O     1 
ATOM   4102  C  CB    . PRO C 2  118  ? -16.375 26.441  27.443  1.00 51.95  ? 118  PRO C CB    1 
ATOM   4103  C  CG    . PRO C 2  118  ? -16.189 27.575  28.371  1.00 54.51  ? 118  PRO C CG    1 
ATOM   4104  C  CD    . PRO C 2  118  ? -15.127 27.126  29.333  1.00 56.21  ? 118  PRO C CD    1 
ATOM   4105  N  N     . VAL C 2  119  ? -16.401 23.300  26.796  1.00 47.67  ? 119  VAL C N     1 
ATOM   4106  C  CA    . VAL C 2  119  ? -15.947 22.130  26.040  1.00 44.94  ? 119  VAL C CA    1 
ATOM   4107  C  C     . VAL C 2  119  ? -14.853 22.452  25.022  1.00 46.58  ? 119  VAL C C     1 
ATOM   4108  O  O     . VAL C 2  119  ? -13.817 21.782  24.974  1.00 44.97  ? 119  VAL C O     1 
ATOM   4109  C  CB    . VAL C 2  119  ? -17.123 21.467  25.290  1.00 43.97  ? 119  VAL C CB    1 
ATOM   4110  C  CG1   . VAL C 2  119  ? -16.618 20.460  24.263  1.00 44.22  ? 119  VAL C CG1   1 
ATOM   4111  C  CG2   . VAL C 2  119  ? -18.082 20.810  26.267  1.00 42.12  ? 119  VAL C CG2   1 
ATOM   4112  N  N     . ASP C 2  120  ? -15.096 23.481  24.214  1.00 49.25  ? 120  ASP C N     1 
ATOM   4113  C  CA    . ASP C 2  120  ? -14.191 23.856  23.132  1.00 49.95  ? 120  ASP C CA    1 
ATOM   4114  C  C     . ASP C 2  120  ? -12.841 24.342  23.658  1.00 50.65  ? 120  ASP C C     1 
ATOM   4115  O  O     . ASP C 2  120  ? -11.803 24.113  23.037  1.00 50.04  ? 120  ASP C O     1 
ATOM   4116  C  CB    . ASP C 2  120  ? -14.836 24.933  22.252  1.00 52.31  ? 120  ASP C CB    1 
ATOM   4117  C  CG    . ASP C 2  120  ? -15.187 26.192  23.028  1.00 63.09  ? 120  ASP C CG    1 
ATOM   4118  O  OD1   . ASP C 2  120  ? -15.482 26.081  24.238  1.00 61.15  ? 120  ASP C OD1   1 
ATOM   4119  O  OD2   . ASP C 2  120  ? -15.166 27.288  22.427  1.00 68.69  ? 120  ASP C OD2   1 
ATOM   4120  N  N     . GLU C 2  121  ? -12.859 25.009  24.805  1.00 52.52  ? 121  GLU C N     1 
ATOM   4121  C  CA    . GLU C 2  121  ? -11.632 25.519  25.397  1.00 53.50  ? 121  GLU C CA    1 
ATOM   4122  C  C     . GLU C 2  121  ? -10.799 24.359  25.920  1.00 45.57  ? 121  GLU C C     1 
ATOM   4123  O  O     . GLU C 2  121  ? -9.569  24.407  25.919  1.00 48.11  ? 121  GLU C O     1 
ATOM   4124  C  CB    . GLU C 2  121  ? -11.949 26.513  26.514  1.00 61.21  ? 121  GLU C CB    1 
ATOM   4125  C  CG    . GLU C 2  121  ? -10.737 27.230  27.078  1.00 68.89  ? 121  GLU C CG    1 
ATOM   4126  C  CD    . GLU C 2  121  ? -11.112 28.228  28.157  1.00 75.44  ? 121  GLU C CD    1 
ATOM   4127  O  OE1   . GLU C 2  121  ? -12.325 28.461  28.354  1.00 72.59  ? 121  GLU C OE1   1 
ATOM   4128  O  OE2   . GLU C 2  121  ? -10.195 28.774  28.809  1.00 81.39  ? 121  GLU C OE2   1 
ATOM   4129  N  N     . CYS C 2  122  ? -11.486 23.310  26.352  1.00 39.33  ? 122  CYS C N     1 
ATOM   4130  C  CA    . CYS C 2  122  ? -10.821 22.116  26.842  1.00 40.68  ? 122  CYS C CA    1 
ATOM   4131  C  C     . CYS C 2  122  ? -10.048 21.410  25.732  1.00 44.66  ? 122  CYS C C     1 
ATOM   4132  O  O     . CYS C 2  122  ? -8.904  21.004  25.936  1.00 47.74  ? 122  CYS C O     1 
ATOM   4133  C  CB    . CYS C 2  122  ? -11.833 21.159  27.470  1.00 43.16  ? 122  CYS C CB    1 
ATOM   4134  S  SG    . CYS C 2  122  ? -12.507 21.715  29.047  1.00 45.38  ? 122  CYS C SG    1 
ATOM   4135  N  N     . LYS C 2  123  ? -10.665 21.264  24.561  1.00 43.31  ? 123  LYS C N     1 
ATOM   4136  C  CA    . LYS C 2  123  ? -10.000 20.611  23.434  1.00 42.74  ? 123  LYS C CA    1 
ATOM   4137  C  C     . LYS C 2  123  ? -8.808  21.443  22.967  1.00 47.03  ? 123  LYS C C     1 
ATOM   4138  O  O     . LYS C 2  123  ? -7.883  20.925  22.335  1.00 47.64  ? 123  LYS C O     1 
ATOM   4139  C  CB    . LYS C 2  123  ? -10.973 20.387  22.273  1.00 41.84  ? 123  LYS C CB    1 
ATOM   4140  C  CG    . LYS C 2  123  ? -12.104 19.413  22.565  1.00 42.18  ? 123  LYS C CG    1 
ATOM   4141  C  CD    . LYS C 2  123  ? -13.041 19.280  21.370  1.00 47.82  ? 123  LYS C CD    1 
ATOM   4142  C  CE    . LYS C 2  123  ? -14.300 18.489  21.714  1.00 44.73  ? 123  LYS C CE    1 
ATOM   4143  N  NZ    . LYS C 2  123  ? -15.253 18.428  20.564  1.00 41.56  ? 123  LYS C NZ    1 
ATOM   4144  N  N     . ASP C 2  124  ? -8.843  22.735  23.291  1.00 48.12  ? 124  ASP C N     1 
ATOM   4145  C  CA    . ASP C 2  124  ? -7.808  23.679  22.887  1.00 49.65  ? 124  ASP C CA    1 
ATOM   4146  C  C     . ASP C 2  124  ? -6.608  23.654  23.831  1.00 47.90  ? 124  ASP C C     1 
ATOM   4147  O  O     . ASP C 2  124  ? -5.480  23.391  23.412  1.00 48.69  ? 124  ASP C O     1 
ATOM   4148  C  CB    . ASP C 2  124  ? -8.382  25.098  22.816  1.00 50.96  ? 124  ASP C CB    1 
ATOM   4149  C  CG    . ASP C 2  124  ? -7.378  26.111  22.291  1.00 53.33  ? 124  ASP C CG    1 
ATOM   4150  O  OD1   . ASP C 2  124  ? -7.198  26.188  21.055  1.00 54.33  ? 124  ASP C OD1   1 
ATOM   4151  O  OD2   . ASP C 2  124  ? -6.771  26.834  23.109  1.00 51.94  ? 124  ASP C OD2   1 
ATOM   4152  N  N     . LYS C 2  125  ? -6.857  23.927  25.108  1.00 45.45  ? 125  LYS C N     1 
ATOM   4153  C  CA    . LYS C 2  125  ? -5.782  24.007  26.091  1.00 44.32  ? 125  LYS C CA    1 
ATOM   4154  C  C     . LYS C 2  125  ? -5.451  22.647  26.686  1.00 41.48  ? 125  LYS C C     1 
ATOM   4155  O  O     . LYS C 2  125  ? -4.854  22.570  27.756  1.00 45.48  ? 125  LYS C O     1 
ATOM   4156  C  CB    . LYS C 2  125  ? -6.149  24.992  27.206  1.00 47.04  ? 125  LYS C CB    1 
ATOM   4157  C  CG    . LYS C 2  125  ? -6.313  26.427  26.725  1.00 52.09  ? 125  LYS C CG    1 
ATOM   4158  C  CD    . LYS C 2  125  ? -6.619  27.386  27.865  1.00 53.30  ? 125  LYS C CD    1 
ATOM   4159  C  CE    . LYS C 2  125  ? -6.767  28.811  27.348  1.00 58.20  ? 125  LYS C CE    1 
ATOM   4160  N  NZ    . LYS C 2  125  ? -7.097  29.782  28.429  1.00 56.22  ? 125  LYS C NZ    1 
ATOM   4161  N  N     . ASP C 2  126  ? -5.849  21.586  25.988  1.00 40.30  ? 126  ASP C N     1 
ATOM   4162  C  CA    . ASP C 2  126  ? -5.541  20.208  26.378  1.00 50.33  ? 126  ASP C CA    1 
ATOM   4163  C  C     . ASP C 2  126  ? -5.813  19.918  27.865  1.00 50.47  ? 126  ASP C C     1 
ATOM   4164  O  O     . ASP C 2  126  ? -5.047  19.203  28.523  1.00 51.32  ? 126  ASP C O     1 
ATOM   4165  C  CB    . ASP C 2  126  ? -4.077  19.879  26.028  1.00 52.26  ? 126  ASP C CB    1 
ATOM   4166  C  CG    . ASP C 2  126  ? -3.951  18.949  24.818  1.00 56.00  ? 126  ASP C CG    1 
ATOM   4167  O  OD1   . ASP C 2  126  ? -4.743  19.092  23.858  1.00 56.04  ? 126  ASP C OD1   1 
ATOM   4168  O  OD2   . ASP C 2  126  ? -3.064  18.067  24.833  1.00 55.77  ? 126  ASP C OD2   1 
ATOM   4169  N  N     . MET C 2  127  ? -6.906  20.472  28.387  1.00 44.15  ? 127  MET C N     1 
ATOM   4170  C  CA    . MET C 2  127  ? -7.292  20.237  29.777  1.00 40.74  ? 127  MET C CA    1 
ATOM   4171  C  C     . MET C 2  127  ? -8.521  19.337  29.858  1.00 37.71  ? 127  MET C C     1 
ATOM   4172  O  O     . MET C 2  127  ? -9.186  19.100  28.852  1.00 40.15  ? 127  MET C O     1 
ATOM   4173  C  CB    . MET C 2  127  ? -7.554  21.562  30.490  1.00 41.04  ? 127  MET C CB    1 
ATOM   4174  C  CG    . MET C 2  127  ? -8.636  22.409  29.855  1.00 41.30  ? 127  MET C CG    1 
ATOM   4175  S  SD    . MET C 2  127  ? -8.695  24.045  30.596  1.00 31.60  ? 127  MET C SD    1 
ATOM   4176  C  CE    . MET C 2  127  ? -8.655  23.610  32.335  1.00 33.44  ? 127  MET C CE    1 
ATOM   4177  N  N     . THR C 2  128  ? -8.821  18.832  31.050  1.00 35.28  ? 128  THR C N     1 
ATOM   4178  C  CA    . THR C 2  128  ? -9.933  17.899  31.204  1.00 37.16  ? 128  THR C CA    1 
ATOM   4179  C  C     . THR C 2  128  ? -11.253 18.590  31.539  1.00 36.85  ? 128  THR C C     1 
ATOM   4180  O  O     . THR C 2  128  ? -11.351 19.379  32.484  1.00 32.29  ? 128  THR C O     1 
ATOM   4181  C  CB    . THR C 2  128  ? -9.631  16.839  32.281  1.00 38.98  ? 128  THR C CB    1 
ATOM   4182  O  OG1   . THR C 2  128  ? -8.541  16.019  31.842  1.00 39.84  ? 128  THR C OG1   1 
ATOM   4183  C  CG2   . THR C 2  128  ? -10.853 15.954  32.532  1.00 37.53  ? 128  THR C CG2   1 
ATOM   4184  N  N     . TYR C 2  129  ? -12.262 18.276  30.732  1.00 41.97  ? 129  TYR C N     1 
ATOM   4185  C  CA    . TYR C 2  129  ? -13.625 18.753  30.921  1.00 42.89  ? 129  TYR C CA    1 
ATOM   4186  C  C     . TYR C 2  129  ? -14.223 18.152  32.184  1.00 40.98  ? 129  TYR C C     1 
ATOM   4187  O  O     . TYR C 2  129  ? -14.517 16.954  32.243  1.00 40.40  ? 129  TYR C O     1 
ATOM   4188  C  CB    . TYR C 2  129  ? -14.475 18.400  29.698  1.00 42.08  ? 129  TYR C CB    1 
ATOM   4189  C  CG    . TYR C 2  129  ? -15.891 18.925  29.720  1.00 42.81  ? 129  TYR C CG    1 
ATOM   4190  C  CD1   . TYR C 2  129  ? -16.149 20.289  29.670  1.00 44.10  ? 129  TYR C CD1   1 
ATOM   4191  C  CD2   . TYR C 2  129  ? -16.972 18.053  29.756  1.00 40.78  ? 129  TYR C CD2   1 
ATOM   4192  C  CE1   . TYR C 2  129  ? -17.449 20.772  29.677  1.00 46.03  ? 129  TYR C CE1   1 
ATOM   4193  C  CE2   . TYR C 2  129  ? -18.275 18.525  29.762  1.00 40.91  ? 129  TYR C CE2   1 
ATOM   4194  C  CZ    . TYR C 2  129  ? -18.509 19.885  29.721  1.00 42.96  ? 129  TYR C CZ    1 
ATOM   4195  O  OH    . TYR C 2  129  ? -19.805 20.357  29.726  1.00 39.21  ? 129  TYR C OH    1 
ATOM   4196  N  N     . ALA C 2  130  ? -14.402 18.990  33.197  1.00 37.91  ? 130  ALA C N     1 
ATOM   4197  C  CA    . ALA C 2  130  ? -14.837 18.504  34.492  1.00 38.07  ? 130  ALA C CA    1 
ATOM   4198  C  C     . ALA C 2  130  ? -15.458 19.608  35.337  1.00 39.03  ? 130  ALA C C     1 
ATOM   4199  O  O     . ALA C 2  130  ? -15.191 20.791  35.133  1.00 43.21  ? 130  ALA C O     1 
ATOM   4200  C  CB    . ALA C 2  130  ? -13.662 17.872  35.226  1.00 40.18  ? 130  ALA C CB    1 
ATOM   4201  N  N     . ALA C 2  131  ? -16.294 19.202  36.286  1.00 38.72  ? 131  ALA C N     1 
ATOM   4202  C  CA    . ALA C 2  131  ? -16.900 20.120  37.240  1.00 42.40  ? 131  ALA C CA    1 
ATOM   4203  C  C     . ALA C 2  131  ? -16.656 19.625  38.670  1.00 44.72  ? 131  ALA C C     1 
ATOM   4204  O  O     . ALA C 2  131  ? -16.900 18.457  38.976  1.00 45.10  ? 131  ALA C O     1 
ATOM   4205  C  CB    . ALA C 2  131  ? -18.389 20.263  36.964  1.00 44.70  ? 131  ALA C CB    1 
ATOM   4206  N  N     . PRO C 2  132  ? -16.172 20.514  39.551  1.00 46.97  ? 132  PRO C N     1 
ATOM   4207  C  CA    . PRO C 2  132  ? -15.784 20.137  40.918  1.00 47.96  ? 132  PRO C CA    1 
ATOM   4208  C  C     . PRO C 2  132  ? -16.921 19.524  41.749  1.00 47.87  ? 132  PRO C C     1 
ATOM   4209  O  O     . PRO C 2  132  ? -18.049 20.017  41.719  1.00 46.48  ? 132  PRO C O     1 
ATOM   4210  C  CB    . PRO C 2  132  ? -15.321 21.468  41.527  1.00 50.99  ? 132  PRO C CB    1 
ATOM   4211  C  CG    . PRO C 2  132  ? -15.938 22.524  40.675  1.00 49.81  ? 132  PRO C CG    1 
ATOM   4212  C  CD    . PRO C 2  132  ? -15.973 21.951  39.297  1.00 47.93  ? 132  PRO C CD    1 
ATOM   4213  N  N     . LEU C 2  133  ? -16.600 18.462  42.486  1.00 49.66  ? 133  LEU C N     1 
ATOM   4214  C  CA    . LEU C 2  133  ? -17.568 17.714  43.290  1.00 49.34  ? 133  LEU C CA    1 
ATOM   4215  C  C     . LEU C 2  133  ? -17.444 17.988  44.794  1.00 53.38  ? 133  LEU C C     1 
ATOM   4216  O  O     . LEU C 2  133  ? -16.356 17.904  45.365  1.00 56.34  ? 133  LEU C O     1 
ATOM   4217  C  CB    . LEU C 2  133  ? -17.403 16.212  43.025  1.00 48.45  ? 133  LEU C CB    1 
ATOM   4218  C  CG    . LEU C 2  133  ? -17.974 15.206  44.027  1.00 47.74  ? 133  LEU C CG    1 
ATOM   4219  C  CD1   . LEU C 2  133  ? -19.492 15.296  44.082  1.00 51.50  ? 133  LEU C CD1   1 
ATOM   4220  C  CD2   . LEU C 2  133  ? -17.523 13.796  43.668  1.00 39.63  ? 133  LEU C CD2   1 
ATOM   4221  N  N     . PHE C 2  134  ? -18.569 18.306  45.430  1.00 56.07  ? 134  PHE C N     1 
ATOM   4222  C  CA    . PHE C 2  134  ? -18.599 18.562  46.869  1.00 60.03  ? 134  PHE C CA    1 
ATOM   4223  C  C     . PHE C 2  134  ? -19.469 17.550  47.605  1.00 63.56  ? 134  PHE C C     1 
ATOM   4224  O  O     . PHE C 2  134  ? -20.409 16.988  47.034  1.00 60.45  ? 134  PHE C O     1 
ATOM   4225  C  CB    . PHE C 2  134  ? -19.117 19.973  47.163  1.00 64.66  ? 134  PHE C CB    1 
ATOM   4226  C  CG    . PHE C 2  134  ? -18.269 21.067  46.589  1.00 63.46  ? 134  PHE C CG    1 
ATOM   4227  C  CD1   . PHE C 2  134  ? -16.894 20.926  46.495  1.00 63.65  ? 134  PHE C CD1   1 
ATOM   4228  C  CD2   . PHE C 2  134  ? -18.851 22.244  46.139  1.00 66.77  ? 134  PHE C CD2   1 
ATOM   4229  C  CE1   . PHE C 2  134  ? -16.114 21.941  45.964  1.00 67.74  ? 134  PHE C CE1   1 
ATOM   4230  C  CE2   . PHE C 2  134  ? -18.077 23.258  45.607  1.00 73.90  ? 134  PHE C CE2   1 
ATOM   4231  C  CZ    . PHE C 2  134  ? -16.705 23.106  45.519  1.00 72.02  ? 134  PHE C CZ    1 
ATOM   4232  N  N     . VAL C 2  135  ? -19.144 17.333  48.878  1.00 68.78  ? 135  VAL C N     1 
ATOM   4233  C  CA    . VAL C 2  135  ? -19.938 16.490  49.769  1.00 71.06  ? 135  VAL C CA    1 
ATOM   4234  C  C     . VAL C 2  135  ? -20.023 17.090  51.168  1.00 70.70  ? 135  VAL C C     1 
ATOM   4235  O  O     . VAL C 2  135  ? -19.241 17.970  51.530  1.00 67.61  ? 135  VAL C O     1 
ATOM   4236  C  CB    . VAL C 2  135  ? -19.360 15.064  49.896  1.00 67.96  ? 135  VAL C CB    1 
ATOM   4237  C  CG1   . VAL C 2  135  ? -19.506 14.297  48.587  1.00 64.57  ? 135  VAL C CG1   1 
ATOM   4238  C  CG2   . VAL C 2  135  ? -17.907 15.114  50.358  1.00 68.18  ? 135  VAL C CG2   1 
ATOM   4239  N  N     . THR C 2  136  ? -20.974 16.599  51.952  1.00 68.13  ? 136  THR C N     1 
ATOM   4240  C  CA    . THR C 2  136  ? -21.117 17.028  53.333  1.00 71.56  ? 136  THR C CA    1 
ATOM   4241  C  C     . THR C 2  136  ? -20.666 15.902  54.262  1.00 73.20  ? 136  THR C C     1 
ATOM   4242  O  O     . THR C 2  136  ? -21.315 14.860  54.360  1.00 69.60  ? 136  THR C O     1 
ATOM   4243  C  CB    . THR C 2  136  ? -22.571 17.444  53.654  1.00 72.37  ? 136  THR C CB    1 
ATOM   4244  O  OG1   . THR C 2  136  ? -22.969 18.511  52.783  1.00 68.28  ? 136  THR C OG1   1 
ATOM   4245  C  CG2   . THR C 2  136  ? -22.696 17.913  55.097  1.00 76.22  ? 136  THR C CG2   1 
ATOM   4246  N  N     . ALA C 2  137  ? -19.535 16.116  54.926  1.00 75.20  ? 137  ALA C N     1 
ATOM   4247  C  CA    . ALA C 2  137  ? -18.990 15.129  55.847  1.00 75.91  ? 137  ALA C CA    1 
ATOM   4248  C  C     . ALA C 2  137  ? -19.110 15.600  57.288  1.00 84.12  ? 137  ALA C C     1 
ATOM   4249  O  O     . ALA C 2  137  ? -18.687 16.707  57.626  1.00 83.50  ? 137  ALA C O     1 
ATOM   4250  C  CB    . ALA C 2  137  ? -17.542 14.835  55.512  1.00 72.55  ? 137  ALA C CB    1 
ATOM   4251  N  N     . GLU C 2  138  ? -19.684 14.754  58.136  1.00 89.78  ? 138  GLU C N     1 
ATOM   4252  C  CA    . GLU C 2  138  ? -19.787 15.062  59.557  1.00 96.87  ? 138  GLU C CA    1 
ATOM   4253  C  C     . GLU C 2  138  ? -19.127 13.978  60.413  1.00 99.31  ? 138  GLU C C     1 
ATOM   4254  O  O     . GLU C 2  138  ? -19.290 12.780  60.162  1.00 91.05  ? 138  GLU C O     1 
ATOM   4255  C  CB    . GLU C 2  138  ? -21.254 15.251  59.961  1.00 99.96  ? 138  GLU C CB    1 
ATOM   4256  C  CG    . GLU C 2  138  ? -22.148 14.040  59.732  1.00 104.00 ? 138  GLU C CG    1 
ATOM   4257  C  CD    . GLU C 2  138  ? -23.570 14.262  60.225  1.00 109.88 ? 138  GLU C CD    1 
ATOM   4258  O  OE1   . GLU C 2  138  ? -24.090 15.388  60.062  1.00 108.32 ? 138  GLU C OE1   1 
ATOM   4259  O  OE2   . GLU C 2  138  ? -24.164 13.313  60.782  1.00 107.65 ? 138  GLU C OE2   1 
ATOM   4260  N  N     . PHE C 2  139  ? -18.369 14.413  61.417  1.00 106.06 ? 139  PHE C N     1 
ATOM   4261  C  CA    . PHE C 2  139  ? -17.679 13.495  62.321  1.00 109.95 ? 139  PHE C CA    1 
ATOM   4262  C  C     . PHE C 2  139  ? -18.474 13.283  63.608  1.00 107.74 ? 139  PHE C C     1 
ATOM   4263  O  O     . PHE C 2  139  ? -18.579 14.178  64.448  1.00 108.20 ? 139  PHE C O     1 
ATOM   4264  C  CB    . PHE C 2  139  ? -16.270 14.006  62.647  1.00 110.13 ? 139  PHE C CB    1 
ATOM   4265  C  CG    . PHE C 2  139  ? -15.564 13.202  63.707  1.00 109.57 ? 139  PHE C CG    1 
ATOM   4266  C  CD1   . PHE C 2  139  ? -15.321 13.740  64.960  1.00 111.96 ? 139  PHE C CD1   1 
ATOM   4267  C  CD2   . PHE C 2  139  ? -15.160 11.901  63.453  1.00 107.51 ? 139  PHE C CD2   1 
ATOM   4268  C  CE1   . PHE C 2  139  ? -14.679 12.998  65.937  1.00 114.60 ? 139  PHE C CE1   1 
ATOM   4269  C  CE2   . PHE C 2  139  ? -14.520 11.155  64.425  1.00 106.43 ? 139  PHE C CE2   1 
ATOM   4270  C  CZ    . PHE C 2  139  ? -14.279 11.705  65.667  1.00 111.83 ? 139  PHE C CZ    1 
ATOM   4271  N  N     . ILE C 2  140  ? -19.033 12.088  63.750  1.00 105.31 ? 140  ILE C N     1 
ATOM   4272  C  CA    . ILE C 2  140  ? -19.804 11.735  64.932  1.00 107.89 ? 140  ILE C CA    1 
ATOM   4273  C  C     . ILE C 2  140  ? -18.890 11.106  65.980  1.00 108.11 ? 140  ILE C C     1 
ATOM   4274  O  O     . ILE C 2  140  ? -18.035 10.285  65.649  1.00 107.98 ? 140  ILE C O     1 
ATOM   4275  C  CB    . ILE C 2  140  ? -20.954 10.761  64.576  1.00 115.06 ? 140  ILE C CB    1 
ATOM   4276  C  CG1   . ILE C 2  140  ? -21.738 11.282  63.364  1.00 109.58 ? 140  ILE C CG1   1 
ATOM   4277  C  CG2   . ILE C 2  140  ? -21.869 10.534  65.776  1.00 111.55 ? 140  ILE C CG2   1 
ATOM   4278  C  CD1   . ILE C 2  140  ? -22.781 10.315  62.832  1.00 96.44  ? 140  ILE C CD1   1 
ATOM   4279  N  N     . ASN C 2  141  ? -19.056 11.507  67.237  1.00 111.19 ? 141  ASN C N     1 
ATOM   4280  C  CA    . ASN C 2  141  ? -18.317 10.893  68.338  1.00 120.67 ? 141  ASN C CA    1 
ATOM   4281  C  C     . ASN C 2  141  ? -19.271 10.402  69.426  1.00 121.02 ? 141  ASN C C     1 
ATOM   4282  O  O     . ASN C 2  141  ? -20.056 11.177  69.976  1.00 119.83 ? 141  ASN C O     1 
ATOM   4283  C  CB    . ASN C 2  141  ? -17.292 11.874  68.920  1.00 118.88 ? 141  ASN C CB    1 
ATOM   4284  C  CG    . ASN C 2  141  ? -16.340 11.214  69.911  1.00 118.10 ? 141  ASN C CG    1 
ATOM   4285  O  OD1   . ASN C 2  141  ? -15.891 11.842  70.871  1.00 112.70 ? 141  ASN C OD1   1 
ATOM   4286  N  ND2   . ASN C 2  141  ? -16.032 9.942   69.683  1.00 119.07 ? 141  ASN C ND2   1 
ATOM   4287  N  N     . ASN C 2  142  ? -19.201 9.109   69.724  1.00 116.01 ? 142  ASN C N     1 
ATOM   4288  C  CA    . ASN C 2  142  ? -20.119 8.489   70.672  1.00 117.08 ? 142  ASN C CA    1 
ATOM   4289  C  C     . ASN C 2  142  ? -19.744 8.755   72.122  1.00 115.33 ? 142  ASN C C     1 
ATOM   4290  O  O     . ASN C 2  142  ? -20.546 8.527   73.026  1.00 123.82 ? 142  ASN C O     1 
ATOM   4291  C  CB    . ASN C 2  142  ? -20.189 6.980   70.437  1.00 114.69 ? 142  ASN C CB    1 
ATOM   4292  C  CG    . ASN C 2  142  ? -20.578 6.627   69.016  1.00 116.19 ? 142  ASN C CG    1 
ATOM   4293  O  OD1   . ASN C 2  142  ? -21.054 7.475   68.259  1.00 116.70 ? 142  ASN C OD1   1 
ATOM   4294  N  ND2   . ASN C 2  142  ? -20.385 5.367   68.649  1.00 108.15 ? 142  ASN C ND2   1 
ATOM   4295  N  N     . ASN C 2  143  ? -18.522 9.232   72.341  1.00 109.15 ? 143  ASN C N     1 
ATOM   4296  C  CA    . ASN C 2  143  ? -18.044 9.496   73.693  1.00 114.92 ? 143  ASN C CA    1 
ATOM   4297  C  C     . ASN C 2  143  ? -18.233 10.951  74.118  1.00 119.03 ? 143  ASN C C     1 
ATOM   4298  O  O     . ASN C 2  143  ? -18.702 11.220  75.224  1.00 124.79 ? 143  ASN C O     1 
ATOM   4299  C  CB    . ASN C 2  143  ? -16.573 9.102   73.821  1.00 117.97 ? 143  ASN C CB    1 
ATOM   4300  C  CG    . ASN C 2  143  ? -16.358 7.608   73.678  1.00 123.52 ? 143  ASN C CG    1 
ATOM   4301  O  OD1   . ASN C 2  143  ? -15.370 7.165   73.093  1.00 132.14 ? 143  ASN C OD1   1 
ATOM   4302  N  ND2   . ASN C 2  143  ? -17.290 6.822   74.206  1.00 117.22 ? 143  ASN C ND2   1 
ATOM   4303  N  N     . THR C 2  144  ? -17.868 11.887  73.248  1.00 119.90 ? 144  THR C N     1 
ATOM   4304  C  CA    . THR C 2  144  ? -18.043 13.304  73.554  1.00 119.37 ? 144  THR C CA    1 
ATOM   4305  C  C     . THR C 2  144  ? -19.450 13.766  73.191  1.00 110.20 ? 144  THR C C     1 
ATOM   4306  O  O     . THR C 2  144  ? -19.916 14.802  73.662  1.00 107.66 ? 144  THR C O     1 
ATOM   4307  C  CB    . THR C 2  144  ? -17.010 14.186  72.820  1.00 119.85 ? 144  THR C CB    1 
ATOM   4308  O  OG1   . THR C 2  144  ? -17.019 13.880  71.421  1.00 119.89 ? 144  THR C OG1   1 
ATOM   4309  C  CG2   . THR C 2  144  ? -15.613 13.948  73.375  1.00 116.77 ? 144  THR C CG2   1 
ATOM   4310  N  N     . GLY C 2  145  ? -20.121 12.991  72.346  1.00 106.18 ? 145  GLY C N     1 
ATOM   4311  C  CA    . GLY C 2  145  ? -21.482 13.297  71.951  1.00 107.50 ? 145  GLY C CA    1 
ATOM   4312  C  C     . GLY C 2  145  ? -21.599 14.455  70.976  1.00 114.92 ? 145  GLY C C     1 
ATOM   4313  O  O     . GLY C 2  145  ? -22.686 14.736  70.474  1.00 115.66 ? 145  GLY C O     1 
ATOM   4314  N  N     . GLU C 2  146  ? -20.485 15.127  70.700  1.00 116.30 ? 146  GLU C N     1 
ATOM   4315  C  CA    . GLU C 2  146  ? -20.491 16.279  69.799  1.00 115.87 ? 146  GLU C CA    1 
ATOM   4316  C  C     . GLU C 2  146  ? -20.336 15.876  68.331  1.00 117.83 ? 146  GLU C C     1 
ATOM   4317  O  O     . GLU C 2  146  ? -19.770 14.827  68.016  1.00 115.78 ? 146  GLU C O     1 
ATOM   4318  C  CB    . GLU C 2  146  ? -19.386 17.263  70.186  1.00 114.34 ? 146  GLU C CB    1 
ATOM   4319  C  CG    . GLU C 2  146  ? -17.993 16.672  70.113  1.00 120.01 ? 146  GLU C CG    1 
ATOM   4320  C  CD    . GLU C 2  146  ? -16.907 17.688  70.407  1.00 121.13 ? 146  GLU C CD    1 
ATOM   4321  O  OE1   . GLU C 2  146  ? -17.186 18.905  70.329  1.00 108.27 ? 146  GLU C OE1   1 
ATOM   4322  O  OE2   . GLU C 2  146  ? -15.771 17.266  70.715  1.00 132.30 ? 146  GLU C OE2   1 
ATOM   4323  N  N     . ILE C 2  147  ? -20.847 16.719  67.438  1.00 117.60 ? 147  ILE C N     1 
ATOM   4324  C  CA    . ILE C 2  147  ? -20.777 16.469  66.000  1.00 114.59 ? 147  ILE C CA    1 
ATOM   4325  C  C     . ILE C 2  147  ? -20.235 17.688  65.261  1.00 106.91 ? 147  ILE C C     1 
ATOM   4326  O  O     . ILE C 2  147  ? -20.748 18.795  65.421  1.00 105.54 ? 147  ILE C O     1 
ATOM   4327  C  CB    . ILE C 2  147  ? -22.165 16.102  65.421  1.00 107.65 ? 147  ILE C CB    1 
ATOM   4328  C  CG1   . ILE C 2  147  ? -22.635 14.752  65.965  1.00 107.05 ? 147  ILE C CG1   1 
ATOM   4329  C  CG2   . ILE C 2  147  ? -22.125 16.077  63.898  1.00 100.76 ? 147  ILE C CG2   1 
ATOM   4330  C  CD1   . ILE C 2  147  ? -23.936 14.266  65.357  1.00 98.62  ? 147  ILE C CD1   1 
ATOM   4331  N  N     . LYS C 2  148  ? -19.195 17.483  64.459  1.00 103.79 ? 148  LYS C N     1 
ATOM   4332  C  CA    . LYS C 2  148  ? -18.637 18.553  63.638  1.00 103.17 ? 148  LYS C CA    1 
ATOM   4333  C  C     . LYS C 2  148  ? -18.910 18.288  62.159  1.00 99.13  ? 148  LYS C C     1 
ATOM   4334  O  O     . LYS C 2  148  ? -18.388 17.333  61.585  1.00 95.58  ? 148  LYS C O     1 
ATOM   4335  C  CB    . LYS C 2  148  ? -17.130 18.697  63.879  1.00 106.66 ? 148  LYS C CB    1 
ATOM   4336  C  CG    . LYS C 2  148  ? -16.741 18.955  65.328  1.00 108.54 ? 148  LYS C CG    1 
ATOM   4337  C  CD    . LYS C 2  148  ? -15.246 19.210  65.461  1.00 110.28 ? 148  LYS C CD    1 
ATOM   4338  C  CE    . LYS C 2  148  ? -14.860 19.512  66.900  1.00 116.09 ? 148  LYS C CE    1 
ATOM   4339  N  NZ    . LYS C 2  148  ? -13.426 19.892  67.017  1.00 115.36 ? 148  LYS C NZ    1 
ATOM   4340  N  N     . SER C 2  149  ? -19.731 19.137  61.549  1.00 100.29 ? 149  SER C N     1 
ATOM   4341  C  CA    . SER C 2  149  ? -20.119 18.960  60.154  1.00 95.29  ? 149  SER C CA    1 
ATOM   4342  C  C     . SER C 2  149  ? -19.609 20.101  59.273  1.00 91.20  ? 149  SER C C     1 
ATOM   4343  O  O     . SER C 2  149  ? -19.756 21.280  59.608  1.00 90.81  ? 149  SER C O     1 
ATOM   4344  C  CB    . SER C 2  149  ? -21.642 18.845  60.035  1.00 94.75  ? 149  SER C CB    1 
ATOM   4345  O  OG    . SER C 2  149  ? -22.027 18.378  58.752  1.00 87.52  ? 149  SER C OG    1 
ATOM   4346  N  N     . GLN C 2  150  ? -19.005 19.737  58.146  1.00 85.91  ? 150  GLN C N     1 
ATOM   4347  C  CA    . GLN C 2  150  ? -18.495 20.712  57.189  1.00 82.72  ? 150  GLN C CA    1 
ATOM   4348  C  C     . GLN C 2  150  ? -18.441 20.101  55.791  1.00 80.70  ? 150  GLN C C     1 
ATOM   4349  O  O     . GLN C 2  150  ? -18.545 18.883  55.636  1.00 79.40  ? 150  GLN C O     1 
ATOM   4350  C  CB    . GLN C 2  150  ? -17.111 21.204  57.612  1.00 80.83  ? 150  GLN C CB    1 
ATOM   4351  C  CG    . GLN C 2  150  ? -16.094 20.090  57.768  1.00 83.33  ? 150  GLN C CG    1 
ATOM   4352  C  CD    . GLN C 2  150  ? -14.796 20.557  58.396  1.00 86.71  ? 150  GLN C CD    1 
ATOM   4353  O  OE1   . GLN C 2  150  ? -13.986 19.746  58.846  1.00 88.65  ? 150  GLN C OE1   1 
ATOM   4354  N  NE2   . GLN C 2  150  ? -14.587 21.868  58.424  1.00 86.01  ? 150  GLN C NE2   1 
ATOM   4355  N  N     . THR C 2  151  ? -18.279 20.952  54.780  1.00 79.01  ? 151  THR C N     1 
ATOM   4356  C  CA    . THR C 2  151  ? -18.258 20.513  53.383  1.00 75.73  ? 151  THR C CA    1 
ATOM   4357  C  C     . THR C 2  151  ? -16.844 20.286  52.855  1.00 79.83  ? 151  THR C C     1 
ATOM   4358  O  O     . THR C 2  151  ? -15.995 21.179  52.923  1.00 79.78  ? 151  THR C O     1 
ATOM   4359  C  CB    . THR C 2  151  ? -18.952 21.535  52.464  1.00 74.28  ? 151  THR C CB    1 
ATOM   4360  O  OG1   . THR C 2  151  ? -20.358 21.548  52.735  1.00 79.70  ? 151  THR C OG1   1 
ATOM   4361  C  CG2   . THR C 2  151  ? -18.727 21.174  51.003  1.00 68.65  ? 151  THR C CG2   1 
ATOM   4362  N  N     . VAL C 2  152  ? -16.602 19.098  52.309  1.00 79.33  ? 152  VAL C N     1 
ATOM   4363  C  CA    . VAL C 2  152  ? -15.274 18.745  51.819  1.00 77.39  ? 152  VAL C CA    1 
ATOM   4364  C  C     . VAL C 2  152  ? -15.215 18.736  50.284  1.00 74.44  ? 152  VAL C C     1 
ATOM   4365  O  O     . VAL C 2  152  ? -16.137 18.260  49.617  1.00 70.32  ? 152  VAL C O     1 
ATOM   4366  C  CB    . VAL C 2  152  ? -14.833 17.371  52.365  1.00 69.51  ? 152  VAL C CB    1 
ATOM   4367  C  CG1   . VAL C 2  152  ? -13.341 17.187  52.180  1.00 70.14  ? 152  VAL C CG1   1 
ATOM   4368  C  CG2   . VAL C 2  152  ? -15.197 17.245  53.838  1.00 66.81  ? 152  VAL C CG2   1 
ATOM   4369  N  N     . PHE C 2  153  ? -14.136 19.290  49.733  1.00 71.13  ? 153  PHE C N     1 
ATOM   4370  C  CA    . PHE C 2  153  ? -13.895 19.267  48.290  1.00 64.25  ? 153  PHE C CA    1 
ATOM   4371  C  C     . PHE C 2  153  ? -13.435 17.869  47.913  1.00 64.06  ? 153  PHE C C     1 
ATOM   4372  O  O     . PHE C 2  153  ? -12.623 17.273  48.621  1.00 66.58  ? 153  PHE C O     1 
ATOM   4373  C  CB    . PHE C 2  153  ? -12.855 20.327  47.894  1.00 65.92  ? 153  PHE C CB    1 
ATOM   4374  C  CG    . PHE C 2  153  ? -12.421 20.267  46.448  1.00 65.71  ? 153  PHE C CG    1 
ATOM   4375  C  CD1   . PHE C 2  153  ? -13.351 20.222  45.425  1.00 63.91  ? 153  PHE C CD1   1 
ATOM   4376  C  CD2   . PHE C 2  153  ? -11.073 20.293  46.113  1.00 71.33  ? 153  PHE C CD2   1 
ATOM   4377  C  CE1   . PHE C 2  153  ? -12.949 20.180  44.098  1.00 64.10  ? 153  PHE C CE1   1 
ATOM   4378  C  CE2   . PHE C 2  153  ? -10.665 20.252  44.787  1.00 69.24  ? 153  PHE C CE2   1 
ATOM   4379  C  CZ    . PHE C 2  153  ? -11.605 20.198  43.781  1.00 63.40  ? 153  PHE C CZ    1 
ATOM   4380  N  N     . MET C 2  154  ? -13.956 17.335  46.815  1.00 59.52  ? 154  MET C N     1 
ATOM   4381  C  CA    . MET C 2  154  ? -13.656 15.953  46.461  1.00 57.96  ? 154  MET C CA    1 
ATOM   4382  C  C     . MET C 2  154  ? -12.847 15.809  45.174  1.00 56.53  ? 154  MET C C     1 
ATOM   4383  O  O     . MET C 2  154  ? -12.306 14.740  44.890  1.00 55.18  ? 154  MET C O     1 
ATOM   4384  C  CB    . MET C 2  154  ? -14.952 15.146  46.362  1.00 57.19  ? 154  MET C CB    1 
ATOM   4385  C  CG    . MET C 2  154  ? -15.452 14.670  47.717  1.00 59.77  ? 154  MET C CG    1 
ATOM   4386  S  SD    . MET C 2  154  ? -14.118 13.939  48.696  1.00 60.16  ? 154  MET C SD    1 
ATOM   4387  C  CE    . MET C 2  154  ? -13.656 12.526  47.690  1.00 57.31  ? 154  MET C CE    1 
ATOM   4388  N  N     . GLY C 2  155  ? -12.747 16.883  44.405  1.00 55.37  ? 155  GLY C N     1 
ATOM   4389  C  CA    . GLY C 2  155  ? -11.935 16.854  43.206  1.00 55.01  ? 155  GLY C CA    1 
ATOM   4390  C  C     . GLY C 2  155  ? -12.727 17.169  41.958  1.00 51.09  ? 155  GLY C C     1 
ATOM   4391  O  O     . GLY C 2  155  ? -13.946 17.005  41.919  1.00 47.33  ? 155  GLY C O     1 
ATOM   4392  N  N     . ASP C 2  156  ? -12.021 17.631  40.933  1.00 52.23  ? 156  ASP C N     1 
ATOM   4393  C  CA    . ASP C 2  156  ? -12.625 17.901  39.637  1.00 47.54  ? 156  ASP C CA    1 
ATOM   4394  C  C     . ASP C 2  156  ? -13.086 16.609  38.949  1.00 42.69  ? 156  ASP C C     1 
ATOM   4395  O  O     . ASP C 2  156  ? -12.285 15.735  38.604  1.00 39.50  ? 156  ASP C O     1 
ATOM   4396  C  CB    . ASP C 2  156  ? -11.640 18.662  38.747  1.00 50.08  ? 156  ASP C CB    1 
ATOM   4397  C  CG    . ASP C 2  156  ? -11.215 19.992  39.351  1.00 50.00  ? 156  ASP C CG    1 
ATOM   4398  O  OD1   . ASP C 2  156  ? -12.039 20.633  40.040  1.00 47.31  ? 156  ASP C OD1   1 
ATOM   4399  O  OD2   . ASP C 2  156  ? -10.057 20.400  39.130  1.00 52.21  ? 156  ASP C OD2   1 
ATOM   4400  N  N     . PHE C 2  157  ? -14.395 16.518  38.746  1.00 40.59  ? 157  PHE C N     1 
ATOM   4401  C  CA    . PHE C 2  157  ? -15.050 15.312  38.258  1.00 37.97  ? 157  PHE C CA    1 
ATOM   4402  C  C     . PHE C 2  157  ? -15.401 15.397  36.775  1.00 37.61  ? 157  PHE C C     1 
ATOM   4403  O  O     . PHE C 2  157  ? -16.227 16.218  36.382  1.00 42.46  ? 157  PHE C O     1 
ATOM   4404  C  CB    . PHE C 2  157  ? -16.315 15.072  39.077  1.00 40.06  ? 157  PHE C CB    1 
ATOM   4405  C  CG    . PHE C 2  157  ? -16.991 13.770  38.795  1.00 37.42  ? 157  PHE C CG    1 
ATOM   4406  C  CD1   . PHE C 2  157  ? -17.904 13.654  37.759  1.00 36.87  ? 157  PHE C CD1   1 
ATOM   4407  C  CD2   . PHE C 2  157  ? -16.738 12.667  39.592  1.00 38.06  ? 157  PHE C CD2   1 
ATOM   4408  C  CE1   . PHE C 2  157  ? -18.537 12.452  37.510  1.00 37.70  ? 157  PHE C CE1   1 
ATOM   4409  C  CE2   . PHE C 2  157  ? -17.367 11.465  39.353  1.00 37.54  ? 157  PHE C CE2   1 
ATOM   4410  C  CZ    . PHE C 2  157  ? -18.269 11.354  38.312  1.00 37.16  ? 157  PHE C CZ    1 
ATOM   4411  N  N     . PRO C 2  158  ? -14.781 14.541  35.949  1.00 34.40  ? 158  PRO C N     1 
ATOM   4412  C  CA    . PRO C 2  158  ? -15.012 14.502  34.500  1.00 33.46  ? 158  PRO C CA    1 
ATOM   4413  C  C     . PRO C 2  158  ? -16.483 14.437  34.129  1.00 32.97  ? 158  PRO C C     1 
ATOM   4414  O  O     . PRO C 2  158  ? -17.159 13.477  34.492  1.00 33.42  ? 158  PRO C O     1 
ATOM   4415  C  CB    . PRO C 2  158  ? -14.308 13.218  34.071  1.00 33.03  ? 158  PRO C CB    1 
ATOM   4416  C  CG    . PRO C 2  158  ? -13.216 13.071  35.044  1.00 37.07  ? 158  PRO C CG    1 
ATOM   4417  C  CD    . PRO C 2  158  ? -13.753 13.571  36.359  1.00 37.34  ? 158  PRO C CD    1 
ATOM   4418  N  N     . MET C 2  159  ? -16.960 15.447  33.409  1.00 33.84  ? 159  MET C N     1 
ATOM   4419  C  CA    . MET C 2  159  ? -18.346 15.477  32.959  1.00 35.44  ? 159  MET C CA    1 
ATOM   4420  C  C     . MET C 2  159  ? -18.491 14.998  31.507  1.00 36.52  ? 159  MET C C     1 
ATOM   4421  O  O     . MET C 2  159  ? -17.604 15.209  30.673  1.00 37.03  ? 159  MET C O     1 
ATOM   4422  C  CB    . MET C 2  159  ? -18.920 16.888  33.118  1.00 35.55  ? 159  MET C CB    1 
ATOM   4423  C  CG    . MET C 2  159  ? -19.107 17.315  34.570  1.00 34.75  ? 159  MET C CG    1 
ATOM   4424  S  SD    . MET C 2  159  ? -20.388 16.351  35.392  1.00 28.83  ? 159  MET C SD    1 
ATOM   4425  C  CE    . MET C 2  159  ? -21.795 16.777  34.368  1.00 32.84  ? 159  MET C CE    1 
ATOM   4426  N  N     . MET C 2  160  ? -19.610 14.336  31.224  1.00 33.15  ? 160  MET C N     1 
ATOM   4427  C  CA    . MET C 2  160  ? -19.911 13.867  29.878  1.00 30.77  ? 160  MET C CA    1 
ATOM   4428  C  C     . MET C 2  160  ? -20.604 14.973  29.103  1.00 30.07  ? 160  MET C C     1 
ATOM   4429  O  O     . MET C 2  160  ? -21.554 15.582  29.601  1.00 31.39  ? 160  MET C O     1 
ATOM   4430  C  CB    . MET C 2  160  ? -20.786 12.615  29.922  1.00 31.09  ? 160  MET C CB    1 
ATOM   4431  C  CG    . MET C 2  160  ? -21.283 12.142  28.566  1.00 32.08  ? 160  MET C CG    1 
ATOM   4432  S  SD    . MET C 2  160  ? -22.412 10.735  28.699  1.00 29.74  ? 160  MET C SD    1 
ATOM   4433  C  CE    . MET C 2  160  ? -21.325 9.429   29.273  1.00 32.95  ? 160  MET C CE    1 
ATOM   4434  N  N     . THR C 2  161  ? -20.122 15.237  27.892  1.00 29.08  ? 161  THR C N     1 
ATOM   4435  C  CA    . THR C 2  161  ? -20.676 16.302  27.062  1.00 32.65  ? 161  THR C CA    1 
ATOM   4436  C  C     . THR C 2  161  ? -22.026 15.918  26.489  1.00 36.15  ? 161  THR C C     1 
ATOM   4437  O  O     . THR C 2  161  ? -22.474 14.778  26.630  1.00 35.94  ? 161  THR C O     1 
ATOM   4438  C  CB    . THR C 2  161  ? -19.757 16.655  25.886  1.00 32.50  ? 161  THR C CB    1 
ATOM   4439  O  OG1   . THR C 2  161  ? -20.001 15.752  24.800  1.00 35.17  ? 161  THR C OG1   1 
ATOM   4440  C  CG2   . THR C 2  161  ? -18.302 16.572  26.303  1.00 37.81  ? 161  THR C CG2   1 
ATOM   4441  N  N     . GLU C 2  162  ? -22.662 16.878  25.826  1.00 39.86  ? 162  GLU C N     1 
ATOM   4442  C  CA    . GLU C 2  162  ? -23.942 16.638  25.178  1.00 42.94  ? 162  GLU C CA    1 
ATOM   4443  C  C     . GLU C 2  162  ? -23.805 15.527  24.146  1.00 39.67  ? 162  GLU C C     1 
ATOM   4444  O  O     . GLU C 2  162  ? -24.686 14.674  24.025  1.00 39.95  ? 162  GLU C O     1 
ATOM   4445  C  CB    . GLU C 2  162  ? -24.471 17.916  24.525  1.00 50.44  ? 162  GLU C CB    1 
ATOM   4446  C  CG    . GLU C 2  162  ? -24.935 18.962  25.525  1.00 62.68  ? 162  GLU C CG    1 
ATOM   4447  C  CD    . GLU C 2  162  ? -25.468 20.218  24.860  1.00 79.70  ? 162  GLU C CD    1 
ATOM   4448  O  OE1   . GLU C 2  162  ? -25.320 20.350  23.627  1.00 82.64  ? 162  GLU C OE1   1 
ATOM   4449  O  OE2   . GLU C 2  162  ? -26.038 21.073  25.571  1.00 82.30  ? 162  GLU C OE2   1 
ATOM   4450  N  N     . LYS C 2  163  ? -22.683 15.520  23.428  1.00 37.85  ? 163  LYS C N     1 
ATOM   4451  C  CA    . LYS C 2  163  ? -22.428 14.499  22.413  1.00 35.16  ? 163  LYS C CA    1 
ATOM   4452  C  C     . LYS C 2  163  ? -22.086 13.141  23.025  1.00 33.85  ? 163  LYS C C     1 
ATOM   4453  O  O     . LYS C 2  163  ? -21.640 12.231  22.323  1.00 32.63  ? 163  LYS C O     1 
ATOM   4454  C  CB    . LYS C 2  163  ? -21.303 14.943  21.478  1.00 36.33  ? 163  LYS C CB    1 
ATOM   4455  C  CG    . LYS C 2  163  ? -21.662 16.119  20.584  1.00 36.86  ? 163  LYS C CG    1 
ATOM   4456  C  CD    . LYS C 2  163  ? -20.447 16.584  19.794  1.00 45.58  ? 163  LYS C CD    1 
ATOM   4457  C  CE    . LYS C 2  163  ? -19.267 16.863  20.723  1.00 50.50  ? 163  LYS C CE    1 
ATOM   4458  N  NZ    . LYS C 2  163  ? -18.027 17.238  19.988  1.00 47.10  ? 163  LYS C NZ    1 
ATOM   4459  N  N     . GLY C 2  164  ? -22.291 13.017  24.334  1.00 32.42  ? 164  GLY C N     1 
ATOM   4460  C  CA    . GLY C 2  164  ? -22.129 11.753  25.027  1.00 32.70  ? 164  GLY C CA    1 
ATOM   4461  C  C     . GLY C 2  164  ? -20.688 11.304  25.138  1.00 31.69  ? 164  GLY C C     1 
ATOM   4462  O  O     . GLY C 2  164  ? -20.408 10.128  25.366  1.00 33.02  ? 164  GLY C O     1 
ATOM   4463  N  N     . THR C 2  165  ? -19.764 12.239  24.971  1.00 31.02  ? 165  THR C N     1 
ATOM   4464  C  CA    . THR C 2  165  ? -18.355 11.905  25.072  1.00 29.95  ? 165  THR C CA    1 
ATOM   4465  C  C     . THR C 2  165  ? -17.743 12.584  26.287  1.00 31.27  ? 165  THR C C     1 
ATOM   4466  O  O     . THR C 2  165  ? -18.389 13.394  26.960  1.00 31.82  ? 165  THR C O     1 
ATOM   4467  C  CB    . THR C 2  165  ? -17.573 12.315  23.805  1.00 31.11  ? 165  THR C CB    1 
ATOM   4468  O  OG1   . THR C 2  165  ? -17.547 13.744  23.692  1.00 34.02  ? 165  THR C OG1   1 
ATOM   4469  C  CG2   . THR C 2  165  ? -18.215 11.723  22.561  1.00 30.64  ? 165  THR C CG2   1 
ATOM   4470  N  N     . PHE C 2  166  ? -16.497 12.229  26.569  1.00 30.75  ? 166  PHE C N     1 
ATOM   4471  C  CA    . PHE C 2  166  ? -15.716 12.901  27.591  1.00 30.62  ? 166  PHE C CA    1 
ATOM   4472  C  C     . PHE C 2  166  ? -14.571 13.643  26.932  1.00 33.98  ? 166  PHE C C     1 
ATOM   4473  O  O     . PHE C 2  166  ? -14.236 13.376  25.778  1.00 35.05  ? 166  PHE C O     1 
ATOM   4474  C  CB    . PHE C 2  166  ? -15.173 11.905  28.609  1.00 29.15  ? 166  PHE C CB    1 
ATOM   4475  C  CG    . PHE C 2  166  ? -16.226 11.287  29.468  1.00 30.29  ? 166  PHE C CG    1 
ATOM   4476  C  CD1   . PHE C 2  166  ? -16.846 10.109  29.086  1.00 29.63  ? 166  PHE C CD1   1 
ATOM   4477  C  CD2   . PHE C 2  166  ? -16.598 11.885  30.662  1.00 31.72  ? 166  PHE C CD2   1 
ATOM   4478  C  CE1   . PHE C 2  166  ? -17.818 9.538   29.881  1.00 29.53  ? 166  PHE C CE1   1 
ATOM   4479  C  CE2   . PHE C 2  166  ? -17.570 11.321  31.461  1.00 30.75  ? 166  PHE C CE2   1 
ATOM   4480  C  CZ    . PHE C 2  166  ? -18.182 10.146  31.071  1.00 29.84  ? 166  PHE C CZ    1 
ATOM   4481  N  N     . ILE C 2  167  ? -13.974 14.579  27.659  1.00 35.06  ? 167  ILE C N     1 
ATOM   4482  C  CA    . ILE C 2  167  ? -12.737 15.198  27.202  1.00 36.32  ? 167  ILE C CA    1 
ATOM   4483  C  C     . ILE C 2  167  ? -11.622 15.004  28.216  1.00 39.54  ? 167  ILE C C     1 
ATOM   4484  O  O     . ILE C 2  167  ? -11.594 15.650  29.268  1.00 38.40  ? 167  ILE C O     1 
ATOM   4485  C  CB    . ILE C 2  167  ? -12.897 16.692  26.936  1.00 33.72  ? 167  ILE C CB    1 
ATOM   4486  C  CG1   . ILE C 2  167  ? -13.871 16.924  25.784  1.00 37.43  ? 167  ILE C CG1   1 
ATOM   4487  C  CG2   . ILE C 2  167  ? -11.548 17.300  26.591  1.00 39.31  ? 167  ILE C CG2   1 
ATOM   4488  C  CD1   . ILE C 2  167  ? -14.078 18.390  25.469  1.00 44.47  ? 167  ILE C CD1   1 
ATOM   4489  N  N     . ILE C 2  168  ? -10.701 14.106  27.889  1.00 41.63  ? 168  ILE C N     1 
ATOM   4490  C  CA    . ILE C 2  168  ? -9.569  13.828  28.757  1.00 40.68  ? 168  ILE C CA    1 
ATOM   4491  C  C     . ILE C 2  168  ? -8.298  14.399  28.135  1.00 45.18  ? 168  ILE C C     1 
ATOM   4492  O  O     . ILE C 2  168  ? -7.841  13.941  27.082  1.00 47.71  ? 168  ILE C O     1 
ATOM   4493  C  CB    . ILE C 2  168  ? -9.417  12.315  29.022  1.00 38.36  ? 168  ILE C CB    1 
ATOM   4494  C  CG1   . ILE C 2  168  ? -10.324 11.894  30.180  1.00 36.98  ? 168  ILE C CG1   1 
ATOM   4495  C  CG2   . ILE C 2  168  ? -7.981  11.960  29.378  1.00 41.48  ? 168  ILE C CG2   1 
ATOM   4496  C  CD1   . ILE C 2  168  ? -11.806 11.914  29.874  1.00 36.76  ? 168  ILE C CD1   1 
ATOM   4497  N  N     . ASN C 2  169  ? -7.757  15.421  28.796  1.00 45.44  ? 169  ASN C N     1 
ATOM   4498  C  CA    . ASN C 2  169  ? -6.544  16.111  28.367  1.00 45.76  ? 169  ASN C CA    1 
ATOM   4499  C  C     . ASN C 2  169  ? -6.644  16.622  26.933  1.00 47.44  ? 169  ASN C C     1 
ATOM   4500  O  O     . ASN C 2  169  ? -5.678  16.556  26.166  1.00 49.24  ? 169  ASN C O     1 
ATOM   4501  C  CB    . ASN C 2  169  ? -5.332  15.195  28.527  1.00 46.92  ? 169  ASN C CB    1 
ATOM   4502  C  CG    . ASN C 2  169  ? -5.339  14.458  29.854  1.00 47.17  ? 169  ASN C CG    1 
ATOM   4503  O  OD1   . ASN C 2  169  ? -5.952  14.912  30.823  1.00 46.86  ? 169  ASN C OD1   1 
ATOM   4504  N  ND2   . ASN C 2  169  ? -4.666  13.311  29.904  1.00 45.99  ? 169  ASN C ND2   1 
ATOM   4505  N  N     . GLY C 2  170  ? -7.825  17.126  26.583  1.00 43.26  ? 170  GLY C N     1 
ATOM   4506  C  CA    . GLY C 2  170  ? -8.048  17.761  25.300  1.00 43.89  ? 170  GLY C CA    1 
ATOM   4507  C  C     . GLY C 2  170  ? -8.288  16.792  24.161  1.00 44.57  ? 170  GLY C C     1 
ATOM   4508  O  O     . GLY C 2  170  ? -8.301  17.196  22.998  1.00 45.71  ? 170  GLY C O     1 
ATOM   4509  N  N     . THR C 2  171  ? -8.463  15.514  24.492  1.00 44.82  ? 171  THR C N     1 
ATOM   4510  C  CA    . THR C 2  171  ? -8.810  14.500  23.496  1.00 42.84  ? 171  THR C CA    1 
ATOM   4511  C  C     . THR C 2  171  ? -10.162 13.860  23.807  1.00 38.33  ? 171  THR C C     1 
ATOM   4512  O  O     . THR C 2  171  ? -10.348 13.244  24.859  1.00 37.17  ? 171  THR C O     1 
ATOM   4513  C  CB    . THR C 2  171  ? -7.734  13.391  23.393  1.00 44.36  ? 171  THR C CB    1 
ATOM   4514  O  OG1   . THR C 2  171  ? -7.525  12.784  24.676  1.00 43.63  ? 171  THR C OG1   1 
ATOM   4515  C  CG2   . THR C 2  171  ? -6.422  13.970  22.882  1.00 44.92  ? 171  THR C CG2   1 
ATOM   4516  N  N     . GLU C 2  172  ? -11.099 14.018  22.877  1.00 35.67  ? 172  GLU C N     1 
ATOM   4517  C  CA    . GLU C 2  172  ? -12.445 13.467  23.002  1.00 35.77  ? 172  GLU C CA    1 
ATOM   4518  C  C     . GLU C 2  172  ? -12.411 11.929  23.085  1.00 36.05  ? 172  GLU C C     1 
ATOM   4519  O  O     . GLU C 2  172  ? -12.090 11.257  22.102  1.00 36.59  ? 172  GLU C O     1 
ATOM   4520  C  CB    . GLU C 2  172  ? -13.302 13.940  21.818  1.00 37.62  ? 172  GLU C CB    1 
ATOM   4521  C  CG    . GLU C 2  172  ? -14.802 14.039  22.093  1.00 40.98  ? 172  GLU C CG    1 
ATOM   4522  C  CD    . GLU C 2  172  ? -15.578 14.710  20.956  1.00 43.92  ? 172  GLU C CD    1 
ATOM   4523  O  OE1   . GLU C 2  172  ? -14.937 15.251  20.028  1.00 46.28  ? 172  GLU C OE1   1 
ATOM   4524  O  OE2   . GLU C 2  172  ? -16.830 14.697  20.991  1.00 40.63  ? 172  GLU C OE2   1 
ATOM   4525  N  N     . ARG C 2  173  ? -12.731 11.383  24.261  1.00 33.43  ? 173  ARG C N     1 
ATOM   4526  C  CA    . ARG C 2  173  ? -12.710 9.929   24.495  1.00 31.81  ? 173  ARG C CA    1 
ATOM   4527  C  C     . ARG C 2  173  ? -14.113 9.346   24.696  1.00 32.87  ? 173  ARG C C     1 
ATOM   4528  O  O     . ARG C 2  173  ? -15.033 10.057  25.103  1.00 36.61  ? 173  ARG C O     1 
ATOM   4529  C  CB    . ARG C 2  173  ? -11.843 9.593   25.717  1.00 33.92  ? 173  ARG C CB    1 
ATOM   4530  C  CG    . ARG C 2  173  ? -10.359 9.886   25.539  1.00 38.49  ? 173  ARG C CG    1 
ATOM   4531  C  CD    . ARG C 2  173  ? -9.509  9.292   26.660  1.00 34.43  ? 173  ARG C CD    1 
ATOM   4532  N  NE    . ARG C 2  173  ? -8.159  8.999   26.188  1.00 35.92  ? 173  ARG C NE    1 
ATOM   4533  C  CZ    . ARG C 2  173  ? -7.831  7.890   25.532  1.00 38.62  ? 173  ARG C CZ    1 
ATOM   4534  N  NH1   . ARG C 2  173  ? -8.756  6.973   25.283  1.00 36.11  ? 173  ARG C NH1   1 
ATOM   4535  N  NH2   . ARG C 2  173  ? -6.583  7.694   25.125  1.00 45.35  ? 173  ARG C NH2   1 
ATOM   4536  N  N     . VAL C 2  174  ? -14.268 8.051   24.421  1.00 30.15  ? 174  VAL C N     1 
ATOM   4537  C  CA    . VAL C 2  174  ? -15.555 7.364   24.584  1.00 27.17  ? 174  VAL C CA    1 
ATOM   4538  C  C     . VAL C 2  174  ? -15.400 6.182   25.535  1.00 28.70  ? 174  VAL C C     1 
ATOM   4539  O  O     . VAL C 2  174  ? -14.474 5.390   25.368  1.00 32.98  ? 174  VAL C O     1 
ATOM   4540  C  CB    . VAL C 2  174  ? -16.110 6.844   23.230  1.00 24.89  ? 174  VAL C CB    1 
ATOM   4541  C  CG1   . VAL C 2  174  ? -17.352 5.996   23.452  1.00 26.67  ? 174  VAL C CG1   1 
ATOM   4542  C  CG2   . VAL C 2  174  ? -16.414 7.992   22.284  1.00 27.46  ? 174  VAL C CG2   1 
ATOM   4543  N  N     . VAL C 2  175  ? -16.279 6.056   26.532  1.00 25.74  ? 175  VAL C N     1 
ATOM   4544  C  CA    . VAL C 2  175  ? -16.243 4.874   27.398  1.00 26.45  ? 175  VAL C CA    1 
ATOM   4545  C  C     . VAL C 2  175  ? -17.236 3.833   26.876  1.00 26.01  ? 175  VAL C C     1 
ATOM   4546  O  O     . VAL C 2  175  ? -18.440 4.078   26.810  1.00 24.74  ? 175  VAL C O     1 
ATOM   4547  C  CB    . VAL C 2  175  ? -16.548 5.208   28.879  1.00 25.23  ? 175  VAL C CB    1 
ATOM   4548  C  CG1   . VAL C 2  175  ? -16.649 3.932   29.700  1.00 27.41  ? 175  VAL C CG1   1 
ATOM   4549  C  CG2   . VAL C 2  175  ? -15.462 6.093   29.456  1.00 26.27  ? 175  VAL C CG2   1 
ATOM   4550  N  N     . VAL C 2  176  ? -16.711 2.677   26.484  1.00 25.74  ? 176  VAL C N     1 
ATOM   4551  C  CA    . VAL C 2  176  ? -17.513 1.629   25.861  1.00 23.49  ? 176  VAL C CA    1 
ATOM   4552  C  C     . VAL C 2  176  ? -18.238 0.814   26.929  1.00 24.96  ? 176  VAL C C     1 
ATOM   4553  O  O     . VAL C 2  176  ? -17.719 0.638   28.029  1.00 27.30  ? 176  VAL C O     1 
ATOM   4554  C  CB    . VAL C 2  176  ? -16.631 0.703   24.988  1.00 24.47  ? 176  VAL C CB    1 
ATOM   4555  C  CG1   . VAL C 2  176  ? -17.451 -0.420  24.377  1.00 27.13  ? 176  VAL C CG1   1 
ATOM   4556  C  CG2   . VAL C 2  176  ? -15.944 1.503   23.894  1.00 25.08  ? 176  VAL C CG2   1 
ATOM   4557  N  N     . SER C 2  177  ? -19.440 0.333   26.614  1.00 24.41  ? 177  SER C N     1 
ATOM   4558  C  CA    . SER C 2  177  ? -20.207 -0.492  27.547  1.00 25.25  ? 177  SER C CA    1 
ATOM   4559  C  C     . SER C 2  177  ? -19.669 -1.918  27.602  1.00 26.83  ? 177  SER C C     1 
ATOM   4560  O  O     . SER C 2  177  ? -19.539 -2.575  26.570  1.00 27.52  ? 177  SER C O     1 
ATOM   4561  C  CB    . SER C 2  177  ? -21.681 -0.510  27.155  1.00 23.78  ? 177  SER C CB    1 
ATOM   4562  O  OG    . SER C 2  177  ? -22.212 0.799   27.134  1.00 25.13  ? 177  SER C OG    1 
ATOM   4563  N  N     . GLN C 2  178  ? -19.374 -2.400  28.808  1.00 28.68  ? 178  GLN C N     1 
ATOM   4564  C  CA    . GLN C 2  178  ? -18.727 -3.702  28.976  1.00 31.14  ? 178  GLN C CA    1 
ATOM   4565  C  C     . GLN C 2  178  ? -19.716 -4.844  29.210  1.00 34.26  ? 178  GLN C C     1 
ATOM   4566  O  O     . GLN C 2  178  ? -20.595 -4.759  30.069  1.00 35.70  ? 178  GLN C O     1 
ATOM   4567  C  CB    . GLN C 2  178  ? -17.713 -3.650  30.131  1.00 32.92  ? 178  GLN C CB    1 
ATOM   4568  C  CG    . GLN C 2  178  ? -16.961 -4.965  30.376  1.00 33.63  ? 178  GLN C CG    1 
ATOM   4569  C  CD    . GLN C 2  178  ? -15.880 -4.844  31.436  1.00 32.99  ? 178  GLN C CD    1 
ATOM   4570  O  OE1   . GLN C 2  178  ? -14.730 -4.541  31.130  1.00 33.27  ? 178  GLN C OE1   1 
ATOM   4571  N  NE2   . GLN C 2  178  ? -16.243 -5.087  32.686  1.00 35.12  ? 178  GLN C NE2   1 
ATOM   4572  N  N     . LEU C 2  179  ? -19.551 -5.919  28.445  1.00 33.26  ? 179  LEU C N     1 
ATOM   4573  C  CA    . LEU C 2  179  ? -20.381 -7.110  28.590  1.00 35.83  ? 179  LEU C CA    1 
ATOM   4574  C  C     . LEU C 2  179  ? -19.776 -8.104  29.576  1.00 39.92  ? 179  LEU C C     1 
ATOM   4575  O  O     . LEU C 2  179  ? -18.802 -8.792  29.262  1.00 41.54  ? 179  LEU C O     1 
ATOM   4576  C  CB    . LEU C 2  179  ? -20.586 -7.793  27.234  1.00 37.41  ? 179  LEU C CB    1 
ATOM   4577  C  CG    . LEU C 2  179  ? -21.800 -7.368  26.407  1.00 36.27  ? 179  LEU C CG    1 
ATOM   4578  C  CD1   . LEU C 2  179  ? -21.875 -8.141  25.090  1.00 36.21  ? 179  LEU C CD1   1 
ATOM   4579  C  CD2   . LEU C 2  179  ? -23.078 -7.552  27.213  1.00 41.53  ? 179  LEU C CD2   1 
ATOM   4580  N  N     . VAL C 2  180  ? -20.360 -8.186  30.766  1.00 43.08  ? 180  VAL C N     1 
ATOM   4581  C  CA    . VAL C 2  180  ? -19.862 -9.101  31.784  1.00 47.85  ? 180  VAL C CA    1 
ATOM   4582  C  C     . VAL C 2  180  ? -20.881 -10.164 32.175  1.00 53.72  ? 180  VAL C C     1 
ATOM   4583  O  O     . VAL C 2  180  ? -22.076 -10.053 31.899  1.00 51.58  ? 180  VAL C O     1 
ATOM   4584  C  CB    . VAL C 2  180  ? -19.426 -8.350  33.071  1.00 47.91  ? 180  VAL C CB    1 
ATOM   4585  C  CG1   . VAL C 2  180  ? -18.052 -7.714  32.894  1.00 44.30  ? 180  VAL C CG1   1 
ATOM   4586  C  CG2   . VAL C 2  180  ? -20.465 -7.313  33.469  1.00 49.26  ? 180  VAL C CG2   1 
ATOM   4587  N  N     . ARG C 2  181  ? -20.369 -11.203 32.816  1.00 63.76  ? 181  ARG C N     1 
ATOM   4588  C  CA    . ARG C 2  181  ? -21.175 -12.240 33.435  1.00 67.55  ? 181  ARG C CA    1 
ATOM   4589  C  C     . ARG C 2  181  ? -21.861 -11.673 34.681  1.00 67.28  ? 181  ARG C C     1 
ATOM   4590  O  O     . ARG C 2  181  ? -21.221 -11.044 35.530  1.00 64.03  ? 181  ARG C O     1 
ATOM   4591  C  CB    . ARG C 2  181  ? -20.276 -13.430 33.774  1.00 74.78  ? 181  ARG C CB    1 
ATOM   4592  C  CG    . ARG C 2  181  ? -20.935 -14.694 34.272  1.00 69.51  ? 181  ARG C CG    1 
ATOM   4593  C  CD    . ARG C 2  181  ? -19.820 -15.637 34.696  1.00 82.64  ? 181  ARG C CD    1 
ATOM   4594  N  NE    . ARG C 2  181  ? -20.234 -17.026 34.845  1.00 100.29 ? 181  ARG C NE    1 
ATOM   4595  C  CZ    . ARG C 2  181  ? -19.381 -18.038 34.981  1.00 111.49 ? 181  ARG C CZ    1 
ATOM   4596  N  NH1   . ARG C 2  181  ? -18.073 -17.807 34.982  1.00 118.33 ? 181  ARG C NH1   1 
ATOM   4597  N  NH2   . ARG C 2  181  ? -19.832 -19.279 35.111  1.00 109.94 ? 181  ARG C NH2   1 
ATOM   4598  N  N     . SER C 2  182  ? -23.168 -11.880 34.776  1.00 68.87  ? 182  SER C N     1 
ATOM   4599  C  CA    . SER C 2  182  ? -23.946 -11.361 35.892  1.00 72.22  ? 182  SER C CA    1 
ATOM   4600  C  C     . SER C 2  182  ? -23.715 -12.182 37.160  1.00 72.66  ? 182  SER C C     1 
ATOM   4601  O  O     . SER C 2  182  ? -23.524 -13.398 37.092  1.00 66.67  ? 182  SER C O     1 
ATOM   4602  C  CB    . SER C 2  182  ? -25.438 -11.339 35.530  1.00 71.98  ? 182  SER C CB    1 
ATOM   4603  O  OG    . SER C 2  182  ? -26.242 -10.915 36.614  1.00 74.62  ? 182  SER C OG    1 
ATOM   4604  N  N     . PRO C 2  183  ? -23.708 -11.511 38.323  1.00 71.87  ? 183  PRO C N     1 
ATOM   4605  C  CA    . PRO C 2  183  ? -23.670 -12.209 39.613  1.00 75.79  ? 183  PRO C CA    1 
ATOM   4606  C  C     . PRO C 2  183  ? -24.932 -13.041 39.809  1.00 84.48  ? 183  PRO C C     1 
ATOM   4607  O  O     . PRO C 2  183  ? -25.958 -12.734 39.205  1.00 86.86  ? 183  PRO C O     1 
ATOM   4608  C  CB    . PRO C 2  183  ? -23.593 -11.070 40.634  1.00 71.43  ? 183  PRO C CB    1 
ATOM   4609  C  CG    . PRO C 2  183  ? -23.083 -9.903  39.872  1.00 76.07  ? 183  PRO C CG    1 
ATOM   4610  C  CD    . PRO C 2  183  ? -23.615 -10.052 38.483  1.00 72.45  ? 183  PRO C CD    1 
ATOM   4611  N  N     . GLY C 2  184  ? -24.858 -14.080 40.633  1.00 89.03  ? 184  GLY C N     1 
ATOM   4612  C  CA    . GLY C 2  184  ? -25.998 -14.949 40.857  1.00 88.33  ? 184  GLY C CA    1 
ATOM   4613  C  C     . GLY C 2  184  ? -25.592 -16.407 40.916  1.00 89.92  ? 184  GLY C C     1 
ATOM   4614  O  O     . GLY C 2  184  ? -24.406 -16.730 40.906  1.00 93.06  ? 184  GLY C O     1 
ATOM   4615  N  N     . VAL C 2  185  ? -26.578 -17.292 40.976  1.00 87.36  ? 185  VAL C N     1 
ATOM   4616  C  CA    . VAL C 2  185  ? -26.304 -18.720 41.068  1.00 89.51  ? 185  VAL C CA    1 
ATOM   4617  C  C     . VAL C 2  185  ? -26.686 -19.433 39.766  1.00 90.00  ? 185  VAL C C     1 
ATOM   4618  O  O     . VAL C 2  185  ? -27.816 -19.316 39.292  1.00 94.76  ? 185  VAL C O     1 
ATOM   4619  C  CB    . VAL C 2  185  ? -27.047 -19.338 42.270  1.00 89.32  ? 185  VAL C CB    1 
ATOM   4620  C  CG1   . VAL C 2  185  ? -28.439 -18.725 42.421  1.00 89.23  ? 185  VAL C CG1   1 
ATOM   4621  C  CG2   . VAL C 2  185  ? -27.114 -20.845 42.144  1.00 95.58  ? 185  VAL C CG2   1 
ATOM   4622  N  N     . TYR C 2  186  ? -25.738 -20.161 39.182  1.00 84.34  ? 186  TYR C N     1 
ATOM   4623  C  CA    . TYR C 2  186  ? -25.953 -20.758 37.866  1.00 85.69  ? 186  TYR C CA    1 
ATOM   4624  C  C     . TYR C 2  186  ? -25.831 -22.277 37.892  1.00 91.15  ? 186  TYR C C     1 
ATOM   4625  O  O     . TYR C 2  186  ? -24.996 -22.839 38.603  1.00 89.85  ? 186  TYR C O     1 
ATOM   4626  C  CB    . TYR C 2  186  ? -24.974 -20.164 36.846  1.00 86.84  ? 186  TYR C CB    1 
ATOM   4627  C  CG    . TYR C 2  186  ? -25.118 -18.666 36.673  1.00 83.66  ? 186  TYR C CG    1 
ATOM   4628  C  CD1   . TYR C 2  186  ? -26.028 -18.136 35.768  1.00 82.66  ? 186  TYR C CD1   1 
ATOM   4629  C  CD2   . TYR C 2  186  ? -24.351 -17.782 37.425  1.00 84.95  ? 186  TYR C CD2   1 
ATOM   4630  C  CE1   . TYR C 2  186  ? -26.168 -16.765 35.614  1.00 84.94  ? 186  TYR C CE1   1 
ATOM   4631  C  CE2   . TYR C 2  186  ? -24.483 -16.411 37.278  1.00 83.45  ? 186  TYR C CE2   1 
ATOM   4632  C  CZ    . TYR C 2  186  ? -25.393 -15.907 36.371  1.00 84.46  ? 186  TYR C CZ    1 
ATOM   4633  O  OH    . TYR C 2  186  ? -25.532 -14.544 36.220  1.00 81.77  ? 186  TYR C OH    1 
ATOM   4634  N  N     . PHE C 2  187  ? -26.676 -22.930 37.101  1.00 95.43  ? 187  PHE C N     1 
ATOM   4635  C  CA    . PHE C 2  187  ? -26.760 -24.385 37.065  1.00 97.03  ? 187  PHE C CA    1 
ATOM   4636  C  C     . PHE C 2  187  ? -26.354 -24.917 35.694  1.00 97.62  ? 187  PHE C C     1 
ATOM   4637  O  O     . PHE C 2  187  ? -26.922 -24.520 34.679  1.00 99.55  ? 187  PHE C O     1 
ATOM   4638  C  CB    . PHE C 2  187  ? -28.182 -24.841 37.413  1.00 93.17  ? 187  PHE C CB    1 
ATOM   4639  C  CG    . PHE C 2  187  ? -28.664 -24.362 38.758  1.00 104.03 ? 187  PHE C CG    1 
ATOM   4640  C  CD1   . PHE C 2  187  ? -29.256 -23.116 38.900  1.00 108.36 ? 187  PHE C CD1   1 
ATOM   4641  C  CD2   . PHE C 2  187  ? -28.528 -25.161 39.881  1.00 109.99 ? 187  PHE C CD2   1 
ATOM   4642  C  CE1   . PHE C 2  187  ? -29.700 -22.675 40.139  1.00 110.34 ? 187  PHE C CE1   1 
ATOM   4643  C  CE2   . PHE C 2  187  ? -28.970 -24.728 41.120  1.00 114.95 ? 187  PHE C CE2   1 
ATOM   4644  C  CZ    . PHE C 2  187  ? -29.554 -23.482 41.250  1.00 113.64 ? 187  PHE C CZ    1 
ATOM   4645  N  N     . ASP C 2  188  ? -25.372 -25.814 35.667  1.00 93.96  ? 188  ASP C N     1 
ATOM   4646  C  CA    . ASP C 2  188  ? -24.870 -26.368 34.410  1.00 98.92  ? 188  ASP C CA    1 
ATOM   4647  C  C     . ASP C 2  188  ? -25.025 -27.885 34.370  1.00 107.17 ? 188  ASP C C     1 
ATOM   4648  O  O     . ASP C 2  188  ? -24.843 -28.559 35.384  1.00 108.26 ? 188  ASP C O     1 
ATOM   4649  C  CB    . ASP C 2  188  ? -23.400 -25.988 34.208  1.00 100.15 ? 188  ASP C CB    1 
ATOM   4650  C  CG    . ASP C 2  188  ? -22.828 -26.523 32.904  1.00 103.28 ? 188  ASP C CG    1 
ATOM   4651  O  OD1   . ASP C 2  188  ? -23.504 -26.403 31.862  1.00 104.25 ? 188  ASP C OD1   1 
ATOM   4652  O  OD2   . ASP C 2  188  ? -21.701 -27.065 32.921  1.00 107.30 ? 188  ASP C OD2   1 
ATOM   4653  N  N     . GLU C 2  189  ? -25.353 -28.419 33.196  1.00 115.88 ? 189  GLU C N     1 
ATOM   4654  C  CA    . GLU C 2  189  ? -25.480 -29.864 33.022  1.00 119.82 ? 189  GLU C CA    1 
ATOM   4655  C  C     . GLU C 2  189  ? -24.315 -30.448 32.226  1.00 118.54 ? 189  GLU C C     1 
ATOM   4656  O  O     . GLU C 2  189  ? -24.229 -30.277 31.008  1.00 113.84 ? 189  GLU C O     1 
ATOM   4657  C  CB    . GLU C 2  189  ? -26.800 -30.211 32.332  1.00 117.31 ? 189  GLU C CB    1 
ATOM   4658  C  CG    . GLU C 2  189  ? -27.044 -31.706 32.180  1.00 121.58 ? 189  GLU C CG    1 
ATOM   4659  C  CD    . GLU C 2  189  ? -28.265 -32.011 31.335  1.00 131.81 ? 189  GLU C CD    1 
ATOM   4660  O  OE1   . GLU C 2  189  ? -28.632 -33.201 31.222  1.00 138.13 ? 189  GLU C OE1   1 
ATOM   4661  O  OE2   . GLU C 2  189  ? -28.855 -31.059 30.780  1.00 132.75 ? 189  GLU C OE2   1 
ATOM   4662  N  N     . THR C 2  190  ? -23.423 -31.141 32.924  1.00 118.81 ? 190  THR C N     1 
ATOM   4663  C  CA    . THR C 2  190  ? -22.293 -31.804 32.286  1.00 120.41 ? 190  THR C CA    1 
ATOM   4664  C  C     . THR C 2  190  ? -22.555 -33.304 32.150  1.00 130.92 ? 190  THR C C     1 
ATOM   4665  O  O     . THR C 2  190  ? -23.012 -33.949 33.096  1.00 134.63 ? 190  THR C O     1 
ATOM   4666  C  CB    . THR C 2  190  ? -20.983 -31.569 33.076  1.00 115.96 ? 190  THR C CB    1 
ATOM   4667  O  OG1   . THR C 2  190  ? -19.965 -32.452 32.592  1.00 115.75 ? 190  THR C OG1   1 
ATOM   4668  C  CG2   . THR C 2  190  ? -21.192 -31.813 34.568  1.00 108.22 ? 190  THR C CG2   1 
ATOM   4669  N  N     . ILE C 2  191  ? -22.283 -33.852 30.968  1.00 134.62 ? 191  ILE C N     1 
ATOM   4670  C  CA    . ILE C 2  191  ? -22.440 -35.288 30.726  1.00 132.36 ? 191  ILE C CA    1 
ATOM   4671  C  C     . ILE C 2  191  ? -21.133 -36.026 31.011  1.00 134.99 ? 191  ILE C C     1 
ATOM   4672  O  O     . ILE C 2  191  ? -20.085 -35.674 30.467  1.00 138.33 ? 191  ILE C O     1 
ATOM   4673  C  CB    . ILE C 2  191  ? -22.884 -35.581 29.275  1.00 119.38 ? 191  ILE C CB    1 
ATOM   4674  C  CG1   . ILE C 2  191  ? -24.262 -34.977 28.996  1.00 108.06 ? 191  ILE C CG1   1 
ATOM   4675  C  CG2   . ILE C 2  191  ? -22.909 -37.078 29.020  1.00 111.51 ? 191  ILE C CG2   1 
ATOM   4676  C  CD1   . ILE C 2  191  ? -25.366 -35.551 29.853  1.00 104.21 ? 191  ILE C CD1   1 
ATOM   4677  N  N     . ASP C 2  192  ? -21.196 -37.047 31.862  1.00 132.24 ? 192  ASP C N     1 
ATOM   4678  C  CA    . ASP C 2  192  ? -20.000 -37.788 32.259  1.00 139.87 ? 192  ASP C CA    1 
ATOM   4679  C  C     . ASP C 2  192  ? -19.455 -38.630 31.102  1.00 140.17 ? 192  ASP C C     1 
ATOM   4680  O  O     . ASP C 2  192  ? -20.215 -39.159 30.290  1.00 138.15 ? 192  ASP C O     1 
ATOM   4681  C  CB    . ASP C 2  192  ? -20.298 -38.677 33.473  1.00 137.74 ? 192  ASP C CB    1 
ATOM   4682  C  CG    . ASP C 2  192  ? -19.037 -39.121 34.202  1.00 140.45 ? 192  ASP C CG    1 
ATOM   4683  O  OD1   . ASP C 2  192  ? -19.070 -40.182 34.862  1.00 139.77 ? 192  ASP C OD1   1 
ATOM   4684  O  OD2   . ASP C 2  192  ? -18.014 -38.409 34.118  1.00 142.49 ? 192  ASP C OD2   1 
ATOM   4685  N  N     . LYS C 2  193  ? -18.132 -38.742 31.031  1.00 137.15 ? 193  LYS C N     1 
ATOM   4686  C  CA    . LYS C 2  193  ? -17.474 -39.479 29.959  1.00 129.41 ? 193  LYS C CA    1 
ATOM   4687  C  C     . LYS C 2  193  ? -17.596 -40.977 30.176  1.00 126.52 ? 193  LYS C C     1 
ATOM   4688  O  O     . LYS C 2  193  ? -17.961 -41.725 29.267  1.00 120.82 ? 193  LYS C O     1 
ATOM   4689  C  CB    . LYS C 2  193  ? -15.999 -39.088 29.873  1.00 133.39 ? 193  LYS C CB    1 
ATOM   4690  C  CG    . LYS C 2  193  ? -15.760 -37.598 29.967  1.00 129.92 ? 193  LYS C CG    1 
ATOM   4691  C  CD    . LYS C 2  193  ? -14.284 -37.277 30.072  1.00 127.20 ? 193  LYS C CD    1 
ATOM   4692  C  CE    . LYS C 2  193  ? -14.076 -35.779 30.173  1.00 124.36 ? 193  LYS C CE    1 
ATOM   4693  N  NZ    . LYS C 2  193  ? -14.648 -35.068 28.995  1.00 128.14 ? 193  LYS C NZ    1 
ATOM   4694  N  N     . SER C 2  194  ? -17.289 -41.401 31.397  1.00 130.80 ? 194  SER C N     1 
ATOM   4695  C  CA    . SER C 2  194  ? -17.256 -42.814 31.752  1.00 137.57 ? 194  SER C CA    1 
ATOM   4696  C  C     . SER C 2  194  ? -18.648 -43.411 31.960  1.00 139.26 ? 194  SER C C     1 
ATOM   4697  O  O     . SER C 2  194  ? -19.072 -44.284 31.202  1.00 140.47 ? 194  SER C O     1 
ATOM   4698  C  CB    . SER C 2  194  ? -16.411 -43.013 33.013  1.00 136.46 ? 194  SER C CB    1 
ATOM   4699  O  OG    . SER C 2  194  ? -16.818 -42.134 34.048  1.00 131.35 ? 194  SER C OG    1 
ATOM   4700  N  N     . THR C 2  195  ? -19.352 -42.943 32.988  1.00 139.00 ? 195  THR C N     1 
ATOM   4701  C  CA    . THR C 2  195  ? -20.652 -43.511 33.347  1.00 135.74 ? 195  THR C CA    1 
ATOM   4702  C  C     . THR C 2  195  ? -21.769 -43.086 32.392  1.00 129.45 ? 195  THR C C     1 
ATOM   4703  O  O     . THR C 2  195  ? -22.847 -43.684 32.389  1.00 123.07 ? 195  THR C O     1 
ATOM   4704  C  CB    . THR C 2  195  ? -21.060 -43.125 34.788  1.00 129.75 ? 195  THR C CB    1 
ATOM   4705  O  OG1   . THR C 2  195  ? -21.180 -41.702 34.895  1.00 126.92 ? 195  THR C OG1   1 
ATOM   4706  C  CG2   . THR C 2  195  ? -20.028 -43.621 35.790  1.00 125.49 ? 195  THR C CG2   1 
ATOM   4707  N  N     . ASP C 2  196  ? -21.502 -42.058 31.589  1.00 129.39 ? 196  ASP C N     1 
ATOM   4708  C  CA    . ASP C 2  196  ? -22.470 -41.532 30.627  1.00 125.07 ? 196  ASP C CA    1 
ATOM   4709  C  C     . ASP C 2  196  ? -23.806 -41.187 31.283  1.00 124.50 ? 196  ASP C C     1 
ATOM   4710  O  O     . ASP C 2  196  ? -24.869 -41.397 30.700  1.00 125.28 ? 196  ASP C O     1 
ATOM   4711  C  CB    . ASP C 2  196  ? -22.681 -42.528 29.483  1.00 120.95 ? 196  ASP C CB    1 
ATOM   4712  C  CG    . ASP C 2  196  ? -21.467 -42.642 28.577  1.00 119.92 ? 196  ASP C CG    1 
ATOM   4713  O  OD1   . ASP C 2  196  ? -20.758 -41.630 28.398  1.00 115.81 ? 196  ASP C OD1   1 
ATOM   4714  O  OD2   . ASP C 2  196  ? -21.221 -43.743 28.043  1.00 127.42 ? 196  ASP C OD2   1 
ATOM   4715  N  N     . LYS C 2  197  ? -23.740 -40.661 32.502  1.00 126.12 ? 197  LYS C N     1 
ATOM   4716  C  CA    . LYS C 2  197  ? -24.929 -40.194 33.201  1.00 125.55 ? 197  LYS C CA    1 
ATOM   4717  C  C     . LYS C 2  197  ? -24.935 -38.668 33.267  1.00 127.75 ? 197  LYS C C     1 
ATOM   4718  O  O     . LYS C 2  197  ? -23.909 -38.023 33.041  1.00 121.92 ? 197  LYS C O     1 
ATOM   4719  C  CB    . LYS C 2  197  ? -25.004 -40.789 34.611  1.00 123.65 ? 197  LYS C CB    1 
ATOM   4720  C  CG    . LYS C 2  197  ? -23.934 -40.275 35.565  1.00 121.48 ? 197  LYS C CG    1 
ATOM   4721  C  CD    . LYS C 2  197  ? -24.108 -40.839 36.968  1.00 115.99 ? 197  LYS C CD    1 
ATOM   4722  C  CE    . LYS C 2  197  ? -23.940 -42.349 36.989  1.00 113.48 ? 197  LYS C CE    1 
ATOM   4723  N  NZ    . LYS C 2  197  ? -24.115 -42.908 38.359  1.00 112.20 ? 197  LYS C NZ    1 
ATOM   4724  N  N     . THR C 2  198  ? -26.095 -38.097 33.572  1.00 129.63 ? 198  THR C N     1 
ATOM   4725  C  CA    . THR C 2  198  ? -26.228 -36.650 33.684  1.00 126.68 ? 198  THR C CA    1 
ATOM   4726  C  C     . THR C 2  198  ? -25.779 -36.153 35.056  1.00 126.01 ? 198  THR C C     1 
ATOM   4727  O  O     . THR C 2  198  ? -26.382 -36.491 36.076  1.00 125.23 ? 198  THR C O     1 
ATOM   4728  C  CB    . THR C 2  198  ? -27.682 -36.197 33.437  1.00 127.28 ? 198  THR C CB    1 
ATOM   4729  O  OG1   . THR C 2  198  ? -28.547 -36.812 34.400  1.00 125.86 ? 198  THR C OG1   1 
ATOM   4730  C  CG2   . THR C 2  198  ? -28.134 -36.582 32.036  1.00 121.69 ? 198  THR C CG2   1 
ATOM   4731  N  N     . LEU C 2  199  ? -24.715 -35.354 35.073  1.00 121.36 ? 199  LEU C N     1 
ATOM   4732  C  CA    . LEU C 2  199  ? -24.237 -34.732 36.303  1.00 118.08 ? 199  LEU C CA    1 
ATOM   4733  C  C     . LEU C 2  199  ? -24.603 -33.258 36.329  1.00 115.08 ? 199  LEU C C     1 
ATOM   4734  O  O     . LEU C 2  199  ? -24.440 -32.553 35.335  1.00 113.53 ? 199  LEU C O     1 
ATOM   4735  C  CB    . LEU C 2  199  ? -22.725 -34.892 36.447  1.00 117.42 ? 199  LEU C CB    1 
ATOM   4736  C  CG    . LEU C 2  199  ? -22.205 -36.326 36.472  1.00 122.45 ? 199  LEU C CG    1 
ATOM   4737  C  CD1   . LEU C 2  199  ? -20.729 -36.342 36.837  1.00 122.35 ? 199  LEU C CD1   1 
ATOM   4738  C  CD2   . LEU C 2  199  ? -23.025 -37.166 37.438  1.00 120.36 ? 199  LEU C CD2   1 
ATOM   4739  N  N     . HIS C 2  200  ? -25.089 -32.794 37.474  1.00 114.23 ? 200  HIS C N     1 
ATOM   4740  C  CA    . HIS C 2  200  ? -25.530 -31.411 37.606  1.00 108.21 ? 200  HIS C CA    1 
ATOM   4741  C  C     . HIS C 2  200  ? -24.631 -30.622 38.551  1.00 102.95 ? 200  HIS C C     1 
ATOM   4742  O  O     . HIS C 2  200  ? -24.380 -31.037 39.682  1.00 100.19 ? 200  HIS C O     1 
ATOM   4743  C  CB    . HIS C 2  200  ? -26.984 -31.365 38.082  1.00 111.39 ? 200  HIS C CB    1 
ATOM   4744  C  CG    . HIS C 2  200  ? -27.976 -31.744 37.024  1.00 118.12 ? 200  HIS C CG    1 
ATOM   4745  N  ND1   . HIS C 2  200  ? -28.920 -30.864 36.540  1.00 117.86 ? 200  HIS C ND1   1 
ATOM   4746  C  CD2   . HIS C 2  200  ? -28.166 -32.905 36.353  1.00 120.27 ? 200  HIS C CD2   1 
ATOM   4747  C  CE1   . HIS C 2  200  ? -29.650 -31.467 35.619  1.00 112.33 ? 200  HIS C CE1   1 
ATOM   4748  N  NE2   . HIS C 2  200  ? -29.213 -32.706 35.486  1.00 115.68 ? 200  HIS C NE2   1 
ATOM   4749  N  N     . SER C 2  201  ? -24.146 -29.481 38.068  1.00 101.26 ? 201  SER C N     1 
ATOM   4750  C  CA    . SER C 2  201  ? -23.196 -28.666 38.814  1.00 100.96 ? 201  SER C CA    1 
ATOM   4751  C  C     . SER C 2  201  ? -23.695 -27.240 39.017  1.00 94.51  ? 201  SER C C     1 
ATOM   4752  O  O     . SER C 2  201  ? -24.230 -26.621 38.099  1.00 93.42  ? 201  SER C O     1 
ATOM   4753  C  CB    . SER C 2  201  ? -21.845 -28.640 38.096  1.00 105.34 ? 201  SER C CB    1 
ATOM   4754  O  OG    . SER C 2  201  ? -21.981 -28.120 36.785  1.00 100.94 ? 201  SER C OG    1 
ATOM   4755  N  N     . VAL C 2  202  ? -23.509 -26.725 40.227  1.00 92.90  ? 202  VAL C N     1 
ATOM   4756  C  CA    . VAL C 2  202  ? -23.916 -25.366 40.555  1.00 95.34  ? 202  VAL C CA    1 
ATOM   4757  C  C     . VAL C 2  202  ? -22.691 -24.497 40.838  1.00 102.96 ? 202  VAL C C     1 
ATOM   4758  O  O     . VAL C 2  202  ? -21.653 -25.002 41.266  1.00 100.99 ? 202  VAL C O     1 
ATOM   4759  C  CB    . VAL C 2  202  ? -24.858 -25.338 41.775  1.00 94.27  ? 202  VAL C CB    1 
ATOM   4760  C  CG1   . VAL C 2  202  ? -25.625 -24.038 41.824  1.00 93.72  ? 202  VAL C CG1   1 
ATOM   4761  C  CG2   . VAL C 2  202  ? -25.822 -26.500 41.721  1.00 95.88  ? 202  VAL C CG2   1 
ATOM   4762  N  N     . LYS C 2  203  ? -22.814 -23.196 40.582  1.00 104.26 ? 203  LYS C N     1 
ATOM   4763  C  CA    . LYS C 2  203  ? -21.760 -22.231 40.893  1.00 96.08  ? 203  LYS C CA    1 
ATOM   4764  C  C     . LYS C 2  203  ? -22.362 -20.902 41.363  1.00 91.71  ? 203  LYS C C     1 
ATOM   4765  O  O     . LYS C 2  203  ? -23.195 -20.309 40.676  1.00 89.63  ? 203  LYS C O     1 
