data_5UHF
# 
_entry.id   5UHF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5UHF         
WWPDB D_1000225869 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5UH6 unspecified 
PDB . 5UH7 unspecified 
PDB . 5UH8 unspecified 
PDB . 5UH9 unspecified 
PDB . 5UHA unspecified 
PDB . 5UHB unspecified 
PDB . 5UHC unspecified 
PDB . 5UHD unspecified 
PDB . 5UHE unspecified 
PDB . 5UHG unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5UHF 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lin, W.'       1 ? 
'Das, K.'       2 ? 
'Feng, Y.'      3 ? 
'Ebright, R.H.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            66 
_citation.language                  ? 
_citation.page_first                169 
_citation.page_last                 179.e8 
_citation.title                     'Structural Basis of Mycobacterium tuberculosis Transcription and Transcription Inhibition.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2017.03.001 
_citation.pdbx_database_id_PubMed   28392175 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lin, W.'       1  
primary 'Mandal, S.'    2  
primary 'Degen, D.'     3  
primary 'Liu, Y.'       4  
primary 'Ebright, Y.W.' 5  
primary 'Li, S.'        6  
primary 'Feng, Y.'      7  
primary 'Zhang, Y.'     8  
primary 'Mandal, S.'    9  
primary 'Jiang, Y.'     10 
primary 'Liu, S.'       11 
primary 'Gigliotti, M.' 12 
primary 'Talaue, M.'    13 
primary 'Connell, N.'   14 
primary 'Das, K.'       15 
primary 'Arnold, E.'    16 
primary 'Ebright, R.H.' 17 
# 
_cell.length_a           152.374 
_cell.length_b           163.460 
_cell.length_c           197.384 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5UHF 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         5UHF 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed RNA polymerase subunit alpha'                                           37745.328  2 2.7.7.6 ? ? 
? 
2  polymer     man 'DNA-directed RNA polymerase subunit beta'                                            130018.828 1 2.7.7.6 ? ? 
? 
3  polymer     man 
;DNA-directed RNA polymerase subunit beta'
;
146968.969 1 2.7.7.6 ? ? ? 
4  polymer     man 'DNA-directed RNA polymerase subunit omega'                                           11851.140  1 2.7.7.6 ? ? 
? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                                    57877.160  1 ?       ? ? 
? 
6  polymer     syn 
;DNA (5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*G)-3')
;
7160.632   1 ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*CP*AP*GP*G)-3')
;
4899.180   1 ?       ? ? ? 
8  non-polymer syn 'ZINC ION'                                                                            65.409     2 ?       ? ? 
? 
9  non-polymer syn 'MAGNESIUM ION'                                                                       24.305     1 ?       ? ? 
? 
10 non-polymer syn 'N-(2-methylphenyl)-Nalpha-(selenophene-2-carbonyl)-D-phenylalaninamide'              411.356    1 ?       ? ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
5 Sigma-A                                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
A,B ? 
2 'polypeptide(L)'        no no 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
C   ? 
3 'polypeptide(L)'        no no 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
D   ? 
4 'polypeptide(L)'        no no 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
E   ? 
5 'polypeptide(L)'        no no 
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
F   ? 
6 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)
;
TATAATGGGAGCTGTCACGGATG H   ? 
7 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DC)(DA)(DG)(DG)' CATCCGTGAGTCCAGG G   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ILE n 
1 4    SER n 
1 5    GLN n 
1 6    ARG n 
1 7    PRO n 
1 8    THR n 
1 9    LEU n 
1 10   SER n 
1 11   GLU n 
1 12   ASP n 
1 13   VAL n 
1 14   LEU n 
1 15   THR n 
1 16   ASP n 
1 17   ASN n 
1 18   ARG n 
1 19   SER n 
1 20   GLN n 
1 21   PHE n 
1 22   VAL n 
1 23   ILE n 
1 24   GLU n 
1 25   PRO n 
1 26   LEU n 
1 27   GLU n 
1 28   PRO n 
1 29   GLY n 
1 30   PHE n 
1 31   GLY n 
1 32   TYR n 
1 33   THR n 
1 34   LEU n 
1 35   GLY n 
1 36   ASN n 
1 37   SER n 
1 38   LEU n 
1 39   ARG n 
1 40   ARG n 
1 41   THR n 
1 42   LEU n 
1 43   LEU n 
1 44   SER n 
1 45   SER n 
1 46   ILE n 
1 47   PRO n 
1 48   GLY n 
1 49   ALA n 
1 50   ALA n 
1 51   VAL n 
1 52   THR n 
1 53   SER n 
1 54   ILE n 
1 55   ARG n 
1 56   ILE n 
1 57   ASP n 
1 58   GLY n 
1 59   VAL n 
1 60   LEU n 
1 61   HIS n 
1 62   GLU n 
1 63   PHE n 
1 64   THR n 
1 65   THR n 
1 66   VAL n 
1 67   PRO n 
1 68   GLY n 
1 69   VAL n 
1 70   LYS n 
1 71   GLU n 
1 72   ASP n 
1 73   VAL n 
1 74   THR n 
1 75   GLU n 
1 76   ILE n 
1 77   ILE n 
1 78   LEU n 
1 79   ASN n 
1 80   LEU n 
1 81   LYS n 
1 82   SER n 
1 83   LEU n 
1 84   VAL n 
1 85   VAL n 
1 86   SER n 
1 87   SER n 
1 88   GLU n 
1 89   GLU n 
1 90   ASP n 
1 91   GLU n 
1 92   PRO n 
1 93   VAL n 
1 94   THR n 
1 95   MET n 
1 96   TYR n 
1 97   LEU n 
1 98   ARG n 
1 99   LYS n 
1 100  GLN n 
1 101  GLY n 
1 102  PRO n 
1 103  GLY n 
1 104  GLU n 
1 105  VAL n 
1 106  THR n 
1 107  ALA n 
1 108  GLY n 
1 109  ASP n 
1 110  ILE n 
1 111  VAL n 
1 112  PRO n 
1 113  PRO n 
1 114  ALA n 
1 115  GLY n 
1 116  VAL n 
1 117  THR n 
1 118  VAL n 
1 119  HIS n 
1 120  ASN n 
1 121  PRO n 
1 122  GLY n 
1 123  MET n 
1 124  HIS n 
1 125  ILE n 
1 126  ALA n 
1 127  THR n 
1 128  LEU n 
1 129  ASN n 
1 130  ASP n 
1 131  LYS n 
1 132  GLY n 
1 133  LYS n 
1 134  LEU n 
1 135  GLU n 
1 136  VAL n 
1 137  GLU n 
1 138  LEU n 
1 139  VAL n 
1 140  VAL n 
1 141  GLU n 
1 142  ARG n 
1 143  GLY n 
1 144  ARG n 
1 145  GLY n 
1 146  TYR n 
1 147  VAL n 
1 148  PRO n 
1 149  ALA n 
1 150  VAL n 
1 151  GLN n 
1 152  ASN n 
1 153  ARG n 
1 154  ALA n 
1 155  SER n 
1 156  GLY n 
1 157  ALA n 
1 158  GLU n 
1 159  ILE n 
1 160  GLY n 
1 161  ARG n 
1 162  ILE n 
1 163  PRO n 
1 164  VAL n 
1 165  ASP n 
1 166  SER n 
1 167  ILE n 
1 168  TYR n 
1 169  SER n 
1 170  PRO n 
1 171  VAL n 
1 172  LEU n 
1 173  LYS n 
1 174  VAL n 
1 175  THR n 
1 176  TYR n 
1 177  LYS n 
1 178  VAL n 
1 179  ASP n 
1 180  ALA n 
1 181  THR n 
1 182  ARG n 
1 183  VAL n 
1 184  GLU n 
1 185  GLN n 
1 186  ARG n 
1 187  THR n 
1 188  ASP n 
1 189  PHE n 
1 190  ASP n 
1 191  LYS n 
1 192  LEU n 
1 193  ILE n 
1 194  LEU n 
1 195  ASP n 
1 196  VAL n 
1 197  GLU n 
1 198  THR n 
1 199  LYS n 
1 200  ASN n 
1 201  SER n 
1 202  ILE n 
1 203  SER n 
1 204  PRO n 
1 205  ARG n 
1 206  ASP n 
1 207  ALA n 
1 208  LEU n 
1 209  ALA n 
1 210  SER n 
1 211  ALA n 
1 212  GLY n 
1 213  LYS n 
1 214  THR n 
1 215  LEU n 
1 216  VAL n 
1 217  GLU n 
1 218  LEU n 
1 219  PHE n 
1 220  GLY n 
1 221  LEU n 
1 222  ALA n 
1 223  ARG n 
1 224  GLU n 
1 225  LEU n 
1 226  ASN n 
1 227  VAL n 
1 228  GLU n 
1 229  ALA n 
1 230  GLU n 
1 231  GLY n 
1 232  ILE n 
1 233  GLU n 
1 234  ILE n 
1 235  GLY n 
1 236  PRO n 
1 237  SER n 
1 238  PRO n 
1 239  ALA n 
1 240  GLU n 
1 241  ALA n 
1 242  ASP n 
1 243  HIS n 
1 244  ILE n 
1 245  ALA n 
1 246  SER n 
1 247  PHE n 
1 248  ALA n 
1 249  LEU n 
1 250  PRO n 
1 251  ILE n 
1 252  ASP n 
1 253  ASP n 
1 254  LEU n 
1 255  ASP n 
1 256  LEU n 
1 257  THR n 
1 258  VAL n 
1 259  ARG n 
1 260  SER n 
1 261  TYR n 
1 262  ASN n 
1 263  CYS n 
1 264  LEU n 
1 265  LYS n 
1 266  ARG n 
1 267  GLU n 
1 268  GLY n 
1 269  VAL n 
1 270  HIS n 
1 271  THR n 
1 272  VAL n 
1 273  GLY n 
1 274  GLU n 
1 275  LEU n 
1 276  VAL n 
1 277  ALA n 
1 278  ARG n 
1 279  THR n 
1 280  GLU n 
1 281  SER n 
1 282  ASP n 
1 283  LEU n 
1 284  LEU n 
1 285  ASP n 
1 286  ILE n 
1 287  ARG n 
1 288  ASN n 
1 289  PHE n 
1 290  GLY n 
1 291  GLN n 
1 292  LYS n 
1 293  SER n 
1 294  ILE n 
1 295  ASP n 
1 296  GLU n 
1 297  VAL n 
1 298  LYS n 
1 299  ILE n 
1 300  LYS n 
1 301  LEU n 
1 302  HIS n 
1 303  GLN n 
1 304  LEU n 
1 305  GLY n 
1 306  LEU n 
1 307  SER n 
1 308  LEU n 
1 309  LYS n 
1 310  ASP n 
1 311  SER n 
1 312  PRO n 
1 313  PRO n 
1 314  SER n 
1 315  PHE n 
1 316  ASP n 
1 317  PRO n 
1 318  SER n 
1 319  GLU n 
1 320  VAL n 
1 321  ALA n 
1 322  GLY n 
1 323  TYR n 
1 324  ASP n 
1 325  VAL n 
1 326  ALA n 
1 327  THR n 
1 328  GLY n 
1 329  THR n 
1 330  TRP n 
1 331  SER n 
1 332  THR n 
1 333  GLU n 
1 334  GLY n 
1 335  ALA n 
1 336  TYR n 
1 337  ASP n 
1 338  GLU n 
1 339  GLN n 
1 340  ASP n 
1 341  TYR n 
1 342  ALA n 
1 343  GLU n 
1 344  THR n 
1 345  GLU n 
1 346  GLN n 
1 347  LEU n 
2 1    MET n 
2 2    LEU n 
2 3    GLU n 
2 4    GLY n 
2 5    CYS n 
2 6    ILE n 
2 7    LEU n 
2 8    ALA n 
2 9    ASP n 
2 10   SER n 
2 11   ARG n 
2 12   GLN n 
2 13   SER n 
2 14   LYS n 
2 15   THR n 
2 16   ALA n 
2 17   ALA n 
2 18   SER n 
2 19   PRO n 
2 20   SER n 
2 21   PRO n 
2 22   SER n 
2 23   ARG n 
2 24   PRO n 
2 25   GLN n 
2 26   SER n 
2 27   SER n 
2 28   SER n 
2 29   ASN n 
2 30   ASN n 
2 31   SER n 
2 32   VAL n 
2 33   PRO n 
2 34   GLY n 
2 35   ALA n 
2 36   PRO n 
2 37   ASN n 
2 38   ARG n 
2 39   VAL n 
2 40   SER n 
2 41   PHE n 
2 42   ALA n 
2 43   LYS n 
2 44   LEU n 
2 45   ARG n 
2 46   GLU n 
2 47   PRO n 
2 48   LEU n 
2 49   GLU n 
2 50   VAL n 
2 51   PRO n 
2 52   GLY n 
2 53   LEU n 
2 54   LEU n 
2 55   ASP n 
2 56   VAL n 
2 57   GLN n 
2 58   THR n 
2 59   ASP n 
2 60   SER n 
2 61   PHE n 
2 62   GLU n 
2 63   TRP n 
2 64   LEU n 
2 65   ILE n 
2 66   GLY n 
2 67   SER n 
2 68   PRO n 
2 69   ARG n 
2 70   TRP n 
2 71   ARG n 
2 72   GLU n 
2 73   SER n 
2 74   ALA n 
2 75   ALA n 
2 76   GLU n 
2 77   ARG n 
2 78   GLY n 
2 79   ASP n 
2 80   VAL n 
2 81   ASN n 
2 82   PRO n 
2 83   VAL n 
2 84   GLY n 
2 85   GLY n 
2 86   LEU n 
2 87   GLU n 
2 88   GLU n 
2 89   VAL n 
2 90   LEU n 
2 91   TYR n 
2 92   GLU n 
2 93   LEU n 
2 94   SER n 
2 95   PRO n 
2 96   ILE n 
2 97   GLU n 
2 98   ASP n 
2 99   PHE n 
2 100  SER n 
2 101  GLY n 
2 102  SER n 
2 103  MET n 
2 104  SER n 
2 105  LEU n 
2 106  SER n 
2 107  PHE n 
2 108  SER n 
2 109  ASP n 
2 110  PRO n 
2 111  ARG n 
2 112  PHE n 
2 113  ASP n 
2 114  ASP n 
2 115  VAL n 
2 116  LYS n 
2 117  ALA n 
2 118  PRO n 
2 119  VAL n 
2 120  ASP n 
2 121  GLU n 
2 122  CYS n 
2 123  LYS n 
2 124  ASP n 
2 125  LYS n 
2 126  ASP n 
2 127  MET n 
2 128  THR n 
2 129  TYR n 
2 130  ALA n 
2 131  ALA n 
2 132  PRO n 
2 133  LEU n 
2 134  PHE n 
2 135  VAL n 
2 136  THR n 
2 137  ALA n 
2 138  GLU n 
2 139  PHE n 
2 140  ILE n 
2 141  ASN n 
2 142  ASN n 
2 143  ASN n 
2 144  THR n 
2 145  GLY n 
2 146  GLU n 
2 147  ILE n 
2 148  LYS n 
2 149  SER n 
2 150  GLN n 
2 151  THR n 
2 152  VAL n 
2 153  PHE n 
2 154  MET n 
2 155  GLY n 
2 156  ASP n 
2 157  PHE n 
2 158  PRO n 
2 159  MET n 
2 160  MET n 
2 161  THR n 
2 162  GLU n 
2 163  LYS n 
2 164  GLY n 
2 165  THR n 
2 166  PHE n 
2 167  ILE n 
2 168  ILE n 
2 169  ASN n 
2 170  GLY n 
2 171  THR n 
2 172  GLU n 
2 173  ARG n 
2 174  VAL n 
2 175  VAL n 
2 176  VAL n 
2 177  SER n 
2 178  GLN n 
2 179  LEU n 
2 180  VAL n 
2 181  ARG n 
2 182  SER n 
2 183  PRO n 
2 184  GLY n 
2 185  VAL n 
2 186  TYR n 
2 187  PHE n 
2 188  ASP n 
2 189  GLU n 
2 190  THR n 
2 191  ILE n 
2 192  ASP n 
2 193  LYS n 
2 194  SER n 
2 195  THR n 
2 196  ASP n 
2 197  LYS n 
2 198  THR n 
2 199  LEU n 
2 200  HIS n 
2 201  SER n 
2 202  VAL n 
2 203  LYS n 
2 204  VAL n 
2 205  ILE n 
2 206  PRO n 
2 207  SER n 
2 208  ARG n 
2 209  GLY n 
2 210  ALA n 
2 211  TRP n 
2 212  LEU n 
2 213  GLU n 
2 214  PHE n 
2 215  ASP n 
2 216  VAL n 
2 217  ASP n 
2 218  LYS n 
2 219  ARG n 
2 220  ASP n 
2 221  THR n 
2 222  VAL n 
2 223  GLY n 
2 224  VAL n 
2 225  ARG n 
2 226  ILE n 
2 227  ASP n 
2 228  ARG n 
2 229  LYS n 
2 230  ARG n 
2 231  ARG n 
2 232  GLN n 
2 233  PRO n 
2 234  VAL n 
2 235  THR n 
2 236  VAL n 
2 237  LEU n 
2 238  LEU n 
2 239  LYS n 
2 240  ALA n 
2 241  LEU n 
2 242  GLY n 
2 243  TRP n 
2 244  THR n 
2 245  SER n 
2 246  GLU n 
2 247  GLN n 
2 248  ILE n 
2 249  VAL n 
2 250  GLU n 
2 251  ARG n 
2 252  PHE n 
2 253  GLY n 
2 254  PHE n 
2 255  SER n 
2 256  GLU n 
2 257  ILE n 
2 258  MET n 
2 259  ARG n 
2 260  SER n 
2 261  THR n 
2 262  LEU n 
2 263  GLU n 
2 264  LYS n 
2 265  ASP n 
2 266  ASN n 
2 267  THR n 
2 268  VAL n 
2 269  GLY n 
2 270  THR n 
2 271  ASP n 
2 272  GLU n 
2 273  ALA n 
2 274  LEU n 
2 275  LEU n 
2 276  ASP n 
2 277  ILE n 
2 278  TYR n 
2 279  ARG n 
2 280  LYS n 
2 281  LEU n 
2 282  ARG n 
2 283  PRO n 
2 284  GLY n 
2 285  GLU n 
2 286  PRO n 
2 287  PRO n 
2 288  THR n 
2 289  LYS n 
2 290  GLU n 
2 291  SER n 
2 292  ALA n 
2 293  GLN n 
2 294  THR n 
2 295  LEU n 
2 296  LEU n 
2 297  GLU n 
2 298  ASN n 
2 299  LEU n 
2 300  PHE n 
2 301  PHE n 
2 302  LYS n 
2 303  GLU n 
2 304  LYS n 
2 305  ARG n 
2 306  TYR n 
2 307  ASP n 
2 308  LEU n 
2 309  ALA n 
2 310  ARG n 
2 311  VAL n 
2 312  GLY n 
2 313  ARG n 
2 314  TYR n 
2 315  LYS n 
2 316  VAL n 
2 317  ASN n 
2 318  LYS n 
2 319  LYS n 
2 320  LEU n 
2 321  GLY n 
2 322  LEU n 
2 323  HIS n 
2 324  VAL n 
2 325  GLY n 
2 326  GLU n 
2 327  PRO n 
2 328  ILE n 
2 329  THR n 
2 330  SER n 
2 331  SER n 
2 332  THR n 
2 333  LEU n 
2 334  THR n 
2 335  GLU n 
2 336  GLU n 
2 337  ASP n 
2 338  VAL n 
2 339  VAL n 
2 340  ALA n 
2 341  THR n 
2 342  ILE n 
2 343  GLU n 
2 344  TYR n 
2 345  LEU n 
2 346  VAL n 
2 347  ARG n 
2 348  LEU n 
2 349  HIS n 
2 350  GLU n 
2 351  GLY n 
2 352  GLN n 
2 353  THR n 
2 354  THR n 
2 355  MET n 
2 356  THR n 
2 357  VAL n 
2 358  PRO n 
2 359  GLY n 
2 360  GLY n 
2 361  VAL n 
2 362  GLU n 
2 363  VAL n 
2 364  PRO n 
2 365  VAL n 
2 366  GLU n 
2 367  THR n 
2 368  ASP n 
2 369  ASP n 
2 370  ILE n 
2 371  ASP n 
2 372  HIS n 
2 373  PHE n 
2 374  GLY n 
2 375  ASN n 
2 376  ARG n 
2 377  ARG n 
2 378  LEU n 
2 379  ARG n 
2 380  THR n 
2 381  VAL n 
2 382  GLY n 
2 383  GLU n 
2 384  LEU n 
2 385  ILE n 
2 386  GLN n 
2 387  ASN n 
2 388  GLN n 
2 389  ILE n 
2 390  ARG n 
2 391  VAL n 
2 392  GLY n 
2 393  MET n 
2 394  SER n 
2 395  ARG n 
2 396  MET n 
2 397  GLU n 
2 398  ARG n 
2 399  VAL n 
2 400  VAL n 
2 401  ARG n 
2 402  GLU n 
2 403  ARG n 
2 404  MET n 
2 405  THR n 
2 406  THR n 
2 407  GLN n 
2 408  ASP n 
2 409  VAL n 
2 410  GLU n 
2 411  ALA n 
2 412  ILE n 
2 413  THR n 
2 414  PRO n 
2 415  GLN n 
2 416  THR n 
2 417  LEU n 
2 418  ILE n 
2 419  ASN n 
2 420  ILE n 
2 421  ARG n 
2 422  PRO n 
2 423  VAL n 
2 424  VAL n 
2 425  ALA n 
2 426  ALA n 
2 427  ILE n 
2 428  LYS n 
2 429  GLU n 
2 430  PHE n 
2 431  PHE n 
2 432  GLY n 
2 433  THR n 
2 434  SER n 
2 435  GLN n 
2 436  LEU n 
2 437  SER n 
2 438  GLN n 
2 439  PHE n 
2 440  MET n 
2 441  ASP n 
2 442  GLN n 
2 443  ASN n 
2 444  ASN n 
2 445  PRO n 
2 446  LEU n 
2 447  SER n 
2 448  GLY n 
2 449  LEU n 
2 450  THR n 
2 451  HIS n 
2 452  LYS n 
2 453  ARG n 
2 454  ARG n 
2 455  LEU n 
2 456  SER n 
2 457  ALA n 
2 458  LEU n 
2 459  GLY n 
2 460  PRO n 
2 461  GLY n 
2 462  GLY n 
2 463  LEU n 
2 464  SER n 
2 465  ARG n 
2 466  GLU n 
2 467  ARG n 
2 468  ALA n 
2 469  GLY n 
2 470  LEU n 
2 471  GLU n 
2 472  VAL n 
2 473  ARG n 
2 474  ASP n 
2 475  VAL n 
2 476  HIS n 
2 477  PRO n 
2 478  SER n 
2 479  HIS n 
2 480  TYR n 
2 481  GLY n 
2 482  ARG n 
2 483  MET n 
2 484  CYS n 
2 485  PRO n 
2 486  ILE n 
2 487  GLU n 
2 488  THR n 
2 489  PRO n 
2 490  GLU n 
2 491  GLY n 
2 492  PRO n 
2 493  ASN n 
2 494  ILE n 
2 495  GLY n 
2 496  LEU n 
2 497  ILE n 
2 498  GLY n 
2 499  SER n 
2 500  LEU n 
2 501  SER n 
2 502  VAL n 
2 503  TYR n 
2 504  ALA n 
2 505  ARG n 
2 506  VAL n 
2 507  ASN n 
2 508  PRO n 
2 509  PHE n 
2 510  GLY n 
2 511  PHE n 
2 512  ILE n 
2 513  GLU n 
2 514  THR n 
2 515  PRO n 
2 516  TYR n 
2 517  ARG n 
2 518  LYS n 
2 519  VAL n 
2 520  VAL n 
2 521  ASP n 
2 522  GLY n 
2 523  VAL n 
2 524  VAL n 
2 525  SER n 
2 526  ASP n 
2 527  GLU n 
2 528  ILE n 
2 529  VAL n 
2 530  TYR n 
2 531  LEU n 
2 532  THR n 
2 533  ALA n 
2 534  ASP n 
2 535  GLU n 
2 536  GLU n 
2 537  ASP n 
2 538  ARG n 
2 539  HIS n 
2 540  VAL n 
2 541  VAL n 
2 542  ALA n 
2 543  GLN n 
2 544  ALA n 
2 545  ASN n 
2 546  SER n 
2 547  PRO n 
2 548  ILE n 
2 549  ASP n 
2 550  ALA n 
2 551  ASP n 
2 552  GLY n 
2 553  ARG n 
2 554  PHE n 
2 555  VAL n 
2 556  GLU n 
2 557  PRO n 
2 558  ARG n 
2 559  VAL n 
2 560  LEU n 
2 561  VAL n 
2 562  ARG n 
2 563  ARG n 
2 564  LYS n 
2 565  ALA n 
2 566  GLY n 
2 567  GLU n 
2 568  VAL n 
2 569  GLU n 
2 570  TYR n 
2 571  VAL n 
2 572  PRO n 
2 573  SER n 
2 574  SER n 
2 575  GLU n 
2 576  VAL n 
2 577  ASP n 
2 578  TYR n 
2 579  MET n 
2 580  ASP n 
2 581  VAL n 
2 582  SER n 
2 583  PRO n 
2 584  ARG n 
2 585  GLN n 
2 586  MET n 
2 587  VAL n 
2 588  SER n 
2 589  VAL n 
2 590  ALA n 
2 591  THR n 
2 592  ALA n 
2 593  MET n 
2 594  ILE n 
2 595  PRO n 
2 596  PHE n 
2 597  LEU n 
2 598  GLU n 
2 599  HIS n 
2 600  ASP n 
2 601  ASP n 
2 602  ALA n 
2 603  ASN n 
2 604  ARG n 
2 605  ALA n 
2 606  LEU n 
2 607  MET n 
2 608  GLY n 
2 609  ALA n 
2 610  ASN n 
2 611  MET n 
2 612  GLN n 
2 613  ARG n 
2 614  GLN n 
2 615  ALA n 
2 616  VAL n 
2 617  PRO n 
2 618  LEU n 
2 619  VAL n 
2 620  ARG n 
2 621  SER n 
2 622  GLU n 
2 623  ALA n 
2 624  PRO n 
2 625  LEU n 
2 626  VAL n 
2 627  GLY n 
2 628  THR n 
2 629  GLY n 
2 630  MET n 
2 631  GLU n 
2 632  LEU n 
2 633  ARG n 
2 634  ALA n 
2 635  ALA n 
2 636  ILE n 
2 637  ASP n 
2 638  ALA n 
2 639  GLY n 
2 640  ASP n 
2 641  VAL n 
2 642  VAL n 
2 643  VAL n 
2 644  ALA n 
2 645  GLU n 
2 646  GLU n 
2 647  SER n 
2 648  GLY n 
2 649  VAL n 
2 650  ILE n 
2 651  GLU n 
2 652  GLU n 
2 653  VAL n 
2 654  SER n 
2 655  ALA n 
2 656  ASP n 
2 657  TYR n 
2 658  ILE n 
2 659  THR n 
2 660  VAL n 
2 661  MET n 
2 662  HIS n 
2 663  ASP n 
2 664  ASN n 
2 665  GLY n 
2 666  THR n 
2 667  ARG n 
2 668  ARG n 
2 669  THR n 
2 670  TYR n 
2 671  ARG n 
2 672  MET n 
2 673  ARG n 
2 674  LYS n 
2 675  PHE n 
2 676  ALA n 
2 677  ARG n 
2 678  SER n 
2 679  ASN n 
2 680  HIS n 
2 681  GLY n 
2 682  THR n 
2 683  CYS n 
2 684  ALA n 
2 685  ASN n 
2 686  GLN n 
2 687  CYS n 
2 688  PRO n 
2 689  ILE n 
2 690  VAL n 
2 691  ASP n 
2 692  ALA n 
2 693  GLY n 
2 694  ASP n 
2 695  ARG n 
2 696  VAL n 
2 697  GLU n 
2 698  ALA n 
2 699  GLY n 
2 700  GLN n 
2 701  VAL n 
2 702  ILE n 
2 703  ALA n 
2 704  ASP n 
2 705  GLY n 
2 706  PRO n 
2 707  CYS n 
2 708  THR n 
2 709  ASP n 
2 710  ASP n 
2 711  GLY n 
2 712  GLU n 
2 713  MET n 
2 714  ALA n 
2 715  LEU n 
2 716  GLY n 
2 717  LYS n 
2 718  ASN n 
2 719  LEU n 
2 720  LEU n 
2 721  VAL n 
2 722  ALA n 
2 723  ILE n 
2 724  MET n 
2 725  PRO n 
2 726  TRP n 
2 727  GLU n 
2 728  GLY n 
2 729  HIS n 
2 730  ASN n 
2 731  TYR n 
2 732  GLU n 
2 733  ASP n 
2 734  ALA n 
2 735  ILE n 
2 736  ILE n 
2 737  LEU n 
2 738  SER n 
2 739  ASN n 
2 740  ARG n 
2 741  LEU n 
2 742  VAL n 
2 743  GLU n 
2 744  GLU n 
2 745  ASP n 
2 746  VAL n 
2 747  LEU n 
2 748  THR n 
2 749  SER n 
2 750  ILE n 
2 751  HIS n 
2 752  ILE n 
2 753  GLU n 
2 754  GLU n 
2 755  HIS n 
2 756  GLU n 
2 757  ILE n 
2 758  ASP n 
2 759  ALA n 
2 760  ARG n 
2 761  ASP n 
2 762  THR n 
2 763  LYS n 
2 764  LEU n 
2 765  GLY n 
2 766  ALA n 
2 767  GLU n 
2 768  GLU n 
2 769  ILE n 
2 770  THR n 
2 771  ARG n 
2 772  ASP n 
2 773  ILE n 
2 774  PRO n 
2 775  ASN n 
2 776  ILE n 
2 777  SER n 
2 778  ASP n 
2 779  GLU n 
2 780  VAL n 
2 781  LEU n 
2 782  ALA n 
2 783  ASP n 
2 784  LEU n 
2 785  ASP n 
2 786  GLU n 
2 787  ARG n 
2 788  GLY n 
2 789  ILE n 
2 790  VAL n 
2 791  ARG n 
2 792  ILE n 
2 793  GLY n 
2 794  ALA n 
2 795  GLU n 
2 796  VAL n 
2 797  ARG n 
2 798  ASP n 
2 799  GLY n 
2 800  ASP n 
2 801  ILE n 
2 802  LEU n 
2 803  VAL n 
2 804  GLY n 
2 805  LYS n 
2 806  VAL n 
2 807  THR n 
2 808  PRO n 
2 809  LYS n 
2 810  GLY n 
2 811  GLU n 
2 812  THR n 
2 813  GLU n 
2 814  LEU n 
2 815  THR n 
2 816  PRO n 
2 817  GLU n 
2 818  GLU n 
2 819  ARG n 
2 820  LEU n 
2 821  LEU n 
2 822  ARG n 
2 823  ALA n 
2 824  ILE n 
2 825  PHE n 
2 826  GLY n 
2 827  GLU n 
2 828  LYS n 
2 829  ALA n 
2 830  ARG n 
2 831  GLU n 
2 832  VAL n 
2 833  ARG n 
2 834  ASP n 
2 835  THR n 
2 836  SER n 
2 837  LEU n 
2 838  LYS n 
2 839  VAL n 
2 840  PRO n 
2 841  HIS n 
2 842  GLY n 
2 843  GLU n 
2 844  SER n 
2 845  GLY n 
2 846  LYS n 
2 847  VAL n 
2 848  ILE n 
2 849  GLY n 
2 850  ILE n 
2 851  ARG n 
2 852  VAL n 
2 853  PHE n 
2 854  SER n 
2 855  ARG n 
2 856  GLU n 
2 857  ASP n 
2 858  GLU n 
2 859  ASP n 
2 860  GLU n 
2 861  LEU n 
2 862  PRO n 
2 863  ALA n 
2 864  GLY n 
2 865  VAL n 
2 866  ASN n 
2 867  GLU n 
2 868  LEU n 
2 869  VAL n 
2 870  ARG n 
2 871  VAL n 
2 872  TYR n 
2 873  VAL n 
2 874  ALA n 
2 875  GLN n 
2 876  LYS n 
2 877  ARG n 
2 878  LYS n 
2 879  ILE n 
2 880  SER n 
2 881  ASP n 
2 882  GLY n 
2 883  ASP n 
2 884  LYS n 
2 885  LEU n 
2 886  ALA n 
2 887  GLY n 
2 888  ARG n 
2 889  HIS n 
2 890  GLY n 
2 891  ASN n 
2 892  LYS n 
2 893  GLY n 
2 894  VAL n 
2 895  ILE n 
2 896  GLY n 
2 897  LYS n 
2 898  ILE n 
2 899  LEU n 
2 900  PRO n 
2 901  VAL n 
2 902  GLU n 
2 903  ASP n 
2 904  MET n 
2 905  PRO n 
2 906  PHE n 
2 907  LEU n 
2 908  ALA n 
2 909  ASP n 
2 910  GLY n 
2 911  THR n 
2 912  PRO n 
2 913  VAL n 
2 914  ASP n 
2 915  ILE n 
2 916  ILE n 
2 917  LEU n 
2 918  ASN n 
2 919  THR n 
2 920  HIS n 
2 921  GLY n 
2 922  VAL n 
2 923  PRO n 
2 924  ARG n 
2 925  ARG n 
2 926  MET n 
2 927  ASN n 
2 928  ILE n 
2 929  GLY n 
2 930  GLN n 
2 931  ILE n 
2 932  LEU n 
2 933  GLU n 
2 934  THR n 
2 935  HIS n 
2 936  LEU n 
2 937  GLY n 
2 938  TRP n 
2 939  CYS n 
2 940  ALA n 
2 941  HIS n 
2 942  SER n 
2 943  GLY n 
2 944  TRP n 
2 945  LYS n 
2 946  VAL n 
2 947  ASP n 
2 948  ALA n 
2 949  ALA n 
2 950  LYS n 
2 951  GLY n 
2 952  VAL n 
2 953  PRO n 
2 954  ASP n 
2 955  TRP n 
2 956  ALA n 
2 957  ALA n 
2 958  ARG n 
2 959  LEU n 
2 960  PRO n 
2 961  ASP n 
2 962  GLU n 
2 963  LEU n 
2 964  LEU n 
2 965  GLU n 
2 966  ALA n 
2 967  GLN n 
2 968  PRO n 
2 969  ASN n 
2 970  ALA n 
2 971  ILE n 
2 972  VAL n 
2 973  SER n 
2 974  THR n 
2 975  PRO n 
2 976  VAL n 
2 977  PHE n 
2 978  ASP n 
2 979  GLY n 
2 980  ALA n 
2 981  GLN n 
2 982  GLU n 
2 983  ALA n 
2 984  GLU n 
2 985  LEU n 
2 986  GLN n 
2 987  GLY n 
2 988  LEU n 
2 989  LEU n 
2 990  SER n 
2 991  CYS n 
2 992  THR n 
2 993  LEU n 
2 994  PRO n 
2 995  ASN n 
2 996  ARG n 
2 997  ASP n 
2 998  GLY n 
2 999  ASP n 
2 1000 VAL n 
2 1001 LEU n 
2 1002 VAL n 
2 1003 ASP n 
2 1004 ALA n 
2 1005 ASP n 
2 1006 GLY n 
2 1007 LYS n 
2 1008 ALA n 
2 1009 MET n 
2 1010 LEU n 
2 1011 PHE n 
2 1012 ASP n 
2 1013 GLY n 
2 1014 ARG n 
2 1015 SER n 
2 1016 GLY n 
2 1017 GLU n 
2 1018 PRO n 
2 1019 PHE n 
2 1020 PRO n 
2 1021 TYR n 
2 1022 PRO n 
2 1023 VAL n 
2 1024 THR n 
2 1025 VAL n 
2 1026 GLY n 
2 1027 TYR n 
2 1028 MET n 
2 1029 TYR n 
2 1030 ILE n 
2 1031 MET n 
2 1032 LYS n 
2 1033 LEU n 
2 1034 HIS n 
2 1035 HIS n 
2 1036 LEU n 
2 1037 VAL n 
2 1038 ASP n 
2 1039 ASP n 
2 1040 LYS n 
2 1041 ILE n 
2 1042 HIS n 
2 1043 ALA n 
2 1044 ARG n 
2 1045 SER n 
2 1046 THR n 
2 1047 GLY n 
2 1048 PRO n 
2 1049 TYR n 
2 1050 SER n 
2 1051 MET n 
2 1052 ILE n 
2 1053 THR n 
2 1054 GLN n 
2 1055 GLN n 
2 1056 PRO n 
2 1057 LEU n 
2 1058 GLY n 
2 1059 GLY n 
2 1060 LYS n 
2 1061 ALA n 
2 1062 GLN n 
2 1063 PHE n 
2 1064 GLY n 
2 1065 GLY n 
2 1066 GLN n 
2 1067 ARG n 
2 1068 PHE n 
2 1069 GLY n 
2 1070 GLU n 
2 1071 MET n 
2 1072 GLU n 
2 1073 CYS n 
2 1074 TRP n 
2 1075 ALA n 
2 1076 MET n 
2 1077 GLN n 
2 1078 ALA n 
2 1079 TYR n 
2 1080 GLY n 
2 1081 ALA n 
2 1082 ALA n 
2 1083 TYR n 
2 1084 THR n 
2 1085 LEU n 
2 1086 GLN n 
2 1087 GLU n 
2 1088 LEU n 
2 1089 LEU n 
2 1090 THR n 
2 1091 ILE n 
2 1092 LYS n 
2 1093 SER n 
2 1094 ASP n 
2 1095 ASP n 
2 1096 THR n 
2 1097 VAL n 
2 1098 GLY n 
2 1099 ARG n 
2 1100 VAL n 
2 1101 LYS n 
2 1102 VAL n 
2 1103 TYR n 
2 1104 GLU n 
2 1105 ALA n 
2 1106 ILE n 
2 1107 VAL n 
2 1108 LYS n 
2 1109 GLY n 
2 1110 GLU n 
2 1111 ASN n 
2 1112 ILE n 
2 1113 PRO n 
2 1114 GLU n 
2 1115 PRO n 
2 1116 GLY n 
2 1117 ILE n 
2 1118 PRO n 
2 1119 GLU n 
2 1120 SER n 
2 1121 PHE n 
2 1122 LYS n 
2 1123 VAL n 
2 1124 LEU n 
2 1125 LEU n 
2 1126 LYS n 
2 1127 GLU n 
2 1128 LEU n 
2 1129 GLN n 
2 1130 SER n 
2 1131 LEU n 
2 1132 CYS n 
2 1133 LEU n 
2 1134 ASN n 
2 1135 VAL n 
2 1136 GLU n 
2 1137 VAL n 
2 1138 LEU n 
2 1139 SER n 
2 1140 SER n 
2 1141 ASP n 
2 1142 GLY n 
2 1143 ALA n 
2 1144 ALA n 
2 1145 ILE n 
2 1146 GLU n 
2 1147 LEU n 
2 1148 ARG n 
2 1149 GLU n 
2 1150 GLY n 
2 1151 GLU n 
2 1152 ASP n 
2 1153 GLU n 
2 1154 ASP n 
2 1155 LEU n 
2 1156 GLU n 
2 1157 ARG n 
2 1158 ALA n 
2 1159 ALA n 
2 1160 ALA n 
2 1161 ASN n 
2 1162 LEU n 
2 1163 GLY n 
2 1164 ILE n 
2 1165 ASN n 
2 1166 LEU n 
2 1167 SER n 
2 1168 ARG n 
2 1169 ASN n 
2 1170 GLU n 
2 1171 SER n 
2 1172 ALA n 
2 1173 SER n 
2 1174 VAL n 
2 1175 GLU n 
2 1176 ASP n 
2 1177 LEU n 
2 1178 ALA n 
3 1    MET n 
3 2    LEU n 
3 3    ASP n 
3 4    VAL n 
3 5    ASN n 
3 6    PHE n 
3 7    PHE n 
3 8    ASP n 
3 9    GLU n 
3 10   LEU n 
3 11   ARG n 
3 12   ILE n 
3 13   GLY n 
3 14   LEU n 
3 15   ALA n 
3 16   THR n 
3 17   ALA n 
3 18   GLU n 
3 19   ASP n 
3 20   ILE n 
3 21   ARG n 
3 22   GLN n 
3 23   TRP n 
3 24   SER n 
3 25   TYR n 
3 26   GLY n 
3 27   GLU n 
3 28   VAL n 
3 29   LYS n 
3 30   LYS n 
3 31   PRO n 
3 32   GLU n 
3 33   THR n 
3 34   ILE n 
3 35   ASN n 
3 36   TYR n 
3 37   ARG n 
3 38   THR n 
3 39   LEU n 
3 40   LYS n 
3 41   PRO n 
3 42   GLU n 
3 43   LYS n 
3 44   ASP n 
3 45   GLY n 
3 46   LEU n 
3 47   PHE n 
3 48   CYS n 
3 49   GLU n 
3 50   LYS n 
3 51   ILE n 
3 52   PHE n 
3 53   GLY n 
3 54   PRO n 
3 55   THR n 
3 56   ARG n 
3 57   ASP n 
3 58   TRP n 
3 59   GLU n 
3 60   CYS n 
3 61   TYR n 
3 62   CYS n 
3 63   GLY n 
3 64   LYS n 
3 65   TYR n 
3 66   LYS n 
3 67   ARG n 
3 68   VAL n 
3 69   ARG n 
3 70   PHE n 
3 71   LYS n 
3 72   GLY n 
3 73   ILE n 
3 74   ILE n 
3 75   CYS n 
3 76   GLU n 
3 77   ARG n 
3 78   CYS n 
3 79   GLY n 
3 80   VAL n 
3 81   GLU n 
3 82   VAL n 
3 83   THR n 
3 84   ARG n 
3 85   ALA n 
3 86   LYS n 
3 87   VAL n 
3 88   ARG n 
3 89   ARG n 
3 90   GLU n 
3 91   ARG n 
3 92   MET n 
3 93   GLY n 
3 94   HIS n 
3 95   ILE n 
3 96   GLU n 
3 97   LEU n 
3 98   ALA n 
3 99   ALA n 
3 100  PRO n 
3 101  VAL n 
3 102  THR n 
3 103  HIS n 
3 104  ILE n 
3 105  TRP n 
3 106  TYR n 
3 107  PHE n 
3 108  LYS n 
3 109  GLY n 
3 110  VAL n 
3 111  PRO n 
3 112  SER n 
3 113  ARG n 
3 114  LEU n 
3 115  GLY n 
3 116  TYR n 
3 117  LEU n 
3 118  LEU n 
3 119  ASP n 
3 120  LEU n 
3 121  ALA n 
3 122  PRO n 
3 123  LYS n 
3 124  ASP n 
3 125  LEU n 
3 126  GLU n 
3 127  LYS n 
3 128  ILE n 
3 129  ILE n 
3 130  TYR n 
3 131  PHE n 
3 132  ALA n 
3 133  ALA n 
3 134  TYR n 
3 135  VAL n 
3 136  ILE n 
3 137  THR n 
3 138  SER n 
3 139  VAL n 
3 140  ASP n 
3 141  GLU n 
3 142  GLU n 
3 143  MET n 
3 144  ARG n 
3 145  HIS n 
3 146  ASN n 
3 147  GLU n 
3 148  LEU n 
3 149  SER n 
3 150  THR n 
3 151  LEU n 
3 152  GLU n 
3 153  ALA n 
3 154  GLU n 
3 155  MET n 
3 156  ALA n 
3 157  VAL n 
3 158  GLU n 
3 159  ARG n 
3 160  LYS n 
3 161  ALA n 
3 162  VAL n 
3 163  GLU n 
3 164  ASP n 
3 165  GLN n 
3 166  ARG n 
3 167  ASP n 
3 168  GLY n 
3 169  GLU n 
3 170  LEU n 
3 171  GLU n 
3 172  ALA n 
3 173  ARG n 
3 174  ALA n 
3 175  GLN n 
3 176  LYS n 
3 177  LEU n 
3 178  GLU n 
3 179  ALA n 
3 180  ASP n 
3 181  LEU n 
3 182  ALA n 
3 183  GLU n 
3 184  LEU n 
3 185  GLU n 
3 186  ALA n 
3 187  GLU n 
3 188  GLY n 
3 189  ALA n 
3 190  LYS n 
3 191  ALA n 
3 192  ASP n 
3 193  ALA n 
3 194  ARG n 
3 195  ARG n 
3 196  LYS n 
3 197  VAL n 
3 198  ARG n 
3 199  ASP n 
3 200  GLY n 
3 201  GLY n 
3 202  GLU n 
3 203  ARG n 
3 204  GLU n 
3 205  MET n 
3 206  ARG n 
3 207  GLN n 
3 208  ILE n 
3 209  ARG n 
3 210  ASP n 
3 211  ARG n 
3 212  ALA n 
3 213  GLN n 
3 214  ARG n 
3 215  GLU n 
3 216  LEU n 
3 217  ASP n 
3 218  ARG n 
3 219  LEU n 
3 220  GLU n 
3 221  ASP n 
3 222  ILE n 
3 223  TRP n 
3 224  SER n 
3 225  THR n 
3 226  PHE n 
3 227  THR n 
3 228  LYS n 
3 229  LEU n 
3 230  ALA n 
3 231  PRO n 
3 232  LYS n 
3 233  GLN n 
3 234  LEU n 
3 235  ILE n 
3 236  VAL n 
3 237  ASP n 
3 238  GLU n 
3 239  ASN n 
3 240  LEU n 
3 241  TYR n 
3 242  ARG n 
3 243  GLU n 
3 244  LEU n 
3 245  VAL n 
3 246  ASP n 
3 247  ARG n 
3 248  TYR n 
3 249  GLY n 
3 250  GLU n 
3 251  TYR n 
3 252  PHE n 
3 253  THR n 
3 254  GLY n 
3 255  ALA n 
3 256  MET n 
3 257  GLY n 
3 258  ALA n 
3 259  GLU n 
3 260  SER n 
3 261  ILE n 
3 262  GLN n 
3 263  LYS n 
3 264  LEU n 
3 265  ILE n 
3 266  GLU n 
3 267  ASN n 
3 268  PHE n 
3 269  ASP n 
3 270  ILE n 
3 271  ASP n 
3 272  ALA n 
3 273  GLU n 
3 274  ALA n 
3 275  GLU n 
3 276  SER n 
3 277  LEU n 
3 278  ARG n 
3 279  ASP n 
3 280  VAL n 
3 281  ILE n 
3 282  ARG n 
3 283  ASN n 
3 284  GLY n 
3 285  LYS n 
3 286  GLY n 
3 287  GLN n 
3 288  LYS n 
3 289  LYS n 
3 290  LEU n 
3 291  ARG n 
3 292  ALA n 
3 293  LEU n 
3 294  LYS n 
3 295  ARG n 
3 296  LEU n 
3 297  LYS n 
3 298  VAL n 
3 299  VAL n 
3 300  ALA n 
3 301  ALA n 
3 302  PHE n 
3 303  GLN n 
3 304  GLN n 
3 305  SER n 
3 306  GLY n 
3 307  ASN n 
3 308  SER n 
3 309  PRO n 
3 310  MET n 
3 311  GLY n 
3 312  MET n 
3 313  VAL n 
3 314  LEU n 
3 315  ASP n 
3 316  ALA n 
3 317  VAL n 
3 318  PRO n 
3 319  VAL n 
3 320  ILE n 
3 321  PRO n 
3 322  PRO n 
3 323  GLU n 
3 324  LEU n 
3 325  ARG n 
3 326  PRO n 
3 327  MET n 
3 328  VAL n 
3 329  GLN n 
3 330  LEU n 
3 331  ASP n 
3 332  GLY n 
3 333  GLY n 
3 334  ARG n 
3 335  PHE n 
3 336  ALA n 
3 337  THR n 
3 338  SER n 
3 339  ASP n 
3 340  LEU n 
3 341  ASN n 
3 342  ASP n 
3 343  LEU n 
3 344  TYR n 
3 345  ARG n 
3 346  ARG n 
3 347  VAL n 
3 348  ILE n 
3 349  ASN n 
3 350  ARG n 
3 351  ASN n 
3 352  ASN n 
3 353  ARG n 
3 354  LEU n 
3 355  LYS n 
3 356  ARG n 
3 357  LEU n 
3 358  ILE n 
3 359  ASP n 
3 360  LEU n 
3 361  GLY n 
3 362  ALA n 
3 363  PRO n 
3 364  GLU n 
3 365  ILE n 
3 366  ILE n 
3 367  VAL n 
3 368  ASN n 
3 369  ASN n 
3 370  GLU n 
3 371  LYS n 
3 372  ARG n 
3 373  MET n 
3 374  LEU n 
3 375  GLN n 
3 376  GLU n 
3 377  SER n 
3 378  VAL n 
3 379  ASP n 
3 380  ALA n 
3 381  LEU n 
3 382  PHE n 
3 383  ASP n 
3 384  ASN n 
3 385  GLY n 
3 386  ARG n 
3 387  ARG n 
3 388  GLY n 
3 389  ARG n 
3 390  PRO n 
3 391  VAL n 
3 392  THR n 
3 393  GLY n 
3 394  PRO n 
3 395  GLY n 
3 396  ASN n 
3 397  ARG n 
3 398  PRO n 
3 399  LEU n 
3 400  LYS n 
3 401  SER n 
3 402  LEU n 
3 403  SER n 
3 404  ASP n 
3 405  LEU n 
3 406  LEU n 
3 407  LYS n 
3 408  GLY n 
3 409  LYS n 
3 410  GLN n 
3 411  GLY n 
3 412  ARG n 
3 413  PHE n 
3 414  ARG n 
3 415  GLN n 
3 416  ASN n 
3 417  LEU n 
3 418  LEU n 
3 419  GLY n 
3 420  LYS n 
3 421  ARG n 
3 422  VAL n 
3 423  ASP n 
3 424  TYR n 
3 425  SER n 
3 426  GLY n 
3 427  ARG n 
3 428  SER n 
3 429  VAL n 
3 430  ILE n 
3 431  VAL n 
3 432  VAL n 
3 433  GLY n 
3 434  PRO n 
3 435  GLN n 
3 436  LEU n 
3 437  LYS n 
3 438  LEU n 
3 439  HIS n 
3 440  GLN n 
3 441  CYS n 
3 442  GLY n 
3 443  LEU n 
3 444  PRO n 
3 445  LYS n 
3 446  LEU n 
3 447  MET n 
3 448  ALA n 
3 449  LEU n 
3 450  GLU n 
3 451  LEU n 
3 452  PHE n 
3 453  LYS n 
3 454  PRO n 
3 455  PHE n 
3 456  VAL n 
3 457  MET n 
3 458  LYS n 
3 459  ARG n 
3 460  LEU n 
3 461  VAL n 
3 462  ASP n 
3 463  LEU n 
3 464  ASN n 
3 465  HIS n 
3 466  ALA n 
3 467  GLN n 
3 468  ASN n 
3 469  ILE n 
3 470  LYS n 
3 471  SER n 
3 472  ALA n 
3 473  LYS n 
3 474  ARG n 
3 475  MET n 
3 476  VAL n 
3 477  GLU n 
3 478  ARG n 
3 479  GLN n 
3 480  ARG n 
3 481  PRO n 
3 482  GLN n 
3 483  VAL n 
3 484  TRP n 
3 485  ASP n 
3 486  VAL n 
3 487  LEU n 
3 488  GLU n 
3 489  GLU n 
3 490  VAL n 
3 491  ILE n 
3 492  ALA n 
3 493  GLU n 
3 494  HIS n 
3 495  PRO n 
3 496  VAL n 
3 497  LEU n 
3 498  LEU n 
3 499  ASN n 
3 500  ARG n 
3 501  ALA n 
3 502  PRO n 
3 503  THR n 
3 504  LEU n 
3 505  HIS n 
3 506  ARG n 
3 507  LEU n 
3 508  GLY n 
3 509  ILE n 
3 510  GLN n 
3 511  ALA n 
3 512  PHE n 
3 513  GLU n 
3 514  PRO n 
3 515  MET n 
3 516  LEU n 
3 517  VAL n 
3 518  GLU n 
3 519  GLY n 
3 520  LYS n 
3 521  ALA n 
3 522  ILE n 
3 523  GLN n 
3 524  LEU n 
3 525  HIS n 
3 526  PRO n 
3 527  LEU n 
3 528  VAL n 
3 529  CYS n 
3 530  GLU n 
3 531  ALA n 
3 532  PHE n 
3 533  ASN n 
3 534  ALA n 
3 535  ASP n 
3 536  PHE n 
3 537  ASP n 
3 538  GLY n 
3 539  ASP n 
3 540  GLN n 
3 541  MET n 
3 542  ALA n 
3 543  VAL n 
3 544  HIS n 
3 545  LEU n 
3 546  PRO n 
3 547  LEU n 
3 548  SER n 
3 549  ALA n 
3 550  GLU n 
3 551  ALA n 
3 552  GLN n 
3 553  ALA n 
3 554  GLU n 
3 555  ALA n 
3 556  ARG n 
3 557  ILE n 
3 558  LEU n 
3 559  MET n 
3 560  LEU n 
3 561  SER n 
3 562  SER n 
3 563  ASN n 
3 564  ASN n 
3 565  ILE n 
3 566  LEU n 
3 567  SER n 
3 568  PRO n 
3 569  ALA n 
3 570  SER n 
3 571  GLY n 
3 572  ARG n 
3 573  PRO n 
3 574  LEU n 
3 575  ALA n 
3 576  MET n 
3 577  PRO n 
3 578  ARG n 
3 579  LEU n 
3 580  ASP n 
3 581  MET n 
3 582  VAL n 
3 583  THR n 
3 584  GLY n 
3 585  LEU n 
3 586  TYR n 
3 587  TYR n 
3 588  LEU n 
3 589  THR n 
3 590  THR n 
3 591  GLU n 
3 592  VAL n 
3 593  PRO n 
3 594  GLY n 
3 595  ASP n 
3 596  THR n 
3 597  GLY n 
3 598  GLU n 
3 599  TYR n 
3 600  GLN n 
3 601  PRO n 
3 602  ALA n 
3 603  SER n 
3 604  GLY n 
3 605  ASP n 
3 606  HIS n 
3 607  PRO n 
3 608  GLU n 
3 609  THR n 
3 610  GLY n 
3 611  VAL n 
3 612  TYR n 
3 613  SER n 
3 614  SER n 
3 615  PRO n 
3 616  ALA n 
3 617  GLU n 
3 618  ALA n 
3 619  ILE n 
3 620  MET n 
3 621  ALA n 
3 622  ALA n 
3 623  ASP n 
3 624  ARG n 
3 625  GLY n 
3 626  VAL n 
3 627  LEU n 
3 628  SER n 
3 629  VAL n 
3 630  ARG n 
3 631  ALA n 
3 632  LYS n 
3 633  ILE n 
3 634  LYS n 
3 635  VAL n 
3 636  ARG n 
3 637  LEU n 
3 638  THR n 
3 639  GLN n 
3 640  LEU n 
3 641  ARG n 
3 642  PRO n 
3 643  PRO n 
3 644  VAL n 
3 645  GLU n 
3 646  ILE n 
3 647  GLU n 
3 648  ALA n 
3 649  GLU n 
3 650  LEU n 
3 651  PHE n 
3 652  GLY n 
3 653  HIS n 
3 654  SER n 
3 655  GLY n 
3 656  TRP n 
3 657  GLN n 
3 658  PRO n 
3 659  GLY n 
3 660  ASP n 
3 661  ALA n 
3 662  TRP n 
3 663  MET n 
3 664  ALA n 
3 665  GLU n 
3 666  THR n 
3 667  THR n 
3 668  LEU n 
3 669  GLY n 
3 670  ARG n 
3 671  VAL n 
3 672  MET n 
3 673  PHE n 
3 674  ASN n 
3 675  GLU n 
3 676  LEU n 
3 677  LEU n 
3 678  PRO n 
3 679  LEU n 
3 680  GLY n 
3 681  TYR n 
3 682  PRO n 
3 683  PHE n 
3 684  VAL n 
3 685  ASN n 
3 686  LYS n 
3 687  GLN n 
3 688  MET n 
3 689  HIS n 
3 690  LYS n 
3 691  LYS n 
3 692  VAL n 
3 693  GLN n 
3 694  ALA n 
3 695  ALA n 
3 696  ILE n 
3 697  ILE n 
3 698  ASN n 
3 699  ASP n 
3 700  LEU n 
3 701  ALA n 
3 702  GLU n 
3 703  ARG n 
3 704  TYR n 
3 705  PRO n 
3 706  MET n 
3 707  ILE n 
3 708  VAL n 
3 709  VAL n 
3 710  ALA n 
3 711  GLN n 
3 712  THR n 
3 713  VAL n 
3 714  ASP n 
3 715  LYS n 
3 716  LEU n 
3 717  LYS n 
3 718  ASP n 
3 719  ALA n 
3 720  GLY n 
3 721  PHE n 
3 722  TYR n 
3 723  TRP n 
3 724  ALA n 
3 725  THR n 
3 726  ARG n 
3 727  SER n 
3 728  GLY n 
3 729  VAL n 
3 730  THR n 
3 731  VAL n 
3 732  SER n 
3 733  MET n 
3 734  ALA n 
3 735  ASP n 
3 736  VAL n 
3 737  LEU n 
3 738  VAL n 
3 739  PRO n 
3 740  PRO n 
3 741  ARG n 
3 742  LYS n 
3 743  LYS n 
3 744  GLU n 
3 745  ILE n 
3 746  LEU n 
3 747  ASP n 
3 748  HIS n 
3 749  TYR n 
3 750  GLU n 
3 751  GLU n 
3 752  ARG n 
3 753  ALA n 
3 754  ASP n 
3 755  LYS n 
3 756  VAL n 
3 757  GLU n 
3 758  LYS n 
3 759  GLN n 
3 760  PHE n 
3 761  GLN n 
3 762  ARG n 
3 763  GLY n 
3 764  ALA n 
3 765  LEU n 
3 766  ASN n 
3 767  HIS n 
3 768  ASP n 
3 769  GLU n 
3 770  ARG n 
3 771  ASN n 
3 772  GLU n 
3 773  ALA n 
3 774  LEU n 
3 775  VAL n 
3 776  GLU n 
3 777  ILE n 
3 778  TRP n 
3 779  LYS n 
3 780  GLU n 
3 781  ALA n 
3 782  THR n 
3 783  ASP n 
3 784  GLU n 
3 785  VAL n 
3 786  GLY n 
3 787  GLN n 
3 788  ALA n 
3 789  LEU n 
3 790  ARG n 
3 791  GLU n 
3 792  HIS n 
3 793  TYR n 
3 794  PRO n 
3 795  ASP n 
3 796  ASP n 
3 797  ASN n 
3 798  PRO n 
3 799  ILE n 
3 800  ILE n 
3 801  THR n 
3 802  ILE n 
3 803  VAL n 
3 804  ASP n 
3 805  SER n 
3 806  GLY n 
3 807  ALA n 
3 808  THR n 
3 809  GLY n 
3 810  ASN n 
3 811  PHE n 
3 812  THR n 
3 813  GLN n 
3 814  THR n 
3 815  ARG n 
3 816  THR n 
3 817  LEU n 
3 818  ALA n 
3 819  GLY n 
3 820  MET n 
3 821  LYS n 
3 822  GLY n 
3 823  LEU n 
3 824  VAL n 
3 825  THR n 
3 826  ASN n 
3 827  PRO n 
3 828  LYS n 
3 829  GLY n 
3 830  GLU n 
3 831  PHE n 
3 832  ILE n 
3 833  PRO n 
3 834  ARG n 
3 835  PRO n 
3 836  VAL n 
3 837  LYS n 
3 838  SER n 
3 839  SER n 
3 840  PHE n 
3 841  ARG n 
3 842  GLU n 
3 843  GLY n 
3 844  LEU n 
3 845  THR n 
3 846  VAL n 
3 847  LEU n 
3 848  GLU n 
3 849  TYR n 
3 850  PHE n 
3 851  ILE n 
3 852  ASN n 
3 853  THR n 
3 854  HIS n 
3 855  GLY n 
3 856  ALA n 
3 857  ARG n 
3 858  LYS n 
3 859  GLY n 
3 860  LEU n 
3 861  ALA n 
3 862  ASP n 
3 863  THR n 
3 864  ALA n 
3 865  LEU n 
3 866  ARG n 
3 867  THR n 
3 868  ALA n 
3 869  ASP n 
3 870  SER n 
3 871  GLY n 
3 872  TYR n 
3 873  LEU n 
3 874  THR n 
3 875  ARG n 
3 876  ARG n 
3 877  LEU n 
3 878  VAL n 
3 879  ASP n 
3 880  VAL n 
3 881  SER n 
3 882  GLN n 
3 883  ASP n 
3 884  VAL n 
3 885  ILE n 
3 886  VAL n 
3 887  ARG n 
3 888  GLU n 
3 889  HIS n 
3 890  ASP n 
3 891  CYS n 
3 892  GLN n 
3 893  THR n 
3 894  GLU n 
3 895  ARG n 
3 896  GLY n 
3 897  ILE n 
3 898  VAL n 
3 899  VAL n 
3 900  GLU n 
3 901  LEU n 
3 902  ALA n 
3 903  GLU n 
3 904  ARG n 
3 905  ALA n 
3 906  PRO n 
3 907  ASP n 
3 908  GLY n 
3 909  THR n 
3 910  LEU n 
3 911  ILE n 
3 912  ARG n 
3 913  ASP n 
3 914  PRO n 
3 915  TYR n 
3 916  ILE n 
3 917  GLU n 
3 918  THR n 
3 919  SER n 
3 920  ALA n 
3 921  TYR n 
3 922  ALA n 
3 923  ARG n 
3 924  THR n 
3 925  LEU n 
3 926  GLY n 
3 927  THR n 
3 928  ASP n 
3 929  ALA n 
3 930  VAL n 
3 931  ASP n 
3 932  GLU n 
3 933  ALA n 
3 934  GLY n 
3 935  ASN n 
3 936  VAL n 
3 937  ILE n 
3 938  VAL n 
3 939  GLU n 
3 940  ARG n 
3 941  GLY n 
3 942  GLN n 
3 943  ASP n 
3 944  LEU n 
3 945  GLY n 
3 946  ASP n 
3 947  PRO n 
3 948  GLU n 
3 949  ILE n 
3 950  ASP n 
3 951  ALA n 
3 952  LEU n 
3 953  LEU n 
3 954  ALA n 
3 955  ALA n 
3 956  GLY n 
3 957  ILE n 
3 958  THR n 
3 959  GLN n 
3 960  VAL n 
3 961  LYS n 
3 962  VAL n 
3 963  ARG n 
3 964  SER n 
3 965  VAL n 
3 966  LEU n 
3 967  THR n 
3 968  CYS n 
3 969  ALA n 
3 970  THR n 
3 971  SER n 
3 972  THR n 
3 973  GLY n 
3 974  VAL n 
3 975  CYS n 
3 976  ALA n 
3 977  THR n 
3 978  CYS n 
3 979  TYR n 
3 980  GLY n 
3 981  ARG n 
3 982  SER n 
3 983  MET n 
3 984  ALA n 
3 985  THR n 
3 986  GLY n 
3 987  LYS n 
3 988  LEU n 
3 989  VAL n 
3 990  ASP n 
3 991  ILE n 
3 992  GLY n 
3 993  GLU n 
3 994  ALA n 
3 995  VAL n 
3 996  GLY n 
3 997  ILE n 
3 998  VAL n 
3 999  ALA n 
3 1000 ALA n 
3 1001 GLN n 
3 1002 SER n 
3 1003 ILE n 
3 1004 GLY n 
3 1005 GLU n 
3 1006 PRO n 
3 1007 GLY n 
3 1008 THR n 
3 1009 GLN n 
3 1010 LEU n 
3 1011 THR n 
3 1012 MET n 
3 1013 ARG n 
3 1014 THR n 
3 1015 PHE n 
3 1016 HIS n 
3 1017 GLN n 
3 1018 GLY n 
3 1019 GLY n 
3 1020 VAL n 
3 1021 GLY n 
3 1022 GLU n 
3 1023 ASP n 
3 1024 ILE n 
3 1025 THR n 
3 1026 GLY n 
3 1027 GLY n 
3 1028 LEU n 
3 1029 PRO n 
3 1030 ARG n 
3 1031 VAL n 
3 1032 GLN n 
3 1033 GLU n 
3 1034 LEU n 
3 1035 PHE n 
3 1036 GLU n 
3 1037 ALA n 
3 1038 ARG n 
3 1039 VAL n 
3 1040 PRO n 
3 1041 ARG n 
3 1042 GLY n 
3 1043 LYS n 
3 1044 ALA n 
3 1045 PRO n 
3 1046 ILE n 
3 1047 ALA n 
3 1048 ASP n 
3 1049 VAL n 
3 1050 THR n 
3 1051 GLY n 
3 1052 ARG n 
3 1053 VAL n 
3 1054 ARG n 
3 1055 LEU n 
3 1056 GLU n 
3 1057 ASP n 
3 1058 GLY n 
3 1059 GLU n 
3 1060 ARG n 
3 1061 PHE n 
3 1062 TYR n 
3 1063 LYS n 
3 1064 ILE n 
3 1065 THR n 
3 1066 ILE n 
3 1067 VAL n 
3 1068 PRO n 
3 1069 ASP n 
3 1070 ASP n 
3 1071 GLY n 
3 1072 GLY n 
3 1073 GLU n 
3 1074 GLU n 
3 1075 VAL n 
3 1076 VAL n 
3 1077 TYR n 
3 1078 ASP n 
3 1079 LYS n 
3 1080 ILE n 
3 1081 SER n 
3 1082 LYS n 
3 1083 ARG n 
3 1084 GLN n 
3 1085 ARG n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 VAL n 
3 1089 PHE n 
3 1090 LYS n 
3 1091 HIS n 
3 1092 GLU n 
3 1093 ASP n 
3 1094 GLY n 
3 1095 SER n 
3 1096 GLU n 
3 1097 ARG n 
3 1098 VAL n 
3 1099 LEU n 
3 1100 SER n 
3 1101 ASP n 
3 1102 GLY n 
3 1103 ASP n 
3 1104 HIS n 
3 1105 VAL n 
3 1106 GLU n 
3 1107 VAL n 
3 1108 GLY n 
3 1109 GLN n 
3 1110 GLN n 
3 1111 LEU n 
3 1112 MET n 
3 1113 GLU n 
3 1114 GLY n 
3 1115 SER n 
3 1116 ALA n 
3 1117 ASP n 
3 1118 PRO n 
3 1119 HIS n 
3 1120 GLU n 
3 1121 VAL n 
3 1122 LEU n 
3 1123 ARG n 
3 1124 VAL n 
3 1125 GLN n 
3 1126 GLY n 
3 1127 PRO n 
3 1128 ARG n 
3 1129 GLU n 
3 1130 VAL n 
3 1131 GLN n 
3 1132 ILE n 
3 1133 HIS n 
3 1134 LEU n 
3 1135 VAL n 
3 1136 ARG n 
3 1137 GLU n 
3 1138 VAL n 
3 1139 GLN n 
3 1140 GLU n 
3 1141 VAL n 
3 1142 TYR n 
3 1143 ARG n 
3 1144 ALA n 
3 1145 GLN n 
3 1146 GLY n 
3 1147 VAL n 
3 1148 SER n 
3 1149 ILE n 
3 1150 HIS n 
3 1151 ASP n 
3 1152 LYS n 
3 1153 HIS n 
3 1154 ILE n 
3 1155 GLU n 
3 1156 VAL n 
3 1157 ILE n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 GLN n 
3 1161 MET n 
3 1162 LEU n 
3 1163 ARG n 
3 1164 ARG n 
3 1165 VAL n 
3 1166 THR n 
3 1167 ILE n 
3 1168 ILE n 
3 1169 ASP n 
3 1170 SER n 
3 1171 GLY n 
3 1172 SER n 
3 1173 THR n 
3 1174 GLU n 
3 1175 PHE n 
3 1176 LEU n 
3 1177 PRO n 
3 1178 GLY n 
3 1179 SER n 
3 1180 LEU n 
3 1181 ILE n 
3 1182 ASP n 
3 1183 ARG n 
3 1184 ALA n 
3 1185 GLU n 
3 1186 PHE n 
3 1187 GLU n 
3 1188 ALA n 
3 1189 GLU n 
3 1190 ASN n 
3 1191 ARG n 
3 1192 ARG n 
3 1193 VAL n 
3 1194 VAL n 
3 1195 ALA n 
3 1196 GLU n 
3 1197 GLY n 
3 1198 GLY n 
3 1199 GLU n 
3 1200 PRO n 
3 1201 ALA n 
3 1202 ALA n 
3 1203 GLY n 
3 1204 ARG n 
3 1205 PRO n 
3 1206 VAL n 
3 1207 LEU n 
3 1208 MET n 
3 1209 GLY n 
3 1210 ILE n 
3 1211 THR n 
3 1212 LYS n 
3 1213 ALA n 
3 1214 SER n 
3 1215 LEU n 
3 1216 ALA n 
3 1217 THR n 
3 1218 ASP n 
3 1219 SER n 
3 1220 TRP n 
3 1221 LEU n 
3 1222 SER n 
3 1223 ALA n 
3 1224 ALA n 
3 1225 SER n 
3 1226 PHE n 
3 1227 GLN n 
3 1228 GLU n 
3 1229 THR n 
3 1230 THR n 
3 1231 ARG n 
3 1232 VAL n 
3 1233 LEU n 
3 1234 THR n 
3 1235 ASP n 
3 1236 ALA n 
3 1237 ALA n 
3 1238 ILE n 
3 1239 ASN n 
3 1240 CYS n 
3 1241 ARG n 
3 1242 SER n 
3 1243 ASP n 
3 1244 LYS n 
3 1245 LEU n 
3 1246 ASN n 
3 1247 GLY n 
3 1248 LEU n 
3 1249 LYS n 
3 1250 GLU n 
3 1251 ASN n 
3 1252 VAL n 
3 1253 ILE n 
3 1254 ILE n 
3 1255 GLY n 
3 1256 LYS n 
3 1257 LEU n 
3 1258 ILE n 
3 1259 PRO n 
3 1260 ALA n 
3 1261 GLY n 
3 1262 THR n 
3 1263 GLY n 
3 1264 ILE n 
3 1265 ASN n 
3 1266 ARG n 
3 1267 TYR n 
3 1268 ARG n 
3 1269 ASN n 
3 1270 ILE n 
3 1271 ALA n 
3 1272 VAL n 
3 1273 GLN n 
3 1274 PRO n 
3 1275 THR n 
3 1276 GLU n 
3 1277 GLU n 
3 1278 ALA n 
3 1279 ARG n 
3 1280 ALA n 
3 1281 ALA n 
3 1282 ALA n 
3 1283 TYR n 
3 1284 THR n 
3 1285 ILE n 
3 1286 PRO n 
3 1287 SER n 
3 1288 TYR n 
3 1289 GLU n 
3 1290 ASP n 
3 1291 GLN n 
3 1292 TYR n 
3 1293 TYR n 
3 1294 SER n 
3 1295 PRO n 
3 1296 ASP n 
3 1297 PHE n 
3 1298 GLY n 
3 1299 ALA n 
3 1300 ALA n 
3 1301 THR n 
3 1302 GLY n 
3 1303 ALA n 
3 1304 ALA n 
3 1305 VAL n 
3 1306 PRO n 
3 1307 LEU n 
3 1308 ASP n 
3 1309 ASP n 
3 1310 TYR n 
3 1311 GLY n 
3 1312 TYR n 
3 1313 SER n 
3 1314 ASP n 
3 1315 TYR n 
3 1316 ARG n 
4 1    MET n 
4 2    SER n 
4 3    ILE n 
4 4    SER n 
4 5    GLN n 
4 6    SER n 
4 7    ASP n 
4 8    ALA n 
4 9    SER n 
4 10   LEU n 
4 11   ALA n 
4 12   ALA n 
4 13   VAL n 
4 14   PRO n 
4 15   ALA n 
4 16   VAL n 
4 17   ASP n 
4 18   GLN n 
4 19   PHE n 
4 20   ASP n 
4 21   PRO n 
4 22   SER n 
4 23   SER n 
4 24   GLY n 
4 25   ALA n 
4 26   SER n 
4 27   GLY n 
4 28   GLY n 
4 29   TYR n 
4 30   ASP n 
4 31   THR n 
4 32   PRO n 
4 33   LEU n 
4 34   GLY n 
4 35   ILE n 
4 36   THR n 
4 37   ASN n 
4 38   PRO n 
4 39   PRO n 
4 40   ILE n 
4 41   ASP n 
4 42   GLU n 
4 43   LEU n 
4 44   LEU n 
4 45   ASP n 
4 46   ARG n 
4 47   VAL n 
4 48   SER n 
4 49   SER n 
4 50   LYS n 
4 51   TYR n 
4 52   ALA n 
4 53   LEU n 
4 54   VAL n 
4 55   ILE n 
4 56   TYR n 
4 57   ALA n 
4 58   ALA n 
4 59   LYS n 
4 60   ARG n 
4 61   ALA n 
4 62   ARG n 
4 63   GLN n 
4 64   ILE n 
4 65   ASN n 
4 66   ASP n 
4 67   TYR n 
4 68   TYR n 
4 69   ASN n 
4 70   GLN n 
4 71   LEU n 
4 72   GLY n 
4 73   GLU n 
4 74   GLY n 
4 75   ILE n 
4 76   LEU n 
4 77   GLU n 
4 78   TYR n 
4 79   VAL n 
4 80   GLY n 
4 81   PRO n 
4 82   LEU n 
4 83   VAL n 
4 84   GLU n 
4 85   PRO n 
4 86   GLY n 
4 87   LEU n 
4 88   GLN n 
4 89   GLU n 
4 90   LYS n 
4 91   PRO n 
4 92   LEU n 
4 93   SER n 
4 94   ILE n 
4 95   ALA n 
4 96   LEU n 
4 97   ARG n 
4 98   GLU n 
4 99   ILE n 
4 100  HIS n 
4 101  ALA n 
4 102  ASP n 
4 103  LEU n 
4 104  LEU n 
4 105  GLU n 
4 106  HIS n 
4 107  THR n 
4 108  GLU n 
4 109  GLY n 
4 110  GLU n 
5 1    MET n 
5 2    ALA n 
5 3    ALA n 
5 4    THR n 
5 5    LYS n 
5 6    ALA n 
5 7    SER n 
5 8    THR n 
5 9    ALA n 
5 10   THR n 
5 11   ASP n 
5 12   GLU n 
5 13   PRO n 
5 14   VAL n 
5 15   LYS n 
5 16   ARG n 
5 17   THR n 
5 18   ALA n 
5 19   THR n 
5 20   LYS n 
5 21   SER n 
5 22   PRO n 
5 23   ALA n 
5 24   ALA n 
5 25   SER n 
5 26   ALA n 
5 27   SER n 
5 28   GLY n 
5 29   ALA n 
5 30   LYS n 
5 31   THR n 
5 32   GLY n 
5 33   ALA n 
5 34   LYS n 
5 35   ARG n 
5 36   THR n 
5 37   ALA n 
5 38   ALA n 
5 39   LYS n 
5 40   SER n 
5 41   ALA n 
5 42   SER n 
5 43   GLY n 
5 44   SER n 
5 45   PRO n 
5 46   PRO n 
5 47   ALA n 
5 48   LYS n 
5 49   ARG n 
5 50   ALA n 
5 51   THR n 
5 52   LYS n 
5 53   PRO n 
5 54   ALA n 
5 55   ALA n 
5 56   ARG n 
5 57   SER n 
5 58   VAL n 
5 59   LYS n 
5 60   PRO n 
5 61   ALA n 
5 62   SER n 
5 63   ALA n 
5 64   PRO n 
5 65   GLN n 
5 66   ASP n 
5 67   THR n 
5 68   THR n 
5 69   THR n 
5 70   SER n 
5 71   THR n 
5 72   ILE n 
5 73   PRO n 
5 74   LYS n 
5 75   ARG n 
5 76   LYS n 
5 77   THR n 
5 78   ARG n 
5 79   ALA n 
5 80   ALA n 
5 81   ALA n 
5 82   LYS n 
5 83   SER n 
5 84   ALA n 
5 85   ALA n 
5 86   ALA n 
5 87   LYS n 
5 88   ALA n 
5 89   PRO n 
5 90   SER n 
5 91   ALA n 
5 92   ARG n 
5 93   GLY n 
5 94   HIS n 
5 95   ALA n 
5 96   THR n 
5 97   LYS n 
5 98   PRO n 
5 99   ARG n 
5 100  ALA n 
5 101  PRO n 
5 102  LYS n 
5 103  ASP n 
5 104  ALA n 
5 105  GLN n 
5 106  HIS n 
5 107  GLU n 
5 108  ALA n 
5 109  ALA n 
5 110  THR n 
5 111  ASP n 
5 112  PRO n 
5 113  GLU n 
5 114  ASP n 
5 115  ALA n 
5 116  LEU n 
5 117  ASP n 
5 118  SER n 
5 119  VAL n 
5 120  GLU n 
5 121  GLU n 
5 122  LEU n 
5 123  ASP n 
5 124  ALA n 
5 125  GLU n 
5 126  PRO n 
5 127  ASP n 
5 128  LEU n 
5 129  ASP n 
5 130  VAL n 
5 131  GLU n 
5 132  PRO n 
5 133  GLY n 
5 134  GLU n 
5 135  ASP n 
5 136  LEU n 
5 137  ASP n 
5 138  LEU n 
5 139  ASP n 
5 140  ALA n 
5 141  ALA n 
5 142  ASP n 
5 143  LEU n 
5 144  ASN n 
5 145  LEU n 
5 146  ASP n 
5 147  ASP n 
5 148  LEU n 
5 149  GLU n 
5 150  ASP n 
5 151  ASP n 
5 152  VAL n 
5 153  ALA n 
5 154  PRO n 
5 155  ASP n 
5 156  ALA n 
5 157  ASP n 
5 158  ASP n 
5 159  ASP n 
5 160  LEU n 
5 161  ASP n 
5 162  SER n 
5 163  GLY n 
5 164  ASP n 
5 165  ASP n 
5 166  GLU n 
5 167  ASP n 
5 168  HIS n 
5 169  GLU n 
5 170  ASP n 
5 171  LEU n 
5 172  GLU n 
5 173  ALA n 
5 174  GLU n 
5 175  ALA n 
5 176  ALA n 
5 177  VAL n 
5 178  ALA n 
5 179  PRO n 
5 180  GLY n 
5 181  GLN n 
5 182  THR n 
5 183  ALA n 
5 184  ASP n 
5 185  ASP n 
5 186  ASP n 
5 187  GLU n 
5 188  GLU n 
5 189  ILE n 
5 190  ALA n 
5 191  GLU n 
5 192  PRO n 
5 193  THR n 
5 194  GLU n 
5 195  LYS n 
5 196  ASP n 
5 197  LYS n 
5 198  ALA n 
5 199  SER n 
5 200  GLY n 
5 201  ASP n 
5 202  PHE n 
5 203  VAL n 
5 204  TRP n 
5 205  ASP n 
5 206  GLU n 
5 207  ASP n 
5 208  GLU n 
5 209  SER n 
5 210  GLU n 
5 211  ALA n 
5 212  LEU n 
5 213  ARG n 
5 214  GLN n 
5 215  ALA n 
5 216  ARG n 
5 217  LYS n 
5 218  ASP n 
5 219  ALA n 
5 220  GLU n 
5 221  LEU n 
5 222  THR n 
5 223  ALA n 
5 224  SER n 
5 225  ALA n 
5 226  ASP n 
5 227  SER n 
5 228  VAL n 
5 229  ARG n 
5 230  ALA n 
5 231  TYR n 
5 232  LEU n 
5 233  LYS n 
5 234  GLN n 
5 235  ILE n 
5 236  GLY n 
5 237  LYS n 
5 238  VAL n 
5 239  ALA n 
5 240  LEU n 
5 241  LEU n 
5 242  ASN n 
5 243  ALA n 
5 244  GLU n 
5 245  GLU n 
5 246  GLU n 
5 247  VAL n 
5 248  GLU n 
5 249  LEU n 
5 250  ALA n 
5 251  LYS n 
5 252  ARG n 
5 253  ILE n 
5 254  GLU n 
5 255  ALA n 
5 256  GLY n 
5 257  LEU n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  GLN n 
5 262  LEU n 
5 263  MET n 
5 264  THR n 
5 265  GLU n 
5 266  LEU n 
5 267  SER n 
5 268  GLU n 
5 269  ARG n 
5 270  GLY n 
5 271  GLU n 
5 272  LYS n 
5 273  LEU n 
5 274  PRO n 
5 275  ALA n 
5 276  ALA n 
5 277  GLN n 
5 278  ARG n 
5 279  ARG n 
5 280  ASP n 
5 281  MET n 
5 282  MET n 
5 283  TRP n 
5 284  ILE n 
5 285  CYS n 
5 286  ARG n 
5 287  ASP n 
5 288  GLY n 
5 289  ASP n 
5 290  ARG n 
5 291  ALA n 
5 292  LYS n 
5 293  ASN n 
5 294  HIS n 
5 295  LEU n 
5 296  LEU n 
5 297  GLU n 
5 298  ALA n 
5 299  ASN n 
5 300  LEU n 
5 301  ARG n 
5 302  LEU n 
5 303  VAL n 
5 304  VAL n 
5 305  SER n 
5 306  LEU n 
5 307  ALA n 
5 308  LYS n 
5 309  ARG n 
5 310  TYR n 
5 311  THR n 
5 312  GLY n 
5 313  ARG n 
5 314  GLY n 
5 315  MET n 
5 316  ALA n 
5 317  PHE n 
5 318  LEU n 
5 319  ASP n 
5 320  LEU n 
5 321  ILE n 
5 322  GLN n 
5 323  GLU n 
5 324  GLY n 
5 325  ASN n 
5 326  LEU n 
5 327  GLY n 
5 328  LEU n 
5 329  ILE n 
5 330  ARG n 
5 331  ALA n 
5 332  VAL n 
5 333  GLU n 
5 334  LYS n 
5 335  PHE n 
5 336  ASP n 
5 337  TYR n 
5 338  THR n 
5 339  LYS n 
5 340  GLY n 
5 341  TYR n 
5 342  LYS n 
5 343  PHE n 
5 344  SER n 
5 345  THR n 
5 346  TYR n 
5 347  ALA n 
5 348  THR n 
5 349  TRP n 
5 350  TRP n 
5 351  ILE n 
5 352  ARG n 
5 353  GLN n 
5 354  ALA n 
5 355  ILE n 
5 356  THR n 
5 357  ARG n 
5 358  ALA n 
5 359  MET n 
5 360  ALA n 
5 361  ASP n 
5 362  GLN n 
5 363  ALA n 
5 364  ARG n 
5 365  THR n 
5 366  ILE n 
5 367  ARG n 
5 368  ILE n 
5 369  PRO n 
5 370  VAL n 
5 371  HIS n 
5 372  MET n 
5 373  VAL n 
5 374  GLU n 
5 375  VAL n 
5 376  ILE n 
5 377  ASN n 
5 378  LYS n 
5 379  LEU n 
5 380  GLY n 
5 381  ARG n 
5 382  ILE n 
5 383  GLN n 
5 384  ARG n 
5 385  GLU n 
5 386  LEU n 
5 387  LEU n 
5 388  GLN n 
5 389  ASP n 
5 390  LEU n 
5 391  GLY n 
5 392  ARG n 
5 393  GLU n 
5 394  PRO n 
5 395  THR n 
5 396  PRO n 
5 397  GLU n 
5 398  GLU n 
5 399  LEU n 
5 400  ALA n 
5 401  LYS n 
5 402  GLU n 
5 403  MET n 
5 404  ASP n 
5 405  ILE n 
5 406  THR n 
5 407  PRO n 
5 408  GLU n 
5 409  LYS n 
5 410  VAL n 
5 411  LEU n 
5 412  GLU n 
5 413  ILE n 
5 414  GLN n 
5 415  GLN n 
5 416  TYR n 
5 417  ALA n 
5 418  ARG n 
5 419  GLU n 
5 420  PRO n 
5 421  ILE n 
5 422  SER n 
5 423  LEU n 
5 424  ASP n 
5 425  GLN n 
5 426  THR n 
5 427  ILE n 
5 428  GLY n 
5 429  ASP n 
5 430  GLU n 
5 431  GLY n 
5 432  ASP n 
5 433  SER n 
5 434  GLN n 
5 435  LEU n 
5 436  GLY n 
5 437  ASP n 
5 438  PHE n 
5 439  ILE n 
5 440  GLU n 
5 441  ASP n 
5 442  SER n 
5 443  GLU n 
5 444  ALA n 
5 445  VAL n 
5 446  VAL n 
5 447  ALA n 
5 448  VAL n 
5 449  ASP n 
5 450  ALA n 
5 451  VAL n 
5 452  SER n 
5 453  PHE n 
5 454  THR n 
5 455  LEU n 
5 456  LEU n 
5 457  GLN n 
5 458  ASP n 
5 459  GLN n 
5 460  LEU n 
5 461  GLN n 
5 462  SER n 
5 463  VAL n 
5 464  LEU n 
5 465  ASP n 
5 466  THR n 
5 467  LEU n 
5 468  SER n 
5 469  GLU n 
5 470  ARG n 
5 471  GLU n 
5 472  ALA n 
5 473  GLY n 
5 474  VAL n 
5 475  VAL n 
5 476  ARG n 
5 477  LEU n 
5 478  ARG n 
5 479  PHE n 
5 480  GLY n 
5 481  LEU n 
5 482  THR n 
5 483  ASP n 
5 484  GLY n 
5 485  GLN n 
5 486  PRO n 
5 487  ARG n 
5 488  THR n 
5 489  LEU n 
5 490  ASP n 
5 491  GLU n 
5 492  ILE n 
5 493  GLY n 
5 494  GLN n 
5 495  VAL n 
5 496  TYR n 
5 497  GLY n 
5 498  VAL n 
5 499  THR n 
5 500  ARG n 
5 501  GLU n 
5 502  ARG n 
5 503  ILE n 
5 504  ARG n 
5 505  GLN n 
5 506  ILE n 
5 507  GLU n 
5 508  SER n 
5 509  LYS n 
5 510  THR n 
5 511  MET n 
5 512  SER n 
5 513  LYS n 
5 514  LEU n 
5 515  ARG n 
5 516  HIS n 
5 517  PRO n 
5 518  SER n 
5 519  ARG n 
5 520  SER n 
5 521  GLN n 
5 522  VAL n 
5 523  LEU n 
5 524  ARG n 
5 525  ASP n 
5 526  TYR n 
5 527  LEU n 
5 528  ASP n 
6 1    DT  n 
6 2    DA  n 
6 3    DT  n 
6 4    DA  n 
6 5    DA  n 
6 6    DT  n 
6 7    DG  n 
6 8    DG  n 
6 9    DG  n 
6 10   DA  n 
6 11   DG  n 
6 12   DC  n 
6 13   DT  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DA  n 
6 18   DC  n 
6 19   DG  n 
6 20   DG  n 
6 21   DA  n 
6 22   DT  n 
6 23   DG  n 
7 1    DC  n 
7 2    DA  n 
7 3    DT  n 
7 4    DC  n 
7 5    DC  n 
7 6    DG  n 
7 7    DT  n 
7 8    DG  n 
7 9    DA  n 
7 10   DG  n 
7 11   DT  n 
7 12   DC  n 
7 13   DC  n 
7 14   DA  n 
7 15   DG  n 
7 16   DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 347  ? ? 'rpoA, Rv3457c, MTCY13E12.10c'                ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1178 ? ? 'rpoB, Rv0667, MTCI376.08c'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 1316 ? ? 'rpoC, Rv0668, MTCI376.07c'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 110  ? ? 'rpoZ, Rv1390, MTCY21B4.07'                   ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 528  ? ? 'sigA, mysA, rpoD, rpoV, Rv2703, MTCY05A6.24' ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 23 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' ? 83332 ? 