ATOM   4766  C  CB    . LYS C 2  203  ? -20.853 -22.009 39.677  1.00 91.16  ? 203  LYS C CB    1 
ATOM   4767  C  CG    . LYS C 2  203  ? -19.970 -23.205 39.325  1.00 93.37  ? 203  LYS C CG    1 
ATOM   4768  C  CD    . LYS C 2  203  ? -19.467 -23.142 37.891  1.00 82.67  ? 203  LYS C CD    1 
ATOM   4769  C  CE    . LYS C 2  203  ? -18.696 -24.401 37.521  1.00 83.88  ? 203  LYS C CE    1 
ATOM   4770  N  NZ    . LYS C 2  203  ? -18.281 -24.391 36.093  1.00 80.37  ? 203  LYS C NZ    1 
ATOM   4771  N  N     . VAL C 2  204  ? -21.938 -20.454 42.544  1.00 94.87  ? 204  VAL C N     1 
ATOM   4772  C  CA    . VAL C 2  204  ? -22.398 -19.192 43.126  1.00 95.31  ? 204  VAL C CA    1 
ATOM   4773  C  C     . VAL C 2  204  ? -21.347 -18.091 42.976  1.00 100.70 ? 204  VAL C C     1 
ATOM   4774  O  O     . VAL C 2  204  ? -20.251 -18.182 43.534  1.00 107.61 ? 204  VAL C O     1 
ATOM   4775  C  CB    . VAL C 2  204  ? -22.745 -19.355 44.622  1.00 84.88  ? 204  VAL C CB    1 
ATOM   4776  C  CG1   . VAL C 2  204  ? -22.932 -17.996 45.286  1.00 78.92  ? 204  VAL C CG1   1 
ATOM   4777  C  CG2   . VAL C 2  204  ? -23.986 -20.216 44.786  1.00 76.88  ? 204  VAL C CG2   1 
ATOM   4778  N  N     . ILE C 2  205  ? -21.688 -17.047 42.227  1.00 96.43  ? 205  ILE C N     1 
ATOM   4779  C  CA    . ILE C 2  205  ? -20.734 -15.986 41.931  1.00 90.49  ? 205  ILE C CA    1 
ATOM   4780  C  C     . ILE C 2  205  ? -21.154 -14.661 42.566  1.00 87.29  ? 205  ILE C C     1 
ATOM   4781  O  O     . ILE C 2  205  ? -22.211 -14.112 42.248  1.00 84.54  ? 205  ILE C O     1 
ATOM   4782  C  CB    . ILE C 2  205  ? -20.566 -15.796 40.409  1.00 87.64  ? 205  ILE C CB    1 
ATOM   4783  C  CG1   . ILE C 2  205  ? -20.793 -17.123 39.681  1.00 85.63  ? 205  ILE C CG1   1 
ATOM   4784  C  CG2   . ILE C 2  205  ? -19.191 -15.213 40.087  1.00 86.91  ? 205  ILE C CG2   1 
ATOM   4785  C  CD1   . ILE C 2  205  ? -20.898 -16.990 38.179  1.00 89.90  ? 205  ILE C CD1   1 
ATOM   4786  N  N     . PRO C 2  206  ? -20.327 -14.149 43.484  1.00 88.39  ? 206  PRO C N     1 
ATOM   4787  C  CA    . PRO C 2  206  ? -20.585 -12.840 44.085  1.00 91.39  ? 206  PRO C CA    1 
ATOM   4788  C  C     . PRO C 2  206  ? -20.152 -11.707 43.168  1.00 87.88  ? 206  PRO C C     1 
ATOM   4789  O  O     . PRO C 2  206  ? -19.509 -11.955 42.150  1.00 87.00  ? 206  PRO C O     1 
ATOM   4790  C  CB    . PRO C 2  206  ? -19.735 -12.870 45.356  1.00 100.60 ? 206  PRO C CB    1 
ATOM   4791  C  CG    . PRO C 2  206  ? -18.585 -13.750 44.996  1.00 104.16 ? 206  PRO C CG    1 
ATOM   4792  C  CD    . PRO C 2  206  ? -19.153 -14.810 44.082  1.00 98.49  ? 206  PRO C CD    1 
ATOM   4793  N  N     . SER C 2  207  ? -20.512 -10.479 43.521  1.00 89.17  ? 207  SER C N     1 
ATOM   4794  C  CA    . SER C 2  207  ? -19.964 -9.312  42.844  1.00 90.80  ? 207  SER C CA    1 
ATOM   4795  C  C     . SER C 2  207  ? -18.480 -9.206  43.179  1.00 101.09 ? 207  SER C C     1 
ATOM   4796  O  O     . SER C 2  207  ? -17.670 -8.779  42.355  1.00 110.28 ? 207  SER C O     1 
ATOM   4797  C  CB    . SER C 2  207  ? -20.706 -8.041  43.255  1.00 86.34  ? 207  SER C CB    1 
ATOM   4798  O  OG    . SER C 2  207  ? -20.083 -6.891  42.717  1.00 82.61  ? 207  SER C OG    1 
ATOM   4799  N  N     . ARG C 2  208  ? -18.137 -9.609  44.398  1.00 96.84  ? 208  ARG C N     1 
ATOM   4800  C  CA    . ARG C 2  208  ? -16.754 -9.643  44.856  1.00 94.57  ? 208  ARG C CA    1 
ATOM   4801  C  C     . ARG C 2  208  ? -16.641 -10.513 46.103  1.00 93.23  ? 208  ARG C C     1 
ATOM   4802  O  O     . ARG C 2  208  ? -17.260 -10.226 47.126  1.00 98.33  ? 208  ARG C O     1 
ATOM   4803  C  CB    . ARG C 2  208  ? -16.238 -8.228  45.145  1.00 100.15 ? 208  ARG C CB    1 
ATOM   4804  C  CG    . ARG C 2  208  ? -17.181 -7.375  45.990  1.00 102.37 ? 208  ARG C CG    1 
ATOM   4805  C  CD    . ARG C 2  208  ? -16.476 -6.155  46.566  1.00 112.12 ? 208  ARG C CD    1 
ATOM   4806  N  NE    . ARG C 2  208  ? -17.373 -5.333  47.377  1.00 120.24 ? 208  ARG C NE    1 
ATOM   4807  C  CZ    . ARG C 2  208  ? -17.579 -5.510  48.679  1.00 110.05 ? 208  ARG C CZ    1 
ATOM   4808  N  NH1   . ARG C 2  208  ? -16.954 -6.486  49.325  1.00 98.86  ? 208  ARG C NH1   1 
ATOM   4809  N  NH2   . ARG C 2  208  ? -18.414 -4.713  49.334  1.00 110.00 ? 208  ARG C NH2   1 
ATOM   4810  N  N     . GLY C 2  209  ? -15.863 -11.585 46.019  1.00 94.75  ? 209  GLY C N     1 
ATOM   4811  C  CA    . GLY C 2  209  ? -15.672 -12.437 47.177  1.00 103.15 ? 209  GLY C CA    1 
ATOM   4812  C  C     . GLY C 2  209  ? -15.168 -13.831 46.872  1.00 114.85 ? 209  GLY C C     1 
ATOM   4813  O  O     . GLY C 2  209  ? -14.626 -14.094 45.795  1.00 118.90 ? 209  GLY C O     1 
ATOM   4814  N  N     . ALA C 2  210  ? -15.348 -14.728 47.836  1.00 117.48 ? 210  ALA C N     1 
ATOM   4815  C  CA    . ALA C 2  210  ? -14.886 -16.101 47.704  1.00 117.78 ? 210  ALA C CA    1 
ATOM   4816  C  C     . ALA C 2  210  ? -15.860 -16.928 46.881  1.00 116.00 ? 210  ALA C C     1 
ATOM   4817  O  O     . ALA C 2  210  ? -17.046 -16.603 46.779  1.00 110.87 ? 210  ALA C O     1 
ATOM   4818  C  CB    . ALA C 2  210  ? -14.685 -16.729 49.076  1.00 113.42 ? 210  ALA C CB    1 
ATOM   4819  N  N     . TRP C 2  211  ? -15.348 -18.002 46.294  1.00 119.81 ? 211  TRP C N     1 
ATOM   4820  C  CA    . TRP C 2  211  ? -16.159 -18.879 45.464  1.00 121.61 ? 211  TRP C CA    1 
ATOM   4821  C  C     . TRP C 2  211  ? -16.879 -19.943 46.285  1.00 122.54 ? 211  TRP C C     1 
ATOM   4822  O  O     . TRP C 2  211  ? -16.498 -20.232 47.421  1.00 123.39 ? 211  TRP C O     1 
ATOM   4823  C  CB    . TRP C 2  211  ? -15.294 -19.540 44.394  1.00 126.05 ? 211  TRP C CB    1 
ATOM   4824  C  CG    . TRP C 2  211  ? -15.149 -18.704 43.172  1.00 128.02 ? 211  TRP C CG    1 
ATOM   4825  C  CD1   . TRP C 2  211  ? -15.139 -17.342 43.104  1.00 125.97 ? 211  TRP C CD1   1 
ATOM   4826  C  CD2   . TRP C 2  211  ? -15.021 -19.179 41.830  1.00 131.13 ? 211  TRP C CD2   1 
ATOM   4827  N  NE1   . TRP C 2  211  ? -14.999 -16.940 41.797  1.00 139.32 ? 211  TRP C NE1   1 
ATOM   4828  C  CE2   . TRP C 2  211  ? -14.926 -18.048 40.997  1.00 137.76 ? 211  TRP C CE2   1 
ATOM   4829  C  CE3   . TRP C 2  211  ? -14.972 -20.451 41.255  1.00 127.12 ? 211  TRP C CE3   1 
ATOM   4830  C  CZ2   . TRP C 2  211  ? -14.785 -18.153 39.619  1.00 145.35 ? 211  TRP C CZ2   1 
ATOM   4831  C  CZ3   . TRP C 2  211  ? -14.833 -20.552 39.888  1.00 131.90 ? 211  TRP C CZ3   1 
ATOM   4832  C  CH2   . TRP C 2  211  ? -14.740 -19.409 39.085  1.00 142.10 ? 211  TRP C CH2   1 
ATOM   4833  N  N     . LEU C 2  212  ? -17.920 -20.520 45.692  1.00 122.06 ? 212  LEU C N     1 
ATOM   4834  C  CA    . LEU C 2  212  ? -18.757 -21.513 46.356  1.00 112.24 ? 212  LEU C CA    1 
ATOM   4835  C  C     . LEU C 2  212  ? -19.569 -22.304 45.330  1.00 108.85 ? 212  LEU C C     1 
ATOM   4836  O  O     . LEU C 2  212  ? -20.527 -21.784 44.758  1.00 104.62 ? 212  LEU C O     1 
ATOM   4837  C  CB    . LEU C 2  212  ? -19.693 -20.837 47.360  1.00 104.35 ? 212  LEU C CB    1 
ATOM   4838  C  CG    . LEU C 2  212  ? -20.457 -21.755 48.311  1.00 99.74  ? 212  LEU C CG    1 
ATOM   4839  C  CD1   . LEU C 2  212  ? -19.484 -22.553 49.154  1.00 107.17 ? 212  LEU C CD1   1 
ATOM   4840  C  CD2   . LEU C 2  212  ? -21.394 -20.955 49.196  1.00 96.50  ? 212  LEU C CD2   1 
ATOM   4841  N  N     . GLU C 2  213  ? -19.190 -23.559 45.100  1.00 115.21 ? 213  GLU C N     1 
ATOM   4842  C  CA    . GLU C 2  213  ? -19.863 -24.384 44.097  1.00 115.27 ? 213  GLU C CA    1 
ATOM   4843  C  C     . GLU C 2  213  ? -20.255 -25.773 44.613  1.00 116.57 ? 213  GLU C C     1 
ATOM   4844  O  O     . GLU C 2  213  ? -19.425 -26.511 45.143  1.00 120.00 ? 213  GLU C O     1 
ATOM   4845  C  CB    . GLU C 2  213  ? -18.977 -24.527 42.855  1.00 117.74 ? 213  GLU C CB    1 
ATOM   4846  C  CG    . GLU C 2  213  ? -17.540 -24.932 43.149  1.00 122.01 ? 213  GLU C CG    1 
ATOM   4847  C  CD    . GLU C 2  213  ? -16.728 -25.181 41.892  1.00 123.47 ? 213  GLU C CD    1 
ATOM   4848  O  OE1   . GLU C 2  213  ? -15.505 -24.925 41.919  1.00 131.13 ? 213  GLU C OE1   1 
ATOM   4849  O  OE2   . GLU C 2  213  ? -17.307 -25.638 40.883  1.00 117.93 ? 213  GLU C OE2   1 
ATOM   4850  N  N     . PHE C 2  214  ? -21.527 -26.121 44.449  1.00 112.08 ? 214  PHE C N     1 
ATOM   4851  C  CA    . PHE C 2  214  ? -22.010 -27.454 44.793  1.00 114.22 ? 214  PHE C CA    1 
ATOM   4852  C  C     . PHE C 2  214  ? -22.168 -28.302 43.532  1.00 121.61 ? 214  PHE C C     1 
ATOM   4853  O  O     . PHE C 2  214  ? -22.929 -27.943 42.633  1.00 121.15 ? 214  PHE C O     1 
ATOM   4854  C  CB    . PHE C 2  214  ? -23.346 -27.378 45.537  1.00 114.57 ? 214  PHE C CB    1 
ATOM   4855  C  CG    . PHE C 2  214  ? -23.314 -26.514 46.764  1.00 111.02 ? 214  PHE C CG    1 
ATOM   4856  C  CD1   . PHE C 2  214  ? -22.836 -27.012 47.962  1.00 114.24 ? 214  PHE C CD1   1 
ATOM   4857  C  CD2   . PHE C 2  214  ? -23.780 -25.211 46.724  1.00 108.24 ? 214  PHE C CD2   1 
ATOM   4858  C  CE1   . PHE C 2  214  ? -22.810 -26.223 49.095  1.00 118.82 ? 214  PHE C CE1   1 
ATOM   4859  C  CE2   . PHE C 2  214  ? -23.759 -24.415 47.854  1.00 104.99 ? 214  PHE C CE2   1 
ATOM   4860  C  CZ    . PHE C 2  214  ? -23.273 -24.922 49.041  1.00 110.57 ? 214  PHE C CZ    1 
ATOM   4861  N  N     . ASP C 2  215  ? -21.453 -29.421 43.464  1.00 124.08 ? 215  ASP C N     1 
ATOM   4862  C  CA    . ASP C 2  215  ? -21.530 -30.299 42.298  1.00 122.12 ? 215  ASP C CA    1 
ATOM   4863  C  C     . ASP C 2  215  ? -22.104 -31.658 42.677  1.00 125.02 ? 215  ASP C C     1 
ATOM   4864  O  O     . ASP C 2  215  ? -22.230 -31.978 43.858  1.00 129.53 ? 215  ASP C O     1 
ATOM   4865  C  CB    . ASP C 2  215  ? -20.151 -30.474 41.656  1.00 120.87 ? 215  ASP C CB    1 
ATOM   4866  C  CG    . ASP C 2  215  ? -19.521 -29.154 41.253  1.00 128.79 ? 215  ASP C CG    1 
ATOM   4867  O  OD1   . ASP C 2  215  ? -20.269 -28.202 40.940  1.00 126.40 ? 215  ASP C OD1   1 
ATOM   4868  O  OD2   . ASP C 2  215  ? -18.275 -29.070 41.248  1.00 132.52 ? 215  ASP C OD2   1 
ATOM   4869  N  N     . VAL C 2  216  ? -22.455 -32.455 41.673  1.00 126.29 ? 216  VAL C N     1 
ATOM   4870  C  CA    . VAL C 2  216  ? -22.969 -33.798 41.919  1.00 126.70 ? 216  VAL C CA    1 
ATOM   4871  C  C     . VAL C 2  216  ? -22.105 -34.848 41.235  1.00 123.94 ? 216  VAL C C     1 
ATOM   4872  O  O     . VAL C 2  216  ? -21.905 -34.815 40.019  1.00 116.61 ? 216  VAL C O     1 
ATOM   4873  C  CB    . VAL C 2  216  ? -24.427 -33.952 41.447  1.00 116.66 ? 216  VAL C CB    1 
ATOM   4874  C  CG1   . VAL C 2  216  ? -24.843 -35.411 41.486  1.00 118.40 ? 216  VAL C CG1   1 
ATOM   4875  C  CG2   . VAL C 2  216  ? -25.350 -33.126 42.320  1.00 112.09 ? 216  VAL C CG2   1 
ATOM   4876  N  N     . ASP C 2  217  ? -21.593 -35.776 42.035  1.00 127.05 ? 217  ASP C N     1 
ATOM   4877  C  CA    . ASP C 2  217  ? -20.753 -36.855 41.536  1.00 133.28 ? 217  ASP C CA    1 
ATOM   4878  C  C     . ASP C 2  217  ? -21.526 -37.870 40.705  1.00 143.28 ? 217  ASP C C     1 
ATOM   4879  O  O     . ASP C 2  217  ? -22.748 -37.780 40.557  1.00 143.05 ? 217  ASP C O     1 
ATOM   4880  C  CB    . ASP C 2  217  ? -20.070 -37.579 42.701  1.00 129.51 ? 217  ASP C CB    1 
ATOM   4881  C  CG    . ASP C 2  217  ? -18.782 -36.914 43.123  1.00 127.64 ? 217  ASP C CG    1 
ATOM   4882  O  OD1   . ASP C 2  217  ? -18.220 -36.151 42.311  1.00 136.24 ? 217  ASP C OD1   1 
ATOM   4883  O  OD2   . ASP C 2  217  ? -18.329 -37.156 44.261  1.00 121.96 ? 217  ASP C OD2   1 
ATOM   4884  N  N     . LYS C 2  218  ? -20.789 -38.835 40.162  1.00 149.32 ? 218  LYS C N     1 
ATOM   4885  C  CA    . LYS C 2  218  ? -21.374 -40.001 39.514  1.00 144.72 ? 218  LYS C CA    1 
ATOM   4886  C  C     . LYS C 2  218  ? -21.676 -41.039 40.583  1.00 136.83 ? 218  LYS C C     1 
ATOM   4887  O  O     . LYS C 2  218  ? -22.298 -42.069 40.320  1.00 132.53 ? 218  LYS C O     1 
ATOM   4888  C  CB    . LYS C 2  218  ? -20.427 -40.571 38.450  1.00 139.04 ? 218  LYS C CB    1 
ATOM   4889  C  CG    . LYS C 2  218  ? -19.045 -40.954 38.973  1.00 130.14 ? 218  LYS C CG    1 
ATOM   4890  C  CD    . LYS C 2  218  ? -18.075 -41.236 37.829  1.00 128.19 ? 218  LYS C CD    1 
ATOM   4891  C  CE    . LYS C 2  218  ? -16.648 -41.405 38.334  1.00 125.80 ? 218  LYS C CE    1 
ATOM   4892  N  NZ    . LYS C 2  218  ? -15.664 -41.547 37.222  1.00 119.33 ? 218  LYS C NZ    1 
ATOM   4893  N  N     . ARG C 2  219  ? -21.226 -40.742 41.798  1.00 135.28 ? 219  ARG C N     1 
ATOM   4894  C  CA    . ARG C 2  219  ? -21.381 -41.638 42.934  1.00 140.05 ? 219  ARG C CA    1 
ATOM   4895  C  C     . ARG C 2  219  ? -22.624 -41.287 43.748  1.00 142.41 ? 219  ARG C C     1 
ATOM   4896  O  O     . ARG C 2  219  ? -22.821 -41.806 44.849  1.00 148.40 ? 219  ARG C O     1 
ATOM   4897  C  CB    . ARG C 2  219  ? -20.134 -41.583 43.821  1.00 140.43 ? 219  ARG C CB    1 
ATOM   4898  C  CG    . ARG C 2  219  ? -18.818 -41.663 43.055  1.00 138.27 ? 219  ARG C CG    1 
ATOM   4899  C  CD    . ARG C 2  219  ? -18.748 -42.908 42.177  1.00 141.50 ? 219  ARG C CD    1 
ATOM   4900  N  NE    . ARG C 2  219  ? -17.407 -43.123 41.636  1.00 143.14 ? 219  ARG C NE    1 
ATOM   4901  C  CZ    . ARG C 2  219  ? -17.074 -44.130 40.833  1.00 136.74 ? 219  ARG C CZ    1 
ATOM   4902  N  NH1   . ARG C 2  219  ? -17.987 -45.019 40.468  1.00 139.03 ? 219  ARG C NH1   1 
ATOM   4903  N  NH2   . ARG C 2  219  ? -15.828 -44.247 40.394  1.00 131.15 ? 219  ARG C NH2   1 
ATOM   4904  N  N     . ASP C 2  220  ? -23.451 -40.401 43.196  1.00 138.15 ? 220  ASP C N     1 
ATOM   4905  C  CA    . ASP C 2  220  ? -24.672 -39.935 43.851  1.00 139.93 ? 220  ASP C CA    1 
ATOM   4906  C  C     . ASP C 2  220  ? -24.386 -39.319 45.224  1.00 137.54 ? 220  ASP C C     1 
ATOM   4907  O  O     . ASP C 2  220  ? -25.201 -39.415 46.142  1.00 133.05 ? 220  ASP C O     1 
ATOM   4908  C  CB    . ASP C 2  220  ? -25.684 -41.080 43.976  1.00 134.31 ? 220  ASP C CB    1 
ATOM   4909  C  CG    . ASP C 2  220  ? -26.196 -41.556 42.626  1.00 128.96 ? 220  ASP C CG    1 
ATOM   4910  O  OD1   . ASP C 2  220  ? -27.335 -42.065 42.565  1.00 126.58 ? 220  ASP C OD1   1 
ATOM   4911  O  OD2   . ASP C 2  220  ? -25.460 -41.417 41.624  1.00 123.42 ? 220  ASP C OD2   1 
ATOM   4912  N  N     . THR C 2  221  ? -23.220 -38.686 45.350  1.00 139.19 ? 221  THR C N     1 
ATOM   4913  C  CA    . THR C 2  221  ? -22.829 -37.990 46.574  1.00 135.05 ? 221  THR C CA    1 
ATOM   4914  C  C     . THR C 2  221  ? -22.508 -36.530 46.283  1.00 130.47 ? 221  THR C C     1 
ATOM   4915  O  O     . THR C 2  221  ? -21.627 -36.225 45.479  1.00 126.85 ? 221  THR C O     1 
ATOM   4916  C  CB    . THR C 2  221  ? -21.603 -38.639 47.242  1.00 133.72 ? 221  THR C CB    1 
ATOM   4917  O  OG1   . THR C 2  221  ? -20.466 -38.522 46.378  1.00 135.15 ? 221  THR C OG1   1 
ATOM   4918  C  CG2   . THR C 2  221  ? -21.866 -40.104 47.536  1.00 130.82 ? 221  THR C CG2   1 
ATOM   4919  N  N     . VAL C 2  222  ? -23.220 -35.630 46.950  1.00 129.55 ? 222  VAL C N     1 
ATOM   4920  C  CA    . VAL C 2  222  ? -23.066 -34.204 46.708  1.00 124.23 ? 222  VAL C CA    1 
ATOM   4921  C  C     . VAL C 2  222  ? -21.802 -33.663 47.371  1.00 121.60 ? 222  VAL C C     1 
ATOM   4922  O  O     . VAL C 2  222  ? -21.497 -33.992 48.517  1.00 117.84 ? 222  VAL C O     1 
ATOM   4923  C  CB    . VAL C 2  222  ? -24.295 -33.428 47.210  1.00 121.36 ? 222  VAL C CB    1 
ATOM   4924  C  CG1   . VAL C 2  222  ? -24.181 -31.958 46.853  1.00 119.11 ? 222  VAL C CG1   1 
ATOM   4925  C  CG2   . VAL C 2  222  ? -25.562 -34.023 46.615  1.00 122.29 ? 222  VAL C CG2   1 
ATOM   4926  N  N     . GLY C 2  223  ? -21.067 -32.840 46.630  1.00 127.30 ? 223  GLY C N     1 
ATOM   4927  C  CA    . GLY C 2  223  ? -19.826 -32.263 47.112  1.00 128.94 ? 223  GLY C CA    1 
ATOM   4928  C  C     . GLY C 2  223  ? -19.731 -30.773 46.847  1.00 130.08 ? 223  GLY C C     1 
ATOM   4929  O  O     . GLY C 2  223  ? -20.332 -30.258 45.904  1.00 126.71 ? 223  GLY C O     1 
ATOM   4930  N  N     . VAL C 2  224  ? -18.967 -30.078 47.683  1.00 128.94 ? 224  VAL C N     1 
ATOM   4931  C  CA    . VAL C 2  224  ? -18.849 -28.628 47.590  1.00 128.97 ? 224  VAL C CA    1 
ATOM   4932  C  C     . VAL C 2  224  ? -17.386 -28.193 47.563  1.00 135.51 ? 224  VAL C C     1 
ATOM   4933  O  O     . VAL C 2  224  ? -16.573 -28.672 48.354  1.00 139.47 ? 224  VAL C O     1 
ATOM   4934  C  CB    . VAL C 2  224  ? -19.582 -27.928 48.769  1.00 128.82 ? 224  VAL C CB    1 
ATOM   4935  C  CG1   . VAL C 2  224  ? -19.287 -28.632 50.084  1.00 135.35 ? 224  VAL C CG1   1 
ATOM   4936  C  CG2   . VAL C 2  224  ? -19.216 -26.450 48.849  1.00 121.87 ? 224  VAL C CG2   1 
ATOM   4937  N  N     . ARG C 2  225  ? -17.054 -27.302 46.633  1.00 136.60 ? 225  ARG C N     1 
ATOM   4938  C  CA    . ARG C 2  225  ? -15.725 -26.698 46.577  1.00 133.82 ? 225  ARG C CA    1 
ATOM   4939  C  C     . ARG C 2  225  ? -15.796 -25.223 46.964  1.00 132.34 ? 225  ARG C C     1 
ATOM   4940  O  O     . ARG C 2  225  ? -16.522 -24.451 46.340  1.00 134.18 ? 225  ARG C O     1 
ATOM   4941  C  CB    . ARG C 2  225  ? -15.116 -26.838 45.180  1.00 127.12 ? 225  ARG C CB    1 
ATOM   4942  C  CG    . ARG C 2  225  ? -14.727 -28.253 44.786  1.00 125.69 ? 225  ARG C CG    1 
ATOM   4943  C  CD    . ARG C 2  225  ? -13.725 -28.220 43.642  1.00 131.96 ? 225  ARG C CD    1 
ATOM   4944  N  NE    . ARG C 2  225  ? -12.755 -29.309 43.717  1.00 138.33 ? 225  ARG C NE    1 
ATOM   4945  C  CZ    . ARG C 2  225  ? -11.599 -29.318 43.060  1.00 142.66 ? 225  ARG C CZ    1 
ATOM   4946  N  NH1   . ARG C 2  225  ? -11.273 -28.293 42.283  1.00 140.44 ? 225  ARG C NH1   1 
ATOM   4947  N  NH2   . ARG C 2  225  ? -10.768 -30.346 43.179  1.00 144.08 ? 225  ARG C NH2   1 
ATOM   4948  N  N     . ILE C 2  226  ? -15.040 -24.835 47.989  1.00 125.03 ? 226  ILE C N     1 
ATOM   4949  C  CA    . ILE C 2  226  ? -15.020 -23.450 48.461  1.00 130.14 ? 226  ILE C CA    1 
ATOM   4950  C  C     . ILE C 2  226  ? -13.730 -22.740 48.038  1.00 138.34 ? 226  ILE C C     1 
ATOM   4951  O  O     . ILE C 2  226  ? -12.651 -23.081 48.519  1.00 141.48 ? 226  ILE C O     1 
ATOM   4952  C  CB    . ILE C 2  226  ? -15.165 -23.384 50.001  1.00 119.74 ? 226  ILE C CB    1 
ATOM   4953  C  CG1   . ILE C 2  226  ? -16.458 -24.072 50.444  1.00 107.91 ? 226  ILE C CG1   1 
ATOM   4954  C  CG2   . ILE C 2  226  ? -15.120 -21.942 50.497  1.00 115.29 ? 226  ILE C CG2   1 
ATOM   4955  C  CD1   . ILE C 2  226  ? -16.688 -24.032 51.935  1.00 109.74 ? 226  ILE C CD1   1 
ATOM   4956  N  N     . ASP C 2  227  ? -13.852 -21.758 47.143  1.00 136.50 ? 227  ASP C N     1 
ATOM   4957  C  CA    . ASP C 2  227  ? -12.699 -21.041 46.588  1.00 136.64 ? 227  ASP C CA    1 
ATOM   4958  C  C     . ASP C 2  227  ? -11.709 -22.025 45.961  1.00 136.41 ? 227  ASP C C     1 
ATOM   4959  O  O     . ASP C 2  227  ? -10.497 -21.905 46.146  1.00 137.56 ? 227  ASP C O     1 
ATOM   4960  C  CB    . ASP C 2  227  ? -12.007 -20.196 47.667  1.00 136.19 ? 227  ASP C CB    1 
ATOM   4961  C  CG    . ASP C 2  227  ? -11.324 -18.959 47.102  1.00 139.03 ? 227  ASP C CG    1 
ATOM   4962  O  OD1   . ASP C 2  227  ? -11.123 -18.888 45.870  1.00 146.86 ? 227  ASP C OD1   1 
ATOM   4963  O  OD2   . ASP C 2  227  ? -10.983 -18.058 47.898  1.00 134.02 ? 227  ASP C OD2   1 
ATOM   4964  N  N     . ARG C 2  228  ? -12.251 -23.001 45.236  1.00 130.18 ? 228  ARG C N     1 
ATOM   4965  C  CA    . ARG C 2  228  ? -11.473 -24.053 44.578  1.00 129.12 ? 228  ARG C CA    1 
ATOM   4966  C  C     . ARG C 2  228  ? -10.597 -24.878 45.531  1.00 131.79 ? 228  ARG C C     1 
ATOM   4967  O  O     . ARG C 2  228  ? -9.427  -25.128 45.241  1.00 127.02 ? 228  ARG C O     1 
ATOM   4968  C  CB    . ARG C 2  228  ? -10.601 -23.452 43.470  1.00 128.63 ? 228  ARG C CB    1 
ATOM   4969  N  N     . LYS C 2  229  ? -11.168 -25.300 46.659  1.00 136.81 ? 229  LYS C N     1 
ATOM   4970  C  CA    . LYS C 2  229  ? -10.529 -26.299 47.519  1.00 142.20 ? 229  LYS C CA    1 
ATOM   4971  C  C     . LYS C 2  229  ? -11.037 -27.698 47.134  1.00 139.76 ? 229  LYS C C     1 
ATOM   4972  O  O     . LYS C 2  229  ? -11.908 -27.828 46.271  1.00 136.85 ? 229  LYS C O     1 
ATOM   4973  C  CB    . LYS C 2  229  ? -10.798 -26.019 49.005  1.00 134.34 ? 229  LYS C CB    1 
ATOM   4974  C  CG    . LYS C 2  229  ? -10.238 -24.697 49.530  1.00 124.16 ? 229  LYS C CG    1 
ATOM   4975  C  CD    . LYS C 2  229  ? -8.753  -24.542 49.253  1.00 123.31 ? 229  LYS C CD    1 
ATOM   4976  C  CE    . LYS C 2  229  ? -8.291  -23.120 49.551  1.00 126.11 ? 229  LYS C CE    1 
ATOM   4977  N  NZ    . LYS C 2  229  ? -9.009  -22.111 48.717  1.00 126.53 ? 229  LYS C NZ    1 
ATOM   4978  N  N     . ARG C 2  230  ? -10.496 -28.737 47.769  1.00 135.92 ? 230  ARG C N     1 
ATOM   4979  C  CA    . ARG C 2  230  ? -10.871 -30.124 47.466  1.00 125.08 ? 230  ARG C CA    1 
ATOM   4980  C  C     . ARG C 2  230  ? -12.282 -30.461 47.953  1.00 131.91 ? 230  ARG C C     1 
ATOM   4981  O  O     . ARG C 2  230  ? -12.728 -29.953 48.979  1.00 140.43 ? 230  ARG C O     1 
ATOM   4982  C  CB    . ARG C 2  230  ? -9.865  -31.090 48.091  1.00 127.59 ? 230  ARG C CB    1 
ATOM   4983  C  CG    . ARG C 2  230  ? -8.423  -30.636 47.959  1.00 142.75 ? 230  ARG C CG    1 
ATOM   4984  C  CD    . ARG C 2  230  ? -7.897  -30.843 46.548  1.00 149.32 ? 230  ARG C CD    1 
ATOM   4985  N  NE    . ARG C 2  230  ? -7.429  -32.209 46.343  1.00 152.88 ? 230  ARG C NE    1 
ATOM   4986  C  CZ    . ARG C 2  230  ? -6.822  -32.634 45.241  1.00 153.71 ? 230  ARG C CZ    1 
ATOM   4987  N  NH1   . ARG C 2  230  ? -6.610  -31.797 44.233  1.00 154.13 ? 230  ARG C NH1   1 
ATOM   4988  N  NH2   . ARG C 2  230  ? -6.425  -33.897 45.145  1.00 146.19 ? 230  ARG C NH2   1 
ATOM   4989  N  N     . ARG C 2  231  ? -12.966 -31.339 47.223  1.00 133.72 ? 231  ARG C N     1 
ATOM   4990  C  CA    . ARG C 2  231  ? -14.376 -31.655 47.479  1.00 132.57 ? 231  ARG C CA    1 
ATOM   4991  C  C     . ARG C 2  231  ? -14.635 -32.393 48.792  1.00 122.73 ? 231  ARG C C     1 
ATOM   4992  O  O     . ARG C 2  231  ? -13.915 -33.322 49.156  1.00 126.26 ? 231  ARG C O     1 
ATOM   4993  C  CB    . ARG C 2  231  ? -14.943 -32.485 46.320  1.00 138.64 ? 231  ARG C CB    1 
ATOM   4994  C  CG    . ARG C 2  231  ? -16.229 -33.245 46.646  1.00 130.44 ? 231  ARG C CG    1 
ATOM   4995  C  CD    . ARG C 2  231  ? -16.587 -34.253 45.558  1.00 135.36 ? 231  ARG C CD    1 
ATOM   4996  N  NE    . ARG C 2  231  ? -17.198 -33.627 44.387  1.00 141.60 ? 231  ARG C NE    1 
ATOM   4997  C  CZ    . ARG C 2  231  ? -18.487 -33.725 44.070  1.00 134.06 ? 231  ARG C CZ    1 
ATOM   4998  N  NH1   . ARG C 2  231  ? -19.311 -34.436 44.828  1.00 130.67 ? 231  ARG C NH1   1 
ATOM   4999  N  NH2   . ARG C 2  231  ? -18.949 -33.123 42.983  1.00 125.58 ? 231  ARG C NH2   1 
ATOM   5000  N  N     . GLN C 2  232  ? -15.683 -31.969 49.488  1.00 121.85 ? 232  GLN C N     1 
ATOM   5001  C  CA    . GLN C 2  232  ? -16.153 -32.652 50.682  1.00 129.02 ? 232  GLN C CA    1 
ATOM   5002  C  C     . GLN C 2  232  ? -17.651 -32.910 50.578  1.00 131.74 ? 232  GLN C C     1 
ATOM   5003  O  O     . GLN C 2  232  ? -18.329 -32.273 49.777  1.00 132.19 ? 232  GLN C O     1 
ATOM   5004  C  CB    . GLN C 2  232  ? -15.843 -31.825 51.929  1.00 130.20 ? 232  GLN C CB    1 
ATOM   5005  C  CG    . GLN C 2  232  ? -14.394 -31.872 52.353  1.00 138.28 ? 232  GLN C CG    1 
ATOM   5006  C  CD    . GLN C 2  232  ? -14.220 -31.507 53.808  1.00 148.18 ? 232  GLN C CD    1 
ATOM   5007  O  OE1   . GLN C 2  232  ? -13.200 -31.820 54.421  1.00 152.51 ? 232  GLN C OE1   1 
ATOM   5008  N  NE2   . GLN C 2  232  ? -15.224 -30.847 54.375  1.00 149.07 ? 232  GLN C NE2   1 
ATOM   5009  N  N     . PRO C 2  233  ? -18.170 -33.856 51.376  1.00 131.10 ? 233  PRO C N     1 
ATOM   5010  C  CA    . PRO C 2  233  ? -19.621 -34.057 51.455  1.00 130.82 ? 233  PRO C CA    1 
ATOM   5011  C  C     . PRO C 2  233  ? -20.364 -32.777 51.838  1.00 129.35 ? 233  PRO C C     1 
ATOM   5012  O  O     . PRO C 2  233  ? -19.856 -31.977 52.626  1.00 122.57 ? 233  PRO C O     1 
ATOM   5013  C  CB    . PRO C 2  233  ? -19.765 -35.122 52.543  1.00 134.34 ? 233  PRO C CB    1 
ATOM   5014  C  CG    . PRO C 2  233  ? -18.493 -35.887 52.475  1.00 134.87 ? 233  PRO C CG    1 
ATOM   5015  C  CD    . PRO C 2  233  ? -17.432 -34.881 52.134  1.00 132.49 ? 233  PRO C CD    1 
ATOM   5016  N  N     . VAL C 2  234  ? -21.557 -32.596 51.280  1.00 131.08 ? 234  VAL C N     1 
ATOM   5017  C  CA    . VAL C 2  234  ? -22.320 -31.368 51.472  1.00 129.91 ? 234  VAL C CA    1 
ATOM   5018  C  C     . VAL C 2  234  ? -22.937 -31.295 52.870  1.00 136.51 ? 234  VAL C C     1 
ATOM   5019  O  O     . VAL C 2  234  ? -23.218 -30.209 53.379  1.00 128.10 ? 234  VAL C O     1 
ATOM   5020  C  CB    . VAL C 2  234  ? -23.432 -31.231 50.404  1.00 122.69 ? 234  VAL C CB    1 
ATOM   5021  C  CG1   . VAL C 2  234  ? -24.563 -32.219 50.663  1.00 125.37 ? 234  VAL C CG1   1 
ATOM   5022  C  CG2   . VAL C 2  234  ? -23.958 -29.807 50.359  1.00 121.39 ? 234  VAL C CG2   1 
ATOM   5023  N  N     . THR C 2  235  ? -23.130 -32.454 53.494  1.00 146.44 ? 235  THR C N     1 
ATOM   5024  C  CA    . THR C 2  235  ? -23.688 -32.510 54.841  1.00 148.58 ? 235  THR C CA    1 
ATOM   5025  C  C     . THR C 2  235  ? -22.682 -31.992 55.871  1.00 144.17 ? 235  THR C C     1 
ATOM   5026  O  O     . THR C 2  235  ? -23.068 -31.546 56.952  1.00 141.88 ? 235  THR C O     1 
ATOM   5027  C  CB    . THR C 2  235  ? -24.126 -33.945 55.220  1.00 149.51 ? 235  THR C CB    1 
ATOM   5028  O  OG1   . THR C 2  235  ? -23.048 -34.859 54.985  1.00 151.59 ? 235  THR C OG1   1 
ATOM   5029  C  CG2   . THR C 2  235  ? -25.337 -34.371 54.397  1.00 139.06 ? 235  THR C CG2   1 
ATOM   5030  N  N     . VAL C 2  236  ? -21.396 -32.050 55.525  1.00 139.62 ? 236  VAL C N     1 
ATOM   5031  C  CA    . VAL C 2  236  ? -20.337 -31.504 56.372  1.00 130.42 ? 236  VAL C CA    1 
ATOM   5032  C  C     . VAL C 2  236  ? -20.573 -30.018 56.594  1.00 128.27 ? 236  VAL C C     1 
ATOM   5033  O  O     . VAL C 2  236  ? -20.277 -29.470 57.657  1.00 128.98 ? 236  VAL C O     1 
ATOM   5034  C  CB    . VAL C 2  236  ? -18.938 -31.707 55.749  1.00 118.98 ? 236  VAL C CB    1 
ATOM   5035  C  CG1   . VAL C 2  236  ? -17.862 -31.105 56.639  1.00 122.69 ? 236  VAL C CG1   1 
ATOM   5036  C  CG2   . VAL C 2  236  ? -18.667 -33.181 55.513  1.00 124.06 ? 236  VAL C CG2   1 
ATOM   5037  N  N     . LEU C 2  237  ? -21.125 -29.376 55.575  1.00 129.07 ? 237  LEU C N     1 
ATOM   5038  C  CA    . LEU C 2  237  ? -21.414 -27.955 55.633  1.00 140.50 ? 237  LEU C CA    1 
ATOM   5039  C  C     . LEU C 2  237  ? -22.696 -27.693 56.419  1.00 141.38 ? 237  LEU C C     1 
ATOM   5040  O  O     . LEU C 2  237  ? -22.812 -26.682 57.113  1.00 144.39 ? 237  LEU C O     1 
ATOM   5041  C  CB    . LEU C 2  237  ? -21.517 -27.385 54.216  1.00 143.77 ? 237  LEU C CB    1 
ATOM   5042  C  CG    . LEU C 2  237  ? -21.709 -25.877 54.054  1.00 141.57 ? 237  LEU C CG    1 
ATOM   5043  C  CD1   . LEU C 2  237  ? -20.709 -25.102 54.899  1.00 128.41 ? 237  LEU C CD1   1 
ATOM   5044  C  CD2   . LEU C 2  237  ? -21.579 -25.500 52.585  1.00 133.95 ? 237  LEU C CD2   1 
ATOM   5045  N  N     . LEU C 2  238  ? -23.651 -28.614 56.319  1.00 136.37 ? 238  LEU C N     1 
ATOM   5046  C  CA    . LEU C 2  238  ? -24.936 -28.458 56.995  1.00 139.05 ? 238  LEU C CA    1 
ATOM   5047  C  C     . LEU C 2  238  ? -24.819 -28.657 58.504  1.00 143.03 ? 238  LEU C C     1 
ATOM   5048  O  O     . LEU C 2  238  ? -25.535 -28.020 59.277  1.00 140.76 ? 238  LEU C O     1 
ATOM   5049  C  CB    . LEU C 2  238  ? -25.963 -29.433 56.418  1.00 142.64 ? 238  LEU C CB    1 
ATOM   5050  C  CG    . LEU C 2  238  ? -26.537 -29.062 55.049  1.00 140.39 ? 238  LEU C CG    1 
ATOM   5051  C  CD1   . LEU C 2  238  ? -27.403 -30.188 54.504  1.00 143.32 ? 238  LEU C CD1   1 
ATOM   5052  C  CD2   . LEU C 2  238  ? -27.331 -27.768 55.147  1.00 139.85 ? 238  LEU C CD2   1 
ATOM   5053  N  N     . LYS C 2  239  ? -23.919 -29.542 58.920  1.00 143.10 ? 239  LYS C N     1 
ATOM   5054  C  CA    . LYS C 2  239  ? -23.675 -29.768 60.341  1.00 142.54 ? 239  LYS C CA    1 
ATOM   5055  C  C     . LYS C 2  239  ? -22.735 -28.699 60.893  1.00 143.02 ? 239  LYS C C     1 
ATOM   5056  O  O     . LYS C 2  239  ? -22.553 -28.584 62.105  1.00 143.71 ? 239  LYS C O     1 
ATOM   5057  C  CB    . LYS C 2  239  ? -23.097 -31.167 60.576  1.00 142.14 ? 239  LYS C CB    1 
ATOM   5058  C  CG    . LYS C 2  239  ? -24.044 -32.301 60.203  1.00 140.90 ? 239  LYS C CG    1 
ATOM   5059  C  CD    . LYS C 2  239  ? -23.395 -33.669 60.376  1.00 131.59 ? 239  LYS C CD    1 
ATOM   5060  C  CE    . LYS C 2  239  ? -24.357 -34.781 59.983  1.00 126.91 ? 239  LYS C CE    1 
ATOM   5061  N  NZ    . LYS C 2  239  ? -23.723 -36.128 59.995  1.00 123.03 ? 239  LYS C NZ    1 
ATOM   5062  N  N     . ALA C 2  240  ? -22.145 -27.918 59.993  1.00 140.51 ? 240  ALA C N     1 
ATOM   5063  C  CA    . ALA C 2  240  ? -21.262 -26.822 60.377  1.00 134.00 ? 240  ALA C CA    1 
ATOM   5064  C  C     . ALA C 2  240  ? -22.060 -25.548 60.633  1.00 136.97 ? 240  ALA C C     1 
ATOM   5065  O  O     . ALA C 2  240  ? -21.720 -24.758 61.514  1.00 138.23 ? 240  ALA C O     1 
ATOM   5066  C  CB    . ALA C 2  240  ? -20.215 -26.585 59.306  1.00 128.13 ? 240  ALA C CB    1 
ATOM   5067  N  N     . LEU C 2  241  ? -23.120 -25.354 59.856  1.00 142.07 ? 241  LEU C N     1 
ATOM   5068  C  CA    . LEU C 2  241  ? -24.007 -24.210 60.036  1.00 143.65 ? 241  LEU C CA    1 
ATOM   5069  C  C     . LEU C 2  241  ? -24.724 -24.277 61.379  1.00 144.88 ? 241  LEU C C     1 
ATOM   5070  O  O     . LEU C 2  241  ? -24.922 -23.258 62.042  1.00 140.08 ? 241  LEU C O     1 
ATOM   5071  C  CB    . LEU C 2  241  ? -25.032 -24.141 58.902  1.00 148.55 ? 241  LEU C CB    1 
ATOM   5072  C  CG    . LEU C 2  241  ? -24.499 -23.851 57.499  1.00 138.18 ? 241  LEU C CG    1 
ATOM   5073  C  CD1   . LEU C 2  241  ? -25.617 -23.956 56.475  1.00 139.88 ? 241  LEU C CD1   1 
ATOM   5074  C  CD2   . LEU C 2  241  ? -23.855 -22.476 57.452  1.00 128.96 ? 241  LEU C CD2   1 
ATOM   5075  N  N     . GLY C 2  242  ? -25.111 -25.487 61.772  1.00 148.41 ? 242  GLY C N     1 
ATOM   5076  C  CA    . GLY C 2  242  ? -25.842 -25.698 63.006  1.00 145.57 ? 242  GLY C CA    1 
ATOM   5077  C  C     . GLY C 2  242  ? -27.129 -26.472 62.790  1.00 152.88 ? 242  GLY C C     1 
ATOM   5078  O  O     . GLY C 2  242  ? -27.907 -26.666 63.725  1.00 154.50 ? 242  GLY C O     1 
ATOM   5079  N  N     . TRP C 2  243  ? -27.359 -26.912 61.556  1.00 157.70 ? 243  TRP C N     1 
ATOM   5080  C  CA    . TRP C 2  243  ? -28.546 -27.702 61.238  1.00 164.86 ? 243  TRP C CA    1 
ATOM   5081  C  C     . TRP C 2  243  ? -28.397 -29.132 61.758  1.00 168.05 ? 243  TRP C C     1 
ATOM   5082  O  O     . TRP C 2  243  ? -27.374 -29.781 61.532  1.00 160.61 ? 243  TRP C O     1 
ATOM   5083  C  CB    . TRP C 2  243  ? -28.810 -27.706 59.727  1.00 156.80 ? 243  TRP C CB    1 
ATOM   5084  C  CG    . TRP C 2  243  ? -29.201 -26.361 59.176  1.00 155.82 ? 243  TRP C CG    1 
ATOM   5085  C  CD1   . TRP C 2  243  ? -28.406 -25.497 58.479  1.00 151.38 ? 243  TRP C CD1   1 
ATOM   5086  C  CD2   . TRP C 2  243  ? -30.484 -25.724 59.283  1.00 160.23 ? 243  TRP C CD2   1 
ATOM   5087  N  NE1   . TRP C 2  243  ? -29.113 -24.366 58.144  1.00 157.49 ? 243  TRP C NE1   1 
ATOM   5088  C  CE2   . TRP C 2  243  ? -30.391 -24.480 58.626  1.00 159.86 ? 243  TRP C CE2   1 
ATOM   5089  C  CE3   . TRP C 2  243  ? -31.702 -26.086 59.870  1.00 153.91 ? 243  TRP C CE3   1 
ATOM   5090  C  CZ2   . TRP C 2  243  ? -31.467 -23.597 58.539  1.00 149.09 ? 243  TRP C CZ2   1 
ATOM   5091  C  CZ3   . TRP C 2  243  ? -32.771 -25.207 59.782  1.00 139.68 ? 243  TRP C CZ3   1 
ATOM   5092  C  CH2   . TRP C 2  243  ? -32.645 -23.978 59.122  1.00 137.78 ? 243  TRP C CH2   1 
ATOM   5093  N  N     . THR C 2  244  ? -29.422 -29.610 62.460  1.00 166.90 ? 244  THR C N     1 
ATOM   5094  C  CA    . THR C 2  244  ? -29.396 -30.932 63.080  1.00 159.18 ? 244  THR C CA    1 
ATOM   5095  C  C     . THR C 2  244  ? -29.305 -32.037 62.033  1.00 152.16 ? 244  THR C C     1 
ATOM   5096  O  O     . THR C 2  244  ? -29.680 -31.839 60.879  1.00 149.28 ? 244  THR C O     1 
ATOM   5097  C  CB    . THR C 2  244  ? -30.646 -31.166 63.954  1.00 155.19 ? 244  THR C CB    1 
ATOM   5098  O  OG1   . THR C 2  244  ? -31.797 -31.319 63.116  1.00 153.83 ? 244  THR C OG1   1 
ATOM   5099  C  CG2   . THR C 2  244  ? -30.866 -29.994 64.900  1.00 146.11 ? 244  THR C CG2   1 
ATOM   5100  N  N     . SER C 2  245  ? -28.810 -33.203 62.438  1.00 150.09 ? 245  SER C N     1 
ATOM   5101  C  CA    . SER C 2  245  ? -28.692 -34.332 61.521  1.00 155.48 ? 245  SER C CA    1 
ATOM   5102  C  C     . SER C 2  245  ? -30.069 -34.900 61.177  1.00 157.71 ? 245  SER C C     1 
ATOM   5103  O  O     . SER C 2  245  ? -30.210 -35.691 60.243  1.00 153.53 ? 245  SER C O     1 
ATOM   5104  C  CB    . SER C 2  245  ? -27.798 -35.422 62.118  1.00 151.94 ? 245  SER C CB    1 
ATOM   5105  O  OG    . SER C 2  245  ? -26.486 -34.939 62.356  1.00 144.89 ? 245  SER C OG    1 
ATOM   5106  N  N     . GLU C 2  246  ? -31.081 -34.485 61.936  1.00 163.53 ? 246  GLU C N     1 
ATOM   5107  C  CA    . GLU C 2  246  ? -32.460 -34.904 61.699  1.00 166.99 ? 246  GLU C CA    1 
ATOM   5108  C  C     . GLU C 2  246  ? -33.173 -33.985 60.707  1.00 166.19 ? 246  GLU C C     1 
ATOM   5109  O  O     . GLU C 2  246  ? -34.059 -34.425 59.971  1.00 167.26 ? 246  GLU C O     1 
ATOM   5110  C  CB    . GLU C 2  246  ? -33.241 -34.950 63.017  1.00 172.74 ? 246  GLU C CB    1 
ATOM   5111  C  CG    . GLU C 2  246  ? -33.362 -36.339 63.635  1.00 169.55 ? 246  GLU C CG    1 
ATOM   5112  C  CD    . GLU C 2  246  ? -32.037 -36.884 64.130  1.00 170.89 ? 246  GLU C CD    1 
ATOM   5113  O  OE1   . GLU C 2  246  ? -31.129 -36.078 64.425  1.00 170.40 ? 246  GLU C OE1   1 
ATOM   5114  O  OE2   . GLU C 2  246  ? -31.902 -38.123 64.223  1.00 175.04 ? 246  GLU C OE2   1 
ATOM   5115  N  N     . GLN C 2  247  ? -32.794 -32.709 60.697  1.00 162.64 ? 247  GLN C N     1 
ATOM   5116  C  CA    . GLN C 2  247  ? -33.360 -31.752 59.750  1.00 159.44 ? 247  GLN C CA    1 
ATOM   5117  C  C     . GLN C 2  247  ? -32.820 -32.009 58.344  1.00 162.49 ? 247  GLN C C     1 
ATOM   5118  O  O     . GLN C 2  247  ? -33.462 -31.663 57.350  1.00 157.88 ? 247  GLN C O     1 
ATOM   5119  C  CB    . GLN C 2  247  ? -33.060 -30.314 60.183  1.00 154.11 ? 247  GLN C CB    1 
ATOM   5120  C  CG    . GLN C 2  247  ? -33.920 -29.809 61.333  1.00 145.94 ? 247  GLN C CG    1 
ATOM   5121  C  CD    . GLN C 2  247  ? -33.549 -28.401 61.762  1.00 148.65 ? 247  GLN C CD    1 
ATOM   5122  O  OE1   . GLN C 2  247  ? -32.469 -28.169 62.309  1.00 138.13 ? 247  GLN C OE1   1 
ATOM   5123  N  NE2   . GLN C 2  247  ? -34.442 -27.452 61.510  1.00 158.25 ? 247  GLN C NE2   1 
ATOM   5124  N  N     . ILE C 2  248  ? -31.636 -32.615 58.274  1.00 163.17 ? 248  ILE C N     1 
ATOM   5125  C  CA    . ILE C 2  248  ? -31.041 -33.022 57.004  1.00 161.79 ? 248  ILE C CA    1 
ATOM   5126  C  C     . ILE C 2  248  ? -31.903 -34.105 56.355  1.00 162.57 ? 248  ILE C C     1 
ATOM   5127  O  O     . ILE C 2  248  ? -32.113 -34.107 55.141  1.00 159.89 ? 248  ILE C O     1 
ATOM   5128  C  CB    . ILE C 2  248  ? -29.594 -33.550 57.186  1.00 155.79 ? 248  ILE C CB    1 
ATOM   5129  C  CG1   . ILE C 2  248  ? -28.726 -32.521 57.913  1.00 152.19 ? 248  ILE C CG1   1 
ATOM   5130  C  CG2   . ILE C 2  248  ? -28.973 -33.900 55.841  1.00 153.72 ? 248  ILE C CG2   1 
ATOM   5131  C  CD1   . ILE C 2  248  ? -27.296 -32.975 58.135  1.00 145.47 ? 248  ILE C CD1   1 
ATOM   5132  N  N     . VAL C 2  249  ? -32.405 -35.016 57.185  1.00 164.13 ? 249  VAL C N     1 
ATOM   5133  C  CA    . VAL C 2  249  ? -33.272 -36.101 56.736  1.00 161.35 ? 249  VAL C CA    1 
ATOM   5134  C  C     . VAL C 2  249  ? -34.648 -35.577 56.309  1.00 160.30 ? 249  VAL C C     1 
ATOM   5135  O  O     . VAL C 2  249  ? -35.279 -36.126 55.405  1.00 159.29 ? 249  VAL C O     1 
ATOM   5136  C  CB    . VAL C 2  249  ? -33.448 -37.165 57.846  1.00 156.14 ? 249  VAL C CB    1 
ATOM   5137  C  CG1   . VAL C 2  249  ? -34.214 -38.371 57.326  1.00 151.19 ? 249  VAL C CG1   1 
ATOM   5138  C  CG2   . VAL C 2  249  ? -32.094 -37.592 58.389  1.00 156.94 ? 249  VAL C CG2   1 
ATOM   5139  N  N     . GLU C 2  250  ? -35.102 -34.508 56.958  1.00 157.42 ? 250  GLU C N     1 
ATOM   5140  C  CA    . GLU C 2  250  ? -36.415 -33.929 56.675  1.00 150.35 ? 250  GLU C CA    1 
ATOM   5141  C  C     . GLU C 2  250  ? -36.464 -33.208 55.335  1.00 150.77 ? 250  GLU C C     1 
ATOM   5142  O  O     . GLU C 2  250  ? -37.311 -33.499 54.491  1.00 157.45 ? 250  GLU C O     1 
ATOM   5143  C  CB    . GLU C 2  250  ? -36.821 -32.951 57.780  1.00 148.57 ? 250  GLU C CB    1 
ATOM   5144  C  CG    . GLU C 2  250  ? -38.088 -32.162 57.464  1.00 145.59 ? 250  GLU C CG    1 
ATOM   5145  C  CD    . GLU C 2  250  ? -38.276 -30.962 58.374  1.00 147.49 ? 250  GLU C CD    1 
ATOM   5146  O  OE1   . GLU C 2  250  ? -39.386 -30.385 58.384  1.00 141.23 ? 250  GLU C OE1   1 
ATOM   5147  O  OE2   . GLU C 2  250  ? -37.312 -30.592 59.076  1.00 147.83 ? 250  GLU C OE2   1 
ATOM   5148  N  N     . ARG C 2  251  ? -35.553 -32.259 55.151  1.00 146.84 ? 251  ARG C N     1 
ATOM   5149  C  CA    . ARG C 2  251  ? -35.585 -31.371 53.995  1.00 152.93 ? 251  ARG C CA    1 
ATOM   5150  C  C     . ARG C 2  251  ? -35.184 -32.060 52.691  1.00 150.83 ? 251  ARG C C     1 
ATOM   5151  O  O     . ARG C 2  251  ? -35.793 -31.826 51.647  1.00 143.92 ? 251  ARG C O     1 
ATOM   5152  C  CB    . ARG C 2  251  ? -34.673 -30.167 54.242  1.00 153.55 ? 251  ARG C CB    1 
ATOM   5153  C  CG    . ARG C 2  251  ? -34.701 -29.120 53.140  1.00 149.75 ? 251  ARG C CG    1 
ATOM   5154  C  CD    . ARG C 2  251  ? -36.077 -28.487 53.000  1.00 146.35 ? 251  ARG C CD    1 
ATOM   5155  N  NE    . ARG C 2  251  ? -36.062 -27.383 52.045  1.00 136.78 ? 251  ARG C NE    1 
ATOM   5156  C  CZ    . ARG C 2  251  ? -35.777 -26.123 52.360  1.00 133.18 ? 251  ARG C CZ    1 
ATOM   5157  N  NH1   . ARG C 2  251  ? -35.485 -25.797 53.612  1.00 136.06 ? 251  ARG C NH1   1 
ATOM   5158  N  NH2   . ARG C 2  251  ? -35.782 -25.188 51.421  1.00 132.23 ? 251  ARG C NH2   1 
ATOM   5159  N  N     . PHE C 2  252  ? -34.161 -32.908 52.759  1.00 151.87 ? 252  PHE C N     1 
ATOM   5160  C  CA    . PHE C 2  252  ? -33.598 -33.541 51.569  1.00 148.91 ? 252  PHE C CA    1 
ATOM   5161  C  C     . PHE C 2  252  ? -33.838 -35.046 51.543  1.00 148.69 ? 252  PHE C C     1 
ATOM   5162  O  O     . PHE C 2  252  ? -33.071 -35.792 50.931  1.00 144.04 ? 252  PHE C O     1 
ATOM   5163  C  CB    . PHE C 2  252  ? -32.094 -33.270 51.484  1.00 149.63 ? 252  PHE C CB    1 
ATOM   5164  C  CG    . PHE C 2  252  ? -31.720 -31.829 51.680  1.00 156.21 ? 252  PHE C CG    1 
ATOM   5165  C  CD1   . PHE C 2  252  ? -31.730 -30.945 50.613  1.00 155.86 ? 252  PHE C CD1   1 
ATOM   5166  C  CD2   . PHE C 2  252  ? -31.347 -31.360 52.929  1.00 159.03 ? 252  PHE C CD2   1 
ATOM   5167  C  CE1   . PHE C 2  252  ? -31.383 -29.617 50.790  1.00 154.36 ? 252  PHE C CE1   1 
ATOM   5168  C  CE2   . PHE C 2  252  ? -30.999 -30.033 53.114  1.00 163.37 ? 252  PHE C CE2   1 
ATOM   5169  C  CZ    . PHE C 2  252  ? -31.017 -29.161 52.042  1.00 156.81 ? 252  PHE C CZ    1 
ATOM   5170  N  N     . GLY C 2  253  ? -34.901 -35.491 52.205  1.00 152.10 ? 253  GLY C N     1 
ATOM   5171  C  CA    . GLY C 2  253  ? -35.175 -36.911 52.335  1.00 151.56 ? 253  GLY C CA    1 
ATOM   5172  C  C     . GLY C 2  253  ? -35.848 -37.523 51.123  1.00 148.90 ? 253  GLY C C     1 
ATOM   5173  O  O     . GLY C 2  253  ? -35.791 -38.736 50.914  1.00 148.27 ? 253  GLY C O     1 
ATOM   5174  N  N     . PHE C 2  254  ? -36.481 -36.676 50.318  1.00 144.03 ? 254  PHE C N     1 
ATOM   5175  C  CA    . PHE C 2  254  ? -37.227 -37.133 49.151  1.00 141.94 ? 254  PHE C CA    1 
ATOM   5176  C  C     . PHE C 2  254  ? -36.323 -37.731 48.071  1.00 141.55 ? 254  PHE C C     1 
ATOM   5177  O  O     . PHE C 2  254  ? -36.804 -38.380 47.142  1.00 131.32 ? 254  PHE C O     1 
ATOM   5178  C  CB    . PHE C 2  254  ? -38.051 -35.980 48.572  1.00 136.50 ? 254  PHE C CB    1 
ATOM   5179  C  CG    . PHE C 2  254  ? -37.234 -34.777 48.193  1.00 141.78 ? 254  PHE C CG    1 
ATOM   5180  C  CD1   . PHE C 2  254  ? -36.967 -33.780 49.118  1.00 138.47 ? 254  PHE C CD1   1 
ATOM   5181  C  CD2   . PHE C 2  254  ? -36.738 -34.639 46.906  1.00 139.83 ? 254  PHE C CD2   1 
ATOM   5182  C  CE1   . PHE C 2  254  ? -36.217 -32.671 48.766  1.00 134.87 ? 254  PHE C CE1   1 
ATOM   5183  C  CE2   . PHE C 2  254  ? -35.989 -33.533 46.550  1.00 133.72 ? 254  PHE C CE2   1 
ATOM   5184  C  CZ    . PHE C 2  254  ? -35.728 -32.548 47.482  1.00 134.14 ? 254  PHE C CZ    1 
ATOM   5185  N  N     . SER C 2  255  ? -35.017 -37.512 48.194  1.00 146.16 ? 255  SER C N     1 
ATOM   5186  C  CA    . SER C 2  255  ? -34.054 -38.079 47.255  1.00 137.10 ? 255  SER C CA    1 
ATOM   5187  C  C     . SER C 2  255  ? -33.216 -39.166 47.917  1.00 142.41 ? 255  SER C C     1 
ATOM   5188  O  O     . SER C 2  255  ? -33.006 -39.152 49.130  1.00 142.60 ? 255  SER C O     1 
ATOM   5189  C  CB    . SER C 2  255  ? -33.138 -36.992 46.695  1.00 125.47 ? 255  SER C CB    1 
ATOM   5190  O  OG    . SER C 2  255  ? -32.200 -36.568 47.667  1.00 127.63 ? 255  SER C OG    1 
ATOM   5191  N  N     . GLU C 2  256  ? -32.736 -40.103 47.108  1.00 144.14 ? 256  GLU C N     1 
ATOM   5192  C  CA    . GLU C 2  256  ? -31.896 -41.187 47.600  1.00 142.96 ? 256  GLU C CA    1 
ATOM   5193  C  C     . GLU C 2  256  ? -30.426 -40.776 47.568  1.00 143.78 ? 256  GLU C C     1 
ATOM   5194  O  O     . GLU C 2  256  ? -29.587 -41.371 48.247  1.00 141.79 ? 256  GLU C O     1 
ATOM   5195  C  CB    . GLU C 2  256  ? -32.121 -42.455 46.768  1.00 139.76 ? 256  GLU C CB    1 
ATOM   5196  C  CG    . GLU C 2  256  ? -31.458 -43.709 47.320  1.00 135.84 ? 256  GLU C CG    1 
ATOM   5197  C  CD    . GLU C 2  256  ? -32.049 -44.154 48.644  1.00 144.63 ? 256  GLU C CD    1 
ATOM   5198  O  OE1   . GLU C 2  256  ? -33.214 -43.802 48.930  1.00 153.13 ? 256  GLU C OE1   1 
ATOM   5199  O  OE2   . GLU C 2  256  ? -31.346 -44.856 49.400  1.00 144.08 ? 256  GLU C OE2   1 
ATOM   5200  N  N     . ILE C 2  257  ? -30.120 -39.746 46.784  1.00 148.13 ? 257  ILE C N     1 
ATOM   5201  C  CA    . ILE C 2  257  ? -28.745 -39.284 46.636  1.00 146.92 ? 257  ILE C CA    1 
ATOM   5202  C  C     . ILE C 2  257  ? -28.295 -38.442 47.834  1.00 144.78 ? 257  ILE C C     1 
ATOM   5203  O  O     . ILE C 2  257  ? -27.098 -38.326 48.097  1.00 140.79 ? 257  ILE C O     1 
ATOM   5204  C  CB    . ILE C 2  257  ? -28.556 -38.473 45.328  1.00 143.77 ? 257  ILE C CB    1 
ATOM   5205  C  CG1   . ILE C 2  257  ? -29.452 -37.232 45.317  1.00 146.76 ? 257  ILE C CG1   1 
ATOM   5206  C  CG2   . ILE C 2  257  ? -28.842 -39.342 44.111  1.00 131.44 ? 257  ILE C CG2   1 
ATOM   5207  C  CD1   . ILE C 2  257  ? -28.685 -35.928 45.398  1.00 138.87 ? 257  ILE C CD1   1 
ATOM   5208  N  N     . MET C 2  258  ? -29.248 -37.863 48.562  1.00 141.63 ? 258  MET C N     1 
ATOM   5209  C  CA    . MET C 2  258  ? -28.928 -37.102 49.770  1.00 135.87 ? 258  MET C CA    1 
ATOM   5210  C  C     . MET C 2  258  ? -28.918 -38.010 50.989  1.00 133.81 ? 258  MET C C     1 
ATOM   5211  O  O     . MET C 2  258  ? -28.184 -37.777 51.950  1.00 135.05 ? 258  MET C O     1 
ATOM   5212  C  CB    . MET C 2  258  ? -29.919 -35.959 49.976  1.00 135.47 ? 258  MET C CB    1 
ATOM   5213  C  CG    . MET C 2  258  ? -29.646 -34.746 49.104  1.00 143.41 ? 258  MET C CG    1 
ATOM   5214  S  SD    . MET C 2  258  ? -28.038 -33.991 49.430  1.00 141.65 ? 258  MET C SD    1 
ATOM   5215  C  CE    . MET C 2  258  ? -28.256 -33.421 51.115  1.00 139.57 ? 258  MET C CE    1 
ATOM   5216  N  N     . ARG C 2  259  ? -29.750 -39.042 50.943  1.00 134.86 ? 259  ARG C N     1 
ATOM   5217  C  CA    . ARG C 2  259  ? -29.727 -40.079 51.958  1.00 141.37 ? 259  ARG C CA    1 
ATOM   5218  C  C     . ARG C 2  259  ? -28.414 -40.848 51.868  1.00 140.59 ? 259  ARG C C     1 
ATOM   5219  O  O     . ARG C 2  259  ? -27.831 -41.221 52.885  1.00 144.33 ? 259  ARG C O     1 
ATOM   5220  C  CB    . ARG C 2  259  ? -30.921 -41.020 51.791  1.00 143.57 ? 259  ARG C CB    1 
ATOM   5221  C  CG    . ARG C 2  259  ? -32.256 -40.365 52.081  1.00 137.16 ? 259  ARG C CG    1 
ATOM   5222  C  CD    . ARG C 2  259  ? -32.302 -39.856 53.509  1.00 139.60 ? 259  ARG C CD    1 
ATOM   5223  N  NE    . ARG C 2  259  ? -33.628 -39.364 53.862  1.00 143.92 ? 259  ARG C NE    1 
ATOM   5224  C  CZ    . ARG C 2  259  ? -34.615 -40.138 54.297  1.00 152.67 ? 259  ARG C CZ    1 
ATOM   5225  N  NH1   . ARG C 2  259  ? -34.422 -41.444 54.434  1.00 149.43 ? 259  ARG C NH1   1 
ATOM   5226  N  NH2   . ARG C 2  259  ? -35.794 -39.610 54.595  1.00 159.45 ? 259  ARG C NH2   1 
ATOM   5227  N  N     . SER C 2  260  ? -27.946 -41.065 50.643  1.00 137.37 ? 260  SER C N     1 
ATOM   5228  C  CA    . SER C 2  260  ? -26.687 -41.765 50.413  1.00 136.99 ? 260  SER C CA    1 
ATOM   5229  C  C     . SER C 2  260  ? -25.487 -40.903 50.798  1.00 137.00 ? 260  SER C C     1 
ATOM   5230  O  O     . SER C 2  260  ? -24.369 -41.401 50.923  1.00 131.78 ? 260  SER C O     1 
ATOM   5231  C  CB    . SER C 2  260  ? -26.574 -42.193 48.948  1.00 134.25 ? 260  SER C CB    1 
ATOM   5232  O  OG    . SER C 2  260  ? -25.319 -42.794 48.684  1.00 124.01 ? 260  SER C OG    1 
ATOM   5233  N  N     . THR C 2  261  ? -25.726 -39.609 50.983  1.00 139.93 ? 261  THR C N     1 
ATOM   5234  C  CA    . THR C 2  261  ? -24.660 -38.669 51.312  1.00 140.25 ? 261  THR C CA    1 
ATOM   5235  C  C     . THR C 2  261  ? -24.484 -38.541 52.819  1.00 136.77 ? 261  THR C C     1 
ATOM   5236  O  O     . THR C 2  261  ? -23.365 -38.593 53.330  1.00 134.84 ? 261  THR C O     1 
ATOM   5237  C  CB    . THR C 2  261  ? -24.937 -37.273 50.719  1.00 143.71 ? 261  THR C CB    1 
ATOM   5238  O  OG1   . THR C 2  261  ? -25.155 -37.383 49.307  1.00 143.90 ? 261  THR C OG1   1 
ATOM   5239  C  CG2   . THR C 2  261  ? -23.763 -36.339 50.978  1.00 140.89 ? 261  THR C CG2   1 
ATOM   5240  N  N     . LEU C 2  262  ? -25.599 -38.376 53.524  1.00 135.78 ? 262  LEU C N     1 
ATOM   5241  C  CA    . LEU C 2  262  ? -25.583 -38.226 54.974  1.00 136.77 ? 262  LEU C CA    1 
ATOM   5242  C  C     . LEU C 2  262  ? -25.093 -39.507 55.649  1.00 140.32 ? 262  LEU C C     1 
ATOM   5243  O  O     . LEU C 2  262  ? -24.643 -39.485 56.796  1.00 138.65 ? 262  LEU C O     1 
ATOM   5244  C  CB    . LEU C 2  262  ? -26.977 -37.849 55.485  1.00 131.86 ? 262  LEU C CB    1 
ATOM   5245  C  CG    . LEU C 2  262  ? -27.110 -37.537 56.977  1.00 132.91 ? 262  LEU C CG    1 
ATOM   5246  C  CD1   . LEU C 2  262  ? -26.179 -36.406 57.376  1.00 127.21 ? 262  LEU C CD1   1 
ATOM   5247  C  CD2   . LEU C 2  262  ? -28.549 -37.202 57.330  1.00 138.10 ? 262  LEU C CD2   1 
ATOM   5248  N  N     . GLU C 2  263  ? -25.174 -40.618 54.920  1.00 144.66 ? 263  GLU C N     1 
ATOM   5249  C  CA    . GLU C 2  263  ? -24.726 -41.916 55.419  1.00 152.22 ? 263  GLU C CA    1 
ATOM   5250  C  C     . GLU C 2  263  ? -23.226 -42.116 55.184  1.00 152.50 ? 263  GLU C C     1 
ATOM   5251  O  O     . GLU C 2  263  ? -22.524 -42.653 56.045  1.00 154.35 ? 263  GLU C O     1 
ATOM   5252  C  CB    . GLU C 2  263  ? -25.524 -43.045 54.755  1.00 153.96 ? 263  GLU C CB    1 
ATOM   5253  C  CG    . GLU C 2  263  ? -25.523 -44.367 55.522  1.00 150.72 ? 263  GLU C CG    1 
ATOM   5254  C  CD    . GLU C 2  263  ? -24.384 -45.290 55.124  1.00 154.10 ? 263  GLU C CD    1 
ATOM   5255  O  OE1   . GLU C 2  263  ? -23.844 -45.131 54.008  1.00 154.58 ? 263  GLU C OE1   1 
ATOM   5256  O  OE2   . GLU C 2  263  ? -24.032 -46.179 55.928  1.00 153.44 ? 263  GLU C OE2   1 
ATOM   5257  N  N     . LYS C 2  264  ? -22.742 -41.682 54.021  1.00 146.38 ? 264  LYS C N     1 
ATOM   5258  C  CA    . LYS C 2  264  ? -21.317 -41.763 53.692  1.00 139.66 ? 264  LYS C CA    1 
ATOM   5259  C  C     . LYS C 2  264  ? -20.546 -40.634 54.365  1.00 136.21 ? 264  LYS C C     1 
ATOM   5260  O  O     . LYS C 2  264  ? -19.317 -40.572 54.291  1.00 127.15 ? 264  LYS C O     1 
ATOM   5261  C  CB    . LYS C 2  264  ? -21.106 -41.716 52.177  1.00 131.16 ? 264  LYS C CB    1 
ATOM   5262  C  CG    . LYS C 2  264  ? -21.630 -42.933 51.436  1.00 125.96 ? 264  LYS C CG    1 
ATOM   5263  C  CD    . LYS C 2  264  ? -21.611 -42.705 49.937  1.00 117.60 ? 264  LYS C CD    1 
ATOM   5264  C  CE    . LYS C 2  264  ? -22.373 -43.792 49.206  1.00 121.26 ? 264  LYS C CE    1 
ATOM   5265  N  NZ    . LYS C 2  264  ? -22.701 -43.396 47.809  1.00 121.52 ? 264  LYS C NZ    1 
ATOM   5266  N  N     . ASP C 2  265  ? -21.293 -39.743 55.011  1.00 138.24 ? 265  ASP C N     1 
ATOM   5267  C  CA    . ASP C 2  265  ? -20.731 -38.657 55.802  1.00 131.66 ? 265  ASP C CA    1 
ATOM   5268  C  C     . ASP C 2  265  ? -19.739 -39.178 56.835  1.00 131.46 ? 265  ASP C C     1 
ATOM   5269  O  O     . ASP C 2  265  ? -20.068 -40.035 57.656  1.00 133.95 ? 265  ASP C O     1 
ATOM   5270  C  CB    . ASP C 2  265  ? -21.851 -37.879 56.493  1.00 129.23 ? 265  ASP C CB    1 
ATOM   5271  C  CG    . ASP C 2  265  ? -21.345 -37.000 57.612  1.00 126.05 ? 265  ASP C CG    1 
ATOM   5272  O  OD1   . ASP C 2  265  ? -20.317 -36.318 57.419  1.00 122.36 ? 265  ASP C OD1   1 
ATOM   5273  O  OD2   . ASP C 2  265  ? -21.979 -36.998 58.688  1.00 129.16 ? 265  ASP C OD2   1 
ATOM   5274  N  N     . ASN C 2  266  ? -18.524 -38.646 56.788  1.00 126.58 ? 266  ASN C N     1 
ATOM   5275  C  CA    . ASN C 2  266  ? -17.441 -39.140 57.622  1.00 122.62 ? 266  ASN C CA    1 
ATOM   5276  C  C     . ASN C 2  266  ? -17.679 -38.902 59.110  1.00 122.76 ? 266  ASN C C     1 
ATOM   5277  O  O     . ASN C 2  266  ? -17.753 -39.849 59.891  1.00 122.20 ? 266  ASN C O     1 
ATOM   5278  C  CB    . ASN C 2  266  ? -16.124 -38.497 57.197  1.00 114.02 ? 266  ASN C CB    1 
ATOM   5279  C  CG    . ASN C 2  266  ? -14.931 -39.367 57.510  1.00 110.67 ? 266  ASN C CG    1 
ATOM   5280  O  OD1   . ASN C 2  266  ? -14.979 -40.204 58.410  1.00 116.56 ? 266  ASN C OD1   1 
ATOM   5281  N  ND2   . ASN C 2  266  ? -13.851 -39.179 56.763  1.00 105.00 ? 266  ASN C ND2   1 
ATOM   5282  N  N     . THR C 2  267  ? -17.800 -37.638 59.501  1.00 123.35 ? 267  THR C N     1 
ATOM   5283  C  CA    . THR C 2  267  ? -17.958 -37.296 60.910  1.00 128.72 ? 267  THR C CA    1 
ATOM   5284  C  C     . THR C 2  267  ? -19.275 -36.578 61.183  1.00 134.27 ? 267  THR C C     1 
ATOM   5285  O  O     . THR C 2  267  ? -19.887 -36.019 60.274  1.00 138.21 ? 267  THR C O     1 
ATOM   5286  C  CB    . THR C 2  267  ? -16.800 -36.406 61.407  1.00 135.04 ? 267  THR C CB    1 
ATOM   5287  O  OG1   . THR C 2  267  ? -16.851 -35.134 60.748  1.00 137.82 ? 267  THR C OG1   1 
ATOM   5288  C  CG2   . THR C 2  267  ? -15.459 -37.066 61.127  1.00 130.63 ? 267  THR C CG2   1 
ATOM   5289  N  N     . VAL C 2  268  ? -19.702 -36.597 62.442  1.00 133.04 ? 268  VAL C N     1 
ATOM   5290  C  CA    . VAL C 2  268  ? -20.898 -35.876 62.868  1.00 134.08 ? 268  VAL C CA    1 
ATOM   5291  C  C     . VAL C 2  268  ? -20.536 -34.938 64.025  1.00 137.96 ? 268  VAL C C     1 
ATOM   5292  O  O     . VAL C 2  268  ? -19.491 -35.094 64.659  1.00 133.47 ? 268  VAL C O     1 
ATOM   5293  C  CB    . VAL C 2  268  ? -22.029 -36.847 63.294  1.00 125.00 ? 268  VAL C CB    1 
ATOM   5294  C  CG1   . VAL C 2  268  ? -21.747 -37.425 64.669  1.00 124.20 ? 268  VAL C CG1   1 
ATOM   5295  C  CG2   . VAL C 2  268  ? -23.391 -36.157 63.270  1.00 119.95 ? 268  VAL C CG2   1 
ATOM   5296  N  N     . GLY C 2  269  ? -21.393 -33.956 64.286  1.00 138.96 ? 269  GLY C N     1 
ATOM   5297  C  CA    . GLY C 2  269  ? -21.157 -33.009 65.358  1.00 133.44 ? 269  GLY C CA    1 
ATOM   5298  C  C     . GLY C 2  269  ? -20.921 -31.617 64.814  1.00 134.39 ? 269  GLY C C     1 
ATOM   5299  O  O     . GLY C 2  269  ? -20.251 -31.445 63.796  1.00 130.00 ? 269  GLY C O     1 
ATOM   5300  N  N     . THR C 2  270  ? -21.477 -30.621 65.495  1.00 140.39 ? 270  THR C N     1 
ATOM   5301  C  CA    . THR C 2  270  ? -21.354 -29.235 65.064  1.00 147.18 ? 270  THR C CA    1 
ATOM   5302  C  C     . THR C 2  270  ? -19.912 -28.743 65.214  1.00 147.31 ? 270  THR C C     1 
ATOM   5303  O  O     . THR C 2  270  ? -19.424 -27.977 64.383  1.00 146.67 ? 270  THR C O     1 
ATOM   5304  C  CB    . THR C 2  270  ? -22.312 -28.313 65.853  1.00 148.27 ? 270  THR C CB    1 
ATOM   5305  O  OG1   . THR C 2  270  ? -23.654 -28.806 65.741  1.00 145.10 ? 270  THR C OG1   1 
ATOM   5306  C  CG2   . THR C 2  270  ? -22.260 -26.886 65.319  1.00 135.88 ? 270  THR C CG2   1 
ATOM   5307  N  N     . ASP C 2  271  ? -19.232 -29.193 66.266  1.00 150.19 ? 271  ASP C N     1 
ATOM   5308  C  CA    . ASP C 2  271  ? -17.824 -28.855 66.466  1.00 143.05 ? 271  ASP C CA    1 
ATOM   5309  C  C     . ASP C 2  271  ? -16.933 -29.530 65.427  1.00 144.98 ? 271  ASP C C     1 
ATOM   5310  O  O     . ASP C 2  271  ? -16.069 -28.890 64.831  1.00 143.29 ? 271  ASP C O     1 
ATOM   5311  C  CB    . ASP C 2  271  ? -17.360 -29.248 67.871  1.00 137.53 ? 271  ASP C CB    1 
ATOM   5312  C  CG    . ASP C 2  271  ? -17.545 -28.134 68.880  1.00 135.72 ? 271  ASP C CG    1 
ATOM   5313  O  OD1   . ASP C 2  271  ? -17.702 -28.438 70.081  1.00 134.09 ? 271  ASP C OD1   1 
ATOM   5314  O  OD2   . ASP C 2  271  ? -17.532 -26.954 68.472  1.00 136.16 ? 271  ASP C OD2   1 
ATOM   5315  N  N     . GLU C 2  272  ? -17.157 -30.823 65.212  1.00 150.20 ? 272  GLU C N     1 
ATOM   5316  C  CA    . GLU C 2  272  ? -16.313 -31.623 64.327  1.00 146.82 ? 272  GLU C CA    1 
ATOM   5317  C  C     . GLU C 2  272  ? -16.427 -31.209 62.861  1.00 143.84 ? 272  GLU C C     1 
ATOM   5318  O  O     . GLU C 2  272  ? -15.492 -31.399 62.084  1.00 137.59 ? 272  GLU C O     1 
ATOM   5319  C  CB    . GLU C 2  272  ? -16.659 -33.106 64.476  1.00 142.09 ? 272  GLU C CB    1 
ATOM   5320  C  CG    . GLU C 2  272  ? -16.693 -33.580 65.921  1.00 143.69 ? 272  GLU C CG    1 
ATOM   5321  C  CD    . GLU C 2  272  ? -15.411 -33.261 66.669  1.00 143.92 ? 272  GLU C CD    1 
ATOM   5322  O  OE1   . GLU C 2  272  ? -14.321 -33.474 66.099  1.00 140.07 ? 272  GLU C OE1   1 
ATOM   5323  O  OE2   . GLU C 2  272  ? -15.494 -32.790 67.825  1.00 140.83 ? 272  GLU C OE2   1 
ATOM   5324  N  N     . ALA C 2  273  ? -17.573 -30.647 62.487  1.00 146.09 ? 273  ALA C N     1 
ATOM   5325  C  CA    . ALA C 2  273  ? -17.790 -30.196 61.115  1.00 143.66 ? 273  ALA C CA    1 
ATOM   5326  C  C     . ALA C 2  273  ? -17.075 -28.875 60.845  1.00 141.26 ? 273  ALA C C     1 
ATOM   5327  O  O     . ALA C 2  273  ? -16.448 -28.704 59.800  1.00 137.70 ? 273  ALA C O     1 
ATOM   5328  C  CB    . ALA C 2  273  ? -19.277 -30.062 60.830  1.00 143.12 ? 273  ALA C CB    1 
ATOM   5329  N  N     . LEU C 2  274  ? -17.176 -27.943 61.790  1.00 143.20 ? 274  LEU C N     1 
ATOM   5330  C  CA    . LEU C 2  274  ? -16.476 -26.666 61.686  1.00 140.49 ? 274  LEU C CA    1 
ATOM   5331  C  C     . LEU C 2  274  ? -14.966 -26.880 61.691  1.00 141.70 ? 274  LEU C C     1 
ATOM   5332  O  O     . LEU C 2  274  ? -14.236 -26.220 60.951  1.00 141.73 ? 274  LEU C O     1 
ATOM   5333  C  CB    . LEU C 2  274  ? -16.878 -25.729 62.829  1.00 137.00 ? 274  LEU C CB    1 
ATOM   5334  C  CG    . LEU C 2  274  ? -18.297 -25.161 62.809  1.00 129.79 ? 274  LEU C CG    1 
ATOM   5335  C  CD1   . LEU C 2  274  ? -18.584 -24.416 64.099  1.00 123.93 ? 274  LEU C CD1   1 
ATOM   5336  C  CD2   . LEU C 2  274  ? -18.488 -24.248 61.615  1.00 123.14 ? 274  LEU C CD2   1 
ATOM   5337  N  N     . LEU C 2  275  ? -14.505 -27.805 62.529  1.00 142.75 ? 275  LEU C N     1 
ATOM   5338  C  CA    . LEU C 2  275  ? -13.087 -28.141 62.602  1.00 141.58 ? 275  LEU C CA    1 
ATOM   5339  C  C     . LEU C 2  275  ? -12.612 -28.781 61.301  1.00 146.28 ? 275  LEU C C     1 
ATOM   5340  O  O     . LEU C 2  275  ? -11.489 -28.545 60.858  1.00 145.62 ? 275  LEU C O     1 
ATOM   5341  C  CB    . LEU C 2  275  ? -12.814 -29.079 63.780  1.00 135.31 ? 275  LEU C CB    1 
ATOM   5342  C  CG    . LEU C 2  275  ? -13.016 -28.495 65.181  1.00 138.58 ? 275  LEU C CG    1 
ATOM   5343  C  CD1   . LEU C 2  275  ? -13.066 -29.605 66.218  1.00 144.30 ? 275  LEU C CD1   1 
ATOM   5344  C  CD2   . LEU C 2  275  ? -11.934 -27.479 65.524  1.00 131.89 ? 275  LEU C CD2   1 
ATOM   5345  N  N     . ASP C 2  276  ? -13.483 -29.582 60.692  1.00 150.70 ? 276  ASP C N     1 
ATOM   5346  C  CA    . ASP C 2  276  ? -13.173 -30.284 59.447  1.00 151.43 ? 276  ASP C CA    1 
ATOM   5347  C  C     . ASP C 2  276  ? -13.005 -29.317 58.271  1.00 144.90 ? 276  ASP C C     1 
ATOM   5348  O  O     . ASP C 2  276  ? -12.037 -29.406 57.513  1.00 139.29 ? 276  ASP C O     1 
ATOM   5349  C  CB    . ASP C 2  276  ? -14.273 -31.309 59.141  1.00 147.74 ? 276  ASP C CB    1 
ATOM   5350  C  CG    . ASP C 2  276  ? -13.957 -32.170 57.931  1.00 151.96 ? 276  ASP C CG    1 
ATOM   5351  O  OD1   . ASP C 2  276  ? -12.761 -32.364 57.626  1.00 152.16 ? 276  ASP C OD1   1 
ATOM   5352  O  OD2   . ASP C 2  276  ? -14.912 -32.659 57.289  1.00 150.50 ? 276  ASP C OD2   1 
ATOM   5353  N  N     . ILE C 2  277  ? -13.950 -28.393 58.128  1.00 142.50 ? 277  ILE C N     1 
ATOM   5354  C  CA    . ILE C 2  277  ? -13.907 -27.408 57.053  1.00 135.20 ? 277  ILE C CA    1 
ATOM   5355  C  C     . ILE C 2  277  ? -12.710 -26.471 57.202  1.00 136.16 ? 277  ILE C C     1 
ATOM   5356  O  O     . ILE C 2  277  ? -11.985 -26.220 56.239  1.00 133.49 ? 277  ILE C O     1 
ATOM   5357  C  CB    . ILE C 2  277  ? -15.203 -26.579 57.008  1.00 134.41 ? 277  ILE C CB    1 
ATOM   5358  C  CG1   . ILE C 2  277  ? -16.405 -27.493 56.760  1.00 137.20 ? 277  ILE C CG1   1 
ATOM   5359  C  CG2   . ILE C 2  277  ? -15.113 -25.502 55.939  1.00 128.57 ? 277  ILE C CG2   1 
ATOM   5360  C  CD1   . ILE C 2  277  ? -17.731 -26.766 56.704  1.00 143.07 ? 277  ILE C CD1   1 
ATOM   5361  N  N     . TYR C 2  278  ? -12.516 -25.965 58.418  1.00 139.64 ? 278  TYR C N     1 
ATOM   5362  C  CA    . TYR C 2  278  ? -11.386 -25.098 58.746  1.00 134.59 ? 278  TYR C CA    1 
ATOM   5363  C  C     . TYR C 2  278  ? -10.062 -25.748 58.353  1.00 133.62 ? 278  TYR C C     1 
ATOM   5364  O  O     . TYR C 2  278  ? -9.182  -25.097 57.790  1.00 131.25 ? 278  TYR C O     1 
ATOM   5365  C  CB    . TYR C 2  278  ? -11.390 -24.771 60.245  1.00 130.09 ? 278  TYR C CB    1 
ATOM   5366  C  CG    . TYR C 2  278  ? -10.339 -23.775 60.694  1.00 123.81 ? 278  TYR C CG    1 
ATOM   5367  C  CD1   . TYR C 2  278  ? -10.659 -22.438 60.881  1.00 122.34 ? 278  TYR C CD1   1 
ATOM   5368  C  CD2   . TYR C 2  278  ? -9.033  -24.176 60.950  1.00 128.74 ? 278  TYR C CD2   1 
ATOM   5369  C  CE1   . TYR C 2  278  ? -9.708  -21.526 61.299  1.00 124.93 ? 278  TYR C CE1   1 
ATOM   5370  C  CE2   . TYR C 2  278  ? -8.074  -23.270 61.364  1.00 130.64 ? 278  TYR C CE2   1 
ATOM   5371  C  CZ    . TYR C 2  278  ? -8.418  -21.947 61.537  1.00 129.63 ? 278  TYR C CZ    1 
ATOM   5372  O  OH    . TYR C 2  278  ? -7.469  -21.040 61.951  1.00 132.72 ? 278  TYR C OH    1 
ATOM   5373  N  N     . ARG C 2  279  ? -9.936  -27.038 58.653  1.00 135.36 ? 279  ARG C N     1 
ATOM   5374  C  CA    . ARG C 2  279  ? -8.713  -27.786 58.383  1.00 138.43 ? 279  ARG C CA    1 
ATOM   5375  C  C     . ARG C 2  279  ? -8.390  -27.864 56.897  1.00 133.07 ? 279  ARG C C     1 
ATOM   5376  O  O     . ARG C 2  279  ? -7.222  -27.924 56.508  1.00 132.49 ? 279  ARG C O     1 
ATOM   5377  C  CB    . ARG C 2  279  ? -8.822  -29.199 58.957  1.00 137.03 ? 279  ARG C CB    1 
ATOM   5378  C  CG    . ARG C 2  279  ? -8.495  -29.296 60.433  1.00 133.23 ? 279  ARG C CG    1 
ATOM   5379  C  CD    . ARG C 2  279  ? -8.759  -30.697 60.953  1.00 136.58 ? 279  ARG C CD    1 
ATOM   5380  N  NE    . ARG C 2  279  ? -10.162 -30.914 61.296  1.00 142.02 ? 279  ARG C NE    1 
ATOM   5381  C  CZ    . ARG C 2  279  ? -10.641 -32.052 61.790  1.00 141.31 ? 279  ARG C CZ    1 
ATOM   5382  N  NH1   . ARG C 2  279  ? -9.828  -33.081 61.995  1.00 132.31 ? 279  ARG C NH1   1 
ATOM   5383  N  NH2   . ARG C 2  279  ? -11.931 -32.163 62.079  1.00 144.66 ? 279  ARG C NH2   1 
ATOM   5384  N  N     . LYS C 2  280  ? -9.429  -27.864 56.070  1.00 127.44 ? 280  LYS C N     1 
ATOM   5385  C  CA    . LYS C 2  280  ? -9.256  -28.009 54.632  1.00 130.91 ? 280  LYS C CA    1 
ATOM   5386  C  C     . LYS C 2  280  ? -9.161  -26.654 53.940  1.00 130.91 ? 280  LYS C C     1 
ATOM   5387  O  O     . LYS C 2  280  ? -8.723  -26.561 52.793  1.00 127.98 ? 280  LYS C O     1 
ATOM   5388  C  CB    . LYS C 2  280  ? -10.409 -28.822 54.044  1.00 127.96 ? 280  LYS C CB    1 
ATOM   5389  C  CG    . LYS C 2  280  ? -10.605 -30.180 54.698  1.00 124.37 ? 280  LYS C CG    1 
ATOM   5390  C  CD    . LYS C 2  280  ? -9.563  -31.190 54.246  1.00 115.73 ? 280  LYS C CD    1 
ATOM   5391  C  CE    . LYS C 2  280  ? -9.859  -32.568 54.817  1.00 101.73 ? 280  LYS C CE    1 
ATOM   5392  N  NZ    . LYS C 2  280  ? -8.942  -33.603 54.273  1.00 95.49  ? 280  LYS C NZ    1 
ATOM   5393  N  N     . LEU C 2  281  ? -9.567  -25.603 54.644  1.00 134.24 ? 281  LEU C N     1 
ATOM   5394  C  CA    . LEU C 2  281  ? -9.561  -24.260 54.077  1.00 137.05 ? 281  LEU C CA    1 
ATOM   5395  C  C     . LEU C 2  281  ? -8.217  -23.582 54.311  1.00 134.48 ? 281  LEU C C     1 
ATOM   5396  O  O     . LEU C 2  281  ? -7.542  -23.174 53.365  1.00 132.37 ? 281  LEU C O     1 
ATOM   5397  C  CB    . LEU C 2  281  ? -10.695 -23.420 54.675  1.00 136.91 ? 281  LEU C CB    1 
ATOM   5398  C  CG    . LEU C 2  281  ? -11.361 -22.353 53.801  1.00 126.03 ? 281  LEU C CG    1 
ATOM   5399  C  CD1   . LEU C 2  281  ? -12.652 -21.887 54.454  1.00 122.19 ? 281  LEU C CD1   1 
ATOM   5400  C  CD2   . LEU C 2  281  ? -10.437 -21.171 53.545  1.00 126.58 ? 281  LEU C CD2   1 
ATOM   5401  N  N     . ARG C 2  282  ? -7.832  -23.465 55.578  1.00 133.14 ? 282  ARG C N     1 
ATOM   5402  C  CA    . ARG C 2  282  ? -6.584  -22.801 55.934  1.00 131.65 ? 282  ARG C CA    1 
ATOM   5403  C  C     . ARG C 2  282  ? -5.690  -23.672 56.810  1.00 130.53 ? 282  ARG C C     1 
ATOM   5404  O  O     . ARG C 2  282  ? -5.646  -23.498 58.030  1.00 123.06 ? 282  ARG C O     1 
ATOM   5405  C  CB    . ARG C 2  282  ? -6.872  -21.478 56.646  1.00 128.31 ? 282  ARG C CB    1 
ATOM   5406  C  CG    . ARG C 2  282  ? -7.512  -20.423 55.762  1.00 124.20 ? 282  ARG C CG    1 
ATOM   5407  C  CD    . ARG C 2  282  ? -7.949  -19.217 56.578  1.00 120.82 ? 282  ARG C CD    1 
ATOM   5408  N  NE    . ARG C 2  282  ? -8.626  -18.222 55.752  1.00 123.85 ? 282  ARG C NE    1 
ATOM   5409  C  CZ    . ARG C 2  282  ? -8.116  -17.036 55.436  1.00 121.80 ? 282  ARG C CZ    1 
ATOM   5410  N  NH1   . ARG C 2  282  ? -6.918  -16.684 55.886  1.00 120.05 ? 282  ARG C NH1   1 
ATOM   5411  N  NH2   . ARG C 2  282  ? -8.809  -16.198 54.676  1.00 108.68 ? 282  ARG C NH2   1 
ATOM   5412  N  N     . PRO C 2  283  ? -4.977  -24.623 56.188  1.00 135.91 ? 283  PRO C N     1 
ATOM   5413  C  CA    . PRO C 2  283  ? -3.958  -25.393 56.908  1.00 137.58 ? 283  PRO C CA    1 
ATOM   5414  C  C     . PRO C 2  283  ? -2.769  -24.515 57.296  1.00 132.70 ? 283  PRO C C     1 
ATOM   5415  O  O     . PRO C 2  283  ? -2.395  -23.612 56.544  1.00 124.43 ? 283  PRO C O     1 
ATOM   5416  C  CB    . PRO C 2  283  ? -3.542  -26.468 55.893  1.00 139.98 ? 283  PRO C CB    1 
ATOM   5417  C  CG    . PRO C 2  283  ? -4.664  -26.522 54.897  1.00 134.70 ? 283  PRO C CG    1 
ATOM   5418  C  CD    . PRO C 2  283  ? -5.169  -25.118 54.814  1.00 134.59 ? 283  PRO C CD    1 
ATOM   5419  N  N     . GLY C 2  284  ? -2.187  -24.780 58.462  1.00 132.00 ? 284  GLY C N     1 
ATOM   5420  C  CA    . GLY C 2  284  ? -1.051  -24.014 58.943  1.00 126.18 ? 284  GLY C CA    1 
ATOM   5421  C  C     . GLY C 2  284  ? -1.421  -23.144 60.128  1.00 131.49 ? 284  GLY C C     1 
ATOM   5422  O  O     . GLY C 2  284  ? -0.575  -22.447 60.691  1.00 125.31 ? 284  GLY C O     1 
ATOM   5423  N  N     . GLU C 2  285  ? -2.694  -23.195 60.508  1.00 131.48 ? 285  GLU C N     1 
ATOM   5424  C  CA    . GLU C 2  285  ? -3.224  -22.336 61.560  1.00 126.58 ? 285  GLU C CA    1 
ATOM   5425  C  C     . GLU C 2  285  ? -3.933  -23.146 62.644  1.00 124.15 ? 285  GLU C C     1 
ATOM   5426  O  O     . GLU C 2  285  ? -4.677  -24.079 62.338  1.00 122.36 ? 285  GLU C O     1 
ATOM   5427  C  CB    . GLU C 2  285  ? -4.177  -21.304 60.954  1.00 127.73 ? 285  GLU C CB    1 
ATOM   5428  C  CG    . GLU C 2  285  ? -3.545  -20.471 59.846  1.00 132.92 ? 285  GLU C CG    1 
ATOM   5429  C  CD    . GLU C 2  285  ? -4.572  -19.839 58.928  1.00 131.35 ? 285  GLU C CD    1 