7 1 sample 1 16 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' ? 83332 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_MYCTU P9WGZ1 ? 1 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
1 
2 UNP RPOB_MYCTU P9WGY9 ? 2 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
1 
3 UNP RPOC_MYCTU P9WGY7 ? 3 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
1 
4 UNP RPOZ_MYCTU P9WGY5 ? 4 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
1 
5 UNP SIGA_MYCTU P9WGI1 ? 5 
;MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRATKPAARSVKPASAPQDTTTSTIPKRKTRAA
AKSAAAKAPSARGHATKPRAPKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLEDDVAPDADDDL
DSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDL
IQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFG
LTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
1 
6 PDB 5UHF       5UHF   ? 6 ? 1 
7 PDB 5UHF       5UHF   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5UHF A 1 ? 347  ? P9WGZ1 1 ? 347  ? 1 347  
2 1 5UHF B 1 ? 347  ? P9WGZ1 1 ? 347  ? 1 347  
3 2 5UHF C 1 ? 1178 ? P9WGY9 1 ? 1178 ? 1 1178 
4 3 5UHF D 1 ? 1316 ? P9WGY7 1 ? 1316 ? 1 1316 
5 4 5UHF E 1 ? 110  ? P9WGY5 1 ? 110  ? 1 110  
6 5 5UHF F 1 ? 528  ? P9WGI1 1 ? 528  ? 1 528  
7 6 5UHF H 1 ? 23   ? 5UHF   1 ? 23   ? 1 23   
8 7 5UHF G 1 ? 16   ? 5UHF   5 ? 20   ? 5 20   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
88D non-polymer         . 'N-(2-methylphenyl)-Nalpha-(selenophene-2-carbonyl)-D-phenylalaninamide' ? 'C21 H20 N2 O2 Se' 411.356 
ALA 'L-peptide linking' y ALANINE                                                                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                          ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                 ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                     ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                      ? 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                     ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                             ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                ? 'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                               ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                   ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                               ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                          ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                   ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                               ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                 ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                   ? 'C5 H11 N O2'      117.146 
ZN  non-polymer         . 'ZINC ION'                                                               ? 'Zn 2'             65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5UHF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.87 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.15 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM Tris-HCl, pH 8.4, 200 mM KCl, 50 mM MgCl2, and 10% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-04-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.033 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.entry_id                     5UHF 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            4.350 
_reflns.number_obs                   44904 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.000 
_reflns.pdbx_Rmerge_I_obs            0.203 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.800 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              12.100 
_reflns.pdbx_Rrim_I_all              0.212 
_reflns.pdbx_Rpim_I_all              0.065 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_netI_over_av_sigmaI     ? 
_reflns.pdbx_number_measured_all     395911 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_chi_squared             0.945 
_reflns.Rmerge_F_all                 ? 
_reflns.Rmerge_F_obs                 ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.observed_criterion_I_max     ? 
_reflns.observed_criterion_I_min     ? 
_reflns.pdbx_d_res_high_opt          ? 
_reflns.pdbx_d_res_low_opt           ? 
_reflns.details                      ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  4.350 4.510  ? ? ? ? ?     ? ? 0.974 8.500  ? ? ? 3018 ? ? ? ? 92.800  ?     0.428 0.632 
1 2  4.510 4.690  ? ? ? ? ?     ? ? 0.919 9.900  ? ? ? 3232 ? ? ? ? 99.100  ?     0.327 0.775 
1 3  4.690 4.900  ? ? ? ? 0.913 ? ? 0.922 11.400 ? ? ? 3267 ? ? ? ? 100.000 0.956 0.277 0.855 
1 4  4.900 5.160  ? ? ? ? 0.896 ? ? 0.934 12.700 ? ? ? 3242 ? ? ? ? 99.800  0.934 0.259 0.884 
1 5  5.160 5.480  ? ? ? ? 0.774 ? ? 0.925 13.300 ? ? ? 3282 ? ? ? ? 100.000 0.804 0.219 0.921 
1 6  5.480 5.900  ? ? ? ? 0.643 ? ? 0.948 12.200 ? ? ? 3269 ? ? ? ? 99.700  0.671 0.191 0.923 
1 7  5.900 6.490  ? ? ? ? 0.469 ? ? 0.926 13.800 ? ? ? 3290 ? ? ? ? 99.900  0.487 0.130 0.966 
1 8  6.490 7.430  ? ? ? ? 0.284 ? ? 0.977 13.600 ? ? ? 3328 ? ? ? ? 100.000 0.295 0.080 0.984 
1 9  7.430 9.350  ? ? ? ? 0.178 ? ? 1.099 12.500 ? ? ? 3348 ? ? ? ? 99.600  0.185 0.051 0.988 
1 10 9.350 50.000 ? ? ? ? 0.118 ? ? 0.834 12.600 ? ? ? 3500 ? ? ? ? 99.500  0.123 0.034 0.993 
# 
_refine.entry_id                                 5UHF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            4.3450 
_refine.ls_d_res_low                             48.5040 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    71.5700 
_refine.ls_number_reflns_obs                     44904 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2025 
_refine.ls_R_factor_R_work                       0.1976 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2670 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 6.9800 
_refine.ls_number_reflns_R_free                  3135 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               68.0678 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.5500 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                373.710 
_refine.B_iso_min                                19.090 
_refine.pdbx_overall_phase_error                 24.9300 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       4.3450 
_refine_hist.d_res_low                        48.5040 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               25950 
_refine_hist.pdbx_number_residues_total       3278 
_refine_hist.pdbx_B_iso_mean_ligand           70.04 
_refine_hist.pdbx_number_atoms_protein        25204 
_refine_hist.pdbx_number_atoms_nucleic_acid   717 
# 
_struct.entry_id                     5UHF 
_struct.title                        
'Crystal structure of Mycobacterium tuberculosis transcription initiation complex in complex with D-IX336' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5UHF 
_struct_keywords.text            'RNA polymerase complex, transcription, DNA, RNA, TRANSCRIPTION-DNA-RNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 8  ? 
K N N 9  ? 
L N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? ILE A 46   ? GLY A 31   ILE A 46   1 ? 16 
HELX_P HELX_P2   AA2 ASP A 72   ? LEU A 80   ? ASP A 72   LEU A 80   1 ? 9  
HELX_P HELX_P3   AA3 GLY A 108  ? ILE A 110  ? GLY A 108  ILE A 110  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 148  ? GLY A 156  ? PRO A 148  GLY A 156  5 ? 9  
HELX_P HELX_P5   AA5 SER A 203  ? GLY A 220  ? SER A 203  GLY A 220  1 ? 18 
HELX_P HELX_P6   AA6 LEU A 221  ? ARG A 223  ? LEU A 221  ARG A 223  5 ? 3  
HELX_P HELX_P7   AA7 PHE B 30   ? LEU B 43   ? PHE B 30   LEU B 43   1 ? 14 
HELX_P HELX_P8   AA8 ASP B 72   ? SER B 82   ? ASP B 72   SER B 82   1 ? 11 
HELX_P HELX_P9   AA9 ALA B 149  ? ARG B 153  ? ALA B 149  ARG B 153  5 ? 5  
HELX_P HELX_P10  AB1 SER B 203  ? PHE B 219  ? SER B 203  PHE B 219  1 ? 17 
HELX_P HELX_P11  AB2 PHE B 219  ? GLU B 224  ? PHE B 219  GLU B 224  1 ? 6  
HELX_P HELX_P12  AB3 LEU C 54   ? GLY C 66   ? LEU C 54   GLY C 66   1 ? 13 
HELX_P HELX_P13  AB4 SER C 67   ? ARG C 77   ? SER C 67   ARG C 77   1 ? 11 
HELX_P HELX_P14  AB5 GLY C 84   ? SER C 94   ? GLY C 84   SER C 94   1 ? 11 
HELX_P HELX_P15  AB6 PRO C 118  ? ASP C 126  ? PRO C 118  ASP C 126  1 ? 9  
HELX_P HELX_P16  AB7 VAL C 234  ? GLY C 242  ? VAL C 234  GLY C 242  1 ? 9  
HELX_P HELX_P17  AB8 THR C 244  ? PHE C 252  ? THR C 244  PHE C 252  1 ? 9  
HELX_P HELX_P18  AB9 SER C 255  ? LYS C 264  ? SER C 255  LYS C 264  1 ? 10 
HELX_P HELX_P19  AC1 GLY C 269  ? ARG C 282  ? GLY C 269  ARG C 282  1 ? 14 
HELX_P HELX_P20  AC2 GLN C 293  ? LYS C 302  ? GLN C 293  LYS C 302  1 ? 10 
HELX_P HELX_P21  AC3 ALA C 309  ? GLY C 321  ? ALA C 309  GLY C 321  1 ? 13 
HELX_P HELX_P22  AC4 THR C 334  ? GLU C 350  ? THR C 334  GLU C 350  1 ? 17 
HELX_P HELX_P23  AC5 THR C 380  ? GLN C 407  ? THR C 380  GLN C 407  1 ? 28 
HELX_P HELX_P24  AC6 ASP C 408  ? ILE C 412  ? ASP C 408  ILE C 412  5 ? 5  
HELX_P HELX_P25  AC7 THR C 413  ? ILE C 418  ? THR C 413  ILE C 418  1 ? 6  
HELX_P HELX_P26  AC8 ILE C 420  ? SER C 434  ? ILE C 420  SER C 434  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 444  ? ARG C 453  ? ASN C 444  ARG C 453  1 ? 10 
HELX_P HELX_P28  AD1 HIS C 476  ? TYR C 480  ? HIS C 476  TYR C 480  5 ? 5  
HELX_P HELX_P29  AD2 THR C 532  ? ARG C 538  ? THR C 532  ARG C 538  1 ? 7  
HELX_P HELX_P30  AD3 LYS C 564  ? GLY C 566  ? LYS C 564  GLY C 566  5 ? 3  
HELX_P HELX_P31  AD4 PRO C 572  ? VAL C 576  ? PRO C 572  VAL C 576  5 ? 5  
HELX_P HELX_P32  AD5 SER C 588  ? MET C 593  ? SER C 588  MET C 593  1 ? 6  
HELX_P HELX_P33  AD6 PHE C 596  ? ASP C 600  ? PHE C 596  ASP C 600  5 ? 5  
HELX_P HELX_P34  AD7 ASP C 601  ? ARG C 613  ? ASP C 601  ARG C 613  1 ? 13 
HELX_P HELX_P35  AD8 MET C 630  ? ALA C 638  ? MET C 630  ALA C 638  1 ? 9  
HELX_P HELX_P36  AD9 ASN C 739  ? GLU C 744  ? ASN C 739  GLU C 744  1 ? 6  
HELX_P HELX_P37  AE1 GLU C 818  ? PHE C 825  ? GLU C 818  PHE C 825  1 ? 8  
HELX_P HELX_P38  AE2 PRO C 900  ? MET C 904  ? PRO C 900  MET C 904  5 ? 5  
HELX_P HELX_P39  AE3 ILE C 928  ? GLY C 943  ? ILE C 928  GLY C 943  1 ? 16 
HELX_P HELX_P40  AE4 ASP C 954  ? ARG C 958  ? ASP C 954  ARG C 958  5 ? 5  
HELX_P HELX_P41  AE5 PRO C 960  ? LEU C 963  ? PRO C 960  LEU C 963  5 ? 4  
HELX_P HELX_P42  AE6 GLN C 981  ? CYS C 991  ? GLN C 981  CYS C 991  1 ? 11 
HELX_P HELX_P43  AE7 LEU C 1036 ? ILE C 1041 ? LEU C 1036 ILE C 1041 1 ? 6  
HELX_P HELX_P44  AE8 GLY C 1059 ? PHE C 1063 ? GLY C 1059 PHE C 1063 5 ? 5  
HELX_P HELX_P45  AE9 GLY C 1069 ? GLY C 1080 ? GLY C 1069 GLY C 1080 1 ? 12 
HELX_P HELX_P46  AF1 ALA C 1081 ? LEU C 1089 ? ALA C 1081 LEU C 1089 1 ? 9  
HELX_P HELX_P47  AF2 ASP C 1095 ? LYS C 1108 ? ASP C 1095 LYS C 1108 1 ? 14 
HELX_P HELX_P48  AF3 PRO C 1118 ? SER C 1130 ? PRO C 1118 SER C 1130 1 ? 13 
HELX_P HELX_P49  AF4 THR D 16   ? SER D 24   ? THR D 16   SER D 24   1 ? 9  
HELX_P HELX_P50  AF5 ARG D 84   ? GLU D 90   ? ARG D 84   GLU D 90   5 ? 7  
HELX_P HELX_P51  AF6 HIS D 103  ? LYS D 108  ? HIS D 103  LYS D 108  1 ? 6  
HELX_P HELX_P52  AF7 SER D 112  ? LEU D 118  ? SER D 112  LEU D 118  1 ? 7  
HELX_P HELX_P53  AF8 ALA D 121  ? TYR D 130  ? ALA D 121  TYR D 130  1 ? 10 
HELX_P HELX_P54  AF9 ASP D 140  ? GLU D 187  ? ASP D 140  GLU D 187  1 ? 48 
HELX_P HELX_P55  AG1 ARG D 194  ? LYS D 228  ? ARG D 194  LYS D 228  1 ? 35 
HELX_P HELX_P56  AG2 ASP D 237  ? GLY D 249  ? ASP D 237  GLY D 249  1 ? 13 
HELX_P HELX_P57  AG3 GLY D 257  ? ASN D 267  ? GLY D 257  ASN D 267  1 ? 11 
HELX_P HELX_P58  AG4 ASP D 269  ? ARG D 282  ? ASP D 269  ARG D 282  1 ? 14 
HELX_P HELX_P59  AG5 GLY D 286  ? SER D 305  ? GLY D 286  SER D 305  1 ? 20 
HELX_P HELX_P60  AG6 PRO D 321  ? ARG D 325  ? PRO D 321  ARG D 325  5 ? 5  
HELX_P HELX_P61  AG7 ASP D 339  ? GLY D 361  ? ASP D 339  GLY D 361  1 ? 23 
HELX_P HELX_P62  AG8 PRO D 363  ? ASP D 383  ? PRO D 363  ASP D 383  1 ? 21 
HELX_P HELX_P63  AG9 LEU D 402  ? LEU D 406  ? LEU D 402  LEU D 406  5 ? 5  
HELX_P HELX_P64  AH1 GLY D 411  ? LEU D 417  ? GLY D 411  LEU D 417  1 ? 7  
HELX_P HELX_P65  AH2 LYS D 445  ? PHE D 452  ? LYS D 445  PHE D 452  1 ? 8  
HELX_P HELX_P66  AH3 PHE D 452  ? LEU D 463  ? PHE D 452  LEU D 463  1 ? 12 
HELX_P HELX_P67  AH4 ASN D 468  ? ARG D 478  ? ASN D 468  ARG D 478  1 ? 11 
HELX_P HELX_P68  AH5 GLN D 482  ? ILE D 491  ? GLN D 482  ILE D 491  1 ? 10 
HELX_P HELX_P69  AH6 HIS D 505  ? LEU D 507  ? HIS D 505  LEU D 507  5 ? 3  
HELX_P HELX_P70  AH7 VAL D 528  ? ASN D 533  ? VAL D 528  ASN D 533  1 ? 6  
HELX_P HELX_P71  AH8 SER D 548  ? LEU D 558  ? SER D 548  LEU D 558  1 ? 11 
HELX_P HELX_P72  AH9 LEU D 579  ? THR D 589  ? LEU D 579  THR D 589  1 ? 11 
HELX_P HELX_P73  AI1 SER D 614  ? ASP D 623  ? SER D 614  ASP D 623  1 ? 10 
HELX_P HELX_P74  AI2 PRO D 643  ? PHE D 651  ? PRO D 643  PHE D 651  1 ? 9  
HELX_P HELX_P75  AI3 LEU D 668  ? GLU D 675  ? LEU D 668  GLU D 675  1 ? 8  
HELX_P HELX_P76  AI4 HIS D 689  ? ARG D 703  ? HIS D 689  ARG D 703  1 ? 15 
HELX_P HELX_P77  AI5 PRO D 705  ? ARG D 726  ? PRO D 705  ARG D 726  1 ? 22 
HELX_P HELX_P78  AI6 ARG D 741  ? ARG D 762  ? ARG D 741  ARG D 762  1 ? 22 
HELX_P HELX_P79  AI7 ASN D 766  ? TYR D 793  ? ASN D 766  TYR D 793  1 ? 28 
HELX_P HELX_P80  AI8 ASN D 797  ? SER D 805  ? ASN D 797  SER D 805  1 ? 9  
HELX_P HELX_P81  AI9 ASN D 810  ? GLY D 819  ? ASN D 810  GLY D 819  1 ? 10 
HELX_P HELX_P82  AJ1 THR D 845  ? SER D 881  ? THR D 845  SER D 881  1 ? 37 
HELX_P HELX_P83  AJ2 TYR D 915  ? ALA D 920  ? TYR D 915  ALA D 920  1 ? 6  
HELX_P HELX_P84  AJ3 GLY D 945  ? GLY D 956  ? GLY D 945  GLY D 956  1 ? 12 
HELX_P HELX_P85  AJ4 ALA D 994  ? GLU D 1005 ? ALA D 994  GLU D 1005 1 ? 12 
HELX_P HELX_P86  AJ5 GLY D 1027 ? GLU D 1036 ? GLY D 1027 GLU D 1036 1 ? 10 
HELX_P HELX_P87  AJ6 ASP D 1117 ? GLY D 1126 ? ASP D 1117 GLY D 1126 1 ? 10 
HELX_P HELX_P88  AJ7 GLY D 1126 ? GLN D 1145 ? GLY D 1126 GLN D 1145 1 ? 20 
HELX_P HELX_P89  AJ8 HIS D 1150 ? LEU D 1162 ? HIS D 1150 LEU D 1162 1 ? 13 
HELX_P HELX_P90  AJ9 ARG D 1183 ? VAL D 1193 ? ARG D 1183 VAL D 1193 1 ? 11 
HELX_P HELX_P91  AK1 GLY D 1209 ? ALA D 1216 ? GLY D 1209 ALA D 1216 1 ? 8  
HELX_P HELX_P92  AK2 SER D 1219 ? SER D 1225 ? SER D 1219 SER D 1225 1 ? 7  
HELX_P HELX_P93  AK3 GLU D 1228 ? ASN D 1239 ? GLU D 1228 ASN D 1239 1 ? 12 
HELX_P HELX_P94  AK4 GLY D 1247 ? GLY D 1255 ? GLY D 1247 GLY D 1255 1 ? 9  
HELX_P HELX_P95  AK5 ALA D 1260 ? GLY D 1263 ? ALA D 1260 GLY D 1263 5 ? 4  
HELX_P HELX_P96  AK6 ILE D 1264 ? ASN D 1269 ? ILE D 1264 ASN D 1269 1 ? 6  
HELX_P HELX_P97  AK7 LEU E 33   ? ASN E 37   ? LEU E 33   ASN E 37   5 ? 5  
HELX_P HELX_P98  AK8 PRO E 39   ? LEU E 44   ? PRO E 39   LEU E 44   1 ? 6  
HELX_P HELX_P99  AK9 ASP E 45   ? VAL E 47   ? ASP E 45   VAL E 47   5 ? 3  
HELX_P HELX_P100 AL1 SER E 49   ? GLY E 72   ? SER E 49   GLY E 72   1 ? 24 
HELX_P HELX_P101 AL2 LYS E 90   ? ALA E 101  ? LYS E 90   ALA E 101  1 ? 12 
HELX_P HELX_P102 AL3 SER F 209  ? THR F 222  ? SER F 209  THR F 222  1 ? 14 
HELX_P HELX_P103 AL4 ASP F 226  ? GLY F 236  ? ASP F 226  GLY F 236  1 ? 11 
HELX_P HELX_P104 AL5 ASN F 242  ? GLY F 270  ? ASN F 242  GLY F 270  1 ? 29 
HELX_P HELX_P105 AL6 ALA F 276  ? ASN F 299  ? ALA F 276  ASN F 299  1 ? 24 
HELX_P HELX_P106 AL7 ASN F 299  ? LEU F 306  ? ASN F 299  LEU F 306  1 ? 8  
HELX_P HELX_P107 AL8 ALA F 307  ? THR F 311  ? ALA F 307  THR F 311  5 ? 5  
HELX_P HELX_P108 AL9 ALA F 316  ? LYS F 334  ? ALA F 316  LYS F 334  1 ? 19 
HELX_P HELX_P109 AM1 LYS F 342  ? ALA F 363  ? LYS F 342  ALA F 363  1 ? 22 
HELX_P HELX_P110 AM2 PRO F 369  ? LEU F 386  ? PRO F 369  LEU F 386  1 ? 18 
HELX_P HELX_P111 AM3 LEU F 386  ? GLY F 391  ? LEU F 386  GLY F 391  1 ? 6  
HELX_P HELX_P112 AM4 THR F 395  ? ASP F 404  ? THR F 395  ASP F 404  1 ? 10 
HELX_P HELX_P113 AM5 THR F 406  ? ALA F 417  ? THR F 406  ALA F 417  1 ? 12 
HELX_P HELX_P114 AM6 GLY F 436  ? PHE F 438  ? GLY F 436  PHE F 438  5 ? 3  
HELX_P HELX_P115 AM7 VAL F 446  ? ASP F 458  ? VAL F 446  ASP F 458  1 ? 13 
HELX_P HELX_P116 AM8 ARG F 470  ? PHE F 479  ? ARG F 470  PHE F 479  1 ? 10 
HELX_P HELX_P117 AM9 THR F 488  ? TYR F 496  ? THR F 488  TYR F 496  1 ? 9  
HELX_P HELX_P118 AN1 GLU F 501  ? SER F 512  ? GLU F 501  SER F 512  1 ? 12 
HELX_P HELX_P119 AN2 ARG F 515  ? SER F 520  ? ARG F 515  SER F 520  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? D CYS 975 SG  ? ? ? 1_555 D CYS 978 SG ? ? D CYS 975 D CYS 978  1_555 ? ? ? ? ? ? ?                       
2.781 ? 
metalc1  metalc ? ? D CYS 60  SG  ? ? ? 1_555 J ZN  .   ZN ? ? D CYS 60  D ZN  1402 1_555 ? ? ? ? ? ? ?                       
2.120 ? 
metalc2  metalc ? ? D CYS 62  SG  ? ? ? 1_555 J ZN  .   ZN ? ? D CYS 62  D ZN  1402 1_555 ? ? ? ? ? ? ?                       
2.229 ? 
metalc3  metalc ? ? D CYS 75  SG  ? ? ? 1_555 J ZN  .   ZN ? ? D CYS 75  D ZN  1402 1_555 ? ? ? ? ? ? ?                       
2.281 ? 
metalc4  metalc ? ? D CYS 78  SG  ? ? ? 1_555 J ZN  .   ZN ? ? D CYS 78  D ZN  1402 1_555 ? ? ? ? ? ? ?                       
2.218 ? 
metalc5  metalc ? ? D ASP 535 OD1 ? ? ? 1_555 K MG  .   MG ? ? D ASP 535 D MG  1403 1_555 ? ? ? ? ? ? ?                       
2.176 ? 
metalc6  metalc ? ? D ASP 537 OD1 ? ? ? 1_555 K MG  .   MG ? ? D ASP 537 D MG  1403 1_555 ? ? ? ? ? ? ?                       
2.006 ? 
metalc7  metalc ? ? D ASP 537 OD2 ? ? ? 1_555 K MG  .   MG ? ? D ASP 537 D MG  1403 1_555 ? ? ? ? ? ? ?                       
2.597 ? 
metalc8  metalc ? ? D ASP 539 OD1 ? ? ? 1_555 K MG  .   MG ? ? D ASP 539 D MG  1403 1_555 ? ? ? ? ? ? ?                       
2.503 ? 
metalc9  metalc ? ? D CYS 891 SG  ? ? ? 1_555 I ZN  .   ZN ? ? D CYS 891 D ZN  1401 1_555 ? ? ? ? ? ? ?                       
2.133 ? 
metalc10 metalc ? ? D CYS 968 SG  ? ? ? 1_555 I ZN  .   ZN ? ? D CYS 968 D ZN  1401 1_555 ? ? ? ? ? ? ?                       
2.186 ? 
metalc11 metalc ? ? D CYS 975 SG  ? ? ? 1_555 I ZN  .   ZN ? ? D CYS 975 D ZN  1401 1_555 ? ? ? ? ? ? ?                       
2.160 ? 
metalc12 metalc ? ? D CYS 978 SG  ? ? ? 1_555 I ZN  .   ZN ? ? D CYS 978 D ZN  1401 1_555 ? ? ? ? ? ? ?                       
2.287 ? 
hydrog1  hydrog ? ? G DT  15  N3  ? ? ? 1_555 H DA  9   N1 ? ? H DT  15  G DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2  hydrog ? ? G DT  15  O4  ? ? ? 1_555 H DA  9   N6 ? ? H DT  15  G DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3  hydrog ? ? G DC  16  N3  ? ? ? 1_555 H DG  8   N2 ? ? H DC  16  G DG  12   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog4  hydrog ? ? G DC  16  O2  ? ? ? 1_555 H DG  8   N1 ? ? H DC  16  G DG  12   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog5  hydrog ? ? G DA  17  N1  ? ? ? 1_555 H DT  7   N3 ? ? H DA  17  G DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6  hydrog ? ? G DA  17  N6  ? ? ? 1_555 H DT  7   O4 ? ? H DA  17  G DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7  hydrog ? ? G DC  18  N3  ? ? ? 1_555 H DG  6   N1 ? ? H DC  18  G DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8  hydrog ? ? G DC  18  N4  ? ? ? 1_555 H DG  6   O6 ? ? H DC  18  G DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog9  hydrog ? ? G DC  18  O2  ? ? ? 1_555 H DG  6   N2 ? ? H DC  18  G DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10 hydrog ? ? G DG  19  N1  ? ? ? 1_555 H DC  5   N3 ? ? H DG  19  G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11 hydrog ? ? G DG  19  N2  ? ? ? 1_555 H DC  5   O2 ? ? H DG  19  G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12 hydrog ? ? G DG  19  O6  ? ? ? 1_555 H DC  5   N4 ? ? H DG  19  G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13 hydrog ? ? G DG  20  N1  ? ? ? 1_555 H DC  4   N3 ? ? H DG  20  G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14 hydrog ? ? G DG  20  N2  ? ? ? 1_555 H DC  4   O2 ? ? H DG  20  G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15 hydrog ? ? G DG  20  O6  ? ? ? 1_555 H DC  4   N4 ? ? H DG  20  G DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16 hydrog ? ? G DA  21  N1  ? ? ? 1_555 H DT  3   N3 ? ? H DA  21  G DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17 hydrog ? ? G DA  21  N6  ? ? ? 1_555 H DT  3   O4 ? ? H DA  21  G DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18 hydrog ? ? G DT  22  N3  ? ? ? 1_555 H DA  2   N1 ? ? H DT  22  G DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19 hydrog ? ? G DT  22  O4  ? ? ? 1_555 H DA  2   N6 ? ? H DT  22  G DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20 hydrog ? ? G DG  23  N1  ? ? ? 1_555 H DC  1   N3 ? ? H DG  23  G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog21 hydrog ? ? G DG  23  N2  ? ? ? 1_555 H DC  1   O2 ? ? H DG  23  G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog22 hydrog ? ? G DG  23  O6  ? ? ? 1_555 H DC  1   N4 ? ? H DG  23  G DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 24  A . ? GLU 24  A PRO 25  A ? PRO 25  A 1 -2.00 
2 GLU 24  B . ? GLU 24  B PRO 25  B ? PRO 25  B 1 -2.92 
3 SER 94  C . ? SER 94  C PRO 95  C ? PRO 95  C 1 -2.32 
4 VAL 110 D . ? VAL 110 D PRO 111 D ? PRO 111 D 1 1.00  
5 ALA 501 D . ? ALA 501 D PRO 502 D ? PRO 502 D 1 -2.78 
6 LEU 677 D . ? LEU 677 D PRO 678 D ? PRO 678 D 1 -7.24 
7 ASN 37  E . ? ASN 37  E PRO 38  E ? PRO 38  E 1 0.06  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 6 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 6 ? 
AC7 ? 3 ? 
AC8 ? 4 ? 
AC9 ? 3 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 8 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 3 ? 
AD8 ? 3 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 4 ? 
AE6 ? 3 ? 
AE7 ? 2 ? 
AE8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC1 4 5 ? anti-parallel 
AC1 5 6 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? parallel      
AC6 4 5 ? anti-parallel 
AC6 5 6 ? parallel      
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
AD3 5 6 ? parallel      
AD3 6 7 ? anti-parallel 
AD3 7 8 ? parallel      
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? parallel      
AD9 1 2 ? parallel      
AD9 2 3 ? anti-parallel 
AE1 1 2 ? parallel      
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 18   ? LEU A 26   ? ARG A 18   LEU A 26   
AA1 2 PHE A 189  ? THR A 198  ? PHE A 189  THR A 198  
AA1 3 VAL A 171  ? THR A 181  ? VAL A 171  THR A 181  
AA2 1 VAL A 93   ? GLN A 100  ? VAL A 93   GLN A 100  
AA2 2 LYS A 133  ? ARG A 144  ? LYS A 133  ARG A 144  
AA2 3 PRO A 47   ? ILE A 56   ? PRO A 47   ILE A 56   
AA2 4 ILE A 162  ? PRO A 163  ? ILE A 162  PRO A 163  
AA3 1 VAL A 85   ? SER A 87   ? VAL A 85   SER A 87   
AA3 2 VAL A 116  ? VAL A 118  ? VAL A 116  VAL A 118  
AA4 1 GLY A 103  ? THR A 106  ? GLY A 103  THR A 106  
AA4 2 HIS A 124  ? LEU A 128  ? HIS A 124  LEU A 128  
AA5 1 TYR A 146  ? VAL A 147  ? TYR A 146  VAL A 147  
AA5 2 SER A 166  ? ILE A 167  ? SER A 166  ILE A 167  
AA6 1 LEU B 9    ? LEU B 14   ? LEU B 9    LEU B 14   
AA6 2 ARG B 18   ? LEU B 26   ? ARG B 18   LEU B 26   
AA6 3 ASP B 190  ? THR B 198  ? ASP B 190  THR B 198  
AA6 4 VAL B 171  ? ALA B 180  ? VAL B 171  ALA B 180  
AA7 1 VAL B 93   ? GLN B 100  ? VAL B 93   GLN B 100  
AA7 2 LYS B 133  ? GLY B 143  ? LYS B 133  GLY B 143  
AA7 3 GLY B 48   ? ILE B 56   ? GLY B 48   ILE B 56   
AA7 4 ARG B 161  ? PRO B 163  ? ARG B 161  PRO B 163  
AA8 1 VAL B 85   ? SER B 87   ? VAL B 85   SER B 87   
AA8 2 VAL B 116  ? VAL B 118  ? VAL B 116  VAL B 118  
AA9 1 GLY B 103  ? VAL B 105  ? GLY B 103  VAL B 105  
AA9 2 ALA B 126  ? LEU B 128  ? ALA B 126  LEU B 128  
AB1 1 TYR B 146  ? VAL B 147  ? TYR B 146  VAL B 147  
AB1 2 SER B 166  ? ILE B 167  ? SER B 166  ILE B 167  
AB2 1 VAL C 39   ? SER C 40   ? VAL C 39   SER C 40   
AB2 2 VAL C 972  ? SER C 973  ? VAL C 972  SER C 973  
AB2 3 VAL C 626  ? GLY C 627  ? VAL C 626  GLY C 627  
AB3 1 ILE C 96   ? GLU C 97   ? ILE C 96   GLU C 97   
AB3 2 MET C 103  ? PHE C 112  ? MET C 103  PHE C 112  
AB3 3 ALA C 130  ? ASN C 141  ? ALA C 130  ASN C 141  
AB3 4 ILE C 147  ? PRO C 158  ? ILE C 147  PRO C 158  
AB4 1 PHE C 166  ? ILE C 168  ? PHE C 166  ILE C 168  
AB4 2 THR C 171  ? VAL C 175  ? THR C 171  VAL C 175  
AB4 3 SER C 437  ? PHE C 439  ? SER C 437  PHE C 439  
AB5 1 ARG C 376  ? ARG C 379  ? ARG C 376  ARG C 379  
AB5 2 SER C 177  ? ARG C 181  ? SER C 177  ARG C 181  
AB5 3 ARG C 454  ? SER C 456  ? ARG C 454  SER C 456  
AB5 4 ILE C 497  ? SER C 499  ? ILE C 497  SER C 499  
AB6 1 GLY C 184  ? ILE C 191  ? GLY C 184  ILE C 191  
AB6 2 THR C 198  ? ILE C 205  ? THR C 198  ILE C 205  
AB7 1 GLU C 213  ? VAL C 216  ? GLU C 213  VAL C 216  
AB7 2 VAL C 222  ? ARG C 225  ? VAL C 222  ARG C 225  
AB7 3 GLN C 232  ? PRO C 233  ? GLN C 232  PRO C 233  
AB8 1 THR C 354  ? THR C 356  ? THR C 354  THR C 356  
AB8 2 GLU C 362  ? PRO C 364  ? GLU C 362  PRO C 364  
AB9 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AB9 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AB9 3 VAL C 524  ? LEU C 531  ? VAL C 524  LEU C 531  
AC1 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AC1 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AC1 3 TYR C 578  ? ASP C 580  ? TYR C 578  ASP C 580  
AC1 4 VAL C 541  ? ALA C 542  ? VAL C 541  ALA C 542  
AC1 5 VAL C 559  ? ARG C 562  ? VAL C 559  ARG C 562  
AC1 6 VAL C 568  ? VAL C 571  ? VAL C 568  VAL C 571  
AC2 1 VAL C 642  ? VAL C 643  ? VAL C 642  VAL C 643  
AC2 2 VAL C 701  ? ASP C 704  ? VAL C 701  ASP C 704  
AC2 3 CYS C 687  ? PRO C 688  ? CYS C 687  PRO C 688  
AC3 1 ARG C 667  ? ARG C 671  ? ARG C 667  ARG C 671  
AC3 2 TYR C 657  ? HIS C 662  ? TYR C 657  HIS C 662  
AC3 3 GLY C 648  ? VAL C 653  ? GLY C 648  VAL C 653  
AC3 4 ARG C 695  ? VAL C 696  ? ARG C 695  VAL C 696  
AC4 1 ALA C 676  ? ARG C 677  ? ALA C 676  ARG C 677  
AC4 2 CYS C 683  ? ALA C 684  ? CYS C 683  ALA C 684  
AC5 1 THR C 708  ? ASP C 709  ? THR C 708  ASP C 709  
AC5 2 GLU C 712  ? MET C 713  ? GLU C 712  MET C 713  
AC6 1 LEU C 885  ? GLY C 887  ? LEU C 885  GLY C 887  
AC6 2 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC6 3 GLY C 716  ? ILE C 723  ? GLY C 716  ILE C 723  
AC6 4 ILE C 915  ? LEU C 917  ? ILE C 915  LEU C 917  
AC6 5 ILE C 735  ? SER C 738  ? ILE C 735  SER C 738  
AC6 6 ILE C 895  ? LEU C 899  ? ILE C 895  LEU C 899  
AC7 1 LEU C 885  ? GLY C 887  ? LEU C 885  GLY C 887  
AC7 2 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC7 3 LYS C 1007 ? ALA C 1008 ? LYS C 1007 ALA C 1008 
AC8 1 SER C 749  ? ARG C 760  ? SER C 749  ARG C 760  
AC8 2 VAL C 865  ? ARG C 877  ? VAL C 865  ARG C 877  
AC8 3 GLY C 845  ? SER C 854  ? GLY C 845  SER C 854  
AC8 4 GLU C 795  ? VAL C 796  ? GLU C 795  VAL C 796  
AC9 1 GLU C 768  ? ILE C 769  ? GLU C 768  ILE C 769  
AC9 2 LYS C 805  ? PRO C 808  ? LYS C 805  PRO C 808  
AC9 3 VAL C 832  ? ASP C 834  ? VAL C 832  ASP C 834  
AD1 1 ILE C 801  ? VAL C 803  ? ILE C 801  VAL C 803  
AD1 2 LEU C 837  ? LYS C 838  ? LEU C 837  LYS C 838  
AD2 1 TRP C 944  ? LYS C 945  ? TRP C 944  LYS C 945  
AD2 2 GLU C 965  ? ALA C 966  ? GLU C 965  ALA C 966  
AD3 1 HIS C 1042 ? ARG C 1044 ? HIS C 1042 ARG C 1044 
AD3 2 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD3 3 GLN D 540  ? HIS D 544  ? GLN D 540  HIS D 544  
AD3 4 VAL D 496  ? ASN D 499  ? VAL D 496  ASN D 499  
AD3 5 ILE D 509  ? VAL D 517  ? ILE D 509  VAL D 517  
AD3 6 GLN D 440  ? PRO D 444  ? GLN D 440  PRO D 444  
AD3 7 ILE D 522  ? LEU D 524  ? ILE D 522  LEU D 524  
AD3 8 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD4 1 ARG C 1067 ? PHE C 1068 ? ARG C 1067 PHE C 1068 
AD4 2 LYS D 420  ? ARG D 421  ? LYS D 420  ARG D 421  
AD5 1 GLU C 1136 ? LEU C 1138 ? GLU C 1136 LEU C 1138 
AD5 2 GLU D 9    ? ARG D 11   ? GLU D 9    ARG D 11   
AD5 3 SER D 1242 ? LYS D 1244 ? SER D 1242 LYS D 1244 
AD6 1 GLY D 93   ? THR D 102  ? GLY D 93   THR D 102  
AD6 2 VAL D 313  ? VAL D 319  ? VAL D 313  VAL D 319  
AD7 1 LEU D 234  ? ILE D 235  ? LEU D 234  ILE D 235  
AD7 2 TYR D 134  ? VAL D 139  ? TYR D 134  VAL D 139  
AD7 3 PHE D 252  ? ALA D 255  ? PHE D 252  ALA D 255  
AD8 1 MET D 327  ? GLN D 329  ? MET D 327  GLN D 329  
AD8 2 PHE D 335  ? THR D 337  ? PHE D 335  THR D 337  
AD8 3 ILE F 421  ? SER F 422  ? ILE F 421  SER F 422  
AD9 1 VAL D 611  ? TYR D 612  ? VAL D 611  TYR D 612  
AD9 2 LYS D 632  ? LEU D 637  ? LYS D 632  LEU D 637  
AD9 3 TRP D 662  ? THR D 667  ? TRP D 662  THR D 667  
AE1 1 VAL D 886  ? GLU D 888  ? VAL D 886  GLU D 888  
AE1 2 VAL D 974  ? CYS D 975  ? VAL D 974  CYS D 975  
AE2 1 ILE D 897  ? VAL D 899  ? ILE D 897  VAL D 899  
AE2 2 VAL D 960  ? VAL D 962  ? VAL D 960  VAL D 962  
AE3 1 ALA D 902  ? ARG D 904  ? ALA D 902  ARG D 904  
AE3 2 LEU D 910  ? ARG D 912  ? LEU D 910  ARG D 912  
AE4 1 ALA D 929  ? VAL D 930  ? ALA D 929  VAL D 930  
AE4 2 VAL D 936  ? VAL D 938  ? VAL D 936  VAL D 938  
AE5 1 VAL D 1075 ? LYS D 1079 ? VAL D 1075 LYS D 1079 
AE5 2 TYR D 1062 ? PRO D 1068 ? TYR D 1062 PRO D 1068 
AE5 3 GLY D 1051 ? LEU D 1055 ? GLY D 1051 LEU D 1055 
AE5 4 HIS D 1104 ? VAL D 1105 ? HIS D 1104 VAL D 1105 
AE6 1 ILE D 1181 ? ASP D 1182 ? ILE D 1181 ASP D 1182 
AE6 2 ARG D 1164 ? ILE D 1167 ? ARG D 1164 ILE D 1167 
AE6 3 GLY D 1203 ? PRO D 1205 ? GLY D 1203 PRO D 1205 
AE7 1 ALA D 1271 ? PRO D 1274 ? ALA D 1271 PRO D 1274 
AE7 2 LEU E 104  ? THR E 107  ? LEU E 104  THR E 107  
AE8 1 THR F 426  ? ILE F 427  ? THR F 426  ILE F 427  
AE8 2 GLU F 430  ? GLN F 434  ? GLU F 430  GLN F 434  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 23   ? N ILE A 23   O LEU A 192  ? O LEU A 192  
AA1 2 3 O ASP A 195  ? O ASP A 195  N THR A 175  ? N THR A 175  
AA2 1 2 N MET A 95   ? N MET A 95   O LEU A 138  ? O LEU A 138  
AA2 2 3 O VAL A 139  ? O VAL A 139  N THR A 52   ? N THR A 52   
AA2 3 4 N ILE A 54   ? N ILE A 54   O ILE A 162  ? O ILE A 162  
AA3 1 2 N SER A 86   ? N SER A 86   O THR A 117  ? O THR A 117  
AA4 1 2 N VAL A 105  ? N VAL A 105  O ILE A 125  ? O ILE A 125  
AA5 1 2 N VAL A 147  ? N VAL A 147  O SER A 166  ? O SER A 166  
AA6 1 2 N VAL B 13   ? N VAL B 13   O GLN B 20   ? O GLN B 20   
AA6 2 3 N LEU B 26   ? N LEU B 26   O ASP B 190  ? O ASP B 190  
AA6 3 4 O ASP B 195  ? O ASP B 195  N THR B 175  ? N THR B 175  
AA7 1 2 N VAL B 93   ? N VAL B 93   O VAL B 140  ? O VAL B 140  
AA7 2 3 O VAL B 139  ? O VAL B 139  N THR B 52   ? N THR B 52   
AA7 3 4 N ILE B 54   ? N ILE B 54   O ILE B 162  ? O ILE B 162  
AA8 1 2 N SER B 86   ? N SER B 86   O THR B 117  ? O THR B 117  
AA9 1 2 N VAL B 105  ? N VAL B 105  O ALA B 126  ? O ALA B 126  
AB1 1 2 N VAL B 147  ? N VAL B 147  O SER B 166  ? O SER B 166  
AB2 1 2 N VAL C 39   ? N VAL C 39   O SER C 973  ? O SER C 973  
AB2 2 3 O VAL C 972  ? O VAL C 972  N GLY C 627  ? N GLY C 627  
AB3 1 2 N ILE C 96   ? N ILE C 96   O LEU C 105  ? O LEU C 105  
AB3 2 3 N SER C 104  ? N SER C 104  O ILE C 140  ? O ILE C 140  
AB3 3 4 N ALA C 131  ? N ALA C 131  O PHE C 157  ? O PHE C 157  
AB4 1 2 N PHE C 166  ? N PHE C 166  O ARG C 173  ? O ARG C 173  
AB4 2 3 N VAL C 174  ? N VAL C 174  O GLN C 438  ? O GLN C 438  
AB5 1 2 O ARG C 377  ? O ARG C 377  N VAL C 180  ? N VAL C 180  
AB5 2 3 N LEU C 179  ? N LEU C 179  O SER C 456  ? O SER C 456  
AB5 3 4 N LEU C 455  ? N LEU C 455  O GLY C 498  ? O GLY C 498  
AB6 1 2 N ASP C 188  ? N ASP C 188  O SER C 201  ? O SER C 201  
AB7 1 2 N ASP C 215  ? N ASP C 215  O GLY C 223  ? O GLY C 223  
AB7 2 3 N VAL C 224  ? N VAL C 224  O GLN C 232  ? O GLN C 232  
AB8 1 2 N MET C 355  ? N MET C 355  O VAL C 363  ? O VAL C 363  
AB9 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AB9 2 3 N LYS C 518  ? N LYS C 518  O SER C 525  ? O SER C 525  
AC1 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AC1 2 3 N ARG C 517  ? N ARG C 517  O MET C 579  ? O MET C 579  
AC1 3 4 O TYR C 578  ? O TYR C 578  N ALA C 542  ? N ALA C 542  
AC1 4 5 N VAL C 541  ? N VAL C 541  O ARG C 562  ? O ARG C 562  
AC1 5 6 N VAL C 561  ? N VAL C 561  O GLU C 569  ? O GLU C 569  
AC2 1 2 N VAL C 642  ? N VAL C 642  O ALA C 703  ? O ALA C 703  
AC2 2 3 O ASP C 704  ? O ASP C 704  N CYS C 687  ? N CYS C 687  
AC3 1 2 O ARG C 668  ? O ARG C 668  N VAL C 660  ? N VAL C 660  
AC3 2 3 O THR C 659  ? O THR C 659  N GLU C 652  ? N GLU C 652  
AC3 3 4 N GLY C 648  ? N GLY C 648  O VAL C 696  ? O VAL C 696  
AC4 1 2 N ALA C 676  ? N ALA C 676  O ALA C 684  ? O ALA C 684  
AC5 1 2 N ASP C 709  ? N ASP C 709  O GLU C 712  ? O GLU C 712  
AC6 1 2 N ALA C 886  ? N ALA C 886  O MET C 1031 ? O MET C 1031 
AC6 2 3 O ILE C 1030 ? O ILE C 1030 N LYS C 717  ? N LYS C 717  
AC6 3 4 O LEU C 720  ? O LEU C 720  N ILE C 915  ? N ILE C 915  
AC6 4 5 O ILE C 916  ? O ILE C 916  N ILE C 736  ? N ILE C 736  
AC6 5 6 N LEU C 737  ? N LEU C 737  O LYS C 897  ? O LYS C 897  
AC7 1 2 N ALA C 886  ? N ALA C 886  O MET C 1031 ? O MET C 1031 
AC7 2 3 O VAL C 1023 ? O VAL C 1023 N ALA C 1008 ? N ALA C 1008 
AC8 1 2 N HIS C 751  ? N HIS C 751  O GLN C 875  ? O GLN C 875  
AC8 2 3 O ALA C 874  ? O ALA C 874  N LYS C 846  ? N LYS C 846  
AC8 3 4 O GLY C 845  ? O GLY C 845  N VAL C 796  ? N VAL C 796  
AC9 1 2 N GLU C 768  ? N GLU C 768  O VAL C 806  ? O VAL C 806  
AC9 2 3 N THR C 807  ? N THR C 807  O ARG C 833  ? O ARG C 833  
AD1 1 2 N LEU C 802  ? N LEU C 802  O LEU C 837  ? O LEU C 837  
AD2 1 2 N TRP C 944  ? N TRP C 944  O ALA C 966  ? O ALA C 966  
AD3 1 2 N HIS C 1042 ? N HIS C 1042 O ARG D 427  ? O ARG D 427  
AD3 2 3 N GLY D 426  ? N GLY D 426  O VAL D 543  ? O VAL D 543  
AD3 3 4 O ALA D 542  ? O ALA D 542  N ASN D 499  ? N ASN D 499  
AD3 4 5 N LEU D 498  ? N LEU D 498  O GLN D 510  ? O GLN D 510  
AD3 5 6 O MET D 515  ? O MET D 515  N CYS D 441  ? N CYS D 441  
AD3 6 7 N GLY D 442  ? N GLY D 442  O GLN D 523  ? O GLN D 523  
AD3 7 8 O ILE D 522  ? O ILE D 522  N VAL D 429  ? N VAL D 429  
AD4 1 2 N PHE C 1068 ? N PHE C 1068 O LYS D 420  ? O LYS D 420  
AD5 1 2 N GLU C 1136 ? N GLU C 1136 O ARG D 11   ? O ARG D 11   
AD5 2 3 N LEU D 10   ? N LEU D 10   O ASP D 1243 ? O ASP D 1243 
AD6 1 2 N VAL D 101  ? N VAL D 101  O LEU D 314  ? O LEU D 314  
AD7 1 2 O ILE D 235  ? O ILE D 235  N TYR D 134  ? N TYR D 134  
AD7 2 3 N SER D 138  ? N SER D 138  O THR D 253  ? O THR D 253  
AD8 1 2 N VAL D 328  ? N VAL D 328  O ALA D 336  ? O ALA D 336  
AD8 2 3 N PHE D 335  ? N PHE D 335  O ILE F 421  ? O ILE F 421  
AD9 1 2 N TYR D 612  ? N TYR D 612  O LYS D 634  ? O LYS D 634  
AD9 2 3 N ILE D 633  ? N ILE D 633  O THR D 666  ? O THR D 666  
AE1 1 2 N ARG D 887  ? N ARG D 887  O VAL D 974  ? O VAL D 974  
AE2 1 2 N ILE D 897  ? N ILE D 897  O VAL D 962  ? O VAL D 962  
AE3 1 2 N GLU D 903  ? N GLU D 903  O ILE D 911  ? O ILE D 911  
AE4 1 2 N ALA D 929  ? N ALA D 929  O ILE D 937  ? O ILE D 937  
AE5 1 2 O TYR D 1077 ? O TYR D 1077 N ILE D 1064 ? N ILE D 1064 
AE5 2 3 O THR D 1065 ? O THR D 1065 N ARG D 1054 ? N ARG D 1054 
AE5 3 4 N GLY D 1051 ? N GLY D 1051 O VAL D 1105 ? O VAL D 1105 
AE6 1 2 O ILE D 1181 ? O ILE D 1181 N VAL D 1165 ? N VAL D 1165 
AE6 2 3 N THR D 1166 ? N THR D 1166 O ARG D 1204 ? O ARG D 1204 
AE7 1 2 N GLN D 1273 ? N GLN D 1273 O GLU E 105  ? O GLU E 105  
AE8 1 2 N ILE F 427  ? N ILE F 427  O SER F 433  ? O SER F 433  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D ZN  1401 ? 4  'binding site for residue ZN D 1401'  
AC2 Software D ZN  1402 ? 4  'binding site for residue ZN D 1402'  
AC3 Software D MG  1403 ? 3  'binding site for residue MG D 1403'  
AC4 Software D 88D 1404 ? 11 'binding site for residue 88D D 1404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS D 891 ? CYS D 891 . ? 1_555 ? 
2  AC1 4  CYS D 968 ? CYS D 968 . ? 1_555 ? 
3  AC1 4  CYS D 975 ? CYS D 975 . ? 1_555 ? 
4  AC1 4  CYS D 978 ? CYS D 978 . ? 1_555 ? 
5  AC2 4  CYS D 60  ? CYS D 60  . ? 1_555 ? 
6  AC2 4  CYS D 62  ? CYS D 62  . ? 1_555 ? 
7  AC2 4  CYS D 75  ? CYS D 75  . ? 1_555 ? 
8  AC2 4  CYS D 78  ? CYS D 78  . ? 1_555 ? 
9  AC3 3  ASP D 535 ? ASP D 535 . ? 1_555 ? 
10 AC3 3  ASP D 537 ? ASP D 537 . ? 1_555 ? 
11 AC3 3  ASP D 539 ? ASP D 539 . ? 1_555 ? 
12 AC4 11 PRO C 477 ? PRO C 477 . ? 1_555 ? 
13 AC4 11 ARG C 562 ? ARG C 562 . ? 1_555 ? 
14 AC4 11 ARG C 563 ? ARG C 563 . ? 1_555 ? 
15 AC4 11 GLY C 566 ? GLY C 566 . ? 1_555 ? 
16 AC4 11 VAL C 568 ? VAL C 568 . ? 1_555 ? 
17 AC4 11 ARG D 834 ? ARG D 834 . ? 1_555 ? 
18 AC4 11 PRO D 835 ? PRO D 835 . ? 1_555 ? 
19 AC4 11 LEU D 847 ? LEU D 847 . ? 1_555 ? 
20 AC4 11 GLU D 848 ? GLU D 848 . ? 1_555 ? 
21 AC4 11 PHE D 850 ? PHE D 850 . ? 1_555 ? 
22 AC4 11 ILE D 851 ? ILE D 851 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5UHF 
_atom_sites.fract_transf_matrix[1][1]   0.006563 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006118 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005066 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
SE 
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ILE A 1  3    ? 18.282  -0.284  54.870   1.00 182.42 ? 3    ILE A N     1 
ATOM   2     C  CA    . ILE A 1  3    ? 17.851  -0.002  56.234   1.00 175.28 ? 3    ILE A CA    1 
ATOM   3     C  C     . ILE A 1  3    ? 18.345  1.374   56.676   1.00 178.17 ? 3    ILE A C     1 
ATOM   4     O  O     . ILE A 1  3    ? 18.961  1.517   57.733   1.00 171.17 ? 3    ILE A O     1 
ATOM   5     C  CB    . ILE A 1  3    ? 18.359  -1.072  57.219   1.00 164.49 ? 3    ILE A CB    1 
ATOM   6     C  CG1   . ILE A 1  3    ? 18.514  -2.419  56.509   1.00 162.83 ? 3    ILE A CG1   1 
ATOM   7     C  CG2   . ILE A 1  3    ? 17.420  -1.191  58.413   1.00 161.86 ? 3    ILE A CG2   1 
ATOM   8     C  CD1   . ILE A 1  3    ? 19.108  -3.504  57.381   1.00 167.93 ? 3    ILE A CD1   1 
ATOM   9     N  N     . SER A 1  4    ? 18.074  2.383   55.853   1.00 181.58 ? 4    SER A N     1 
ATOM   10    C  CA    . SER A 1  4    ? 18.498  3.749   56.141   1.00 179.81 ? 4    SER A CA    1 
ATOM   11    C  C     . SER A 1  4    ? 17.545  4.767   55.517   1.00 169.34 ? 4    SER A C     1 
ATOM   12    O  O     . SER A 1  4    ? 16.836  4.460   54.558   1.00 163.27 ? 4    SER A O     1 
ATOM   13    C  CB    . SER A 1  4    ? 19.925  3.984   55.637   1.00 183.22 ? 4    SER A CB    1 
ATOM   14    O  OG    . SER A 1  4    ? 20.013  3.785   54.236   1.00 177.89 ? 4    SER A OG    1 
ATOM   15    N  N     . GLN A 1  5    ? 17.533  5.978   56.066   1.00 159.86 ? 5    GLN A N     1 
ATOM   16    C  CA    . GLN A 1  5    ? 16.638  7.029   55.592   1.00 151.78 ? 5    GLN A CA    1 
ATOM   17    C  C     . GLN A 1  5    ? 17.320  8.397   55.568   1.00 153.89 ? 5    GLN A C     1 
ATOM   18    O  O     . GLN A 1  5    ? 17.813  8.869   56.592   1.00 160.76 ? 5    GLN A O     1 
ATOM   19    C  CB    . GLN A 1  5    ? 15.378  7.094   56.465   1.00 145.06 ? 5    GLN A CB    1 
ATOM   20    C  CG    . GLN A 1  5    ? 14.402  5.938   56.253   1.00 134.58 ? 5    GLN A CG    1 
ATOM   21    C  CD    . GLN A 1  5    ? 13.184  6.011   57.161   1.00 125.58 ? 5    GLN A CD    1 
ATOM   22    O  OE1   . GLN A 1  5    ? 12.131  5.452   56.852   1.00 120.75 ? 5    GLN A OE1   1 
ATOM   23    N  NE2   . GLN A 1  5    ? 13.324  6.699   58.287   1.00 122.81 ? 5    GLN A NE2   1 
ATOM   24    N  N     . ARG A 1  6    ? 17.342  9.023   54.392   1.00 155.69 ? 6    ARG A N     1 
ATOM   25    C  CA    . ARG A 1  6    ? 17.841  10.391  54.231   1.00 151.85 ? 6    ARG A CA    1 
ATOM   26    C  C     . ARG A 1  6    ? 17.095  11.127  53.115   1.00 145.46 ? 6    ARG A C     1 
ATOM   27    O  O     . ARG A 1  6    ? 17.014  10.632  51.988   1.00 143.89 ? 6    ARG A O     1 
ATOM   28    C  CB    . ARG A 1  6    ? 19.346  10.397  53.932   1.00 146.78 ? 6    ARG A CB    1 
ATOM   29    C  CG    . ARG A 1  6    ? 20.249  10.200  55.143   1.00 148.18 ? 6    ARG A CG    1 
ATOM   30    C  CD    . ARG A 1  6    ? 21.708  10.090  54.731   1.00 153.11 ? 6    ARG A CD    1 
ATOM   31    N  NE    . ARG A 1  6    ? 21.894  9.151   53.628   1.00 163.61 ? 6    ARG A NE    1 
ATOM   32    C  CZ    . ARG A 1  6    ? 22.061  7.841   53.778   1.00 167.60 ? 6    ARG A CZ    1 
ATOM   33    N  NH1   . ARG A 1  6    ? 22.062  7.304   54.992   1.00 175.11 ? 6    ARG A NH1   1 
ATOM   34    N  NH2   . ARG A 1  6    ? 22.225  7.065   52.714   1.00 158.66 ? 6    ARG A NH2   1 
ATOM   35    N  N     . PRO A 1  7    ? 16.540  12.311  53.428   1.00 134.93 ? 7    PRO A N     1 
ATOM   36    C  CA    . PRO A 1  7    ? 15.910  13.169  52.418   1.00 122.55 ? 7    PRO A CA    1 
ATOM   37    C  C     . PRO A 1  7    ? 16.881  13.500  51.288   1.00 119.14 ? 7    PRO A C     1 
ATOM   38    O  O     . PRO A 1  7    ? 18.009  13.912  51.551   1.00 124.78 ? 7    PRO A O     1 
ATOM   39    C  CB    . PRO A 1  7    ? 15.532  14.423  53.210   1.00 119.87 ? 7    PRO A CB    1 
ATOM   40    C  CG    . PRO A 1  7    ? 15.367  13.941  54.610   1.00 121.86 ? 7    PRO A CG    1 
ATOM   41    C  CD    . PRO A 1  7    ? 16.392  12.859  54.788   1.00 133.48 ? 7    PRO A CD    1 
ATOM   42    N  N     . THR A 1  8    ? 16.443  13.311  50.048   1.00 112.61 ? 8    THR A N     1 
ATOM   43    C  CA    . THR A 1  8    ? 17.313  13.471  48.888   1.00 110.88 ? 8    THR A CA    1 
ATOM   44    C  C     . THR A 1  8    ? 17.692  14.927  48.633   1.00 109.45 ? 8    THR A C     1 
ATOM   45    O  O     . THR A 1  8    ? 16.984  15.846  49.046   1.00 107.62 ? 8    THR A O     1 
ATOM   46    C  CB    . THR A 1  8    ? 16.652  12.913  47.622   1.00 107.68 ? 8    THR A CB    1 
ATOM   47    O  OG1   . THR A 1  8    ? 15.633  13.818  47.181   1.00 125.29 ? 8    THR A OG1   1 
ATOM   48    C  CG2   . THR A 1  8    ? 16.031  11.557  47.904   1.00 96.54  ? 8    THR A CG2   1 
ATOM   49    N  N     . LEU A 1  9    ? 18.808  15.126  47.938   1.00 108.24 ? 9    LEU A N     1 
ATOM   50    C  CA    . LEU A 1  9    ? 19.292  16.466  47.630   1.00 107.40 ? 9    LEU A CA    1 
ATOM   51    C  C     . LEU A 1  9    ? 19.238  16.764  46.136   1.00 105.24 ? 9    LEU A C     1 
ATOM   52    O  O     . LEU A 1  9    ? 18.723  15.969  45.349   1.00 102.74 ? 9    LEU A O     1 
ATOM   53    C  CB    . LEU A 1  9    ? 20.722  16.646  48.136   1.00 110.70 ? 9    LEU A CB    1 
ATOM   54    C  CG    . LEU A 1  9    ? 20.961  16.396  49.626   1.00 119.10 ? 9    LEU A CG    1 
ATOM   55    C  CD1   . LEU A 1  9    ? 22.384  16.779  49.998   1.00 139.13 ? 9    LEU A CD1   1 
ATOM   56    C  CD2   . LEU A 1  9    ? 19.955  17.156  50.475   1.00 119.54 ? 9    LEU A CD2   1 
ATOM   57    N  N     . SER A 1  10   ? 19.781  17.918  45.760   1.00 109.51 ? 10   SER A N     1 
ATOM   58    C  CA    . SER A 1  10   ? 19.833  18.340  44.365   1.00 107.25 ? 10   SER A CA    1 
ATOM   59    C  C     . SER A 1  10   ? 20.988  19.313  44.131   1.00 103.03 ? 10   SER A C     1 
ATOM   60    O  O     . SER A 1  10   ? 20.812  20.528  44.224   1.00 93.47  ? 10   SER A O     1 
ATOM   61    C  CB    . SER A 1  10   ? 18.509  18.982  43.950   1.00 108.03 ? 10   SER A CB    1 
ATOM   62    O  OG    . SER A 1  10   ? 18.536  19.368  42.588   1.00 111.40 ? 10   SER A OG    1 
ATOM   63    N  N     . GLU A 1  11   ? 22.166  18.771  43.832   1.00 103.14 ? 11   GLU A N     1 
ATOM   64    C  CA    . GLU A 1  11   ? 23.355  19.585  43.579   1.00 105.74 ? 11   GLU A CA    1 
ATOM   65    C  C     . GLU A 1  11   ? 23.452  19.991  42.107   1.00 100.68 ? 11   GLU A C     1 
ATOM   66    O  O     . GLU A 1  11   ? 22.526  19.751  41.331   1.00 102.84 ? 11   GLU A O     1 
ATOM   67    C  CB    . GLU A 1  11   ? 24.626  18.834  44.001   1.00 118.00 ? 11   GLU A CB    1 
ATOM   68    C  CG    . GLU A 1  11   ? 24.699  18.496  45.492   1.00 129.92 ? 11   GLU A CG    1 
ATOM   69    C  CD    . GLU A 1  11   ? 26.053  17.937  45.915   1.00 140.80 ? 11   GLU A CD    1 
ATOM   70    O  OE1   . GLU A 1  11   ? 27.056  18.189  45.211   1.00 141.69 ? 11   GLU A OE1   1 
ATOM   71    O  OE2   . GLU A 1  11   ? 26.111  17.240  46.952   1.00 140.65 ? 11   GLU A OE2   1 
ATOM   72    N  N     . ASP A 1  12   ? 24.577  20.598  41.731   1.00 103.21 ? 12   ASP A N     1 
ATOM   73    C  CA    . ASP A 1  12   ? 24.782  21.087  40.366   1.00 98.76  ? 12   ASP A CA    1 
ATOM   74    C  C     . ASP A 1  12   ? 26.269  21.284  40.042   1.00 95.93  ? 12   ASP A C     1 
ATOM   75    O  O     . ASP A 1  12   ? 27.036  21.791  40.860   1.00 96.09  ? 12   ASP A O     1 
ATOM   76    C  CB    . ASP A 1  12   ? 24.017  22.404  40.158   1.00 92.14  ? 12   ASP A CB    1 
ATOM   77    C  CG    . ASP A 1  12   ? 23.821  22.761  38.683   1.00 89.72  ? 12   ASP A CG    1 
ATOM   78    O  OD1   . ASP A 1  12   ? 24.700  22.442  37.852   1.00 90.65  ? 12   ASP A OD1   1 
ATOM   79    O  OD2   . ASP A 1  12   ? 22.778  23.375  38.359   1.00 86.95  ? 12   ASP A OD2   1 
ATOM   80    N  N     . VAL A 1  13   ? 26.663  20.864  38.843   1.00 91.66  ? 13   VAL A N     1 
ATOM   81    C  CA    . VAL A 1  13   ? 27.994  21.137  38.309   1.00 91.29  ? 13   VAL A CA    1 
ATOM   82    C  C     . VAL A 1  13   ? 27.797  21.822  36.954   1.00 89.60  ? 13   VAL A C     1 
ATOM   83    O  O     . VAL A 1  13   ? 27.207  21.240  36.045   1.00 89.18  ? 13   VAL A O     1 
ATOM   84    C  CB    . VAL A 1  13   ? 28.839  19.847  38.165   1.00 98.12  ? 13   VAL A CB    1 
ATOM   85    C  CG1   . VAL A 1  13   ? 30.301  20.190  37.918   1.00 102.99 ? 13   VAL A CG1   1 
ATOM   86    C  CG2   . VAL A 1  13   ? 28.705  18.974  39.408   1.00 87.22  ? 13   VAL A CG2   1 
ATOM   87    N  N     . LEU A 1  14   ? 28.281  23.056  36.822   1.00 84.91  ? 14   LEU A N     1 
ATOM   88    C  CA    . LEU A 1  14   ? 27.844  23.936  35.733   1.00 77.71  ? 14   LEU A CA    1 
ATOM   89    C  C     . LEU A 1  14   ? 28.760  24.053  34.507   1.00 79.96  ? 14   LEU A C     1 
ATOM   90    O  O     . LEU A 1  14   ? 29.944  23.722  34.547   1.00 83.93  ? 14   LEU A O     1 
ATOM   91    C  CB    . LEU A 1  14   ? 27.610  25.346  36.287   1.00 76.39  ? 14   LEU A CB    1 
ATOM   92    C  CG    . LEU A 1  14   ? 26.303  25.590  37.045   1.00 84.20  ? 14   LEU A CG    1 
ATOM   93    C  CD1   . LEU A 1  14   ? 26.341  26.931  37.761   1.00 91.89  ? 14   LEU A CD1   1 
ATOM   94    C  CD2   . LEU A 1  14   ? 25.115  25.525  36.099   1.00 77.69  ? 14   LEU A CD2   1 
ATOM   95    N  N     . THR A 1  15   ? 28.154  24.515  33.414   1.00 83.59  ? 15   THR A N     1 
ATOM   96    C  CA    . THR A 1  15   ? 28.831  25.009  32.214   1.00 87.52  ? 15   THR A CA    1 
ATOM   97    C  C     . THR A 1  15   ? 27.776  25.851  31.486   1.00 80.92  ? 15   THR A C     1 
ATOM   98    O  O     . THR A 1  15   ? 26.583  25.563  31.588   1.00 78.68  ? 15   THR A O     1 
ATOM   99    C  CB    . THR A 1  15   ? 29.382  23.872  31.310   1.00 83.96  ? 15   THR A CB    1 
ATOM   100   O  OG1   . THR A 1  15   ? 30.289  23.054  32.060   1.00 77.20  ? 15   THR A OG1   1 
ATOM   101   C  CG2   . THR A 1  15   ? 30.114  24.437  30.096   1.00 77.80  ? 15   THR A CG2   1 
ATOM   102   N  N     . ASP A 1  16   ? 28.210  26.894  30.781   1.00 76.67  ? 16   ASP A N     1 
ATOM   103   C  CA    . ASP A 1  16   ? 27.305  27.926  30.264   1.00 74.95  ? 16   ASP A CA    1 
ATOM   104   C  C     . ASP A 1  16   ? 26.065  27.386  29.558   1.00 67.90  ? 16   ASP A C     1 
ATOM   105   O  O     . ASP A 1  16   ? 24.944  27.796  29.860   1.00 61.77  ? 16   ASP A O     1 
ATOM   106   C  CB    . ASP A 1  16   ? 28.064  28.856  29.312   1.00 79.73  ? 16   ASP A CB    1 
ATOM   107   C  CG    . ASP A 1  16   ? 27.377  30.201  29.138   1.00 77.87  ? 16   ASP A CG    1 
ATOM   108   O  OD1   . ASP A 1  16   ? 26.158  30.228  28.854   1.00 74.66  ? 16   ASP A OD1   1 
ATOM   109   O  OD2   . ASP A 1  16   ? 28.061  31.234  29.300   1.00 85.32  ? 16   ASP A OD2   1 
ATOM   110   N  N     . ASN A 1  17   ? 26.267  26.461  28.630   1.00 72.53  ? 17   ASN A N     1 
ATOM   111   C  CA    . ASN A 1  17   ? 25.163  25.958  27.830   1.00 75.25  ? 17   ASN A CA    1 
ATOM   112   C  C     . ASN A 1  17   ? 24.628  24.632  28.351   1.00 72.93  ? 17   ASN A C     1 
ATOM   113   O  O     . ASN A 1  17   ? 23.515  24.234  28.014   1.00 73.90  ? 17   ASN A O     1 
ATOM   114   C  CB    . ASN A 1  17   ? 25.591  25.811  26.368   1.00 83.35  ? 17   ASN A CB    1 
ATOM   115   C  CG    . ASN A 1  17   ? 24.413  25.605  25.435   1.00 85.08  ? 17   ASN A CG    1 
ATOM   116   O  OD1   . ASN A 1  17   ? 23.284  25.983  25.750   1.00 84.02  ? 17   ASN A OD1   1 
ATOM   117   N  ND2   . ASN A 1  17   ? 24.671  25.002  24.281   1.00 85.74  ? 17   ASN A ND2   1 
ATOM   118   N  N     . ARG A 1  18   ? 25.413  23.959  29.186   1.00 75.49  ? 18   ARG A N     1 
ATOM   119   C  CA    . ARG A 1  18   ? 25.019  22.649  29.694   1.00 83.05  ? 18   ARG A CA    1 
ATOM   120   C  C     . ARG A 1  18   ? 25.425  22.436  31.153   1.00 88.84  ? 18   ARG A C     1 
ATOM   121   O  O     . ARG A 1  18   ? 26.528  22.789  31.554   1.00 95.30  ? 18   ARG A O     1 
ATOM   122   C  CB    . ARG A 1  18   ? 25.619  21.547  28.819   1.00 81.44  ? 18   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1  18   ? 27.123  21.651  28.632   1.00 73.42  ? 18   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1  18   ? 27.639  20.534  27.747   1.00 73.83  ? 18   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1  18   ? 27.152  19.232  28.189   1.00 82.06  ? 18   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1  18   ? 27.518  18.075  27.644   1.00 82.42  ? 18   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1  18   ? 28.382  18.057  26.639   1.00 82.23  ? 18   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1  18   ? 27.025  16.933  28.106   1.00 80.60  ? 18   ARG A NH2   1 
ATOM   129   N  N     . SER A 1  19   ? 24.535  21.846  31.944   1.00 84.78  ? 19   SER A N     1 
ATOM   130   C  CA    . SER A 1  19   ? 24.811  21.637  33.364   1.00 80.46  ? 19   SER A CA    1 
ATOM   131   C  C     . SER A 1  19   ? 24.446  20.236  33.843   1.00 77.64  ? 19   SER A C     1 
ATOM   132   O  O     . SER A 1  19   ? 23.399  19.697  33.484   1.00 77.59  ? 19   SER A O     1 
ATOM   133   C  CB    . SER A 1  19   ? 24.063  22.671  34.205   1.00 79.06  ? 19   SER A CB    1 
ATOM   134   O  OG    . SER A 1  19   ? 22.664  22.501  34.085   1.00 75.99  ? 19   SER A OG    1 
ATOM   135   N  N     . GLN A 1  20   ? 25.316  19.658  34.665   1.00 78.97  ? 20   GLN A N     1 
ATOM   136   C  CA    . GLN A 1  20   ? 25.053  18.355  35.262   1.00 81.50  ? 20   GLN A CA    1 
ATOM   137   C  C     . GLN A 1  20   ? 24.333  18.486  36.596   1.00 90.52  ? 20   GLN A C     1 
ATOM   138   O  O     . GLN A 1  20   ? 24.826  19.142  37.518   1.00 101.65 ? 20   GLN A O     1 
ATOM   139   C  CB    . GLN A 1  20   ? 26.348  17.573  35.461   1.00 77.06  ? 20   GLN A CB    1 
ATOM   140   C  CG    . GLN A 1  20   ? 26.960  17.044  34.189   1.00 78.18  ? 20   GLN A CG    1 
ATOM   141   C  CD    . GLN A 1  20   ? 28.069  16.052  34.467   1.00 76.29  ? 20   GLN A CD    1 
ATOM   142   O  OE1   . GLN A 1  20   ? 28.319  15.691  35.619   1.00 76.28  ? 20   GLN A OE1   1 
ATOM   143   N  NE2   . GLN A 1  20   ? 28.741  15.604  33.413   1.00 76.59  ? 20   GLN A NE2   1 
ATOM   144   N  N     . PHE A 1  21   ? 23.168  17.853  36.690   1.00 89.07  ? 21   PHE A N     1 
ATOM   145   C  CA    . PHE A 1  21   ? 22.392  17.830  37.925   1.00 88.33  ? 21   PHE A CA    1 
ATOM   146   C  C     . PHE A 1  21   ? 22.594  16.529  38.685   1.00 88.68  ? 21   PHE A C     1 
ATOM   147   O  O     . PHE A 1  21   ? 22.011  15.504  38.336   1.00 87.75  ? 21   PHE A O     1 
ATOM   148   C  CB    . PHE A 1  21   ? 20.905  18.022  37.634   1.00 78.99  ? 21   PHE A CB    1 
ATOM   149   C  CG    . PHE A 1  21   ? 20.556  19.391  37.147   1.00 81.84  ? 21   PHE A CG    1 
ATOM   150   C  CD1   . PHE A 1  21   ? 20.189  20.382  38.040   1.00 82.47  ? 21   PHE A CD1   1 
ATOM   151   C  CD2   . PHE A 1  21   ? 20.594  19.690  35.797   1.00 81.18  ? 21   PHE A CD2   1 
ATOM   152   C  CE1   . PHE A 1  21   ? 19.863  21.646  37.596   1.00 83.11  ? 21   PHE A CE1   1 
ATOM   153   C  CE2   . PHE A 1  21   ? 20.268  20.954  35.345   1.00 82.93  ? 21   PHE A CE2   1 
ATOM   154   C  CZ    . PHE A 1  21   ? 19.903  21.933  36.247   1.00 81.82  ? 21   PHE A CZ    1 
ATOM   155   N  N     . VAL A 1  22   ? 23.420  16.570  39.722   1.00 91.38  ? 22   VAL A N     1 
ATOM   156   C  CA    . VAL A 1  22   ? 23.639  15.399  40.554   1.00 92.12  ? 22   VAL A CA    1 
ATOM   157   C  C     . VAL A 1  22   ? 22.553  15.314  41.623   1.00 96.64  ? 22   VAL A C     1 
ATOM   158   O  O     . VAL A 1  22   ? 22.309  16.279  42.350   1.00 98.67  ? 22   VAL A O     1 
ATOM   159   C  CB    . VAL A 1  22   ? 25.032  15.429  41.215   1.00 101.70 ? 22   VAL A CB    1 
ATOM   160   C  CG1   . VAL A 1  22   ? 25.269  14.159  42.017   1.00 102.96 ? 22   VAL A CG1   1 
ATOM   161   C  CG2   . VAL A 1  22   ? 26.117  15.612  40.158   1.00 100.19 ? 22   VAL A CG2   1 
ATOM   162   N  N     . ILE A 1  23   ? 21.883  14.168  41.699   1.00 98.73  ? 23   ILE A N     1 
ATOM   163   C  CA    . ILE A 1  23   ? 20.847  13.961  42.706   1.00 100.15 ? 23   ILE A CA    1 
ATOM   164   C  C     . ILE A 1  23   ? 21.071  12.647  43.451   1.00 105.08 ? 23   ILE A C     1 
ATOM   165   O  O     . ILE A 1  23   ? 21.173  11.580  42.844   1.00 104.72 ? 23   ILE A O     1 
ATOM   166   C  CB    . ILE A 1  23   ? 19.435  13.982  42.086   1.00 92.93  ? 23   ILE A CB    1 
ATOM   167   C  CG1   . ILE A 1  23   ? 19.076  15.405  41.648   1.00 88.83  ? 23   ILE A CG1   1 
ATOM   168   C  CG2   . ILE A 1  23   ? 18.406  13.474  43.081   1.00 97.88  ? 23   ILE A CG2   1 
ATOM   169   C  CD1   . ILE A 1  23   ? 17.622  15.592  41.262   1.00 82.03  ? 23   ILE A CD1   1 
ATOM   170   N  N     . GLU A 1  24   ? 21.152  12.747  44.775   1.00 114.13 ? 24   GLU A N     1 
ATOM   171   C  CA    . GLU A 1  24   ? 21.499  11.622  45.635   1.00 117.81 ? 24   GLU A CA    1 
ATOM   172   C  C     . GLU A 1  24   ? 21.146  11.943  47.089   1.00 115.94 ? 24   GLU A C     1 
ATOM   173   O  O     . GLU A 1  24   ? 21.094  13.112  47.470   1.00 110.70 ? 24   GLU A O     1 
ATOM   174   C  CB    . GLU A 1  24   ? 22.991  11.293  45.502   1.00 118.92 ? 24   GLU A CB    1 
ATOM   175   C  CG    . GLU A 1  24   ? 23.916  12.484  45.728   1.00 121.99 ? 24   GLU A CG    1 
ATOM   176   C  CD    . GLU A 1  24   ? 25.385  12.123  45.589   1.00 118.19 ? 24   GLU A CD    1 
ATOM   177   O  OE1   . GLU A 1  24   ? 25.704  10.916  45.568   1.00 124.39 ? 24   GLU A OE1   1 
ATOM   178   O  OE2   . GLU A 1  24   ? 26.220  13.049  45.501   1.00 108.11 ? 24   GLU A OE2   1 
ATOM   179   N  N     . PRO A 1  25   ? 20.896  10.909  47.910   1.00 116.89 ? 25   PRO A N     1 
ATOM   180   C  CA    . PRO A 1  25   ? 20.879  9.481   47.575   1.00 120.85 ? 25   PRO A CA    1 
ATOM   181   C  C     . PRO A 1  25   ? 19.519  9.029   47.051   1.00 120.50 ? 25   PRO A C     1 
ATOM   182   O  O     . PRO A 1  25   ? 18.508  9.652   47.371   1.00 116.08 ? 25   PRO A O     1 
ATOM   183   C  CB    . PRO A 1  25   ? 21.197  8.815   48.912   1.00 133.33 ? 25   PRO A CB    1 
ATOM   184   C  CG    . PRO A 1  25   ? 20.585  9.732   49.916   1.00 135.49 ? 25   PRO A CG    1 
ATOM   185   C  CD    . PRO A 1  25   ? 20.707  11.130  49.355   1.00 119.69 ? 25   PRO A CD    1 
ATOM   186   N  N     . LEU A 1  26   ? 19.499  7.959   46.261   1.00 122.74 ? 26   LEU A N     1 
ATOM   187   C  CA    . LEU A 1  26   ? 18.250  7.438   45.712   1.00 120.62 ? 26   LEU A CA    1 
ATOM   188   C  C     . LEU A 1  26   ? 18.162  5.914   45.802   1.00 118.44 ? 26   LEU A C     1 
ATOM   189   O  O     . LEU A 1  26   ? 19.176  5.229   45.946   1.00 119.09 ? 26   LEU A O     1 
ATOM   190   C  CB    . LEU A 1  26   ? 18.084  7.888   44.259   1.00 117.65 ? 26   LEU A CB    1 
ATOM   191   C  CG    . LEU A 1  26   ? 17.879  9.393   44.073   1.00 116.84 ? 26   LEU A CG    1 
ATOM   192   C  CD1   . LEU A 1  26   ? 18.057  9.793   42.618   1.00 115.72 ? 26   LEU A CD1   1 
ATOM   193   C  CD2   . LEU A 1  26   ? 16.508  9.820   44.590   1.00 112.18 ? 26   LEU A CD2   1 
ATOM   194   N  N     . GLU A 1  27   ? 16.936  5.401   45.721   1.00 117.56 ? 27   GLU A N     1 
ATOM   195   C  CA    . GLU A 1  27   ? 16.656  3.968   45.835   1.00 117.56 ? 27   GLU A CA    1 
ATOM   196   C  C     . GLU A 1  27   ? 17.452  3.133   44.826   1.00 115.19 ? 27   GLU A C     1 
ATOM   197   O  O     . GLU A 1  27   ? 17.859  3.639   43.781   1.00 116.73 ? 27   GLU A O     1 
ATOM   198   C  CB    . GLU A 1  27   ? 15.155  3.717   45.651   1.00 116.94 ? 27   GLU A CB    1 
ATOM   199   C  CG    . GLU A 1  27   ? 14.262  4.531   46.575   1.00 129.62 ? 27   GLU A CG    1 
ATOM   200   C  CD    . GLU A 1  27   ? 14.196  3.965   47.985   1.00 137.26 ? 27   GLU A CD    1 
ATOM   201   O  OE1   . GLU A 1  27   ? 14.401  2.742   48.150   1.00 140.55 ? 27   GLU A OE1   1 
ATOM   202   O  OE2   . GLU A 1  27   ? 13.945  4.746   48.928   1.00 133.46 ? 27   GLU A OE2   1 
ATOM   203   N  N     . PRO A 1  28   ? 17.690  1.850   45.146   1.00 115.11 ? 28   PRO A N     1 
ATOM   204   C  CA    . PRO A 1  28   ? 18.422  0.958   44.236   1.00 117.01 ? 28   PRO A CA    1 
ATOM   205   C  C     . PRO A 1  28   ? 17.653  0.652   42.948   1.00 119.18 ? 28   PRO A C     1 
ATOM   206   O  O     . PRO A 1  28   ? 16.468  0.322   42.999   1.00 118.89 ? 28   PRO A O     1 
ATOM   207   C  CB    . PRO A 1  28   ? 18.616  -0.312  45.073   1.00 122.95 ? 28   PRO A CB    1 
ATOM   208   C  CG    . PRO A 1  28   ? 17.540  -0.260  46.100   1.00 121.13 ? 28   PRO A CG    1 
ATOM   209   C  CD    . PRO A 1  28   ? 17.374  1.189   46.424   1.00 111.48 ? 28   PRO A CD    1 
ATOM   210   N  N     . GLY A 1  29   ? 18.330  0.768   41.807   1.00 117.49 ? 29   GLY A N     1 
ATOM   211   C  CA    . GLY A 1  29   ? 17.709  0.542   40.513   1.00 111.00 ? 29   GLY A CA    1 
ATOM   212   C  C     . GLY A 1  29   ? 16.613  1.544   40.204   1.00 98.57  ? 29   GLY A C     1 
ATOM   213   O  O     . GLY A 1  29   ? 15.775  1.314   39.334   1.00 92.35  ? 29   GLY A O     1 
ATOM   214   N  N     . PHE A 1  30   ? 16.627  2.663   40.921   1.00 96.13  ? 30   PHE A N     1 
ATOM   215   C  CA    . PHE A 1  30   ? 15.603  3.692   40.785   1.00 99.89  ? 30   PHE A CA    1 
ATOM   216   C  C     . PHE A 1  30   ? 16.085  4.818   39.877   1.00 95.53  ? 30   PHE A C     1 
ATOM   217   O  O     . PHE A 1  30   ? 15.282  5.524   39.273   1.00 88.13  ? 30   PHE A O     1 
ATOM   218   C  CB    . PHE A 1  30   ? 15.227  4.243   42.165   1.00 103.31 ? 30   PHE A CB    1 
ATOM   219   C  CG    . PHE A 1  30   ? 13.966  5.073   42.185   1.00 102.32 ? 30   PHE A CG    1 
ATOM   220   C  CD1   . PHE A 1  30   ? 14.016  6.450   42.025   1.00 91.41  ? 30   PHE A CD1   1 
ATOM   221   C  CD2   . PHE A 1  30   ? 12.732  4.476   42.397   1.00 109.83 ? 30   PHE A CD2   1 
ATOM   222   C  CE1   . PHE A 1  30   ? 12.856  7.212   42.057   1.00 81.77  ? 30   PHE A CE1   1 
ATOM   223   C  CE2   . PHE A 1  30   ? 11.572  5.232   42.430   1.00 103.76 ? 30   PHE A CE2   1 
ATOM   224   C  CZ    . PHE A 1  30   ? 11.635  6.600   42.260   1.00 89.80  ? 30   PHE A CZ    1 
ATOM   225   N  N     . GLY A 1  31   ? 17.402  4.970   39.778   1.00 94.30  ? 31   GLY A N     1 
ATOM   226   C  CA    . GLY A 1  31   ? 17.999  6.088   39.067   1.00 89.21  ? 31   GLY A CA    1 
ATOM   227   C  C     . GLY A 1  31   ? 17.745  6.128   37.572   1.00 81.53  ? 31   GLY A C     1 
ATOM   228   O  O     . GLY A 1  31   ? 17.449  7.188   37.015   1.00 79.85  ? 31   GLY A O     1 
ATOM   229   N  N     . TYR A 1  32   ? 17.862  4.974   36.923   1.00 82.79  ? 32   TYR A N     1 
ATOM   230   C  CA    . TYR A 1  32   ? 17.722  4.878   35.473   1.00 79.33  ? 32   TYR A CA    1 
ATOM   231   C  C     . TYR A 1  32   ? 16.341  5.321   34.984   1.00 80.54  ? 32   TYR A C     1 
ATOM   232   O  O     . TYR A 1  32   ? 16.233  6.101   34.037   1.00 78.85  ? 32   TYR A O     1 
ATOM   233   C  CB    . TYR A 1  32   ? 18.010  3.445   35.012   1.00 71.94  ? 32   TYR A CB    1 
ATOM   234   C  CG    . TYR A 1  32   ? 19.483  3.097   34.976   1.00 74.90  ? 32   TYR A CG    1 
ATOM   235   C  CD1   . TYR A 1  32   ? 20.415  3.998   34.478   1.00 73.94  ? 32   TYR A CD1   1 
ATOM   236   C  CD2   . TYR A 1  32   ? 19.942  1.873   35.447   1.00 77.89  ? 32   TYR A CD2   1 
ATOM   237   C  CE1   . TYR A 1  32   ? 21.764  3.689   34.442   1.00 77.96  ? 32   TYR A CE1   1 
ATOM   238   C  CE2   . TYR A 1  32   ? 21.291  1.553   35.415   1.00 82.08  ? 32   TYR A CE2   1 
ATOM   239   C  CZ    . TYR A 1  32   ? 22.196  2.466   34.912   1.00 81.85  ? 32   TYR A CZ    1 
ATOM   240   O  OH    . TYR A 1  32   ? 23.538  2.156   34.878   1.00 91.23  ? 32   TYR A OH    1 
ATOM   241   N  N     . THR A 1  33   ? 15.290  4.833   35.638   1.00 87.55  ? 33   THR A N     1 
ATOM   242   C  CA    . THR A 1  33   ? 13.924  5.162   35.237   1.00 87.33  ? 33   THR A CA    1 
ATOM   243   C  C     . THR A 1  33   ? 13.440  6.471   35.861   1.00 72.46  ? 33   THR A C     1 
ATOM   244   O  O     . THR A 1  33   ? 12.308  6.898   35.633   1.00 65.94  ? 33   THR A O     1 
ATOM   245   C  CB    . THR A 1  33   ? 12.940  4.021   35.602   1.00 84.28  ? 33   THR A CB    1 
ATOM   246   O  OG1   . THR A 1  33   ? 11.590  4.479   35.447   1.00 75.50  ? 33   THR A OG1   1 
ATOM   247   C  CG2   . THR A 1  33   ? 13.160  3.556   37.036   1.00 87.88  ? 33   THR A CG2   1 
ATOM   248   N  N     . LEU A 1  34   ? 14.309  7.105   36.642   1.00 70.26  ? 34   LEU A N     1 
ATOM   249   C  CA    . LEU A 1  34   ? 13.993  8.392   37.251   1.00 70.30  ? 34   LEU A CA    1 
ATOM   250   C  C     . LEU A 1  34   ? 14.514  9.541   36.393   1.00 70.15  ? 34   LEU A C     1 
ATOM   251   O  O     . LEU A 1  34   ? 13.803  10.514  36.140   1.00 66.58  ? 34   LEU A O     1 
ATOM   252   C  CB    . LEU A 1  34   ? 14.577  8.485   38.662   1.00 73.59  ? 34   LEU A CB    1 
ATOM   253   C  CG    . LEU A 1  34   ? 14.235  9.762   39.432   1.00 77.58  ? 34   LEU A CG    1 
ATOM   254   C  CD1   . LEU A 1  34   ? 12.730  9.885   39.609   1.00 82.80  ? 34   LEU A CD1   1 
ATOM   255   C  CD2   . LEU A 1  34   ? 14.941  9.791   40.775   1.00 85.96  ? 34   LEU A CD2   1 
ATOM   256   N  N     . GLY A 1  35   ? 15.759  9.420   35.946   1.00 73.14  ? 35   GLY A N     1 
ATOM   257   C  CA    . GLY A 1  35   ? 16.357  10.418  35.079   1.00 71.61  ? 35   GLY A CA    1 
ATOM   258   C  C     . GLY A 1  35   ? 15.675  10.483  33.726   1.00 67.84  ? 35   GLY A C     1 
ATOM   259   O  O     . GLY A 1  35   ? 15.507  11.563  33.160   1.00 67.14  ? 35   GLY A O     1 
ATOM   260   N  N     . ASN A 1  36   ? 15.282  9.322   33.207   1.00 68.88  ? 36   ASN A N     1 
ATOM   261   C  CA    . ASN A 1  36   ? 14.607  9.240   31.916   1.00 67.34  ? 36   ASN A CA    1 
ATOM   262   C  C     . ASN A 1  36   ? 13.242  9.910   31.975   1.00 65.30  ? 36   ASN A C     1 
ATOM   263   O  O     . ASN A 1  36   ? 12.757  10.444  30.979   1.00 63.72  ? 36   ASN A O     1 
ATOM   264   C  CB    . ASN A 1  36   ? 14.464  7.779   31.480   1.00 64.53  ? 36   ASN A CB    1 
ATOM   265   C  CG    . ASN A 1  36   ? 14.014  7.637   30.036   1.00 60.61  ? 36   ASN A CG    1 
ATOM   266   O  OD1   . ASN A 1  36   ? 12.925  7.137   29.757   1.00 63.38  ? 36   ASN A OD1   1 
ATOM   267   N  ND2   . ASN A 1  36   ? 14.854  8.080   29.110   1.00 56.53  ? 36   ASN A ND2   1 
ATOM   268   N  N     . SER A 1  37   ? 12.630  9.879   33.154   1.00 64.01  ? 37   SER A N     1 
ATOM   269   C  CA    . SER A 1  37   ? 11.340  10.519  33.375   1.00 60.91  ? 37   SER A CA    1 
ATOM   270   C  C     . SER A 1  37   ? 11.421  12.016  33.099   1.00 61.56  ? 37   SER A C     1 
ATOM   271   O  O     . SER A 1  37   ? 10.464  12.622  32.619   1.00 63.85  ? 37   SER A O     1 
ATOM   272   C  CB    . SER A 1  37   ? 10.870  10.267  34.804   1.00 65.79  ? 37   SER A CB    1 
ATOM   273   O  OG    . SER A 1  37   ? 11.060  8.909   35.155   1.00 69.37  ? 37   SER A OG    1 
ATOM   274   N  N     . LEU A 1  38   ? 12.579  12.597  33.396   1.00 63.77  ? 38   LEU A N     1 
ATOM   275   C  CA    . LEU A 1  38   ? 12.840  14.008  33.135   1.00 63.81  ? 38   LEU A CA    1 
ATOM   276   C  C     . LEU A 1  38   ? 13.230  14.249  31.682   1.00 64.59  ? 38   LEU A C     1 
ATOM   277   O  O     . LEU A 1  38   ? 12.806  15.232  31.070   1.00 61.80  ? 38   LEU A O     1 
ATOM   278   C  CB    . LEU A 1  38   ? 13.946  14.522  34.056   1.00 63.56  ? 38   LEU A CB    1 
ATOM   279   C  CG    . LEU A 1  38   ? 13.621  14.534  35.548   1.00 64.57  ? 38   LEU A CG    1 
ATOM   280   C  CD1   . LEU A 1  38   ? 14.886  14.722  36.363   1.00 71.65  ? 38   LEU A CD1   1 
ATOM   281   C  CD2   . LEU A 1  38   ? 12.617  15.632  35.852   1.00 65.85  ? 38   LEU A CD2   1 
ATOM   282   N  N     . ARG A 1  39   ? 14.048  13.348  31.144   1.00 64.99  ? 39   ARG A N     1 
ATOM   283   C  CA    . ARG A 1  39   ? 14.535  13.444  29.771   1.00 62.86  ? 39   ARG A CA    1 
ATOM   284   C  C     . ARG A 1  39   ? 13.389  13.511  28.772   1.00 60.58  ? 39   ARG A C     1 
ATOM   285   O  O     . ARG A 1  39   ? 13.392  14.336  27.858   1.00 58.47  ? 39   ARG A O     1 
ATOM   286   C  CB    . ARG A 1  39   ? 15.442  12.253  29.444   1.00 58.50  ? 39   ARG A CB    1 
ATOM   287   C  CG    . ARG A 1  39   ? 15.889  12.197  27.992   1.00 55.86  ? 39   ARG A CG    1 
ATOM   288   C  CD    . ARG A 1  39   ? 16.699  10.944  27.700   1.00 54.78  ? 39   ARG A CD    1 
ATOM   289   N  NE    . ARG A 1  39   ? 17.114  10.884  26.302   1.00 53.14  ? 39   ARG A NE    1 
ATOM   290   C  CZ    . ARG A 1  39   ? 16.400  10.319  25.333   1.00 52.33  ? 39   ARG A CZ    1 
ATOM   291   N  NH1   . ARG A 1  39   ? 15.232  9.755   25.610   1.00 50.42  ? 39   ARG A NH1   1 
ATOM   292   N  NH2   . ARG A 1  39   ? 16.856  10.312  24.087   1.00 52.42  ? 39   ARG A NH2   1 
ATOM   293   N  N     . ARG A 1  40   ? 12.407  12.635  28.959   1.00 62.67  ? 40   ARG A N     1 
ATOM   294   C  CA    . ARG A 1  40   ? 11.255  12.562  28.071   1.00 64.21  ? 40   ARG A CA    1 
ATOM   295   C  C     . ARG A 1  40   ? 10.368  13.791  28.209   1.00 60.21  ? 40   ARG A C     1 
ATOM   296   O  O     . ARG A 1  40   ? 9.636   14.148  27.287   1.00 64.59  ? 40   ARG A O     1 
ATOM   297   C  CB    . ARG A 1  40   ? 10.450  11.292  28.352   1.00 62.00  ? 40   ARG A CB    1 
ATOM   298   C  CG    . ARG A 1  40   ? 11.257  10.012  28.208   1.00 63.34  ? 40   ARG A CG    1 
ATOM   299   C  CD    . ARG A 1  40   ? 10.423  8.787   28.543   1.00 61.18  ? 40   ARG A CD    1 
ATOM   300   N  NE    . ARG A 1  40   ? 9.197   8.739   27.753   1.00 58.68  ? 40   ARG A NE    1 
ATOM   301   C  CZ    . ARG A 1  40   ? 9.138   8.340   26.487   1.00 58.80  ? 40   ARG A CZ    1 
ATOM   302   N  NH1   . ARG A 1  40   ? 10.239  7.955   25.855   1.00 53.81  ? 40   ARG A NH1   1 
ATOM   303   N  NH2   . ARG A 1  40   ? 7.977   8.331   25.848   1.00 69.10  ? 40   ARG A NH2   1 
ATOM   304   N  N     . THR A 1  41   ? 10.444  14.438  29.365   1.00 61.12  ? 41   THR A N     1 
ATOM   305   C  CA    . THR A 1  41   ? 9.650   15.630  29.625   1.00 63.63  ? 41   THR A CA    1 
ATOM   306   C  C     . THR A 1  41   ? 10.271  16.847  28.946   1.00 64.45  ? 41   THR A C     1 
ATOM   307   O  O     . THR A 1  41   ? 9.582   17.617  28.275   1.00 63.19  ? 41   THR A O     1 
ATOM   308   C  CB    . THR A 1  41   ? 9.518   15.895  31.135   1.00 70.81  ? 41   THR A CB    1 
ATOM   309   O  OG1   . THR A 1  41   ? 9.240   14.662  31.810   1.00 74.94  ? 41   THR A OG1   1 
ATOM   310   C  CG2   . THR A 1  41   ? 8.397   16.891  31.409   1.00 77.44  ? 41   THR A CG2   1 
ATOM   311   N  N     . LEU A 1  42   ? 11.580  17.004  29.125   1.00 65.34  ? 42   LEU A N     1 
ATOM   312   C  CA    . LEU A 1  42   ? 12.325  18.122  28.551   1.00 64.57  ? 42   LEU A CA    1 
ATOM   313   C  C     . LEU A 1  42   ? 12.203  18.181  27.030   1.00 64.09  ? 42   LEU A C     1 
ATOM   314   O  O     . LEU A 1  42   ? 11.679  19.149  26.478   1.00 62.29  ? 42   LEU A O     1 
ATOM   315   C  CB    . LEU A 1  42   ? 13.802  18.035  28.946   1.00 63.26  ? 42   LEU A CB    1 
ATOM   316   C  CG    . LEU A 1  42   ? 14.151  18.263  30.416   1.00 67.55  ? 42   LEU A CG    1 
ATOM   317   C  CD1   . LEU A 1  42   ? 15.579  17.822  30.702   1.00 71.79  ? 42   LEU A CD1   1 
ATOM   318   C  CD2   . LEU A 1  42   ? 13.964  19.725  30.784   1.00 73.39  ? 42   LEU A CD2   1 
ATOM   319   N  N     . LEU A 1  43   ? 12.682  17.134  26.364   1.00 62.80  ? 43   LEU A N     1 
ATOM   320   C  CA    . LEU A 1  43   ? 12.718  17.071  24.905   1.00 59.02  ? 43   LEU A CA    1 
ATOM   321   C  C     . LEU A 1  43   ? 11.342  17.214  24.260   1.00 61.04  ? 43   LEU A C     1 
ATOM   322   O  O     . LEU A 1  43   ? 11.238  17.483  23.065   1.00 63.57  ? 43   LEU A O     1 
ATOM   323   C  CB    . LEU A 1  43   ? 13.351  15.753  24.458   1.00 53.29  ? 43   LEU A CB    1 
ATOM   324   C  CG    . LEU A 1  43   ? 14.705  15.415  25.083   1.00 54.68  ? 43   LEU A CG    1 
ATOM   325   C  CD1   . LEU A 1  43   ? 15.089  13.978  24.773   1.00 60.05  ? 43   LEU A CD1   1 
ATOM   326   C  CD2   . LEU A 1  43   ? 15.780  16.378  24.599   1.00 66.61  ? 43   LEU A CD2   1 
ATOM   327   N  N     . SER A 1  44   ? 10.289  17.031  25.049   1.00 58.93  ? 44   SER A N     1 
ATOM   328   C  CA    . SER A 1  44   ? 8.935   17.062  24.518   1.00 56.19  ? 44   SER A CA    1 
ATOM   329   C  C     . SER A 1  44   ? 8.193   18.346  24.873   1.00 58.09  ? 44   SER A C     1 
ATOM   330   O  O     . SER A 1  44   ? 7.919   19.167  24.003   1.00 57.52  ? 44   SER A O     1 
ATOM   331   C  CB    . SER A 1  44   ? 8.142   15.858  25.025   1.00 62.92  ? 44   SER A CB    1 
ATOM   332   O  OG    . SER A 1  44   ? 7.965   15.927  26.430   1.00 61.61  ? 44   SER A OG    1 
ATOM   333   N  N     . SER A 1  45   ? 7.874   18.519  26.153   1.00 59.78  ? 45   SER A N     1 
ATOM   334   C  CA    . SER A 1  45   ? 6.938   19.566  26.557   1.00 67.63  ? 45   SER A CA    1 
ATOM   335   C  C     . SER A 1  45   ? 7.537   20.678  27.423   1.00 73.53  ? 45   SER A C     1 
ATOM   336   O  O     . SER A 1  45   ? 7.019   20.980  28.496   1.00 88.42  ? 45   SER A O     1 
ATOM   337   C  CB    . SER A 1  45   ? 5.756   18.936  27.299   1.00 64.89  ? 45   SER A CB    1 
ATOM   338   O  OG    . SER A 1  45   ? 5.156   17.913  26.522   1.00 63.28  ? 45   SER A OG    1 
ATOM   339   N  N     . ILE A 1  46   ? 8.617   21.294  26.955   1.00 64.10  ? 46   ILE A N     1 
ATOM   340   C  CA    . ILE A 1  46   ? 9.117   22.510  27.589   1.00 61.96  ? 46   ILE A CA    1 
ATOM   341   C  C     . ILE A 1  46   ? 8.752   23.705  26.715   1.00 61.88  ? 46   ILE A C     1 
ATOM   342   O  O     . ILE A 1  46   ? 9.189   23.795  25.571   1.00 61.58  ? 46   ILE A O     1 
ATOM   343   C  CB    . ILE A 1  46   ? 10.638  22.467  27.814   1.00 61.29  ? 46   ILE A CB    1 
ATOM   344   C  CG1   . ILE A 1  46   ? 10.983  21.468  28.918   1.00 60.72  ? 46   ILE A CG1   1 
ATOM   345   C  CG2   . ILE A 1  46   ? 11.158  23.846  28.191   1.00 64.59  ? 46   ILE A CG2   1 
ATOM   346   C  CD1   . ILE A 1  46   ? 10.404  21.833  30.269   1.00 64.79  ? 46   ILE A CD1   1 
ATOM   347   N  N     . PRO A 1  47   ? 7.934   24.622  27.251   1.00 61.21  ? 47   PRO A N     1 
ATOM   348   C  CA    . PRO A 1  47   ? 7.442   25.768  26.476   1.00 64.00  ? 47   PRO A CA    1 
ATOM   349   C  C     . PRO A 1  47   ? 8.557   26.703  26.005   1.00 65.21  ? 47   PRO A C     1 
ATOM   350   O  O     . PRO A 1  47   ? 9.430   27.079  26.786   1.00 69.33  ? 47   PRO A O     1 
ATOM   351   C  CB    . PRO A 1  47   ? 6.507   26.484  27.460   1.00 64.67  ? 47   PRO A CB    1 
ATOM   352   C  CG    . PRO A 1  47   ? 6.951   26.039  28.812   1.00 66.48  ? 47   PRO A CG    1 
ATOM   353   C  CD    . PRO A 1  47   ? 7.425   24.628  28.633   1.00 62.47  ? 47   PRO A CD    1 
ATOM   354   N  N     . GLY A 1  48   ? 8.520   27.066  24.727   1.00 61.75  ? 48   GLY A N     1 
ATOM   355   C  CA    . GLY A 1  48   ? 9.505   27.964  24.151   1.00 57.27  ? 48   GLY A CA    1 
ATOM   356   C  C     . GLY A 1  48   ? 8.863   28.894  23.141   1.00 57.42  ? 48   GLY A C     1 
ATOM   357   O  O     . GLY A 1  48   ? 7.694   29.248  23.277   1.00 61.22  ? 48   GLY A O     1 
ATOM   358   N  N     . ALA A 1  49   ? 9.623   29.289  22.125   1.00 55.19  ? 49   ALA A N     1 
ATOM   359   C  CA    . ALA A 1  49   ? 9.090   30.143  21.071   1.00 54.86  ? 49   ALA A CA    1 
ATOM   360   C  C     . ALA A 1  49   ? 9.905   30.021  19.789   1.00 53.10  ? 49   ALA A C     1 
ATOM   361   O  O     . ALA A 1  49   ? 11.117  29.796  19.824   1.00 49.37  ? 49   ALA A O     1 
ATOM   362   C  CB    . ALA A 1  49   ? 9.046   31.592  21.535   1.00 66.40  ? 49   ALA A CB    1 
ATOM   363   N  N     . ALA A 1  50   ? 9.223   30.171  18.659   1.00 52.90  ? 50   ALA A N     1 
ATOM   364   C  CA    . ALA A 1  50   ? 9.859   30.105  17.349   1.00 52.55  ? 50   ALA A CA    1 
ATOM   365   C  C     . ALA A 1  50   ? 8.961   30.743  16.298   1.00 52.54  ? 50   ALA A C     1 
ATOM   366   O  O     . ALA A 1  50   ? 7.862   31.202  16.606   1.00 50.09  ? 50   ALA A O     1 
ATOM   367   C  CB    . ALA A 1  50   ? 10.174  28.667  16.975   1.00 49.22  ? 50   ALA A CB    1 
ATOM   368   N  N     . VAL A 1  51   ? 9.435   30.766  15.058   1.00 52.11  ? 51   VAL A N     1 
ATOM   369   C  CA    . VAL A 1  51   ? 8.678   31.340  13.954   1.00 47.30  ? 51   VAL A CA    1 
ATOM   370   C  C     . VAL A 1  51   ? 7.559   30.407  13.493   1.00 47.39  ? 51   VAL A C     1 
ATOM   371   O  O     . VAL A 1  51   ? 7.764   29.202  13.348   1.00 50.35  ? 51   VAL A O     1 
ATOM   372   C  CB    . VAL A 1  51   ? 9.586   31.648  12.751   1.00 43.64  ? 51   VAL A CB    1 
ATOM   373   C  CG1   . VAL A 1  51   ? 8.884   32.592  11.791   1.00 41.78  ? 51   VAL A CG1   1 
ATOM   374   C  CG2   . VAL A 1  51   ? 10.912  32.235  13.214   1.00 40.46  ? 51   VAL A CG2   1 
ATOM   375   N  N     . THR A 1  52   ? 6.377   30.970  13.263   1.00 46.77  ? 52   THR A N     1 
ATOM   376   C  CA    . THR A 1  52   ? 5.243   30.198  12.768   1.00 46.74  ? 52   THR A CA    1 
ATOM   377   C  C     . THR A 1  52   ? 5.114   30.335  11.258   1.00 46.68  ? 52   THR A C     1 
ATOM   378   O  O     . THR A 1  52   ? 5.199   29.356  10.526   1.00 46.01  ? 52   THR A O     1 
ATOM   379   C  CB    . THR A 1  52   ? 3.917   30.640  13.415   1.00 48.71  ? 52   THR A CB    1 
ATOM   380   O  OG1   . THR A 1  52   ? 3.646   32.004  13.068   1.00 50.74  ? 52   THR A OG1   1 
ATOM   381   C  CG2   . THR A 1  52   ? 3.985   30.500  14.922   1.00 56.60  ? 52   THR A CG2   1 
ATOM   382   N  N     . SER A 1  53   ? 4.894   31.560  10.797   1.00 49.72  ? 53   SER A N     1 
ATOM   383   C  CA    . SER A 1  53   ? 4.766   31.820  9.367    1.00 49.85  ? 53   SER A CA    1 
ATOM   384   C  C     . SER A 1  53   ? 5.598   33.038  8.958    1.00 49.76  ? 53   SER A C     1 
ATOM   385   O  O     . SER A 1  53   ? 6.096   33.773  9.813    1.00 49.18  ? 53   SER A O     1 
ATOM   386   C  CB    . SER A 1  53   ? 3.294   32.021  8.987    1.00 52.36  ? 53   SER A CB    1 
ATOM   387   O  OG    . SER A 1  53   ? 2.654   32.918  9.883    1.00 53.93  ? 53   SER A OG    1 
ATOM   388   N  N     . ILE A 1  54   ? 5.762   33.236  7.652    1.00 49.88  ? 54   ILE A N     1 
ATOM   389   C  CA    . ILE A 1  54   ? 6.516   34.376  7.130    1.00 46.77  ? 54   ILE A CA    1 
ATOM   390   C  C     . ILE A 1  54   ? 5.809   35.040  5.947    1.00 46.43  ? 54   ILE A C     1 
ATOM   391   O  O     . ILE A 1  54   ? 4.764   34.575  5.494    1.00 49.96  ? 54   ILE A O     1 
ATOM   392   C  CB    . ILE A 1  54   ? 7.931   33.965  6.676    1.00 43.00  ? 54   ILE A CB    1 
ATOM   393   C  CG1   . ILE A 1  54   ? 7.850   32.975  5.511    1.00 41.65  ? 54   ILE A CG1   1 
ATOM   394   C  CG2   . ILE A 1  54   ? 8.719   33.370  7.834    1.00 40.82  ? 54   ILE A CG2   1 
ATOM   395   C  CD1   . ILE A 1  54   ? 9.146   32.819  4.747    1.00 36.90  ? 54   ILE A CD1   1 
ATOM   396   N  N     . ARG A 1  55   ? 6.386   36.139  5.464    1.00 46.91  ? 55   ARG A N     1 
ATOM   397   C  CA    . ARG A 1  55   ? 5.945   36.791  4.232    1.00 46.17  ? 55   ARG A CA    1 
ATOM   398   C  C     . ARG A 1  55   ? 7.102   37.558  3.605    1.00 45.85  ? 55   ARG A C     1 
ATOM   399   O  O     . ARG A 1  55   ? 7.921   38.145  4.311    1.00 48.06  ? 55   ARG A O     1 
ATOM   400   C  CB    . ARG A 1  55   ? 4.759   37.728  4.487    1.00 45.53  ? 55   ARG A CB    1 
ATOM   401   C  CG    . ARG A 1  55   ? 3.405   37.092  4.207    1.00 45.60  ? 55   ARG A CG    1 
ATOM   402   C  CD    . ARG A 1  55   ? 2.256   38.078  4.345    1.00 47.69  ? 55   ARG A CD    1 
ATOM   403   N  NE    . ARG A 1  55   ? 2.323   39.138  3.344    1.00 57.71  ? 55   ARG A NE    1 
ATOM   404   C  CZ    . ARG A 1  55   ? 1.351   40.018  3.125    1.00 62.76  ? 55   ARG A CZ    1 
ATOM   405   N  NH1   . ARG A 1  55   ? 0.232   39.959  3.835    1.00 65.01  ? 55   ARG A NH1   1 
ATOM   406   N  NH2   . ARG A 1  55   ? 1.495   40.955  2.197    1.00 66.86  ? 55   ARG A NH2   1 
ATOM   407   N  N     . ILE A 1  56   ? 7.172   37.538  2.278    1.00 43.60  ? 56   ILE A N     1 
ATOM   408   C  CA    . ILE A 1  56   ? 8.251   38.204  1.554    1.00 42.67  ? 56   ILE A CA    1 
ATOM   409   C  C     . ILE A 1  56   ? 7.693   39.133  0.474    1.00 44.77  ? 56   ILE A C     1 
ATOM   410   O  O     . ILE A 1  56   ? 6.704   38.808  -0.182   1.00 47.08  ? 56   ILE A O     1 
ATOM   411   C  CB    . ILE A 1  56   ? 9.206   37.181  0.908    1.00 37.89  ? 56   ILE A CB    1 
ATOM   412   C  CG1   . ILE A 1  56   ? 9.553   36.074  1.902    1.00 40.25  ? 56   ILE A CG1   1 
ATOM   413   C  CG2   . ILE A 1  56   ? 10.470  37.862  0.404    1.00 37.05  ? 56   ILE A CG2   1 
ATOM   414   C  CD1   . ILE A 1  56   ? 10.315  34.927  1.293    1.00 51.15  ? 56   ILE A CD1   1 
ATOM   415   N  N     . ASP A 1  57   ? 8.333   40.287  0.300    1.00 48.21  ? 57   ASP A N     1 
ATOM   416   C  CA    . ASP A 1  57   ? 7.896   41.284  -0.673   1.00 46.31  ? 57   ASP A CA    1 
ATOM   417   C  C     . ASP A 1  57   ? 8.082   40.773  -2.100   1.00 44.01  ? 57   ASP A C     1 
ATOM   418   O  O     . ASP A 1  57   ? 9.208   40.646  -2.580   1.00 46.67  ? 57   ASP A O     1 
ATOM   419   C  CB    . ASP A 1  57   ? 8.666   42.594  -0.475   1.00 51.14  ? 57   ASP A CB    1 
ATOM   420   C  CG    . ASP A 1  57   ? 7.952   43.794  -1.075   1.00 55.03  ? 57   ASP A CG    1 
ATOM   421   O  OD1   . ASP A 1  57   ? 6.928   43.595  -1.761   1.00 54.74  ? 57   ASP A OD1   1 
ATOM   422   O  OD2   . ASP A 1  57   ? 8.418   44.935  -0.864   1.00 56.86  ? 57   ASP A OD2   1 
ATOM   423   N  N     . GLY A 1  58   ? 6.974   40.475  -2.771   1.00 40.91  ? 58   GLY A N     1 
ATOM   424   C  CA    . GLY A 1  58   ? 7.021   39.962  -4.130   1.00 42.66  ? 58   GLY A CA    1 
ATOM   425   C  C     . GLY A 1  58   ? 6.961   38.445  -4.201   1.00 45.71  ? 58   GLY A C     1 
ATOM   426   O  O     . GLY A 1  58   ? 7.227   37.850  -5.246   1.00 46.29  ? 58   GLY A O     1 
ATOM   427   N  N     . VAL A 1  59   ? 6.608   37.816  -3.085   1.00 45.76  ? 59   VAL A N     1 
ATOM   428   C  CA    . VAL A 1  59   ? 6.530   36.361  -3.016   1.00 38.74  ? 59   VAL A CA    1 
ATOM   429   C  C     . VAL A 1  59   ? 5.130   35.902  -2.609   1.00 35.05  ? 59   VAL A C     1 
ATOM   430   O  O     . VAL A 1  59   ? 4.572   36.370  -1.615   1.00 34.49  ? 59   VAL A O     1 
ATOM   431   C  CB    . VAL A 1  59   ? 7.573   35.799  -2.033   1.00 38.95  ? 59   VAL A CB    1 
ATOM   432   C  CG1   . VAL A 1  59   ? 7.356   34.314  -1.812   1.00 35.91  ? 59   VAL A CG1   1 
ATOM   433   C  CG2   . VAL A 1  59   ? 8.977   36.068  -2.548   1.00 37.65  ? 59   VAL A CG2   1 
ATOM   434   N  N     . LEU A 1  60   ? 4.566   34.988  -3.391   1.00 33.31  ? 60   LEU A N     1 
ATOM   435   C  CA    . LEU A 1  60   ? 3.199   34.534  -3.173   1.00 32.74  ? 60   LEU A CA    1 
ATOM   436   C  C     . LEU A 1  60   ? 3.163   33.136  -2.560   1.00 35.55  ? 60   LEU A C     1 
ATOM   437   O  O     . LEU A 1  60   ? 2.184   32.758  -1.916   1.00 35.35  ? 60   LEU A O     1 
ATOM   438   C  CB    . LEU A 1  60   ? 2.411   34.551  -4.488   1.00 33.51  ? 60   LEU A CB    1 
ATOM   439   C  CG    . LEU A 1  60   ? 2.017   35.906  -5.091   1.00 32.66  ? 60   LEU A CG    1 
ATOM   440   C  CD1   . LEU A 1  60   ? 3.206   36.642  -5.680   1.00 31.23  ? 60   LEU A CD1   1 
ATOM   441   C  CD2   . LEU A 1  60   ? 0.935   35.728  -6.142   1.00 35.91  ? 60   LEU A CD2   1 
ATOM   442   N  N     . HIS A 1  61   ? 4.235   32.374  -2.759   1.00 38.18  ? 61   HIS A N     1 
ATOM   443   C  CA    . HIS A 1  61   ? 4.312   31.011  -2.241   1.00 37.45  ? 61   HIS A CA    1 
ATOM   444   C  C     . HIS A 1  61   ? 5.749   30.574  -1.962   1.00 37.22  ? 61   HIS A C     1 
ATOM   445   O  O     . HIS A 1  61   ? 6.701   31.277  -2.294   1.00 35.99  ? 61   HIS A O     1 
ATOM   446   C  CB    . HIS A 1  61   ? 3.656   30.038  -3.218   1.00 35.54  ? 61   HIS A CB    1 
ATOM   447   C  CG    . HIS A 1  61   ? 4.269   30.051  -4.581   1.00 33.12  ? 61   HIS A CG    1 
ATOM   448   N  ND1   . HIS A 1  61   ? 5.454   29.409  -4.871   1.00 31.53  ? 61   HIS A ND1   1 
ATOM   449   C  CD2   . HIS A 1  61   ? 3.866   30.636  -5.733   1.00 32.01  ? 61   HIS A CD2   1 
ATOM   450   C  CE1   . HIS A 1  61   ? 5.750   29.592  -6.145   1.00 31.31  ? 61   HIS A CE1   1 
ATOM   451   N  NE2   . HIS A 1  61   ? 4.803   30.335  -6.691   1.00 32.45  ? 61   HIS A NE2   1 
ATOM   452   N  N     . GLU A 1  62   ? 5.889   29.396  -1.365   1.00 38.44  ? 62   GLU A N     1 
ATOM   453   C  CA    . GLU A 1  62   ? 7.172   28.908  -0.868   1.00 36.94  ? 62   GLU A CA    1 
ATOM   454   C  C     . GLU A 1  62   ? 8.196   28.603  -1.964   1.00 36.41  ? 62   GLU A C     1 
ATOM   455   O  O     . GLU A 1  62   ? 9.401   28.710  -1.742   1.00 36.54  ? 62   GLU A O     1 
ATOM   456   C  CB    . GLU A 1  62   ? 6.943   27.655  -0.020   1.00 38.45  ? 62   GLU A CB    1 
ATOM   457   C  CG    . GLU A 1  62   ? 8.198   27.093  0.614    1.00 39.62  ? 62   GLU A CG    1 
ATOM   458   C  CD    . GLU A 1  62   ? 7.939   25.823  1.406    1.00 46.63  ? 62   GLU A CD    1 
ATOM   459   O  OE1   . GLU A 1  62   ? 6.775   25.367  1.441    1.00 48.16  ? 62   GLU A OE1   1 
ATOM   460   O  OE2   . GLU A 1  62   ? 8.903   25.283  1.992    1.00 53.71  ? 62   GLU A OE2   1 
ATOM   461   N  N     . PHE A 1  63   ? 7.720   28.242  -3.148   1.00 35.69  ? 63   PHE A N     1 
ATOM   462   C  CA    . PHE A 1  63   ? 8.600   27.683  -4.170   1.00 35.51  ? 63   PHE A CA    1 
ATOM   463   C  C     . PHE A 1  63   ? 8.995   28.675  -5.269   1.00 35.91  ? 63   PHE A C     1 
ATOM   464   O  O     . PHE A 1  63   ? 8.526   28.570  -6.401   1.00 36.00  ? 63   PHE A O     1 
ATOM   465   C  CB    . PHE A 1  63   ? 7.933   26.458  -4.799   1.00 36.10  ? 63   PHE A CB    1 
ATOM   466   C  CG    . PHE A 1  63   ? 7.396   25.474  -3.794   1.00 35.81  ? 63   PHE A CG    1 
ATOM   467   C  CD1   . PHE A 1  63   ? 8.199   24.465  -3.292   1.00 35.62  ? 63   PHE A CD1   1 
ATOM   468   C  CD2   . PHE A 1  63   ? 6.084   25.554  -3.358   1.00 35.90  ? 63   PHE A CD2   1 
ATOM   469   C  CE1   . PHE A 1  63   ? 7.706   23.557  -2.369   1.00 35.13  ? 63   PHE A CE1   1 
ATOM   470   C  CE2   . PHE A 1  63   ? 5.587   24.649  -2.436   1.00 35.49  ? 63   PHE A CE2   1 
ATOM   471   C  CZ    . PHE A 1  63   ? 6.399   23.651  -1.941   1.00 35.10  ? 63   PHE A CZ    1 
ATOM   472   N  N     . THR A 1  64   ? 9.868   29.622  -4.939   1.00 37.60  ? 64   THR A N     1 
ATOM   473   C  CA    . THR A 1  64   ? 10.341  30.593  -5.923   1.00 33.32  ? 64   THR A CA    1 
ATOM   474   C  C     . THR A 1  64   ? 11.667  31.233  -5.514   1.00 32.69  ? 64   THR A C     1 
ATOM   475   O  O     . THR A 1  64   ? 12.294  30.814  -4.541   1.00 32.67  ? 64   THR A O     1 
ATOM   476   C  CB    . THR A 1  64   ? 9.299   31.704  -6.159   1.00 33.22  ? 64   THR A CB    1 
ATOM   477   O  OG1   . THR A 1  64   ? 9.855   32.706  -7.018   1.00 37.22  ? 64   THR A OG1   1 
ATOM   478   C  CG2   . THR A 1  64   ? 8.891   32.340  -4.840   1.00 33.84  ? 64   THR A CG2   1 
ATOM   479   N  N     . THR A 1  65   ? 12.092  32.239  -6.274   1.00 31.82  ? 65   THR A N     1 
ATOM   480   C  CA    . THR A 1  65   ? 13.331  32.958  -5.994   1.00 34.22  ? 65   THR A CA    1 
ATOM   481   C  C     . THR A 1  65   ? 13.105  34.461  -6.007   1.00 32.46  ? 65   THR A C     1 
ATOM   482   O  O     . THR A 1  65   ? 12.153  34.945  -6.613   1.00 32.13  ? 65   THR A O     1 
ATOM   483   C  CB    . THR A 1  65   ? 14.437  32.628  -7.019   1.00 34.09  ? 65   THR A CB    1 
ATOM   484   O  OG1   . THR A 1  65   ? 14.024  33.047  -8.325   1.00 32.03  ? 65   THR A OG1   1 
ATOM   485   C  CG2   . THR A 1  65   ? 14.733  31.136  -7.039   1.00 35.27  ? 65   THR A CG2   1 
ATOM   486   N  N     . VAL A 1  66   ? 13.983  35.197  -5.337   1.00 34.30  ? 66   VAL A N     1 
ATOM   487   C  CA    . VAL A 1  66   ? 13.939  36.652  -5.385   1.00 35.64  ? 66   VAL A CA    1 
ATOM   488   C  C     . VAL A 1  66   ? 15.159  37.168  -6.144   1.00 34.09  ? 66   VAL A C     1 
ATOM   489   O  O     . VAL A 1  66   ? 16.295  36.814  -5.814   1.00 33.26  ? 66   VAL A O     1 
ATOM   490   C  CB    . VAL A 1  66   ? 13.880  37.270  -3.976   1.00 37.98  ? 66   VAL A CB    1 
ATOM   491   C  CG1   . VAL A 1  66   ? 14.069  38.777  -4.045   1.00 38.36  ? 66   VAL A CG1   1 
ATOM   492   C  CG2   . VAL A 1  66   ? 12.552  36.930  -3.305   1.00 36.46  ? 66   VAL A CG2   1 
ATOM   493   N  N     . PRO A 1  67   ? 14.920  37.992  -7.178   1.00 32.60  ? 67   PRO A N     1 
ATOM   494   C  CA    . PRO A 1  67   ? 15.968  38.495  -8.073   1.00 31.77  ? 67   PRO A CA    1 
ATOM   495   C  C     . PRO A 1  67   ? 17.119  39.149  -7.321   1.00 34.85  ? 67   PRO A C     1 
ATOM   496   O  O     . PRO A 1  67   ? 16.931  40.187  -6.690   1.00 38.35  ? 67   PRO A O     1 
ATOM   497   C  CB    . PRO A 1  67   ? 15.225  39.519  -8.933   1.00 33.64  ? 67   PRO A CB    1 
ATOM   498   C  CG    . PRO A 1  67   ? 13.818  39.046  -8.941   1.00 32.32  ? 67   PRO A CG    1 
ATOM   499   C  CD    . PRO A 1  67   ? 13.584  38.470  -7.577   1.00 33.51  ? 67   PRO A CD    1 
ATOM   500   N  N     . GLY A 1  68   ? 18.295  38.532  -7.382   1.00 36.63  ? 68   GLY A N     1 
ATOM   501   C  CA    . GLY A 1  68   ? 19.473  39.084  -6.742   1.00 43.02  ? 68   GLY A CA    1 
ATOM   502   C  C     . GLY A 1  68   ? 19.970  38.287  -5.551   1.00 42.88  ? 68   GLY A C     1 
ATOM   503   O  O     . GLY A 1  68   ? 21.118  38.440  -5.135   1.00 46.98  ? 68   GLY A O     1 
ATOM   504   N  N     . VAL A 1  69   ? 19.107  37.442  -4.995   1.00 38.46  ? 69   VAL A N     1 
ATOM   505   C  CA    . VAL A 1  69   ? 19.474  36.629  -3.841   1.00 37.83  ? 69   VAL A CA    1 
ATOM   506   C  C     . VAL A 1  69   ? 20.025  35.286  -4.299   1.00 39.01  ? 69   VAL A C     1 
ATOM   507   O  O     . VAL A 1  69   ? 19.458  34.650  -5.183   1.00 38.84  ? 69   VAL A O     1 
ATOM   508   C  CB    . VAL A 1  69   ? 18.275  36.393  -2.906   1.00 35.74  ? 69   VAL A CB    1 
ATOM   509   C  CG1   . VAL A 1  69   ? 18.757  35.974  -1.524   1.00 37.13  ? 69   VAL A CG1   1 
ATOM   510   C  CG2   . VAL A 1  69   ? 17.426  37.646  -2.811   1.00 38.47  ? 69   VAL A CG2   1 
ATOM   511   N  N     . LYS A 1  70   ? 21.127  34.859  -3.689   1.00 39.90  ? 70   LYS A N     1 
ATOM   512   C  CA    . LYS A 1  70   ? 21.818  33.634  -4.087   1.00 38.05  ? 70   LYS A CA    1 
ATOM   513   C  C     . LYS A 1  70   ? 20.997  32.385  -3.790   1.00 35.56  ? 70   LYS A C     1 
ATOM   514   O  O     . LYS A 1  70   ? 21.051  31.403  -4.528   1.00 34.90  ? 70   LYS A O     1 
ATOM   515   C  CB    . LYS A 1  70   ? 23.176  33.546  -3.384   1.00 43.49  ? 70   LYS A CB    1 
ATOM   516   C  CG    . LYS A 1  70   ? 24.073  32.425  -3.880   1.00 43.49  ? 70   LYS A CG    1 
ATOM   517   C  CD    . LYS A 1  70   ? 25.362  32.362  -3.075   1.00 47.48  ? 70   LYS A CD    1 
ATOM   518   C  CE    . LYS A 1  70   ? 26.250  31.219  -3.540   1.00 51.32  ? 70   LYS A CE    1 
ATOM   519   N  NZ    . LYS A 1  70   ? 27.453  31.064  -2.669   1.00 61.12  ? 70   LYS A NZ    1 
ATOM   520   N  N     . GLU A 1  71   ? 20.239  32.437  -2.700   1.00 36.35  ? 71   GLU A N     1 
ATOM   521   C  CA    . GLU A 1  71   ? 19.389  31.327  -2.288   1.00 37.61  ? 71   GLU A CA    1 
ATOM   522   C  C     . GLU A 1  71   ? 17.954  31.519  -2.770   1.00 39.34  ? 71   GLU A C     1 
ATOM   523   O  O     . GLU A 1  71   ? 17.573  32.609  -3.195   1.00 38.91  ? 71   GLU A O     1 
ATOM   524   C  CB    . GLU A 1  71   ? 19.407  31.174  -0.762   1.00 37.68  ? 71   GLU A CB    1 
ATOM   525   C  CG    . GLU A 1  71   ? 20.776  30.867  -0.161   1.00 43.90  ? 71   GLU A CG    1 
ATOM   526   C  CD    . GLU A 1  71   ? 21.641  32.104  0.025    1.00 48.33  ? 71   GLU A CD    1 
ATOM   527   O  OE1   . GLU A 1  71   ? 21.253  33.187  -0.464   1.00 50.56  ? 71   GLU A OE1   1 
ATOM   528   O  OE2   . GLU A 1  71   ? 22.711  31.992  0.663    1.00 50.93  ? 71   GLU A OE2   1 
ATOM   529   N  N     . ASP A 1  72   ? 17.165  30.450  -2.706   1.00 36.99  ? 72   ASP A N     1 
ATOM   530   C  CA    . ASP A 1  72   ? 15.739  30.522  -3.005   1.00 36.47  ? 72   ASP A CA    1 
ATOM   531   C  C     . ASP A 1  72   ? 14.940  30.604  -1.710   1.00 35.00  ? 72   ASP A C     1 
ATOM   532   O  O     . ASP A 1  72   ? 15.507  30.492  -0.624   1.00 34.83  ? 72   ASP A O     1 
ATOM   533   C  CB    . ASP A 1  72   ? 15.294  29.313  -3.830   1.00 35.87  ? 72   ASP A CB    1 
ATOM   534   C  CG    . ASP A 1  72   ? 15.756  28.000  -3.234   1.00 36.12  ? 72   ASP A CG    1 
ATOM   535   O  OD1   . ASP A 1  72   ? 15.125  27.530  -2.265   1.00 35.83  ? 72   ASP A OD1   1 
ATOM   536   O  OD2   . ASP A 1  72   ? 16.751  27.437  -3.735   1.00 36.97  ? 72   ASP A OD2   1 
ATOM   537   N  N     . VAL A 1  73   ? 13.629  30.794  -1.829   1.00 32.80  ? 73   VAL A N     1 
ATOM   538   C  CA    . VAL A 1  73   ? 12.758  30.952  -0.666   1.00 32.73  ? 73   VAL A CA    1 
ATOM   539   C  C     . VAL A 1  73   ? 12.797  29.727  0.249    1.00 34.31  ? 73   VAL A C     1 
ATOM   540   O  O     . VAL A 1  73   ? 12.838  29.861  1.471    1.00 35.29  ? 73   VAL A O     1 
ATOM   541   C  CB    . VAL A 1  73   ? 11.298  31.223  -1.093   1.00 34.22  ? 73   VAL A CB    1 
ATOM   542   C  CG1   . VAL A 1  73   ? 10.388  31.329  0.123    1.00 32.99  ? 73   VAL A CG1   1 
ATOM   543   C  CG2   . VAL A 1  73   ? 11.219  32.487  -1.927   1.00 32.03  ? 73   VAL A CG2   1 
ATOM   544   N  N     . THR A 1  74   ? 12.801  28.538  -0.349   1.00 33.75  ? 74   THR A N     1 
ATOM   545   C  CA    . THR A 1  74   ? 12.835  27.287  0.407    1.00 32.23  ? 74   THR A CA    1 
ATOM   546   C  C     . THR A 1  74   ? 14.047  27.205  1.330    1.00 33.26  ? 74   THR A C     1 
ATOM   547   O  O     . THR A 1  74   ? 13.908  26.934  2.522    1.00 35.47  ? 74   THR A O     1 
ATOM   548   C  CB    . THR A 1  74   ? 12.850  26.064  -0.528   1.00 32.04  ? 74   THR A CB    1 
ATOM   549   O  OG1   . THR A 1  74   ? 11.699  26.095  -1.380   1.00 34.46  ? 74   THR A OG1   1 
ATOM   550   C  CG2   . THR A 1  74   ? 12.851  24.771  0.278    1.00 31.56  ? 74   THR A CG2   1 
ATOM   551   N  N     . GLU A 1  75   ? 15.231  27.446  0.773    1.00 34.15  ? 75   GLU A N     1 
ATOM   552   C  CA    . GLU A 1  75   ? 16.470  27.398  1.547    1.00 34.88  ? 75   GLU A CA    1 
ATOM   553   C  C     . GLU A 1  75   ? 16.485  28.484  2.626    1.00 35.36  ? 75   GLU A C     1 
ATOM   554   O  O     . GLU A 1  75   ? 17.023  28.281  3.716    1.00 35.10  ? 75   GLU A O     1 
ATOM   555   C  CB    . GLU A 1  75   ? 17.688  27.544  0.627    1.00 35.73  ? 75   GLU A CB    1 
ATOM   556   C  CG    . GLU A 1  75   ? 19.034  27.422  1.337    1.00 38.85  ? 75   GLU A CG    1 
ATOM   557   C  CD    . GLU A 1  75   ? 20.218  27.548  0.391    1.00 39.35  ? 75   GLU A CD    1 
ATOM   558   O  OE1   . GLU A 1  75   ? 20.005  27.525  -0.840   1.00 39.18  ? 75   GLU A OE1   1 
ATOM   559   O  OE2   . GLU A 1  75   ? 21.363  27.675  0.879    1.00 36.41  ? 75   GLU A OE2   1 
ATOM   560   N  N     . ILE A 1  76   ? 15.882  29.629  2.319    1.00 34.71  ? 76   ILE A N     1 
ATOM   561   C  CA    . ILE A 1  76   ? 15.781  30.730  3.274    1.00 35.09  ? 76   ILE A CA    1 
ATOM   562   C  C     . ILE A 1  76   ? 14.880  30.354  4.447    1.00 34.41  ? 76   ILE A C     1 
ATOM   563   O  O     . ILE A 1  76   ? 15.238  30.559  5.610    1.00 35.13  ? 76   ILE A O     1 
ATOM   564   C  CB    . ILE A 1  76   ? 15.246  32.005  2.604    1.00 33.50  ? 76   ILE A CB    1 
ATOM   565   C  CG1   . ILE A 1  76   ? 16.288  32.573  1.637    1.00 33.15  ? 76   ILE A CG1   1 
ATOM   566   C  CG2   . ILE A 1  76   ? 14.873  33.039  3.652    1.00 31.99  ? 76   ILE A CG2   1 
ATOM   567   C  CD1   . ILE A 1  76   ? 15.753  33.674  0.742    1.00 39.23  ? 76   ILE A CD1   1 
ATOM   568   N  N     . ILE A 1  77   ? 13.712  29.803  4.131    1.00 35.56  ? 77   ILE A N     1 
ATOM   569   C  CA    . ILE A 1  77   ? 12.835  29.232  5.144    1.00 36.88  ? 77   ILE A CA    1 
ATOM   570   C  C     . ILE A 1  77   ? 13.569  28.115  5.891    1.00 38.62  ? 77   ILE A C     1 
ATOM   571   O  O     . ILE A 1  77   ? 13.421  27.963  7.105    1.00 38.16  ? 77   ILE A O     1 
ATOM   572   C  CB    . ILE A 1  77   ? 11.528  28.681  4.522    1.00 39.97  ? 77   ILE A CB    1 
ATOM   573   C  CG1   . ILE A 1  77   ? 10.739  29.804  3.845    1.00 36.36  ? 77   ILE A CG1   1 
ATOM   574   C  CG2   . ILE A 1  77   ? 10.670  28.009  5.579    1.00 42.26  ? 77   ILE A CG2   1 
ATOM   575   C  CD1   . ILE A 1  77   ? 9.412   29.360  3.247    1.00 37.55  ? 77   ILE A CD1   1 
ATOM   576   N  N     . LEU A 1  78   ? 14.380  27.352  5.161    1.00 39.91  ? 78   LEU A N     1 
ATOM   577   C  CA    . LEU A 1  78   ? 15.134  26.240  5.739    1.00 37.60  ? 78   LEU A CA    1 
ATOM   578   C  C     . LEU A 1  78   ? 16.201  26.742  6.708    1.00 35.27  ? 78   LEU A C     1 
ATOM   579   O  O     . LEU A 1  78   ? 16.538  26.073  7.685    1.00 32.63  ? 78   LEU A O     1 
ATOM   580   C  CB    . LEU A 1  78   ? 15.776  25.394  4.633    1.00 44.09  ? 78   LEU A CB    1 
ATOM   581   C  CG    . LEU A 1  78   ? 16.241  23.976  4.982    1.00 56.19  ? 78   LEU A CG    1 
ATOM   582   C  CD1   . LEU A 1  78   ? 15.833  23.000  3.887    1.00 58.81  ? 78   LEU A CD1   1 
ATOM   583   C  CD2   . LEU A 1  78   ? 17.746  23.927  5.206    1.00 57.66  ? 78   LEU A CD2   1 
ATOM   584   N  N     . ASN A 1  79   ? 16.734  27.925  6.431    1.00 31.08  ? 79   ASN A N     1 
ATOM   585   C  CA    . ASN A 1  79   ? 17.698  28.542  7.327    1.00 30.79  ? 79   ASN A CA    1 
ATOM   586   C  C     . ASN A 1  79   ? 17.020  29.041  8.599    1.00 32.16  ? 79   ASN A C     1 
ATOM   587   O  O     . ASN A 1  79   ? 17.547  28.882  9.700    1.00 33.40  ? 79   ASN A O     1 
ATOM   588   C  CB    . ASN A 1  79   ? 18.421  29.694  6.625    1.00 32.38  ? 79   ASN A CB    1 
ATOM   589   C  CG    . ASN A 1  79   ? 19.295  29.221  5.479    1.00 32.25  ? 79   ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1  79   ? 19.825  28.112  5.506    1.00 31.02  ? 79   ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1  79   ? 19.450  30.063  4.464    1.00 34.20  ? 79   ASN A ND2   1 
ATOM   592   N  N     . LEU A 1  80   ? 15.836  29.628  8.441    1.00 35.52  ? 80   LEU A N     1 
ATOM   593   C  CA    . LEU A 1  80   ? 15.097  30.212  9.560    1.00 33.56  ? 80   LEU A CA    1 
ATOM   594   C  C     . LEU A 1  80   ? 14.563  29.176  10.548   1.00 34.78  ? 80   LEU A C     1 
ATOM   595   O  O     . LEU A 1  80   ? 13.936  29.530  11.547   1.00 32.85  ? 80   LEU A O     1 
ATOM   596   C  CB    . LEU A 1  80   ? 13.939  31.063  9.035    1.00 31.13  ? 80   LEU A CB    1 
ATOM   597   C  CG    . LEU A 1  80   ? 14.324  32.438  8.494    1.00 25.57  ? 80   LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1  80   ? 13.168  33.055  7.736    1.00 25.08  ? 80   LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1  80   ? 14.758  33.340  9.636    1.00 26.48  ? 80   LEU A CD2   1 
ATOM   600   N  N     . LYS A 1  81   ? 14.814  27.901  10.267   1.00 40.13  ? 81   LYS A N     1 
ATOM   601   C  CA    . LYS A 1  81   ? 14.443  26.828  11.183   1.00 43.18  ? 81   LYS A CA    1 
ATOM   602   C  C     . LYS A 1  81   ? 15.383  26.816  12.383   1.00 42.63  ? 81   LYS A C     1 
ATOM   603   O  O     . LYS A 1  81   ? 15.001  26.425  13.488   1.00 42.06  ? 81   LYS A O     1 
ATOM   604   C  CB    . LYS A 1  81   ? 14.482  25.469  10.481   1.00 48.62  ? 81   LYS A CB    1 
ATOM   605   C  CG    . LYS A 1  81   ? 13.743  25.421  9.153    1.00 45.90  ? 81   LYS A CG    1 
ATOM   606   C  CD    . LYS A 1  81   ? 12.247  25.232  9.324    1.00 48.60  ? 81   LYS A CD    1 
ATOM   607   C  CE    . LYS A 1  81   ? 11.593  25.047  7.969    1.00 48.18  ? 81   LYS A CE    1 
ATOM   608   N  NZ    . LYS A 1  81   ? 10.178  24.620  8.077    1.00 60.27  ? 81   LYS A NZ    1 
ATOM   609   N  N     . SER A 1  82   ? 16.620  27.241  12.151   1.00 40.18  ? 82   SER A N     1 
ATOM   610   C  CA    . SER A 1  82   ? 17.637  27.232  13.195   1.00 40.67  ? 82   SER A CA    1 
ATOM   611   C  C     . SER A 1  82   ? 17.653  28.547  13.968   1.00 39.94  ? 82   SER A C     1 
ATOM   612   O  O     . SER A 1  82   ? 18.443  28.723  14.895   1.00 43.27  ? 82   SER A O     1 
ATOM   613   C  CB    . SER A 1  82   ? 19.015  26.946  12.591   1.00 43.03  ? 82   SER A CB    1 
ATOM   614   O  OG    . SER A 1  82   ? 19.165  27.599  11.343   1.00 42.53  ? 82   SER A OG    1 
ATOM   615   N  N     . LEU A 1  83   ? 16.769  29.465  13.590   1.00 38.88  ? 83   LEU A N     1 
ATOM   616   C  CA    . LEU A 1  83   ? 16.654  30.746  14.279   1.00 43.50  ? 83   LEU A CA    1 
ATOM   617   C  C     . LEU A 1  83   ? 16.207  30.548  15.727   1.00 48.26  ? 83   LEU A C     1 
ATOM   618   O  O     . LEU A 1  83   ? 15.109  30.059  15.984   1.00 55.33  ? 83   LEU A O     1 
ATOM   619   C  CB    . LEU A 1  83   ? 15.675  31.665  13.540   1.00 43.27  ? 83   LEU A CB    1 
ATOM   620   C  CG    . LEU A 1  83   ? 15.385  33.033  14.163   1.00 47.38  ? 83   LEU A CG    1 
ATOM   621   C  CD1   . LEU A 1  83   ? 16.642  33.895  14.229   1.00 55.82  ? 83   LEU A CD1   1 
ATOM   622   C  CD2   . LEU A 1  83   ? 14.269  33.754  13.414   1.00 44.35  ? 83   LEU A CD2   1 
ATOM   623   N  N     . VAL A 1  84   ? 17.063  30.925  16.672   1.00 44.79  ? 84   VAL A N     1 
ATOM   624   C  CA    . VAL A 1  84   ? 16.751  30.760  18.088   1.00 44.36  ? 84   VAL A CA    1 
ATOM   625   C  C     . VAL A 1  84   ? 16.064  31.995  18.671   1.00 46.19  ? 84   VAL A C     1 
ATOM   626   O  O     . VAL A 1  84   ? 16.691  33.037  18.859   1.00 47.89  ? 84   VAL A O     1 
ATOM   627   C  CB    . VAL A 1  84   ? 18.015  30.460  18.909   1.00 45.28  ? 84   VAL A CB    1 
ATOM   628   C  CG1   . VAL A 1  84   ? 17.666  30.334  20.383   1.00 52.51  ? 84   VAL A CG1   1 
ATOM   629   C  CG2   . VAL A 1  84   ? 18.679  29.193  18.408   1.00 45.93  ? 84   VAL A CG2   1 
ATOM   630   N  N     . VAL A 1  85   ? 14.772  31.872  18.957   1.00 45.30  ? 85   VAL A N     1 
ATOM   631   C  CA    . VAL A 1  85   ? 14.003  32.993  19.483   1.00 46.35  ? 85   VAL A CA    1 
ATOM   632   C  C     . VAL A 1  85   ? 13.383  32.664  20.834   1.00 48.50  ? 85   VAL A C     1 
ATOM   633   O  O     . VAL A 1  85   ? 12.952  31.536  21.072   1.00 46.18  ? 85   VAL A O     1 
ATOM   634   C  CB    . VAL A 1  85   ? 12.873  33.409  18.515   1.00 45.65  ? 85   VAL A CB    1 
ATOM   635   C  CG1   . VAL A 1  85   ? 12.311  34.775  18.895   1.00 45.47  ? 85   VAL A CG1   1 
ATOM   636   C  CG2   . VAL A 1  85   ? 13.373  33.426  17.087   1.00 41.95  ? 85   VAL A CG2   1 
ATOM   637   N  N     . SER A 1  86   ? 13.356  33.654  21.719   1.00 52.41  ? 86   SER A N     1 
ATOM   638   C  CA    . SER A 1  86   ? 12.557  33.571  22.933   1.00 56.70  ? 86   SER A CA    1 
ATOM   639   C  C     . SER A 1  86   ? 11.648  34.793  23.011   1.00 63.21  ? 86   SER A C     1 
ATOM   640   O  O     . SER A 1  86   ? 12.093  35.922  22.804   1.00 60.30  ? 86   SER A O     1 
ATOM   641   C  CB    . SER A 1  86   ? 13.443  33.479  24.177   1.00 54.49  ? 86   SER A CB    1 
ATOM   642   O  OG    . SER A 1  86   ? 14.063  34.721  24.461   1.00 64.82  ? 86   SER A OG    1 
ATOM   643   N  N     . SER A 1  87   ? 10.371  34.566  23.299   1.00 67.31  ? 87   SER A N     1 
ATOM   644   C  CA    . SER A 1  87   ? 9.416   35.662  23.398   1.00 74.29  ? 87   SER A CA    1 
ATOM   645   C  C     . SER A 1  87   ? 8.587   35.570  24.676   1.00 77.04  ? 87   SER A C     1 
ATOM   646   O  O     . SER A 1  87   ? 8.259   34.480  25.142   1.00 72.96  ? 87   SER A O     1 
ATOM   647   C  CB    . SER A 1  87   ? 8.497   35.685  22.175   1.00 79.42  ? 87   SER A CB    1 
ATOM   648   O  OG    . SER A 1  87   ? 7.717   36.870  22.147   1.00 95.50  ? 87   SER A OG    1 
ATOM   649   N  N     . GLU A 1  88   ? 8.258   36.729  25.237   1.00 84.53  ? 88   GLU A N     1 
ATOM   650   C  CA    . GLU A 1  88   ? 7.481   36.815  26.466   1.00 85.15  ? 88   GLU A CA    1 
ATOM   651   C  C     . GLU A 1  88   ? 6.009   37.016  26.144   1.00 85.95  ? 88   GLU A C     1 
ATOM   652   O  O     . GLU A 1  88   ? 5.130   36.672  26.936   1.00 85.96  ? 88   GLU A O     1 
ATOM   653   C  CB    . GLU A 1  88   ? 7.994   37.959  27.337   1.00 92.98  ? 88   GLU A CB    1 
ATOM   654   C  CG    . GLU A 1  88   ? 9.489   37.907  27.597   1.00 103.86 ? 88   GLU A CG    1 
ATOM   655   C  CD    . GLU A 1  88   ? 10.039  39.224  28.118   1.00 106.11 ? 88   GLU A CD    1 
ATOM   656   O  OE1   . GLU A 1  88   ? 9.237   40.145  28.383   1.00 106.66 ? 88   GLU A OE1   1 
ATOM   657   O  OE2   . GLU A 1  88   ? 11.276  39.338  28.258   1.00 104.40 ? 88   GLU A OE2   1 
ATOM   658   N  N     . GLU A 1  89   ? 5.756   37.579  24.966   1.00 88.28  ? 89   GLU A N     1 
ATOM   659   C  CA    . GLU A 1  89   ? 4.400   37.780  24.478   1.00 91.30  ? 89   GLU A CA    1 
ATOM   660   C  C     . GLU A 1  89   ? 3.746   36.438  24.187   1.00 94.68  ? 89   GLU A C     1 
ATOM   661   O  O     . GLU A 1  89   ? 4.098   35.765  23.219   1.00 97.40  ? 89   GLU A O     1 
ATOM   662   C  CB    . GLU A 1  89   ? 4.405   38.646  23.219   1.00 87.04  ? 89   GLU A CB    1 
ATOM   663   C  CG    . GLU A 1  89   ? 5.180   39.941  23.361   1.00 89.90  ? 89   GLU A CG    1 
ATOM   664   C  CD    . GLU A 1  89   ? 4.450   40.962  24.208   1.00 105.14 ? 89   GLU A CD    1 
ATOM   665   O  OE1   . GLU A 1  89   ? 3.215   40.832  24.359   1.00 105.71 ? 89   GLU A OE1   1 
ATOM   666   O  OE2   . GLU A 1  89   ? 5.110   41.888  24.727   1.00 112.14 ? 89   GLU A OE2   1 
ATOM   667   N  N     . ASP A 1  90   ? 2.799   36.049  25.032   1.00 95.67  ? 90   ASP A N     1 
ATOM   668   C  CA    . ASP A 1  90   ? 2.068   34.805  24.837   1.00 93.38  ? 90   ASP A CA    1 
ATOM   669   C  C     . ASP A 1  90   ? 1.290   34.865  23.527   1.00 93.72  ? 90   ASP A C     1 
ATOM   670   O  O     . ASP A 1  90   ? 1.078   33.849  22.864   1.00 88.45  ? 90   ASP A O     1 
ATOM   671   C  CB    . ASP A 1  90   ? 1.131   34.548  26.016   1.00 105.45 ? 90   ASP A CB    1 
ATOM   672   C  CG    . ASP A 1  90   ? 1.232   33.133  26.539   1.00 110.15 ? 90   ASP A CG    1 
ATOM   673   O  OD1   . ASP A 1  90   ? 1.249   32.197  25.713   1.00 114.32 ? 90   ASP A OD1   1 
ATOM   674   O  OD2   . ASP A 1  90   ? 1.304   32.957  27.773   1.00 111.02 ? 90   ASP A OD2   1 
ATOM   675   N  N     . GLU A 1  91   ? 0.885   36.077  23.160   1.00 99.94  ? 91   GLU A N     1 
ATOM   676   C  CA    . GLU A 1  91   ? 0.190   36.337  21.906   1.00 98.80  ? 91   GLU A CA    1 
ATOM   677   C  C     . GLU A 1  91   ? 1.182   36.525  20.757   1.00 86.22  ? 91   GLU A C     1 
ATOM   678   O  O     . GLU A 1  91   ? 2.330   36.904  20.988   1.00 86.75  ? 91   GLU A O     1 
ATOM   679   C  CB    . GLU A 1  91   ? -0.706  37.573  22.052   1.00 107.82 ? 91   GLU A CB    1 
ATOM   680   C  CG    . GLU A 1  91   ? -0.003  38.785  22.646   1.00 110.61 ? 91   GLU A CG    1 
ATOM   681   C  CD    . GLU A 1  91   ? -0.928  39.975  22.804   1.00 124.08 ? 91   GLU A CD    1 
ATOM   682   O  OE1   . GLU A 1  91   ? -2.017  39.969  22.192   1.00 137.07 ? 91   GLU A OE1   1 
ATOM   683   O  OE2   . GLU A 1  91   ? -0.570  40.915  23.545   1.00 120.89 ? 91   GLU A OE2   1 
ATOM   684   N  N     . PRO A 1  92   ? 0.743   36.252  19.515   1.00 74.88  ? 92   PRO A N     1 
ATOM   685   C  CA    . PRO A 1  92   ? 1.601   36.408  18.333   1.00 71.00  ? 92   PRO A CA    1 
ATOM   686   C  C     . PRO A 1  92   ? 2.173   37.817  18.181   1.00 71.33  ? 92   PRO A C     1 
ATOM   687   O  O     . PRO A 1  92   ? 1.494   38.789  18.509   1.00 68.09  ? 92   PRO A O     1 
ATOM   688   C  CB    . PRO A 1  92   ? 0.655   36.088  17.172   1.00 65.16  ? 92   PRO A CB    1 
ATOM   689   C  CG    . PRO A 1  92   ? -0.378  35.211  17.761   1.00 68.48  ? 92   PRO A CG    1 
ATOM   690   C  CD    . PRO A 1  92   ? -0.575  35.693  19.164   1.00 74.00  ? 92   PRO A CD    1 
ATOM   691   N  N     . VAL A 1  93   ? 3.409   37.912  17.695   1.00 71.00  ? 93   VAL A N     1 
ATOM   692   C  CA    . VAL A 1  93   ? 4.060   39.195  17.433   1.00 65.34  ? 93   VAL A CA    1 
ATOM   693   C  C     . VAL A 1  93   ? 4.755   39.189  16.069   1.00 59.70  ? 93   VAL A C     1 
ATOM   694   O  O     . VAL A 1  93   ? 5.030   38.127  15.513   1.00 58.77  ? 93   VAL A O     1 
ATOM   695   C  CB    . VAL A 1  93   ? 5.095   39.546  18.524   1.00 69.41  ? 93   VAL A CB    1 
ATOM   696   C  CG1   . VAL A 1  93   ? 4.399   39.983  19.805   1.00 75.97  ? 93   VAL A CG1   1 
ATOM   697   C  CG2   . VAL A 1  93   ? 6.024   38.369  18.776   1.00 69.17  ? 93   VAL A CG2   1 
ATOM   698   N  N     . THR A 1  94   ? 5.044   40.374  15.539   1.00 58.36  ? 94   THR A N     1 
ATOM   699   C  CA    . THR A 1  94   ? 5.604   40.500  14.194   1.00 55.25  ? 94   THR A CA    1 
ATOM   700   C  C     . THR A 1  94   ? 7.030   41.052  14.204   1.00 56.95  ? 94   THR A C     1 
ATOM   701   O  O     . THR A 1  94   ? 7.283   42.122  14.754   1.00 59.61  ? 94   THR A O     1 
ATOM   702   C  CB    . THR A 1  94   ? 4.722   41.413  13.310   1.00 52.81  ? 94   THR A CB    1 
ATOM   703   O  OG1   . THR A 1  94   ? 3.399   40.869  13.220   1.00 48.43  ? 94   THR A OG1   1 
ATOM   704   C  CG2   . THR A 1  94   ? 5.308   41.540  11.913   1.00 56.38  ? 94   THR A CG2   1 
ATOM   705   N  N     . MET A 1  95   ? 7.959   40.318  13.594   1.00 57.83  ? 95   MET A N     1 
ATOM   706   C  CA    . MET A 1  95   ? 9.335   40.789  13.448   1.00 58.81  ? 95   MET A CA    1 
ATOM   707   C  C     . MET A 1  95   ? 9.542   41.388  12.060   1.00 61.00  ? 95   MET A C     1 
ATOM   708   O  O     . MET A 1  95   ? 8.642   41.349  11.224   1.00 61.28  ? 95   MET A O     1 
ATOM   709   C  CB    . MET A 1  95   ? 10.330  39.654  13.685   1.00 56.16  ? 95   MET A CB    1 
ATOM   710   C  CG    . MET A 1  95   ? 10.093  38.881  14.970   1.00 57.70  ? 95   MET A CG    1 
ATOM   711   S  SD    . MET A 1  95   ? 11.428  37.732  15.362   1.00 75.04  ? 95   MET A SD    1 
ATOM   712   C  CE    . MET A 1  95   ? 11.659  36.904  13.792   1.00 59.23  ? 95   MET A CE    1 
ATOM   713   N  N     . TYR A 1  96   ? 10.725  41.945  11.817   1.00 61.20  ? 96   TYR A N     1 
ATOM   714   C  CA    . TYR A 1  96   ? 11.013  42.592  10.539   1.00 60.24  ? 96   TYR A CA    1 
ATOM   715   C  C     . TYR A 1  96   ? 12.484  42.484  10.163   1.00 57.48  ? 96   TYR A C     1 
ATOM   716   O  O     . TYR A 1  96   ? 13.361  42.601  11.015   1.00 56.63  ? 96   TYR A O     1 
ATOM   717   C  CB    . TYR A 1  96   ? 10.597  44.067  10.578   1.00 62.14  ? 96   TYR A CB    1 
ATOM   718   C  CG    . TYR A 1  96   ? 9.101   44.289  10.513   1.00 64.43  ? 96   TYR A CG    1 
ATOM   719   C  CD1   . TYR A 1  96   ? 8.427   44.259  9.298    1.00 61.46  ? 96   TYR A CD1   1 
ATOM   720   C  CD2   . TYR A 1  96   ? 8.364   44.533  11.665   1.00 71.18  ? 96   TYR A CD2   1 
ATOM   721   C  CE1   . TYR A 1  96   ? 7.058   44.460  9.233    1.00 69.47  ? 96   TYR A CE1   1 
ATOM   722   C  CE2   . TYR A 1  96   ? 6.995   44.736  11.611   1.00 72.87  ? 96   TYR A CE2   1 
ATOM   723   C  CZ    . TYR A 1  96   ? 6.347   44.698  10.393   1.00 72.95  ? 96   TYR A CZ    1 
ATOM   724   O  OH    . TYR A 1  96   ? 4.986   44.900  10.335   1.00 69.93  ? 96   TYR A OH    1 
ATOM   725   N  N     . LEU A 1  97   ? 12.745  42.257  8.880    1.00 56.52  ? 97   LEU A N     1 
ATOM   726   C  CA    . LEU A 1  97   ? 14.109  42.245  8.369    1.00 57.15  ? 97   LEU A CA    1 
ATOM   727   C  C     . LEU A 1  97   ? 14.168  42.859  6.978    1.00 56.59  ? 97   LEU A C     1 
ATOM   728   O  O     . LEU A 1  97   ? 13.432  42.455  6.078    1.00 56.47  ? 97   LEU A O     1 
ATOM   729   C  CB    . LEU A 1  97   ? 14.670  40.820  8.341    1.00 61.87  ? 97   LEU A CB    1 
ATOM   730   C  CG    . LEU A 1  97   ? 16.101  40.640  7.810    1.00 69.82  ? 97   LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1  97   ? 16.838  39.567  8.599    1.00 71.25  ? 97   LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1  97   ? 16.122  40.303  6.316    1.00 64.82  ? 97   LEU A CD2   1 
ATOM   733   N  N     . ARG A 1  98   ? 15.051  43.838  6.809    1.00 54.99  ? 98   ARG A N     1 
ATOM   734   C  CA    . ARG A 1  98   ? 15.277  44.460  5.511    1.00 53.85  ? 98   ARG A CA    1 
ATOM   735   C  C     . ARG A 1  98   ? 16.752  44.778  5.314    1.00 53.09  ? 98   ARG A C     1 
ATOM   736   O  O     . ARG A 1  98   ? 17.450  45.156  6.256    1.00 56.61  ? 98   ARG A O     1 
ATOM   737   C  CB    . ARG A 1  98   ? 14.441  45.735  5.364    1.00 59.45  ? 98   ARG A CB    1 
ATOM   738   C  CG    . ARG A 1  98   ? 12.943  45.495  5.330    1.00 56.27  ? 98   ARG A CG    1 
ATOM   739   C  CD    . ARG A 1  98   ? 12.159  46.791  5.397    1.00 58.90  ? 98   ARG A CD    1 
ATOM   740   N  NE    . ARG A 1  98   ? 10.767  46.554  5.769    1.00 68.42  ? 98   ARG A NE    1 
ATOM   741   C  CZ    . ARG A 1  98   ? 9.845   47.506  5.863    1.00 73.51  ? 98   ARG A CZ    1 
ATOM   742   N  NH1   . ARG A 1  98   ? 10.166  48.767  5.605    1.00 81.79  ? 98   ARG A NH1   1 
ATOM   743   N  NH2   . ARG A 1  98   ? 8.603   47.196  6.210    1.00 78.22  ? 98   ARG A NH2   1 
ATOM   744   N  N     . LYS A 1  99   ? 17.211  44.620  4.077    1.00 50.63  ? 99   LYS A N     1 
ATOM   745   C  CA    . LYS A 1  99   ? 18.584  44.935  3.701    1.00 53.90  ? 99   LYS A CA    1 
ATOM   746   C  C     . LYS A 1  99   ? 18.694  44.959  2.177    1.00 56.00  ? 99   LYS A C     1 
ATOM   747   O  O     . LYS A 1  99   ? 18.093  44.126  1.502    1.00 58.14  ? 99   LYS A O     1 
ATOM   748   C  CB    . LYS A 1  99   ? 19.560  43.919  4.303    1.00 54.98  ? 99   LYS A CB    1 
ATOM   749   C  CG    . LYS A 1  99   ? 20.997  44.411  4.380    1.00 63.43  ? 99   LYS A CG    1 
ATOM   750   C  CD    . LYS A 1  99   ? 21.865  43.476  5.209    1.00 62.24  ? 99   LYS A CD    1 
ATOM   751   C  CE    . LYS A 1  99   ? 23.247  44.069  5.452    1.00 55.49  ? 99   LYS A CE    1 
ATOM   752   N  NZ    . LYS A 1  99   ? 24.025  44.208  4.186    1.00 50.28  ? 99   LYS A NZ    1 
ATOM   753   N  N     . GLN A 1  100  ? 19.453  45.909  1.636    1.00 55.89  ? 100  GLN A N     1 
ATOM   754   C  CA    . GLN A 1  100  ? 19.549  46.067  0.185    1.00 58.91  ? 100  GLN A CA    1 
ATOM   755   C  C     . GLN A 1  100  ? 20.999  46.054  -0.313   1.00 59.70  ? 100  GLN A C     1 
ATOM   756   O  O     . GLN A 1  100  ? 21.940  46.027  0.482    1.00 58.10  ? 100  GLN A O     1 
ATOM   757   C  CB    . GLN A 1  100  ? 18.859  47.365  -0.252   1.00 61.41  ? 100  GLN A CB    1 
ATOM   758   C  CG    . GLN A 1  100  ? 18.237  47.309  -1.648   1.00 69.00  ? 100  GLN A CG    1 
ATOM   759   C  CD    . GLN A 1  100  ? 17.871  48.681  -2.200   1.00 82.80  ? 100  GLN A CD    1 
ATOM   760   O  OE1   . GLN A 1  100  ? 18.407  49.703  -1.768   1.00 91.53  ? 100  GLN A OE1   1 
ATOM   761   N  NE2   . GLN A 1  100  ? 16.952  48.708  -3.162   1.00 74.70  ? 100  GLN A NE2   1 
ATOM   762   N  N     . GLY A 1  101  ? 21.165  46.060  -1.634   1.00 58.43  ? 101  GLY A N     1 
ATOM   763   C  CA    . GLY A 1  101  ? 22.478  46.061  -2.255   1.00 53.79  ? 101  GLY A CA    1 
ATOM   764   C  C     . GLY A 1  101  ? 23.291  44.830  -1.907   1.00 54.92  ? 101  GLY A C     1 
ATOM   765   O  O     . GLY A 1  101  ? 22.743  43.829  -1.452   1.00 55.35  ? 101  GLY A O     1 
ATOM   766   N  N     . PRO A 1  102  ? 24.612  44.893  -2.124   1.00 53.84  ? 102  PRO A N     1 
ATOM   767   C  CA    . PRO A 1  102  ? 25.522  43.812  -1.731   1.00 55.91  ? 102  PRO A CA    1 
ATOM   768   C  C     . PRO A 1  102  ? 25.637  43.710  -0.214   1.00 54.91  ? 102  PRO A C     1 
ATOM   769   O  O     . PRO A 1  102  ? 25.176  44.606  0.493    1.00 53.57  ? 102  PRO A O     1 
ATOM   770   C  CB    . PRO A 1  102  ? 26.863  44.224  -2.356   1.00 57.68  ? 102  PRO A CB    1 
ATOM   771   C  CG    . PRO A 1  102  ? 26.523  45.270  -3.375   1.00 69.07  ? 102  PRO A CG    1 
ATOM   772   C  CD    . PRO A 1  102  ? 25.311  45.969  -2.840   1.00 62.17  ? 102  PRO A CD    1 
ATOM   773   N  N     . GLY A 1  103  ? 26.245  42.636  0.277    1.00 57.38  ? 103  GLY A N     1 
ATOM   774   C  CA    . GLY A 1  103  ? 26.390  42.430  1.707    1.00 59.85  ? 103  GLY A CA    1 
ATOM   775   C  C     . GLY A 1  103  ? 25.595  41.231  2.187    1.00 58.96  ? 103  GLY A C     1 
ATOM   776   O  O     . GLY A 1  103  ? 24.512  40.952  1.673    1.00 56.24  ? 103  GLY A O     1 
ATOM   777   N  N     . GLU A 1  104  ? 26.136  40.521  3.173    1.00 59.10  ? 104  GLU A N     1 
ATOM   778   C  CA    . GLU A 1  104  ? 25.468  39.355  3.745    1.00 55.20  ? 104  GLU A CA    1 
ATOM   779   C  C     . GLU A 1  104  ? 24.430  39.771  4.785    1.00 55.58  ? 104  GLU A C     1 
ATOM   780   O  O     . GLU A 1  104  ? 24.665  40.690  5.569    1.00 59.20  ? 104  GLU A O     1 
ATOM   781   C  CB    . GLU A 1  104  ? 26.494  38.412  4.377    1.00 55.50  ? 104  GLU A CB    1 
ATOM   782   C  CG    . GLU A 1  104  ? 25.982  37.005  4.630    1.00 58.16  ? 104  GLU A CG    1 
ATOM   783   C  CD    . GLU A 1  104  ? 27.028  36.111  5.271    1.00 67.50  ? 104  GLU A CD    1 
ATOM   784   O  OE1   . GLU A 1  104  ? 27.568  36.496  6.331    1.00 66.51  ? 104  GLU A OE1   1 
ATOM   785   O  OE2   . GLU A 1  104  ? 27.314  35.028  4.716    1.00 65.55  ? 104  GLU A OE2   1 
ATOM   786   N  N     . VAL A 1  105  ? 23.282  39.097  4.785    1.00 55.00  ? 105  VAL A N     1 
ATOM   787   C  CA    . VAL A 1  105  ? 22.251  39.336  5.793    1.00 53.41  ? 105  VAL A CA    1 
ATOM   788   C  C     . VAL A 1  105  ? 22.279  38.211  6.832    1.00 53.98  ? 105  VAL A C     1 
ATOM   789   O  O     . VAL A 1  105  ? 22.554  37.057  6.500    1.00 51.51  ? 105  VAL A O     1 
ATOM   790   C  CB    . VAL A 1  105  ? 20.833  39.450  5.158    1.00 54.50  ? 105  VAL A CB    1 
ATOM   791   C  CG1   . VAL A 1  105  ? 20.324  38.094  4.684    1.00 51.57  ? 105  VAL A CG1   1 
ATOM   792   C  CG2   . VAL A 1  105  ? 19.847  40.070  6.141    1.00 58.93  ? 105  VAL A CG2   1 
ATOM   793   N  N     . THR A 1  106  ? 22.022  38.554  8.093    1.00 55.75  ? 106  THR A N     1 
ATOM   794   C  CA    . THR A 1  106  ? 22.035  37.580  9.185    1.00 53.91  ? 106  THR A CA    1 
ATOM   795   C  C     . THR A 1  106  ? 20.833  37.757  10.117   1.00 55.31  ? 106  THR A C     1 
ATOM   796   O  O     . THR A 1  106  ? 19.941  38.566  9.850    1.00 53.04  ? 106  THR A O     1 
ATOM   797   C  CB    . THR A 1  106  ? 23.331  37.678  10.016   1.00 52.86  ? 106  THR A CB    1 
ATOM   798   O  OG1   . THR A 1  106  ? 23.534  39.033  10.435   1.00 56.02  ? 106  THR A OG1   1 
ATOM   799   C  CG2   . THR A 1  106  ? 24.533  37.221  9.200    1.00 52.33  ? 106  THR A CG2   1 
ATOM   800   N  N     . ALA A 1  107  ? 20.810  37.002  11.212   1.00 55.58  ? 107  ALA A N     1 
ATOM   801   C  CA    . ALA A 1  107  ? 19.710  37.090  12.174   1.00 55.44  ? 107  ALA A CA    1 
ATOM   802   C  C     . ALA A 1  107  ? 19.772  38.384  12.977   1.00 54.41  ? 107  ALA A C     1 
ATOM   803   O  O     . ALA A 1  107  ? 18.881  38.678  13.775   1.00 52.01  ? 107  ALA A O     1 
ATOM   804   C  CB    . ALA A 1  107  ? 19.718  35.886  13.111   1.00 59.90  ? 107  ALA A CB    1 
ATOM   805   N  N     . GLY A 1  108  ? 20.833  39.154  12.761   1.00 55.30  ? 108  GLY A N     1 
ATOM   806   C  CA    . GLY A 1  108  ? 21.013  40.419  13.446   1.00 65.68  ? 108  GLY A CA    1 
ATOM   807   C  C     . GLY A 1  108  ? 20.265  41.560  12.784   1.00 66.03  ? 108  GLY A C     1 
ATOM   808   O  O     . GLY A 1  108  ? 19.975  42.571  13.425   1.00 81.18  ? 108  GLY A O     1 
ATOM   809   N  N     . ASP A 1  109  ? 19.952  41.400  11.501   1.00 61.02  ? 109  ASP A N     1 
ATOM   810   C  CA    . ASP A 1  109  ? 19.224  42.428  10.760   1.00 62.18  ? 109  ASP A CA    1 
ATOM   811   C  C     . ASP A 1  109  ? 17.722  42.337  11.015   1.00 58.86  ? 109  ASP A C     1 
ATOM   812   O  O     . ASP A 1  109  ? 16.934  43.089  10.440   1.00 57.81  ? 109  ASP A O     1 
ATOM   813   C  CB    . ASP A 1  109  ? 19.505  42.320  9.258    1.00 61.43  ? 109  ASP A CB    1 
ATOM   814   C  CG    . ASP A 1  109  ? 20.960  42.579  8.915    1.00 57.79  ? 109  ASP A CG    1 
ATOM   815   O  OD1   . ASP A 1  109  ? 21.371  43.758  8.913    1.00 56.00  ? 109  ASP A OD1   1 
ATOM   816   O  OD2   . ASP A 1  109  ? 21.689  41.604  8.640    1.00 60.14  ? 109  ASP A OD2   1 
ATOM   817   N  N     . ILE A 1  110  ? 17.334  41.403  11.877   1.00 54.77  ? 110  ILE A N     1 
ATOM   818   C  CA    . ILE A 1  110  ? 15.948  41.267  12.293   1.00 55.46  ? 110  ILE A CA    1 
ATOM   819   C  C     . ILE A 1  110  ? 15.604  42.393  13.265   1.00 58.02  ? 110  ILE A C     1 
ATOM   820   O  O     . ILE A 1  110  ? 16.472  42.863  13.997   1.00 57.88  ? 110  ILE A O     1 
ATOM   821   C  CB    . ILE A 1  110  ? 15.694  39.894  12.954   1.00 50.35  ? 110  ILE A CB    1 
ATOM   822   C  CG1   . ILE A 1  110  ? 16.257  38.771  12.082   1.00 50.46  ? 110  ILE A CG1   1 
ATOM   823   C  CG2   . ILE A 1  110  ? 14.211  39.671  13.198   1.00 56.74  ? 110  ILE A CG2   1 
ATOM   824   C  CD1   . ILE A 1  110  ? 16.009  37.387  12.636   1.00 56.15  ? 110  ILE A CD1   1 
ATOM   825   N  N     . VAL A 1  111  ? 14.351  42.838  13.258   1.00 59.99  ? 111  VAL A N     1 
ATOM   826   C  CA    . VAL A 1  111  ? 13.901  43.867  14.192   1.00 62.14  ? 111  VAL A CA    1 
ATOM   827   C  C     . VAL A 1  111  ? 12.931  43.285  15.216   1.00 65.45  ? 111  VAL A C     1 
ATOM   828   O  O     . VAL A 1  111  ? 11.714  43.324  15.022   1.00 61.48  ? 111  VAL A O     1 
ATOM   829   C  CB    . VAL A 1  111  ? 13.222  45.038  13.462   1.00 66.44  ? 111  VAL A CB    1 
ATOM   830   C  CG1   . VAL A 1  111  ? 12.962  46.189  14.427   1.00 99.26  ? 111  VAL A CG1   1 
ATOM   831   C  CG2   . VAL A 1  111  ? 14.081  45.501  12.303   1.00 77.12  ? 111  VAL A CG2   1 
ATOM   832   N  N     . PRO A 1  112  ? 13.471  42.735  16.314   1.00 71.78  ? 112  PRO A N     1 
ATOM   833   C  CA    . PRO A 1  112  ? 12.626  42.122  17.342   1.00 72.82  ? 112  PRO A CA    1 
ATOM   834   C  C     . PRO A 1  112  ? 11.899  43.162  18.187   1.00 70.94  ? 112  PRO A C     1 
ATOM   835   O  O     . PRO A 1  112  ? 12.538  44.042  18.765   1.00 73.45  ? 112  PRO A O     1 
ATOM   836   C  CB    . PRO A 1  112  ? 13.624  41.324  18.189   1.00 81.48  ? 112  PRO A CB    1 
ATOM   837   C  CG    . PRO A 1  112  ? 14.915  42.046  18.027   1.00 83.76  ? 112  PRO A CG    1 
ATOM   838   C  CD    . PRO A 1  112  ? 14.905  42.641  16.644   1.00 70.14  ? 112  PRO A CD    1 
ATOM   839   N  N     . PRO A 1  113  ? 10.565  43.063  18.254   1.00 68.78  ? 113  PRO A N     1 
ATOM   840   C  CA    . PRO A 1  113  ? 9.764   44.006  19.039   1.00 79.79  ? 113  PRO A CA    1 
ATOM   841   C  C     . PRO A 1  113  ? 9.965   43.825  20.541   1.00 84.18  ? 113  PRO A C     1 
ATOM   842   O  O     . PRO A 1  113  ? 10.883  43.121  20.968   1.00 79.50  ? 113  PRO A O     1 
ATOM   843   C  CB    . PRO A 1  113  ? 8.330   43.664  18.633   1.00 81.53  ? 113  PRO A CB    1 
ATOM   844   C  CG    . PRO A 1  113  ? 8.391   42.229  18.241   1.00 76.24  ? 113  PRO A CG    1 
ATOM   845   C  CD    . PRO A 1  113  ? 9.730   42.048  17.589   1.00 69.05  ? 113  PRO A CD    1 
ATOM   846   N  N     . ALA A 1  114  ? 9.104   44.458  21.329   1.00 94.11  ? 114  ALA A N     1 
ATOM   847   C  CA    . ALA A 1  114  ? 9.171   44.361  22.781   1.00 93.31  ? 114  ALA A CA    1 