ATOM   5430  O  OE1   . GLU C 2  285  ? -5.765  -19.819 59.296  1.00 135.02 ? 285  GLU C OE1   1 
ATOM   5431  O  OE2   . GLU C 2  285  ? -4.188  -19.368 57.836  1.00 123.57 ? 285  GLU C OE2   1 
ATOM   5432  N  N     . PRO C 2  286  ? -3.699  -22.789 63.919  1.00 127.97 ? 286  PRO C N     1 
ATOM   5433  C  CA    . PRO C 2  286  ? -4.292  -23.473 65.077  1.00 127.08 ? 286  PRO C CA    1 
ATOM   5434  C  C     . PRO C 2  286  ? -5.819  -23.354 65.121  1.00 127.23 ? 286  PRO C C     1 
ATOM   5435  O  O     . PRO C 2  286  ? -6.344  -22.248 65.236  1.00 129.42 ? 286  PRO C O     1 
ATOM   5436  C  CB    . PRO C 2  286  ? -3.651  -22.761 66.275  1.00 127.25 ? 286  PRO C CB    1 
ATOM   5437  C  CG    . PRO C 2  286  ? -3.191  -21.442 65.745  1.00 126.19 ? 286  PRO C CG    1 
ATOM   5438  C  CD    . PRO C 2  286  ? -2.799  -21.695 64.324  1.00 125.80 ? 286  PRO C CD    1 
ATOM   5439  N  N     . PRO C 2  287  ? -6.524  -24.493 65.035  1.00 126.79 ? 287  PRO C N     1 
ATOM   5440  C  CA    . PRO C 2  287  ? -7.989  -24.539 64.952  1.00 127.51 ? 287  PRO C CA    1 
ATOM   5441  C  C     . PRO C 2  287  ? -8.704  -24.384 66.295  1.00 130.73 ? 287  PRO C C     1 
ATOM   5442  O  O     . PRO C 2  287  ? -8.790  -25.343 67.063  1.00 137.51 ? 287  PRO C O     1 
ATOM   5443  C  CB    . PRO C 2  287  ? -8.253  -25.929 64.365  1.00 131.46 ? 287  PRO C CB    1 
ATOM   5444  C  CG    . PRO C 2  287  ? -7.114  -26.754 64.851  1.00 129.26 ? 287  PRO C CG    1 
ATOM   5445  C  CD    . PRO C 2  287  ? -5.921  -25.832 64.908  1.00 129.08 ? 287  PRO C CD    1 
ATOM   5446  N  N     . THR C 2  288  ? -9.216  -23.187 66.564  1.00 131.71 ? 288  THR C N     1 
ATOM   5447  C  CA    . THR C 2  288  ? -10.067 -22.958 67.728  1.00 136.56 ? 288  THR C CA    1 
ATOM   5448  C  C     . THR C 2  288  ? -11.519 -23.254 67.349  1.00 135.33 ? 288  THR C C     1 
ATOM   5449  O  O     . THR C 2  288  ? -11.886 -23.177 66.176  1.00 132.83 ? 288  THR C O     1 
ATOM   5450  C  CB    . THR C 2  288  ? -9.948  -21.501 68.254  1.00 129.62 ? 288  THR C CB    1 
ATOM   5451  O  OG1   . THR C 2  288  ? -8.573  -21.101 68.269  1.00 121.01 ? 288  THR C OG1   1 
ATOM   5452  C  CG2   . THR C 2  288  ? -10.525 -21.370 69.664  1.00 124.65 ? 288  THR C CG2   1 
ATOM   5453  N  N     . LYS C 2  289  ? -12.344 -23.601 68.334  1.00 135.79 ? 289  LYS C N     1 
ATOM   5454  C  CA    . LYS C 2  289  ? -13.774 -23.743 68.094  1.00 134.35 ? 289  LYS C CA    1 
ATOM   5455  C  C     . LYS C 2  289  ? -14.384 -22.367 67.841  1.00 134.05 ? 289  LYS C C     1 
ATOM   5456  O  O     . LYS C 2  289  ? -15.521 -22.254 67.388  1.00 135.35 ? 289  LYS C O     1 
ATOM   5457  C  CB    . LYS C 2  289  ? -14.471 -24.425 69.274  1.00 135.92 ? 289  LYS C CB    1 
ATOM   5458  C  CG    . LYS C 2  289  ? -13.963 -25.824 69.589  1.00 130.56 ? 289  LYS C CG    1 
ATOM   5459  C  CD    . LYS C 2  289  ? -14.869 -26.518 70.595  1.00 132.43 ? 289  LYS C CD    1 
ATOM   5460  C  CE    . LYS C 2  289  ? -14.283 -27.843 71.056  1.00 130.47 ? 289  LYS C CE    1 
ATOM   5461  N  NZ    . LYS C 2  289  ? -13.078 -27.653 71.912  1.00 135.63 ? 289  LYS C NZ    1 
ATOM   5462  N  N     . GLU C 2  290  ? -13.611 -21.326 68.137  1.00 135.09 ? 290  GLU C N     1 
ATOM   5463  C  CA    . GLU C 2  290  ? -14.059 -19.951 67.956  1.00 136.77 ? 290  GLU C CA    1 
ATOM   5464  C  C     . GLU C 2  290  ? -13.466 -19.293 66.707  1.00 140.47 ? 290  GLU C C     1 
ATOM   5465  O  O     . GLU C 2  290  ? -13.898 -18.211 66.312  1.00 143.20 ? 290  GLU C O     1 
ATOM   5466  C  CB    . GLU C 2  290  ? -13.717 -19.119 69.196  1.00 132.79 ? 290  GLU C CB    1 
ATOM   5467  C  CG    . GLU C 2  290  ? -14.553 -19.475 70.410  1.00 133.08 ? 290  GLU C CG    1 
ATOM   5468  C  CD    . GLU C 2  290  ? -16.037 -19.382 70.125  1.00 132.21 ? 290  GLU C CD    1 
ATOM   5469  O  OE1   . GLU C 2  290  ? -16.471 -18.344 69.582  1.00 130.75 ? 290  GLU C OE1   1 
ATOM   5470  O  OE2   . GLU C 2  290  ? -16.767 -20.349 70.428  1.00 136.08 ? 290  GLU C OE2   1 
ATOM   5471  N  N     . SER C 2  291  ? -12.485 -19.945 66.085  1.00 139.59 ? 291  SER C N     1 
ATOM   5472  C  CA    . SER C 2  291  ? -11.856 -19.409 64.876  1.00 131.04 ? 291  SER C CA    1 
ATOM   5473  C  C     . SER C 2  291  ? -12.368 -20.105 63.617  1.00 126.66 ? 291  SER C C     1 
ATOM   5474  O  O     . SER C 2  291  ? -12.104 -19.661 62.501  1.00 120.51 ? 291  SER C O     1 
ATOM   5475  C  CB    . SER C 2  291  ? -10.334 -19.539 64.954  1.00 126.74 ? 291  SER C CB    1 
ATOM   5476  O  OG    . SER C 2  291  ? -9.930  -20.890 64.815  1.00 132.20 ? 291  SER C OG    1 
ATOM   5477  N  N     . ALA C 2  292  ? -13.089 -21.205 63.805  1.00 132.75 ? 292  ALA C N     1 
ATOM   5478  C  CA    . ALA C 2  292  ? -13.692 -21.926 62.690  1.00 134.40 ? 292  ALA C CA    1 
ATOM   5479  C  C     . ALA C 2  292  ? -15.140 -21.493 62.523  1.00 129.87 ? 292  ALA C C     1 
ATOM   5480  O  O     . ALA C 2  292  ? -15.711 -21.585 61.439  1.00 124.87 ? 292  ALA C O     1 
ATOM   5481  C  CB    . ALA C 2  292  ? -13.604 -23.424 62.911  1.00 138.84 ? 292  ALA C CB    1 
ATOM   5482  N  N     . GLN C 2  293  ? -15.726 -21.029 63.619  1.00 132.44 ? 293  GLN C N     1 
ATOM   5483  C  CA    . GLN C 2  293  ? -17.064 -20.463 63.601  1.00 135.58 ? 293  GLN C CA    1 
ATOM   5484  C  C     . GLN C 2  293  ? -17.012 -19.055 63.015  1.00 132.00 ? 293  GLN C C     1 
ATOM   5485  O  O     . GLN C 2  293  ? -17.982 -18.575 62.430  1.00 129.10 ? 293  GLN C O     1 
ATOM   5486  C  CB    . GLN C 2  293  ? -17.655 -20.439 65.016  1.00 146.56 ? 293  GLN C CB    1 
ATOM   5487  C  CG    . GLN C 2  293  ? -19.040 -19.808 65.129  1.00 150.01 ? 293  GLN C CG    1 
ATOM   5488  C  CD    . GLN C 2  293  ? -20.160 -20.834 65.131  1.00 145.34 ? 293  GLN C CD    1 
ATOM   5489  O  OE1   . GLN C 2  293  ? -19.971 -21.977 65.546  1.00 140.52 ? 293  GLN C OE1   1 
ATOM   5490  N  NE2   . GLN C 2  293  ? -21.337 -20.425 64.669  1.00 140.78 ? 293  GLN C NE2   1 
ATOM   5491  N  N     . THR C 2  294  ? -15.858 -18.409 63.159  1.00 132.24 ? 294  THR C N     1 
ATOM   5492  C  CA    . THR C 2  294  ? -15.705 -17.004 62.794  1.00 131.70 ? 294  THR C CA    1 
ATOM   5493  C  C     . THR C 2  294  ? -15.588 -16.773 61.286  1.00 129.22 ? 294  THR C C     1 
ATOM   5494  O  O     . THR C 2  294  ? -16.235 -15.874 60.745  1.00 128.91 ? 294  THR C O     1 
ATOM   5495  C  CB    . THR C 2  294  ? -14.470 -16.383 63.484  1.00 128.63 ? 294  THR C CB    1 
ATOM   5496  O  OG1   . THR C 2  294  ? -14.582 -16.541 64.904  1.00 133.18 ? 294  THR C OG1   1 
ATOM   5497  C  CG2   . THR C 2  294  ? -14.357 -14.899 63.154  1.00 121.41 ? 294  THR C CG2   1 
ATOM   5498  N  N     . LEU C 2  295  ? -14.771 -17.573 60.606  1.00 129.97 ? 295  LEU C N     1 
ATOM   5499  C  CA    . LEU C 2  295  ? -14.514 -17.330 59.187  1.00 130.52 ? 295  LEU C CA    1 
ATOM   5500  C  C     . LEU C 2  295  ? -15.645 -17.843 58.297  1.00 126.93 ? 295  LEU C C     1 
ATOM   5501  O  O     . LEU C 2  295  ? -15.820 -17.367 57.174  1.00 121.82 ? 295  LEU C O     1 
ATOM   5502  C  CB    . LEU C 2  295  ? -13.170 -17.944 58.758  1.00 127.42 ? 295  LEU C CB    1 
ATOM   5503  C  CG    . LEU C 2  295  ? -12.826 -19.431 58.883  1.00 116.39 ? 295  LEU C CG    1 
ATOM   5504  C  CD1   . LEU C 2  295  ? -13.411 -20.254 57.748  1.00 117.65 ? 295  LEU C CD1   1 
ATOM   5505  C  CD2   . LEU C 2  295  ? -11.319 -19.586 58.910  1.00 118.61 ? 295  LEU C CD2   1 
ATOM   5506  N  N     . LEU C 2  296  ? -16.414 -18.806 58.797  1.00 124.86 ? 296  LEU C N     1 
ATOM   5507  C  CA    . LEU C 2  296  ? -17.564 -19.300 58.048  1.00 119.69 ? 296  LEU C CA    1 
ATOM   5508  C  C     . LEU C 2  296  ? -18.635 -18.213 57.951  1.00 113.87 ? 296  LEU C C     1 
ATOM   5509  O  O     . LEU C 2  296  ? -19.342 -18.116 56.949  1.00 106.78 ? 296  LEU C O     1 
ATOM   5510  C  CB    . LEU C 2  296  ? -18.129 -20.571 58.687  1.00 123.57 ? 296  LEU C CB    1 
ATOM   5511  C  CG    . LEU C 2  296  ? -17.703 -21.888 58.021  1.00 128.40 ? 296  LEU C CG    1 
ATOM   5512  C  CD1   . LEU C 2  296  ? -16.299 -22.321 58.433  1.00 122.44 ? 296  LEU C CD1   1 
ATOM   5513  C  CD2   . LEU C 2  296  ? -18.715 -22.995 58.285  1.00 135.24 ? 296  LEU C CD2   1 
ATOM   5514  N  N     . GLU C 2  297  ? -18.739 -17.392 58.993  1.00 118.74 ? 297  GLU C N     1 
ATOM   5515  C  CA    . GLU C 2  297  ? -19.599 -16.213 58.959  1.00 120.92 ? 297  GLU C CA    1 
ATOM   5516  C  C     . GLU C 2  297  ? -19.036 -15.175 57.994  1.00 118.44 ? 297  GLU C C     1 
ATOM   5517  O  O     . GLU C 2  297  ? -19.756 -14.625 57.162  1.00 117.20 ? 297  GLU C O     1 
ATOM   5518  C  CB    . GLU C 2  297  ? -19.740 -15.593 60.355  1.00 125.05 ? 297  GLU C CB    1 
ATOM   5519  C  CG    . GLU C 2  297  ? -20.274 -16.527 61.430  1.00 128.64 ? 297  GLU C CG    1 
ATOM   5520  C  CD    . GLU C 2  297  ? -20.311 -15.870 62.802  1.00 131.03 ? 297  GLU C CD    1 
ATOM   5521  O  OE1   . GLU C 2  297  ? -20.136 -14.635 62.877  1.00 128.61 ? 297  GLU C OE1   1 
ATOM   5522  O  OE2   . GLU C 2  297  ? -20.512 -16.588 63.805  1.00 129.90 ? 297  GLU C OE2   1 
ATOM   5523  N  N     . ASN C 2  298  ? -17.737 -14.916 58.116  1.00 120.56 ? 298  ASN C N     1 
ATOM   5524  C  CA    . ASN C 2  298  ? -17.070 -13.881 57.333  1.00 120.20 ? 298  ASN C CA    1 
ATOM   5525  C  C     . ASN C 2  298  ? -17.033 -14.161 55.831  1.00 116.00 ? 298  ASN C C     1 
ATOM   5526  O  O     . ASN C 2  298  ? -17.318 -13.275 55.025  1.00 119.56 ? 298  ASN C O     1 
ATOM   5527  C  CB    . ASN C 2  298  ? -15.638 -13.675 57.842  1.00 120.95 ? 298  ASN C CB    1 
ATOM   5528  C  CG    . ASN C 2  298  ? -15.583 -12.888 59.141  1.00 115.54 ? 298  ASN C CG    1 
ATOM   5529  O  OD1   . ASN C 2  298  ? -16.461 -12.072 59.425  1.00 112.31 ? 298  ASN C OD1   1 
ATOM   5530  N  ND2   . ASN C 2  298  ? -14.543 -13.125 59.932  1.00 108.57 ? 298  ASN C ND2   1 
ATOM   5531  N  N     . LEU C 2  299  ? -16.683 -15.389 55.459  1.00 109.04 ? 299  LEU C N     1 
ATOM   5532  C  CA    . LEU C 2  299  ? -16.446 -15.718 54.055  1.00 108.30 ? 299  LEU C CA    1 
ATOM   5533  C  C     . LEU C 2  299  ? -17.680 -15.614 53.158  1.00 110.78 ? 299  LEU C C     1 
ATOM   5534  O  O     . LEU C 2  299  ? -17.546 -15.536 51.936  1.00 111.84 ? 299  LEU C O     1 
ATOM   5535  C  CB    . LEU C 2  299  ? -15.860 -17.127 53.931  1.00 103.23 ? 299  LEU C CB    1 
ATOM   5536  C  CG    . LEU C 2  299  ? -14.363 -17.294 54.190  1.00 107.72 ? 299  LEU C CG    1 
ATOM   5537  C  CD1   . LEU C 2  299  ? -13.845 -18.540 53.489  1.00 108.76 ? 299  LEU C CD1   1 
ATOM   5538  C  CD2   . LEU C 2  299  ? -13.591 -16.064 53.742  1.00 116.48 ? 299  LEU C CD2   1 
ATOM   5539  N  N     . PHE C 2  300  ? -18.876 -15.614 53.741  1.00 112.27 ? 300  PHE C N     1 
ATOM   5540  C  CA    . PHE C 2  300  ? -20.085 -15.648 52.921  1.00 111.40 ? 300  PHE C CA    1 
ATOM   5541  C  C     . PHE C 2  300  ? -21.254 -14.808 53.431  1.00 110.69 ? 300  PHE C C     1 
ATOM   5542  O  O     . PHE C 2  300  ? -22.242 -14.631 52.718  1.00 106.73 ? 300  PHE C O     1 
ATOM   5543  C  CB    . PHE C 2  300  ? -20.551 -17.097 52.758  1.00 107.18 ? 300  PHE C CB    1 
ATOM   5544  C  CG    . PHE C 2  300  ? -19.565 -17.965 52.041  1.00 105.20 ? 300  PHE C CG    1 
ATOM   5545  C  CD1   . PHE C 2  300  ? -19.512 -17.975 50.659  1.00 107.36 ? 300  PHE C CD1   1 
ATOM   5546  C  CD2   . PHE C 2  300  ? -18.679 -18.761 52.748  1.00 104.27 ? 300  PHE C CD2   1 
ATOM   5547  C  CE1   . PHE C 2  300  ? -18.600 -18.766 49.993  1.00 110.33 ? 300  PHE C CE1   1 
ATOM   5548  C  CE2   . PHE C 2  300  ? -17.762 -19.555 52.088  1.00 105.35 ? 300  PHE C CE2   1 
ATOM   5549  C  CZ    . PHE C 2  300  ? -17.724 -19.558 50.709  1.00 108.85 ? 300  PHE C CZ    1 
ATOM   5550  N  N     . PHE C 2  301  ? -21.154 -14.285 54.649  1.00 114.82 ? 301  PHE C N     1 
ATOM   5551  C  CA    . PHE C 2  301  ? -22.309 -13.632 55.261  1.00 117.27 ? 301  PHE C CA    1 
ATOM   5552  C  C     . PHE C 2  301  ? -22.001 -12.271 55.886  1.00 120.67 ? 301  PHE C C     1 
ATOM   5553  O  O     . PHE C 2  301  ? -22.775 -11.768 56.702  1.00 119.05 ? 301  PHE C O     1 
ATOM   5554  C  CB    . PHE C 2  301  ? -22.922 -14.556 56.315  1.00 122.90 ? 301  PHE C CB    1 
ATOM   5555  C  CG    . PHE C 2  301  ? -23.213 -15.943 55.807  1.00 124.53 ? 301  PHE C CG    1 
ATOM   5556  C  CD1   . PHE C 2  301  ? -24.389 -16.214 55.128  1.00 123.34 ? 301  PHE C CD1   1 
ATOM   5557  C  CD2   . PHE C 2  301  ? -22.308 -16.973 56.006  1.00 120.11 ? 301  PHE C CD2   1 
ATOM   5558  C  CE1   . PHE C 2  301  ? -24.658 -17.488 54.658  1.00 117.31 ? 301  PHE C CE1   1 
ATOM   5559  C  CE2   . PHE C 2  301  ? -22.572 -18.248 55.538  1.00 116.66 ? 301  PHE C CE2   1 
ATOM   5560  C  CZ    . PHE C 2  301  ? -23.750 -18.504 54.864  1.00 113.45 ? 301  PHE C CZ    1 
ATOM   5561  N  N     . LYS C 2  302  ? -20.880 -11.673 55.496  1.00 123.24 ? 302  LYS C N     1 
ATOM   5562  C  CA    . LYS C 2  302  ? -20.523 -10.336 55.965  1.00 125.02 ? 302  LYS C CA    1 
ATOM   5563  C  C     . LYS C 2  302  ? -20.368 -9.379  54.790  1.00 120.99 ? 302  LYS C C     1 
ATOM   5564  O  O     . LYS C 2  302  ? -19.854 -9.764  53.742  1.00 118.17 ? 302  LYS C O     1 
ATOM   5565  C  CB    . LYS C 2  302  ? -19.232 -10.377 56.786  1.00 121.61 ? 302  LYS C CB    1 
ATOM   5566  C  CG    . LYS C 2  302  ? -19.446 -10.595 58.273  1.00 124.54 ? 302  LYS C CG    1 
ATOM   5567  C  CD    . LYS C 2  302  ? -20.182 -9.418  58.898  1.00 126.84 ? 302  LYS C CD    1 
ATOM   5568  C  CE    . LYS C 2  302  ? -19.413 -8.117  58.714  1.00 114.50 ? 302  LYS C CE    1 
ATOM   5569  N  NZ    . LYS C 2  302  ? -20.125 -6.953  59.311  1.00 112.05 ? 302  LYS C NZ    1 
ATOM   5570  N  N     . GLU C 2  303  ? -20.799 -8.132  54.971  1.00 116.80 ? 303  GLU C N     1 
ATOM   5571  C  CA    . GLU C 2  303  ? -20.718 -7.124  53.912  1.00 116.87 ? 303  GLU C CA    1 
ATOM   5572  C  C     . GLU C 2  303  ? -19.277 -6.757  53.570  1.00 114.96 ? 303  GLU C C     1 
ATOM   5573  O  O     . GLU C 2  303  ? -19.031 -6.000  52.632  1.00 114.18 ? 303  GLU C O     1 
ATOM   5574  C  CB    . GLU C 2  303  ? -21.479 -5.853  54.307  1.00 125.54 ? 303  GLU C CB    1 
ATOM   5575  C  CG    . GLU C 2  303  ? -22.996 -5.968  54.268  1.00 128.50 ? 303  GLU C CG    1 
ATOM   5576  C  CD    . GLU C 2  303  ? -23.691 -4.632  54.502  1.00 131.31 ? 303  GLU C CD    1 
ATOM   5577  O  OE1   . GLU C 2  303  ? -23.001 -3.643  54.833  1.00 132.62 ? 303  GLU C OE1   1 
ATOM   5578  O  OE2   . GLU C 2  303  ? -24.930 -4.572  54.353  1.00 127.53 ? 303  GLU C OE2   1 
ATOM   5579  N  N     . LYS C 2  304  ? -18.334 -7.293  54.338  1.00 118.66 ? 304  LYS C N     1 
ATOM   5580  C  CA    . LYS C 2  304  ? -16.921 -6.973  54.177  1.00 122.01 ? 304  LYS C CA    1 
ATOM   5581  C  C     . LYS C 2  304  ? -16.219 -7.898  53.180  1.00 112.93 ? 304  LYS C C     1 
ATOM   5582  O  O     . LYS C 2  304  ? -15.658 -7.443  52.182  1.00 108.60 ? 304  LYS C O     1 
ATOM   5583  C  CB    . LYS C 2  304  ? -16.217 -7.037  55.535  1.00 117.59 ? 304  LYS C CB    1 
ATOM   5584  C  CG    . LYS C 2  304  ? -16.877 -6.180  56.605  1.00 109.38 ? 304  LYS C CG    1 
ATOM   5585  C  CD    . LYS C 2  304  ? -16.183 -6.333  57.946  1.00 111.72 ? 304  LYS C CD    1 
ATOM   5586  C  CE    . LYS C 2  304  ? -16.844 -5.477  59.012  1.00 118.60 ? 304  LYS C CE    1 
ATOM   5587  N  NZ    . LYS C 2  304  ? -16.148 -5.605  60.320  1.00 129.10 ? 304  LYS C NZ    1 
ATOM   5588  N  N     . ARG C 2  305  ? -16.255 -9.196  53.452  1.00 106.72 ? 305  ARG C N     1 
ATOM   5589  C  CA    . ARG C 2  305  ? -15.525 -10.159 52.637  1.00 104.62 ? 305  ARG C CA    1 
ATOM   5590  C  C     . ARG C 2  305  ? -16.399 -10.769 51.545  1.00 108.97 ? 305  ARG C C     1 
ATOM   5591  O  O     . ARG C 2  305  ? -15.908 -11.508 50.692  1.00 108.90 ? 305  ARG C O     1 
ATOM   5592  C  CB    . ARG C 2  305  ? -14.948 -11.259 53.527  1.00 107.72 ? 305  ARG C CB    1 
ATOM   5593  C  CG    . ARG C 2  305  ? -14.073 -10.732 54.651  1.00 108.70 ? 305  ARG C CG    1 
ATOM   5594  C  CD    . ARG C 2  305  ? -12.599 -10.864 54.314  1.00 107.92 ? 305  ARG C CD    1 
ATOM   5595  N  NE    . ARG C 2  305  ? -12.178 -12.262 54.311  1.00 110.39 ? 305  ARG C NE    1 
ATOM   5596  C  CZ    . ARG C 2  305  ? -10.940 -12.673 54.060  1.00 111.91 ? 305  ARG C CZ    1 
ATOM   5597  N  NH1   . ARG C 2  305  ? -9.987  -11.792 53.789  1.00 110.09 ? 305  ARG C NH1   1 
ATOM   5598  N  NH2   . ARG C 2  305  ? -10.655 -13.968 54.082  1.00 106.34 ? 305  ARG C NH2   1 
ATOM   5599  N  N     . TYR C 2  306  ? -17.691 -10.452 51.573  1.00 112.42 ? 306  TYR C N     1 
ATOM   5600  C  CA    . TYR C 2  306  ? -18.641 -11.000 50.607  1.00 115.14 ? 306  TYR C CA    1 
ATOM   5601  C  C     . TYR C 2  306  ? -19.718 -9.981  50.262  1.00 111.73 ? 306  TYR C C     1 
ATOM   5602  O  O     . TYR C 2  306  ? -20.239 -9.303  51.144  1.00 113.34 ? 306  TYR C O     1 
ATOM   5603  C  CB    . TYR C 2  306  ? -19.289 -12.272 51.156  1.00 114.17 ? 306  TYR C CB    1 
ATOM   5604  C  CG    . TYR C 2  306  ? -19.827 -13.208 50.096  1.00 110.90 ? 306  TYR C CG    1 
ATOM   5605  C  CD1   . TYR C 2  306  ? -21.155 -13.143 49.689  1.00 108.02 ? 306  TYR C CD1   1 
ATOM   5606  C  CD2   . TYR C 2  306  ? -19.007 -14.164 49.511  1.00 109.21 ? 306  TYR C CD2   1 
ATOM   5607  C  CE1   . TYR C 2  306  ? -21.647 -14.005 48.723  1.00 112.33 ? 306  TYR C CE1   1 
ATOM   5608  C  CE2   . TYR C 2  306  ? -19.489 -15.028 48.546  1.00 109.09 ? 306  TYR C CE2   1 
ATOM   5609  C  CZ    . TYR C 2  306  ? -20.809 -14.947 48.155  1.00 112.14 ? 306  TYR C CZ    1 
ATOM   5610  O  OH    . TYR C 2  306  ? -21.290 -15.809 47.193  1.00 107.26 ? 306  TYR C OH    1 
ATOM   5611  N  N     . ASP C 2  307  ? -20.061 -9.876  48.983  1.00 107.44 ? 307  ASP C N     1 
ATOM   5612  C  CA    . ASP C 2  307  ? -21.075 -8.914  48.568  1.00 103.99 ? 307  ASP C CA    1 
ATOM   5613  C  C     . ASP C 2  307  ? -21.665 -9.232  47.203  1.00 99.55  ? 307  ASP C C     1 
ATOM   5614  O  O     . ASP C 2  307  ? -20.986 -9.141  46.182  1.00 99.14  ? 307  ASP C O     1 
ATOM   5615  C  CB    . ASP C 2  307  ? -20.493 -7.496  48.553  1.00 105.30 ? 307  ASP C CB    1 
ATOM   5616  C  CG    . ASP C 2  307  ? -21.524 -6.440  48.183  1.00 96.52  ? 307  ASP C CG    1 
ATOM   5617  O  OD1   . ASP C 2  307  ? -22.595 -6.390  48.826  1.00 93.81  ? 307  ASP C OD1   1 
ATOM   5618  O  OD2   . ASP C 2  307  ? -21.264 -5.659  47.244  1.00 92.94  ? 307  ASP C OD2   1 
ATOM   5619  N  N     . LEU C 2  308  ? -22.936 -9.618  47.201  1.00 102.47 ? 308  LEU C N     1 
ATOM   5620  C  CA    . LEU C 2  308  ? -23.720 -9.659  45.979  1.00 99.95  ? 308  LEU C CA    1 
ATOM   5621  C  C     . LEU C 2  308  ? -24.231 -8.253  45.728  1.00 94.61  ? 308  LEU C C     1 
ATOM   5622  O  O     . LEU C 2  308  ? -24.796 -7.635  46.628  1.00 103.54 ? 308  LEU C O     1 
ATOM   5623  C  CB    . LEU C 2  308  ? -24.893 -10.635 46.099  1.00 102.22 ? 308  LEU C CB    1 
ATOM   5624  C  CG    . LEU C 2  308  ? -24.614 -12.060 46.576  1.00 105.77 ? 308  LEU C CG    1 
ATOM   5625  C  CD1   . LEU C 2  308  ? -25.920 -12.788 46.858  1.00 105.97 ? 308  LEU C CD1   1 
ATOM   5626  C  CD2   . LEU C 2  308  ? -23.799 -12.817 45.546  1.00 102.19 ? 308  LEU C CD2   1 
ATOM   5627  N  N     . ALA C 2  309  ? -24.043 -7.737  44.520  1.00 90.22  ? 309  ALA C N     1 
ATOM   5628  C  CA    . ALA C 2  309  ? -24.602 -6.432  44.194  1.00 88.77  ? 309  ALA C CA    1 
ATOM   5629  C  C     . ALA C 2  309  ? -26.123 -6.515  44.200  1.00 94.33  ? 309  ALA C C     1 
ATOM   5630  O  O     . ALA C 2  309  ? -26.689 -7.580  44.461  1.00 96.07  ? 309  ALA C O     1 
ATOM   5631  C  CB    . ALA C 2  309  ? -24.095 -5.949  42.852  1.00 89.10  ? 309  ALA C CB    1 
ATOM   5632  N  N     . ARG C 2  310  ? -26.785 -5.395  43.924  1.00 98.47  ? 310  ARG C N     1 
ATOM   5633  C  CA    . ARG C 2  310  ? -28.244 -5.391  43.810  1.00 108.64 ? 310  ARG C CA    1 
ATOM   5634  C  C     . ARG C 2  310  ? -28.684 -6.417  42.772  1.00 101.54 ? 310  ARG C C     1 
ATOM   5635  O  O     . ARG C 2  310  ? -29.667 -7.137  42.967  1.00 90.22  ? 310  ARG C O     1 
ATOM   5636  C  CB    . ARG C 2  310  ? -28.765 -3.995  43.446  1.00 105.81 ? 310  ARG C CB    1 
ATOM   5637  C  CG    . ARG C 2  310  ? -28.859 -3.046  44.635  1.00 102.17 ? 310  ARG C CG    1 
ATOM   5638  C  CD    . ARG C 2  310  ? -29.375 -1.671  44.231  1.00 97.39  ? 310  ARG C CD    1 
ATOM   5639  N  NE    . ARG C 2  310  ? -29.213 -0.688  45.301  1.00 99.54  ? 310  ARG C NE    1 
ATOM   5640  C  CZ    . ARG C 2  310  ? -28.057 -0.106  45.609  1.00 95.97  ? 310  ARG C CZ    1 
ATOM   5641  N  NH1   . ARG C 2  310  ? -26.959 -0.415  44.936  1.00 94.32  ? 310  ARG C NH1   1 
ATOM   5642  N  NH2   . ARG C 2  310  ? -27.994 0.778   46.594  1.00 92.24  ? 310  ARG C NH2   1 
ATOM   5643  N  N     . VAL C 2  311  ? -27.930 -6.480  41.677  1.00 98.05  ? 311  VAL C N     1 
ATOM   5644  C  CA    . VAL C 2  311  ? -28.126 -7.492  40.650  1.00 88.98  ? 311  VAL C CA    1 
ATOM   5645  C  C     . VAL C 2  311  ? -27.826 -8.871  41.218  1.00 88.27  ? 311  VAL C C     1 
ATOM   5646  O  O     . VAL C 2  311  ? -28.587 -9.812  41.008  1.00 94.44  ? 311  VAL C O     1 
ATOM   5647  C  CB    . VAL C 2  311  ? -27.233 -7.230  39.416  1.00 81.32  ? 311  VAL C CB    1 
ATOM   5648  C  CG1   . VAL C 2  311  ? -25.861 -6.723  39.838  1.00 75.24  ? 311  VAL C CG1   1 
ATOM   5649  C  CG2   . VAL C 2  311  ? -27.113 -8.484  38.564  1.00 78.60  ? 311  VAL C CG2   1 
ATOM   5650  N  N     . GLY C 2  312  ? -26.720 -8.977  41.950  1.00 89.54  ? 312  GLY C N     1 
ATOM   5651  C  CA    . GLY C 2  312  ? -26.354 -10.212 42.617  1.00 93.17  ? 312  GLY C CA    1 
ATOM   5652  C  C     . GLY C 2  312  ? -27.451 -10.735 43.524  1.00 96.52  ? 312  GLY C C     1 
ATOM   5653  O  O     . GLY C 2  312  ? -27.719 -11.934 43.556  1.00 93.84  ? 312  GLY C O     1 
ATOM   5654  N  N     . ARG C 2  313  ? -28.096 -9.839  44.262  1.00 95.05  ? 313  ARG C N     1 
ATOM   5655  C  CA    . ARG C 2  313  ? -29.207 -10.238 45.115  1.00 97.80  ? 313  ARG C CA    1 
ATOM   5656  C  C     . ARG C 2  313  ? -30.416 -10.605 44.257  1.00 97.21  ? 313  ARG C C     1 
ATOM   5657  O  O     . ARG C 2  313  ? -30.959 -11.704 44.373  1.00 95.36  ? 313  ARG C O     1 
ATOM   5658  C  CB    . ARG C 2  313  ? -29.565 -9.123  46.104  1.00 101.96 ? 313  ARG C CB    1 
ATOM   5659  C  CG    . ARG C 2  313  ? -30.694 -9.462  47.081  1.00 109.79 ? 313  ARG C CG    1 
ATOM   5660  C  CD    . ARG C 2  313  ? -30.246 -10.414 48.189  1.00 105.39 ? 313  ARG C CD    1 
ATOM   5661  N  NE    . ARG C 2  313  ? -30.438 -11.816 47.834  1.00 104.64 ? 313  ARG C NE    1 
ATOM   5662  C  CZ    . ARG C 2  313  ? -30.083 -12.841 48.602  1.00 104.41 ? 313  ARG C CZ    1 
ATOM   5663  N  NH1   . ARG C 2  313  ? -29.510 -12.631 49.780  1.00 105.74 ? 313  ARG C NH1   1 
ATOM   5664  N  NH2   . ARG C 2  313  ? -30.299 -14.079 48.186  1.00 103.18 ? 313  ARG C NH2   1 
ATOM   5665  N  N     . TYR C 2  314  ? -30.807 -9.683  43.380  1.00 94.66  ? 314  TYR C N     1 
ATOM   5666  C  CA    . TYR C 2  314  ? -31.994 -9.828  42.535  1.00 97.74  ? 314  TYR C CA    1 
ATOM   5667  C  C     . TYR C 2  314  ? -31.942 -11.025 41.577  1.00 97.43  ? 314  TYR C C     1 
ATOM   5668  O  O     . TYR C 2  314  ? -32.972 -11.631 41.269  1.00 93.60  ? 314  TYR C O     1 
ATOM   5669  C  CB    . TYR C 2  314  ? -32.209 -8.536  41.741  1.00 96.72  ? 314  TYR C CB    1 
ATOM   5670  C  CG    . TYR C 2  314  ? -33.286 -8.620  40.687  1.00 99.92  ? 314  TYR C CG    1 
ATOM   5671  C  CD1   . TYR C 2  314  ? -34.606 -8.871  41.036  1.00 105.03 ? 314  TYR C CD1   1 
ATOM   5672  C  CD2   . TYR C 2  314  ? -32.986 -8.435  39.343  1.00 96.55  ? 314  TYR C CD2   1 
ATOM   5673  C  CE1   . TYR C 2  314  ? -35.596 -8.947  40.076  1.00 109.29 ? 314  TYR C CE1   1 
ATOM   5674  C  CE2   . TYR C 2  314  ? -33.969 -8.509  38.376  1.00 102.41 ? 314  TYR C CE2   1 
ATOM   5675  C  CZ    . TYR C 2  314  ? -35.272 -8.764  38.747  1.00 107.50 ? 314  TYR C CZ    1 
ATOM   5676  O  OH    . TYR C 2  314  ? -36.253 -8.838  37.782  1.00 103.22 ? 314  TYR C OH    1 
ATOM   5677  N  N     . LYS C 2  315  ? -30.746 -11.361 41.104  1.00 98.27  ? 315  LYS C N     1 
ATOM   5678  C  CA    . LYS C 2  315  ? -30.583 -12.493 40.198  1.00 96.19  ? 315  LYS C CA    1 
ATOM   5679  C  C     . LYS C 2  315  ? -30.756 -13.798 40.963  1.00 97.04  ? 315  LYS C C     1 
ATOM   5680  O  O     . LYS C 2  315  ? -31.383 -14.740 40.475  1.00 96.73  ? 315  LYS C O     1 
ATOM   5681  C  CB    . LYS C 2  315  ? -29.212 -12.456 39.515  1.00 92.51  ? 315  LYS C CB    1 
ATOM   5682  C  CG    . LYS C 2  315  ? -29.128 -13.297 38.259  1.00 81.71  ? 315  LYS C CG    1 
ATOM   5683  C  CD    . LYS C 2  315  ? -30.137 -12.811 37.238  1.00 84.53  ? 315  LYS C CD    1 
ATOM   5684  C  CE    . LYS C 2  315  ? -30.350 -13.832 36.141  1.00 83.06  ? 315  LYS C CE    1 
ATOM   5685  N  NZ    . LYS C 2  315  ? -31.411 -13.404 35.184  1.00 81.57  ? 315  LYS C NZ    1 
ATOM   5686  N  N     . VAL C 2  316  ? -30.193 -13.841 42.166  1.00 94.43  ? 316  VAL C N     1 
ATOM   5687  C  CA    . VAL C 2  316  ? -30.316 -15.005 43.032  1.00 93.09  ? 316  VAL C CA    1 
ATOM   5688  C  C     . VAL C 2  316  ? -31.779 -15.235 43.396  1.00 94.69  ? 316  VAL C C     1 
ATOM   5689  O  O     . VAL C 2  316  ? -32.291 -16.352 43.293  1.00 92.00  ? 316  VAL C O     1 
ATOM   5690  C  CB    . VAL C 2  316  ? -29.474 -14.841 44.312  1.00 87.32  ? 316  VAL C CB    1 
ATOM   5691  C  CG1   . VAL C 2  316  ? -29.924 -15.822 45.378  1.00 96.32  ? 316  VAL C CG1   1 
ATOM   5692  C  CG2   . VAL C 2  316  ? -27.998 -15.028 44.001  1.00 88.24  ? 316  VAL C CG2   1 
ATOM   5693  N  N     . ASN C 2  317  ? -32.446 -14.157 43.795  1.00 96.93  ? 317  ASN C N     1 
ATOM   5694  C  CA    . ASN C 2  317  ? -33.845 -14.200 44.210  1.00 101.00 ? 317  ASN C CA    1 
ATOM   5695  C  C     . ASN C 2  317  ? -34.810 -14.625 43.102  1.00 103.57 ? 317  ASN C C     1 
ATOM   5696  O  O     . ASN C 2  317  ? -35.785 -15.323 43.365  1.00 109.30 ? 317  ASN C O     1 
ATOM   5697  C  CB    . ASN C 2  317  ? -34.265 -12.835 44.758  1.00 96.54  ? 317  ASN C CB    1 
ATOM   5698  C  CG    . ASN C 2  317  ? -33.536 -12.472 46.036  1.00 94.08  ? 317  ASN C CG    1 
ATOM   5699  O  OD1   . ASN C 2  317  ? -32.505 -13.058 46.363  1.00 94.45  ? 317  ASN C OD1   1 
ATOM   5700  N  ND2   . ASN C 2  317  ? -34.071 -11.503 46.767  1.00 96.06  ? 317  ASN C ND2   1 
ATOM   5701  N  N     . LYS C 2  318  ? -34.551 -14.199 41.870  1.00 98.29  ? 318  LYS C N     1 
ATOM   5702  C  CA    . LYS C 2  318  ? -35.396 -14.615 40.756  1.00 94.74  ? 318  LYS C CA    1 
ATOM   5703  C  C     . LYS C 2  318  ? -35.205 -16.100 40.479  1.00 97.72  ? 318  LYS C C     1 
ATOM   5704  O  O     . LYS C 2  318  ? -36.125 -16.782 40.025  1.00 97.99  ? 318  LYS C O     1 
ATOM   5705  C  CB    . LYS C 2  318  ? -35.094 -13.804 39.493  1.00 94.47  ? 318  LYS C CB    1 
ATOM   5706  C  CG    . LYS C 2  318  ? -35.745 -12.429 39.448  1.00 96.81  ? 318  LYS C CG    1 
ATOM   5707  C  CD    . LYS C 2  318  ? -36.057 -12.012 38.010  1.00 97.24  ? 318  LYS C CD    1 
ATOM   5708  C  CE    . LYS C 2  318  ? -34.809 -12.007 37.131  1.00 94.94  ? 318  LYS C CE    1 
ATOM   5709  N  NZ    . LYS C 2  318  ? -35.122 -11.657 35.714  1.00 83.32  ? 318  LYS C NZ    1 
ATOM   5710  N  N     . LYS C 2  319  ? -34.006 -16.597 40.768  1.00 96.30  ? 319  LYS C N     1 
ATOM   5711  C  CA    . LYS C 2  319  ? -33.669 -17.986 40.486  1.00 101.46 ? 319  LYS C CA    1 
ATOM   5712  C  C     . LYS C 2  319  ? -34.236 -18.930 41.544  1.00 103.69 ? 319  LYS C C     1 
ATOM   5713  O  O     . LYS C 2  319  ? -34.583 -20.071 41.241  1.00 105.72 ? 319  LYS C O     1 
ATOM   5714  C  CB    . LYS C 2  319  ? -32.151 -18.156 40.381  1.00 92.47  ? 319  LYS C CB    1 
ATOM   5715  C  CG    . LYS C 2  319  ? -31.717 -19.505 39.830  1.00 88.64  ? 319  LYS C CG    1 
ATOM   5716  C  CD    . LYS C 2  319  ? -32.496 -19.859 38.572  1.00 88.84  ? 319  LYS C CD    1 
ATOM   5717  C  CE    . LYS C 2  319  ? -32.072 -21.208 38.017  1.00 93.73  ? 319  LYS C CE    1 
ATOM   5718  N  NZ    . LYS C 2  319  ? -32.997 -21.701 36.957  1.00 94.68  ? 319  LYS C NZ    1 
ATOM   5719  N  N     . LEU C 2  320  ? -34.335 -18.453 42.781  1.00 100.77 ? 320  LEU C N     1 
ATOM   5720  C  CA    . LEU C 2  320  ? -34.853 -19.277 43.870  1.00 102.62 ? 320  LEU C CA    1 
ATOM   5721  C  C     . LEU C 2  320  ? -36.286 -18.894 44.241  1.00 105.27 ? 320  LEU C C     1 
ATOM   5722  O  O     . LEU C 2  320  ? -36.993 -19.664 44.890  1.00 107.46 ? 320  LEU C O     1 
ATOM   5723  C  CB    . LEU C 2  320  ? -33.941 -19.173 45.097  1.00 104.74 ? 320  LEU C CB    1 
ATOM   5724  C  CG    . LEU C 2  320  ? -32.521 -19.720 44.919  1.00 109.10 ? 320  LEU C CG    1 
ATOM   5725  C  CD1   . LEU C 2  320  ? -31.702 -19.546 46.193  1.00 106.84 ? 320  LEU C CD1   1 
ATOM   5726  C  CD2   . LEU C 2  320  ? -32.549 -21.185 44.484  1.00 113.46 ? 320  LEU C CD2   1 
ATOM   5727  N  N     . GLY C 2  321  ? -36.707 -17.703 43.824  1.00 107.05 ? 321  GLY C N     1 
ATOM   5728  C  CA    . GLY C 2  321  ? -38.070 -17.246 44.039  1.00 106.45 ? 321  GLY C CA    1 
ATOM   5729  C  C     . GLY C 2  321  ? -38.445 -17.032 45.491  1.00 106.51 ? 321  GLY C C     1 
ATOM   5730  O  O     . GLY C 2  321  ? -39.457 -17.551 45.957  1.00 111.23 ? 321  GLY C O     1 
ATOM   5731  N  N     . LEU C 2  322  ? -37.632 -16.262 46.205  1.00 105.21 ? 322  LEU C N     1 
ATOM   5732  C  CA    . LEU C 2  322  ? -37.898 -15.953 47.604  1.00 105.56 ? 322  LEU C CA    1 
ATOM   5733  C  C     . LEU C 2  322  ? -37.679 -14.469 47.866  1.00 102.13 ? 322  LEU C C     1 
ATOM   5734  O  O     . LEU C 2  322  ? -36.721 -13.884 47.360  1.00 99.47  ? 322  LEU C O     1 
ATOM   5735  C  CB    . LEU C 2  322  ? -37.016 -16.807 48.521  1.00 112.94 ? 322  LEU C CB    1 
ATOM   5736  C  CG    . LEU C 2  322  ? -35.530 -16.976 48.182  1.00 107.07 ? 322  LEU C CG    1 
ATOM   5737  C  CD1   . LEU C 2  322  ? -34.679 -15.920 48.877  1.00 98.91  ? 322  LEU C CD1   1 
ATOM   5738  C  CD2   . LEU C 2  322  ? -35.051 -18.381 48.536  1.00 105.32 ? 322  LEU C CD2   1 
ATOM   5739  N  N     . HIS C 2  323  ? -38.579 -13.870 48.645  1.00 103.56 ? 323  HIS C N     1 
ATOM   5740  C  CA    . HIS C 2  323  ? -38.566 -12.430 48.902  1.00 104.18 ? 323  HIS C CA    1 
ATOM   5741  C  C     . HIS C 2  323  ? -38.697 -11.676 47.589  1.00 103.70 ? 323  HIS C C     1 
ATOM   5742  O  O     . HIS C 2  323  ? -38.106 -10.615 47.407  1.00 104.29 ? 323  HIS C O     1 
ATOM   5743  C  CB    . HIS C 2  323  ? -37.289 -12.007 49.631  1.00 104.55 ? 323  HIS C CB    1 
ATOM   5744  C  CG    . HIS C 2  323  ? -37.053 -12.739 50.913  1.00 106.86 ? 323  HIS C CG    1 
ATOM   5745  N  ND1   . HIS C 2  323  ? -37.017 -12.103 52.136  1.00 115.27 ? 323  HIS C ND1   1 
ATOM   5746  C  CD2   . HIS C 2  323  ? -36.844 -14.053 51.168  1.00 106.07 ? 323  HIS C CD2   1 
ATOM   5747  C  CE1   . HIS C 2  323  ? -36.794 -12.992 53.086  1.00 115.92 ? 323  HIS C CE1   1 
ATOM   5748  N  NE2   . HIS C 2  323  ? -36.687 -14.183 52.526  1.00 111.50 ? 323  HIS C NE2   1 
ATOM   5749  N  N     . VAL C 2  324  ? -39.478 -12.243 46.677  1.00 104.32 ? 324  VAL C N     1 
ATOM   5750  C  CA    . VAL C 2  324  ? -39.575 -11.739 45.313  1.00 115.76 ? 324  VAL C CA    1 
ATOM   5751  C  C     . VAL C 2  324  ? -40.252 -10.366 45.252  1.00 118.74 ? 324  VAL C C     1 
ATOM   5752  O  O     . VAL C 2  324  ? -39.883 -9.515  44.438  1.00 115.90 ? 324  VAL C O     1 
ATOM   5753  C  CB    . VAL C 2  324  ? -40.331 -12.750 44.413  1.00 118.03 ? 324  VAL C CB    1 
ATOM   5754  C  CG1   . VAL C 2  324  ? -41.663 -13.147 45.042  1.00 112.73 ? 324  VAL C CG1   1 
ATOM   5755  C  CG2   . VAL C 2  324  ? -40.518 -12.201 43.003  1.00 124.92 ? 324  VAL C CG2   1 
ATOM   5756  N  N     . GLY C 2  325  ? -41.227 -10.145 46.127  1.00 118.59 ? 325  GLY C N     1 
ATOM   5757  C  CA    . GLY C 2  325  ? -41.934 -8.878  46.168  1.00 120.83 ? 325  GLY C CA    1 
ATOM   5758  C  C     . GLY C 2  325  ? -41.195 -7.839  46.987  1.00 125.70 ? 325  GLY C C     1 
ATOM   5759  O  O     . GLY C 2  325  ? -41.208 -6.650  46.663  1.00 118.02 ? 325  GLY C O     1 
ATOM   5760  N  N     . GLU C 2  326  ? -40.546 -8.301  48.052  1.00 131.77 ? 326  GLU C N     1 
ATOM   5761  C  CA    . GLU C 2  326  ? -39.803 -7.438  48.965  1.00 131.93 ? 326  GLU C CA    1 
ATOM   5762  C  C     . GLU C 2  326  ? -38.704 -6.653  48.245  1.00 128.72 ? 326  GLU C C     1 
ATOM   5763  O  O     . GLU C 2  326  ? -37.969 -7.216  47.432  1.00 132.11 ? 326  GLU C O     1 
ATOM   5764  C  CB    . GLU C 2  326  ? -39.203 -8.280  50.096  1.00 127.97 ? 326  GLU C CB    1 
ATOM   5765  C  CG    . GLU C 2  326  ? -38.501 -7.483  51.175  1.00 130.25 ? 326  GLU C CG    1 
ATOM   5766  C  CD    . GLU C 2  326  ? -38.071 -8.345  52.340  1.00 134.48 ? 326  GLU C CD    1 
ATOM   5767  O  OE1   . GLU C 2  326  ? -38.391 -9.553  52.334  1.00 133.18 ? 326  GLU C OE1   1 
ATOM   5768  O  OE2   . GLU C 2  326  ? -37.415 -7.814  53.260  1.00 139.73 ? 326  GLU C OE2   1 
ATOM   5769  N  N     . PRO C 2  327  ? -38.599 -5.345  48.536  1.00 120.94 ? 327  PRO C N     1 
ATOM   5770  C  CA    . PRO C 2  327  ? -37.583 -4.468  47.937  1.00 118.76 ? 327  PRO C CA    1 
ATOM   5771  C  C     . PRO C 2  327  ? -36.156 -4.925  48.223  1.00 124.80 ? 327  PRO C C     1 
ATOM   5772  O  O     . PRO C 2  327  ? -35.929 -5.698  49.155  1.00 130.96 ? 327  PRO C O     1 
ATOM   5773  C  CB    . PRO C 2  327  ? -37.857 -3.111  48.595  1.00 120.30 ? 327  PRO C CB    1 
ATOM   5774  C  CG    . PRO C 2  327  ? -38.644 -3.428  49.829  1.00 119.16 ? 327  PRO C CG    1 
ATOM   5775  C  CD    . PRO C 2  327  ? -39.480 -4.606  49.455  1.00 118.17 ? 327  PRO C CD    1 
ATOM   5776  N  N     . ILE C 2  328  ? -35.205 -4.441  47.430  1.00 124.65 ? 328  ILE C N     1 
ATOM   5777  C  CA    . ILE C 2  328  ? -33.818 -4.874  47.554  1.00 129.67 ? 328  ILE C CA    1 
ATOM   5778  C  C     . ILE C 2  328  ? -33.121 -4.165  48.715  1.00 124.74 ? 328  ILE C C     1 
ATOM   5779  O  O     . ILE C 2  328  ? -32.790 -2.981  48.631  1.00 121.10 ? 328  ILE C O     1 
ATOM   5780  C  CB    . ILE C 2  328  ? -33.018 -4.631  46.247  1.00 128.65 ? 328  ILE C CB    1 
ATOM   5781  C  CG1   . ILE C 2  328  ? -33.786 -5.155  45.026  1.00 124.40 ? 328  ILE C CG1   1 
ATOM   5782  C  CG2   . ILE C 2  328  ? -31.634 -5.273  46.337  1.00 110.93 ? 328  ILE C CG2   1 
ATOM   5783  C  CD1   . ILE C 2  328  ? -34.620 -4.102  44.301  1.00 113.98 ? 328  ILE C CD1   1 
ATOM   5784  N  N     . THR C 2  329  ? -32.911 -4.902  49.801  1.00 123.15 ? 329  THR C N     1 
ATOM   5785  C  CA    . THR C 2  329  ? -32.223 -4.371  50.972  1.00 124.58 ? 329  THR C CA    1 
ATOM   5786  C  C     . THR C 2  329  ? -31.005 -5.226  51.314  1.00 123.46 ? 329  THR C C     1 
ATOM   5787  O  O     . THR C 2  329  ? -30.021 -4.728  51.865  1.00 127.48 ? 329  THR C O     1 
ATOM   5788  C  CB    . THR C 2  329  ? -33.164 -4.292  52.195  1.00 127.34 ? 329  THR C CB    1 
ATOM   5789  O  OG1   . THR C 2  329  ? -32.417 -3.912  53.357  1.00 133.30 ? 329  THR C OG1   1 
ATOM   5790  C  CG2   . THR C 2  329  ? -33.838 -5.634  52.445  1.00 117.10 ? 329  THR C CG2   1 
ATOM   5791  N  N     . SER C 2  330  ? -31.071 -6.511  50.975  1.00 118.10 ? 330  SER C N     1 
ATOM   5792  C  CA    . SER C 2  330  ? -29.982 -7.439  51.268  1.00 118.86 ? 330  SER C CA    1 
ATOM   5793  C  C     . SER C 2  330  ? -28.869 -7.355  50.234  1.00 115.33 ? 330  SER C C     1 
ATOM   5794  O  O     . SER C 2  330  ? -29.100 -7.524  49.038  1.00 112.40 ? 330  SER C O     1 
ATOM   5795  C  CB    . SER C 2  330  ? -30.500 -8.876  51.345  1.00 119.66 ? 330  SER C CB    1 
ATOM   5796  O  OG    . SER C 2  330  ? -29.427 -9.804  51.302  1.00 115.57 ? 330  SER C OG    1 
ATOM   5797  N  N     . SER C 2  331  ? -27.658 -7.092  50.708  1.00 116.20 ? 331  SER C N     1 
ATOM   5798  C  CA    . SER C 2  331  ? -26.487 -7.083  49.846  1.00 117.00 ? 331  SER C CA    1 
ATOM   5799  C  C     . SER C 2  331  ? -25.656 -8.333  50.100  1.00 117.39 ? 331  SER C C     1 
ATOM   5800  O  O     . SER C 2  331  ? -24.556 -8.474  49.567  1.00 121.22 ? 331  SER C O     1 
ATOM   5801  C  CB    . SER C 2  331  ? -25.640 -5.827  50.083  1.00 112.85 ? 331  SER C CB    1 
ATOM   5802  O  OG    . SER C 2  331  ? -26.371 -4.640  49.830  1.00 102.99 ? 331  SER C OG    1 
ATOM   5803  N  N     . THR C 2  332  ? -26.184 -9.242  50.915  1.00 113.53 ? 332  THR C N     1 
ATOM   5804  C  CA    . THR C 2  332  ? -25.387 -10.362 51.398  1.00 113.89 ? 332  THR C CA    1 
ATOM   5805  C  C     . THR C 2  332  ? -26.102 -11.705 51.281  1.00 108.35 ? 332  THR C C     1 
ATOM   5806  O  O     . THR C 2  332  ? -27.330 -11.785 51.347  1.00 103.46 ? 332  THR C O     1 
ATOM   5807  C  CB    . THR C 2  332  ? -24.972 -10.149 52.873  1.00 117.05 ? 332  THR C CB    1 
ATOM   5808  O  OG1   . THR C 2  332  ? -24.630 -8.774  53.086  1.00 118.86 ? 332  THR C OG1   1 
ATOM   5809  C  CG2   . THR C 2  332  ? -23.777 -11.019 53.231  1.00 113.16 ? 332  THR C CG2   1 
ATOM   5810  N  N     . LEU C 2  333  ? -25.307 -12.753 51.098  1.00 113.43 ? 333  LEU C N     1 
ATOM   5811  C  CA    . LEU C 2  333  ? -25.781 -14.129 51.089  1.00 117.99 ? 333  LEU C CA    1 
ATOM   5812  C  C     . LEU C 2  333  ? -26.337 -14.505 52.463  1.00 120.75 ? 333  LEU C C     1 
ATOM   5813  O  O     . LEU C 2  333  ? -25.920 -13.945 53.479  1.00 114.91 ? 333  LEU C O     1 
ATOM   5814  C  CB    . LEU C 2  333  ? -24.635 -15.066 50.695  1.00 114.19 ? 333  LEU C CB    1 
ATOM   5815  C  CG    . LEU C 2  333  ? -24.923 -16.480 50.200  1.00 107.45 ? 333  LEU C CG    1 
ATOM   5816  C  CD1   . LEU C 2  333  ? -25.717 -16.428 48.911  1.00 107.38 ? 333  LEU C CD1   1 
ATOM   5817  C  CD2   . LEU C 2  333  ? -23.614 -17.225 49.995  1.00 102.48 ? 333  LEU C CD2   1 
ATOM   5818  N  N     . THR C 2  334  ? -27.286 -15.441 52.491  1.00 127.33 ? 334  THR C N     1 
ATOM   5819  C  CA    . THR C 2  334  ? -27.866 -15.922 53.748  1.00 127.72 ? 334  THR C CA    1 
ATOM   5820  C  C     . THR C 2  334  ? -27.869 -17.453 53.808  1.00 123.76 ? 334  THR C C     1 
ATOM   5821  O  O     . THR C 2  334  ? -27.598 -18.120 52.808  1.00 118.86 ? 334  THR C O     1 
ATOM   5822  C  CB    . THR C 2  334  ? -29.316 -15.408 53.950  1.00 125.83 ? 334  THR C CB    1 
ATOM   5823  O  OG1   . THR C 2  334  ? -30.200 -16.062 53.030  1.00 123.69 ? 334  THR C OG1   1 
ATOM   5824  C  CG2   . THR C 2  334  ? -29.399 -13.898 53.749  1.00 116.84 ? 334  THR C CG2   1 
ATOM   5825  N  N     . GLU C 2  335  ? -28.167 -18.006 54.984  1.00 122.86 ? 335  GLU C N     1 
ATOM   5826  C  CA    . GLU C 2  335  ? -28.280 -19.457 55.141  1.00 127.29 ? 335  GLU C CA    1 
ATOM   5827  C  C     . GLU C 2  335  ? -29.411 -19.991 54.276  1.00 125.51 ? 335  GLU C C     1 
ATOM   5828  O  O     . GLU C 2  335  ? -29.302 -21.060 53.671  1.00 116.69 ? 335  GLU C O     1 
ATOM   5829  C  CB    . GLU C 2  335  ? -28.528 -19.841 56.604  1.00 139.36 ? 335  GLU C CB    1 
ATOM   5830  C  CG    . GLU C 2  335  ? -27.353 -19.611 57.541  1.00 142.45 ? 335  GLU C CG    1 
ATOM   5831  C  CD    . GLU C 2  335  ? -27.577 -20.224 58.915  1.00 143.24 ? 335  GLU C CD    1 
ATOM   5832  O  OE1   . GLU C 2  335  ? -28.306 -21.236 59.005  1.00 140.58 ? 335  GLU C OE1   1 
ATOM   5833  O  OE2   . GLU C 2  335  ? -27.028 -19.692 59.904  1.00 140.17 ? 335  GLU C OE2   1 
ATOM   5834  N  N     . GLU C 2  336  ? -30.497 -19.225 54.235  1.00 131.18 ? 336  GLU C N     1 
ATOM   5835  C  CA    . GLU C 2  336  ? -31.685 -19.556 53.459  1.00 129.31 ? 336  GLU C CA    1 
ATOM   5836  C  C     . GLU C 2  336  ? -31.354 -19.770 51.987  1.00 125.42 ? 336  GLU C C     1 
ATOM   5837  O  O     . GLU C 2  336  ? -31.892 -20.669 51.338  1.00 120.08 ? 336  GLU C O     1 
ATOM   5838  C  CB    . GLU C 2  336  ? -32.723 -18.445 53.610  1.00 115.02 ? 336  GLU C CB    1 
ATOM   5839  C  CG    . GLU C 2  336  ? -34.017 -18.688 52.870  1.00 114.01 ? 336  GLU C CG    1 
ATOM   5840  C  CD    . GLU C 2  336  ? -34.940 -17.495 52.946  1.00 114.79 ? 336  GLU C CD    1 
ATOM   5841  O  OE1   . GLU C 2  336  ? -36.123 -17.626 52.568  1.00 122.99 ? 336  GLU C OE1   1 
ATOM   5842  O  OE2   . GLU C 2  336  ? -34.476 -16.422 53.386  1.00 112.50 ? 336  GLU C OE2   1 
ATOM   5843  N  N     . ASP C 2  337  ? -30.461 -18.936 51.469  1.00 125.99 ? 337  ASP C N     1 
ATOM   5844  C  CA    . ASP C 2  337  ? -30.027 -19.050 50.087  1.00 118.75 ? 337  ASP C CA    1 
ATOM   5845  C  C     . ASP C 2  337  ? -29.244 -20.345 49.877  1.00 113.62 ? 337  ASP C C     1 
ATOM   5846  O  O     . ASP C 2  337  ? -29.431 -21.027 48.872  1.00 112.30 ? 337  ASP C O     1 
ATOM   5847  C  CB    . ASP C 2  337  ? -29.180 -17.836 49.687  1.00 118.13 ? 337  ASP C CB    1 
ATOM   5848  C  CG    . ASP C 2  337  ? -29.906 -16.516 49.908  1.00 111.98 ? 337  ASP C CG    1 
ATOM   5849  O  OD1   . ASP C 2  337  ? -31.155 -16.511 49.908  1.00 115.06 ? 337  ASP C OD1   1 
ATOM   5850  O  OD2   . ASP C 2  337  ? -29.226 -15.481 50.076  1.00 100.13 ? 337  ASP C OD2   1 
ATOM   5851  N  N     . VAL C 2  338  ? -28.384 -20.683 50.837  1.00 113.85 ? 338  VAL C N     1 
ATOM   5852  C  CA    . VAL C 2  338  ? -27.537 -21.874 50.738  1.00 119.32 ? 338  VAL C CA    1 
ATOM   5853  C  C     . VAL C 2  338  ? -28.351 -23.158 50.619  1.00 126.35 ? 338  VAL C C     1 
ATOM   5854  O  O     . VAL C 2  338  ? -28.081 -23.996 49.760  1.00 121.35 ? 338  VAL C O     1 
ATOM   5855  C  CB    . VAL C 2  338  ? -26.604 -22.015 51.954  1.00 117.12 ? 338  VAL C CB    1 
ATOM   5856  C  CG1   . VAL C 2  338  ? -25.668 -23.206 51.766  1.00 112.68 ? 338  VAL C CG1   1 
ATOM   5857  C  CG2   . VAL C 2  338  ? -25.816 -20.737 52.172  1.00 123.08 ? 338  VAL C CG2   1 
ATOM   5858  N  N     . VAL C 2  339  ? -29.344 -23.301 51.492  1.00 132.02 ? 339  VAL C N     1 
ATOM   5859  C  CA    . VAL C 2  339  ? -30.199 -24.484 51.520  1.00 131.12 ? 339  VAL C CA    1 
ATOM   5860  C  C     . VAL C 2  339  ? -31.054 -24.582 50.260  1.00 122.72 ? 339  VAL C C     1 
ATOM   5861  O  O     . VAL C 2  339  ? -31.133 -25.638 49.631  1.00 116.70 ? 339  VAL C O     1 
ATOM   5862  C  CB    . VAL C 2  339  ? -31.121 -24.473 52.756  1.00 134.51 ? 339  VAL C CB    1 
ATOM   5863  C  CG1   . VAL C 2  339  ? -31.927 -25.765 52.837  1.00 128.43 ? 339  VAL C CG1   1 
ATOM   5864  C  CG2   . VAL C 2  339  ? -30.305 -24.257 54.027  1.00 136.01 ? 339  VAL C CG2   1 
ATOM   5865  N  N     . ALA C 2  340  ? -31.686 -23.467 49.901  1.00 123.79 ? 340  ALA C N     1 
ATOM   5866  C  CA    . ALA C 2  340  ? -32.549 -23.396 48.725  1.00 125.01 ? 340  ALA C CA    1 
ATOM   5867  C  C     . ALA C 2  340  ? -31.761 -23.659 47.447  1.00 121.07 ? 340  ALA C C     1 
ATOM   5868  O  O     . ALA C 2  340  ? -32.327 -24.025 46.416  1.00 119.30 ? 340  ALA C O     1 
ATOM   5869  C  CB    . ALA C 2  340  ? -33.239 -22.038 48.655  1.00 123.35 ? 340  ALA C CB    1 
ATOM   5870  N  N     . THR C 2  341  ? -30.451 -23.463 47.525  1.00 121.19 ? 341  THR C N     1 
ATOM   5871  C  CA    . THR C 2  341  ? -29.566 -23.743 46.405  1.00 123.27 ? 341  THR C CA    1 
ATOM   5872  C  C     . THR C 2  341  ? -29.379 -25.242 46.248  1.00 126.66 ? 341  THR C C     1 
ATOM   5873  O  O     . THR C 2  341  ? -29.538 -25.788 45.156  1.00 132.13 ? 341  THR C O     1 
ATOM   5874  C  CB    . THR C 2  341  ? -28.194 -23.079 46.589  1.00 123.09 ? 341  THR C CB    1 
ATOM   5875  O  OG1   . THR C 2  341  ? -28.366 -21.666 46.748  1.00 128.58 ? 341  THR C OG1   1 
ATOM   5876  C  CG2   . THR C 2  341  ? -27.303 -23.351 45.384  1.00 116.82 ? 341  THR C CG2   1 
ATOM   5877  N  N     . ILE C 2  342  ? -29.040 -25.899 47.351  1.00 122.55 ? 342  ILE C N     1 
ATOM   5878  C  CA    . ILE C 2  342  ? -28.844 -27.342 47.361  1.00 123.79 ? 342  ILE C CA    1 
ATOM   5879  C  C     . ILE C 2  342  ? -30.124 -28.062 46.937  1.00 126.99 ? 342  ILE C C     1 
ATOM   5880  O  O     . ILE C 2  342  ? -30.076 -29.068 46.229  1.00 119.66 ? 342  ILE C O     1 
ATOM   5881  C  CB    . ILE C 2  342  ? -28.407 -27.833 48.752  1.00 125.11 ? 342  ILE C CB    1 
ATOM   5882  C  CG1   . ILE C 2  342  ? -27.323 -26.917 49.319  1.00 116.48 ? 342  ILE C CG1   1 
ATOM   5883  C  CG2   . ILE C 2  342  ? -27.905 -29.266 48.679  1.00 134.26 ? 342  ILE C CG2   1 
ATOM   5884  C  CD1   . ILE C 2  342  ? -27.165 -27.014 50.819  1.00 120.89 ? 342  ILE C CD1   1 
ATOM   5885  N  N     . GLU C 2  343  ? -31.265 -27.526 47.365  1.00 130.13 ? 343  GLU C N     1 
ATOM   5886  C  CA    . GLU C 2  343  ? -32.574 -28.079 47.018  1.00 128.91 ? 343  GLU C CA    1 
ATOM   5887  C  C     . GLU C 2  343  ? -32.807 -27.999 45.514  1.00 120.03 ? 343  GLU C C     1 
ATOM   5888  O  O     . GLU C 2  343  ? -33.386 -28.900 44.908  1.00 117.28 ? 343  GLU C O     1 
ATOM   5889  C  CB    . GLU C 2  343  ? -33.684 -27.334 47.772  1.00 139.80 ? 343  GLU C CB    1 
ATOM   5890  C  CG    . GLU C 2  343  ? -35.087 -27.923 47.620  1.00 142.84 ? 343  GLU C CG    1 
ATOM   5891  C  CD    . GLU C 2  343  ? -36.140 -27.147 48.406  1.00 140.42 ? 343  GLU C CD    1 
ATOM   5892  O  OE1   . GLU C 2  343  ? -35.776 -26.175 49.102  1.00 137.02 ? 343  GLU C OE1   1 
ATOM   5893  O  OE2   . GLU C 2  343  ? -37.334 -27.507 48.327  1.00 140.12 ? 343  GLU C OE2   1 
ATOM   5894  N  N     . TYR C 2  344  ? -32.342 -26.904 44.924  1.00 119.04 ? 344  TYR C N     1 
ATOM   5895  C  CA    . TYR C 2  344  ? -32.473 -26.668 43.495  1.00 119.14 ? 344  TYR C CA    1 
ATOM   5896  C  C     . TYR C 2  344  ? -31.610 -27.653 42.709  1.00 115.44 ? 344  TYR C C     1 
ATOM   5897  O  O     . TYR C 2  344  ? -31.978 -28.090 41.618  1.00 113.75 ? 344  TYR C O     1 
ATOM   5898  C  CB    . TYR C 2  344  ? -32.082 -25.225 43.169  1.00 115.59 ? 344  TYR C CB    1 
ATOM   5899  C  CG    . TYR C 2  344  ? -32.749 -24.654 41.943  1.00 113.08 ? 344  TYR C CG    1 
ATOM   5900  C  CD1   . TYR C 2  344  ? -33.718 -23.667 42.054  1.00 108.55 ? 344  TYR C CD1   1 
ATOM   5901  C  CD2   . TYR C 2  344  ? -32.410 -25.101 40.673  1.00 113.35 ? 344  TYR C CD2   1 
ATOM   5902  C  CE1   . TYR C 2  344  ? -34.328 -23.143 40.935  1.00 109.89 ? 344  TYR C CE1   1 
ATOM   5903  C  CE2   . TYR C 2  344  ? -33.011 -24.581 39.551  1.00 109.82 ? 344  TYR C CE2   1 
ATOM   5904  C  CZ    . TYR C 2  344  ? -33.971 -23.604 39.686  1.00 110.22 ? 344  TYR C CZ    1 
ATOM   5905  O  OH    . TYR C 2  344  ? -34.573 -23.084 38.564  1.00 113.41 ? 344  TYR C OH    1 
ATOM   5906  N  N     . LEU C 2  345  ? -30.461 -28.002 43.281  1.00 113.46 ? 345  LEU C N     1 
ATOM   5907  C  CA    . LEU C 2  345  ? -29.508 -28.901 42.636  1.00 115.16 ? 345  LEU C CA    1 
ATOM   5908  C  C     . LEU C 2  345  ? -30.014 -30.337 42.576  1.00 117.78 ? 345  LEU C C     1 
ATOM   5909  O  O     . LEU C 2  345  ? -29.915 -30.996 41.541  1.00 115.67 ? 345  LEU C O     1 
ATOM   5910  C  CB    . LEU C 2  345  ? -28.160 -28.860 43.368  1.00 115.30 ? 345  LEU C CB    1 
ATOM   5911  C  CG    . LEU C 2  345  ? -27.109 -29.919 43.008  1.00 116.41 ? 345  LEU C CG    1 
ATOM   5912  C  CD1   . LEU C 2  345  ? -26.792 -29.924 41.516  1.00 107.00 ? 345  LEU C CD1   1 
ATOM   5913  C  CD2   . LEU C 2  345  ? -25.840 -29.714 43.824  1.00 115.45 ? 345  LEU C CD2   1 
ATOM   5914  N  N     . VAL C 2  346  ? -30.549 -30.821 43.690  1.00 118.37 ? 346  VAL C N     1 
ATOM   5915  C  CA    . VAL C 2  346  ? -30.951 -32.216 43.789  1.00 121.67 ? 346  VAL C CA    1 
ATOM   5916  C  C     . VAL C 2  346  ? -32.205 -32.507 42.959  1.00 123.20 ? 346  VAL C C     1 
ATOM   5917  O  O     . VAL C 2  346  ? -32.253 -33.504 42.238  1.00 125.76 ? 346  VAL C O     1 
ATOM   5918  C  CB    . VAL C 2  346  ? -31.180 -32.624 45.265  1.00 134.27 ? 346  VAL C CB    1 
ATOM   5919  C  CG1   . VAL C 2  346  ? -32.019 -31.584 46.001  1.00 127.02 ? 346  VAL C CG1   1 
ATOM   5920  C  CG2   . VAL C 2  346  ? -31.808 -34.005 45.352  1.00 143.24 ? 346  VAL C CG2   1 
ATOM   5921  N  N     . ARG C 2  347  ? -33.204 -31.632 43.045  1.00 123.55 ? 347  ARG C N     1 
ATOM   5922  C  CA    . ARG C 2  347  ? -34.453 -31.817 42.307  1.00 125.39 ? 347  ARG C CA    1 
ATOM   5923  C  C     . ARG C 2  347  ? -34.211 -31.834 40.802  1.00 119.66 ? 347  ARG C C     1 
ATOM   5924  O  O     . ARG C 2  347  ? -34.766 -32.662 40.080  1.00 113.81 ? 347  ARG C O     1 
ATOM   5925  C  CB    . ARG C 2  347  ? -35.460 -30.719 42.663  1.00 132.02 ? 347  ARG C CB    1 
ATOM   5926  C  CG    . ARG C 2  347  ? -35.929 -30.746 44.112  1.00 133.32 ? 347  ARG C CG    1 
ATOM   5927  C  CD    . ARG C 2  347  ? -37.134 -29.838 44.329  1.00 129.87 ? 347  ARG C CD    1 
ATOM   5928  N  NE    . ARG C 2  347  ? -37.524 -29.775 45.735  1.00 129.29 ? 347  ARG C NE    1 
ATOM   5929  C  CZ    . ARG C 2  347  ? -38.343 -30.639 46.326  1.00 125.11 ? 347  ARG C CZ    1 
ATOM   5930  N  NH1   . ARG C 2  347  ? -38.866 -31.642 45.634  1.00 123.45 ? 347  ARG C NH1   1 
ATOM   5931  N  NH2   . ARG C 2  347  ? -38.638 -30.502 47.611  1.00 127.30 ? 347  ARG C NH2   1 
ATOM   5932  N  N     . LEU C 2  348  ? -33.369 -30.918 40.339  1.00 120.20 ? 348  LEU C N     1 
ATOM   5933  C  CA    . LEU C 2  348  ? -32.983 -30.867 38.936  1.00 125.19 ? 348  LEU C CA    1 
ATOM   5934  C  C     . LEU C 2  348  ? -32.170 -32.106 38.543  1.00 129.54 ? 348  LEU C C     1 
ATOM   5935  O  O     . LEU C 2  348  ? -32.132 -32.491 37.372  1.00 128.03 ? 348  LEU C O     1 
ATOM   5936  C  CB    . LEU C 2  348  ? -32.186 -29.589 38.659  1.00 121.44 ? 348  LEU C CB    1 
ATOM   5937  C  CG    . LEU C 2  348  ? -31.873 -29.240 37.203  1.00 121.80 ? 348  LEU C CG    1 
ATOM   5938  C  CD1   . LEU C 2  348  ? -33.145 -29.226 36.370  1.00 118.99 ? 348  LEU C CD1   1 
ATOM   5939  C  CD2   . LEU C 2  348  ? -31.159 -27.898 37.127  1.00 114.61 ? 348  LEU C CD2   1 
ATOM   5940  N  N     . HIS C 2  349  ? -31.530 -32.731 39.529  1.00 130.11 ? 349  HIS C N     1 
ATOM   5941  C  CA    . HIS C 2  349  ? -30.695 -33.905 39.286  1.00 127.44 ? 349  HIS C CA    1 
ATOM   5942  C  C     . HIS C 2  349  ? -31.533 -35.156 39.035  1.00 126.61 ? 349  HIS C C     1 
ATOM   5943  O  O     . HIS C 2  349  ? -31.166 -36.005 38.220  1.00 121.01 ? 349  HIS C O     1 
ATOM   5944  C  CB    . HIS C 2  349  ? -29.745 -34.143 40.466  1.00 122.21 ? 349  HIS C CB    1 
ATOM   5945  C  CG    . HIS C 2  349  ? -28.872 -35.348 40.306  1.00 122.01 ? 349  HIS C CG    1 
ATOM   5946  N  ND1   . HIS C 2  349  ? -29.088 -36.523 40.996  1.00 123.20 ? 349  HIS C ND1   1 
ATOM   5947  C  CD2   . HIS C 2  349  ? -27.785 -35.565 39.530  1.00 123.25 ? 349  HIS C CD2   1 
ATOM   5948  C  CE1   . HIS C 2  349  ? -28.171 -37.408 40.653  1.00 127.12 ? 349  HIS C CE1   1 
ATOM   5949  N  NE2   . HIS C 2  349  ? -27.367 -36.852 39.764  1.00 124.42 ? 349  HIS C NE2   1 
ATOM   5950  N  N     . GLU C 2  350  ? -32.657 -35.263 39.738  1.00 128.50 ? 350  GLU C N     1 
ATOM   5951  C  CA    . GLU C 2  350  ? -33.526 -36.428 39.621  1.00 126.46 ? 350  GLU C CA    1 
ATOM   5952  C  C     . GLU C 2  350  ? -34.687 -36.171 38.661  1.00 121.23 ? 350  GLU C C     1 
ATOM   5953  O  O     . GLU C 2  350  ? -35.674 -36.906 38.656  1.00 125.10 ? 350  GLU C O     1 
ATOM   5954  C  CB    . GLU C 2  350  ? -34.049 -36.847 41.001  1.00 130.03 ? 350  GLU C CB    1 
ATOM   5955  C  CG    . GLU C 2  350  ? -34.706 -35.731 41.804  1.00 129.96 ? 350  GLU C CG    1 
ATOM   5956  C  CD    . GLU C 2  350  ? -34.906 -36.098 43.268  1.00 134.50 ? 350  GLU C CD    1 
ATOM   5957  O  OE1   . GLU C 2  350  ? -34.325 -37.109 43.719  1.00 135.03 ? 350  GLU C OE1   1 
ATOM   5958  O  OE2   . GLU C 2  350  ? -35.644 -35.371 43.967  1.00 131.02 ? 350  GLU C OE2   1 
ATOM   5959  N  N     . GLY C 2  351  ? -34.561 -35.123 37.852  1.00 112.60 ? 351  GLY C N     1 
ATOM   5960  C  CA    . GLY C 2  351  ? -35.494 -34.887 36.765  1.00 106.20 ? 351  GLY C CA    1 
ATOM   5961  C  C     . GLY C 2  351  ? -36.674 -33.978 37.058  1.00 112.17 ? 351  GLY C C     1 
ATOM   5962  O  O     . GLY C 2  351  ? -37.501 -33.748 36.175  1.00 107.86 ? 351  GLY C O     1 
ATOM   5963  N  N     . GLN C 2  352  ? -36.767 -33.463 38.282  1.00 116.51 ? 352  GLN C N     1 
ATOM   5964  C  CA    . GLN C 2  352  ? -37.860 -32.555 38.629  1.00 116.00 ? 352  GLN C CA    1 
ATOM   5965  C  C     . GLN C 2  352  ? -37.781 -31.281 37.798  1.00 113.35 ? 352  GLN C C     1 
ATOM   5966  O  O     . GLN C 2  352  ? -36.693 -30.795 37.490  1.00 114.78 ? 352  GLN C O     1 
ATOM   5967  C  CB    . GLN C 2  352  ? -37.847 -32.204 40.117  1.00 119.17 ? 352  GLN C CB    1 
ATOM   5968  C  CG    . GLN C 2  352  ? -38.140 -33.368 41.042  1.00 118.19 ? 352  GLN C CG    1 
ATOM   5969  C  CD    . GLN C 2  352  ? -38.493 -32.909 42.442  1.00 123.96 ? 352  GLN C CD    1 
ATOM   5970  O  OE1   . GLN C 2  352  ? -39.142 -31.878 42.623  1.00 123.29 ? 352  GLN C OE1   1 
ATOM   5971  N  NE2   . GLN C 2  352  ? -38.063 -33.670 43.442  1.00 126.25 ? 352  GLN C NE2   1 
ATOM   5972  N  N     . THR C 2  353  ? -38.941 -30.740 37.444  1.00 108.01 ? 353  THR C N     1 
ATOM   5973  C  CA    . THR C 2  353  ? -39.002 -29.626 36.510  1.00 109.73 ? 353  THR C CA    1 
ATOM   5974  C  C     . THR C 2  353  ? -39.420 -28.310 37.172  1.00 114.34 ? 353  THR C C     1 
ATOM   5975  O  O     . THR C 2  353  ? -39.245 -27.238 36.592  1.00 117.24 ? 353  THR C O     1 
ATOM   5976  C  CB    . THR C 2  353  ? -39.971 -29.938 35.352  1.00 103.07 ? 353  THR C CB    1 
ATOM   5977  O  OG1   . THR C 2  353  ? -41.295 -30.110 35.869  1.00 101.82 ? 353  THR C OG1   1 
ATOM   5978  C  CG2   . THR C 2  353  ? -39.549 -31.213 34.635  1.00 95.50  ? 353  THR C CG2   1 
ATOM   5979  N  N     . THR C 2  354  ? -39.965 -28.390 38.384  1.00 113.06 ? 354  THR C N     1 
ATOM   5980  C  CA    . THR C 2  354  ? -40.428 -27.197 39.093  1.00 112.59 ? 354  THR C CA    1 
ATOM   5981  C  C     . THR C 2  354  ? -40.174 -27.315 40.600  1.00 111.22 ? 354  THR C C     1 
ATOM   5982  O  O     . THR C 2  354  ? -39.927 -28.409 41.109  1.00 110.15 ? 354  THR C O     1 
ATOM   5983  C  CB    . THR C 2  354  ? -41.937 -26.941 38.843  1.00 113.27 ? 354  THR C CB    1 
ATOM   5984  O  OG1   . THR C 2  354  ? -42.306 -27.434 37.549  1.00 117.47 ? 354  THR C OG1   1 
ATOM   5985  C  CG2   . THR C 2  354  ? -42.257 -25.456 38.917  1.00 108.58 ? 354  THR C CG2   1 
ATOM   5986  N  N     . MET C 2  355  ? -40.230 -26.187 41.305  1.00 109.22 ? 355  MET C N     1 
ATOM   5987  C  CA    . MET C 2  355  ? -40.049 -26.185 42.754  1.00 113.92 ? 355  MET C CA    1 
ATOM   5988  C  C     . MET C 2  355  ? -40.546 -24.904 43.420  1.00 113.32 ? 355  MET C C     1 
ATOM   5989  O  O     . MET C 2  355  ? -40.364 -23.802 42.902  1.00 106.50 ? 355  MET C O     1 
ATOM   5990  C  CB    . MET C 2  355  ? -38.576 -26.394 43.112  1.00 119.46 ? 355  MET C CB    1 
ATOM   5991  C  CG    . MET C 2  355  ? -38.299 -26.375 44.608  1.00 124.68 ? 355  MET C CG    1 
ATOM   5992  S  SD    . MET C 2  355  ? -36.620 -25.856 45.007  1.00 133.33 ? 355  MET C SD    1 
ATOM   5993  C  CE    . MET C 2  355  ? -36.508 -24.333 44.074  1.00 123.63 ? 355  MET C CE    1 
ATOM   5994  N  N     . THR C 2  356  ? -41.181 -25.065 44.575  1.00 124.86 ? 356  THR C N     1 
ATOM   5995  C  CA    . THR C 2  356  ? -41.484 -23.943 45.450  1.00 125.28 ? 356  THR C CA    1 
ATOM   5996  C  C     . THR C 2  356  ? -40.548 -23.988 46.655  1.00 123.08 ? 356  THR C C     1 
ATOM   5997  O  O     . THR C 2  356  ? -40.515 -24.979 47.385  1.00 124.75 ? 356  THR C O     1 
ATOM   5998  C  CB    . THR C 2  356  ? -42.954 -23.959 45.937  1.00 125.95 ? 356  THR C CB    1 
ATOM   5999  O  OG1   . THR C 2  356  ? -43.220 -25.181 46.637  1.00 132.52 ? 356  THR C OG1   1 
ATOM   6000  C  CG2   . THR C 2  356  ? -43.914 -23.845 44.771  1.00 117.60 ? 356  THR C CG2   1 
ATOM   6001  N  N     . VAL C 2  357  ? -39.769 -22.930 46.849  1.00 116.15 ? 357  VAL C N     1 
ATOM   6002  C  CA    . VAL C 2  357  ? -38.971 -22.801 48.063  1.00 117.23 ? 357  VAL C CA    1 
ATOM   6003  C  C     . VAL C 2  357  ? -39.901 -22.419 49.207  1.00 117.97 ? 357  VAL C C     1 
ATOM   6004  O  O     . VAL C 2  357  ? -40.701 -21.495 49.064  1.00 115.15 ? 357  VAL C O     1 
ATOM   6005  C  CB    . VAL C 2  357  ? -37.851 -21.746 47.913  1.00 116.87 ? 357  VAL C CB    1 
ATOM   6006  C  CG1   . VAL C 2  357  ? -37.270 -21.372 49.271  1.00 112.54 ? 357  VAL C CG1   1 
ATOM   6007  C  CG2   . VAL C 2  357  ? -36.762 -22.253 46.988  1.00 116.67 ? 357  VAL C CG2   1 
ATOM   6008  N  N     . PRO C 2  358  ? -39.816 -23.143 50.338  1.00 120.16 ? 358  PRO C N     1 
ATOM   6009  C  CA    . PRO C 2  358  ? -40.647 -22.849 51.513  1.00 123.68 ? 358  PRO C CA    1 
ATOM   6010  C  C     . PRO C 2  358  ? -40.586 -21.381 51.932  1.00 123.22 ? 358  PRO C C     1 
ATOM   6011  O  O     . PRO C 2  358  ? -39.590 -20.932 52.503  1.00 115.37 ? 358  PRO C O     1 
ATOM   6012  C  CB    . PRO C 2  358  ? -40.059 -23.758 52.605  1.00 115.09 ? 358  PRO C CB    1 
ATOM   6013  C  CG    . PRO C 2  358  ? -38.766 -24.271 52.055  1.00 114.03 ? 358  PRO C CG    1 
ATOM   6014  C  CD    . PRO C 2  358  ? -38.935 -24.297 50.572  1.00 116.67 ? 358  PRO C CD    1 
ATOM   6015  N  N     . GLY C 2  359  ? -41.656 -20.647 51.639  1.00 126.98 ? 359  GLY C N     1 
ATOM   6016  C  CA    . GLY C 2  359  ? -41.724 -19.226 51.918  1.00 121.20 ? 359  GLY C CA    1 
ATOM   6017  C  C     . GLY C 2  359  ? -41.560 -18.415 50.648  1.00 115.09 ? 359  GLY C C     1 
ATOM   6018  O  O     . GLY C 2  359  ? -41.383 -17.197 50.693  1.00 113.40 ? 359  GLY C O     1 
ATOM   6019  N  N     . GLY C 2  360  ? -41.623 -19.097 49.508  1.00 112.90 ? 360  GLY C N     1 
ATOM   6020  C  CA    . GLY C 2  360  ? -41.400 -18.450 48.230  1.00 114.44 ? 360  GLY C CA    1 
ATOM   6021  C  C     . GLY C 2  360  ? -42.223 -18.992 47.077  1.00 117.02 ? 360  GLY C C     1 
ATOM   6022  O  O     . GLY C 2  360  ? -42.600 -20.164 47.056  1.00 117.44 ? 360  GLY C O     1 
ATOM   6023  N  N     . VAL C 2  361  ? -42.484 -18.120 46.107  1.00 118.92 ? 361  VAL C N     1 
ATOM   6024  C  CA    . VAL C 2  361  ? -43.288 -18.443 44.933  1.00 120.16 ? 361  VAL C CA    1 
ATOM   6025  C  C     . VAL C 2  361  ? -42.640 -19.554 44.089  1.00 123.42 ? 361  VAL C C     1 
ATOM   6026  O  O     . VAL C 2  361  ? -41.441 -19.817 44.203  1.00 122.63 ? 361  VAL C O     1 
ATOM   6027  C  CB    . VAL C 2  361  ? -43.516 -17.169 44.072  1.00 113.22 ? 361  VAL C CB    1 
ATOM   6028  C  CG1   . VAL C 2  361  ? -42.254 -16.802 43.304  1.00 113.34 ? 361  VAL C CG1   1 
ATOM   6029  C  CG2   . VAL C 2  361  ? -44.705 -17.336 43.132  1.00 115.58 ? 361  VAL C CG2   1 
ATOM   6030  N  N     . GLU C 2  362  ? -43.449 -20.212 43.260  1.00 122.98 ? 362  GLU C N     1 
ATOM   6031  C  CA    . GLU C 2  362  ? -43.000 -21.321 42.417  1.00 119.82 ? 362  GLU C CA    1 
ATOM   6032  C  C     . GLU C 2  362  ? -42.009 -20.858 41.348  1.00 120.31 ? 362  GLU C C     1 
ATOM   6033  O  O     . GLU C 2  362  ? -42.199 -19.811 40.726  1.00 114.96 ? 362  GLU C O     1 
ATOM   6034  C  CB    . GLU C 2  362  ? -44.213 -21.998 41.763  1.00 125.58 ? 362  GLU C CB    1 
ATOM   6035  C  CG    . GLU C 2  362  ? -43.965 -23.407 41.236  1.00 123.25 ? 362  GLU C CG    1 
ATOM   6036  C  CD    . GLU C 2  362  ? -45.250 -24.106 40.815  1.00 122.88 ? 362  GLU C CD    1 
ATOM   6037  O  OE1   . GLU C 2  362  ? -46.302 -23.434 40.755  1.00 122.16 ? 362  GLU C OE1   1 
ATOM   6038  O  OE2   . GLU C 2  362  ? -45.209 -25.327 40.550  1.00 116.25 ? 362  GLU C OE2   1 
ATOM   6039  N  N     . VAL C 2  363  ? -40.953 -21.646 41.141  1.00 121.58 ? 363  VAL C N     1 
ATOM   6040  C  CA    . VAL C 2  363  ? -39.883 -21.295 40.201  1.00 126.07 ? 363  VAL C CA    1 
ATOM   6041  C  C     . VAL C 2  363  ? -39.587 -22.419 39.207  1.00 121.70 ? 363  VAL C C     1 
ATOM   6042  O  O     . VAL C 2  363  ? -39.479 -23.584 39.596  1.00 120.71 ? 363  VAL C O     1 
ATOM   6043  C  CB    . VAL C 2  363  ? -38.571 -20.949 40.946  1.00 123.36 ? 363  VAL C CB    1 
ATOM   6044  C  CG1   . VAL C 2  363  ? -37.527 -20.381 39.985  1.00 108.29 ? 363  VAL C CG1   1 
ATOM   6045  C  CG2   . VAL C 2  363  ? -38.841 -19.976 42.073  1.00 125.41 ? 363  VAL C CG2   1 
ATOM   6046  N  N     . PRO C 2  364  ? -39.455 -22.072 37.916  1.00 117.06 ? 364  PRO C N     1 
ATOM   6047  C  CA    . PRO C 2  364  ? -39.028 -23.059 36.918  1.00 114.91 ? 364  PRO C CA    1 
ATOM   6048  C  C     . PRO C 2  364  ? -37.630 -23.591 37.225  1.00 107.32 ? 364  PRO C C     1 
ATOM   6049  O  O     . PRO C 2  364  ? -36.731 -22.807 37.527  1.00 113.53 ? 364  PRO C O     1 
ATOM   6050  C  CB    . PRO C 2  364  ? -39.048 -22.266 35.603  1.00 121.93 ? 364  PRO C CB    1 
ATOM   6051  C  CG    . PRO C 2  364  ? -39.022 -20.821 36.014  1.00 115.33 ? 364  PRO C CG    1 
ATOM   6052  C  CD    . PRO C 2  364  ? -39.775 -20.771 37.303  1.00 115.91 ? 364  PRO C CD    1 
ATOM   6053  N  N     . VAL C 2  365  ? -37.456 -24.908 37.158  1.00 106.47 ? 365  VAL C N     1 
ATOM   6054  C  CA    . VAL C 2  365  ? -36.180 -25.524 37.513  1.00 116.45 ? 365  VAL C CA    1 
ATOM   6055  C  C     . VAL C 2  365  ? -35.484 -26.155 36.307  1.00 123.74 ? 365  VAL C C     1 
ATOM   6056  O  O     . VAL C 2  365  ? -35.951 -27.155 35.759  1.00 125.49 ? 365  VAL C O     1 
ATOM   6057  C  CB    . VAL C 2  365  ? -36.364 -26.593 38.609  1.00 119.55 ? 365  VAL C CB    1 
ATOM   6058  C  CG1   . VAL C 2  365  ? -35.050 -27.308 38.889  1.00 117.76 ? 365  VAL C CG1   1 
ATOM   6059  C  CG2   . VAL C 2  365  ? -36.909 -25.956 39.879  1.00 116.16 ? 365  VAL C CG2   1 
ATOM   6060  N  N     . GLU C 2  366  ? -34.360 -25.567 35.906  1.00 120.34 ? 366  GLU C N     1 
ATOM   6061  C  CA    . GLU C 2  366  ? -33.619 -26.040 34.741  1.00 114.06 ? 366  GLU C CA    1 
ATOM   6062  C  C     . GLU C 2  366  ? -32.156 -25.609 34.777  1.00 109.79 ? 366  GLU C C     1 
ATOM   6063  O  O     . GLU C 2  366  ? -31.754 -24.796 35.611  1.00 105.38 ? 366  GLU C O     1 
ATOM   6064  C  CB    . GLU C 2  366  ? -34.281 -25.540 33.455  1.00 117.71 ? 366  GLU C CB    1 
ATOM   6065  C  CG    . GLU C 2  366  ? -34.588 -24.050 33.457  1.00 112.68 ? 366  GLU C CG    1 
ATOM   6066  C  CD    . GLU C 2  366  ? -35.465 -23.632 32.291  1.00 111.72 ? 366  GLU C CD    1 
ATOM   6067  O  OE1   . GLU C 2  366  ? -35.572 -24.407 31.315  1.00 121.23 ? 366  GLU C OE1   1 
ATOM   6068  O  OE2   . GLU C 2  366  ? -36.051 -22.531 32.352  1.00 103.46 ? 366  GLU C OE2   1 
ATOM   6069  N  N     . THR C 2  367  ? -31.365 -26.171 33.868  1.00 108.21 ? 367  THR C N     1 
ATOM   6070  C  CA    . THR C 2  367  ? -29.952 -25.830 33.764  1.00 104.14 ? 367  THR C CA    1 
ATOM   6071  C  C     . THR C 2  367  ? -29.783 -24.475 33.091  1.00 101.64 ? 367  THR C C     1 
ATOM   6072  O  O     . THR C 2  367  ? -30.433 -24.188 32.086  1.00 101.76 ? 367  THR C O     1 
ATOM   6073  C  CB    . THR C 2  367  ? -29.167 -26.895 32.975  1.00 100.87 ? 367  THR C CB    1 
ATOM   6074  O  OG1   . THR C 2  367  ? -29.484 -26.798 31.581  1.00 94.05  ? 367  THR C OG1   1 
ATOM   6075  C  CG2   . THR C 2  367  ? -29.520 -28.281 33.477  1.00 103.71 ? 367  THR C CG2   1 
ATOM   6076  N  N     . ASP C 2  368  ? -28.903 -23.649 33.648  1.00 95.11  ? 368  ASP C N     1 
ATOM   6077  C  CA    . ASP C 2  368  ? -28.721 -22.286 33.164  1.00 87.00  ? 368  ASP C CA    1 
ATOM   6078  C  C     . ASP C 2  368  ? -27.725 -22.157 32.019  1.00 82.46  ? 368  ASP C C     1 
ATOM   6079  O  O     . ASP C 2  368  ? -26.734 -22.885 31.935  1.00 81.49  ? 368  ASP C O     1 
ATOM   6080  C  CB    . ASP C 2  368  ? -28.279 -21.376 34.306  1.00 83.02  ? 368  ASP C CB    1 
ATOM   6081  C  CG    . ASP C 2  368  ? -29.387 -21.112 35.292  1.00 90.13  ? 368  ASP C CG    1 
ATOM   6082  O  OD1   . ASP C 2  368  ? -30.567 -21.154 34.884  1.00 98.62  ? 368  ASP C OD1   1 
ATOM   6083  O  OD2   . ASP C 2  368  ? -29.075 -20.860 36.473  1.00 90.99  ? 368  ASP C OD2   1 
ATOM   6084  N  N     . ASP C 2  369  ? -28.007 -21.200 31.146  1.00 81.66  ? 369  ASP C N     1 
ATOM   6085  C  CA    . ASP C 2  369  ? -27.125 -20.856 30.049  1.00 72.52  ? 369  ASP C CA    1 
ATOM   6086  C  C     . ASP C 2  369  ? -26.439 -19.528 30.361  1.00 73.86  ? 369  ASP C C     1 
ATOM   6087  O  O     . ASP C 2  369  ? -27.089 -18.488 30.424  1.00 76.78  ? 369  ASP C O     1 
ATOM   6088  C  CB    . ASP C 2  369  ? -27.915 -20.773 28.744  1.00 72.83  ? 369  ASP C CB    1 
ATOM   6089  C  CG    . ASP C 2  369  ? -27.026 -20.721 27.527  1.00 72.52  ? 369  ASP C CG    1 
ATOM   6090  O  OD1   . ASP C 2  369  ? -27.490 -20.216 26.483  1.00 72.12  ? 369  ASP C OD1   1 
ATOM   6091  O  OD2   . ASP C 2  369  ? -25.869 -21.188 27.614  1.00 74.39  ? 369  ASP C OD2   1 
ATOM   6092  N  N     . ILE C 2  370  ? -25.127 -19.576 30.567  1.00 73.39  ? 370  ILE C N     1 
ATOM   6093  C  CA    . ILE C 2  370  ? -24.351 -18.412 30.986  1.00 70.76  ? 370  ILE C CA    1 