ATOM   848   C  C     . ALA A 1  114  ? 8.947   42.928  23.254   1.00 89.11  ? 114  ALA A C     1 
ATOM   849   O  O     . ALA A 1  114  ? 8.010   42.259  22.818   1.00 84.74  ? 114  ALA A O     1 
ATOM   850   C  CB    . ALA A 1  114  ? 8.152   45.293  23.420   1.00 90.02  ? 114  ALA A CB    1 
ATOM   851   N  N     . GLY A 1  115  ? 9.818   42.462  24.143   1.00 88.75  ? 115  GLY A N     1 
ATOM   852   C  CA    . GLY A 1  115  ? 9.689   41.135  24.715   1.00 90.54  ? 115  GLY A CA    1 
ATOM   853   C  C     . GLY A 1  115  ? 10.092  40.043  23.746   1.00 85.56  ? 115  GLY A C     1 
ATOM   854   O  O     . GLY A 1  115  ? 9.636   38.903  23.850   1.00 88.81  ? 115  GLY A O     1 
ATOM   855   N  N     . VAL A 1  116  ? 10.944  40.396  22.790   1.00 79.71  ? 116  VAL A N     1 
ATOM   856   C  CA    . VAL A 1  116  ? 11.457  39.433  21.823   1.00 75.01  ? 116  VAL A CA    1 
ATOM   857   C  C     . VAL A 1  116  ? 12.956  39.626  21.645   1.00 71.80  ? 116  VAL A C     1 
ATOM   858   O  O     . VAL A 1  116  ? 13.426  40.748  21.448   1.00 75.05  ? 116  VAL A O     1 
ATOM   859   C  CB    . VAL A 1  116  ? 10.760  39.562  20.457   1.00 74.85  ? 116  VAL A CB    1 
ATOM   860   C  CG1   . VAL A 1  116  ? 11.271  38.497  19.503   1.00 73.77  ? 116  VAL A CG1   1 
ATOM   861   C  CG2   . VAL A 1  116  ? 9.245   39.460  20.612   1.00 79.71  ? 116  VAL A CG2   1 
ATOM   862   N  N     . THR A 1  117  ? 13.705  38.530  21.724   1.00 72.17  ? 117  THR A N     1 
ATOM   863   C  CA    . THR A 1  117  ? 15.160  38.586  21.631   1.00 70.59  ? 117  THR A CA    1 
ATOM   864   C  C     . THR A 1  117  ? 15.725  37.532  20.678   1.00 63.38  ? 117  THR A C     1 
ATOM   865   O  O     . THR A 1  117  ? 15.237  36.404  20.622   1.00 61.01  ? 117  THR A O     1 
ATOM   866   C  CB    . THR A 1  117  ? 15.816  38.410  23.020   1.00 71.72  ? 117  THR A CB    1 
ATOM   867   O  OG1   . THR A 1  117  ? 15.312  37.224  23.648   1.00 67.83  ? 117  THR A OG1   1 
ATOM   868   C  CG2   . THR A 1  117  ? 15.522  39.610  23.913   1.00 82.11  ? 117  THR A CG2   1 
ATOM   869   N  N     . VAL A 1  118  ? 16.754  37.921  19.928   1.00 57.01  ? 118  VAL A N     1 
ATOM   870   C  CA    . VAL A 1  118  ? 17.466  37.015  19.030   1.00 51.97  ? 118  VAL A CA    1 
ATOM   871   C  C     . VAL A 1  118  ? 18.758  36.539  19.680   1.00 50.86  ? 118  VAL A C     1 
ATOM   872   O  O     . VAL A 1  118  ? 19.682  37.323  19.873   1.00 52.31  ? 118  VAL A O     1 
ATOM   873   C  CB    . VAL A 1  118  ? 17.807  37.691  17.688   1.00 49.21  ? 118  VAL A CB    1 
ATOM   874   C  CG1   . VAL A 1  118  ? 18.460  36.693  16.739   1.00 48.42  ? 118  VAL A CG1   1 
ATOM   875   C  CG2   . VAL A 1  118  ? 16.562  38.311  17.062   1.00 47.03  ? 118  VAL A CG2   1 
ATOM   876   N  N     . HIS A 1  119  ? 18.834  35.252  19.998   1.00 50.35  ? 119  HIS A N     1 
ATOM   877   C  CA    . HIS A 1  119  ? 19.966  34.738  20.764   1.00 53.06  ? 119  HIS A CA    1 
ATOM   878   C  C     . HIS A 1  119  ? 21.176  34.355  19.919   1.00 54.09  ? 119  HIS A C     1 
ATOM   879   O  O     . HIS A 1  119  ? 22.223  34.003  20.458   1.00 60.73  ? 119  HIS A O     1 
ATOM   880   C  CB    . HIS A 1  119  ? 19.522  33.536  21.594   1.00 59.74  ? 119  HIS A CB    1 
ATOM   881   C  CG    . HIS A 1  119  ? 18.519  33.880  22.648   1.00 57.07  ? 119  HIS A CG    1 
ATOM   882   N  ND1   . HIS A 1  119  ? 18.863  34.518  23.819   1.00 58.47  ? 119  HIS A ND1   1 
ATOM   883   C  CD2   . HIS A 1  119  ? 17.181  33.682  22.704   1.00 56.99  ? 119  HIS A CD2   1 
ATOM   884   C  CE1   . HIS A 1  119  ? 17.779  34.696  24.555   1.00 61.25  ? 119  HIS A CE1   1 
ATOM   885   N  NE2   . HIS A 1  119  ? 16.746  34.198  23.901   1.00 62.42  ? 119  HIS A NE2   1 
ATOM   886   N  N     . ASN A 1  120  ? 21.037  34.413  18.601   1.00 56.53  ? 120  ASN A N     1 
ATOM   887   C  CA    . ASN A 1  120  ? 22.152  34.076  17.722   1.00 54.40  ? 120  ASN A CA    1 
ATOM   888   C  C     . ASN A 1  120  ? 22.148  34.934  16.462   1.00 54.53  ? 120  ASN A C     1 
ATOM   889   O  O     . ASN A 1  120  ? 21.637  34.531  15.417   1.00 53.90  ? 120  ASN A O     1 
ATOM   890   C  CB    . ASN A 1  120  ? 22.129  32.583  17.368   1.00 54.08  ? 120  ASN A CB    1 
ATOM   891   C  CG    . ASN A 1  120  ? 20.776  32.116  16.857   1.00 59.47  ? 120  ASN A CG    1 
ATOM   892   O  OD1   . ASN A 1  120  ? 19.799  32.868  16.864   1.00 60.14  ? 120  ASN A OD1   1 
ATOM   893   N  ND2   . ASN A 1  120  ? 20.723  30.876  16.382   1.00 57.40  ? 120  ASN A ND2   1 
ATOM   894   N  N     . PRO A 1  121  ? 22.721  36.140  16.571   1.00 55.54  ? 121  PRO A N     1 
ATOM   895   C  CA    . PRO A 1  121  ? 22.801  37.131  15.494   1.00 60.25  ? 121  PRO A CA    1 
ATOM   896   C  C     . PRO A 1  121  ? 23.679  36.693  14.320   1.00 62.71  ? 121  PRO A C     1 
ATOM   897   O  O     . PRO A 1  121  ? 23.390  37.060  13.184   1.00 61.31  ? 121  PRO A O     1 
ATOM   898   C  CB    . PRO A 1  121  ? 23.407  38.357  16.191   1.00 70.20  ? 121  PRO A CB    1 
ATOM   899   C  CG    . PRO A 1  121  ? 23.148  38.144  17.646   1.00 64.79  ? 121  PRO A CG    1 
ATOM   900   C  CD    . PRO A 1  121  ? 23.249  36.669  17.839   1.00 54.99  ? 121  PRO A CD    1 
ATOM   901   N  N     . GLY A 1  122  ? 24.724  35.916  14.586   1.00 61.10  ? 122  GLY A N     1 
ATOM   902   C  CA    . GLY A 1  122  ? 25.653  35.516  13.542   1.00 63.11  ? 122  GLY A CA    1 
ATOM   903   C  C     . GLY A 1  122  ? 25.172  34.381  12.650   1.00 75.09  ? 122  GLY A C     1 
ATOM   904   O  O     . GLY A 1  122  ? 25.981  33.708  12.011   1.00 78.13  ? 122  GLY A O     1 
ATOM   905   N  N     . MET A 1  123  ? 23.858  34.170  12.599   1.00 75.38  ? 123  MET A N     1 
ATOM   906   C  CA    . MET A 1  123  ? 23.268  33.104  11.785   1.00 65.97  ? 123  MET A CA    1 
ATOM   907   C  C     . MET A 1  123  ? 23.042  33.544  10.336   1.00 60.67  ? 123  MET A C     1 
ATOM   908   O  O     . MET A 1  123  ? 22.278  34.473  10.075   1.00 54.80  ? 123  MET A O     1 
ATOM   909   C  CB    . MET A 1  123  ? 21.942  32.640  12.400   1.00 61.05  ? 123  MET A CB    1 
ATOM   910   C  CG    . MET A 1  123  ? 21.316  31.441  11.705   1.00 57.91  ? 123  MET A CG    1 
ATOM   911   S  SD    . MET A 1  123  ? 19.590  31.172  12.163   1.00 64.15  ? 123  MET A SD    1 
ATOM   912   C  CE    . MET A 1  123  ? 18.829  32.666  11.533   1.00 49.62  ? 123  MET A CE    1 
ATOM   913   N  N     . HIS A 1  124  ? 23.712  32.870  9.402    1.00 58.23  ? 124  HIS A N     1 
ATOM   914   C  CA    . HIS A 1  124  ? 23.590  33.175  7.977    1.00 54.50  ? 124  HIS A CA    1 
ATOM   915   C  C     . HIS A 1  124  ? 22.165  32.922  7.493    1.00 48.40  ? 124  HIS A C     1 
ATOM   916   O  O     . HIS A 1  124  ? 21.620  31.839  7.687    1.00 46.84  ? 124  HIS A O     1 
ATOM   917   C  CB    . HIS A 1  124  ? 24.591  32.342  7.158    1.00 52.50  ? 124  HIS A CB    1 
ATOM   918   C  CG    . HIS A 1  124  ? 24.643  32.678  5.700    1.00 55.60  ? 124  HIS A CG    1 
ATOM   919   N  ND1   . HIS A 1  124  ? 25.558  32.124  4.829    1.00 54.66  ? 124  HIS A ND1   1 
ATOM   920   C  CD2   . HIS A 1  124  ? 23.877  33.515  4.939    1.00 51.79  ? 124  HIS A CD2   1 
ATOM   921   C  CE1   . HIS A 1  124  ? 25.367  32.597  3.616    1.00 54.12  ? 124  HIS A CE1   1 
ATOM   922   N  NE2   . HIS A 1  124  ? 24.351  33.438  3.653    1.00 51.73  ? 124  HIS A NE2   1 
ATOM   923   N  N     . ILE A 1  125  ? 21.560  33.931  6.876    1.00 43.89  ? 125  ILE A N     1 
ATOM   924   C  CA    . ILE A 1  125  ? 20.226  33.781  6.309    1.00 42.83  ? 125  ILE A CA    1 
ATOM   925   C  C     . ILE A 1  125  ? 20.294  33.697  4.790    1.00 42.86  ? 125  ILE A C     1 
ATOM   926   O  O     . ILE A 1  125  ? 19.781  32.754  4.189    1.00 43.48  ? 125  ILE A O     1 
ATOM   927   C  CB    . ILE A 1  125  ? 19.302  34.941  6.719    1.00 40.94  ? 125  ILE A CB    1 
ATOM   928   C  CG1   . ILE A 1  125  ? 18.885  34.787  8.182    1.00 41.26  ? 125  ILE A CG1   1 
ATOM   929   C  CG2   . ILE A 1  125  ? 18.069  34.993  5.828    1.00 36.32  ? 125  ILE A CG2   1 
ATOM   930   C  CD1   . ILE A 1  125  ? 17.871  35.805  8.637    1.00 48.77  ? 125  ILE A CD1   1 
ATOM   931   N  N     . ALA A 1  126  ? 20.946  34.677  4.176    1.00 42.01  ? 126  ALA A N     1 
ATOM   932   C  CA    . ALA A 1  126  ? 21.025  34.748  2.723    1.00 42.16  ? 126  ALA A CA    1 
ATOM   933   C  C     . ALA A 1  126  ? 22.297  35.451  2.267    1.00 47.49  ? 126  ALA A C     1 
ATOM   934   O  O     . ALA A 1  126  ? 22.946  36.146  3.046    1.00 45.07  ? 126  ALA A O     1 
ATOM   935   C  CB    . ALA A 1  126  ? 19.802  35.459  2.166    1.00 37.25  ? 126  ALA A CB    1 
ATOM   936   N  N     . THR A 1  127  ? 22.648  35.257  1.000    1.00 46.33  ? 127  THR A N     1 
ATOM   937   C  CA    . THR A 1  127  ? 23.790  35.940  0.401    1.00 50.05  ? 127  THR A CA    1 
ATOM   938   C  C     . THR A 1  127  ? 23.301  36.964  -0.621   1.00 49.47  ? 127  THR A C     1 
ATOM   939   O  O     . THR A 1  127  ? 23.264  36.683  -1.818   1.00 49.08  ? 127  THR A O     1 
ATOM   940   C  CB    . THR A 1  127  ? 24.759  34.947  -0.288   1.00 49.41  ? 127  THR A CB    1 
ATOM   941   O  OG1   . THR A 1  127  ? 25.101  33.889  0.617    1.00 46.55  ? 127  THR A OG1   1 
ATOM   942   C  CG2   . THR A 1  127  ? 26.034  35.656  -0.740   1.00 54.06  ? 127  THR A CG2   1 
ATOM   943   N  N     . LEU A 1  128  ? 22.912  38.146  -0.150   1.00 51.05  ? 128  LEU A N     1 
ATOM   944   C  CA    . LEU A 1  128  ? 22.419  39.189  -1.046   1.00 53.84  ? 128  LEU A CA    1 
ATOM   945   C  C     . LEU A 1  128  ? 23.519  39.689  -1.974   1.00 55.27  ? 128  LEU A C     1 
ATOM   946   O  O     . LEU A 1  128  ? 24.509  40.265  -1.525   1.00 58.60  ? 128  LEU A O     1 
ATOM   947   C  CB    . LEU A 1  128  ? 21.835  40.363  -0.253   1.00 53.84  ? 128  LEU A CB    1 
ATOM   948   C  CG    . LEU A 1  128  ? 20.325  40.352  0.007    1.00 56.57  ? 128  LEU A CG    1 
ATOM   949   C  CD1   . LEU A 1  128  ? 19.976  39.478  1.207    1.00 66.80  ? 128  LEU A CD1   1 
ATOM   950   C  CD2   . LEU A 1  128  ? 19.786  41.763  0.187    1.00 53.38  ? 128  LEU A CD2   1 
ATOM   951   N  N     . ASN A 1  129  ? 23.340  39.459  -3.270   1.00 54.65  ? 129  ASN A N     1 
ATOM   952   C  CA    . ASN A 1  129  ? 24.281  39.940  -4.273   1.00 66.34  ? 129  ASN A CA    1 
ATOM   953   C  C     . ASN A 1  129  ? 23.938  41.378  -4.652   1.00 61.21  ? 129  ASN A C     1 
ATOM   954   O  O     . ASN A 1  129  ? 22.964  41.939  -4.149   1.00 59.34  ? 129  ASN A O     1 
ATOM   955   C  CB    . ASN A 1  129  ? 24.264  39.024  -5.508   1.00 66.74  ? 129  ASN A CB    1 
ATOM   956   C  CG    . ASN A 1  129  ? 25.390  39.327  -6.490   1.00 72.29  ? 129  ASN A CG    1 
ATOM   957   O  OD1   . ASN A 1  129  ? 26.235  40.185  -6.237   1.00 82.65  ? 129  ASN A OD1   1 
ATOM   958   N  ND2   . ASN A 1  129  ? 25.402  38.622  -7.616   1.00 60.52  ? 129  ASN A ND2   1 
ATOM   959   N  N     . ASP A 1  130  ? 24.748  41.972  -5.524   1.00 65.08  ? 130  ASP A N     1 
ATOM   960   C  CA    . ASP A 1  130  ? 24.455  43.280  -6.090   1.00 65.28  ? 130  ASP A CA    1 
ATOM   961   C  C     . ASP A 1  130  ? 23.035  43.270  -6.646   1.00 64.62  ? 130  ASP A C     1 
ATOM   962   O  O     . ASP A 1  130  ? 22.568  42.234  -7.117   1.00 59.49  ? 130  ASP A O     1 
ATOM   963   C  CB    . ASP A 1  130  ? 25.468  43.631  -7.185   1.00 72.97  ? 130  ASP A CB    1 
ATOM   964   C  CG    . ASP A 1  130  ? 25.779  45.113  -7.244   1.00 80.60  ? 130  ASP A CG    1 
ATOM   965   O  OD1   . ASP A 1  130  ? 24.855  45.925  -7.034   1.00 86.05  ? 130  ASP A OD1   1 
ATOM   966   O  OD2   . ASP A 1  130  ? 26.952  45.467  -7.497   1.00 88.31  ? 130  ASP A OD2   1 
ATOM   967   N  N     . LYS A 1  131  ? 22.356  44.412  -6.544   1.00 62.31  ? 131  LYS A N     1 
ATOM   968   C  CA    . LYS A 1  131  ? 20.975  44.606  -7.005   1.00 66.67  ? 131  LYS A CA    1 
ATOM   969   C  C     . LYS A 1  131  ? 19.959  43.767  -6.219   1.00 60.38  ? 131  LYS A C     1 
ATOM   970   O  O     . LYS A 1  131  ? 18.762  43.788  -6.512   1.00 64.15  ? 131  LYS A O     1 
ATOM   971   C  CB    . LYS A 1  131  ? 20.863  44.324  -8.516   1.00 68.59  ? 131  LYS A CB    1 
ATOM   972   C  CG    . LYS A 1  131  ? 20.360  42.937  -8.918   1.00 59.26  ? 131  LYS A CG    1 
ATOM   973   C  CD    . LYS A 1  131  ? 20.708  42.628  -10.365  1.00 58.96  ? 131  LYS A CD    1 
ATOM   974   C  CE    . LYS A 1  131  ? 22.204  42.753  -10.601  1.00 57.75  ? 131  LYS A CE    1 
ATOM   975   N  NZ    . LYS A 1  131  ? 22.569  42.553  -12.030  1.00 61.68  ? 131  LYS A NZ    1 
ATOM   976   N  N     . GLY A 1  132  ? 20.428  43.066  -5.192   1.00 59.17  ? 132  GLY A N     1 
ATOM   977   C  CA    . GLY A 1  132  ? 19.551  42.246  -4.375   1.00 55.28  ? 132  GLY A CA    1 
ATOM   978   C  C     . GLY A 1  132  ? 18.850  43.011  -3.266   1.00 56.95  ? 132  GLY A C     1 
ATOM   979   O  O     . GLY A 1  132  ? 19.483  43.735  -2.497   1.00 60.97  ? 132  GLY A O     1 
ATOM   980   N  N     . LYS A 1  133  ? 17.533  42.856  -3.187   1.00 52.44  ? 133  LYS A N     1 
ATOM   981   C  CA    . LYS A 1  133  ? 16.760  43.470  -2.113   1.00 53.89  ? 133  LYS A CA    1 
ATOM   982   C  C     . LYS A 1  133  ? 15.837  42.444  -1.471   1.00 51.01  ? 133  LYS A C     1 
ATOM   983   O  O     . LYS A 1  133  ? 15.173  41.677  -2.164   1.00 48.25  ? 133  LYS A O     1 
ATOM   984   C  CB    . LYS A 1  133  ? 15.940  44.655  -2.623   1.00 59.38  ? 133  LYS A CB    1 
ATOM   985   C  CG    . LYS A 1  133  ? 15.079  45.288  -1.537   1.00 68.85  ? 133  LYS A CG    1 
ATOM   986   C  CD    . LYS A 1  133  ? 13.862  45.989  -2.106   1.00 85.71  ? 133  LYS A CD    1 
ATOM   987   C  CE    . LYS A 1  133  ? 12.807  46.185  -1.027   1.00 83.43  ? 133  LYS A CE    1 
ATOM   988   N  NZ    . LYS A 1  133  ? 13.385  46.798  0.207    1.00 78.59  ? 133  LYS A NZ    1 
ATOM   989   N  N     . LEU A 1  134  ? 15.789  42.438  -0.145   1.00 52.50  ? 134  LEU A N     1 
ATOM   990   C  CA    . LEU A 1  134  ? 15.009  41.441  0.571    1.00 47.85  ? 134  LEU A CA    1 
ATOM   991   C  C     . LEU A 1  134  ? 14.226  42.056  1.720    1.00 46.32  ? 134  LEU A C     1 
ATOM   992   O  O     . LEU A 1  134  ? 14.796  42.473  2.728    1.00 46.65  ? 134  LEU A O     1 
ATOM   993   C  CB    . LEU A 1  134  ? 15.924  40.333  1.089    1.00 49.34  ? 134  LEU A CB    1 
ATOM   994   C  CG    . LEU A 1  134  ? 15.257  39.092  1.676    1.00 51.35  ? 134  LEU A CG    1 
ATOM   995   C  CD1   . LEU A 1  134  ? 14.260  38.483  0.696    1.00 54.71  ? 134  LEU A CD1   1 
ATOM   996   C  CD2   . LEU A 1  134  ? 16.321  38.080  2.054    1.00 51.86  ? 134  LEU A CD2   1 
ATOM   997   N  N     . GLU A 1  135  ? 12.910  42.105  1.556    1.00 46.88  ? 135  GLU A N     1 
ATOM   998   C  CA    . GLU A 1  135  ? 12.032  42.662  2.571    1.00 50.77  ? 135  GLU A CA    1 
ATOM   999   C  C     . GLU A 1  135  ? 11.168  41.565  3.180    1.00 50.72  ? 135  GLU A C     1 
ATOM   1000  O  O     . GLU A 1  135  ? 10.205  41.112  2.562    1.00 47.43  ? 135  GLU A O     1 
ATOM   1001  C  CB    . GLU A 1  135  ? 11.165  43.764  1.969    1.00 58.86  ? 135  GLU A CB    1 
ATOM   1002  C  CG    . GLU A 1  135  ? 10.175  44.381  2.932    1.00 71.83  ? 135  GLU A CG    1 
ATOM   1003  C  CD    . GLU A 1  135  ? 9.406   45.524  2.300    1.00 77.22  ? 135  GLU A CD    1 
ATOM   1004  O  OE1   . GLU A 1  135  ? 8.159   45.511  2.369    1.00 84.69  ? 135  GLU A OE1   1 
ATOM   1005  O  OE2   . GLU A 1  135  ? 10.049  46.431  1.729    1.00 75.14  ? 135  GLU A OE2   1 
ATOM   1006  N  N     . VAL A 1  136  ? 11.520  41.142  4.392    1.00 56.35  ? 136  VAL A N     1 
ATOM   1007  C  CA    . VAL A 1  136  ? 10.872  40.000  5.036    1.00 57.89  ? 136  VAL A CA    1 
ATOM   1008  C  C     . VAL A 1  136  ? 9.996   40.394  6.227    1.00 56.64  ? 136  VAL A C     1 
ATOM   1009  O  O     . VAL A 1  136  ? 10.091  41.506  6.746    1.00 59.89  ? 136  VAL A O     1 
ATOM   1010  C  CB    . VAL A 1  136  ? 11.914  38.973  5.523    1.00 52.95  ? 136  VAL A CB    1 
ATOM   1011  C  CG1   . VAL A 1  136  ? 11.339  37.564  5.474    1.00 45.78  ? 136  VAL A CG1   1 
ATOM   1012  C  CG2   . VAL A 1  136  ? 13.164  39.052  4.672    1.00 55.42  ? 136  VAL A CG2   1 
ATOM   1013  N  N     . GLU A 1  137  ? 9.153   39.458  6.657    1.00 53.26  ? 137  GLU A N     1 
ATOM   1014  C  CA    . GLU A 1  137  ? 8.209   39.671  7.748    1.00 55.97  ? 137  GLU A CA    1 
ATOM   1015  C  C     . GLU A 1  137  ? 7.918   38.346  8.448    1.00 53.43  ? 137  GLU A C     1 
ATOM   1016  O  O     . GLU A 1  137  ? 7.440   37.406  7.816    1.00 52.91  ? 137  GLU A O     1 
ATOM   1017  C  CB    . GLU A 1  137  ? 6.922   40.294  7.213    1.00 66.09  ? 137  GLU A CB    1 
ATOM   1018  C  CG    . GLU A 1  137  ? 5.878   40.598  8.270    1.00 70.08  ? 137  GLU A CG    1 
ATOM   1019  C  CD    . GLU A 1  137  ? 4.672   41.322  7.691    1.00 71.79  ? 137  GLU A CD    1 
ATOM   1020  O  OE1   . GLU A 1  137  ? 4.790   41.874  6.576    1.00 69.31  ? 137  GLU A OE1   1 
ATOM   1021  O  OE2   . GLU A 1  137  ? 3.606   41.331  8.344    1.00 72.73  ? 137  GLU A OE2   1 
ATOM   1022  N  N     . LEU A 1  138  ? 8.208   38.273  9.745    1.00 53.57  ? 138  LEU A N     1 
ATOM   1023  C  CA    . LEU A 1  138  ? 8.156   37.002  10.469   1.00 53.25  ? 138  LEU A CA    1 
ATOM   1024  C  C     . LEU A 1  138  ? 7.256   37.038  11.714   1.00 52.20  ? 138  LEU A C     1 
ATOM   1025  O  O     . LEU A 1  138  ? 7.247   38.016  12.461   1.00 54.08  ? 138  LEU A O     1 
ATOM   1026  C  CB    . LEU A 1  138  ? 9.574   36.573  10.867   1.00 54.02  ? 138  LEU A CB    1 
ATOM   1027  C  CG    . LEU A 1  138  ? 10.610  36.350  9.755    1.00 51.55  ? 138  LEU A CG    1 
ATOM   1028  C  CD1   . LEU A 1  138  ? 11.268  37.650  9.290    1.00 49.50  ? 138  LEU A CD1   1 
ATOM   1029  C  CD2   . LEU A 1  138  ? 11.670  35.344  10.193   1.00 49.29  ? 138  LEU A CD2   1 
ATOM   1030  N  N     . VAL A 1  139  ? 6.505   35.959  11.929   1.00 48.82  ? 139  VAL A N     1 
ATOM   1031  C  CA    . VAL A 1  139  ? 5.596   35.856  13.070   1.00 46.74  ? 139  VAL A CA    1 
ATOM   1032  C  C     . VAL A 1  139  ? 6.087   34.821  14.078   1.00 48.94  ? 139  VAL A C     1 
ATOM   1033  O  O     . VAL A 1  139  ? 6.349   33.672  13.721   1.00 48.12  ? 139  VAL A O     1 
ATOM   1034  C  CB    . VAL A 1  139  ? 4.168   35.480  12.625   1.00 41.09  ? 139  VAL A CB    1 
ATOM   1035  C  CG1   . VAL A 1  139  ? 3.285   35.197  13.834   1.00 42.20  ? 139  VAL A CG1   1 
ATOM   1036  C  CG2   . VAL A 1  139  ? 3.573   36.581  11.777   1.00 45.33  ? 139  VAL A CG2   1 
ATOM   1037  N  N     . VAL A 1  140  ? 6.217   35.238  15.334   1.00 54.75  ? 140  VAL A N     1 
ATOM   1038  C  CA    . VAL A 1  140  ? 6.658   34.346  16.404   1.00 56.63  ? 140  VAL A CA    1 
ATOM   1039  C  C     . VAL A 1  140  ? 5.584   34.214  17.483   1.00 60.36  ? 140  VAL A C     1 
ATOM   1040  O  O     . VAL A 1  140  ? 4.976   35.203  17.890   1.00 66.43  ? 140  VAL A O     1 
ATOM   1041  C  CB    . VAL A 1  140  ? 7.973   34.844  17.051   1.00 55.28  ? 140  VAL A CB    1 
ATOM   1042  C  CG1   . VAL A 1  140  ? 8.358   33.978  18.245   1.00 53.57  ? 140  VAL A CG1   1 
ATOM   1043  C  CG2   . VAL A 1  140  ? 9.098   34.872  16.022   1.00 59.92  ? 140  VAL A CG2   1 
ATOM   1044  N  N     . GLU A 1  141  ? 5.343   32.987  17.933   1.00 59.30  ? 141  GLU A N     1 
ATOM   1045  C  CA    . GLU A 1  141  ? 4.381   32.742  18.999   1.00 58.33  ? 141  GLU A CA    1 
ATOM   1046  C  C     . GLU A 1  141  ? 4.994   31.865  20.078   1.00 55.27  ? 141  GLU A C     1 
ATOM   1047  O  O     . GLU A 1  141  ? 6.126   31.400  19.947   1.00 51.20  ? 141  GLU A O     1 
ATOM   1048  C  CB    . GLU A 1  141  ? 3.116   32.084  18.449   1.00 62.16  ? 141  GLU A CB    1 
ATOM   1049  C  CG    . GLU A 1  141  ? 2.426   32.863  17.339   1.00 68.32  ? 141  GLU A CG    1 
ATOM   1050  C  CD    . GLU A 1  141  ? 1.223   32.124  16.765   1.00 71.64  ? 141  GLU A CD    1 
ATOM   1051  O  OE1   . GLU A 1  141  ? 0.825   31.089  17.346   1.00 71.85  ? 141  GLU A OE1   1 
ATOM   1052  O  OE2   . GLU A 1  141  ? 0.684   32.577  15.731   1.00 76.20  ? 141  GLU A OE2   1 
ATOM   1053  N  N     . ARG A 1  142  ? 4.243   31.656  21.153   1.00 59.26  ? 142  ARG A N     1 
ATOM   1054  C  CA    . ARG A 1  142  ? 4.676   30.761  22.216   1.00 63.15  ? 142  ARG A CA    1 
ATOM   1055  C  C     . ARG A 1  142  ? 3.906   29.439  22.151   1.00 68.45  ? 142  ARG A C     1 
ATOM   1056  O  O     . ARG A 1  142  ? 2.685   29.427  21.989   1.00 72.40  ? 142  ARG A O     1 
ATOM   1057  C  CB    . ARG A 1  142  ? 4.498   31.418  23.591   1.00 69.55  ? 142  ARG A CB    1 
ATOM   1058  C  CG    . ARG A 1  142  ? 5.489   32.537  23.890   1.00 69.18  ? 142  ARG A CG    1 
ATOM   1059  C  CD    . ARG A 1  142  ? 5.462   32.943  25.364   1.00 74.92  ? 142  ARG A CD    1 
ATOM   1060  N  NE    . ARG A 1  142  ? 5.902   31.874  26.262   1.00 70.22  ? 142  ARG A NE    1 
ATOM   1061  C  CZ    . ARG A 1  142  ? 7.160   31.685  26.651   1.00 60.63  ? 142  ARG A CZ    1 
ATOM   1062  N  NH1   . ARG A 1  142  ? 8.119   32.491  26.217   1.00 61.31  ? 142  ARG A NH1   1 
ATOM   1063  N  NH2   . ARG A 1  142  ? 7.462   30.687  27.473   1.00 54.15  ? 142  ARG A NH2   1 
ATOM   1064  N  N     . GLY A 1  143  ? 4.630   28.330  22.266   1.00 64.87  ? 143  GLY A N     1 
ATOM   1065  C  CA    . GLY A 1  143  ? 4.033   27.005  22.239   1.00 61.33  ? 143  GLY A CA    1 
ATOM   1066  C  C     . GLY A 1  143  ? 4.993   25.978  22.806   1.00 61.54  ? 143  GLY A C     1 
ATOM   1067  O  O     . GLY A 1  143  ? 5.978   26.339  23.450   1.00 61.51  ? 143  GLY A O     1 
ATOM   1068  N  N     . ARG A 1  144  ? 4.719   24.699  22.570   1.00 63.06  ? 144  ARG A N     1 
ATOM   1069  C  CA    . ARG A 1  144  ? 5.601   23.648  23.065   1.00 62.48  ? 144  ARG A CA    1 
ATOM   1070  C  C     . ARG A 1  144  ? 5.757   22.504  22.072   1.00 61.78  ? 144  ARG A C     1 
ATOM   1071  O  O     . ARG A 1  144  ? 4.884   22.262  21.238   1.00 59.25  ? 144  ARG A O     1 
ATOM   1072  C  CB    . ARG A 1  144  ? 5.090   23.106  24.400   1.00 64.69  ? 144  ARG A CB    1 
ATOM   1073  C  CG    . ARG A 1  144  ? 3.743   22.416  24.318   1.00 66.78  ? 144  ARG A CG    1 
ATOM   1074  C  CD    . ARG A 1  144  ? 3.351   21.833  25.660   1.00 67.75  ? 144  ARG A CD    1 
ATOM   1075  N  NE    . ARG A 1  144  ? 1.968   21.369  25.663   1.00 70.84  ? 144  ARG A NE    1 
ATOM   1076  C  CZ    . ARG A 1  144  ? 0.921   22.154  25.893   1.00 80.86  ? 144  ARG A CZ    1 
ATOM   1077  N  NH1   . ARG A 1  144  ? 1.098   23.447  26.135   1.00 88.95  ? 144  ARG A NH1   1 
ATOM   1078  N  NH2   . ARG A 1  144  ? -0.304  21.649  25.878   1.00 84.77  ? 144  ARG A NH2   1 
ATOM   1079  N  N     . GLY A 1  145  ? 6.884   21.806  22.173   1.00 63.67  ? 145  GLY A N     1 
ATOM   1080  C  CA    . GLY A 1  145  ? 7.146   20.633  21.359   1.00 62.38  ? 145  GLY A CA    1 
ATOM   1081  C  C     . GLY A 1  145  ? 7.320   20.916  19.880   1.00 59.66  ? 145  GLY A C     1 
ATOM   1082  O  O     . GLY A 1  145  ? 8.061   21.820  19.491   1.00 57.68  ? 145  GLY A O     1 
ATOM   1083  N  N     . TYR A 1  146  ? 6.625   20.135  19.056   1.00 61.70  ? 146  TYR A N     1 
ATOM   1084  C  CA    . TYR A 1  146  ? 6.702   20.264  17.603   1.00 60.62  ? 146  TYR A CA    1 
ATOM   1085  C  C     . TYR A 1  146  ? 5.322   20.477  16.973   1.00 56.67  ? 146  TYR A C     1 
ATOM   1086  O  O     . TYR A 1  146  ? 4.397   19.696  17.196   1.00 54.44  ? 146  TYR A O     1 
ATOM   1087  C  CB    . TYR A 1  146  ? 7.379   19.027  16.999   1.00 56.40  ? 146  TYR A CB    1 
ATOM   1088  C  CG    . TYR A 1  146  ? 7.284   18.936  15.491   1.00 55.17  ? 146  TYR A CG    1 
ATOM   1089  C  CD1   . TYR A 1  146  ? 7.900   19.877  14.677   1.00 54.41  ? 146  TYR A CD1   1 
ATOM   1090  C  CD2   . TYR A 1  146  ? 6.586   17.900  14.882   1.00 51.52  ? 146  TYR A CD2   1 
ATOM   1091  C  CE1   . TYR A 1  146  ? 7.815   19.795  13.298   1.00 53.52  ? 146  TYR A CE1   1 
ATOM   1092  C  CE2   . TYR A 1  146  ? 6.498   17.808  13.504   1.00 50.32  ? 146  TYR A CE2   1 
ATOM   1093  C  CZ    . TYR A 1  146  ? 7.113   18.759  12.717   1.00 55.16  ? 146  TYR A CZ    1 
ATOM   1094  O  OH    . TYR A 1  146  ? 7.026   18.672  11.344   1.00 52.66  ? 146  TYR A OH    1 
ATOM   1095  N  N     . VAL A 1  147  ? 5.195   21.545  16.191   1.00 55.18  ? 147  VAL A N     1 
ATOM   1096  C  CA    . VAL A 1  147  ? 3.941   21.871  15.515   1.00 53.56  ? 147  VAL A CA    1 
ATOM   1097  C  C     . VAL A 1  147  ? 4.156   22.118  14.021   1.00 54.32  ? 147  VAL A C     1 
ATOM   1098  O  O     . VAL A 1  147  ? 4.810   23.086  13.638   1.00 55.46  ? 147  VAL A O     1 
ATOM   1099  C  CB    . VAL A 1  147  ? 3.271   23.116  16.135   1.00 60.82  ? 147  VAL A CB    1 
ATOM   1100  C  CG1   . VAL A 1  147  ? 2.029   23.504  15.340   1.00 68.28  ? 147  VAL A CG1   1 
ATOM   1101  C  CG2   . VAL A 1  147  ? 2.924   22.871  17.598   1.00 65.65  ? 147  VAL A CG2   1 
ATOM   1102  N  N     . PRO A 1  148  ? 3.595   21.239  13.174   1.00 56.52  ? 148  PRO A N     1 
ATOM   1103  C  CA    . PRO A 1  148  ? 3.729   21.275  11.711   1.00 58.16  ? 148  PRO A CA    1 
ATOM   1104  C  C     . PRO A 1  148  ? 3.269   22.589  11.068   1.00 63.31  ? 148  PRO A C     1 
ATOM   1105  O  O     . PRO A 1  148  ? 2.408   23.284  11.607   1.00 65.86  ? 148  PRO A O     1 
ATOM   1106  C  CB    . PRO A 1  148  ? 2.837   20.114  11.254   1.00 63.46  ? 148  PRO A CB    1 
ATOM   1107  C  CG    . PRO A 1  148  ? 2.797   19.187  12.419   1.00 64.53  ? 148  PRO A CG    1 
ATOM   1108  C  CD    . PRO A 1  148  ? 2.800   20.082  13.622   1.00 62.50  ? 148  PRO A CD    1 
ATOM   1109  N  N     . ALA A 1  149  ? 3.845   22.910  9.913    1.00 62.66  ? 149  ALA A N     1 
ATOM   1110  C  CA    . ALA A 1  149  ? 3.530   24.146  9.202    1.00 67.64  ? 149  ALA A CA    1 
ATOM   1111  C  C     . ALA A 1  149  ? 2.108   24.137  8.662    1.00 73.71  ? 149  ALA A C     1 
ATOM   1112  O  O     . ALA A 1  149  ? 1.373   25.116  8.792    1.00 73.27  ? 149  ALA A O     1 
ATOM   1113  C  CB    . ALA A 1  149  ? 4.513   24.361  8.062    1.00 66.30  ? 149  ALA A CB    1 
ATOM   1114  N  N     . VAL A 1  150  ? 1.731   23.008  8.071    1.00 76.25  ? 150  VAL A N     1 
ATOM   1115  C  CA    . VAL A 1  150  ? 0.494   22.864  7.303    1.00 87.56  ? 150  VAL A CA    1 
ATOM   1116  C  C     . VAL A 1  150  ? -0.783  23.346  8.003    1.00 88.51  ? 150  VAL A C     1 
ATOM   1117  O  O     . VAL A 1  150  ? -1.813  23.547  7.358    1.00 90.85  ? 150  VAL A O     1 
ATOM   1118  C  CB    . VAL A 1  150  ? 0.293   21.388  6.902    1.00 95.45  ? 150  VAL A CB    1 
ATOM   1119  C  CG1   . VAL A 1  150  ? 1.446   20.920  6.023    1.00 92.55  ? 150  VAL A CG1   1 
ATOM   1120  C  CG2   . VAL A 1  150  ? 0.177   20.514  8.140    1.00 101.36 ? 150  VAL A CG2   1 
ATOM   1121  N  N     . GLN A 1  151  ? -0.709  23.548  9.314    1.00 87.20  ? 151  GLN A N     1 
ATOM   1122  C  CA    . GLN A 1  151  ? -1.889  23.870  10.108   1.00 98.16  ? 151  GLN A CA    1 
ATOM   1123  C  C     . GLN A 1  151  ? -2.344  25.324  9.964    1.00 92.49  ? 151  GLN A C     1 
ATOM   1124  O  O     . GLN A 1  151  ? -3.532  25.623  10.091   1.00 106.12 ? 151  GLN A O     1 
ATOM   1125  C  CB    . GLN A 1  151  ? -1.624  23.556  11.580   1.00 102.96 ? 151  GLN A CB    1 
ATOM   1126  C  CG    . GLN A 1  151  ? -1.190  22.122  11.832   1.00 99.80  ? 151  GLN A CG    1 
ATOM   1127  C  CD    . GLN A 1  151  ? -1.098  21.796  13.307   1.00 102.47 ? 151  GLN A CD    1 
ATOM   1128  O  OE1   . GLN A 1  151  ? -1.265  22.671  14.157   1.00 116.69 ? 151  GLN A OE1   1 
ATOM   1129  N  NE2   . GLN A 1  151  ? -0.838  20.531  13.621   1.00 89.30  ? 151  GLN A NE2   1 
ATOM   1130  N  N     . ASN A 1  152  ? -1.401  26.221  9.693    1.00 86.56  ? 152  ASN A N     1 
ATOM   1131  C  CA    . ASN A 1  152  ? -1.698  27.649  9.610    1.00 94.19  ? 152  ASN A CA    1 
ATOM   1132  C  C     . ASN A 1  152  ? -2.537  28.015  8.387    1.00 90.86  ? 152  ASN A C     1 
ATOM   1133  O  O     . ASN A 1  152  ? -3.299  28.981  8.407    1.00 99.90  ? 152  ASN A O     1 
ATOM   1134  C  CB    . ASN A 1  152  ? -0.394  28.450  9.601    1.00 103.96 ? 152  ASN A CB    1 
ATOM   1135  C  CG    . ASN A 1  152  ? -0.626  29.952  9.559    1.00 121.71 ? 152  ASN A CG    1 
ATOM   1136  O  OD1   . ASN A 1  152  ? -0.814  30.535  8.489    1.00 124.16 ? 152  ASN A OD1   1 
ATOM   1137  N  ND2   . ASN A 1  152  ? -0.600  30.587  10.728   1.00 116.06 ? 152  ASN A ND2   1 
ATOM   1138  N  N     . ARG A 1  153  ? -2.405  27.216  7.335    1.00 81.58  ? 153  ARG A N     1 
ATOM   1139  C  CA    . ARG A 1  153  ? -2.989  27.515  6.032    1.00 79.64  ? 153  ARG A CA    1 
ATOM   1140  C  C     . ARG A 1  153  ? -4.519  27.594  6.014    1.00 78.49  ? 153  ARG A C     1 
ATOM   1141  O  O     . ARG A 1  153  ? -5.093  28.455  5.345    1.00 78.37  ? 153  ARG A O     1 
ATOM   1142  C  CB    . ARG A 1  153  ? -2.519  26.460  5.030    1.00 76.44  ? 153  ARG A CB    1 
ATOM   1143  C  CG    . ARG A 1  153  ? -3.119  26.571  3.642    1.00 72.42  ? 153  ARG A CG    1 
ATOM   1144  C  CD    . ARG A 1  153  ? -2.591  25.463  2.748    1.00 68.48  ? 153  ARG A CD    1 
ATOM   1145  N  NE    . ARG A 1  153  ? -1.151  25.573  2.526    1.00 79.60  ? 153  ARG A NE    1 
ATOM   1146  C  CZ    . ARG A 1  153  ? -0.237  24.832  3.148    1.00 84.82  ? 153  ARG A CZ    1 
ATOM   1147  N  NH1   . ARG A 1  153  ? -0.616  23.918  4.031    1.00 87.62  ? 153  ARG A NH1   1 
ATOM   1148  N  NH2   . ARG A 1  153  ? 1.053   25.001  2.883    1.00 74.60  ? 153  ARG A NH2   1 
ATOM   1149  N  N     . ALA A 1  154  ? -5.173  26.704  6.753    1.00 83.34  ? 154  ALA A N     1 
ATOM   1150  C  CA    . ALA A 1  154  ? -6.622  26.536  6.648    1.00 84.43  ? 154  ALA A CA    1 
ATOM   1151  C  C     . ALA A 1  154  ? -7.430  27.473  7.547    1.00 84.78  ? 154  ALA A C     1 
ATOM   1152  O  O     . ALA A 1  154  ? -8.661  27.435  7.535    1.00 89.62  ? 154  ALA A O     1 
ATOM   1153  C  CB    . ALA A 1  154  ? -6.996  25.094  6.947    1.00 88.66  ? 154  ALA A CB    1 
ATOM   1154  N  N     . SER A 1  155  ? -6.745  28.309  8.321    1.00 81.40  ? 155  SER A N     1 
ATOM   1155  C  CA    . SER A 1  155  ? -7.424  29.252  9.207    1.00 80.65  ? 155  SER A CA    1 
ATOM   1156  C  C     . SER A 1  155  ? -8.152  30.333  8.422    1.00 84.73  ? 155  SER A C     1 
ATOM   1157  O  O     . SER A 1  155  ? -9.103  30.943  8.913    1.00 88.22  ? 155  SER A O     1 
ATOM   1158  C  CB    . SER A 1  155  ? -6.426  29.900  10.167   1.00 75.98  ? 155  SER A CB    1 
ATOM   1159  O  OG    . SER A 1  155  ? -5.879  28.939  11.048   1.00 77.04  ? 155  SER A OG    1 
ATOM   1160  N  N     . GLY A 1  156  ? -7.694  30.561  7.196    1.00 82.95  ? 156  GLY A N     1 
ATOM   1161  C  CA    . GLY A 1  156  ? -8.201  31.635  6.366    1.00 80.76  ? 156  GLY A CA    1 
ATOM   1162  C  C     . GLY A 1  156  ? -7.062  32.577  6.038    1.00 76.87  ? 156  GLY A C     1 
ATOM   1163  O  O     . GLY A 1  156  ? -7.279  33.715  5.613    1.00 77.48  ? 156  GLY A O     1 
ATOM   1164  N  N     . ALA A 1  157  ? -5.842  32.090  6.251    1.00 75.01  ? 157  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1  157  ? -4.635  32.876  6.025    1.00 69.81  ? 157  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1  157  ? -4.582  33.386  4.595    1.00 68.81  ? 157  ALA A C     1 
ATOM   1167  O  O     . ALA A 1  157  ? -4.756  32.620  3.647    1.00 76.78  ? 157  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1  157  ? -3.393  32.053  6.342    1.00 66.15  ? 157  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1  158  ? -4.358  34.689  4.456    1.00 61.16  ? 158  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1  158  ? -4.246  35.333  3.153    1.00 58.36  ? 158  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1  158  ? -3.178  34.666  2.289    1.00 55.87  ? 158  GLU A C     1 
ATOM   1172  O  O     . GLU A 1  158  ? -2.214  34.100  2.802    1.00 56.35  ? 158  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1  158  ? -3.931  36.820  3.322    1.00 58.23  ? 158  GLU A CB    1 
ATOM   1174  N  N     . ILE A 1  159  ? -3.356  34.751  0.974    1.00 50.87  ? 159  ILE A N     1 
ATOM   1175  C  CA    . ILE A 1  159  ? -2.529  34.021  0.018    1.00 46.59  ? 159  ILE A CA    1 
ATOM   1176  C  C     . ILE A 1  159  ? -1.056  34.438  0.055    1.00 42.27  ? 159  ILE A C     1 
ATOM   1177  O  O     . ILE A 1  159  ? -0.185  33.714  -0.427   1.00 39.45  ? 159  ILE A O     1 
ATOM   1178  C  CB    . ILE A 1  159  ? -3.079  34.202  -1.409   1.00 44.52  ? 159  ILE A CB    1 
ATOM   1179  C  CG1   . ILE A 1  159  ? -4.612  34.190  -1.378   1.00 45.87  ? 159  ILE A CG1   1 
ATOM   1180  C  CG2   . ILE A 1  159  ? -2.519  33.137  -2.340   1.00 40.89  ? 159  ILE A CG2   1 
ATOM   1181  C  CD1   . ILE A 1  159  ? -5.260  33.427  -2.514   1.00 50.56  ? 159  ILE A CD1   1 
ATOM   1182  N  N     . GLY A 1  160  ? -0.775  35.595  0.641    1.00 44.08  ? 160  GLY A N     1 
ATOM   1183  C  CA    . GLY A 1  160  ? 0.592   36.072  0.746    1.00 44.41  ? 160  GLY A CA    1 
ATOM   1184  C  C     . GLY A 1  160  ? 1.412   35.326  1.781    1.00 44.02  ? 160  GLY A C     1 
ATOM   1185  O  O     . GLY A 1  160  ? 2.632   35.228  1.660    1.00 42.94  ? 160  GLY A O     1 
ATOM   1186  N  N     . ARG A 1  161  ? 0.739   34.787  2.794    1.00 44.02  ? 161  ARG A N     1 
ATOM   1187  C  CA    . ARG A 1  161  ? 1.418   34.143  3.916    1.00 44.30  ? 161  ARG A CA    1 
ATOM   1188  C  C     . ARG A 1  161  ? 1.868   32.721  3.618    1.00 41.23  ? 161  ARG A C     1 
ATOM   1189  O  O     . ARG A 1  161  ? 1.148   31.950  2.989    1.00 42.97  ? 161  ARG A O     1 
ATOM   1190  C  CB    . ARG A 1  161  ? 0.513   34.147  5.147    1.00 44.96  ? 161  ARG A CB    1 
ATOM   1191  C  CG    . ARG A 1  161  ? 0.856   35.234  6.150    1.00 45.16  ? 161  ARG A CG    1 
ATOM   1192  C  CD    . ARG A 1  161  ? -0.262  35.421  7.146    1.00 47.78  ? 161  ARG A CD    1 
ATOM   1193  N  NE    . ARG A 1  161  ? -1.339  36.235  6.596    1.00 52.40  ? 161  ARG A NE    1 
ATOM   1194  C  CZ    . ARG A 1  161  ? -2.518  36.399  7.184    1.00 55.68  ? 161  ARG A CZ    1 
ATOM   1195  N  NH1   . ARG A 1  161  ? -3.442  37.164  6.620    1.00 58.48  ? 161  ARG A NH1   1 
ATOM   1196  N  NH2   . ARG A 1  161  ? -2.775  35.795  8.335    1.00 60.12  ? 161  ARG A NH2   1 
ATOM   1197  N  N     . ILE A 1  162  ? 3.068   32.391  4.088    1.00 39.25  ? 162  ILE A N     1 
ATOM   1198  C  CA    . ILE A 1  162  ? 3.640   31.060  3.924    1.00 41.45  ? 162  ILE A CA    1 
ATOM   1199  C  C     . ILE A 1  162  ? 3.984   30.447  5.279    1.00 42.80  ? 162  ILE A C     1 
ATOM   1200  O  O     . ILE A 1  162  ? 4.962   30.841  5.909    1.00 43.79  ? 162  ILE A O     1 
ATOM   1201  C  CB    . ILE A 1  162  ? 4.915   31.092  3.062    1.00 40.02  ? 162  ILE A CB    1 
ATOM   1202  C  CG1   . ILE A 1  162  ? 4.713   31.974  1.828    1.00 37.98  ? 162  ILE A CG1   1 
ATOM   1203  C  CG2   . ILE A 1  162  ? 5.326   29.680  2.667    1.00 39.92  ? 162  ILE A CG2   1 
ATOM   1204  C  CD1   . ILE A 1  162  ? 5.987   32.224  1.049    1.00 40.78  ? 162  ILE A CD1   1 
ATOM   1205  N  N     . PRO A 1  163  ? 3.181   29.475  5.729    1.00 45.12  ? 163  PRO A N     1 
ATOM   1206  C  CA    . PRO A 1  163  ? 3.381   28.793  7.014    1.00 47.34  ? 163  PRO A CA    1 
ATOM   1207  C  C     . PRO A 1  163  ? 4.705   28.032  7.093    1.00 44.05  ? 163  PRO A C     1 
ATOM   1208  O  O     . PRO A 1  163  ? 5.152   27.475  6.093    1.00 44.27  ? 163  PRO A O     1 
ATOM   1209  C  CB    . PRO A 1  163  ? 2.195   27.823  7.084    1.00 64.44  ? 163  PRO A CB    1 
ATOM   1210  C  CG    . PRO A 1  163  ? 1.762   27.640  5.665    1.00 67.03  ? 163  PRO A CG    1 
ATOM   1211  C  CD    . PRO A 1  163  ? 2.000   28.965  5.014    1.00 52.92  ? 163  PRO A CD    1 
ATOM   1212  N  N     . VAL A 1  164  ? 5.315   28.016  8.277    1.00 44.69  ? 164  VAL A N     1 
ATOM   1213  C  CA    . VAL A 1  164  ? 6.593   27.342  8.502    1.00 46.89  ? 164  VAL A CA    1 
ATOM   1214  C  C     . VAL A 1  164  ? 6.505   26.445  9.742    1.00 49.93  ? 164  VAL A C     1 
ATOM   1215  O  O     . VAL A 1  164  ? 5.805   26.774  10.695   1.00 50.66  ? 164  VAL A O     1 
ATOM   1216  C  CB    . VAL A 1  164  ? 7.740   28.365  8.680    1.00 45.26  ? 164  VAL A CB    1 
ATOM   1217  C  CG1   . VAL A 1  164  ? 9.081   27.666  8.853    1.00 43.86  ? 164  VAL A CG1   1 
ATOM   1218  C  CG2   . VAL A 1  164  ? 7.788   29.326  7.502    1.00 50.81  ? 164  VAL A CG2   1 
ATOM   1219  N  N     . ASP A 1  165  ? 7.197   25.307  9.728    1.00 53.15  ? 165  ASP A N     1 
ATOM   1220  C  CA    . ASP A 1  165  ? 7.196   24.400  10.876   1.00 54.71  ? 165  ASP A CA    1 
ATOM   1221  C  C     . ASP A 1  165  ? 7.752   25.081  12.128   1.00 52.57  ? 165  ASP A C     1 
ATOM   1222  O  O     . ASP A 1  165  ? 8.746   25.806  12.063   1.00 54.49  ? 165  ASP A O     1 
ATOM   1223  C  CB    . ASP A 1  165  ? 8.005   23.136  10.565   1.00 62.41  ? 165  ASP A CB    1 
ATOM   1224  C  CG    . ASP A 1  165  ? 7.338   22.254  9.521    1.00 62.98  ? 165  ASP A CG    1 
ATOM   1225  O  OD1   . ASP A 1  165  ? 8.035   21.800  8.587    1.00 65.12  ? 165  ASP A OD1   1 
ATOM   1226  O  OD2   . ASP A 1  165  ? 6.120   22.003  9.639    1.00 60.96  ? 165  ASP A OD2   1 
ATOM   1227  N  N     . SER A 1  166  ? 7.100   24.849  13.264   1.00 52.34  ? 166  SER A N     1 
ATOM   1228  C  CA    . SER A 1  166  ? 7.506   25.466  14.523   1.00 50.09  ? 166  SER A CA    1 
ATOM   1229  C  C     . SER A 1  166  ? 8.092   24.449  15.497   1.00 52.02  ? 166  SER A C     1 
ATOM   1230  O  O     . SER A 1  166  ? 7.378   23.602  16.028   1.00 52.33  ? 166  SER A O     1 
ATOM   1231  C  CB    . SER A 1  166  ? 6.319   26.179  15.177   1.00 48.53  ? 166  SER A CB    1 
ATOM   1232  O  OG    . SER A 1  166  ? 5.771   27.160  14.314   1.00 49.45  ? 166  SER A OG    1 
ATOM   1233  N  N     . ILE A 1  167  ? 9.397   24.536  15.729   1.00 53.47  ? 167  ILE A N     1 
ATOM   1234  C  CA    . ILE A 1  167  ? 10.045  23.701  16.732   1.00 55.33  ? 167  ILE A CA    1 
ATOM   1235  C  C     . ILE A 1  167  ? 10.187  24.499  18.025   1.00 56.16  ? 167  ILE A C     1 
ATOM   1236  O  O     . ILE A 1  167  ? 11.206  25.154  18.257   1.00 61.46  ? 167  ILE A O     1 
ATOM   1237  C  CB    . ILE A 1  167  ? 11.429  23.204  16.261   1.00 56.19  ? 167  ILE A CB    1 
ATOM   1238  C  CG1   . ILE A 1  167  ? 11.330  22.589  14.863   1.00 52.51  ? 167  ILE A CG1   1 
ATOM   1239  C  CG2   . ILE A 1  167  ? 12.007  22.201  17.248   1.00 59.59  ? 167  ILE A CG2   1 
ATOM   1240  C  CD1   . ILE A 1  167  ? 12.643  22.048  14.333   1.00 61.71  ? 167  ILE A CD1   1 
ATOM   1241  N  N     . TYR A 1  168  ? 9.155   24.444  18.861   1.00 52.88  ? 168  TYR A N     1 
ATOM   1242  C  CA    . TYR A 1  168  ? 9.110   25.258  20.073   1.00 54.58  ? 168  TYR A CA    1 
ATOM   1243  C  C     . TYR A 1  168  ? 10.127  24.812  21.120   1.00 56.00  ? 168  TYR A C     1 
ATOM   1244  O  O     . TYR A 1  168  ? 10.806  25.644  21.724   1.00 56.30  ? 168  TYR A O     1 
ATOM   1245  C  CB    . TYR A 1  168  ? 7.707   25.237  20.684   1.00 55.42  ? 168  TYR A CB    1 
ATOM   1246  C  CG    . TYR A 1  168  ? 6.658   25.937  19.851   1.00 56.81  ? 168  TYR A CG    1 
ATOM   1247  C  CD1   . TYR A 1  168  ? 6.665   27.318  19.708   1.00 55.15  ? 168  TYR A CD1   1 
ATOM   1248  C  CD2   . TYR A 1  168  ? 5.657   25.219  19.213   1.00 57.18  ? 168  TYR A CD2   1 
ATOM   1249  C  CE1   . TYR A 1  168  ? 5.709   27.964  18.947   1.00 54.72  ? 168  TYR A CE1   1 
ATOM   1250  C  CE2   . TYR A 1  168  ? 4.696   25.856  18.451   1.00 54.70  ? 168  TYR A CE2   1 
ATOM   1251  C  CZ    . TYR A 1  168  ? 4.726   27.227  18.320   1.00 54.80  ? 168  TYR A CZ    1 
ATOM   1252  O  OH    . TYR A 1  168  ? 3.767   27.856  17.560   1.00 53.14  ? 168  TYR A OH    1 
ATOM   1253  N  N     . SER A 1  169  ? 10.228  23.500  21.319   1.00 55.23  ? 169  SER A N     1 
ATOM   1254  C  CA    . SER A 1  169  ? 11.078  22.924  22.359   1.00 53.75  ? 169  SER A CA    1 
ATOM   1255  C  C     . SER A 1  169  ? 12.515  23.434  22.295   1.00 50.74  ? 169  SER A C     1 
ATOM   1256  O  O     . SER A 1  169  ? 13.282  23.052  21.415   1.00 49.21  ? 169  SER A O     1 
ATOM   1257  C  CB    . SER A 1  169  ? 11.067  21.399  22.267   1.00 54.38  ? 169  SER A CB    1 
ATOM   1258  O  OG    . SER A 1  169  ? 11.838  20.829  23.307   1.00 56.59  ? 169  SER A OG    1 
ATOM   1259  N  N     . PRO A 1  170  ? 12.884  24.295  23.253   1.00 49.72  ? 170  PRO A N     1 
ATOM   1260  C  CA    . PRO A 1  170  ? 14.190  24.953  23.284   1.00 53.25  ? 170  PRO A CA    1 
ATOM   1261  C  C     . PRO A 1  170  ? 15.281  24.050  23.846   1.00 53.26  ? 170  PRO A C     1 
ATOM   1262  O  O     . PRO A 1  170  ? 16.341  24.534  24.238   1.00 56.66  ? 170  PRO A O     1 
ATOM   1263  C  CB    . PRO A 1  170  ? 13.945  26.149  24.202   1.00 56.17  ? 170  PRO A CB    1 
ATOM   1264  C  CG    . PRO A 1  170  ? 12.928  25.649  25.170   1.00 51.01  ? 170  PRO A CG    1 
ATOM   1265  C  CD    . PRO A 1  170  ? 12.054  24.678  24.410   1.00 53.12  ? 170  PRO A CD    1 
ATOM   1266  N  N     . VAL A 1  171  ? 15.017  22.750  23.879   1.00 49.67  ? 171  VAL A N     1 
ATOM   1267  C  CA    . VAL A 1  171  ? 15.982  21.783  24.380   1.00 52.93  ? 171  VAL A CA    1 
ATOM   1268  C  C     . VAL A 1  171  ? 16.836  21.249  23.231   1.00 55.03  ? 171  VAL A C     1 
ATOM   1269  O  O     . VAL A 1  171  ? 16.390  21.209  22.084   1.00 53.04  ? 171  VAL A O     1 
ATOM   1270  C  CB    . VAL A 1  171  ? 15.278  20.620  25.099   1.00 59.22  ? 171  VAL A CB    1 
ATOM   1271  C  CG1   . VAL A 1  171  ? 16.268  19.830  25.946   1.00 61.69  ? 171  VAL A CG1   1 
ATOM   1272  C  CG2   . VAL A 1  171  ? 14.152  21.157  25.966   1.00 58.94  ? 171  VAL A CG2   1 
ATOM   1273  N  N     . LEU A 1  172  ? 18.065  20.849  23.538   1.00 58.27  ? 172  LEU A N     1 
ATOM   1274  C  CA    . LEU A 1  172  ? 18.986  20.381  22.512   1.00 59.41  ? 172  LEU A CA    1 
ATOM   1275  C  C     . LEU A 1  172  ? 19.311  18.897  22.678   1.00 57.11  ? 172  LEU A C     1 
ATOM   1276  O  O     . LEU A 1  172  ? 19.029  18.095  21.791   1.00 51.56  ? 172  LEU A O     1 
ATOM   1277  C  CB    . LEU A 1  172  ? 20.271  21.220  22.532   1.00 59.83  ? 172  LEU A CB    1 
ATOM   1278  C  CG    . LEU A 1  172  ? 21.132  21.259  21.263   1.00 60.52  ? 172  LEU A CG    1 
ATOM   1279  C  CD1   . LEU A 1  172  ? 21.929  22.553  21.207   1.00 60.06  ? 172  LEU A CD1   1 
ATOM   1280  C  CD2   . LEU A 1  172  ? 22.069  20.059  21.170   1.00 66.82  ? 172  LEU A CD2   1 
ATOM   1281  N  N     . LYS A 1  173  ? 19.902  18.537  23.814   1.00 59.57  ? 173  LYS A N     1 
ATOM   1282  C  CA    . LYS A 1  173  ? 20.358  17.167  24.045   1.00 61.79  ? 173  LYS A CA    1 
ATOM   1283  C  C     . LYS A 1  173  ? 20.413  16.844  25.539   1.00 66.31  ? 173  LYS A C     1 
ATOM   1284  O  O     . LYS A 1  173  ? 21.044  17.563  26.313   1.00 74.41  ? 173  LYS A O     1 
ATOM   1285  C  CB    . LYS A 1  173  ? 21.735  16.951  23.408   1.00 66.13  ? 173  LYS A CB    1 
ATOM   1286  C  CG    . LYS A 1  173  ? 22.332  15.570  23.632   1.00 58.80  ? 173  LYS A CG    1 
ATOM   1287  C  CD    . LYS A 1  173  ? 23.712  15.462  22.997   1.00 59.51  ? 173  LYS A CD    1 
ATOM   1288  C  CE    . LYS A 1  173  ? 23.653  15.758  21.508   1.00 61.09  ? 173  LYS A CE    1 
ATOM   1289  N  NZ    . LYS A 1  173  ? 24.978  15.585  20.856   1.00 71.56  ? 173  LYS A NZ    1 
ATOM   1290  N  N     . VAL A 1  174  ? 19.757  15.758  25.937   1.00 64.15  ? 174  VAL A N     1 
ATOM   1291  C  CA    . VAL A 1  174  ? 19.671  15.381  27.345   1.00 63.60  ? 174  VAL A CA    1 
ATOM   1292  C  C     . VAL A 1  174  ? 20.082  13.925  27.573   1.00 59.39  ? 174  VAL A C     1 
ATOM   1293  O  O     . VAL A 1  174  ? 19.686  13.038  26.821   1.00 58.07  ? 174  VAL A O     1 
ATOM   1294  C  CB    . VAL A 1  174  ? 18.235  15.588  27.891   1.00 67.69  ? 174  VAL A CB    1 
ATOM   1295  C  CG1   . VAL A 1  174  ? 18.154  15.216  29.362   1.00 72.66  ? 174  VAL A CG1   1 
ATOM   1296  C  CG2   . VAL A 1  174  ? 17.778  17.026  27.683   1.00 68.15  ? 174  VAL A CG2   1 
ATOM   1297  N  N     . THR A 1  175  ? 20.875  13.684  28.614   1.00 62.06  ? 175  THR A N     1 
ATOM   1298  C  CA    . THR A 1  175  ? 21.266  12.326  28.983   1.00 64.86  ? 175  THR A CA    1 
ATOM   1299  C  C     . THR A 1  175  ? 21.457  12.202  30.497   1.00 67.37  ? 175  THR A C     1 
ATOM   1300  O  O     . THR A 1  175  ? 21.208  13.150  31.242   1.00 70.02  ? 175  THR A O     1 
ATOM   1301  C  CB    . THR A 1  175  ? 22.559  11.892  28.253   1.00 60.77  ? 175  THR A CB    1 
ATOM   1302  O  OG1   . THR A 1  175  ? 23.044  10.662  28.807   1.00 54.66  ? 175  THR A OG1   1 
ATOM   1303  C  CG2   . THR A 1  175  ? 23.631  12.961  28.374   1.00 64.61  ? 175  THR A CG2   1 
ATOM   1304  N  N     . TYR A 1  176  ? 21.889  11.027  30.949   1.00 65.70  ? 176  TYR A N     1 
ATOM   1305  C  CA    . TYR A 1  176  ? 22.140  10.795  32.371   1.00 68.30  ? 176  TYR A CA    1 
ATOM   1306  C  C     . TYR A 1  176  ? 22.989  9.550   32.611   1.00 67.42  ? 176  TYR A C     1 
ATOM   1307  O  O     . TYR A 1  176  ? 23.068  8.664   31.760   1.00 63.46  ? 176  TYR A O     1 
ATOM   1308  C  CB    . TYR A 1  176  ? 20.820  10.667  33.144   1.00 66.90  ? 176  TYR A CB    1 
ATOM   1309  C  CG    . TYR A 1  176  ? 19.897  9.597   32.600   1.00 74.54  ? 176  TYR A CG    1 
ATOM   1310  C  CD1   . TYR A 1  176  ? 19.986  8.280   33.041   1.00 83.78  ? 176  TYR A CD1   1 
ATOM   1311  C  CD2   . TYR A 1  176  ? 18.938  9.901   31.640   1.00 73.89  ? 176  TYR A CD2   1 
ATOM   1312  C  CE1   . TYR A 1  176  ? 19.148  7.298   32.541   1.00 79.24  ? 176  TYR A CE1   1 
ATOM   1313  C  CE2   . TYR A 1  176  ? 18.094  8.923   31.135   1.00 71.87  ? 176  TYR A CE2   1 
ATOM   1314  C  CZ    . TYR A 1  176  ? 18.205  7.625   31.589   1.00 71.98  ? 176  TYR A CZ    1 
ATOM   1315  O  OH    . TYR A 1  176  ? 17.372  6.649   31.091   1.00 68.56  ? 176  TYR A OH    1 
ATOM   1316  N  N     . LYS A 1  177  ? 23.615  9.492   33.782   1.00 71.52  ? 177  LYS A N     1 
ATOM   1317  C  CA    . LYS A 1  177  ? 24.363  8.315   34.207   1.00 72.79  ? 177  LYS A CA    1 
ATOM   1318  C  C     . LYS A 1  177  ? 24.097  8.038   35.686   1.00 82.20  ? 177  LYS A C     1 
ATOM   1319  O  O     . LYS A 1  177  ? 23.639  8.918   36.417   1.00 84.75  ? 177  LYS A O     1 
ATOM   1320  C  CB    . LYS A 1  177  ? 25.858  8.500   33.943   1.00 70.56  ? 177  LYS A CB    1 
ATOM   1321  C  CG    . LYS A 1  177  ? 26.384  9.890   34.255   1.00 72.99  ? 177  LYS A CG    1 
ATOM   1322  C  CD    . LYS A 1  177  ? 27.833  10.040  33.808   1.00 74.68  ? 177  LYS A CD    1 
ATOM   1323  C  CE    . LYS A 1  177  ? 28.336  11.462  34.019   1.00 74.42  ? 177  LYS A CE    1 
ATOM   1324  N  NZ    . LYS A 1  177  ? 29.753  11.627  33.590   1.00 70.14  ? 177  LYS A NZ    1 
ATOM   1325  N  N     . VAL A 1  178  ? 24.372  6.812   36.122   1.00 86.66  ? 178  VAL A N     1 
ATOM   1326  C  CA    . VAL A 1  178  ? 23.997  6.388   37.469   1.00 90.42  ? 178  VAL A CA    1 
ATOM   1327  C  C     . VAL A 1  178  ? 25.134  5.703   38.230   1.00 95.10  ? 178  VAL A C     1 
ATOM   1328  O  O     . VAL A 1  178  ? 25.733  4.744   37.743   1.00 88.61  ? 178  VAL A O     1 
ATOM   1329  C  CB    . VAL A 1  178  ? 22.782  5.434   37.422   1.00 91.32  ? 178  VAL A CB    1 
ATOM   1330  C  CG1   . VAL A 1  178  ? 22.593  4.729   38.757   1.00 104.68 ? 178  VAL A CG1   1 
ATOM   1331  C  CG2   . VAL A 1  178  ? 21.521  6.194   37.024   1.00 86.50  ? 178  VAL A CG2   1 
ATOM   1332  N  N     . ASP A 1  179  ? 25.421  6.209   39.428   1.00 101.56 ? 179  ASP A N     1 
ATOM   1333  C  CA    . ASP A 1  179  ? 26.401  5.596   40.321   1.00 108.61 ? 179  ASP A CA    1 
ATOM   1334  C  C     . ASP A 1  179  ? 25.710  4.775   41.403   1.00 112.94 ? 179  ASP A C     1 
ATOM   1335  O  O     . ASP A 1  179  ? 25.515  5.247   42.524   1.00 114.49 ? 179  ASP A O     1 
ATOM   1336  C  CB    . ASP A 1  179  ? 27.295  6.658   40.968   1.00 106.33 ? 179  ASP A CB    1 
ATOM   1337  C  CG    . ASP A 1  179  ? 28.511  6.996   40.124   1.00 113.34 ? 179  ASP A CG    1 
ATOM   1338  O  OD1   . ASP A 1  179  ? 28.986  8.149   40.199   1.00 106.97 ? 179  ASP A OD1   1 
ATOM   1339  O  OD2   . ASP A 1  179  ? 28.994  6.109   39.390   1.00 123.08 ? 179  ASP A OD2   1 
ATOM   1340  N  N     . ALA A 1  180  ? 25.344  3.545   41.058   1.00 113.99 ? 180  ALA A N     1 
ATOM   1341  C  CA    . ALA A 1  180  ? 24.669  2.653   41.994   1.00 126.42 ? 180  ALA A CA    1 
ATOM   1342  C  C     . ALA A 1  180  ? 25.664  1.860   42.836   1.00 142.61 ? 180  ALA A C     1 
ATOM   1343  O  O     . ALA A 1  180  ? 26.306  0.932   42.343   1.00 152.40 ? 180  ALA A O     1 
ATOM   1344  C  CB    . ALA A 1  180  ? 23.744  1.708   41.246   1.00 132.14 ? 180  ALA A CB    1 
ATOM   1345  N  N     . THR A 1  181  ? 25.794  2.233   44.105   1.00 141.83 ? 181  THR A N     1 
ATOM   1346  C  CA    . THR A 1  181  ? 26.621  1.477   45.037   1.00 144.17 ? 181  THR A CA    1 
ATOM   1347  C  C     . THR A 1  181  ? 25.938  0.150   45.356   1.00 147.45 ? 181  THR A C     1 
ATOM   1348  O  O     . THR A 1  181  ? 24.845  0.131   45.917   1.00 145.18 ? 181  THR A O     1 
ATOM   1349  C  CB    . THR A 1  181  ? 26.878  2.259   46.342   1.00 140.88 ? 181  THR A CB    1 
ATOM   1350  O  OG1   . THR A 1  181  ? 27.550  3.490   46.043   1.00 130.89 ? 181  THR A OG1   1 
ATOM   1351  C  CG2   . THR A 1  181  ? 27.733  1.442   47.295   1.00 150.07 ? 181  THR A CG2   1 
ATOM   1352  N  N     . ARG A 1  182  ? 26.569  -0.957  44.979   1.00 146.86 ? 182  ARG A N     1 
ATOM   1353  C  CA    . ARG A 1  182  ? 25.968  -2.271  45.185   1.00 142.94 ? 182  ARG A CA    1 
ATOM   1354  C  C     . ARG A 1  182  ? 26.751  -3.092  46.201   1.00 148.25 ? 182  ARG A C     1 
ATOM   1355  O  O     . ARG A 1  182  ? 26.687  -4.321  46.201   1.00 147.82 ? 182  ARG A O     1 
ATOM   1356  C  CB    . ARG A 1  182  ? 25.870  -3.030  43.859   1.00 135.75 ? 182  ARG A CB    1 
ATOM   1357  C  CG    . ARG A 1  182  ? 24.465  -3.511  43.525   1.00 128.16 ? 182  ARG A CG    1 
ATOM   1358  C  CD    . ARG A 1  182  ? 23.483  -2.349  43.471   1.00 133.97 ? 182  ARG A CD    1 
ATOM   1359  N  NE    . ARG A 1  182  ? 22.118  -2.784  43.184   1.00 122.10 ? 182  ARG A NE    1 
ATOM   1360  C  CZ    . ARG A 1  182  ? 21.089  -1.958  43.020   1.00 122.38 ? 182  ARG A CZ    1 
ATOM   1361  N  NH1   . ARG A 1  182  ? 19.882  -2.442  42.762   1.00 107.74 ? 182  ARG A NH1   1 
ATOM   1362  N  NH2   . ARG A 1  182  ? 21.267  -0.646  43.112   1.00 128.69 ? 182  ARG A NH2   1 
ATOM   1363  N  N     . VAL A 1  183  ? 27.483  -2.404  47.071   1.00 155.78 ? 183  VAL A N     1 
ATOM   1364  C  CA    . VAL A 1  183  ? 28.255  -3.065  48.117   1.00 165.70 ? 183  VAL A CA    1 
ATOM   1365  C  C     . VAL A 1  183  ? 27.325  -3.750  49.119   1.00 168.81 ? 183  VAL A C     1 
ATOM   1366  O  O     . VAL A 1  183  ? 26.371  -3.142  49.609   1.00 157.67 ? 183  VAL A O     1 
ATOM   1367  C  CB    . VAL A 1  183  ? 29.172  -2.067  48.853   1.00 162.81 ? 183  VAL A CB    1 
ATOM   1368  C  CG1   . VAL A 1  183  ? 29.935  -2.760  49.972   1.00 159.36 ? 183  VAL A CG1   1 
ATOM   1369  C  CG2   . VAL A 1  183  ? 30.134  -1.410  47.873   1.00 162.23 ? 183  VAL A CG2   1 
ATOM   1370  N  N     . GLU A 1  184  ? 27.604  -5.019  49.408   1.00 179.06 ? 184  GLU A N     1 
ATOM   1371  C  CA    . GLU A 1  184  ? 26.780  -5.803  50.325   1.00 172.65 ? 184  GLU A CA    1 
ATOM   1372  C  C     . GLU A 1  184  ? 26.755  -5.203  51.725   1.00 164.45 ? 184  GLU A C     1 
ATOM   1373  O  O     . GLU A 1  184  ? 27.539  -5.583  52.596   1.00 160.61 ? 184  GLU A O     1 
ATOM   1374  C  CB    . GLU A 1  184  ? 27.268  -7.254  50.390   1.00 173.71 ? 184  GLU A CB    1 
ATOM   1375  C  CG    . GLU A 1  184  ? 26.745  -8.140  49.266   1.00 174.87 ? 184  GLU A CG    1 
ATOM   1376  C  CD    . GLU A 1  184  ? 26.807  -9.618  49.608   1.00 168.84 ? 184  GLU A CD    1 
ATOM   1377  O  OE1   . GLU A 1  184  ? 27.170  -9.949  50.757   1.00 167.46 ? 184  GLU A OE1   1 
ATOM   1378  O  OE2   . GLU A 1  184  ? 26.489  -10.450 48.731   1.00 165.03 ? 184  GLU A OE2   1 
ATOM   1379  N  N     . GLN A 1  185  ? 25.842  -4.260  51.923   1.00 158.75 ? 185  GLN A N     1 
ATOM   1380  C  CA    . GLN A 1  185  ? 25.640  -3.613  53.210   1.00 156.75 ? 185  GLN A CA    1 
ATOM   1381  C  C     . GLN A 1  185  ? 24.370  -2.779  53.106   1.00 158.06 ? 185  GLN A C     1 
ATOM   1382  O  O     . GLN A 1  185  ? 23.683  -2.819  52.086   1.00 153.96 ? 185  GLN A O     1 
ATOM   1383  C  CB    . GLN A 1  185  ? 26.843  -2.741  53.588   1.00 152.81 ? 185  GLN A CB    1 
ATOM   1384  C  CG    . GLN A 1  185  ? 27.010  -2.493  55.081   1.00 152.24 ? 185  GLN A CG    1 
ATOM   1385  C  CD    . GLN A 1  185  ? 28.110  -1.497  55.380   1.00 148.25 ? 185  GLN A CD    1 
ATOM   1386  O  OE1   . GLN A 1  185  ? 28.920  -1.173  54.512   1.00 146.11 ? 185  GLN A OE1   1 
ATOM   1387  N  NE2   . GLN A 1  185  ? 28.142  -1.001  56.611   1.00 143.76 ? 185  GLN A NE2   1 
ATOM   1388  N  N     . ARG A 1  186  ? 24.059  -2.025  54.154   1.00 170.58 ? 186  ARG A N     1 
ATOM   1389  C  CA    . ARG A 1  186  ? 22.960  -1.068  54.108   1.00 173.67 ? 186  ARG A CA    1 
ATOM   1390  C  C     . ARG A 1  186  ? 23.460  0.251   53.525   1.00 171.91 ? 186  ARG A C     1 
ATOM   1391  O  O     . ARG A 1  186  ? 22.861  1.308   53.729   1.00 172.63 ? 186  ARG A O     1 
ATOM   1392  C  CB    . ARG A 1  186  ? 22.362  -0.866  55.501   1.00 179.56 ? 186  ARG A CB    1 
ATOM   1393  C  CG    . ARG A 1  186  ? 23.395  -0.731  56.606   1.00 183.14 ? 186  ARG A CG    1 
ATOM   1394  C  CD    . ARG A 1  186  ? 22.835  -1.187  57.948   1.00 184.66 ? 186  ARG A CD    1 
ATOM   1395  N  NE    . ARG A 1  186  ? 21.755  -0.327  58.424   1.00 179.81 ? 186  ARG A NE    1 
ATOM   1396  C  CZ    . ARG A 1  186  ? 21.032  -0.571  59.512   1.00 172.96 ? 186  ARG A CZ    1 
ATOM   1397  N  NH1   . ARG A 1  186  ? 21.270  -1.656  60.236   1.00 170.27 ? 186  ARG A NH1   1 
ATOM   1398  N  NH2   . ARG A 1  186  ? 20.070  0.268   59.874   1.00 171.24 ? 186  ARG A NH2   1 
ATOM   1399  N  N     . THR A 1  187  ? 24.570  0.166   52.798   1.00 170.44 ? 187  THR A N     1 
ATOM   1400  C  CA    . THR A 1  187  ? 25.169  1.312   52.129   1.00 165.18 ? 187  THR A CA    1 
ATOM   1401  C  C     . THR A 1  187  ? 24.913  1.261   50.622   1.00 161.26 ? 187  THR A C     1 
ATOM   1402  O  O     . THR A 1  187  ? 25.586  1.940   49.847   1.00 158.98 ? 187  THR A O     1 
ATOM   1403  C  CB    . THR A 1  187  ? 26.690  1.380   52.385   1.00 157.63 ? 187  THR A CB    1 
ATOM   1404  O  OG1   . THR A 1  187  ? 27.315  0.185   51.899   1.00 156.06 ? 187  THR A OG1   1 
ATOM   1405  C  CG2   . THR A 1  187  ? 26.976  1.526   53.871   1.00 145.41 ? 187  THR A CG2   1 
ATOM   1406  N  N     . ASP A 1  188  ? 23.938  0.452   50.213   1.00 160.44 ? 188  ASP A N     1 
ATOM   1407  C  CA    . ASP A 1  188  ? 23.597  0.319   48.798   1.00 153.02 ? 188  ASP A CA    1 
ATOM   1408  C  C     . ASP A 1  188  ? 22.557  1.355   48.368   1.00 149.89 ? 188  ASP A C     1 
ATOM   1409  O  O     . ASP A 1  188  ? 21.445  1.394   48.894   1.00 152.53 ? 188  ASP A O     1 
ATOM   1410  C  CB    . ASP A 1  188  ? 23.095  -1.099  48.497   1.00 143.47 ? 188  ASP A CB    1 
ATOM   1411  C  CG    . ASP A 1  188  ? 21.997  -1.545  49.442   1.00 145.08 ? 188  ASP A CG    1 
ATOM   1412  O  OD1   . ASP A 1  188  ? 21.952  -1.046  50.585   1.00 151.59 ? 188  ASP A OD1   1 
ATOM   1413  O  OD2   . ASP A 1  188  ? 21.178  -2.398  49.040   1.00 136.04 ? 188  ASP A OD2   1 
ATOM   1414  N  N     . PHE A 1  189  ? 22.929  2.194   47.406   1.00 142.99 ? 189  PHE A N     1 
ATOM   1415  C  CA    . PHE A 1  189  ? 22.066  3.279   46.956   1.00 133.62 ? 189  PHE A CA    1 
ATOM   1416  C  C     . PHE A 1  189  ? 22.370  3.654   45.513   1.00 127.13 ? 189  PHE A C     1 
ATOM   1417  O  O     . PHE A 1  189  ? 23.272  3.089   44.896   1.00 127.54 ? 189  PHE A O     1 
ATOM   1418  C  CB    . PHE A 1  189  ? 22.232  4.503   47.860   1.00 143.65 ? 189  PHE A CB    1 
ATOM   1419  C  CG    . PHE A 1  189  ? 23.551  5.208   47.692   1.00 146.68 ? 189  PHE A CG    1 
ATOM   1420  C  CD1   . PHE A 1  189  ? 23.642  6.370   46.942   1.00 142.58 ? 189  PHE A CD1   1 
ATOM   1421  C  CD2   . PHE A 1  189  ? 24.701  4.707   48.283   1.00 148.60 ? 189  PHE A CD2   1 
ATOM   1422  C  CE1   . PHE A 1  189  ? 24.854  7.018   46.785   1.00 141.18 ? 189  PHE A CE1   1 
ATOM   1423  C  CE2   . PHE A 1  189  ? 25.914  5.350   48.128   1.00 146.65 ? 189  PHE A CE2   1 
ATOM   1424  C  CZ    . PHE A 1  189  ? 25.991  6.507   47.379   1.00 147.40 ? 189  PHE A CZ    1 
ATOM   1425  N  N     . ASP A 1  190  ? 21.617  4.610   44.977   1.00 125.46 ? 190  ASP A N     1 
ATOM   1426  C  CA    . ASP A 1  190  ? 21.847  5.083   43.617   1.00 126.67 ? 190  ASP A CA    1 
ATOM   1427  C  C     . ASP A 1  190  ? 22.082  6.593   43.578   1.00 126.63 ? 190  ASP A C     1 
ATOM   1428  O  O     . ASP A 1  190  ? 21.384  7.360   44.243   1.00 125.45 ? 190  ASP A O     1 
ATOM   1429  C  CB    . ASP A 1  190  ? 20.672  4.704   42.712   1.00 122.88 ? 190  ASP A CB    1 
ATOM   1430  C  CG    . ASP A 1  190  ? 20.671  3.224   42.340   1.00 123.62 ? 190  ASP A CG    1 
ATOM   1431  O  OD1   . ASP A 1  190  ? 20.197  2.886   41.233   1.00 123.45 ? 190  ASP A OD1   1 
ATOM   1432  O  OD2   . ASP A 1  190  ? 21.148  2.397   43.148   1.00 122.41 ? 190  ASP A OD2   1 
ATOM   1433  N  N     . LYS A 1  191  ? 23.077  7.003   42.796   1.00 128.49 ? 191  LYS A N     1 
ATOM   1434  C  CA    . LYS A 1  191  ? 23.410  8.414   42.610   1.00 118.75 ? 191  LYS A CA    1 
ATOM   1435  C  C     . LYS A 1  191  ? 23.142  8.831   41.167   1.00 107.47 ? 191  LYS A C     1 
ATOM   1436  O  O     . LYS A 1  191  ? 23.728  8.281   40.236   1.00 105.51 ? 191  LYS A O     1 
ATOM   1437  C  CB    . LYS A 1  191  ? 24.874  8.675   42.978   1.00 122.64 ? 191  LYS A CB    1 
ATOM   1438  C  CG    . LYS A 1  191  ? 25.424  10.013  42.492   1.00 116.93 ? 191  LYS A CG    1 
ATOM   1439  C  CD    . LYS A 1  191  ? 26.944  10.042  42.594   1.00 117.27 ? 191  LYS A CD    1 
ATOM   1440  C  CE    . LYS A 1  191  ? 27.539  11.226  41.854   1.00 113.23 ? 191  LYS A CE    1 
ATOM   1441  N  NZ    . LYS A 1  191  ? 29.027  11.173  41.857   1.00 105.84 ? 191  LYS A NZ    1 
ATOM   1442  N  N     . LEU A 1  192  ? 22.255  9.802   40.980   1.00 97.30  ? 192  LEU A N     1 
ATOM   1443  C  CA    . LEU A 1  192  ? 21.868  10.213  39.637   1.00 89.26  ? 192  LEU A CA    1 
ATOM   1444  C  C     . LEU A 1  192  ? 22.637  11.443  39.171   1.00 88.57  ? 192  LEU A C     1 
ATOM   1445  O  O     . LEU A 1  192  ? 22.818  12.395  39.927   1.00 88.55  ? 192  LEU A O     1 
ATOM   1446  C  CB    . LEU A 1  192  ? 20.364  10.485  39.577   1.00 85.52  ? 192  LEU A CB    1 
ATOM   1447  C  CG    . LEU A 1  192  ? 19.812  11.016  38.253   1.00 80.53  ? 192  LEU A CG    1 
ATOM   1448  C  CD1   . LEU A 1  192  ? 20.096  10.045  37.117   1.00 81.16  ? 192  LEU A CD1   1 
ATOM   1449  C  CD2   . LEU A 1  192  ? 18.322  11.283  38.378   1.00 73.80  ? 192  LEU A CD2   1 
ATOM   1450  N  N     . ILE A 1  193  ? 23.102  11.402  37.925   1.00 89.75  ? 193  ILE A N     1 
ATOM   1451  C  CA    . ILE A 1  193  ? 23.730  12.556  37.288   1.00 91.10  ? 193  ILE A CA    1 
ATOM   1452  C  C     . ILE A 1  193  ? 23.070  12.840  35.938   1.00 84.39  ? 193  ILE A C     1 
ATOM   1453  O  O     . ILE A 1  193  ? 23.413  12.226  34.927   1.00 80.78  ? 193  ILE A O     1 
ATOM   1454  C  CB    . ILE A 1  193  ? 25.250  12.352  37.078   1.00 94.63  ? 193  ILE A CB    1 
ATOM   1455  C  CG1   . ILE A 1  193  ? 25.956  12.088  38.411   1.00 103.47 ? 193  ILE A CG1   1 
ATOM   1456  C  CG2   . ILE A 1  193  ? 25.864  13.569  36.399   1.00 89.71  ? 193  ILE A CG2   1 
ATOM   1457  C  CD1   . ILE A 1  193  ? 27.465  11.955  38.289   1.00 99.53  ? 193  ILE A CD1   1 
ATOM   1458  N  N     . LEU A 1  194  ? 22.115  13.766  35.937   1.00 79.63  ? 194  LEU A N     1 
ATOM   1459  C  CA    . LEU A 1  194  ? 21.428  14.188  34.718   1.00 75.80  ? 194  LEU A CA    1 
ATOM   1460  C  C     . LEU A 1  194  ? 22.239  15.242  33.966   1.00 77.91  ? 194  LEU A C     1 
ATOM   1461  O  O     . LEU A 1  194  ? 22.884  16.090  34.581   1.00 85.35  ? 194  LEU A O     1 
ATOM   1462  C  CB    . LEU A 1  194  ? 20.039  14.741  35.050   1.00 74.88  ? 194  LEU A CB    1 
ATOM   1463  C  CG    . LEU A 1  194  ? 19.175  15.231  33.883   1.00 76.28  ? 194  LEU A CG    1 
ATOM   1464  C  CD1   . LEU A 1  194  ? 18.649  14.057  33.069   1.00 83.74  ? 194  LEU A CD1   1 
ATOM   1465  C  CD2   . LEU A 1  194  ? 18.030  16.113  34.364   1.00 80.38  ? 194  LEU A CD2   1 
ATOM   1466  N  N     . ASP A 1  195  ? 22.198  15.189  32.637   1.00 77.72  ? 195  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1  195  ? 22.902  16.159  31.802   1.00 79.96  ? 195  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1  195  ? 21.927  16.853  30.851   1.00 76.57  ? 195  ASP A C     1 
ATOM   1469  O  O     . ASP A 1  195  ? 21.207  16.200  30.097   1.00 72.99  ? 195  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1  195  ? 24.026  15.474  31.016   1.00 85.28  ? 195  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1  195  ? 25.102  16.449  30.554   1.00 90.83  ? 195  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1  195  ? 26.292  16.068  30.574   1.00 95.37  ? 195  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1  195  ? 24.763  17.589  30.169   1.00 91.04  ? 195  ASP A OD2   1 
ATOM   1474  N  N     . VAL A 1  196  ? 21.911  18.181  30.894   1.00 78.84  ? 196  VAL A N     1 
ATOM   1475  C  CA    . VAL A 1  196  ? 20.976  18.967  30.098   1.00 79.42  ? 196  VAL A CA    1 
ATOM   1476  C  C     . VAL A 1  196  ? 21.696  20.076  29.334   1.00 78.94  ? 196  VAL A C     1 
ATOM   1477  O  O     . VAL A 1  196  ? 22.462  20.836  29.918   1.00 84.25  ? 196  VAL A O     1 
ATOM   1478  C  CB    . VAL A 1  196  ? 19.874  19.593  30.985   1.00 86.39  ? 196  VAL A CB    1 
ATOM   1479  C  CG1   . VAL A 1  196  ? 18.998  20.531  30.170   1.00 87.19  ? 196  VAL A CG1   1 
ATOM   1480  C  CG2   . VAL A 1  196  ? 19.034  18.505  31.653   1.00 82.35  ? 196  VAL A CG2   1 
ATOM   1481  N  N     . GLU A 1  197  ? 21.449  20.161  28.030   1.00 76.65  ? 197  GLU A N     1 
ATOM   1482  C  CA    . GLU A 1  197  ? 22.043  21.208  27.204   1.00 75.01  ? 197  GLU A CA    1 
ATOM   1483  C  C     . GLU A 1  197  ? 20.950  21.966  26.452   1.00 70.42  ? 197  GLU A C     1 
ATOM   1484  O  O     . GLU A 1  197  ? 20.115  21.355  25.786   1.00 71.12  ? 197  GLU A O     1 
ATOM   1485  C  CB    . GLU A 1  197  ? 23.056  20.608  26.227   1.00 74.47  ? 197  GLU A CB    1 
ATOM   1486  C  CG    . GLU A 1  197  ? 23.885  21.630  25.469   1.00 74.11  ? 197  GLU A CG    1 
ATOM   1487  C  CD    . GLU A 1  197  ? 24.849  20.982  24.495   1.00 71.04  ? 197  GLU A CD    1 
ATOM   1488  O  OE1   . GLU A 1  197  ? 24.627  19.808  24.138   1.00 67.84  ? 197  GLU A OE1   1 
ATOM   1489  O  OE2   . GLU A 1  197  ? 25.829  21.641  24.092   1.00 70.60  ? 197  GLU A OE2   1 
ATOM   1490  N  N     . THR A 1  198  ? 20.957  23.293  26.560   1.00 72.42  ? 198  THR A N     1 
ATOM   1491  C  CA    . THR A 1  198  ? 19.890  24.113  25.984   1.00 71.57  ? 198  THR A CA    1 
ATOM   1492  C  C     . THR A 1  198  ? 20.228  24.700  24.619   1.00 71.02  ? 198  THR A C     1 
ATOM   1493  O  O     . THR A 1  198  ? 21.120  24.222  23.920   1.00 71.74  ? 198  THR A O     1 
ATOM   1494  C  CB    . THR A 1  198  ? 19.511  25.281  26.920   1.00 72.03  ? 198  THR A CB    1 
ATOM   1495  O  OG1   . THR A 1  198  ? 20.697  25.959  27.352   1.00 72.27  ? 198  THR A OG1   1 
ATOM   1496  C  CG2   . THR A 1  198  ? 18.754  24.770  28.129   1.00 74.22  ? 198  THR A CG2   1 
ATOM   1497  N  N     . LYS A 1  199  ? 19.490  25.744  24.251   1.00 69.37  ? 199  LYS A N     1 
ATOM   1498  C  CA    . LYS A 1  199  ? 19.671  26.423  22.971   1.00 73.28  ? 199  LYS A CA    1 
ATOM   1499  C  C     . LYS A 1  199  ? 20.021  27.903  23.151   1.00 73.96  ? 199  LYS A C     1 
ATOM   1500  O  O     . LYS A 1  199  ? 19.870  28.698  22.221   1.00 77.28  ? 199  LYS A O     1 
ATOM   1501  C  CB    . LYS A 1  199  ? 18.404  26.302  22.115   1.00 71.70  ? 199  LYS A CB    1 
ATOM   1502  C  CG    . LYS A 1  199  ? 18.186  24.951  21.434   1.00 61.48  ? 199  LYS A CG    1 
ATOM   1503  C  CD    . LYS A 1  199  ? 16.985  25.024  20.492   1.00 63.70  ? 199  LYS A CD    1 
ATOM   1504  C  CE    . LYS A 1  199  ? 16.823  23.773  19.639   1.00 60.97  ? 199  LYS A CE    1 
ATOM   1505  N  NZ    . LYS A 1  199  ? 15.687  23.905  18.674   1.00 59.37  ? 199  LYS A NZ    1 
ATOM   1506  N  N     . ASN A 1  200  ? 20.482  28.264  24.348   1.00 70.41  ? 200  ASN A N     1 
ATOM   1507  C  CA    . ASN A 1  200  ? 20.719  29.662  24.725   1.00 66.16  ? 200  ASN A CA    1 
ATOM   1508  C  C     . ASN A 1  200  ? 19.455  30.520  24.621   1.00 63.92  ? 200  ASN A C     1 
ATOM   1509  O  O     . ASN A 1  200  ? 19.532  31.749  24.564   1.00 59.50  ? 200  ASN A O     1 
ATOM   1510  C  CB    . ASN A 1  200  ? 21.842  30.280  23.877   1.00 64.25  ? 200  ASN A CB    1 
ATOM   1511  C  CG    . ASN A 1  200  ? 23.219  29.755  24.252   1.00 66.74  ? 200  ASN A CG    1 
ATOM   1512  O  OD1   . ASN A 1  200  ? 23.446  29.333  25.386   1.00 70.77  ? 200  ASN A OD1   1 
ATOM   1513  N  ND2   . ASN A 1  200  ? 24.147  29.788  23.300   1.00 66.19  ? 200  ASN A ND2   1 
ATOM   1514  N  N     . SER A 1  201  ? 18.297  29.862  24.598   1.00 64.18  ? 201  SER A N     1 
ATOM   1515  C  CA    . SER A 1  201  ? 17.009  30.549  24.660   1.00 59.17  ? 201  SER A CA    1 
ATOM   1516  C  C     . SER A 1  201  ? 16.593  30.683  26.118   1.00 58.96  ? 201  SER A C     1 
ATOM   1517  O  O     . SER A 1  201  ? 16.173  31.751  26.565   1.00 57.78  ? 201  SER A O     1 
ATOM   1518  C  CB    . SER A 1  201  ? 15.939  29.797  23.865   1.00 56.54  ? 201  SER A CB    1 
ATOM   1519  O  OG    . SER A 1  201  ? 14.710  30.508  23.849   1.00 54.14  ? 201  SER A OG    1 
ATOM   1520  N  N     . ILE A 1  202  ? 16.709  29.580  26.852   1.00 56.48  ? 202  ILE A N     1 
ATOM   1521  C  CA    . ILE A 1  202  ? 16.562  29.591  28.301   1.00 56.51  ? 202  ILE A CA    1 
ATOM   1522  C  C     . ILE A 1  202  ? 17.705  28.795  28.925   1.00 60.85  ? 202  ILE A C     1 
ATOM   1523  O  O     . ILE A 1  202  ? 18.524  28.215  28.215   1.00 59.02  ? 202  ILE A O     1 
ATOM   1524  C  CB    . ILE A 1  202  ? 15.206  29.011  28.760   1.00 56.57  ? 202  ILE A CB    1 
ATOM   1525  C  CG1   . ILE A 1  202  ? 15.067  27.552  28.334   1.00 59.34  ? 202  ILE A CG1   1 
ATOM   1526  C  CG2   . ILE A 1  202  ? 14.046  29.840  28.227   1.00 52.60  ? 202  ILE A CG2   1 
ATOM   1527  C  CD1   . ILE A 1  202  ? 13.797  26.898  28.833   1.00 67.19  ? 202  ILE A CD1   1 
ATOM   1528  N  N     . SER A 1  203  ? 17.756  28.774  30.252   1.00 62.74  ? 203  SER A N     1 
ATOM   1529  C  CA    . SER A 1  203  ? 18.851  28.139  30.978   1.00 67.32  ? 203  SER A CA    1 
ATOM   1530  C  C     . SER A 1  203  ? 18.644  26.636  31.168   1.00 71.47  ? 203  SER A C     1 
ATOM   1531  O  O     . SER A 1  203  ? 17.505  26.168  31.241   1.00 70.07  ? 203  SER A O     1 
ATOM   1532  C  CB    . SER A 1  203  ? 19.027  28.815  32.341   1.00 68.35  ? 203  SER A CB    1 
ATOM   1533  O  OG    . SER A 1  203  ? 19.846  28.044  33.203   1.00 76.89  ? 203  SER A OG    1 
ATOM   1534  N  N     . PRO A 1  204  ? 19.751  25.874  31.236   1.00 71.00  ? 204  PRO A N     1 
ATOM   1535  C  CA    . PRO A 1  204  ? 19.708  24.446  31.570   1.00 69.02  ? 204  PRO A CA    1 
ATOM   1536  C  C     . PRO A 1  204  ? 18.979  24.181  32.886   1.00 71.96  ? 204  PRO A C     1 
ATOM   1537  O  O     . PRO A 1  204  ? 18.338  23.139  33.035   1.00 73.93  ? 204  PRO A O     1 
ATOM   1538  C  CB    . PRO A 1  204  ? 21.187  24.070  31.675   1.00 70.27  ? 204  PRO A CB    1 
ATOM   1539  C  CG    . PRO A 1  204  ? 21.868  25.012  30.745   1.00 69.24  ? 204  PRO A CG    1 
ATOM   1540  C  CD    . PRO A 1  204  ? 21.108  26.306  30.850   1.00 69.88  ? 204  PRO A CD    1 
ATOM   1541  N  N     . ARG A 1  205  ? 19.081  25.123  33.821   1.00 76.61  ? 205  ARG A N     1 
ATOM   1542  C  CA    . ARG A 1  205  ? 18.363  25.047  35.090   1.00 82.12  ? 205  ARG A CA    1 
ATOM   1543  C  C     . ARG A 1  205  ? 16.901  25.450  34.921   1.00 77.57  ? 205  ARG A C     1 
ATOM   1544  O  O     . ARG A 1  205  ? 16.000  24.779  35.425   1.00 80.71  ? 205  ARG A O     1 
ATOM   1545  C  CB    . ARG A 1  205  ? 19.033  25.940  36.140   1.00 90.55  ? 205  ARG A CB    1 
ATOM   1546  C  CG    . ARG A 1  205  ? 20.360  25.414  36.664   1.00 80.21  ? 205  ARG A CG    1 
ATOM   1547  C  CD    . ARG A 1  205  ? 21.043  26.428  37.569   1.00 78.12  ? 205  ARG A CD    1 
ATOM   1548  N  NE    . ARG A 1  205  ? 22.013  25.792  38.453   1.00 80.22  ? 205  ARG A NE    1 
ATOM   1549  C  CZ    . ARG A 1  205  ? 22.139  26.077  39.745   1.00 86.84  ? 205  ARG A CZ    1 
ATOM   1550  N  NH1   . ARG A 1  205  ? 21.359  26.994  40.299   1.00 98.39  ? 205  ARG A NH1   1 
ATOM   1551  N  NH2   . ARG A 1  205  ? 23.043  25.449  40.482   1.00 87.37  ? 205  ARG A NH2   1 
ATOM   1552  N  N     . ASP A 1  206  ? 16.675  26.550  34.208   1.00 76.65  ? 206  ASP A N     1 
ATOM   1553  C  CA    . ASP A 1  206  ? 15.326  27.066  33.992   1.00 76.16  ? 206  ASP A CA    1 
ATOM   1554  C  C     . ASP A 1  206  ? 14.471  26.074  33.205   1.00 73.94  ? 206  ASP A C     1 
ATOM   1555  O  O     . ASP A 1  206  ? 13.246  26.064  33.321   1.00 78.25  ? 206  ASP A O     1 
ATOM   1556  C  CB    . ASP A 1  206  ? 15.374  28.416  33.266   1.00 77.35  ? 206  ASP A CB    1 
ATOM   1557  C  CG    . ASP A 1  206  ? 15.971  29.525  34.120   1.00 75.27  ? 206  ASP A CG    1 
ATOM   1558  O  OD1   . ASP A 1  206  ? 15.826  29.472  35.361   1.00 71.48  ? 206  ASP A OD1   1 
ATOM   1559  O  OD2   . ASP A 1  206  ? 16.584  30.450  33.545   1.00 81.38  ? 206  ASP A OD2   1 
ATOM   1560  N  N     . ALA A 1  207  ? 15.127  25.239  32.408   1.00 68.58  ? 207  ALA A N     1 
ATOM   1561  C  CA    . ALA A 1  207  ? 14.436  24.210  31.645   1.00 70.40  ? 207  ALA A CA    1 
ATOM   1562  C  C     . ALA A 1  207  ? 13.962  23.091  32.562   1.00 71.32  ? 207  ALA A C     1 
ATOM   1563  O  O     . ALA A 1  207  ? 12.839  22.600  32.439   1.00 70.63  ? 207  ALA A O     1 
ATOM   1564  C  CB    . ALA A 1  207  ? 15.343  23.654  30.559   1.00 78.36  ? 207  ALA A CB    1 
ATOM   1565  N  N     . LEU A 1  208  ? 14.833  22.692  33.482   1.00 72.33  ? 208  LEU A N     1 
ATOM   1566  C  CA    . LEU A 1  208  ? 14.530  21.608  34.406   1.00 69.07  ? 208  LEU A CA    1 
ATOM   1567  C  C     . LEU A 1  208  ? 13.541  22.064  35.471   1.00 71.36  ? 208  LEU A C     1 
ATOM   1568  O  O     . LEU A 1  208  ? 12.921  21.245  36.149   1.00 73.98  ? 208  LEU A O     1 
ATOM   1569  C  CB    . LEU A 1  208  ? 15.812  21.087  35.056   1.00 66.46  ? 208  LEU A CB    1 
ATOM   1570  C  CG    . LEU A 1  208  ? 15.731  19.733  35.761   1.00 67.16  ? 208  LEU A CG    1 
ATOM   1571  C  CD1   . LEU A 1  208  ? 15.369  18.642  34.771   1.00 71.34  ? 208  LEU A CD1   1 
ATOM   1572  C  CD2   . LEU A 1  208  ? 17.045  19.413  36.453   1.00 82.70  ? 208  LEU A CD2   1 
ATOM   1573  N  N     . ALA A 1  209  ? 13.392  23.378  35.602   1.00 75.61  ? 209  ALA A N     1 
ATOM   1574  C  CA    . ALA A 1  209  ? 12.460  23.957  36.563   1.00 89.27  ? 209  ALA A CA    1 
ATOM   1575  C  C     . ALA A 1  209  ? 11.032  23.964  36.021   1.00 87.68  ? 209  ALA A C     1 
ATOM   1576  O  O     . ALA A 1  209  ? 10.074  23.790  36.777   1.00 92.83  ? 209  ALA A O     1 
ATOM   1577  C  CB    . ALA A 1  209  ? 12.890  25.368  36.937   1.00 96.02  ? 209  ALA A CB    1 
ATOM   1578  N  N     . SER A 1  210  ? 10.890  24.177  34.716   1.00 82.98  ? 210  SER A N     1 
ATOM   1579  C  CA    . SER A 1  210  ? 9.583   24.091  34.077   1.00 81.43  ? 210  SER A CA    1 
ATOM   1580  C  C     . SER A 1  210  ? 9.266   22.631  33.791   1.00 81.53  ? 210  SER A C     1 
ATOM   1581  O  O     . SER A 1  210  ? 8.132   22.277  33.462   1.00 81.62  ? 210  SER A O     1 
ATOM   1582  C  CB    . SER A 1  210  ? 9.537   24.909  32.788   1.00 79.03  ? 210  SER A CB    1 
ATOM   1583  O  OG    . SER A 1  210  ? 8.254   24.832  32.186   1.00 79.67  ? 210  SER A OG    1 
ATOM   1584  N  N     . ALA A 1  211  ? 10.289  21.791  33.913   1.00 80.37  ? 211  ALA A N     1 
ATOM   1585  C  CA    . ALA A 1  211  ? 10.124  20.351  33.788   1.00 77.70  ? 211  ALA A CA    1 
ATOM   1586  C  C     . ALA A 1  211  ? 9.600   19.776  35.094   1.00 78.44  ? 211  ALA A C     1 
ATOM   1587  O  O     . ALA A 1  211  ? 8.910   18.760  35.103   1.00 77.84  ? 211  ALA A O     1 
ATOM   1588  C  CB    . ALA A 1  211  ? 11.436  19.694  33.406   1.00 70.68  ? 211  ALA A CB    1 
ATOM   1589  N  N     . GLY A 1  212  ? 9.937   20.437  36.195   1.00 78.61  ? 212  GLY A N     1 
ATOM   1590  C  CA    . GLY A 1  212  ? 9.468   20.025  37.503   1.00 82.39  ? 212  GLY A CA    1 
ATOM   1591  C  C     . GLY A 1  212  ? 8.105   20.597  37.838   1.00 89.56  ? 212  GLY A C     1 
ATOM   1592  O  O     . GLY A 1  212  ? 7.365   20.017  38.629   1.00 94.77  ? 212  GLY A O     1 
ATOM   1593  N  N     . LYS A 1  213  ? 7.773   21.739  37.239   1.00 94.07  ? 213  LYS A N     1 
ATOM   1594  C  CA    . LYS A 1  213  ? 6.472   22.372  37.457   1.00 101.62 ? 213  LYS A CA    1 
ATOM   1595  C  C     . LYS A 1  213  ? 5.357   21.559  36.801   1.00 98.90  ? 213  LYS A C     1 
ATOM   1596  O  O     . LYS A 1  213  ? 4.235   21.494  37.307   1.00 96.66  ? 213  LYS A O     1 
ATOM   1597  C  CB    . LYS A 1  213  ? 6.472   23.808  36.918   1.00 96.65  ? 213  LYS A CB    1 
ATOM   1598  C  CG    . LYS A 1  213  ? 5.120   24.517  36.995   1.00 94.69  ? 213  LYS A CG    1 
ATOM   1599  C  CD    . LYS A 1  213  ? 4.588   24.554  38.420   1.00 84.71  ? 213  LYS A CD    1 
ATOM   1600  C  CE    . LYS A 1  213  ? 3.200   25.170  38.479   1.00 81.24  ? 213  LYS A CE    1 
ATOM   1601  N  NZ    . LYS A 1  213  ? 3.183   26.534  37.886   1.00 79.39  ? 213  LYS A NZ    1 
ATOM   1602  N  N     . THR A 1  214  ? 5.680   20.935  35.674   1.00 94.41  ? 214  THR A N     1 
ATOM   1603  C  CA    . THR A 1  214  ? 4.719   20.123  34.938   1.00 89.92  ? 214  THR A CA    1 
ATOM   1604  C  C     . THR A 1  214  ? 4.444   18.802  35.650   1.00 87.99  ? 214  THR A C     1 
ATOM   1605  O  O     . THR A 1  214  ? 3.291   18.439  35.882   1.00 89.55  ? 214  THR A O     1 
ATOM   1606  C  CB    . THR A 1  214  ? 5.216   19.838  33.507   1.00 88.64  ? 214  THR A CB    1 
ATOM   1607  O  OG1   . THR A 1  214  ? 5.282   21.064  32.768   1.00 93.35  ? 214  THR A OG1   1 
ATOM   1608  C  CG2   . THR A 1  214  ? 4.281   18.874  32.794   1.00 87.60  ? 214  THR A CG2   1 
ATOM   1609  N  N     . LEU A 1  215  ? 5.514   18.095  36.002   1.00 86.24  ? 215  LEU A N     1 
ATOM   1610  C  CA    . LEU A 1  215  ? 5.417   16.767  36.604   1.00 80.77  ? 215  LEU A CA    1 
ATOM   1611  C  C     . LEU A 1  215  ? 4.665   16.753  37.935   1.00 85.06  ? 215  LEU A C     1 
ATOM   1612  O  O     . LEU A 1  215  ? 3.819   15.887  38.159   1.00 86.14  ? 215  LEU A O     1 
ATOM   1613  C  CB    . LEU A 1  215  ? 6.816   16.178  36.797   1.00 77.10  ? 215  LEU A CB    1 
ATOM   1614  C  CG    . LEU A 1  215  ? 7.601   15.928  35.509   1.00 78.09  ? 215  LEU A CG    1 
ATOM   1615  C  CD1   . LEU A 1  215  ? 8.978   15.358  35.814   1.00 84.55  ? 215  LEU A CD1   1 
ATOM   1616  C  CD2   . LEU A 1  215  ? 6.829   15.013  34.576   1.00 76.77  ? 215  LEU A CD2   1 
ATOM   1617  N  N     . VAL A 1  216  ? 4.974   17.705  38.812   1.00 88.25  ? 216  VAL A N     1 
ATOM   1618  C  CA    . VAL A 1  216  ? 4.301   17.802  40.107   1.00 92.99  ? 216  VAL A CA    1 
ATOM   1619  C  C     . VAL A 1  216  ? 2.797   18.025  39.930   1.00 93.81  ? 216  VAL A C     1 
ATOM   1620  O  O     . VAL A 1  216  ? 1.986   17.448  40.658   1.00 101.93 ? 216  VAL A O     1 
ATOM   1621  C  CB    . VAL A 1  216  ? 4.895   18.940  40.974   1.00 96.76  ? 216  VAL A CB    1 
ATOM   1622  C  CG1   . VAL A 1  216  ? 4.069   19.149  42.237   1.00 99.48  ? 216  VAL A CG1   1 
ATOM   1623  C  CG2   . VAL A 1  216  ? 6.341   18.638  41.334   1.00 95.42  ? 216  VAL A CG2   1 
ATOM   1624  N  N     . GLU A 1  217  ? 2.429   18.848  38.950   1.00 92.21  ? 217  GLU A N     1 
ATOM   1625  C  CA    . GLU A 1  217  ? 1.024   19.146  38.671   1.00 97.44  ? 217  GLU A CA    1 
ATOM   1626  C  C     . GLU A 1  217  ? 0.317   17.913  38.100   1.00 93.69  ? 217  GLU A C     1 
ATOM   1627  O  O     . GLU A 1  217  ? -0.913  17.836  38.080   1.00 95.94  ? 217  GLU A O     1 
ATOM   1628  C  CB    . GLU A 1  217  ? 0.910   20.340  37.709   1.00 103.20 ? 217  GLU A CB    1 
ATOM   1629  C  CG    . GLU A 1  217  ? -0.487  20.959  37.600   1.00 113.97 ? 217  GLU A CG    1 
ATOM   1630  C  CD    . GLU A 1  217  ? -0.497  22.287  36.847   1.00 113.14 ? 217  GLU A CD    1 
ATOM   1631  O  OE1   . GLU A 1  217  ? -1.593  22.852  36.642   1.00 118.02 ? 217  GLU A OE1   1 
ATOM   1632  O  OE2   . GLU A 1  217  ? 0.589   22.773  36.468   1.00 107.07 ? 217  GLU A OE2   1 
ATOM   1633  N  N     . LEU A 1  218  ? 1.108   16.946  37.644   1.00 86.84  ? 218  LEU A N     1 
ATOM   1634  C  CA    . LEU A 1  218  ? 0.572   15.691  37.133   1.00 82.38  ? 218  LEU A CA    1 
ATOM   1635  C  C     . LEU A 1  218  ? 0.541   14.619  38.220   1.00 88.33  ? 218  LEU A C     1 
ATOM   1636  O  O     . LEU A 1  218  ? -0.444  13.896  38.357   1.00 95.02  ? 218  LEU A O     1 
ATOM   1637  C  CB    . LEU A 1  218  ? 1.387   15.207  35.931   1.00 75.94  ? 218  LEU A CB    1 
ATOM   1638  C  CG    . LEU A 1  218  ? 0.850   15.590  34.547   1.00 85.84  ? 218  LEU A CG    1 
ATOM   1639  C  CD1   . LEU A 1  218  ? -0.523  14.981  34.338   1.00 88.64  ? 218  LEU A CD1   1 
ATOM   1640  C  CD2   . LEU A 1  218  ? 0.795   17.100  34.359   1.00 96.64  ? 218  LEU A CD2   1 
ATOM   1641  N  N     . PHE A 1  219  ? 1.612   14.528  39.003   1.00 88.67  ? 219  PHE A N     1 
ATOM   1642  C  CA    . PHE A 1  219  ? 1.693   13.539  40.078   1.00 94.02  ? 219  PHE A CA    1 
ATOM   1643  C  C     . PHE A 1  219  ? 0.829   13.903  41.288   1.00 107.78 ? 219  PHE A C     1 
ATOM   1644  O  O     . PHE A 1  219  ? 0.766   13.149  42.259   1.00 113.22 ? 219  PHE A O     1 
ATOM   1645  C  CB    . PHE A 1  219  ? 3.146   13.354  40.527   1.00 92.22  ? 219  PHE A CB    1 
ATOM   1646  C  CG    . PHE A 1  219  ? 3.939   12.398  39.672   1.00 82.99  ? 219  PHE A CG    1 
ATOM   1647  C  CD1   . PHE A 1  219  ? 4.141   11.087  40.078   1.00 78.04  ? 219  PHE A CD1   1 
ATOM   1648  C  CD2   . PHE A 1  219  ? 4.496   12.815  38.474   1.00 78.58  ? 219  PHE A CD2   1 
ATOM   1649  C  CE1   . PHE A 1  219  ? 4.873   10.214  39.300   1.00 71.62  ? 219  PHE A CE1   1 
ATOM   1650  C  CE2   . PHE A 1  219  ? 5.231   11.945  37.695   1.00 74.47  ? 219  PHE A CE2   1 
ATOM   1651  C  CZ    . PHE A 1  219  ? 5.420   10.645  38.109   1.00 68.74  ? 219  PHE A CZ    1 
ATOM   1652  N  N     . GLY A 1  220  ? 0.165   15.052  41.228   1.00 110.10 ? 220  GLY A N     1 
ATOM   1653  C  CA    . GLY A 1  220  ? -0.693  15.488  42.316   1.00 124.26 ? 220  GLY A CA    1 
ATOM   1654  C  C     . GLY A 1  220  ? -2.066  14.843  42.281   1.00 132.58 ? 220  GLY A C     1 
ATOM   1655  O  O     . GLY A 1  220  ? -2.755  14.768  43.301   1.00 140.05 ? 220  GLY A O     1 
ATOM   1656  N  N     . LEU A 1  221  ? -2.465  14.370  41.104   1.00 127.75 ? 221  LEU A N     1 
ATOM   1657  C  CA    . LEU A 1  221  ? -3.782  13.765  40.923   1.00 130.60 ? 221  LEU A CA    1 
ATOM   1658  C  C     . LEU A 1  221  ? -3.793  12.316  41.419   1.00 127.50 ? 221  LEU A C     1 
ATOM   1659  O  O     . LEU A 1  221  ? -4.830  11.652  41.408   1.00 123.82 ? 221  LEU A O     1 
ATOM   1660  C  CB    . LEU A 1  221  ? -4.207  13.843  39.450   1.00 128.46 ? 221  LEU A CB    1 
ATOM   1661  C  CG    . LEU A 1  221  ? -4.427  15.257  38.886   1.00 132.98 ? 221  LEU A CG    1 
ATOM   1662  C  CD1   . LEU A 1  221  ? -4.186  15.301  37.385   1.00 123.20 ? 221  LEU A CD1   1 
ATOM   1663  C  CD2   . LEU A 1  221  ? -5.823  15.789  39.212   1.00 128.89 ? 221  LEU A CD2   1 
ATOM   1664  N  N     . ALA A 1  222  ? -2.632  11.842  41.866   1.00 128.72 ? 222  ALA A N     1 
ATOM   1665  C  CA    . ALA A 1  222  ? -2.509  10.514  42.461   1.00 128.60 ? 222  ALA A CA    1 
ATOM   1666  C  C     . ALA A 1  222  ? -2.545  10.594  43.984   1.00 132.30 ? 222  ALA A C     1 
ATOM   1667  O  O     . ALA A 1  222  ? -2.383  9.585   44.674   1.00 127.50 ? 222  ALA A O     1 
ATOM   1668  C  CB    . ALA A 1  222  ? -1.227  9.839   41.997   1.00 118.01 ? 222  ALA A CB    1 
ATOM   1669  N  N     . ARG A 1  223  ? -2.763  11.801  44.498   1.00 139.29 ? 223  ARG A N     1 
ATOM   1670  C  CA    . ARG A 1  223  ? -2.802  12.038  45.937   1.00 142.86 ? 223  ARG A CA    1 
ATOM   1671  C  C     . ARG A 1  223  ? -4.210  12.436  46.394   1.00 159.47 ? 223  ARG A C     1 
ATOM   1672  O  O     . ARG A 1  223  ? -4.566  12.256  47.559   1.00 170.10 ? 223  ARG A O     1 
ATOM   1673  C  CB    . ARG A 1  223  ? -1.780  13.116  46.322   1.00 135.41 ? 223  ARG A CB    1 
ATOM   1674  C  CG    . ARG A 1  223  ? -1.660  13.388  47.817   1.00 135.72 ? 223  ARG A CG    1 
ATOM   1675  C  CD    . ARG A 1  223  ? -0.339  14.066  48.155   1.00 135.10 ? 223  ARG A CD    1 
ATOM   1676  N  NE    . ARG A 1  223  ? -0.061  15.211  47.293   1.00 153.46 ? 223  ARG A NE    1 
ATOM   1677  C  CZ    . ARG A 1  223  ? -0.391  16.466  47.582   1.00 156.47 ? 223  ARG A CZ    1 
ATOM   1678  N  NH1   . ARG A 1  223  ? -1.020  16.745  48.716   1.00 155.83 ? 223  ARG A NH1   1 
ATOM   1679  N  NH2   . ARG A 1  223  ? -0.093  17.444  46.735   1.00 145.32 ? 223  ARG A NH2   1 
ATOM   1680  N  N     . GLU A 1  224  ? -5.013  12.964  45.472   1.00 155.90 ? 224  GLU A N     1 
ATOM   1681  C  CA    . GLU A 1  224  ? -6.384  13.359  45.794   1.00 161.30 ? 224  GLU A CA    1 
ATOM   1682  C  C     . GLU A 1  224  ? -7.265  12.135  46.062   1.00 168.85 ? 224  GLU A C     1 
ATOM   1683  O  O     . GLU A 1  224  ? -7.120  11.098  45.412   1.00 168.21 ? 224  GLU A O     1 
ATOM   1684  C  CB    . GLU A 1  224  ? -6.981  14.214  44.668   1.00 155.01 ? 224  GLU A CB    1 
ATOM   1685  C  CG    . GLU A 1  224  ? -7.028  13.538  43.306   1.00 150.01 ? 224  GLU A CG    1 
ATOM   1686  C  CD    . GLU A 1  224  ? -7.720  14.386  42.250   1.00 149.17 ? 224  GLU A CD    1 
ATOM   1687  O  OE1   . GLU A 1  224  ? -8.148  15.514  42.573   1.00 152.86 ? 224  GLU A OE1   1 
ATOM   1688  O  OE2   . GLU A 1  224  ? -7.833  13.923  41.095   1.00 146.58 ? 224  GLU A OE2   1 
ATOM   1689  N  N     . LEU A 1  225  ? -8.172  12.262  47.026   1.00 169.47 ? 225  LEU A N     1 
ATOM   1690  C  CA    . LEU A 1  225  ? -9.025  11.149  47.440   1.00 165.40 ? 225  LEU A CA    1 
ATOM   1691  C  C     . LEU A 1  225  ? -10.219 10.971  46.505   1.00 169.13 ? 225  LEU A C     1 
ATOM   1692  O  O     . LEU A 1  225  ? -10.665 11.921  45.864   1.00 174.43 ? 225  LEU A O     1 
ATOM   1693  C  CB    . LEU A 1  225  ? -9.503  11.335  48.894   1.00 155.99 ? 225  LEU A CB    1 
ATOM   1694  C  CG    . LEU A 1  225  ? -10.348 12.508  49.438   1.00 147.21 ? 225  LEU A CG    1 
ATOM   1695  C  CD1   . LEU A 1  225  ? -9.719  13.879  49.181   1.00 149.62 ? 225  LEU A CD1   1 
ATOM   1696  C  CD2   . LEU A 1  225  ? -11.797 12.479  48.955   1.00 144.70 ? 225  LEU A CD2   1 
ATOM   1697  N  N     . ASN A 1  226  ? -10.727 9.744   46.433   1.00 170.79 ? 226  ASN A N     1 
ATOM   1698  C  CA    . ASN A 1  226  ? -11.883 9.436   45.599   1.00 165.91 ? 226  ASN A CA    1 
ATOM   1699  C  C     . ASN A 1  226  ? -13.192 9.851   46.262   1.00 169.56 ? 226  ASN A C     1 
ATOM   1700  O  O     . ASN A 1  226  ? -13.480 11.040  46.400   1.00 173.01 ? 226  ASN A O     1 
ATOM   1701  C  CB    . ASN A 1  226  ? -11.920 7.943   45.271   1.00 148.67 ? 226  ASN A CB    1 
ATOM   1702  C  CG    . ASN A 1  226  ? -13.146 7.553   44.471   1.00 144.05 ? 226  ASN A CG    1 
ATOM   1703  O  OD1   . ASN A 1  226  ? -13.619 8.314   43.627   1.00 148.12 ? 226  ASN A OD1   1 
ATOM   1704  N  ND2   . ASN A 1  226  ? -13.675 6.366   44.741   1.00 141.80 ? 226  ASN A ND2   1 
ATOM   1705  N  N     . ARG B 1  6    ? -8.233  19.200  27.916   1.00 106.85 ? 6    ARG B N     1 
ATOM   1706  C  CA    . ARG B 1  6    ? -9.051  18.713  29.020   1.00 111.18 ? 6    ARG B CA    1 
ATOM   1707  C  C     . ARG B 1  6    ? -8.201  17.995  30.066   1.00 119.06 ? 6    ARG B C     1 
ATOM   1708  O  O     . ARG B 1  6    ? -7.413  17.111  29.728   1.00 116.42 ? 6    ARG B O     1 
ATOM   1709  C  CB    . ARG B 1  6    ? -10.146 17.778  28.500   1.00 98.94  ? 6    ARG B CB    1 
ATOM   1710  N  N     . PRO B 1  7    ? -8.355  18.383  31.345   1.00 131.60 ? 7    PRO B N     1 
ATOM   1711  C  CA    . PRO B 1  7    ? -7.652  17.754  32.472   1.00 127.13 ? 7    PRO B CA    1 
ATOM   1712  C  C     . PRO B 1  7    ? -7.890  16.244  32.552   1.00 110.70 ? 7    PRO B C     1 
ATOM   1713  O  O     . PRO B 1  7    ? -8.830  15.732  31.944   1.00 103.69 ? 7    PRO B O     1 
ATOM   1714  C  CB    . PRO B 1  7    ? -8.242  18.467  33.693   1.00 135.29 ? 7    PRO B CB    1 
ATOM   1715  C  CG    . PRO B 1  7    ? -8.662  19.800  33.176   1.00 137.00 ? 7    PRO B CG    1 
ATOM   1716  C  CD    . PRO B 1  7    ? -9.150  19.547  31.775   1.00 132.63 ? 7    PRO B CD    1 
ATOM   1717  N  N     . THR B 1  8    ? -7.044  15.544  33.302   1.00 103.43 ? 8    THR B N     1 
ATOM   1718  C  CA    . THR B 1  8    ? -7.066  14.084  33.323   1.00 101.10 ? 8    THR B CA    1 
ATOM   1719  C  C     . THR B 1  8    ? -7.941  13.516  34.438   1.00 101.24 ? 8    THR B C     1 
ATOM   1720  O  O     . THR B 1  8    ? -8.175  14.173  35.453   1.00 109.25 ? 8    THR B O     1 
ATOM   1721  C  CB    . THR B 1  8    ? -5.645  13.512  33.478   1.00 99.25  ? 8    THR B CB    1 
ATOM   1722  O  OG1   . THR B 1  8    ? -5.180  13.738  34.813   1.00 98.87  ? 8    THR B OG1   1 
ATOM   1723  C  CG2   . THR B 1  8    ? -4.694  14.175  32.495   1.00 97.10  ? 8    THR B CG2   1 
ATOM   1724  N  N     . LEU B 1  9    ? -8.413  12.287  34.235   1.00 94.50  ? 9    LEU B N     1 
ATOM   1725  C  CA    . LEU B 1  9    ? -9.244  11.594  35.216   1.00 90.78  ? 9    LEU B CA    1 
ATOM   1726  C  C     . LEU B 1  9    ? -8.482  10.470  35.913   1.00 87.22  ? 9    LEU B C     1 
ATOM   1727  O  O     . LEU B 1  9    ? -7.356  10.137  35.541   1.00 84.80  ? 9    LEU B O     1 
ATOM   1728  C  CB    . LEU B 1  9    ? -10.497 11.016  34.552   1.00 86.63  ? 9    LEU B CB    1 
ATOM   1729  C  CG    . LEU B 1  9    ? -11.309 11.945  33.652   1.00 82.27  ? 9    LEU B CG    1 
ATOM   1730  C  CD1   . LEU B 1  9    ? -12.565 11.243  33.163   1.00 74.49  ? 9    LEU B CD1   1 
ATOM   1731  C  CD2   . LEU B 1  9    ? -11.657 13.224  34.383   1.00 87.12  ? 9    LEU B CD2   1 
ATOM   1732  N  N     . SER B 1  10   ? -9.113  9.886   36.925   1.00 84.07  ? 10   SER B N     1 
ATOM   1733  C  CA    . SER B 1  10   ? -8.550  8.739   37.623   1.00 85.37  ? 10   SER B CA    1 
ATOM   1734  C  C     . SER B 1  10   ? -9.660  7.744   37.926   1.00 86.97  ? 10   SER B C     1 
ATOM   1735  O  O     . SER B 1  10   ? -10.688 8.110   38.493   1.00 90.09  ? 10   SER B O     1 
ATOM   1736  C  CB    . SER B 1  10   ? -7.851  9.168   38.912   1.00 87.26  ? 10   SER B CB    1 
ATOM   1737  O  OG    . SER B 1  10   ? -7.271  8.052   39.563   1.00 94.12  ? 10   SER B OG    1 
ATOM   1738  N  N     . GLU B 1  11   ? -9.455  6.489   37.541   1.00 83.04  ? 11   GLU B N     1 
ATOM   1739  C  CA    . GLU B 1  11   ? -10.498 5.479   37.675   1.00 81.76  ? 11   GLU B CA    1 
ATOM   1740  C  C     . GLU B 1  11   ? -10.002 4.222   38.377   1.00 76.37  ? 11   GLU B C     1 
ATOM   1741  O  O     . GLU B 1  11   ? -8.819  4.104   38.698   1.00 78.94  ? 11   GLU B O     1 
ATOM   1742  C  CB    . GLU B 1  11   ? -11.062 5.125   36.300   1.00 91.54  ? 11   GLU B CB    1 
ATOM   1743  C  CG    . GLU B 1  11   ? -11.667 6.313   35.569   1.00 94.93  ? 11   GLU B CG    1 
ATOM   1744  C  CD    . GLU B 1  11   ? -12.155 5.965   34.176   1.00 102.00 ? 11   GLU B CD    1 
ATOM   1745  O  OE1   . GLU B 1  11   ? -12.136 4.768   33.816   1.00 108.46 ? 11   GLU B OE1   1 
ATOM   1746  O  OE2   . GLU B 1  11   ? -12.556 6.892   33.440   1.00 101.87 ? 11   GLU B OE2   1 
ATOM   1747  N  N     . ASP B 1  12   ? -10.912 3.283   38.614   1.00 76.06  ? 12   ASP B N     1 
ATOM   1748  C  CA    . ASP B 1  12   ? -10.580 2.091   39.383   1.00 79.94  ? 12   ASP B CA    1 
ATOM   1749  C  C     . ASP B 1  12   ? -11.520 0.918   39.095   1.00 86.31  ? 12   ASP B C     1 
ATOM   1750  O  O     . ASP B 1  12   ? -12.743 1.060   39.137   1.00 93.96  ? 12   ASP B O     1 
ATOM   1751  C  CB    . ASP B 1  12   ? -10.600 2.421   40.880   1.00 78.31  ? 12   ASP B CB    1 
ATOM   1752  C  CG    . ASP B 1  12   ? -9.809  1.431   41.713   1.00 83.99  ? 12   ASP B CG    1 
ATOM   1753  O  OD1   . ASP B 1  12   ? -9.500  0.330   41.213   1.00 85.03  ? 12   ASP B OD1   1 
ATOM   1754  O  OD2   . ASP B 1  12   ? -9.494  1.758   42.875   1.00 85.74  ? 12   ASP B OD2   1 
ATOM   1755  N  N     . VAL B 1  13   ? -10.930 -0.238  38.797   1.00 87.79  ? 13   VAL B N     1 
ATOM   1756  C  CA    . VAL B 1  13   ? -11.657 -1.505  38.734   1.00 89.71  ? 13   VAL B CA    1 
ATOM   1757  C  C     . VAL B 1  13   ? -11.029 -2.454  39.762   1.00 88.37  ? 13   VAL B C     1 
ATOM   1758  O  O     . VAL B 1  13   ? -9.833  -2.738  39.703   1.00 87.90  ? 13   VAL B O     1 
ATOM   1759  C  CB    . VAL B 1  13   ? -11.620 -2.131  37.327   1.00 87.60  ? 13   VAL B CB    1 
ATOM   1760  C  CG1   . VAL B 1  13   ? -12.698 -3.194  37.195   1.00 90.49  ? 13   VAL B CG1   1 
ATOM   1761  C  CG2   . VAL B 1  13   ? -11.807 -1.059  36.263   1.00 79.72  ? 13   VAL B CG2   1 
ATOM   1762  N  N     . LEU B 1  14   ? -11.837 -2.945  40.698   1.00 85.98  ? 14   LEU B N     1 
ATOM   1763  C  CA    . LEU B 1  14   ? -11.318 -3.457  41.968   1.00 80.88  ? 14   LEU B CA    1 
ATOM   1764  C  C     . LEU B 1  14   ? -11.233 -4.976  42.153   1.00 80.92  ? 14   LEU B C     1 
ATOM   1765  O  O     . LEU B 1  14   ? -11.740 -5.760  41.350   1.00 84.72  ? 14   LEU B O     1 
ATOM   1766  C  CB    . LEU B 1  14   ? -12.168 -2.889  43.108   1.00 78.50  ? 14   LEU B CB    1 
ATOM   1767  C  CG    . LEU B 1  14   ? -12.110 -1.377  43.319   1.00 76.47  ? 14   LEU B CG    1 
ATOM   1768  C  CD1   . LEU B 1  14   ? -13.308 -0.898  44.126   1.00 75.45  ? 14   LEU B CD1   1 
ATOM   1769  C  CD2   . LEU B 1  14   ? -10.818 -1.006  44.015   1.00 79.64  ? 14   LEU B CD2   1 
ATOM   1770  N  N     . THR B 1  15   ? -10.558 -5.353  43.238   1.00 83.52  ? 15   THR B N     1 
ATOM   1771  C  CA    . THR B 1  15   ? -10.536 -6.706  43.792   1.00 84.72  ? 15   THR B CA    1 
ATOM   1772  C  C     . THR B 1  15   ? -10.146 -6.511  45.261   1.00 90.61  ? 15   THR B C     1 
ATOM   1773  O  O     . THR B 1  15   ? -9.734  -5.416  45.639   1.00 93.11  ? 15   THR B O     1 
ATOM   1774  C  CB    . THR B 1  15   ? -9.542  -7.643  43.062   1.00 83.57  ? 15   THR B CB    1 
ATOM   1775  O  OG1   . THR B 1  15   ? -9.676  -7.485  41.645   1.00 81.52  ? 15   THR B OG1   1 
ATOM   1776  C  CG2   . THR B 1  15   ? -9.793  -9.103  43.425   1.00 77.97  ? 15   THR B CG2   1 
ATOM   1777  N  N     . ASP B 1  16   ? -10.283 -7.538  46.094   1.00 91.01  ? 16   ASP B N     1 
ATOM   1778  C  CA    . ASP B 1  16   ? -10.002 -7.386  47.520   1.00 95.63  ? 16   ASP B CA    1 
ATOM   1779  C  C     . ASP B 1  16   ? -8.555  -7.003  47.803   1.00 93.99  ? 16   ASP B C     1 
ATOM   1780  O  O     . ASP B 1  16   ? -8.293  -6.050  48.537   1.00 90.82  ? 16   ASP B O     1 
ATOM   1781  C  CB    . ASP B 1  16   ? -10.343 -8.672  48.271   1.00 101.53 ? 16   ASP B CB    1 
ATOM   1782  C  CG    . ASP B 1  16   ? -11.836 -8.868  48.437   1.00 105.57 ? 16   ASP B CG    1 
ATOM   1783  O  OD1   . ASP B 1  16   ? -12.539 -7.874  48.723   1.00 113.99 ? 16   ASP B OD1   1 
ATOM   1784  O  OD2   . ASP B 1  16   ? -12.307 -10.014 48.272   1.00 102.48 ? 16   ASP B OD2   1 
ATOM   1785  N  N     . ASN B 1  17   ? -7.619  -7.744  47.221   1.00 91.79  ? 17   ASN B N     1 
ATOM   1786  C  CA    . ASN B 1  17   ? -6.209  -7.523  47.507   1.00 96.24  ? 17   ASN B CA    1 
ATOM   1787  C  C     . ASN B 1  17   ? -5.530  -6.611  46.491   1.00 100.45 ? 17   ASN B C     1 
ATOM   1788  O  O     . ASN B 1  17   ? -4.514  -5.985  46.794   1.00 103.23 ? 17   ASN B O     1 
ATOM   1789  C  CB    . ASN B 1  17   ? -5.469  -8.857  47.581   1.00 104.51 ? 17   ASN B CB    1 
ATOM   1790  C  CG    . ASN B 1  17   ? -4.758  -9.050  48.907   1.00 110.03 ? 17   ASN B CG    1 
ATOM   1791  O  OD1   . ASN B 1  17   ? -5.084  -8.396  49.897   1.00 112.10 ? 17   ASN B OD1   1 
ATOM   1792  N  ND2   . ASN B 1  17   ? -3.781  -9.950  48.933   1.00 113.35 ? 17   ASN B ND2   1 
ATOM   1793  N  N     . ARG B 1  18   ? -6.091  -6.529  45.288   1.00 102.30 ? 18   ARG B N     1 
ATOM   1794  C  CA    . ARG B 1  18   ? -5.509  -5.692  44.246   1.00 96.87  ? 18   ARG B CA    1 
ATOM   1795  C  C     . ARG B 1  18   ? -6.577  -4.953  43.453   1.00 96.63  ? 18   ARG B C     1 
ATOM   1796  O  O     . ARG B 1  18   ? -7.766  -5.099  43.720   1.00 101.38 ? 18   ARG B O     1 
ATOM   1797  C  CB    . ARG B 1  18   ? -4.648  -6.533  43.304   1.00 102.29 ? 18   ARG B CB    1 
ATOM   1798  C  CG    . ARG B 1  18   ? -5.408  -7.425  42.339   1.00 110.80 ? 18   ARG B CG    1 
ATOM   1799  C  CD    . ARG B 1  18   ? -4.422  -8.140  41.420   1.00 117.64 ? 18   ARG B CD    1 
ATOM   1800  N  NE    . ARG B 1  18   ? -5.073  -8.949  40.395   1.00 121.44 ? 18   ARG B NE    1 
ATOM   1801  C  CZ    . ARG B 1  18   ? -4.418  -9.663  39.484   1.00 109.57 ? 18   ARG B CZ    1 
ATOM   1802  N  NH1   . ARG B 1  18   ? -3.090  -9.670  39.468   1.00 109.81 ? 18   ARG B NH1   1 
ATOM   1803  N  NH2   . ARG B 1  18   ? -5.091  -10.371 38.586   1.00 98.92  ? 18   ARG B NH2   1 
ATOM   1804  N  N     . SER B 1  19   ? -6.146  -4.160  42.477   1.00 94.16  ? 19   SER B N     1 
ATOM   1805  C  CA    . SER B 1  19   ? -7.073  -3.385  41.657   1.00 101.14 ? 19   SER B CA    1 
ATOM   1806  C  C     . SER B 1  19   ? -6.408  -2.836  40.394   1.00 101.30 ? 19   SER B C     1 
ATOM   1807  O  O     . SER B 1  19   ? -5.182  -2.841  40.271   1.00 96.54  ? 19   SER B O     1 
ATOM   1808  C  CB    . SER B 1  19   ? -7.666  -2.234  42.475   1.00 98.05  ? 19   SER B CB    1 
ATOM   1809  O  OG    . SER B 1  19   ? -6.656  -1.550  43.200   1.00 100.12 ? 19   SER B OG    1 
ATOM   1810  N  N     . GLN B 1  20   ? -7.227  -2.368  39.456   1.00 94.86  ? 20   GLN B N     1 
ATOM   1811  C  CA    . GLN B 1  20   ? -6.724  -1.763  38.226   1.00 86.09  ? 20   GLN B CA    1 
ATOM   1812  C  C     . GLN B 1  20   ? -7.027  -0.271  38.171   1.00 83.42  ? 20   GLN B C     1 
ATOM   1813  O  O     . GLN B 1  20   ? -8.186  0.142   38.241   1.00 83.05  ? 20   GLN B O     1 
ATOM   1814  C  CB    . GLN B 1  20   ? -7.319  -2.449  36.998   1.00 77.57  ? 20   GLN B CB    1 
ATOM   1815  C  CG    . GLN B 1  20   ? -6.690  -3.782  36.668   1.00 77.37  ? 20   GLN B CG    1 
ATOM   1816  C  CD    . GLN B 1  20   ? -7.084  -4.274  35.292   1.00 72.44  ? 20   GLN B CD    1 
ATOM   1817  O  OE1   . GLN B 1  20   ? -7.984  -3.720  34.658   1.00 69.62  ? 20   GLN B OE1   1 
ATOM   1818  N  NE2   . GLN B 1  20   ? -6.408  -5.315  34.819   1.00 76.33  ? 20   GLN B NE2   1 
ATOM   1819  N  N     . PHE B 1  21   ? -5.976  0.530   38.042   1.00 79.33  ? 21   PHE B N     1 
ATOM   1820  C  CA    . PHE B 1  21   ? -6.115  1.978   37.950   1.00 76.16  ? 21   PHE B CA    1 
ATOM   1821  C  C     . PHE B 1  21   ? -6.007  2.436   36.503   1.00 71.51  ? 21   PHE B C     1 
ATOM   1822  O  O     . PHE B 1  21   ? -5.096  2.033   35.782   1.00 70.35  ? 21   PHE B O     1 
ATOM   1823  C  CB    . PHE B 1  21   ? -5.056  2.675   38.806   1.00 80.40  ? 21   PHE B CB    1 
ATOM   1824  C  CG    . PHE B 1  21   ? -5.116  2.305   40.259   1.00 85.33  ? 21   PHE B CG    1 
ATOM   1825  C  CD1   . PHE B 1  21   ? -5.847  3.070   41.153   1.00 95.38  ? 21   PHE B CD1   1 
ATOM   1826  C  CD2   . PHE B 1  21   ? -4.444  1.189   40.731   1.00 87.40  ? 21   PHE B CD2   1 
ATOM   1827  C  CE1   . PHE B 1  21   ? -5.906  2.730   42.492   1.00 100.96 ? 21   PHE B CE1   1 
ATOM   1828  C  CE2   . PHE B 1  21   ? -4.499  0.844   42.068   1.00 91.46  ? 21   PHE B CE2   1 
ATOM   1829  C  CZ    . PHE B 1  21   ? -5.231  1.616   42.950   1.00 95.92  ? 21   PHE B CZ    1 
ATOM   1830  N  N     . VAL B 1  22   ? -6.943  3.279   36.083   1.00 72.47  ? 22   VAL B N     1 
ATOM   1831  C  CA    . VAL B 1  22   ? -6.963  3.770   34.711   1.00 74.22  ? 22   VAL B CA    1 
ATOM   1832  C  C     . VAL B 1  22   ? -6.674  5.270   34.665   1.00 77.79  ? 22   VAL B C     1 
ATOM   1833  O  O     . VAL B 1  22   ? -7.413  6.073   35.234   1.00 78.36  ? 22   VAL B O     1 
ATOM   1834  C  CB    . VAL B 1  22   ? -8.316  3.488   34.036   1.00 78.40  ? 22   VAL B CB    1 
ATOM   1835  C  CG1   . VAL B 1  22   ? -8.251  3.827   32.559   1.00 80.33  ? 22   VAL B CG1   1 
ATOM   1836  C  CG2   . VAL B 1  22   ? -8.714  2.036   34.235   1.00 85.36  ? 22   VAL B CG2   1 
ATOM   1837  N  N     . ILE B 1  23   ? -5.592  5.642   33.988   1.00 77.24  ? 23   ILE B N     1 
ATOM   1838  C  CA    . ILE B 1  23   ? -5.179  7.040   33.919   1.00 75.64  ? 23   ILE B CA    1 
ATOM   1839  C  C     . ILE B 1  23   ? -5.245  7.585   32.494   1.00 80.91  ? 23   ILE B C     1 
ATOM   1840  O  O     . ILE B 1  23   ? -4.550  7.101   31.601   1.00 79.74  ? 23   ILE B O     1 
ATOM   1841  C  CB    . ILE B 1  23   ? -3.756  7.220   34.459   1.00 66.73  ? 23   ILE B CB    1 
ATOM   1842  C  CG1   . ILE B 1  23   ? -3.651  6.636   35.867   1.00 68.53  ? 23   ILE B CG1   1 
ATOM   1843  C  CG2   . ILE B 1  23   ? -3.373  8.686   34.457   1.00 72.93  ? 23   ILE B CG2   1 
ATOM   1844  C  CD1   . ILE B 1  23   ? -2.261  6.701   36.445   1.00 72.85  ? 23   ILE B CD1   1 
ATOM   1845  N  N     . GLU B 1  24   ? -6.082  8.600   32.296   1.00 85.07  ? 24   GLU B N     1 
ATOM   1846  C  CA    . GLU B 1  24   ? -6.312  9.173   30.973   1.00 86.27  ? 24   GLU B CA    1 
ATOM   1847  C  C     . GLU B 1  24   ? -6.987  10.540  31.087   1.00 93.90  ? 24   GLU B C     1 
ATOM   1848  O  O     . GLU B 1  24   ? -7.713  10.789  32.046   1.00 92.65  ? 24   GLU B O     1 
ATOM   1849  C  CB    . GLU B 1  24   ? -7.164  8.221   30.128   1.00 88.64  ? 24   GLU B CB    1 
ATOM   1850  C  CG    . GLU B 1  24   ? -8.392  7.674   30.841   1.00 91.95  ? 24   GLU B CG    1 
ATOM   1851  C  CD    . GLU B 1  24   ? -9.093  6.585   30.043   1.00 99.51  ? 24   GLU B CD    1 
ATOM   1852  O  OE1   . GLU B 1  24   ? -8.779  6.428   28.844   1.00 108.75 ? 24   GLU B OE1   1 
ATOM   1853  O  OE2   . GLU B 1  24   ? -9.953  5.882   30.617   1.00 95.72  ? 24   GLU B OE2   1 
ATOM   1854  N  N     . PRO B 1  25   ? -6.746  11.436  30.112   1.00 100.13 ? 25   PRO B N     1 
ATOM   1855  C  CA    . PRO B 1  25   ? -5.841  11.234  28.977   1.00 91.50  ? 25   PRO B CA    1 
ATOM   1856  C  C     . PRO B 1  25   ? -4.465  11.867  29.166   1.00 81.69  ? 25   PRO B C     1 
ATOM   1857  O  O     . PRO B 1  25   ? -4.360  13.040  29.522   1.00 81.20  ? 25   PRO B O     1 
ATOM   1858  C  CB    . PRO B 1  25   ? -6.589  11.908  27.828   1.00 94.32  ? 25   PRO B CB    1 
ATOM   1859  C  CG    . PRO B 1  25   ? -7.304  13.049  28.489   1.00 102.79 ? 25   PRO B CG    1 
ATOM   1860  C  CD    . PRO B 1  25   ? -7.587  12.633  29.923   1.00 103.23 ? 25   PRO B CD    1 
ATOM   1861  N  N     . LEU B 1  26   ? -3.417  11.090  28.923   1.00 76.09  ? 26   LEU B N     1 
ATOM   1862  C  CA    . LEU B 1  26   ? -2.060  11.617  28.976   1.00 72.42  ? 26   LEU B CA    1 
ATOM   1863  C  C     . LEU B 1  26   ? -1.645  12.149  27.610   1.00 78.44  ? 26   LEU B C     1 
ATOM   1864  O  O     . LEU B 1  26   ? -2.004  11.582  26.579   1.00 83.66  ? 26   LEU B O     1 
ATOM   1865  C  CB    . LEU B 1  26   ? -1.074  10.547  29.445   1.00 70.18  ? 26   LEU B CB    1 
ATOM   1866  C  CG    . LEU B 1  26   ? -1.326  9.920   30.818   1.00 67.36  ? 26   LEU B CG    1 
ATOM   1867  C  CD1   . LEU B 1  26   ? -0.083  9.184   31.306   1.00 67.18  ? 26   LEU B CD1   1 
ATOM   1868  C  CD2   . LEU B 1  26   ? -1.775  10.964  31.829   1.00 66.33  ? 26   LEU B CD2   1 
ATOM   1869  N  N     . GLU B 1  27   ? -0.896  13.247  27.616   1.00 80.23  ? 27   GLU B N     1 
ATOM   1870  C  CA    . GLU B 1  27   ? -0.377  13.846  26.392   1.00 80.65  ? 27   GLU B CA    1 
ATOM   1871  C  C     . GLU B 1  27   ? 0.484   12.833  25.638   1.00 80.61  ? 27   GLU B C     1 
ATOM   1872  O  O     . GLU B 1  27   ? 1.267   12.110  26.252   1.00 75.37  ? 27   GLU B O     1 
ATOM   1873  C  CB    . GLU B 1  27   ? 0.417   15.117  26.726   1.00 76.57  ? 27   GLU B CB    1 
ATOM   1874  C  CG    . GLU B 1  27   ? 1.114   15.789  25.550   1.00 74.90  ? 27   GLU B CG    1 
ATOM   1875  C  CD    . GLU B 1  27   ? 1.187   17.297  25.698   1.00 74.99  ? 27   GLU B CD    1 
ATOM   1876  O  OE1   . GLU B 1  27   ? 0.211   17.889  26.205   1.00 79.04  ? 27   GLU B OE1   1 
ATOM   1877  O  OE2   . GLU B 1  27   ? 2.216   17.890  25.313   1.00 72.95  ? 27   GLU B OE2   1 
ATOM   1878  N  N     . PRO B 1  28   ? 0.315   12.759  24.305   1.00 84.64  ? 28   PRO B N     1 
ATOM   1879  C  CA    . PRO B 1  28   ? 1.025   11.817  23.431   1.00 85.80  ? 28   PRO B CA    1 
ATOM   1880  C  C     . PRO B 1  28   ? 2.513   11.678  23.755   1.00 79.36  ? 28   PRO B C     1 
ATOM   1881  O  O     . PRO B 1  28   ? 3.314   12.559  23.444   1.00 77.65  ? 28   PRO B O     1 
ATOM   1882  C  CB    . PRO B 1  28   ? 0.824   12.419  22.028   1.00 97.73  ? 28   PRO B CB    1 
ATOM   1883  C  CG    . PRO B 1  28   ? 0.120   13.753  22.239   1.00 92.35  ? 28   PRO B CG    1 
ATOM   1884  C  CD    . PRO B 1  28   ? -0.603  13.609  23.532   1.00 89.95  ? 28   PRO B CD    1 
ATOM   1885  N  N     . GLY B 1  29   ? 2.867   10.568  24.394   1.00 74.95  ? 29   GLY B N     1 
ATOM   1886  C  CA    . GLY B 1  29   ? 4.244   10.305  24.762   1.00 74.13  ? 29   GLY B CA    1 
ATOM   1887  C  C     . GLY B 1  29   ? 4.496   10.395  26.256   1.00 74.92  ? 29   GLY B C     1 
ATOM   1888  O  O     . GLY B 1  29   ? 5.646   10.384  26.694   1.00 75.89  ? 29   GLY B O     1 
ATOM   1889  N  N     . PHE B 1  30   ? 3.425   10.480  27.041   1.00 72.07  ? 30   PHE B N     1 
ATOM   1890  C  CA    . PHE B 1  30   ? 3.555   10.599  28.493   1.00 72.11  ? 30   PHE B CA    1 
ATOM   1891  C  C     . PHE B 1  30   ? 3.040   9.369   29.236   1.00 66.87  ? 30   PHE B C     1 
ATOM   1892  O  O     . PHE B 1  30   ? 3.137   9.288   30.463   1.00 61.85  ? 30   PHE B O     1 
ATOM   1893  C  CB    . PHE B 1  30   ? 2.824   11.844  28.999   1.00 70.89  ? 30   PHE B CB    1 
ATOM   1894  C  CG    . PHE B 1  30   ? 3.667   13.089  28.994   1.00 70.14  ? 30   PHE B CG    1 
ATOM   1895  C  CD1   . PHE B 1  30   ? 4.631   13.291  29.968   1.00 72.04  ? 30   PHE B CD1   1 
ATOM   1896  C  CD2   . PHE B 1  30   ? 3.487   14.063  28.026   1.00 70.93  ? 30   PHE B CD2   1 
ATOM   1897  C  CE1   . PHE B 1  30   ? 5.408   14.437  29.970   1.00 73.84  ? 30   PHE B CE1   1 
ATOM   1898  C  CE2   . PHE B 1  30   ? 4.261   15.212  28.023   1.00 78.83  ? 30   PHE B CE2   1 
ATOM   1899  C  CZ    . PHE B 1  30   ? 5.223   15.399  28.996   1.00 79.90  ? 30   PHE B CZ    1 
ATOM   1900  N  N     . GLY B 1  31   ? 2.488   8.417   28.494   1.00 68.81  ? 31   GLY B N     1 
ATOM   1901  C  CA    . GLY B 1  31   ? 2.071   7.160   29.083   1.00 65.58  ? 31   GLY B CA    1 
ATOM   1902  C  C     . GLY B 1  31   ? 3.287   6.399   29.567   1.00 70.44  ? 31   GLY B C     1 
ATOM   1903  O  O     . GLY B 1  31   ? 3.303   5.871   30.680   1.00 75.72  ? 31   GLY B O     1 
ATOM   1904  N  N     . TYR B 1  32   ? 4.316   6.357   28.724   1.00 72.58  ? 32   TYR B N     1 
ATOM   1905  C  CA    . TYR B 1  32   ? 5.554   5.650   29.044   1.00 73.92  ? 32   TYR B CA    1 
ATOM   1906  C  C     . TYR B 1  32   ? 6.449   6.469   29.965   1.00 70.83  ? 32   TYR B C     1 
ATOM   1907  O  O     . TYR B 1  32   ? 7.281   5.917   30.684   1.00 75.38  ? 32   TYR B O     1 
ATOM   1908  C  CB    . TYR B 1  32   ? 6.314   5.286   27.764   1.00 70.43  ? 32   TYR B CB    1 
ATOM   1909  C  CG    . TYR B 1  32   ? 5.734   4.097   27.028   1.00 78.53  ? 32   TYR B CG    1 
ATOM   1910  C  CD1   . TYR B 1  32   ? 6.143   2.802   27.328   1.00 72.05  ? 32   TYR B CD1   1 
ATOM   1911  C  CD2   . TYR B 1  32   ? 4.773   4.268   26.038   1.00 88.75  ? 32   TYR B CD2   1 
ATOM   1912  C  CE1   . TYR B 1  32   ? 5.611   1.711   26.660   1.00 70.11  ? 32   TYR B CE1   1 
ATOM   1913  C  CE2   . TYR B 1  32   ? 4.237   3.181   25.366   1.00 79.56  ? 32   TYR B CE2   1 
ATOM   1914  C  CZ    . TYR B 1  32   ? 4.659   1.907   25.681   1.00 69.34  ? 32   TYR B CZ    1 
ATOM   1915  O  OH    . TYR B 1  32   ? 4.127   0.827   25.015   1.00 54.49  ? 32   TYR B OH    1 
ATOM   1916  N  N     . THR B 1  33   ? 6.275   7.787   29.938   1.00 69.39  ? 33   THR B N     1 
ATOM   1917  C  CA    . THR B 1  33   ? 7.042   8.680   30.797   1.00 67.97  ? 33   THR B CA    1 
ATOM   1918  C  C     . THR B 1  33   ? 6.656   8.464   32.258   1.00 67.45  ? 33   THR B C     1 
ATOM   1919  O  O     . THR B 1  33   ? 7.472   8.630   33.162   1.00 68.02  ? 33   THR B O     1 
ATOM   1920  C  CB    . THR B 1  33   ? 6.822   10.159  30.412   1.00 69.69  ? 33   THR B CB    1 
ATOM   1921  O  OG1   . THR B 1  33   ? 7.063   10.332  29.010   1.00 72.52  ? 33   THR B OG1   1 
ATOM   1922  C  CG2   . THR B 1  33   ? 7.755   11.072  31.196   1.00 72.79  ? 33   THR B CG2   1 
ATOM   1923  N  N     . LEU B 1  34   ? 5.404   8.077   32.477   1.00 65.46  ? 34   LEU B N     1 
ATOM   1924  C  CA    . LEU B 1  34   ? 4.891   7.840   33.820   1.00 66.10  ? 34   LEU B CA    1 
ATOM   1925  C  C     . LEU B 1  34   ? 4.990   6.365   34.210   1.00 66.24  ? 34   LEU B C     1 
ATOM   1926  O  O     . LEU B 1  34   ? 5.072   6.028   35.392   1.00 65.50  ? 34   LEU B O     1 
ATOM   1927  C  CB    . LEU B 1  34   ? 3.440   8.323   33.911   1.00 67.06  ? 34   LEU B CB    1 
ATOM   1928  C  CG    . LEU B 1  34   ? 2.638   7.988   35.170   1.00 79.32  ? 34   LEU B CG    1 
ATOM   1929  C  CD1   . LEU B 1  34   ? 3.325   8.523   36.414   1.00 77.22  ? 34   LEU B CD1   1 
ATOM   1930  C  CD2   . LEU B 1  34   ? 1.215   8.526   35.063   1.00 88.19  ? 34   LEU B CD2   1 
ATOM   1931  N  N     . GLY B 1  35   ? 5.003   5.497   33.203   1.00 67.83  ? 35   GLY B N     1 
ATOM   1932  C  CA    . GLY B 1  35   ? 4.955   4.058   33.400   1.00 73.19  ? 35   GLY B CA    1 
ATOM   1933  C  C     . GLY B 1  35   ? 5.997   3.445   34.321   1.00 80.13  ? 35   GLY B C     1 
ATOM   1934  O  O     . GLY B 1  35   ? 5.731   3.219   35.503   1.00 81.09  ? 35   GLY B O     1 
ATOM   1935  N  N     . ASN B 1  36   ? 7.185   3.176   33.784   1.00 79.16  ? 36   ASN B N     1 
ATOM   1936  C  CA    . ASN B 1  36   ? 8.216   2.439   34.514   1.00 79.99  ? 36   ASN B CA    1 
ATOM   1937  C  C     . ASN B 1  36   ? 8.717   3.173   35.760   1.00 77.78  ? 36   ASN B C     1 
ATOM   1938  O  O     . ASN B 1  36   ? 9.450   2.609   36.575   1.00 80.62  ? 36   ASN B O     1 
ATOM   1939  C  CB    . ASN B 1  36   ? 9.397   2.130   33.589   1.00 79.36  ? 36   ASN B CB    1 
ATOM   1940  C  CG    . ASN B 1  36   ? 10.361  1.121   34.190   1.00 82.12  ? 36   ASN B CG    1 
ATOM   1941  O  OD1   . ASN B 1  36   ? 9.955   0.209   34.910   1.00 87.63  ? 36   ASN B OD1   1 
ATOM   1942  N  ND2   . ASN B 1  36   ? 11.647  1.287   33.902   1.00 81.22  ? 36   ASN B ND2   1 
ATOM   1943  N  N     . SER B 1  37   ? 8.310   4.429   35.906   1.00 74.40  ? 37   SER B N     1 
ATOM   1944  C  CA    . SER B 1  37   ? 8.720   5.250   37.039   1.00 72.77  ? 37   SER B CA    1 
ATOM   1945  C  C     . SER B 1  37   ? 7.801   5.084   38.252   1.00 73.64  ? 37   SER B C     1 
ATOM   1946  O  O     . SER B 1  37   ? 8.265   5.075   39.394   1.00 73.98  ? 37   SER B O     1 
ATOM   1947  C  CB    . SER B 1  37   ? 8.770   6.718   36.622   1.00 77.94  ? 37   SER B CB    1 
ATOM   1948  O  OG    . SER B 1  37   ? 7.585   7.084   35.931   1.00 77.54  ? 37   SER B OG    1 
ATOM   1949  N  N     . LEU B 1  38   ? 6.501   4.951   38.007   1.00 74.23  ? 38   LEU B N     1 
ATOM   1950  C  CA    . LEU B 1  38   ? 5.534   4.820   39.093   1.00 73.37  ? 38   LEU B CA    1 
ATOM   1951  C  C     . LEU B 1  38   ? 5.528   3.394   39.648   1.00 76.87  ? 38   LEU B C     1 
ATOM   1952  O  O     . LEU B 1  38   ? 5.213   3.175   40.819   1.00 78.34  ? 38   LEU B O     1 
ATOM   1953  C  CB    . LEU B 1  38   ? 4.135   5.220   38.615   1.00 67.87  ? 38   LEU B CB    1 
ATOM   1954  C  CG    . LEU B 1  38   ? 3.045   5.322   39.683   1.00 67.87  ? 38   LEU B CG    1 
ATOM   1955  C  CD1   . LEU B 1  38   ? 3.529   6.164   40.847   1.00 79.77  ? 38   LEU B CD1   1 
ATOM   1956  C  CD2   . LEU B 1  38   ? 1.760   5.898   39.103   1.00 60.09  ? 38   LEU B CD2   1 
ATOM   1957  N  N     . ARG B 1  39   ? 5.886   2.432   38.800   1.00 76.66  ? 39   ARG B N     1 
ATOM   1958  C  CA    . ARG B 1  39   ? 5.980   1.030   39.203   1.00 78.61  ? 39   ARG B CA    1 
ATOM   1959  C  C     . ARG B 1  39   ? 7.145   0.812   40.162   1.00 79.88  ? 39   ARG B C     1 
ATOM   1960  O  O     . ARG B 1  39   ? 6.976   0.243   41.241   1.00 84.98  ? 39   ARG B O     1 
ATOM   1961  C  CB    . ARG B 1  39   ? 6.141   0.124   37.979   1.00 80.76  ? 39   ARG B CB    1 
ATOM   1962  C  CG    . ARG B 1  39   ? 6.613   -1.292  38.305   1.00 83.48  ? 39   ARG B CG    1 
ATOM   1963  C  CD    . ARG B 1  39   ? 6.793   -2.145  37.051   1.00 84.48  ? 39   ARG B CD    1 
ATOM   1964  N  NE    . ARG B 1  39   ? 7.262   -3.493  37.370   1.00 82.39  ? 39   ARG B NE    1 
ATOM   1965  C  CZ    . ARG B 1  39   ? 8.528   -3.890  37.273   1.00 85.35  ? 39   ARG B CZ    1 
ATOM   1966  N  NH1   . ARG B 1  39   ? 9.459   -3.043  36.854   1.00 92.32  ? 39   ARG B NH1   1 
ATOM   1967  N  NH2   . ARG B 1  39   ? 8.862   -5.135  37.589   1.00 82.29  ? 39   ARG B NH2   1 
ATOM   1968  N  N     . ARG B 1  40   ? 8.327   1.276   39.760   1.00 76.76  ? 40   ARG B N     1 
ATOM   1969  C  CA    . ARG B 1  40   ? 9.540   1.112   40.556   1.00 75.28  ? 40   ARG B CA    1 
ATOM   1970  C  C     . ARG B 1  40   ? 9.433   1.852   41.886   1.00 79.99  ? 40   ARG B C     1 
ATOM   1971  O  O     . ARG B 1  40   ? 10.204  1.601   42.811   1.00 81.37  ? 40   ARG B O     1 
ATOM   1972  C  CB    . ARG B 1  40   ? 10.762  1.603   39.774   1.00 72.28  ? 40   ARG B CB    1 
ATOM   1973  C  CG    . ARG B 1  40   ? 12.085  1.027   40.256   1.00 75.90  ? 40   ARG B CG    1 
ATOM   1974  C  CD    . ARG B 1  40   ? 12.099  -0.480  40.104   1.00 81.81  ? 40   ARG B CD    1 
ATOM   1975  N  NE    . ARG B 1  40   ? 12.010  -0.881  38.702   1.00 87.43  ? 40   ARG B NE    1 
ATOM   1976  C  CZ    . ARG B 1  40   ? 13.014  -1.417  38.015   1.00 88.02  ? 40   ARG B CZ    1 
ATOM   1977  N  NH1   . ARG B 1  40   ? 14.182  -1.626  38.607   1.00 82.58  ? 40   ARG B NH1   1 
ATOM   1978  N  NH2   . ARG B 1  40   ? 12.848  -1.753  36.741   1.00 88.01  ? 40   ARG B NH2   1 
ATOM   1979  N  N     . THR B 1  41   ? 8.469   2.763   41.977   1.00 80.25  ? 41   THR B N     1 
ATOM   1980  C  CA    . THR B 1  41   ? 8.208   3.489   43.213   1.00 83.77  ? 41   THR B CA    1 
ATOM   1981  C  C     . THR B 1  41   ? 7.353   2.650   44.156   1.00 87.40  ? 41   THR B C     1 
ATOM   1982  O  O     . THR B 1  41   ? 7.570   2.635   45.367   1.00 94.31  ? 41   THR B O     1 
ATOM   1983  C  CB    . THR B 1  41   ? 7.498   4.828   42.941   1.00 82.50  ? 41   THR B CB    1 
ATOM   1984  O  OG1   . THR B 1  41   ? 8.274   5.603   42.019   1.00 77.69  ? 41   THR B OG1   1 
ATOM   1985  C  CG2   . THR B 1  41   ? 7.316   5.613   44.232   1.00 91.19  ? 41   THR B CG2   1 
ATOM   1986  N  N     . LEU B 1  42   ? 6.378   1.949   43.589   1.00 85.37  ? 42   LEU B N     1 
ATOM   1987  C  CA    . LEU B 1  42   ? 5.472   1.117   44.372   1.00 89.42  ? 42   LEU B CA    1 
ATOM   1988  C  C     . LEU B 1  42   ? 6.182   -0.101  44.953   1.00 93.67  ? 42   LEU B C     1 
ATOM   1989  O  O     . LEU B 1  42   ? 5.837   -0.572  46.036   1.00 97.86  ? 42   LEU B O     1 
ATOM   1990  C  CB    . LEU B 1  42   ? 4.289   0.671   43.512   1.00 88.50  ? 42   LEU B CB    1 
ATOM   1991  C  CG    . LEU B 1  42   ? 3.231   1.732   43.209   1.00 95.37  ? 42   LEU B CG    1 
ATOM   1992  C  CD1   . LEU B 1  42   ? 2.418   1.338   41.991   1.00 99.16  ? 42   LEU B CD1   1 
ATOM   1993  C  CD2   . LEU B 1  42   ? 2.325   1.924   44.417   1.00 110.30 ? 42   LEU B CD2   1 
ATOM   1994  N  N     . LEU B 1  43   ? 7.181   -0.598  44.231   1.00 98.97  ? 43   LEU B N     1 
ATOM   1995  C  CA    . LEU B 1  43   ? 7.876   -1.821  44.617   1.00 101.70 ? 43   LEU B CA    1 
ATOM   1996  C  C     . LEU B 1  43   ? 9.146   -1.564  45.433   1.00 103.35 ? 43   LEU B C     1 
ATOM   1997  O  O     . LEU B 1  43   ? 9.849   -2.508  45.795   1.00 103.91 ? 43   LEU B O     1 
ATOM   1998  C  CB    . LEU B 1  43   ? 8.230   -2.641  43.370   1.00 98.74  ? 43   LEU B CB    1 
ATOM   1999  C  CG    . LEU B 1  43   ? 7.094   -3.265  42.554   1.00 98.02  ? 43   LEU B CG    1 
ATOM   2000  C  CD1   . LEU B 1  43   ? 7.638   -3.998  41.334   1.00 94.93  ? 43   LEU B CD1   1 
ATOM   2001  C  CD2   . LEU B 1  43   ? 6.274   -4.208  43.415   1.00 99.37  ? 43   LEU B CD2   1 
ATOM   2002  N  N     . SER B 1  44   ? 9.440   -0.299  45.730   1.00 101.44 ? 44   SER B N     1 
ATOM   2003  C  CA    . SER B 1  44   ? 10.708  0.035   46.379   1.00 99.92  ? 44   SER B CA    1 
ATOM   2004  C  C     . SER B 1  44   ? 10.666  1.230   47.342   1.00 100.83 ? 44   SER B C     1 
ATOM   2005  O  O     . SER B 1  44   ? 11.589  1.411   48.138   1.00 104.18 ? 44   SER B O     1 
ATOM   2006  C  CB    . SER B 1  44   ? 11.776  0.300   45.312   1.00 96.06  ? 44   SER B CB    1 
ATOM   2007  O  OG    . SER B 1  44   ? 11.891  -0.788  44.411   1.00 89.57  ? 44   SER B OG    1 
ATOM   2008  N  N     . SER B 1  45   ? 9.613   2.041   47.284   1.00 100.65 ? 45   SER B N     1 
ATOM   2009  C  CA    . SER B 1  45   ? 9.613   3.305   48.024   1.00 108.74 ? 45   SER B CA    1 
ATOM   2010  C  C     . SER B 1  45   ? 8.549   3.421   49.119   1.00 111.21 ? 45   SER B C     1 
ATOM   2011  O  O     . SER B 1  45   ? 8.220   4.529   49.548   1.00 116.00 ? 45   SER B O     1 
ATOM   2012  C  CB    . SER B 1  45   ? 9.457   4.475   47.051   1.00 109.67 ? 45   SER B CB    1 
ATOM   2013  O  OG    . SER B 1  45   ? 9.408   5.711   47.743   1.00 111.71 ? 45   SER B OG    1 
ATOM   2014  N  N     . ILE B 1  46   ? 8.016   2.292   49.574   1.00 113.48 ? 46   ILE B N     1 
ATOM   2015  C  CA    . ILE B 1  46   ? 7.092   2.299   50.708   1.00 114.44 ? 46   ILE B CA    1 
ATOM   2016  C  C     . ILE B 1  46   ? 7.638   1.440   51.849   1.00 116.68 ? 46   ILE B C     1 
ATOM   2017  O  O     . ILE B 1  46   ? 7.926   0.259   51.655   1.00 116.04 ? 46   ILE B O     1 
ATOM   2018  C  CB    . ILE B 1  46   ? 5.691   1.792   50.317   1.00 108.81 ? 46   ILE B CB    1 
ATOM   2019  C  CG1   . ILE B 1  46   ? 5.240   2.411   48.994   1.00 109.05 ? 46   ILE B CG1   1 
ATOM   2020  C  CG2   . ILE B 1  46   ? 4.689   2.112   51.417   1.00 108.90 ? 46   ILE B CG2   1 
ATOM   2021  C  CD1   . ILE B 1  46   ? 5.048   3.910   49.055   1.00 116.18 ? 46   ILE B CD1   1 
ATOM   2022  N  N     . PRO B 1  47   ? 7.787   2.038   53.043   1.00 118.64 ? 47   PRO B N     1 
ATOM   2023  C  CA    . PRO B 1  47   ? 8.355   1.345   54.205   1.00 118.77 ? 47   PRO B CA    1 
ATOM   2024  C  C     . PRO B 1  47   ? 7.362   0.417   54.907   1.00 119.04 ? 47   PRO B C     1 
ATOM   2025  O  O     . PRO B 1  47   ? 6.157   0.664   54.897   1.00 111.05 ? 47   PRO B O     1 
ATOM   2026  C  CB    . PRO B 1  47   ? 8.760   2.497   55.123   1.00 116.08 ? 47   PRO B CB    1 
ATOM   2027  C  CG    . PRO B 1  47   ? 7.767   3.563   54.815   1.00 118.13 ? 47   PRO B CG    1 
ATOM   2028  C  CD    . PRO B 1  47   ? 7.474   3.447   53.342   1.00 118.69 ? 47   PRO B CD    1 
ATOM   2029  N  N     . GLY B 1  48   ? 7.882   -0.643  55.518   1.00 118.65 ? 48   GLY B N     1 
ATOM   2030  C  CA    . GLY B 1  48   ? 7.062   -1.592  56.247   1.00 118.51 ? 48   GLY B CA    1 
ATOM   2031  C  C     . GLY B 1  48   ? 7.896   -2.390  57.231   1.00 128.73 ? 48   GLY B C     1 
ATOM   2032  O  O     . GLY B 1  48   ? 8.754   -1.835  57.919   1.00 129.64 ? 48   GLY B O     1 
ATOM   2033  N  N     . ALA B 1  49   ? 7.650   -3.696  57.293   1.00 133.53 ? 49   ALA B N     1 
ATOM   2034  C  CA    . ALA B 1  49   ? 8.399   -4.576  58.183   1.00 135.51 ? 49   ALA B CA    1 
ATOM   2035  C  C     . ALA B 1  49   ? 8.361   -6.025  57.705   1.00 130.39 ? 49   ALA B C     1 
ATOM   2036  O  O     . ALA B 1  49   ? 7.309   -6.539  57.324   1.00 127.20 ? 49   ALA B O     1 
ATOM   2037  C  CB    . ALA B 1  49   ? 7.861   -4.476  59.602   1.00 141.30 ? 49   ALA B CB    1 
ATOM   2038  N  N     . ALA B 1  50   ? 9.518   -6.679  57.727   1.00 131.18 ? 50   ALA B N     1 
ATOM   2039  C  CA    . ALA B 1  50   ? 9.620   -8.077  57.328   1.00 128.56 ? 50   ALA B CA    1 
ATOM   2040  C  C     . ALA B 1  50   ? 10.664  -8.797  58.176   1.00 132.14 ? 50   ALA B C     1 
ATOM   2041  O  O     . ALA B 1  50   ? 11.307  -8.188  59.029   1.00 138.04 ? 50   ALA B O     1 
ATOM   2042  C  CB    . ALA B 1  50   ? 9.961   -8.186  55.852   1.00 120.91 ? 50   ALA B CB    1 
ATOM   2043  N  N     . VAL B 1  51   ? 10.829  -10.093 57.937   1.00 127.95 ? 51   VAL B N     1 
ATOM   2044  C  CA    . VAL B 1  51   ? 11.747  -10.905 58.728   1.00 130.82 ? 51   VAL B CA    1 
ATOM   2045  C  C     . VAL B 1  51   ? 13.169  -10.856 58.179   1.00 131.71 ? 51   VAL B C     1 
ATOM   2046  O  O     . VAL B 1  51   ? 13.388  -11.038 56.982   1.00 129.82 ? 51   VAL B O     1 
ATOM   2047  C  CB    . VAL B 1  51   ? 11.287  -12.374 58.786   1.00 142.13 ? 51   VAL B CB    1 
ATOM   2048  C  CG1   . VAL B 1  51   ? 12.281  -13.215 59.571   1.00 148.36 ? 51   VAL B CG1   1 
ATOM   2049  C  CG2   . VAL B 1  51   ? 9.898   -12.471 59.400   1.00 149.25 ? 51   VAL B CG2   1 
ATOM   2050  N  N     . THR B 1  52   ? 14.132  -10.612 59.062   1.00 135.09 ? 52   THR B N     1 
ATOM   2051  C  CA    . THR B 1  52   ? 15.534  -10.567 58.669   1.00 139.90 ? 52   THR B CA    1 
ATOM   2052  C  C     . THR B 1  52   ? 16.221  -11.914 58.879   1.00 139.13 ? 52   THR B C     1 
ATOM   2053  O  O     . THR B 1  52   ? 16.841  -12.451 57.961   1.00 139.94 ? 52   THR B O     1 
ATOM   2054  C  CB    . THR B 1  52   ? 16.300  -9.479  59.444   1.00 148.21 ? 52   THR B CB    1 
ATOM   2055  O  OG1   . THR B 1  52   ? 15.904  -8.187  58.967   1.00 149.53 ? 52   THR B OG1   1 
ATOM   2056  C  CG2   . THR B 1  52   ? 17.799  -9.637  59.247   1.00 158.86 ? 52   THR B CG2   1 
ATOM   2057  N  N     . SER B 1  53   ? 16.109  -12.459 60.086   1.00 138.21 ? 53   SER B N     1 
ATOM   2058  C  CA    . SER B 1  53   ? 16.730  -13.743 60.395   1.00 148.05 ? 53   SER B CA    1 
ATOM   2059  C  C     . SER B 1  53   ? 15.895  -14.545 61.385   1.00 146.53 ? 53   SER B C     1 
ATOM   2060  O  O     . SER B 1  53   ? 15.068  -13.988 62.106   1.00 152.86 ? 53   SER B O     1 
ATOM   2061  C  CB    . SER B 1  53   ? 18.140  -13.536 60.951   1.00 153.66 ? 53   SER B CB    1 
ATOM   2062  O  OG    . SER B 1  53   ? 18.098  -12.873 62.202   1.00 162.56 ? 53   SER B OG    1 
ATOM   2063  N  N     . ILE B 1  54   ? 16.110  -15.857 61.413   1.00 142.98 ? 54   ILE B N     1 
ATOM   2064  C  CA    . ILE B 1  54   ? 15.375  -16.733 62.320   1.00 154.78 ? 54   ILE B CA    1 
ATOM   2065  C  C     . ILE B 1  54   ? 16.311  -17.689 63.050   1.00 165.58 ? 54   ILE B C     1 