ATOM   6094  C  C     . ILE C 2  370  ? -24.342 -17.285 29.942  1.00 72.89  ? 370  ILE C C     1 
ATOM   6095  O  O     . ILE C 2  370  ? -24.170 -16.115 30.279  1.00 73.46  ? 370  ILE C O     1 
ATOM   6096  C  CB    . ILE C 2  370  ? -22.896 -18.827 31.305  1.00 73.12  ? 370  ILE C CB    1 
ATOM   6097  C  CG1   . ILE C 2  370  ? -22.116 -17.675 31.942  1.00 77.57  ? 370  ILE C CG1   1 
ATOM   6098  C  CG2   . ILE C 2  370  ? -22.198 -19.361 30.054  1.00 85.92  ? 370  ILE C CG2   1 
ATOM   6099  C  CD1   . ILE C 2  370  ? -20.620 -17.799 31.773  1.00 97.28  ? 370  ILE C CD1   1 
ATOM   6100  N  N     . ASP C 2  371  ? -24.545 -17.632 28.676  1.00 75.49  ? 371  ASP C N     1 
ATOM   6101  C  CA    . ASP C 2  371  ? -24.455 -16.646 27.604  1.00 73.41  ? 371  ASP C CA    1 
ATOM   6102  C  C     . ASP C 2  371  ? -25.752 -15.873 27.400  1.00 69.07  ? 371  ASP C C     1 
ATOM   6103  O  O     . ASP C 2  371  ? -25.759 -14.833 26.739  1.00 64.38  ? 371  ASP C O     1 
ATOM   6104  C  CB    . ASP C 2  371  ? -24.054 -17.325 26.296  1.00 81.96  ? 371  ASP C CB    1 
ATOM   6105  C  CG    . ASP C 2  371  ? -22.670 -17.926 26.361  1.00 90.00  ? 371  ASP C CG    1 
ATOM   6106  O  OD1   . ASP C 2  371  ? -21.818 -17.345 27.062  1.00 95.44  ? 371  ASP C OD1   1 
ATOM   6107  O  OD2   . ASP C 2  371  ? -22.438 -18.973 25.721  1.00 86.20  ? 371  ASP C OD2   1 
ATOM   6108  N  N     . HIS C 2  372  ? -26.843 -16.386 27.965  1.00 68.44  ? 372  HIS C N     1 
ATOM   6109  C  CA    . HIS C 2  372  ? -28.165 -15.778 27.814  1.00 65.54  ? 372  HIS C CA    1 
ATOM   6110  C  C     . HIS C 2  372  ? -28.199 -14.339 28.336  1.00 64.79  ? 372  HIS C C     1 
ATOM   6111  O  O     . HIS C 2  372  ? -27.763 -14.066 29.456  1.00 64.33  ? 372  HIS C O     1 
ATOM   6112  C  CB    . HIS C 2  372  ? -29.218 -16.621 28.537  1.00 65.20  ? 372  HIS C CB    1 
ATOM   6113  C  CG    . HIS C 2  372  ? -30.621 -16.321 28.121  1.00 66.91  ? 372  HIS C CG    1 
ATOM   6114  N  ND1   . HIS C 2  372  ? -31.360 -15.293 28.672  1.00 67.80  ? 372  HIS C ND1   1 
ATOM   6115  C  CD2   . HIS C 2  372  ? -31.427 -16.911 27.208  1.00 73.22  ? 372  HIS C CD2   1 
ATOM   6116  C  CE1   . HIS C 2  372  ? -32.555 -15.266 28.116  1.00 73.14  ? 372  HIS C CE1   1 
ATOM   6117  N  NE2   . HIS C 2  372  ? -32.624 -16.239 27.222  1.00 79.71  ? 372  HIS C NE2   1 
ATOM   6118  N  N     . PHE C 2  373  ? -28.735 -13.424 27.529  1.00 59.97  ? 373  PHE C N     1 
ATOM   6119  C  CA    . PHE C 2  373  ? -28.716 -11.997 27.856  1.00 57.07  ? 373  PHE C CA    1 
ATOM   6120  C  C     . PHE C 2  373  ? -29.541 -11.650 29.099  1.00 57.23  ? 373  PHE C C     1 
ATOM   6121  O  O     . PHE C 2  373  ? -29.648 -10.480 29.475  1.00 54.44  ? 373  PHE C O     1 
ATOM   6122  C  CB    . PHE C 2  373  ? -29.209 -11.167 26.664  1.00 56.41  ? 373  PHE C CB    1 
ATOM   6123  C  CG    . PHE C 2  373  ? -28.101 -10.606 25.807  1.00 52.60  ? 373  PHE C CG    1 
ATOM   6124  C  CD1   . PHE C 2  373  ? -28.277 -9.413  25.115  1.00 49.59  ? 373  PHE C CD1   1 
ATOM   6125  C  CD2   . PHE C 2  373  ? -26.892 -11.272 25.682  1.00 52.77  ? 373  PHE C CD2   1 
ATOM   6126  C  CE1   . PHE C 2  373  ? -27.264 -8.890  24.323  1.00 44.51  ? 373  PHE C CE1   1 
ATOM   6127  C  CE2   . PHE C 2  373  ? -25.876 -10.754 24.891  1.00 50.27  ? 373  PHE C CE2   1 
ATOM   6128  C  CZ    . PHE C 2  373  ? -26.064 -9.561  24.211  1.00 44.83  ? 373  PHE C CZ    1 
ATOM   6129  N  N     . GLY C 2  374  ? -30.130 -12.666 29.721  1.00 56.85  ? 374  GLY C N     1 
ATOM   6130  C  CA    . GLY C 2  374  ? -30.784 -12.501 31.003  1.00 59.39  ? 374  GLY C CA    1 
ATOM   6131  C  C     . GLY C 2  374  ? -29.794 -12.822 32.103  1.00 60.89  ? 374  GLY C C     1 
ATOM   6132  O  O     . GLY C 2  374  ? -29.963 -12.416 33.252  1.00 65.97  ? 374  GLY C O     1 
ATOM   6133  N  N     . ASN C 2  375  ? -28.750 -13.559 31.737  1.00 57.55  ? 375  ASN C N     1 
ATOM   6134  C  CA    . ASN C 2  375  ? -27.677 -13.898 32.661  1.00 58.96  ? 375  ASN C CA    1 
ATOM   6135  C  C     . ASN C 2  375  ? -26.387 -13.182 32.296  1.00 62.45  ? 375  ASN C C     1 
ATOM   6136  O  O     . ASN C 2  375  ? -25.415 -13.213 33.049  1.00 67.40  ? 375  ASN C O     1 
ATOM   6137  C  CB    . ASN C 2  375  ? -27.438 -15.404 32.676  1.00 62.14  ? 375  ASN C CB    1 
ATOM   6138  C  CG    . ASN C 2  375  ? -28.682 -16.182 33.022  1.00 68.48  ? 375  ASN C CG    1 
ATOM   6139  O  OD1   . ASN C 2  375  ? -29.566 -15.679 33.711  1.00 73.50  ? 375  ASN C OD1   1 
ATOM   6140  N  ND2   . ASN C 2  375  ? -28.762 -17.417 32.542  1.00 74.78  ? 375  ASN C ND2   1 
ATOM   6141  N  N     . ARG C 2  376  ? -26.379 -12.555 31.124  1.00 60.53  ? 376  ARG C N     1 
ATOM   6142  C  CA    . ARG C 2  376  ? -25.225 -11.790 30.666  1.00 56.55  ? 376  ARG C CA    1 
ATOM   6143  C  C     . ARG C 2  376  ? -25.488 -10.305 30.845  1.00 53.47  ? 376  ARG C C     1 
ATOM   6144  O  O     . ARG C 2  376  ? -26.361 -9.736  30.192  1.00 53.55  ? 376  ARG C O     1 
ATOM   6145  C  CB    . ARG C 2  376  ? -24.910 -12.097 29.203  1.00 56.68  ? 376  ARG C CB    1 
ATOM   6146  C  CG    . ARG C 2  376  ? -23.625 -11.457 28.703  1.00 57.87  ? 376  ARG C CG    1 
ATOM   6147  C  CD    . ARG C 2  376  ? -22.672 -12.518 28.182  1.00 61.94  ? 376  ARG C CD    1 
ATOM   6148  N  NE    . ARG C 2  376  ? -21.417 -11.961 27.683  1.00 55.84  ? 376  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C 2  376  ? -21.148 -11.755 26.397  1.00 50.34  ? 376  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C 2  376  ? -22.046 -12.059 25.469  1.00 51.83  ? 376  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C 2  376  ? -19.978 -11.247 26.037  1.00 44.60  ? 376  ARG C NH2   1 
ATOM   6152  N  N     . ARG C 2  377  ? -24.723 -9.677  31.725  1.00 51.44  ? 377  ARG C N     1 
ATOM   6153  C  CA    . ARG C 2  377  ? -24.993 -8.301  32.096  1.00 48.07  ? 377  ARG C CA    1 
ATOM   6154  C  C     . ARG C 2  377  ? -24.195 -7.275  31.276  1.00 45.44  ? 377  ARG C C     1 
ATOM   6155  O  O     . ARG C 2  377  ? -23.046 -7.511  30.900  1.00 47.11  ? 377  ARG C O     1 
ATOM   6156  C  CB    . ARG C 2  377  ? -24.716 -8.124  33.584  1.00 49.28  ? 377  ARG C CB    1 
ATOM   6157  C  CG    . ARG C 2  377  ? -25.034 -6.760  34.098  1.00 45.18  ? 377  ARG C CG    1 
ATOM   6158  C  CD    . ARG C 2  377  ? -25.399 -6.812  35.547  1.00 47.74  ? 377  ARG C CD    1 
ATOM   6159  N  NE    . ARG C 2  377  ? -25.575 -5.466  36.060  1.00 44.55  ? 377  ARG C NE    1 
ATOM   6160  C  CZ    . ARG C 2  377  ? -24.583 -4.731  36.539  1.00 46.00  ? 377  ARG C CZ    1 
ATOM   6161  N  NH1   . ARG C 2  377  ? -23.351 -5.224  36.576  1.00 45.04  ? 377  ARG C NH1   1 
ATOM   6162  N  NH2   . ARG C 2  377  ? -24.826 -3.506  36.982  1.00 49.28  ? 377  ARG C NH2   1 
ATOM   6163  N  N     . LEU C 2  378  ? -24.829 -6.139  30.998  1.00 42.01  ? 378  LEU C N     1 
ATOM   6164  C  CA    . LEU C 2  378  ? -24.191 -5.034  30.289  1.00 36.78  ? 378  LEU C CA    1 
ATOM   6165  C  C     . LEU C 2  378  ? -23.940 -3.872  31.251  1.00 35.61  ? 378  LEU C C     1 
ATOM   6166  O  O     . LEU C 2  378  ? -24.852 -3.110  31.575  1.00 35.32  ? 378  LEU C O     1 
ATOM   6167  C  CB    . LEU C 2  378  ? -25.062 -4.595  29.102  1.00 34.82  ? 378  LEU C CB    1 
ATOM   6168  C  CG    . LEU C 2  378  ? -24.503 -3.700  27.985  1.00 31.38  ? 378  LEU C CG    1 
ATOM   6169  C  CD1   . LEU C 2  378  ? -24.723 -2.240  28.297  1.00 32.87  ? 378  LEU C CD1   1 
ATOM   6170  C  CD2   . LEU C 2  378  ? -23.025 -3.964  27.697  1.00 34.37  ? 378  LEU C CD2   1 
ATOM   6171  N  N     . ARG C 2  379  ? -22.703 -3.740  31.719  1.00 33.81  ? 379  ARG C N     1 
ATOM   6172  C  CA    . ARG C 2  379  ? -22.384 -2.664  32.649  1.00 31.76  ? 379  ARG C CA    1 
ATOM   6173  C  C     . ARG C 2  379  ? -21.981 -1.390  31.904  1.00 30.41  ? 379  ARG C C     1 
ATOM   6174  O  O     . ARG C 2  379  ? -20.892 -1.293  31.332  1.00 29.21  ? 379  ARG C O     1 
ATOM   6175  C  CB    . ARG C 2  379  ? -21.287 -3.097  33.629  1.00 34.35  ? 379  ARG C CB    1 
ATOM   6176  C  CG    . ARG C 2  379  ? -20.037 -3.687  33.003  1.00 35.44  ? 379  ARG C CG    1 
ATOM   6177  C  CD    . ARG C 2  379  ? -18.841 -3.548  33.940  1.00 38.76  ? 379  ARG C CD    1 
ATOM   6178  N  NE    . ARG C 2  379  ? -18.647 -4.702  34.819  1.00 41.54  ? 379  ARG C NE    1 
ATOM   6179  C  CZ    . ARG C 2  379  ? -17.706 -4.773  35.758  1.00 43.66  ? 379  ARG C CZ    1 
ATOM   6180  N  NH1   . ARG C 2  379  ? -16.879 -3.750  35.948  1.00 43.01  ? 379  ARG C NH1   1 
ATOM   6181  N  NH2   . ARG C 2  379  ? -17.593 -5.860  36.511  1.00 46.53  ? 379  ARG C NH2   1 
ATOM   6182  N  N     . THR C 2  380  ? -22.877 -0.408  31.925  1.00 29.97  ? 380  THR C N     1 
ATOM   6183  C  CA    . THR C 2  380  ? -22.708 0.814   31.145  1.00 26.11  ? 380  THR C CA    1 
ATOM   6184  C  C     . THR C 2  380  ? -21.607 1.715   31.680  1.00 26.46  ? 380  THR C C     1 
ATOM   6185  O  O     . THR C 2  380  ? -20.830 1.325   32.551  1.00 27.86  ? 380  THR C O     1 
ATOM   6186  C  CB    . THR C 2  380  ? -24.020 1.624   31.087  1.00 23.83  ? 380  THR C CB    1 
ATOM   6187  O  OG1   . THR C 2  380  ? -24.597 1.708   32.396  1.00 23.03  ? 380  THR C OG1   1 
ATOM   6188  C  CG2   . THR C 2  380  ? -25.008 0.959   30.151  1.00 26.65  ? 380  THR C CG2   1 
ATOM   6189  N  N     . VAL C 2  381  ? -21.548 2.924   31.137  1.00 24.46  ? 381  VAL C N     1 
ATOM   6190  C  CA    . VAL C 2  381  ? -20.578 3.920   31.568  1.00 25.46  ? 381  VAL C CA    1 
ATOM   6191  C  C     . VAL C 2  381  ? -20.701 4.207   33.056  1.00 28.07  ? 381  VAL C C     1 
ATOM   6192  O  O     . VAL C 2  381  ? -19.703 4.257   33.777  1.00 28.04  ? 381  VAL C O     1 
ATOM   6193  C  CB    . VAL C 2  381  ? -20.759 5.232   30.795  1.00 25.42  ? 381  VAL C CB    1 
ATOM   6194  C  CG1   . VAL C 2  381  ? -19.611 6.185   31.083  1.00 27.40  ? 381  VAL C CG1   1 
ATOM   6195  C  CG2   . VAL C 2  381  ? -20.857 4.950   29.321  1.00 26.24  ? 381  VAL C CG2   1 
ATOM   6196  N  N     . GLY C 2  382  ? -21.941 4.385   33.504  1.00 30.60  ? 382  GLY C N     1 
ATOM   6197  C  CA    . GLY C 2  382  ? -22.227 4.840   34.853  1.00 30.81  ? 382  GLY C CA    1 
ATOM   6198  C  C     . GLY C 2  382  ? -21.665 3.922   35.912  1.00 29.55  ? 382  GLY C C     1 
ATOM   6199  O  O     . GLY C 2  382  ? -21.014 4.371   36.855  1.00 30.18  ? 382  GLY C O     1 
ATOM   6200  N  N     . GLU C 2  383  ? -21.916 2.629   35.750  1.00 28.44  ? 383  GLU C N     1 
ATOM   6201  C  CA    . GLU C 2  383  ? -21.372 1.644   36.666  1.00 32.07  ? 383  GLU C CA    1 
ATOM   6202  C  C     . GLU C 2  383  ? -19.859 1.576   36.532  1.00 34.11  ? 383  GLU C C     1 
ATOM   6203  O  O     . GLU C 2  383  ? -19.150 1.541   37.536  1.00 37.87  ? 383  GLU C O     1 
ATOM   6204  C  CB    . GLU C 2  383  ? -21.977 0.266   36.418  1.00 34.32  ? 383  GLU C CB    1 
ATOM   6205  C  CG    . GLU C 2  383  ? -21.435 -0.808  37.352  1.00 41.11  ? 383  GLU C CG    1 
ATOM   6206  C  CD    . GLU C 2  383  ? -21.914 -2.188  36.968  1.00 47.93  ? 383  GLU C CD    1 
ATOM   6207  O  OE1   . GLU C 2  383  ? -22.913 -2.260  36.221  1.00 48.92  ? 383  GLU C OE1   1 
ATOM   6208  O  OE2   . GLU C 2  383  ? -21.294 -3.189  37.396  1.00 49.96  ? 383  GLU C OE2   1 
ATOM   6209  N  N     . LEU C 2  384  ? -19.374 1.563   35.291  1.00 31.67  ? 384  LEU C N     1 
ATOM   6210  C  CA    . LEU C 2  384  ? -17.941 1.450   35.010  1.00 31.17  ? 384  LEU C CA    1 
ATOM   6211  C  C     . LEU C 2  384  ? -17.134 2.512   35.745  1.00 32.10  ? 384  LEU C C     1 
ATOM   6212  O  O     . LEU C 2  384  ? -16.024 2.254   36.219  1.00 32.22  ? 384  LEU C O     1 
ATOM   6213  C  CB    . LEU C 2  384  ? -17.681 1.552   33.508  1.00 27.62  ? 384  LEU C CB    1 
ATOM   6214  C  CG    . LEU C 2  384  ? -17.897 0.272   32.704  1.00 27.46  ? 384  LEU C CG    1 
ATOM   6215  C  CD1   . LEU C 2  384  ? -17.877 0.570   31.218  1.00 26.28  ? 384  LEU C CD1   1 
ATOM   6216  C  CD2   . LEU C 2  384  ? -16.835 -0.744  33.069  1.00 32.39  ? 384  LEU C CD2   1 
ATOM   6217  N  N     . ILE C 2  385  ? -17.708 3.706   35.830  1.00 30.81  ? 385  ILE C N     1 
ATOM   6218  C  CA    . ILE C 2  385  ? -17.107 4.808   36.559  1.00 29.67  ? 385  ILE C CA    1 
ATOM   6219  C  C     . ILE C 2  385  ? -17.360 4.658   38.056  1.00 31.95  ? 385  ILE C C     1 
ATOM   6220  O  O     . ILE C 2  385  ? -16.463 4.880   38.866  1.00 33.97  ? 385  ILE C O     1 
ATOM   6221  C  CB    . ILE C 2  385  ? -17.649 6.157   36.061  1.00 27.17  ? 385  ILE C CB    1 
ATOM   6222  C  CG1   . ILE C 2  385  ? -17.226 6.382   34.612  1.00 26.37  ? 385  ILE C CG1   1 
ATOM   6223  C  CG2   . ILE C 2  385  ? -17.143 7.294   36.919  1.00 30.63  ? 385  ILE C CG2   1 
ATOM   6224  C  CD1   . ILE C 2  385  ? -17.594 7.737   34.076  1.00 29.93  ? 385  ILE C CD1   1 
ATOM   6225  N  N     . GLN C 2  386  ? -18.578 4.268   38.418  1.00 31.63  ? 386  GLN C N     1 
ATOM   6226  C  CA    . GLN C 2  386  ? -18.916 4.024   39.815  1.00 33.81  ? 386  GLN C CA    1 
ATOM   6227  C  C     . GLN C 2  386  ? -17.939 3.048   40.476  1.00 37.56  ? 386  GLN C C     1 
ATOM   6228  O  O     . GLN C 2  386  ? -17.405 3.333   41.548  1.00 39.76  ? 386  GLN C O     1 
ATOM   6229  C  CB    . GLN C 2  386  ? -20.343 3.489   39.932  1.00 35.44  ? 386  GLN C CB    1 
ATOM   6230  C  CG    . GLN C 2  386  ? -20.654 2.855   41.278  1.00 40.04  ? 386  GLN C CG    1 
ATOM   6231  C  CD    . GLN C 2  386  ? -21.988 2.133   41.297  1.00 43.50  ? 386  GLN C CD    1 
ATOM   6232  O  OE1   . GLN C 2  386  ? -22.095 0.984   40.859  1.00 42.25  ? 386  GLN C OE1   1 
ATOM   6233  N  NE2   . GLN C 2  386  ? -23.015 2.804   41.809  1.00 47.95  ? 386  GLN C NE2   1 
ATOM   6234  N  N     . ASN C 2  387  ? -17.705 1.908   39.828  1.00 37.28  ? 387  ASN C N     1 
ATOM   6235  C  CA    . ASN C 2  387  ? -16.790 0.893   40.352  1.00 38.19  ? 387  ASN C CA    1 
ATOM   6236  C  C     . ASN C 2  387  ? -15.407 1.457   40.613  1.00 39.10  ? 387  ASN C C     1 
ATOM   6237  O  O     . ASN C 2  387  ? -14.767 1.116   41.604  1.00 40.52  ? 387  ASN C O     1 
ATOM   6238  C  CB    . ASN C 2  387  ? -16.681 -0.290  39.390  1.00 41.55  ? 387  ASN C CB    1 
ATOM   6239  C  CG    . ASN C 2  387  ? -17.722 -1.355  39.655  1.00 46.94  ? 387  ASN C CG    1 
ATOM   6240  O  OD1   . ASN C 2  387  ? -18.628 -1.166  40.468  1.00 46.61  ? 387  ASN C OD1   1 
ATOM   6241  N  ND2   . ASN C 2  387  ? -17.600 -2.484  38.964  1.00 54.15  ? 387  ASN C ND2   1 
ATOM   6242  N  N     . GLN C 2  388  ? -14.956 2.318   39.706  1.00 38.31  ? 388  GLN C N     1 
ATOM   6243  C  CA    . GLN C 2  388  ? -13.673 2.997   39.840  1.00 37.56  ? 388  GLN C CA    1 
ATOM   6244  C  C     . GLN C 2  388  ? -13.678 4.037   40.945  1.00 37.17  ? 388  GLN C C     1 
ATOM   6245  O  O     . GLN C 2  388  ? -12.639 4.339   41.532  1.00 37.11  ? 388  GLN C O     1 
ATOM   6246  C  CB    . GLN C 2  388  ? -13.288 3.661   38.524  1.00 35.69  ? 388  GLN C CB    1 
ATOM   6247  C  CG    . GLN C 2  388  ? -12.483 2.759   37.650  1.00 36.35  ? 388  GLN C CG    1 
ATOM   6248  C  CD    . GLN C 2  388  ? -11.253 2.263   38.362  1.00 38.97  ? 388  GLN C CD    1 
ATOM   6249  O  OE1   . GLN C 2  388  ? -11.065 1.058   38.532  1.00 39.90  ? 388  GLN C OE1   1 
ATOM   6250  N  NE2   . GLN C 2  388  ? -10.404 3.190   38.790  1.00 39.12  ? 388  GLN C NE2   1 
ATOM   6251  N  N     . ILE C 2  389  ? -14.851 4.602   41.204  1.00 34.98  ? 389  ILE C N     1 
ATOM   6252  C  CA    . ILE C 2  389  ? -15.007 5.524   42.311  1.00 33.43  ? 389  ILE C CA    1 
ATOM   6253  C  C     . ILE C 2  389  ? -15.046 4.732   43.607  1.00 36.96  ? 389  ILE C C     1 
ATOM   6254  O  O     . ILE C 2  389  ? -14.451 5.135   44.601  1.00 40.73  ? 389  ILE C O     1 
ATOM   6255  C  CB    . ILE C 2  389  ? -16.270 6.371   42.169  1.00 31.62  ? 389  ILE C CB    1 
ATOM   6256  C  CG1   . ILE C 2  389  ? -16.165 7.256   40.928  1.00 31.87  ? 389  ILE C CG1   1 
ATOM   6257  C  CG2   . ILE C 2  389  ? -16.466 7.233   43.398  1.00 34.16  ? 389  ILE C CG2   1 
ATOM   6258  C  CD1   . ILE C 2  389  ? -17.396 8.073   40.654  1.00 32.05  ? 389  ILE C CD1   1 
ATOM   6259  N  N     . ARG C 2  390  ? -15.730 3.592   43.582  1.00 37.67  ? 390  ARG C N     1 
ATOM   6260  C  CA    . ARG C 2  390  ? -15.781 2.703   44.739  1.00 41.09  ? 390  ARG C CA    1 
ATOM   6261  C  C     . ARG C 2  390  ? -14.376 2.296   45.189  1.00 42.75  ? 390  ARG C C     1 
ATOM   6262  O  O     . ARG C 2  390  ? -14.099 2.204   46.387  1.00 42.92  ? 390  ARG C O     1 
ATOM   6263  C  CB    . ARG C 2  390  ? -16.615 1.460   44.419  1.00 42.32  ? 390  ARG C CB    1 
ATOM   6264  C  CG    . ARG C 2  390  ? -16.698 0.452   45.558  1.00 48.10  ? 390  ARG C CG    1 
ATOM   6265  C  CD    . ARG C 2  390  ? -17.777 -0.594  45.309  1.00 52.36  ? 390  ARG C CD    1 
ATOM   6266  N  NE    . ARG C 2  390  ? -19.109 0.005   45.255  1.00 58.92  ? 390  ARG C NE    1 
ATOM   6267  C  CZ    . ARG C 2  390  ? -19.780 0.245   44.132  1.00 56.04  ? 390  ARG C CZ    1 
ATOM   6268  N  NH1   . ARG C 2  390  ? -19.249 -0.072  42.958  1.00 51.19  ? 390  ARG C NH1   1 
ATOM   6269  N  NH2   . ARG C 2  390  ? -20.985 0.798   44.184  1.00 55.10  ? 390  ARG C NH2   1 
ATOM   6270  N  N     . VAL C 2  391  ? -13.495 2.066   44.219  1.00 40.79  ? 391  VAL C N     1 
ATOM   6271  C  CA    . VAL C 2  391  ? -12.112 1.704   44.505  1.00 39.64  ? 391  VAL C CA    1 
ATOM   6272  C  C     . VAL C 2  391  ? -11.371 2.876   45.146  1.00 43.03  ? 391  VAL C C     1 
ATOM   6273  O  O     . VAL C 2  391  ? -10.610 2.698   46.096  1.00 49.07  ? 391  VAL C O     1 
ATOM   6274  C  CB    . VAL C 2  391  ? -11.377 1.247   43.227  1.00 37.22  ? 391  VAL C CB    1 
ATOM   6275  C  CG1   . VAL C 2  391  ? -9.917  0.973   43.518  1.00 42.51  ? 391  VAL C CG1   1 
ATOM   6276  C  CG2   . VAL C 2  391  ? -12.032 -0.001  42.661  1.00 37.42  ? 391  VAL C CG2   1 
ATOM   6277  N  N     . GLY C 2  392  ? -11.614 4.078   44.638  1.00 41.10  ? 392  GLY C N     1 
ATOM   6278  C  CA    . GLY C 2  392  ? -10.992 5.270   45.185  1.00 45.33  ? 392  GLY C CA    1 
ATOM   6279  C  C     . GLY C 2  392  ? -11.436 5.593   46.601  1.00 49.61  ? 392  GLY C C     1 
ATOM   6280  O  O     . GLY C 2  392  ? -10.719 6.270   47.338  1.00 52.07  ? 392  GLY C O     1 
ATOM   6281  N  N     . MET C 2  393  ? -12.617 5.110   46.985  1.00 51.02  ? 393  MET C N     1 
ATOM   6282  C  CA    . MET C 2  393  ? -13.164 5.388   48.313  1.00 53.37  ? 393  MET C CA    1 
ATOM   6283  C  C     . MET C 2  393  ? -12.531 4.488   49.373  1.00 55.89  ? 393  MET C C     1 
ATOM   6284  O  O     . MET C 2  393  ? -12.009 4.974   50.377  1.00 57.17  ? 393  MET C O     1 
ATOM   6285  C  CB    . MET C 2  393  ? -14.688 5.214   48.332  1.00 50.87  ? 393  MET C CB    1 
ATOM   6286  C  CG    . MET C 2  393  ? -15.459 6.115   47.368  1.00 48.76  ? 393  MET C CG    1 
ATOM   6287  S  SD    . MET C 2  393  ? -15.108 7.878   47.532  1.00 44.04  ? 393  MET C SD    1 
ATOM   6288  C  CE    . MET C 2  393  ? -15.636 8.186   49.216  1.00 54.02  ? 393  MET C CE    1 
ATOM   6289  N  N     . SER C 2  394  ? -12.578 3.178   49.141  1.00 56.03  ? 394  SER C N     1 
ATOM   6290  C  CA    . SER C 2  394  ? -12.039 2.199   50.085  1.00 61.69  ? 394  SER C CA    1 
ATOM   6291  C  C     . SER C 2  394  ? -10.570 2.454   50.417  1.00 61.79  ? 394  SER C C     1 
ATOM   6292  O  O     . SER C 2  394  ? -10.118 2.155   51.521  1.00 64.53  ? 394  SER C O     1 
ATOM   6293  C  CB    . SER C 2  394  ? -12.196 0.786   49.531  1.00 60.42  ? 394  SER C CB    1 
ATOM   6294  O  OG    . SER C 2  394  ? -11.261 0.554   48.491  1.00 64.57  ? 394  SER C OG    1 
ATOM   6295  N  N     . ARG C 2  395  ? -9.828  2.993   49.454  1.00 57.86  ? 395  ARG C N     1 
ATOM   6296  C  CA    . ARG C 2  395  ? -8.440  3.368   49.689  1.00 58.08  ? 395  ARG C CA    1 
ATOM   6297  C  C     . ARG C 2  395  ? -8.343  4.533   50.660  1.00 64.24  ? 395  ARG C C     1 
ATOM   6298  O  O     . ARG C 2  395  ? -7.479  4.546   51.537  1.00 72.24  ? 395  ARG C O     1 
ATOM   6299  C  CB    . ARG C 2  395  ? -7.742  3.737   48.383  1.00 53.74  ? 395  ARG C CB    1 
ATOM   6300  C  CG    . ARG C 2  395  ? -7.522  2.573   47.457  1.00 53.72  ? 395  ARG C CG    1 
ATOM   6301  C  CD    . ARG C 2  395  ? -6.621  2.963   46.307  1.00 58.35  ? 395  ARG C CD    1 
ATOM   6302  N  NE    . ARG C 2  395  ? -6.372  1.833   45.420  1.00 64.74  ? 395  ARG C NE    1 
ATOM   6303  C  CZ    . ARG C 2  395  ? -6.471  1.889   44.097  1.00 61.51  ? 395  ARG C CZ    1 
ATOM   6304  N  NH1   . ARG C 2  395  ? -6.810  3.028   43.504  1.00 54.30  ? 395  ARG C NH1   1 
ATOM   6305  N  NH2   . ARG C 2  395  ? -6.229  0.806   43.367  1.00 59.08  ? 395  ARG C NH2   1 
ATOM   6306  N  N     . MET C 2  396  ? -9.221  5.518   50.495  1.00 58.73  ? 396  MET C N     1 
ATOM   6307  C  CA    . MET C 2  396  ? -9.190  6.685   51.365  1.00 65.35  ? 396  MET C CA    1 
ATOM   6308  C  C     . MET C 2  396  ? -9.852  6.355   52.700  1.00 69.94  ? 396  MET C C     1 
ATOM   6309  O  O     . MET C 2  396  ? -9.636  7.049   53.693  1.00 75.51  ? 396  MET C O     1 
ATOM   6310  C  CB    . MET C 2  396  ? -9.869  7.890   50.706  1.00 64.60  ? 396  MET C CB    1 
ATOM   6311  C  CG    . MET C 2  396  ? -11.379 7.944   50.894  1.00 64.48  ? 396  MET C CG    1 
ATOM   6312  S  SD    . MET C 2  396  ? -12.009 9.619   51.134  1.00 77.85  ? 396  MET C SD    1 
ATOM   6313  C  CE    . MET C 2  396  ? -10.959 10.158  52.479  1.00 76.49  ? 396  MET C CE    1 
ATOM   6314  N  N     . GLU C 2  397  ? -10.650 5.289   52.718  1.00 66.12  ? 397  GLU C N     1 
ATOM   6315  C  CA    . GLU C 2  397  ? -11.239 4.775   53.955  1.00 69.63  ? 397  GLU C CA    1 
ATOM   6316  C  C     . GLU C 2  397  ? -10.140 4.224   54.864  1.00 74.08  ? 397  GLU C C     1 
ATOM   6317  O  O     . GLU C 2  397  ? -10.197 4.366   56.087  1.00 74.64  ? 397  GLU C O     1 
ATOM   6318  C  CB    . GLU C 2  397  ? -12.277 3.686   53.649  1.00 70.27  ? 397  GLU C CB    1 
ATOM   6319  C  CG    . GLU C 2  397  ? -13.045 3.166   54.867  1.00 75.21  ? 397  GLU C CG    1 
ATOM   6320  C  CD    . GLU C 2  397  ? -13.918 1.955   54.549  1.00 76.72  ? 397  GLU C CD    1 
ATOM   6321  O  OE1   . GLU C 2  397  ? -15.057 1.880   55.061  1.00 75.93  ? 397  GLU C OE1   1 
ATOM   6322  O  OE2   . GLU C 2  397  ? -13.460 1.070   53.796  1.00 71.12  ? 397  GLU C OE2   1 
ATOM   6323  N  N     . ARG C 2  398  ? -9.145  3.592   54.244  1.00 74.49  ? 398  ARG C N     1 
ATOM   6324  C  CA    . ARG C 2  398  ? -7.980  3.067   54.950  1.00 75.72  ? 398  ARG C CA    1 
ATOM   6325  C  C     . ARG C 2  398  ? -7.194  4.210   55.580  1.00 77.83  ? 398  ARG C C     1 
ATOM   6326  O  O     . ARG C 2  398  ? -6.774  4.126   56.731  1.00 84.16  ? 398  ARG C O     1 
ATOM   6327  C  CB    . ARG C 2  398  ? -7.083  2.273   53.995  1.00 72.94  ? 398  ARG C CB    1 
ATOM   6328  C  CG    . ARG C 2  398  ? -6.409  1.062   54.620  1.00 72.27  ? 398  ARG C CG    1 
ATOM   6329  C  CD    . ARG C 2  398  ? -5.440  0.405   53.647  1.00 73.75  ? 398  ARG C CD    1 
ATOM   6330  N  NE    . ARG C 2  398  ? -4.209  1.175   53.491  1.00 69.00  ? 398  ARG C NE    1 
ATOM   6331  C  CZ    . ARG C 2  398  ? -3.118  0.992   54.229  1.00 60.51  ? 398  ARG C CZ    1 
ATOM   6332  N  NH1   . ARG C 2  398  ? -2.040  1.736   54.021  1.00 51.99  ? 398  ARG C NH1   1 
ATOM   6333  N  NH2   . ARG C 2  398  ? -3.104  0.065   55.177  1.00 59.77  ? 398  ARG C NH2   1 
ATOM   6334  N  N     . VAL C 2  399  ? -7.004  5.277   54.809  1.00 76.35  ? 399  VAL C N     1 
ATOM   6335  C  CA    . VAL C 2  399  ? -6.332  6.475   55.296  1.00 78.19  ? 399  VAL C CA    1 
ATOM   6336  C  C     . VAL C 2  399  ? -7.136  7.114   56.426  1.00 79.37  ? 399  VAL C C     1 
ATOM   6337  O  O     . VAL C 2  399  ? -6.569  7.595   57.407  1.00 83.73  ? 399  VAL C O     1 
ATOM   6338  C  CB    . VAL C 2  399  ? -6.118  7.500   54.163  1.00 82.49  ? 399  VAL C CB    1 
ATOM   6339  C  CG1   . VAL C 2  399  ? -5.653  8.838   54.720  1.00 82.78  ? 399  VAL C CG1   1 
ATOM   6340  C  CG2   . VAL C 2  399  ? -5.121  6.961   53.146  1.00 80.66  ? 399  VAL C CG2   1 
ATOM   6341  N  N     . VAL C 2  400  ? -8.458  7.100   56.292  1.00 75.05  ? 400  VAL C N     1 
ATOM   6342  C  CA    . VAL C 2  400  ? -9.335  7.620   57.335  1.00 76.32  ? 400  VAL C CA    1 
ATOM   6343  C  C     . VAL C 2  400  ? -9.198  6.826   58.639  1.00 83.34  ? 400  VAL C C     1 
ATOM   6344  O  O     . VAL C 2  400  ? -9.018  7.413   59.704  1.00 87.30  ? 400  VAL C O     1 
ATOM   6345  C  CB    . VAL C 2  400  ? -10.809 7.620   56.877  1.00 72.85  ? 400  VAL C CB    1 
ATOM   6346  C  CG1   . VAL C 2  400  ? -11.746 7.722   58.069  1.00 77.72  ? 400  VAL C CG1   1 
ATOM   6347  C  CG2   . VAL C 2  400  ? -11.057 8.764   55.910  1.00 76.06  ? 400  VAL C CG2   1 
ATOM   6348  N  N     . ARG C 2  401  ? -9.257  5.499   58.557  1.00 83.34  ? 401  ARG C N     1 
ATOM   6349  C  CA    . ARG C 2  401  ? -9.158  4.657   59.752  1.00 83.36  ? 401  ARG C CA    1 
ATOM   6350  C  C     . ARG C 2  401  ? -7.742  4.634   60.329  1.00 81.89  ? 401  ARG C C     1 
ATOM   6351  O  O     . ARG C 2  401  ? -7.517  4.127   61.428  1.00 79.72  ? 401  ARG C O     1 
ATOM   6352  C  CB    . ARG C 2  401  ? -9.625  3.229   59.445  1.00 82.23  ? 401  ARG C CB    1 
ATOM   6353  C  CG    . ARG C 2  401  ? -11.143 3.078   59.384  1.00 85.23  ? 401  ARG C CG    1 
ATOM   6354  C  CD    . ARG C 2  401  ? -11.575 1.648   59.071  1.00 85.07  ? 401  ARG C CD    1 
ATOM   6355  N  NE    . ARG C 2  401  ? -13.031 1.502   59.084  1.00 90.18  ? 401  ARG C NE    1 
ATOM   6356  C  CZ    . ARG C 2  401  ? -13.683 0.418   58.674  1.00 87.10  ? 401  ARG C CZ    1 
ATOM   6357  N  NH1   . ARG C 2  401  ? -13.012 -0.627  58.208  1.00 93.96  ? 401  ARG C NH1   1 
ATOM   6358  N  NH2   . ARG C 2  401  ? -15.008 0.378   58.725  1.00 87.32  ? 401  ARG C NH2   1 
ATOM   6359  N  N     . GLU C 2  402  ? -6.798  5.191   59.576  1.00 87.81  ? 402  GLU C N     1 
ATOM   6360  C  CA    . GLU C 2  402  ? -5.410  5.305   60.012  1.00 92.37  ? 402  GLU C CA    1 
ATOM   6361  C  C     . GLU C 2  402  ? -5.162  6.668   60.650  1.00 91.55  ? 402  GLU C C     1 
ATOM   6362  O  O     . GLU C 2  402  ? -4.398  6.791   61.610  1.00 89.83  ? 402  GLU C O     1 
ATOM   6363  C  CB    . GLU C 2  402  ? -4.454  5.091   58.831  1.00 92.93  ? 402  GLU C CB    1 
ATOM   6364  C  CG    . GLU C 2  402  ? -2.981  5.154   59.204  1.00 89.90  ? 402  GLU C CG    1 
ATOM   6365  C  CD    . GLU C 2  402  ? -2.640  4.234   60.362  1.00 92.48  ? 402  GLU C CD    1 
ATOM   6366  O  OE1   . GLU C 2  402  ? -3.066  3.057   60.336  1.00 88.03  ? 402  GLU C OE1   1 
ATOM   6367  O  OE2   . GLU C 2  402  ? -1.958  4.693   61.303  1.00 98.00  ? 402  GLU C OE2   1 
ATOM   6368  N  N     . ARG C 2  403  ? -5.818  7.687   60.102  1.00 90.47  ? 403  ARG C N     1 
ATOM   6369  C  CA    . ARG C 2  403  ? -5.718  9.049   60.617  1.00 90.12  ? 403  ARG C CA    1 
ATOM   6370  C  C     . ARG C 2  403  ? -6.601  9.235   61.852  1.00 97.42  ? 403  ARG C C     1 
ATOM   6371  O  O     . ARG C 2  403  ? -6.473  10.235  62.561  1.00 103.00 ? 403  ARG C O     1 
ATOM   6372  C  CB    . ARG C 2  403  ? -6.106  10.072  59.538  1.00 86.83  ? 403  ARG C CB    1 
ATOM   6373  C  CG    . ARG C 2  403  ? -5.065  10.295  58.440  1.00 84.82  ? 403  ARG C CG    1 
ATOM   6374  C  CD    . ARG C 2  403  ? -5.537  11.342  57.429  1.00 87.21  ? 403  ARG C CD    1 
ATOM   6375  N  NE    . ARG C 2  403  ? -4.454  11.825  56.573  1.00 92.21  ? 403  ARG C NE    1 
ATOM   6376  C  CZ    . ARG C 2  403  ? -4.521  12.925  55.825  1.00 89.79  ? 403  ARG C CZ    1 
ATOM   6377  N  NH1   . ARG C 2  403  ? -5.621  13.670  55.825  1.00 84.16  ? 403  ARG C NH1   1 
ATOM   6378  N  NH2   . ARG C 2  403  ? -3.484  13.287  55.080  1.00 88.36  ? 403  ARG C NH2   1 
ATOM   6379  N  N     . MET C 2  404  ? -7.496  8.276   62.100  1.00 96.62  ? 404  MET C N     1 
ATOM   6380  C  CA    . MET C 2  404  ? -8.417  8.343   63.240  1.00 99.87  ? 404  MET C CA    1 
ATOM   6381  C  C     . MET C 2  404  ? -7.737  7.937   64.547  1.00 99.49  ? 404  MET C C     1 
ATOM   6382  O  O     . MET C 2  404  ? -7.967  8.547   65.594  1.00 98.72  ? 404  MET C O     1 
ATOM   6383  C  CB    . MET C 2  404  ? -9.652  7.457   63.004  1.00 98.95  ? 404  MET C CB    1 
ATOM   6384  C  CG    . MET C 2  404  ? -10.767 8.114   62.185  1.00 95.47  ? 404  MET C CG    1 
ATOM   6385  S  SD    . MET C 2  404  ? -12.370 7.291   62.339  1.00 91.12  ? 404  MET C SD    1 
ATOM   6386  C  CE    . MET C 2  404  ? -11.891 5.583   62.101  1.00 93.38  ? 404  MET C CE    1 
ATOM   6387  N  N     . THR C 2  405  ? -6.899  6.906   64.481  1.00 97.32  ? 405  THR C N     1 
ATOM   6388  C  CA    . THR C 2  405  ? -6.212  6.406   65.667  1.00 95.63  ? 405  THR C CA    1 
ATOM   6389  C  C     . THR C 2  405  ? -4.989  7.258   66.030  1.00 98.67  ? 405  THR C C     1 
ATOM   6390  O  O     . THR C 2  405  ? -4.585  7.299   67.192  1.00 101.32 ? 405  THR C O     1 
ATOM   6391  C  CB    . THR C 2  405  ? -5.775  4.935   65.481  1.00 87.30  ? 405  THR C CB    1 
ATOM   6392  O  OG1   . THR C 2  405  ? -4.820  4.844   64.417  1.00 84.60  ? 405  THR C OG1   1 
ATOM   6393  C  CG2   . THR C 2  405  ? -6.976  4.058   65.155  1.00 85.58  ? 405  THR C CG2   1 
ATOM   6394  N  N     . THR C 2  406  ? -4.412  7.942   65.043  1.00 99.48  ? 406  THR C N     1 
ATOM   6395  C  CA    . THR C 2  406  ? -3.224  8.776   65.258  1.00 97.68  ? 406  THR C CA    1 
ATOM   6396  C  C     . THR C 2  406  ? -3.521  10.072  66.004  1.00 99.62  ? 406  THR C C     1 
ATOM   6397  O  O     . THR C 2  406  ? -2.870  10.397  67.000  1.00 99.14  ? 406  THR C O     1 
ATOM   6398  C  CB    . THR C 2  406  ? -2.552  9.157   63.924  1.00 96.70  ? 406  THR C CB    1 
ATOM   6399  O  OG1   . THR C 2  406  ? -1.992  7.989   63.314  1.00 95.37  ? 406  THR C OG1   1 
ATOM   6400  C  CG2   . THR C 2  406  ? -1.451  10.188  64.155  1.00 89.31  ? 406  THR C CG2   1 
ATOM   6401  N  N     . GLN C 2  407  ? -4.500  10.813  65.494  1.00 105.08 ? 407  GLN C N     1 
ATOM   6402  C  CA    . GLN C 2  407  ? -4.870  12.117  66.033  1.00 110.40 ? 407  GLN C CA    1 
ATOM   6403  C  C     . GLN C 2  407  ? -5.774  11.982  67.259  1.00 113.60 ? 407  GLN C C     1 
ATOM   6404  O  O     . GLN C 2  407  ? -6.441  10.962  67.441  1.00 108.95 ? 407  GLN C O     1 
ATOM   6405  C  CB    . GLN C 2  407  ? -5.571  12.954  64.958  1.00 110.57 ? 407  GLN C CB    1 
ATOM   6406  C  CG    . GLN C 2  407  ? -4.863  12.977  63.608  1.00 107.09 ? 407  GLN C CG    1 
ATOM   6407  C  CD    . GLN C 2  407  ? -5.792  13.374  62.473  1.00 102.05 ? 407  GLN C CD    1 
ATOM   6408  O  OE1   . GLN C 2  407  ? -6.904  13.853  62.702  1.00 97.90  ? 407  GLN C OE1   1 
ATOM   6409  N  NE2   . GLN C 2  407  ? -5.341  13.168  61.239  1.00 98.92  ? 407  GLN C NE2   1 
ATOM   6410  N  N     . ASP C 2  408  ? -5.791  13.017  68.094  1.00 116.74 ? 408  ASP C N     1 
ATOM   6411  C  CA    . ASP C 2  408  ? -6.635  13.042  69.286  1.00 112.69 ? 408  ASP C CA    1 
ATOM   6412  C  C     . ASP C 2  408  ? -8.105  13.274  68.931  1.00 116.23 ? 408  ASP C C     1 
ATOM   6413  O  O     . ASP C 2  408  ? -8.409  13.949  67.948  1.00 119.79 ? 408  ASP C O     1 
ATOM   6414  C  CB    . ASP C 2  408  ? -6.145  14.123  70.251  1.00 114.59 ? 408  ASP C CB    1 
ATOM   6415  C  CG    . ASP C 2  408  ? -5.719  15.396  69.534  1.00 117.70 ? 408  ASP C CG    1 
ATOM   6416  O  OD1   . ASP C 2  408  ? -5.065  15.295  68.472  1.00 109.91 ? 408  ASP C OD1   1 
ATOM   6417  O  OD2   . ASP C 2  408  ? -6.039  16.497  70.029  1.00 121.14 ? 408  ASP C OD2   1 
ATOM   6418  N  N     . VAL C 2  409  ? -9.008  12.721  69.739  1.00 112.90 ? 409  VAL C N     1 
ATOM   6419  C  CA    . VAL C 2  409  ? -10.449 12.786  69.471  1.00 116.21 ? 409  VAL C CA    1 
ATOM   6420  C  C     . VAL C 2  409  ? -10.978 14.221  69.351  1.00 125.82 ? 409  VAL C C     1 
ATOM   6421  O  O     . VAL C 2  409  ? -11.824 14.508  68.501  1.00 129.20 ? 409  VAL C O     1 
ATOM   6422  C  CB    . VAL C 2  409  ? -11.256 12.042  70.572  1.00 106.70 ? 409  VAL C CB    1 
ATOM   6423  C  CG1   . VAL C 2  409  ? -12.753 12.266  70.406  1.00 97.49  ? 409  VAL C CG1   1 
ATOM   6424  C  CG2   . VAL C 2  409  ? -10.945 10.558  70.547  1.00 99.29  ? 409  VAL C CG2   1 
ATOM   6425  N  N     . GLU C 2  410  ? -10.468 15.124  70.185  1.00 125.10 ? 410  GLU C N     1 
ATOM   6426  C  CA    . GLU C 2  410  ? -10.988 16.490  70.238  1.00 121.62 ? 410  GLU C CA    1 
ATOM   6427  C  C     . GLU C 2  410  ? -10.661 17.326  69.001  1.00 125.95 ? 410  GLU C C     1 
ATOM   6428  O  O     . GLU C 2  410  ? -11.462 18.169  68.590  1.00 130.10 ? 410  GLU C O     1 
ATOM   6429  C  CB    . GLU C 2  410  ? -10.468 17.207  71.487  1.00 118.94 ? 410  GLU C CB    1 
ATOM   6430  C  CG    . GLU C 2  410  ? -11.349 17.018  72.705  1.00 117.44 ? 410  GLU C CG    1 
ATOM   6431  C  CD    . GLU C 2  410  ? -12.791 17.388  72.428  1.00 117.00 ? 410  GLU C CD    1 
ATOM   6432  O  OE1   . GLU C 2  410  ? -13.679 16.557  72.712  1.00 119.73 ? 410  GLU C OE1   1 
ATOM   6433  O  OE2   . GLU C 2  410  ? -13.035 18.506  71.923  1.00 117.95 ? 410  GLU C OE2   1 
ATOM   6434  N  N     . ALA C 2  411  ? -9.492  17.094  68.409  1.00 123.03 ? 411  ALA C N     1 
ATOM   6435  C  CA    . ALA C 2  411  ? -9.021  17.923  67.300  1.00 128.43 ? 411  ALA C CA    1 
ATOM   6436  C  C     . ALA C 2  411  ? -9.264  17.278  65.937  1.00 121.99 ? 411  ALA C C     1 
ATOM   6437  O  O     . ALA C 2  411  ? -8.653  17.665  64.939  1.00 117.60 ? 411  ALA C O     1 
ATOM   6438  C  CB    . ALA C 2  411  ? -7.540  18.239  67.474  1.00 126.16 ? 411  ALA C CB    1 
ATOM   6439  N  N     . ILE C 2  412  ? -10.161 16.298  65.898  1.00 118.93 ? 412  ILE C N     1 
ATOM   6440  C  CA    . ILE C 2  412  ? -10.501 15.632  64.648  1.00 114.86 ? 412  ILE C CA    1 
ATOM   6441  C  C     . ILE C 2  412  ? -11.625 16.359  63.906  1.00 115.22 ? 412  ILE C C     1 
ATOM   6442  O  O     . ILE C 2  412  ? -12.750 16.483  64.401  1.00 110.89 ? 412  ILE C O     1 
ATOM   6443  C  CB    . ILE C 2  412  ? -10.903 14.158  64.885  1.00 108.27 ? 412  ILE C CB    1 
ATOM   6444  C  CG1   . ILE C 2  412  ? -9.661  13.305  65.144  1.00 101.80 ? 412  ILE C CG1   1 
ATOM   6445  C  CG2   . ILE C 2  412  ? -11.652 13.597  63.689  1.00 106.98 ? 412  ILE C CG2   1 
ATOM   6446  C  CD1   . ILE C 2  412  ? -9.967  11.840  65.352  1.00 101.44 ? 412  ILE C CD1   1 
ATOM   6447  N  N     . THR C 2  413  ? -11.284 16.859  62.722  1.00 112.61 ? 413  THR C N     1 
ATOM   6448  C  CA    . THR C 2  413  ? -12.259 17.369  61.767  1.00 105.62 ? 413  THR C CA    1 
ATOM   6449  C  C     . THR C 2  413  ? -12.240 16.465  60.532  1.00 101.60 ? 413  THR C C     1 
ATOM   6450  O  O     . THR C 2  413  ? -11.212 15.857  60.226  1.00 101.27 ? 413  THR C O     1 
ATOM   6451  C  CB    . THR C 2  413  ? -11.958 18.829  61.366  1.00 97.81  ? 413  THR C CB    1 
ATOM   6452  O  OG1   . THR C 2  413  ? -10.730 18.890  60.628  1.00 90.85  ? 413  THR C OG1   1 
ATOM   6453  C  CG2   . THR C 2  413  ? -11.841 19.704  62.602  1.00 97.41  ? 413  THR C CG2   1 
ATOM   6454  N  N     . PRO C 2  414  ? -13.376 16.355  59.825  1.00 95.20  ? 414  PRO C N     1 
ATOM   6455  C  CA    . PRO C 2  414  ? -13.378 15.583  58.575  1.00 90.85  ? 414  PRO C CA    1 
ATOM   6456  C  C     . PRO C 2  414  ? -12.381 16.125  57.545  1.00 86.49  ? 414  PRO C C     1 
ATOM   6457  O  O     . PRO C 2  414  ? -12.026 15.416  56.608  1.00 84.76  ? 414  PRO C O     1 
ATOM   6458  C  CB    . PRO C 2  414  ? -14.825 15.718  58.073  1.00 91.56  ? 414  PRO C CB    1 
ATOM   6459  C  CG    . PRO C 2  414  ? -15.449 16.803  58.906  1.00 90.25  ? 414  PRO C CG    1 
ATOM   6460  C  CD    . PRO C 2  414  ? -14.728 16.787  60.211  1.00 92.74  ? 414  PRO C CD    1 
ATOM   6461  N  N     . GLN C 2  415  ? -11.931 17.361  57.729  1.00 80.47  ? 415  GLN C N     1 
ATOM   6462  C  CA    . GLN C 2  415  ? -10.892 17.934  56.881  1.00 83.50  ? 415  GLN C CA    1 
ATOM   6463  C  C     . GLN C 2  415  ? -9.529  17.288  57.129  1.00 90.87  ? 415  GLN C C     1 
ATOM   6464  O  O     . GLN C 2  415  ? -8.636  17.351  56.281  1.00 91.16  ? 415  GLN C O     1 
ATOM   6465  C  CB    . GLN C 2  415  ? -10.794 19.444  57.103  1.00 82.68  ? 415  GLN C CB    1 
ATOM   6466  C  CG    . GLN C 2  415  ? -11.962 20.237  56.545  1.00 83.90  ? 415  GLN C CG    1 
ATOM   6467  C  CD    . GLN C 2  415  ? -12.060 20.151  55.037  1.00 89.04  ? 415  GLN C CD    1 
ATOM   6468  O  OE1   . GLN C 2  415  ? -11.109 19.758  54.365  1.00 95.10  ? 415  GLN C OE1   1 
ATOM   6469  N  NE2   . GLN C 2  415  ? -13.215 20.517  54.494  1.00 86.81  ? 415  GLN C NE2   1 
ATOM   6470  N  N     . THR C 2  416  ? -9.371  16.667  58.293  1.00 94.88  ? 416  THR C N     1 
ATOM   6471  C  CA    . THR C 2  416  ? -8.085  16.095  58.675  1.00 94.91  ? 416  THR C CA    1 
ATOM   6472  C  C     . THR C 2  416  ? -8.031  14.590  58.431  1.00 85.26  ? 416  THR C C     1 
ATOM   6473  O  O     . THR C 2  416  ? -6.963  14.042  58.170  1.00 76.94  ? 416  THR C O     1 
ATOM   6474  C  CB    . THR C 2  416  ? -7.766  16.376  60.156  1.00 107.35 ? 416  THR C CB    1 
ATOM   6475  O  OG1   . THR C 2  416  ? -8.807  15.841  60.982  1.00 109.60 ? 416  THR C OG1   1 
ATOM   6476  C  CG2   . THR C 2  416  ? -7.642  17.879  60.404  1.00 107.39 ? 416  THR C CG2   1 
ATOM   6477  N  N     . LEU C 2  417  ? -9.183  13.931  58.515  1.00 83.59  ? 417  LEU C N     1 
ATOM   6478  C  CA    . LEU C 2  417  ? -9.273  12.490  58.281  1.00 83.11  ? 417  LEU C CA    1 
ATOM   6479  C  C     . LEU C 2  417  ? -9.251  12.155  56.792  1.00 84.00  ? 417  LEU C C     1 
ATOM   6480  O  O     . LEU C 2  417  ? -8.811  11.076  56.385  1.00 76.53  ? 417  LEU C O     1 
ATOM   6481  C  CB    . LEU C 2  417  ? -10.551 11.923  58.902  1.00 78.45  ? 417  LEU C CB    1 
ATOM   6482  C  CG    . LEU C 2  417  ? -10.860 12.218  60.366  1.00 78.60  ? 417  LEU C CG    1 
ATOM   6483  C  CD1   . LEU C 2  417  ? -12.192 11.595  60.737  1.00 86.35  ? 417  LEU C CD1   1 
ATOM   6484  C  CD2   . LEU C 2  417  ? -9.758  11.692  61.260  1.00 87.26  ? 417  LEU C CD2   1 
ATOM   6485  N  N     . ILE C 2  418  ? -9.734  13.097  55.987  1.00 87.75  ? 418  ILE C N     1 
ATOM   6486  C  CA    . ILE C 2  418  ? -9.975  12.866  54.568  1.00 78.97  ? 418  ILE C CA    1 
ATOM   6487  C  C     . ILE C 2  418  ? -8.800  13.260  53.668  1.00 75.16  ? 418  ILE C C     1 
ATOM   6488  O  O     . ILE C 2  418  ? -8.330  14.402  53.685  1.00 70.45  ? 418  ILE C O     1 
ATOM   6489  C  CB    . ILE C 2  418  ? -11.242 13.625  54.108  1.00 74.47  ? 418  ILE C CB    1 
ATOM   6490  C  CG1   . ILE C 2  418  ? -12.500 12.962  54.680  1.00 70.30  ? 418  ILE C CG1   1 
ATOM   6491  C  CG2   . ILE C 2  418  ? -11.314 13.696  52.593  1.00 72.84  ? 418  ILE C CG2   1 
ATOM   6492  C  CD1   . ILE C 2  418  ? -13.763 13.764  54.467  1.00 68.62  ? 418  ILE C CD1   1 
ATOM   6493  N  N     . ASN C 2  419  ? -8.330  12.286  52.894  1.00 70.94  ? 419  ASN C N     1 
ATOM   6494  C  CA    . ASN C 2  419  ? -7.368  12.524  51.825  1.00 69.96  ? 419  ASN C CA    1 
ATOM   6495  C  C     . ASN C 2  419  ? -7.986  12.102  50.492  1.00 67.84  ? 419  ASN C C     1 
ATOM   6496  O  O     . ASN C 2  419  ? -8.165  10.912  50.235  1.00 65.40  ? 419  ASN C O     1 
ATOM   6497  C  CB    . ASN C 2  419  ? -6.066  11.763  52.087  1.00 70.50  ? 419  ASN C CB    1 
ATOM   6498  C  CG    . ASN C 2  419  ? -4.987  12.074  51.065  1.00 66.33  ? 419  ASN C CG    1 
ATOM   6499  O  OD1   . ASN C 2  419  ? -4.927  13.176  50.521  1.00 64.17  ? 419  ASN C OD1   1 
ATOM   6500  N  ND2   . ASN C 2  419  ? -4.126  11.097  50.800  1.00 65.01  ? 419  ASN C ND2   1 
ATOM   6501  N  N     . ILE C 2  420  ? -8.329  13.081  49.656  1.00 67.03  ? 420  ILE C N     1 
ATOM   6502  C  CA    . ILE C 2  420  ? -9.009  12.819  48.386  1.00 59.32  ? 420  ILE C CA    1 
ATOM   6503  C  C     . ILE C 2  420  ? -8.031  12.435  47.286  1.00 54.37  ? 420  ILE C C     1 
ATOM   6504  O  O     . ILE C 2  420  ? -8.428  12.159  46.159  1.00 53.29  ? 420  ILE C O     1 
ATOM   6505  C  CB    . ILE C 2  420  ? -9.810  14.043  47.907  1.00 55.04  ? 420  ILE C CB    1 
ATOM   6506  C  CG1   . ILE C 2  420  ? -8.860  15.134  47.411  1.00 52.66  ? 420  ILE C CG1   1 
ATOM   6507  C  CG2   . ILE C 2  420  ? -10.689 14.571  49.020  1.00 55.96  ? 420  ILE C CG2   1 
ATOM   6508  C  CD1   . ILE C 2  420  ? -9.559  16.375  46.926  1.00 55.53  ? 420  ILE C CD1   1 
ATOM   6509  N  N     . ARG C 2  421  ? -6.749  12.432  47.623  1.00 55.20  ? 421  ARG C N     1 
ATOM   6510  C  CA    . ARG C 2  421  ? -5.700  12.120  46.664  1.00 56.43  ? 421  ARG C CA    1 
ATOM   6511  C  C     . ARG C 2  421  ? -5.881  10.765  45.960  1.00 55.02  ? 421  ARG C C     1 
ATOM   6512  O  O     . ARG C 2  421  ? -5.684  10.684  44.747  1.00 53.85  ? 421  ARG C O     1 
ATOM   6513  C  CB    . ARG C 2  421  ? -4.337  12.181  47.360  1.00 64.75  ? 421  ARG C CB    1 
ATOM   6514  C  CG    . ARG C 2  421  ? -3.143  11.920  46.464  1.00 68.98  ? 421  ARG C CG    1 
ATOM   6515  C  CD    . ARG C 2  421  ? -1.978  12.835  46.841  1.00 85.82  ? 421  ARG C CD    1 
ATOM   6516  N  NE    . ARG C 2  421  ? -1.894  13.088  48.281  1.00 93.49  ? 421  ARG C NE    1 
ATOM   6517  C  CZ    . ARG C 2  421  ? -1.970  14.294  48.844  1.00 83.90  ? 421  ARG C CZ    1 
ATOM   6518  N  NH1   . ARG C 2  421  ? -2.129  15.378  48.093  1.00 75.97  ? 421  ARG C NH1   1 
ATOM   6519  N  NH2   . ARG C 2  421  ? -1.882  14.417  50.163  1.00 77.41  ? 421  ARG C NH2   1 
ATOM   6520  N  N     . PRO C 2  422  ? -6.257  9.698   46.702  1.00 57.48  ? 422  PRO C N     1 
ATOM   6521  C  CA    . PRO C 2  422  ? -6.455  8.437   45.973  1.00 57.59  ? 422  PRO C CA    1 
ATOM   6522  C  C     . PRO C 2  422  ? -7.739  8.421   45.144  1.00 56.51  ? 422  PRO C C     1 
ATOM   6523  O  O     . PRO C 2  422  ? -7.817  7.679   44.161  1.00 56.16  ? 422  PRO C O     1 
ATOM   6524  C  CB    . PRO C 2  422  ? -6.520  7.385   47.091  1.00 54.41  ? 422  PRO C CB    1 
ATOM   6525  C  CG    . PRO C 2  422  ? -5.921  8.038   48.283  1.00 56.22  ? 422  PRO C CG    1 
ATOM   6526  C  CD    . PRO C 2  422  ? -6.298  9.478   48.158  1.00 60.34  ? 422  PRO C CD    1 
ATOM   6527  N  N     . VAL C 2  423  ? -8.728  9.220   45.541  1.00 54.76  ? 423  VAL C N     1 
ATOM   6528  C  CA    . VAL C 2  423  ? -9.972  9.350   44.783  1.00 50.40  ? 423  VAL C CA    1 
ATOM   6529  C  C     . VAL C 2  423  ? -9.710  9.959   43.407  1.00 48.05  ? 423  VAL C C     1 
ATOM   6530  O  O     . VAL C 2  423  ? -10.128 9.408   42.391  1.00 43.37  ? 423  VAL C O     1 
ATOM   6531  C  CB    . VAL C 2  423  ? -11.014 10.212  45.539  1.00 48.13  ? 423  VAL C CB    1 
ATOM   6532  C  CG1   . VAL C 2  423  ? -12.075 10.752  44.589  1.00 45.70  ? 423  VAL C CG1   1 
ATOM   6533  C  CG2   . VAL C 2  423  ? -11.661 9.404   46.642  1.00 48.71  ? 423  VAL C CG2   1 
ATOM   6534  N  N     . VAL C 2  424  ? -9.004  11.088  43.383  1.00 50.95  ? 424  VAL C N     1 
ATOM   6535  C  CA    . VAL C 2  424  ? -8.694  11.783  42.137  1.00 50.85  ? 424  VAL C CA    1 
ATOM   6536  C  C     . VAL C 2  424  ? -7.789  10.931  41.253  1.00 45.85  ? 424  VAL C C     1 
ATOM   6537  O  O     . VAL C 2  424  ? -7.799  11.052  40.027  1.00 44.41  ? 424  VAL C O     1 
ATOM   6538  C  CB    . VAL C 2  424  ? -8.007  13.148  42.395  1.00 53.76  ? 424  VAL C CB    1 
ATOM   6539  C  CG1   . VAL C 2  424  ? -8.031  14.002  41.134  1.00 54.66  ? 424  VAL C CG1   1 
ATOM   6540  C  CG2   . VAL C 2  424  ? -8.685  13.887  43.538  1.00 53.35  ? 424  VAL C CG2   1 
ATOM   6541  N  N     . ALA C 2  425  ? -7.004  10.067  41.884  1.00 46.21  ? 425  ALA C N     1 
ATOM   6542  C  CA    . ALA C 2  425  ? -6.103  9.189   41.153  1.00 46.35  ? 425  ALA C CA    1 
ATOM   6543  C  C     . ALA C 2  425  ? -6.873  8.084   40.444  1.00 44.51  ? 425  ALA C C     1 
ATOM   6544  O  O     . ALA C 2  425  ? -6.619  7.794   39.278  1.00 43.19  ? 425  ALA C O     1 
ATOM   6545  C  CB    . ALA C 2  425  ? -5.066  8.597   42.091  1.00 51.93  ? 425  ALA C CB    1 
ATOM   6546  N  N     . ALA C 2  426  ? -7.822  7.479   41.154  1.00 44.31  ? 426  ALA C N     1 
ATOM   6547  C  CA    . ALA C 2  426  ? -8.565  6.331   40.640  1.00 44.30  ? 426  ALA C CA    1 
ATOM   6548  C  C     . ALA C 2  426  ? -9.417  6.692   39.421  1.00 43.60  ? 426  ALA C C     1 
ATOM   6549  O  O     . ALA C 2  426  ? -9.583  5.879   38.506  1.00 38.87  ? 426  ALA C O     1 
ATOM   6550  C  CB    . ALA C 2  426  ? -9.436  5.736   41.740  1.00 46.63  ? 426  ALA C CB    1 
ATOM   6551  N  N     . ILE C 2  427  ? -9.952  7.912   39.414  1.00 44.86  ? 427  ILE C N     1 
ATOM   6552  C  CA    . ILE C 2  427  ? -10.724 8.409   38.277  1.00 41.43  ? 427  ILE C CA    1 
ATOM   6553  C  C     . ILE C 2  427  ? -9.808  8.830   37.127  1.00 41.25  ? 427  ILE C C     1 
ATOM   6554  O  O     . ILE C 2  427  ? -10.086 8.529   35.965  1.00 40.94  ? 427  ILE C O     1 
ATOM   6555  C  CB    . ILE C 2  427  ? -11.632 9.606   38.669  1.00 37.11  ? 427  ILE C CB    1 
ATOM   6556  C  CG1   . ILE C 2  427  ? -10.897 10.566  39.606  1.00 41.08  ? 427  ILE C CG1   1 
ATOM   6557  C  CG2   . ILE C 2  427  ? -12.920 9.118   39.317  1.00 33.58  ? 427  ILE C CG2   1 
ATOM   6558  C  CD1   . ILE C 2  427  ? -10.731 11.976  39.060  1.00 42.86  ? 427  ILE C CD1   1 
ATOM   6559  N  N     . LYS C 2  428  ? -8.718  9.523   37.450  1.00 40.21  ? 428  LYS C N     1 
ATOM   6560  C  CA    . LYS C 2  428  ? -7.751  9.928   36.436  1.00 38.05  ? 428  LYS C CA    1 
ATOM   6561  C  C     . LYS C 2  428  ? -7.161  8.697   35.766  1.00 38.10  ? 428  LYS C C     1 
ATOM   6562  O  O     . LYS C 2  428  ? -6.870  8.704   34.567  1.00 36.31  ? 428  LYS C O     1 
ATOM   6563  C  CB    . LYS C 2  428  ? -6.632  10.779  37.042  1.00 43.35  ? 428  LYS C CB    1 
ATOM   6564  C  CG    . LYS C 2  428  ? -5.538  11.149  36.039  1.00 51.95  ? 428  LYS C CG    1 
ATOM   6565  C  CD    . LYS C 2  428  ? -4.261  11.642  36.717  1.00 59.66  ? 428  LYS C CD    1 
ATOM   6566  C  CE    . LYS C 2  428  ? -3.134  11.840  35.703  1.00 58.97  ? 428  LYS C CE    1 
ATOM   6567  N  NZ    . LYS C 2  428  ? -1.856  12.271  36.339  1.00 61.70  ? 428  LYS C NZ    1 
ATOM   6568  N  N     . GLU C 2  429  ? -7.001  7.638   36.555  1.00 39.96  ? 429  GLU C N     1 
ATOM   6569  C  CA    . GLU C 2  429  ? -6.386  6.406   36.082  1.00 41.57  ? 429  GLU C CA    1 
ATOM   6570  C  C     . GLU C 2  429  ? -7.322  5.608   35.198  1.00 40.37  ? 429  GLU C C     1 
ATOM   6571  O  O     . GLU C 2  429  ? -6.888  4.925   34.269  1.00 41.86  ? 429  GLU C O     1 
ATOM   6572  C  CB    . GLU C 2  429  ? -5.947  5.536   37.253  1.00 43.86  ? 429  GLU C CB    1 
ATOM   6573  C  CG    . GLU C 2  429  ? -5.047  4.396   36.830  1.00 49.86  ? 429  GLU C CG    1 
ATOM   6574  C  CD    . GLU C 2  429  ? -5.334  3.111   37.573  1.00 54.34  ? 429  GLU C CD    1 
ATOM   6575  O  OE1   . GLU C 2  429  ? -6.373  3.037   38.266  1.00 50.22  ? 429  GLU C OE1   1 
ATOM   6576  O  OE2   . GLU C 2  429  ? -4.516  2.173   37.462  1.00 56.32  ? 429  GLU C OE2   1 
ATOM   6577  N  N     . PHE C 2  430  ? -8.609  5.677   35.506  1.00 36.88  ? 430  PHE C N     1 
ATOM   6578  C  CA    . PHE C 2  430  ? -9.591  4.997   34.686  1.00 36.64  ? 430  PHE C CA    1 
ATOM   6579  C  C     . PHE C 2  430  ? -9.610  5.580   33.278  1.00 35.95  ? 430  PHE C C     1 
ATOM   6580  O  O     . PHE C 2  430  ? -9.389  4.870   32.295  1.00 35.42  ? 430  PHE C O     1 
ATOM   6581  C  CB    . PHE C 2  430  ? -10.979 5.090   35.310  1.00 35.71  ? 430  PHE C CB    1 
ATOM   6582  C  CG    . PHE C 2  430  ? -12.040 4.430   34.488  1.00 37.34  ? 430  PHE C CG    1 
ATOM   6583  C  CD1   . PHE C 2  430  ? -12.027 3.054   34.295  1.00 37.49  ? 430  PHE C CD1   1 
ATOM   6584  C  CD2   . PHE C 2  430  ? -13.037 5.178   33.888  1.00 35.79  ? 430  PHE C CD2   1 
ATOM   6585  C  CE1   . PHE C 2  430  ? -12.997 2.433   33.532  1.00 35.06  ? 430  PHE C CE1   1 
ATOM   6586  C  CE2   . PHE C 2  430  ? -14.012 4.566   33.121  1.00 35.15  ? 430  PHE C CE2   1 
ATOM   6587  C  CZ    . PHE C 2  430  ? -13.992 3.190   32.943  1.00 35.56  ? 430  PHE C CZ    1 
ATOM   6588  N  N     . PHE C 2  431  ? -9.862  6.883   33.195  1.00 34.23  ? 431  PHE C N     1 
ATOM   6589  C  CA    . PHE C 2  431  ? -9.941  7.581   31.918  1.00 33.09  ? 431  PHE C CA    1 
ATOM   6590  C  C     . PHE C 2  431  ? -8.609  7.585   31.161  1.00 35.43  ? 431  PHE C C     1 
ATOM   6591  O  O     . PHE C 2  431  ? -8.585  7.735   29.941  1.00 33.90  ? 431  PHE C O     1 
ATOM   6592  C  CB    . PHE C 2  431  ? -10.399 9.026   32.128  1.00 33.61  ? 431  PHE C CB    1 
ATOM   6593  C  CG    . PHE C 2  431  ? -11.858 9.177   32.486  1.00 31.32  ? 431  PHE C CG    1 
ATOM   6594  C  CD1   . PHE C 2  431  ? -12.851 8.977   31.540  1.00 31.27  ? 431  PHE C CD1   1 
ATOM   6595  C  CD2   . PHE C 2  431  ? -12.233 9.573   33.762  1.00 33.09  ? 431  PHE C CD2   1 
ATOM   6596  C  CE1   . PHE C 2  431  ? -14.190 9.141   31.872  1.00 33.80  ? 431  PHE C CE1   1 
ATOM   6597  C  CE2   . PHE C 2  431  ? -13.570 9.736   34.098  1.00 30.21  ? 431  PHE C CE2   1 
ATOM   6598  C  CZ    . PHE C 2  431  ? -14.546 9.522   33.154  1.00 31.65  ? 431  PHE C CZ    1 
ATOM   6599  N  N     . GLY C 2  432  ? -7.506  7.436   31.889  1.00 36.37  ? 432  GLY C N     1 
ATOM   6600  C  CA    . GLY C 2  432  ? -6.188  7.472   31.283  1.00 36.25  ? 432  GLY C CA    1 
ATOM   6601  C  C     . GLY C 2  432  ? -5.670  6.126   30.804  1.00 39.77  ? 432  GLY C C     1 
ATOM   6602  O  O     . GLY C 2  432  ? -5.037  6.039   29.750  1.00 42.56  ? 432  GLY C O     1 
ATOM   6603  N  N     . THR C 2  433  ? -5.947  5.072   31.565  1.00 39.44  ? 433  THR C N     1 
ATOM   6604  C  CA    . THR C 2  433  ? -5.309  3.782   31.320  1.00 40.79  ? 433  THR C CA    1 
ATOM   6605  C  C     . THR C 2  433  ? -6.252  2.672   30.851  1.00 44.83  ? 433  THR C C     1 
ATOM   6606  O  O     . THR C 2  433  ? -5.869  1.862   30.004  1.00 53.74  ? 433  THR C O     1 
ATOM   6607  C  CB    . THR C 2  433  ? -4.580  3.286   32.584  1.00 38.56  ? 433  THR C CB    1 
ATOM   6608  O  OG1   . THR C 2  433  ? -3.794  4.353   33.131  1.00 36.88  ? 433  THR C OG1   1 
ATOM   6609  C  CG2   . THR C 2  433  ? -3.674  2.110   32.253  1.00 37.47  ? 433  THR C CG2   1 
ATOM   6610  N  N     . SER C 2  434  ? -7.471  2.632   31.393  1.00 41.13  ? 434  SER C N     1 
ATOM   6611  C  CA    . SER C 2  434  ? -8.395  1.516   31.143  1.00 44.12  ? 434  SER C CA    1 
ATOM   6612  C  C     . SER C 2  434  ? -8.595  1.210   29.661  1.00 44.81  ? 434  SER C C     1 
ATOM   6613  O  O     . SER C 2  434  ? -8.564  2.109   28.816  1.00 43.12  ? 434  SER C O     1 
ATOM   6614  C  CB    . SER C 2  434  ? -9.762  1.785   31.784  1.00 41.08  ? 434  SER C CB    1 
ATOM   6615  O  OG    . SER C 2  434  ? -10.627 0.668   31.633  1.00 39.99  ? 434  SER C OG    1 
ATOM   6616  N  N     . GLN C 2  435  ? -8.810  -0.069  29.363  1.00 45.10  ? 435  GLN C N     1 
ATOM   6617  C  CA    . GLN C 2  435  ? -9.025  -0.535  27.995  1.00 47.94  ? 435  GLN C CA    1 
ATOM   6618  C  C     . GLN C 2  435  ? -10.387 -0.116  27.449  1.00 44.10  ? 435  GLN C C     1 
ATOM   6619  O  O     . GLN C 2  435  ? -10.761 -0.492  26.334  1.00 43.69  ? 435  GLN C O     1 
ATOM   6620  C  CB    . GLN C 2  435  ? -8.898  -2.057  27.927  1.00 52.27  ? 435  GLN C CB    1 
ATOM   6621  C  CG    . GLN C 2  435  ? -7.551  -2.586  28.371  1.00 62.73  ? 435  GLN C CG    1 
ATOM   6622  C  CD    . GLN C 2  435  ? -7.481  -4.100  28.331  1.00 78.15  ? 435  GLN C CD    1 
ATOM   6623  O  OE1   . GLN C 2  435  ? -8.499  -4.785  28.440  1.00 70.09  ? 435  GLN C OE1   1 
ATOM   6624  N  NE2   . GLN C 2  435  ? -6.276  -4.631  28.168  1.00 97.03  ? 435  GLN C NE2   1 
ATOM   6625  N  N     . LEU C 2  436  ? -11.122 0.661   28.240  1.00 40.65  ? 436  LEU C N     1 
ATOM   6626  C  CA    . LEU C 2  436  ? -12.471 1.083   27.882  1.00 35.04  ? 436  LEU C CA    1 
ATOM   6627  C  C     . LEU C 2  436  ? -12.574 2.573   27.589  1.00 33.74  ? 436  LEU C C     1 
ATOM   6628  O  O     . LEU C 2  436  ? -13.481 2.995   26.875  1.00 35.17  ? 436  LEU C O     1 
ATOM   6629  C  CB    . LEU C 2  436  ? -13.445 0.707   28.995  1.00 33.78  ? 436  LEU C CB    1 
ATOM   6630  C  CG    . LEU C 2  436  ? -13.692 -0.794  29.090  1.00 32.39  ? 436  LEU C CG    1 
ATOM   6631  C  CD1   . LEU C 2  436  ? -14.518 -1.131  30.311  1.00 33.35  ? 436  LEU C CD1   1 
ATOM   6632  C  CD2   . LEU C 2  436  ? -14.389 -1.248  27.827  1.00 33.92  ? 436  LEU C CD2   1 
ATOM   6633  N  N     . SER C 2  437  ? -11.668 3.375   28.144  1.00 33.66  ? 437  SER C N     1 
ATOM   6634  C  CA    . SER C 2  437  ? -11.656 4.802   27.826  1.00 32.27  ? 437  SER C CA    1 
ATOM   6635  C  C     . SER C 2  437  ? -10.959 5.000   26.493  1.00 32.64  ? 437  SER C C     1 
ATOM   6636  O  O     . SER C 2  437  ? -9.729  5.080   26.421  1.00 35.55  ? 437  SER C O     1 
ATOM   6637  C  CB    . SER C 2  437  ? -10.967 5.622   28.912  1.00 33.98  ? 437  SER C CB    1 
ATOM   6638  O  OG    . SER C 2  437  ? -10.869 6.977   28.508  1.00 29.82  ? 437  SER C OG    1 
ATOM   6639  N  N     . GLN C 2  438  ? -11.762 5.085   25.439  1.00 32.64  ? 438  GLN C N     1 
ATOM   6640  C  CA    . GLN C 2  438  ? -11.253 4.921   24.087  1.00 35.15  ? 438  GLN C CA    1 
ATOM   6641  C  C     . GLN C 2  438  ? -11.224 6.218   23.276  1.00 33.37  ? 438  GLN C C     1 
ATOM   6642  O  O     . GLN C 2  438  ? -12.166 7.015   23.296  1.00 30.87  ? 438  GLN C O     1 
ATOM   6643  C  CB    . GLN C 2  438  ? -12.079 3.852   23.346  1.00 36.68  ? 438  GLN C CB    1 
ATOM   6644  C  CG    . GLN C 2  438  ? -11.966 2.435   23.935  1.00 33.66  ? 438  GLN C CG    1 
ATOM   6645  C  CD    . GLN C 2  438  ? -12.665 1.368   23.091  1.00 28.69  ? 438  GLN C CD    1 
ATOM   6646  O  OE1   . GLN C 2  438  ? -13.264 1.664   22.055  1.00 24.62  ? 438  GLN C OE1   1 
ATOM   6647  N  NE2   . GLN C 2  438  ? -12.590 0.120   23.541  1.00 30.36  ? 438  GLN C NE2   1 
ATOM   6648  N  N     . PHE C 2  439  ? -10.099 6.411   22.591  1.00 34.04  ? 439  PHE C N     1 
ATOM   6649  C  CA    . PHE C 2  439  ? -9.920  7.442   21.579  1.00 34.45  ? 439  PHE C CA    1 
ATOM   6650  C  C     . PHE C 2  439  ? -11.067 7.339   20.583  1.00 33.07  ? 439  PHE C C     1 
ATOM   6651  O  O     . PHE C 2  439  ? -11.165 6.352   19.853  1.00 34.51  ? 439  PHE C O     1 
ATOM   6652  C  CB    . PHE C 2  439  ? -8.569  7.251   20.880  1.00 42.21  ? 439  PHE C CB    1 
ATOM   6653  C  CG    . PHE C 2  439  ? -7.836  8.530   20.571  1.00 49.99  ? 439  PHE C CG    1 
ATOM   6654  C  CD1   . PHE C 2  439  ? -7.527  9.435   21.575  1.00 46.14  ? 439  PHE C CD1   1 
ATOM   6655  C  CD2   . PHE C 2  439  ? -7.410  8.803   19.276  1.00 54.74  ? 439  PHE C CD2   1 
ATOM   6656  C  CE1   . PHE C 2  439  ? -6.836  10.604  21.285  1.00 54.57  ? 439  PHE C CE1   1 
ATOM   6657  C  CE2   . PHE C 2  439  ? -6.716  9.969   18.980  1.00 54.89  ? 439  PHE C CE2   1 
ATOM   6658  C  CZ    . PHE C 2  439  ? -6.430  10.869  19.984  1.00 54.15  ? 439  PHE C CZ    1 
ATOM   6659  N  N     . MET C 2  440  ? -11.934 8.347   20.561  1.00 32.82  ? 440  MET C N     1 
ATOM   6660  C  CA    . MET C 2  440  ? -13.171 8.292   19.774  1.00 33.29  ? 440  MET C CA    1 
ATOM   6661  C  C     . MET C 2  440  ? -12.960 8.155   18.263  1.00 31.64  ? 440  MET C C     1 
ATOM   6662  O  O     . MET C 2  440  ? -12.347 9.016   17.623  1.00 30.15  ? 440  MET C O     1 
ATOM   6663  C  CB    . MET C 2  440  ? -14.024 9.533   20.044  1.00 33.09  ? 440  MET C CB    1 
ATOM   6664  C  CG    . MET C 2  440  ? -15.284 9.599   19.193  1.00 28.77  ? 440  MET C CG    1 
ATOM   6665  S  SD    . MET C 2  440  ? -16.353 10.984  19.619  1.00 27.07  ? 440  MET C SD    1 
ATOM   6666  C  CE    . MET C 2  440  ? -17.489 10.974  18.230  1.00 29.74  ? 440  MET C CE    1 
ATOM   6667  N  N     . ASP C 2  441  ? -13.484 7.063   17.710  1.00 29.92  ? 441  ASP C N     1 
ATOM   6668  C  CA    . ASP C 2  441  ? -13.481 6.823   16.273  1.00 29.93  ? 441  ASP C CA    1 
ATOM   6669  C  C     . ASP C 2  441  ? -14.129 8.012   15.582  1.00 27.80  ? 441  ASP C C     1 
ATOM   6670  O  O     . ASP C 2  441  ? -15.340 8.196   15.670  1.00 29.85  ? 441  ASP C O     1 
ATOM   6671  C  CB    . ASP C 2  441  ? -14.237 5.530   15.949  1.00 31.07  ? 441  ASP C CB    1 
ATOM   6672  C  CG    . ASP C 2  441  ? -13.616 4.746   14.805  1.00 33.38  ? 441  ASP C CG    1 
ATOM   6673  O  OD1   . ASP C 2  441  ? -13.864 3.520   14.741  1.00 31.25  ? 441  ASP C OD1   1 
ATOM   6674  O  OD2   . ASP C 2  441  ? -12.892 5.346   13.978  1.00 35.37  ? 441  ASP C OD2   1 
ATOM   6675  N  N     . GLN C 2  442  ? -13.328 8.833   14.915  1.00 27.05  ? 442  GLN C N     1 
ATOM   6676  C  CA    . GLN C 2  442  ? -13.855 10.074  14.358  1.00 30.01  ? 442  GLN C CA    1 
ATOM   6677  C  C     . GLN C 2  442  ? -13.656 10.211  12.854  1.00 26.60  ? 442  GLN C C     1 
ATOM   6678  O  O     . GLN C 2  442  ? -13.490 11.322  12.348  1.00 28.20  ? 442  GLN C O     1 
ATOM   6679  C  CB    . GLN C 2  442  ? -13.221 11.280  15.062  1.00 34.11  ? 442  GLN C CB    1 
ATOM   6680  C  CG    . GLN C 2  442  ? -14.018 11.790  16.256  1.00 36.71  ? 442  GLN C CG    1 
ATOM   6681  C  CD    . GLN C 2  442  ? -13.528 13.135  16.764  1.00 37.54  ? 442  GLN C CD    1 
ATOM   6682  O  OE1   . GLN C 2  442  ? -12.466 13.615  16.366  1.00 32.30  ? 442  GLN C OE1   1 
ATOM   6683  N  NE2   . GLN C 2  442  ? -14.308 13.754  17.645  1.00 44.13  ? 442  GLN C NE2   1 
ATOM   6684  N  N     . ASN C 2  443  ? -13.679 9.095   12.137  1.00 23.31  ? 443  ASN C N     1 
ATOM   6685  C  CA    . ASN C 2  443  ? -13.521 9.158   10.693  1.00 23.06  ? 443  ASN C CA    1 
ATOM   6686  C  C     . ASN C 2  443  ? -14.691 9.918   10.069  1.00 24.86  ? 443  ASN C C     1 
ATOM   6687  O  O     . ASN C 2  443  ? -14.487 10.824  9.260   1.00 25.90  ? 443  ASN C O     1 
ATOM   6688  C  CB    . ASN C 2  443  ? -13.391 7.754   10.101  1.00 24.35  ? 443  ASN C CB    1 
ATOM   6689  C  CG    . ASN C 2  443  ? -12.047 7.107   10.419  1.00 24.77  ? 443  ASN C CG    1 
ATOM   6690  O  OD1   . ASN C 2  443  ? -11.072 7.277   9.684   1.00 20.62  ? 443  ASN C OD1   1 
ATOM   6691  N  ND2   . ASN C 2  443  ? -11.993 6.364   11.520  1.00 25.95  ? 443  ASN C ND2   1 
ATOM   6692  N  N     . ASN C 2  444  ? -15.907 9.559   10.482  1.00 24.85  ? 444  ASN C N     1 
ATOM   6693  C  CA    . ASN C 2  444  ? -17.138 10.218  10.043  1.00 23.46  ? 444  ASN C CA    1 
ATOM   6694  C  C     . ASN C 2  444  ? -18.150 10.241  11.199  1.00 23.16  ? 444  ASN C C     1 
ATOM   6695  O  O     . ASN C 2  444  ? -17.925 9.589   12.214  1.00 23.24  ? 444  ASN C O     1 
ATOM   6696  C  CB    . ASN C 2  444  ? -17.704 9.506   8.812   1.00 21.60  ? 444  ASN C CB    1 
ATOM   6697  C  CG    . ASN C 2  444  ? -17.903 8.027   9.039   1.00 23.02  ? 444  ASN C CG    1 
ATOM   6698  O  OD1   . ASN C 2  444  ? -18.491 7.622   10.036  1.00 23.37  ? 444  ASN C OD1   1 
ATOM   6699  N  ND2   . ASN C 2  444  ? -17.399 7.209   8.120   1.00 24.04  ? 444  ASN C ND2   1 
ATOM   6700  N  N     . PRO C 2  445  ? -19.246 11.014  11.066  1.00 23.41  ? 445  PRO C N     1 
ATOM   6701  C  CA    . PRO C 2  445  ? -20.265 11.071  12.126  1.00 25.08  ? 445  PRO C CA    1 
ATOM   6702  C  C     . PRO C 2  445  ? -20.810 9.708   12.547  1.00 24.30  ? 445  PRO C C     1 
ATOM   6703  O  O     . PRO C 2  445  ? -21.074 9.492   13.733  1.00 25.44  ? 445  PRO C O     1 
ATOM   6704  C  CB    . PRO C 2  445  ? -21.369 11.917  11.491  1.00 27.26  ? 445  PRO C CB    1 
ATOM   6705  C  CG    . PRO C 2  445  ? -20.631 12.859  10.626  1.00 28.52  ? 445  PRO C CG    1 
ATOM   6706  C  CD    . PRO C 2  445  ? -19.459 12.078  10.066  1.00 26.84  ? 445  PRO C CD    1 
ATOM   6707  N  N     . LEU C 2  446  ? -20.984 8.808   11.584  1.00 23.81  ? 446  LEU C N     1 
ATOM   6708  C  CA    . LEU C 2  446  ? -21.429 7.448   11.875  1.00 24.66  ? 446  LEU C CA    1 
ATOM   6709  C  C     . LEU C 2  446  ? -20.374 6.673   12.653  1.00 25.20  ? 446  LEU C C     1 
ATOM   6710  O  O     . LEU C 2  446  ? -20.697 5.912   13.570  1.00 24.06  ? 446  LEU C O     1 
ATOM   6711  C  CB    . LEU C 2  446  ? -21.760 6.703   10.584  1.00 24.01  ? 446  LEU C CB    1 
ATOM   6712  C  CG    . LEU C 2  446  ? -21.823 5.180   10.715  1.00 22.76  ? 446  LEU C CG    1 
ATOM   6713  C  CD1   . LEU C 2  446  ? -22.955 4.773   11.638  1.00 22.39  ? 446  LEU C CD1   1 
ATOM   6714  C  CD2   . LEU C 2  446  ? -21.974 4.527   9.355   1.00 25.41  ? 446  LEU C CD2   1 
ATOM   6715  N  N     . SER C 2  447  ? -19.117 6.858   12.262  1.00 25.11  ? 447  SER C N     1 
ATOM   6716  C  CA    . SER C 2  447  ? -17.996 6.217   12.935  1.00 25.36  ? 447  SER C CA    1 
ATOM   6717  C  C     . SER C 2  447  ? -18.066 6.493   14.430  1.00 24.44  ? 447  SER C C     1 
ATOM   6718  O  O     . SER C 2  447  ? -18.007 5.572   15.244  1.00 24.87  ? 447  SER C O     1 
ATOM   6719  C  CB    . SER C 2  447  ? -16.670 6.710   12.346  1.00 27.01  ? 447  SER C CB    1 
ATOM   6720  O  OG    . SER C 2  447  ? -15.610 6.596   13.275  1.00 28.90  ? 447  SER C OG    1 
ATOM   6721  N  N     . GLY C 2  448  ? -18.228 7.765   14.778  1.00 25.70  ? 448  GLY C N     1 
ATOM   6722  C  CA    . GLY C 2  448  ? -18.403 8.166   16.160  1.00 25.67  ? 448  GLY C CA    1 
ATOM   6723  C  C     . GLY C 2  448  ? -19.641 7.568   16.802  1.00 26.42  ? 448  GLY C C     1 
ATOM   6724  O  O     . GLY C 2  448  ? -19.565 7.016   17.896  1.00 28.12  ? 448  GLY C O     1 
ATOM   6725  N  N     . LEU C 2  449  ? -20.780 7.678   16.123  1.00 25.67  ? 449  LEU C N     1 
ATOM   6726  C  CA    . LEU C 2  449  ? -22.050 7.184   16.657  1.00 25.64  ? 449  LEU C CA    1 
ATOM   6727  C  C     . LEU C 2  449  ? -21.982 5.701   17.048  1.00 24.64  ? 449  LEU C C     1 
ATOM   6728  O  O     . LEU C 2  449  ? -22.339 5.331   18.170  1.00 22.90  ? 449  LEU C O     1 
ATOM   6729  C  CB    . LEU C 2  449  ? -23.174 7.410   15.641  1.00 24.47  ? 449  LEU C CB    1 
ATOM   6730  C  CG    . LEU C 2  449  ? -24.568 6.894   16.013  1.00 22.57  ? 449  LEU C CG    1 
ATOM   6731  C  CD1   . LEU C 2  449  ? -25.110 7.643   17.219  1.00 25.74  ? 449  LEU C CD1   1 
ATOM   6732  C  CD2   . LEU C 2  449  ? -25.536 6.988   14.834  1.00 22.33  ? 449  LEU C CD2   1 
ATOM   6733  N  N     . THR C 2  450  ? -21.513 4.863   16.126  1.00 24.43  ? 450  THR C N     1 
ATOM   6734  C  CA    . THR C 2  450  ? -21.416 3.428   16.375  1.00 23.97  ? 450  THR C CA    1 
ATOM   6735  C  C     . THR C 2  450  ? -20.437 3.129   17.497  1.00 24.93  ? 450  THR C C     1 
ATOM   6736  O  O     . THR C 2  450  ? -20.606 2.153   18.230  1.00 25.89  ? 450  THR C O     1 
ATOM   6737  C  CB    . THR C 2  450  ? -20.958 2.647   15.131  1.00 23.58  ? 450  THR C CB    1 
ATOM   6738  O  OG1   . THR C 2  450  ? -21.466 3.265   13.945  1.00 22.55  ? 450  THR C OG1   1 
ATOM   6739  C  CG2   . THR C 2  450  ? -21.434 1.203   15.207  1.00 24.15  ? 450  THR C CG2   1 
ATOM   6740  N  N     . HIS C 2  451  ? -19.404 3.962   17.605  1.00 23.94  ? 451  HIS C N     1 
ATOM   6741  C  CA    . HIS C 2  451  ? -18.382 3.795   18.630  1.00 25.56  ? 451  HIS C CA    1 
ATOM   6742  C  C     . HIS C 2  451  ? -19.031 3.810   20.006  1.00 25.92  ? 451  HIS C C     1 
ATOM   6743  O  O     . HIS C 2  451  ? -18.709 2.980   20.850  1.00 26.75  ? 451  HIS C O     1 
ATOM   6744  C  CB    . HIS C 2  451  ? -17.309 4.893   18.530  1.00 27.83  ? 451  HIS C CB    1 
ATOM   6745  C  CG    . HIS C 2  451  ? -16.104 4.657   19.395  1.00 27.53  ? 451  HIS C CG    1 
ATOM   6746  N  ND1   . HIS C 2  451  ? -16.187 4.422   20.752  1.00 27.02  ? 451  HIS C ND1   1 
ATOM   6747  C  CD2   . HIS C 2  451  ? -14.783 4.642   19.096  1.00 27.99  ? 451  HIS C CD2   1 
ATOM   6748  C  CE1   . HIS C 2  451  ? -14.974 4.259   21.246  1.00 29.45  ? 451  HIS C CE1   1 
ATOM   6749  N  NE2   . HIS C 2  451  ? -14.102 4.389   20.262  1.00 30.55  ? 451  HIS C NE2   1 
ATOM   6750  N  N     . LYS C 2  452  ? -19.957 4.741   20.216  1.00 21.04  ? 452  LYS C N     1 
ATOM   6751  C  CA    . LYS C 2  452  ? -20.607 4.910   21.512  1.00 23.38  ? 452  LYS C CA    1 
ATOM   6752  C  C     . LYS C 2  452  ? -21.478 3.712   21.890  1.00 26.14  ? 452  LYS C C     1 
ATOM   6753  O  O     . LYS C 2  452  ? -21.651 3.395   23.071  1.00 22.04  ? 452  LYS C O     1 
ATOM   6754  C  CB    . LYS C 2  452  ? -21.446 6.187   21.508  1.00 26.26  ? 452  LYS C CB    1 
ATOM   6755  C  CG    . LYS C 2  452  ? -20.633 7.472   21.513  1.00 27.66  ? 452  LYS C CG    1 
ATOM   6756  C  CD    . LYS C 2  452  ? -21.141 8.470   20.476  1.00 25.99  ? 452  LYS C CD    1 
ATOM   6757  C  CE    . LYS C 2  452  ? -20.388 9.802   20.535  1.00 26.60  ? 452  LYS C CE    1 