ATOM   2066  O  O     . ILE B 1  54   ? 17.498  -17.780 62.729   1.00 162.99 ? 54   ILE B O     1 
ATOM   2067  C  CB    . ILE B 1  54   ? 14.312  -17.564 61.575   1.00 157.38 ? 54   ILE B CB    1 
ATOM   2068  C  CG1   . ILE B 1  54   ? 14.983  -18.537 60.602   1.00 160.07 ? 54   ILE B CG1   1 
ATOM   2069  C  CG2   . ILE B 1  54   ? 13.332  -16.659 60.847   1.00 154.39 ? 54   ILE B CG2   1 
ATOM   2070  C  CD1   . ILE B 1  54   ? 14.019  -19.485 59.922   1.00 156.81 ? 54   ILE B CD1   1 
ATOM   2071  N  N     . ARG B 1  55   ? 15.764  -18.400 64.032   1.00 174.45 ? 55   ARG B N     1 
ATOM   2072  C  CA    . ARG B 1  55   ? 16.513  -19.404 64.780   1.00 170.19 ? 55   ARG B CA    1 
ATOM   2073  C  C     . ARG B 1  55   ? 15.613  -20.577 65.164   1.00 154.45 ? 55   ARG B C     1 
ATOM   2074  O  O     . ARG B 1  55   ? 14.527  -20.385 65.710   1.00 149.17 ? 55   ARG B O     1 
ATOM   2075  C  CB    . ARG B 1  55   ? 17.148  -18.788 66.034   1.00 174.99 ? 55   ARG B CB    1 
ATOM   2076  C  CG    . ARG B 1  55   ? 18.358  -17.898 65.758   1.00 171.95 ? 55   ARG B CG    1 
ATOM   2077  C  CD    . ARG B 1  55   ? 18.799  -17.147 67.004   1.00 166.36 ? 55   ARG B CD    1 
ATOM   2078  N  NE    . ARG B 1  55   ? 19.267  -18.042 68.058   1.00 168.11 ? 55   ARG B NE    1 
ATOM   2079  C  CZ    . ARG B 1  55   ? 19.605  -17.643 69.279   1.00 158.04 ? 55   ARG B CZ    1 
ATOM   2080  N  NH1   . ARG B 1  55   ? 19.526  -16.360 69.603   1.00 153.50 ? 55   ARG B NH1   1 
ATOM   2081  N  NH2   . ARG B 1  55   ? 20.023  -18.526 70.175   1.00 155.76 ? 55   ARG B NH2   1 
ATOM   2082  N  N     . ILE B 1  56   ? 16.067  -21.789 64.864   1.00 155.67 ? 56   ILE B N     1 
ATOM   2083  C  CA    . ILE B 1  56   ? 15.325  -22.992 65.220   1.00 160.24 ? 56   ILE B CA    1 
ATOM   2084  C  C     . ILE B 1  56   ? 16.078  -23.779 66.288   1.00 160.98 ? 56   ILE B C     1 
ATOM   2085  O  O     . ILE B 1  56   ? 17.306  -23.868 66.256   1.00 164.20 ? 56   ILE B O     1 
ATOM   2086  C  CB    . ILE B 1  56   ? 15.079  -23.894 63.997   1.00 164.51 ? 56   ILE B CB    1 
ATOM   2087  C  CG1   . ILE B 1  56   ? 14.613  -23.063 62.803   1.00 164.23 ? 56   ILE B CG1   1 
ATOM   2088  C  CG2   . ILE B 1  56   ? 14.058  -24.973 64.327   1.00 167.59 ? 56   ILE B CG2   1 
ATOM   2089  C  CD1   . ILE B 1  56   ? 14.357  -23.883 61.555   1.00 182.45 ? 56   ILE B CD1   1 
ATOM   2090  N  N     . ASP B 1  57   ? 15.333  -24.351 67.228   1.00 154.81 ? 57   ASP B N     1 
ATOM   2091  C  CA    . ASP B 1  57   ? 15.923  -25.020 68.382   1.00 150.52 ? 57   ASP B CA    1 
ATOM   2092  C  C     . ASP B 1  57   ? 16.716  -26.271 68.003   1.00 153.95 ? 57   ASP B C     1 
ATOM   2093  O  O     . ASP B 1  57   ? 17.923  -26.341 68.237   1.00 154.56 ? 57   ASP B O     1 
ATOM   2094  C  CB    . ASP B 1  57   ? 14.831  -25.383 69.390   1.00 151.57 ? 57   ASP B CB    1 
ATOM   2095  C  CG    . ASP B 1  57   ? 15.351  -25.450 70.810   1.00 152.25 ? 57   ASP B CG    1 
ATOM   2096  O  OD1   . ASP B 1  57   ? 16.585  -25.516 70.988   1.00 153.53 ? 57   ASP B OD1   1 
ATOM   2097  O  OD2   . ASP B 1  57   ? 14.529  -25.438 71.750   1.00 152.45 ? 57   ASP B OD2   1 
ATOM   2098  N  N     . GLY B 1  58   ? 16.039  -27.254 67.418   1.00 157.39 ? 58   GLY B N     1 
ATOM   2099  C  CA    . GLY B 1  58   ? 16.669  -28.523 67.100   1.00 159.48 ? 58   GLY B CA    1 
ATOM   2100  C  C     . GLY B 1  58   ? 17.314  -28.576 65.728   1.00 161.61 ? 58   GLY B C     1 
ATOM   2101  O  O     . GLY B 1  58   ? 17.189  -29.573 65.016   1.00 163.70 ? 58   GLY B O     1 
ATOM   2102  N  N     . VAL B 1  59   ? 18.010  -27.505 65.357   1.00 160.09 ? 59   VAL B N     1 
ATOM   2103  C  CA    . VAL B 1  59   ? 18.696  -27.445 64.069   1.00 158.52 ? 59   VAL B CA    1 
ATOM   2104  C  C     . VAL B 1  59   ? 20.163  -27.051 64.224   1.00 155.39 ? 59   VAL B C     1 
ATOM   2105  O  O     . VAL B 1  59   ? 20.478  -25.980 64.742   1.00 151.92 ? 59   VAL B O     1 
ATOM   2106  C  CB    . VAL B 1  59   ? 18.014  -26.449 63.107   1.00 157.63 ? 59   VAL B CB    1 
ATOM   2107  C  CG1   . VAL B 1  59   ? 18.894  -26.190 61.893   1.00 151.78 ? 59   VAL B CG1   1 
ATOM   2108  C  CG2   . VAL B 1  59   ? 16.652  -26.969 62.677   1.00 163.78 ? 59   VAL B CG2   1 
ATOM   2109  N  N     . LEU B 1  60   ? 21.055  -27.928 63.774   1.00 155.63 ? 60   LEU B N     1 
ATOM   2110  C  CA    . LEU B 1  60   ? 22.480  -27.625 63.737   1.00 153.36 ? 60   LEU B CA    1 
ATOM   2111  C  C     . LEU B 1  60   ? 22.924  -27.450 62.289   1.00 155.51 ? 60   LEU B C     1 
ATOM   2112  O  O     . LEU B 1  60   ? 23.890  -26.742 62.003   1.00 148.68 ? 60   LEU B O     1 
ATOM   2113  C  CB    . LEU B 1  60   ? 23.298  -28.724 64.423   1.00 150.88 ? 60   LEU B CB    1 
ATOM   2114  C  CG    . LEU B 1  60   ? 23.300  -28.751 65.956   1.00 151.04 ? 60   LEU B CG    1 
ATOM   2115  C  CD1   . LEU B 1  60   ? 21.998  -29.315 66.517   1.00 162.60 ? 60   LEU B CD1   1 
ATOM   2116  C  CD2   . LEU B 1  60   ? 24.497  -29.533 66.475   1.00 140.60 ? 60   LEU B CD2   1 
ATOM   2117  N  N     . HIS B 1  61   ? 22.207  -28.110 61.384   1.00 161.23 ? 61   HIS B N     1 
ATOM   2118  C  CA    . HIS B 1  61   ? 22.406  -27.937 59.949   1.00 163.21 ? 61   HIS B CA    1 
ATOM   2119  C  C     . HIS B 1  61   ? 21.056  -28.008 59.229   1.00 168.68 ? 61   HIS B C     1 
ATOM   2120  O  O     . HIS B 1  61   ? 20.078  -28.517 59.779   1.00 168.18 ? 61   HIS B O     1 
ATOM   2121  C  CB    . HIS B 1  61   ? 23.386  -28.981 59.399   1.00 159.20 ? 61   HIS B CB    1 
ATOM   2122  C  CG    . HIS B 1  61   ? 22.983  -30.401 59.659   1.00 157.25 ? 61   HIS B CG    1 
ATOM   2123  N  ND1   . HIS B 1  61   ? 22.920  -30.939 60.927   1.00 157.66 ? 61   HIS B ND1   1 
ATOM   2124  C  CD2   . HIS B 1  61   ? 22.651  -31.401 58.809   1.00 156.35 ? 61   HIS B CD2   1 
ATOM   2125  C  CE1   . HIS B 1  61   ? 22.550  -32.205 60.847   1.00 159.84 ? 61   HIS B CE1   1 
ATOM   2126  N  NE2   . HIS B 1  61   ? 22.382  -32.510 59.573   1.00 158.23 ? 61   HIS B NE2   1 
ATOM   2127  N  N     . GLU B 1  62   ? 21.010  -27.494 58.003   1.00 170.82 ? 62   GLU B N     1 
ATOM   2128  C  CA    . GLU B 1  62   ? 19.747  -27.272 57.294   1.00 168.38 ? 62   GLU B CA    1 
ATOM   2129  C  C     . GLU B 1  62   ? 19.089  -28.513 56.685   1.00 169.81 ? 62   GLU B C     1 
ATOM   2130  O  O     . GLU B 1  62   ? 17.860  -28.606 56.659   1.00 162.76 ? 62   GLU B O     1 
ATOM   2131  C  CB    . GLU B 1  62   ? 19.954  -26.239 56.181   1.00 164.42 ? 62   GLU B CB    1 
ATOM   2132  C  CG    . GLU B 1  62   ? 19.666  -24.806 56.595   1.00 161.82 ? 62   GLU B CG    1 
ATOM   2133  C  CD    . GLU B 1  62   ? 20.599  -24.314 57.682   1.00 176.07 ? 62   GLU B CD    1 
ATOM   2134  O  OE1   . GLU B 1  62   ? 20.159  -23.495 58.516   1.00 177.75 ? 62   GLU B OE1   1 
ATOM   2135  O  OE2   . GLU B 1  62   ? 21.773  -24.741 57.697   1.00 183.80 ? 62   GLU B OE2   1 
ATOM   2136  N  N     . PHE B 1  63   ? 19.895  -29.449 56.186   1.00 177.90 ? 63   PHE B N     1 
ATOM   2137  C  CA    . PHE B 1  63   ? 19.375  -30.575 55.403   1.00 178.79 ? 63   PHE B CA    1 
ATOM   2138  C  C     . PHE B 1  63   ? 18.360  -31.413 56.177   1.00 174.22 ? 63   PHE B C     1 
ATOM   2139  O  O     . PHE B 1  63   ? 17.292  -31.741 55.659   1.00 166.44 ? 63   PHE B O     1 
ATOM   2140  C  CB    . PHE B 1  63   ? 20.521  -31.469 54.915   1.00 180.70 ? 63   PHE B CB    1 
ATOM   2141  C  CG    . PHE B 1  63   ? 20.180  -32.277 53.689   1.00 182.89 ? 63   PHE B CG    1 
ATOM   2142  C  CD1   . PHE B 1  63   ? 20.204  -31.693 52.432   1.00 183.20 ? 63   PHE B CD1   1 
ATOM   2143  C  CD2   . PHE B 1  63   ? 19.836  -33.617 53.791   1.00 180.55 ? 63   PHE B CD2   1 
ATOM   2144  C  CE1   . PHE B 1  63   ? 19.891  -32.427 51.300   1.00 176.96 ? 63   PHE B CE1   1 
ATOM   2145  C  CE2   . PHE B 1  63   ? 19.523  -34.358 52.662   1.00 172.89 ? 63   PHE B CE2   1 
ATOM   2146  C  CZ    . PHE B 1  63   ? 19.551  -33.762 51.415   1.00 169.90 ? 63   PHE B CZ    1 
ATOM   2147  N  N     . THR B 1  64   ? 18.690  -31.753 57.418   1.00 175.96 ? 64   THR B N     1 
ATOM   2148  C  CA    . THR B 1  64   ? 17.768  -32.509 58.254   1.00 170.24 ? 64   THR B CA    1 
ATOM   2149  C  C     . THR B 1  64   ? 16.562  -31.649 58.614   1.00 166.22 ? 64   THR B C     1 
ATOM   2150  O  O     . THR B 1  64   ? 16.699  -30.460 58.903   1.00 167.40 ? 64   THR B O     1 
ATOM   2151  C  CB    . THR B 1  64   ? 18.449  -33.020 59.541   1.00 171.75 ? 64   THR B CB    1 
ATOM   2152  O  OG1   . THR B 1  64   ? 19.062  -31.925 60.232   1.00 177.51 ? 64   THR B OG1   1 
ATOM   2153  C  CG2   . THR B 1  64   ? 19.509  -34.055 59.202   1.00 163.83 ? 64   THR B CG2   1 
ATOM   2154  N  N     . THR B 1  65   ? 15.378  -32.253 58.574   1.00 163.86 ? 65   THR B N     1 
ATOM   2155  C  CA    . THR B 1  65   ? 14.151  -31.548 58.920   1.00 168.89 ? 65   THR B CA    1 
ATOM   2156  C  C     . THR B 1  65   ? 13.992  -31.473 60.434   1.00 175.07 ? 65   THR B C     1 
ATOM   2157  O  O     . THR B 1  65   ? 14.522  -32.311 61.163   1.00 174.07 ? 65   THR B O     1 
ATOM   2158  C  CB    . THR B 1  65   ? 12.910  -32.228 58.313   1.00 163.32 ? 65   THR B CB    1 
ATOM   2159  O  OG1   . THR B 1  65   ? 12.726  -33.516 58.913   1.00 166.47 ? 65   THR B OG1   1 
ATOM   2160  C  CG2   . THR B 1  65   ? 13.066  -32.388 56.808   1.00 154.57 ? 65   THR B CG2   1 
ATOM   2161  N  N     . VAL B 1  66   ? 13.258  -30.466 60.897   1.00 175.74 ? 66   VAL B N     1 
ATOM   2162  C  CA    . VAL B 1  66   ? 13.037  -30.261 62.325   1.00 172.39 ? 66   VAL B CA    1 
ATOM   2163  C  C     . VAL B 1  66   ? 12.249  -31.416 62.942   1.00 170.23 ? 66   VAL B C     1 
ATOM   2164  O  O     . VAL B 1  66   ? 11.166  -31.756 62.463   1.00 167.85 ? 66   VAL B O     1 
ATOM   2165  C  CB    . VAL B 1  66   ? 12.287  -28.940 62.589   1.00 174.77 ? 66   VAL B CB    1 
ATOM   2166  C  CG1   . VAL B 1  66   ? 12.123  -28.711 64.082   1.00 174.71 ? 66   VAL B CG1   1 
ATOM   2167  C  CG2   . VAL B 1  66   ? 13.017  -27.772 61.943   1.00 171.59 ? 66   VAL B CG2   1 
ATOM   2168  N  N     . PRO B 1  67   ? 12.801  -32.025 64.007   1.00 172.08 ? 67   PRO B N     1 
ATOM   2169  C  CA    . PRO B 1  67   ? 12.191  -33.155 64.718   1.00 171.33 ? 67   PRO B CA    1 
ATOM   2170  C  C     . PRO B 1  67   ? 10.743  -32.901 65.135   1.00 168.38 ? 67   PRO B C     1 
ATOM   2171  O  O     . PRO B 1  67   ? 10.491  -32.121 66.054   1.00 162.94 ? 67   PRO B O     1 
ATOM   2172  C  CB    . PRO B 1  67   ? 13.086  -33.311 65.949   1.00 170.38 ? 67   PRO B CB    1 
ATOM   2173  C  CG    . PRO B 1  67   ? 14.408  -32.811 65.505   1.00 168.21 ? 67   PRO B CG    1 
ATOM   2174  C  CD    . PRO B 1  67   ? 14.121  -31.677 64.565   1.00 167.40 ? 67   PRO B CD    1 
ATOM   2175  N  N     . GLY B 1  68   ? 9.807   -33.559 64.458   1.00 170.46 ? 68   GLY B N     1 
ATOM   2176  C  CA    . GLY B 1  68   ? 8.398   -33.437 64.784   1.00 168.34 ? 68   GLY B CA    1 
ATOM   2177  C  C     . GLY B 1  68   ? 7.618   -32.600 63.788   1.00 162.50 ? 68   GLY B C     1 
ATOM   2178  O  O     . GLY B 1  68   ? 6.419   -32.381 63.958   1.00 156.71 ? 68   GLY B O     1 
ATOM   2179  N  N     . VAL B 1  69   ? 8.294   -32.132 62.744   1.00 159.38 ? 69   VAL B N     1 
ATOM   2180  C  CA    . VAL B 1  69   ? 7.656   -31.281 61.748   1.00 156.13 ? 69   VAL B CA    1 
ATOM   2181  C  C     . VAL B 1  69   ? 7.583   -31.967 60.387   1.00 151.83 ? 69   VAL B C     1 
ATOM   2182  O  O     . VAL B 1  69   ? 8.561   -32.551 59.923   1.00 146.03 ? 69   VAL B O     1 
ATOM   2183  C  CB    . VAL B 1  69   ? 8.402   -29.941 61.596   1.00 159.48 ? 69   VAL B CB    1 
ATOM   2184  C  CG1   . VAL B 1  69   ? 7.590   -28.976 60.747   1.00 157.13 ? 69   VAL B CG1   1 
ATOM   2185  C  CG2   . VAL B 1  69   ? 8.688   -29.338 62.959   1.00 157.26 ? 69   VAL B CG2   1 
ATOM   2186  N  N     . LYS B 1  70   ? 6.414   -31.888 59.758   1.00 155.62 ? 70   LYS B N     1 
ATOM   2187  C  CA    . LYS B 1  70   ? 6.193   -32.471 58.439   1.00 155.64 ? 70   LYS B CA    1 
ATOM   2188  C  C     . LYS B 1  70   ? 7.035   -31.792 57.364   1.00 149.93 ? 70   LYS B C     1 
ATOM   2189  O  O     . LYS B 1  70   ? 7.696   -32.456 56.566   1.00 145.29 ? 70   LYS B O     1 
ATOM   2190  C  CB    . LYS B 1  70   ? 4.708   -32.386 58.070   1.00 158.25 ? 70   LYS B CB    1 
ATOM   2191  C  CG    . LYS B 1  70   ? 4.400   -32.696 56.614   1.00 155.02 ? 70   LYS B CG    1 
ATOM   2192  C  CD    . LYS B 1  70   ? 2.927   -32.470 56.305   1.00 145.37 ? 70   LYS B CD    1 
ATOM   2193  C  CE    . LYS B 1  70   ? 2.626   -32.703 54.834   1.00 134.08 ? 70   LYS B CE    1 
ATOM   2194  N  NZ    . LYS B 1  70   ? 1.189   -32.467 54.538   1.00 135.60 ? 70   LYS B NZ    1 
ATOM   2195  N  N     . GLU B 1  71   ? 7.003   -30.463 57.354   1.00 152.15 ? 71   GLU B N     1 
ATOM   2196  C  CA    . GLU B 1  71   ? 7.705   -29.678 56.346   1.00 147.36 ? 71   GLU B CA    1 
ATOM   2197  C  C     . GLU B 1  71   ? 9.221   -29.777 56.490   1.00 149.00 ? 71   GLU B C     1 
ATOM   2198  O  O     . GLU B 1  71   ? 9.736   -30.144 57.547   1.00 149.93 ? 71   GLU B O     1 
ATOM   2199  C  CB    . GLU B 1  71   ? 7.278   -28.207 56.420   1.00 140.64 ? 71   GLU B CB    1 
ATOM   2200  C  CG    . GLU B 1  71   ? 5.819   -27.943 56.060   1.00 140.15 ? 71   GLU B CG    1 
ATOM   2201  C  CD    . GLU B 1  71   ? 4.857   -28.258 57.192   1.00 137.34 ? 71   GLU B CD    1 
ATOM   2202  O  OE1   . GLU B 1  71   ? 5.322   -28.675 58.275   1.00 135.19 ? 71   GLU B OE1   1 
ATOM   2203  O  OE2   . GLU B 1  71   ? 3.634   -28.082 56.998   1.00 136.37 ? 71   GLU B OE2   1 
ATOM   2204  N  N     . ASP B 1  72   ? 9.927   -29.446 55.414   1.00 146.22 ? 72   ASP B N     1 
ATOM   2205  C  CA    . ASP B 1  72   ? 11.380  -29.386 55.440   1.00 140.21 ? 72   ASP B CA    1 
ATOM   2206  C  C     . ASP B 1  72   ? 11.807  -28.020 55.966   1.00 133.53 ? 72   ASP B C     1 
ATOM   2207  O  O     . ASP B 1  72   ? 10.993  -27.100 56.045   1.00 128.97 ? 72   ASP B O     1 
ATOM   2208  C  CB    . ASP B 1  72   ? 11.958  -29.637 54.044   1.00 126.80 ? 72   ASP B CB    1 
ATOM   2209  C  CG    . ASP B 1  72   ? 13.413  -30.061 54.078   1.00 121.24 ? 72   ASP B CG    1 
ATOM   2210  O  OD1   . ASP B 1  72   ? 14.119  -29.714 55.047   1.00 131.38 ? 72   ASP B OD1   1 
ATOM   2211  O  OD2   . ASP B 1  72   ? 13.853  -30.744 53.130   1.00 115.66 ? 72   ASP B OD2   1 
ATOM   2212  N  N     . VAL B 1  73   ? 13.081  -27.894 56.325   1.00 130.33 ? 73   VAL B N     1 
ATOM   2213  C  CA    . VAL B 1  73   ? 13.630  -26.626 56.789   1.00 117.40 ? 73   VAL B CA    1 
ATOM   2214  C  C     . VAL B 1  73   ? 13.398  -25.532 55.751   1.00 110.35 ? 73   VAL B C     1 
ATOM   2215  O  O     . VAL B 1  73   ? 13.082  -24.393 56.092   1.00 110.17 ? 73   VAL B O     1 
ATOM   2216  C  CB    . VAL B 1  73   ? 15.139  -26.752 57.101   1.00 122.75 ? 73   VAL B CB    1 
ATOM   2217  C  CG1   . VAL B 1  73   ? 15.794  -25.385 57.203   1.00 124.09 ? 73   VAL B CG1   1 
ATOM   2218  C  CG2   . VAL B 1  73   ? 15.346  -27.544 58.385   1.00 137.09 ? 73   VAL B CG2   1 
ATOM   2219  N  N     . THR B 1  74   ? 13.516  -25.903 54.482   1.00 110.09 ? 74   THR B N     1 
ATOM   2220  C  CA    . THR B 1  74   ? 13.358  -24.965 53.377   1.00 109.13 ? 74   THR B CA    1 
ATOM   2221  C  C     . THR B 1  74   ? 11.942  -24.391 53.260   1.00 109.52 ? 74   THR B C     1 
ATOM   2222  O  O     . THR B 1  74   ? 11.763  -23.174 53.225   1.00 103.93 ? 74   THR B O     1 
ATOM   2223  C  CB    . THR B 1  74   ? 13.725  -25.629 52.037   1.00 109.18 ? 74   THR B CB    1 
ATOM   2224  O  OG1   . THR B 1  74   ? 12.735  -26.607 51.694   1.00 112.25 ? 74   THR B OG1   1 
ATOM   2225  C  CG2   . THR B 1  74   ? 15.083  -26.303 52.136   1.00 100.62 ? 74   THR B CG2   1 
ATOM   2226  N  N     . GLU B 1  75   ? 10.943  -25.269 53.201   1.00 114.99 ? 75   GLU B N     1 
ATOM   2227  C  CA    . GLU B 1  75   ? 9.566   -24.858 52.918   1.00 114.32 ? 75   GLU B CA    1 
ATOM   2228  C  C     . GLU B 1  75   ? 8.938   -23.993 54.008   1.00 116.98 ? 75   GLU B C     1 
ATOM   2229  O  O     . GLU B 1  75   ? 7.995   -23.241 53.748   1.00 113.14 ? 75   GLU B O     1 
ATOM   2230  C  CB    . GLU B 1  75   ? 8.689   -26.088 52.679   1.00 105.11 ? 75   GLU B CB    1 
ATOM   2231  C  CG    . GLU B 1  75   ? 8.789   -26.639 51.268   1.00 96.62  ? 75   GLU B CG    1 
ATOM   2232  C  CD    . GLU B 1  75   ? 7.793   -27.743 51.004   1.00 90.06  ? 75   GLU B CD    1 
ATOM   2233  O  OE1   . GLU B 1  75   ? 7.172   -28.226 51.971   1.00 96.75  ? 75   GLU B OE1   1 
ATOM   2234  O  OE2   . GLU B 1  75   ? 7.627   -28.127 49.830   1.00 86.60  ? 75   GLU B OE2   1 
ATOM   2235  N  N     . ILE B 1  76   ? 9.453   -24.107 55.228   1.00 122.39 ? 76   ILE B N     1 
ATOM   2236  C  CA    . ILE B 1  76   ? 8.966   -23.294 56.336   1.00 126.54 ? 76   ILE B CA    1 
ATOM   2237  C  C     . ILE B 1  76   ? 9.437   -21.850 56.183   1.00 110.35 ? 76   ILE B C     1 
ATOM   2238  O  O     . ILE B 1  76   ? 8.720   -20.910 56.533   1.00 101.10 ? 76   ILE B O     1 
ATOM   2239  C  CB    . ILE B 1  76   ? 9.435   -23.845 57.696   1.00 136.93 ? 76   ILE B CB    1 
ATOM   2240  C  CG1   . ILE B 1  76   ? 9.112   -25.336 57.808   1.00 139.83 ? 76   ILE B CG1   1 
ATOM   2241  C  CG2   . ILE B 1  76   ? 8.787   -23.074 58.838   1.00 136.24 ? 76   ILE B CG2   1 
ATOM   2242  C  CD1   . ILE B 1  76   ? 9.674   -25.993 59.053   1.00 142.11 ? 76   ILE B CD1   1 
ATOM   2243  N  N     . ILE B 1  77   ? 10.648  -21.685 55.659   1.00 103.35 ? 77   ILE B N     1 
ATOM   2244  C  CA    . ILE B 1  77   ? 11.203  -20.362 55.396   1.00 96.63  ? 77   ILE B CA    1 
ATOM   2245  C  C     . ILE B 1  77   ? 10.298  -19.608 54.435   1.00 97.01  ? 77   ILE B C     1 
ATOM   2246  O  O     . ILE B 1  77   ? 10.014  -18.422 54.616   1.00 93.07  ? 77   ILE B O     1 
ATOM   2247  C  CB    . ILE B 1  77   ? 12.616  -20.442 54.790   1.00 90.41  ? 77   ILE B CB    1 
ATOM   2248  C  CG1   . ILE B 1  77   ? 13.531  -21.304 55.656   1.00 89.84  ? 77   ILE B CG1   1 
ATOM   2249  C  CG2   . ILE B 1  77   ? 13.206  -19.049 54.618   1.00 105.14 ? 77   ILE B CG2   1 
ATOM   2250  C  CD1   . ILE B 1  77   ? 14.811  -21.705 54.955   1.00 95.02  ? 77   ILE B CD1   1 
ATOM   2251  N  N     . LEU B 1  78   ? 9.840   -20.331 53.420   1.00 100.05 ? 78   LEU B N     1 
ATOM   2252  C  CA    . LEU B 1  78   ? 9.019   -19.772 52.355   1.00 99.92  ? 78   LEU B CA    1 
ATOM   2253  C  C     . LEU B 1  78   ? 7.669   -19.300 52.880   1.00 94.37  ? 78   LEU B C     1 
ATOM   2254  O  O     . LEU B 1  78   ? 7.196   -18.222 52.517   1.00 93.90  ? 78   LEU B O     1 
ATOM   2255  C  CB    . LEU B 1  78   ? 8.827   -20.805 51.240   1.00 95.71  ? 78   LEU B CB    1 
ATOM   2256  C  CG    . LEU B 1  78   ? 9.917   -20.893 50.164   1.00 91.87  ? 78   LEU B CG    1 
ATOM   2257  C  CD1   . LEU B 1  78   ? 11.306  -21.064 50.763   1.00 91.14  ? 78   LEU B CD1   1 
ATOM   2258  C  CD2   . LEU B 1  78   ? 9.615   -22.026 49.198   1.00 92.41  ? 78   LEU B CD2   1 
ATOM   2259  N  N     . ASN B 1  79   ? 7.050   -20.110 53.732   1.00 97.42  ? 79   ASN B N     1 
ATOM   2260  C  CA    . ASN B 1  79   ? 5.812   -19.711 54.387   1.00 100.21 ? 79   ASN B CA    1 
ATOM   2261  C  C     . ASN B 1  79   ? 6.032   -18.487 55.271   1.00 101.28 ? 79   ASN B C     1 
ATOM   2262  O  O     . ASN B 1  79   ? 5.169   -17.616 55.373   1.00 105.04 ? 79   ASN B O     1 
ATOM   2263  C  CB    . ASN B 1  79   ? 5.242   -20.867 55.216   1.00 110.87 ? 79   ASN B CB    1 
ATOM   2264  C  CG    . ASN B 1  79   ? 4.645   -21.966 54.356   1.00 111.77 ? 79   ASN B CG    1 
ATOM   2265  O  OD1   . ASN B 1  79   ? 3.477   -21.902 53.972   1.00 122.95 ? 79   ASN B OD1   1 
ATOM   2266  N  ND2   . ASN B 1  79   ? 5.443   -22.984 54.056   1.00 108.76 ? 79   ASN B ND2   1 
ATOM   2267  N  N     . LEU B 1  80   ? 7.203   -18.425 55.899   1.00 100.39 ? 80   LEU B N     1 
ATOM   2268  C  CA    . LEU B 1  80   ? 7.534   -17.337 56.812   1.00 97.63  ? 80   LEU B CA    1 
ATOM   2269  C  C     . LEU B 1  80   ? 7.809   -16.036 56.080   1.00 93.64  ? 80   LEU B C     1 
ATOM   2270  O  O     . LEU B 1  80   ? 7.529   -14.954 56.596   1.00 96.30  ? 80   LEU B O     1 
ATOM   2271  C  CB    . LEU B 1  80   ? 8.743   -17.707 57.665   1.00 97.30  ? 80   LEU B CB    1 
ATOM   2272  C  CG    . LEU B 1  80   ? 8.439   -18.634 58.837   1.00 102.78 ? 80   LEU B CG    1 
ATOM   2273  C  CD1   . LEU B 1  80   ? 9.671   -18.793 59.708   1.00 105.81 ? 80   LEU B CD1   1 
ATOM   2274  C  CD2   . LEU B 1  80   ? 7.266   -18.091 59.645   1.00 107.42 ? 80   LEU B CD2   1 
ATOM   2275  N  N     . LYS B 1  81   ? 8.369   -16.145 54.882   1.00 88.65  ? 81   LYS B N     1 
ATOM   2276  C  CA    . LYS B 1  81   ? 8.600   -14.972 54.053   1.00 92.91  ? 81   LYS B CA    1 
ATOM   2277  C  C     . LYS B 1  81   ? 7.273   -14.303 53.723   1.00 96.79  ? 81   LYS B C     1 
ATOM   2278  O  O     . LYS B 1  81   ? 7.198   -13.084 53.578   1.00 97.53  ? 81   LYS B O     1 
ATOM   2279  C  CB    . LYS B 1  81   ? 9.330   -15.349 52.766   1.00 98.03  ? 81   LYS B CB    1 
ATOM   2280  C  CG    . LYS B 1  81   ? 10.751  -15.837 52.960   1.00 96.96  ? 81   LYS B CG    1 
ATOM   2281  C  CD    . LYS B 1  81   ? 11.348  -16.222 51.622   1.00 94.91  ? 81   LYS B CD    1 
ATOM   2282  C  CE    . LYS B 1  81   ? 12.721  -16.834 51.768   1.00 99.81  ? 81   LYS B CE    1 
ATOM   2283  N  NZ    . LYS B 1  81   ? 13.215  -17.296 50.446   1.00 98.27  ? 81   LYS B NZ    1 
ATOM   2284  N  N     . SER B 1  82   ? 6.226   -15.117 53.626   1.00 98.03  ? 82   SER B N     1 
ATOM   2285  C  CA    . SER B 1  82   ? 4.907   -14.644 53.223   1.00 102.83 ? 82   SER B CA    1 
ATOM   2286  C  C     . SER B 1  82   ? 4.111   -14.076 54.396   1.00 104.73 ? 82   SER B C     1 
ATOM   2287  O  O     . SER B 1  82   ? 2.929   -13.756 54.259   1.00 110.97 ? 82   SER B O     1 
ATOM   2288  C  CB    . SER B 1  82   ? 4.123   -15.779 52.563   1.00 103.20 ? 82   SER B CB    1 
ATOM   2289  O  OG    . SER B 1  82   ? 2.888   -15.311 52.052   1.00 108.83 ? 82   SER B OG    1 
ATOM   2290  N  N     . LEU B 1  83   ? 4.760   -13.955 55.548   1.00 102.14 ? 83   LEU B N     1 
ATOM   2291  C  CA    . LEU B 1  83   ? 4.112   -13.407 56.732   1.00 103.83 ? 83   LEU B CA    1 
ATOM   2292  C  C     . LEU B 1  83   ? 4.112   -11.885 56.687   1.00 104.24 ? 83   LEU B C     1 
ATOM   2293  O  O     . LEU B 1  83   ? 5.155   -11.262 56.495   1.00 102.97 ? 83   LEU B O     1 
ATOM   2294  C  CB    . LEU B 1  83   ? 4.806   -13.896 58.002   1.00 102.22 ? 83   LEU B CB    1 
ATOM   2295  C  CG    . LEU B 1  83   ? 4.244   -13.344 59.311   1.00 111.68 ? 83   LEU B CG    1 
ATOM   2296  C  CD1   . LEU B 1  83   ? 2.795   -13.766 59.492   1.00 125.17 ? 83   LEU B CD1   1 
ATOM   2297  C  CD2   . LEU B 1  83   ? 5.095   -13.806 60.480   1.00 114.59 ? 83   LEU B CD2   1 
ATOM   2298  N  N     . VAL B 1  84   ? 2.938   -11.292 56.862   1.00 104.38 ? 84   VAL B N     1 
ATOM   2299  C  CA    . VAL B 1  84   ? 2.805   -9.844  56.800   1.00 113.30 ? 84   VAL B CA    1 
ATOM   2300  C  C     . VAL B 1  84   ? 2.778   -9.237  58.205   1.00 119.72 ? 84   VAL B C     1 
ATOM   2301  O  O     . VAL B 1  84   ? 1.917   -9.563  59.023   1.00 124.07 ? 84   VAL B O     1 
ATOM   2302  C  CB    . VAL B 1  84   ? 1.544   -9.443  56.008   1.00 119.41 ? 84   VAL B CB    1 
ATOM   2303  C  CG1   . VAL B 1  84   ? 1.802   -9.579  54.521   1.00 122.85 ? 84   VAL B CG1   1 
ATOM   2304  C  CG2   . VAL B 1  84   ? 0.369   -10.314 56.401   1.00 120.58 ? 84   VAL B CG2   1 
ATOM   2305  N  N     . VAL B 1  85   ? 3.747   -8.365  58.479   1.00 121.18 ? 85   VAL B N     1 
ATOM   2306  C  CA    . VAL B 1  85   ? 3.930   -7.776  59.807   1.00 129.65 ? 85   VAL B CA    1 
ATOM   2307  C  C     . VAL B 1  85   ? 4.262   -6.284  59.705   1.00 138.83 ? 85   VAL B C     1 
ATOM   2308  O  O     . VAL B 1  85   ? 5.016   -5.876  58.822   1.00 140.75 ? 85   VAL B O     1 
ATOM   2309  C  CB    . VAL B 1  85   ? 5.058   -8.503  60.590   1.00 131.22 ? 85   VAL B CB    1 
ATOM   2310  C  CG1   . VAL B 1  85   ? 5.419   -7.759  61.868   1.00 138.68 ? 85   VAL B CG1   1 
ATOM   2311  C  CG2   . VAL B 1  85   ? 4.660   -9.935  60.907   1.00 131.91 ? 85   VAL B CG2   1 
ATOM   2312  N  N     . SER B 1  86   ? 3.694   -5.475  60.600   1.00 146.20 ? 86   SER B N     1 
ATOM   2313  C  CA    . SER B 1  86   ? 4.018   -4.048  60.672   1.00 144.03 ? 86   SER B CA    1 
ATOM   2314  C  C     . SER B 1  86   ? 4.581   -3.650  62.038   1.00 145.03 ? 86   SER B C     1 
ATOM   2315  O  O     . SER B 1  86   ? 3.848   -3.589  63.026   1.00 147.68 ? 86   SER B O     1 
ATOM   2316  C  CB    . SER B 1  86   ? 2.784   -3.195  60.362   1.00 145.03 ? 86   SER B CB    1 
ATOM   2317  O  OG    . SER B 1  86   ? 2.348   -3.384  59.027   1.00 151.76 ? 86   SER B OG    1 
ATOM   2318  N  N     . SER B 1  87   ? 5.881   -3.373  62.085   1.00 145.06 ? 87   SER B N     1 
ATOM   2319  C  CA    . SER B 1  87   ? 6.537   -2.926  63.311   1.00 147.94 ? 87   SER B CA    1 
ATOM   2320  C  C     . SER B 1  87   ? 6.402   -1.416  63.453   1.00 143.41 ? 87   SER B C     1 
ATOM   2321  O  O     . SER B 1  87   ? 6.396   -0.697  62.456   1.00 144.13 ? 87   SER B O     1 
ATOM   2322  C  CB    . SER B 1  87   ? 8.013   -3.333  63.313   1.00 153.79 ? 87   SER B CB    1 
ATOM   2323  O  OG    . SER B 1  87   ? 8.692   -2.814  64.444   1.00 148.51 ? 87   SER B OG    1 
ATOM   2324  N  N     . GLU B 1  88   ? 6.288   -0.934  64.687   1.00 143.91 ? 88   GLU B N     1 
ATOM   2325  C  CA    . GLU B 1  88   ? 6.104   0.495   64.914   1.00 146.53 ? 88   GLU B CA    1 
ATOM   2326  C  C     . GLU B 1  88   ? 7.437   1.200   65.122   1.00 146.78 ? 88   GLU B C     1 
ATOM   2327  O  O     . GLU B 1  88   ? 7.562   2.400   64.868   1.00 150.70 ? 88   GLU B O     1 
ATOM   2328  C  CB    . GLU B 1  88   ? 5.190   0.737   66.114   1.00 152.82 ? 88   GLU B CB    1 
ATOM   2329  C  CG    . GLU B 1  88   ? 4.701   2.171   66.231   1.00 163.55 ? 88   GLU B CG    1 
ATOM   2330  C  CD    . GLU B 1  88   ? 3.363   2.272   66.934   1.00 170.49 ? 88   GLU B CD    1 
ATOM   2331  O  OE1   . GLU B 1  88   ? 2.873   1.233   67.424   1.00 176.26 ? 88   GLU B OE1   1 
ATOM   2332  O  OE2   . GLU B 1  88   ? 2.797   3.385   66.988   1.00 167.56 ? 88   GLU B OE2   1 
ATOM   2333  N  N     . GLU B 1  89   ? 8.433   0.449   65.579   1.00 148.28 ? 89   GLU B N     1 
ATOM   2334  C  CA    . GLU B 1  89   ? 9.761   1.002   65.793   1.00 146.84 ? 89   GLU B CA    1 
ATOM   2335  C  C     . GLU B 1  89   ? 10.746  0.541   64.728   1.00 153.68 ? 89   GLU B C     1 
ATOM   2336  O  O     . GLU B 1  89   ? 10.769  -0.631  64.349   1.00 148.39 ? 89   GLU B O     1 
ATOM   2337  C  CB    . GLU B 1  89   ? 10.281  0.632   67.182   1.00 144.14 ? 89   GLU B CB    1 
ATOM   2338  C  CG    . GLU B 1  89   ? 9.854   1.607   68.265   1.00 141.06 ? 89   GLU B CG    1 
ATOM   2339  C  CD    . GLU B 1  89   ? 10.286  3.029   67.961   1.00 137.99 ? 89   GLU B CD    1 
ATOM   2340  O  OE1   . GLU B 1  89   ? 11.398  3.211   67.420   1.00 137.96 ? 89   GLU B OE1   1 
ATOM   2341  O  OE2   . GLU B 1  89   ? 9.512   3.964   68.254   1.00 135.91 ? 89   GLU B OE2   1 
ATOM   2342  N  N     . ASP B 1  90   ? 11.550  1.487   64.252   1.00 160.48 ? 90   ASP B N     1 
ATOM   2343  C  CA    . ASP B 1  90   ? 12.586  1.234   63.258   1.00 159.49 ? 90   ASP B CA    1 
ATOM   2344  C  C     . ASP B 1  90   ? 13.535  0.137   63.723   1.00 159.00 ? 90   ASP B C     1 
ATOM   2345  O  O     . ASP B 1  90   ? 13.934  -0.729  62.944   1.00 157.73 ? 90   ASP B O     1 
ATOM   2346  C  CB    . ASP B 1  90   ? 13.365  2.525   62.979   1.00 157.21 ? 90   ASP B CB    1 
ATOM   2347  C  CG    . ASP B 1  90   ? 14.202  2.452   61.714   1.00 152.63 ? 90   ASP B CG    1 
ATOM   2348  O  OD1   . ASP B 1  90   ? 14.892  1.435   61.497   1.00 150.81 ? 90   ASP B OD1   1 
ATOM   2349  O  OD2   . ASP B 1  90   ? 14.175  3.426   60.934   1.00 153.47 ? 90   ASP B OD2   1 
ATOM   2350  N  N     . GLU B 1  91   ? 13.887  0.181   65.002   1.00 157.78 ? 91   GLU B N     1 
ATOM   2351  C  CA    . GLU B 1  91   ? 14.869  -0.737  65.560   1.00 157.80 ? 91   GLU B CA    1 
ATOM   2352  C  C     . GLU B 1  91   ? 14.347  -2.169  65.573   1.00 160.47 ? 91   GLU B C     1 
ATOM   2353  O  O     . GLU B 1  91   ? 13.176  -2.402  65.884   1.00 163.91 ? 91   GLU B O     1 
ATOM   2354  C  CB    . GLU B 1  91   ? 15.267  -0.291  66.969   1.00 158.03 ? 91   GLU B CB    1 
ATOM   2355  C  CG    . GLU B 1  91   ? 16.336  0.796   66.988   1.00 163.59 ? 91   GLU B CG    1 
ATOM   2356  C  CD    . GLU B 1  91   ? 15.979  1.989   66.115   1.00 164.01 ? 91   GLU B CD    1 
ATOM   2357  O  OE1   . GLU B 1  91   ? 14.813  2.437   66.158   1.00 162.80 ? 91   GLU B OE1   1 
ATOM   2358  O  OE2   . GLU B 1  91   ? 16.861  2.470   65.374   1.00 167.80 ? 91   GLU B OE2   1 
ATOM   2359  N  N     . PRO B 1  92   ? 15.220  -3.132  65.229   1.00 158.76 ? 92   PRO B N     1 
ATOM   2360  C  CA    . PRO B 1  92   ? 14.857  -4.549  65.092   1.00 162.57 ? 92   PRO B CA    1 
ATOM   2361  C  C     . PRO B 1  92   ? 14.247  -5.143  66.361   1.00 165.21 ? 92   PRO B C     1 
ATOM   2362  O  O     . PRO B 1  92   ? 14.897  -5.150  67.405   1.00 166.32 ? 92   PRO B O     1 
ATOM   2363  C  CB    . PRO B 1  92   ? 16.195  -5.227  64.768   1.00 157.16 ? 92   PRO B CB    1 
ATOM   2364  C  CG    . PRO B 1  92   ? 17.242  -4.262  65.219   1.00 147.30 ? 92   PRO B CG    1 
ATOM   2365  C  CD    . PRO B 1  92   ? 16.658  -2.910  64.996   1.00 150.26 ? 92   PRO B CD    1 
ATOM   2366  N  N     . VAL B 1  93   ? 13.012  -5.629  66.264   1.00 168.23 ? 93   VAL B N     1 
ATOM   2367  C  CA    . VAL B 1  93   ? 12.340  -6.261  67.397   1.00 171.76 ? 93   VAL B CA    1 
ATOM   2368  C  C     . VAL B 1  93   ? 12.444  -7.785  67.296   1.00 173.90 ? 93   VAL B C     1 
ATOM   2369  O  O     . VAL B 1  93   ? 12.972  -8.312  66.317   1.00 170.48 ? 93   VAL B O     1 
ATOM   2370  C  CB    . VAL B 1  93   ? 10.853  -5.844  67.486   1.00 166.07 ? 93   VAL B CB    1 
ATOM   2371  C  CG1   . VAL B 1  93   ? 10.727  -4.326  67.549   1.00 157.67 ? 93   VAL B CG1   1 
ATOM   2372  C  CG2   . VAL B 1  93   ? 10.064  -6.398  66.309   1.00 162.76 ? 93   VAL B CG2   1 
ATOM   2373  N  N     . THR B 1  94   ? 11.949  -8.491  68.310   1.00 174.15 ? 94   THR B N     1 
ATOM   2374  C  CA    . THR B 1  94   ? 12.010  -9.952  68.320   1.00 169.15 ? 94   THR B CA    1 
ATOM   2375  C  C     . THR B 1  94   ? 10.748  -10.581 68.904   1.00 163.04 ? 94   THR B C     1 
ATOM   2376  O  O     . THR B 1  94   ? 10.350  -10.282 70.031   1.00 163.34 ? 94   THR B O     1 
ATOM   2377  C  CB    . THR B 1  94   ? 13.233  -10.465 69.112   1.00 168.10 ? 94   THR B CB    1 
ATOM   2378  O  OG1   . THR B 1  94   ? 14.431  -10.186 68.376   1.00 154.81 ? 94   THR B OG1   1 
ATOM   2379  C  CG2   . THR B 1  94   ? 13.133  -11.969 69.343   1.00 168.21 ? 94   THR B CG2   1 
ATOM   2380  N  N     . MET B 1  95   ? 10.123  -11.455 68.125   1.00 158.46 ? 95   MET B N     1 
ATOM   2381  C  CA    . MET B 1  95   ? 8.934   -12.165 68.569   1.00 157.98 ? 95   MET B CA    1 
ATOM   2382  C  C     . MET B 1  95   ? 9.198   -13.664 68.604   1.00 167.04 ? 95   MET B C     1 
ATOM   2383  O  O     . MET B 1  95   ? 10.023  -14.176 67.846   1.00 161.51 ? 95   MET B O     1 
ATOM   2384  C  CB    . MET B 1  95   ? 7.754   -11.857 67.654   1.00 153.98 ? 95   MET B CB    1 
ATOM   2385  C  CG    . MET B 1  95   ? 7.954   -12.328 66.227   1.00 157.01 ? 95   MET B CG    1 
ATOM   2386  S  SD    . MET B 1  95   ? 6.600   -11.845 65.147   1.00 169.50 ? 95   MET B SD    1 
ATOM   2387  C  CE    . MET B 1  95   ? 6.689   -10.065 65.290   1.00 159.99 ? 95   MET B CE    1 
ATOM   2388  N  N     . TYR B 1  96   ? 8.498   -14.366 69.488   1.00 176.01 ? 96   TYR B N     1 
ATOM   2389  C  CA    . TYR B 1  96   ? 8.681   -15.804 69.628   1.00 180.44 ? 96   TYR B CA    1 
ATOM   2390  C  C     . TYR B 1  96   ? 7.411   -16.568 69.267   1.00 175.32 ? 96   TYR B C     1 
ATOM   2391  O  O     . TYR B 1  96   ? 6.297   -16.077 69.455   1.00 172.18 ? 96   TYR B O     1 
ATOM   2392  C  CB    . TYR B 1  96   ? 9.109   -16.155 71.057   1.00 187.37 ? 96   TYR B CB    1 
ATOM   2393  C  CG    . TYR B 1  96   ? 10.481  -15.649 71.459   1.00 179.29 ? 96   TYR B CG    1 
ATOM   2394  C  CD1   . TYR B 1  96   ? 11.621  -16.409 71.223   1.00 176.34 ? 96   TYR B CD1   1 
ATOM   2395  C  CD2   . TYR B 1  96   ? 10.634  -14.423 72.095   1.00 175.38 ? 96   TYR B CD2   1 
ATOM   2396  C  CE1   . TYR B 1  96   ? 12.876  -15.957 71.597   1.00 172.83 ? 96   TYR B CE1   1 
ATOM   2397  C  CE2   . TYR B 1  96   ? 11.885  -13.962 72.474   1.00 171.47 ? 96   TYR B CE2   1 
ATOM   2398  C  CZ    . TYR B 1  96   ? 13.002  -14.733 72.222   1.00 168.06 ? 96   TYR B CZ    1 
ATOM   2399  O  OH    . TYR B 1  96   ? 14.249  -14.282 72.595   1.00 153.97 ? 96   TYR B OH    1 
ATOM   2400  N  N     . LEU B 1  97   ? 7.588   -17.774 68.741   1.00 165.84 ? 97   LEU B N     1 
ATOM   2401  C  CA    . LEU B 1  97   ? 6.463   -18.653 68.463   1.00 157.11 ? 97   LEU B CA    1 
ATOM   2402  C  C     . LEU B 1  97   ? 6.793   -20.068 68.913   1.00 158.58 ? 97   LEU B C     1 
ATOM   2403  O  O     . LEU B 1  97   ? 7.753   -20.675 68.437   1.00 156.79 ? 97   LEU B O     1 
ATOM   2404  C  CB    . LEU B 1  97   ? 6.102   -18.630 66.977   1.00 154.18 ? 97   LEU B CB    1 
ATOM   2405  C  CG    . LEU B 1  97   ? 5.019   -19.618 66.537   1.00 153.12 ? 97   LEU B CG    1 
ATOM   2406  C  CD1   . LEU B 1  97   ? 3.804   -19.514 67.435   1.00 150.80 ? 97   LEU B CD1   1 
ATOM   2407  C  CD2   . LEU B 1  97   ? 4.630   -19.379 65.089   1.00 152.58 ? 97   LEU B CD2   1 
ATOM   2408  N  N     . ARG B 1  98   ? 5.996   -20.581 69.844   1.00 162.78 ? 98   ARG B N     1 
ATOM   2409  C  CA    . ARG B 1  98   ? 6.198   -21.920 70.380   1.00 161.27 ? 98   ARG B CA    1 
ATOM   2410  C  C     . ARG B 1  98   ? 4.890   -22.709 70.387   1.00 157.78 ? 98   ARG B C     1 
ATOM   2411  O  O     . ARG B 1  98   ? 3.841   -22.185 70.765   1.00 155.52 ? 98   ARG B O     1 
ATOM   2412  C  CB    . ARG B 1  98   ? 6.773   -21.851 71.798   1.00 163.44 ? 98   ARG B CB    1 
ATOM   2413  C  CG    . ARG B 1  98   ? 7.988   -20.946 71.953   1.00 160.84 ? 98   ARG B CG    1 
ATOM   2414  C  CD    . ARG B 1  98   ? 8.517   -20.983 73.381   1.00 163.81 ? 98   ARG B CD    1 
ATOM   2415  N  NE    . ARG B 1  98   ? 9.612   -20.039 73.596   1.00 162.18 ? 98   ARG B NE    1 
ATOM   2416  C  CZ    . ARG B 1  98   ? 9.465   -18.832 74.134   1.00 161.15 ? 98   ARG B CZ    1 
ATOM   2417  N  NH1   . ARG B 1  98   ? 8.265   -18.416 74.516   1.00 156.12 ? 98   ARG B NH1   1 
ATOM   2418  N  NH2   . ARG B 1  98   ? 10.518  -18.042 74.292   1.00 162.05 ? 98   ARG B NH2   1 
ATOM   2419  N  N     . LYS B 1  99   ? 4.959   -23.967 69.963   1.00 148.07 ? 99   LYS B N     1 
ATOM   2420  C  CA    . LYS B 1  99   ? 3.808   -24.860 70.026   1.00 139.25 ? 99   LYS B CA    1 
ATOM   2421  C  C     . LYS B 1  99   ? 4.257   -26.313 69.915   1.00 140.41 ? 99   LYS B C     1 
ATOM   2422  O  O     . LYS B 1  99   ? 5.218   -26.621 69.210   1.00 141.24 ? 99   LYS B O     1 
ATOM   2423  C  CB    . LYS B 1  99   ? 2.797   -24.528 68.927   1.00 130.22 ? 99   LYS B CB    1 
ATOM   2424  C  CG    . LYS B 1  99   ? 1.354   -24.725 69.357   1.00 124.60 ? 99   LYS B CG    1 
ATOM   2425  C  CD    . LYS B 1  99   ? 0.376   -24.233 68.307   1.00 127.77 ? 99   LYS B CD    1 
ATOM   2426  C  CE    . LYS B 1  99   ? -1.050  -24.286 68.831   1.00 128.34 ? 99   LYS B CE    1 
ATOM   2427  N  NZ    . LYS B 1  99   ? -1.427  -25.657 69.269   1.00 123.21 ? 99   LYS B NZ    1 
ATOM   2428  N  N     . GLN B 1  100  ? 3.562   -27.198 70.622   1.00 142.43 ? 100  GLN B N     1 
ATOM   2429  C  CA    . GLN B 1  100  ? 3.930   -28.609 70.665   1.00 143.99 ? 100  GLN B CA    1 
ATOM   2430  C  C     . GLN B 1  100  ? 2.685   -29.493 70.589   1.00 146.00 ? 100  GLN B C     1 
ATOM   2431  O  O     . GLN B 1  100  ? 1.575   -29.044 70.876   1.00 142.03 ? 100  GLN B O     1 
ATOM   2432  C  CB    . GLN B 1  100  ? 4.730   -28.909 71.939   1.00 150.04 ? 100  GLN B CB    1 
ATOM   2433  C  CG    . GLN B 1  100  ? 5.443   -30.257 71.943   1.00 154.40 ? 100  GLN B CG    1 
ATOM   2434  C  CD    . GLN B 1  100  ? 6.199   -30.524 73.233   1.00 161.77 ? 100  GLN B CD    1 
ATOM   2435  O  OE1   . GLN B 1  100  ? 6.493   -29.604 73.998   1.00 163.27 ? 100  GLN B OE1   1 
ATOM   2436  N  NE2   . GLN B 1  100  ? 6.516   -31.791 73.480   1.00 163.95 ? 100  GLN B NE2   1 
ATOM   2437  N  N     . GLY B 1  101  ? 2.874   -30.748 70.194   1.00 146.56 ? 101  GLY B N     1 
ATOM   2438  C  CA    . GLY B 1  101  ? 1.778   -31.693 70.102   1.00 137.24 ? 101  GLY B CA    1 
ATOM   2439  C  C     . GLY B 1  101  ? 1.223   -31.789 68.697   1.00 132.44 ? 101  GLY B C     1 
ATOM   2440  O  O     . GLY B 1  101  ? 1.715   -31.124 67.788   1.00 135.04 ? 101  GLY B O     1 
ATOM   2441  N  N     . PRO B 1  102  ? 0.190   -32.622 68.510   1.00 131.71 ? 102  PRO B N     1 
ATOM   2442  C  CA    . PRO B 1  102  ? -0.447  -32.796 67.201   1.00 133.09 ? 102  PRO B CA    1 
ATOM   2443  C  C     . PRO B 1  102  ? -1.280  -31.581 66.805   1.00 134.41 ? 102  PRO B C     1 
ATOM   2444  O  O     . PRO B 1  102  ? -1.909  -30.965 67.664   1.00 130.24 ? 102  PRO B O     1 
ATOM   2445  C  CB    . PRO B 1  102  ? -1.335  -34.025 67.408   1.00 130.64 ? 102  PRO B CB    1 
ATOM   2446  C  CG    . PRO B 1  102  ? -1.656  -34.006 68.860   1.00 125.71 ? 102  PRO B CG    1 
ATOM   2447  C  CD    . PRO B 1  102  ? -0.428  -33.472 69.542   1.00 127.57 ? 102  PRO B CD    1 
ATOM   2448  N  N     . GLY B 1  103  ? -1.278  -31.244 65.518   1.00 137.19 ? 103  GLY B N     1 
ATOM   2449  C  CA    . GLY B 1  103  ? -2.047  -30.116 65.023   1.00 134.83 ? 103  GLY B CA    1 
ATOM   2450  C  C     . GLY B 1  103  ? -1.313  -29.320 63.960   1.00 139.16 ? 103  GLY B C     1 
ATOM   2451  O  O     . GLY B 1  103  ? -0.412  -29.835 63.298   1.00 140.79 ? 103  GLY B O     1 
ATOM   2452  N  N     . GLU B 1  104  ? -1.704  -28.060 63.794   1.00 141.89 ? 104  GLU B N     1 
ATOM   2453  C  CA    . GLU B 1  104  ? -1.064  -27.175 62.825   1.00 143.35 ? 104  GLU B CA    1 
ATOM   2454  C  C     . GLU B 1  104  ? -0.804  -25.790 63.415   1.00 146.88 ? 104  GLU B C     1 
ATOM   2455  O  O     . GLU B 1  104  ? -1.691  -25.180 64.013   1.00 141.97 ? 104  GLU B O     1 
ATOM   2456  C  CB    . GLU B 1  104  ? -1.919  -27.048 61.563   1.00 141.10 ? 104  GLU B CB    1 
ATOM   2457  C  CG    . GLU B 1  104  ? -2.039  -28.332 60.761   1.00 136.95 ? 104  GLU B CG    1 
ATOM   2458  C  CD    . GLU B 1  104  ? -2.810  -28.142 59.470   1.00 136.66 ? 104  GLU B CD    1 
ATOM   2459  O  OE1   . GLU B 1  104  ? -3.263  -27.007 59.205   1.00 137.18 ? 104  GLU B OE1   1 
ATOM   2460  O  OE2   . GLU B 1  104  ? -2.962  -29.128 58.719   1.00 141.15 ? 104  GLU B OE2   1 
ATOM   2461  N  N     . VAL B 1  105  ? 0.419   -25.300 63.241   1.00 147.68 ? 105  VAL B N     1 
ATOM   2462  C  CA    . VAL B 1  105  ? 0.795   -23.987 63.750   1.00 143.46 ? 105  VAL B CA    1 
ATOM   2463  C  C     . VAL B 1  105  ? 0.522   -22.912 62.707   1.00 141.17 ? 105  VAL B C     1 
ATOM   2464  O  O     . VAL B 1  105  ? 0.886   -23.062 61.542   1.00 138.75 ? 105  VAL B O     1 
ATOM   2465  C  CB    . VAL B 1  105  ? 2.279   -23.943 64.153   1.00 142.68 ? 105  VAL B CB    1 
ATOM   2466  C  CG1   . VAL B 1  105  ? 2.610   -22.610 64.806   1.00 146.42 ? 105  VAL B CG1   1 
ATOM   2467  C  CG2   . VAL B 1  105  ? 2.604   -25.094 65.090   1.00 145.80 ? 105  VAL B CG2   1 
ATOM   2468  N  N     . THR B 1  106  ? -0.121  -21.829 63.130   1.00 144.64 ? 106  THR B N     1 
ATOM   2469  C  CA    . THR B 1  106  ? -0.474  -20.749 62.217   1.00 143.52 ? 106  THR B CA    1 
ATOM   2470  C  C     . THR B 1  106  ? 0.153   -19.426 62.642   1.00 137.81 ? 106  THR B C     1 
ATOM   2471  O  O     . THR B 1  106  ? 1.081   -19.399 63.451   1.00 136.81 ? 106  THR B O     1 
ATOM   2472  C  CB    . THR B 1  106  ? -2.000  -20.573 62.119   1.00 152.37 ? 106  THR B CB    1 
ATOM   2473  O  OG1   . THR B 1  106  ? -2.524  -20.206 63.401   1.00 165.56 ? 106  THR B OG1   1 
ATOM   2474  C  CG2   . THR B 1  106  ? -2.659  -21.866 61.658   1.00 153.15 ? 106  THR B CG2   1 
ATOM   2475  N  N     . ALA B 1  107  ? -0.358  -18.332 62.089   1.00 136.46 ? 107  ALA B N     1 
ATOM   2476  C  CA    . ALA B 1  107  ? 0.162   -17.006 62.398   1.00 145.09 ? 107  ALA B CA    1 
ATOM   2477  C  C     . ALA B 1  107  ? -0.608  -16.369 63.548   1.00 145.46 ? 107  ALA B C     1 
ATOM   2478  O  O     . ALA B 1  107  ? -0.272  -15.276 64.006   1.00 146.51 ? 107  ALA B O     1 
ATOM   2479  C  CB    . ALA B 1  107  ? 0.112   -16.118 61.168   1.00 144.73 ? 107  ALA B CB    1 
ATOM   2480  N  N     . GLY B 1  108  ? -1.647  -17.058 64.006   1.00 137.07 ? 108  GLY B N     1 
ATOM   2481  C  CA    . GLY B 1  108  ? -2.427  -16.594 65.136   1.00 134.21 ? 108  GLY B CA    1 
ATOM   2482  C  C     . GLY B 1  108  ? -1.807  -17.028 66.448   1.00 138.53 ? 108  GLY B C     1 
ATOM   2483  O  O     . GLY B 1  108  ? -2.155  -16.514 67.511   1.00 135.63 ? 108  GLY B O     1 
ATOM   2484  N  N     . ASP B 1  109  ? -0.884  -17.983 66.371   1.00 149.64 ? 109  ASP B N     1 
ATOM   2485  C  CA    . ASP B 1  109  ? -0.191  -18.486 67.553   1.00 160.94 ? 109  ASP B CA    1 
ATOM   2486  C  C     . ASP B 1  109  ? 1.022   -17.630 67.895   1.00 163.58 ? 109  ASP B C     1 
ATOM   2487  O  O     . ASP B 1  109  ? 1.595   -17.752 68.978   1.00 172.66 ? 109  ASP B O     1 
ATOM   2488  C  CB    . ASP B 1  109  ? 0.247   -19.938 67.347   1.00 161.49 ? 109  ASP B CB    1 
ATOM   2489  C  CG    . ASP B 1  109  ? -0.922  -20.879 67.151   1.00 160.67 ? 109  ASP B CG    1 
ATOM   2490  O  OD1   . ASP B 1  109  ? -0.809  -21.799 66.312   1.00 159.43 ? 109  ASP B OD1   1 
ATOM   2491  O  OD2   . ASP B 1  109  ? -1.953  -20.700 67.835   1.00 160.45 ? 109  ASP B OD2   1 
ATOM   2492  N  N     . ILE B 1  110  ? 1.415   -16.775 66.956   1.00 160.03 ? 110  ILE B N     1 
ATOM   2493  C  CA    . ILE B 1  110  ? 2.585   -15.920 67.127   1.00 156.29 ? 110  ILE B CA    1 
ATOM   2494  C  C     . ILE B 1  110  ? 2.409   -14.960 68.301   1.00 157.74 ? 110  ILE B C     1 
ATOM   2495  O  O     . ILE B 1  110  ? 1.341   -14.376 68.476   1.00 158.09 ? 110  ILE B O     1 
ATOM   2496  C  CB    . ILE B 1  110  ? 2.870   -15.107 65.850   1.00 159.25 ? 110  ILE B CB    1 
ATOM   2497  C  CG1   . ILE B 1  110  ? 2.999   -16.035 64.641   1.00 158.99 ? 110  ILE B CG1   1 
ATOM   2498  C  CG2   . ILE B 1  110  ? 4.130   -14.274 66.011   1.00 160.38 ? 110  ILE B CG2   1 
ATOM   2499  C  CD1   . ILE B 1  110  ? 3.289   -15.303 63.348   1.00 156.12 ? 110  ILE B CD1   1 
ATOM   2500  N  N     . VAL B 1  111  ? 3.457   -14.810 69.105   1.00 155.29 ? 111  VAL B N     1 
ATOM   2501  C  CA    . VAL B 1  111  ? 3.445   -13.873 70.223   1.00 153.21 ? 111  VAL B CA    1 
ATOM   2502  C  C     . VAL B 1  111  ? 4.156   -12.575 69.844   1.00 148.91 ? 111  VAL B C     1 
ATOM   2503  O  O     . VAL B 1  111  ? 5.384   -12.519 69.825   1.00 149.45 ? 111  VAL B O     1 
ATOM   2504  C  CB    . VAL B 1  111  ? 4.116   -14.476 71.470   1.00 154.09 ? 111  VAL B CB    1 
ATOM   2505  C  CG1   . VAL B 1  111  ? 4.003   -13.519 72.645   1.00 158.70 ? 111  VAL B CG1   1 
ATOM   2506  C  CG2   . VAL B 1  111  ? 3.495   -15.822 71.808   1.00 156.48 ? 111  VAL B CG2   1 
ATOM   2507  N  N     . PRO B 1  112  ? 3.379   -11.524 69.538   1.00 150.49 ? 112  PRO B N     1 
ATOM   2508  C  CA    . PRO B 1  112  ? 3.928   -10.258 69.040   1.00 159.17 ? 112  PRO B CA    1 
ATOM   2509  C  C     . PRO B 1  112  ? 4.267   -9.249  70.142   1.00 160.02 ? 112  PRO B C     1 
ATOM   2510  O  O     . PRO B 1  112  ? 3.597   -9.230  71.176   1.00 159.83 ? 112  PRO B O     1 
ATOM   2511  C  CB    . PRO B 1  112  ? 2.797   -9.730  68.157   1.00 163.64 ? 112  PRO B CB    1 
ATOM   2512  C  CG    . PRO B 1  112  ? 1.553   -10.222 68.838   1.00 154.98 ? 112  PRO B CG    1 
ATOM   2513  C  CD    . PRO B 1  112  ? 1.905   -11.516 69.543   1.00 147.24 ? 112  PRO B CD    1 
ATOM   2514  N  N     . PRO B 1  113  ? 5.309   -8.425  69.924   1.00 154.13 ? 113  PRO B N     1 
ATOM   2515  C  CA    . PRO B 1  113  ? 5.674   -7.333  70.836   1.00 143.88 ? 113  PRO B CA    1 
ATOM   2516  C  C     . PRO B 1  113  ? 4.690   -6.166  70.763   1.00 143.46 ? 113  PRO B C     1 
ATOM   2517  O  O     . PRO B 1  113  ? 3.768   -6.194  69.950   1.00 149.31 ? 113  PRO B O     1 
ATOM   2518  C  CB    . PRO B 1  113  ? 7.061   -6.900  70.339   1.00 144.81 ? 113  PRO B CB    1 
ATOM   2519  C  CG    . PRO B 1  113  ? 7.537   -8.013  69.462   1.00 154.99 ? 113  PRO B CG    1 
ATOM   2520  C  CD    . PRO B 1  113  ? 6.305   -8.596  68.855   1.00 156.44 ? 113  PRO B CD    1 
ATOM   2521  N  N     . ALA B 1  114  ? 4.894   -5.150  71.597   1.00 141.55 ? 114  ALA B N     1 
ATOM   2522  C  CA    . ALA B 1  114  ? 4.011   -3.987  71.622   1.00 141.94 ? 114  ALA B CA    1 
ATOM   2523  C  C     . ALA B 1  114  ? 4.222   -3.101  70.398   1.00 140.83 ? 114  ALA B C     1 
ATOM   2524  O  O     . ALA B 1  114  ? 5.346   -2.706  70.093   1.00 141.43 ? 114  ALA B O     1 
ATOM   2525  C  CB    . ALA B 1  114  ? 4.226   -3.188  72.897   1.00 134.38 ? 114  ALA B CB    1 
ATOM   2526  N  N     . GLY B 1  115  ? 3.134   -2.788  69.702   1.00 138.87 ? 115  GLY B N     1 
ATOM   2527  C  CA    . GLY B 1  115  ? 3.209   -1.978  68.500   1.00 144.32 ? 115  GLY B CA    1 
ATOM   2528  C  C     . GLY B 1  115  ? 3.593   -2.793  67.279   1.00 154.40 ? 115  GLY B C     1 
ATOM   2529  O  O     . GLY B 1  115  ? 3.990   -2.241  66.253   1.00 155.33 ? 115  GLY B O     1 
ATOM   2530  N  N     . VAL B 1  116  ? 3.477   -4.113  67.395   1.00 156.18 ? 116  VAL B N     1 
ATOM   2531  C  CA    . VAL B 1  116  ? 3.770   -5.024  66.290   1.00 153.95 ? 116  VAL B CA    1 
ATOM   2532  C  C     . VAL B 1  116  ? 2.561   -5.918  66.004   1.00 152.91 ? 116  VAL B C     1 
ATOM   2533  O  O     . VAL B 1  116  ? 2.037   -6.569  66.909   1.00 150.65 ? 116  VAL B O     1 
ATOM   2534  C  CB    . VAL B 1  116  ? 5.001   -5.907  66.589   1.00 147.73 ? 116  VAL B CB    1 
ATOM   2535  C  CG1   . VAL B 1  116  ? 5.330   -6.774  65.390   1.00 146.80 ? 116  VAL B CG1   1 
ATOM   2536  C  CG2   . VAL B 1  116  ? 6.200   -5.050  66.970   1.00 147.71 ? 116  VAL B CG2   1 
ATOM   2537  N  N     . THR B 1  117  ? 2.125   -5.954  64.747   1.00 154.18 ? 117  THR B N     1 
ATOM   2538  C  CA    . THR B 1  117  ? 0.892   -6.652  64.383   1.00 152.04 ? 117  THR B CA    1 
ATOM   2539  C  C     . THR B 1  117  ? 1.095   -7.702  63.281   1.00 142.46 ? 117  THR B C     1 
ATOM   2540  O  O     . THR B 1  117  ? 1.809   -7.464  62.307   1.00 140.90 ? 117  THR B O     1 
ATOM   2541  C  CB    . THR B 1  117  ? -0.189  -5.648  63.920   1.00 146.02 ? 117  THR B CB    1 
ATOM   2542  O  OG1   . THR B 1  117  ? -0.164  -4.488  64.763   1.00 148.64 ? 117  THR B OG1   1 
ATOM   2543  C  CG2   . THR B 1  117  ? -1.571  -6.278  63.973   1.00 141.69 ? 117  THR B CG2   1 
ATOM   2544  N  N     . VAL B 1  118  ? 0.463   -8.862  63.451   1.00 144.91 ? 118  VAL B N     1 
ATOM   2545  C  CA    . VAL B 1  118  ? 0.464   -9.920  62.440   1.00 142.90 ? 118  VAL B CA    1 
ATOM   2546  C  C     . VAL B 1  118  ? -0.853  -9.873  61.662   1.00 142.87 ? 118  VAL B C     1 
ATOM   2547  O  O     . VAL B 1  118  ? -1.923  -10.061 62.239   1.00 149.78 ? 118  VAL B O     1 
ATOM   2548  C  CB    . VAL B 1  118  ? 0.652   -11.318 63.076   1.00 144.47 ? 118  VAL B CB    1 
ATOM   2549  C  CG1   . VAL B 1  118  ? 0.545   -12.409 62.023   1.00 141.15 ? 118  VAL B CG1   1 
ATOM   2550  C  CG2   . VAL B 1  118  ? 1.986   -11.401 63.805   1.00 146.17 ? 118  VAL B CG2   1 
ATOM   2551  N  N     . HIS B 1  119  ? -0.776  -9.630  60.356   1.00 136.18 ? 119  HIS B N     1 
ATOM   2552  C  CA    . HIS B 1  119  ? -1.967  -9.268  59.584   1.00 139.95 ? 119  HIS B CA    1 
ATOM   2553  C  C     . HIS B 1  119  ? -2.711  -10.441 58.930   1.00 134.16 ? 119  HIS B C     1 
ATOM   2554  O  O     . HIS B 1  119  ? -3.821  -10.261 58.426   1.00 133.70 ? 119  HIS B O     1 
ATOM   2555  C  CB    . HIS B 1  119  ? -1.590  -8.243  58.509   1.00 138.39 ? 119  HIS B CB    1 
ATOM   2556  C  CG    . HIS B 1  119  ? -0.912  -7.021  59.048   1.00 139.95 ? 119  HIS B CG    1 
ATOM   2557  N  ND1   . HIS B 1  119  ? -1.608  -5.943  59.552   1.00 144.26 ? 119  HIS B ND1   1 
ATOM   2558  C  CD2   . HIS B 1  119  ? 0.401   -6.706  59.162   1.00 132.11 ? 119  HIS B CD2   1 
ATOM   2559  C  CE1   . HIS B 1  119  ? -0.755  -5.019  59.954   1.00 139.77 ? 119  HIS B CE1   1 
ATOM   2560  N  NE2   . HIS B 1  119  ? 0.471   -5.457  59.728   1.00 135.40 ? 119  HIS B NE2   1 
ATOM   2561  N  N     . ASN B 1  120  ? -2.116  -11.632 58.934   1.00 133.07 ? 120  ASN B N     1 
ATOM   2562  C  CA    . ASN B 1  120  ? -2.798  -12.816 58.402   1.00 133.48 ? 120  ASN B CA    1 
ATOM   2563  C  C     . ASN B 1  120  ? -2.718  -14.023 59.345   1.00 137.56 ? 120  ASN B C     1 
ATOM   2564  O  O     . ASN B 1  120  ? -1.999  -14.985 59.077   1.00 140.51 ? 120  ASN B O     1 
ATOM   2565  C  CB    . ASN B 1  120  ? -2.234  -13.182 57.022   1.00 130.42 ? 120  ASN B CB    1 
ATOM   2566  C  CG    . ASN B 1  120  ? -0.739  -13.448 57.047   1.00 129.60 ? 120  ASN B CG    1 
ATOM   2567  O  OD1   . ASN B 1  120  ? -0.047  -13.078 57.994   1.00 131.56 ? 120  ASN B OD1   1 
ATOM   2568  N  ND2   . ASN B 1  120  ? -0.235  -14.092 56.001   1.00 128.45 ? 120  ASN B ND2   1 
ATOM   2569  N  N     . PRO B 1  121  ? -3.485  -13.982 60.448   1.00 138.78 ? 121  PRO B N     1 
ATOM   2570  C  CA    . PRO B 1  121  ? -3.449  -14.992 61.517   1.00 145.21 ? 121  PRO B CA    1 
ATOM   2571  C  C     . PRO B 1  121  ? -3.793  -16.411 61.057   1.00 146.38 ? 121  PRO B C     1 
ATOM   2572  O  O     . PRO B 1  121  ? -3.575  -17.361 61.809   1.00 149.13 ? 121  PRO B O     1 
ATOM   2573  C  CB    . PRO B 1  121  ? -4.504  -14.487 62.510   1.00 146.47 ? 121  PRO B CB    1 
ATOM   2574  C  CG    . PRO B 1  121  ? -4.636  -13.031 62.223   1.00 145.52 ? 121  PRO B CG    1 
ATOM   2575  C  CD    . PRO B 1  121  ? -4.445  -12.907 60.747   1.00 138.93 ? 121  PRO B CD    1 
ATOM   2576  N  N     . GLY B 1  122  ? -4.319  -16.552 59.845   1.00 142.01 ? 122  GLY B N     1 
ATOM   2577  C  CA    . GLY B 1  122  ? -4.721  -17.853 59.345   1.00 137.52 ? 122  GLY B CA    1 
ATOM   2578  C  C     . GLY B 1  122  ? -3.765  -18.461 58.335   1.00 131.42 ? 122  GLY B C     1 
ATOM   2579  O  O     . GLY B 1  122  ? -4.128  -19.385 57.608   1.00 129.66 ? 122  GLY B O     1 
ATOM   2580  N  N     . MET B 1  123  ? -2.539  -17.950 58.285   1.00 130.70 ? 123  MET B N     1 
ATOM   2581  C  CA    . MET B 1  123  ? -1.554  -18.449 57.333   1.00 120.12 ? 123  MET B CA    1 
ATOM   2582  C  C     . MET B 1  123  ? -0.961  -19.775 57.789   1.00 118.98 ? 123  MET B C     1 
ATOM   2583  O  O     . MET B 1  123  ? -0.523  -19.909 58.931   1.00 121.59 ? 123  MET B O     1 
ATOM   2584  C  CB    . MET B 1  123  ? -0.439  -17.428 57.129   1.00 114.21 ? 123  MET B CB    1 
ATOM   2585  C  CG    . MET B 1  123  ? 0.634   -17.879 56.161   1.00 104.39 ? 123  MET B CG    1 
ATOM   2586  S  SD    . MET B 1  123  ? 2.097   -16.838 56.276   1.00 100.24 ? 123  MET B SD    1 
ATOM   2587  C  CE    . MET B 1  123  ? 2.574   -17.143 57.976   1.00 115.98 ? 123  MET B CE    1 
ATOM   2588  N  N     . HIS B 1  124  ? -0.951  -20.752 56.889   1.00 119.46 ? 124  HIS B N     1 
ATOM   2589  C  CA    . HIS B 1  124  ? -0.372  -22.060 57.180   1.00 120.40 ? 124  HIS B CA    1 
ATOM   2590  C  C     . HIS B 1  124  ? 1.148   -21.966 57.266   1.00 118.72 ? 124  HIS B C     1 
ATOM   2591  O  O     . HIS B 1  124  ? 1.777   -21.279 56.463   1.00 117.67 ? 124  HIS B O     1 
ATOM   2592  C  CB    . HIS B 1  124  ? -0.783  -23.077 56.112   1.00 125.13 ? 124  HIS B CB    1 
ATOM   2593  C  CG    . HIS B 1  124  ? -0.237  -24.451 56.346   1.00 121.04 ? 124  HIS B CG    1 
ATOM   2594  N  ND1   . HIS B 1  124  ? -0.774  -25.316 57.272   1.00 127.91 ? 124  HIS B ND1   1 
ATOM   2595  C  CD2   . HIS B 1  124  ? 0.800   -25.106 55.772   1.00 121.60 ? 124  HIS B CD2   1 
ATOM   2596  C  CE1   . HIS B 1  124  ? -0.092  -26.448 57.261   1.00 127.93 ? 124  HIS B CE1   1 
ATOM   2597  N  NE2   . HIS B 1  124  ? 0.868   -26.346 56.360   1.00 125.59 ? 124  HIS B NE2   1 
ATOM   2598  N  N     . ILE B 1  125  ? 1.734   -22.658 58.241   1.00 121.60 ? 125  ILE B N     1 
ATOM   2599  C  CA    . ILE B 1  125  ? 3.180   -22.608 58.452   1.00 123.55 ? 125  ILE B CA    1 
ATOM   2600  C  C     . ILE B 1  125  ? 3.814   -23.997 58.514   1.00 127.23 ? 125  ILE B C     1 
ATOM   2601  O  O     . ILE B 1  125  ? 4.514   -24.406 57.589   1.00 127.28 ? 125  ILE B O     1 
ATOM   2602  C  CB    . ILE B 1  125  ? 3.539   -21.853 59.749   1.00 124.66 ? 125  ILE B CB    1 
ATOM   2603  C  CG1   . ILE B 1  125  ? 2.972   -20.433 59.722   1.00 135.09 ? 125  ILE B CG1   1 
ATOM   2604  C  CG2   . ILE B 1  125  ? 5.047   -21.816 59.943   1.00 115.11 ? 125  ILE B CG2   1 
ATOM   2605  C  CD1   . ILE B 1  125  ? 3.287   -19.627 60.964   1.00 136.86 ? 125  ILE B CD1   1 
ATOM   2606  N  N     . ALA B 1  126  ? 3.574   -24.715 59.607   1.00 133.35 ? 126  ALA B N     1 
ATOM   2607  C  CA    . ALA B 1  126  ? 4.186   -26.026 59.803   1.00 142.49 ? 126  ALA B CA    1 
ATOM   2608  C  C     . ALA B 1  126  ? 3.237   -27.010 60.481   1.00 145.98 ? 126  ALA B C     1 
ATOM   2609  O  O     . ALA B 1  126  ? 2.693   -26.727 61.549   1.00 152.59 ? 126  ALA B O     1 
ATOM   2610  C  CB    . ALA B 1  126  ? 5.468   -25.892 60.612   1.00 141.77 ? 126  ALA B CB    1 
ATOM   2611  N  N     . THR B 1  127  ? 3.051   -28.170 59.859   1.00 143.86 ? 127  THR B N     1 
ATOM   2612  C  CA    . THR B 1  127  ? 2.189   -29.211 60.411   1.00 146.71 ? 127  THR B CA    1 
ATOM   2613  C  C     . THR B 1  127  ? 2.942   -30.085 61.414   1.00 148.99 ? 127  THR B C     1 
ATOM   2614  O  O     . THR B 1  127  ? 3.802   -30.882 61.037   1.00 148.82 ? 127  THR B O     1 
ATOM   2615  C  CB    . THR B 1  127  ? 1.603   -30.105 59.300   1.00 141.91 ? 127  THR B CB    1 
ATOM   2616  O  OG1   . THR B 1  127  ? 0.867   -29.300 58.371   1.00 131.01 ? 127  THR B OG1   1 
ATOM   2617  C  CG2   . THR B 1  127  ? 0.679   -31.159 59.893   1.00 146.67 ? 127  THR B CG2   1 
ATOM   2618  N  N     . LEU B 1  128  ? 2.610   -29.929 62.692   1.00 147.55 ? 128  LEU B N     1 
ATOM   2619  C  CA    . LEU B 1  128  ? 3.242   -30.706 63.754   1.00 148.26 ? 128  LEU B CA    1 
ATOM   2620  C  C     . LEU B 1  128  ? 2.511   -32.022 64.016   1.00 150.25 ? 128  LEU B C     1 
ATOM   2621  O  O     . LEU B 1  128  ? 1.282   -32.082 63.958   1.00 150.00 ? 128  LEU B O     1 
ATOM   2622  C  CB    . LEU B 1  128  ? 3.306   -29.887 65.048   1.00 143.87 ? 128  LEU B CB    1 
ATOM   2623  C  CG    . LEU B 1  128  ? 4.381   -28.804 65.162   1.00 144.22 ? 128  LEU B CG    1 
ATOM   2624  C  CD1   . LEU B 1  128  ? 4.233   -28.043 66.467   1.00 140.88 ? 128  LEU B CD1   1 
ATOM   2625  C  CD2   . LEU B 1  128  ? 5.760   -29.423 65.068   1.00 152.43 ? 128  LEU B CD2   1 
ATOM   2626  N  N     . ASN B 1  129  ? 3.273   -33.073 64.304   1.00 153.76 ? 129  ASN B N     1 
ATOM   2627  C  CA    . ASN B 1  129  ? 2.696   -34.349 64.716   1.00 153.67 ? 129  ASN B CA    1 
ATOM   2628  C  C     . ASN B 1  129  ? 2.810   -34.518 66.229   1.00 155.20 ? 129  ASN B C     1 
ATOM   2629  O  O     . ASN B 1  129  ? 3.235   -33.595 66.926   1.00 154.35 ? 129  ASN B O     1 
ATOM   2630  C  CB    . ASN B 1  129  ? 3.377   -35.516 63.995   1.00 154.59 ? 129  ASN B CB    1 
ATOM   2631  C  CG    . ASN B 1  129  ? 4.787   -35.775 64.495   1.00 150.29 ? 129  ASN B CG    1 
ATOM   2632  O  OD1   . ASN B 1  129  ? 5.488   -34.859 64.920   1.00 151.73 ? 129  ASN B OD1   1 
ATOM   2633  N  ND2   . ASN B 1  129  ? 5.208   -37.034 64.445   1.00 145.88 ? 129  ASN B ND2   1 
ATOM   2634  N  N     . ASP B 1  130  ? 2.434   -35.688 66.740   1.00 157.85 ? 130  ASP B N     1 
ATOM   2635  C  CA    . ASP B 1  130  ? 2.584   -35.953 68.168   1.00 158.76 ? 130  ASP B CA    1 
ATOM   2636  C  C     . ASP B 1  130  ? 4.069   -36.049 68.502   1.00 161.59 ? 130  ASP B C     1 
ATOM   2637  O  O     . ASP B 1  130  ? 4.878   -36.412 67.645   1.00 155.85 ? 130  ASP B O     1 
ATOM   2638  C  CB    . ASP B 1  130  ? 1.845   -37.232 68.583   1.00 163.86 ? 130  ASP B CB    1 
ATOM   2639  C  CG    . ASP B 1  130  ? 2.573   -38.496 68.163   1.00 169.77 ? 130  ASP B CG    1 
ATOM   2640  O  OD1   . ASP B 1  130  ? 3.082   -38.546 67.023   1.00 172.04 ? 130  ASP B OD1   1 
ATOM   2641  O  OD2   . ASP B 1  130  ? 2.638   -39.440 68.980   1.00 168.41 ? 130  ASP B OD2   1 
ATOM   2642  N  N     . LYS B 1  131  ? 4.418   -35.711 69.742   1.00 163.87 ? 131  LYS B N     1 
ATOM   2643  C  CA    . LYS B 1  131  ? 5.811   -35.644 70.184   1.00 161.37 ? 131  LYS B CA    1 
ATOM   2644  C  C     . LYS B 1  131  ? 6.615   -34.700 69.289   1.00 148.99 ? 131  LYS B C     1 
ATOM   2645  O  O     . LYS B 1  131  ? 7.810   -34.898 69.070   1.00 150.53 ? 131  LYS B O     1 
ATOM   2646  C  CB    . LYS B 1  131  ? 6.447   -37.043 70.210   1.00 162.49 ? 131  LYS B CB    1 
ATOM   2647  C  CG    . LYS B 1  131  ? 5.758   -38.028 71.152   1.00 158.52 ? 131  LYS B CG    1 
ATOM   2648  C  CD    . LYS B 1  131  ? 6.524   -39.341 71.258   1.00 142.85 ? 131  LYS B CD    1 
ATOM   2649  C  CE    . LYS B 1  131  ? 6.629   -40.033 69.909   1.00 144.17 ? 131  LYS B CE    1 
ATOM   2650  N  NZ    . LYS B 1  131  ? 7.341   -41.339 70.008   1.00 144.46 ? 131  LYS B NZ    1 
ATOM   2651  N  N     . GLY B 1  132  ? 5.942   -33.673 68.777   1.00 142.94 ? 132  GLY B N     1 
ATOM   2652  C  CA    . GLY B 1  132  ? 6.562   -32.712 67.885   1.00 151.73 ? 132  GLY B CA    1 
ATOM   2653  C  C     . GLY B 1  132  ? 6.773   -31.368 68.552   1.00 153.10 ? 132  GLY B C     1 
ATOM   2654  O  O     . GLY B 1  132  ? 5.844   -30.569 68.678   1.00 149.86 ? 132  GLY B O     1 
ATOM   2655  N  N     . LYS B 1  133  ? 8.007   -31.121 68.979   1.00 156.14 ? 133  LYS B N     1 
ATOM   2656  C  CA    . LYS B 1  133  ? 8.357   -29.884 69.664   1.00 150.49 ? 133  LYS B CA    1 
ATOM   2657  C  C     . LYS B 1  133  ? 8.863   -28.845 68.670   1.00 144.10 ? 133  LYS B C     1 
ATOM   2658  O  O     . LYS B 1  133  ? 9.594   -29.175 67.736   1.00 142.36 ? 133  LYS B O     1 
ATOM   2659  C  CB    . LYS B 1  133  ? 9.410   -30.156 70.740   1.00 157.62 ? 133  LYS B CB    1 
ATOM   2660  C  CG    . LYS B 1  133  ? 9.758   -28.961 71.608   1.00 161.01 ? 133  LYS B CG    1 
ATOM   2661  C  CD    . LYS B 1  133  ? 10.701  -29.368 72.730   1.00 163.17 ? 133  LYS B CD    1 
ATOM   2662  C  CE    . LYS B 1  133  ? 11.095  -28.174 73.581   1.00 168.54 ? 133  LYS B CE    1 
ATOM   2663  N  NZ    . LYS B 1  133  ? 9.905   -27.502 74.172   1.00 167.21 ? 133  LYS B NZ    1 
ATOM   2664  N  N     . LEU B 1  134  ? 8.471   -27.591 68.871   1.00 146.14 ? 134  LEU B N     1 
ATOM   2665  C  CA    . LEU B 1  134  ? 8.825   -26.537 67.930   1.00 147.22 ? 134  LEU B CA    1 
ATOM   2666  C  C     . LEU B 1  134  ? 8.958   -25.178 68.609   1.00 147.81 ? 134  LEU B C     1 
ATOM   2667  O  O     . LEU B 1  134  ? 7.981   -24.618 69.104   1.00 143.66 ? 134  LEU B O     1 
ATOM   2668  C  CB    . LEU B 1  134  ? 7.787   -26.466 66.810   1.00 150.43 ? 134  LEU B CB    1 
ATOM   2669  C  CG    . LEU B 1  134  ? 8.205   -25.717 65.546   1.00 149.03 ? 134  LEU B CG    1 
ATOM   2670  C  CD1   . LEU B 1  134  ? 9.514   -26.270 65.010   1.00 146.11 ? 134  LEU B CD1   1 
ATOM   2671  C  CD2   . LEU B 1  134  ? 7.113   -25.810 64.491   1.00 157.30 ? 134  LEU B CD2   1 
ATOM   2672  N  N     . GLU B 1  135  ? 10.181  -24.658 68.630   1.00 157.67 ? 135  GLU B N     1 
ATOM   2673  C  CA    . GLU B 1  135  ? 10.461  -23.352 69.215   1.00 169.10 ? 135  GLU B CA    1 
ATOM   2674  C  C     . GLU B 1  135  ? 11.289  -22.508 68.254   1.00 176.29 ? 135  GLU B C     1 
ATOM   2675  O  O     . GLU B 1  135  ? 12.383  -22.909 67.853   1.00 173.95 ? 135  GLU B O     1 
ATOM   2676  C  CB    . GLU B 1  135  ? 11.194  -23.501 70.550   1.00 170.13 ? 135  GLU B CB    1 
ATOM   2677  C  CG    . GLU B 1  135  ? 10.406  -24.236 71.621   1.00 166.61 ? 135  GLU B CG    1 
ATOM   2678  C  CD    . GLU B 1  135  ? 11.175  -24.365 72.922   1.00 166.21 ? 135  GLU B CD    1 
ATOM   2679  O  OE1   . GLU B 1  135  ? 12.345  -23.931 72.968   1.00 164.35 ? 135  GLU B OE1   1 
ATOM   2680  O  OE2   . GLU B 1  135  ? 10.609  -24.899 73.898   1.00 169.26 ? 135  GLU B OE2   1 
ATOM   2681  N  N     . VAL B 1  136  ? 10.770  -21.342 67.879   1.00 176.70 ? 136  VAL B N     1 
ATOM   2682  C  CA    . VAL B 1  136  ? 11.458  -20.487 66.914   1.00 174.53 ? 136  VAL B CA    1 
ATOM   2683  C  C     . VAL B 1  136  ? 11.503  -19.020 67.343   1.00 171.91 ? 136  VAL B C     1 
ATOM   2684  O  O     . VAL B 1  136  ? 10.505  -18.456 67.796   1.00 163.60 ? 136  VAL B O     1 
ATOM   2685  C  CB    . VAL B 1  136  ? 10.800  -20.573 65.518   1.00 173.94 ? 136  VAL B CB    1 
ATOM   2686  C  CG1   . VAL B 1  136  ? 11.543  -19.697 64.522   1.00 170.43 ? 136  VAL B CG1   1 
ATOM   2687  C  CG2   . VAL B 1  136  ? 10.769  -22.013 65.028   1.00 173.36 ? 136  VAL B CG2   1 
ATOM   2688  N  N     . GLU B 1  137  ? 12.677  -18.413 67.195   1.00 171.49 ? 137  GLU B N     1 
ATOM   2689  C  CA    . GLU B 1  137  ? 12.863  -16.990 67.449   1.00 165.40 ? 137  GLU B CA    1 
ATOM   2690  C  C     . GLU B 1  137  ? 12.883  -16.208 66.136   1.00 162.05 ? 137  GLU B C     1 
ATOM   2691  O  O     . GLU B 1  137  ? 13.465  -16.655 65.147   1.00 162.85 ? 137  GLU B O     1 
ATOM   2692  C  CB    . GLU B 1  137  ? 14.158  -16.756 68.229   1.00 166.06 ? 137  GLU B CB    1 
ATOM   2693  C  CG    . GLU B 1  137  ? 14.556  -15.299 68.363   1.00 159.82 ? 137  GLU B CG    1 
ATOM   2694  C  CD    . GLU B 1  137  ? 15.914  -15.129 69.006   1.00 150.00 ? 137  GLU B CD    1 
ATOM   2695  O  OE1   . GLU B 1  137  ? 16.285  -15.973 69.846   1.00 141.78 ? 137  GLU B OE1   1 
ATOM   2696  O  OE2   . GLU B 1  137  ? 16.612  -14.152 68.668   1.00 151.60 ? 137  GLU B OE2   1 
ATOM   2697  N  N     . LEU B 1  138  ? 12.247  -15.039 66.130   1.00 159.62 ? 138  LEU B N     1 
ATOM   2698  C  CA    . LEU B 1  138  ? 12.153  -14.227 64.922   1.00 160.98 ? 138  LEU B CA    1 
ATOM   2699  C  C     . LEU B 1  138  ? 12.754  -12.834 65.105   1.00 165.81 ? 138  LEU B C     1 
ATOM   2700  O  O     . LEU B 1  138  ? 12.592  -12.212 66.153   1.00 164.03 ? 138  LEU B O     1 
ATOM   2701  C  CB    . LEU B 1  138  ? 10.692  -14.105 64.487   1.00 160.77 ? 138  LEU B CB    1 
ATOM   2702  C  CG    . LEU B 1  138  ? 9.939   -15.427 64.341   1.00 159.82 ? 138  LEU B CG    1 
ATOM   2703  C  CD1   . LEU B 1  138  ? 8.493   -15.182 63.946   1.00 166.61 ? 138  LEU B CD1   1 
ATOM   2704  C  CD2   . LEU B 1  138  ? 10.633  -16.329 63.332   1.00 150.02 ? 138  LEU B CD2   1 
ATOM   2705  N  N     . VAL B 1  139  ? 13.442  -12.352 64.074   1.00 165.12 ? 139  VAL B N     1 
ATOM   2706  C  CA    . VAL B 1  139  ? 14.012  -11.007 64.079   1.00 159.10 ? 139  VAL B CA    1 
ATOM   2707  C  C     . VAL B 1  139  ? 13.329  -10.128 63.033   1.00 156.48 ? 139  VAL B C     1 
ATOM   2708  O  O     . VAL B 1  139  ? 13.555  -10.290 61.834   1.00 144.57 ? 139  VAL B O     1 
ATOM   2709  C  CB    . VAL B 1  139  ? 15.529  -11.031 63.809   1.00 153.39 ? 139  VAL B CB    1 
ATOM   2710  C  CG1   . VAL B 1  139  ? 16.085  -9.615  63.772   1.00 151.88 ? 139  VAL B CG1   1 
ATOM   2711  C  CG2   . VAL B 1  139  ? 16.245  -11.862 64.864   1.00 158.56 ? 139  VAL B CG2   1 
ATOM   2712  N  N     . VAL B 1  140  ? 12.495  -9.200  63.495   1.00 167.41 ? 140  VAL B N     1 
ATOM   2713  C  CA    . VAL B 1  140  ? 11.732  -8.329  62.602   1.00 164.97 ? 140  VAL B CA    1 
ATOM   2714  C  C     . VAL B 1  140  ? 12.332  -6.925  62.519   1.00 167.01 ? 140  VAL B C     1 
ATOM   2715  O  O     . VAL B 1  140  ? 12.460  -6.235  63.532   1.00 173.07 ? 140  VAL B O     1 
ATOM   2716  C  CB    . VAL B 1  140  ? 10.256  -8.210  63.051   1.00 159.03 ? 140  VAL B CB    1 
ATOM   2717  C  CG1   . VAL B 1  140  ? 9.503   -7.231  62.162   1.00 149.91 ? 140  VAL B CG1   1 
ATOM   2718  C  CG2   . VAL B 1  140  ? 9.577   -9.570  63.042   1.00 158.83 ? 140  VAL B CG2   1 
ATOM   2719  N  N     . GLU B 1  141  ? 12.696  -6.507  61.309   1.00 163.93 ? 141  GLU B N     1 
ATOM   2720  C  CA    . GLU B 1  141  ? 13.221  -5.162  61.080   1.00 158.61 ? 141  GLU B CA    1 
ATOM   2721  C  C     . GLU B 1  141  ? 12.265  -4.322  60.235   1.00 142.91 ? 141  GLU B C     1 
ATOM   2722  O  O     . GLU B 1  141  ? 11.167  -4.761  59.900   1.00 141.57 ? 141  GLU B O     1 
ATOM   2723  C  CB    . GLU B 1  141  ? 14.590  -5.223  60.396   1.00 161.24 ? 141  GLU B CB    1 
ATOM   2724  C  CG    . GLU B 1  141  ? 15.687  -5.891  61.211   1.00 171.57 ? 141  GLU B CG    1 
ATOM   2725  C  CD    . GLU B 1  141  ? 17.044  -5.810  60.531   1.00 186.05 ? 141  GLU B CD    1 
ATOM   2726  O  OE1   . GLU B 1  141  ? 17.222  -4.928  59.662   1.00 189.34 ? 141  GLU B OE1   1 
ATOM   2727  O  OE2   . GLU B 1  141  ? 17.928  -6.632  60.858   1.00 192.71 ? 141  GLU B OE2   1 
ATOM   2728  N  N     . ARG B 1  142  ? 12.690  -3.108  59.900   1.00 136.27 ? 142  ARG B N     1 
ATOM   2729  C  CA    . ARG B 1  142  ? 11.936  -2.254  58.992   1.00 126.00 ? 142  ARG B CA    1 
ATOM   2730  C  C     . ARG B 1  142  ? 12.796  -1.861  57.797   1.00 120.64 ? 142  ARG B C     1 
ATOM   2731  O  O     . ARG B 1  142  ? 14.023  -1.952  57.846   1.00 122.65 ? 142  ARG B O     1 
ATOM   2732  C  CB    . ARG B 1  142  ? 11.429  -1.002  59.712   1.00 126.95 ? 142  ARG B CB    1 
ATOM   2733  C  CG    . ARG B 1  142  ? 10.317  -1.263  60.712   1.00 129.57 ? 142  ARG B CG    1 
ATOM   2734  C  CD    . ARG B 1  142  ? 9.795   0.036   61.303   1.00 130.74 ? 142  ARG B CD    1 
ATOM   2735  N  NE    . ARG B 1  142  ? 9.558   1.044   60.275   1.00 123.87 ? 142  ARG B NE    1 
ATOM   2736  C  CZ    . ARG B 1  142  ? 8.422   1.165   59.596   1.00 123.55 ? 142  ARG B CZ    1 
ATOM   2737  N  NH1   . ARG B 1  142  ? 7.414   0.338   59.833   1.00 135.79 ? 142  ARG B NH1   1 
ATOM   2738  N  NH2   . ARG B 1  142  ? 8.295   2.112   58.678   1.00 118.20 ? 142  ARG B NH2   1 
ATOM   2739  N  N     . GLY B 1  143  ? 12.147  -1.424  56.725   1.00 116.63 ? 143  GLY B N     1 
ATOM   2740  C  CA    . GLY B 1  143  ? 12.854  -1.029  55.522   1.00 118.01 ? 143  GLY B CA    1 
ATOM   2741  C  C     . GLY B 1  143  ? 11.957  -0.992  54.300   1.00 120.55 ? 143  GLY B C     1 
ATOM   2742  O  O     . GLY B 1  143  ? 10.731  -0.931  54.416   1.00 117.12 ? 143  GLY B O     1 
ATOM   2743  N  N     . ARG B 1  144  ? 12.574  -1.030  53.122   1.00 117.82 ? 144  ARG B N     1 
ATOM   2744  C  CA    . ARG B 1  144  ? 11.840  -0.967  51.860   1.00 110.86 ? 144  ARG B CA    1 
ATOM   2745  C  C     . ARG B 1  144  ? 12.374  -1.982  50.851   1.00 110.04 ? 144  ARG B C     1 
ATOM   2746  O  O     . ARG B 1  144  ? 13.554  -2.329  50.868   1.00 107.44 ? 144  ARG B O     1 
ATOM   2747  C  CB    . ARG B 1  144  ? 11.919  0.442   51.263   1.00 104.80 ? 144  ARG B CB    1 
ATOM   2748  C  CG    . ARG B 1  144  ? 11.592  1.559   52.240   1.00 100.56 ? 144  ARG B CG    1 
ATOM   2749  C  CD    . ARG B 1  144  ? 12.239  2.866   51.820   1.00 101.42 ? 144  ARG B CD    1 
ATOM   2750  N  NE    . ARG B 1  144  ? 12.295  3.818   52.924   1.00 102.77 ? 144  ARG B NE    1 
ATOM   2751  C  CZ    . ARG B 1  144  ? 11.380  4.753   53.150   1.00 104.06 ? 144  ARG B CZ    1 
ATOM   2752  N  NH1   . ARG B 1  144  ? 10.336  4.871   52.342   1.00 103.01 ? 144  ARG B NH1   1 
ATOM   2753  N  NH2   . ARG B 1  144  ? 11.510  5.574   54.182   1.00 108.45 ? 144  ARG B NH2   1 
ATOM   2754  N  N     . GLY B 1  145  ? 11.497  -2.460  49.976   1.00 104.44 ? 145  GLY B N     1 
ATOM   2755  C  CA    . GLY B 1  145  ? 11.907  -3.314  48.877   1.00 100.46 ? 145  GLY B CA    1 
ATOM   2756  C  C     . GLY B 1  145  ? 12.316  -4.725  49.253   1.00 98.43  ? 145  GLY B C     1 
ATOM   2757  O  O     . GLY B 1  145  ? 11.714  -5.344  50.128   1.00 106.21 ? 145  GLY B O     1 
ATOM   2758  N  N     . TYR B 1  146  ? 13.346  -5.230  48.581   1.00 87.41  ? 146  TYR B N     1 
ATOM   2759  C  CA    . TYR B 1  146  ? 13.773  -6.615  48.737   1.00 88.88  ? 146  TYR B CA    1 
ATOM   2760  C  C     . TYR B 1  146  ? 15.256  -6.688  49.077   1.00 93.84  ? 146  TYR B C     1 
ATOM   2761  O  O     . TYR B 1  146  ? 16.067  -5.966  48.499   1.00 95.50  ? 146  TYR B O     1 
ATOM   2762  C  CB    . TYR B 1  146  ? 13.477  -7.401  47.456   1.00 93.34  ? 146  TYR B CB    1 
ATOM   2763  C  CG    . TYR B 1  146  ? 13.924  -8.850  47.477   1.00 99.67  ? 146  TYR B CG    1 
ATOM   2764  C  CD1   . TYR B 1  146  ? 15.167  -9.224  46.977   1.00 100.78 ? 146  TYR B CD1   1 
ATOM   2765  C  CD2   . TYR B 1  146  ? 13.097  -9.848  47.982   1.00 101.96 ? 146  TYR B CD2   1 
ATOM   2766  C  CE1   . TYR B 1  146  ? 15.577  -10.550 46.990   1.00 98.11  ? 146  TYR B CE1   1 
ATOM   2767  C  CE2   . TYR B 1  146  ? 13.499  -11.177 47.998   1.00 98.10  ? 146  TYR B CE2   1 
ATOM   2768  C  CZ    . TYR B 1  146  ? 14.738  -11.519 47.501   1.00 92.81  ? 146  TYR B CZ    1 
ATOM   2769  O  OH    . TYR B 1  146  ? 15.142  -12.833 47.515   1.00 83.44  ? 146  TYR B OH    1 
ATOM   2770  N  N     . VAL B 1  147  ? 15.604  -7.560  50.020   1.00 97.28  ? 147  VAL B N     1 
ATOM   2771  C  CA    . VAL B 1  147  ? 16.994  -7.731  50.436   1.00 99.41  ? 147  VAL B CA    1 
ATOM   2772  C  C     . VAL B 1  147  ? 17.411  -9.204  50.469   1.00 101.42 ? 147  VAL B C     1 
ATOM   2773  O  O     . VAL B 1  147  ? 16.766  -10.020 51.129   1.00 106.83 ? 147  VAL B O     1 
ATOM   2774  C  CB    . VAL B 1  147  ? 17.240  -7.111  51.827   1.00 104.28 ? 147  VAL B CB    1 
ATOM   2775  C  CG1   . VAL B 1  147  ? 18.620  -7.492  52.345   1.00 114.04 ? 147  VAL B CG1   1 
ATOM   2776  C  CG2   . VAL B 1  147  ? 17.083  -5.601  51.771   1.00 102.16 ? 147  VAL B CG2   1 
ATOM   2777  N  N     . PRO B 1  148  ? 18.496  -9.544  49.752   1.00 98.64  ? 148  PRO B N     1 
ATOM   2778  C  CA    . PRO B 1  148  ? 19.067  -10.898 49.706   1.00 104.72 ? 148  PRO B CA    1 
ATOM   2779  C  C     . PRO B 1  148  ? 19.434  -11.437 51.088   1.00 117.16 ? 148  PRO B C     1 
ATOM   2780  O  O     . PRO B 1  148  ? 19.454  -10.680 52.058   1.00 120.82 ? 148  PRO B O     1 
ATOM   2781  C  CB    . PRO B 1  148  ? 20.320  -10.720 48.845   1.00 98.54  ? 148  PRO B CB    1 
ATOM   2782  C  CG    . PRO B 1  148  ? 20.019  -9.548  47.991   1.00 95.06  ? 148  PRO B CG    1 
ATOM   2783  C  CD    . PRO B 1  148  ? 19.202  -8.624  48.845   1.00 102.39 ? 148  PRO B CD    1 
ATOM   2784  N  N     . ALA B 1  149  ? 19.731  -12.732 51.166   1.00 131.95 ? 149  ALA B N     1 
ATOM   2785  C  CA    . ALA B 1  149  ? 19.984  -13.393 52.444   1.00 145.22 ? 149  ALA B CA    1 
ATOM   2786  C  C     . ALA B 1  149  ? 21.445  -13.298 52.895   1.00 153.72 ? 149  ALA B C     1 
ATOM   2787  O  O     . ALA B 1  149  ? 21.728  -13.304 54.092   1.00 154.54 ? 149  ALA B O     1 
ATOM   2788  C  CB    . ALA B 1  149  ? 19.555  -14.855 52.366   1.00 143.31 ? 149  ALA B CB    1 
ATOM   2789  N  N     . VAL B 1  150  ? 22.369  -13.207 51.941   1.00 156.83 ? 150  VAL B N     1 
ATOM   2790  C  CA    . VAL B 1  150  ? 23.798  -13.150 52.256   1.00 157.81 ? 150  VAL B CA    1 
ATOM   2791  C  C     . VAL B 1  150  ? 24.141  -11.870 53.019   1.00 156.18 ? 150  VAL B C     1 
ATOM   2792  O  O     . VAL B 1  150  ? 25.128  -11.814 53.756   1.00 152.81 ? 150  VAL B O     1 
ATOM   2793  C  CB    . VAL B 1  150  ? 24.661  -13.231 50.976   1.00 160.54 ? 150  VAL B CB    1 
ATOM   2794  C  CG1   . VAL B 1  150  ? 26.130  -13.448 51.324   1.00 155.16 ? 150  VAL B CG1   1 
ATOM   2795  C  CG2   . VAL B 1  150  ? 24.166  -14.352 50.076   1.00 166.67 ? 150  VAL B CG2   1 
ATOM   2796  N  N     . GLN B 1  151  ? 23.310  -10.849 52.841   1.00 157.98 ? 151  GLN B N     1 
ATOM   2797  C  CA    . GLN B 1  151  ? 23.491  -9.576  53.528   1.00 164.19 ? 151  GLN B CA    1 
ATOM   2798  C  C     . GLN B 1  151  ? 22.908  -9.617  54.941   1.00 168.79 ? 151  GLN B C     1 
ATOM   2799  O  O     . GLN B 1  151  ? 23.035  -8.656  55.700   1.00 175.99 ? 151  GLN B O     1 
ATOM   2800  C  CB    . GLN B 1  151  ? 22.853  -8.438  52.727   1.00 157.92 ? 151  GLN B CB    1 
ATOM   2801  C  CG    . GLN B 1  151  ? 23.397  -8.283  51.311   1.00 152.85 ? 151  GLN B CG    1 
ATOM   2802  C  CD    . GLN B 1  151  ? 23.067  -6.931  50.707   1.00 148.34 ? 151  GLN B CD    1 
ATOM   2803  O  OE1   . GLN B 1  151  ? 22.562  -6.042  51.392   1.00 145.89 ? 151  GLN B OE1   1 
ATOM   2804  N  NE2   . GLN B 1  151  ? 23.355  -6.769  49.421   1.00 154.53 ? 151  GLN B NE2   1 
ATOM   2805  N  N     . ASN B 1  152  ? 22.264  -10.728 55.287   1.00 162.58 ? 152  ASN B N     1 
ATOM   2806  C  CA    . ASN B 1  152  ? 21.739  -10.920 56.635   1.00 163.21 ? 152  ASN B CA    1 
ATOM   2807  C  C     . ASN B 1  152  ? 22.368  -12.137 57.315   1.00 164.53 ? 152  ASN B C     1 
ATOM   2808  O  O     . ASN B 1  152  ? 21.737  -12.783 58.151   1.00 166.47 ? 152  ASN B O     1 
ATOM   2809  C  CB    . ASN B 1  152  ? 20.214  -11.071 56.607   1.00 156.54 ? 152  ASN B CB    1 
ATOM   2810  C  CG    . ASN B 1  152  ? 19.514  -9.870  55.990   1.00 155.27 ? 152  ASN B CG    1 
ATOM   2811  O  OD1   . ASN B 1  152  ? 19.431  -8.802  56.599   1.00 157.92 ? 152  ASN B OD1   1 
ATOM   2812  N  ND2   . ASN B 1  152  ? 18.991  -10.046 54.782   1.00 147.90 ? 152  ASN B ND2   1 
ATOM   2813  N  N     . ARG B 1  153  ? 23.614  -12.438 56.957   1.00 164.20 ? 153  ARG B N     1 
ATOM   2814  C  CA    . ARG B 1  153  ? 24.301  -13.623 57.470   1.00 165.50 ? 153  ARG B CA    1 
ATOM   2815  C  C     . ARG B 1  153  ? 25.023  -13.363 58.792   1.00 167.21 ? 153  ARG B C     1 
ATOM   2816  O  O     . ARG B 1  153  ? 25.818  -14.187 59.249   1.00 163.06 ? 153  ARG B O     1 
ATOM   2817  C  CB    . ARG B 1  153  ? 25.304  -14.141 56.440   1.00 158.85 ? 153  ARG B CB    1 
ATOM   2818  C  CG    . ARG B 1  153  ? 26.559  -13.294 56.326   1.00 156.48 ? 153  ARG B CG    1 
ATOM   2819  C  CD    . ARG B 1  153  ? 27.526  -13.877 55.314   1.00 154.63 ? 153  ARG B CD    1 
ATOM   2820  N  NE    . ARG B 1  153  ? 28.842  -13.253 55.400   1.00 157.58 ? 153  ARG B NE    1 
ATOM   2821  C  CZ    . ARG B 1  153  ? 29.887  -13.618 54.665   1.00 149.21 ? 153  ARG B CZ    1 
ATOM   2822  N  NH1   . ARG B 1  153  ? 31.052  -12.997 54.808   1.00 146.48 ? 153  ARG B NH1   1 
ATOM   2823  N  NH2   . ARG B 1  153  ? 29.767  -14.604 53.787   1.00 138.61 ? 153  ARG B NH2   1 
ATOM   2824  N  N     . ALA B 1  154  ? 24.752  -12.214 59.401   1.00 167.64 ? 154  ALA B N     1 
ATOM   2825  C  CA    . ALA B 1  154  ? 25.358  -11.871 60.681   1.00 162.82 ? 154  ALA B CA    1 
ATOM   2826  C  C     . ALA B 1  154  ? 24.380  -11.073 61.537   1.00 168.55 ? 154  ALA B C     1 
ATOM   2827  O  O     . ALA B 1  154  ? 24.688  -9.966  61.980   1.00 168.79 ? 154  ALA B O     1 
ATOM   2828  C  CB    . ALA B 1  154  ? 26.646  -11.090 60.469   1.00 148.11 ? 154  ALA B CB    1 
ATOM   2829  N  N     . SER B 1  155  ? 23.202  -11.648 61.765   1.00 172.84 ? 155  SER B N     1 
ATOM   2830  C  CA    . SER B 1  155  ? 22.146  -10.981 62.521   1.00 174.06 ? 155  SER B CA    1 
ATOM   2831  C  C     . SER B 1  155  ? 21.456  -11.918 63.514   1.00 173.74 ? 155  SER B C     1 
ATOM   2832  O  O     . SER B 1  155  ? 20.293  -11.715 63.865   1.00 170.44 ? 155  SER B O     1 
ATOM   2833  C  CB    . SER B 1  155  ? 21.109  -10.386 61.566   1.00 173.04 ? 155  SER B CB    1 
ATOM   2834  O  OG    . SER B 1  155  ? 20.595  -11.375 60.691   1.00 169.93 ? 155  SER B OG    1 
ATOM   2835  N  N     . GLU B 1  158  ? 25.217  -17.422 66.611   1.00 156.63 ? 158  GLU B N     1 
ATOM   2836  C  CA    . GLU B 1  158  ? 25.832  -18.424 65.743   1.00 154.44 ? 158  GLU B CA    1 
ATOM   2837  C  C     . GLU B 1  158  ? 25.676  -19.848 66.285   1.00 164.59 ? 158  GLU B C     1 
ATOM   2838  O  O     . GLU B 1  158  ? 26.576  -20.679 66.154   1.00 158.72 ? 158  GLU B O     1 
ATOM   2839  C  CB    . GLU B 1  158  ? 27.314  -18.094 65.540   1.00 140.07 ? 158  GLU B CB    1 
ATOM   2840  C  CG    . GLU B 1  158  ? 27.908  -18.594 64.229   1.00 131.46 ? 158  GLU B CG    1 
ATOM   2841  C  CD    . GLU B 1  158  ? 29.268  -17.985 63.941   1.00 124.03 ? 158  GLU B CD    1 
ATOM   2842  O  OE1   . GLU B 1  158  ? 29.559  -16.899 64.487   1.00 112.36 ? 158  GLU B OE1   1 
ATOM   2843  O  OE2   . GLU B 1  158  ? 30.046  -18.590 63.173   1.00 128.34 ? 158  GLU B OE2   1 
ATOM   2844  N  N     . ILE B 1  159  ? 24.525  -20.120 66.893   1.00 176.09 ? 159  ILE B N     1 
ATOM   2845  C  CA    . ILE B 1  159  ? 24.185  -21.458 67.360   1.00 184.69 ? 159  ILE B CA    1 
ATOM   2846  C  C     . ILE B 1  159  ? 22.909  -21.918 66.653   1.00 184.47 ? 159  ILE B C     1 
ATOM   2847  O  O     . ILE B 1  159  ? 22.090  -22.644 67.219   1.00 184.56 ? 159  ILE B O     1 
ATOM   2848  C  CB    . ILE B 1  159  ? 23.987  -21.502 68.894   1.00 189.54 ? 159  ILE B CB    1 
ATOM   2849  C  CG1   . ILE B 1  159  ? 24.884  -20.471 69.584   1.00 184.99 ? 159  ILE B CG1   1 
ATOM   2850  C  CG2   . ILE B 1  159  ? 24.264  -22.901 69.439   1.00 183.37 ? 159  ILE B CG2   1 
ATOM   2851  C  CD1   . ILE B 1  159  ? 24.770  -20.475 71.095   1.00 180.63 ? 159  ILE B CD1   1 
ATOM   2852  N  N     . GLY B 1  160  ? 22.744  -21.475 65.409   1.00 179.60 ? 160  GLY B N     1 
ATOM   2853  C  CA    . GLY B 1  160  ? 21.579  -21.828 64.618   1.00 172.04 ? 160  GLY B CA    1 
ATOM   2854  C  C     . GLY B 1  160  ? 20.852  -20.627 64.042   1.00 167.42 ? 160  GLY B C     1 
ATOM   2855  O  O     . GLY B 1  160  ? 19.623  -20.614 63.971   1.00 167.39 ? 160  GLY B O     1 
ATOM   2856  N  N     . ARG B 1  161  ? 21.608  -19.614 63.629   1.00 168.22 ? 161  ARG B N     1 
ATOM   2857  C  CA    . ARG B 1  161  ? 21.022  -18.426 63.013   1.00 166.80 ? 161  ARG B CA    1 
ATOM   2858  C  C     . ARG B 1  161  ? 20.902  -18.596 61.502   1.00 164.02 ? 161  ARG B C     1 
ATOM   2859  O  O     . ARG B 1  161  ? 21.866  -18.966 60.832   1.00 164.33 ? 161  ARG B O     1 
ATOM   2860  C  CB    . ARG B 1  161  ? 21.853  -17.183 63.334   1.00 166.81 ? 161  ARG B CB    1 
ATOM   2861  N  N     . ILE B 1  162  ? 19.718  -18.318 60.969   1.00 161.74 ? 162  ILE B N     1 
ATOM   2862  C  CA    . ILE B 1  162  ? 19.471  -18.484 59.542   1.00 157.52 ? 162  ILE B CA    1 
ATOM   2863  C  C     . ILE B 1  162  ? 19.071  -17.166 58.886   1.00 148.17 ? 162  ILE B C     1 
ATOM   2864  O  O     . ILE B 1  162  ? 18.102  -16.528 59.301   1.00 143.99 ? 162  ILE B O     1 
ATOM   2865  C  CB    . ILE B 1  162  ? 18.373  -19.534 59.281   1.00 162.49 ? 162  ILE B CB    1 
ATOM   2866  C  CG1   . ILE B 1  162  ? 18.698  -20.837 60.015   1.00 164.80 ? 162  ILE B CG1   1 
ATOM   2867  C  CG2   . ILE B 1  162  ? 18.218  -19.784 57.789   1.00 159.47 ? 162  ILE B CG2   1 
ATOM   2868  C  CD1   . ILE B 1  162  ? 17.627  -21.898 59.887   1.00 171.55 ? 162  ILE B CD1   1 
ATOM   2869  N  N     . PRO B 1  163  ? 19.828  -16.751 57.859   1.00 144.78 ? 163  PRO B N     1 
ATOM   2870  C  CA    . PRO B 1  163  ? 19.524  -15.538 57.095   1.00 141.95 ? 163  PRO B CA    1 
ATOM   2871  C  C     . PRO B 1  163  ? 18.355  -15.739 56.132   1.00 135.31 ? 163  PRO B C     1 
ATOM   2872  O  O     . PRO B 1  163  ? 18.334  -16.707 55.372   1.00 132.40 ? 163  PRO B O     1 
ATOM   2873  C  CB    . PRO B 1  163  ? 20.824  -15.271 56.337   1.00 146.42 ? 163  PRO B CB    1 
ATOM   2874  C  CG    . PRO B 1  163  ? 21.448  -16.606 56.186   1.00 148.04 ? 163  PRO B CG    1 
ATOM   2875  C  CD    . PRO B 1  163  ? 21.082  -17.385 57.416   1.00 147.82 ? 163  PRO B CD    1 
ATOM   2876  N  N     . VAL B 1  164  ? 17.392  -14.823 56.167   1.00 129.86 ? 164  VAL B N     1 
ATOM   2877  C  CA    . VAL B 1  164  ? 16.178  -14.961 55.370   1.00 127.29 ? 164  VAL B CA    1 
ATOM   2878  C  C     . VAL B 1  164  ? 16.031  -13.822 54.362   1.00 128.19 ? 164  VAL B C     1 
ATOM   2879  O  O     . VAL B 1  164  ? 16.473  -12.701 54.613   1.00 129.35 ? 164  VAL B O     1 
ATOM   2880  C  CB    . VAL B 1  164  ? 14.926  -15.004 56.272   1.00 133.56 ? 164  VAL B CB    1 
ATOM   2881  C  CG1   . VAL B 1  164  ? 13.721  -15.520 55.499   1.00 128.47 ? 164  VAL B CG1   1 
ATOM   2882  C  CG2   . VAL B 1  164  ? 15.183  -15.876 57.493   1.00 149.05 ? 164  VAL B CG2   1 
ATOM   2883  N  N     . ASP B 1  165  ? 15.416  -14.119 53.220   1.00 126.66 ? 165  ASP B N     1 
ATOM   2884  C  CA    . ASP B 1  165  ? 15.104  -13.101 52.223   1.00 121.13 ? 165  ASP B CA    1 
ATOM   2885  C  C     . ASP B 1  165  ? 14.092  -12.103 52.781   1.00 117.32 ? 165  ASP B C     1 
ATOM   2886  O  O     . ASP B 1  165  ? 12.937  -12.452 53.026   1.00 115.82 ? 165  ASP B O     1 
ATOM   2887  C  CB    . ASP B 1  165  ? 14.559  -13.744 50.944   1.00 118.85 ? 165  ASP B CB    1 
ATOM   2888  C  CG    . ASP B 1  165  ? 15.553  -14.692 50.297   1.00 125.34 ? 165  ASP B CG    1 
ATOM   2889  O  OD1   . ASP B 1  165  ? 16.767  -14.403 50.337   1.00 132.19 ? 165  ASP B OD1   1 
ATOM   2890  O  OD2   . ASP B 1  165  ? 15.120  -15.727 49.747   1.00 119.11 ? 165  ASP B OD2   1 
ATOM   2891  N  N     . SER B 1  166  ? 14.531  -10.865 52.982   1.00 116.63 ? 166  SER B N     1 
ATOM   2892  C  CA    . SER B 1  166  ? 13.679  -9.833  53.565   1.00 119.34 ? 166  SER B CA    1 
ATOM   2893  C  C     . SER B 1  166  ? 12.842  -9.126  52.503   1.00 115.42 ? 166  SER B C     1 
ATOM   2894  O  O     . SER B 1  166  ? 13.379  -8.450  51.625   1.00 112.48 ? 166  SER B O     1 
ATOM   2895  C  CB    . SER B 1  166  ? 14.523  -8.808  54.328   1.00 126.19 ? 166  SER B CB    1 
ATOM   2896  O  OG    . SER B 1  166  ? 15.300  -9.423  55.341   1.00 139.81 ? 166  SER B OG    1 
ATOM   2897  N  N     . ILE B 1  167  ? 11.524  -9.281  52.590   1.00 110.17 ? 167  ILE B N     1 
ATOM   2898  C  CA    . ILE B 1  167  ? 10.615  -8.606  51.672   1.00 105.41 ? 167  ILE B CA    1 
ATOM   2899  C  C     . ILE B 1  167  ? 9.860   -7.501  52.400   1.00 101.20 ? 167  ILE B C     1 
ATOM   2900  O  O     . ILE B 1  167  ? 8.680   -7.645  52.724   1.00 97.50  ? 167  ILE B O     1 
ATOM   2901  C  CB    . ILE B 1  167  ? 9.612   -9.585  51.043   1.00 108.52 ? 167  ILE B CB    1 
ATOM   2902  C  CG1   . ILE B 1  167  ? 10.313  -10.891 50.662   1.00 108.92 ? 167  ILE B CG1   1 
ATOM   2903  C  CG2   . ILE B 1  167  ? 8.944   -8.952  49.832   1.00 109.89 ? 167  ILE B CG2   1 
ATOM   2904  C  CD1   . ILE B 1  167  ? 9.393   -11.922 50.053   1.00 108.95 ? 167  ILE B CD1   1 
ATOM   2905  N  N     . TYR B 1  168  ? 10.558  -6.399  52.656   1.00 109.85 ? 168  TYR B N     1 
ATOM   2906  C  CA    . TYR B 1  168  ? 10.013  -5.289  53.430   1.00 114.59 ? 168  TYR B CA    1 
ATOM   2907  C  C     . TYR B 1  168  ? 8.784   -4.668  52.772   1.00 108.95 ? 168  TYR B C     1 
ATOM   2908  O  O     . TYR B 1  168  ? 7.817   -4.320  53.450   1.00 111.68 ? 168  TYR B O     1 
ATOM   2909  C  CB    . TYR B 1  168  ? 11.075  -4.203  53.634   1.00 127.29 ? 168  TYR B CB    1 
ATOM   2910  C  CG    . TYR B 1  168  ? 12.324  -4.638  54.378   1.00 125.59 ? 168  TYR B CG    1 
ATOM   2911  C  CD1   . TYR B 1  168  ? 12.324  -4.781  55.761   1.00 129.12 ? 168  TYR B CD1   1 
ATOM   2912  C  CD2   . TYR B 1  168  ? 13.513  -4.874  53.697   1.00 120.43 ? 168  TYR B CD2   1 
ATOM   2913  C  CE1   . TYR B 1  168  ? 13.468  -5.167  56.442   1.00 127.84 ? 168  TYR B CE1   1 
ATOM   2914  C  CE2   . TYR B 1  168  ? 14.660  -5.258  54.369   1.00 116.95 ? 168  TYR B CE2   1 
ATOM   2915  C  CZ    . TYR B 1  168  ? 14.633  -5.404  55.740   1.00 122.04 ? 168  TYR B CZ    1 
ATOM   2916  O  OH    . TYR B 1  168  ? 15.773  -5.788  56.410   1.00 124.91 ? 168  TYR B OH    1 
ATOM   2917  N  N     . SER B 1  169  ? 8.831   -4.535  51.451   1.00 105.95 ? 169  SER B N     1 
ATOM   2918  C  CA    . SER B 1  169  ? 7.826   -3.783  50.704   1.00 102.33 ? 169  SER B CA    1 
ATOM   2919  C  C     . SER B 1  169  ? 6.404   -4.303  50.912   1.00 103.39 ? 169  SER B C     1 
ATOM   2920  O  O     . SER B 1  169  ? 6.173   -5.507  50.878   1.00 101.74 ? 169  SER B O     1 
ATOM   2921  C  CB    . SER B 1  169  ? 8.164   -3.799  49.213   1.00 102.98 ? 169  SER B CB    1 
ATOM   2922  O  OG    . SER B 1  169  ? 7.254   -2.999  48.481   1.00 108.46 ? 169  SER B OG    1 
ATOM   2923  N  N     . PRO B 1  170  ? 5.449   -3.384  51.136   1.00 108.88 ? 170  PRO B N     1 
ATOM   2924  C  CA    . PRO B 1  170  ? 4.031   -3.699  51.344   1.00 112.56 ? 170  PRO B CA    1 
ATOM   2925  C  C     . PRO B 1  170  ? 3.241   -3.779  50.040   1.00 110.58 ? 170  PRO B C     1 
ATOM   2926  O  O     . PRO B 1  170  ? 2.014   -3.897  50.070   1.00 111.30 ? 170  PRO B O     1 
ATOM   2927  C  CB    . PRO B 1  170  ? 3.545   -2.531  52.201   1.00 112.20 ? 170  PRO B CB    1 
ATOM   2928  C  CG    . PRO B 1  170  ? 4.368   -1.390  51.732   1.00 110.08 ? 170  PRO B CG    1 
ATOM   2929  C  CD    . PRO B 1  170  ? 5.720   -1.952  51.352   1.00 110.81 ? 170  PRO B CD    1 
ATOM   2930  N  N     . VAL B 1  171  ? 3.941   -3.702  48.913   1.00 106.59 ? 171  VAL B N     1 
ATOM   2931  C  CA    . VAL B 1  171  ? 3.323   -3.879  47.604   1.00 105.26 ? 171  VAL B CA    1 
ATOM   2932  C  C     . VAL B 1  171  ? 3.975   -5.075  46.908   1.00 98.45  ? 171  VAL B C     1 
ATOM   2933  O  O     . VAL B 1  171  ? 5.198   -5.152  46.806   1.00 103.59 ? 171  VAL B O     1 
ATOM   2934  C  CB    . VAL B 1  171  ? 3.451   -2.611  46.733   1.00 102.75 ? 171  VAL B CB    1 
ATOM   2935  C  CG1   . VAL B 1  171  ? 2.685   -2.782  45.431   1.00 109.17 ? 171  VAL B CG1   1 
ATOM   2936  C  CG2   . VAL B 1  171  ? 2.943   -1.385  47.493   1.00 96.09  ? 171  VAL B CG2   1 
ATOM   2937  N  N     . LEU B 1  172  ? 3.154   -6.006  46.433   1.00 93.21  ? 172  LEU B N     1 
ATOM   2938  C  CA    . LEU B 1  172  ? 3.642   -7.306  45.984   1.00 85.86  ? 172  LEU B CA    1 
ATOM   2939  C  C     . LEU B 1  172  ? 4.096   -7.336  44.524   1.00 82.08  ? 172  LEU B C     1 
ATOM   2940  O  O     . LEU B 1  172  ? 5.260   -7.623  44.244   1.00 76.32  ? 172  LEU B O     1 
ATOM   2941  C  CB    . LEU B 1  172  ? 2.562   -8.361  46.220   1.00 89.94  ? 172  LEU B CB    1 
ATOM   2942  C  CG    . LEU B 1  172  ? 2.311   -8.620  47.707   1.00 96.63  ? 172  LEU B CG    1 
ATOM   2943  C  CD1   . LEU B 1  172  ? 1.118   -9.539  47.927   1.00 110.11 ? 172  LEU B CD1   1 
ATOM   2944  C  CD2   . LEU B 1  172  ? 3.560   -9.203  48.339   1.00 94.68  ? 172  LEU B CD2   1 
ATOM   2945  N  N     . LYS B 1  173  ? 3.188   -7.050  43.596   1.00 85.45  ? 173  LYS B N     1 
ATOM   2946  C  CA    . LYS B 1  173  ? 3.534   -7.084  42.175   1.00 88.82  ? 173  LYS B CA    1 
ATOM   2947  C  C     . LYS B 1  173  ? 2.699   -6.099  41.347   1.00 93.86  ? 173  LYS B C     1 
ATOM   2948  O  O     . LYS B 1  173  ? 1.485   -5.982  41.530   1.00 91.30  ? 173  LYS B O     1 
ATOM   2949  C  CB    . LYS B 1  173  ? 3.378   -8.504  41.624   1.00 95.54  ? 173  LYS B CB    1 
ATOM   2950  C  CG    . LYS B 1  173  ? 3.780   -8.649  40.165   1.00 97.18  ? 173  LYS B CG    1 
ATOM   2951  C  CD    . LYS B 1  173  ? 5.134   -8.009  39.902   1.00 94.16  ? 173  LYS B CD    1 
ATOM   2952  C  CE    . LYS B 1  173  ? 5.281   -7.616  38.439   1.00 99.66  ? 173  LYS B CE    1 
ATOM   2953  N  NZ    . LYS B 1  173  ? 6.350   -6.593  38.244   1.00 90.15  ? 173  LYS B NZ    1 
ATOM   2954  N  N     . VAL B 1  174  ? 3.369   -5.403  40.430   1.00 95.79  ? 174  VAL B N     1 
ATOM   2955  C  CA    . VAL B 1  174  ? 2.763   -4.326  39.651   1.00 91.62  ? 174  VAL B CA    1 
ATOM   2956  C  C     . VAL B 1  174  ? 3.092   -4.423  38.155   1.00 82.05  ? 174  VAL B C     1 
ATOM   2957  O  O     . VAL B 1  174  ? 4.247   -4.613  37.773   1.00 80.18  ? 174  VAL B O     1 
ATOM   2958  C  CB    . VAL B 1  174  ? 3.222   -2.943  40.183   1.00 97.73  ? 174  VAL B CB    1 
ATOM   2959  C  CG1   . VAL B 1  174  ? 2.797   -1.829  39.251   1.00 92.97  ? 174  VAL B CG1   1 
ATOM   2960  C  CG2   . VAL B 1  174  ? 2.678   -2.697  41.584   1.00 100.80 ? 174  VAL B CG2   1 
ATOM   2961  N  N     . THR B 1  175  ? 2.067   -4.294  37.314   1.00 79.20  ? 175  THR B N     1 
ATOM   2962  C  CA    . THR B 1  175  ? 2.244   -4.284  35.862   1.00 73.94  ? 175  THR B CA    1 
ATOM   2963  C  C     . THR B 1  175  ? 1.502   -3.111  35.215   1.00 74.00  ? 175  THR B C     1 
ATOM   2964  O  O     . THR B 1  175  ? 0.462   -2.677  35.713   1.00 75.85  ? 175  THR B O     1 
ATOM   2965  C  CB    . THR B 1  175  ? 1.759   -5.597  35.228   1.00 75.46  ? 175  THR B CB    1 
ATOM   2966  O  OG1   . THR B 1  175  ? 0.399   -5.842  35.608   1.00 85.00  ? 175  THR B OG1   1 
ATOM   2967  C  CG2   . THR B 1  175  ? 2.623   -6.761  35.688   1.00 77.07  ? 175  THR B CG2   1 
ATOM   2968  N  N     . TYR B 1  176  ? 2.033   -2.607  34.103   1.00 73.36  ? 176  TYR B N     1 
ATOM   2969  C  CA    . TYR B 1  176  ? 1.456   -1.438  33.438   1.00 69.71  ? 176  TYR B CA    1 
ATOM   2970  C  C     . TYR B 1  176  ? 1.425   -1.581  31.919   1.00 69.63  ? 176  TYR B C     1 
ATOM   2971  O  O     . TYR B 1  176  ? 2.356   -2.113  31.318   1.00 69.77  ? 176  TYR B O     1 
ATOM   2972  C  CB    . TYR B 1  176  ? 2.236   -0.175  33.813   1.00 71.88  ? 176  TYR B CB    1 
ATOM   2973  C  CG    . TYR B 1  176  ? 3.637   -0.104  33.237   1.00 81.07  ? 176  TYR B CG    1 
ATOM   2974  C  CD1   . TYR B 1  176  ? 3.948   0.795   32.222   1.00 83.05  ? 176  TYR B CD1   1 
ATOM   2975  C  CD2   . TYR B 1  176  ? 4.650   -0.931  33.712   1.00 87.89  ? 176  TYR B CD2   1 
ATOM   2976  C  CE1   . TYR B 1  176  ? 5.228   0.869   31.694   1.00 85.69  ? 176  TYR B CE1   1 
ATOM   2977  C  CE2   . TYR B 1  176  ? 5.932   -0.867  33.190   1.00 86.61  ? 176  TYR B CE2   1 
ATOM   2978  C  CZ    . TYR B 1  176  ? 6.216   0.035   32.182   1.00 86.37  ? 176  TYR B CZ    1 
ATOM   2979  O  OH    . TYR B 1  176  ? 7.489   0.100   31.662   1.00 78.46  ? 176  TYR B OH    1 
ATOM   2980  N  N     . LYS B 1  177  ? 0.346   -1.103  31.306   1.00 68.98  ? 177  LYS B N     1 
ATOM   2981  C  CA    . LYS B 1  177  ? 0.233   -1.084  29.851   1.00 69.51  ? 177  LYS B CA    1 
ATOM   2982  C  C     . LYS B 1  177  ? -0.202  0.296   29.379   1.00 68.57  ? 177  LYS B C     1 
ATOM   2983  O  O     . LYS B 1  177  ? -0.956  0.981   30.067   1.00 65.19  ? 177  LYS B O     1 
ATOM   2984  C  CB    . LYS B 1  177  ? -0.754  -2.149  29.360   1.00 77.60  ? 177  LYS B CB    1 
ATOM   2985  C  CG    . LYS B 1  177  ? -0.744  -2.348  27.847   1.00 73.34  ? 177  LYS B CG    1 
ATOM   2986  C  CD    . LYS B 1  177  ? -1.746  -3.401  27.403   1.00 65.84  ? 177  LYS B CD    1 
ATOM   2987  C  CE    . LYS B 1  177  ? -1.651  -3.644  25.902   1.00 67.24  ? 177  LYS B CE    1 
ATOM   2988  N  NZ    . LYS B 1  177  ? -2.650  -4.646  25.431   1.00 69.78  ? 177  LYS B NZ    1 
ATOM   2989  N  N     . VAL B 1  178  ? 0.283   0.706   28.211   1.00 74.99  ? 178  VAL B N     1 
ATOM   2990  C  CA    . VAL B 1  178  ? -0.021  2.030   27.682   1.00 78.80  ? 178  VAL B CA    1 
ATOM   2991  C  C     . VAL B 1  178  ? -0.683  1.970   26.308   1.00 79.72  ? 178  VAL B C     1 
ATOM   2992  O  O     . VAL B 1  178  ? -0.027  1.681   25.308   1.00 80.76  ? 178  VAL B O     1 
ATOM   2993  C  CB    . VAL B 1  178  ? 1.251   2.896   27.575   1.00 82.22  ? 178  VAL B CB    1 
ATOM   2994  C  CG1   . VAL B 1  178  ? 0.904   4.298   27.092   1.00 87.31  ? 178  VAL B CG1   1 
ATOM   2995  C  CG2   . VAL B 1  178  ? 1.984   2.942   28.913   1.00 86.55  ? 178  VAL B CG2   1 
ATOM   2996  N  N     . ASP B 1  179  ? -1.980  2.258   26.265   1.00 77.55  ? 179  ASP B N     1 
ATOM   2997  C  CA    . ASP B 1  179  ? -2.720  2.301   25.006   1.00 81.19  ? 179  ASP B CA    1 
ATOM   2998  C  C     . ASP B 1  179  ? -2.940  3.751   24.573   1.00 87.16  ? 179  ASP B C     1 
ATOM   2999  O  O     . ASP B 1  179  ? -2.579  4.677   25.298   1.00 92.57  ? 179  ASP B O     1 
ATOM   3000  C  CB    . ASP B 1  179  ? -4.059  1.570   25.140   1.00 86.37  ? 179  ASP B CB    1 
ATOM   3001  C  CG    . ASP B 1  179  ? -3.892  0.105   25.522   1.00 100.65 ? 179  ASP B CG    1 
ATOM   3002  O  OD1   . ASP B 1  179  ? -2.814  -0.465  25.240   1.00 109.70 ? 179  ASP B OD1   1 
ATOM   3003  O  OD2   . ASP B 1  179  ? -4.838  -0.477  26.099   1.00 107.33 ? 179  ASP B OD2   1 
ATOM   3004  N  N     . ALA B 1  180  ? -3.526  3.949   23.395   1.00 93.69  ? 180  ALA B N     1 
ATOM   3005  C  CA    . ALA B 1  180  ? -3.737  5.300   22.874   1.00 99.85  ? 180  ALA B CA    1 
ATOM   3006  C  C     . ALA B 1  180  ? -5.217  5.669   22.783   1.00 102.57 ? 180  ALA B C     1 
ATOM   3007  O  O     . ALA B 1  180  ? -5.994  4.988   22.114   1.00 112.48 ? 180  ALA B O     1 
ATOM   3008  C  CB    . ALA B 1  180  ? -3.076  5.446   21.507   1.00 102.86 ? 180  ALA B CB    1 
ATOM   3009  N  N     . THR B 1  181  ? -5.598  6.752   23.455   1.00 103.39 ? 181  THR B N     1 
ATOM   3010  C  CA    . THR B 1  181  ? -6.969  7.255   23.393   1.00 106.04 ? 181  THR B CA    1 
ATOM   3011  C  C     . THR B 1  181  ? -7.098  8.351   22.335   1.00 109.81 ? 181  THR B C     1 
ATOM   3012  O  O     . THR B 1  181  ? -6.101  8.952   21.930   1.00 110.62 ? 181  THR B O     1 
ATOM   3013  C  CB    . THR B 1  181  ? -7.439  7.798   24.759   1.00 98.32  ? 181  THR B CB    1 
ATOM   3014  O  OG1   . THR B 1  181  ? -8.730  8.403   24.618   1.00 96.17  ? 181  THR B OG1   1 
ATOM   3015  C  CG2   . THR B 1  181  ? -6.458  8.830   25.298   1.00 98.58  ? 181  THR B CG2   1 
ATOM   3016  N  N     . ARG B 1  182  ? -8.326  8.611   21.893   1.00 112.97 ? 182  ARG B N     1 
ATOM   3017  C  CA    . ARG B 1  182  ? -8.562  9.545   20.795   1.00 114.82 ? 182  ARG B CA    1 
ATOM   3018  C  C     . ARG B 1  182  ? -9.286  10.816  21.244   1.00 117.41 ? 182  ARG B C     1 
ATOM   3019  O  O     . ARG B 1  182  ? -10.514 10.891  21.195   1.00 114.17 ? 182  ARG B O     1 
ATOM   3020  C  CB    . ARG B 1  182  ? -9.367  8.860   19.686   1.00 114.09 ? 182  ARG B CB    1 
ATOM   3021  C  CG    . ARG B 1  182  ? -8.853  7.473   19.311   1.00 114.96 ? 182  ARG B CG    1 
ATOM   3022  C  CD    . ARG B 1  182  ? -9.680  6.844   18.199   1.00 116.82 ? 182  ARG B CD    1 
ATOM   3023  N  NE    . ARG B 1  182  ? -11.106 6.810   18.515   1.00 121.04 ? 182  ARG B NE    1 
ATOM   3024  C  CZ    . ARG B 1  182  ? -11.714 5.809   19.145   1.00 114.69 ? 182  ARG B CZ    1 
ATOM   3025  N  NH1   . ARG B 1  182  ? -11.023 4.748   19.539   1.00 108.58 ? 182  ARG B NH1   1 
ATOM   3026  N  NH2   . ARG B 1  182  ? -13.017 5.871   19.383   1.00 112.84 ? 182  ARG B NH2   1 
ATOM   3027  N  N     . VAL B 1  183  ? -8.517  11.813  21.673   1.00 120.66 ? 183  VAL B N     1 
ATOM   3028  C  CA    . VAL B 1  183  ? -9.074  13.103  22.068   1.00 115.16 ? 183  VAL B CA    1 
ATOM   3029  C  C     . VAL B 1  183  ? -9.224  14.007  20.849   1.00 115.60 ? 183  VAL B C     1 
ATOM   3030  O  O     . VAL B 1  183  ? -8.309  14.106  20.030   1.00 115.20 ? 183  VAL B O     1 
ATOM   3031  C  CB    . VAL B 1  183  ? -8.191  13.807  23.123   1.00 109.76 ? 183  VAL B CB    1 
ATOM   3032  C  CG1   . VAL B 1  183  ? -8.820  15.122  23.556   1.00 114.22 ? 183  VAL B CG1   1 
ATOM   3033  C  CG2   . VAL B 1  183  ? -7.969  12.905  24.325   1.00 110.27 ? 183  VAL B CG2   1 
ATOM   3034  N  N     . GLU B 1  184  ? -10.381 14.659  20.738   1.00 119.23 ? 184  GLU B N     1 
ATOM   3035  C  CA    . GLU B 1  184  ? -10.692 15.532  19.607   1.00 122.11 ? 184  GLU B CA    1 
ATOM   3036  C  C     . GLU B 1  184  ? -10.596 14.771  18.287   1.00 121.79 ? 184  GLU B C     1 
ATOM   3037  O  O     . GLU B 1  184  ? -11.391 13.871  18.013   1.00 116.89 ? 184  GLU B O     1 
ATOM   3038  C  CB    . GLU B 1  184  ? -9.756  16.748  19.578   1.00 123.58 ? 184  GLU B CB    1 
ATOM   3039  C  CG    . GLU B 1  184  ? -9.696  17.538  20.876   1.00 123.68 ? 184  GLU B CG    1 
ATOM   3040  C  CD    . GLU B 1  184  ? -10.826 18.542  21.009   1.00 128.02 ? 184  GLU B CD    1 
ATOM   3041  O  OE1   . GLU B 1  184  ? -11.732 18.545  20.149   1.00 134.16 ? 184  GLU B OE1   1 
ATOM   3042  O  OE2   . GLU B 1  184  ? -10.803 19.336  21.974   1.00 126.48 ? 184  GLU B OE2   1 
ATOM   3043  N  N     . GLN B 1  185  ? -9.613  15.144  17.475   1.00 119.81 ? 185  GLN B N     1 
ATOM   3044  C  CA    . GLN B 1  185  ? -9.331  14.451  16.225   1.00 113.62 ? 185  GLN B CA    1 
ATOM   3045  C  C     . GLN B 1  185  ? -8.071  13.610  16.390   1.00 105.99 ? 185  GLN B C     1 
ATOM   3046  O  O     . GLN B 1  185  ? -7.894  12.586  15.728   1.00 98.00  ? 185  GLN B O     1 
ATOM   3047  C  CB    . GLN B 1  185  ? -9.169  15.452  15.076   1.00 126.31 ? 185  GLN B CB    1 
ATOM   3048  C  CG    . GLN B 1  185  ? -8.904  14.820  13.718   1.00 124.16 ? 185  GLN B CG    1 
ATOM   3049  C  CD    . GLN B 1  185  ? -8.773  15.852  12.611   1.00 132.13 ? 185  GLN B CD    1 
ATOM   3050  O  OE1   . GLN B 1  185  ? -9.063  17.033  12.808   1.00 138.82 ? 185  GLN B OE1   1 
ATOM   3051  N  NE2   . GLN B 1  185  ? -8.333  15.409  11.438   1.00 114.52 ? 185  GLN B NE2   1 
ATOM   3052  N  N     . ARG B 1  186  ? -7.203  14.051  17.293   1.00 108.28 ? 186  ARG B N     1 
ATOM   3053  C  CA    . ARG B 1  186  ? -5.929  13.386  17.535   1.00 104.12 ? 186  ARG B CA    1 
ATOM   3054  C  C     . ARG B 1  186  ? -6.111  12.019  18.193   1.00 101.52 ? 186  ARG B C     1 
ATOM   3055  O  O     . ARG B 1  186  ? -6.736  11.908  19.246   1.00 102.91 ? 186  ARG B O     1 
ATOM   3056  C  CB    . ARG B 1  186  ? -5.032  14.262  18.415   1.00 109.48 ? 186  ARG B CB    1 
ATOM   3057  C  CG    . ARG B 1  186  ? -4.953  15.725  18.002   1.00 100.93 ? 186  ARG B CG    1 
ATOM   3058  C  CD    . ARG B 1  186  ? -3.906  16.448  18.835   1.00 100.88 ? 186  ARG B CD    1 
ATOM   3059  N  NE    . ARG B 1  186  ? -2.592  15.826  18.691   1.00 103.11 ? 186  ARG B NE    1 
ATOM   3060  C  CZ    . ARG B 1  186  ? -1.600  15.945  19.567   1.00 99.09  ? 186  ARG B CZ    1 
ATOM   3061  N  NH1   . ARG B 1  186  ? -0.441  15.341  19.338   1.00 91.66  ? 186  ARG B NH1   1 
ATOM   3062  N  NH2   . ARG B 1  186  ? -1.764  16.661  20.672   1.00 106.33 ? 186  ARG B NH2   1 
ATOM   3063  N  N     . THR B 1  187  ? -5.559  10.981  17.574   1.00 95.49  ? 187  THR B N     1 
ATOM   3064  C  CA    . THR B 1  187  ? -5.551  9.654   18.182   1.00 101.50 ? 187  THR B CA    1 
ATOM   3065  C  C     . THR B 1  187  ? -4.163  9.368   18.742   1.00 103.99 ? 187  THR B C     1 
ATOM   3066  O  O     . THR B 1  187  ? -3.692  8.230   18.734   1.00 105.26 ? 187  THR B O     1 
ATOM   3067  C  CB    . THR B 1  187  ? -5.945  8.554   17.178   1.00 94.50  ? 187  THR B CB    1 
ATOM   3068  O  OG1   . THR B 1  187  ? -4.870  8.331   16.256   1.00 93.01  ? 187  THR B OG1   1 
ATOM   3069  C  CG2   . THR B 1  187  ? -7.195  8.954   16.411   1.00 92.65  ? 187  THR B CG2   1 
ATOM   3070  N  N     . ASP B 1  188  ? -3.515  10.422  19.231   1.00 99.55  ? 188  ASP B N     1 
ATOM   3071  C  CA    . ASP B 1  188  ? -2.129  10.346  19.673   1.00 101.58 ? 188  ASP B CA    1 
ATOM   3072  C  C     . ASP B 1  188  ? -2.007  10.248  21.190   1.00 101.10 ? 188  ASP B C     1 
ATOM   3073  O  O     . ASP B 1  188  ? -1.010  9.743   21.707   1.00 101.77 ? 188  ASP B O     1 
ATOM   3074  C  CB    . ASP B 1  188  ? -1.351  11.567  19.176   1.00 93.12  ? 188  ASP B CB    1 
ATOM   3075  C  CG    . ASP B 1  188  ? -1.574  11.840  17.704   1.00 93.41  ? 188  ASP B CG    1 
ATOM   3076  O  OD1   . ASP B 1  188  ? -1.768  10.872  16.942   1.00 91.16  ? 188  ASP B OD1   1 
ATOM   3077  O  OD2   . ASP B 1  188  ? -1.556  13.024  17.309   1.00 92.48  ? 188  ASP B OD2   1 
ATOM   3078  N  N     . PHE B 1  189  ? -3.026  10.734  21.893   1.00 101.21 ? 189  PHE B N     1 
ATOM   3079  C  CA    . PHE B 1  189  ? -2.998  10.805  23.352   1.00 95.77  ? 189  PHE B CA    1 
ATOM   3080  C  C     . PHE B 1  189  ? -2.808  9.424   23.982   1.00 91.03  ? 189  PHE B C     1 
ATOM   3081  O  O     . PHE B 1  189  ? -3.215  8.411   23.414   1.00 88.18  ? 189  PHE B O     1 
ATOM   3082  C  CB    . PHE B 1  189  ? -4.279  11.465  23.875   1.00 95.38  ? 189  PHE B CB    1 
ATOM   3083  C  CG    . PHE B 1  189  ? -4.402  12.921  23.515   1.00 95.21  ? 189  PHE B CG    1 
ATOM   3084  C  CD1   . PHE B 1  189  ? -4.809  13.306  22.248   1.00 99.52  ? 189  PHE B CD1   1 
ATOM   3085  C  CD2   . PHE B 1  189  ? -4.112  13.906  24.444   1.00 96.48  ? 189  PHE B CD2   1 
ATOM   3086  C  CE1   . PHE B 1  189  ? -4.922  14.646  21.913   1.00 101.98 ? 189  PHE B CE1   1 
ATOM   3087  C  CE2   . PHE B 1  189  ? -4.222  15.248  24.115   1.00 110.72 ? 189  PHE B CE2   1 
ATOM   3088  C  CZ    . PHE B 1  189  ? -4.628  15.617  22.847   1.00 105.23 ? 189  PHE B CZ    1 
ATOM   3089  N  N     . ASP B 1  190  ? -2.172  9.392   25.149   1.00 87.36  ? 190  ASP B N     1 
ATOM   3090  C  CA    . ASP B 1  190  ? -1.859  8.133   25.818   1.00 83.11  ? 190  ASP B CA    1 
ATOM   3091  C  C     . ASP B 1  190  ? -2.844  7.783   26.932   1.00 79.73  ? 190  ASP B C     1 
ATOM   3092  O  O     . ASP B 1  190  ? -3.473  8.656   27.531   1.00 81.18  ? 190  ASP B O     1 
ATOM   3093  C  CB    . ASP B 1  190  ? -0.439  8.171   26.393   1.00 81.74  ? 190  ASP B CB    1 
ATOM   3094  C  CG    . ASP B 1  190  ? 0.631   8.082   25.323   1.00 79.12  ? 190  ASP B CG    1 
ATOM   3095  O  OD1   . ASP B 1  190  ? 0.307   7.697   24.181   1.00 85.75  ? 190  ASP B OD1   1 
ATOM   3096  O  OD2   . ASP B 1  190  ? 1.802   8.387   25.629   1.00 72.31  ? 190  ASP B OD2   1 
ATOM   3097  N  N     . LYS B 1  191  ? -2.958  6.488   27.199   1.00 77.47  ? 191  LYS B N     1 
ATOM   3098  C  CA    . LYS B 1  191  ? -3.788  5.981   28.280   1.00 75.29  ? 191  LYS B CA    1 
ATOM   3099  C  C     . LYS B 1  191  ? -2.992  4.952   29.077   1.00 77.18  ? 191  LYS B C     1 
ATOM   3100  O  O     . LYS B 1  191  ? -2.528  3.959   28.519   1.00 79.46  ? 191  LYS B O     1 
ATOM   3101  C  CB    . LYS B 1  191  ? -5.074  5.361   27.731   1.00 84.36  ? 191  LYS B CB    1 
ATOM   3102  C  CG    . LYS B 1  191  ? -5.827  4.501   28.734   1.00 88.08  ? 191  LYS B CG    1 
ATOM   3103  C  CD    . LYS B 1  191  ? -6.947  3.715   28.070   1.00 79.72  ? 191  LYS B CD    1 
ATOM   3104  C  CE    . LYS B 1  191  ? -7.605  2.759   29.048   1.00 67.52  ? 191  LYS B CE    1 
ATOM   3105  N  NZ    . LYS B 1  191  ? -8.666  1.935   28.409   1.00 70.31  ? 191  LYS B NZ    1 
ATOM   3106  N  N     . LEU B 1  192  ? -2.830  5.187   30.376   1.00 73.45  ? 192  LEU B N     1 
ATOM   3107  C  CA    . LEU B 1  192  ? -2.035  4.286   31.207   1.00 72.94  ? 192  LEU B CA    1 
ATOM   3108  C  C     . LEU B 1  192  ? -2.884  3.478   32.185   1.00 74.66  ? 192  LEU B C     1 
ATOM   3109  O  O     . LEU B 1  192  ? -3.444  4.019   33.140   1.00 72.30  ? 192  LEU B O     1 
ATOM   3110  C  CB    . LEU B 1  192  ? -0.968  5.068   31.977   1.00 77.78  ? 192  LEU B CB    1 
ATOM   3111  C  CG    . LEU B 1  192  ? -0.115  4.256   32.959   1.00 86.40  ? 192  LEU B CG    1 
ATOM   3112  C  CD1   . LEU B 1  192  ? 0.559   3.075   32.269   1.00 82.38  ? 192  LEU B CD1   1 
ATOM   3113  C  CD2   . LEU B 1  192  ? 0.924   5.139   33.631   1.00 86.83  ? 192  LEU B CD2   1 
ATOM   3114  N  N     . ILE B 1  193  ? -2.970  2.175   31.932   1.00 77.03  ? 193  ILE B N     1 
ATOM   3115  C  CA    . ILE B 1  193  ? -3.622  1.248   32.849   1.00 80.23  ? 193  ILE B CA    1 
ATOM   3116  C  C     . ILE B 1  193  ? -2.569  0.624   33.756   1.00 79.48  ? 193  ILE B C     1 
ATOM   3117  O  O     . ILE B 1  193  ? -1.544  0.132   33.282   1.00 77.66  ? 193  ILE B O     1 
ATOM   3118  C  CB    . ILE B 1  193  ? -4.396  0.137   32.103   1.00 85.90  ? 193  ILE B CB    1 
ATOM   3119  C  CG1   . ILE B 1  193  ? -5.607  0.721   31.370   1.00 82.54  ? 193  ILE B CG1   1 
ATOM   3120  C  CG2   . ILE B 1  193  ? -4.849  -0.947  33.073   1.00 83.69  ? 193  ILE B CG2   1 
ATOM   3121  C  CD1   . ILE B 1  193  ? -6.471  -0.321  30.676   1.00 83.40  ? 193  ILE B CD1   1 
ATOM   3122  N  N     . LEU B 1  194  ? -2.819  0.660   35.060   1.00 75.39  ? 194  LEU B N     1 
ATOM   3123  C  CA    . LEU B 1  194  ? -1.871  0.131   36.030   1.00 76.08  ? 194  LEU B CA    1 
ATOM   3124  C  C     . LEU B 1  194  ? -2.501  -0.933  36.917   1.00 76.18  ? 194  LEU B C     1 
ATOM   3125  O  O     . LEU B 1  194  ? -3.593  -0.746  37.452   1.00 80.85  ? 194  LEU B O     1 
ATOM   3126  C  CB    . LEU B 1  194  ? -1.310  1.258   36.894   1.00 77.36  ? 194  LEU B CB    1 
ATOM   3127  C  CG    . LEU B 1  194  ? -0.203  0.839   37.861   1.00 83.42  ? 194  LEU B CG    1 
ATOM   3128  C  CD1   . LEU B 1  194  ? 0.966   0.272   37.089   1.00 81.30  ? 194  LEU B CD1   1 
ATOM   3129  C  CD2   . LEU B 1  194  ? 0.245   2.005   38.729   1.00 94.79  ? 194  LEU B CD2   1 
ATOM   3130  N  N     . ASP B 1  195  ? -1.808  -2.054  37.063   1.00 79.97  ? 195  ASP B N     1 
ATOM   3131  C  CA    . ASP B 1  195  ? -2.268  -3.122  37.936   1.00 93.92  ? 195  ASP B CA    1 
ATOM   3132  C  C     . ASP B 1  195  ? -1.356  -3.196  39.151   1.00 92.68  ? 195  ASP B C     1 
ATOM   3133  O  O     . ASP B 1  195  ? -0.135  -3.243  39.014   1.00 88.42  ? 195  ASP B O     1 
ATOM   3134  C  CB    . ASP B 1  195  ? -2.296  -4.458  37.191   1.00 105.07 ? 195  ASP B CB    1 
ATOM   3135  C  CG    . ASP B 1  195  ? -2.924  -5.571  38.009   1.00 108.11 ? 195  ASP B CG    1 
ATOM   3136  O  OD1   . ASP B 1  195  ? -2.201  -6.199  38.811   1.00 114.88 ? 195  ASP B OD1   1 
ATOM   3137  O  OD2   . ASP B 1  195  ? -4.140  -5.817  37.846   1.00 99.71  ? 195  ASP B OD2   1 
ATOM   3138  N  N     . VAL B 1  196  ? -1.948  -3.190  40.340   1.00 100.06 ? 196  VAL B N     1 
ATOM   3139  C  CA    . VAL B 1  196  ? -1.166  -3.165  41.572   1.00 101.88 ? 196  VAL B CA    1 
ATOM   3140  C  C     . VAL B 1  196  ? -1.717  -4.116  42.626   1.00 103.97 ? 196  VAL B C     1 
ATOM   3141  O  O     . VAL B 1  196  ? -2.869  -3.991  43.042   1.00 103.27 ? 196  VAL B O     1 
ATOM   3142  C  CB    . VAL B 1  196  ? -1.114  -1.751  42.177   1.00 100.10 ? 196  VAL B CB    1 
ATOM   3143  C  CG1   . VAL B 1  196  ? -0.419  -1.781  43.532   1.00 102.03 ? 196  VAL B CG1   1 
ATOM   3144  C  CG2   . VAL B 1  196  ? -0.415  -0.789  41.231   1.00 98.52  ? 196  VAL B CG2   1 
ATOM   3145  N  N     . GLU B 1  197  ? -0.892  -5.062  43.063   1.00 102.27 ? 197  GLU B N     1 
ATOM   3146  C  CA    . GLU B 1  197  ? -1.293  -5.951  44.144   1.00 98.90  ? 197  GLU B CA    1 
ATOM   3147  C  C     . GLU B 1  197  ? -0.464  -5.706  45.393   1.00 98.33  ? 197  GLU B C     1 
ATOM   3148  O  O     . GLU B 1  197  ? 0.764   -5.746  45.355   1.00 94.62  ? 197  GLU B O     1 
ATOM   3149  C  CB    . GLU B 1  197  ? -1.183  -7.416  43.722   1.00 102.92 ? 197  GLU B CB    1 
ATOM   3150  C  CG    . GLU B 1  197  ? -1.757  -8.369  44.760   1.00 115.44 ? 197  GLU B CG    1 
ATOM   3151  C  CD    . GLU B 1  197  ? -2.019  -9.759  44.211   1.00 127.01 ? 197  GLU B CD    1 
ATOM   3152  O  OE1   . GLU B 1  197  ? -1.555  -10.058 43.091   1.00 135.53 ? 197  GLU B OE1   1 
ATOM   3153  O  OE2   . GLU B 1  197  ? -2.696  -10.550 44.903   1.00 123.21 ? 197  GLU B OE2   1 
ATOM   3154  N  N     . THR B 1  198  ? -1.150  -5.443  46.500   1.00 103.90 ? 198  THR B N     1 
ATOM   3155  C  CA    . THR B 1  198  ? -0.488  -5.209  47.776   1.00 111.45 ? 198  THR B CA    1 
ATOM   3156  C  C     . THR B 1  198  ? -0.689  -6.385  48.730   1.00 112.48 ? 198  THR B C     1 
ATOM   3157  O  O     . THR B 1  198  ? -1.443  -7.313  48.439   1.00 111.26 ? 198  THR B O     1 
ATOM   3158  C  CB    . THR B 1  198  ? -0.998  -3.918  48.446   1.00 109.10 ? 198  THR B CB    1 
ATOM   3159  O  OG1   . THR B 1  198  ? -2.419  -3.992  48.625   1.00 103.83 ? 198  THR B OG1   1 
ATOM   3160  C  CG2   . THR B 1  198  ? -0.665  -2.709  47.588   1.00 109.36 ? 198  THR B CG2   1 
ATOM   3161  N  N     . LYS B 1  199  ? -0.005  -6.337  49.868   1.00 117.75 ? 199  LYS B N     1 
ATOM   3162  C  CA    . LYS B 1  199  ? -0.112  -7.378  50.884   1.00 117.93 ? 199  LYS B CA    1 
ATOM   3163  C  C     . LYS B 1  199  ? -1.449  -7.306  51.617   1.00 127.74 ? 199  LYS B C     1 
ATOM   3164  O  O     . LYS B 1  199  ? -2.374  -6.617  51.181   1.00 129.61 ? 199  LYS B O     1 
ATOM   3165  C  CB    . LYS B 1  199  ? 1.038   -7.259  51.887   1.00 117.46 ? 199  LYS B CB    1 
ATOM   3166  C  CG    . LYS B 1  199  ? 2.387   -7.714  51.356   1.00 114.44 ? 199  LYS B CG    1 
ATOM   3167  C  CD    . LYS B 1  199  ? 3.512   -7.353  52.316   1.00 119.81 ? 199  LYS B CD    1 
ATOM   3168  C  CE    . LYS B 1  199  ? 4.792   -8.109  51.984   1.00 120.86 ? 199  LYS B CE    1 
ATOM   3169  N  NZ    . LYS B 1  199  ? 5.955   -7.642  52.796   1.00 115.75 ? 199  LYS B NZ    1 
ATOM   3170  N  N     . ASN B 1  200  ? -1.544  -8.017  52.736   1.00 131.39 ? 200  ASN B N     1 
ATOM   3171  C  CA    . ASN B 1  200  ? -2.728  -7.954  53.584   1.00 136.92 ? 200  ASN B CA    1 
ATOM   3172  C  C     . ASN B 1  200  ? -2.600  -6.802  54.579   1.00 143.37 ? 200  ASN B C     1 
ATOM   3173  O  O     . ASN B 1  200  ? -3.389  -6.678  55.517   1.00 147.34 ? 200  ASN B O     1 
ATOM   3174  C  CB    . ASN B 1  200  ? -2.936  -9.281  54.319   1.00 128.86 ? 200  ASN B CB    1 
ATOM   3175  C  CG    . ASN B 1  200  ? -4.367  -9.477  54.784   1.00 124.68 ? 200  ASN B CG    1 
ATOM   3176  O  OD1   . ASN B 1  200  ? -4.714  -9.151  55.919   1.00 124.79 ? 200  ASN B OD1   1 
ATOM   3177  N  ND2   . ASN B 1  200  ? -5.206  -10.014 53.905   1.00 124.68 ? 200  ASN B ND2   1 
ATOM   3178  N  N     . SER B 1  201  ? -1.601  -5.954  54.351   1.00 139.48 ? 201  SER B N     1 
ATOM   3179  C  CA    . SER B 1  201  ? -1.297  -4.842  55.243   1.00 133.54 ? 201  SER B CA    1 
ATOM   3180  C  C     . SER B 1  201  ? -2.002  -3.552  54.829   1.00 130.98 ? 201  SER B C     1 
ATOM   3181  O  O     . SER B 1  201  ? -2.782  -2.990  55.598   1.00 131.18 ? 201  SER B O     1 
ATOM   3182  C  CB    . SER B 1  201  ? 0.215   -4.611  55.295   1.00 128.13 ? 201  SER B CB    1 
ATOM   3183  O  OG    . SER B 1  201  ? 0.546   -3.585  56.212   1.00 137.63 ? 201  SER B OG    1 
ATOM   3184  N  N     . ILE B 1  202  ? -1.727  -3.085  53.615   1.00 125.10 ? 202  ILE B N     1 
ATOM   3185  C  CA    . ILE B 1  202  ? -2.271  -1.812  53.155   1.00 115.43 ? 202  ILE B CA    1 
ATOM   3186  C  C     . ILE B 1  202  ? -3.114  -1.978  51.890   1.00 108.24 ? 202  ILE B C     1 
ATOM   3187  O  O     . ILE B 1  202  ? -2.862  -2.864  51.073   1.00 105.11 ? 202  ILE B O     1 
ATOM   3188  C  CB    . ILE B 1  202  ? -1.135  -0.784  52.902   1.00 115.48 ? 202  ILE B CB    1 
ATOM   3189  C  CG1   . ILE B 1  202  ? -1.693  0.640   52.801   1.00 107.50 ? 202  ILE B CG1   1 
ATOM   3190  C  CG2   . ILE B 1  202  ? -0.317  -1.161  51.671   1.00 110.18 ? 202  ILE B CG2   1 
ATOM   3191  C  CD1   . ILE B 1  202  ? -2.368  1.125   54.070   1.00 103.61 ? 202  ILE B CD1   1 
ATOM   3192  N  N     . SER B 1  203  ? -4.129  -1.130  51.750   1.00 109.03 ? 203  SER B N     1 
ATOM   3193  C  CA    . SER B 1  203  ? -4.981  -1.128  50.567   1.00 108.85 ? 203  SER B CA    1 
ATOM   3194  C  C     . SER B 1  203  ? -4.232  -0.587  49.356   1.00 107.13 ? 203  SER B C     1 
ATOM   3195  O  O     . SER B 1  203  ? -3.418  0.327   49.487   1.00 108.12 ? 203  SER B O     1 
ATOM   3196  C  CB    . SER B 1  203  ? -6.242  -0.296  50.819   1.00 116.46 ? 203  SER B CB    1 
ATOM   3197  O  OG    . SER B 1  203  ? -6.958  -0.069  49.615   1.00 112.49 ? 203  SER B OG    1 
ATOM   3198  N  N     . PRO B 1  204  ? -4.498  -1.161  48.171   1.00 105.97 ? 204  PRO B N     1 
ATOM   3199  C  CA    . PRO B 1  204  ? -3.898  -0.690  46.918   1.00 107.16 ? 204  PRO B CA    1 
ATOM   3200  C  C     . PRO B 1  204  ? -4.214  0.782   46.661   1.00 105.90 ? 204  PRO B C     1 
ATOM   3201  O  O     . PRO B 1  204  ? -3.370  1.524   46.155   1.00 105.38 ? 204  PRO B O     1 
ATOM   3202  C  CB    . PRO B 1  204  ? -4.550  -1.584  45.859   1.00 104.23 ? 204  PRO B CB    1 
ATOM   3203  C  CG    . PRO B 1  204  ? -4.950  -2.816  46.599   1.00 97.99  ? 204  PRO B CG    1 
ATOM   3204  C  CD    . PRO B 1  204  ? -5.354  -2.342  47.962   1.00 103.85 ? 204  PRO B CD    1 
ATOM   3205  N  N     . ARG B 1  205  ? -5.427  1.193   47.017   1.00 101.53 ? 205  ARG B N     1 
ATOM   3206  C  CA    . ARG B 1  205  ? -5.855  2.578   46.864   1.00 98.05  ? 205  ARG B CA    1 
ATOM   3207  C  C     . ARG B 1  205  ? -5.030  3.509   47.739   1.00 99.85  ? 205  ARG B C     1 
ATOM   3208  O  O     . ARG B 1  205  ? -4.847  4.680   47.413   1.00 98.59  ? 205  ARG B O     1 
ATOM   3209  C  CB    . ARG B 1  205  ? -7.335  2.716   47.207   1.00 92.71  ? 205  ARG B CB    1 
ATOM   3210  C  CG    . ARG B 1  205  ? -8.218  1.709   46.504   1.00 89.72  ? 205  ARG B CG    1 
ATOM   3211  C  CD    . ARG B 1  205  ? -9.646  1.840   46.977   1.00 98.55  ? 205  ARG B CD    1 
ATOM   3212  N  NE    . ARG B 1  205  ? -10.165 3.182   46.741   1.00 113.68 ? 205  ARG B NE    1 
ATOM   3213  C  CZ    . ARG B 1  205  ? -11.349 3.609   47.164   1.00 122.82 ? 205  ARG B CZ    1 
ATOM   3214  N  NH1   . ARG B 1  205  ? -11.739 4.848   46.899   1.00 130.86 ? 205  ARG B NH1   1 
ATOM   3215  N  NH2   . ARG B 1  205  ? -12.143 2.801   47.855   1.00 114.57 ? 205  ARG B NH2   1 
ATOM   3216  N  N     . ASP B 1  206  ? -4.540  2.979   48.855   1.00 106.96 ? 206  ASP B N     1 
ATOM   3217  C  CA    . ASP B 1  206  ? -3.701  3.741   49.772   1.00 108.02 ? 206  ASP B CA    1 
ATOM   3218  C  C     . ASP B 1  206  ? -2.247  3.768   49.318   1.00 106.05 ? 206  ASP B C     1 
ATOM   3219  O  O     . ASP B 1  206  ? -1.595  4.810   49.370   1.00 108.96 ? 206  ASP B O     1 
ATOM   3220  C  CB    . ASP B 1  206  ? -3.783  3.163   51.188   1.00 114.26 ? 206  ASP B CB    1 
ATOM   3221  C  CG    . ASP B 1  206  ? -5.049  3.574   51.920   1.00 120.71 ? 206  ASP B CG    1 
ATOM   3222  O  OD1   . ASP B 1  206  ? -4.999  4.554   52.697   1.00 125.91 ? 206  ASP B OD1   1 
ATOM   3223  O  OD2   . ASP B 1  206  ? -6.091  2.911   51.723   1.00 118.89 ? 206  ASP B OD2   1 
ATOM   3224  N  N     . ALA B 1  207  ? -1.742  2.618   48.881   1.00 102.79 ? 207  ALA B N     1 
ATOM   3225  C  CA    . ALA B 1  207  ? -0.333  2.487   48.516   1.00 108.05 ? 207  ALA B CA    1 
ATOM   3226  C  C     . ALA B 1  207  ? 0.020   3.327   47.293   1.00 104.30 ? 207  ALA B C     1 
ATOM   3227  O  O     . ALA B 1  207  ? 1.187   3.649   47.064   1.00 104.40 ? 207  ALA B O     1 
ATOM   3228  C  CB    . ALA B 1  207  ? 0.019   1.026   48.271   1.00 120.18 ? 207  ALA B CB    1 
ATOM   3229  N  N     . LEU B 1  208  ? -0.995  3.681   46.511   1.00 103.39 ? 208  LEU B N     1 
ATOM   3230  C  CA    . LEU B 1  208  ? -0.796  4.533   45.346   1.00 102.70 ? 208  LEU B CA    1 
ATOM   3231  C  C     . LEU B 1  208  ? -0.661  5.995   45.757   1.00 105.11 ? 208  LEU B C     1 
ATOM   3232  O  O     . LEU B 1  208  ? 0.135   6.738   45.184   1.00 108.64 ? 208  LEU B O     1 
ATOM   3233  C  CB    . LEU B 1  208  ? -1.949  4.371   44.355   1.00 103.08 ? 208  LEU B CB    1 
ATOM   3234  C  CG    . LEU B 1  208  ? -1.779  5.120   43.031   1.00 107.90 ? 208  LEU B CG    1 
ATOM   3235  C  CD1   . LEU B 1  208  ? -0.535  4.636   42.294   1.00 102.70 ? 208  LEU B CD1   1 
ATOM   3236  C  CD2   . LEU B 1  208  ? -3.016  4.969   42.159   1.00 101.58 ? 208  LEU B CD2   1 
ATOM   3237  N  N     . ALA B 1  209  ? -1.443  6.404   46.753   1.00 104.87 ? 209  ALA B N     1 
ATOM   3238  C  CA    . ALA B 1  209  ? -1.393  7.778   47.239   1.00 107.91 ? 209  ALA B CA    1 
ATOM   3239  C  C     . ALA B 1  209  ? -0.057  8.070   47.914   1.00 109.59 ? 209  ALA B C     1 
ATOM   3240  O  O     . ALA B 1  209  ? 0.497   9.161   47.766   1.00 111.54 ? 209  ALA B O     1 
ATOM   3241  C  CB    . ALA B 1  209  ? -2.543  8.047   48.196   1.00 118.92 ? 209  ALA B CB    1 
ATOM   3242  N  N     . SER B 1  210  ? 0.456   7.086   48.648   1.00 115.78 ? 210  SER B N     1 
ATOM   3243  C  CA    . SER B 1  210  ? 1.754   7.205   49.303   1.00 124.06 ? 210  SER B CA    1 
ATOM   3244  C  C     . SER B 1  210  ? 2.873   7.295   48.270   1.00 113.76 ? 210  SER B C     1 
ATOM   3245  O  O     . SER B 1  210  ? 3.742   8.162   48.360   1.00 108.90 ? 210  SER B O     1 
ATOM   3246  C  CB    . SER B 1  210  ? 1.996   6.019   50.241   1.00 129.80 ? 210  SER B CB    1 
ATOM   3247  O  OG    . SER B 1  210  ? 3.260   6.113   50.878   1.00 127.35 ? 210  SER B OG    1 
ATOM   3248  N  N     . ALA B 1  211  ? 2.846   6.396   47.292   1.00 105.73 ? 211  ALA B N     1 
ATOM   3249  C  CA    . ALA B 1  211  ? 3.824   6.415   46.212   1.00 106.89 ? 211  ALA B CA    1 
ATOM   3250  C  C     . ALA B 1  211  ? 3.679   7.690   45.391   1.00 99.94  ? 211  ALA B C     1 
ATOM   3251  O  O     . ALA B 1  211  ? 4.664   8.234   44.889   1.00 103.84 ? 211  ALA B O     1 
ATOM   3252  C  CB    . ALA B 1  211  ? 3.667   5.189   45.328   1.00 105.73 ? 211  ALA B CB    1 
ATOM   3253  N  N     . GLY B 1  212  ? 2.442   8.158   45.256   1.00 100.57 ? 212  GLY B N     1 
ATOM   3254  C  CA    . GLY B 1  212  ? 2.163   9.389   44.542   1.00 103.60 ? 212  GLY B CA    1 
ATOM   3255  C  C     . GLY B 1  212  ? 2.780   10.582  45.240   1.00 96.56  ? 212  GLY B C     1 
ATOM   3256  O  O     . GLY B 1  212  ? 3.539   11.340  44.638   1.00 96.77  ? 212  GLY B O     1 
ATOM   3257  N  N     . LYS B 1  213  ? 2.458   10.736  46.520   1.00 100.63 ? 213  LYS B N     1 
ATOM   3258  C  CA    . LYS B 1  213  ? 2.996   11.820  47.335   1.00 102.34 ? 213  LYS B CA    1 
ATOM   3259  C  C     . LYS B 1  213  ? 4.522   11.769  47.416   1.00 100.07 ? 213  LYS B C     1 
ATOM   3260  O  O     . LYS B 1  213  ? 5.180   12.807  47.444   1.00 98.95  ? 213  LYS B O     1 
ATOM   3261  C  CB    . LYS B 1  213  ? 2.394   11.773  48.743   1.00 112.91 ? 213  LYS B CB    1 
ATOM   3262  C  CG    . LYS B 1  213  ? 2.884   12.876  49.676   1.00 106.07 ? 213  LYS B CG    1 
ATOM   3263  C  CD    . LYS B 1  213  ? 2.290   12.736  51.073   1.00 96.15  ? 213  LYS B CD    1 
ATOM   3264  C  CE    . LYS B 1  213  ? 2.794   13.831  51.998   1.00 89.44  ? 213  LYS B CE    1 
ATOM   3265  N  NZ    . LYS B 1  213  ? 2.245   13.711  53.378   1.00 89.32  ? 213  LYS B NZ    1 
ATOM   3266  N  N     . THR B 1  214  ? 5.076   10.559  47.452   1.00 101.83 ? 214  THR B N     1 
ATOM   3267  C  CA    . THR B 1  214  ? 6.525   10.373  47.545   1.00 100.37 ? 214  THR B CA    1 
ATOM   3268  C  C     . THR B 1  214  ? 7.251   11.000  46.363   1.00 99.28  ? 214  THR B C     1 
ATOM   3269  O  O     . THR B 1  214  ? 8.267   11.678  46.527   1.00 104.71 ? 214  THR B O     1 
ATOM   3270  C  CB    . THR B 1  214  ? 6.909   8.880   47.610   1.00 96.14  ? 214  THR B CB    1 
ATOM   3271  O  OG1   . THR B 1  214  ? 6.448   8.313   48.841   1.00 97.87  ? 214  THR B OG1   1 
ATOM   3272  C  CG2   . THR B 1  214  ? 8.419   8.714   47.522   1.00 90.34  ? 214  THR B CG2   1 
ATOM   3273  N  N     . LEU B 1  215  ? 6.720   10.767  45.168   1.00 98.61  ? 215  LEU B N     1 
ATOM   3274  C  CA    . LEU B 1  215  ? 7.345   11.256  43.948   1.00 95.10  ? 215  LEU B CA    1 
ATOM   3275  C  C     . LEU B 1  215  ? 7.115   12.754  43.758   1.00 95.25  ? 215  LEU B C     1 
ATOM   3276  O  O     . LEU B 1  215  ? 7.880   13.420  43.059   1.00 94.26  ? 215  LEU B O     1 
ATOM   3277  C  CB    . LEU B 1  215  ? 6.825   10.473  42.741   1.00 88.88  ? 215  LEU B CB    1 
ATOM   3278  C  CG    . LEU B 1  215  ? 7.167   8.981   42.780   1.00 91.39  ? 215  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B 1  215  ? 6.551   8.241   41.604   1.00 89.29  ? 215  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B 1  215  ? 8.676   8.773   42.817   1.00 87.78  ? 215  LEU B CD2   1 
ATOM   3281  N  N     . VAL B 1  216  ? 6.069   13.282  44.389   1.00 95.41  ? 216  VAL B N     1 
ATOM   3282  C  CA    . VAL B 1  216  ? 5.802   14.718  44.358   1.00 94.83  ? 216  VAL B CA    1 
ATOM   3283  C  C     . VAL B 1  216  ? 6.951   15.465  45.037   1.00 98.61  ? 216  VAL B C     1 