ATOM   6758  N  NZ    . LYS C 2  452  ? -20.794 10.741  19.443  1.00 26.27  ? 452  LYS C NZ    1 
ATOM   6759  N  N     . ARG C 2  453  ? -22.015 3.046   20.875  1.00 25.85  ? 453  ARG C N     1 
ATOM   6760  C  CA    . ARG C 2  453  ? -22.952 1.948   21.075  1.00 24.68  ? 453  ARG C CA    1 
ATOM   6761  C  C     . ARG C 2  453  ? -22.247 0.604   21.019  1.00 24.28  ? 453  ARG C C     1 
ATOM   6762  O  O     . ARG C 2  453  ? -22.893 -0.433  20.899  1.00 26.19  ? 453  ARG C O     1 
ATOM   6763  C  CB    . ARG C 2  453  ? -24.066 2.009   20.022  1.00 25.41  ? 453  ARG C CB    1 
ATOM   6764  C  CG    . ARG C 2  453  ? -24.487 3.437   19.681  1.00 25.23  ? 453  ARG C CG    1 
ATOM   6765  C  CD    . ARG C 2  453  ? -25.621 3.497   18.678  1.00 22.17  ? 453  ARG C CD    1 
ATOM   6766  N  NE    . ARG C 2  453  ? -26.934 3.566   19.317  1.00 22.10  ? 453  ARG C NE    1 
ATOM   6767  C  CZ    . ARG C 2  453  ? -27.770 2.538   19.407  1.00 24.67  ? 453  ARG C CZ    1 
ATOM   6768  N  NH1   . ARG C 2  453  ? -27.425 1.361   18.898  1.00 25.99  ? 453  ARG C NH1   1 
ATOM   6769  N  NH2   . ARG C 2  453  ? -28.948 2.687   19.997  1.00 25.13  ? 453  ARG C NH2   1 
ATOM   6770  N  N     . ARG C 2  454  ? -20.921 0.626   21.103  1.00 23.80  ? 454  ARG C N     1 
ATOM   6771  C  CA    . ARG C 2  454  ? -20.146 -0.610  21.084  1.00 24.82  ? 454  ARG C CA    1 
ATOM   6772  C  C     . ARG C 2  454  ? -20.387 -1.385  22.374  1.00 27.28  ? 454  ARG C C     1 
ATOM   6773  O  O     . ARG C 2  454  ? -20.506 -0.796  23.452  1.00 27.35  ? 454  ARG C O     1 
ATOM   6774  C  CB    . ARG C 2  454  ? -18.650 -0.321  20.899  1.00 25.10  ? 454  ARG C CB    1 
ATOM   6775  C  CG    . ARG C 2  454  ? -18.035 -0.929  19.634  1.00 25.25  ? 454  ARG C CG    1 
ATOM   6776  C  CD    . ARG C 2  454  ? -16.560 -0.543  19.475  1.00 28.98  ? 454  ARG C CD    1 
ATOM   6777  N  NE    . ARG C 2  454  ? -16.299 0.161   18.217  1.00 35.88  ? 454  ARG C NE    1 
ATOM   6778  C  CZ    . ARG C 2  454  ? -15.116 0.662   17.862  1.00 42.61  ? 454  ARG C CZ    1 
ATOM   6779  N  NH1   . ARG C 2  454  ? -14.069 0.542   18.671  1.00 45.58  ? 454  ARG C NH1   1 
ATOM   6780  N  NH2   . ARG C 2  454  ? -14.978 1.287   16.696  1.00 39.47  ? 454  ARG C NH2   1 
ATOM   6781  N  N     . LEU C 2  455  ? -20.478 -2.707  22.255  1.00 27.60  ? 455  LEU C N     1 
ATOM   6782  C  CA    . LEU C 2  455  ? -20.670 -3.577  23.410  1.00 27.03  ? 455  LEU C CA    1 
ATOM   6783  C  C     . LEU C 2  455  ? -19.509 -4.573  23.491  1.00 28.80  ? 455  LEU C C     1 
ATOM   6784  O  O     . LEU C 2  455  ? -19.473 -5.559  22.750  1.00 27.99  ? 455  LEU C O     1 
ATOM   6785  C  CB    . LEU C 2  455  ? -22.022 -4.295  23.321  1.00 26.34  ? 455  LEU C CB    1 
ATOM   6786  C  CG    . LEU C 2  455  ? -23.244 -3.369  23.214  1.00 25.29  ? 455  LEU C CG    1 
ATOM   6787  C  CD1   . LEU C 2  455  ? -24.547 -4.139  23.050  1.00 24.76  ? 455  LEU C CD1   1 
ATOM   6788  C  CD2   . LEU C 2  455  ? -23.324 -2.452  24.424  1.00 26.33  ? 455  LEU C CD2   1 
ATOM   6789  N  N     . SER C 2  456  ? -18.564 -4.299  24.395  1.00 30.34  ? 456  SER C N     1 
ATOM   6790  C  CA    . SER C 2  456  ? -17.277 -5.001  24.435  1.00 30.96  ? 456  SER C CA    1 
ATOM   6791  C  C     . SER C 2  456  ? -17.119 -5.874  25.680  1.00 32.06  ? 456  SER C C     1 
ATOM   6792  O  O     . SER C 2  456  ? -17.363 -5.430  26.802  1.00 30.32  ? 456  SER C O     1 
ATOM   6793  C  CB    . SER C 2  456  ? -16.123 -3.988  24.355  1.00 28.85  ? 456  SER C CB    1 
ATOM   6794  O  OG    . SER C 2  456  ? -14.882 -4.619  24.096  1.00 29.64  ? 456  SER C OG    1 
ATOM   6795  N  N     . ALA C 2  457  ? -16.703 -7.120  25.468  1.00 33.13  ? 457  ALA C N     1 
ATOM   6796  C  CA    . ALA C 2  457  ? -16.532 -8.079  26.553  1.00 34.08  ? 457  ALA C CA    1 
ATOM   6797  C  C     . ALA C 2  457  ? -15.157 -7.924  27.185  1.00 34.41  ? 457  ALA C C     1 
ATOM   6798  O  O     . ALA C 2  457  ? -14.922 -8.334  28.324  1.00 39.93  ? 457  ALA C O     1 
ATOM   6799  C  CB    . ALA C 2  457  ? -16.726 -9.498  26.041  1.00 37.52  ? 457  ALA C CB    1 
ATOM   6800  N  N     . LEU C 2  458  ? -14.258 -7.313  26.426  1.00 31.94  ? 458  LEU C N     1 
ATOM   6801  C  CA    . LEU C 2  458  ? -12.874 -7.130  26.835  1.00 35.69  ? 458  LEU C CA    1 
ATOM   6802  C  C     . LEU C 2  458  ? -12.741 -6.176  28.019  1.00 38.35  ? 458  LEU C C     1 
ATOM   6803  O  O     . LEU C 2  458  ? -13.647 -5.398  28.299  1.00 39.31  ? 458  LEU C O     1 
ATOM   6804  C  CB    . LEU C 2  458  ? -12.056 -6.611  25.653  1.00 38.76  ? 458  LEU C CB    1 
ATOM   6805  C  CG    . LEU C 2  458  ? -12.301 -7.335  24.326  1.00 39.75  ? 458  LEU C CG    1 
ATOM   6806  C  CD1   . LEU C 2  458  ? -11.443 -6.756  23.215  1.00 43.24  ? 458  LEU C CD1   1 
ATOM   6807  C  CD2   . LEU C 2  458  ? -12.024 -8.811  24.492  1.00 47.40  ? 458  LEU C CD2   1 
ATOM   6808  N  N     . GLY C 2  459  ? -11.607 -6.244  28.712  1.00 44.52  ? 459  GLY C N     1 
ATOM   6809  C  CA    . GLY C 2  459  ? -11.308 -5.318  29.791  1.00 48.89  ? 459  GLY C CA    1 
ATOM   6810  C  C     . GLY C 2  459  ? -11.307 -5.896  31.197  1.00 52.38  ? 459  GLY C C     1 
ATOM   6811  O  O     . GLY C 2  459  ? -11.617 -7.072  31.396  1.00 51.61  ? 459  GLY C O     1 
ATOM   6812  N  N     . PRO C 2  460  ? -10.945 -5.060  32.188  1.00 56.30  ? 460  PRO C N     1 
ATOM   6813  C  CA    . PRO C 2  460  ? -10.950 -5.397  33.619  1.00 57.37  ? 460  PRO C CA    1 
ATOM   6814  C  C     . PRO C 2  460  ? -12.334 -5.778  34.129  1.00 52.51  ? 460  PRO C C     1 
ATOM   6815  O  O     . PRO C 2  460  ? -13.263 -4.976  34.033  1.00 50.65  ? 460  PRO C O     1 
ATOM   6816  C  CB    . PRO C 2  460  ? -10.478 -4.101  34.290  1.00 58.06  ? 460  PRO C CB    1 
ATOM   6817  C  CG    . PRO C 2  460  ? -9.721  -3.373  33.239  1.00 55.76  ? 460  PRO C CG    1 
ATOM   6818  C  CD    . PRO C 2  460  ? -10.403 -3.709  31.943  1.00 57.07  ? 460  PRO C CD    1 
ATOM   6819  N  N     . GLY C 2  461  ? -12.461 -6.979  34.683  1.00 50.88  ? 461  GLY C N     1 
ATOM   6820  C  CA    . GLY C 2  461  ? -13.750 -7.471  35.132  1.00 52.53  ? 461  GLY C CA    1 
ATOM   6821  C  C     . GLY C 2  461  ? -14.408 -8.272  34.029  1.00 51.05  ? 461  GLY C C     1 
ATOM   6822  O  O     . GLY C 2  461  ? -15.389 -8.982  34.256  1.00 53.08  ? 461  GLY C O     1 
ATOM   6823  N  N     . GLY C 2  462  ? -13.855 -8.143  32.826  1.00 51.46  ? 462  GLY C N     1 
ATOM   6824  C  CA    . GLY C 2  462  ? -14.282 -8.922  31.679  1.00 56.53  ? 462  GLY C CA    1 
ATOM   6825  C  C     . GLY C 2  462  ? -13.347 -10.092 31.426  1.00 66.06  ? 462  GLY C C     1 
ATOM   6826  O  O     . GLY C 2  462  ? -12.788 -10.661 32.364  1.00 75.83  ? 462  GLY C O     1 
ATOM   6827  N  N     . LEU C 2  463  ? -13.173 -10.447 30.155  1.00 61.43  ? 463  LEU C N     1 
ATOM   6828  C  CA    . LEU C 2  463  ? -12.345 -11.589 29.778  1.00 65.85  ? 463  LEU C CA    1 
ATOM   6829  C  C     . LEU C 2  463  ? -11.172 -11.174 28.893  1.00 68.53  ? 463  LEU C C     1 
ATOM   6830  O  O     . LEU C 2  463  ? -11.217 -10.130 28.246  1.00 63.52  ? 463  LEU C O     1 
ATOM   6831  C  CB    . LEU C 2  463  ? -13.197 -12.647 29.062  1.00 68.38  ? 463  LEU C CB    1 
ATOM   6832  C  CG    . LEU C 2  463  ? -14.177 -12.206 27.965  1.00 61.82  ? 463  LEU C CG    1 
ATOM   6833  C  CD1   . LEU C 2  463  ? -13.489 -11.983 26.627  1.00 60.90  ? 463  LEU C CD1   1 
ATOM   6834  C  CD2   . LEU C 2  463  ? -15.304 -13.217 27.817  1.00 77.55  ? 463  LEU C CD2   1 
ATOM   6835  N  N     . SER C 2  464  ? -10.123 -11.995 28.875  1.00 82.30  ? 464  SER C N     1 
ATOM   6836  C  CA    . SER C 2  464  ? -8.994  -11.806 27.961  1.00 88.83  ? 464  SER C CA    1 
ATOM   6837  C  C     . SER C 2  464  ? -9.361  -12.321 26.571  1.00 85.71  ? 464  SER C C     1 
ATOM   6838  O  O     . SER C 2  464  ? -10.313 -13.085 26.425  1.00 90.66  ? 464  SER C O     1 
ATOM   6839  C  CB    . SER C 2  464  ? -7.743  -12.522 28.486  1.00 88.85  ? 464  SER C CB    1 
ATOM   6840  O  OG    . SER C 2  464  ? -6.713  -12.560 27.513  1.00 83.62  ? 464  SER C OG    1 
ATOM   6841  N  N     . ARG C 2  465  ? -8.617  -11.906 25.550  1.00 75.95  ? 465  ARG C N     1 
ATOM   6842  C  CA    . ARG C 2  465  ? -8.883  -12.386 24.197  1.00 74.45  ? 465  ARG C CA    1 
ATOM   6843  C  C     . ARG C 2  465  ? -8.452  -13.846 24.068  1.00 90.52  ? 465  ARG C C     1 
ATOM   6844  O  O     . ARG C 2  465  ? -9.000  -14.599 23.257  1.00 85.64  ? 465  ARG C O     1 
ATOM   6845  C  CB    . ARG C 2  465  ? -8.170  -11.519 23.157  1.00 65.82  ? 465  ARG C CB    1 
ATOM   6846  C  CG    . ARG C 2  465  ? -8.441  -11.932 21.714  1.00 62.19  ? 465  ARG C CG    1 
ATOM   6847  C  CD    . ARG C 2  465  ? -7.730  -11.026 20.719  1.00 57.35  ? 465  ARG C CD    1 
ATOM   6848  N  NE    . ARG C 2  465  ? -8.105  -9.628  20.904  1.00 57.90  ? 465  ARG C NE    1 
ATOM   6849  C  CZ    . ARG C 2  465  ? -7.245  -8.649  21.169  1.00 66.71  ? 465  ARG C CZ    1 
ATOM   6850  N  NH1   . ARG C 2  465  ? -5.948  -8.907  21.269  1.00 77.01  ? 465  ARG C NH1   1 
ATOM   6851  N  NH2   . ARG C 2  465  ? -7.680  -7.408  21.326  1.00 66.36  ? 465  ARG C NH2   1 
ATOM   6852  N  N     . GLU C 2  466  ? -7.476  -14.242 24.884  1.00 99.38  ? 466  GLU C N     1 
ATOM   6853  C  CA    . GLU C 2  466  ? -6.995  -15.620 24.900  1.00 113.19 ? 466  GLU C CA    1 
ATOM   6854  C  C     . GLU C 2  466  ? -7.882  -16.518 25.762  1.00 119.22 ? 466  GLU C C     1 
ATOM   6855  O  O     . GLU C 2  466  ? -7.885  -17.737 25.592  1.00 133.99 ? 466  GLU C O     1 
ATOM   6856  C  CB    . GLU C 2  466  ? -5.549  -15.687 25.402  1.00 129.54 ? 466  GLU C CB    1 
ATOM   6857  C  CG    . GLU C 2  466  ? -4.528  -15.051 24.465  1.00 139.51 ? 466  GLU C CG    1 
ATOM   6858  C  CD    . GLU C 2  466  ? -3.095  -15.445 24.797  1.00 171.79 ? 466  GLU C CD    1 
ATOM   6859  O  OE1   . GLU C 2  466  ? -2.878  -16.105 25.837  1.00 189.51 ? 466  GLU C OE1   1 
ATOM   6860  O  OE2   . GLU C 2  466  ? -2.187  -15.099 24.010  1.00 158.83 ? 466  GLU C OE2   1 
ATOM   6861  N  N     . ARG C 2  467  ? -8.632  -15.914 26.682  1.00 112.37 ? 467  ARG C N     1 
ATOM   6862  C  CA    . ARG C 2  467  ? -9.521  -16.668 27.567  1.00 114.81 ? 467  ARG C CA    1 
ATOM   6863  C  C     . ARG C 2  467  ? -10.863 -17.000 26.921  1.00 110.33 ? 467  ARG C C     1 
ATOM   6864  O  O     . ARG C 2  467  ? -11.638 -17.789 27.459  1.00 119.12 ? 467  ARG C O     1 
ATOM   6865  C  CB    . ARG C 2  467  ? -9.776  -15.898 28.865  1.00 108.36 ? 467  ARG C CB    1 
ATOM   6866  C  CG    . ARG C 2  467  ? -8.561  -15.743 29.758  1.00 115.87 ? 467  ARG C CG    1 
ATOM   6867  C  CD    . ARG C 2  467  ? -8.972  -15.494 31.201  1.00 135.78 ? 467  ARG C CD    1 
ATOM   6868  N  NE    . ARG C 2  467  ? -8.719  -16.660 32.042  1.00 145.64 ? 467  ARG C NE    1 
ATOM   6869  C  CZ    . ARG C 2  467  ? -7.559  -16.905 32.645  1.00 145.00 ? 467  ARG C CZ    1 
ATOM   6870  N  NH1   . ARG C 2  467  ? -6.546  -16.062 32.499  1.00 145.77 ? 467  ARG C NH1   1 
ATOM   6871  N  NH2   . ARG C 2  467  ? -7.411  -17.991 33.392  1.00 141.87 ? 467  ARG C NH2   1 
ATOM   6872  N  N     . ALA C 2  468  ? -11.135 -16.396 25.770  1.00 100.93 ? 468  ALA C N     1 
ATOM   6873  C  CA    . ALA C 2  468  ? -12.429 -16.555 25.111  1.00 98.69  ? 468  ALA C CA    1 
ATOM   6874  C  C     . ALA C 2  468  ? -12.502 -17.802 24.229  1.00 96.36  ? 468  ALA C C     1 
ATOM   6875  O  O     . ALA C 2  468  ? -11.683 -17.984 23.325  1.00 94.77  ? 468  ALA C O     1 
ATOM   6876  C  CB    . ALA C 2  468  ? -12.747 -15.315 24.288  1.00 91.25  ? 468  ALA C CB    1 
ATOM   6877  N  N     . GLY C 2  469  ? -13.493 -18.652 24.497  1.00 92.47  ? 469  GLY C N     1 
ATOM   6878  C  CA    . GLY C 2  469  ? -13.754 -19.824 23.679  1.00 90.14  ? 469  GLY C CA    1 
ATOM   6879  C  C     . GLY C 2  469  ? -14.674 -19.482 22.520  1.00 86.93  ? 469  GLY C C     1 
ATOM   6880  O  O     . GLY C 2  469  ? -15.045 -18.322 22.348  1.00 82.38  ? 469  GLY C O     1 
ATOM   6881  N  N     . LEU C 2  470  ? -15.056 -20.485 21.732  1.00 90.98  ? 470  LEU C N     1 
ATOM   6882  C  CA    . LEU C 2  470  ? -15.863 -20.251 20.530  1.00 93.93  ? 470  LEU C CA    1 
ATOM   6883  C  C     . LEU C 2  470  ? -17.359 -20.041 20.813  1.00 89.43  ? 470  LEU C C     1 
ATOM   6884  O  O     . LEU C 2  470  ? -18.133 -19.756 19.896  1.00 85.16  ? 470  LEU C O     1 
ATOM   6885  C  CB    . LEU C 2  470  ? -15.693 -21.413 19.539  1.00 92.03  ? 470  LEU C CB    1 
ATOM   6886  C  CG    . LEU C 2  470  ? -14.349 -21.619 18.825  1.00 87.06  ? 470  LEU C CG    1 
ATOM   6887  C  CD1   . LEU C 2  470  ? -14.469 -22.713 17.767  1.00 77.60  ? 470  LEU C CD1   1 
ATOM   6888  C  CD2   . LEU C 2  470  ? -13.822 -20.330 18.204  1.00 79.77  ? 470  LEU C CD2   1 
ATOM   6889  N  N     . GLU C 2  471  ? -17.759 -20.175 22.077  1.00 92.48  ? 471  GLU C N     1 
ATOM   6890  C  CA    . GLU C 2  471  ? -19.164 -20.033 22.469  1.00 87.49  ? 471  GLU C CA    1 
ATOM   6891  C  C     . GLU C 2  471  ? -19.532 -18.572 22.729  1.00 78.52  ? 471  GLU C C     1 
ATOM   6892  O  O     . GLU C 2  471  ? -20.640 -18.127 22.425  1.00 71.32  ? 471  GLU C O     1 
ATOM   6893  C  CB    . GLU C 2  471  ? -19.465 -20.867 23.719  1.00 97.46  ? 471  GLU C CB    1 
ATOM   6894  C  CG    . GLU C 2  471  ? -18.770 -22.220 23.774  1.00 101.76 ? 471  GLU C CG    1 
ATOM   6895  C  CD    . GLU C 2  471  ? -17.472 -22.170 24.557  1.00 109.71 ? 471  GLU C CD    1 
ATOM   6896  O  OE1   . GLU C 2  471  ? -16.867 -21.078 24.634  1.00 109.72 ? 471  GLU C OE1   1 
ATOM   6897  O  OE2   . GLU C 2  471  ? -17.065 -23.217 25.102  1.00 121.56 ? 471  GLU C OE2   1 
ATOM   6898  N  N     . VAL C 2  472  ? -18.591 -17.836 23.306  1.00 79.91  ? 472  VAL C N     1 
ATOM   6899  C  CA    . VAL C 2  472  ? -18.800 -16.434 23.631  1.00 75.16  ? 472  VAL C CA    1 
ATOM   6900  C  C     . VAL C 2  472  ? -19.072 -15.622 22.386  1.00 62.55  ? 472  VAL C C     1 
ATOM   6901  O  O     . VAL C 2  472  ? -19.824 -14.651 22.407  1.00 60.37  ? 472  VAL C O     1 
ATOM   6902  C  CB    . VAL C 2  472  ? -17.571 -15.824 24.320  1.00 83.73  ? 472  VAL C CB    1 
ATOM   6903  C  CG1   . VAL C 2  472  ? -17.966 -14.564 25.088  1.00 82.33  ? 472  VAL C CG1   1 
ATOM   6904  C  CG2   . VAL C 2  472  ? -16.890 -16.851 25.220  1.00 99.12  ? 472  VAL C CG2   1 
ATOM   6905  N  N     . ARG C 2  473  ? -18.445 -16.052 21.298  1.00 66.50  ? 473  ARG C N     1 
ATOM   6906  C  CA    . ARG C 2  473  ? -18.245 -15.209 20.130  1.00 66.74  ? 473  ARG C CA    1 
ATOM   6907  C  C     . ARG C 2  473  ? -19.259 -15.443 19.008  1.00 66.75  ? 473  ARG C C     1 
ATOM   6908  O  O     . ARG C 2  473  ? -19.362 -14.630 18.088  1.00 62.25  ? 473  ARG C O     1 
ATOM   6909  C  CB    . ARG C 2  473  ? -16.817 -15.412 19.598  1.00 64.09  ? 473  ARG C CB    1 
ATOM   6910  C  CG    . ARG C 2  473  ? -15.740 -15.521 20.684  1.00 62.98  ? 473  ARG C CG    1 
ATOM   6911  C  CD    . ARG C 2  473  ? -14.434 -16.083 20.128  1.00 61.48  ? 473  ARG C CD    1 
ATOM   6912  N  NE    . ARG C 2  473  ? -13.565 -15.049 19.574  1.00 56.02  ? 473  ARG C NE    1 
ATOM   6913  C  CZ    . ARG C 2  473  ? -12.380 -14.723 20.080  1.00 56.54  ? 473  ARG C CZ    1 
ATOM   6914  N  NH1   . ARG C 2  473  ? -11.913 -15.357 21.148  1.00 57.85  ? 473  ARG C NH1   1 
ATOM   6915  N  NH2   . ARG C 2  473  ? -11.655 -13.770 19.510  1.00 56.08  ? 473  ARG C NH2   1 
ATOM   6916  N  N     . ASP C 2  474  ? -20.005 -16.541 19.072  1.00 69.66  ? 474  ASP C N     1 
ATOM   6917  C  CA    . ASP C 2  474  ? -21.008 -16.795 18.040  1.00 67.76  ? 474  ASP C CA    1 
ATOM   6918  C  C     . ASP C 2  474  ? -22.351 -16.161 18.414  1.00 61.77  ? 474  ASP C C     1 
ATOM   6919  O  O     . ASP C 2  474  ? -22.587 -15.833 19.575  1.00 59.62  ? 474  ASP C O     1 
ATOM   6920  C  CB    . ASP C 2  474  ? -21.167 -18.302 17.774  1.00 76.73  ? 474  ASP C CB    1 
ATOM   6921  C  CG    . ASP C 2  474  ? -21.405 -19.116 19.043  1.00 86.87  ? 474  ASP C CG    1 
ATOM   6922  O  OD1   . ASP C 2  474  ? -21.832 -18.534 20.063  1.00 84.94  ? 474  ASP C OD1   1 
ATOM   6923  O  OD2   . ASP C 2  474  ? -21.176 -20.349 19.010  1.00 85.40  ? 474  ASP C OD2   1 
ATOM   6924  N  N     . VAL C 2  475  ? -23.206 -15.974 17.411  1.00 55.75  ? 475  VAL C N     1 
ATOM   6925  C  CA    . VAL C 2  475  ? -24.503 -15.333 17.592  1.00 52.28  ? 475  VAL C CA    1 
ATOM   6926  C  C     . VAL C 2  475  ? -25.439 -16.130 18.492  1.00 54.80  ? 475  VAL C C     1 
ATOM   6927  O  O     . VAL C 2  475  ? -25.911 -17.197 18.111  1.00 63.39  ? 475  VAL C O     1 
ATOM   6928  C  CB    . VAL C 2  475  ? -25.220 -15.115 16.240  1.00 49.15  ? 475  VAL C CB    1 
ATOM   6929  C  CG1   . VAL C 2  475  ? -26.549 -14.409 16.447  1.00 43.98  ? 475  VAL C CG1   1 
ATOM   6930  C  CG2   . VAL C 2  475  ? -24.340 -14.325 15.298  1.00 49.25  ? 475  VAL C CG2   1 
ATOM   6931  N  N     . HIS C 2  476  ? -25.713 -15.606 19.682  1.00 52.50  ? 476  HIS C N     1 
ATOM   6932  C  CA    . HIS C 2  476  ? -26.682 -16.224 20.585  1.00 53.95  ? 476  HIS C CA    1 
ATOM   6933  C  C     . HIS C 2  476  ? -28.103 -15.762 20.237  1.00 50.79  ? 476  HIS C C     1 
ATOM   6934  O  O     . HIS C 2  476  ? -28.304 -14.611 19.854  1.00 49.58  ? 476  HIS C O     1 
ATOM   6935  C  CB    . HIS C 2  476  ? -26.335 -15.880 22.034  1.00 54.75  ? 476  HIS C CB    1 
ATOM   6936  C  CG    . HIS C 2  476  ? -27.119 -16.645 23.052  1.00 55.15  ? 476  HIS C CG    1 
ATOM   6937  N  ND1   . HIS C 2  476  ? -28.300 -16.176 23.592  1.00 56.14  ? 476  HIS C ND1   1 
ATOM   6938  C  CD2   . HIS C 2  476  ? -26.889 -17.841 23.643  1.00 58.11  ? 476  HIS C CD2   1 
ATOM   6939  C  CE1   . HIS C 2  476  ? -28.762 -17.051 24.464  1.00 59.60  ? 476  HIS C CE1   1 
ATOM   6940  N  NE2   . HIS C 2  476  ? -27.925 -18.072 24.515  1.00 62.64  ? 476  HIS C NE2   1 
ATOM   6941  N  N     . PRO C 2  477  ? -29.093 -16.660 20.351  1.00 48.52  ? 477  PRO C N     1 
ATOM   6942  C  CA    . PRO C 2  477  ? -30.478 -16.302 20.022  1.00 48.25  ? 477  PRO C CA    1 
ATOM   6943  C  C     . PRO C 2  477  ? -31.019 -15.108 20.816  1.00 49.95  ? 477  PRO C C     1 
ATOM   6944  O  O     . PRO C 2  477  ? -31.780 -14.327 20.246  1.00 51.97  ? 477  PRO C O     1 
ATOM   6945  C  CB    . PRO C 2  477  ? -31.261 -17.582 20.355  1.00 53.91  ? 477  PRO C CB    1 
ATOM   6946  C  CG    . PRO C 2  477  ? -30.343 -18.403 21.204  1.00 56.11  ? 477  PRO C CG    1 
ATOM   6947  C  CD    . PRO C 2  477  ? -28.970 -18.081 20.705  1.00 53.21  ? 477  PRO C CD    1 
ATOM   6948  N  N     . SER C 2  478  ? -30.628 -14.951 22.081  1.00 52.27  ? 478  SER C N     1 
ATOM   6949  C  CA    . SER C 2  478  ? -31.159 -13.862 22.910  1.00 53.98  ? 478  SER C CA    1 
ATOM   6950  C  C     . SER C 2  478  ? -30.667 -12.482 22.457  1.00 51.11  ? 478  SER C C     1 
ATOM   6951  O  O     . SER C 2  478  ? -31.130 -11.458 22.966  1.00 48.85  ? 478  SER C O     1 
ATOM   6952  C  CB    . SER C 2  478  ? -30.809 -14.076 24.392  1.00 52.90  ? 478  SER C CB    1 
ATOM   6953  O  OG    . SER C 2  478  ? -29.452 -13.773 24.664  1.00 52.08  ? 478  SER C OG    1 
ATOM   6954  N  N     . HIS C 2  479  ? -29.739 -12.458 21.500  1.00 49.82  ? 479  HIS C N     1 
ATOM   6955  C  CA    . HIS C 2  479  ? -29.228 -11.203 20.948  1.00 45.06  ? 479  HIS C CA    1 
ATOM   6956  C  C     . HIS C 2  479  ? -30.313 -10.427 20.218  1.00 43.43  ? 479  HIS C C     1 
ATOM   6957  O  O     . HIS C 2  479  ? -30.173 -9.225  19.995  1.00 43.86  ? 479  HIS C O     1 
ATOM   6958  C  CB    . HIS C 2  479  ? -28.065 -11.448 19.973  1.00 44.32  ? 479  HIS C CB    1 
ATOM   6959  C  CG    . HIS C 2  479  ? -26.767 -11.778 20.644  1.00 46.36  ? 479  HIS C CG    1 
ATOM   6960  N  ND1   . HIS C 2  479  ? -26.692 -12.443 21.842  1.00 50.42  ? 479  HIS C ND1   1 
ATOM   6961  C  CD2   . HIS C 2  479  ? -25.487 -11.540 20.260  1.00 46.99  ? 479  HIS C CD2   1 
ATOM   6962  C  CE1   . HIS C 2  479  ? -25.426 -12.601 22.181  1.00 47.34  ? 479  HIS C CE1   1 
ATOM   6963  N  NE2   . HIS C 2  479  ? -24.674 -12.064 21.243  1.00 48.86  ? 479  HIS C NE2   1 
ATOM   6964  N  N     . TYR C 2  480  ? -31.383 -11.124 19.840  1.00 43.63  ? 480  TYR C N     1 
ATOM   6965  C  CA    . TYR C 2  480  ? -32.405 -10.563 18.961  1.00 43.72  ? 480  TYR C CA    1 
ATOM   6966  C  C     . TYR C 2  480  ? -33.001 -9.265  19.497  1.00 45.28  ? 480  TYR C C     1 
ATOM   6967  O  O     . TYR C 2  480  ? -33.489 -9.217  20.627  1.00 47.73  ? 480  TYR C O     1 
ATOM   6968  C  CB    . TYR C 2  480  ? -33.522 -11.581 18.725  1.00 41.10  ? 480  TYR C CB    1 
ATOM   6969  C  CG    . TYR C 2  480  ? -34.480 -11.166 17.632  1.00 39.73  ? 480  TYR C CG    1 
ATOM   6970  C  CD1   . TYR C 2  480  ? -35.712 -10.602 17.937  1.00 43.37  ? 480  TYR C CD1   1 
ATOM   6971  C  CD2   . TYR C 2  480  ? -34.145 -11.325 16.293  1.00 39.01  ? 480  TYR C CD2   1 
ATOM   6972  C  CE1   . TYR C 2  480  ? -36.591 -10.217 16.937  1.00 47.67  ? 480  TYR C CE1   1 
ATOM   6973  C  CE2   . TYR C 2  480  ? -35.016 -10.941 15.287  1.00 43.07  ? 480  TYR C CE2   1 
ATOM   6974  C  CZ    . TYR C 2  480  ? -36.238 -10.388 15.614  1.00 48.71  ? 480  TYR C CZ    1 
ATOM   6975  O  OH    . TYR C 2  480  ? -37.115 -10.004 14.621  1.00 47.39  ? 480  TYR C OH    1 
ATOM   6976  N  N     . GLY C 2  481  ? -32.939 -8.213  18.679  1.00 41.54  ? 481  GLY C N     1 
ATOM   6977  C  CA    . GLY C 2  481  ? -33.494 -6.918  19.036  1.00 38.68  ? 481  GLY C CA    1 
ATOM   6978  C  C     . GLY C 2  481  ? -32.738 -6.219  20.148  1.00 39.68  ? 481  GLY C C     1 
ATOM   6979  O  O     . GLY C 2  481  ? -33.176 -5.174  20.635  1.00 42.14  ? 481  GLY C O     1 
ATOM   6980  N  N     . ARG C 2  482  ? -31.603 -6.800  20.543  1.00 39.29  ? 482  ARG C N     1 
ATOM   6981  C  CA    . ARG C 2  482  ? -30.764 -6.281  21.628  1.00 38.49  ? 482  ARG C CA    1 
ATOM   6982  C  C     . ARG C 2  482  ? -29.333 -5.999  21.162  1.00 35.73  ? 482  ARG C C     1 
ATOM   6983  O  O     . ARG C 2  482  ? -28.831 -4.881  21.297  1.00 33.38  ? 482  ARG C O     1 
ATOM   6984  C  CB    . ARG C 2  482  ? -30.738 -7.267  22.795  1.00 38.83  ? 482  ARG C CB    1 
ATOM   6985  C  CG    . ARG C 2  482  ? -32.082 -7.478  23.444  1.00 41.19  ? 482  ARG C CG    1 
ATOM   6986  C  CD    . ARG C 2  482  ? -32.036 -8.602  24.453  1.00 48.75  ? 482  ARG C CD    1 
ATOM   6987  N  NE    . ARG C 2  482  ? -33.334 -8.794  25.092  1.00 55.85  ? 482  ARG C NE    1 
ATOM   6988  C  CZ    . ARG C 2  482  ? -34.316 -9.530  24.581  1.00 58.72  ? 482  ARG C CZ    1 
ATOM   6989  N  NH1   . ARG C 2  482  ? -34.146 -10.148 23.417  1.00 58.21  ? 482  ARG C NH1   1 
ATOM   6990  N  NH2   . ARG C 2  482  ? -35.469 -9.647  25.230  1.00 57.33  ? 482  ARG C NH2   1 
ATOM   6991  N  N     . MET C 2  483  ? -28.677 -7.024  20.625  1.00 35.96  ? 483  MET C N     1 
ATOM   6992  C  CA    . MET C 2  483  ? -27.319 -6.884  20.103  1.00 32.61  ? 483  MET C CA    1 
ATOM   6993  C  C     . MET C 2  483  ? -27.243 -7.355  18.655  1.00 32.45  ? 483  MET C C     1 
ATOM   6994  O  O     . MET C 2  483  ? -27.786 -8.402  18.299  1.00 33.60  ? 483  MET C O     1 
ATOM   6995  C  CB    . MET C 2  483  ? -26.319 -7.664  20.965  1.00 34.07  ? 483  MET C CB    1 
ATOM   6996  C  CG    . MET C 2  483  ? -24.914 -7.748  20.377  1.00 30.97  ? 483  MET C CG    1 
ATOM   6997  S  SD    . MET C 2  483  ? -23.684 -8.375  21.540  1.00 26.45  ? 483  MET C SD    1 
ATOM   6998  C  CE    . MET C 2  483  ? -22.307 -8.701  20.440  1.00 32.01  ? 483  MET C CE    1 
ATOM   6999  N  N     . CYS C 2  484  ? -26.559 -6.576  17.826  1.00 30.94  ? 484  CYS C N     1 
ATOM   7000  C  CA    . CYS C 2  484  ? -26.465 -6.877  16.407  1.00 30.04  ? 484  CYS C CA    1 
ATOM   7001  C  C     . CYS C 2  484  ? -25.637 -8.132  16.150  1.00 28.03  ? 484  CYS C C     1 
ATOM   7002  O  O     . CYS C 2  484  ? -24.537 -8.283  16.680  1.00 27.50  ? 484  CYS C O     1 
ATOM   7003  C  CB    . CYS C 2  484  ? -25.869 -5.690  15.648  1.00 28.40  ? 484  CYS C CB    1 
ATOM   7004  S  SG    . CYS C 2  484  ? -26.357 -5.615  13.902  1.00 29.31  ? 484  CYS C SG    1 
ATOM   7005  N  N     . PRO C 2  485  ? -26.184 -9.044  15.340  1.00 26.87  ? 485  PRO C N     1 
ATOM   7006  C  CA    . PRO C 2  485  ? -25.509 -10.265 14.914  1.00 26.37  ? 485  PRO C CA    1 
ATOM   7007  C  C     . PRO C 2  485  ? -24.669 -10.037 13.670  1.00 28.17  ? 485  PRO C C     1 
ATOM   7008  O  O     . PRO C 2  485  ? -23.914 -10.926 13.288  1.00 31.90  ? 485  PRO C O     1 
ATOM   7009  C  CB    . PRO C 2  485  ? -26.666 -11.195 14.602  1.00 31.61  ? 485  PRO C CB    1 
ATOM   7010  C  CG    . PRO C 2  485  ? -27.667 -10.269 14.014  1.00 30.92  ? 485  PRO C CG    1 
ATOM   7011  C  CD    . PRO C 2  485  ? -27.561 -8.993  14.822  1.00 28.72  ? 485  PRO C CD    1 
ATOM   7012  N  N     . ILE C 2  486  ? -24.813 -8.876  13.038  1.00 27.33  ? 486  ILE C N     1 
ATOM   7013  C  CA    . ILE C 2  486  ? -24.011 -8.539  11.861  1.00 30.13  ? 486  ILE C CA    1 
ATOM   7014  C  C     . ILE C 2  486  ? -22.781 -7.697  12.215  1.00 29.56  ? 486  ILE C C     1 
ATOM   7015  O  O     . ILE C 2  486  ? -21.683 -7.944  11.713  1.00 30.15  ? 486  ILE C O     1 
ATOM   7016  C  CB    . ILE C 2  486  ? -24.839 -7.774  10.808  1.00 27.12  ? 486  ILE C CB    1 
ATOM   7017  C  CG1   . ILE C 2  486  ? -26.034 -8.611  10.360  1.00 26.56  ? 486  ILE C CG1   1 
ATOM   7018  C  CG2   . ILE C 2  486  ? -23.972 -7.420  9.606   1.00 26.96  ? 486  ILE C CG2   1 
ATOM   7019  C  CD1   . ILE C 2  486  ? -25.641 -9.890  9.665   1.00 31.36  ? 486  ILE C CD1   1 
ATOM   7020  N  N     . GLU C 2  487  ? -22.969 -6.704  13.081  1.00 27.95  ? 487  GLU C N     1 
ATOM   7021  C  CA    . GLU C 2  487  ? -21.900 -5.761  13.393  1.00 26.77  ? 487  GLU C CA    1 
ATOM   7022  C  C     . GLU C 2  487  ? -20.943 -6.344  14.425  1.00 26.05  ? 487  GLU C C     1 
ATOM   7023  O  O     . GLU C 2  487  ? -21.295 -6.525  15.591  1.00 24.26  ? 487  GLU C O     1 
ATOM   7024  C  CB    . GLU C 2  487  ? -22.476 -4.423  13.878  1.00 27.58  ? 487  GLU C CB    1 
ATOM   7025  C  CG    . GLU C 2  487  ? -21.443 -3.294  13.963  1.00 27.78  ? 487  GLU C CG    1 
ATOM   7026  C  CD    . GLU C 2  487  ? -21.988 -1.934  13.531  1.00 27.54  ? 487  GLU C CD    1 
ATOM   7027  O  OE1   . GLU C 2  487  ? -23.197 -1.673  13.720  1.00 27.81  ? 487  GLU C OE1   1 
ATOM   7028  O  OE2   . GLU C 2  487  ? -21.199 -1.123  12.999  1.00 27.01  ? 487  GLU C OE2   1 
ATOM   7029  N  N     . THR C 2  488  ? -19.732 -6.640  13.960  1.00 28.89  ? 488  THR C N     1 
ATOM   7030  C  CA    . THR C 2  488  ? -18.663 -7.207  14.773  1.00 30.78  ? 488  THR C CA    1 
ATOM   7031  C  C     . THR C 2  488  ? -17.370 -7.222  13.954  1.00 33.78  ? 488  THR C C     1 
ATOM   7032  O  O     . THR C 2  488  ? -17.419 -7.358  12.730  1.00 34.68  ? 488  THR C O     1 
ATOM   7033  C  CB    . THR C 2  488  ? -18.994 -8.636  15.243  1.00 33.30  ? 488  THR C CB    1 
ATOM   7034  O  OG1   . THR C 2  488  ? -17.892 -9.164  15.990  1.00 38.45  ? 488  THR C OG1   1 
ATOM   7035  C  CG2   . THR C 2  488  ? -19.266 -9.541  14.056  1.00 33.66  ? 488  THR C CG2   1 
ATOM   7036  N  N     . PRO C 2  489  ? -16.209 -7.066  14.620  1.00 37.50  ? 489  PRO C N     1 
ATOM   7037  C  CA    . PRO C 2  489  ? -14.920 -7.060  13.911  1.00 40.28  ? 489  PRO C CA    1 
ATOM   7038  C  C     . PRO C 2  489  ? -14.623 -8.309  13.086  1.00 36.05  ? 489  PRO C C     1 
ATOM   7039  O  O     . PRO C 2  489  ? -15.132 -9.399  13.344  1.00 32.57  ? 489  PRO C O     1 
ATOM   7040  C  CB    . PRO C 2  489  ? -13.888 -6.924  15.046  1.00 43.75  ? 489  PRO C CB    1 
ATOM   7041  C  CG    . PRO C 2  489  ? -14.645 -7.166  16.320  1.00 40.68  ? 489  PRO C CG    1 
ATOM   7042  C  CD    . PRO C 2  489  ? -16.043 -6.717  16.040  1.00 36.37  ? 489  PRO C CD    1 
ATOM   7043  N  N     . GLU C 2  490  ? -13.780 -8.118  12.082  1.00 35.53  ? 490  GLU C N     1 
ATOM   7044  C  CA    . GLU C 2  490  ? -13.312 -9.202  11.244  1.00 36.34  ? 490  GLU C CA    1 
ATOM   7045  C  C     . GLU C 2  490  ? -12.155 -9.955  11.890  1.00 43.28  ? 490  GLU C C     1 
ATOM   7046  O  O     . GLU C 2  490  ? -12.036 -11.168 11.733  1.00 45.52  ? 490  GLU C O     1 
ATOM   7047  C  CB    . GLU C 2  490  ? -12.870 -8.660  9.890   1.00 37.01  ? 490  GLU C CB    1 
ATOM   7048  C  CG    . GLU C 2  490  ? -13.810 -8.957  8.754   1.00 40.35  ? 490  GLU C CG    1 
ATOM   7049  C  CD    . GLU C 2  490  ? -13.116 -8.837  7.417   1.00 41.87  ? 490  GLU C CD    1 
ATOM   7050  O  OE1   . GLU C 2  490  ? -12.937 -9.875  6.746   1.00 42.52  ? 490  GLU C OE1   1 
ATOM   7051  O  OE2   . GLU C 2  490  ? -12.735 -7.707  7.043   1.00 40.20  ? 490  GLU C OE2   1 
ATOM   7052  N  N     . GLY C 2  491  ? -11.307 -9.227  12.614  1.00 48.72  ? 491  GLY C N     1 
ATOM   7053  C  CA    . GLY C 2  491  ? -10.041 -9.762  13.093  1.00 48.77  ? 491  GLY C CA    1 
ATOM   7054  C  C     . GLY C 2  491  ? -10.107 -10.765 14.230  1.00 46.95  ? 491  GLY C C     1 
ATOM   7055  O  O     . GLY C 2  491  ? -11.078 -11.509 14.363  1.00 44.45  ? 491  GLY C O     1 
ATOM   7056  N  N     . PRO C 2  492  ? -9.054  -10.796 15.062  1.00 53.38  ? 492  PRO C N     1 
ATOM   7057  C  CA    . PRO C 2  492  ? -8.995  -11.699 16.218  1.00 56.14  ? 492  PRO C CA    1 
ATOM   7058  C  C     . PRO C 2  492  ? -9.951  -11.272 17.327  1.00 53.05  ? 492  PRO C C     1 
ATOM   7059  O  O     . PRO C 2  492  ? -10.138 -12.001 18.300  1.00 52.80  ? 492  PRO C O     1 
ATOM   7060  C  CB    . PRO C 2  492  ? -7.536  -11.584 16.678  1.00 63.14  ? 492  PRO C CB    1 
ATOM   7061  C  CG    . PRO C 2  492  ? -7.122  -10.217 16.251  1.00 60.14  ? 492  PRO C CG    1 
ATOM   7062  C  CD    . PRO C 2  492  ? -7.842  -9.965  14.947  1.00 59.84  ? 492  PRO C CD    1 
ATOM   7063  N  N     . ASN C 2  493  ? -10.548 -10.096 17.171  1.00 48.35  ? 493  ASN C N     1 
ATOM   7064  C  CA    . ASN C 2  493  ? -11.472 -9.579  18.164  1.00 45.02  ? 493  ASN C CA    1 
ATOM   7065  C  C     . ASN C 2  493  ? -12.916 -9.922  17.850  1.00 45.06  ? 493  ASN C C     1 
ATOM   7066  O  O     . ASN C 2  493  ? -13.835 -9.418  18.495  1.00 45.30  ? 493  ASN C O     1 
ATOM   7067  C  CB    . ASN C 2  493  ? -11.321 -8.070  18.291  1.00 42.76  ? 493  ASN C CB    1 
ATOM   7068  C  CG    . ASN C 2  493  ? -10.785 -7.665  19.637  1.00 45.32  ? 493  ASN C CG    1 
ATOM   7069  O  OD1   . ASN C 2  493  ? -10.408 -8.514  20.443  1.00 46.74  ? 493  ASN C OD1   1 
ATOM   7070  N  ND2   . ASN C 2  493  ? -10.743 -6.363  19.893  1.00 49.38  ? 493  ASN C ND2   1 
ATOM   7071  N  N     . ILE C 2  494  ? -13.114 -10.787 16.863  1.00 44.91  ? 494  ILE C N     1 
ATOM   7072  C  CA    . ILE C 2  494  ? -14.455 -11.095 16.397  1.00 39.87  ? 494  ILE C CA    1 
ATOM   7073  C  C     . ILE C 2  494  ? -15.262 -11.795 17.495  1.00 36.07  ? 494  ILE C C     1 
ATOM   7074  O  O     . ILE C 2  494  ? -14.737 -12.603 18.259  1.00 38.60  ? 494  ILE C O     1 
ATOM   7075  C  CB    . ILE C 2  494  ? -14.409 -11.949 15.104  1.00 39.13  ? 494  ILE C CB    1 
ATOM   7076  C  CG1   . ILE C 2  494  ? -15.818 -12.215 14.566  1.00 34.62  ? 494  ILE C CG1   1 
ATOM   7077  C  CG2   . ILE C 2  494  ? -13.618 -13.235 15.326  1.00 43.88  ? 494  ILE C CG2   1 
ATOM   7078  C  CD1   . ILE C 2  494  ? -15.840 -12.999 13.270  1.00 36.66  ? 494  ILE C CD1   1 
ATOM   7079  N  N     . GLY C 2  495  ? -16.534 -11.429 17.594  1.00 35.47  ? 495  GLY C N     1 
ATOM   7080  C  CA    . GLY C 2  495  ? -17.432 -12.011 18.573  1.00 38.19  ? 495  GLY C CA    1 
ATOM   7081  C  C     . GLY C 2  495  ? -17.454 -11.283 19.903  1.00 36.27  ? 495  GLY C C     1 
ATOM   7082  O  O     . GLY C 2  495  ? -18.489 -11.228 20.565  1.00 35.63  ? 495  GLY C O     1 
ATOM   7083  N  N     . LEU C 2  496  ? -16.309 -10.720 20.283  1.00 37.88  ? 496  LEU C N     1 
ATOM   7084  C  CA    . LEU C 2  496  ? -16.131 -10.073 21.588  1.00 40.16  ? 496  LEU C CA    1 
ATOM   7085  C  C     . LEU C 2  496  ? -16.549 -8.608  21.600  1.00 37.31  ? 496  LEU C C     1 
ATOM   7086  O  O     . LEU C 2  496  ? -16.743 -8.006  22.662  1.00 33.02  ? 496  LEU C O     1 
ATOM   7087  C  CB    . LEU C 2  496  ? -14.671 -10.178 22.022  1.00 41.50  ? 496  LEU C CB    1 
ATOM   7088  C  CG    . LEU C 2  496  ? -14.098 -11.583 21.889  1.00 45.85  ? 496  LEU C CG    1 
ATOM   7089  C  CD1   . LEU C 2  496  ? -12.625 -11.586 22.244  1.00 53.85  ? 496  LEU C CD1   1 
ATOM   7090  C  CD2   . LEU C 2  496  ? -14.876 -12.552 22.769  1.00 51.00  ? 496  LEU C CD2   1 
ATOM   7091  N  N     . ILE C 2  497  ? -16.659 -8.035  20.410  1.00 35.92  ? 497  ILE C N     1 
ATOM   7092  C  CA    . ILE C 2  497  ? -17.126 -6.672  20.263  1.00 29.53  ? 497  ILE C CA    1 
ATOM   7093  C  C     . ILE C 2  497  ? -18.344 -6.629  19.357  1.00 30.54  ? 497  ILE C C     1 
ATOM   7094  O  O     . ILE C 2  497  ? -18.297 -7.106  18.224  1.00 32.68  ? 497  ILE C O     1 
ATOM   7095  C  CB    . ILE C 2  497  ? -16.047 -5.764  19.678  1.00 29.67  ? 497  ILE C CB    1 
ATOM   7096  C  CG1   . ILE C 2  497  ? -14.846 -5.680  20.621  1.00 34.82  ? 497  ILE C CG1   1 
ATOM   7097  C  CG2   . ILE C 2  497  ? -16.611 -4.385  19.437  1.00 33.77  ? 497  ILE C CG2   1 
ATOM   7098  C  CD1   . ILE C 2  497  ? -13.762 -4.714  20.146  1.00 41.57  ? 497  ILE C CD1   1 
ATOM   7099  N  N     . GLY C 2  498  ? -19.434 -6.060  19.853  1.00 28.35  ? 498  GLY C N     1 
ATOM   7100  C  CA    . GLY C 2  498  ? -20.620 -5.887  19.036  1.00 28.30  ? 498  GLY C CA    1 
ATOM   7101  C  C     . GLY C 2  498  ? -21.173 -4.480  19.134  1.00 26.08  ? 498  GLY C C     1 
ATOM   7102  O  O     . GLY C 2  498  ? -20.596 -3.617  19.798  1.00 27.11  ? 498  GLY C O     1 
ATOM   7103  N  N     . SER C 2  499  ? -22.291 -4.254  18.454  1.00 24.36  ? 499  SER C N     1 
ATOM   7104  C  CA    . SER C 2  499  ? -23.039 -3.010  18.568  1.00 25.45  ? 499  SER C CA    1 
ATOM   7105  C  C     . SER C 2  499  ? -24.419 -3.309  19.179  1.00 27.98  ? 499  SER C C     1 
ATOM   7106  O  O     . SER C 2  499  ? -24.940 -4.415  19.034  1.00 29.11  ? 499  SER C O     1 
ATOM   7107  C  CB    . SER C 2  499  ? -23.174 -2.334  17.195  1.00 25.78  ? 499  SER C CB    1 
ATOM   7108  O  OG    . SER C 2  499  ? -23.513 -0.956  17.301  1.00 26.52  ? 499  SER C OG    1 
ATOM   7109  N  N     . LEU C 2  500  ? -24.985 -2.325  19.878  1.00 28.55  ? 500  LEU C N     1 
ATOM   7110  C  CA    . LEU C 2  500  ? -26.348 -2.397  20.409  1.00 25.85  ? 500  LEU C CA    1 
ATOM   7111  C  C     . LEU C 2  500  ? -27.391 -2.233  19.308  1.00 27.03  ? 500  LEU C C     1 
ATOM   7112  O  O     . LEU C 2  500  ? -27.298 -1.308  18.494  1.00 27.53  ? 500  LEU C O     1 
ATOM   7113  C  CB    . LEU C 2  500  ? -26.573 -1.315  21.471  1.00 24.71  ? 500  LEU C CB    1 
ATOM   7114  C  CG    . LEU C 2  500  ? -28.025 -1.146  21.922  1.00 24.44  ? 500  LEU C CG    1 
ATOM   7115  C  CD1   . LEU C 2  500  ? -28.300 -2.025  23.120  1.00 29.92  ? 500  LEU C CD1   1 
ATOM   7116  C  CD2   . LEU C 2  500  ? -28.378 0.301   22.222  1.00 25.89  ? 500  LEU C CD2   1 
ATOM   7117  N  N     . SER C 2  501  ? -28.388 -3.115  19.288  1.00 27.16  ? 501  SER C N     1 
ATOM   7118  C  CA    . SER C 2  501  ? -29.474 -3.001  18.316  1.00 28.05  ? 501  SER C CA    1 
ATOM   7119  C  C     . SER C 2  501  ? -30.201 -1.672  18.480  1.00 27.01  ? 501  SER C C     1 
ATOM   7120  O  O     . SER C 2  501  ? -30.154 -1.057  19.543  1.00 26.32  ? 501  SER C O     1 
ATOM   7121  C  CB    . SER C 2  501  ? -30.464 -4.161  18.447  1.00 32.90  ? 501  SER C CB    1 
ATOM   7122  O  OG    . SER C 2  501  ? -29.887 -5.387  18.031  1.00 34.00  ? 501  SER C OG    1 
ATOM   7123  N  N     . VAL C 2  502  ? -30.876 -1.244  17.418  1.00 26.28  ? 502  VAL C N     1 
ATOM   7124  C  CA    . VAL C 2  502  ? -31.444 0.101   17.329  1.00 26.44  ? 502  VAL C CA    1 
ATOM   7125  C  C     . VAL C 2  502  ? -32.430 0.429   18.446  1.00 27.37  ? 502  VAL C C     1 
ATOM   7126  O  O     . VAL C 2  502  ? -32.311 1.464   19.108  1.00 26.22  ? 502  VAL C O     1 
ATOM   7127  C  CB    . VAL C 2  502  ? -32.164 0.306   15.970  1.00 26.81  ? 502  VAL C CB    1 
ATOM   7128  C  CG1   . VAL C 2  502  ? -32.809 1.666   15.913  1.00 30.25  ? 502  VAL C CG1   1 
ATOM   7129  C  CG2   . VAL C 2  502  ? -31.196 0.145   14.818  1.00 26.96  ? 502  VAL C CG2   1 
ATOM   7130  N  N     . TYR C 2  503  ? -33.392 -0.465  18.656  1.00 28.27  ? 503  TYR C N     1 
ATOM   7131  C  CA    . TYR C 2  503  ? -34.528 -0.188  19.527  1.00 30.13  ? 503  TYR C CA    1 
ATOM   7132  C  C     . TYR C 2  503  ? -34.286 -0.606  20.975  1.00 29.89  ? 503  TYR C C     1 
ATOM   7133  O  O     . TYR C 2  503  ? -35.124 -0.363  21.839  1.00 32.60  ? 503  TYR C O     1 
ATOM   7134  C  CB    . TYR C 2  503  ? -35.779 -0.885  18.982  1.00 33.66  ? 503  TYR C CB    1 
ATOM   7135  C  CG    . TYR C 2  503  ? -36.279 -0.322  17.662  1.00 39.11  ? 503  TYR C CG    1 
ATOM   7136  C  CD1   . TYR C 2  503  ? -36.903 0.922   17.608  1.00 41.55  ? 503  TYR C CD1   1 
ATOM   7137  C  CD2   . TYR C 2  503  ? -36.133 -1.032  16.472  1.00 39.60  ? 503  TYR C CD2   1 
ATOM   7138  C  CE1   . TYR C 2  503  ? -37.365 1.448   16.408  1.00 42.74  ? 503  TYR C CE1   1 
ATOM   7139  C  CE2   . TYR C 2  503  ? -36.593 -0.512  15.263  1.00 39.95  ? 503  TYR C CE2   1 
ATOM   7140  C  CZ    . TYR C 2  503  ? -37.208 0.729   15.242  1.00 44.27  ? 503  TYR C CZ    1 
ATOM   7141  O  OH    . TYR C 2  503  ? -37.669 1.259   14.057  1.00 50.68  ? 503  TYR C OH    1 
ATOM   7142  N  N     . ALA C 2  504  ? -33.133 -1.212  21.237  1.00 29.77  ? 504  ALA C N     1 
ATOM   7143  C  CA    . ALA C 2  504  ? -32.827 -1.735  22.567  1.00 32.15  ? 504  ALA C CA    1 
ATOM   7144  C  C     . ALA C 2  504  ? -32.392 -0.655  23.553  1.00 31.66  ? 504  ALA C C     1 
ATOM   7145  O  O     . ALA C 2  504  ? -31.670 0.274   23.196  1.00 29.71  ? 504  ALA C O     1 
ATOM   7146  C  CB    . ALA C 2  504  ? -31.754 -2.804  22.471  1.00 34.64  ? 504  ALA C CB    1 
ATOM   7147  N  N     . ARG C 2  505  ? -32.828 -0.794  24.802  1.00 34.86  ? 505  ARG C N     1 
ATOM   7148  C  CA    . ARG C 2  505  ? -32.405 0.111   25.865  1.00 37.53  ? 505  ARG C CA    1 
ATOM   7149  C  C     . ARG C 2  505  ? -31.899 -0.661  27.082  1.00 41.87  ? 505  ARG C C     1 
ATOM   7150  O  O     . ARG C 2  505  ? -32.088 -1.876  27.186  1.00 42.68  ? 505  ARG C O     1 
ATOM   7151  C  CB    . ARG C 2  505  ? -33.552 1.034   26.277  1.00 43.71  ? 505  ARG C CB    1 
ATOM   7152  C  CG    . ARG C 2  505  ? -34.533 0.402   27.249  1.00 50.02  ? 505  ARG C CG    1 
ATOM   7153  C  CD    . ARG C 2  505  ? -35.628 1.383   27.630  1.00 57.51  ? 505  ARG C CD    1 
ATOM   7154  N  NE    . ARG C 2  505  ? -36.440 0.902   28.744  1.00 61.40  ? 505  ARG C NE    1 
ATOM   7155  C  CZ    . ARG C 2  505  ? -37.509 1.538   29.215  1.00 69.24  ? 505  ARG C CZ    1 
ATOM   7156  N  NH1   . ARG C 2  505  ? -37.903 2.679   28.662  1.00 64.72  ? 505  ARG C NH1   1 
ATOM   7157  N  NH2   . ARG C 2  505  ? -38.190 1.029   30.234  1.00 74.91  ? 505  ARG C NH2   1 
ATOM   7158  N  N     . VAL C 2  506  ? -31.257 0.053   28.004  1.00 41.74  ? 506  VAL C N     1 
ATOM   7159  C  CA    . VAL C 2  506  ? -30.714 -0.564  29.209  1.00 41.47  ? 506  VAL C CA    1 
ATOM   7160  C  C     . VAL C 2  506  ? -31.599 -0.282  30.422  1.00 44.57  ? 506  VAL C C     1 
ATOM   7161  O  O     . VAL C 2  506  ? -31.994 0.861   30.669  1.00 46.55  ? 506  VAL C O     1 
ATOM   7162  C  CB    . VAL C 2  506  ? -29.282 -0.068  29.508  1.00 41.98  ? 506  VAL C CB    1 
ATOM   7163  C  CG1   . VAL C 2  506  ? -28.538 -1.093  30.352  1.00 42.68  ? 506  VAL C CG1   1 
ATOM   7164  C  CG2   . VAL C 2  506  ? -28.526 0.213   28.214  1.00 39.14  ? 506  VAL C CG2   1 
ATOM   7165  N  N     . ASN C 2  507  ? -31.908 -1.336  31.171  1.00 49.16  ? 507  ASN C N     1 
ATOM   7166  C  CA    . ASN C 2  507  ? -32.694 -1.215  32.393  1.00 55.11  ? 507  ASN C CA    1 
ATOM   7167  C  C     . ASN C 2  507  ? -31.774 -1.066  33.605  1.00 53.47  ? 507  ASN C C     1 
ATOM   7168  O  O     . ASN C 2  507  ? -30.629 -1.520  33.572  1.00 52.63  ? 507  ASN C O     1 
ATOM   7169  C  CB    . ASN C 2  507  ? -33.628 -2.423  32.558  1.00 57.63  ? 507  ASN C CB    1 
ATOM   7170  C  CG    . ASN C 2  507  ? -32.896 -3.682  32.982  1.00 57.94  ? 507  ASN C CG    1 
ATOM   7171  O  OD1   . ASN C 2  507  ? -31.721 -3.874  32.668  1.00 56.77  ? 507  ASN C OD1   1 
ATOM   7172  N  ND2   . ASN C 2  507  ? -33.598 -4.555  33.696  1.00 56.80  ? 507  ASN C ND2   1 
ATOM   7173  N  N     . PRO C 2  508  ? -32.270 -0.422  34.677  1.00 57.68  ? 508  PRO C N     1 
ATOM   7174  C  CA    . PRO C 2  508  ? -31.472 -0.087  35.866  1.00 60.92  ? 508  PRO C CA    1 
ATOM   7175  C  C     . PRO C 2  508  ? -30.640 -1.225  36.461  1.00 57.21  ? 508  PRO C C     1 
ATOM   7176  O  O     . PRO C 2  508  ? -29.749 -0.952  37.265  1.00 58.43  ? 508  PRO C O     1 
ATOM   7177  C  CB    . PRO C 2  508  ? -32.538 0.364   36.866  1.00 69.90  ? 508  PRO C CB    1 
ATOM   7178  C  CG    . PRO C 2  508  ? -33.577 0.991   36.018  1.00 71.71  ? 508  PRO C CG    1 
ATOM   7179  C  CD    . PRO C 2  508  ? -33.626 0.156   34.760  1.00 65.37  ? 508  PRO C CD    1 
ATOM   7180  N  N     . PHE C 2  509  ? -30.918 -2.468  36.085  1.00 56.20  ? 509  PHE C N     1 
ATOM   7181  C  CA    . PHE C 2  509  ? -30.149 -3.590  36.606  1.00 59.19  ? 509  PHE C CA    1 
ATOM   7182  C  C     . PHE C 2  509  ? -29.077 -4.040  35.628  1.00 55.94  ? 509  PHE C C     1 
ATOM   7183  O  O     . PHE C 2  509  ? -28.367 -5.014  35.874  1.00 58.18  ? 509  PHE C O     1 
ATOM   7184  C  CB    . PHE C 2  509  ? -31.072 -4.754  36.966  1.00 67.80  ? 509  PHE C CB    1 
ATOM   7185  C  CG    . PHE C 2  509  ? -31.558 -4.709  38.383  1.00 77.37  ? 509  PHE C CG    1 
ATOM   7186  C  CD1   . PHE C 2  509  ? -32.626 -3.903  38.738  1.00 84.21  ? 509  PHE C CD1   1 
ATOM   7187  C  CD2   . PHE C 2  509  ? -30.927 -5.449  39.369  1.00 82.86  ? 509  PHE C CD2   1 
ATOM   7188  C  CE1   . PHE C 2  509  ? -33.067 -3.846  40.049  1.00 91.23  ? 509  PHE C CE1   1 
ATOM   7189  C  CE2   . PHE C 2  509  ? -31.363 -5.395  40.680  1.00 92.21  ? 509  PHE C CE2   1 
ATOM   7190  C  CZ    . PHE C 2  509  ? -32.435 -4.594  41.020  1.00 93.98  ? 509  PHE C CZ    1 
ATOM   7191  N  N     . GLY C 2  510  ? -28.958 -3.323  34.517  1.00 54.89  ? 510  GLY C N     1 
ATOM   7192  C  CA    . GLY C 2  510  ? -27.868 -3.552  33.589  1.00 53.99  ? 510  GLY C CA    1 
ATOM   7193  C  C     . GLY C 2  510  ? -28.069 -4.702  32.622  1.00 51.45  ? 510  GLY C C     1 
ATOM   7194  O  O     . GLY C 2  510  ? -27.100 -5.281  32.132  1.00 54.23  ? 510  GLY C O     1 
ATOM   7195  N  N     . PHE C 2  511  ? -29.322 -5.038  32.343  1.00 47.03  ? 511  PHE C N     1 
ATOM   7196  C  CA    . PHE C 2  511  ? -29.615 -6.037  31.324  1.00 47.38  ? 511  PHE C CA    1 
ATOM   7197  C  C     . PHE C 2  511  ? -30.193 -5.335  30.108  1.00 46.27  ? 511  PHE C C     1 
ATOM   7198  O  O     . PHE C 2  511  ? -30.483 -4.139  30.162  1.00 49.83  ? 511  PHE C O     1 
ATOM   7199  C  CB    . PHE C 2  511  ? -30.569 -7.098  31.865  1.00 52.51  ? 511  PHE C CB    1 
ATOM   7200  C  CG    . PHE C 2  511  ? -30.054 -7.792  33.093  1.00 57.45  ? 511  PHE C CG    1 
ATOM   7201  C  CD1   . PHE C 2  511  ? -29.250 -8.916  32.985  1.00 58.76  ? 511  PHE C CD1   1 
ATOM   7202  C  CD2   . PHE C 2  511  ? -30.355 -7.307  34.355  1.00 58.82  ? 511  PHE C CD2   1 
ATOM   7203  C  CE1   . PHE C 2  511  ? -28.764 -9.553  34.116  1.00 58.36  ? 511  PHE C CE1   1 
ATOM   7204  C  CE2   . PHE C 2  511  ? -29.874 -7.938  35.488  1.00 62.03  ? 511  PHE C CE2   1 
ATOM   7205  C  CZ    . PHE C 2  511  ? -29.077 -9.064  35.368  1.00 61.53  ? 511  PHE C CZ    1 
ATOM   7206  N  N     . ILE C 2  512  ? -30.351 -6.055  29.004  1.00 40.97  ? 512  ILE C N     1 
ATOM   7207  C  CA    . ILE C 2  512  ? -30.772 -5.394  27.775  1.00 41.32  ? 512  ILE C CA    1 
ATOM   7208  C  C     . ILE C 2  512  ? -32.229 -5.667  27.418  1.00 43.18  ? 512  ILE C C     1 
ATOM   7209  O  O     . ILE C 2  512  ? -32.600 -6.792  27.085  1.00 46.07  ? 512  ILE C O     1 
ATOM   7210  C  CB    . ILE C 2  512  ? -29.878 -5.799  26.597  1.00 39.83  ? 512  ILE C CB    1 
ATOM   7211  C  CG1   . ILE C 2  512  ? -28.410 -5.790  27.037  1.00 41.73  ? 512  ILE C CG1   1 
ATOM   7212  C  CG2   . ILE C 2  512  ? -30.109 -4.857  25.423  1.00 37.55  ? 512  ILE C CG2   1 
ATOM   7213  C  CD1   . ILE C 2  512  ? -27.412 -5.712  25.900  1.00 41.10  ? 512  ILE C CD1   1 
ATOM   7214  N  N     . GLU C 2  513  ? -33.045 -4.617  27.494  1.00 44.61  ? 513  GLU C N     1 
ATOM   7215  C  CA    . GLU C 2  513  ? -34.461 -4.690  27.139  1.00 48.00  ? 513  GLU C CA    1 
ATOM   7216  C  C     . GLU C 2  513  ? -34.698 -4.303  25.669  1.00 47.41  ? 513  GLU C C     1 
ATOM   7217  O  O     . GLU C 2  513  ? -33.830 -3.708  25.025  1.00 45.64  ? 513  GLU C O     1 
ATOM   7218  C  CB    . GLU C 2  513  ? -35.293 -3.792  28.069  1.00 51.86  ? 513  GLU C CB    1 
ATOM   7219  C  CG    . GLU C 2  513  ? -35.421 -4.313  29.510  1.00 54.88  ? 513  GLU C CG    1 
ATOM   7220  C  CD    . GLU C 2  513  ? -36.306 -3.434  30.394  1.00 61.12  ? 513  GLU C CD    1 
ATOM   7221  O  OE1   . GLU C 2  513  ? -36.523 -2.253  30.040  1.00 59.93  ? 513  GLU C OE1   1 
ATOM   7222  O  OE2   . GLU C 2  513  ? -36.784 -3.926  31.443  1.00 61.13  ? 513  GLU C OE2   1 
ATOM   7223  N  N     . THR C 2  514  ? -35.877 -4.649  25.152  1.00 46.31  ? 514  THR C N     1 
ATOM   7224  C  CA    . THR C 2  514  ? -36.236 -4.404  23.754  1.00 42.26  ? 514  THR C CA    1 
ATOM   7225  C  C     . THR C 2  514  ? -37.757 -4.223  23.640  1.00 45.50  ? 514  THR C C     1 
ATOM   7226  O  O     . THR C 2  514  ? -38.517 -4.909  24.325  1.00 47.85  ? 514  THR C O     1 
ATOM   7227  C  CB    . THR C 2  514  ? -35.746 -5.564  22.845  1.00 39.57  ? 514  THR C CB    1 
ATOM   7228  O  OG1   . THR C 2  514  ? -36.125 -5.332  21.483  1.00 37.09  ? 514  THR C OG1   1 
ATOM   7229  C  CG2   . THR C 2  514  ? -36.321 -6.885  23.309  1.00 44.24  ? 514  THR C CG2   1 
ATOM   7230  N  N     . PRO C 2  515  ? -38.212 -3.280  22.791  1.00 45.74  ? 515  PRO C N     1 
ATOM   7231  C  CA    . PRO C 2  515  ? -39.646 -2.983  22.688  1.00 46.47  ? 515  PRO C CA    1 
ATOM   7232  C  C     . PRO C 2  515  ? -40.432 -4.023  21.890  1.00 47.40  ? 515  PRO C C     1 
ATOM   7233  O  O     . PRO C 2  515  ? -40.062 -4.365  20.765  1.00 47.28  ? 515  PRO C O     1 
ATOM   7234  C  CB    . PRO C 2  515  ? -39.671 -1.625  21.976  1.00 43.39  ? 515  PRO C CB    1 
ATOM   7235  C  CG    . PRO C 2  515  ? -38.455 -1.621  21.150  1.00 39.17  ? 515  PRO C CG    1 
ATOM   7236  C  CD    . PRO C 2  515  ? -37.414 -2.412  21.909  1.00 43.05  ? 515  PRO C CD    1 
ATOM   7237  N  N     . TYR C 2  516  ? -41.508 -4.522  22.490  1.00 46.82  ? 516  TYR C N     1 
ATOM   7238  C  CA    . TYR C 2  516  ? -42.437 -5.410  21.803  1.00 50.57  ? 516  TYR C CA    1 
ATOM   7239  C  C     . TYR C 2  516  ? -43.862 -4.866  21.880  1.00 55.73  ? 516  TYR C C     1 
ATOM   7240  O  O     . TYR C 2  516  ? -44.291 -4.385  22.930  1.00 52.45  ? 516  TYR C O     1 
ATOM   7241  C  CB    . TYR C 2  516  ? -42.391 -6.815  22.397  1.00 50.98  ? 516  TYR C CB    1 
ATOM   7242  C  CG    . TYR C 2  516  ? -41.149 -7.612  22.060  1.00 49.71  ? 516  TYR C CG    1 
ATOM   7243  C  CD1   . TYR C 2  516  ? -40.858 -7.967  20.751  1.00 47.72  ? 516  TYR C CD1   1 
ATOM   7244  C  CD2   . TYR C 2  516  ? -40.283 -8.036  23.060  1.00 52.53  ? 516  TYR C CD2   1 
ATOM   7245  C  CE1   . TYR C 2  516  ? -39.730 -8.706  20.448  1.00 48.62  ? 516  TYR C CE1   1 
ATOM   7246  C  CE2   . TYR C 2  516  ? -39.156 -8.778  22.765  1.00 52.90  ? 516  TYR C CE2   1 
ATOM   7247  C  CZ    . TYR C 2  516  ? -38.883 -9.109  21.456  1.00 51.61  ? 516  TYR C CZ    1 
ATOM   7248  O  OH    . TYR C 2  516  ? -37.762 -9.845  21.150  1.00 51.78  ? 516  TYR C OH    1 
ATOM   7249  N  N     . ARG C 2  517  ? -44.587 -4.934  20.765  1.00 58.72  ? 517  ARG C N     1 
ATOM   7250  C  CA    . ARG C 2  517  ? -46.007 -4.595  20.765  1.00 58.00  ? 517  ARG C CA    1 
ATOM   7251  C  C     . ARG C 2  517  ? -46.773 -5.704  21.464  1.00 67.79  ? 517  ARG C C     1 
ATOM   7252  O  O     . ARG C 2  517  ? -46.391 -6.871  21.381  1.00 63.31  ? 517  ARG C O     1 
ATOM   7253  C  CB    . ARG C 2  517  ? -46.540 -4.391  19.345  1.00 55.74  ? 517  ARG C CB    1 
ATOM   7254  C  CG    . ARG C 2  517  ? -46.539 -2.944  18.892  1.00 58.11  ? 517  ARG C CG    1 
ATOM   7255  C  CD    . ARG C 2  517  ? -47.440 -2.727  17.688  1.00 58.99  ? 517  ARG C CD    1 
ATOM   7256  N  NE    . ARG C 2  517  ? -46.971 -3.450  16.509  1.00 58.45  ? 517  ARG C NE    1 
ATOM   7257  C  CZ    . ARG C 2  517  ? -47.521 -3.344  15.305  1.00 61.92  ? 517  ARG C CZ    1 
ATOM   7258  N  NH1   . ARG C 2  517  ? -48.561 -2.539  15.119  1.00 56.87  ? 517  ARG C NH1   1 
ATOM   7259  N  NH2   . ARG C 2  517  ? -47.030 -4.040  14.287  1.00 62.93  ? 517  ARG C NH2   1 
ATOM   7260  N  N     . LYS C 2  518  ? -47.851 -5.334  22.149  1.00 78.33  ? 518  LYS C N     1 
ATOM   7261  C  CA    . LYS C 2  518  ? -48.630 -6.285  22.941  1.00 76.27  ? 518  LYS C CA    1 
ATOM   7262  C  C     . LYS C 2  518  ? -49.865 -6.781  22.193  1.00 73.65  ? 518  LYS C C     1 
ATOM   7263  O  O     . LYS C 2  518  ? -50.588 -6.006  21.567  1.00 70.96  ? 518  LYS C O     1 
ATOM   7264  C  CB    . LYS C 2  518  ? -49.045 -5.654  24.271  1.00 68.94  ? 518  LYS C CB    1 
ATOM   7265  C  CG    . LYS C 2  518  ? -49.781 -6.596  25.205  1.00 64.99  ? 518  LYS C CG    1 
ATOM   7266  C  CD    . LYS C 2  518  ? -50.154 -5.884  26.488  1.00 68.53  ? 518  LYS C CD    1 
ATOM   7267  C  CE    . LYS C 2  518  ? -51.022 -6.752  27.378  1.00 71.99  ? 518  LYS C CE    1 
ATOM   7268  N  NZ    . LYS C 2  518  ? -51.489 -6.009  28.585  1.00 74.17  ? 518  LYS C NZ    1 
ATOM   7269  N  N     . VAL C 2  519  ? -50.099 -8.083  22.259  1.00 67.50  ? 519  VAL C N     1 
ATOM   7270  C  CA    . VAL C 2  519  ? -51.264 -8.659  21.620  1.00 70.97  ? 519  VAL C CA    1 
ATOM   7271  C  C     . VAL C 2  519  ? -52.190 -9.199  22.696  1.00 80.22  ? 519  VAL C C     1 
ATOM   7272  O  O     . VAL C 2  519  ? -51.844 -10.146 23.403  1.00 78.89  ? 519  VAL C O     1 
ATOM   7273  C  CB    . VAL C 2  519  ? -50.871 -9.763  20.622  1.00 68.71  ? 519  VAL C CB    1 
ATOM   7274  C  CG1   . VAL C 2  519  ? -52.092 -10.519 20.140  1.00 78.10  ? 519  VAL C CG1   1 
ATOM   7275  C  CG2   . VAL C 2  519  ? -50.137 -9.152  19.447  1.00 65.94  ? 519  VAL C CG2   1 
ATOM   7276  N  N     . VAL C 2  520  ? -53.351 -8.563  22.834  1.00 82.30  ? 520  VAL C N     1 
ATOM   7277  C  CA    . VAL C 2  520  ? -54.345 -8.958  23.824  1.00 79.42  ? 520  VAL C CA    1 
ATOM   7278  C  C     . VAL C 2  520  ? -54.889 -10.344 23.500  1.00 87.76  ? 520  VAL C C     1 
ATOM   7279  O  O     . VAL C 2  520  ? -54.589 -11.319 24.191  1.00 94.38  ? 520  VAL C O     1 
ATOM   7280  C  CB    . VAL C 2  520  ? -55.501 -7.944  23.891  1.00 67.81  ? 520  VAL C CB    1 
ATOM   7281  C  CG1   . VAL C 2  520  ? -56.470 -8.323  24.996  1.00 76.02  ? 520  VAL C CG1   1 
ATOM   7282  C  CG2   . VAL C 2  520  ? -54.959 -6.542  24.113  1.00 62.21  ? 520  VAL C CG2   1 
ATOM   7283  N  N     . ASP C 2  521  ? -55.682 -10.428 22.437  1.00 88.22  ? 521  ASP C N     1 
ATOM   7284  C  CA    . ASP C 2  521  ? -56.190 -11.709 21.953  1.00 95.10  ? 521  ASP C CA    1 
ATOM   7285  C  C     . ASP C 2  521  ? -56.269 -11.716 20.433  1.00 95.02  ? 521  ASP C C     1 
ATOM   7286  O  O     . ASP C 2  521  ? -57.342 -11.545 19.856  1.00 96.23  ? 521  ASP C O     1 
ATOM   7287  C  CB    . ASP C 2  521  ? -57.564 -12.005 22.555  1.00 96.75  ? 521  ASP C CB    1 
ATOM   7288  C  CG    . ASP C 2  521  ? -57.470 -12.653 23.921  1.00 102.93 ? 521  ASP C CG    1 
ATOM   7289  O  OD1   . ASP C 2  521  ? -56.564 -13.492 24.114  1.00 102.99 ? 521  ASP C OD1   1 
ATOM   7290  O  OD2   . ASP C 2  521  ? -58.298 -12.321 24.795  1.00 105.52 ? 521  ASP C OD2   1 
ATOM   7291  N  N     . GLY C 2  522  ? -55.127 -11.905 19.784  1.00 90.82  ? 522  GLY C N     1 
ATOM   7292  C  CA    . GLY C 2  522  ? -55.072 -11.838 18.338  1.00 82.79  ? 522  GLY C CA    1 
ATOM   7293  C  C     . GLY C 2  522  ? -55.217 -10.417 17.824  1.00 76.94  ? 522  GLY C C     1 
ATOM   7294  O  O     . GLY C 2  522  ? -55.219 -10.197 16.620  1.00 74.80  ? 522  GLY C O     1 
ATOM   7295  N  N     . VAL C 2  523  ? -55.327 -9.452  18.734  1.00 74.71  ? 523  VAL C N     1 
ATOM   7296  C  CA    . VAL C 2  523  ? -55.515 -8.052  18.359  1.00 74.14  ? 523  VAL C CA    1 
ATOM   7297  C  C     . VAL C 2  523  ? -54.314 -7.195  18.742  1.00 80.24  ? 523  VAL C C     1 
ATOM   7298  O  O     . VAL C 2  523  ? -54.076 -6.966  19.928  1.00 78.85  ? 523  VAL C O     1 
ATOM   7299  C  CB    . VAL C 2  523  ? -56.757 -7.446  19.030  1.00 67.48  ? 523  VAL C CB    1 
ATOM   7300  C  CG1   . VAL C 2  523  ? -57.043 -6.055  18.466  1.00 67.42  ? 523  VAL C CG1   1 
ATOM   7301  C  CG2   . VAL C 2  523  ? -57.954 -8.371  18.871  1.00 77.80  ? 523  VAL C CG2   1 
ATOM   7302  N  N     . VAL C 2  524  ? -53.578 -6.709  17.740  1.00 83.87  ? 524  VAL C N     1 
ATOM   7303  C  CA    . VAL C 2  524  ? -52.372 -5.902  17.952  1.00 75.53  ? 524  VAL C CA    1 
ATOM   7304  C  C     . VAL C 2  524  ? -52.649 -4.586  18.664  1.00 72.02  ? 524  VAL C C     1 
ATOM   7305  O  O     . VAL C 2  524  ? -53.433 -3.764  18.186  1.00 75.18  ? 524  VAL C O     1 
ATOM   7306  C  CB    . VAL C 2  524  ? -51.669 -5.568  16.618  1.00 74.16  ? 524  VAL C CB    1 
ATOM   7307  C  CG1   . VAL C 2  524  ? -50.535 -4.557  16.844  1.00 68.89  ? 524  VAL C CG1   1 
ATOM   7308  C  CG2   . VAL C 2  524  ? -51.168 -6.836  15.938  1.00 74.96  ? 524  VAL C CG2   1 
ATOM   7309  N  N     . SER C 2  525  ? -51.989 -4.383  19.798  1.00 65.75  ? 525  SER C N     1 
ATOM   7310  C  CA    . SER C 2  525  ? -52.152 -3.156  20.561  1.00 69.23  ? 525  SER C CA    1 
ATOM   7311  C  C     . SER C 2  525  ? -50.972 -2.219  20.356  1.00 69.12  ? 525  SER C C     1 
ATOM   7312  O  O     . SER C 2  525  ? -49.836 -2.667  20.193  1.00 70.60  ? 525  SER C O     1 
ATOM   7313  C  CB    . SER C 2  525  ? -52.316 -3.468  22.050  1.00 71.33  ? 525  SER C CB    1 
ATOM   7314  O  OG    . SER C 2  525  ? -52.361 -2.274  22.814  1.00 71.62  ? 525  SER C OG    1 
ATOM   7315  N  N     . ASP C 2  526  ? -51.247 -0.918  20.371  1.00 69.53  ? 526  ASP C N     1 
ATOM   7316  C  CA    . ASP C 2  526  ? -50.201 0.089   20.229  1.00 71.94  ? 526  ASP C CA    1 
ATOM   7317  C  C     . ASP C 2  526  ? -49.526 0.368   21.573  1.00 68.47  ? 526  ASP C C     1 
ATOM   7318  O  O     . ASP C 2  526  ? -48.619 1.196   21.671  1.00 68.26  ? 526  ASP C O     1 
ATOM   7319  C  CB    . ASP C 2  526  ? -50.773 1.377   19.629  1.00 75.95  ? 526  ASP C CB    1 
ATOM   7320  C  CG    . ASP C 2  526  ? -50.996 1.268   18.127  1.00 73.02  ? 526  ASP C CG    1 
ATOM   7321  O  OD1   . ASP C 2  526  ? -51.135 0.128   17.632  1.00 66.00  ? 526  ASP C OD1   1 
ATOM   7322  O  OD2   . ASP C 2  526  ? -51.028 2.312   17.443  1.00 80.61  ? 526  ASP C OD2   1 
ATOM   7323  N  N     . GLU C 2  527  ? -49.974 -0.335  22.607  1.00 63.74  ? 527  GLU C N     1 
ATOM   7324  C  CA    . GLU C 2  527  ? -49.278 -0.339  23.882  1.00 60.30  ? 527  GLU C CA    1 
ATOM   7325  C  C     . GLU C 2  527  ? -47.988 -1.139  23.748  1.00 59.60  ? 527  GLU C C     1 
ATOM   7326  O  O     . GLU C 2  527  ? -47.993 -2.245  23.209  1.00 60.21  ? 527  GLU C O     1 
ATOM   7327  C  CB    . GLU C 2  527  ? -50.158 -0.931  24.980  1.00 61.24  ? 527  GLU C CB    1 
ATOM   7328  C  CG    . GLU C 2  527  ? -49.435 -1.161  26.288  1.00 61.26  ? 527  GLU C CG    1 
ATOM   7329  C  CD    . GLU C 2  527  ? -50.332 -1.759  27.345  1.00 61.00  ? 527  GLU C CD    1 
ATOM   7330  O  OE1   . GLU C 2  527  ? -51.562 -1.576  27.250  1.00 61.29  ? 527  GLU C OE1   1 
ATOM   7331  O  OE2   . GLU C 2  527  ? -49.807 -2.415  28.268  1.00 65.98  ? 527  GLU C OE2   1 
ATOM   7332  N  N     . ILE C 2  528  ? -46.884 -0.580  24.234  1.00 58.88  ? 528  ILE C N     1 
ATOM   7333  C  CA    . ILE C 2  528  ? -45.589 -1.240  24.112  1.00 51.69  ? 528  ILE C CA    1 
ATOM   7334  C  C     . ILE C 2  528  ? -44.905 -1.448  25.461  1.00 47.40  ? 528  ILE C C     1 
ATOM   7335  O  O     . ILE C 2  528  ? -44.839 -0.535  26.285  1.00 43.66  ? 528  ILE C O     1 
ATOM   7336  C  CB    . ILE C 2  528  ? -44.646 -0.440  23.206  1.00 50.01  ? 528  ILE C CB    1 
ATOM   7337  C  CG1   . ILE C 2  528  ? -45.364 -0.030  21.921  1.00 54.95  ? 528  ILE C CG1   1 
ATOM   7338  C  CG2   . ILE C 2  528  ? -43.413 -1.259  22.889  1.00 51.33  ? 528  ILE C CG2   1 
ATOM   7339  C  CD1   . ILE C 2  528  ? -44.738 1.153   21.232  1.00 53.76  ? 528  ILE C CD1   1 
ATOM   7340  N  N     . VAL C 2  529  ? -44.393 -2.655  25.676  1.00 47.21  ? 529  VAL C N     1 
ATOM   7341  C  CA    . VAL C 2  529  ? -43.667 -2.975  26.898  1.00 51.67  ? 529  VAL C CA    1 
ATOM   7342  C  C     . VAL C 2  529  ? -42.287 -3.545  26.560  1.00 56.18  ? 529  VAL C C     1 
ATOM   7343  O  O     . VAL C 2  529  ? -42.158 -4.405  25.683  1.00 54.49  ? 529  VAL C O     1 
ATOM   7344  C  CB    . VAL C 2  529  ? -44.456 -3.975  27.772  1.00 50.51  ? 529  VAL C CB    1 
ATOM   7345  C  CG1   . VAL C 2  529  ? -44.905 -5.163  26.940  1.00 47.39  ? 529  VAL C CG1   1 
ATOM   7346  C  CG2   . VAL C 2  529  ? -43.630 -4.426  28.974  1.00 54.34  ? 529  VAL C CG2   1 
ATOM   7347  N  N     . TYR C 2  530  ? -41.259 -3.036  27.237  1.00 55.23  ? 530  TYR C N     1 
ATOM   7348  C  CA    . TYR C 2  530  ? -39.895 -3.534  27.076  1.00 51.66  ? 530  TYR C CA    1 
ATOM   7349  C  C     . TYR C 2  530  ? -39.711 -4.844  27.839  1.00 52.47  ? 530  TYR C C     1 
ATOM   7350  O  O     . TYR C 2  530  ? -40.100 -4.955  29.004  1.00 51.51  ? 530  TYR C O     1 
ATOM   7351  C  CB    . TYR C 2  530  ? -38.869 -2.501  27.560  1.00 51.26  ? 530  TYR C CB    1 
ATOM   7352  C  CG    . TYR C 2  530  ? -38.644 -1.315  26.638  1.00 51.10  ? 530  TYR C CG    1 
ATOM   7353  C  CD1   . TYR C 2  530  ? -39.230 -0.081  26.901  1.00 56.07  ? 530  TYR C CD1   1 
ATOM   7354  C  CD2   . TYR C 2  530  ? -37.826 -1.421  25.518  1.00 49.02  ? 530  TYR C CD2   1 
ATOM   7355  C  CE1   . TYR C 2  530  ? -39.017 1.015   26.068  1.00 57.97  ? 530  TYR C CE1   1 
ATOM   7356  C  CE2   . TYR C 2  530  ? -37.609 -0.331  24.677  1.00 48.52  ? 530  TYR C CE2   1 
ATOM   7357  C  CZ    . TYR C 2  530  ? -38.207 0.884   24.958  1.00 50.92  ? 530  TYR C CZ    1 
ATOM   7358  O  OH    . TYR C 2  530  ? -37.994 1.966   24.130  1.00 42.82  ? 530  TYR C OH    1 
ATOM   7359  N  N     . LEU C 2  531  ? -39.115 -5.829  27.174  1.00 52.13  ? 531  LEU C N     1 
ATOM   7360  C  CA    . LEU C 2  531  ? -38.859 -7.135  27.776  1.00 54.58  ? 531  LEU C CA    1 
ATOM   7361  C  C     . LEU C 2  531  ? -37.371 -7.399  27.949  1.00 57.75  ? 531  LEU C C     1 
ATOM   7362  O  O     . LEU C 2  531  ? -36.583 -7.160  27.034  1.00 56.56  ? 531  LEU C O     1 
ATOM   7363  C  CB    . LEU C 2  531  ? -39.461 -8.253  26.924  1.00 52.95  ? 531  LEU C CB    1 
ATOM   7364  C  CG    . LEU C 2  531  ? -40.962 -8.511  27.022  1.00 56.06  ? 531  LEU C CG    1 
ATOM   7365  C  CD1   . LEU C 2  531  ? -41.747 -7.485  26.224  1.00 55.54  ? 531  LEU C CD1   1 
ATOM   7366  C  CD2   . LEU C 2  531  ? -41.280 -9.923  26.560  1.00 61.42  ? 531  LEU C CD2   1 
ATOM   7367  N  N     . THR C 2  532  ? -36.983 -7.910  29.113  1.00 60.59  ? 532  THR C N     1 
ATOM   7368  C  CA    . THR C 2  532  ? -35.618 -8.389  29.282  1.00 59.42  ? 532  THR C CA    1 
ATOM   7369  C  C     . THR C 2  532  ? -35.508 -9.723  28.543  1.00 60.52  ? 532  THR C C     1 
ATOM   7370  O  O     . THR C 2  532  ? -36.506 -10.230 28.024  1.00 62.64  ? 532  THR C O     1 
ATOM   7371  C  CB    . THR C 2  532  ? -35.228 -8.546  30.768  1.00 61.81  ? 532  THR C CB    1 
ATOM   7372  O  OG1   . THR C 2  532  ? -35.780 -9.759  31.291  1.00 61.19  ? 532  THR C OG1   1 
ATOM   7373  C  CG2   . THR C 2  532  ? -35.722 -7.354  31.589  1.00 62.08  ? 532  THR C CG2   1 
ATOM   7374  N  N     . ALA C 2  533  ? -34.308 -10.288 28.482  1.00 60.48  ? 533  ALA C N     1 
ATOM   7375  C  CA    . ALA C 2  533  ? -34.088 -11.500 27.694  1.00 63.29  ? 533  ALA C CA    1 
ATOM   7376  C  C     . ALA C 2  533  ? -34.847 -12.706 28.251  1.00 66.78  ? 533  ALA C C     1 
ATOM   7377  O  O     . ALA C 2  533  ? -35.544 -13.401 27.510  1.00 68.56  ? 533  ALA C O     1 
ATOM   7378  C  CB    . ALA C 2  533  ? -32.606 -11.809 27.604  1.00 62.26  ? 533  ALA C CB    1 
ATOM   7379  N  N     . ASP C 2  534  ? -34.716 -12.953 29.551  1.00 63.67  ? 534  ASP C N     1 
ATOM   7380  C  CA    . ASP C 2  534  ? -35.361 -14.108 30.162  1.00 61.83  ? 534  ASP C CA    1 
ATOM   7381  C  C     . ASP C 2  534  ? -36.880 -13.948 30.219  1.00 64.20  ? 534  ASP C C     1 
ATOM   7382  O  O     . ASP C 2  534  ? -37.612 -14.937 30.156  1.00 67.37  ? 534  ASP C O     1 
ATOM   7383  C  CB    . ASP C 2  534  ? -34.802 -14.361 31.564  1.00 62.99  ? 534  ASP C CB    1 
ATOM   7384  C  CG    . ASP C 2  534  ? -34.743 -13.103 32.414  1.00 65.87  ? 534  ASP C CG    1 
ATOM   7385  O  OD1   . ASP C 2  534  ? -35.446 -12.121 32.094  1.00 63.28  ? 534  ASP C OD1   1 
ATOM   7386  O  OD2   . ASP C 2  534  ? -33.990 -13.103 33.411  1.00 69.50  ? 534  ASP C OD2   1 
ATOM   7387  N  N     . GLU C 2  535  ? -37.345 -12.706 30.342  1.00 63.30  ? 535  GLU C N     1 
ATOM   7388  C  CA    . GLU C 2  535  ? -38.777 -12.399 30.326  1.00 65.88  ? 535  GLU C CA    1 
ATOM   7389  C  C     . GLU C 2  535  ? -39.415 -12.806 29.004  1.00 65.31  ? 535  GLU C C     1 
ATOM   7390  O  O     . GLU C 2  535  ? -40.543 -13.299 28.960  1.00 69.38  ? 535  GLU C O     1 
ATOM   7391  C  CB    . GLU C 2  535  ? -39.015 -10.907 30.559  1.00 61.00  ? 535  GLU C CB    1 
ATOM   7392  C  CG    . GLU C 2  535  ? -38.745 -10.426 31.967  1.00 61.83  ? 535  GLU C CG    1 
ATOM   7393  C  CD    . GLU C 2  535  ? -38.774 -8.911  32.067  1.00 63.03  ? 535  GLU C CD    1 
ATOM   7394  O  OE1   . GLU C 2  535  ? -39.021 -8.250  31.036  1.00 52.50  ? 535  GLU C OE1   1 
ATOM   7395  O  OE2   . GLU C 2  535  ? -38.546 -8.380  33.173  1.00 75.81  ? 535  GLU C OE2   1 
ATOM   7396  N  N     . GLU C 2  536  ? -38.675 -12.575 27.928  1.00 61.91  ? 536  GLU C N     1 
ATOM   7397  C  CA    . GLU C 2  536  ? -39.118 -12.897 26.582  1.00 61.86  ? 536  GLU C CA    1 
ATOM   7398  C  C     . GLU C 2  536  ? -39.174 -14.411 26.347  1.00 64.09  ? 536  GLU C C     1 
ATOM   7399  O  O     . GLU C 2  536  ? -39.981 -14.900 25.554  1.00 64.28  ? 536  GLU C O     1 
ATOM   7400  C  CB    . GLU C 2  536  ? -38.188 -12.220 25.575  1.00 61.08  ? 536  GLU C CB    1 
ATOM   7401  C  CG    . GLU C 2  536  ? -38.334 -12.687 24.147  1.00 63.37  ? 536  GLU C CG    1 
ATOM   7402  C  CD    . GLU C 2  536  ? -37.308 -12.051 23.235  1.00 60.39  ? 536  GLU C CD    1 
ATOM   7403  O  OE1   . GLU C 2  536  ? -36.872 -10.920 23.538  1.00 55.76  ? 536  GLU C OE1   1 
ATOM   7404  O  OE2   . GLU C 2  536  ? -36.933 -12.683 22.223  1.00 58.36  ? 536  GLU C OE2   1 
ATOM   7405  N  N     . ASP C 2  537  ? -38.324 -15.149 27.052  1.00 65.82  ? 537  ASP C N     1 
ATOM   7406  C  CA    . ASP C 2  537  ? -38.291 -16.604 26.935  1.00 72.58  ? 537  ASP C CA    1 
ATOM   7407  C  C     . ASP C 2  537  ? -39.572 -17.256 27.449  1.00 75.90  ? 537  ASP C C     1 
ATOM   7408  O  O     . ASP C 2  537  ? -40.002 -18.292 26.933  1.00 73.47  ? 537  ASP C O     1 
ATOM   7409  C  CB    . ASP C 2  537  ? -37.090 -17.171 27.691  1.00 75.26  ? 537  ASP C CB    1 
ATOM   7410  C  CG    . ASP C 2  537  ? -35.834 -17.191 26.853  1.00 77.99  ? 537  ASP C CG    1 
ATOM   7411  O  OD1   . ASP C 2  537  ? -35.786 -16.463 25.838  1.00 73.89  ? 537  ASP C OD1   1 
ATOM   7412  O  OD2   . ASP C 2  537  ? -34.896 -17.936 27.209  1.00 82.34  ? 537  ASP C OD2   1 
ATOM   7413  N  N     . ARG C 2  538  ? -40.168 -16.645 28.471  1.00 77.15  ? 538  ARG C N     1 
ATOM   7414  C  CA    . ARG C 2  538  ? -41.385 -17.155 29.096  1.00 75.46  ? 538  ARG C CA    1 
ATOM   7415  C  C     . ARG C 2  538  ? -42.635 -16.774 28.310  1.00 71.83  ? 538  ARG C C     1 
ATOM   7416  O  O     . ARG C 2  538  ? -43.732 -17.246 28.608  1.00 75.68  ? 538  ARG C O     1 
ATOM   7417  C  CB    . ARG C 2  538  ? -41.521 -16.633 30.528  1.00 74.83  ? 538  ARG C CB    1 
ATOM   7418  C  CG    . ARG C 2  538  ? -40.408 -17.014 31.491  1.00 72.15  ? 538  ARG C CG    1 
ATOM   7419  C  CD    . ARG C 2  538  ? -40.726 -16.501 32.897  1.00 79.45  ? 538  ARG C CD    1 
ATOM   7420  N  NE    . ARG C 2  538  ? -40.969 -15.056 32.929  1.00 88.44  ? 538  ARG C NE    1 
ATOM   7421  C  CZ    . ARG C 2  538  ? -42.175 -14.486 32.917  1.00 90.97  ? 538  ARG C CZ    1 
ATOM   7422  N  NH1   . ARG C 2  538  ? -42.286 -13.163 32.945  1.00 90.26  ? 538  ARG C NH1   1 
ATOM   7423  N  NH2   . ARG C 2  538  ? -43.270 -15.234 32.873  1.00 82.36  ? 538  ARG C NH2   1 
ATOM   7424  N  N     . HIS C 2  539  ? -42.477 -15.903 27.322  1.00 63.17  ? 539  HIS C N     1 
ATOM   7425  C  CA    . HIS C 2  539  ? -43.602 -15.535 26.479  1.00 60.51  ? 539  HIS C CA    1 
ATOM   7426  C  C     . HIS C 2  539  ? -43.453 -16.106 25.080  1.00 63.15  ? 539  HIS C C     1 
ATOM   7427  O  O     . HIS C 2  539  ? -42.558 -16.905 24.813  1.00 65.58  ? 539  HIS C O     1 
ATOM   7428  C  CB    . HIS C 2  539  ? -43.747 -14.019 26.405  1.00 60.17  ? 539  HIS C CB    1 
ATOM   7429  C  CG    . HIS C 2  539  ? -44.388 -13.414 27.612  1.00 68.00  ? 539  HIS C CG    1 
ATOM   7430  N  ND1   . HIS C 2  539  ? -45.716 -13.042 27.642  1.00 72.84  ? 539  HIS C ND1   1 
ATOM   7431  C  CD2   . HIS C 2  539  ? -43.889 -13.118 28.836  1.00 72.92  ? 539  HIS C CD2   1 
ATOM   7432  C  CE1   . HIS C 2  539  ? -46.004 -12.538 28.827  1.00 75.71  ? 539  HIS C CE1   1 
ATOM   7433  N  NE2   . HIS C 2  539  ? -44.911 -12.573 29.572  1.00 77.44  ? 539  HIS C NE2   1 
ATOM   7434  N  N     . VAL C 2  540  ? -44.344 -15.683 24.193  1.00 64.35  ? 540  VAL C N     1 
ATOM   7435  C  CA    . VAL C 2  540  ? -44.342 -16.143 22.814  1.00 67.42  ? 540  VAL C CA    1 
ATOM   7436  C  C     . VAL C 2  540  ? -44.503 -14.951 21.874  1.00 62.95  ? 540  VAL C C     1 
ATOM   7437  O  O     . VAL C 2  540  ? -45.474 -14.199 21.959  1.00 60.08  ? 540  VAL C O     1 
ATOM   7438  C  CB    . VAL C 2  540  ? -45.454 -17.194 22.575  1.00 73.93  ? 540  VAL C CB    1 
ATOM   7439  C  CG1   . VAL C 2  540  ? -45.917 -17.191 21.121  1.00 69.00  ? 540  VAL C CG1   1 
ATOM   7440  C  CG2   . VAL C 2  540  ? -44.976 -18.579 23.014  1.00 74.72  ? 540  VAL C CG2   1 
ATOM   7441  N  N     . VAL C 2  541  ? -43.528 -14.776 20.988  1.00 60.86  ? 541  VAL C N     1 
ATOM   7442  C  CA    . VAL C 2  541  ? -43.432 -13.557 20.199  1.00 59.19  ? 541  VAL C CA    1 
ATOM   7443  C  C     . VAL C 2  541  ? -43.599 -13.810 18.702  1.00 62.31  ? 541  VAL C C     1 
ATOM   7444  O  O     . VAL C 2  541  ? -43.044 -14.760 18.150  1.00 63.95  ? 541  VAL C O     1 
ATOM   7445  C  CB    . VAL C 2  541  ? -42.083 -12.854 20.450  1.00 58.55  ? 541  VAL C CB    1 
ATOM   7446  C  CG1   . VAL C 2  541  ? -41.959 -11.597 19.603  1.00 58.68  ? 541  VAL C CG1   1 
ATOM   7447  C  CG2   . VAL C 2  541  ? -41.928 -12.530 21.929  1.00 55.63  ? 541  VAL C CG2   1 
ATOM   7448  N  N     . ALA C 2  542  ? -44.379 -12.949 18.058  1.00 61.30  ? 542  ALA C N     1 
ATOM   7449  C  CA    . ALA C 2  542  ? -44.628 -13.040 16.627  1.00 65.69  ? 542  ALA C CA    1 
ATOM   7450  C  C     . ALA C 2  542  ? -43.686 -12.132 15.848  1.00 62.58  ? 542  ALA C C     1 
ATOM   7451  O  O     . ALA C 2  542  ? -43.441 -10.995 16.244  1.00 60.33  ? 542  ALA C O     1 
ATOM   7452  C  CB    . ALA C 2  542  ? -46.076 -12.682 16.324  1.00 74.54  ? 542  ALA C CB    1 
ATOM   7453  N  N     . GLN C 2  543  ? -43.171 -12.638 14.733  1.00 67.91  ? 543  GLN C N     1 
ATOM   7454  C  CA    . GLN C 2  543  ? -42.318 -11.851 13.848  1.00 67.71  ? 543  GLN C CA    1 
ATOM   7455  C  C     . GLN C 2  543  ? -43.068 -10.615 13.330  1.00 64.17  ? 543  GLN C C     1 
ATOM   7456  O  O     . GLN C 2  543  ? -44.291 -10.632 13.197  1.00 62.71  ? 543  GLN C O     1 
ATOM   7457  C  CB    . GLN C 2  543  ? -41.827 -12.719 12.688  1.00 71.38  ? 543  GLN C CB    1 
ATOM   7458  C  CG    . GLN C 2  543  ? -40.768 -12.084 11.813  1.00 70.55  ? 543  GLN C CG    1 
ATOM   7459  C  CD    . GLN C 2  543  ? -40.402 -12.976 10.645  1.00 82.75  ? 543  GLN C CD    1 
ATOM   7460  O  OE1   . GLN C 2  543  ? -40.622 -14.188 10.685  1.00 86.64  ? 543  GLN C OE1   1 
ATOM   7461  N  NE2   . GLN C 2  543  ? -39.852 -12.380 9.592   1.00 82.26  ? 543  GLN C NE2   1 
ATOM   7462  N  N     . ALA C 2  544  ? -42.328 -9.547  13.048  1.00 58.06  ? 544  ALA C N     1 
ATOM   7463  C  CA    . ALA C 2  544  ? -42.921 -8.242  12.769  1.00 53.30  ? 544  ALA C CA    1 
ATOM   7464  C  C     . ALA C 2  544  ? -43.753 -8.190  11.493  1.00 58.37  ? 544  ALA C C     1 
ATOM   7465  O  O     . ALA C 2  544  ? -44.779 -7.512  11.446  1.00 60.18  ? 544  ALA C O     1 
ATOM   7466  C  CB    . ALA C 2  544  ? -41.837 -7.193  12.703  1.00 53.45  ? 544  ALA C CB    1 
ATOM   7467  N  N     . ASN C 2  545  ? -43.306 -8.892  10.458  1.00 54.06  ? 545  ASN C N     1 
ATOM   7468  C  CA    . ASN C 2  545  ? -43.916 -8.752  9.141   1.00 69.00  ? 545  ASN C CA    1 
ATOM   7469  C  C     . ASN C 2  545  ? -45.115 -9.680  8.902   1.00 72.10  ? 545  ASN C C     1 
ATOM   7470  O  O     . ASN C 2  545  ? -45.580 -9.824  7.770   1.00 75.18  ? 545  ASN C O     1 
ATOM   7471  C  CB    . ASN C 2  545  ? -42.862 -8.980  8.057   1.00 72.76  ? 545  ASN C CB    1 
ATOM   7472  C  CG    . ASN C 2  545  ? -43.344 -8.571  6.683   1.00 96.40  ? 545  ASN C CG    1 
ATOM   7473  O  OD1   . ASN C 2  545  ? -44.150 -7.648  6.545   1.00 102.84 ? 545  ASN C OD1   1 
ATOM   7474  N  ND2   . ASN C 2  545  ? -42.848 -9.251  5.654   1.00 96.55  ? 545  ASN C ND2   1 
ATOM   7475  N  N     . SER C 2  546  ? -45.612 -10.310 9.962   1.00 66.37  ? 546  SER C N     1 
ATOM   7476  C  CA    . SER C 2  546  ? -46.824 -11.116 9.860   1.00 67.88  ? 546  SER C CA    1 
ATOM   7477  C  C     . SER C 2  546  ? -48.031 -10.207 9.599   1.00 70.24  ? 546  SER C C     1 
ATOM   7478  O  O     . SER C 2  546  ? -48.251 -9.250  10.339  1.00 70.35  ? 546  SER C O     1 
ATOM   7479  C  CB    . SER C 2  546  ? -47.039 -11.945 11.134  1.00 69.96  ? 546  SER C CB    1 
ATOM   7480  O  OG    . SER C 2  546  ? -46.024 -12.923 11.305  1.00 65.29  ? 546  SER C OG    1 
ATOM   7481  N  N     . PRO C 2  547  ? -48.805 -10.498 8.535   1.00 73.56  ? 547  PRO C N     1 
ATOM   7482  C  CA    . PRO C 2  547  ? -49.966 -9.709  8.087   1.00 72.96  ? 547  PRO C CA    1 
ATOM   7483  C  C     . PRO C 2  547  ? -51.009 -9.429  9.178   1.00 72.60  ? 547  PRO C C     1 
ATOM   7484  O  O     . PRO C 2  547  ? -51.386 -10.329 9.931   1.00 70.29  ? 547  PRO C O     1 
ATOM   7485  C  CB    . PRO C 2  547  ? -50.565 -10.580 6.979   1.00 68.77  ? 547  PRO C CB    1 
ATOM   7486  C  CG    . PRO C 2  547  ? -49.402 -11.338 6.437   1.00 70.10  ? 547  PRO C CG    1 
ATOM   7487  C  CD    . PRO C 2  547  ? -48.528 -11.627 7.627   1.00 73.61  ? 547  PRO C CD    1 
ATOM   7488  N  N     . ILE C 2  548  ? -51.473 -8.182  9.244   1.00 73.20  ? 548  ILE C N     1 
ATOM   7489  C  CA    . ILE C 2  548  ? -52.366 -7.733  10.311  1.00 75.23  ? 548  ILE C CA    1 
ATOM   7490  C  C     . ILE C 2  548  ? -53.562 -6.949  9.769   1.00 80.23  ? 548  ILE C C     1 
ATOM   7491  O  O     . ILE C 2  548  ? -53.413 -6.120  8.872   1.00 79.33  ? 548  ILE C O     1 
ATOM   7492  C  CB    . ILE C 2  548  ? -51.612 -6.850  11.330  1.00 73.10  ? 548  ILE C CB    1 
ATOM   7493  C  CG1   . ILE C 2  548  ? -50.445 -7.621  11.945  1.00 75.92  ? 548  ILE C CG1   1 
ATOM   7494  C  CG2   . ILE C 2  548  ? -52.544 -6.362  12.427  1.00 72.91  ? 548  ILE C CG2   1 
ATOM   7495  C  CD1   . ILE C 2  548  ? -49.445 -6.742  12.645  1.00 74.92  ? 548  ILE C CD1   1 
ATOM   7496  N  N     . ASP C 2  549  ? -54.741 -7.221  10.327  1.00 81.47  ? 549  ASP C N     1 
ATOM   7497  C  CA    . ASP C 2  549  ? -55.984 -6.537  9.970   1.00 77.78  ? 549  ASP C CA    1 
ATOM   7498  C  C     . ASP C 2  549  ? -55.920 -5.027  10.223  1.00 75.96  ? 549  ASP C C     1 
ATOM   7499  O  O     . ASP C 2  549  ? -55.134 -4.560  11.046  1.00 79.06  ? 549  ASP C O     1 
ATOM   7500  C  CB    . ASP C 2  549  ? -57.148 -7.159  10.753  1.00 78.52  ? 549  ASP C CB    1 
ATOM   7501  C  CG    . ASP C 2  549  ? -58.455 -6.410  10.573  1.00 86.87  ? 549  ASP C CG    1 
ATOM   7502  O  OD1   . ASP C 2  549  ? -59.268 -6.412  11.521  1.00 90.87  ? 549  ASP C OD1   1 
ATOM   7503  O  OD2   . ASP C 2  549  ? -58.671 -5.826  9.490   1.00 87.67  ? 549  ASP C OD2   1 
ATOM   7504  N  N     . ALA C 2  550  ? -56.754 -4.275  9.506   1.00 73.82  ? 550  ALA C N     1 
ATOM   7505  C  CA    . ALA C 2  550  ? -56.845 -2.823  9.662   1.00 77.29  ? 550  ALA C CA    1 
ATOM   7506  C  C     . ALA C 2  550  ? -57.276 -2.427  11.076  1.00 81.86  ? 550  ALA C C     1 
ATOM   7507  O  O     . ALA C 2  550  ? -57.021 -1.306  11.521  1.00 78.22  ? 550  ALA C O     1 
ATOM   7508  C  CB    . ALA C 2  550  ? -57.808 -2.241  8.633   1.00 70.69  ? 550  ALA C CB    1 
ATOM   7509  N  N     . ASP C 2  551  ? -57.937 -3.349  11.772  1.00 87.16  ? 551  ASP C N     1 
ATOM   7510  C  CA    . ASP C 2  551  ? -58.287 -3.153  13.177  1.00 90.11  ? 551  ASP C CA    1 
ATOM   7511  C  C     . ASP C 2  551  ? -57.134 -3.606  14.072  1.00 85.06  ? 551  ASP C C     1 
ATOM   7512  O  O     . ASP C 2  551  ? -56.765 -2.918  15.025  1.00 83.55  ? 551  ASP C O     1 
ATOM   7513  C  CB    . ASP C 2  551  ? -59.571 -3.912  13.540  1.00 95.73  ? 551  ASP C CB    1 
ATOM   7514  C  CG    . ASP C 2  551  ? -60.809 -3.347  12.852  1.00 103.27 ? 551  ASP C CG    1 
ATOM   7515  O  OD1   . ASP C 2  551  ? -60.779 -2.172  12.427  1.00 103.48 ? 551  ASP C OD1   1 
ATOM   7516  O  OD2   . ASP C 2  551  ? -61.819 -4.081  12.745  1.00 101.39 ? 551  ASP C OD2   1 
ATOM   7517  N  N     . GLY C 2  552  ? -56.566 -4.768  13.760  1.00 78.52  ? 552  GLY C N     1 
ATOM   7518  C  CA    . GLY C 2  552  ? -55.403 -5.249  14.480  1.00 76.65  ? 552  GLY C CA    1 
ATOM   7519  C  C     . GLY C 2  552  ? -55.247 -6.757  14.512  1.00 76.23  ? 552  GLY C C     1 
ATOM   7520  O  O     . GLY C 2  552  ? -54.281 -7.270  15.074  1.00 74.16  ? 552  GLY C O     1 
ATOM   7521  N  N     . ARG C 2  553  ? -56.182 -7.473  13.897  1.00 75.76  ? 553  ARG C N     1 
ATOM   7522  C  CA    . ARG C 2  553  ? -56.199 -8.930  13.993  1.00 77.14  ? 553  ARG C CA    1 
ATOM   7523  C  C     . ARG C 2  553  ? -55.308 -9.631  12.965  1.00 72.65  ? 553  ARG C C     1 
ATOM   7524  O  O     . ARG C 2  553  ? -54.943 -9.055  11.943  1.00 72.86  ? 553  ARG C O     1 
ATOM   7525  C  CB    . ARG C 2  553  ? -57.636 -9.439  13.879  1.00 81.11  ? 553  ARG C CB    1 
ATOM   7526  C  CG    . ARG C 2  553  ? -58.395 -9.378  15.197  1.00 81.60  ? 553  ARG C CG    1 
ATOM   7527  C  CD    . ARG C 2  553  ? -59.864 -9.711  15.021  1.00 80.64  ? 553  ARG C CD    1 
ATOM   7528  N  NE    . ARG C 2  553  ? -60.571 -8.668  14.286  1.00 81.93  ? 553  ARG C NE    1 
ATOM   7529  C  CZ    . ARG C 2  553  ? -61.044 -7.558  14.843  1.00 79.15  ? 553  ARG C CZ    1 
ATOM   7530  N  NH1   . ARG C 2  553  ? -60.882 -7.347  16.142  1.00 71.14  ? 553  ARG C NH1   1 
ATOM   7531  N  NH2   . ARG C 2  553  ? -61.678 -6.659  14.102  1.00 85.63  ? 553  ARG C NH2   1 
ATOM   7532  N  N     . PHE C 2  554  ? -54.950 -10.878 13.254  1.00 69.31  ? 554  PHE C N     1 
ATOM   7533  C  CA    . PHE C 2  554  ? -54.052 -11.632 12.387  1.00 67.21  ? 554  PHE C CA    1 
ATOM   7534  C  C     . PHE C 2  554  ? -54.809 -12.199 11.195  1.00 71.34  ? 554  PHE C C     1 
ATOM   7535  O  O     . PHE C 2  554  ? -56.015 -12.413 11.271  1.00 75.20  ? 554  PHE C O     1 
ATOM   7536  C  CB    . PHE C 2  554  ? -53.368 -12.763 13.161  1.00 77.14  ? 554  PHE C CB    1 
ATOM   7537  C  CG    . PHE C 2  554  ? -52.255 -12.303 14.069  1.00 84.82  ? 554  PHE C CG    1 
ATOM   7538  C  CD1   . PHE C 2  554  ? -51.368 -13.221 14.615  1.00 89.59  ? 554  PHE C CD1   1 
ATOM   7539  C  CD2   . PHE C 2  554  ? -52.096 -10.962 14.384  1.00 81.71  ? 554  PHE C CD2   1 
ATOM   7540  C  CE1   . PHE C 2  554  ? -50.340 -12.811 15.452  1.00 82.48  ? 554  PHE C CE1   1 
ATOM   7541  C  CE2   . PHE C 2  554  ? -51.072 -10.546 15.222  1.00 81.54  ? 554  PHE C CE2   1 
ATOM   7542  C  CZ    . PHE C 2  554  ? -50.193 -11.473 15.757  1.00 78.35  ? 554  PHE C CZ    1 
ATOM   7543  N  N     . VAL C 2  555  ? -54.097 -12.440 10.096  1.00 70.99  ? 555  VAL C N     1 
ATOM   7544  C  CA    . VAL C 2  555  ? -54.708 -12.994 8.888   1.00 69.83  ? 555  VAL C CA    1 
ATOM   7545  C  C     . VAL C 2  555  ? -54.815 -14.512 8.955   1.00 70.41  ? 555  VAL C C     1 
ATOM   7546  O  O     . VAL C 2  555  ? -55.893 -15.072 8.767   1.00 70.61  ? 555  VAL C O     1 
ATOM   7547  C  CB    . VAL C 2  555  ? -53.919 -12.613 7.618   1.00 65.14  ? 555  VAL C CB    1 
ATOM   7548  C  CG1   . VAL C 2  555  ? -54.392 -13.437 6.425   1.00 50.31  ? 555  VAL C CG1   1 
ATOM   7549  C  CG2   . VAL C 2  555  ? -54.062 -11.130 7.334   1.00 66.07  ? 555  VAL C CG2   1 
ATOM   7550  N  N     . GLU C 2  556  ? -53.696 -15.178 9.214   1.00 75.37  ? 556  GLU C N     1 
ATOM   7551  C  CA    . GLU C 2  556  ? -53.689 -16.633 9.321   1.00 78.88  ? 556  GLU C CA    1 
ATOM   7552  C  C     . GLU C 2  556  ? -53.653 -17.074 10.778  1.00 84.40  ? 556  GLU C C     1 
ATOM   7553  O  O     . GLU C 2  556  ? -53.028 -16.417 11.613  1.00 84.24  ? 556  GLU C O     1 
ATOM   7554  C  CB    . GLU C 2  556  ? -52.500 -17.221 8.565   1.00 79.70  ? 556  GLU C CB    1 
ATOM   7555  C  CG    . GLU C 2  556  ? -52.488 -16.895 7.086   1.00 82.55  ? 556  GLU C CG    1 
ATOM   7556  C  CD    . GLU C 2  556  ? -51.321 -17.534 6.372   1.00 85.24  ? 556  GLU C CD    1 
ATOM   7557  O  OE1   . GLU C 2  556  ? -50.561 -18.272 7.033   1.00 88.75  ? 556  GLU C OE1   1 
ATOM   7558  O  OE2   . GLU C 2  556  ? -51.161 -17.299 5.155   1.00 80.53  ? 556  GLU C OE2   1 
ATOM   7559  N  N     . PRO C 2  557  ? -54.330 -18.191 11.089  1.00 88.55  ? 557  PRO C N     1 
ATOM   7560  C  CA    . PRO C 2  557  ? -54.354 -18.711 12.460  1.00 92.74  ? 557  PRO C CA    1 
ATOM   7561  C  C     . PRO C 2  557  ? -52.958 -19.067 12.949  1.00 88.90  ? 557  PRO C C     1 
ATOM   7562  O  O     . PRO C 2  557  ? -52.493 -18.524 13.952  1.00 85.97  ? 557  PRO C O     1 
ATOM   7563  C  CB    . PRO C 2  557  ? -55.230 -19.965 12.349  1.00 95.15  ? 557  PRO C CB    1 
ATOM   7564  C  CG    . PRO C 2  557  ? -56.051 -19.748 11.120  1.00 87.21  ? 557  PRO C CG    1 
ATOM   7565  C  CD    . PRO C 2  557  ? -55.156 -19.003 10.179  1.00 80.58  ? 557  PRO C CD    1 
ATOM   7566  N  N     . ARG C 2  558  ? -52.300 -19.972 12.233  1.00 87.50  ? 558  ARG C N     1 
ATOM   7567  C  CA    . ARG C 2  558  ? -50.942 -20.371 12.560  1.00 87.41  ? 558  ARG C CA    1 
ATOM   7568  C  C     . ARG C 2  558  ? -49.950 -19.389 11.954  1.00 90.38  ? 558  ARG C C     1 
ATOM   7569  O  O     . ARG C 2  558  ? -49.948 -19.169 10.744  1.00 95.07  ? 558  ARG C O     1 
ATOM   7570  C  CB    . ARG C 2  558  ? -50.667 -21.785 12.055  1.00 84.87  ? 558  ARG C CB    1 
ATOM   7571  C  CG    . ARG C 2  558  ? -51.723 -22.797 12.454  1.00 75.56  ? 558  ARG C CG    1 
ATOM   7572  C  CD    . ARG C 2  558  ? -51.567 -24.075 11.659  1.00 83.48  ? 558  ARG C CD    1 
ATOM   7573  N  NE    . ARG C 2  558  ? -52.616 -25.044 11.958  1.00 97.82  ? 558  ARG C NE    1 
ATOM   7574  C  CZ    . ARG C 2  558  ? -52.795 -26.176 11.284  1.00 105.86 ? 558  ARG C CZ    1 
ATOM   7575  N  NH1   . ARG C 2  558  ? -51.996 -26.473 10.268  1.00 114.44 ? 558  ARG C NH1   1 
ATOM   7576  N  NH2   . ARG C 2  558  ? -53.773 -27.008 11.618  1.00 93.81  ? 558  ARG C NH2   1 
ATOM   7577  N  N     . VAL C 2  559  ? -49.113 -18.795 12.799  1.00 89.42  ? 559  VAL C N     1 
ATOM   7578  C  CA    . VAL C 2  559  ? -48.123 -17.829 12.335  1.00 96.68  ? 559  VAL C CA    1 
ATOM   7579  C  C     . VAL C 2  559  ? -46.709 -18.261 12.706  1.00 93.90  ? 559  VAL C C     1 
ATOM   7580  O  O     . VAL C 2  559  ? -46.517 -19.199 13.477  1.00 83.28  ? 559  VAL C O     1 
ATOM   7581  C  CB    . VAL C 2  559  ? -48.387 -16.416 12.912  1.00 96.48  ? 559  VAL C CB    1 
ATOM   7582  C  CG1   . VAL C 2  559  ? -49.430 -15.675 12.082  1.00 92.30  ? 559  VAL C CG1   1 
ATOM   7583  C  CG2   . VAL C 2  559  ? -48.812 -16.507 14.369  1.00 92.66  ? 559  VAL C CG2   1 
ATOM   7584  N  N     . LEU C 2  560  ? -45.727 -17.570 12.135  1.00 104.05 ? 560  LEU C N     1 
ATOM   7585  C  CA    . LEU C 2  560  ? -44.321 -17.780 12.463  1.00 96.95  ? 560  LEU C CA    1 
ATOM   7586  C  C     . LEU C 2  560  ? -44.023 -17.245 13.854  1.00 89.73  ? 560  LEU C C     1 
ATOM   7587  O  O     . LEU C 2  560  ? -44.328 -16.092 14.162  1.00 87.90  ? 560  LEU C O     1 
ATOM   7588  C  CB    . LEU C 2  560  ? -43.425 -17.093 11.434  1.00 100.92 ? 560  LEU C CB    1 
ATOM   7589  C  CG    . LEU C 2  560  ? -43.419 -17.669 10.022  1.00 102.84 ? 560  LEU C CG    1 
ATOM   7590  C  CD1   . LEU C 2  560  ? -42.554 -16.811 9.113   1.00 94.45  ? 560  LEU C CD1   1 
ATOM   7591  C  CD2   . LEU C 2  560  ? -42.908 -19.096 10.074  1.00 96.62  ? 560  LEU C CD2   1 
ATOM   7592  N  N     . VAL C 2  561  ? -43.424 -18.076 14.698  1.00 80.83  ? 561  VAL C N     1 
ATOM   7593  C  CA    . VAL C 2  561  ? -43.213 -17.689 16.088  1.00 85.32  ? 561  VAL C CA    1 
ATOM   7594  C  C     . VAL C 2  561  ? -41.808 -18.032 16.574  1.00 81.75  ? 561  VAL C C     1 
ATOM   7595  O  O     . VAL C 2  561  ? -41.295 -19.116 16.306  1.00 74.04  ? 561  VAL C O     1 
ATOM   7596  C  CB    . VAL C 2  561  ? -44.261 -18.358 17.013  1.00 92.78  ? 561  VAL C CB    1 
ATOM   7597  C  CG1   . VAL C 2  561  ? -43.847 -18.258 18.477  1.00 85.15  ? 561  VAL C CG1   1 
ATOM   7598  C  CG2   . VAL C 2  561  ? -45.645 -17.744 16.787  1.00 92.64  ? 561  VAL C CG2   1 
ATOM   7599  N  N     . ARG C 2  562  ? -41.187 -17.087 17.274  1.00 79.87  ? 562  ARG C N     1 
ATOM   7600  C  CA    . ARG C 2  562  ? -39.892 -17.307 17.902  1.00 72.33  ? 562  ARG C CA    1 
ATOM   7601  C  C     . ARG C 2  562  ? -40.125 -17.863 19.308  1.00 69.30  ? 562  ARG C C     1 
ATOM   7602  O  O     . ARG C 2  562  ? -40.893 -17.296 20.087  1.00 69.07  ? 562  ARG C O     1 
ATOM   7603  C  CB    . ARG C 2  562  ? -39.086 -16.001 17.943  1.00 70.84  ? 562  ARG C CB    1 
ATOM   7604  C  CG    . ARG C 2  562  ? -39.140 -15.201 16.632  1.00 62.53  ? 562  ARG C CG    1 
ATOM   7605  C  CD    . ARG C 2  562  ? -38.269 -13.947 16.662  1.00 52.27  ? 562  ARG C CD    1 
ATOM   7606  N  NE    . ARG C 2  562  ? -38.708 -12.958 17.645  1.00 51.40  ? 562  ARG C NE    1 
ATOM   7607  C  CZ    . ARG C 2  562  ? -38.162 -12.801 18.848  1.00 50.79  ? 562  ARG C CZ    1 
ATOM   7608  N  NH1   . ARG C 2  562  ? -38.626 -11.870 19.671  1.00 45.84  ? 562  ARG C NH1   1 
ATOM   7609  N  NH2   . ARG C 2  562  ? -37.152 -13.572 19.230  1.00 51.85  ? 562  ARG C NH2   1 
ATOM   7610  N  N     . ARG C 2  563  ? -39.484 -18.986 19.618  1.00 66.28  ? 563  ARG C N     1 
ATOM   7611  C  CA    . ARG C 2  563  ? -39.627 -19.622 20.926  1.00 69.44  ? 563  ARG C CA    1 
ATOM   7612  C  C     . ARG C 2  563  ? -38.276 -19.800 21.607  1.00 69.66  ? 563  ARG C C     1 
ATOM   7613  O  O     . ARG C 2  563  ? -37.254 -19.908 20.937  1.00 72.62  ? 563  ARG C O     1 
ATOM   7614  C  CB    . ARG C 2  563  ? -40.326 -20.976 20.784  1.00 75.69  ? 563  ARG C CB    1 
ATOM   7615  C  CG    . ARG C 2  563  ? -40.395 -21.803 22.060  1.00 75.70  ? 563  ARG C CG    1 
ATOM   7616  C  CD    . ARG C 2  563  ? -41.360 -22.952 21.896  1.00 83.12  ? 563  ARG C CD    1 
ATOM   7617  N  NE    . ARG C 2  563  ? -42.634 -22.502 21.340  1.00 91.93  ? 563  ARG C NE    1 
ATOM   7618  C  CZ    . ARG C 2  563  ? -43.570 -21.856 22.031  1.00 92.83  ? 563  ARG C CZ    1 
ATOM   7619  N  NH1   . ARG C 2  563  ? -43.377 -21.570 23.311  1.00 93.12  ? 563  ARG C NH1   1 
ATOM   7620  N  NH2   . ARG C 2  563  ? -44.699 -21.490 21.439  1.00 91.26  ? 563  ARG C NH2   1 
ATOM   7621  N  N     . LYS C 2  564  ? -38.294 -19.817 22.939  1.00 70.14  ? 564  LYS C N     1 
ATOM   7622  C  CA    . LYS C 2  564  ? -37.126 -20.069 23.786  1.00 73.89  ? 564  LYS C CA    1 
ATOM   7623  C  C     . LYS C 2  564  ? -36.138 -21.105 23.225  1.00 73.93  ? 564  LYS C C     1 
ATOM   7624  O  O     . LYS C 2  564  ? -36.540 -22.050 22.542  1.00 73.87  ? 564  LYS C O     1 
ATOM   7625  C  CB    . LYS C 2  564  ? -37.609 -20.508 25.170  1.00 74.50  ? 564  LYS C CB    1 
ATOM   7626  C  CG    . LYS C 2  564  ? -36.524 -20.929 26.143  1.00 75.37  ? 564  LYS C CG    1 
ATOM   7627  C  CD    . LYS C 2  564  ? -37.136 -21.400 27.452  1.00 75.87  ? 564  LYS C CD    1 
ATOM   7628  C  CE    . LYS C 2  564  ? -36.090 -21.999 28.383  1.00 90.27  ? 564  LYS C CE    1 
ATOM   7629  N  NZ    . LYS C 2  564  ? -36.689 -22.534 29.645  1.00 98.43  ? 564  LYS C NZ    1 
ATOM   7630  N  N     . ALA C 2  565  ? -34.851 -20.894 23.510  1.00 71.22  ? 565  ALA C N     1 
ATOM   7631  C  CA    . ALA C 2  565  ? -33.748 -21.751 23.057  1.00 69.22  ? 565  ALA C CA    1 
ATOM   7632  C  C     . ALA C 2  565  ? -33.528 -21.703 21.537  1.00 72.62  ? 565  ALA C C     1 
ATOM   7633  O  O     . ALA C 2  565  ? -33.051 -22.671 20.941  1.00 73.75  ? 565  ALA C O     1 
ATOM   7634  C  CB    . ALA C 2  565  ? -33.969 -23.199 23.517  1.00 73.02  ? 565  ALA C CB    1 
ATOM   7635  N  N     . GLY C 2  566  ? -33.861 -20.573 20.917  1.00 73.94  ? 566  GLY C N     1 
ATOM   7636  C  CA    . GLY C 2  566  ? -33.666 -20.394 19.486  1.00 70.51  ? 566  GLY C CA    1 
ATOM   7637  C  C     . GLY C 2  566  ? -34.628 -21.163 18.589  1.00 73.97  ? 566  GLY C C     1 
ATOM   7638  O  O     . GLY C 2  566  ? -34.533 -21.090 17.363  1.00 71.90  ? 566  GLY C O     1 
ATOM   7639  N  N     . GLU C 2  567  ? -35.559 -21.894 19.199  1.00 76.98  ? 567  GLU C N     1 
ATOM   7640  C  CA    . GLU C 2  567  ? -36.514 -22.723 18.459  1.00 82.64  ? 567  GLU C CA    1 
ATOM   7641  C  C     . GLU C 2  567  ? -37.656 -21.897 17.845  1.00 79.66  ? 567  GLU C C     1 
ATOM   7642  O  O     . GLU C 2  567  ? -38.103 -20.903 18.422  1.00 72.48  ? 567  GLU C O     1 
ATOM   7643  C  CB    . GLU C 2  567  ? -37.090 -23.814 19.380  1.00 89.41  ? 567  GLU C CB    1 
ATOM   7644  C  CG    . GLU C 2  567  ? -37.946 -24.889 18.680  1.00 104.50 ? 567  GLU C CG    1 
ATOM   7645  C  CD    . GLU C 2  567  ? -38.864 -25.660 19.640  1.00 114.04 ? 567  GLU C CD    1 
ATOM   7646  O  OE1   . GLU C 2  567  ? -38.876 -25.349 20.852  1.00 118.31 ? 567  GLU C OE1   1 
ATOM   7647  O  OE2   . GLU C 2  567  ? -39.584 -26.576 19.181  1.00 104.74 ? 567  GLU C OE2   1 
ATOM   7648  N  N     . VAL C 2  568  ? -38.118 -22.317 16.669  1.00 80.34  ? 568  VAL C N     1 
ATOM   7649  C  CA    . VAL C 2  568  ? -39.234 -21.665 15.985  1.00 82.68  ? 568  VAL C CA    1 
ATOM   7650  C  C     . VAL C 2  568  ? -40.285 -22.694 15.563  1.00 91.34  ? 568  VAL C C     1 
ATOM   7651  O  O     . VAL C 2  568  ? -39.941 -23.781 15.091  1.00 83.79  ? 568  VAL C O     1 
ATOM   7652  C  CB    . VAL C 2  568  ? -38.742 -20.870 14.748  1.00 77.60  ? 568  VAL C CB    1 
ATOM   7653  C  CG1   . VAL C 2  568  ? -39.903 -20.476 13.831  1.00 81.06  ? 568  VAL C CG1   1 
ATOM   7654  C  CG2   . VAL C 2  568  ? -37.977 -19.645 15.190  1.00 78.12  ? 568  VAL C CG2   1 
ATOM   7655  N  N     . GLU C 2  569  ? -41.561 -22.358 15.753  1.00 95.58  ? 569  GLU C N     1 
ATOM   7656  C  CA    . GLU C 2  569  ? -42.663 -23.228 15.340  1.00 91.68  ? 569  GLU C CA    1 
ATOM   7657  C  C     . GLU C 2  569  ? -43.939 -22.436 15.063  1.00 88.85  ? 569  GLU C C     1 
ATOM   7658  O  O     . GLU C 2  569  ? -44.205 -21.422 15.709  1.00 85.73  ? 569  GLU C O     1 
ATOM   7659  C  CB    . GLU C 2  569  ? -42.934 -24.290 16.406  1.00 84.52  ? 569  GLU C CB    1 
ATOM   7660  C  CG    . GLU C 2  569  ? -43.274 -23.722 17.773  1.00 84.98  ? 569  GLU C CG    1 
ATOM   7661  C  CD    . GLU C 2  569  ? -43.312 -24.786 18.851  1.00 95.41  ? 569  GLU C CD    1 
ATOM   7662  O  OE1   . GLU C 2  569  ? -43.133 -25.976 18.520  1.00 101.89 ? 569  GLU C OE1   1 
ATOM   7663  O  OE2   . GLU C 2  569  ? -43.519 -24.433 20.029  1.00 99.30  ? 569  GLU C OE2   1 
ATOM   7664  N  N     . TYR C 2  570  ? -44.722 -22.900 14.094  1.00 86.53  ? 570  TYR C N     1 
ATOM   7665  C  CA    . TYR C 2  570  ? -46.014 -22.291 13.804  1.00 88.50  ? 570  TYR C CA    1 
ATOM   7666  C  C     . TYR C 2  570  ? -46.924 -22.425 15.020  1.00 84.90  ? 570  TYR C C     1 
ATOM   7667  O  O     . TYR C 2  570  ? -46.946 -23.472 15.664  1.00 86.07  ? 570  TYR C O     1 
ATOM   7668  C  CB    . TYR C 2  570  ? -46.654 -22.938 12.573  1.00 95.47  ? 570  TYR C CB    1 
ATOM   7669  C  CG    . TYR C 2  570  ? -45.968 -22.591 11.269  1.00 92.48  ? 570  TYR C CG    1 
ATOM   7670  C  CD1   . TYR C 2  570  ? -46.336 -21.459 10.553  1.00 95.88  ? 570  TYR C CD1   1 
ATOM   7671  C  CD2   . TYR C 2  570  ? -44.956 -23.392 10.755  1.00 84.57  ? 570  TYR C CD2   1 
ATOM   7672  C  CE1   . TYR C 2  570  ? -45.716 -21.133 9.362   1.00 98.58  ? 570  TYR C CE1   1 
ATOM   7673  C  CE2   . TYR C 2  570  ? -44.328 -23.074 9.563   1.00 88.40  ? 570  TYR C CE2   1 
ATOM   7674  C  CZ    . TYR C 2  570  ? -44.713 -21.942 8.872   1.00 100.01 ? 570  TYR C CZ    1 
ATOM   7675  O  OH    . TYR C 2  570  ? -44.095 -21.615 7.685   1.00 107.22 ? 570  TYR C OH    1 
ATOM   7676  N  N     . VAL C 2  571  ? -47.657 -21.367 15.350  1.00 80.11  ? 571  VAL C N     1 
ATOM   7677  C  CA    . VAL C 2  571  ? -48.523 -21.391 16.528  1.00 83.62  ? 571  VAL C CA    1 
ATOM   7678  C  C     . VAL C 2  571  ? -49.825 -20.626 16.276  1.00 86.44  ? 571  VAL C C     1 
ATOM   7679  O  O     . VAL C 2  571  ? -49.796 -19.526 15.722  1.00 85.86  ? 571  VAL C O     1 
ATOM   7680  C  CB    . VAL C 2  571  ? -47.799 -20.800 17.768  1.00 86.32  ? 571  VAL C CB    1 
ATOM   7681  C  CG1   . VAL C 2  571  ? -48.781 -20.486 18.884  1.00 86.71  ? 571  VAL C CG1   1 
ATOM   7682  C  CG2   . VAL C 2  571  ? -46.715 -21.749 18.269  1.00 84.19  ? 571  VAL C CG2   1 
ATOM   7683  N  N     . PRO C 2  572  ? -50.973 -21.217 16.672  1.00 88.06  ? 572  PRO C N     1 
ATOM   7684  C  CA    . PRO C 2  572  ? -52.275 -20.552 16.537  1.00 83.75  ? 572  PRO C CA    1 
ATOM   7685  C  C     . PRO C 2  572  ? -52.286 -19.175 17.191  1.00 78.83  ? 572  PRO C C     1 
ATOM   7686  O  O     . PRO C 2  572  ? -51.665 -18.975 18.234  1.00 75.81  ? 572  PRO C O     1 
ATOM   7687  C  CB    . PRO C 2  572  ? -53.245 -21.508 17.249  1.00 81.54  ? 572  PRO C CB    1 
ATOM   7688  C  CG    . PRO C 2  572  ? -52.381 -22.421 18.063  1.00 83.73  ? 572  PRO C CG    1 
ATOM   7689  C  CD    . PRO C 2  572  ? -51.109 -22.549 17.285  1.00 86.83  ? 572  PRO C CD    1 
ATOM   7690  N  N     . SER C 2  573  ? -53.000 -18.242 16.571  1.00 76.85  ? 573  SER C N     1 
ATOM   7691  C  CA    . SER C 2  573  ? -52.967 -16.837 16.962  1.00 73.34  ? 573  SER C CA    1 
ATOM   7692  C  C     . SER C 2  573  ? -53.552 -16.567 18.350  1.00 72.80  ? 573  SER C C     1 
ATOM   7693  O  O     . SER C 2  573  ? -53.431 -15.457 18.869  1.00 71.38  ? 573  SER C O     1 
ATOM   7694  C  CB    . SER C 2  573  ? -53.705 -15.999 15.916  1.00 74.71  ? 573  SER C CB    1 
ATOM   7695  O  OG    . SER C 2  573  ? -53.688 -14.626 16.254  1.00 79.51  ? 573  SER C OG    1 
ATOM   7696  N  N     . SER C 2  574  ? -54.181 -17.574 18.949  1.00 74.15  ? 574  SER C N     1 
ATOM   7697  C  CA    . SER C 2  574  ? -54.765 -17.423 20.280  1.00 78.25  ? 574  SER C CA    1 
ATOM   7698  C  C     . SER C 2  574  ? -53.698 -17.479 21.363  1.00 80.64  ? 574  SER C C     1 
ATOM   7699  O  O     . SER C 2  574  ? -53.966 -17.180 22.528  1.00 88.73  ? 574  SER C O     1 
ATOM   7700  C  CB    . SER C 2  574  ? -55.819 -18.503 20.540  1.00 82.49  ? 574  SER C CB    1 
ATOM   7701  O  OG    . SER C 2  574  ? -57.011 -18.247 19.821  1.00 81.64  ? 574  SER C OG    1 
ATOM   7702  N  N     . GLU C 2  575  ? -52.489 -17.862 20.968  1.00 76.88  ? 575  GLU C N     1 
ATOM   7703  C  CA    . GLU C 2  575  ? -51.378 -18.015 21.901  1.00 84.23  ? 575  GLU C CA    1 
ATOM   7704  C  C     . GLU C 2  575  ? -50.313 -16.923 21.719  1.00 85.59  ? 575  GLU C C     1 
ATOM   7705  O  O     . GLU C 2  575  ? -49.305 -16.907 22.430  1.00 81.56  ? 575  GLU C O     1 
ATOM   7706  C  CB    . GLU C 2  575  ? -50.750 -19.401 21.733  1.00 85.56  ? 575  GLU C CB    1 
ATOM   7707  C  CG    . GLU C 2  575  ? -50.601 -20.199 23.019  1.00 88.16  ? 575  GLU C CG    1 
ATOM   7708  C  CD    . GLU C 2  575  ? -50.295 -21.663 22.755  1.00 93.84  ? 575  GLU C CD    1 
ATOM   7709  O  OE1   . GLU C 2  575  ? -51.198 -22.381 22.275  1.00 93.46  ? 575  GLU C OE1   1 
ATOM   7710  O  OE2   . GLU C 2  575  ? -49.152 -22.094 23.017  1.00 98.96  ? 575  GLU C OE2   1 
ATOM   7711  N  N     . VAL C 2  576  ? -50.543 -16.014 20.770  1.00 86.90  ? 576  VAL C N     1 
ATOM   7712  C  CA    . VAL C 2  576  ? -49.616 -14.913 20.493  1.00 74.64  ? 576  VAL C CA    1 
ATOM   7713  C  C     . VAL C 2  576  ? -49.668 -13.841 21.576  1.00 73.86  ? 576  VAL C C     1 
ATOM   7714  O  O     . VAL C 2  576  ? -50.670 -13.138 21.708  1.00 78.11  ? 576  VAL C O     1 
ATOM   7715  C  CB    . VAL C 2  576  ? -49.913 -14.241 19.131  1.00 71.24  ? 576  VAL C CB    1 
ATOM   7716  C  CG1   . VAL C 2  576  ? -49.056 -13.000 18.950  1.00 60.76  ? 576  VAL C CG1   1 
ATOM   7717  C  CG2   . VAL C 2  576  ? -49.677 -15.210 17.994  1.00 78.52  ? 576  VAL C CG2   1 
ATOM   7718  N  N     . ASP C 2  577  ? -48.590 -13.710 22.345  1.00 70.62  ? 577  ASP C N     1 
ATOM   7719  C  CA    . ASP C 2  577  ? -48.521 -12.703 23.406  1.00 70.10  ? 577  ASP C CA    1 
ATOM   7720  C  C     . ASP C 2  577  ? -48.103 -11.329 22.877  1.00 66.56  ? 577  ASP C C     1 
ATOM   7721  O  O     . ASP C 2  577  ? -48.807 -10.335 23.064  1.00 58.12  ? 577  ASP C O     1 
ATOM   7722  C  CB    . ASP C 2  577  ? -47.546 -13.143 24.504  1.00 67.57  ? 577  ASP C CB    1 
ATOM   7723  C  CG    . ASP C 2  577  ? -48.044 -14.343 25.286  1.00 69.67  ? 577  ASP C CG    1 
ATOM   7724  O  OD1   . ASP C 2  577  ? -49.276 -14.492 25.438  1.00 75.67  ? 577  ASP C OD1   1 
ATOM   7725  O  OD2   . ASP C 2  577  ? -47.199 -15.135 25.755  1.00 69.43  ? 577  ASP C OD2   1 
ATOM   7726  N  N     . TYR C 2  578  ? -46.940 -11.288 22.231  1.00 66.94  ? 578  TYR C N     1 
ATOM   7727  C  CA    . TYR C 2  578  ? -46.385 -10.053 21.692  1.00 60.93  ? 578  TYR C CA    1 
ATOM   7728  C  C     . TYR C 2  578  ? -45.923 -10.254 20.254  1.00 58.06  ? 578  TYR C C     1 
ATOM   7729  O  O     . TYR C 2  578  ? -45.836 -11.382 19.772  1.00 58.24  ? 578  TYR C O     1 
ATOM   7730  C  CB    . TYR C 2  578  ? -45.205 -9.566  22.537  1.00 60.31  ? 578  TYR C CB    1 
ATOM   7731  C  CG    . TYR C 2  578  ? -45.486 -9.413  24.014  1.00 60.61  ? 578  TYR C CG    1 
ATOM   7732  C  CD1   . TYR C 2  578  ? -46.252 -8.358  24.490  1.00 59.66  ? 578  TYR C CD1   1 
ATOM   7733  C  CD2   . TYR C 2  578  ? -44.958 -10.309 24.936  1.00 62.35  ? 578  TYR C CD2   1 
ATOM   7734  C  CE1   . TYR C 2  578  ? -46.501 -8.209  25.843  1.00 62.68  ? 578  TYR C CE1   1 
ATOM   7735  C  CE2   . TYR C 2  578  ? -45.199 -10.168 26.291  1.00 65.06  ? 578  TYR C CE2   1 
ATOM   7736  C  CZ    . TYR C 2  578  ? -45.971 -9.118  26.740  1.00 67.72  ? 578  TYR C CZ    1 
ATOM   7737  O  OH    . TYR C 2  578  ? -46.210 -8.981  28.089  1.00 72.20  ? 578  TYR C OH    1 
ATOM   7738  N  N     . MET C 2  579  ? -45.617 -9.155  19.576  1.00 55.72  ? 579  MET C N     1 
ATOM   7739  C  CA    . MET C 2  579  ? -45.030 -9.224  18.246  1.00 57.29  ? 579  MET C CA    1 
ATOM   7740  C  C     . MET C 2  579  ? -43.916 -8.188  18.113  1.00 57.94  ? 579  MET C C     1 
ATOM   7741  O  O     . MET C 2  579  ? -43.913 -7.182  18.826  1.00 55.96  ? 579  MET C O     1 
ATOM   7742  C  CB    . MET C 2  579  ? -46.090 -9.009  17.167  1.00 57.75  ? 579  MET C CB    1 
ATOM   7743  C  CG    . MET C 2  579  ? -46.321 -7.557  16.805  1.00 58.49  ? 579  MET C CG    1 
ATOM   7744  S  SD    . MET C 2  579  ? -47.264 -7.408  15.281  1.00 63.80  ? 579  MET C SD    1 
ATOM   7745  C  CE    . MET C 2  579  ? -46.301 -8.435  14.179  1.00 57.27  ? 579  MET C CE    1 
ATOM   7746  N  N     . ASP C 2  580  ? -42.965 -8.444  17.216  1.00 61.35  ? 580  ASP C N     1 
ATOM   7747  C  CA    . ASP C 2  580  ? -41.833 -7.540  17.023  1.00 53.84  ? 580  ASP C CA    1 
ATOM   7748  C  C     . ASP C 2  580  ? -42.336 -6.160  16.627  1.00 49.09  ? 580  ASP C C     1 
ATOM   7749  O  O     . ASP C 2  580  ? -43.308 -6.033  15.880  1.00 50.56  ? 580  ASP C O     1 
ATOM   7750  C  CB    . ASP C 2  580  ? -40.861 -8.078  15.961  1.00 54.06  ? 580  ASP C CB    1 
ATOM   7751  C  CG    . ASP C 2  580  ? -40.123 -9.335  16.411  1.00 55.72  ? 580  ASP C CG    1 
ATOM   7752  O  OD1   . ASP C 2  580  ? -39.728 -9.411  17.591  1.00 51.18  ? 580  ASP C OD1   1 
ATOM   7753  O  OD2   . ASP C 2  580  ? -39.934 -10.252 15.580  1.00 58.15  ? 580  ASP C OD2   1 
ATOM   7754  N  N     . VAL C 2  581  ? -41.683 -5.132  17.155  1.00 47.34  ? 581  VAL C N     1 
ATOM   7755  C  CA    . VAL C 2  581  ? -42.024 -3.758  16.823  1.00 47.38  ? 581  VAL C CA    1 
ATOM   7756  C  C     . VAL C 2  581  ? -41.789 -3.491  15.341  1.00 50.73  ? 581  VAL C C     1 
ATOM   7757  O  O     . VAL C 2  581  ? -42.714 -3.114  14.624  1.00 52.59  ? 581  VAL C O     1 
ATOM   7758  C  CB    . VAL C 2  581  ? -41.212 -2.760  17.672  1.00 47.09  ? 581  VAL C CB    1 
ATOM   7759  C  CG1   . VAL C 2  581  ? -41.032 -1.439  16.938  1.00 50.43  ? 581  VAL C CG1   1 
ATOM   7760  C  CG2   . VAL C 2  581  ? -41.892 -2.545  19.011  1.00 47.36  ? 581  VAL C CG2   1 
ATOM   7761  N  N     . SER C 2  582  ? -40.559 -3.716  14.883  1.00 50.24  ? 582  SER C N     1 
ATOM   7762  C  CA    . SER C 2  582  ? -40.187 -3.443  13.499  1.00 45.40  ? 582  SER C CA    1 
ATOM   7763  C  C     . SER C 2  582  ? -39.460 -4.651  12.897  1.00 43.63  ? 582  SER C C     1 
ATOM   7764  O  O     . SER C 2  582  ? -38.847 -5.433  13.624  1.00 42.23  ? 582  SER C O     1 
ATOM   7765  C  CB    . SER C 2  582  ? -39.316 -2.184  13.427  1.00 42.51  ? 582  SER C CB    1 
ATOM   7766  O  OG    . SER C 2  582  ? -39.313 -1.622  12.128  1.00 43.66  ? 582  SER C OG    1 
ATOM   7767  N  N     . PRO C 2  583  ? -39.553 -4.830  11.567  1.00 41.14  ? 583  PRO C N     1 
ATOM   7768  C  CA    . PRO C 2  583  ? -38.790 -5.915  10.934  1.00 40.16  ? 583  PRO C CA    1 
ATOM   7769  C  C     . PRO C 2  583  ? -37.294 -5.718  11.157  1.00 39.34  ? 583  PRO C C     1 
ATOM   7770  O  O     . PRO C 2  583  ? -36.573 -6.652  11.514  1.00 38.01  ? 583  PRO C O     1 
ATOM   7771  C  CB    . PRO C 2  583  ? -39.151 -5.785  9.451   1.00 41.50  ? 583  PRO C CB    1 
ATOM   7772  C  CG    . PRO C 2  583  ? -40.451 -5.039  9.433   1.00 43.93  ? 583  PRO C CG    1 
ATOM   7773  C  CD    . PRO C 2  583  ? -40.401 -4.107  10.602  1.00 41.27  ? 583  PRO C CD    1 
ATOM   7774  N  N     . ARG C 2  584  ? -36.858 -4.478  10.961  1.00 42.45  ? 584  ARG C N     1 
ATOM   7775  C  CA    . ARG C 2  584  ? -35.476 -4.058  11.148  1.00 40.65  ? 584  ARG C CA    1 
ATOM   7776  C  C     . ARG C 2  584  ? -35.096 -3.927  12.636  1.00 42.91  ? 584  ARG C C     1 
ATOM   7777  O  O     . ARG C 2  584  ? -34.495 -2.928  13.031  1.00 45.09  ? 584  ARG C O     1 
ATOM   7778  C  CB    . ARG C 2  584  ? -35.252 -2.716  10.420  1.00 35.07  ? 584  ARG C CB    1 
ATOM   7779  C  CG    . ARG C 2  584  ? -36.311 -1.652  10.769  1.00 35.78  ? 584  ARG C CG    1 
ATOM   7780  C  CD    . ARG C 2  584  ? -36.073 -0.285  10.129  1.00 37.90  ? 584  ARG C CD    1 
ATOM   7781  N  NE    . ARG C 2  584  ? -36.536 0.792   11.009  1.00 42.83  ? 584  ARG C NE    1 
ATOM   7782  C  CZ    . ARG C 2  584  ? -36.439 2.094   10.742  1.00 46.61  ? 584  ARG C CZ    1 
ATOM   7783  N  NH1   . ARG C 2  584  ? -35.901 2.511   9.605   1.00 45.16  ? 584  ARG C NH1   1 
ATOM   7784  N  NH2   . ARG C 2  584  ? -36.883 2.988   11.616  1.00 48.46  ? 584  ARG C NH2   1 
ATOM   7785  N  N     . GLN C 2  585  ? -35.428 -4.925  13.459  1.00 40.25  ? 585  GLN C N     1 
ATOM   7786  C  CA    . GLN C 2  585  ? -35.270 -4.786  14.917  1.00 40.33  ? 585  GLN C CA    1 
ATOM   7787  C  C     . GLN C 2  585  ? -34.027 -5.482  15.488  1.00 37.37  ? 585  GLN C C     1 
ATOM   7788  O  O     . GLN C 2  585  ? -33.476 -5.054  16.511  1.00 34.13  ? 585  GLN C O     1 
ATOM   7789  C  CB    . GLN C 2  585  ? -36.517 -5.309  15.636  1.00 40.35  ? 585  GLN C CB    1 
ATOM   7790  C  CG    . GLN C 2  585  ? -36.521 -5.050  17.140  1.00 38.86  ? 585  GLN C CG    1 
ATOM   7791  C  CD    . GLN C 2  585  ? -37.794 -5.517  17.816  1.00 44.70  ? 585  GLN C CD    1 
ATOM   7792  O  OE1   . GLN C 2  585  ? -38.867 -5.517  17.215  1.00 47.39  ? 585  GLN C OE1   1 
ATOM   7793  N  NE2   . GLN C 2  585  ? -37.677 -5.927  19.075  1.00 45.80  ? 585  GLN C NE2   1 
ATOM   7794  N  N     . MET C 2  586  ? -33.591 -6.549  14.827  1.00 35.87  ? 586  MET C N     1 
ATOM   7795  C  CA    . MET C 2  586  ? -32.414 -7.306  15.246  1.00 35.24  ? 586  MET C CA    1 
ATOM   7796  C  C     . MET C 2  586  ? -31.128 -6.555  14.939  1.00 34.15  ? 586  MET C C     1 
ATOM   7797  O  O     . MET C 2  586  ? -30.085 -6.836  15.527  1.00 34.99  ? 586  MET C O     1 
ATOM   7798  C  CB    . MET C 2  586  ? -32.387 -8.661  14.544  1.00 38.41  ? 586  MET C CB    1 
ATOM   7799  C  CG    . MET C 2  586  ? -32.422 -8.520  13.026  1.00 39.51  ? 586  MET C CG    1 
ATOM   7800  S  SD    . MET C 2  586  ? -32.329 -10.067 12.094  1.00 46.68  ? 586  MET C SD    1 
ATOM   7801  C  CE    . MET C 2  586  ? -30.560 -10.278 11.910  1.00 41.92  ? 586  MET C CE    1 
ATOM   7802  N  N     . VAL C 2  587  ? -31.220 -5.603  14.012  1.00 30.73  ? 587  VAL C N     1 
ATOM   7803  C  CA    . VAL C 2  587  ? -30.051 -4.933  13.453  1.00 28.14  ? 587  VAL C CA    1 
ATOM   7804  C  C     . VAL C 2  587  ? -29.547 -3.735  14.263  1.00 26.76  ? 587  VAL C C     1 
ATOM   7805  O  O     . VAL C 2  587  ? -30.259 -3.207  15.117  1.00 27.01  ? 587  VAL C O     1 
ATOM   7806  C  CB    . VAL C 2  587  ? -30.343 -4.437  12.024  1.00 25.81  ? 587  VAL C CB    1 
ATOM   7807  C  CG1   . VAL C 2  587  ? -31.150 -5.481  11.271  1.00 30.85  ? 587  VAL C CG1   1 
ATOM   7808  C  CG2   . VAL C 2  587  ? -31.091 -3.122  12.062  1.00 25.80  ? 587  VAL C CG2   1 
ATOM   7809  N  N     . SER C 2  588  ? -28.310 -3.317  13.993  1.00 25.63  ? 588  SER C N     1 
ATOM   7810  C  CA    . SER C 2  588  ? -27.774 -2.098  14.585  1.00 27.18  ? 588  SER C CA    1 
ATOM   7811  C  C     . SER C 2  588  ? -28.017 -0.926  13.644  1.00 27.11  ? 588  SER C C     1 
ATOM   7812  O  O     . SER C 2  588  ? -28.619 -1.095  12.575  1.00 26.30  ? 588  SER C O     1 
ATOM   7813  C  CB    . SER C 2  588  ? -26.278 -2.226  14.886  1.00 26.16  ? 588  SER C CB    1 
ATOM   7814  O  OG    . SER C 2  588  ? -25.492 -1.740  13.812  1.00 25.79  ? 588  SER C OG    1 
ATOM   7815  N  N     . VAL C 2  589  ? -27.543 0.253   14.047  1.00 25.26  ? 589  VAL C N     1 
ATOM   7816  C  CA    . VAL C 2  589  ? -27.773 1.478   13.293  1.00 22.86  ? 589  VAL C CA    1 
ATOM   7817  C  C     . VAL C 2  589  ? -26.986 1.466   11.993  1.00 23.06  ? 589  VAL C C     1 
ATOM   7818  O  O     . VAL C 2  589  ? -27.470 1.922   10.954  1.00 23.48  ? 589  VAL C O     1 
ATOM   7819  C  CB    . VAL C 2  589  ? -27.382 2.716   14.101  1.00 21.72  ? 589  VAL C CB    1 
ATOM   7820  C  CG1   . VAL C 2  589  ? -28.069 3.949   13.543  1.00 22.06  ? 589  VAL C CG1   1 
ATOM   7821  C  CG2   . VAL C 2  589  ? -27.751 2.524   15.565  1.00 25.05  ? 589  VAL C CG2   1 
ATOM   7822  N  N     . ALA C 2  590  ? -25.770 0.932   12.066  1.00 24.55  ? 590  ALA C N     1 
ATOM   7823  C  CA    . ALA C 2  590  ? -24.904 0.793   10.904  1.00 25.02  ? 590  ALA C CA    1 
ATOM   7824  C  C     . ALA C 2  590  ? -25.495 -0.196  9.919   1.00 25.16  ? 590  ALA C C     1 
ATOM   7825  O  O     . ALA C 2  590  ? -25.665 0.111   8.738   1.00 24.70  ? 590  ALA C O     1 
ATOM   7826  C  CB    . ALA C 2  590  ? -23.513 0.353   11.329  1.00 24.34  ? 590  ALA C CB    1 
ATOM   7827  N  N     . THR C 2  591  ? -25.808 -1.381  10.429  1.00 25.83  ? 591  THR C N     1 
ATOM   7828  C  CA    . THR C 2  591  ? -26.331 -2.478  9.624   1.00 25.89  ? 591  THR C CA    1 
ATOM   7829  C  C     . THR C 2  591  ? -27.586 -2.053  8.870   1.00 24.43  ? 591  THR C C     1 
ATOM   7830  O  O     . THR C 2  591  ? -27.783 -2.405  7.706   1.00 22.56  ? 591  THR C O     1 
ATOM   7831  C  CB    . THR C 2  591  ? -26.646 -3.707  10.506  1.00 27.83  ? 591  THR C CB    1 
ATOM   7832  O  OG1   . THR C 2  591  ? -25.578 -3.916  11.443  1.00 28.89  ? 591  THR C OG1   1 
ATOM   7833  C  CG2   . THR C 2  591  ? -26.824 -4.951  9.651   1.00 26.82  ? 591  THR C CG2   1 
ATOM   7834  N  N     . ALA C 2  592  ? -28.411 -1.260  9.544   1.00 24.08  ? 592  ALA C N     1 
ATOM   7835  C  CA    . ALA C 2  592  ? -29.694 -0.819  9.013   1.00 24.65  ? 592  ALA C CA    1 
ATOM   7836  C  C     . ALA C 2  592  ? -29.566 0.139   7.830   1.00 23.93  ? 592  ALA C C     1 
ATOM   7837  O  O     . ALA C 2  592  ? -30.574 0.554   7.256   1.00 24.20  ? 592  ALA C O     1 
ATOM   7838  C  CB    . ALA C 2  592  ? -30.504 -0.169  10.119  1.00 27.10  ? 592  ALA C CB    1 
ATOM   7839  N  N     . MET C 2  593  ? -28.336 0.493   7.468   1.00 23.89  ? 593  MET C N     1 
ATOM   7840  C  CA    . MET C 2  593  ? -28.106 1.452   6.390   1.00 24.26  ? 593  MET C CA    1 
ATOM   7841  C  C     . MET C 2  593  ? -27.662 0.784   5.098   1.00 24.68  ? 593  MET C C     1 
ATOM   7842  O  O     . MET C 2  593  ? -27.325 1.463   4.125   1.00 24.28  ? 593  MET C O     1 
ATOM   7843  C  CB    . MET C 2  593  ? -27.069 2.484   6.812   1.00 23.96  ? 593  MET C CB    1 
ATOM   7844  C  CG    . MET C 2  593  ? -27.637 3.616   7.636   1.00 25.74  ? 593  MET C CG    1 
ATOM   7845  S  SD    . MET C 2  593  ? -26.343 4.758   8.132   1.00 23.55  ? 593  MET C SD    1 
ATOM   7846  C  CE    . MET C 2  593  ? -25.619 3.878   9.501   1.00 23.77  ? 593  MET C CE    1 
ATOM   7847  N  N     . ILE C 2  594  ? -27.659 -0.547  5.107   1.00 24.20  ? 594  ILE C N     1 
ATOM   7848  C  CA    . ILE C 2  594  ? -27.330 -1.340  3.929   1.00 24.95  ? 594  ILE C CA    1 
ATOM   7849  C  C     . ILE C 2  594  ? -28.595 -1.734  3.175   1.00 25.75  ? 594  ILE C C     1 
ATOM   7850  O  O     . ILE C 2  594  ? -29.303 -2.652  3.595   1.00 26.26  ? 594  ILE C O     1 
ATOM   7851  C  CB    . ILE C 2  594  ? -26.559 -2.620  4.306   1.00 25.00  ? 594  ILE C CB    1 
ATOM   7852  C  CG1   . ILE C 2  594  ? -25.360 -2.290  5.204   1.00 25.48  ? 594  ILE C CG1   1 
ATOM   7853  C  CG2   . ILE C 2  594  ? -26.141 -3.373  3.051   1.00 27.51  ? 594  ILE C CG2   1 
ATOM   7854  C  CD1   . ILE C 2  594  ? -24.473 -3.487  5.525   1.00 25.47  ? 594  ILE C CD1   1 
ATOM   7855  N  N     . PRO C 2  595  ? -28.883 -1.043  2.057   1.00 24.30  ? 595  PRO C N     1 
ATOM   7856  C  CA    . PRO C 2  595  ? -30.090 -1.303  1.267   1.00 25.44  ? 595  PRO C CA    1 
ATOM   7857  C  C     . PRO C 2  595  ? -30.076 -2.714  0.708   1.00 29.54  ? 595  PRO C C     1 
ATOM   7858  O  O     . PRO C 2  595  ? -29.013 -3.180  0.297   1.00 30.93  ? 595  PRO C O     1 
ATOM   7859  C  CB    . PRO C 2  595  ? -30.013 -0.260  0.148   1.00 25.81  ? 595  PRO C CB    1 
ATOM   7860  C  CG    . PRO C 2  595  ? -28.573 0.025   0.013   1.00 26.88  ? 595  PRO C CG    1 
ATOM   7861  C  CD    . PRO C 2  595  ? -28.021 -0.042  1.409   1.00 26.29  ? 595  PRO C CD    1 
ATOM   7862  N  N     . PHE C 2  596  ? -31.232 -3.373  0.706   1.00 33.70  ? 596  PHE C N     1 
ATOM   7863  C  CA    . PHE C 2  596  ? -31.344 -4.766  0.276   1.00 35.99  ? 596  PHE C CA    1 
ATOM   7864  C  C     . PHE C 2  596  ? -30.420 -5.677  1.100   1.00 32.56  ? 596  PHE C C     1 
ATOM   7865  O  O     . PHE C 2  596  ? -29.726 -6.528  0.543   1.00 34.09  ? 596  PHE C O     1 
ATOM   7866  C  CB    . PHE C 2  596  ? -31.031 -4.906  -1.231  1.00 36.92  ? 596  PHE C CB    1 
ATOM   7867  C  CG    . PHE C 2  596  ? -31.889 -4.038  -2.133  1.00 34.55  ? 596  PHE C CG    1 
ATOM   7868  C  CD1   . PHE C 2  596  ? -33.153 -4.452  -2.523  1.00 35.18  ? 596  PHE C CD1   1 
ATOM   7869  C  CD2   . PHE C 2  596  ? -31.413 -2.824  -2.615  1.00 32.03  ? 596  PHE C CD2   1 
ATOM   7870  C  CE1   . PHE C 2  596  ? -33.934 -3.667  -3.357  1.00 36.86  ? 596  PHE C CE1   1 
ATOM   7871  C  CE2   . PHE C 2  596  ? -32.191 -2.036  -3.451  1.00 31.11  ? 596  PHE C CE2   1 
ATOM   7872  C  CZ    . PHE C 2  596  ? -33.452 -2.460  -3.821  1.00 31.88  ? 596  PHE C CZ    1 
ATOM   7873  N  N     . LEU C 2  597  ? -30.419 -5.496  2.420   1.00 30.03  ? 597  LEU C N     1 
ATOM   7874  C  CA    . LEU C 2  597  ? -29.580 -6.306  3.305   1.00 32.55  ? 597  LEU C CA    1 
ATOM   7875  C  C     . LEU C 2  597  ? -29.929 -7.788  3.206   1.00 36.96  ? 597  LEU C C     1 
ATOM   7876  O  O     . LEU C 2  597  ? -29.043 -8.643  3.230   1.00 38.04  ? 597  LEU C O     1 
ATOM   7877  C  CB    . LEU C 2  597  ? -29.707 -5.843  4.767   1.00 32.76  ? 597  LEU C CB    1 
ATOM   7878  C  CG    . LEU C 2  597  ? -28.997 -6.708  5.825   1.00 31.41  ? 597  LEU C CG    1 
ATOM   7879  C  CD1   . LEU C 2  597  ? -27.503 -6.790  5.548   1.00 31.91  ? 597  LEU C CD1   1 
ATOM   7880  C  CD2   . LEU C 2  597  ? -29.251 -6.223  7.252   1.00 29.31  ? 597  LEU C CD2   1 
ATOM   7881  N  N     . GLU C 2  598  ? -31.218 -8.090  3.065   1.00 38.17  ? 598  GLU C N     1 
ATOM   7882  C  CA    . GLU C 2  598  ? -31.676 -9.479  3.093   1.00 39.91  ? 598  GLU C CA    1 
ATOM   7883  C  C     . GLU C 2  598  ? -31.238 -10.235 1.843   1.00 40.27  ? 598  GLU C C     1 
ATOM   7884  O  O     . GLU C 2  598  ? -31.572 -11.405 1.661   1.00 45.57  ? 598  GLU C O     1 
ATOM   7885  C  CB    . GLU C 2  598  ? -33.201 -9.547  3.256   1.00 45.31  ? 598  GLU C CB    1 
ATOM   7886  C  CG    . GLU C 2  598  ? -34.016 -9.051  2.060   1.00 49.78  ? 598  GLU C CG    1 
ATOM   7887  C  CD    . GLU C 2  598  ? -34.976 -7.919  2.421   1.00 51.28  ? 598  GLU C CD    1 
ATOM   7888  O  OE1   . GLU C 2  598  ? -34.667 -7.156  3.361   1.00 49.31  ? 598  GLU C OE1   1 
ATOM   7889  O  OE2   . GLU C 2  598  ? -36.034 -7.791  1.762   1.00 52.39  ? 598  GLU C OE2   1 
ATOM   7890  N  N     . HIS C 2  599  ? -30.474 -9.555  0.994   1.00 39.59  ? 599  HIS C N     1 
ATOM   7891  C  CA    . HIS C 2  599  ? -30.005 -10.115 -0.264  1.00 43.59  ? 599  HIS C CA    1 
ATOM   7892  C  C     . HIS C 2  599  ? -28.504 -10.401 -0.225  1.00 40.08  ? 599  HIS C C     1 
ATOM   7893  O  O     . HIS C 2  599  ? -27.954 -11.007 -1.146  1.00 41.05  ? 599  HIS C O     1 
ATOM   7894  C  CB    . HIS C 2  599  ? -30.339 -9.163  -1.420  1.00 44.77  ? 599  HIS C CB    1 
ATOM   7895  C  CG    . HIS C 2  599  ? -31.809 -9.021  -1.684  1.00 47.88  ? 599  HIS C CG    1 
ATOM   7896  N  ND1   . HIS C 2  599  ? -32.537 -9.972  -2.366  1.00 49.39  ? 599  HIS C ND1   1 
ATOM   7897  C  CD2   . HIS C 2  599  ? -32.682 -8.038  -1.361  1.00 46.16  ? 599  HIS C CD2   1 
ATOM   7898  C  CE1   . HIS C 2  599  ? -33.798 -9.583  -2.449  1.00 47.91  ? 599  HIS C CE1   1 
ATOM   7899  N  NE2   . HIS C 2  599  ? -33.912 -8.413  -1.848  1.00 46.04  ? 599  HIS C NE2   1 
ATOM   7900  N  N     . ASP C 2  600  ? -27.842 -9.966  0.843   1.00 37.46  ? 600  ASP C N     1 
ATOM   7901  C  CA    . ASP C 2  600  ? -26.396 -10.145 0.959   1.00 35.48  ? 600  ASP C CA    1 
ATOM   7902  C  C     . ASP C 2  600  ? -26.042 -11.195 1.985   1.00 37.01  ? 600  ASP C C     1 
ATOM   7903  O  O     . ASP C 2  600  ? -26.719 -11.334 3.001   1.00 37.58  ? 600  ASP C O     1 
ATOM   7904  C  CB    . ASP C 2  600  ? -25.710 -8.839  1.338   1.00 34.67  ? 600  ASP C CB    1 
ATOM   7905  C  CG    . ASP C 2  600  ? -25.920 -7.756  0.312   1.00 37.07  ? 600  ASP C CG    1 
ATOM   7906  O  OD1   . ASP C 2  600  ? -26.233 -8.097  -0.848  1.00 38.85  ? 600  ASP C OD1   1 
ATOM   7907  O  OD2   . ASP C 2  600  ? -25.774 -6.566  0.665   1.00 35.64  ? 600  ASP C OD2   1 
ATOM   7908  N  N     . ASP C 2  601  ? -24.967 -11.924 1.721   1.00 38.36  ? 601  ASP C N     1 
ATOM   7909  C  CA    . ASP C 2  601  ? -24.508 -12.928 2.659   1.00 39.76  ? 601  ASP C CA    1 
ATOM   7910  C  C     . ASP C 2  601  ? -23.982 -12.222 3.892   1.00 35.14  ? 601  ASP C C     1 
ATOM   7911  O  O     . ASP C 2  601  ? -23.393 -11.147 3.793   1.00 34.71  ? 601  ASP C O     1 
ATOM   7912  C  CB    . ASP C 2  601  ? -23.435 -13.818 2.034   1.00 43.06  ? 601  ASP C CB    1 
ATOM   7913  C  CG    . ASP C 2  601  ? -23.395 -15.199 2.657   1.00 49.05  ? 601  ASP C CG    1 
ATOM   7914  O  OD1   . ASP C 2  601  ? -23.500 -16.196 1.910   1.00 51.00  ? 601  ASP C OD1   1 
ATOM   7915  O  OD2   . ASP C 2  601  ? -23.268 -15.283 3.897   1.00 51.73  ? 601  ASP C OD2   1 
ATOM   7916  N  N     . ALA C 2  602  ? -24.209 -12.818 5.056   1.00 33.64  ? 602  ALA C N     1 
ATOM   7917  C  CA    . ALA C 2  602  ? -23.795 -12.200 6.308   1.00 35.02  ? 602  ALA C CA    1 
ATOM   7918  C  C     . ALA C 2  602  ? -22.300 -11.893 6.306   1.00 36.31  ? 602  ALA C C     1 
ATOM   7919  O  O     . ALA C 2  602  ? -21.862 -10.942 6.945   1.00 35.94  ? 602  ALA C O     1 
ATOM   7920  C  CB    . ALA C 2  602  ? -24.156 -13.087 7.477   1.00 40.26  ? 602  ALA C CB    1 
ATOM   7921  N  N     . ASN C 2  603  ? -21.534 -12.695 5.567   1.00 38.67  ? 603  ASN C N     1 
ATOM   7922  C  CA    . ASN C 2  603  ? -20.086 -12.527 5.450   1.00 39.36  ? 603  ASN C CA    1 
ATOM   7923  C  C     . ASN C 2  603  ? -19.661 -11.171 4.883   1.00 39.81  ? 603  ASN C C     1 
ATOM   7924  O  O     . ASN C 2  603  ? -18.749 -10.531 5.413   1.00 43.54  ? 603  ASN C O     1 
ATOM   7925  C  CB    . ASN C 2  603  ? -19.498 -13.644 4.583   1.00 41.82  ? 603  ASN C CB    1 
ATOM   7926  C  CG    . ASN C 2  603  ? -19.498 -14.990 5.286   1.00 51.84  ? 603  ASN C CG    1 
ATOM   7927  O  OD1   . ASN C 2  603  ? -18.678 -15.238 6.168   1.00 53.95  ? 603  ASN C OD1   1 
ATOM   7928  N  ND2   . ASN C 2  603  ? -20.416 -15.869 4.894   1.00 54.92  ? 603  ASN C ND2   1 
ATOM   7929  N  N     . ARG C 2  604  ? -20.316 -10.739 3.808   1.00 34.79  ? 604  ARG C N     1 
ATOM   7930  C  CA    . ARG C 2  604  ? -19.980 -9.468  3.172   1.00 29.38  ? 604  ARG C CA    1 
ATOM   7931  C  C     . ARG C 2  604  ? -20.872 -8.356  3.706   1.00 26.95  ? 604  ARG C C     1 
ATOM   7932  O  O     . ARG C 2  604  ? -20.529 -7.178  3.629   1.00 25.35  ? 604  ARG C O     1 
ATOM   7933  C  CB    . ARG C 2  604  ? -20.108 -9.577  1.653   1.00 30.34  ? 604  ARG C CB    1 
ATOM   7934  C  CG    . ARG C 2  604  ? -19.489 -10.837 1.085   1.00 34.89  ? 604  ARG C CG    1 
ATOM   7935  C  CD    . ARG C 2  604  ? -18.021 -10.907 1.420   1.00 35.47  ? 604  ARG C CD    1 
ATOM   7936  N  NE    . ARG C 2  604  ? -17.254 -9.964  0.617   1.00 36.69  ? 604  ARG C NE    1 
ATOM   7937  C  CZ    . ARG C 2  604  ? -16.136 -10.282 -0.026  1.00 43.89  ? 604  ARG C CZ    1 
ATOM   7938  N  NH1   . ARG C 2  604  ? -15.655 -11.517 0.058   1.00 46.69  ? 604  ARG C NH1   1 
ATOM   7939  N  NH2   . ARG C 2  604  ? -15.497 -9.369  -0.747  1.00 45.14  ? 604  ARG C NH2   1 
ATOM   7940  N  N     . ALA C 2  605  ? -22.021 -8.742  4.249   1.00 27.37  ? 605  ALA C N     1 
ATOM   7941  C  CA    . ALA C 2  605  ? -22.905 -7.791  4.902   1.00 26.77  ? 605  ALA C CA    1 
ATOM   7942  C  C     . ALA C 2  605  ? -22.241 -7.300  6.172   1.00 26.33  ? 605  ALA C C     1 
ATOM   7943  O  O     . ALA C 2  605  ? -22.451 -6.172  6.609   1.00 25.69  ? 605  ALA C O     1 
ATOM   7944  C  CB    . ALA C 2  605  ? -24.244 -8.422  5.213   1.00 31.26  ? 605  ALA C CB    1 
ATOM   7945  N  N     . LEU C 2  606  ? -21.439 -8.175  6.760   1.00 27.36  ? 606  LEU C N     1 
ATOM   7946  C  CA    . LEU C 2  606  ? -20.676 -7.839  7.946   1.00 28.40  ? 606  LEU C CA    1 
ATOM   7947  C  C     . LEU C 2  606  ? -19.600 -6.809  7.606   1.00 29.66  ? 606  LEU C C     1 
ATOM   7948  O  O     . LEU C 2  606  ? -19.485 -5.778  8.274   1.00 30.11  ? 606  LEU C O     1 
ATOM   7949  C  CB    . LEU C 2  606  ? -20.057 -9.099  8.543   1.00 26.60  ? 606  LEU C CB    1 
ATOM   7950  C  CG    . LEU C 2  606  ? -19.222 -9.004  9.810   1.00 26.59  ? 606  LEU C CG    1 
ATOM   7951  C  CD1   . LEU C 2  606  ? -19.485 -10.235 10.641  1.00 29.72  ? 606  LEU C CD1   1 
ATOM   7952  C  CD2   . LEU C 2  606  ? -17.742 -8.896  9.468   1.00 31.13  ? 606  LEU C CD2   1 
ATOM   7953  N  N     . MET C 2  607  ? -18.816 -7.087  6.568   1.00 29.18  ? 607  MET C N     1 
ATOM   7954  C  CA    . MET C 2  607  ? -17.805 -6.143  6.106   1.00 27.28  ? 607  MET C CA    1 
ATOM   7955  C  C     . MET C 2  607  ? -18.461 -4.815  5.728   1.00 26.70  ? 607  MET C C     1 
ATOM   7956  O  O     . MET C 2  607  ? -18.036 -3.758  6.189   1.00 25.23  ? 607  MET C O     1 
ATOM   7957  C  CB    . MET C 2  607  ? -17.028 -6.710  4.912   1.00 30.74  ? 607  MET C CB    1 
ATOM   7958  C  CG    . MET C 2  607  ? -16.371 -8.063  5.144   1.00 29.83  ? 607  MET C CG    1 
ATOM   7959  S  SD    . MET C 2  607  ? -15.378 -8.543  3.717   1.00 22.92  ? 607  MET C SD    1 
ATOM   7960  C  CE    . MET C 2  607  ? -15.061 -10.268 4.071   1.00 34.93  ? 607  MET C CE    1 
ATOM   7961  N  N     . GLY C 2  608  ? -19.506 -4.886  4.904   1.00 25.56  ? 608  GLY C N     1 
ATOM   7962  C  CA    . GLY C 2  608  ? -20.250 -3.711  4.482   1.00 25.81  ? 608  GLY C CA    1 
ATOM   7963  C  C     . GLY C 2  608  ? -20.687 -2.840  5.646   1.00 26.60  ? 608  GLY C C     1 
ATOM   7964  O  O     . GLY C 2  608  ? -20.753 -1.611  5.539   1.00 26.73  ? 608  GLY C O     1 
ATOM   7965  N  N     . ALA C 2  609  ? -20.978 -3.487  6.770   1.00 26.00  ? 609  ALA C N     1 
ATOM   7966  C  CA    . ALA C 2  609  ? -21.321 -2.791  8.003   1.00 27.57  ? 609  ALA C CA    1 
ATOM   7967  C  C     . ALA C 2  609  ? -20.093 -2.115  8.603   1.00 27.94  ? 609  ALA C C     1 
ATOM   7968  O  O     . ALA C 2  609  ? -20.100 -0.912  8.878   1.00 28.22  ? 609  ALA C O     1 
ATOM   7969  C  CB    . ALA C 2  609  ? -21.932 -3.761  9.004   1.00 27.97  ? 609  ALA C CB    1 
ATOM   7970  N  N     . ASN C 2  610  ? -19.039 -2.900  8.793   1.00 26.32  ? 610  ASN C N     1 
ATOM   7971  C  CA    . ASN C 2  610  ? -17.817 -2.413  9.416   1.00 26.79  ? 610  ASN C CA    1 
ATOM   7972  C  C     . ASN C 2  610  ? -17.153 -1.295  8.616   1.00 26.27  ? 610  ASN C C     1 
ATOM   7973  O  O     . ASN C 2  610  ? -16.461 -0.447  9.180   1.00 27.32  ? 610  ASN C O     1 
ATOM   7974  C  CB    . ASN C 2  610  ? -16.829 -3.570  9.613   1.00 29.62  ? 610  ASN C CB    1 
ATOM   7975  C  CG    . ASN C 2  610  ? -17.313 -4.591  10.632  1.00 28.86  ? 610  ASN C CG    1 
ATOM   7976  O  OD1   . ASN C 2  610  ? -18.066 -4.261  11.551  1.00 26.68  ? 610  ASN C OD1   1 
ATOM   7977  N  ND2   . ASN C 2  610  ? -16.874 -5.835  10.477  1.00 30.09  ? 610  ASN C ND2   1 
ATOM   7978  N  N     . MET C 2  611  ? -17.386 -1.288  7.305   1.00 26.81  ? 611  MET C N     1 
ATOM   7979  C  CA    . MET C 2  611  ? -16.681 -0.385  6.391   1.00 27.49  ? 611  MET C CA    1 
ATOM   7980  C  C     . MET C 2  611  ? -17.278 1.015   6.287   1.00 25.91  ? 611  MET C C     1 
ATOM   7981  O  O     . MET C 2  611  ? -16.578 1.962   5.922   1.00 24.74  ? 611  MET C O     1 
ATOM   7982  C  CB    . MET C 2  611  ? -16.623 -0.991  4.991   1.00 27.01  ? 611  MET C CB    1 
ATOM   7983  C  CG    . MET C 2  611  ? -15.686 -2.172  4.851   1.00 26.64  ? 611  MET C CG    1 
ATOM   7984  S  SD    . MET C 2  611  ? -15.668 -2.734  3.143   1.00 26.20  ? 611  MET C SD    1 
ATOM   7985  C  CE    . MET C 2  611  ? -17.364 -2.408  2.667   1.00 23.87  ? 611  MET C CE    1 
ATOM   7986  N  N     . GLN C 2  612  ? -18.567 1.145   6.581   1.00 25.08  ? 612  GLN C N     1 
ATOM   7987  C  CA    . GLN C 2  612  ? -19.213 2.450   6.541   1.00 24.61  ? 612  GLN C CA    1 
ATOM   7988  C  C     . GLN C 2  612  ? -18.570 3.406   7.542   1.00 24.92  ? 612  GLN C C     1 
ATOM   7989  O  O     . GLN C 2  612  ? -18.433 4.602   7.282   1.00 26.47  ? 612  GLN C O     1 
ATOM   7990  C  CB    . GLN C 2  612  ? -20.702 2.314   6.822   1.00 24.00  ? 612  GLN C CB    1 
ATOM   7991  C  CG    . GLN C 2  612  ? -21.468 1.592   5.745   1.00 23.11  ? 612  GLN C CG    1 
ATOM   7992  C  CD    . GLN C 2  612  ? -22.923 1.474   6.098   1.00 23.14  ? 612  GLN C CD    1 
ATOM   7993  O  OE1   . GLN C 2  612  ? -23.347 0.485   6.692   1.00 24.27  ? 612  GLN C OE1   1 
ATOM   7994  N  NE2   . GLN C 2  612  ? -23.701 2.496   5.759   1.00 22.16  ? 612  GLN C NE2   1 
ATOM   7995  N  N     . ARG C 2  613  ? -18.158 2.864   8.683   1.00 25.11  ? 613  ARG C N     1 
ATOM   7996  C  CA    . ARG C 2  613  ? -17.464 3.656   9.686   1.00 24.49  ? 613  ARG C CA    1 
ATOM   7997  C  C     . ARG C 2  613  ? -16.026 3.926   9.256   1.00 24.65  ? 613  ARG C C     1 
ATOM   7998  O  O     . ARG C 2  613  ? -15.296 4.635   9.940   1.00 25.32  ? 613  ARG C O     1 
ATOM   7999  C  CB    . ARG C 2  613  ? -17.477 2.950   11.041  1.00 26.62  ? 613  ARG C CB    1 
ATOM   8000  C  CG    . ARG C 2  613  ? -18.661 2.027   11.268  1.00 28.35  ? 613  ARG C CG    1 
ATOM   8001  C  CD    . ARG C 2  613  ? -18.561 1.368   12.638  1.00 32.23  ? 613  ARG C CD    1 
ATOM   8002  N  NE    . ARG C 2  613  ? -17.244 0.768   12.861  1.00 35.90  ? 613  ARG C NE    1 
ATOM   8003  C  CZ    . ARG C 2  613  ? -17.012 -0.541  12.921  1.00 37.99  ? 613  ARG C CZ    1 
ATOM   8004  N  NH1   . ARG C 2  613  ? -18.014 -1.404  12.792  1.00 34.24  ? 613  ARG C NH1   1 
ATOM   8005  N  NH2   . ARG C 2  613  ? -15.777 -0.988  13.120  1.00 37.68  ? 613  ARG C NH2   1 
ATOM   8006  N  N     . GLN C 2  614  ? -15.616 3.346   8.132   1.00 22.81  ? 614  GLN C N     1 
ATOM   8007  C  CA    . GLN C 2  614  ? -14.277 3.583   7.608   1.00 23.84  ? 614  GLN C CA    1 
ATOM   8008  C  C     . GLN C 2  614  ? -14.280 4.628   6.496   1.00 24.91  ? 614  GLN C C     1 
ATOM   8009  O  O     . GLN C 2  614  ? -13.224 4.958   5.958   1.00 26.45  ? 614  GLN C O     1 
ATOM   8010  C  CB    . GLN C 2  614  ? -13.653 2.290   7.082   1.00 24.45  ? 614  GLN C CB    1 
ATOM   8011  C  CG    . GLN C 2  614  ? -13.361 1.233   8.138   1.00 26.81  ? 614  GLN C CG    1 
ATOM   8012  C  CD    . GLN C 2  614  ? -12.701 -0.023  7.557   1.00 30.08  ? 614  GLN C CD    1 
ATOM   8013  O  OE1   . GLN C 2  614  ? -12.552 -0.161  6.338   1.00 31.12  ? 614  GLN C OE1   1 
ATOM   8014  N  NE2   . GLN C 2  614  ? -12.303 -0.941  8.434   1.00 29.60  ? 614  GLN C NE2   1 
ATOM   8015  N  N     . ALA C 2  615  ? -15.457 5.146   6.153   1.00 21.68  ? 615  ALA C N     1 
ATOM   8016  C  CA    . ALA C 2  615  ? -15.575 6.125   5.069   1.00 24.41  ? 615  ALA C CA    1 
ATOM   8017  C  C     . ALA C 2  615  ? -14.955 7.478   5.432   1.00 23.12  ? 615  ALA C C     1 
ATOM   8018  O  O     . ALA C 2  615  ? -14.843 7.828   6.604   1.00 24.15  ? 615  ALA C O     1 
ATOM   8019  C  CB    . ALA C 2  615  ? -17.028 6.300   4.675   1.00 25.29  ? 615  ALA C CB    1 
ATOM   8020  N  N     . VAL C 2  616  ? -14.554 8.233   4.414   1.00 22.81  ? 616  VAL C N     1 
ATOM   8021  C  CA    . VAL C 2  616  ? -13.866 9.506   4.622   1.00 24.34  ? 616  VAL C CA    1 
ATOM   8022  C  C     . VAL C 2  616  ? -14.714 10.661  4.104   1.00 25.16  ? 616  VAL C C     1 
ATOM   8023  O  O     . VAL C 2  616  ? -15.257 10.584  3.002   1.00 26.10  ? 616  VAL C O     1 
ATOM   8024  C  CB    . VAL C 2  616  ? -12.483 9.529   3.917   1.00 25.61  ? 616  VAL C CB    1 
ATOM   8025  C  CG1   . VAL C 2  616  ? -11.782 10.865  4.125   1.00 26.75  ? 616  VAL C CG1   1 
ATOM   8026  C  CG2   . VAL C 2  616  ? -11.609 8.395   4.414   1.00 28.17  ? 616  VAL C CG2   1 
ATOM   8027  N  N     . PRO C 2  617  ? -14.836 11.734  4.903   1.00 23.45  ? 617  PRO C N     1 
ATOM   8028  C  CA    . PRO C 2  617  ? -15.566 12.950  4.517   1.00 25.49  ? 617  PRO C CA    1 
ATOM   8029  C  C     . PRO C 2  617  ? -15.001 13.659  3.286   1.00 26.77  ? 617  PRO C C     1 
ATOM   8030  O  O     . PRO C 2  617  ? -13.837 14.076  3.263   1.00 27.88  ? 617  PRO C O     1 
ATOM   8031  C  CB    . PRO C 2  617  ? -15.441 13.841  5.758   1.00 27.91  ? 617  PRO C CB    1 
ATOM   8032  C  CG    . PRO C 2  617  ? -14.287 13.273  6.533   1.00 26.32  ? 617  PRO C CG    1 
ATOM   8033  C  CD    . PRO C 2  617  ? -14.352 11.807  6.290   1.00 24.72  ? 617  PRO C CD    1 
ATOM   8034  N  N     . LEU C 2  618  ? -15.847 13.800  2.271   1.00 26.75  ? 618  LEU C N     1 
ATOM   8035  C  CA    . LEU C 2  618  ? -15.448 14.409  1.012   1.00 29.73  ? 618  LEU C CA    1 
ATOM   8036  C  C     . LEU C 2  618  ? -15.740 15.902  1.013   1.00 33.76  ? 618  LEU C C     1 
ATOM   8037  O  O     . LEU C 2  618  ? -16.624 16.358  1.742   1.00 34.21  ? 618  LEU C O     1 
ATOM   8038  C  CB    . LEU C 2  618  ? -16.167 13.731  -0.152  1.00 29.60  ? 618  LEU C CB    1 
ATOM   8039  C  CG    . LEU C 2  618  ? -16.097 12.201  -0.153  1.00 26.89  ? 618  LEU C CG    1 
ATOM   8040  C  CD1   . LEU C 2  618  ? -16.859 11.624  -1.337  1.00 29.42  ? 618  LEU C CD1   1 
ATOM   8041  C  CD2   . LEU C 2  618  ? -14.653 11.722  -0.152  1.00 28.16  ? 618  LEU C CD2   1 
ATOM   8042  N  N     . VAL C 2  619  ? -14.993 16.637  0.185   1.00 34.75  ? 619  VAL C N     1 
ATOM   8043  C  CA    . VAL C 2  619  ? -15.073 18.099  0.074   1.00 38.42  ? 619  VAL C CA    1 
ATOM   8044  C  C     . VAL C 2  619  ? -16.499 18.641  0.217   1.00 42.47  ? 619  VAL C C     1 
ATOM   8045  O  O     . VAL C 2  619  ? -16.732 19.630  0.914   1.00 47.37  ? 619  VAL C O     1 
ATOM   8046  C  CB    . VAL C 2  619  ? -14.489 18.579  -1.274  1.00 37.41  ? 619  VAL C CB    1 
ATOM   8047  C  CG1   . VAL C 2  619  ? -14.558 20.101  -1.389  1.00 39.72  ? 619  VAL C CG1   1 
ATOM   8048  C  CG2   . VAL C 2  619  ? -13.056 18.100  -1.422  1.00 34.00  ? 619  VAL C CG2   1 
ATOM   8049  N  N     . ARG C 2  620  ? -17.448 17.987  -0.442  1.00 39.09  ? 620  ARG C N     1 
ATOM   8050  C  CA    . ARG C 2  620  ? -18.856 18.206  -0.157  1.00 38.38  ? 620  ARG C CA    1 
ATOM   8051  C  C     . ARG C 2  620  ? -19.590 16.895  -0.354  1.00 32.76  ? 620  ARG C C     1 
ATOM   8052  O  O     . ARG C 2  620  ? -19.112 16.004  -1.051  1.00 32.17  ? 620  ARG C O     1 
ATOM   8053  C  CB    . ARG C 2  620  ? -19.444 19.315  -1.032  1.00 51.72  ? 620  ARG C CB    1 
ATOM   8054  C  CG    . ARG C 2  620  ? -19.517 19.023  -2.518  1.00 58.52  ? 620  ARG C CG    1 
ATOM   8055  C  CD    . ARG C 2  620  ? -20.209 20.183  -3.223  1.00 68.92  ? 620  ARG C CD    1 
ATOM   8056  N  NE    . ARG C 2  620  ? -20.342 19.991  -4.664  1.00 84.31  ? 620  ARG C NE    1 
ATOM   8057  C  CZ    . ARG C 2  620  ? -20.937 20.862  -5.475  1.00 88.89  ? 620  ARG C CZ    1 
ATOM   8058  N  NH1   . ARG C 2  620  ? -21.013 20.617  -6.777  1.00 99.39  ? 620  ARG C NH1   1 
ATOM   8059  N  NH2   . ARG C 2  620  ? -21.448 21.985  -4.982  1.00 84.45  ? 620  ARG C NH2   1 
ATOM   8060  N  N     . SER C 2  621  ? -20.752 16.776  0.268   1.00 32.01  ? 621  SER C N     1 
ATOM   8061  C  CA    . SER C 2  621  ? -21.401 15.479  0.393   1.00 32.90  ? 621  SER C CA    1 
ATOM   8062  C  C     . SER C 2  621  ? -22.728 15.382  -0.357  1.00 31.35  ? 621  SER C C     1 
ATOM   8063  O  O     . SER C 2  621  ? -23.508 16.337  -0.394  1.00 33.13  ? 621  SER C O     1 
ATOM   8064  C  CB    . SER C 2  621  ? -21.613 15.167  1.877   1.00 35.44  ? 621  SER C CB    1 
ATOM   8065  O  OG    . SER C 2  621  ? -21.445 16.333  2.674   1.00 35.52  ? 621  SER C OG    1 
ATOM   8066  N  N     . GLU C 2  622  ? -22.971 14.221  -0.959  1.00 28.83  ? 622  GLU C N     1 
ATOM   8067  C  CA    . GLU C 2  622  ? -24.257 13.926  -1.584  1.00 29.98  ? 622  GLU C CA    1 
ATOM   8068  C  C     . GLU C 2  622  ? -24.986 12.842  -0.807  1.00 28.02  ? 622  GLU C C     1 
ATOM   8069  O  O     . GLU C 2  622  ? -24.403 11.803  -0.497  1.00 28.02  ? 622  GLU C O     1 
ATOM   8070  C  CB    . GLU C 2  622  ? -24.085 13.461  -3.033  1.00 31.96  ? 622  GLU C CB    1 
ATOM   8071  C  CG    . GLU C 2  622  ? -23.563 14.499  -4.008  1.00 36.49  ? 622  GLU C CG    1 
ATOM   8072  C  CD    . GLU C 2  622  ? -23.281 13.897  -5.377  1.00 43.57  ? 622  GLU C CD    1 
ATOM   8073  O  OE1   . GLU C 2  622  ? -23.598 12.702  -5.578  1.00 37.95  ? 622  GLU C OE1   1 
ATOM   8074  O  OE2   . GLU C 2  622  ? -22.737 14.615  -6.247  1.00 50.90  ? 622  GLU C OE2   1 
ATOM   8075  N  N     . ALA C 2  623  ? -26.259 13.078  -0.497  1.00 27.27  ? 623  ALA C N     1 
ATOM   8076  C  CA    . ALA C 2  623  ? -27.116 12.015  0.014   1.00 27.26  ? 623  ALA C CA    1 
ATOM   8077  C  C     . ALA C 2  623  ? -27.247 10.943  -1.063  1.00 27.64  ? 623  ALA C C     1 
ATOM   8078  O  O     . ALA C 2  623  ? -27.199 11.255  -2.254  1.00 30.00  ? 623  ALA C O     1 
ATOM   8079  C  CB    . ALA C 2  623  ? -28.486 12.555  0.410   1.00 29.16  ? 623  ALA C CB    1 
ATOM   8080  N  N     . PRO C 2  624  ? -27.388 9.672   -0.653  1.00 27.05  ? 624  PRO C N     1 
ATOM   8081  C  CA    . PRO C 2  624  ? -27.546 8.565   -1.604  1.00 27.31  ? 624  PRO C CA    1 
ATOM   8082  C  C     . PRO C 2  624  ? -28.933 8.516   -2.248  1.00 31.85  ? 624  PRO C C     1 
ATOM   8083  O  O     . PRO C 2  624  ? -29.934 8.696   -1.551  1.00 33.91  ? 624  PRO C O     1 
ATOM   8084  C  CB    . PRO C 2  624  ? -27.316 7.329   -0.734  1.00 28.00  ? 624  PRO C CB    1 
ATOM   8085  C  CG    . PRO C 2  624  ? -27.762 7.758   0.621   1.00 28.33  ? 624  PRO C CG    1 
ATOM   8086  C  CD    . PRO C 2  624  ? -27.307 9.187   0.736   1.00 28.94  ? 624  PRO C CD    1 
ATOM   8087  N  N     . LEU C 2  625  ? -28.983 8.271   -3.557  1.00 32.61  ? 625  LEU C N     1 
ATOM   8088  C  CA    . LEU C 2  625  ? -30.248 8.148   -4.280  1.00 29.57  ? 625  LEU C CA    1 
ATOM   8089  C  C     . LEU C 2  625  ? -31.106 7.052   -3.671  1.00 29.87  ? 625  LEU C C     1 
ATOM   8090  O  O     . LEU C 2  625  ? -32.329 7.169   -3.607  1.00 30.54  ? 625  LEU C O     1 
ATOM   8091  C  CB    . LEU C 2  625  ? -29.995 7.864   -5.764  1.00 27.78  ? 625  LEU C CB    1 
ATOM   8092  C  CG    . LEU C 2  625  ? -29.661 9.101   -6.600  1.00 29.73  ? 625  LEU C CG    1 
ATOM   8093  C  CD1   . LEU C 2  625  ? -28.891 8.740   -7.865  1.00 30.38  ? 625  LEU C CD1   1 
ATOM   8094  C  CD2   . LEU C 2  625  ? -30.945 9.849   -6.938  1.00 35.43  ? 625  LEU C CD2   1 
ATOM   8095  N  N     . VAL C 2  626  ? -30.437 5.999   -3.207  1.00 30.36  ? 626  VAL C N     1 
ATOM   8096  C  CA    . VAL C 2  626  ? -31.072 4.857   -2.551  1.00 32.53  ? 626  VAL C CA    1 
ATOM   8097  C  C     . VAL C 2  626  ? -30.727 4.776   -1.061  1.00 32.06  ? 626  VAL C C     1 
ATOM   8098  O  O     . VAL C 2  626  ? -29.553 4.713   -0.698  1.00 32.82  ? 626  VAL C O     1 
ATOM   8099  C  CB    . VAL C 2  626  ? -30.641 3.535   -3.207  1.00 33.82  ? 626  VAL C CB    1 
ATOM   8100  C  CG1   . VAL C 2  626  ? -31.227 2.345   -2.446  1.00 33.45  ? 626  VAL C CG1   1 
ATOM   8101  C  CG2   . VAL C 2  626  ? -31.025 3.518   -4.682  1.00 34.73  ? 626  VAL C CG2   1 
ATOM   8102  N  N     . GLY C 2  627  ? -31.740 4.756   -0.201  1.00 32.58  ? 627  GLY C N     1 
ATOM   8103  C  CA    . GLY C 2  627  ? -31.503 4.678   1.229   1.00 31.64  ? 627  GLY C CA    1 
ATOM   8104  C  C     . GLY C 2  627  ? -32.431 3.704   1.925   1.00 29.90  ? 627  GLY C C     1 
ATOM   8105  O  O     . GLY C 2  627  ? -33.099 2.907   1.271   1.00 32.49  ? 627  GLY C O     1 
ATOM   8106  N  N     . THR C 2  628  ? -32.464 3.765   3.255   1.00 28.00  ? 628  THR C N     1 
ATOM   8107  C  CA    . THR C 2  628  ? -33.282 2.859   4.058   1.00 28.63  ? 628  THR C CA    1 
ATOM   8108  C  C     . THR C 2  628  ? -34.114 3.624   5.094   1.00 31.30  ? 628  THR C C     1 
ATOM   8109  O  O     . THR C 2  628  ? -34.998 3.060   5.745   1.00 30.51  ? 628  THR C O     1 
ATOM   8110  C  CB    . THR C 2  628  ? -32.407 1.802   4.773   1.00 27.61  ? 628  THR C CB    1 
ATOM   8111  O  OG1   . THR C 2  628  ? -31.804 2.377   5.938   1.00 25.88  ? 628  THR C OG1   1 
ATOM   8112  C  CG2   . THR C 2  628  ? -31.316 1.298   3.840   1.00 29.96  ? 628  THR C CG2   1 
ATOM   8113  N  N     . GLY C 2  629  ? -33.832 4.916   5.225   1.00 33.59  ? 629  GLY C N     1 
ATOM   8114  C  CA    . GLY C 2  629  ? -34.568 5.773   6.135   1.00 37.52  ? 629  GLY C CA    1 
ATOM   8115  C  C     . GLY C 2  629  ? -33.766 6.083   7.387   1.00 34.57  ? 629  GLY C C     1 
ATOM   8116  O  O     . GLY C 2  629  ? -34.048 7.038   8.114   1.00 36.26  ? 629  GLY C O     1 
ATOM   8117  N  N     . MET C 2  630  ? -32.749 5.263   7.625   1.00 30.98  ? 630  MET C N     1 
ATOM   8118  C  CA    . MET C 2  630  ? -31.893 5.388   8.796   1.00 28.44  ? 630  MET C CA    1 
ATOM   8119  C  C     . MET C 2  630  ? -30.951 6.588   8.683   1.00 27.20  ? 630  MET C C     1 
ATOM   8120  O  O     . MET C 2  630  ? -30.510 7.138   9.701   1.00 27.19  ? 630  MET C O     1 
ATOM   8121  C  CB    . MET C 2  630  ? -31.086 4.110   8.988   1.00 27.04  ? 630  MET C CB    1 
ATOM   8122  C  CG    . MET C 2  630  ? -30.283 4.058   10.269  1.00 26.34  ? 630  MET C CG    1 
ATOM   8123  S  SD    . MET C 2  630  ? -31.340 4.163   11.720  1.00 27.70  ? 630  MET C SD    1 
ATOM   8124  C  CE    . MET C 2  630  ? -32.237 2.619   11.604  1.00 27.60  ? 630  MET C CE    1 
ATOM   8125  N  N     . GLU C 2  631  ? -30.667 6.999   7.444   1.00 26.55  ? 631  GLU C N     1 
ATOM   8126  C  CA    . GLU C 2  631  ? -29.685 8.049   7.133   1.00 26.41  ? 631  GLU C CA    1 
ATOM   8127  C  C     . GLU C 2  631  ? -29.965 9.355   7.849   1.00 29.02  ? 631  GLU C C     1 
ATOM   8128  O  O     . GLU C 2  631  ? -29.047 10.072  8.255   1.00 26.42  ? 631  GLU C O     1 
ATOM   8129  C  CB    . GLU C 2  631  ? -29.652 8.321   5.625   1.00 25.01  ? 631  GLU C CB    1 
ATOM   8130  C  CG    . GLU C 2  631  ? -29.238 7.142   4.778   1.00 25.25  ? 631  GLU C CG    1 
ATOM   8131  C  CD    . GLU C 2  631  ? -30.349 6.130   4.638   1.00 30.59  ? 631  GLU C CD    1 
ATOM   8132  O  OE1   . GLU C 2  631  ? -31.509 6.498   4.934   1.00 30.43  ? 631  GLU C OE1   1 
ATOM   8133  O  OE2   . GLU C 2  631  ? -30.061 4.976   4.247   1.00 34.05  ? 631  GLU C OE2   1 
ATOM   8134  N  N     . LEU C 2  632  ? -31.248 9.668   7.967   1.00 32.67  ? 632  LEU C N     1 
ATOM   8135  C  CA    . LEU C 2  632  ? -31.671 10.885  8.628   1.00 32.35  ? 632  LEU C CA    1 
ATOM   8136  C  C     . LEU C 2  632  ? -31.398 10.819  10.124  1.00 29.65  ? 632  LEU C C     1 
ATOM   8137  O  O     . LEU C 2  632  ? -30.610 11.604  10.652  1.00 29.32  ? 632  LEU C O     1 
ATOM   8138  C  CB    . LEU C 2  632  ? -33.156 11.130  8.378   1.00 34.29  ? 632  LEU C CB    1 
ATOM   8139  C  CG    . LEU C 2  632  ? -33.720 12.305  9.170   1.00 37.55  ? 632  LEU C CG    1 
ATOM   8140  C  CD1   . LEU C 2  632  ? -33.131 13.617  8.666   1.00 32.31  ? 632  LEU C CD1   1 
ATOM   8141  C  CD2   . LEU C 2  632  ? -35.238 12.303  9.103   1.00 54.12  ? 632  LEU C CD2   1 
ATOM   8142  N  N     . ARG C 2  633  ? -32.053 9.870   10.791  1.00 29.53  ? 633  ARG C N     1 
ATOM   8143  C  CA    . ARG C 2  633  ? -31.982 9.727   12.244  1.00 26.45  ? 633  ARG C CA    1 
ATOM   8144  C  C     . ARG C 2  633  ? -30.565 9.525   12.738  1.00 26.57  ? 633  ARG C C     1 
ATOM   8145  O  O     . ARG C 2  633  ? -30.204 9.984   13.821  1.00 26.23  ? 633  ARG C O     1 
ATOM   8146  C  CB    . ARG C 2  633  ? -32.847 8.562   12.704  1.00 25.24  ? 633  ARG C CB    1 
ATOM   8147  C  CG    . ARG C 2  633  ? -34.313 8.904   12.774  1.00 28.42  ? 633  ARG C CG    1 
ATOM   8148  C  CD    . ARG C 2  633  ? -34.544 10.058  13.730  1.00 25.61  ? 633  ARG C CD    1 
ATOM   8149  N  NE    . ARG C 2  633  ? -34.035 9.767   15.066  1.00 22.39  ? 633  ARG C NE    1 
ATOM   8150  C  CZ    . ARG C 2  633  ? -34.786 9.355   16.082  1.00 23.59  ? 633  ARG C CZ    1 
ATOM   8151  N  NH1   . ARG C 2  633  ? -36.094 9.180   15.929  1.00 26.39  ? 633  ARG C NH1   1 
ATOM   8152  N  NH2   . ARG C 2  633  ? -34.226 9.117   17.257  1.00 25.03  ? 633  ARG C NH2   1 
ATOM   8153  N  N     . ALA C 2  634  ? -29.769 8.827   11.939  1.00 25.09  ? 634  ALA C N     1 
ATOM   8154  C  CA    . ALA C 2  634  ? -28.367 8.616   12.252  1.00 24.51  ? 634  ALA C CA    1 
ATOM   8155  C  C     . ALA C 2  634  ? -27.604 9.935   12.334  1.00 24.56  ? 634  ALA C C     1 
ATOM   8156  O  O     . ALA C 2  634  ? -27.019 10.255  13.368  1.00 23.86  ? 634  ALA C O     1 
ATOM   8157  C  CB    . ALA C 2  634  ? -27.740 7.716   11.221  1.00 26.16  ? 634  ALA C CB    1 
ATOM   8158  N  N     . ALA C 2  635  ? -27.619 10.690  11.237  1.00 24.32  ? 635  ALA C N     1 
ATOM   8159  C  CA    . ALA C 2  635  ? -26.874 11.944  11.138  1.00 26.25  ? 635  ALA C CA    1 
ATOM   8160  C  C     . ALA C 2  635  ? -27.215 12.913  12.271  1.00 26.63  ? 635  ALA C C     1 
ATOM   8161  O  O     . ALA C 2  635  ? -26.327 13.550  12.843  1.00 25.35  ? 635  ALA C O     1 
ATOM   8162  C  CB    . ALA C 2  635  ? -27.129 12.602  9.782   1.00 28.54  ? 635  ALA C CB    1 
ATOM   8163  N  N     . ILE C 2  636  ? -28.503 13.008  12.594  1.00 27.69  ? 636  ILE C N     1 
ATOM   8164  C  CA    . ILE C 2  636  ? -28.974 13.885  13.662  1.00 25.68  ? 636  ILE C CA    1 
ATOM   8165  C  C     . ILE C 2  636  ? -28.466 13.422  15.019  1.00 26.51  ? 636  ILE C C     1 
ATOM   8166  O  O     . ILE C 2  636  ? -27.825 14.180  15.745  1.00 28.54  ? 636  ILE C O     1 
ATOM   8167  C  CB    . ILE C 2  636  ? -30.511 13.954  13.712  1.00 23.99  ? 636  ILE C CB    1 
ATOM   8168  C  CG1   . ILE C 2  636  ? -31.062 14.607  12.444  1.00 26.02  ? 636  ILE C CG1   1 
ATOM   8169  C  CG2   . ILE C 2  636  ? -30.966 14.722  14.938  1.00 23.21  ? 636  ILE C CG2   1 
ATOM   8170  C  CD1   . ILE C 2  636  ? -32.574 14.677  12.403  1.00 29.98  ? 636  ILE C CD1   1 
ATOM   8171  N  N     . ASP C 2  637  ? -28.750 12.169  15.353  1.00 26.41  ? 637  ASP C N     1 
ATOM   8172  C  CA    . ASP C 2  637  ? -28.384 11.629  16.656  1.00 28.18  ? 637  ASP C CA    1 
ATOM   8173  C  C     . ASP C 2  637  ? -26.865 11.472  16.791  1.00 25.72  ? 637  ASP C C     1 
ATOM   8174  O  O     . ASP C 2  637  ? -26.353 11.217  17.881  1.00 23.19  ? 637  ASP C O     1 
ATOM   8175  C  CB    . ASP C 2  637  ? -29.090 10.286  16.892  1.00 30.43  ? 637  ASP C CB    1 
ATOM   8176  C  CG    . ASP C 2  637  ? -30.610 10.423  17.013  1.00 26.58  ? 637  ASP C CG    1 
ATOM   8177  O  OD1   . ASP C 2  637  ? -31.206 11.274  16.316  1.00 24.41  ? 637  ASP C OD1   1 
ATOM   8178  O  OD2   . ASP C 2  637  ? -31.210 9.664   17.808  1.00 25.69  ? 637  ASP C OD2   1 
ATOM   8179  N  N     . ALA C 2  638  ? -26.153 11.635  15.679  1.00 25.91  ? 638  ALA C N     1 
ATOM   8180  C  CA    . ALA C 2  638  ? -24.695 11.540  15.669  1.00 28.56  ? 638  ALA C CA    1 
ATOM   8181  C  C     . ALA C 2  638  ? -24.045 12.764  16.304  1.00 31.37  ? 638  ALA C C     1 
ATOM   8182  O  O     . ALA C 2  638  ? -22.913 12.692  16.785  1.00 33.35  ? 638  ALA C O     1 
ATOM   8183  C  CB    . ALA C 2  638  ? -24.187 11.358  14.251  1.00 30.87  ? 638  ALA C CB    1 
ATOM   8184  N  N     . GLY C 2  639  ? -24.756 13.888  16.288  1.00 30.86  ? 639  GLY C N     1 
ATOM   8185  C  CA    . GLY C 2  639  ? -24.316 15.075  16.999  1.00 34.25  ? 639  GLY C CA    1 
ATOM   8186  C  C     . GLY C 2  639  ? -23.151 15.790  16.348  1.00 35.44  ? 639  GLY C C     1 
ATOM   8187  O  O     . GLY C 2  639  ? -22.489 16.621  16.977  1.00 35.42  ? 639  GLY C O     1 
ATOM   8188  N  N     . ASP C 2  640  ? -22.893 15.463  15.085  1.00 33.88  ? 640  ASP C N     1 
ATOM   8189  C  CA    . ASP C 2  640  ? -21.871 16.161  14.313  1.00 36.63  ? 640  ASP C CA    1 
ATOM   8190  C  C     . ASP C 2  640  ? -22.518 17.055  13.244  1.00 34.76  ? 640  ASP C C     1 
ATOM   8191  O  O     . ASP C 2  640  ? -21.850 17.553  12.335  1.00 33.71  ? 640  ASP C O     1 
ATOM   8192  C  CB    . ASP C 2  640  ? -20.890 15.155  13.698  1.00 37.11  ? 640  ASP C CB    1 
ATOM   8193  C  CG    . ASP C 2  640  ? -19.957 14.540  14.741  1.00 41.19  ? 640  ASP C CG    1 
ATOM   8194  O  OD1   . ASP C 2  640  ? -20.276 14.622  15.946  1.00 41.17  ? 640  ASP C OD1   1 
ATOM   8195  O  OD2   . ASP C 2  640  ? -18.906 13.978  14.362  1.00 43.93  ? 640  ASP C OD2   1 
ATOM   8196  N  N     . VAL C 2  641  ? -23.825 17.261  13.376  1.00 31.93  ? 641  VAL C N     1 
ATOM   8197  C  CA    . VAL C 2  641  ? -24.524 18.272  12.597  1.00 30.81  ? 641  VAL C CA    1 
ATOM   8198  C  C     . VAL C 2  641  ? -25.006 19.335  13.586  1.00 32.32  ? 641  VAL C C     1 
ATOM   8199  O  O     . VAL C 2  641  ? -24.677 19.265  14.771  1.00 30.42  ? 641  VAL C O     1 
ATOM   8200  C  CB    . VAL C 2  641  ? -25.694 17.669  11.769  1.00 28.89  ? 641  VAL C CB    1 
ATOM   8201  C  CG1   . VAL C 2  641  ? -25.178 16.543  10.885  1.00 30.59  ? 641  VAL C CG1   1 
ATOM   8202  C  CG2   . VAL C 2  641  ? -26.815 17.161  12.666  1.00 27.76  ? 641  VAL C CG2   1 
ATOM   8203  N  N     . VAL C 2  642  ? -25.749 20.331  13.110  1.00 35.59  ? 642  VAL C N     1 
ATOM   8204  C  CA    . VAL C 2  642  ? -26.269 21.371  13.997  1.00 32.58  ? 642  VAL C CA    1 
ATOM   8205  C  C     . VAL C 2  642  ? -27.789 21.397  14.011  1.00 31.90  ? 642  VAL C C     1 
ATOM   8206  O  O     . VAL C 2  642  ? -28.427 21.688  12.997  1.00 31.88  ? 642  VAL C O     1 
ATOM   8207  C  CB    . VAL C 2  642  ? -25.780 22.777  13.609  1.00 29.58  ? 642  VAL C CB    1 
ATOM   8208  C  CG1   . VAL C 2  642  ? -26.347 23.789  14.573  1.00 30.44  ? 642  VAL C CG1   1 
ATOM   8209  C  CG2   . VAL C 2  642  ? -24.267 22.842  13.620  1.00 32.07  ? 642  VAL C CG2   1 
ATOM   8210  N  N     . VAL C 2  643  ? -28.356 21.104  15.175  1.00 30.76  ? 643  VAL C N     1 
ATOM   8211  C  CA    . VAL C 2  643  ? -29.799 21.061  15.357  1.00 31.89  ? 643  VAL C CA    1 
ATOM   8212  C  C     . VAL C 2  643  ? -30.256 22.316  16.091  1.00 37.39  ? 643  VAL C C     1 
ATOM   8213  O  O     . VAL C 2  643  ? -29.514 22.858  16.911  1.00 40.51  ? 643  VAL C O     1 
ATOM   8214  C  CB    . VAL C 2  643  ? -30.222 19.809  16.152  1.00 31.70  ? 643  VAL C CB    1 
ATOM   8215  C  CG1   . VAL C 2  643  ? -31.716 19.551  16.007  1.00 35.69  ? 643  VAL C CG1   1 
ATOM   8216  C  CG2   . VAL C 2  643  ? -29.423 18.602  15.694  1.00 33.37  ? 643  VAL C CG2   1 
ATOM   8217  N  N     . ALA C 2  644  ? -31.470 22.775  15.796  1.00 37.42  ? 644  ALA C N     1 
ATOM   8218  C  CA    . ALA C 2  644  ? -32.036 23.949  16.456  1.00 37.93  ? 644  ALA C CA    1 
ATOM   8219  C  C     . ALA C 2  644  ? -32.688 23.604  17.796  1.00 37.91  ? 644  ALA C C     1 
ATOM   8220  O  O     . ALA C 2  644  ? -33.524 22.700  17.878  1.00 37.32  ? 644  ALA C O     1 
ATOM   8221  C  CB    . ALA C 2  644  ? -33.047 24.617  15.549  1.00 36.91  ? 644  ALA C CB    1 
ATOM   8222  N  N     . GLU C 2  645  ? -32.309 24.329  18.844  1.00 36.28  ? 645  GLU C N     1 
ATOM   8223  C  CA    . GLU C 2  645  ? -32.901 24.108  20.155  1.00 39.14  ? 645  GLU C CA    1 
ATOM   8224  C  C     . GLU C 2  645  ? -34.370 24.475  20.125  1.00 42.65  ? 645  GLU C C     1 
ATOM   8225  O  O     . GLU C 2  645  ? -35.235 23.603  20.144  1.00 45.87  ? 645  GLU C O     1 
ATOM   8226  C  CB    . GLU C 2  645  ? -32.181 24.917  21.235  1.00 47.65  ? 645  GLU C CB    1 
ATOM   8227  C  CG    . GLU C 2  645  ? -30.768 24.442  21.527  1.00 61.98  ? 645  GLU C CG    1 
ATOM   8228  C  CD    . GLU C 2  645  ? -30.281 24.837  22.917  1.00 72.10  ? 645  GLU C CD    1 
ATOM   8229  O  OE1   . GLU C 2  645  ? -31.127 24.998  23.824  1.00 69.32  ? 645  GLU C OE1   1 
ATOM   8230  O  OE2   . GLU C 2  645  ? -29.051 24.983  23.100  1.00 77.06  ? 645  GLU C OE2   1 
ATOM   8231  N  N     . GLU C 2  646  ? -34.638 25.774  20.066  1.00 45.81  ? 646  GLU C N     1 
ATOM   8232  C  CA    . GLU C 2  646  ? -36.002 26.288  20.074  1.00 48.04  ? 646  GLU C CA    1 
ATOM   8233  C  C     . GLU C 2  646  ? -36.376 26.853  18.703  1.00 44.88  ? 646  GLU C C     1 
ATOM   8234  O  O     . GLU C 2  646  ? -35.504 27.270  17.938  1.00 44.74  ? 646  GLU C O     1 
ATOM   8235  C  CB    . GLU C 2  646  ? -36.155 27.362  21.157  1.00 50.98  ? 646  GLU C CB    1 
ATOM   8236  C  CG    . GLU C 2  646  ? -35.835 26.871  22.566  1.00 56.49  ? 646  GLU C CG    1 
ATOM   8237  C  CD    . GLU C 2  646  ? -35.488 28.002  23.521  1.00 59.84  ? 646  GLU C CD    1 
ATOM   8238  O  OE1   . GLU C 2  646  ? -35.452 29.171  23.080  1.00 56.07  ? 646  GLU C OE1   1 
ATOM   8239  O  OE2   . GLU C 2  646  ? -35.244 27.720  24.713  1.00 75.45  ? 646  GLU C OE2   1 
ATOM   8240  N  N     . SER C 2  647  ? -37.671 26.858  18.397  1.00 43.44  ? 647  SER C N     1 
ATOM   8241  C  CA    . SER C 2  647  ? -38.164 27.372  17.119  1.00 44.55  ? 647  SER C CA    1 
ATOM   8242  C  C     . SER C 2  647  ? -37.854 28.859  16.965  1.00 45.78  ? 647  SER C C     1 
ATOM   8243  O  O     . SER C 2  647  ? -37.653 29.559  17.954  1.00 48.98  ? 647  SER C O     1 
ATOM   8244  C  CB    . SER C 2  647  ? -39.672 27.138  16.998  1.00 47.82  ? 647  SER C CB    1 
ATOM   8245  O  OG    . SER C 2  647  ? -40.024 25.832  17.420  1.00 53.03  ? 647  SER C OG    1 
ATOM   8246  N  N     . GLY C 2  648  ? -37.815 29.340  15.727  1.00 44.34  ? 648  GLY C N     1 
ATOM   8247  C  CA    . GLY C 2  648  ? -37.590 30.753  15.484  1.00 42.51  ? 648  GLY C CA    1 
ATOM   8248  C  C     . GLY C 2  648  ? -37.260 31.091  14.045  1.00 39.53  ? 648  GLY C C     1 
ATOM   8249  O  O     . GLY C 2  648  ? -37.579 30.341  13.125  1.00 41.49  ? 648  GLY C O     1 
ATOM   8250  N  N     . VAL C 2  649  ? -36.617 32.233  13.847  1.00 36.23  ? 649  VAL C N     1 
ATOM   8251  C  CA    . VAL C 2  649  ? -36.255 32.670  12.507  1.00 37.85  ? 649  VAL C CA    1 
ATOM   8252  C  C     . VAL C 2  649  ? -34.771 33.013  12.466  1.00 40.00  ? 649  VAL C C     1 
ATOM   8253  O  O     . VAL C 2  649  ? -34.230 33.554  13.431  1.00 41.53  ? 649  VAL C O     1 
ATOM   8254  C  CB    . VAL C 2  649  ? -37.108 33.887  12.057  1.00 41.40  ? 649  VAL C CB    1 
ATOM   8255  C  CG1   . VAL C 2  649  ? -37.017 35.027  13.072  1.00 44.40  ? 649  VAL C CG1   1 
ATOM   8256  C  CG2   . VAL C 2  649  ? -36.701 34.357  10.661  1.00 40.86  ? 649  VAL C CG2   1 
ATOM   8257  N  N     . ILE C 2  650  ? -34.111 32.675  11.362  1.00 40.02  ? 650  ILE C N     1 
ATOM   8258  C  CA    . ILE C 2  650  ? -32.699 32.996  11.191  1.00 36.99  ? 650  ILE C CA    1 
ATOM   8259  C  C     . ILE C 2  650  ? -32.509 34.509  11.127  1.00 37.14  ? 650  ILE C C     1 
ATOM   8260  O  O     . ILE C 2  650  ? -32.912 35.154  10.159  1.00 38.09  ? 650  ILE C O     1 
ATOM   8261  C  CB    . ILE C 2  650  ? -32.113 32.346  9.919   1.00 34.10  ? 650  ILE C CB    1 
ATOM   8262  C  CG1   . ILE C 2  650  ? -32.390 30.838  9.916   1.00 34.28  ? 650  ILE C CG1   1 
ATOM   8263  C  CG2   . ILE C 2  650  ? -30.622 32.609  9.822   1.00 35.49  ? 650  ILE C CG2   1 
ATOM   8264  C  CD1   . ILE C 2  650  ? -31.928 30.122  11.172  1.00 31.87  ? 650  ILE C CD1   1 
ATOM   8265  N  N     . GLU C 2  651  ? -31.908 35.070  12.172  1.00 35.79  ? 651  GLU C N     1 
ATOM   8266  C  CA    . GLU C 2  651  ? -31.691 36.507  12.250  1.00 32.83  ? 651  GLU C CA    1 
ATOM   8267  C  C     . GLU C 2  651  ? -30.449 36.912  11.451  1.00 36.88  ? 651  GLU C C     1 
ATOM   8268  O  O     . GLU C 2  651  ? -30.438 37.947  10.782  1.00 39.75  ? 651  GLU C O     1 
ATOM   8269  C  CB    . GLU C 2  651  ? -31.568 36.951  13.713  1.00 31.90  ? 651  GLU C CB    1 
ATOM   8270  C  CG    . GLU C 2  651  ? -31.318 38.442  13.884  1.00 33.96  ? 651  GLU C CG    1 
ATOM   8271  C  CD    . GLU C 2  651  ? -31.421 38.909  15.324  1.00 34.16  ? 651  GLU C CD    1 
ATOM   8272  O  OE1   . GLU C 2  651  ? -32.512 38.779  15.921  1.00 36.67  ? 651  GLU C OE1   1 
ATOM   8273  O  OE2   . GLU C 2  651  ? -30.409 39.415  15.857  1.00 29.63  ? 651  GLU C OE2   1 
ATOM   8274  N  N     . GLU C 2  652  ? -29.410 36.087  11.511  1.00 37.66  ? 652  GLU C N     1 
ATOM   8275  C  CA    . GLU C 2  652  ? -28.182 36.352  10.771  1.00 40.95  ? 652  GLU C CA    1 
ATOM   8276  C  C     . GLU C 2  652  ? -27.459 35.055  10.434  1.00 41.20  ? 652  GLU C C     1 
ATOM   8277  O  O     . GLU C 2  652  ? -27.361 34.155  11.268  1.00 39.85  ? 652  GLU C O     1 
ATOM   8278  C  CB    . GLU C 2  652  ? -27.261 37.280  11.572  1.00 47.12  ? 652  GLU C CB    1 
ATOM   8279  C  CG    . GLU C 2  652  ? -25.932 37.588  10.888  1.00 52.16  ? 652  GLU C CG    1 
ATOM   8280  C  CD    . GLU C 2  652  ? -25.155 38.702  11.571  1.00 61.51  ? 652  GLU C CD    1 
ATOM   8281  O  OE1   . GLU C 2  652  ? -25.483 39.888  11.344  1.00 64.00  ? 652  GLU C OE1   1 
ATOM   8282  O  OE2   . GLU C 2  652  ? -24.212 38.389  12.329  1.00 62.74  ? 652  GLU C OE2   1 
ATOM   8283  N  N     . VAL C 2  653  ? -26.960 34.959  9.206   1.00 43.62  ? 653  VAL C N     1 
ATOM   8284  C  CA    . VAL C 2  653  ? -26.219 33.775  8.789   1.00 41.91  ? 653  VAL C CA    1 
ATOM   8285  C  C     . VAL C 2  653  ? -24.837 34.132  8.246   1.00 42.83  ? 653  VAL C C     1 
ATOM   8286  O  O     . VAL C 2  653  ? -24.668 35.089  7.487   1.00 45.64  ? 653  VAL C O     1 
ATOM   8287  C  CB    . VAL C 2  653  ? -26.992 32.961  7.727   1.00 41.56  ? 653  VAL C CB    1 
ATOM   8288  C  CG1   . VAL C 2  653  ? -27.225 33.780  6.457   1.00 43.76  ? 653  VAL C CG1   1 
ATOM   8289  C  CG2   . VAL C 2  653  ? -26.254 31.667  7.413   1.00 40.91  ? 653  VAL C CG2   1 
ATOM   8290  N  N     . SER C 2  654  ? -23.848 33.350  8.658   1.00 39.56  ? 654  SER C N     1 
ATOM   8291  C  CA    . SER C 2  654  ? -22.477 33.549  8.225   1.00 40.39  ? 654  SER C CA    1 
ATOM   8292  C  C     . SER C 2  654  ? -21.836 32.191  7.954   1.00 40.82  ? 654  SER C C     1 
ATOM   8293  O  O     . SER C 2  654  ? -22.433 31.153  8.241   1.00 42.63  ? 654  SER C O     1 
ATOM   8294  C  CB    . SER C 2  654  ? -21.700 34.332  9.289   1.00 40.31  ? 654  SER C CB    1 
ATOM   8295  O  OG    . SER C 2  654  ? -20.330 34.464  8.959   1.00 41.25  ? 654  SER C OG    1 
ATOM   8296  N  N     . ALA C 2  655  ? -20.633 32.191  7.388   1.00 41.38  ? 655  ALA C N     1 
ATOM   8297  C  CA    . ALA C 2  655  ? -19.869 30.953  7.257   1.00 39.23  ? 655  ALA C CA    1 
ATOM   8298  C  C     . ALA C 2  655  ? -19.323 30.581  8.624   1.00 37.31  ? 655  ALA C C     1 
ATOM   8299  O  O     . ALA C 2  655  ? -18.911 29.447  8.862   1.00 38.25  ? 655  ALA C O     1 
ATOM   8300  C  CB    . ALA C 2  655  ? -18.741 31.105  6.249   1.00 36.93  ? 655  ALA C CB    1 
ATOM   8301  N  N     . ASP C 2  656  ? -19.342 31.561  9.520   1.00 37.23  ? 656  ASP C N     1 
ATOM   8302  C  CA    . ASP C 2  656  ? -18.786 31.425  10.855  1.00 38.44  ? 656  ASP C CA    1 
ATOM   8303  C  C     . ASP C 2  656  ? -19.840 30.999  11.874  1.00 38.27  ? 656  ASP C C     1 
ATOM   8304  O  O     . ASP C 2  656  ? -19.639 30.029  12.607  1.00 38.43  ? 656  ASP C O     1 
ATOM   8305  C  CB    . ASP C 2  656  ? -18.136 32.743  11.266  1.00 40.74  ? 656  ASP C CB    1 
ATOM   8306  C  CG    . ASP C 2  656  ? -17.055 33.175  10.296  1.00 38.92  ? 656  ASP C CG    1 
ATOM   8307  O  OD1   . ASP C 2  656  ? -16.175 32.340  9.989   1.00 38.36  ? 656  ASP C OD1   1 
ATOM   8308  O  OD2   . ASP C 2  656  ? -17.095 34.332  9.825   1.00 40.75  ? 656  ASP C OD2   1 
ATOM   8309  N  N     . TYR C 2  657  ? -20.966 31.705  11.923  1.00 35.83  ? 657  TYR C N     1 
ATOM   8310  C  CA    . TYR C 2  657  ? -22.011 31.321  12.865  1.00 35.27  ? 657  TYR C CA    1 
ATOM   8311  C  C     . TYR C 2  657  ? -23.436 31.569  12.355  1.00 37.11  ? 657  TYR C C     1 
ATOM   8312  O  O     . TYR C 2  657  ? -23.656 32.368  11.442  1.00 37.34  ? 657  TYR C O     1 
ATOM   8313  C  CB    . TYR C 2  657  ? -21.795 32.039  14.202  1.00 35.06  ? 657  TYR C CB    1 
ATOM   8314  C  CG    . TYR C 2  657  ? -21.966 33.547  14.161  1.00 44.60  ? 657  TYR C CG    1 
ATOM   8315  C  CD1   . TYR C 2  657  ? -23.227 34.131  14.288  1.00 48.59  ? 657  TYR C CD1   1 
ATOM   8316  C  CD2   . TYR C 2  657  ? -20.871 34.391  14.018  1.00 47.40  ? 657  TYR C CD2   1 
ATOM   8317  C  CE1   . TYR C 2  657  ? -23.396 35.512  14.263  1.00 47.68  ? 657  TYR C CE1   1 
ATOM   8318  C  CE2   . TYR C 2  657  ? -21.033 35.779  13.990  1.00 57.33  ? 657  TYR C CE2   1 
ATOM   8319  C  CZ    . TYR C 2  657  ? -22.298 36.332  14.114  1.00 49.91  ? 657  TYR C CZ    1 
ATOM   8320  O  OH    . TYR C 2  657  ? -22.465 37.700  14.090  1.00 38.00  ? 657  TYR C OH    1 
ATOM   8321  N  N     . ILE C 2  658  ? -24.389 30.850  12.951  1.00 35.73  ? 658  ILE C N     1 
ATOM   8322  C  CA    . ILE C 2  658  ? -25.820 31.018  12.691  1.00 34.64  ? 658  ILE C CA    1 
ATOM   8323  C  C     . ILE C 2  658  ? -26.521 31.560  13.937  1.00 40.99  ? 658  ILE C C     1 
ATOM   8324  O  O     . ILE C 2  658  ? -26.403 30.983  15.023  1.00 42.41  ? 658  ILE C O     1 
ATOM   8325  C  CB    . ILE C 2  658  ? -26.496 29.687  12.278  1.00 30.88  ? 658  ILE C CB    1 
ATOM   8326  C  CG1   . ILE C 2  658  ? -26.284 29.395  10.796  1.00 32.23  ? 658  ILE C CG1   1 
ATOM   8327  C  CG2   . ILE C 2  658  ? -27.992 29.722  12.557  1.00 33.51  ? 658  ILE C CG2   1 
ATOM   8328  C  CD1   . ILE C 2  658  ? -26.967 28.113  10.347  1.00 31.59  ? 658  ILE C CD1   1 
ATOM   8329  N  N     . THR C 2  659  ? -27.245 32.667  13.779  1.00 42.14  ? 659  THR C N     1 
ATOM   8330  C  CA    . THR C 2  659  ? -27.991 33.268  14.882  1.00 36.81  ? 659  THR C CA    1 
ATOM   8331  C  C     . THR C 2  659  ? -29.489 33.058  14.699  1.00 33.72  ? 659  THR C C     1 
ATOM   8332  O  O     . THR C 2  659  ? -30.015 33.208  13.597  1.00 35.95  ? 659  THR C O     1 
ATOM   8333  C  CB    . THR C 2  659  ? -27.714 34.779  15.000  1.00 38.62  ? 659  THR C CB    1 
ATOM   8334  O  OG1   . THR C 2  659  ? -26.300 35.015  15.006  1.00 36.69  ? 659  THR C OG1   1 
ATOM   8335  C  CG2   . THR C 2  659  ? -28.331 35.330  16.277  1.00 39.35  ? 659  THR C CG2   1 
ATOM   8336  N  N     . VAL C 2  660  ? -30.183 32.711  15.775  1.00 30.23  ? 660  VAL C N     1 
ATOM   8337  C  CA    . VAL C 2  660  ? -31.612 32.455  15.667  1.00 34.00  ? 660  VAL C CA    1 
ATOM   8338  C  C     . VAL C 2  660  ? -32.414 33.370  16.585  1.00 39.92  ? 660  VAL C C     1 
ATOM   8339  O  O     . VAL C 2  660  ? -32.042 33.588  17.740  1.00 41.57  ? 660  VAL C O     1 
ATOM   8340  C  CB    . VAL C 2  660  ? -31.937 30.985  15.981  1.00 33.92  ? 660  VAL C CB    1 
ATOM   8341  C  CG1   . VAL C 2  660  ? -33.440 30.742  15.949  1.00 36.54  ? 660  VAL C CG1   1 
ATOM   8342  C  CG2   . VAL C 2  660  ? -31.237 30.083  14.985  1.00 36.63  ? 660  VAL C CG2   1 
ATOM   8343  N  N     . MET C 2  661  ? -33.504 33.919  16.052  1.00 43.08  ? 661  MET C N     1 
ATOM   8344  C  CA    . MET C 2  661  ? -34.403 34.760  16.830  1.00 42.65  ? 661  MET C CA    1 
ATOM   8345  C  C     . MET C 2  661  ? -35.606 33.951  17.291  1.00 42.18  ? 661  MET C C     1 
ATOM   8346  O  O     . MET C 2  661  ? -36.490 33.619  16.496  1.00 40.52  ? 661  MET C O     1 
ATOM   8347  C  CB    . MET C 2  661  ? -34.860 35.976  16.023  1.00 40.14  ? 661  MET C CB    1 
ATOM   8348  C  CG    . MET C 2  661  ? -35.740 36.945  16.805  1.00 40.90  ? 661  MET C CG    1 
ATOM   8349  S  SD    . MET C 2  661  ? -34.937 37.625  18.275  1.00 43.23  ? 661  MET C SD    1 
ATOM   8350  C  CE    . MET C 2  661  ? -36.155 38.830  18.808  1.00 45.46  ? 661  MET C CE    1 
ATOM   8351  N  N     . HIS C 2  662  ? -35.622 33.633  18.582  1.00 43.86  ? 662  HIS C N     1 
ATOM   8352  C  CA    . HIS C 2  662  ? -36.698 32.855  19.183  1.00 43.66  ? 662  HIS C CA    1 
ATOM   8353  C  C     . HIS C 2  662  ? -37.990 33.652  19.263  1.00 43.32  ? 662  HIS C C     1 
ATOM   8354  O  O     . HIS C 2  662  ? -37.993 34.872  19.099  1.00 44.13  ? 662  HIS C O     1 
ATOM   8355  C  CB    . HIS C 2  662  ? -36.304 32.386  20.583  1.00 43.86  ? 662  HIS C CB    1 
ATOM   8356  C  CG    . HIS C 2  662  ? -35.103 31.493  20.611  1.00 43.42  ? 662  HIS C CG    1 
ATOM   8357  N  ND1   . HIS C 2  662  ? -34.032 31.713  21.447  1.00 44.51  ? 662  HIS C ND1   1 
ATOM   8358  C  CD2   . HIS C 2  662  ? -34.812 30.371  19.910  1.00 43.09  ? 662  HIS C CD2   1 
ATOM   8359  C  CE1   . HIS C 2  662  ? -33.128 30.767  21.260  1.00 44.66  ? 662  HIS C CE1   1 
ATOM   8360  N  NE2   . HIS C 2  662  ? -33.576 29.941  20.334  1.00 43.43  ? 662  HIS C NE2   1 
ATOM   8361  N  N     . ASP C 2  663  ? -39.086 32.952  19.530  1.00 44.07  ? 663  ASP C N     1 
ATOM   8362  C  CA    . ASP C 2  663  ? -40.380 33.596  19.690  1.00 44.62  ? 663  ASP C CA    1 
ATOM   8363  C  C     . ASP C 2  663  ? -40.433 34.396  20.984  1.00 46.57  ? 663  ASP C C     1 
ATOM   8364  O  O     . ASP C 2  663  ? -41.021 35.477  21.023  1.00 52.23  ? 663  ASP C O     1 
ATOM   8365  C  CB    . ASP C 2  663  ? -41.500 32.558  19.654  1.00 42.99  ? 663  ASP C CB    1 
ATOM   8366  C  CG    . ASP C 2  663  ? -41.664 31.936  18.282  1.00 47.96  ? 663  ASP C CG    1 
ATOM   8367  O  OD1   . ASP C 2  663  ? -41.318 32.611  17.287  1.00 43.72  ? 663  ASP C OD1   1 
ATOM   8368  O  OD2   . ASP C 2  663  ? -42.134 30.778  18.198  1.00 50.11  ? 663  ASP C OD2   1 
ATOM   8369  N  N     . ASN C 2  664  ? -39.806 33.877  22.037  1.00 44.00  ? 664  ASN C N     1 
ATOM   8370  C  CA    . ASN C 2  664  ? -39.815 34.567  23.324  1.00 44.32  ? 664  ASN C CA    1 
ATOM   8371  C  C     . ASN C 2  664  ? -38.822 35.726  23.348  1.00 42.10  ? 664  ASN C C     1 
ATOM   8372  O  O     . ASN C 2  664  ? -38.662 36.400  24.365  1.00 43.14  ? 664  ASN C O     1 
ATOM   8373  C  CB    . ASN C 2  664  ? -39.534 33.593  24.481  1.00 45.37  ? 664  ASN C CB    1 
ATOM   8374  C  CG    . ASN C 2  664  ? -38.163 32.937  24.394  1.00 45.40  ? 664  ASN C CG    1 
ATOM   8375  O  OD1   . ASN C 2  664  ? -37.342 33.278  23.544  1.00 46.27  ? 664  ASN C OD1   1 
ATOM   8376  N  ND2   . ASN C 2  664  ? -37.909 31.991  25.294  1.00 39.92  ? 664  ASN C ND2   1 
ATOM   8377  N  N     . GLY C 2  665  ? -38.155 35.948  22.220  1.00 39.78  ? 665  GLY C N     1 
ATOM   8378  C  CA    . GLY C 2  665  ? -37.272 37.087  22.074  1.00 41.00  ? 665  GLY C CA    1 
ATOM   8379  C  C     . GLY C 2  665  ? -35.807 36.772  22.294  1.00 39.72  ? 665  GLY C C     1 
ATOM   8380  O  O     . GLY C 2  665  ? -34.940 37.394  21.682  1.00 39.02  ? 665  GLY C O     1 
ATOM   8381  N  N     . THR C 2  666  ? -35.526 35.813  23.172  1.00 39.82  ? 666  THR C N     1 
ATOM   8382  C  CA    . THR C 2  666  ? -34.148 35.444  23.474  1.00 38.29  ? 666  THR C CA    1 
ATOM   8383  C  C     . THR C 2  666  ? -33.465 34.916  22.218  1.00 37.08  ? 666  THR C C     1 
ATOM   8384  O  O     . THR C 2  666  ? -34.127 34.495  21.274  1.00 37.95  ? 666  THR C O     1 
ATOM   8385  C  CB    . THR C 2  666  ? -34.068 34.392  24.608  1.00 40.34  ? 666  THR C CB    1 
ATOM   8386  O  OG1   . THR C 2  666  ? -35.116 33.428  24.453  1.00 43.99  ? 666  THR C OG1   1 
ATOM   8387  C  CG2   . THR C 2  666  ? -34.223 35.063  25.962  1.00 40.45  ? 666  THR C CG2   1 
ATOM   8388  N  N     . ARG C 2  667  ? -32.139 34.968  22.200  1.00 37.51  ? 667  ARG C N     1 
ATOM   8389  C  CA    . ARG C 2  667  ? -31.373 34.527  21.042  1.00 37.70  ? 667  ARG C CA    1 
ATOM   8390  C  C     . ARG C 2  667  ? -30.406 33.404  21.419  1.00 40.44  ? 667  ARG C C     1 
ATOM   8391  O  O     . ARG C 2  667  ? -29.902 33.351  22.545  1.00 40.12  ? 667  ARG C O     1 
ATOM   8392  C  CB    . ARG C 2  667  ? -30.595 35.705  20.422  1.00 35.07  ? 667  ARG C CB    1 
ATOM   8393  C  CG    . ARG C 2  667  ? -31.455 36.888  19.974  1.00 32.72  ? 667  ARG C CG    1 
ATOM   8394  C  CD    . ARG C 2  667  ? -30.670 37.872  19.094  1.00 32.13  ? 667  ARG C CD    1 
ATOM   8395  N  NE    . ARG C 2  667  ? -29.614 38.585  19.814  1.00 33.26  ? 667  ARG C NE    1 
ATOM   8396  C  CZ    . ARG C 2  667  ? -28.750 39.424  19.245  1.00 35.61  ? 667  ARG C CZ    1 
ATOM   8397  N  NH1   . ARG C 2  667  ? -28.807 39.662  17.941  1.00 37.54  ? 667  ARG C NH1   1 
ATOM   8398  N  NH2   . ARG C 2  667  ? -27.823 40.026  19.980  1.00 34.16  ? 667  ARG C NH2   1 
ATOM   8399  N  N     . ARG C 2  668  ? -30.165 32.497  20.478  1.00 41.63  ? 668  ARG C N     1 
ATOM   8400  C  CA    . ARG C 2  668  ? -29.069 31.543  20.606  1.00 40.54  ? 668  ARG C CA    1 
ATOM   8401  C  C     . ARG C 2  668  ? -28.273 31.499  19.310  1.00 35.24  ? 668  ARG C C     1 
ATOM   8402  O  O     . ARG C 2  668  ? -28.823 31.294  18.227  1.00 33.58  ? 668  ARG C O     1 
ATOM   8403  C  CB    . ARG C 2  668  ? -29.571 30.143  20.966  1.00 47.60  ? 668  ARG C CB    1 
ATOM   8404  C  CG    . ARG C 2  668  ? -28.492 29.233  21.563  1.00 46.61  ? 668  ARG C CG    1 
ATOM   8405  C  CD    . ARG C 2  668  ? -29.091 27.931  22.066  1.00 51.67  ? 668  ARG C CD    1 
ATOM   8406  N  NE    . ARG C 2  668  ? -30.405 28.149  22.671  1.00 63.72  ? 668  ARG C NE    1 
ATOM   8407  C  CZ    . ARG C 2  668  ? -30.601 28.493  23.940  1.00 68.54  ? 668  ARG C CZ    1 
ATOM   8408  N  NH1   . ARG C 2  668  ? -29.564 28.654  24.751  1.00 80.64  ? 668  ARG C NH1   1 
ATOM   8409  N  NH2   . ARG C 2  668  ? -31.832 28.678  24.401  1.00 57.90  ? 668  ARG C NH2   1 
ATOM   8410  N  N     . THR C 2  669  ? -26.970 31.703  19.435  1.00 33.31  ? 669  THR C N     1 
ATOM   8411  C  CA    . THR C 2  669  ? -26.093 31.672  18.285  1.00 32.43  ? 669  THR C CA    1 
ATOM   8412  C  C     . THR C 2  669  ? -25.283 30.389  18.260  1.00 35.59  ? 669  THR C C     1 
ATOM   8413  O  O     . THR C 2  669  ? -24.648 30.015  19.244  1.00 37.09  ? 669  THR C O     1 
ATOM   8414  C  CB    . THR C 2  669  ? -25.154 32.869  18.274  1.00 31.30  ? 669  THR C CB    1 
ATOM   8415  O  OG1   . THR C 2  669  ? -25.911 34.052  18.001  1.00 33.89  ? 669  THR C OG1   1 
ATOM   8416  C  CG2   . THR C 2  669  ? -24.105 32.698  17.206  1.00 33.38  ? 669  THR C CG2   1 
ATOM   8417  N  N     . TYR C 2  670  ? -25.322 29.711  17.123  1.00 33.16  ? 670  TYR C N     1 
ATOM   8418  C  CA    . TYR C 2  670  ? -24.626 28.452  16.973  1.00 27.49  ? 670  TYR C CA    1 
ATOM   8419  C  C     . TYR C 2  670  ? -23.353 28.702  16.184  1.00 28.51  ? 670  TYR C C     1 
ATOM   8420  O  O     . TYR C 2  670  ? -23.397 29.275  15.097  1.00 29.52  ? 670  TYR C O     1 
ATOM   8421  C  CB    . TYR C 2  670  ? -25.524 27.432  16.280  1.00 31.39  ? 670  TYR C CB    1 
ATOM   8422  C  CG    . TYR C 2  670  ? -26.890 27.258  16.927  1.00 33.45  ? 670  TYR C CG    1 
ATOM   8423  C  CD1   . TYR C 2  670  ? -27.060 26.431  18.035  1.00 34.77  ? 670  TYR C CD1   1 
ATOM   8424  C  CD2   . TYR C 2  670  ? -28.009 27.910  16.420  1.00 32.85  ? 670  TYR C CD2   1 
ATOM   8425  C  CE1   . TYR C 2  670  ? -28.307 26.263  18.625  1.00 35.82  ? 670  TYR C CE1   1 
ATOM   8426  C  CE2   . TYR C 2  670  ? -29.258 27.748  17.003  1.00 34.12  ? 670  TYR C CE2   1 
ATOM   8427  C  CZ    . TYR C 2  670  ? -29.402 26.923  18.104  1.00 35.99  ? 670  TYR C CZ    1 
ATOM   8428  O  OH    . TYR C 2  670  ? -30.647 26.763  18.680  1.00 38.36  ? 670  TYR C OH    1 
ATOM   8429  N  N     . ARG C 2  671  ? -22.220 28.296  16.751  1.00 30.29  ? 671  ARG C N     1 
ATOM   8430  C  CA    . ARG C 2  671  ? -20.915 28.523  16.134  1.00 32.76  ? 671  ARG C CA    1 
ATOM   8431  C  C     . ARG C 2  671  ? -20.477 27.309  15.319  1.00 29.32  ? 671  ARG C C     1 
ATOM   8432  O  O     . ARG C 2  671  ? -20.356 26.204  15.847  1.00 30.08  ? 671  ARG C O     1 
ATOM   8433  C  CB    . ARG C 2  671  ? -19.863 28.857  17.203  1.00 35.95  ? 671  ARG C CB    1 
ATOM   8434  C  CG    . ARG C 2  671  ? -20.180 30.105  18.031  1.00 37.52  ? 671  ARG C CG    1 
ATOM   8435  C  CD    . ARG C 2  671  ? -19.009 30.506  18.917  1.00 38.35  ? 671  ARG C CD    1 
ATOM   8436  N  NE    . ARG C 2  671  ? -17.761 30.520  18.157  1.00 43.23  ? 671  ARG C NE    1 
ATOM   8437  C  CZ    . ARG C 2  671  ? -16.556 30.715  18.684  1.00 46.80  ? 671  ARG C CZ    1 
ATOM   8438  N  NH1   . ARG C 2  671  ? -16.420 30.922  19.989  1.00 50.99  ? 671  ARG C NH1   1 
ATOM   8439  N  NH2   . ARG C 2  671  ? -15.485 30.702  17.902  1.00 43.05  ? 671  ARG C NH2   1 
ATOM   8440  N  N     . MET C 2  672  ? -20.248 27.522  14.029  1.00 27.56  ? 672  MET C N     1 
ATOM   8441  C  CA    . MET C 2  672  ? -19.905 26.433  13.121  1.00 30.85  ? 672  MET C CA    1 
ATOM   8442  C  C     . MET C 2  672  ? -18.494 25.917  13.389  1.00 36.68  ? 672  MET C C     1 
ATOM   8443  O  O     . MET C 2  672  ? -17.575 26.715  13.570  1.00 39.27  ? 672  MET C O     1 
ATOM   8444  C  CB    . MET C 2  672  ? -20.026 26.901  11.668  1.00 32.56  ? 672  MET C CB    1 
ATOM   8445  C  CG    . MET C 2  672  ? -21.414 27.374  11.280  1.00 33.02  ? 672  MET C CG    1 
ATOM   8446  S  SD    . MET C 2  672  ? -22.606 26.021  11.245  1.00 33.39  ? 672  MET C SD    1 
ATOM   8447  C  CE    . MET C 2  672  ? -24.051 26.835  11.906  1.00 34.79  ? 672  MET C CE    1 
ATOM   8448  N  N     . ARG C 2  673  ? -18.324 24.594  13.430  1.00 38.23  ? 673  ARG C N     1 
ATOM   8449  C  CA    . ARG C 2  673  ? -16.986 24.001  13.496  1.00 36.72  ? 673  ARG C CA    1 
ATOM   8450  C  C     . ARG C 2  673  ? -16.399 23.998  12.089  1.00 35.83  ? 673  ARG C C     1 
ATOM   8451  O  O     . ARG C 2  673  ? -16.911 23.318  11.198  1.00 36.48  ? 673  ARG C O     1 
ATOM   8452  C  CB    . ARG C 2  673  ? -17.016 22.576  14.076  1.00 36.90  ? 673  ARG C CB    1 
ATOM   8453  C  CG    . ARG C 2  673  ? -16.394 22.446  15.471  1.00 37.26  ? 673  ARG C CG    1 
ATOM   8454  C  CD    . ARG C 2  673  ? -15.967 21.009  15.783  1.00 46.24  ? 673  ARG C CD    1 
ATOM   8455  N  NE    . ARG C 2  673  ? -17.075 20.059  15.689  1.00 56.05  ? 673  ARG C NE    1 
ATOM   8456  C  CZ    . ARG C 2  673  ? -16.965 18.751  15.907  1.00 56.25  ? 673  ARG C CZ    1 
ATOM   8457  N  NH1   . ARG C 2  673  ? -15.790 18.226  16.235  1.00 51.53  ? 673  ARG C NH1   1 
ATOM   8458  N  NH2   . ARG C 2  673  ? -18.030 17.965  15.798  1.00 46.47  ? 673  ARG C NH2   1 
ATOM   8459  N  N     . LYS C 2  674  ? -15.343 24.777  11.880  1.00 33.87  ? 674  LYS C N     1 
ATOM   8460  C  CA    . LYS C 2  674  ? -14.788 24.926  10.541  1.00 34.43  ? 674  LYS C CA    1 
ATOM   8461  C  C     . LYS C 2  674  ? -13.380 24.354  10.416  1.00 38.32  ? 674  LYS C C     1 
ATOM   8462  O  O     . LYS C 2  674  ? -12.477 24.743  11.162  1.00 39.27  ? 674  LYS C O     1 
ATOM   8463  C  CB    . LYS C 2  674  ? -14.783 26.398  10.125  1.00 32.90  ? 674  LYS C CB    1 
ATOM   8464  C  CG    . LYS C 2  674  ? -16.163 27.032  10.070  1.00 35.86  ? 674  LYS C CG    1 
ATOM   8465  C  CD    . LYS C 2  674  ? -17.117 26.295  9.126   1.00 36.72  ? 674  LYS C CD    1 
ATOM   8466  C  CE    . LYS C 2  674  ? -16.710 26.418  7.657   1.00 35.70  ? 674  LYS C CE    1 
ATOM   8467  N  NZ    . LYS C 2  674  ? -17.876 26.222  6.734   1.00 35.05  ? 674  LYS C NZ    1 
ATOM   8468  N  N     . PHE C 2  675  ? -13.217 23.436  9.462   1.00 37.08  ? 675  PHE C N     1 
ATOM   8469  C  CA    . PHE C 2  675  ? -11.924 22.842  9.120   1.00 35.18  ? 675  PHE C CA    1 
ATOM   8470  C  C     . PHE C 2  675  ? -11.183 22.377  10.364  1.00 36.74  ? 675  PHE C C     1 
ATOM   8471  O  O     . PHE C 2  675  ? -10.103 22.880  10.684  1.00 38.16  ? 675  PHE C O     1 
ATOM   8472  C  CB    . PHE C 2  675  ? -11.063 23.838  8.328   1.00 35.58  ? 675  PHE C CB    1 
ATOM   8473  C  CG    . PHE C 2  675  ? -11.647 24.218  6.992   1.00 36.45  ? 675  PHE C CG    1 
ATOM   8474  C  CD1   . PHE C 2  675  ? -11.382 23.458  5.861   1.00 34.34  ? 675  PHE C CD1   1 
ATOM   8475  C  CD2   . PHE C 2  675  ? -12.466 25.333  6.869   1.00 38.59  ? 675  PHE C CD2   1 
ATOM   8476  C  CE1   . PHE C 2  675  ? -11.921 23.805  4.636   1.00 36.35  ? 675  PHE C CE1   1 
ATOM   8477  C  CE2   . PHE C 2  675  ? -13.009 25.684  5.649   1.00 37.90  ? 675  PHE C CE2   1 
ATOM   8478  C  CZ    . PHE C 2  675  ? -12.736 24.920  4.531   1.00 38.58  ? 675  PHE C CZ    1 
ATOM   8479  N  N     . ALA C 2  676  ? -11.782 21.429  11.075  1.00 36.61  ? 676  ALA C N     1 
ATOM   8480  C  CA    . ALA C 2  676  ? -11.178 20.904  12.290  1.00 37.94  ? 676  ALA C CA    1 
ATOM   8481  C  C     . ALA C 2  676  ? -10.549 19.534  12.058  1.00 34.68  ? 676  ALA C C     1 
ATOM   8482  O  O     . ALA C 2  676  ? -11.050 18.714  11.278  1.00 29.93  ? 676  ALA C O     1 
ATOM   8483  C  CB    . ALA C 2  676  ? -12.212 20.834  13.413  1.00 39.95  ? 676  ALA C CB    1 
ATOM   8484  N  N     . ARG C 2  677  ? -9.433  19.308  12.743  1.00 33.83  ? 677  ARG C N     1 
ATOM   8485  C  CA    . ARG C 2  677  ? -8.770  18.016  12.729  1.00 32.44  ? 677  ARG C CA    1 
ATOM   8486  C  C     . ARG C 2  677  ? -9.509  17.049  13.637  1.00 30.18  ? 677  ARG C C     1 
ATOM   8487  O  O     . ARG C 2  677  ? -9.794  17.364  14.792  1.00 31.18  ? 677  ARG C O     1 
ATOM   8488  C  CB    . ARG C 2  677  ? -7.311  18.142  13.177  1.00 32.71  ? 677  ARG C CB    1 
ATOM   8489  C  CG    . ARG C 2  677  ? -6.533  16.840  13.074  1.00 30.91  ? 677  ARG C CG    1 
ATOM   8490  C  CD    . ARG C 2  677  ? -5.157  16.933  13.709  1.00 31.04  ? 677  ARG C CD    1 
ATOM   8491  N  NE    . ARG C 2  677  ? -4.313  15.807  13.313  1.00 35.67  ? 677  ARG C NE    1 
ATOM   8492  C  CZ    . ARG C 2  677  ? -4.355  14.604  13.878  1.00 34.69  ? 677  ARG C CZ    1 
ATOM   8493  N  NH1   . ARG C 2  677  ? -5.206  14.369  14.870  1.00 32.86  ? 677  ARG C NH1   1 
ATOM   8494  N  NH2   . ARG C 2  677  ? -3.551  13.636  13.451  1.00 33.53  ? 677  ARG C NH2   1 
ATOM   8495  N  N     . SER C 2  678  ? -9.826  15.874  13.111  1.00 28.75  ? 678  SER C N     1 
ATOM   8496  C  CA    . SER C 2  678  ? -10.429 14.832  13.922  1.00 30.04  ? 678  SER C CA    1 
ATOM   8497  C  C     . SER C 2  678  ? -9.366  14.048  14.666  1.00 32.01  ? 678  SER C C     1 
ATOM   8498  O  O     . SER C 2  678  ? -8.166  14.320  14.552  1.00 33.46  ? 678  SER C O     1 
ATOM   8499  C  CB    . SER C 2  678  ? -11.246 13.876  13.058  1.00 33.05  ? 678  SER C CB    1 
ATOM   8500  O  OG    . SER C 2  678  ? -10.405 13.195  12.145  1.00 31.06  ? 678  SER C OG    1 
ATOM   8501  N  N     . ASN C 2  679  ? -9.827  13.065  15.426  1.00 32.80  ? 679  ASN C N     1 
ATOM   8502  C  CA    . ASN C 2  679  ? -8.949  12.098  16.059  1.00 33.80  ? 679  ASN C CA    1 
ATOM   8503  C  C     . ASN C 2  679  ? -8.164  11.304  15.019  1.00 32.79  ? 679  ASN C C     1 
ATOM   8504  O  O     . ASN C 2  679  ? -7.044  10.862  15.282  1.00 33.37  ? 679  ASN C O     1 
ATOM   8505  C  CB    . ASN C 2  679  ? -9.768  11.155  16.943  1.00 36.75  ? 679  ASN C CB    1 
ATOM   8506  C  CG    . ASN C 2  679  ? -10.375 11.861  18.142  1.00 39.48  ? 679  ASN C CG    1 
ATOM   8507  O  OD1   . ASN C 2  679  ? -9.806  12.826  18.660  1.00 42.54  ? 679  ASN C OD1   1 
ATOM   8508  N  ND2   . ASN C 2  679  ? -11.529 11.376  18.596  1.00 36.00  ? 679  ASN C ND2   1 
ATOM   8509  N  N     . HIS C 2  680  ? -8.757  11.144  13.835  1.00 31.57  ? 680  HIS C N     1 
ATOM   8510  C  CA    . HIS C 2  680  ? -8.157  10.375  12.745  1.00 30.13  ? 680  HIS C CA    1 
ATOM   8511  C  C     . HIS C 2  680  ? -7.796  11.282  11.567  1.00 30.46  ? 680  HIS C C     1 
ATOM   8512  O  O     . HIS C 2  680  ? -7.592  10.819  10.442  1.00 29.69  ? 680  HIS C O     1 
ATOM   8513  C  CB    . HIS C 2  680  ? -9.104  9.264   12.287  1.00 28.72  ? 680  HIS C CB    1 
ATOM   8514  C  CG    . HIS C 2  680  ? -9.476  8.305   13.373  1.00 30.43  ? 680  HIS C CG    1 
ATOM   8515  N  ND1   . HIS C 2  680  ? -9.963  8.719   14.595  1.00 30.34  ? 680  HIS C ND1   1 
ATOM   8516  C  CD2   . HIS C 2  680  ? -9.432  6.953   13.427  1.00 33.81  ? 680  HIS C CD2   1 
ATOM   8517  C  CE1   . HIS C 2  680  ? -10.199 7.666   15.355  1.00 32.83  ? 680  HIS C CE1   1 
ATOM   8518  N  NE2   . HIS C 2  680  ? -9.886  6.582   14.670  1.00 37.55  ? 680  HIS C NE2   1 
ATOM   8519  N  N     . GLY C 2  681  ? -7.728  12.581  11.839  1.00 30.26  ? 681  GLY C N     1 
ATOM   8520  C  CA    . GLY C 2  681  ? -7.260  13.540  10.862  1.00 29.43  ? 681  GLY C CA    1 
ATOM   8521  C  C     . GLY C 2  681  ? -8.214  13.808  9.718   1.00 27.25  ? 681  GLY C C     1 
ATOM   8522  O  O     . GLY C 2  681  ? -7.820  14.403  8.721   1.00 29.67  ? 681  GLY C O     1 
ATOM   8523  N  N     . THR C 2  682  ? -9.463  13.374  9.840   1.00 25.56  ? 682  THR C N     1 
ATOM   8524  C  CA    . THR C 2  682  ? -10.443 13.683  8.806   1.00 25.39  ? 682  THR C CA    1 
ATOM   8525  C  C     . THR C 2  682  ? -10.943 15.110  8.998   1.00 27.00  ? 682  THR C C     1 
ATOM   8526  O  O     . THR C 2  682  ? -10.591 15.774  9.974   1.00 28.82  ? 682  THR C O     1 
ATOM   8527  C  CB    . THR C 2  682  ? -11.621 12.688  8.804   1.00 25.21  ? 682  THR C CB    1 
ATOM   8528  O  OG1   . THR C 2  682  ? -11.953 12.321  10.148  1.00 25.76  ? 682  THR C OG1   1 
ATOM   8529  C  CG2   . THR C 2  682  ? -11.239 11.437  8.045   1.00 27.43  ? 682  THR C CG2   1 
ATOM   8530  N  N     . CYS C 2  683  ? -11.753 15.592  8.063   1.00 27.36  ? 683  CYS C N     1 
ATOM   8531  C  CA    . CYS C 2  683  ? -12.147 16.998  8.080   1.00 29.30  ? 683  CYS C CA    1 
ATOM   8532  C  C     . CYS C 2  683  ? -13.584 17.226  8.542   1.00 30.63  ? 683  CYS C C     1 
ATOM   8533  O  O     . CYS C 2  683  ? -14.537 17.107  7.765   1.00 31.56  ? 683  CYS C O     1 
ATOM   8534  C  CB    . CYS C 2  683  ? -11.952 17.615  6.694   1.00 32.19  ? 683  CYS C CB    1 
ATOM   8535  S  SG    . CYS C 2  683  ? -12.548 19.317  6.560   1.00 40.45  ? 683  CYS C SG    1 
ATOM   8536  N  N     . ALA C 2  684  ? -13.723 17.577  9.816   1.00 31.82  ? 684  ALA C N     1 
ATOM   8537  C  CA    . ALA C 2  684  ? -15.017 17.932  10.383  1.00 34.97  ? 684  ALA C CA    1 
ATOM   8538  C  C     . ALA C 2  684  ? -15.383 19.381  10.048  1.00 36.75  ? 684  ALA C C     1 
ATOM   8539  O  O     . ALA C 2  684  ? -15.121 20.290  10.837  1.00 38.64  ? 684  ALA C O     1 
ATOM   8540  C  CB    . ALA C 2  684  ? -15.007 17.721  11.894  1.00 35.94  ? 684  ALA C CB    1 
ATOM   8541  N  N     . ASN C 2  685  ? -15.985 19.594  8.879   1.00 34.16  ? 685  ASN C N     1 
ATOM   8542  C  CA    . ASN C 2  685  ? -16.367 20.941  8.452   1.00 34.87  ? 685  ASN C CA    1 
ATOM   8543  C  C     . ASN C 2  685  ? -17.888 21.112  8.367   1.00 34.70  ? 685  ASN C C     1 
ATOM   8544  O  O     . ASN C 2  685  ? -18.558 20.394  7.625   1.00 35.91  ? 685  ASN C O     1 
ATOM   8545  C  CB    . ASN C 2  685  ? -15.726 21.276  7.098   1.00 36.38  ? 685  ASN C CB    1 
ATOM   8546  C  CG    . ASN C 2  685  ? -15.490 22.771  6.909   1.00 38.23  ? 685  ASN C CG    1 
ATOM   8547  O  OD1   . ASN C 2  685  ? -15.098 23.468  7.839   1.00 36.53  ? 685  ASN C OD1   1 
ATOM   8548  N  ND2   . ASN C 2  685  ? -15.730 23.266  5.697   1.00 38.01  ? 685  ASN C ND2   1 
ATOM   8549  N  N     . GLN C 2  686  ? -18.422 22.070  9.122   1.00 32.95  ? 686  GLN C N     1 
ATOM   8550  C  CA    . GLN C 2  686  ? -19.864 22.308  9.168   1.00 30.14  ? 686  GLN C CA    1 
ATOM   8551  C  C     . GLN C 2  686  ? -20.299 23.509  8.333   1.00 31.56  ? 686  GLN C C     1 
ATOM   8552  O  O     . GLN C 2  686  ? -19.784 24.612  8.502   1.00 34.09  ? 686  GLN C O     1 
ATOM   8553  C  CB    . GLN C 2  686  ? -20.316 22.505  10.614  1.00 29.66  ? 686  GLN C CB    1 
ATOM   8554  C  CG    . GLN C 2  686  ? -20.088 21.296  11.501  1.00 31.26  ? 686  GLN C CG    1 
ATOM   8555  C  CD    . GLN C 2  686  ? -20.551 21.526  12.922  1.00 32.47  ? 686  GLN C CD    1 
ATOM   8556  O  OE1   . GLN C 2  686  ? -20.310 22.586  13.500  1.00 33.71  ? 686  GLN C OE1   1 
ATOM   8557  N  NE2   . GLN C 2  686  ? -21.230 20.534  13.494  1.00 31.78  ? 686  GLN C NE2   1 
ATOM   8558  N  N     . CYS C 2  687  ? -21.256 23.292  7.437   1.00 31.92  ? 687  CYS C N     1 
ATOM   8559  C  CA    . CYS C 2  687  ? -21.798 24.376  6.624   1.00 33.77  ? 687  CYS C CA    1 
ATOM   8560  C  C     . CYS C 2  687  ? -23.275 24.578  6.924   1.00 34.79  ? 687  CYS C C     1 
ATOM   8561  O  O     . CYS C 2  687  ? -24.040 23.611  6.974   1.00 31.74  ? 687  CYS C O     1 
ATOM   8562  C  CB    . CYS C 2  687  ? -21.601 24.095  5.132   1.00 35.39  ? 687  CYS C CB    1 
ATOM   8563  S  SG    . CYS C 2  687  ? -19.873 23.919  4.612   1.00 50.69  ? 687  CYS C SG    1 
ATOM   8564  N  N     . PRO C 2  688  ? -23.676 25.841  7.145   1.00 38.10  ? 688  PRO C N     1 
ATOM   8565  C  CA    . PRO C 2  688  ? -25.080 26.204  7.369   1.00 34.23  ? 688  PRO C CA    1 
ATOM   8566  C  C     . PRO C 2  688  ? -25.978 25.758  6.221   1.00 33.97  ? 688  PRO C C     1 
ATOM   8567  O  O     . PRO C 2  688  ? -25.558 25.806  5.064   1.00 35.52  ? 688  PRO C O     1 
ATOM   8568  C  CB    . PRO C 2  688  ? -25.031 27.730  7.465   1.00 32.92  ? 688  PRO C CB    1 
ATOM   8569  C  CG    . PRO C 2  688  ? -23.669 28.016  7.989   1.00 34.65  ? 688  PRO C CG    1 
ATOM   8570  C  CD    . PRO C 2  688  ? -22.781 26.999  7.320   1.00 37.56  ? 688  PRO C CD    1 
ATOM   8571  N  N     . ILE C 2  689  ? -27.189 25.316  6.541   1.00 31.30  ? 689  ILE C N     1 
ATOM   8572  C  CA    . ILE C 2  689  ? -28.143 24.913  5.517   1.00 30.80  ? 689  ILE C CA    1 
ATOM   8573  C  C     . ILE C 2  689  ? -29.067 26.066  5.164   1.00 36.01  ? 689  ILE C C     1 
ATOM   8574  O  O     . ILE C 2  689  ? -29.260 26.390  3.989   1.00 36.10  ? 689  ILE C O     1 
ATOM   8575  C  CB    . ILE C 2  689  ? -28.989 23.713  5.969   1.00 29.81  ? 689  ILE C CB    1 
ATOM   8576  C  CG1   . ILE C 2  689  ? -28.145 22.441  5.965   1.00 33.53  ? 689  ILE C CG1   1 
ATOM   8577  C  CG2   . ILE C 2  689  ? -30.191 23.532  5.056   1.00 32.54  ? 689  ILE C CG2   1 
ATOM   8578  C  CD1   . ILE C 2  689  ? -28.902 21.193  6.385   1.00 37.06  ? 689  ILE C CD1   1 
ATOM   8579  N  N     . VAL C 2  690  ? -29.615 26.692  6.200   1.00 38.05  ? 690  VAL C N     1 
ATOM   8580  C  CA    . VAL C 2  690  ? -30.660 27.697  6.048   1.00 37.62  ? 690  VAL C CA    1 
ATOM   8581  C  C     . VAL C 2  690  ? -30.141 29.066  5.624   1.00 35.59  ? 690  VAL C C     1 
ATOM   8582  O  O     . VAL C 2  690  ? -29.099 29.528  6.089   1.00 31.80  ? 690  VAL C O     1 
ATOM   8583  C  CB    . VAL C 2  690  ? -31.449 27.856  7.357   1.00 34.46  ? 690  VAL C CB    1 
ATOM   8584  C  CG1   . VAL C 2  690  ? -32.328 26.643  7.578   1.00 32.89  ? 690  VAL C CG1   1 
ATOM   8585  C  CG2   . VAL C 2  690  ? -30.500 28.040  8.525   1.00 34.25  ? 690  VAL C CG2   1 
ATOM   8586  N  N     . ASP C 2  691  ? -30.883 29.709  4.729   1.00 39.32  ? 691  ASP C N     1 
ATOM   8587  C  CA    . ASP C 2  691  ? -30.568 31.064  4.300   1.00 42.71  ? 691  ASP C CA    1 
ATOM   8588  C  C     . ASP C 2  691  ? -31.092 32.056  5.343   1.00 41.18  ? 691  ASP C C     1 
ATOM   8589  O  O     . ASP C 2  691  ? -31.779 31.664  6.289   1.00 40.29  ? 691  ASP C O     1 
ATOM   8590  C  CB    . ASP C 2  691  ? -31.167 31.343  2.918   1.00 45.50  ? 691  ASP C CB    1 
ATOM   8591  C  CG    . ASP C 2  691  ? -30.161 31.954  1.954   1.00 52.24  ? 691  ASP C CG    1 
ATOM   8592  O  OD1   . ASP C 2  691  ? -29.403 32.859  2.366   1.00 51.73  ? 691  ASP C OD1   1 
ATOM   8593  O  OD2   . ASP C 2  691  ? -30.123 31.526  0.781   1.00 56.63  ? 691  ASP C OD2   1 
ATOM   8594  N  N     . ALA C 2  692  ? -30.765 33.335  5.182   1.00 37.34  ? 692  ALA C N     1 
ATOM   8595  C  CA    . ALA C 2  692  ? -31.151 34.326  6.178   1.00 34.82  ? 692  ALA C CA    1 
ATOM   8596  C  C     . ALA C 2  692  ? -32.661 34.541  6.180   1.00 32.84  ? 692  ALA C C     1 
ATOM   8597  O  O     . ALA C 2  692  ? -33.301 34.534  5.132   1.00 33.20  ? 692  ALA C O     1 
ATOM   8598  C  CB    . ALA C 2  692  ? -30.425 35.640  5.936   1.00 35.45  ? 692  ALA C CB    1 
ATOM   8599  N  N     . GLY C 2  693  ? -33.226 34.711  7.368   1.00 31.87  ? 693  GLY C N     1 
ATOM   8600  C  CA    . GLY C 2  693  ? -34.638 35.003  7.501   1.00 31.78  ? 693  GLY C CA    1 
ATOM   8601  C  C     . GLY C 2  693  ? -35.545 33.816  7.253   1.00 34.91  ? 693  GLY C C     1 
ATOM   8602  O  O     . GLY C 2  693  ? -36.737 33.989  7.012   1.00 39.01  ? 693  GLY C O     1 
ATOM   8603  N  N     . ASP C 2  694  ? -34.996 32.607  7.306   1.00 34.67  ? 694  ASP C N     1 
ATOM   8604  C  CA    . ASP C 2  694  ? -35.825 31.415  7.155   1.00 35.35  ? 694  ASP C CA    1 
ATOM   8605  C  C     . ASP C 2  694  ? -36.562 31.113  8.458   1.00 34.94  ? 694  ASP C C     1 
ATOM   8606  O  O     . ASP C 2  694  ? -36.028 31.317  9.547   1.00 36.35  ? 694  ASP C O     1 
ATOM   8607  C  CB    . ASP C 2  694  ? -34.985 30.206  6.726   1.00 38.56  ? 694  ASP C CB    1 
ATOM   8608  C  CG    . ASP C 2  694  ? -34.404 30.362  5.326   1.00 41.24  ? 694  ASP C CG    1 
ATOM   8609  O  OD1   . ASP C 2  694  ? -34.864 31.256  4.584   1.00 39.88  ? 694  ASP C OD1   1 
ATOM   8610  O  OD2   . ASP C 2  694  ? -33.492 29.585  4.965   1.00 41.13  ? 694  ASP C OD2   1 
ATOM   8611  N  N     . ARG C 2  695  ? -37.801 30.650  8.341   1.00 36.92  ? 695  ARG C N     1 
ATOM   8612  C  CA    . ARG C 2  695  ? -38.546 30.196  9.506   1.00 40.46  ? 695  ARG C CA    1 
ATOM   8613  C  C     . ARG C 2  695  ? -38.201 28.741  9.790   1.00 44.01  ? 695  ARG C C     1 
ATOM   8614  O  O     . ARG C 2  695  ? -38.504 27.850  8.993   1.00 44.15  ? 695  ARG C O     1 
ATOM   8615  C  CB    . ARG C 2  695  ? -40.052 30.352  9.299   1.00 45.22  ? 695  ARG C CB    1 
ATOM   8616  C  CG    . ARG C 2  695  ? -40.884 29.642  10.359  1.00 47.20  ? 695  ARG C CG    1 
ATOM   8617  C  CD    . ARG C 2  695  ? -40.663 30.251  11.737  1.00 49.81  ? 695  ARG C CD    1 
ATOM   8618  N  NE    . ARG C 2  695  ? -41.107 29.371  12.819  1.00 53.46  ? 695  ARG C NE    1 
ATOM   8619  C  CZ    . ARG C 2  695  ? -41.392 29.785  14.052  1.00 53.63  ? 695  ARG C CZ    1 
ATOM   8620  N  NH1   . ARG C 2  695  ? -41.293 31.074  14.361  1.00 50.01  ? 695  ARG C NH1   1 
ATOM   8621  N  NH2   . ARG C 2  695  ? -41.785 28.913  14.975  1.00 48.71  ? 695  ARG C NH2   1 
ATOM   8622  N  N     . VAL C 2  696  ? -37.560 28.509  10.930  1.00 45.27  ? 696  VAL C N     1 
ATOM   8623  C  CA    . VAL C 2  696  ? -37.119 27.172  11.298  1.00 43.50  ? 696  VAL C CA    1 
ATOM   8624  C  C     . VAL C 2  696  ? -37.799 26.707  12.582  1.00 43.61  ? 696  VAL C C     1 
ATOM   8625  O  O     . VAL C 2  696  ? -38.041 27.501  13.491  1.00 44.39  ? 696  VAL C O     1 
ATOM   8626  C  CB    . VAL C 2  696  ? -35.588 27.119  11.474  1.00 40.21  ? 696  VAL C CB    1 
ATOM   8627  C  CG1   . VAL C 2  696  ? -34.897 27.228  10.124  1.00 38.40  ? 696  VAL C CG1   1 
ATOM   8628  C  CG2   . VAL C 2  696  ? -35.123 28.232  12.399  1.00 38.81  ? 696  VAL C CG2   1 
ATOM   8629  N  N     . GLU C 2  697  ? -38.116 25.419  12.647  1.00 43.55  ? 697  GLU C N     1 
ATOM   8630  C  CA    . GLU C 2  697  ? -38.771 24.861  13.823  1.00 46.08  ? 697  GLU C CA    1 
ATOM   8631  C  C     . GLU C 2  697  ? -37.787 24.053  14.663  1.00 40.39  ? 697  GLU C C     1 
ATOM   8632  O  O     . GLU C 2  697  ? -36.737 23.631  14.179  1.00 36.71  ? 697  GLU C O     1 
ATOM   8633  C  CB    . GLU C 2  697  ? -39.967 24.000  13.410  1.00 50.87  ? 697  GLU C CB    1 
ATOM   8634  C  CG    . GLU C 2  697  ? -41.034 24.775  12.641  1.00 64.20  ? 697  GLU C CG    1 
ATOM   8635  C  CD    . GLU C 2  697  ? -42.079 23.873  12.007  1.00 91.09  ? 697  GLU C CD    1 
ATOM   8636  O  OE1   . GLU C 2  697  ? -42.239 22.726  12.476  1.00 86.53  ? 697  GLU C OE1   1 
ATOM   8637  O  OE2   . GLU C 2  697  ? -42.736 24.309  11.035  1.00 101.19 ? 697  GLU C OE2   1 
ATOM   8638  N  N     . ALA C 2  698  ? -38.138 23.853  15.927  1.00 41.16  ? 698  ALA C N     1 
ATOM   8639  C  CA    . ALA C 2  698  ? -37.248 23.220  16.891  1.00 39.56  ? 698  ALA C CA    1 
ATOM   8640  C  C     . ALA C 2  698  ? -36.976 21.766  16.538  1.00 37.24  ? 698  ALA C C     1 
ATOM   8641  O  O     . ALA C 2  698  ? -37.890 21.024  16.183  1.00 38.60  ? 698  ALA C O     1 
ATOM   8642  C  CB    . ALA C 2  698  ? -37.836 23.323  18.286  1.00 43.99  ? 698  ALA C CB    1 
ATOM   8643  N  N     . GLY C 2  699  ? -35.713 21.366  16.645  1.00 37.62  ? 699  GLY C N     1 
ATOM   8644  C  CA    . GLY C 2  699  ? -35.310 20.010  16.322  1.00 38.52  ? 699  GLY C CA    1 
ATOM   8645  C  C     . GLY C 2  699  ? -34.957 19.826  14.857  1.00 37.55  ? 699  GLY C C     1 
ATOM   8646  O  O     . GLY C 2  699  ? -34.726 18.707  14.402  1.00 36.89  ? 699  GLY C O     1 
ATOM   8647  N  N     . GLN C 2  700  ? -34.910 20.925  14.114  1.00 38.02  ? 700  GLN C N     1 
ATOM   8648  C  CA    . GLN C 2  700  ? -34.596 20.869  12.691  1.00 37.83  ? 700  GLN C CA    1 
ATOM   8649  C  C     . GLN C 2  700  ? -33.105 21.101  12.454  1.00 33.67  ? 700  GLN C C     1 
ATOM   8650  O  O     . GLN C 2  700  ? -32.490 21.936  13.120  1.00 32.64  ? 700  GLN C O     1 
ATOM   8651  C  CB    . GLN C 2  700  ? -35.428 21.903  11.929  1.00 40.45  ? 700  GLN C CB    1 
ATOM   8652  C  CG    . GLN C 2  700  ? -35.190 21.940  10.430  1.00 40.07  ? 700  GLN C CG    1 
ATOM   8653  C  CD    . GLN C 2  700  ? -35.729 23.207  9.798   1.00 41.95  ? 700  GLN C CD    1 
ATOM   8654  O  OE1   . GLN C 2  700  ? -36.398 24.008  10.454  1.00 39.36  ? 700  GLN C OE1   1 
ATOM   8655  N  NE2   . GLN C 2  700  ? -35.432 23.401  8.519   1.00 47.97  ? 700  GLN C NE2   1 
ATOM   8656  N  N     . VAL C 2  701  ? -32.526 20.359  11.512  1.00 30.57  ? 701  VAL C N     1 
ATOM   8657  C  CA    . VAL C 2  701  ? -31.118 20.547  11.167  1.00 30.61  ? 701  VAL C CA    1 
ATOM   8658  C  C     . VAL C 2  701  ? -30.917 21.846  10.400  1.00 29.34  ? 701  VAL C C     1 
ATOM   8659  O  O     . VAL C 2  701  ? -31.396 22.005  9.274   1.00 28.44  ? 701  VAL C O     1 
ATOM   8660  C  CB    . VAL C 2  701  ? -30.554 19.385  10.326  1.00 30.34  ? 701  VAL C CB    1 
ATOM   8661  C  CG1   . VAL C 2  701  ? -29.097 19.662  9.964   1.00 31.17  ? 701  VAL C CG1   1 
ATOM   8662  C  CG2   . VAL C 2  701  ? -30.675 18.069  11.080  1.00 30.90  ? 701  VAL C CG2   1 
ATOM   8663  N  N     . ILE C 2  702  ? -30.189 22.765  11.020  1.00 28.54  ? 702  ILE C N     1 
ATOM   8664  C  CA    . ILE C 2  702  ? -29.998 24.095  10.470  1.00 29.65  ? 702  ILE C CA    1 
ATOM   8665  C  C     . ILE C 2  702  ? -28.640 24.196  9.785   1.00 31.10  ? 702  ILE C C     1 
ATOM   8666  O  O     . ILE C 2  702  ? -28.367 25.140  9.039   1.00 30.07  ? 702  ILE C O     1 
ATOM   8667  C  CB    . ILE C 2  702  ? -30.121 25.155  11.571  1.00 28.23  ? 702  ILE C CB    1 
ATOM   8668  C  CG1   . ILE C 2  702  ? -28.812 25.301  12.338  1.00 29.36  ? 702  ILE C CG1   1 
ATOM   8669  C  CG2   . ILE C 2  702  ? -31.219 24.768  12.535  1.00 28.67  ? 702  ILE C CG2   1 
ATOM   8670  C  CD1   . ILE C 2  702  ? -28.910 26.288  13.470  1.00 31.50  ? 702  ILE C CD1   1 
ATOM   8671  N  N     . ALA C 2  703  ? -27.802 23.196  10.043  1.00 32.94  ? 703  ALA C N     1 
ATOM   8672  C  CA    . ALA C 2  703  ? -26.472 23.108  9.455   1.00 34.25  ? 703  ALA C CA    1 
ATOM   8673  C  C     . ALA C 2  703  ? -25.936 21.692  9.588   1.00 32.51  ? 703  ALA C C     1 
ATOM   8674  O  O     . ALA C 2  703  ? -25.875 21.147  10.688  1.00 33.76  ? 703  ALA C O     1 
ATOM   8675  C  CB    . ALA C 2  703  ? -25.527 24.094  10.119  1.00 34.51  ? 703  ALA C CB    1 
ATOM   8676  N  N     . ASP C 2  704  ? -25.556 21.088  8.470   1.00 31.97  ? 704  ASP C N     1 
ATOM   8677  C  CA    . ASP C 2  704  ? -24.999 19.740  8.517   1.00 32.69  ? 704  ASP C CA    1 
ATOM   8678  C  C     . ASP C 2  704  ? -23.482 19.796  8.543   1.00 33.44  ? 704  ASP C C     1 
ATOM   8679  O  O     . ASP C 2  704  ? -22.886 20.840  8.273   1.00 33.65  ? 704  ASP C O     1 
ATOM   8680  C  CB    . ASP C 2  704  ? -25.493 18.899  7.336   1.00 33.79  ? 704  ASP C CB    1 
ATOM   8681  C  CG    . ASP C 2  704  ? -25.411 19.632  6.014   1.00 36.00  ? 704  ASP C CG    1 
ATOM   8682  O  OD1   . ASP C 2  704  ? -24.480 20.446  5.823   1.00 37.94  ? 704  ASP C OD1   1 
ATOM   8683  O  OD2   . ASP C 2  704  ? -26.290 19.391  5.159   1.00 36.10  ? 704  ASP C OD2   1 
ATOM   8684  N  N     . GLY C 2  705  ? -22.866 18.667  8.867   1.00 34.67  ? 705  GLY C N     1 
ATOM   8685  C  CA    . GLY C 2  705  ? -21.427 18.610  9.002   1.00 36.44  ? 705  GLY C CA    1 
ATOM   8686  C  C     . GLY C 2  705  ? -20.767 17.703  7.987   1.00 34.37  ? 705  GLY C C     1 
ATOM   8687  O  O     . GLY C 2  705  ? -21.207 17.619  6.836   1.00 32.91  ? 705  GLY C O     1 
ATOM   8688  N  N     . PRO C 2  706  ? -19.703 17.007  8.417   1.00 32.06  ? 706  PRO C N     1 
ATOM   8689  C  CA    . PRO C 2  706  ? -18.957 16.102  7.540   1.00 31.79  ? 706  PRO C CA    1 
ATOM   8690  C  C     . PRO C 2  706  ? -19.831 14.920  7.150   1.00 32.17  ? 706  PRO C C     1 
ATOM   8691  O  O     . PRO C 2  706  ? -20.614 14.465  7.985   1.00 33.33  ? 706  PRO C O     1 
ATOM   8692  C  CB    . PRO C 2  706  ? -17.776 15.667  8.411   1.00 33.00  ? 706  PRO C CB    1 
ATOM   8693  C  CG    . PRO C 2  706  ? -18.307 15.740  9.808   1.00 31.27  ? 706  PRO C CG    1 
ATOM   8694  C  CD    . PRO C 2  706  ? -19.271 16.899  9.824   1.00 30.55  ? 706  PRO C CD    1 
ATOM   8695  N  N     . CYS C 2  707  ? -19.710 14.450  5.911   1.00 30.19  ? 707  CYS C N     1 
ATOM   8696  C  CA    . CYS C 2  707  ? -20.550 13.363  5.402   1.00 29.69  ? 707  CYS C CA    1 
ATOM   8697  C  C     . CYS C 2  707  ? -22.039 13.546  5.723   1.00 31.26  ? 707  CYS C C     1 
ATOM   8698  O  O     . CYS C 2  707  ? -22.678 12.615  6.223   1.00 31.51  ? 707  CYS C O     1 
ATOM   8699  C  CB    . CYS C 2  707  ? -20.096 12.008  5.966   1.00 29.57  ? 707  CYS C CB    1 
ATOM   8700  S  SG    . CYS C 2  707  ? -18.328 11.680  5.970   1.00 30.20  ? 707  CYS C SG    1 
ATOM   8701  N  N     . THR C 2  708  ? -22.586 14.733  5.462   1.00 31.41  ? 708  THR C N     1 
ATOM   8702  C  CA    . THR C 2  708  ? -24.011 14.977  5.707   1.00 31.82  ? 708  THR C CA    1 
ATOM   8703  C  C     . THR C 2  708  ? -24.620 15.983  4.711   1.00 32.50  ? 708  THR C C     1 
ATOM   8704  O  O     . THR C 2  708  ? -24.119 17.100  4.559   1.00 34.10  ? 708  THR C O     1 
ATOM   8705  C  CB    . THR C 2  708  ? -24.268 15.484  7.157   1.00 32.54  ? 708  THR C CB    1 
ATOM   8706  O  OG1   . THR C 2  708  ? -23.544 14.680  8.099   1.00 31.96  ? 708  THR C OG1   1 
ATOM   8707  C  CG2   . THR C 2  708  ? -25.743 15.401  7.488   1.00 32.60  ? 708  THR C CG2   1 
ATOM   8708  N  N     . ASP C 2  709  ? -25.697 15.571  4.038   1.00 33.07  ? 709  ASP C N     1 
ATOM   8709  C  CA    . ASP C 2  709  ? -26.421 16.420  3.084   1.00 34.28  ? 709  ASP C CA    1 
ATOM   8710  C  C     . ASP C 2  709  ? -27.885 16.574  3.509   1.00 33.45  ? 709  ASP C C     1 
ATOM   8711  O  O     . ASP C 2  709  ? -28.637 15.596  3.541   1.00 31.93  ? 709  ASP C O     1 
ATOM   8712  C  CB    . ASP C 2  709  ? -26.336 15.841  1.660   1.00 32.02  ? 709  ASP C CB    1 
ATOM   8713  C  CG    . ASP C 2  709  ? -26.795 16.830  0.587   1.00 32.29  ? 709  ASP C CG    1 
ATOM   8714  O  OD1   . ASP C 2  709  ? -26.693 18.056  0.813   1.00 33.18  ? 709  ASP C OD1   1 
ATOM   8715  O  OD2   . ASP C 2  709  ? -27.248 16.381  -0.490  1.00 31.13  ? 709  ASP C OD2   1 
ATOM   8716  N  N     . ASP C 2  710  ? -28.272 17.807  3.833   1.00 33.93  ? 710  ASP C N     1 
ATOM   8717  C  CA    . ASP C 2  710  ? -29.620 18.131  4.296   1.00 34.45  ? 710  ASP C CA    1 
ATOM   8718  C  C     . ASP C 2  710  ? -29.963 17.297  5.524   1.00 27.55  ? 710  ASP C C     1 
ATOM   8719  O  O     . ASP C 2  710  ? -31.094 16.860  5.696   1.00 31.30  ? 710  ASP C O     1 
ATOM   8720  C  CB    . ASP C 2  710  ? -30.660 17.911  3.182   1.00 42.75  ? 710  ASP C CB    1 
ATOM   8721  C  CG    . ASP C 2  710  ? -31.711 19.029  3.116   1.00 50.09  ? 710  ASP C CG    1 
ATOM   8722  O  OD1   . ASP C 2  710  ? -32.912 18.729  2.925   1.00 52.27  ? 710  ASP C OD1   1 
ATOM   8723  O  OD2   . ASP C 2  710  ? -31.336 20.214  3.237   1.00 53.67  ? 710  ASP C OD2   1 
ATOM   8724  N  N     . GLY C 2  711  ? -28.974 17.073  6.376   1.00 25.02  ? 711  GLY C N     1 
ATOM   8725  C  CA    . GLY C 2  711  ? -29.196 16.326  7.594   1.00 28.30  ? 711  GLY C CA    1 
ATOM   8726  C  C     . GLY C 2  711  ? -29.331 14.828  7.389   1.00 28.66  ? 711  GLY C C     1 
ATOM   8727  O  O     . GLY C 2  711  ? -29.970 14.142  8.185   1.00 28.82  ? 711  GLY C O     1 
ATOM   8728  N  N     . GLU C 2  712  ? -28.731 14.305  6.328   1.00 29.10  ? 712  GLU C N     1 
ATOM   8729  C  CA    . GLU C 2  712  ? -28.749 12.860  6.111   1.00 30.77  ? 712  GLU C CA    1 
ATOM   8730  C  C     . GLU C 2  712  ? -27.335 12.303  5.954   1.00 30.19  ? 712  GLU C C     1 
ATOM   8731  O  O     . GLU C 2  712  ? -26.465 12.963  5.391   1.00 32.48  ? 712  GLU C O     1 
ATOM   8732  C  CB    . GLU C 2  712  ? -29.599 12.506  4.883   1.00 34.32  ? 712  GLU C CB    1 
ATOM   8733  C  CG    . GLU C 2  712  ? -31.107 12.609  5.129   1.00 37.20  ? 712  GLU C CG    1 
ATOM   8734  C  CD    . GLU C 2  712  ? -31.953 11.999  4.015   1.00 34.23  ? 712  GLU C CD    1 
ATOM   8735  O  OE1   . GLU C 2  712  ? -31.659 12.255  2.826   1.00 30.61  ? 712  GLU C OE1   1 
ATOM   8736  O  OE2   . GLU C 2  712  ? -32.918 11.268  4.335   1.00 33.60  ? 712  GLU C OE2   1 
ATOM   8737  N  N     . MET C 2  713  ? -27.109 11.091  6.457   1.00 27.59  ? 713  MET C N     1 
ATOM   8738  C  CA    . MET C 2  713  ? -25.783 10.468  6.395   1.00 27.16  ? 713  MET C CA    1 
ATOM   8739  C  C     . MET C 2  713  ? -25.290 10.277  4.960   1.00 25.99  ? 713  MET C C     1 
ATOM   8740  O  O     . MET C 2  713  ? -25.826 9.466   4.209   1.00 26.87  ? 713  MET C O     1 
ATOM   8741  C  CB    . MET C 2  713  ? -25.784 9.116   7.119   1.00 27.79  ? 713  MET C CB    1 
ATOM   8742  C  CG    . MET C 2  713  ? -25.699 9.203   8.640   1.00 27.45  ? 713  MET C CG    1 
ATOM   8743  S  SD    . MET C 2  713  ? -24.186 9.992   9.229   1.00 24.39  ? 713  MET C SD    1 
ATOM   8744  C  CE    . MET C 2  713  ? -22.966 9.122   8.259   1.00 24.97  ? 713  MET C CE    1 
ATOM   8745  N  N     . ALA C 2  714  ? -24.254 11.022  4.591   1.00 28.35  ? 714  ALA C N     1 
ATOM   8746  C  CA    . ALA C 2  714  ? -23.719 10.971  3.235   1.00 30.92  ? 714  ALA C CA    1 
ATOM   8747  C  C     . ALA C 2  714  ? -22.254 10.519  3.206   1.00 31.79  ? 714  ALA C C     1 
ATOM   8748  O  O     . ALA C 2  714  ? -21.337 11.337  3.086   1.00 30.62  ? 714  ALA C O     1 
ATOM   8749  C  CB    . ALA C 2  714  ? -23.869 12.329  2.566   1.00 32.57  ? 714  ALA C CB    1 
ATOM   8750  N  N     . LEU C 2  715  ? -22.044 9.210   3.294   1.00 28.06  ? 715  LEU C N     1 
ATOM   8751  C  CA    . LEU C 2  715  ? -20.699 8.651   3.368   1.00 25.47  ? 715  LEU C CA    1 
ATOM   8752  C  C     . LEU C 2  715  ? -19.991 8.545   2.018   1.00 25.45  ? 715  LEU C C     1 
ATOM   8753  O  O     . LEU C 2  715  ? -18.787 8.287   1.960   1.00 25.16  ? 715  LEU C O     1 
ATOM   8754  C  CB    . LEU C 2  715  ? -20.760 7.275   4.023   1.00 23.84  ? 715  LEU C CB    1 
ATOM   8755  C  CG    . LEU C 2  715  ? -21.174 7.357   5.487   1.00 24.26  ? 715  LEU C CG    1 
ATOM   8756  C  CD1   . LEU C 2  715  ? -21.265 5.968   6.081   1.00 26.22  ? 715  LEU C CD1   1 
ATOM   8757  C  CD2   . LEU C 2  715  ? -20.173 8.217   6.245   1.00 24.49  ? 715  LEU C CD2   1 
ATOM   8758  N  N     . GLY C 2  716  ? -20.730 8.747   0.933   1.00 26.61  ? 716  GLY C N     1 
ATOM   8759  C  CA    . GLY C 2  716  ? -20.148 8.629   -0.390  1.00 26.78  ? 716  GLY C CA    1 
ATOM   8760  C  C     . GLY C 2  716  ? -20.846 9.439   -1.464  1.00 27.06  ? 716  GLY C C     1 
ATOM   8761  O  O     . GLY C 2  716  ? -21.589 10.377  -1.166  1.00 28.20  ? 716  GLY C O     1 
ATOM   8762  N  N     . LYS C 2  717  ? -20.596 9.076   -2.719  1.00 25.58  ? 717  LYS C N     1 
ATOM   8763  C  CA    . LYS C 2  717  ? -21.247 9.712   -3.858  1.00 26.44  ? 717  LYS C CA    1 
ATOM   8764  C  C     . LYS C 2  717  ? -22.075 8.688   -4.636  1.00 27.79  ? 717  LYS C C     1 
ATOM   8765  O  O     . LYS C 2  717  ? -21.909 7.477   -4.463  1.00 26.84  ? 717  LYS C O     1 
ATOM   8766  C  CB    . LYS C 2  717  ? -20.215 10.366  -4.785  1.00 24.49  ? 717  LYS C CB    1 
ATOM   8767  C  CG    . LYS C 2  717  ? -19.327 11.417  -4.137  1.00 23.56  ? 717  LYS C CG    1 
ATOM   8768  C  CD    . LYS C 2  717  ? -20.146 12.545  -3.538  1.00 27.74  ? 717  LYS C CD    1 
ATOM   8769  C  CE    . LYS C 2  717  ? -19.361 13.854  -3.511  1.00 33.01  ? 717  LYS C CE    1 
ATOM   8770  N  NZ    . LYS C 2  717  ? -19.142 14.430  -4.877  1.00 33.72  ? 717  LYS C NZ    1 
ATOM   8771  N  N     . ASN C 2  718  ? -22.968 9.183   -5.486  1.00 28.54  ? 718  ASN C N     1 
ATOM   8772  C  CA    . ASN C 2  718  ? -23.734 8.324   -6.381  1.00 26.93  ? 718  ASN C CA    1 
ATOM   8773  C  C     . ASN C 2  718  ? -23.093 8.323   -7.758  1.00 27.55  ? 718  ASN C C     1 
ATOM   8774  O  O     . ASN C 2  718  ? -23.174 9.307   -8.494  1.00 29.90  ? 718  ASN C O     1 
ATOM   8775  C  CB    . ASN C 2  718  ? -25.187 8.780   -6.462  1.00 25.47  ? 718  ASN C CB    1 
ATOM   8776  C  CG    . ASN C 2  718  ? -25.803 8.978   -5.101  1.00 24.89  ? 718  ASN C CG    1 
ATOM   8777  O  OD1   . ASN C 2  718  ? -26.340 8.046   -4.510  1.00 24.15  ? 718  ASN C OD1   1 
ATOM   8778  N  ND2   . ASN C 2  718  ? -25.712 10.197  -4.586  1.00 26.78  ? 718  ASN C ND2   1 
ATOM   8779  N  N     . LEU C 2  719  ? -22.446 7.214   -8.092  1.00 25.65  ? 719  LEU C N     1 
ATOM   8780  C  CA    . LEU C 2  719  ? -21.645 7.133   -9.302  1.00 26.74  ? 719  LEU C CA    1 
ATOM   8781  C  C     . LEU C 2  719  ? -22.332 6.296   -10.373 1.00 30.49  ? 719  LEU C C     1 
ATOM   8782  O  O     . LEU C 2  719  ? -23.220 5.498   -10.070 1.00 30.58  ? 719  LEU C O     1 
ATOM   8783  C  CB    . LEU C 2  719  ? -20.270 6.553   -8.976  1.00 27.76  ? 719  LEU C CB    1 
ATOM   8784  C  CG    . LEU C 2  719  ? -19.111 7.505   -8.666  1.00 28.15  ? 719  LEU C CG    1 
ATOM   8785  C  CD1   . LEU C 2  719  ? -19.546 8.722   -7.868  1.00 29.73  ? 719  LEU C CD1   1 
ATOM   8786  C  CD2   . LEU C 2  719  ? -18.034 6.747   -7.913  1.00 28.73  ? 719  LEU C CD2   1 
ATOM   8787  N  N     . LEU C 2  720  ? -21.916 6.485   -11.625 1.00 33.57  ? 720  LEU C N     1 
ATOM   8788  C  CA    . LEU C 2  720  ? -22.475 5.740   -12.752 1.00 32.86  ? 720  LEU C CA    1 
ATOM   8789  C  C     . LEU C 2  720  ? -21.701 4.450   -12.974 1.00 30.94  ? 720  LEU C C     1 
ATOM   8790  O  O     . LEU C 2  720  ? -20.566 4.468   -13.453 1.00 29.07  ? 720  LEU C O     1 
ATOM   8791  C  CB    . LEU C 2  720  ? -22.466 6.594   -14.020 1.00 32.51  ? 720  LEU C CB    1 
ATOM   8792  C  CG    . LEU C 2  720  ? -22.996 5.935   -15.292 1.00 30.91  ? 720  LEU C CG    1 
ATOM   8793  C  CD1   . LEU C 2  720  ? -24.336 5.297   -15.027 1.00 31.77  ? 720  LEU C CD1   1 
ATOM   8794  C  CD2   . LEU C 2  720  ? -23.117 6.965   -16.398 1.00 35.62  ? 720  LEU C CD2   1 
ATOM   8795  N  N     . VAL C 2  721  ? -22.333 3.331   -12.634 1.00 30.85  ? 721  VAL C N     1 
ATOM   8796  C  CA    . VAL C 2  721  ? -21.655 2.039   -12.596 1.00 33.19  ? 721  VAL C CA    1 
ATOM   8797  C  C     . VAL C 2  721  ? -21.891 1.197   -13.859 1.00 36.95  ? 721  VAL C C     1 
ATOM   8798  O  O     . VAL C 2  721  ? -22.968 1.238   -14.459 1.00 38.98  ? 721  VAL C O     1 
ATOM   8799  C  CB    . VAL C 2  721  ? -22.089 1.229   -11.340 1.00 29.90  ? 721  VAL C CB    1 
ATOM   8800  C  CG1   . VAL C 2  721  ? -23.540 0.794   -11.438 1.00 29.03  ? 721  VAL C CG1   1 
ATOM   8801  C  CG2   . VAL C 2  721  ? -21.180 0.029   -11.124 1.00 33.32  ? 721  VAL C CG2   1 
ATOM   8802  N  N     . ALA C 2  722  ? -20.859 0.457   -14.266 1.00 35.96  ? 722  ALA C N     1 
ATOM   8803  C  CA    . ALA C 2  722  ? -20.954 -0.487  -15.376 1.00 34.07  ? 722  ALA C CA    1 
ATOM   8804  C  C     . ALA C 2  722  ? -20.403 -1.851  -14.949 1.00 35.56  ? 722  ALA C C     1 
ATOM   8805  O  O     . ALA C 2  722  ? -19.212 -1.977  -14.654 1.00 36.53  ? 722  ALA C O     1 
ATOM   8806  C  CB    . ALA C 2  722  ? -20.204 0.043   -16.599 1.00 33.10  ? 722  ALA C CB    1 
ATOM   8807  N  N     . ILE C 2  723  ? -21.275 -2.860  -14.907 1.00 35.86  ? 723  ILE C N     1 
ATOM   8808  C  CA    . ILE C 2  723  ? -20.895 -4.222  -14.515 1.00 33.94  ? 723  ILE C CA    1 
ATOM   8809  C  C     . ILE C 2  723  ? -20.277 -4.993  -15.678 1.00 33.04  ? 723  ILE C C     1 
ATOM   8810  O  O     . ILE C 2  723  ? -20.987 -5.612  -16.470 1.00 33.27  ? 723  ILE C O     1 
ATOM   8811  C  CB    . ILE C 2  723  ? -22.108 -5.024  -13.984 1.00 35.33  ? 723  ILE C CB    1 
ATOM   8812  C  CG1   . ILE C 2  723  ? -22.862 -4.221  -12.923 1.00 34.93  ? 723  ILE C CG1   1 
ATOM   8813  C  CG2   . ILE C 2  723  ? -21.665 -6.379  -13.434 1.00 36.62  ? 723  ILE C CG2   1 
ATOM   8814  C  CD1   . ILE C 2  723  ? -22.026 -3.864  -11.714 1.00 35.36  ? 723  ILE C CD1   1 
ATOM   8815  N  N     . MET C 2  724  ? -18.952 -4.961  -15.772 1.00 33.90  ? 724  MET C N     1 
ATOM   8816  C  CA    . MET C 2  724  ? -18.262 -5.585  -16.893 1.00 33.51  ? 724  MET C CA    1 
ATOM   8817  C  C     . MET C 2  724  ? -16.749 -5.659  -16.695 1.00 31.02  ? 724  MET C C     1 
ATOM   8818  O  O     . MET C 2  724  ? -16.142 -4.755  -16.119 1.00 32.61  ? 724  MET C O     1 
ATOM   8819  C  CB    . MET C 2  724  ? -18.565 -4.826  -18.192 1.00 34.99  ? 724  MET C CB    1 
ATOM   8820  C  CG    . MET C 2  724  ? -17.988 -3.422  -18.244 1.00 33.64  ? 724  MET C CG    1 
ATOM   8821  S  SD    . MET C 2  724  ? -18.049 -2.732  -19.903 1.00 31.05  ? 724  MET C SD    1 
ATOM   8822  C  CE    . MET C 2  724  ? -16.942 -3.840  -20.774 1.00 32.89  ? 724  MET C CE    1 
ATOM   8823  N  N     . PRO C 2  725  ? -16.138 -6.750  -17.167 1.00 28.42  ? 725  PRO C N     1 
ATOM   8824  C  CA    . PRO C 2  725  ? -14.678 -6.852  -17.219 1.00 28.56  ? 725  PRO C CA    1 
ATOM   8825  C  C     . PRO C 2  725  ? -14.142 -5.874  -18.247 1.00 30.48  ? 725  PRO C C     1 
ATOM   8826  O  O     . PRO C 2  725  ? -14.778 -5.729  -19.288 1.00 31.25  ? 725  PRO C O     1 
ATOM   8827  C  CB    . PRO C 2  725  ? -14.433 -8.296  -17.656 1.00 33.20  ? 725  PRO C CB    1 
ATOM   8828  C  CG    . PRO C 2  725  ? -15.731 -9.003  -17.416 1.00 36.14  ? 725  PRO C CG    1 
ATOM   8829  C  CD    . PRO C 2  725  ? -16.798 -7.990  -17.596 1.00 31.59  ? 725  PRO C CD    1 
ATOM   8830  N  N     . TRP C 2  726  ? -13.013 -5.223  -17.977 1.00 32.76  ? 726  TRP C N     1 
ATOM   8831  C  CA    . TRP C 2  726  ? -12.499 -4.198  -18.886 1.00 36.53  ? 726  TRP C CA    1 
ATOM   8832  C  C     . TRP C 2  726  ? -10.972 -4.229  -18.996 1.00 35.75  ? 726  TRP C C     1 
ATOM   8833  O  O     . TRP C 2  726  ? -10.265 -3.650  -18.165 1.00 36.29  ? 726  TRP C O     1 
ATOM   8834  C  CB    . TRP C 2  726  ? -12.968 -2.806  -18.434 1.00 36.43  ? 726  TRP C CB    1 
ATOM   8835  C  CG    . TRP C 2  726  ? -12.869 -1.738  -19.496 1.00 32.11  ? 726  TRP C CG    1 
ATOM   8836  C  CD1   . TRP C 2  726  ? -13.858 -1.329  -20.341 1.00 31.25  ? 726  TRP C CD1   1 
ATOM   8837  C  CD2   . TRP C 2  726  ? -11.716 -0.946  -19.814 1.00 31.38  ? 726  TRP C CD2   1 
ATOM   8838  N  NE1   . TRP C 2  726  ? -13.392 -0.336  -21.168 1.00 31.98  ? 726  TRP C NE1   1 
ATOM   8839  C  CE2   . TRP C 2  726  ? -12.082 -0.083  -20.865 1.00 32.55  ? 726  TRP C CE2   1 
ATOM   8840  C  CE3   . TRP C 2  726  ? -10.412 -0.885  -19.315 1.00 31.31  ? 726  TRP C CE3   1 
ATOM   8841  C  CZ2   . TRP C 2  726  ? -11.190 0.827   -21.424 1.00 35.76  ? 726  TRP C CZ2   1 
ATOM   8842  C  CZ3   . TRP C 2  726  ? -9.530  0.015   -19.872 1.00 32.32  ? 726  TRP C CZ3   1 
ATOM   8843  C  CH2   . TRP C 2  726  ? -9.923  0.860   -20.917 1.00 35.01  ? 726  TRP C CH2   1 
ATOM   8844  N  N     . GLU C 2  727  ? -10.483 -4.915  -20.028 1.00 34.07  ? 727  GLU C N     1 
ATOM   8845  C  CA    . GLU C 2  727  ? -9.059  -4.966  -20.359 1.00 33.70  ? 727  GLU C CA    1 
ATOM   8846  C  C     . GLU C 2  727  ? -8.187  -5.280  -19.138 1.00 36.25  ? 727  GLU C C     1 
ATOM   8847  O  O     . GLU C 2  727  ? -7.054  -4.805  -19.040 1.00 36.46  ? 727  GLU C O     1 
ATOM   8848  C  CB    . GLU C 2  727  ? -8.611  -3.645  -20.996 1.00 37.16  ? 727  GLU C CB    1 
ATOM   8849  C  CG    . GLU C 2  727  ? -9.634  -3.010  -21.944 1.00 42.56  ? 727  GLU C CG    1 
ATOM   8850  C  CD    . GLU C 2  727  ? -9.463  -3.417  -23.403 1.00 44.15  ? 727  GLU C CD    1 
ATOM   8851  O  OE1   . GLU C 2  727  ? -8.753  -2.699  -24.145 1.00 47.74  ? 727  GLU C OE1   1 
ATOM   8852  O  OE2   . GLU C 2  727  ? -10.058 -4.438  -23.811 1.00 41.53  ? 727  GLU C OE2   1 
ATOM   8853  N  N     . GLY C 2  728  ? -8.737  -6.057  -18.202 1.00 36.08  ? 728  GLY C N     1 
ATOM   8854  C  CA    . GLY C 2  728  ? -7.986  -6.580  -17.066 1.00 34.18  ? 728  GLY C CA    1 
ATOM   8855  C  C     . GLY C 2  728  ? -7.689  -5.639  -15.908 1.00 32.52  ? 728  GLY C C     1 
ATOM   8856  O  O     . GLY C 2  728  ? -7.132  -6.058  -14.893 1.00 29.54  ? 728  GLY C O     1 
ATOM   8857  N  N     . HIS C 2  729  ? -8.060  -4.372  -16.049 1.00 33.75  ? 729  HIS C N     1 
ATOM   8858  C  CA    . HIS C 2  729  ? -7.738  -3.370  -15.038 1.00 32.98  ? 729  HIS C CA    1 
ATOM   8859  C  C     . HIS C 2  729  ? -8.690  -3.388  -13.836 1.00 33.09  ? 729  HIS C C     1 
ATOM   8860  O  O     . HIS C 2  729  ? -8.506  -2.622  -12.889 1.00 33.83  ? 729  HIS C O     1 
ATOM   8861  C  CB    . HIS C 2  729  ? -7.730  -1.973  -15.666 1.00 34.44  ? 729  HIS C CB    1 
ATOM   8862  C  CG    . HIS C 2  729  ? -6.402  -1.557  -16.215 1.00 34.58  ? 729  HIS C CG    1 
ATOM   8863  N  ND1   . HIS C 2  729  ? -5.361  -1.136  -15.410 1.00 35.42  ? 729  HIS C ND1   1 
ATOM   8864  C  CD2   . HIS C 2  729  ? -5.946  -1.472  -17.487 1.00 35.10  ? 729  HIS C CD2   1 
ATOM   8865  C  CE1   . HIS C 2  729  ? -4.327  -0.819  -16.162 1.00 39.55  ? 729  HIS C CE1   1 
ATOM   8866  N  NE2   . HIS C 2  729  ? -4.653  -1.015  -17.429 1.00 38.44  ? 729  HIS C NE2   1 
ATOM   8867  N  N     . ASN C 2  730  ? -9.705  -4.250  -13.876 1.00 33.03  ? 730  ASN C N     1 
ATOM   8868  C  CA    . ASN C 2  730  ? -10.586 -4.446  -12.721 1.00 33.94  ? 730  ASN C CA    1 
ATOM   8869  C  C     . ASN C 2  730  ? -10.535 -5.882  -12.194 1.00 35.55  ? 730  ASN C C     1 
ATOM   8870  O  O     . ASN C 2  730  ? -11.381 -6.297  -11.399 1.00 35.23  ? 730  ASN C O     1 
ATOM   8871  C  CB    . ASN C 2  730  ? -12.031 -4.071  -13.065 1.00 31.42  ? 730  ASN C CB    1 
ATOM   8872  C  CG    . ASN C 2  730  ? -12.514 -4.716  -14.348 1.00 32.17  ? 730  ASN C CG    1 
ATOM   8873  O  OD1   . ASN C 2  730  ? -11.791 -5.483  -14.985 1.00 32.83  ? 730  ASN C OD1   1 
ATOM   8874  N  ND2   . ASN C 2  730  ? -13.747 -4.409  -14.733 1.00 33.00  ? 730  ASN C ND2   1 
ATOM   8875  N  N     . TYR C 2  731  ? -9.522  -6.622  -12.636 1.00 33.42  ? 731  TYR C N     1 
ATOM   8876  C  CA    . TYR C 2  731  ? -9.358  -8.035  -12.304 1.00 30.69  ? 731  TYR C CA    1 
ATOM   8877  C  C     . TYR C 2  731  ? -8.995  -8.239  -10.829 1.00 31.45  ? 731  TYR C C     1 
ATOM   8878  O  O     . TYR C 2  731  ? -8.162  -7.515  -10.280 1.00 33.24  ? 731  TYR C O     1 
ATOM   8879  C  CB    . TYR C 2  731  ? -8.302  -8.640  -13.234 1.00 32.46  ? 731  TYR C CB    1 
ATOM   8880  C  CG    . TYR C 2  731  ? -7.650  -9.915  -12.758 1.00 35.37  ? 731  TYR C CG    1 
ATOM   8881  C  CD1   . TYR C 2  731  ? -8.242  -11.150 -12.983 1.00 35.59  ? 731  TYR C CD1   1 
ATOM   8882  C  CD2   . TYR C 2  731  ? -6.419  -9.885  -12.117 1.00 35.30  ? 731  TYR C CD2   1 
ATOM   8883  C  CE1   . TYR C 2  731  ? -7.635  -12.315 -12.561 1.00 36.28  ? 731  TYR C CE1   1 
ATOM   8884  C  CE2   . TYR C 2  731  ? -5.807  -11.041 -11.693 1.00 34.12  ? 731  TYR C CE2   1 
ATOM   8885  C  CZ    . TYR C 2  731  ? -6.418  -12.252 -11.916 1.00 36.38  ? 731  TYR C CZ    1 
ATOM   8886  O  OH    . TYR C 2  731  ? -5.801  -13.404 -11.489 1.00 42.64  ? 731  TYR C OH    1 
ATOM   8887  N  N     . GLU C 2  732  ? -9.638  -9.226  -10.205 1.00 31.27  ? 732  GLU C N     1 
ATOM   8888  C  CA    . GLU C 2  732  ? -9.537  -9.497  -8.763  1.00 34.24  ? 732  GLU C CA    1 
ATOM   8889  C  C     . GLU C 2  732  ? -9.914  -8.290  -7.901  1.00 31.94  ? 732  GLU C C     1 
ATOM   8890  O  O     . GLU C 2  732  ? -9.104  -7.803  -7.112  1.00 30.58  ? 732  GLU C O     1 
ATOM   8891  C  CB    . GLU C 2  732  ? -8.129  -9.987  -8.387  1.00 34.10  ? 732  GLU C CB    1 
ATOM   8892  C  CG    . GLU C 2  732  ? -7.934  -11.514 -8.443  1.00 36.74  ? 732  GLU C CG    1 
ATOM   8893  C  CD    . GLU C 2  732  ? -8.487  -12.252 -7.221  1.00 41.72  ? 732  GLU C CD    1 
ATOM   8894  O  OE1   . GLU C 2  732  ? -9.611  -11.942 -6.773  1.00 44.68  ? 732  GLU C OE1   1 
ATOM   8895  O  OE2   . GLU C 2  732  ? -7.793  -13.156 -6.707  1.00 42.89  ? 732  GLU C OE2   1 
ATOM   8896  N  N     . ASP C 2  733  ? -11.150 -7.820  -8.069  1.00 32.53  ? 733  ASP C N     1 
ATOM   8897  C  CA    . ASP C 2  733  ? -11.754 -6.802  -7.204  1.00 34.54  ? 733  ASP C CA    1 
ATOM   8898  C  C     . ASP C 2  733  ? -11.106 -5.421  -7.318  1.00 35.76  ? 733  ASP C C     1 
ATOM   8899  O  O     . ASP C 2  733  ? -11.387 -4.531  -6.509  1.00 35.53  ? 733  ASP C O     1 
ATOM   8900  C  CB    . ASP C 2  733  ? -11.724 -7.266  -5.741  1.00 35.98  ? 733  ASP C CB    1 
ATOM   8901  C  CG    . ASP C 2  733  ? -12.391 -8.615  -5.546  1.00 45.49  ? 733  ASP C CG    1 
ATOM   8902  O  OD1   . ASP C 2  733  ? -13.235 -8.992  -6.388  1.00 49.00  ? 733  ASP C OD1   1 
ATOM   8903  O  OD2   . ASP C 2  733  ? -12.077 -9.303  -4.547  1.00 48.05  ? 733  ASP C OD2   1 
ATOM   8904  N  N     . ALA C 2  734  ? -10.247 -5.246  -8.320  1.00 35.00  ? 734  ALA C N     1 
ATOM   8905  C  CA    . ALA C 2  734  ? -9.660  -3.938  -8.615  1.00 30.55  ? 734  ALA C CA    1 
ATOM   8906  C  C     . ALA C 2  734  ? -10.710 -3.035  -9.248  1.00 31.26  ? 734  ALA C C     1 
ATOM   8907  O  O     . ALA C 2  734  ? -11.647 -3.519  -9.883  1.00 32.93  ? 734  ALA C O     1 
ATOM   8908  C  CB    . ALA C 2  734  ? -8.456  -4.085  -9.528  1.00 29.54  ? 734  ALA C CB    1 
ATOM   8909  N  N     . ILE C 2  735  ? -10.558 -1.727  -9.081  1.00 31.34  ? 735  ILE C N     1 
ATOM   8910  C  CA    . ILE C 2  735  ? -11.586 -0.796  -9.539  1.00 31.19  ? 735  ILE C CA    1 
ATOM   8911  C  C     . ILE C 2  735  ? -11.054 0.190   -10.582 1.00 30.76  ? 735  ILE C C     1 
ATOM   8912  O  O     . ILE C 2  735  ? -9.937  0.694   -10.463 1.00 32.30  ? 735  ILE C O     1 
ATOM   8913  C  CB    . ILE C 2  735  ? -12.184 -0.010  -8.349  1.00 31.74  ? 735  ILE C CB    1 
ATOM   8914  C  CG1   . ILE C 2  735  ? -12.710 -0.979  -7.283  1.00 31.14  ? 735  ILE C CG1   1 
ATOM   8915  C  CG2   . ILE C 2  735  ? -13.287 0.921   -8.817  1.00 30.97  ? 735  ILE C CG2   1 
ATOM   8916  C  CD1   . ILE C 2  735  ? -13.355 -0.300  -6.090  1.00 30.22  ? 735  ILE C CD1   1 
ATOM   8917  N  N     . ILE C 2  736  ? -11.857 0.452   -11.610 1.00 28.79  ? 736  ILE C N     1 
ATOM   8918  C  CA    . ILE C 2  736  ? -11.495 1.429   -12.633 1.00 31.86  ? 736  ILE C CA    1 
ATOM   8919  C  C     . ILE C 2  736  ? -12.360 2.693   -12.499 1.00 37.69  ? 736  ILE C C     1 
ATOM   8920  O  O     . ILE C 2  736  ? -13.586 2.603   -12.359 1.00 37.66  ? 736  ILE C O     1 
ATOM   8921  C  CB    . ILE C 2  736  ? -11.636 0.834   -14.050 1.00 30.22  ? 736  ILE C CB    1 
ATOM   8922  C  CG1   . ILE C 2  736  ? -11.118 -0.606  -14.077 1.00 31.08  ? 736  ILE C CG1   1 
ATOM   8923  C  CG2   . ILE C 2  736  ? -10.895 1.691   -15.069 1.00 31.90  ? 736  ILE C CG2   1 
ATOM   8924  C  CD1   . ILE C 2  736  ? -11.298 -1.294  -15.412 1.00 34.36  ? 736  ILE C CD1   1 
ATOM   8925  N  N     . LEU C 2  737  ? -11.717 3.863   -12.534 1.00 37.87  ? 737  LEU C N     1 
ATOM   8926  C  CA    . LEU C 2  737  ? -12.408 5.138   -12.320 1.00 34.61  ? 737  LEU C CA    1 
ATOM   8927  C  C     . LEU C 2  737  ? -12.310 6.090   -13.509 1.00 36.44  ? 737  LEU C C     1 
ATOM   8928  O  O     . LEU C 2  737  ? -11.320 6.087   -14.240 1.00 36.56  ? 737  LEU C O     1 
ATOM   8929  C  CB    . LEU C 2  737  ? -11.858 5.842   -11.074 1.00 31.82  ? 737  LEU C CB    1 
ATOM   8930  C  CG    . LEU C 2  737  ? -12.318 5.325   -9.709  1.00 29.19  ? 737  LEU C CG    1 
ATOM   8931  C  CD1   . LEU C 2  737  ? -11.941 6.298   -8.602  1.00 28.17  ? 737  LEU C CD1   1 
ATOM   8932  C  CD2   . LEU C 2  737  ? -13.816 5.070   -9.719  1.00 29.09  ? 737  LEU C CD2   1 
ATOM   8933  N  N     . SER C 2  738  ? -13.349 6.907   -13.677 1.00 38.28  ? 738  SER C N     1 
ATOM   8934  C  CA    . SER C 2  738  ? -13.373 7.986   -14.665 1.00 39.47  ? 738  SER C CA    1 
ATOM   8935  C  C     . SER C 2  738  ? -12.616 9.209   -14.152 1.00 38.38  ? 738  SER C C     1 
ATOM   8936  O  O     . SER C 2  738  ? -12.750 9.580   -12.986 1.00 37.13  ? 738  SER C O     1 
ATOM   8937  C  CB    . SER C 2  738  ? -14.823 8.360   -15.006 1.00 40.25  ? 738  SER C CB    1 
ATOM   8938  O  OG    . SER C 2  738  ? -14.896 9.409   -15.958 1.00 41.89  ? 738  SER C OG    1 
ATOM   8939  N  N     . ASN C 2  739  ? -11.833 9.846   -15.021 1.00 38.38  ? 739  ASN C N     1 
ATOM   8940  C  CA    . ASN C 2  739  ? -11.019 10.992  -14.615 1.00 39.24  ? 739  ASN C CA    1 
ATOM   8941  C  C     . ASN C 2  739  ? -11.877 12.191  -14.209 1.00 39.92  ? 739  ASN C C     1 
ATOM   8942  O  O     . ASN C 2  739  ? -11.376 13.162  -13.641 1.00 39.62  ? 739  ASN C O     1 
ATOM   8943  C  CB    . ASN C 2  739  ? -10.058 11.388  -15.739 1.00 42.57  ? 739  ASN C CB    1 
ATOM   8944  C  CG    . ASN C 2  739  ? -8.842  12.151  -15.233 1.00 45.27  ? 739  ASN C CG    1 
ATOM   8945  O  OD1   . ASN C 2  739  ? -8.473  12.057  -14.059 1.00 41.85  ? 739  ASN C OD1   1 
ATOM   8946  N  ND2   . ASN C 2  739  ? -8.209  12.906  -16.125 1.00 53.55  ? 739  ASN C ND2   1 
ATOM   8947  N  N     . ARG C 2  740  ? -13.171 12.106  -14.508 1.00 40.37  ? 740  ARG C N     1 
ATOM   8948  C  CA    . ARG C 2  740  ? -14.152 13.094  -14.076 1.00 39.45  ? 740  ARG C CA    1 
ATOM   8949  C  C     . ARG C 2  740  ? -14.089 13.284  -12.565 1.00 38.42  ? 740  ARG C C     1 
ATOM   8950  O  O     . ARG C 2  740  ? -14.124 14.406  -12.064 1.00 39.36  ? 740  ARG C O     1 
ATOM   8951  C  CB    . ARG C 2  740  ? -15.564 12.662  -14.495 1.00 37.69  ? 740  ARG C CB    1 
ATOM   8952  C  CG    . ARG C 2  740  ? -16.644 13.694  -14.213 1.00 39.31  ? 740  ARG C CG    1 
ATOM   8953  C  CD    . ARG C 2  740  ? -18.045 13.124  -14.401 1.00 39.72  ? 740  ARG C CD    1 
ATOM   8954  N  NE    . ARG C 2  740  ? -18.470 12.289  -13.280 1.00 39.49  ? 740  ARG C NE    1 
ATOM   8955  C  CZ    . ARG C 2  740  ? -19.037 12.752  -12.167 1.00 39.12  ? 740  ARG C CZ    1 
ATOM   8956  N  NH1   . ARG C 2  740  ? -19.246 14.052  -12.006 1.00 38.57  ? 740  ARG C NH1   1 
ATOM   8957  N  NH2   . ARG C 2  740  ? -19.393 11.909  -11.208 1.00 38.35  ? 740  ARG C NH2   1 
ATOM   8958  N  N     . LEU C 2  741  ? -13.970 12.169  -11.851 1.00 36.18  ? 741  LEU C N     1 
ATOM   8959  C  CA    . LEU C 2  741  ? -13.975 12.159  -10.391 1.00 35.72  ? 741  LEU C CA    1 
ATOM   8960  C  C     . LEU C 2  741  ? -12.744 12.839  -9.794  1.00 34.89  ? 741  LEU C C     1 
ATOM   8961  O  O     . LEU C 2  741  ? -12.752 13.248  -8.632  1.00 32.99  ? 741  LEU C O     1 
ATOM   8962  C  CB    . LEU C 2  741  ? -14.077 10.719  -9.887  1.00 35.14  ? 741  LEU C CB    1 
ATOM   8963  C  CG    . LEU C 2  741  ? -15.169 9.887   -10.566 1.00 34.85  ? 741  LEU C CG    1 
ATOM   8964  C  CD1   . LEU C 2  741  ? -15.177 8.457   -10.044 1.00 33.49  ? 741  LEU C CD1   1 
ATOM   8965  C  CD2   . LEU C 2  741  ? -16.539 10.536  -10.401 1.00 34.55  ? 741  LEU C CD2   1 
ATOM   8966  N  N     . VAL C 2  742  ? -11.690 12.948  -10.597 1.00 36.18  ? 742  VAL C N     1 
ATOM   8967  C  CA    . VAL C 2  742  ? -10.480 13.669  -10.211 1.00 37.87  ? 742  VAL C CA    1 
ATOM   8968  C  C     . VAL C 2  742  ? -10.573 15.137  -10.621 1.00 42.69  ? 742  VAL C C     1 
ATOM   8969  O  O     . VAL C 2  742  ? -10.271 16.037  -9.835  1.00 43.84  ? 742  VAL C O     1 
ATOM   8970  C  CB    . VAL C 2  742  ? -9.227  13.047  -10.851 1.00 37.25  ? 742  VAL C CB    1 
ATOM   8971  C  CG1   . VAL C 2  742  ? -8.012  13.930  -10.612 1.00 40.50  ? 742  VAL C CG1   1 
ATOM   8972  C  CG2   . VAL C 2  742  ? -8.997  11.644  -10.314 1.00 37.36  ? 742  VAL C CG2   1 
ATOM   8973  N  N     . GLU C 2  743  ? -10.999 15.362  -11.862 1.00 43.60  ? 743  GLU C N     1 
ATOM   8974  C  CA    . GLU C 2  743  ? -11.140 16.705  -12.417 1.00 42.49  ? 743  GLU C CA    1 
ATOM   8975  C  C     . GLU C 2  743  ? -12.240 17.497  -11.714 1.00 39.31  ? 743  GLU C C     1 
ATOM   8976  O  O     . GLU C 2  743  ? -12.116 18.708  -11.529 1.00 39.86  ? 743  GLU C O     1 
ATOM   8977  C  CB    . GLU C 2  743  ? -11.429 16.635  -13.926 1.00 45.01  ? 743  GLU C CB    1 
ATOM   8978  C  CG    . GLU C 2  743  ? -10.358 15.908  -14.749 1.00 50.13  ? 743  GLU C CG    1 
ATOM   8979  C  CD    . GLU C 2  743  ? -10.697 15.813  -16.237 1.00 58.40  ? 743  GLU C CD    1 
ATOM   8980  O  OE1   . GLU C 2  743  ? -11.807 16.232  -16.629 1.00 62.49  ? 743  GLU C OE1   1 
ATOM   8981  O  OE2   . GLU C 2  743  ? -9.852  15.320  -17.018 1.00 59.30  ? 743  GLU C OE2   1 
ATOM   8982  N  N     . GLU C 2  744  ? -13.312 16.806  -11.326 1.00 36.63  ? 744  GLU C N     1 
ATOM   8983  C  CA    . GLU C 2  744  ? -14.467 17.446  -10.694 1.00 37.42  ? 744  GLU C CA    1 
ATOM   8984  C  C     . GLU C 2  744  ? -14.464 17.308  -9.173  1.00 34.01  ? 744  GLU C C     1 
ATOM   8985  O  O     . GLU C 2  744  ? -15.456 17.637  -8.520  1.00 33.95  ? 744  GLU C O     1 
ATOM   8986  C  CB    . GLU C 2  744  ? -15.780 16.878  -11.256 1.00 40.19  ? 744  GLU C CB    1 
ATOM   8987  C  CG    . GLU C 2  744  ? -16.084 17.293  -12.696 1.00 41.60  ? 744  GLU C CG    1 
ATOM   8988  C  CD    . GLU C 2  744  ? -17.527 17.018  -13.108 1.00 43.88  ? 744  GLU C CD    1 
ATOM   8989  O  OE1   . GLU C 2  744  ? -18.312 16.528  -12.266 1.00 42.02  ? 744  GLU C OE1   1 
ATOM   8990  O  OE2   . GLU C 2  744  ? -17.875 17.295  -14.277 1.00 45.12  ? 744  GLU C OE2   1 
ATOM   8991  N  N     . ASP C 2  745  ? -13.355 16.824  -8.617  1.00 34.81  ? 745  ASP C N     1 
ATOM   8992  C  CA    . ASP C 2  745  ? -13.196 16.717  -7.165  1.00 38.56  ? 745  ASP C CA    1 
ATOM   8993  C  C     . ASP C 2  745  ? -14.341 15.930  -6.521  1.00 34.39  ? 745  ASP C C     1 
ATOM   8994  O  O     . ASP C 2  745  ? -14.760 16.217  -5.397  1.00 33.00  ? 745  ASP C O     1 
ATOM   8995  C  CB    . ASP C 2  745  ? -13.091 18.115  -6.531  1.00 41.72  ? 745  ASP C CB    1 
ATOM   8996  C  CG    . ASP C 2  745  ? -11.658 18.636  -6.480  1.00 42.28  ? 745  ASP C CG    1 
ATOM   8997  O  OD1   . ASP C 2  745  ? -10.723 17.806  -6.491  1.00 37.84  ? 745  ASP C OD1   1 
ATOM   8998  O  OD2   . ASP C 2  745  ? -11.470 19.874  -6.414  1.00 46.07  ? 745  ASP C OD2   1 
ATOM   8999  N  N     . VAL C 2  746  ? -14.852 14.940  -7.243  1.00 31.41  ? 746  VAL C N     1 
ATOM   9000  C  CA    . VAL C 2  746  ? -15.935 14.124  -6.724  1.00 31.62  ? 746  VAL C CA    1 
ATOM   9001  C  C     . VAL C 2  746  ? -15.451 13.292  -5.537  1.00 29.24  ? 746  VAL C C     1 
ATOM   9002  O  O     . VAL C 2  746  ? -16.046 13.335  -4.463  1.00 30.56  ? 746  VAL C O     1 
ATOM   9003  C  CB    . VAL C 2  746  ? -16.520 13.213  -7.821  1.00 35.94  ? 746  VAL C CB    1 
ATOM   9004  C  CG1   . VAL C 2  746  ? -17.400 12.123  -7.211  1.00 35.51  ? 746  VAL C CG1   1 
ATOM   9005  C  CG2   . VAL C 2  746  ? -17.297 14.045  -8.846  1.00 37.62  ? 746  VAL C CG2   1 
ATOM   9006  N  N     . LEU C 2  747  ? -14.363 12.553  -5.722  1.00 28.41  ? 747  LEU C N     1 
ATOM   9007  C  CA    . LEU C 2  747  ? -13.821 11.743  -4.635  1.00 28.00  ? 747  LEU C CA    1 
ATOM   9008  C  C     . LEU C 2  747  ? -12.564 12.351  -4.034  1.00 29.20  ? 747  LEU C C     1 
ATOM   9009  O  O     . LEU C 2  747  ? -11.581 11.656  -3.782  1.00 28.43  ? 747  LEU C O     1 
ATOM   9010  C  CB    . LEU C 2  747  ? -13.534 10.324  -5.115  1.00 26.58  ? 747  LEU C CB    1 
ATOM   9011  C  CG    . LEU C 2  747  ? -14.813 9.503   -5.277  1.00 26.25  ? 747  LEU C CG    1 
ATOM   9012  C  CD1   . LEU C 2  747  ? -14.563 8.247   -6.084  1.00 27.84  ? 747  LEU C CD1   1 
ATOM   9013  C  CD2   . LEU C 2  747  ? -15.408 9.158   -3.917  1.00 26.53  ? 747  LEU C CD2   1 
ATOM   9014  N  N     . THR C 2  748  ? -12.612 13.655  -3.799  1.00 29.51  ? 748  THR C N     1 
ATOM   9015  C  CA    . THR C 2  748  ? -11.501 14.370  -3.193  1.00 28.46  ? 748  THR C CA    1 
ATOM   9016  C  C     . THR C 2  748  ? -11.837 14.680  -1.734  1.00 26.65  ? 748  THR C C     1 
ATOM   9017  O  O     . THR C 2  748  ? -12.972 15.030  -1.417  1.00 26.98  ? 748  THR C O     1 
ATOM   9018  C  CB    . THR C 2  748  ? -11.186 15.667  -3.974  1.00 29.02  ? 748  THR C CB    1 
ATOM   9019  O  OG1   . THR C 2  748  ? -10.726 15.334  -5.291  1.00 29.20  ? 748  THR C OG1   1 
ATOM   9020  C  CG2   . THR C 2  748  ? -10.125 16.484  -3.269  1.00 30.73  ? 748  THR C CG2   1 
ATOM   9021  N  N     . SER C 2  749  ? -10.858 14.529  -0.847  1.00 25.82  ? 749  SER C N     1 
ATOM   9022  C  CA    . SER C 2  749  ? -11.071 14.757  0.579   1.00 26.26  ? 749  SER C CA    1 
ATOM   9023  C  C     . SER C 2  749  ? -10.013 15.680  1.181   1.00 28.62  ? 749  SER C C     1 
ATOM   9024  O  O     . SER C 2  749  ? -8.981  15.950  0.560   1.00 29.19  ? 749  SER C O     1 
ATOM   9025  C  CB    . SER C 2  749  ? -11.077 13.424  1.320   1.00 27.52  ? 749  SER C CB    1 
ATOM   9026  O  OG    . SER C 2  749  ? -9.990  12.619  0.899   1.00 26.79  ? 749  SER C OG    1 
ATOM   9027  N  N     . ILE C 2  750  ? -10.270 16.166  2.393   1.00 28.53  ? 750  ILE C N     1 
ATOM   9028  C  CA    . ILE C 2  750  ? -9.285  16.979  3.103   1.00 28.68  ? 750  ILE C CA    1 
ATOM   9029  C  C     . ILE C 2  750  ? -8.847  16.320  4.400   1.00 27.24  ? 750  ILE C C     1 
ATOM   9030  O  O     . ILE C 2  750  ? -9.673  15.880  5.200   1.00 27.46  ? 750  ILE C O     1 
ATOM   9031  C  CB    . ILE C 2  750  ? -9.813  18.385  3.432   1.00 31.28  ? 750  ILE C CB    1 
ATOM   9032  C  CG1   . ILE C 2  750  ? -10.026 19.200  2.154   1.00 33.13  ? 750  ILE C CG1   1 
ATOM   9033  C  CG2   . ILE C 2  750  ? -8.841  19.110  4.361   1.00 29.39  ? 750  ILE C CG2   1 
ATOM   9034  C  CD1   . ILE C 2  750  ? -10.661 20.565  2.396   1.00 34.46  ? 750  ILE C CD1   1 
ATOM   9035  N  N     . HIS C 2  751  ? -7.534  16.270  4.596   1.00 28.14  ? 751  HIS C N     1 
ATOM   9036  C  CA    . HIS C 2  751  ? -6.934  15.662  5.777   1.00 30.63  ? 751  HIS C CA    1 
ATOM   9037  C  C     . HIS C 2  751  ? -5.982  16.634  6.463   1.00 32.05  ? 751  HIS C C     1 
ATOM   9038  O  O     . HIS C 2  751  ? -5.212  17.335  5.804   1.00 34.68  ? 751  HIS C O     1 
ATOM   9039  C  CB    . HIS C 2  751  ? -6.189  14.379  5.397   1.00 30.98  ? 751  HIS C CB    1 
ATOM   9040  C  CG    . HIS C 2  751  ? -7.016  13.418  4.603   1.00 30.30  ? 751  HIS C CG    1 
ATOM   9041  N  ND1   . HIS C 2  751  ? -7.665  12.347  5.175   1.00 29.68  ? 751  HIS C ND1   1 
ATOM   9042  C  CD2   . HIS C 2  751  ? -7.311  13.378  3.282   1.00 30.49  ? 751  HIS C CD2   1 
ATOM   9043  C  CE1   . HIS C 2  751  ? -8.321  11.683  4.239   1.00 30.24  ? 751  HIS C CE1   1 
ATOM   9044  N  NE2   . HIS C 2  751  ? -8.122  12.288  3.082   1.00 31.16  ? 751  HIS C NE2   1 
ATOM   9045  N  N     . ILE C 2  752  ? -6.032  16.663  7.790   1.00 29.12  ? 752  ILE C N     1 
ATOM   9046  C  CA    . ILE C 2  752  ? -5.200  17.572  8.559   1.00 25.75  ? 752  ILE C CA    1 
ATOM   9047  C  C     . ILE C 2  752  ? -4.297  16.819  9.519   1.00 25.76  ? 752  ILE C C     1 
ATOM   9048  O  O     . ILE C 2  752  ? -4.750  15.945  10.254  1.00 25.52  ? 752  ILE C O     1 
ATOM   9049  C  CB    . ILE C 2  752  ? -6.051  18.565  9.355   1.00 25.28  ? 752  ILE C CB    1 
ATOM   9050  C  CG1   . ILE C 2  752  ? -7.020  19.288  8.420   1.00 25.47  ? 752  ILE C CG1   1 
ATOM   9051  C  CG2   . ILE C 2  752  ? -5.160  19.552  10.078  1.00 26.97  ? 752  ILE C CG2   1 
ATOM   9052  C  CD1   . ILE C 2  752  ? -8.154  19.993  9.127   1.00 27.66  ? 752  ILE C CD1   1 
ATOM   9053  N  N     . GLU C 2  753  ? -3.013  17.159  9.492   1.00 29.29  ? 753  GLU C N     1 
ATOM   9054  C  CA    . GLU C 2  753  ? -2.048  16.644  10.458  1.00 30.76  ? 753  GLU C CA    1 
ATOM   9055  C  C     . GLU C 2  753  ? -1.698  17.729  11.469  1.00 31.03  ? 753  GLU C C     1 
ATOM   9056  O  O     . GLU C 2  753  ? -1.671  18.917  11.137  1.00 30.96  ? 753  GLU C O     1 
ATOM   9057  C  CB    . GLU C 2  753  ? -0.781  16.145  9.758   1.00 32.99  ? 753  GLU C CB    1 
ATOM   9058  C  CG    . GLU C 2  753  ? -0.921  14.787  9.087   1.00 35.88  ? 753  GLU C CG    1 
ATOM   9059  C  CD    . GLU C 2  753  ? -0.855  13.644  10.079  1.00 34.61  ? 753  GLU C CD    1 
ATOM   9060  O  OE1   . GLU C 2  753  ? -0.639  13.916  11.280  1.00 28.15  ? 753  GLU C OE1   1 
ATOM   9061  O  OE2   . GLU C 2  753  ? -1.015  12.478  9.657   1.00 40.05  ? 753  GLU C OE2   1 
ATOM   9062  N  N     . GLU C 2  754  ? -1.450  17.315  12.707  1.00 30.83  ? 754  GLU C N     1 
ATOM   9063  C  CA    . GLU C 2  754  ? -1.014  18.238  13.746  1.00 32.68  ? 754  GLU C CA    1 
ATOM   9064  C  C     . GLU C 2  754  ? 0.399   17.890  14.167  1.00 35.58  ? 754  GLU C C     1 
ATOM   9065  O  O     . GLU C 2  754  ? 0.653   16.804  14.700  1.00 40.71  ? 754  GLU C O     1 
ATOM   9066  C  CB    . GLU C 2  754  ? -1.945  18.202  14.953  1.00 34.31  ? 754  GLU C CB    1 
ATOM   9067  C  CG    . GLU C 2  754  ? -1.371  18.911  16.169  1.00 36.15  ? 754  GLU C CG    1 
ATOM   9068  C  CD    . GLU C 2  754  ? -2.096  18.547  17.447  1.00 44.57  ? 754  GLU C CD    1 
ATOM   9069  O  OE1   . GLU C 2  754  ? -1.593  17.673  18.189  1.00 51.23  ? 754  GLU C OE1   1 
ATOM   9070  O  OE2   . GLU C 2  754  ? -3.171  19.133  17.705  1.00 44.32  ? 754  GLU C OE2   1 
ATOM   9071  N  N     . HIS C 2  755  ? 1.312   18.820  13.912  1.00 32.85  ? 755  HIS C N     1 
ATOM   9072  C  CA    . HIS C 2  755  ? 2.722   18.623  14.193  1.00 30.02  ? 755  HIS C CA    1 
ATOM   9073  C  C     . HIS C 2  755  ? 3.093   19.428  15.423  1.00 30.09  ? 755  HIS C C     1 
ATOM   9074  O  O     . HIS C 2  755  ? 2.484   20.460  15.707  1.00 29.75  ? 755  HIS C O     1 
ATOM   9075  C  CB    . HIS C 2  755  ? 3.554   19.012  12.973  1.00 27.65  ? 755  HIS C CB    1 
ATOM   9076  C  CG    . HIS C 2  755  ? 3.163   18.263  11.738  1.00 29.15  ? 755  HIS C CG    1 
ATOM   9077  N  ND1   . HIS C 2  755  ? 3.586   16.975  11.488  1.00 33.47  ? 755  HIS C ND1   1 
ATOM   9078  C  CD2   . HIS C 2  755  ? 2.353   18.600  10.706  1.00 30.37  ? 755  HIS C CD2   1 
ATOM   9079  C  CE1   . HIS C 2  755  ? 3.070   16.558  10.346  1.00 37.19  ? 755  HIS C CE1   1 
ATOM   9080  N  NE2   . HIS C 2  755  ? 2.318   17.526  9.850   1.00 34.75  ? 755  HIS C NE2   1 
ATOM   9081  N  N     . GLU C 2  756  ? 4.076   18.942  16.168  1.00 30.46  ? 756  GLU C N     1 
ATOM   9082  C  CA    . GLU C 2  756  ? 4.345   19.494  17.484  1.00 32.44  ? 756  GLU C CA    1 
ATOM   9083  C  C     . GLU C 2  756  ? 5.835   19.591  17.754  1.00 34.74  ? 756  GLU C C     1 
ATOM   9084  O  O     . GLU C 2  756  ? 6.612   18.745  17.311  1.00 37.09  ? 756  GLU C O     1 
ATOM   9085  C  CB    . GLU C 2  756  ? 3.677   18.628  18.551  1.00 34.14  ? 756  GLU C CB    1 
ATOM   9086  C  CG    . GLU C 2  756  ? 3.104   19.391  19.718  1.00 36.31  ? 756  GLU C CG    1 
ATOM   9087  C  CD    . GLU C 2  756  ? 2.246   18.507  20.594  1.00 38.79  ? 756  GLU C CD    1 
ATOM   9088  O  OE1   . GLU C 2  756  ? 2.702   17.394  20.931  1.00 40.60  ? 756  GLU C OE1   1 
ATOM   9089  O  OE2   . GLU C 2  756  ? 1.114   18.918  20.931  1.00 37.60  ? 756  GLU C OE2   1 
ATOM   9090  N  N     . ILE C 2  757  ? 6.232   20.628  18.481  1.00 34.51  ? 757  ILE C N     1 
ATOM   9091  C  CA    . ILE C 2  757  ? 7.588   20.687  18.997  1.00 38.01  ? 757  ILE C CA    1 
ATOM   9092  C  C     . ILE C 2  757  ? 7.689   21.664  20.164  1.00 41.06  ? 757  ILE C C     1 
ATOM   9093  O  O     . ILE C 2  757  ? 6.937   22.634  20.256  1.00 40.33  ? 757  ILE C O     1 
ATOM   9094  C  CB    . ILE C 2  757  ? 8.603   21.065  17.905  1.00 37.46  ? 757  ILE C CB    1 
ATOM   9095  C  CG1   . ILE C 2  757  ? 10.017  20.747  18.389  1.00 44.94  ? 757  ILE C CG1   1 
ATOM   9096  C  CG2   . ILE C 2  757  ? 8.453   22.518  17.511  1.00 39.68  ? 757  ILE C CG2   1 
ATOM   9097  C  CD1   . ILE C 2  757  ? 11.045  20.676  17.307  1.00 53.84  ? 757  ILE C CD1   1 
ATOM   9098  N  N     . ASP C 2  758  ? 8.621   21.377  21.066  1.00 46.58  ? 758  ASP C N     1 
ATOM   9099  C  CA    . ASP C 2  758  ? 8.763   22.124  22.304  1.00 48.88  ? 758  ASP C CA    1 
ATOM   9100  C  C     . ASP C 2  758  ? 10.213  22.531  22.563  1.00 56.18  ? 758  ASP C C     1 
ATOM   9101  O  O     . ASP C 2  758  ? 11.145  21.958  21.995  1.00 57.28  ? 758  ASP C O     1 
ATOM   9102  C  CB    . ASP C 2  758  ? 8.227   21.294  23.474  1.00 53.09  ? 758  ASP C CB    1 
ATOM   9103  C  CG    . ASP C 2  758  ? 8.749   19.856  23.466  1.00 58.84  ? 758  ASP C CG    1 
ATOM   9104  O  OD1   . ASP C 2  758  ? 9.367   19.444  22.460  1.00 58.67  ? 758  ASP C OD1   1 
ATOM   9105  O  OD2   . ASP C 2  758  ? 8.531   19.135  24.464  1.00 59.37  ? 758  ASP C OD2   1 
ATOM   9106  N  N     . ALA C 2  759  ? 10.388  23.528  23.424  1.00 57.22  ? 759  ALA C N     1 
ATOM   9107  C  CA    . ALA C 2  759  ? 11.711  24.021  23.788  1.00 61.94  ? 759  ALA C CA    1 
ATOM   9108  C  C     . ALA C 2  759  ? 11.931  23.866  25.294  1.00 61.91  ? 759  ALA C C     1 
ATOM   9109  O  O     . ALA C 2  759  ? 11.356  24.599  26.100  1.00 57.58  ? 759  ALA C O     1 
ATOM   9110  C  CB    . ALA C 2  759  ? 11.875  25.475  23.359  1.00 62.11  ? 759  ALA C CB    1 
ATOM   9111  N  N     . ARG C 2  760  ? 12.768  22.904  25.663  1.00 61.88  ? 760  ARG C N     1 
ATOM   9112  C  CA    . ARG C 2  760  ? 12.972  22.571  27.065  1.00 61.51  ? 760  ARG C CA    1 
ATOM   9113  C  C     . ARG C 2  760  ? 14.269  23.133  27.654  1.00 66.15  ? 760  ARG C C     1 
ATOM   9114  O  O     . ARG C 2  760  ? 15.078  23.754  26.957  1.00 65.06  ? 760  ARG C O     1 
ATOM   9115  C  CB    . ARG C 2  760  ? 12.962  21.052  27.247  1.00 65.56  ? 760  ARG C CB    1 
ATOM   9116  C  CG    . ARG C 2  760  ? 12.045  20.304  26.291  1.00 64.21  ? 760  ARG C CG    1 
ATOM   9117  C  CD    . ARG C 2  760  ? 12.240  18.798  26.427  1.00 71.80  ? 760  ARG C CD    1 
ATOM   9118  N  NE    . ARG C 2  760  ? 11.621  18.050  25.335  1.00 72.44  ? 760  ARG C NE    1 
ATOM   9119  C  CZ    . ARG C 2  760  ? 12.245  17.716  24.209  1.00 67.02  ? 760  ARG C CZ    1 
ATOM   9120  N  NH1   . ARG C 2  760  ? 13.510  18.064  24.018  1.00 61.91  ? 760  ARG C NH1   1 
ATOM   9121  N  NH2   . ARG C 2  760  ? 11.606  17.032  23.271  1.00 71.99  ? 760  ARG C NH2   1 
ATOM   9122  N  N     . ASP C 2  761  ? 14.444  22.904  28.953  1.00 66.43  ? 761  ASP C N     1 
ATOM   9123  C  CA    . ASP C 2  761  ? 15.698  23.179  29.645  1.00 68.56  ? 761  ASP C CA    1 
ATOM   9124  C  C     . ASP C 2  761  ? 16.636  21.986  29.559  1.00 75.47  ? 761  ASP C C     1 
ATOM   9125  O  O     . ASP C 2  761  ? 16.282  20.880  29.974  1.00 74.30  ? 761  ASP C O     1 
ATOM   9126  C  CB    . ASP C 2  761  ? 15.451  23.502  31.118  1.00 61.42  ? 761  ASP C CB    1 
ATOM   9127  C  CG    . ASP C 2  761  ? 14.843  24.862  31.326  1.00 66.35  ? 761  ASP C CG    1 
ATOM   9128  O  OD1   . ASP C 2  761  ? 15.344  25.843  30.734  1.00 73.01  ? 761  ASP C OD1   1 
ATOM   9129  O  OD2   . ASP C 2  761  ? 13.864  24.947  32.092  1.00 65.30  ? 761  ASP C OD2   1 
ATOM   9130  N  N     . THR C 2  762  ? 17.834  22.207  29.033  1.00 81.54  ? 762  THR C N     1 
ATOM   9131  C  CA    . THR C 2  762  ? 18.836  21.149  29.012  1.00 88.14  ? 762  THR C CA    1 
ATOM   9132  C  C     . THR C 2  762  ? 19.953  21.453  30.004  1.00 83.63  ? 762  THR C C     1 
ATOM   9133  O  O     . THR C 2  762  ? 19.871  22.410  30.773  1.00 80.66  ? 762  THR C O     1 
ATOM   9134  C  CB    . THR C 2  762  ? 19.427  20.944  27.598  1.00 95.01  ? 762  THR C CB    1 
ATOM   9135  O  OG1   . THR C 2  762  ? 20.427  19.918  27.640  1.00 97.22  ? 762  THR C OG1   1 
ATOM   9136  C  CG2   . THR C 2  762  ? 20.043  22.229  27.072  1.00 85.26  ? 762  THR C CG2   1 
ATOM   9137  N  N     . LYS C 2  763  ? 20.991  20.626  29.993  1.00 82.32  ? 763  LYS C N     1 
ATOM   9138  C  CA    . LYS C 2  763  ? 22.116  20.808  30.899  1.00 81.37  ? 763  LYS C CA    1 
ATOM   9139  C  C     . LYS C 2  763  ? 23.166  21.718  30.276  1.00 78.80  ? 763  LYS C C     1 
ATOM   9140  O  O     . LYS C 2  763  ? 24.088  22.181  30.947  1.00 77.66  ? 763  LYS C O     1 
ATOM   9141  C  CB    . LYS C 2  763  ? 22.725  19.455  31.264  1.00 87.27  ? 763  LYS C CB    1 
ATOM   9142  C  CG    . LYS C 2  763  ? 21.774  18.540  32.020  1.00 85.28  ? 763  LYS C CG    1 
ATOM   9143  C  CD    . LYS C 2  763  ? 21.415  19.125  33.378  1.00 80.45  ? 763  LYS C CD    1 
ATOM   9144  C  CE    . LYS C 2  763  ? 20.401  18.259  34.108  1.00 72.64  ? 763  LYS C CE    1 
ATOM   9145  N  NZ    . LYS C 2  763  ? 19.099  18.214  33.390  1.00 68.70  ? 763  LYS C NZ    1 
ATOM   9146  N  N     . LEU C 2  764  ? 23.010  21.973  28.983  1.00 81.42  ? 764  LEU C N     1 
ATOM   9147  C  CA    . LEU C 2  764  ? 23.925  22.831  28.246  1.00 87.72  ? 764  LEU C CA    1 
ATOM   9148  C  C     . LEU C 2  764  ? 23.312  24.210  28.034  1.00 91.36  ? 764  LEU C C     1 
ATOM   9149  O  O     . LEU C 2  764  ? 23.918  25.090  27.417  1.00 91.13  ? 764  LEU C O     1 
ATOM   9150  C  CB    . LEU C 2  764  ? 24.282  22.180  26.912  1.00 90.05  ? 764  LEU C CB    1 
ATOM   9151  C  CG    . LEU C 2  764  ? 24.962  20.824  27.101  1.00 91.13  ? 764  LEU C CG    1 
ATOM   9152  C  CD1   . LEU C 2  764  ? 24.599  19.855  25.988  1.00 95.02  ? 764  LEU C CD1   1 
ATOM   9153  C  CD2   . LEU C 2  764  ? 26.470  21.010  27.192  1.00 96.17  ? 764  LEU C CD2   1 
ATOM   9154  N  N     . GLY C 2  765  ? 22.105  24.385  28.566  1.00 92.31  ? 765  GLY C N     1 
ATOM   9155  C  CA    . GLY C 2  765  ? 21.352  25.618  28.424  1.00 91.54  ? 765  GLY C CA    1 
ATOM   9156  C  C     . GLY C 2  765  ? 19.865  25.341  28.302  1.00 84.90  ? 765  GLY C C     1 
ATOM   9157  O  O     . GLY C 2  765  ? 19.297  24.565  29.071  1.00 80.84  ? 765  GLY C O     1 
ATOM   9158  N  N     . ALA C 2  766  ? 19.231  25.975  27.326  1.00 86.20  ? 766  ALA C N     1 
ATOM   9159  C  CA    . ALA C 2  766  ? 17.817  25.756  27.062  1.00 79.06  ? 766  ALA C CA    1 
ATOM   9160  C  C     . ALA C 2  766  ? 17.560  25.916  25.575  1.00 83.37  ? 766  ALA C C     1 
ATOM   9161  O  O     . ALA C 2  766  ? 18.095  26.828  24.938  1.00 85.67  ? 766  ALA C O     1 
ATOM   9162  C  CB    . ALA C 2  766  ? 16.958  26.720  27.868  1.00 73.51  ? 766  ALA C CB    1 
ATOM   9163  N  N     . GLU C 2  767  ? 16.755  25.017  25.023  1.00 79.58  ? 767  GLU C N     1 
ATOM   9164  C  CA    . GLU C 2  767  ? 16.438  25.054  23.605  1.00 76.96  ? 767  GLU C CA    1 
ATOM   9165  C  C     . GLU C 2  767  ? 15.713  26.356  23.284  1.00 66.19  ? 767  GLU C C     1 
ATOM   9166  O  O     . GLU C 2  767  ? 14.750  26.715  23.960  1.00 65.97  ? 767  GLU C O     1 
ATOM   9167  C  CB    . GLU C 2  767  ? 15.593  23.835  23.219  1.00 76.91  ? 767  GLU C CB    1 
ATOM   9168  C  CG    . GLU C 2  767  ? 15.994  22.560  23.971  1.00 75.36  ? 767  GLU C CG    1 
ATOM   9169  C  CD    . GLU C 2  767  ? 15.314  21.300  23.442  1.00 77.91  ? 767  GLU C CD    1 
ATOM   9170  O  OE1   . GLU C 2  767  ? 14.104  21.354  23.129  1.00 77.92  ? 767  GLU C OE1   1 
ATOM   9171  O  OE2   . GLU C 2  767  ? 15.996  20.256  23.340  1.00 76.90  ? 767  GLU C OE2   1 
ATOM   9172  N  N     . GLU C 2  768  ? 16.195  27.088  22.285  1.00 62.37  ? 768  GLU C N     1 
ATOM   9173  C  CA    . GLU C 2  768  ? 15.496  28.300  21.879  1.00 68.37  ? 768  GLU C CA    1 
ATOM   9174  C  C     . GLU C 2  768  ? 15.033  28.202  20.431  1.00 65.19  ? 768  GLU C C     1 
ATOM   9175  O  O     . GLU C 2  768  ? 15.771  27.763  19.547  1.00 63.02  ? 768  GLU C O     1 
ATOM   9176  C  CB    . GLU C 2  768  ? 16.368  29.546  22.086  1.00 76.35  ? 768  GLU C CB    1 
ATOM   9177  C  CG    . GLU C 2  768  ? 17.580  29.663  21.175  1.00 83.09  ? 768  GLU C CG    1 
ATOM   9178  C  CD    . GLU C 2  768  ? 17.880  31.108  20.782  1.00 86.89  ? 768  GLU C CD    1 
ATOM   9179  O  OE1   . GLU C 2  768  ? 16.920  31.886  20.576  1.00 81.95  ? 768  GLU C OE1   1 
ATOM   9180  O  OE2   . GLU C 2  768  ? 19.074  31.465  20.679  1.00 87.61  ? 768  GLU C OE2   1 
ATOM   9181  N  N     . ILE C 2  769  ? 13.787  28.597  20.207  1.00 61.45  ? 769  ILE C N     1 
ATOM   9182  C  CA    . ILE C 2  769  ? 13.198  28.549  18.882  1.00 56.66  ? 769  ILE C CA    1 
ATOM   9183  C  C     . ILE C 2  769  ? 13.534  29.831  18.140  1.00 56.56  ? 769  ILE C C     1 
ATOM   9184  O  O     . ILE C 2  769  ? 13.205  30.925  18.600  1.00 61.44  ? 769  ILE C O     1 
ATOM   9185  C  CB    . ILE C 2  769  ? 11.680  28.355  18.958  1.00 53.23  ? 769  ILE C CB    1 
ATOM   9186  C  CG1   . ILE C 2  769  ? 11.362  27.136  19.825  1.00 51.57  ? 769  ILE C CG1   1 
ATOM   9187  C  CG2   . ILE C 2  769  ? 11.096  28.201  17.571  1.00 50.29  ? 769  ILE C CG2   1 
ATOM   9188  C  CD1   . ILE C 2  769  ? 9.897   26.886  20.010  1.00 48.68  ? 769  ILE C CD1   1 
ATOM   9189  N  N     . THR C 2  770  ? 14.201  29.698  17.000  1.00 52.78  ? 770  THR C N     1 
ATOM   9190  C  CA    . THR C 2  770  ? 14.684  30.872  16.292  1.00 56.36  ? 770  THR C CA    1 
ATOM   9191  C  C     . THR C 2  770  ? 14.785  30.667  14.778  1.00 53.80  ? 770  THR C C     1 
ATOM   9192  O  O     . THR C 2  770  ? 14.913  29.541  14.301  1.00 54.86  ? 770  THR C O     1 
ATOM   9193  C  CB    . THR C 2  770  ? 16.053  31.297  16.845  1.00 61.77  ? 770  THR C CB    1 
ATOM   9194  O  OG1   . THR C 2  770  ? 16.509  32.476  16.169  1.00 66.93  ? 770  THR C OG1   1 
ATOM   9195  C  CG2   . THR C 2  770  ? 17.055  30.181  16.659  1.00 65.02  ? 770  THR C CG2   1 
ATOM   9196  N  N     . ARG C 2  771  ? 14.716  31.774  14.039  1.00 53.75  ? 771  ARG C N     1 
ATOM   9197  C  CA    . ARG C 2  771  ? 14.806  31.773  12.579  1.00 53.29  ? 771  ARG C CA    1 
ATOM   9198  C  C     . ARG C 2  771  ? 16.256  31.587  12.130  1.00 60.85  ? 771  ARG C C     1 
ATOM   9199  O  O     . ARG C 2  771  ? 16.539  31.455  10.939  1.00 63.54  ? 771  ARG C O     1 
ATOM   9200  C  CB    . ARG C 2  771  ? 14.234  33.081  12.001  1.00 51.31  ? 771  ARG C CB    1 
ATOM   9201  C  CG    . ARG C 2  771  ? 13.928  33.056  10.498  1.00 53.17  ? 771  ARG C CG    1 
ATOM   9202  C  CD    . ARG C 2  771  ? 13.748  34.464  9.922   1.00 56.68  ? 771  ARG C CD    1 
ATOM   9203  N  NE    . ARG C 2  771  ? 13.384  34.453  8.504   1.00 58.99  ? 771  ARG C NE    1 
ATOM   9204  C  CZ    . ARG C 2  771  ? 14.262  34.460  7.504   1.00 66.65  ? 771  ARG C CZ    1 
ATOM   9205  N  NH1   . ARG C 2  771  ? 15.561  34.474  7.764   1.00 75.97  ? 771  ARG C NH1   1 
ATOM   9206  N  NH2   . ARG C 2  771  ? 13.843  34.450  6.244   1.00 59.76  ? 771  ARG C NH2   1 
ATOM   9207  N  N     . ASP C 2  772  ? 17.169  31.573  13.097  1.00 65.40  ? 772  ASP C N     1 
ATOM   9208  C  CA    . ASP C 2  772  ? 18.602  31.475  12.822  1.00 69.84  ? 772  ASP C CA    1 
ATOM   9209  C  C     . ASP C 2  772  ? 19.121  30.046  12.994  1.00 70.05  ? 772  ASP C C     1 
ATOM   9210  O  O     . ASP C 2  772  ? 19.509  29.644  14.091  1.00 68.35  ? 772  ASP C O     1 
ATOM   9211  C  CB    . ASP C 2  772  ? 19.378  32.432  13.735  1.00 64.69  ? 772  ASP C CB    1 
ATOM   9212  C  CG    . ASP C 2  772  ? 20.857  32.489  13.402  1.00 66.13  ? 772  ASP C CG    1 
ATOM   9213  O  OD1   . ASP C 2  772  ? 21.648  31.805  14.084  1.00 70.70  ? 772  ASP C OD1   1 
ATOM   9214  O  OD2   . ASP C 2  772  ? 21.224  33.221  12.458  1.00 66.12  ? 772  ASP C OD2   1 
ATOM   9215  N  N     . ILE C 2  773  ? 19.138  29.288  11.901  1.00 71.15  ? 773  ILE C N     1 
ATOM   9216  C  CA    . ILE C 2  773  ? 19.538  27.884  11.947  1.00 77.67  ? 773  ILE C CA    1 
ATOM   9217  C  C     . ILE C 2  773  ? 20.871  27.626  11.242  1.00 85.71  ? 773  ILE C C     1 
ATOM   9218  O  O     . ILE C 2  773  ? 21.041  28.001  10.080  1.00 84.27  ? 773  ILE C O     1 
ATOM   9219  C  CB    . ILE C 2  773  ? 18.460  26.981  11.320  1.00 80.61  ? 773  ILE C CB    1 
ATOM   9220  C  CG1   . ILE C 2  773  ? 17.138  27.128  12.078  1.00 74.72  ? 773  ILE C CG1   1 
ATOM   9221  C  CG2   . ILE C 2  773  ? 18.909  25.530  11.325  1.00 86.99  ? 773  ILE C CG2   1 
ATOM   9222  C  CD1   . ILE C 2  773  ? 16.098  26.089  11.706  1.00 72.14  ? 773  ILE C CD1   1 
ATOM   9223  N  N     . PRO C 2  774  ? 21.815  26.974  11.951  1.00 92.79  ? 774  PRO C N     1 
ATOM   9224  C  CA    . PRO C 2  774  ? 23.186  26.676  11.507  1.00 98.86  ? 774  PRO C CA    1 
ATOM   9225  C  C     . PRO C 2  774  ? 23.309  26.102  10.090  1.00 98.85  ? 774  PRO C C     1 
ATOM   9226  O  O     . PRO C 2  774  ? 22.681  25.091  9.771   1.00 95.01  ? 774  PRO C O     1 
ATOM   9227  C  CB    . PRO C 2  774  ? 23.658  25.647  12.536  1.00 93.83  ? 774  PRO C CB    1 
ATOM   9228  C  CG    . PRO C 2  774  ? 22.933  26.019  13.777  1.00 87.35  ? 774  PRO C CG    1 
ATOM   9229  C  CD    . PRO C 2  774  ? 21.585  26.522  13.338  1.00 85.10  ? 774  PRO C CD    1 
ATOM   9230  N  N     . ASN C 2  775  ? 24.127  26.758  9.266   1.00 101.67 ? 775  ASN C N     1 
ATOM   9231  C  CA    . ASN C 2  775  ? 24.441  26.314  7.905   1.00 101.38 ? 775  ASN C CA    1 
ATOM   9232  C  C     . ASN C 2  775  ? 23.213  26.100  7.012   1.00 95.35  ? 775  ASN C C     1 
ATOM   9233  O  O     . ASN C 2  775  ? 23.114  25.089  6.313   1.00 88.97  ? 775  ASN C O     1 
ATOM   9234  C  CB    . ASN C 2  775  ? 25.278  25.029  7.954   1.00 104.64 ? 775  ASN C CB    1 
ATOM   9235  C  CG    . ASN C 2  775  ? 26.661  25.253  8.553   1.00 115.58 ? 775  ASN C CG    1 
ATOM   9236  O  OD1   . ASN C 2  775  ? 27.237  26.336  8.430   1.00 120.64 ? 775  ASN C OD1   1 
ATOM   9237  N  ND2   . ASN C 2  775  ? 27.199  24.226  9.204   1.00 114.52 ? 775  ASN C ND2   1 
ATOM   9238  N  N     . ILE C 2  776  ? 22.294  27.067  7.032   1.00 92.62  ? 776  ILE C N     1 
ATOM   9239  C  CA    . ILE C 2  776  ? 21.068  27.016  6.230   1.00 84.91  ? 776  ILE C CA    1 
ATOM   9240  C  C     . ILE C 2  776  ? 20.876  28.280  5.384   1.00 83.69  ? 776  ILE C C     1 
ATOM   9241  O  O     . ILE C 2  776  ? 20.967  29.398  5.898   1.00 85.42  ? 776  ILE C O     1 
ATOM   9242  C  CB    . ILE C 2  776  ? 19.824  26.830  7.120   1.00 79.40  ? 776  ILE C CB    1 
ATOM   9243  C  CG1   . ILE C 2  776  ? 19.990  25.608  8.022   1.00 84.18  ? 776  ILE C CG1   1 
ATOM   9244  C  CG2   . ILE C 2  776  ? 18.576  26.694  6.268   1.00 77.43  ? 776  ILE C CG2   1 
ATOM   9245  C  CD1   . ILE C 2  776  ? 20.116  24.305  7.273   1.00 95.85  ? 776  ILE C CD1   1 
ATOM   9246  N  N     . SER C 2  777  ? 20.601  28.099  4.093   1.00 80.31  ? 777  SER C N     1 
ATOM   9247  C  CA    . SER C 2  777  ? 20.419  29.223  3.175   1.00 79.19  ? 777  SER C CA    1 
ATOM   9248  C  C     . SER C 2  777  ? 19.191  30.041  3.546   1.00 79.90  ? 777  SER C C     1 
ATOM   9249  O  O     . SER C 2  777  ? 18.307  29.556  4.248   1.00 81.75  ? 777  SER C O     1 
ATOM   9250  C  CB    . SER C 2  777  ? 20.292  28.731  1.732   1.00 72.49  ? 777  SER C CB    1 
ATOM   9251  O  OG    . SER C 2  777  ? 18.988  28.242  1.477   1.00 69.32  ? 777  SER C OG    1 
ATOM   9252  N  N     . ASP C 2  778  ? 19.127  31.278  3.065   1.00 84.30  ? 778  ASP C N     1 
ATOM   9253  C  CA    . ASP C 2  778  ? 17.968  32.121  3.334   1.00 87.42  ? 778  ASP C CA    1 
ATOM   9254  C  C     . ASP C 2  778  ? 16.816  31.723  2.414   1.00 84.67  ? 778  ASP C C     1 
ATOM   9255  O  O     . ASP C 2  778  ? 15.714  32.265  2.506   1.00 84.88  ? 778  ASP C O     1 
ATOM   9256  C  CB    . ASP C 2  778  ? 18.317  33.604  3.168   1.00 98.05  ? 778  ASP C CB    1 
ATOM   9257  C  CG    . ASP C 2  778  ? 19.296  34.097  4.227   1.00 101.56 ? 778  ASP C CG    1 
ATOM   9258  O  OD1   . ASP C 2  778  ? 19.479  33.391  5.244   1.00 100.04 ? 778  ASP C OD1   1 
ATOM   9259  O  OD2   . ASP C 2  778  ? 19.875  35.192  4.050   1.00 96.68  ? 778  ASP C OD2   1 
ATOM   9260  N  N     . GLU C 2  779  ? 17.084  30.762  1.534   1.00 80.98  ? 779  GLU C N     1 
ATOM   9261  C  CA    . GLU C 2  779  ? 16.069  30.215  0.644   1.00 84.29  ? 779  GLU C CA    1 
ATOM   9262  C  C     . GLU C 2  779  ? 15.203  29.190  1.366   1.00 82.32  ? 779  GLU C C     1 
ATOM   9263  O  O     . GLU C 2  779  ? 13.987  29.139  1.172   1.00 82.56  ? 779  GLU C O     1 
ATOM   9264  C  CB    . GLU C 2  779  ? 16.723  29.576  -0.577  1.00 88.81  ? 779  GLU C CB    1 
ATOM   9265  C  CG    . GLU C 2  779  ? 17.650  30.503  -1.334  1.00 98.90  ? 779  GLU C CG    1 
ATOM   9266  C  CD    . GLU C 2  779  ? 18.115  29.908  -2.648  1.00 120.79 ? 779  GLU C CD    1 
ATOM   9267  O  OE1   . GLU C 2  779  ? 17.562  28.863  -3.057  1.00 127.21 ? 779  GLU C OE1   1 
ATOM   9268  O  OE2   . GLU C 2  779  ? 19.033  30.483  -3.270  1.00 129.91 ? 779  GLU C OE2   1 
ATOM   9269  N  N     . VAL C 2  780  ? 15.841  28.372  2.197   1.00 80.97  ? 780  VAL C N     1 
ATOM   9270  C  CA    . VAL C 2  780  ? 15.134  27.380  2.998   1.00 81.32  ? 780  VAL C CA    1 
ATOM   9271  C  C     . VAL C 2  780  ? 14.354  28.051  4.131   1.00 77.89  ? 780  VAL C C     1 
ATOM   9272  O  O     . VAL C 2  780  ? 13.353  27.519  4.610   1.00 78.97  ? 780  VAL C O     1 
ATOM   9273  C  CB    . VAL C 2  780  ? 16.108  26.340  3.592   1.00 77.89  ? 780  VAL C CB    1 
ATOM   9274  C  CG1   . VAL C 2  780  ? 15.344  25.131  4.118   1.00 76.85  ? 780  VAL C CG1   1 
ATOM   9275  C  CG2   . VAL C 2  780  ? 17.131  25.912  2.549   1.00 73.41  ? 780  VAL C CG2   1 
ATOM   9276  N  N     . LEU C 2  781  ? 14.814  29.226  4.551   1.00 75.61  ? 781  LEU C N     1 
ATOM   9277  C  CA    . LEU C 2  781  ? 14.164  29.962  5.630   1.00 69.96  ? 781  LEU C CA    1 
ATOM   9278  C  C     . LEU C 2  781  ? 13.216  31.028  5.086   1.00 66.97  ? 781  LEU C C     1 
ATOM   9279  O  O     . LEU C 2  781  ? 12.669  31.833  5.841   1.00 64.26  ? 781  LEU C O     1 
ATOM   9280  C  CB    . LEU C 2  781  ? 15.210  30.615  6.536   1.00 71.71  ? 781  LEU C CB    1 
ATOM   9281  C  CG    . LEU C 2  781  ? 16.378  29.750  7.017   1.00 69.80  ? 781  LEU C CG    1 
ATOM   9282  C  CD1   . LEU C 2  781  ? 17.369  30.605  7.787   1.00 77.42  ? 781  LEU C CD1   1 
ATOM   9283  C  CD2   . LEU C 2  781  ? 15.885  28.601  7.871   1.00 61.93  ? 781  LEU C CD2   1 
ATOM   9284  N  N     . ALA C 2  782  ? 13.018  31.024  3.773   1.00 66.11  ? 782  ALA C N     1 
ATOM   9285  C  CA    . ALA C 2  782  ? 12.226  32.056  3.115   1.00 66.97  ? 782  ALA C CA    1 
ATOM   9286  C  C     . ALA C 2  782  ? 10.747  31.999  3.493   1.00 60.77  ? 782  ALA C C     1 
ATOM   9287  O  O     . ALA C 2  782  ? 10.008  32.959  3.271   1.00 60.31  ? 782  ALA C O     1 
ATOM   9288  C  CB    . ALA C 2  782  ? 12.384  31.952  1.606   1.00 71.71  ? 782  ALA C CB    1 
ATOM   9289  N  N     . ASP C 2  783  ? 10.314  30.881  4.067   1.00 56.65  ? 783  ASP C N     1 
ATOM   9290  C  CA    . ASP C 2  783  ? 8.905   30.715  4.406   1.00 53.05  ? 783  ASP C CA    1 
ATOM   9291  C  C     . ASP C 2  783  ? 8.635   30.867  5.907   1.00 48.07  ? 783  ASP C C     1 
ATOM   9292  O  O     . ASP C 2  783  ? 7.522   30.618  6.369   1.00 46.82  ? 783  ASP C O     1 
ATOM   9293  C  CB    . ASP C 2  783  ? 8.398   29.354  3.912   1.00 57.39  ? 783  ASP C CB    1 
ATOM   9294  C  CG    . ASP C 2  783  ? 8.322   29.271  2.390   1.00 59.60  ? 783  ASP C CG    1 
ATOM   9295  O  OD1   . ASP C 2  783  ? 8.765   28.248  1.822   1.00 58.42  ? 783  ASP C OD1   1 
ATOM   9296  O  OD2   . ASP C 2  783  ? 7.815   30.227  1.762   1.00 59.76  ? 783  ASP C OD2   1 
ATOM   9297  N  N     . LEU C 2  784  ? 9.646   31.288  6.661   1.00 46.39  ? 784  LEU C N     1 
ATOM   9298  C  CA    . LEU C 2  784  ? 9.490   31.489  8.101   1.00 44.63  ? 784  LEU C CA    1 
ATOM   9299  C  C     . LEU C 2  784  ? 9.238   32.942  8.467   1.00 46.71  ? 784  LEU C C     1 
ATOM   9300  O  O     . LEU C 2  784  ? 9.531   33.849  7.688   1.00 50.46  ? 784  LEU C O     1 
ATOM   9301  C  CB    . LEU C 2  784  ? 10.728  31.002  8.853   1.00 44.25  ? 784  LEU C CB    1 
ATOM   9302  C  CG    . LEU C 2  784  ? 11.085  29.534  8.660   1.00 45.86  ? 784  LEU C CG    1 
ATOM   9303  C  CD1   . LEU C 2  784  ? 12.074  29.074  9.720   1.00 48.75  ? 784  LEU C CD1   1 
ATOM   9304  C  CD2   . LEU C 2  784  ? 9.829   28.687  8.689   1.00 45.93  ? 784  LEU C CD2   1 
ATOM   9305  N  N     . ASP C 2  785  ? 8.706   33.162  9.664   1.00 45.53  ? 785  ASP C N     1 
ATOM   9306  C  CA    . ASP C 2  785  ? 8.626   34.514  10.200  1.00 46.87  ? 785  ASP C CA    1 
ATOM   9307  C  C     . ASP C 2  785  ? 9.879   34.836  11.003  1.00 46.63  ? 785  ASP C C     1 
ATOM   9308  O  O     . ASP C 2  785  ? 10.840  34.066  11.013  1.00 46.23  ? 785  ASP C O     1 
ATOM   9309  C  CB    . ASP C 2  785  ? 7.374   34.703  11.068  1.00 47.11  ? 785  ASP C CB    1 
ATOM   9310  C  CG    . ASP C 2  785  ? 7.280   33.706  12.216  1.00 44.66  ? 785  ASP C CG    1 
ATOM   9311  O  OD1   . ASP C 2  785  ? 8.317   33.178  12.671  1.00 44.03  ? 785  ASP C OD1   1 
ATOM   9312  O  OD2   . ASP C 2  785  ? 6.145   33.459  12.676  1.00 43.93  ? 785  ASP C OD2   1 
ATOM   9313  N  N     . GLU C 2  786  ? 9.847   35.970  11.689  1.00 49.59  ? 786  GLU C N     1 
ATOM   9314  C  CA    . GLU C 2  786  ? 10.973  36.418  12.497  1.00 53.07  ? 786  GLU C CA    1 
ATOM   9315  C  C     . GLU C 2  786  ? 11.217  35.502  13.700  1.00 48.64  ? 786  GLU C C     1 
ATOM   9316  O  O     . GLU C 2  786  ? 12.339  35.395  14.200  1.00 45.28  ? 786  GLU C O     1 
ATOM   9317  C  CB    . GLU C 2  786  ? 10.736  37.860  12.962  1.00 60.20  ? 786  GLU C CB    1 
ATOM   9318  C  CG    . GLU C 2  786  ? 9.737   38.025  14.115  1.00 58.86  ? 786  GLU C CG    1 
ATOM   9319  C  CD    . GLU C 2  786  ? 8.295   37.696  13.743  1.00 55.38  ? 786  GLU C CD    1 
ATOM   9320  O  OE1   . GLU C 2  786  ? 7.994   37.513  12.544  1.00 52.02  ? 786  GLU C OE1   1 
ATOM   9321  O  OE2   . GLU C 2  786  ? 7.455   37.623  14.666  1.00 53.12  ? 786  GLU C OE2   1 
ATOM   9322  N  N     . ARG C 2  787  ? 10.160  34.838  14.154  1.00 45.42  ? 787  ARG C N     1 
ATOM   9323  C  CA    . ARG C 2  787  ? 10.245  33.978  15.321  1.00 41.67  ? 787  ARG C CA    1 
ATOM   9324  C  C     . ARG C 2  787  ? 11.002  32.702  14.998  1.00 39.79  ? 787  ARG C C     1 
ATOM   9325  O  O     . ARG C 2  787  ? 11.870  32.279  15.753  1.00 42.60  ? 787  ARG C O     1 
ATOM   9326  C  CB    . ARG C 2  787  ? 8.846   33.647  15.840  1.00 45.11  ? 787  ARG C CB    1 
ATOM   9327  C  CG    . ARG C 2  787  ? 8.015   34.869  16.179  1.00 46.92  ? 787  ARG C CG    1 
ATOM   9328  C  CD    . ARG C 2  787  ? 6.642   34.472  16.668  1.00 44.41  ? 787  ARG C CD    1 
ATOM   9329  N  NE    . ARG C 2  787  ? 5.953   33.632  15.696  1.00 40.35  ? 787  ARG C NE    1 
ATOM   9330  C  CZ    . ARG C 2  787  ? 4.688   33.250  15.817  1.00 39.95  ? 787  ARG C CZ    1 
ATOM   9331  N  NH1   . ARG C 2  787  ? 3.980   33.644  16.867  1.00 38.72  ? 787  ARG C NH1   1 
ATOM   9332  N  NH2   . ARG C 2  787  ? 4.132   32.483  14.889  1.00 39.91  ? 787  ARG C NH2   1 
ATOM   9333  N  N     . GLY C 2  788  ? 10.673  32.099  13.864  1.00 40.78  ? 788  GLY C N     1 
ATOM   9334  C  CA    . GLY C 2  788  ? 11.250  30.825  13.481  1.00 43.10  ? 788  GLY C CA    1 
ATOM   9335  C  C     . GLY C 2  788  ? 10.145  29.843  13.151  1.00 41.82  ? 788  GLY C C     1 
ATOM   9336  O  O     . GLY C 2  788  ? 10.386  28.648  12.965  1.00 41.93  ? 788  GLY C O     1 
ATOM   9337  N  N     . ILE C 2  789  ? 8.923   30.366  13.083  1.00 43.11  ? 789  ILE C N     1 
ATOM   9338  C  CA    . ILE C 2  789  ? 7.738   29.581  12.755  1.00 40.54  ? 789  ILE C CA    1 
ATOM   9339  C  C     . ILE C 2  789  ? 7.335   29.782  11.297  1.00 40.25  ? 789  ILE C C     1 
ATOM   9340  O  O     . ILE C 2  789  ? 7.525   30.860  10.728  1.00 43.58  ? 789  ILE C O     1 
ATOM   9341  C  CB    . ILE C 2  789  ? 6.535   29.957  13.658  1.00 40.79  ? 789  ILE C CB    1 
ATOM   9342  C  CG1   . ILE C 2  789  ? 6.972   30.104  15.116  1.00 40.96  ? 789  ILE C CG1   1 
ATOM   9343  C  CG2   . ILE C 2  789  ? 5.413   28.933  13.537  1.00 39.90  ? 789  ILE C CG2   1 
ATOM   9344  C  CD1   . ILE C 2  789  ? 7.582   28.853  15.701  1.00 39.12  ? 789  ILE C CD1   1 
ATOM   9345  N  N     . VAL C 2  790  ? 6.782   28.738  10.694  1.00 36.30  ? 790  VAL C N     1 
ATOM   9346  C  CA    . VAL C 2  790  ? 6.230   28.852  9.358   1.00 36.56  ? 790  VAL C CA    1 
ATOM   9347  C  C     . VAL C 2  790  ? 5.069   29.847  9.381   1.00 36.00  ? 790  VAL C C     1 
ATOM   9348  O  O     . VAL C 2  790  ? 4.364   29.973  10.384  1.00 34.40  ? 790  VAL C O     1 
ATOM   9349  C  CB    . VAL C 2  790  ? 5.766   27.483  8.823   1.00 37.92  ? 790  VAL C CB    1 
ATOM   9350  C  CG1   . VAL C 2  790  ? 4.648   26.921  9.689   1.00 37.89  ? 790  VAL C CG1   1 
ATOM   9351  C  CG2   . VAL C 2  790  ? 5.335   27.589  7.364   1.00 41.93  ? 790  VAL C CG2   1 
ATOM   9352  N  N     . ARG C 2  791  ? 4.897   30.572  8.281   1.00 38.79  ? 791  ARG C N     1 
ATOM   9353  C  CA    . ARG C 2  791  ? 3.836   31.563  8.170   1.00 40.35  ? 791  ARG C CA    1 
ATOM   9354  C  C     . ARG C 2  791  ? 2.556   30.906  7.659   1.00 35.49  ? 791  ARG C C     1 
ATOM   9355  O  O     . ARG C 2  791  ? 2.609   29.994  6.831   1.00 34.67  ? 791  ARG C O     1 
ATOM   9356  C  CB    . ARG C 2  791  ? 4.277   32.704  7.248   1.00 44.16  ? 791  ARG C CB    1 
ATOM   9357  C  CG    . ARG C 2  791  ? 5.751   33.074  7.418   1.00 42.59  ? 791  ARG C CG    1 
ATOM   9358  C  CD    . ARG C 2  791  ? 6.054   34.502  6.990   1.00 43.02  ? 791  ARG C CD    1 
ATOM   9359  N  NE    . ARG C 2  791  ? 5.927   34.705  5.548   1.00 47.71  ? 791  ARG C NE    1 
ATOM   9360  C  CZ    . ARG C 2  791  ? 6.922   34.550  4.679   1.00 50.44  ? 791  ARG C CZ    1 
ATOM   9361  N  NH1   . ARG C 2  791  ? 8.124   34.180  5.100   1.00 50.13  ? 791  ARG C NH1   1 
ATOM   9362  N  NH2   . ARG C 2  791  ? 6.715   34.764  3.386   1.00 52.19  ? 791  ARG C NH2   1 
ATOM   9363  N  N     . ILE C 2  792  ? 1.409   31.353  8.164   1.00 31.65  ? 792  ILE C N     1 
ATOM   9364  C  CA    . ILE C 2  792  ? 0.135   30.777  7.746   1.00 30.95  ? 792  ILE C CA    1 
ATOM   9365  C  C     . ILE C 2  792  ? -0.114  31.082  6.276   1.00 34.79  ? 792  ILE C C     1 
ATOM   9366  O  O     . ILE C 2  792  ? 0.110   32.206  5.817   1.00 36.05  ? 792  ILE C O     1 
ATOM   9367  C  CB    . ILE C 2  792  ? -1.053  31.304  8.578   1.00 30.81  ? 792  ILE C CB    1 
ATOM   9368  C  CG1   . ILE C 2  792  ? -0.811  31.092  10.071  1.00 32.92  ? 792  ILE C CG1   1 
ATOM   9369  C  CG2   . ILE C 2  792  ? -2.352  30.622  8.153   1.00 28.54  ? 792  ILE C CG2   1 
ATOM   9370  C  CD1   . ILE C 2  792  ? -1.998  31.477  10.937  1.00 34.54  ? 792  ILE C CD1   1 
ATOM   9371  N  N     . GLY C 2  793  ? -0.572  30.070  5.545   1.00 37.29  ? 793  GLY C N     1 
ATOM   9372  C  CA    . GLY C 2  793  ? -0.846  30.203  4.128   1.00 38.12  ? 793  GLY C CA    1 
ATOM   9373  C  C     . GLY C 2  793  ? 0.239   29.561  3.294   1.00 37.71  ? 793  GLY C C     1 
ATOM   9374  O  O     . GLY C 2  793  ? 0.021   29.230  2.128   1.00 37.49  ? 793  GLY C O     1 
ATOM   9375  N  N     . ALA C 2  794  ? 1.411   29.389  3.901   1.00 37.53  ? 794  ALA C N     1 
ATOM   9376  C  CA    . ALA C 2  794  ? 2.560   28.818  3.213   1.00 41.91  ? 794  ALA C CA    1 
ATOM   9377  C  C     . ALA C 2  794  ? 2.264   27.373  2.849   1.00 45.10  ? 794  ALA C C     1 
ATOM   9378  O  O     . ALA C 2  794  ? 1.453   26.717  3.503   1.00 43.72  ? 794  ALA C O     1 
ATOM   9379  C  CB    . ALA C 2  794  ? 3.813   28.917  4.077   1.00 38.55  ? 794  ALA C CB    1 
ATOM   9380  N  N     . GLU C 2  795  ? 2.908   26.890  1.791   1.00 46.49  ? 795  GLU C N     1 
ATOM   9381  C  CA    . GLU C 2  795  ? 2.743   25.508  1.359   1.00 46.10  ? 795  GLU C CA    1 
ATOM   9382  C  C     . GLU C 2  795  ? 4.016   24.744  1.668   1.00 48.05  ? 795  GLU C C     1 
ATOM   9383  O  O     . GLU C 2  795  ? 5.111   25.227  1.388   1.00 51.24  ? 795  GLU C O     1 
ATOM   9384  C  CB    . GLU C 2  795  ? 2.414   25.430  -0.130  1.00 57.65  ? 795  GLU C CB    1 
ATOM   9385  N  N     . VAL C 2  796  ? 3.875   23.555  2.243   1.00 44.05  ? 796  VAL C N     1 
ATOM   9386  C  CA    . VAL C 2  796  ? 5.032   22.816  2.732   1.00 47.29  ? 796  VAL C CA    1 
ATOM   9387  C  C     . VAL C 2  796  ? 5.180   21.438  2.082   1.00 49.29  ? 796  VAL C C     1 
ATOM   9388  O  O     . VAL C 2  796  ? 4.202   20.711  1.889   1.00 46.55  ? 796  VAL C O     1 
ATOM   9389  C  CB    . VAL C 2  796  ? 4.973   22.657  4.268   1.00 42.76  ? 796  VAL C CB    1 
ATOM   9390  C  CG1   . VAL C 2  796  ? 5.269   23.985  4.946   1.00 43.29  ? 796  VAL C CG1   1 
ATOM   9391  C  CG2   . VAL C 2  796  ? 3.612   22.147  4.698   1.00 40.53  ? 796  VAL C CG2   1 
ATOM   9392  N  N     . ARG C 2  797  ? 6.422   21.111  1.729   1.00 56.21  ? 797  ARG C N     1 
ATOM   9393  C  CA    . ARG C 2  797  ? 6.799   19.808  1.192   1.00 57.87  ? 797  ARG C CA    1 
ATOM   9394  C  C     . ARG C 2  797  ? 7.505   19.034  2.292   1.00 58.11  ? 797  ARG C C     1 
ATOM   9395  O  O     . ARG C 2  797  ? 7.861   19.617  3.313   1.00 61.40  ? 797  ARG C O     1 
ATOM   9396  C  CB    . ARG C 2  797  ? 7.715   19.965  -0.026  1.00 61.90  ? 797  ARG C CB    1 
ATOM   9397  C  CG    . ARG C 2  797  ? 7.116   19.481  -1.331  1.00 65.33  ? 797  ARG C CG    1 
ATOM   9398  C  CD    . ARG C 2  797  ? 8.104   19.612  -2.481  1.00 71.30  ? 797  ARG C CD    1 
ATOM   9399  N  NE    . ARG C 2  797  ? 8.022   18.460  -3.374  1.00 88.73  ? 797  ARG C NE    1 
ATOM   9400  C  CZ    . ARG C 2  797  ? 8.685   17.323  -3.184  1.00 83.61  ? 797  ARG C CZ    1 
ATOM   9401  N  NH1   . ARG C 2  797  ? 9.487   17.187  -2.134  1.00 71.42  ? 797  ARG C NH1   1 
ATOM   9402  N  NH2   . ARG C 2  797  ? 8.548   16.321  -4.043  1.00 80.48  ? 797  ARG C NH2   1 
ATOM   9403  N  N     . ASP C 2  798  ? 7.720   17.735  2.099   1.00 58.03  ? 798  ASP C N     1 
ATOM   9404  C  CA    . ASP C 2  798  ? 8.475   16.967  3.086   1.00 59.60  ? 798  ASP C CA    1 
ATOM   9405  C  C     . ASP C 2  798  ? 9.953   17.348  3.003   1.00 60.74  ? 798  ASP C C     1 
ATOM   9406  O  O     . ASP C 2  798  ? 10.473  17.639  1.922   1.00 60.13  ? 798  ASP C O     1 
ATOM   9407  C  CB    . ASP C 2  798  ? 8.274   15.453  2.898   1.00 65.01  ? 798  ASP C CB    1 
ATOM   9408  C  CG    . ASP C 2  798  ? 8.629   14.978  1.502   1.00 76.30  ? 798  ASP C CG    1 
ATOM   9409  O  OD1   . ASP C 2  798  ? 8.716   15.833  0.596   1.00 81.89  ? 798  ASP C OD1   1 
ATOM   9410  O  OD2   . ASP C 2  798  ? 8.811   13.753  1.310   1.00 70.98  ? 798  ASP C OD2   1 
ATOM   9411  N  N     . GLY C 2  799  ? 10.613  17.375  4.158   1.00 58.35  ? 799  GLY C N     1 
ATOM   9412  C  CA    . GLY C 2  799  ? 11.999  17.795  4.238   1.00 60.23  ? 799  GLY C CA    1 
ATOM   9413  C  C     . GLY C 2  799  ? 12.138  19.256  4.628   1.00 62.50  ? 799  GLY C C     1 
ATOM   9414  O  O     . GLY C 2  799  ? 13.182  19.669  5.136   1.00 68.32  ? 799  GLY C O     1 
AT