ATOM   3284  O  O     . VAL B 1  216  ? 7.320   16.571  44.631   1.00 95.72  ? 216  VAL B O     1 
ATOM   3285  C  CB    . VAL B 1  216  ? 4.457   15.070  45.044   1.00 89.42  ? 216  VAL B CB    1 
ATOM   3286  C  CG1   . VAL B 1  216  ? 4.280   16.579  45.160   1.00 92.50  ? 216  VAL B CG1   1 
ATOM   3287  C  CG2   . VAL B 1  216  ? 3.294   14.466  44.276   1.00 94.61  ? 216  VAL B CG2   1 
ATOM   3288  N  N     . GLU B 1  217  ? 7.527   14.836  46.059   1.00 102.44 ? 217  GLU B N     1 
ATOM   3289  C  CA    . GLU B 1  217  ? 8.673   15.390  46.777   1.00 104.12 ? 217  GLU B CA    1 
ATOM   3290  C  C     . GLU B 1  217  ? 9.906   15.504  45.881   1.00 98.52  ? 217  GLU B C     1 
ATOM   3291  O  O     . GLU B 1  217  ? 10.582  16.535  45.871   1.00 105.94 ? 217  GLU B O     1 
ATOM   3292  C  CB    . GLU B 1  217  ? 9.012   14.531  48.004   1.00 110.52 ? 217  GLU B CB    1 
ATOM   3293  C  CG    . GLU B 1  217  ? 7.953   14.509  49.105   1.00 119.72 ? 217  GLU B CG    1 
ATOM   3294  C  CD    . GLU B 1  217  ? 8.445   13.827  50.375   1.00 114.49 ? 217  GLU B CD    1 
ATOM   3295  O  OE1   . GLU B 1  217  ? 9.640   13.472  50.437   1.00 112.19 ? 217  GLU B OE1   1 
ATOM   3296  O  OE2   . GLU B 1  217  ? 7.640   13.645  51.312   1.00 114.74 ? 217  GLU B OE2   1 
ATOM   3297  N  N     . LEU B 1  218  ? 10.194  14.438  45.136   1.00 91.90  ? 218  LEU B N     1 
ATOM   3298  C  CA    . LEU B 1  218  ? 11.372  14.385  44.272   1.00 89.79  ? 218  LEU B CA    1 
ATOM   3299  C  C     . LEU B 1  218  ? 11.385  15.515  43.247   1.00 92.00  ? 218  LEU B C     1 
ATOM   3300  O  O     . LEU B 1  218  ? 12.377  16.232  43.114   1.00 97.82  ? 218  LEU B O     1 
ATOM   3301  C  CB    . LEU B 1  218  ? 11.451  13.034  43.554   1.00 86.33  ? 218  LEU B CB    1 
ATOM   3302  C  CG    . LEU B 1  218  ? 11.793  11.812  44.411   1.00 90.29  ? 218  LEU B CG    1 
ATOM   3303  C  CD1   . LEU B 1  218  ? 11.928  10.562  43.551   1.00 102.54 ? 218  LEU B CD1   1 
ATOM   3304  C  CD2   . LEU B 1  218  ? 13.064  12.056  45.203   1.00 92.76  ? 218  LEU B CD2   1 
ATOM   3305  N  N     . PHE B 1  219  ? 10.276  15.675  42.532   1.00 93.53  ? 219  PHE B N     1 
ATOM   3306  C  CA    . PHE B 1  219  ? 10.173  16.697  41.496   1.00 94.57  ? 219  PHE B CA    1 
ATOM   3307  C  C     . PHE B 1  219  ? 9.985   18.088  42.099   1.00 92.10  ? 219  PHE B C     1 
ATOM   3308  O  O     . PHE B 1  219  ? 9.855   19.076  41.376   1.00 89.02  ? 219  PHE B O     1 
ATOM   3309  C  CB    . PHE B 1  219  ? 9.025   16.370  40.539   1.00 93.38  ? 219  PHE B CB    1 
ATOM   3310  C  CG    . PHE B 1  219  ? 9.225   15.096  39.759   1.00 98.16  ? 219  PHE B CG    1 
ATOM   3311  C  CD1   . PHE B 1  219  ? 10.449  14.801  39.176   1.00 98.07  ? 219  PHE B CD1   1 
ATOM   3312  C  CD2   . PHE B 1  219  ? 8.187   14.189  39.616   1.00 101.34 ? 219  PHE B CD2   1 
ATOM   3313  C  CE1   . PHE B 1  219  ? 10.629  13.627  38.459   1.00 90.85  ? 219  PHE B CE1   1 
ATOM   3314  C  CE2   . PHE B 1  219  ? 8.361   13.014  38.904   1.00 96.79  ? 219  PHE B CE2   1 
ATOM   3315  C  CZ    . PHE B 1  219  ? 9.583   12.733  38.324   1.00 90.03  ? 219  PHE B CZ    1 
ATOM   3316  N  N     . GLY B 1  220  ? 9.976   18.156  43.426   1.00 92.90  ? 220  GLY B N     1 
ATOM   3317  C  CA    . GLY B 1  220  ? 9.952   19.426  44.123   1.00 94.15  ? 220  GLY B CA    1 
ATOM   3318  C  C     . GLY B 1  220  ? 11.285  20.141  44.009   1.00 103.27 ? 220  GLY B C     1 
ATOM   3319  O  O     . GLY B 1  220  ? 11.328  21.345  43.758   1.00 107.16 ? 220  GLY B O     1 
ATOM   3320  N  N     . LEU B 1  221  ? 12.373  19.390  44.177   1.00 103.17 ? 221  LEU B N     1 
ATOM   3321  C  CA    . LEU B 1  221  ? 13.729  19.948  44.146   1.00 106.20 ? 221  LEU B CA    1 
ATOM   3322  C  C     . LEU B 1  221  ? 14.006  20.746  42.874   1.00 104.70 ? 221  LEU B C     1 
ATOM   3323  O  O     . LEU B 1  221  ? 14.772  21.712  42.888   1.00 100.26 ? 221  LEU B O     1 
ATOM   3324  C  CB    . LEU B 1  221  ? 14.772  18.834  44.289   1.00 107.65 ? 221  LEU B CB    1 
ATOM   3325  C  CG    . LEU B 1  221  ? 15.227  18.450  45.701   1.00 109.12 ? 221  LEU B CG    1 
ATOM   3326  C  CD1   . LEU B 1  221  ? 15.813  19.653  46.431   1.00 111.78 ? 221  LEU B CD1   1 
ATOM   3327  C  CD2   . LEU B 1  221  ? 14.094  17.832  46.507   1.00 104.87 ? 221  LEU B CD2   1 
ATOM   3328  N  N     . ALA B 1  222  ? 13.370  20.343  41.779   1.00 97.70  ? 222  ALA B N     1 
ATOM   3329  C  CA    . ALA B 1  222  ? 13.529  21.030  40.504   1.00 97.12  ? 222  ALA B CA    1 
ATOM   3330  C  C     . ALA B 1  222  ? 12.626  22.257  40.409   1.00 96.09  ? 222  ALA B C     1 
ATOM   3331  O  O     . ALA B 1  222  ? 13.086  23.353  40.083   1.00 93.29  ? 222  ALA B O     1 
ATOM   3332  C  CB    . ALA B 1  222  ? 13.244  20.078  39.355   1.00 96.10  ? 222  ALA B CB    1 
ATOM   3333  N  N     . ARG B 1  223  ? 11.342  22.062  40.708   1.00 97.54  ? 223  ARG B N     1 
ATOM   3334  C  CA    . ARG B 1  223  ? 10.327  23.103  40.542   1.00 90.68  ? 223  ARG B CA    1 
ATOM   3335  C  C     . ARG B 1  223  ? 10.618  24.358  41.361   1.00 95.69  ? 223  ARG B C     1 
ATOM   3336  O  O     . ARG B 1  223  ? 10.292  25.471  40.944   1.00 91.35  ? 223  ARG B O     1 
ATOM   3337  C  CB    . ARG B 1  223  ? 8.948   22.563  40.921   1.00 87.60  ? 223  ARG B CB    1 
ATOM   3338  C  CG    . ARG B 1  223  ? 7.842   23.588  40.769   1.00 84.90  ? 223  ARG B CG    1 
ATOM   3339  C  CD    . ARG B 1  223  ? 6.673   23.299  41.687   1.00 83.35  ? 223  ARG B CD    1 
ATOM   3340  N  NE    . ARG B 1  223  ? 5.623   24.300  41.521   1.00 78.54  ? 223  ARG B NE    1 
ATOM   3341  C  CZ    . ARG B 1  223  ? 4.469   24.291  42.178   1.00 77.76  ? 223  ARG B CZ    1 
ATOM   3342  N  NH1   . ARG B 1  223  ? 3.571   25.243  41.959   1.00 83.51  ? 223  ARG B NH1   1 
ATOM   3343  N  NH2   . ARG B 1  223  ? 4.213   23.332  43.055   1.00 70.11  ? 223  ARG B NH2   1 
ATOM   3344  N  N     . GLU B 1  224  ? 11.238  24.169  42.523   1.00 101.56 ? 224  GLU B N     1 
ATOM   3345  C  CA    . GLU B 1  224  ? 11.575  25.270  43.422   1.00 103.51 ? 224  GLU B CA    1 
ATOM   3346  C  C     . GLU B 1  224  ? 12.388  26.366  42.739   1.00 99.67  ? 224  GLU B C     1 
ATOM   3347  O  O     . GLU B 1  224  ? 12.351  27.526  43.149   1.00 111.23 ? 224  GLU B O     1 
ATOM   3348  C  CB    . GLU B 1  224  ? 12.359  24.750  44.628   1.00 109.93 ? 224  GLU B CB    1 
ATOM   3349  C  CG    . GLU B 1  224  ? 11.582  23.833  45.550   1.00 120.58 ? 224  GLU B CG    1 
ATOM   3350  C  CD    . GLU B 1  224  ? 12.493  23.024  46.459   1.00 122.97 ? 224  GLU B CD    1 
ATOM   3351  O  OE1   . GLU B 1  224  ? 13.727  23.200  46.372   1.00 120.70 ? 224  GLU B OE1   1 
ATOM   3352  O  OE2   . GLU B 1  224  ? 11.977  22.212  47.256   1.00 125.55 ? 224  GLU B OE2   1 
ATOM   3353  N  N     . LEU B 1  225  ? 13.112  25.994  41.689   1.00 90.15  ? 225  LEU B N     1 
ATOM   3354  C  CA    . LEU B 1  225  ? 14.087  26.888  41.079   1.00 85.32  ? 225  LEU B CA    1 
ATOM   3355  C  C     . LEU B 1  225  ? 13.475  28.109  40.389   1.00 82.76  ? 225  LEU B C     1 
ATOM   3356  O  O     . LEU B 1  225  ? 14.150  29.125  40.238   1.00 83.67  ? 225  LEU B O     1 
ATOM   3357  C  CB    . LEU B 1  225  ? 14.954  26.110  40.084   1.00 80.02  ? 225  LEU B CB    1 
ATOM   3358  C  CG    . LEU B 1  225  ? 15.974  25.136  40.685   1.00 72.21  ? 225  LEU B CG    1 
ATOM   3359  C  CD1   . LEU B 1  225  ? 16.641  24.308  39.599   1.00 69.04  ? 225  LEU B CD1   1 
ATOM   3360  C  CD2   . LEU B 1  225  ? 17.018  25.884  41.496   1.00 65.64  ? 225  LEU B CD2   1 
ATOM   3361  N  N     . ASN B 1  226  ? 12.208  28.033  39.985   1.00 85.01  ? 226  ASN B N     1 
ATOM   3362  C  CA    . ASN B 1  226  ? 11.624  29.131  39.214   1.00 86.62  ? 226  ASN B CA    1 
ATOM   3363  C  C     . ASN B 1  226  ? 10.096  29.182  39.176   1.00 87.03  ? 226  ASN B C     1 
ATOM   3364  O  O     . ASN B 1  226  ? 9.525   30.271  39.124   1.00 81.44  ? 226  ASN B O     1 
ATOM   3365  C  CB    . ASN B 1  226  ? 12.150  29.072  37.775   1.00 91.62  ? 226  ASN B CB    1 
ATOM   3366  C  CG    . ASN B 1  226  ? 12.085  30.417  37.064   1.00 102.22 ? 226  ASN B CG    1 
ATOM   3367  O  OD1   . ASN B 1  226  ? 11.383  31.334  37.493   1.00 102.02 ? 226  ASN B OD1   1 
ATOM   3368  N  ND2   . ASN B 1  226  ? 12.821  30.534  35.963   1.00 101.31 ? 226  ASN B ND2   1 
ATOM   3369  N  N     . VAL B 1  227  ? 9.457   28.011  39.232   1.00 91.51  ? 227  VAL B N     1 
ATOM   3370  C  CA    . VAL B 1  227  ? 8.037   27.817  38.887   1.00 101.72 ? 227  VAL B CA    1 
ATOM   3371  C  C     . VAL B 1  227  ? 7.590   28.783  37.773   1.00 103.92 ? 227  VAL B C     1 
ATOM   3372  O  O     . VAL B 1  227  ? 7.107   29.890  38.025   1.00 95.81  ? 227  VAL B O     1 
ATOM   3373  C  CB    . VAL B 1  227  ? 7.097   27.923  40.147   1.00 95.99  ? 227  VAL B CB    1 
ATOM   3374  C  CG1   . VAL B 1  227  ? 7.326   29.198  40.961   1.00 97.36  ? 227  VAL B CG1   1 
ATOM   3375  C  CG2   . VAL B 1  227  ? 5.628   27.773  39.753   1.00 87.55  ? 227  VAL B CG2   1 
ATOM   3376  N  N     . GLU B 1  228  ? 7.777   28.345  36.528   1.00 110.28 ? 228  GLU B N     1 
ATOM   3377  C  CA    . GLU B 1  228  ? 7.558   29.198  35.361   1.00 110.13 ? 228  GLU B CA    1 
ATOM   3378  C  C     . GLU B 1  228  ? 6.207   28.973  34.682   1.00 109.68 ? 228  GLU B C     1 
ATOM   3379  O  O     . GLU B 1  228  ? 5.290   29.782  34.829   1.00 108.90 ? 228  GLU B O     1 
ATOM   3380  C  CB    . GLU B 1  228  ? 8.681   28.995  34.334   1.00 107.06 ? 228  GLU B CB    1 
ATOM   3381  C  CG    . GLU B 1  228  ? 8.549   29.881  33.096   1.00 107.15 ? 228  GLU B CG    1 
ATOM   3382  C  CD    . GLU B 1  228  ? 9.646   29.648  32.065   1.00 91.61  ? 228  GLU B CD    1 
ATOM   3383  O  OE1   . GLU B 1  228  ? 10.692  29.059  32.414   1.00 80.28  ? 228  GLU B OE1   1 
ATOM   3384  O  OE2   . GLU B 1  228  ? 9.460   30.056  30.899   1.00 86.73  ? 228  GLU B OE2   1 
ATOM   3385  N  N     . ALA B 1  229  ? 6.085   27.878  33.934   1.00 108.77 ? 229  ALA B N     1 
ATOM   3386  C  CA    . ALA B 1  229  ? 4.902   27.671  33.103   1.00 110.54 ? 229  ALA B CA    1 
ATOM   3387  C  C     . ALA B 1  229  ? 4.478   26.207  32.971   1.00 114.22 ? 229  ALA B C     1 
ATOM   3388  O  O     . ALA B 1  229  ? 5.313   25.307  32.858   1.00 97.42  ? 229  ALA B O     1 
ATOM   3389  C  CB    . ALA B 1  229  ? 5.135   28.267  31.719   1.00 104.14 ? 229  ALA B CB    1 
ATOM   3390  N  N     . GLU B 1  230  ? 3.160   26.008  32.982   1.00 126.12 ? 230  GLU B N     1 
ATOM   3391  C  CA    . GLU B 1  230  ? 2.499   24.721  32.764   1.00 118.30 ? 230  GLU B CA    1 
ATOM   3392  C  C     . GLU B 1  230  ? 0.987   24.953  32.781   1.00 116.00 ? 230  GLU B C     1 
ATOM   3393  O  O     . GLU B 1  230  ? 0.511   25.846  33.479   1.00 123.31 ? 230  GLU B O     1 
ATOM   3394  C  CB    . GLU B 1  230  ? 2.900   23.693  33.828   1.00 110.19 ? 230  GLU B CB    1 
ATOM   3395  C  CG    . GLU B 1  230  ? 2.140   22.375  33.742   1.00 103.37 ? 230  GLU B CG    1 
ATOM   3396  C  CD    . GLU B 1  230  ? 2.189   21.760  32.355   1.00 97.44  ? 230  GLU B CD    1 
ATOM   3397  O  OE1   . GLU B 1  230  ? 3.251   21.843  31.702   1.00 95.36  ? 230  GLU B OE1   1 
ATOM   3398  O  OE2   . GLU B 1  230  ? 1.162   21.202  31.915   1.00 97.34  ? 230  GLU B OE2   1 
ATOM   3399  N  N     . GLY B 1  231  ? 0.232   24.167  32.018   1.00 107.74 ? 231  GLY B N     1 
ATOM   3400  C  CA    . GLY B 1  231  ? -1.211  24.336  31.975   1.00 112.47 ? 231  GLY B CA    1 
ATOM   3401  C  C     . GLY B 1  231  ? -2.027  23.069  32.166   1.00 118.64 ? 231  GLY B C     1 
ATOM   3402  O  O     . GLY B 1  231  ? -1.814  22.074  31.476   1.00 122.92 ? 231  GLY B O     1 
ATOM   3403  N  N     . ILE B 1  232  ? -2.969  23.111  33.106   1.00 121.65 ? 232  ILE B N     1 
ATOM   3404  C  CA    . ILE B 1  232  ? -3.909  22.010  33.314   1.00 119.09 ? 232  ILE B CA    1 
ATOM   3405  C  C     . ILE B 1  232  ? -5.344  22.527  33.375   1.00 121.04 ? 232  ILE B C     1 
ATOM   3406  O  O     . ILE B 1  232  ? -5.677  23.364  34.216   1.00 124.49 ? 232  ILE B O     1 
ATOM   3407  C  CB    . ILE B 1  232  ? -3.608  21.227  34.607   1.00 113.76 ? 232  ILE B CB    1 
ATOM   3408  C  CG1   . ILE B 1  232  ? -2.340  20.390  34.444   1.00 105.53 ? 232  ILE B CG1   1 
ATOM   3409  C  CG2   . ILE B 1  232  ? -4.782  20.325  34.972   1.00 111.67 ? 232  ILE B CG2   1 
ATOM   3410  C  CD1   . ILE B 1  232  ? -2.471  19.280  33.424   1.00 105.73 ? 232  ILE B CD1   1 
ATOM   3411  N  N     . SER C 2  28   ? 43.758  10.756  -2.451   1.00 87.08  ? 28   SER C N     1 
ATOM   3412  C  CA    . SER C 2  28   ? 42.667  11.265  -3.271   1.00 82.30  ? 28   SER C CA    1 
ATOM   3413  C  C     . SER C 2  28   ? 42.275  10.251  -4.342   1.00 91.50  ? 28   SER C C     1 
ATOM   3414  O  O     . SER C 2  28   ? 43.089  9.422   -4.750   1.00 97.28  ? 28   SER C O     1 
ATOM   3415  C  CB    . SER C 2  28   ? 43.060  12.596  -3.914   1.00 79.11  ? 28   SER C CB    1 
ATOM   3416  N  N     . ASN C 2  29   ? 41.026  10.318  -4.793   1.00 87.73  ? 29   ASN C N     1 
ATOM   3417  C  CA    . ASN C 2  29   ? 40.527  9.387   -5.800   1.00 90.38  ? 29   ASN C CA    1 
ATOM   3418  C  C     . ASN C 2  29   ? 40.556  9.990   -7.202   1.00 95.71  ? 29   ASN C C     1 
ATOM   3419  O  O     . ASN C 2  29   ? 41.469  9.724   -7.987   1.00 92.62  ? 29   ASN C O     1 
ATOM   3420  C  CB    . ASN C 2  29   ? 39.106  8.937   -5.454   1.00 76.79  ? 29   ASN C CB    1 
ATOM   3421  N  N     . ASN C 2  30   ? 39.551  10.805  -7.510   1.00 98.37  ? 30   ASN C N     1 
ATOM   3422  C  CA    . ASN C 2  30   ? 39.461  11.461  -8.809   1.00 95.01  ? 30   ASN C CA    1 
ATOM   3423  C  C     . ASN C 2  30   ? 39.916  12.915  -8.739   1.00 86.67  ? 30   ASN C C     1 
ATOM   3424  O  O     . ASN C 2  30   ? 39.099  13.834  -8.659   1.00 80.73  ? 30   ASN C O     1 
ATOM   3425  C  CB    . ASN C 2  30   ? 38.030  11.381  -9.345   1.00 92.72  ? 30   ASN C CB    1 
ATOM   3426  C  CG    . ASN C 2  30   ? 37.548  9.950   -9.510   1.00 94.54  ? 30   ASN C CG    1 
ATOM   3427  O  OD1   . ASN C 2  30   ? 37.191  9.285   -8.536   1.00 92.90  ? 30   ASN C OD1   1 
ATOM   3428  N  ND2   . ASN C 2  30   ? 37.535  9.469   -10.748  1.00 97.56  ? 30   ASN C ND2   1 
ATOM   3429  N  N     . SER C 2  31   ? 41.228  13.116  -8.772   1.00 80.89  ? 31   SER C N     1 
ATOM   3430  C  CA    . SER C 2  31   ? 41.804  14.448  -8.644   1.00 84.74  ? 31   SER C CA    1 
ATOM   3431  C  C     . SER C 2  31   ? 41.844  15.159  -9.997   1.00 81.62  ? 31   SER C C     1 
ATOM   3432  O  O     . SER C 2  31   ? 42.891  15.645  -10.423  1.00 90.70  ? 31   SER C O     1 
ATOM   3433  C  CB    . SER C 2  31   ? 43.211  14.358  -8.047   1.00 85.74  ? 31   SER C CB    1 
ATOM   3434  O  OG    . SER C 2  31   ? 43.229  13.530  -6.896   1.00 76.18  ? 31   SER C OG    1 
ATOM   3435  N  N     . VAL C 2  32   ? 40.698  15.220  -10.668  1.00 70.42  ? 32   VAL C N     1 
ATOM   3436  C  CA    . VAL C 2  32   ? 40.650  15.713  -12.044  1.00 64.93  ? 32   VAL C CA    1 
ATOM   3437  C  C     . VAL C 2  32   ? 39.776  16.963  -12.287  1.00 57.43  ? 32   VAL C C     1 
ATOM   3438  O  O     . VAL C 2  32   ? 40.216  17.880  -12.983  1.00 56.44  ? 32   VAL C O     1 
ATOM   3439  C  CB    . VAL C 2  32   ? 40.174  14.598  -13.004  1.00 62.39  ? 32   VAL C CB    1 
ATOM   3440  C  CG1   . VAL C 2  32   ? 40.555  14.937  -14.438  1.00 63.65  ? 32   VAL C CG1   1 
ATOM   3441  C  CG2   . VAL C 2  32   ? 40.766  13.256  -12.600  1.00 60.83  ? 32   VAL C CG2   1 
ATOM   3442  N  N     . PRO C 2  33   ? 38.545  17.014  -11.730  1.00 47.24  ? 33   PRO C N     1 
ATOM   3443  C  CA    . PRO C 2  33   ? 37.681  18.136  -12.127  1.00 40.46  ? 33   PRO C CA    1 
ATOM   3444  C  C     . PRO C 2  33   ? 37.716  19.372  -11.214  1.00 36.62  ? 33   PRO C C     1 
ATOM   3445  O  O     . PRO C 2  33   ? 37.580  20.490  -11.712  1.00 34.76  ? 33   PRO C O     1 
ATOM   3446  C  CB    . PRO C 2  33   ? 36.277  17.514  -12.103  1.00 39.06  ? 33   PRO C CB    1 
ATOM   3447  C  CG    . PRO C 2  33   ? 36.426  16.155  -11.418  1.00 41.44  ? 33   PRO C CG    1 
ATOM   3448  C  CD    . PRO C 2  33   ? 37.812  16.069  -10.873  1.00 45.94  ? 33   PRO C CD    1 
ATOM   3449  N  N     . GLY C 2  34   ? 37.888  19.174  -9.911   1.00 37.41  ? 34   GLY C N     1 
ATOM   3450  C  CA    . GLY C 2  34   ? 37.753  20.247  -8.938   1.00 34.22  ? 34   GLY C CA    1 
ATOM   3451  C  C     . GLY C 2  34   ? 36.788  19.808  -7.850   1.00 34.78  ? 34   GLY C C     1 
ATOM   3452  O  O     . GLY C 2  34   ? 35.975  20.591  -7.350   1.00 29.27  ? 34   GLY C O     1 
ATOM   3453  N  N     . ALA C 2  35   ? 36.895  18.533  -7.486   1.00 43.68  ? 35   ALA C N     1 
ATOM   3454  C  CA    . ALA C 2  35   ? 35.968  17.885  -6.559   1.00 42.21  ? 35   ALA C CA    1 
ATOM   3455  C  C     . ALA C 2  35   ? 36.500  17.848  -5.130   1.00 41.94  ? 35   ALA C C     1 
ATOM   3456  O  O     . ALA C 2  35   ? 37.715  17.858  -4.923   1.00 46.36  ? 35   ALA C O     1 
ATOM   3457  C  CB    . ALA C 2  35   ? 35.672  16.474  -7.034   1.00 41.83  ? 35   ALA C CB    1 
ATOM   3458  N  N     . PRO C 2  36   ? 35.590  17.814  -4.140   1.00 36.37  ? 36   PRO C N     1 
ATOM   3459  C  CA    . PRO C 2  36   ? 36.008  17.636  -2.746   1.00 38.74  ? 36   PRO C CA    1 
ATOM   3460  C  C     . PRO C 2  36   ? 36.811  16.345  -2.558   1.00 40.21  ? 36   PRO C C     1 
ATOM   3461  O  O     . PRO C 2  36   ? 36.474  15.326  -3.161   1.00 39.65  ? 36   PRO C O     1 
ATOM   3462  C  CB    . PRO C 2  36   ? 34.679  17.580  -1.988   1.00 37.38  ? 36   PRO C CB    1 
ATOM   3463  C  CG    . PRO C 2  36   ? 33.651  17.240  -3.027   1.00 35.07  ? 36   PRO C CG    1 
ATOM   3464  C  CD    . PRO C 2  36   ? 34.126  17.922  -4.261   1.00 33.88  ? 36   PRO C CD    1 
ATOM   3465  N  N     . ASN C 2  37   ? 37.858  16.390  -1.738   1.00 38.75  ? 37   ASN C N     1 
ATOM   3466  C  CA    . ASN C 2  37   ? 38.750  15.243  -1.584   1.00 39.31  ? 37   ASN C CA    1 
ATOM   3467  C  C     . ASN C 2  37   ? 38.077  14.073  -0.881   1.00 37.16  ? 37   ASN C C     1 
ATOM   3468  O  O     . ASN C 2  37   ? 37.771  14.141  0.310    1.00 35.27  ? 37   ASN C O     1 
ATOM   3469  C  CB    . ASN C 2  37   ? 40.019  15.637  -0.821   1.00 54.57  ? 37   ASN C CB    1 
ATOM   3470  C  CG    . ASN C 2  37   ? 41.062  14.527  -0.810   1.00 60.24  ? 37   ASN C CG    1 
ATOM   3471  O  OD1   . ASN C 2  37   ? 41.019  13.613  -1.635   1.00 58.89  ? 37   ASN C OD1   1 
ATOM   3472  N  ND2   . ASN C 2  37   ? 42.002  14.602  0.130    1.00 65.61  ? 37   ASN C ND2   1 
ATOM   3473  N  N     . ARG C 2  38   ? 37.845  13.003  -1.633   1.00 38.69  ? 38   ARG C N     1 
ATOM   3474  C  CA    . ARG C 2  38   ? 37.305  11.773  -1.075   1.00 39.29  ? 38   ARG C CA    1 
ATOM   3475  C  C     . ARG C 2  38   ? 38.403  10.714  -1.062   1.00 42.87  ? 38   ARG C C     1 
ATOM   3476  O  O     . ARG C 2  38   ? 38.686  10.083  -2.080   1.00 45.38  ? 38   ARG C O     1 
ATOM   3477  C  CB    . ARG C 2  38   ? 36.085  11.300  -1.877   1.00 38.01  ? 38   ARG C CB    1 
ATOM   3478  C  CG    . ARG C 2  38   ? 35.258  10.217  -1.188   1.00 36.64  ? 38   ARG C CG    1 
ATOM   3479  C  CD    . ARG C 2  38   ? 33.938  9.944   -1.912   1.00 34.66  ? 38   ARG C CD    1 
ATOM   3480  N  NE    . ARG C 2  38   ? 32.951  10.993  -1.675   1.00 33.91  ? 38   ARG C NE    1 
ATOM   3481  C  CZ    . ARG C 2  38   ? 32.087  10.991  -0.666   1.00 30.77  ? 38   ARG C CZ    1 
ATOM   3482  N  NH1   . ARG C 2  38   ? 31.228  11.990  -0.529   1.00 31.12  ? 38   ARG C NH1   1 
ATOM   3483  N  NH2   . ARG C 2  38   ? 32.080  9.992   0.207    1.00 29.10  ? 38   ARG C NH2   1 
ATOM   3484  N  N     . VAL C 2  39   ? 39.025  10.545  0.101    1.00 43.95  ? 39   VAL C N     1 
ATOM   3485  C  CA    . VAL C 2  39   ? 40.150  9.632   0.267    1.00 47.98  ? 39   VAL C CA    1 
ATOM   3486  C  C     . VAL C 2  39   ? 39.727  8.196   -0.030   1.00 41.96  ? 39   VAL C C     1 
ATOM   3487  O  O     . VAL C 2  39   ? 38.558  7.847   0.119    1.00 42.17  ? 39   VAL C O     1 
ATOM   3488  C  CB    . VAL C 2  39   ? 40.728  9.724   1.689    1.00 49.96  ? 39   VAL C CB    1 
ATOM   3489  C  CG1   . VAL C 2  39   ? 42.175  9.282   1.695    1.00 56.52  ? 39   VAL C CG1   1 
ATOM   3490  C  CG2   . VAL C 2  39   ? 40.619  11.152  2.206    1.00 47.10  ? 39   VAL C CG2   1 
ATOM   3491  N  N     . SER C 2  40   ? 40.670  7.362   -0.451   1.00 42.19  ? 40   SER C N     1 
ATOM   3492  C  CA    . SER C 2  40   ? 40.303  6.051   -0.968   1.00 38.92  ? 40   SER C CA    1 
ATOM   3493  C  C     . SER C 2  40   ? 41.191  4.905   -0.496   1.00 39.01  ? 40   SER C C     1 
ATOM   3494  O  O     . SER C 2  40   ? 42.393  4.893   -0.757   1.00 42.01  ? 40   SER C O     1 
ATOM   3495  C  CB    . SER C 2  40   ? 40.312  6.088   -2.498   1.00 41.55  ? 40   SER C CB    1 
ATOM   3496  O  OG    . SER C 2  40   ? 40.104  4.797   -3.043   1.00 39.34  ? 40   SER C OG    1 
ATOM   3497  N  N     . PHE C 2  41   ? 40.596  3.940   0.197    1.00 36.61  ? 41   PHE C N     1 
ATOM   3498  C  CA    . PHE C 2  41   ? 41.238  2.646   0.370    1.00 35.10  ? 41   PHE C CA    1 
ATOM   3499  C  C     . PHE C 2  41   ? 41.358  2.043   -1.024   1.00 36.05  ? 41   PHE C C     1 
ATOM   3500  O  O     . PHE C 2  41   ? 40.343  1.737   -1.642   1.00 38.00  ? 41   PHE C O     1 
ATOM   3501  C  CB    . PHE C 2  41   ? 40.426  1.709   1.278    1.00 37.90  ? 41   PHE C CB    1 
ATOM   3502  C  CG    . PHE C 2  41   ? 39.948  2.333   2.568    1.00 38.69  ? 41   PHE C CG    1 
ATOM   3503  C  CD1   . PHE C 2  41   ? 40.577  2.042   3.769    1.00 41.05  ? 41   PHE C CD1   1 
ATOM   3504  C  CD2   . PHE C 2  41   ? 38.842  3.168   2.586    1.00 40.38  ? 41   PHE C CD2   1 
ATOM   3505  C  CE1   . PHE C 2  41   ? 40.133  2.598   4.958    1.00 43.61  ? 41   PHE C CE1   1 
ATOM   3506  C  CE2   . PHE C 2  41   ? 38.394  3.727   3.770    1.00 39.73  ? 41   PHE C CE2   1 
ATOM   3507  C  CZ    . PHE C 2  41   ? 39.040  3.439   4.958    1.00 41.11  ? 41   PHE C CZ    1 
ATOM   3508  N  N     . ALA C 2  42   ? 42.572  1.881   -1.539   1.00 35.73  ? 42   ALA C N     1 
ATOM   3509  C  CA    . ALA C 2  42   ? 42.716  1.367   -2.898   1.00 40.36  ? 42   ALA C CA    1 
ATOM   3510  C  C     . ALA C 2  42   ? 44.126  0.913   -3.239   1.00 48.25  ? 42   ALA C C     1 
ATOM   3511  O  O     . ALA C 2  42   ? 45.086  1.226   -2.535   1.00 49.70  ? 42   ALA C O     1 
ATOM   3512  C  CB    . ALA C 2  42   ? 42.267  2.427   -3.903   1.00 38.35  ? 42   ALA C CB    1 
ATOM   3513  N  N     . LYS C 2  43   ? 44.226  0.153   -4.325   1.00 49.88  ? 43   LYS C N     1 
ATOM   3514  C  CA    . LYS C 2  43   ? 45.476  0.007   -5.051   1.00 48.64  ? 43   LYS C CA    1 
ATOM   3515  C  C     . LYS C 2  43   ? 45.457  1.104   -6.112   1.00 54.42  ? 43   LYS C C     1 
ATOM   3516  O  O     . LYS C 2  43   ? 44.384  1.475   -6.591   1.00 56.46  ? 43   LYS C O     1 
ATOM   3517  C  CB    . LYS C 2  43   ? 45.616  -1.382  -5.676   1.00 40.59  ? 43   LYS C CB    1 
ATOM   3518  C  CG    . LYS C 2  43   ? 45.077  -1.505  -7.094   1.00 42.80  ? 43   LYS C CG    1 
ATOM   3519  C  CD    . LYS C 2  43   ? 45.567  -2.781  -7.756   1.00 47.86  ? 43   LYS C CD    1 
ATOM   3520  C  CE    . LYS C 2  43   ? 45.178  -2.840  -9.222   1.00 45.26  ? 43   LYS C CE    1 
ATOM   3521  N  NZ    . LYS C 2  43   ? 45.781  -4.017  -9.911   1.00 48.33  ? 43   LYS C NZ    1 
ATOM   3522  N  N     . LEU C 2  44   ? 46.622  1.641   -6.464   1.00 58.83  ? 44   LEU C N     1 
ATOM   3523  C  CA    . LEU C 2  44   ? 46.676  2.851   -7.288   1.00 55.24  ? 44   LEU C CA    1 
ATOM   3524  C  C     . LEU C 2  44   ? 46.076  2.612   -8.672   1.00 56.10  ? 44   LEU C C     1 
ATOM   3525  O  O     . LEU C 2  44   ? 46.624  1.871   -9.486   1.00 55.35  ? 44   LEU C O     1 
ATOM   3526  C  CB    . LEU C 2  44   ? 48.119  3.359   -7.404   1.00 62.15  ? 44   LEU C CB    1 
ATOM   3527  C  CG    . LEU C 2  44   ? 48.345  4.867   -7.571   1.00 57.14  ? 44   LEU C CG    1 
ATOM   3528  C  CD1   . LEU C 2  44   ? 49.734  5.259   -7.090   1.00 52.13  ? 44   LEU C CD1   1 
ATOM   3529  C  CD2   . LEU C 2  44   ? 48.152  5.301   -9.013   1.00 68.29  ? 44   LEU C CD2   1 
ATOM   3530  N  N     . ARG C 2  45   ? 44.938  3.250   -8.924   1.00 65.67  ? 45   ARG C N     1 
ATOM   3531  C  CA    . ARG C 2  45   ? 44.234  3.101   -10.189  1.00 71.22  ? 45   ARG C CA    1 
ATOM   3532  C  C     . ARG C 2  45   ? 44.523  4.270   -11.120  1.00 71.09  ? 45   ARG C C     1 
ATOM   3533  O  O     . ARG C 2  45   ? 43.851  5.303   -11.073  1.00 76.64  ? 45   ARG C O     1 
ATOM   3534  C  CB    . ARG C 2  45   ? 42.726  2.973   -9.954   1.00 89.65  ? 45   ARG C CB    1 
ATOM   3535  C  CG    . ARG C 2  45   ? 41.918  2.742   -11.226  1.00 85.41  ? 45   ARG C CG    1 
ATOM   3536  C  CD    . ARG C 2  45   ? 40.418  2.764   -10.959  1.00 80.35  ? 45   ARG C CD    1 
ATOM   3537  N  NE    . ARG C 2  45   ? 39.977  4.034   -10.388  1.00 84.36  ? 45   ARG C NE    1 
ATOM   3538  C  CZ    . ARG C 2  45   ? 39.643  5.104   -11.102  1.00 82.56  ? 45   ARG C CZ    1 
ATOM   3539  N  NH1   . ARG C 2  45   ? 39.250  6.213   -10.486  1.00 82.30  ? 45   ARG C NH1   1 
ATOM   3540  N  NH2   . ARG C 2  45   ? 39.696  5.061   -12.429  1.00 74.41  ? 45   ARG C NH2   1 
ATOM   3541  N  N     . GLU C 2  46   ? 45.542  4.099   -11.955  1.00 66.80  ? 46   GLU C N     1 
ATOM   3542  C  CA    . GLU C 2  46   ? 45.839  5.059   -13.008  1.00 77.36  ? 46   GLU C CA    1 
ATOM   3543  C  C     . GLU C 2  46   ? 45.774  4.506   -14.451  1.00 71.57  ? 46   GLU C C     1 
ATOM   3544  O  O     . GLU C 2  46   ? 46.472  5.030   -15.320  1.00 83.56  ? 46   GLU C O     1 
ATOM   3545  C  CB    . GLU C 2  46   ? 47.234  5.666   -12.773  1.00 88.41  ? 46   GLU C CB    1 
ATOM   3546  C  CG    . GLU C 2  46   ? 48.388  4.659   -12.889  1.00 92.55  ? 46   GLU C CG    1 
ATOM   3547  C  CD    . GLU C 2  46   ? 49.764  5.310   -12.789  1.00 78.78  ? 46   GLU C CD    1 
ATOM   3548  O  OE1   . GLU C 2  46   ? 50.555  5.181   -13.747  1.00 60.34  ? 46   GLU C OE1   1 
ATOM   3549  O  OE2   . GLU C 2  46   ? 50.060  5.944   -11.754  1.00 75.68  ? 46   GLU C OE2   1 
ATOM   3550  N  N     . PRO C 2  47   ? 44.956  3.461   -14.729  1.00 58.25  ? 47   PRO C N     1 
ATOM   3551  C  CA    . PRO C 2  47   ? 44.958  3.125   -16.160  1.00 56.36  ? 47   PRO C CA    1 
ATOM   3552  C  C     . PRO C 2  47   ? 44.307  4.215   -17.018  1.00 52.20  ? 47   PRO C C     1 
ATOM   3553  O  O     . PRO C 2  47   ? 45.011  4.942   -17.720  1.00 58.67  ? 47   PRO C O     1 
ATOM   3554  C  CB    . PRO C 2  47   ? 44.156  1.822   -16.212  1.00 51.52  ? 47   PRO C CB    1 
ATOM   3555  C  CG    . PRO C 2  47   ? 44.274  1.256   -14.834  1.00 49.87  ? 47   PRO C CG    1 
ATOM   3556  C  CD    . PRO C 2  47   ? 44.224  2.446   -13.947  1.00 54.33  ? 47   PRO C CD    1 
ATOM   3557  N  N     . LEU C 2  48   ? 42.985  4.324   -16.964  1.00 47.57  ? 48   LEU C N     1 
ATOM   3558  C  CA    . LEU C 2  48   ? 42.293  5.418   -17.630  1.00 43.30  ? 48   LEU C CA    1 
ATOM   3559  C  C     . LEU C 2  48   ? 41.049  5.804   -16.845  1.00 43.89  ? 48   LEU C C     1 
ATOM   3560  O  O     . LEU C 2  48   ? 40.363  4.947   -16.288  1.00 42.58  ? 48   LEU C O     1 
ATOM   3561  C  CB    . LEU C 2  48   ? 41.940  5.059   -19.086  1.00 41.34  ? 48   LEU C CB    1 
ATOM   3562  C  CG    . LEU C 2  48   ? 41.088  3.872   -19.580  1.00 41.21  ? 48   LEU C CG    1 
ATOM   3563  C  CD1   . LEU C 2  48   ? 41.650  2.516   -19.162  1.00 37.60  ? 48   LEU C CD1   1 
ATOM   3564  C  CD2   . LEU C 2  48   ? 39.613  3.986   -19.207  1.00 42.85  ? 48   LEU C CD2   1 
ATOM   3565  N  N     . GLU C 2  49   ? 40.784  7.105   -16.790  1.00 50.16  ? 49   GLU C N     1 
ATOM   3566  C  CA    . GLU C 2  49   ? 39.594  7.629   -16.135  1.00 54.85  ? 49   GLU C CA    1 
ATOM   3567  C  C     . GLU C 2  49   ? 38.341  7.061   -16.798  1.00 47.82  ? 49   GLU C C     1 
ATOM   3568  O  O     . GLU C 2  49   ? 38.382  6.631   -17.953  1.00 46.66  ? 49   GLU C O     1 
ATOM   3569  C  CB    . GLU C 2  49   ? 39.580  9.160   -16.193  1.00 64.03  ? 49   GLU C CB    1 
ATOM   3570  C  CG    . GLU C 2  49   ? 40.848  9.826   -15.658  1.00 81.83  ? 49   GLU C CG    1 
ATOM   3571  C  CD    . GLU C 2  49   ? 40.953  11.292  -16.056  1.00 94.16  ? 49   GLU C CD    1 
ATOM   3572  O  OE1   . GLU C 2  49   ? 40.198  11.719  -16.955  1.00 98.44  ? 49   GLU C OE1   1 
ATOM   3573  O  OE2   . GLU C 2  49   ? 41.790  12.017  -15.475  1.00 101.74 ? 49   GLU C OE2   1 
ATOM   3574  N  N     . VAL C 2  50   ? 37.240  7.038   -16.054  1.00 43.42  ? 50   VAL C N     1 
ATOM   3575  C  CA    . VAL C 2  50   ? 35.948  6.634   -16.593  1.00 36.76  ? 50   VAL C CA    1 
ATOM   3576  C  C     . VAL C 2  50   ? 35.649  7.384   -17.889  1.00 33.74  ? 50   VAL C C     1 
ATOM   3577  O  O     . VAL C 2  50   ? 35.451  8.600   -17.871  1.00 34.44  ? 50   VAL C O     1 
ATOM   3578  C  CB    . VAL C 2  50   ? 34.817  6.889   -15.576  1.00 36.63  ? 50   VAL C CB    1 
ATOM   3579  C  CG1   . VAL C 2  50   ? 33.458  6.617   -16.206  1.00 36.15  ? 50   VAL C CG1   1 
ATOM   3580  C  CG2   . VAL C 2  50   ? 35.025  6.044   -14.322  1.00 38.00  ? 50   VAL C CG2   1 
ATOM   3581  N  N     . PRO C 2  51   ? 35.637  6.662   -19.020  1.00 28.75  ? 51   PRO C N     1 
ATOM   3582  C  CA    . PRO C 2  51   ? 35.389  7.303   -20.316  1.00 29.72  ? 51   PRO C CA    1 
ATOM   3583  C  C     . PRO C 2  51   ? 34.005  7.950   -20.355  1.00 29.17  ? 51   PRO C C     1 
ATOM   3584  O  O     . PRO C 2  51   ? 33.168  7.596   -19.526  1.00 28.28  ? 51   PRO C O     1 
ATOM   3585  C  CB    . PRO C 2  51   ? 35.501  6.140   -21.306  1.00 26.09  ? 51   PRO C CB    1 
ATOM   3586  C  CG    . PRO C 2  51   ? 35.195  4.926   -20.496  1.00 25.23  ? 51   PRO C CG    1 
ATOM   3587  C  CD    . PRO C 2  51   ? 35.758  5.199   -19.140  1.00 26.87  ? 51   PRO C CD    1 
ATOM   3588  N  N     . GLY C 2  52   ? 33.785  8.890   -21.273  1.00 27.63  ? 52   GLY C N     1 
ATOM   3589  C  CA    . GLY C 2  52   ? 32.509  9.577   -21.382  1.00 27.40  ? 52   GLY C CA    1 
ATOM   3590  C  C     . GLY C 2  52   ? 31.346  8.608   -21.353  1.00 26.98  ? 52   GLY C C     1 
ATOM   3591  O  O     . GLY C 2  52   ? 31.150  7.835   -22.288  1.00 27.28  ? 52   GLY C O     1 
ATOM   3592  N  N     . LEU C 2  53   ? 30.592  8.636   -20.259  1.00 26.11  ? 53   LEU C N     1 
ATOM   3593  C  CA    . LEU C 2  53   ? 29.498  7.695   -20.054  1.00 28.98  ? 53   LEU C CA    1 
ATOM   3594  C  C     . LEU C 2  53   ? 28.448  7.785   -21.157  1.00 29.71  ? 53   LEU C C     1 
ATOM   3595  O  O     . LEU C 2  53   ? 27.964  6.765   -21.648  1.00 29.75  ? 53   LEU C O     1 
ATOM   3596  C  CB    . LEU C 2  53   ? 28.847  7.933   -18.689  1.00 28.62  ? 53   LEU C CB    1 
ATOM   3597  C  CG    . LEU C 2  53   ? 29.677  7.512   -17.473  1.00 29.78  ? 53   LEU C CG    1 
ATOM   3598  C  CD1   . LEU C 2  53   ? 29.030  7.973   -16.176  1.00 31.35  ? 53   LEU C CD1   1 
ATOM   3599  C  CD2   . LEU C 2  53   ? 29.879  6.000   -17.463  1.00 29.80  ? 53   LEU C CD2   1 
ATOM   3600  N  N     . LEU C 2  54   ? 28.115  9.010   -21.553  1.00 29.38  ? 54   LEU C N     1 
ATOM   3601  C  CA    . LEU C 2  54   ? 27.062  9.253   -22.532  1.00 26.10  ? 54   LEU C CA    1 
ATOM   3602  C  C     . LEU C 2  54   ? 27.528  9.083   -23.977  1.00 26.08  ? 54   LEU C C     1 
ATOM   3603  O  O     . LEU C 2  54   ? 26.781  9.377   -24.908  1.00 25.48  ? 54   LEU C O     1 
ATOM   3604  C  CB    . LEU C 2  54   ? 26.489  10.660  -22.342  1.00 24.00  ? 54   LEU C CB    1 
ATOM   3605  C  CG    . LEU C 2  54   ? 25.627  10.924  -21.107  1.00 23.20  ? 54   LEU C CG    1 
ATOM   3606  C  CD1   . LEU C 2  54   ? 25.159  12.367  -21.079  1.00 29.35  ? 54   LEU C CD1   1 
ATOM   3607  C  CD2   . LEU C 2  54   ? 24.440  9.992   -21.104  1.00 24.84  ? 54   LEU C CD2   1 
ATOM   3608  N  N     . ASP C 2  55   ? 28.752  8.595   -24.159  1.00 33.49  ? 55   ASP C N     1 
ATOM   3609  C  CA    . ASP C 2  55   ? 29.328  8.436   -25.495  1.00 33.76  ? 55   ASP C CA    1 
ATOM   3610  C  C     . ASP C 2  55   ? 28.640  7.344   -26.318  1.00 34.07  ? 55   ASP C C     1 
ATOM   3611  O  O     . ASP C 2  55   ? 28.757  7.320   -27.544  1.00 32.71  ? 55   ASP C O     1 
ATOM   3612  C  CB    . ASP C 2  55   ? 30.829  8.136   -25.400  1.00 33.03  ? 55   ASP C CB    1 
ATOM   3613  C  CG    . ASP C 2  55   ? 31.646  9.350   -24.974  1.00 36.95  ? 55   ASP C CG    1 
ATOM   3614  O  OD1   . ASP C 2  55   ? 31.098  10.220  -24.262  1.00 42.38  ? 55   ASP C OD1   1 
ATOM   3615  O  OD2   . ASP C 2  55   ? 32.836  9.435   -25.350  1.00 39.99  ? 55   ASP C OD2   1 
ATOM   3616  N  N     . VAL C 2  56   ? 27.934  6.438   -25.649  1.00 30.32  ? 56   VAL C N     1 
ATOM   3617  C  CA    . VAL C 2  56   ? 27.187  5.394   -26.345  1.00 28.42  ? 56   VAL C CA    1 
ATOM   3618  C  C     . VAL C 2  56   ? 26.050  6.031   -27.130  1.00 29.10  ? 56   VAL C C     1 
ATOM   3619  O  O     . VAL C 2  56   ? 25.654  5.546   -28.192  1.00 25.97  ? 56   VAL C O     1 
ATOM   3620  C  CB    . VAL C 2  56   ? 26.620  4.349   -25.368  1.00 29.40  ? 56   VAL C CB    1 
ATOM   3621  C  CG1   . VAL C 2  56   ? 26.133  3.114   -26.124  1.00 30.71  ? 56   VAL C CG1   1 
ATOM   3622  C  CG2   . VAL C 2  56   ? 27.669  3.971   -24.335  1.00 30.65  ? 56   VAL C CG2   1 
ATOM   3623  N  N     . GLN C 2  57   ? 25.537  7.131   -26.587  1.00 33.17  ? 57   GLN C N     1 
ATOM   3624  C  CA    . GLN C 2  57   ? 24.480  7.909   -27.220  1.00 33.77  ? 57   GLN C CA    1 
ATOM   3625  C  C     . GLN C 2  57   ? 25.042  8.998   -28.127  1.00 36.61  ? 57   GLN C C     1 
ATOM   3626  O  O     . GLN C 2  57   ? 24.562  9.196   -29.240  1.00 37.10  ? 57   GLN C O     1 
ATOM   3627  C  CB    . GLN C 2  57   ? 23.585  8.555   -26.164  1.00 32.09  ? 57   GLN C CB    1 
ATOM   3628  C  CG    . GLN C 2  57   ? 22.726  7.589   -25.380  1.00 31.36  ? 57   GLN C CG    1 
ATOM   3629  C  CD    . GLN C 2  57   ? 21.446  7.230   -26.102  1.00 33.18  ? 57   GLN C CD    1 
ATOM   3630  O  OE1   . GLN C 2  57   ? 20.934  8.006   -26.911  1.00 33.58  ? 57   GLN C OE1   1 
ATOM   3631  N  NE2   . GLN C 2  57   ? 20.917  6.048   -25.811  1.00 32.25  ? 57   GLN C NE2   1 
ATOM   3632  N  N     . THR C 2  58   ? 26.053  9.709   -27.633  1.00 36.01  ? 58   THR C N     1 
ATOM   3633  C  CA    . THR C 2  58   ? 26.611  10.866  -28.331  1.00 37.39  ? 58   THR C CA    1 
ATOM   3634  C  C     . THR C 2  58   ? 27.243  10.495  -29.669  1.00 37.43  ? 58   THR C C     1 
ATOM   3635  O  O     . THR C 2  58   ? 26.734  10.864  -30.725  1.00 38.69  ? 58   THR C O     1 
ATOM   3636  C  CB    . THR C 2  58   ? 27.675  11.580  -27.474  1.00 35.92  ? 58   THR C CB    1 
ATOM   3637  O  OG1   . THR C 2  58   ? 27.269  11.594  -26.100  1.00 32.96  ? 58   THR C OG1   1 
ATOM   3638  C  CG2   . THR C 2  58   ? 27.887  13.006  -27.956  1.00 33.15  ? 58   THR C CG2   1 
ATOM   3639  N  N     . ASP C 2  59   ? 28.353  9.764   -29.612  1.00 39.96  ? 59   ASP C N     1 
ATOM   3640  C  CA    . ASP C 2  59   ? 29.105  9.394   -30.806  1.00 38.09  ? 59   ASP C CA    1 
ATOM   3641  C  C     . ASP C 2  59   ? 28.233  8.675   -31.833  1.00 35.39  ? 59   ASP C C     1 
ATOM   3642  O  O     . ASP C 2  59   ? 28.437  8.815   -33.040  1.00 33.89  ? 59   ASP C O     1 
ATOM   3643  C  CB    . ASP C 2  59   ? 30.301  8.517   -30.421  1.00 42.92  ? 59   ASP C CB    1 
ATOM   3644  C  CG    . ASP C 2  59   ? 31.215  9.185   -29.406  1.00 41.55  ? 59   ASP C CG    1 
ATOM   3645  O  OD1   . ASP C 2  59   ? 30.793  10.192  -28.798  1.00 43.50  ? 59   ASP C OD1   1 
ATOM   3646  O  OD2   . ASP C 2  59   ? 32.348  8.688   -29.212  1.00 40.10  ? 59   ASP C OD2   1 
ATOM   3647  N  N     . SER C 2  60   ? 27.257  7.917   -31.341  1.00 35.14  ? 60   SER C N     1 
ATOM   3648  C  CA    . SER C 2  60   ? 26.326  7.187   -32.193  1.00 38.46  ? 60   SER C CA    1 
ATOM   3649  C  C     . SER C 2  60   ? 25.539  8.125   -33.099  1.00 40.00  ? 60   SER C C     1 
ATOM   3650  O  O     . SER C 2  60   ? 25.487  7.932   -34.314  1.00 43.11  ? 60   SER C O     1 
ATOM   3651  C  CB    . SER C 2  60   ? 25.358  6.360   -31.343  1.00 35.71  ? 60   SER C CB    1 
ATOM   3652  O  OG    . SER C 2  60   ? 24.321  5.801   -32.138  1.00 35.00  ? 60   SER C OG    1 
ATOM   3653  N  N     . PHE C 2  61   ? 24.938  9.145   -32.499  1.00 37.24  ? 61   PHE C N     1 
ATOM   3654  C  CA    . PHE C 2  61   ? 24.116  10.095  -33.239  1.00 37.46  ? 61   PHE C CA    1 
ATOM   3655  C  C     . PHE C 2  61   ? 24.966  10.993  -34.131  1.00 40.50  ? 61   PHE C C     1 
ATOM   3656  O  O     . PHE C 2  61   ? 24.479  11.537  -35.124  1.00 38.59  ? 61   PHE C O     1 
ATOM   3657  C  CB    . PHE C 2  61   ? 23.286  10.943  -32.273  1.00 34.92  ? 61   PHE C CB    1 
ATOM   3658  C  CG    . PHE C 2  61   ? 22.354  11.900  -32.954  1.00 31.75  ? 61   PHE C CG    1 
ATOM   3659  C  CD1   . PHE C 2  61   ? 22.613  13.258  -32.955  1.00 32.04  ? 61   PHE C CD1   1 
ATOM   3660  C  CD2   . PHE C 2  61   ? 21.219  11.439  -33.598  1.00 30.88  ? 61   PHE C CD2   1 
ATOM   3661  C  CE1   . PHE C 2  61   ? 21.754  14.138  -33.582  1.00 31.21  ? 61   PHE C CE1   1 
ATOM   3662  C  CE2   . PHE C 2  61   ? 20.357  12.312  -34.227  1.00 32.90  ? 61   PHE C CE2   1 
ATOM   3663  C  CZ    . PHE C 2  61   ? 20.624  13.663  -34.220  1.00 32.36  ? 61   PHE C CZ    1 
ATOM   3664  N  N     . GLU C 2  62   ? 26.239  11.144  -33.776  1.00 43.59  ? 62   GLU C N     1 
ATOM   3665  C  CA    . GLU C 2  62   ? 27.153  11.968  -34.560  1.00 46.38  ? 62   GLU C CA    1 
ATOM   3666  C  C     . GLU C 2  62   ? 27.513  11.262  -35.858  1.00 44.44  ? 62   GLU C C     1 
ATOM   3667  O  O     . GLU C 2  62   ? 27.642  11.896  -36.907  1.00 43.47  ? 62   GLU C O     1 
ATOM   3668  C  CB    . GLU C 2  62   ? 28.419  12.297  -33.763  1.00 51.96  ? 62   GLU C CB    1 
ATOM   3669  C  CG    . GLU C 2  62   ? 28.165  13.096  -32.490  1.00 58.71  ? 62   GLU C CG    1 
ATOM   3670  C  CD    . GLU C 2  62   ? 29.391  13.862  -32.021  1.00 71.56  ? 62   GLU C CD    1 
ATOM   3671  O  OE1   . GLU C 2  62   ? 29.972  14.610  -32.835  1.00 83.86  ? 62   GLU C OE1   1 
ATOM   3672  O  OE2   . GLU C 2  62   ? 29.776  13.711  -30.841  1.00 73.64  ? 62   GLU C OE2   1 
ATOM   3673  N  N     . TRP C 2  63   ? 27.672  9.945   -35.779  1.00 43.80  ? 63   TRP C N     1 
ATOM   3674  C  CA    . TRP C 2  63   ? 27.925  9.134   -36.964  1.00 47.69  ? 63   TRP C CA    1 
ATOM   3675  C  C     . TRP C 2  63   ? 26.778  9.257   -37.963  1.00 48.44  ? 63   TRP C C     1 
ATOM   3676  O  O     . TRP C 2  63   ? 26.988  9.235   -39.176  1.00 50.86  ? 63   TRP C O     1 
ATOM   3677  C  CB    . TRP C 2  63   ? 28.130  7.667   -36.583  1.00 47.82  ? 63   TRP C CB    1 
ATOM   3678  C  CG    . TRP C 2  63   ? 28.005  6.733   -37.743  1.00 48.90  ? 63   TRP C CG    1 
ATOM   3679  C  CD1   . TRP C 2  63   ? 28.951  6.466   -38.688  1.00 55.37  ? 63   TRP C CD1   1 
ATOM   3680  C  CD2   . TRP C 2  63   ? 26.865  5.937   -38.084  1.00 49.25  ? 63   TRP C CD2   1 
ATOM   3681  N  NE1   . TRP C 2  63   ? 28.471  5.554   -39.596  1.00 50.70  ? 63   TRP C NE1   1 
ATOM   3682  C  CE2   . TRP C 2  63   ? 27.191  5.213   -39.247  1.00 49.28  ? 63   TRP C CE2   1 
ATOM   3683  C  CE3   . TRP C 2  63   ? 25.598  5.770   -37.518  1.00 47.70  ? 63   TRP C CE3   1 
ATOM   3684  C  CZ2   . TRP C 2  63   ? 26.299  4.332   -39.856  1.00 49.06  ? 63   TRP C CZ2   1 
ATOM   3685  C  CZ3   . TRP C 2  63   ? 24.711  4.895   -38.124  1.00 54.28  ? 63   TRP C CZ3   1 
ATOM   3686  C  CH2   . TRP C 2  63   ? 25.067  4.187   -39.281  1.00 51.85  ? 63   TRP C CH2   1 
ATOM   3687  N  N     . LEU C 2  64   ? 25.565  9.389   -37.437  1.00 43.64  ? 64   LEU C N     1 
ATOM   3688  C  CA    . LEU C 2  64   ? 24.371  9.530   -38.261  1.00 41.20  ? 64   LEU C CA    1 
ATOM   3689  C  C     . LEU C 2  64   ? 24.426  10.786  -39.126  1.00 41.95  ? 64   LEU C C     1 
ATOM   3690  O  O     . LEU C 2  64   ? 24.308  10.716  -40.350  1.00 41.69  ? 64   LEU C O     1 
ATOM   3691  C  CB    . LEU C 2  64   ? 23.124  9.563   -37.376  1.00 38.92  ? 64   LEU C CB    1 
ATOM   3692  C  CG    . LEU C 2  64   ? 21.762  9.589   -38.071  1.00 39.18  ? 64   LEU C CG    1 
ATOM   3693  C  CD1   . LEU C 2  64   ? 21.492  8.265   -38.764  1.00 40.33  ? 64   LEU C CD1   1 
ATOM   3694  C  CD2   . LEU C 2  64   ? 20.652  9.917   -37.077  1.00 37.24  ? 64   LEU C CD2   1 
ATOM   3695  N  N     . ILE C 2  65   ? 24.617  11.930  -38.478  1.00 41.85  ? 65   ILE C N     1 
ATOM   3696  C  CA    . ILE C 2  65   ? 24.583  13.223  -39.154  1.00 40.14  ? 65   ILE C CA    1 
ATOM   3697  C  C     . ILE C 2  65   ? 25.854  13.509  -39.945  1.00 40.83  ? 65   ILE C C     1 
ATOM   3698  O  O     . ILE C 2  65   ? 25.827  14.244  -40.932  1.00 38.61  ? 65   ILE C O     1 
ATOM   3699  C  CB    . ILE C 2  65   ? 24.360  14.367  -38.146  1.00 36.95  ? 65   ILE C CB    1 
ATOM   3700  C  CG1   . ILE C 2  65   ? 25.296  14.208  -36.948  1.00 38.78  ? 65   ILE C CG1   1 
ATOM   3701  C  CG2   . ILE C 2  65   ? 22.914  14.398  -37.678  1.00 36.18  ? 65   ILE C CG2   1 
ATOM   3702  C  CD1   . ILE C 2  65   ? 25.016  15.181  -35.822  1.00 43.44  ? 65   ILE C CD1   1 
ATOM   3703  N  N     . GLY C 2  66   ? 26.964  12.923  -39.514  1.00 44.11  ? 66   GLY C N     1 
ATOM   3704  C  CA    . GLY C 2  66   ? 28.249  13.216  -40.117  1.00 48.65  ? 66   GLY C CA    1 
ATOM   3705  C  C     . GLY C 2  66   ? 28.815  14.508  -39.560  1.00 51.97  ? 66   GLY C C     1 
ATOM   3706  O  O     . GLY C 2  66   ? 29.413  15.302  -40.286  1.00 53.95  ? 66   GLY C O     1 
ATOM   3707  N  N     . SER C 2  67   ? 28.620  14.712  -38.261  1.00 56.38  ? 67   SER C N     1 
ATOM   3708  C  CA    . SER C 2  67   ? 29.061  15.926  -37.582  1.00 63.51  ? 67   SER C CA    1 
ATOM   3709  C  C     . SER C 2  67   ? 30.578  16.110  -37.684  1.00 68.71  ? 67   SER C C     1 
ATOM   3710  O  O     . SER C 2  67   ? 31.297  15.163  -38.002  1.00 65.45  ? 67   SER C O     1 
ATOM   3711  C  CB    . SER C 2  67   ? 28.627  15.889  -36.110  1.00 59.19  ? 67   SER C CB    1 
ATOM   3712  O  OG    . SER C 2  67   ? 29.363  14.922  -35.378  1.00 64.76  ? 67   SER C OG    1 
ATOM   3713  N  N     . PRO C 2  68   ? 31.068  17.336  -37.426  1.00 71.43  ? 68   PRO C N     1 
ATOM   3714  C  CA    . PRO C 2  68   ? 32.514  17.595  -37.407  1.00 75.32  ? 68   PRO C CA    1 
ATOM   3715  C  C     . PRO C 2  68   ? 33.285  16.676  -36.463  1.00 71.98  ? 68   PRO C C     1 
ATOM   3716  O  O     . PRO C 2  68   ? 34.240  16.024  -36.887  1.00 69.88  ? 68   PRO C O     1 
ATOM   3717  C  CB    . PRO C 2  68   ? 32.600  19.044  -36.924  1.00 81.21  ? 68   PRO C CB    1 
ATOM   3718  C  CG    . PRO C 2  68   ? 31.339  19.662  -37.407  1.00 88.23  ? 68   PRO C CG    1 
ATOM   3719  C  CD    . PRO C 2  68   ? 30.289  18.585  -37.322  1.00 77.31  ? 68   PRO C CD    1 
ATOM   3720  N  N     . ARG C 2  69   ? 32.862  16.625  -35.203  1.00 73.54  ? 69   ARG C N     1 
ATOM   3721  C  CA    . ARG C 2  69   ? 33.554  15.841  -34.185  1.00 73.73  ? 69   ARG C CA    1 
ATOM   3722  C  C     . ARG C 2  69   ? 33.628  14.363  -34.560  1.00 72.29  ? 69   ARG C C     1 
ATOM   3723  O  O     . ARG C 2  69   ? 34.534  13.651  -34.129  1.00 82.92  ? 69   ARG C O     1 
ATOM   3724  C  CB    . ARG C 2  69   ? 32.867  15.999  -32.824  1.00 85.48  ? 69   ARG C CB    1 
ATOM   3725  C  CG    . ARG C 2  69   ? 32.846  17.426  -32.283  1.00 93.96  ? 69   ARG C CG    1 
ATOM   3726  C  CD    . ARG C 2  69   ? 32.286  17.482  -30.866  1.00 105.51 ? 69   ARG C CD    1 
ATOM   3727  N  NE    . ARG C 2  69   ? 30.871  17.121  -30.807  1.00 112.28 ? 69   ARG C NE    1 
ATOM   3728  C  CZ    . ARG C 2  69   ? 29.882  17.992  -30.630  1.00 107.48 ? 69   ARG C CZ    1 
ATOM   3729  N  NH1   . ARG C 2  69   ? 30.148  19.284  -30.488  1.00 107.16 ? 69   ARG C NH1   1 
ATOM   3730  N  NH2   . ARG C 2  69   ? 28.625  17.569  -30.588  1.00 104.68 ? 69   ARG C NH2   1 
ATOM   3731  N  N     . TRP C 2  70   ? 32.677  13.907  -35.368  1.00 67.16  ? 70   TRP C N     1 
ATOM   3732  C  CA    . TRP C 2  70   ? 32.667  12.519  -35.808  1.00 70.56  ? 70   TRP C CA    1 
ATOM   3733  C  C     . TRP C 2  70   ? 33.775  12.231  -36.815  1.00 74.48  ? 70   TRP C C     1 
ATOM   3734  O  O     . TRP C 2  70   ? 34.532  11.275  -36.654  1.00 82.11  ? 70   TRP C O     1 
ATOM   3735  C  CB    . TRP C 2  70   ? 31.315  12.152  -36.418  1.00 66.11  ? 70   TRP C CB    1 
ATOM   3736  C  CG    . TRP C 2  70   ? 31.347  10.837  -37.141  1.00 63.20  ? 70   TRP C CG    1 
ATOM   3737  C  CD1   . TRP C 2  70   ? 31.329  9.594   -36.582  1.00 58.44  ? 70   TRP C CD1   1 
ATOM   3738  C  CD2   . TRP C 2  70   ? 31.414  10.638  -38.559  1.00 62.88  ? 70   TRP C CD2   1 
ATOM   3739  N  NE1   . TRP C 2  70   ? 31.378  8.634   -37.563  1.00 59.64  ? 70   TRP C NE1   1 
ATOM   3740  C  CE2   . TRP C 2  70   ? 31.430  9.248   -38.786  1.00 61.10  ? 70   TRP C CE2   1 
ATOM   3741  C  CE3   . TRP C 2  70   ? 31.461  11.500  -39.658  1.00 70.08  ? 70   TRP C CE3   1 
ATOM   3742  C  CZ2   . TRP C 2  70   ? 31.489  8.699   -40.065  1.00 64.52  ? 70   TRP C CZ2   1 
ATOM   3743  C  CZ3   . TRP C 2  70   ? 31.520  10.954  -40.929  1.00 73.97  ? 70   TRP C CZ3   1 
ATOM   3744  C  CH2   . TRP C 2  70   ? 31.532  9.566   -41.121  1.00 67.93  ? 70   TRP C CH2   1 
ATOM   3745  N  N     . ARG C 2  71   ? 33.865  13.060  -37.850  1.00 72.67  ? 71   ARG C N     1 
ATOM   3746  C  CA    . ARG C 2  71   ? 34.823  12.836  -38.928  1.00 79.20  ? 71   ARG C CA    1 
ATOM   3747  C  C     . ARG C 2  71   ? 36.258  12.966  -38.423  1.00 87.03  ? 71   ARG C C     1 
ATOM   3748  O  O     . ARG C 2  71   ? 37.173  12.340  -38.959  1.00 84.56  ? 71   ARG C O     1 
ATOM   3749  C  CB    . ARG C 2  71   ? 34.568  13.811  -40.080  1.00 84.60  ? 71   ARG C CB    1 
ATOM   3750  C  CG    . ARG C 2  71   ? 34.949  13.273  -41.452  1.00 87.87  ? 71   ARG C CG    1 
ATOM   3751  C  CD    . ARG C 2  71   ? 34.604  14.270  -42.548  1.00 85.56  ? 71   ARG C CD    1 
ATOM   3752  N  NE    . ARG C 2  71   ? 33.223  14.735  -42.446  1.00 91.68  ? 71   ARG C NE    1 
ATOM   3753  C  CZ    . ARG C 2  71   ? 32.186  14.135  -43.021  1.00 93.73  ? 71   ARG C CZ    1 
ATOM   3754  N  NH1   . ARG C 2  71   ? 32.371  13.038  -43.745  1.00 93.14  ? 71   ARG C NH1   1 
ATOM   3755  N  NH2   . ARG C 2  71   ? 30.964  14.633  -42.869  1.00 88.84  ? 71   ARG C NH2   1 
ATOM   3756  N  N     . GLU C 2  72   ? 36.446  13.785  -37.390  1.00 88.38  ? 72   GLU C N     1 
ATOM   3757  C  CA    . GLU C 2  72   ? 37.739  13.898  -36.721  1.00 92.98  ? 72   GLU C CA    1 
ATOM   3758  C  C     . GLU C 2  72   ? 38.027  12.627  -35.927  1.00 94.09  ? 72   GLU C C     1 
ATOM   3759  O  O     . GLU C 2  72   ? 39.157  12.140  -35.901  1.00 104.10 ? 72   GLU C O     1 
ATOM   3760  C  CB    . GLU C 2  72   ? 37.782  15.120  -35.792  1.00 97.24  ? 72   GLU C CB    1 
ATOM   3761  C  CG    . GLU C 2  72   ? 37.867  16.472  -36.502  1.00 110.33 ? 72   GLU C CG    1 
ATOM   3762  C  CD    . GLU C 2  72   ? 38.276  17.608  -35.570  1.00 108.93 ? 72   GLU C CD    1 
ATOM   3763  O  OE1   . GLU C 2  72   ? 38.792  17.323  -34.468  1.00 111.91 ? 72   GLU C OE1   1 
ATOM   3764  O  OE2   . GLU C 2  72   ? 38.083  18.785  -35.942  1.00 110.25 ? 72   GLU C OE2   1 
ATOM   3765  N  N     . SER C 2  73   ? 36.991  12.098  -35.280  1.00 89.59  ? 73   SER C N     1 
ATOM   3766  C  CA    . SER C 2  73   ? 37.098  10.860  -34.512  1.00 91.13  ? 73   SER C CA    1 
ATOM   3767  C  C     . SER C 2  73   ? 37.321  9.679   -35.445  1.00 97.06  ? 73   SER C C     1 
ATOM   3768  O  O     . SER C 2  73   ? 37.852  8.645   -35.043  1.00 98.78  ? 73   SER C O     1 
ATOM   3769  C  CB    . SER C 2  73   ? 35.842  10.640  -33.663  1.00 91.21  ? 73   SER C CB    1 
ATOM   3770  O  OG    . SER C 2  73   ? 35.972  9.503   -32.826  1.00 87.59  ? 73   SER C OG    1 
ATOM   3771  N  N     . ALA C 2  74   ? 36.908  9.847   -36.697  1.00 97.28  ? 74   ALA C N     1 
ATOM   3772  C  CA    . ALA C 2  74   ? 37.151  8.853   -37.732  1.00 107.21 ? 74   ALA C CA    1 
ATOM   3773  C  C     . ALA C 2  74   ? 38.599  8.929   -38.197  1.00 108.18 ? 74   ALA C C     1 
ATOM   3774  O  O     . ALA C 2  74   ? 39.178  7.936   -38.637  1.00 109.80 ? 74   ALA C O     1 
ATOM   3775  C  CB    . ALA C 2  74   ? 36.202  9.060   -38.900  1.00 108.96 ? 74   ALA C CB    1 
ATOM   3776  N  N     . ALA C 2  75   ? 39.179  10.119  -38.086  1.00 107.14 ? 75   ALA C N     1 
ATOM   3777  C  CA    . ALA C 2  75   ? 40.570  10.338  -38.466  1.00 121.69 ? 75   ALA C CA    1 
ATOM   3778  C  C     . ALA C 2  75   ? 41.529  9.813   -37.396  1.00 130.19 ? 75   ALA C C     1 
ATOM   3779  O  O     . ALA C 2  75   ? 42.493  9.111   -37.711  1.00 132.53 ? 75   ALA C O     1 
ATOM   3780  C  CB    . ALA C 2  75   ? 40.820  11.816  -38.725  1.00 121.87 ? 75   ALA C CB    1 
ATOM   3781  N  N     . GLU C 2  76   ? 41.259  10.155  -36.136  1.00 132.18 ? 76   GLU C N     1 
ATOM   3782  C  CA    . GLU C 2  76   ? 42.093  9.721   -35.013  1.00 133.15 ? 76   GLU C CA    1 
ATOM   3783  C  C     . GLU C 2  76   ? 42.059  8.199   -34.851  1.00 128.80 ? 76   GLU C C     1 
ATOM   3784  O  O     . GLU C 2  76   ? 43.069  7.581   -34.507  1.00 128.04 ? 76   GLU C O     1 
ATOM   3785  C  CB    . GLU C 2  76   ? 41.652  10.398  -33.703  1.00 150.36 ? 76   GLU C CB    1 
ATOM   3786  C  CG    . GLU C 2  76   ? 41.892  11.915  -33.628  1.00 171.58 ? 76   GLU C CG    1 
ATOM   3787  C  CD    . GLU C 2  76   ? 41.624  12.498  -32.239  1.00 190.15 ? 76   GLU C CD    1 
ATOM   3788  O  OE1   . GLU C 2  76   ? 41.658  13.740  -32.089  1.00 192.63 ? 76   GLU C OE1   1 
ATOM   3789  O  OE2   . GLU C 2  76   ? 41.383  11.716  -31.295  1.00 196.39 ? 76   GLU C OE2   1 
ATOM   3790  N  N     . ARG C 2  77   ? 40.896  7.599   -35.101  1.00 128.44 ? 77   ARG C N     1 
ATOM   3791  C  CA    . ARG C 2  77   ? 40.759  6.144   -35.052  1.00 129.16 ? 77   ARG C CA    1 
ATOM   3792  C  C     . ARG C 2  77   ? 41.422  5.512   -36.273  1.00 125.88 ? 77   ARG C C     1 
ATOM   3793  O  O     . ARG C 2  77   ? 41.651  4.303   -36.314  1.00 128.82 ? 77   ARG C O     1 
ATOM   3794  C  CB    . ARG C 2  77   ? 39.282  5.730   -34.974  1.00 117.02 ? 77   ARG C CB    1 
ATOM   3795  C  CG    . ARG C 2  77   ? 38.616  5.971   -33.620  1.00 108.44 ? 77   ARG C CG    1 
ATOM   3796  C  CD    . ARG C 2  77   ? 37.170  5.474   -33.619  1.00 103.05 ? 77   ARG C CD    1 
ATOM   3797  N  NE    . ARG C 2  77   ? 36.505  5.681   -32.333  1.00 103.06 ? 77   ARG C NE    1 
ATOM   3798  C  CZ    . ARG C 2  77   ? 35.246  5.337   -32.075  1.00 96.24  ? 77   ARG C CZ    1 
ATOM   3799  N  NH1   . ARG C 2  77   ? 34.727  5.564   -30.875  1.00 88.10  ? 77   ARG C NH1   1 
ATOM   3800  N  NH2   . ARG C 2  77   ? 34.501  4.765   -33.012  1.00 82.53  ? 77   ARG C NH2   1 
ATOM   3801  N  N     . GLY C 2  78   ? 41.723  6.343   -37.265  1.00 118.95 ? 78   GLY C N     1 
ATOM   3802  C  CA    . GLY C 2  78   ? 42.384  5.888   -38.473  1.00 117.36 ? 78   GLY C CA    1 
ATOM   3803  C  C     . GLY C 2  78   ? 41.438  5.180   -39.421  1.00 115.79 ? 78   GLY C C     1 
ATOM   3804  O  O     . GLY C 2  78   ? 41.831  4.255   -40.130  1.00 118.74 ? 78   GLY C O     1 
ATOM   3805  N  N     . ASP C 2  79   ? 40.182  5.611   -39.433  1.00 116.71 ? 79   ASP C N     1 
ATOM   3806  C  CA    . ASP C 2  79   ? 39.194  5.027   -40.330  1.00 119.00 ? 79   ASP C CA    1 
ATOM   3807  C  C     . ASP C 2  79   ? 39.353  5.591   -41.737  1.00 112.09 ? 79   ASP C C     1 
ATOM   3808  O  O     . ASP C 2  79   ? 39.434  6.805   -41.923  1.00 105.85 ? 79   ASP C O     1 
ATOM   3809  C  CB    . ASP C 2  79   ? 37.778  5.277   -39.808  1.00 127.92 ? 79   ASP C CB    1 
ATOM   3810  C  CG    . ASP C 2  79   ? 37.503  4.555   -38.499  1.00 128.95 ? 79   ASP C CG    1 
ATOM   3811  O  OD1   . ASP C 2  79   ? 36.315  4.333   -38.179  1.00 124.64 ? 79   ASP C OD1   1 
ATOM   3812  O  OD2   . ASP C 2  79   ? 38.475  4.207   -37.795  1.00 128.66 ? 79   ASP C OD2   1 
ATOM   3813  N  N     . VAL C 2  80   ? 39.405  4.700   -42.722  1.00 109.64 ? 80   VAL C N     1 
ATOM   3814  C  CA    . VAL C 2  80   ? 39.583  5.100   -44.112  1.00 109.38 ? 80   VAL C CA    1 
ATOM   3815  C  C     . VAL C 2  80   ? 38.242  5.388   -44.786  1.00 110.16 ? 80   VAL C C     1 
ATOM   3816  O  O     . VAL C 2  80   ? 37.330  4.560   -44.753  1.00 106.98 ? 80   VAL C O     1 
ATOM   3817  C  CB    . VAL C 2  80   ? 40.345  4.016   -44.913  1.00 107.35 ? 80   VAL C CB    1 
ATOM   3818  C  CG1   . VAL C 2  80   ? 39.833  2.622   -44.564  1.00 106.67 ? 80   VAL C CG1   1 
ATOM   3819  C  CG2   . VAL C 2  80   ? 40.249  4.280   -46.412  1.00 103.19 ? 80   VAL C CG2   1 
ATOM   3820  N  N     . ASN C 2  81   ? 38.141  6.569   -45.395  1.00 108.01 ? 81   ASN C N     1 
ATOM   3821  C  CA    . ASN C 2  81   ? 36.922  7.021   -46.070  1.00 98.76  ? 81   ASN C CA    1 
ATOM   3822  C  C     . ASN C 2  81   ? 35.677  6.926   -45.191  1.00 92.35  ? 81   ASN C C     1 
ATOM   3823  O  O     . ASN C 2  81   ? 34.855  6.024   -45.364  1.00 97.67  ? 81   ASN C O     1 
ATOM   3824  C  CB    . ASN C 2  81   ? 36.702  6.232   -47.363  1.00 99.88  ? 81   ASN C CB    1 
ATOM   3825  C  CG    . ASN C 2  81   ? 37.435  6.833   -48.546  1.00 91.44  ? 81   ASN C CG    1 
ATOM   3826  O  OD1   . ASN C 2  81   ? 37.309  8.024   -48.828  1.00 85.17  ? 81   ASN C OD1   1 
ATOM   3827  N  ND2   . ASN C 2  81   ? 38.211  6.010   -49.241  1.00 89.73  ? 81   ASN C ND2   1 
ATOM   3828  N  N     . PRO C 2  82   ? 35.537  7.864   -44.244  1.00 88.48  ? 82   PRO C N     1 
ATOM   3829  C  CA    . PRO C 2  82   ? 34.383  7.870   -43.342  1.00 83.79  ? 82   PRO C CA    1 
ATOM   3830  C  C     . PRO C 2  82   ? 33.091  8.284   -44.047  1.00 82.41  ? 82   PRO C C     1 
ATOM   3831  O  O     . PRO C 2  82   ? 32.989  9.402   -44.549  1.00 83.12  ? 82   PRO C O     1 
ATOM   3832  C  CB    . PRO C 2  82   ? 34.783  8.892   -42.277  1.00 87.71  ? 82   PRO C CB    1 
ATOM   3833  C  CG    . PRO C 2  82   ? 35.722  9.815   -42.978  1.00 86.55  ? 82   PRO C CG    1 
ATOM   3834  C  CD    . PRO C 2  82   ? 36.469  8.973   -43.968  1.00 85.66  ? 82   PRO C CD    1 
ATOM   3835  N  N     . VAL C 2  83   ? 32.118  7.380   -44.085  1.00 79.00  ? 83   VAL C N     1 
ATOM   3836  C  CA    . VAL C 2  83   ? 30.820  7.674   -44.685  1.00 78.98  ? 83   VAL C CA    1 
ATOM   3837  C  C     . VAL C 2  83   ? 29.734  7.772   -43.612  1.00 77.20  ? 83   VAL C C     1 
ATOM   3838  O  O     . VAL C 2  83   ? 29.497  6.822   -42.865  1.00 78.05  ? 83   VAL C O     1 
ATOM   3839  C  CB    . VAL C 2  83   ? 30.419  6.605   -45.723  1.00 83.91  ? 83   VAL C CB    1 
ATOM   3840  C  CG1   . VAL C 2  83   ? 29.000  6.846   -46.218  1.00 86.91  ? 83   VAL C CG1   1 
ATOM   3841  C  CG2   . VAL C 2  83   ? 31.400  6.594   -46.886  1.00 80.01  ? 83   VAL C CG2   1 
ATOM   3842  N  N     . GLY C 2  84   ? 29.081  8.929   -43.539  1.00 74.34  ? 84   GLY C N     1 
ATOM   3843  C  CA    . GLY C 2  84   ? 28.037  9.158   -42.555  1.00 67.56  ? 84   GLY C CA    1 
ATOM   3844  C  C     . GLY C 2  84   ? 26.843  8.246   -42.759  1.00 61.40  ? 84   GLY C C     1 
ATOM   3845  O  O     . GLY C 2  84   ? 26.657  7.696   -43.843  1.00 63.96  ? 84   GLY C O     1 
ATOM   3846  N  N     . GLY C 2  85   ? 26.036  8.080   -41.715  1.00 57.76  ? 85   GLY C N     1 
ATOM   3847  C  CA    . GLY C 2  85   ? 24.863  7.230   -41.790  1.00 55.53  ? 85   GLY C CA    1 
ATOM   3848  C  C     . GLY C 2  85   ? 23.890  7.713   -42.847  1.00 57.83  ? 85   GLY C C     1 
ATOM   3849  O  O     . GLY C 2  85   ? 23.336  6.919   -43.611  1.00 57.96  ? 85   GLY C O     1 
ATOM   3850  N  N     . LEU C 2  86   ? 23.693  9.027   -42.889  1.00 56.60  ? 86   LEU C N     1 
ATOM   3851  C  CA    . LEU C 2  86   ? 22.821  9.644   -43.880  1.00 55.05  ? 86   LEU C CA    1 
ATOM   3852  C  C     . LEU C 2  86   ? 23.445  9.574   -45.272  1.00 61.17  ? 86   LEU C C     1 
ATOM   3853  O  O     . LEU C 2  86   ? 22.748  9.334   -46.260  1.00 60.34  ? 86   LEU C O     1 
ATOM   3854  C  CB    . LEU C 2  86   ? 22.516  11.094  -43.496  1.00 49.20  ? 86   LEU C CB    1 
ATOM   3855  C  CG    . LEU C 2  86   ? 21.621  11.288  -42.269  1.00 42.16  ? 86   LEU C CG    1 
ATOM   3856  C  CD1   . LEU C 2  86   ? 21.284  12.759  -42.064  1.00 53.30  ? 86   LEU C CD1   1 
ATOM   3857  C  CD2   . LEU C 2  86   ? 20.357  10.475  -42.411  1.00 37.94  ? 86   LEU C CD2   1 
ATOM   3858  N  N     . GLU C 2  87   ? 24.762  9.768   -45.337  1.00 64.82  ? 87   GLU C N     1 
ATOM   3859  C  CA    . GLU C 2  87   ? 25.516  9.639   -46.586  1.00 70.00  ? 87   GLU C CA    1 
ATOM   3860  C  C     . GLU C 2  87   ? 25.376  8.234   -47.160  1.00 69.87  ? 87   GLU C C     1 
ATOM   3861  O  O     . GLU C 2  87   ? 25.274  8.045   -48.374  1.00 75.75  ? 87   GLU C O     1 
ATOM   3862  C  CB    . GLU C 2  87   ? 27.001  9.953   -46.362  1.00 75.98  ? 87   GLU C CB    1 
ATOM   3863  C  CG    . GLU C 2  87   ? 27.294  11.342  -45.811  1.00 76.73  ? 87   GLU C CG    1 
ATOM   3864  C  CD    . GLU C 2  87   ? 28.783  11.602  -45.612  1.00 84.86  ? 87   GLU C CD    1 
ATOM   3865  O  OE1   . GLU C 2  87   ? 29.596  10.683  -45.853  1.00 79.31  ? 87   GLU C OE1   1 
ATOM   3866  O  OE2   . GLU C 2  87   ? 29.138  12.734  -45.217  1.00 95.42  ? 87   GLU C OE2   1 
ATOM   3867  N  N     . GLU C 2  88   ? 25.375  7.255   -46.263  1.00 64.39  ? 88   GLU C N     1 
ATOM   3868  C  CA    . GLU C 2  88   ? 25.302  5.848   -46.626  1.00 67.82  ? 88   GLU C CA    1 
ATOM   3869  C  C     . GLU C 2  88   ? 24.024  5.508   -47.378  1.00 65.16  ? 88   GLU C C     1 
ATOM   3870  O  O     . GLU C 2  88   ? 24.069  4.988   -48.494  1.00 69.70  ? 88   GLU C O     1 
ATOM   3871  C  CB    . GLU C 2  88   ? 25.406  4.987   -45.369  1.00 73.75  ? 88   GLU C CB    1 
ATOM   3872  C  CG    . GLU C 2  88   ? 25.120  3.518   -45.592  1.00 78.50  ? 88   GLU C CG    1 
ATOM   3873  C  CD    . GLU C 2  88   ? 25.140  2.727   -44.299  1.00 80.79  ? 88   GLU C CD    1 
ATOM   3874  O  OE1   . GLU C 2  88   ? 25.543  3.295   -43.261  1.00 78.12  ? 88   GLU C OE1   1 
ATOM   3875  O  OE2   . GLU C 2  88   ? 24.752  1.540   -44.321  1.00 81.13  ? 88   GLU C OE2   1 
ATOM   3876  N  N     . VAL C 2  89   ? 22.887  5.807   -46.759  1.00 59.18  ? 89   VAL C N     1 
ATOM   3877  C  CA    . VAL C 2  89   ? 21.592  5.443   -47.318  1.00 59.52  ? 89   VAL C CA    1 
ATOM   3878  C  C     . VAL C 2  89   ? 21.413  6.041   -48.713  1.00 63.69  ? 89   VAL C C     1 
ATOM   3879  O  O     . VAL C 2  89   ? 20.795  5.431   -49.587  1.00 68.74  ? 89   VAL C O     1 
ATOM   3880  C  CB    . VAL C 2  89   ? 20.444  5.893   -46.392  1.00 59.23  ? 89   VAL C CB    1 
ATOM   3881  C  CG1   . VAL C 2  89   ? 19.093  5.501   -46.979  1.00 65.96  ? 89   VAL C CG1   1 
ATOM   3882  C  CG2   . VAL C 2  89   ? 20.621  5.281   -45.005  1.00 51.86  ? 89   VAL C CG2   1 
ATOM   3883  N  N     . LEU C 2  90   ? 21.991  7.218   -48.925  1.00 63.92  ? 90   LEU C N     1 
ATOM   3884  C  CA    . LEU C 2  90   ? 21.886  7.901   -50.209  1.00 68.76  ? 90   LEU C CA    1 
ATOM   3885  C  C     . LEU C 2  90   ? 22.703  7.242   -51.321  1.00 78.16  ? 90   LEU C C     1 
ATOM   3886  O  O     . LEU C 2  90   ? 22.394  7.414   -52.499  1.00 86.19  ? 90   LEU C O     1 
ATOM   3887  C  CB    . LEU C 2  90   ? 22.316  9.359   -50.065  1.00 67.20  ? 90   LEU C CB    1 
ATOM   3888  C  CG    . LEU C 2  90   ? 21.457  10.179  -49.110  1.00 64.76  ? 90   LEU C CG    1 
ATOM   3889  C  CD1   . LEU C 2  90   ? 21.859  11.648  -49.148  1.00 76.93  ? 90   LEU C CD1   1 
ATOM   3890  C  CD2   . LEU C 2  90   ? 19.991  10.001  -49.452  1.00 62.33  ? 90   LEU C CD2   1 
ATOM   3891  N  N     . TYR C 2  91   ? 23.742  6.497   -50.955  1.00 79.66  ? 91   TYR C N     1 
ATOM   3892  C  CA    . TYR C 2  91   ? 24.602  5.853   -51.947  1.00 80.10  ? 91   TYR C CA    1 
ATOM   3893  C  C     . TYR C 2  91   ? 24.024  4.514   -52.384  1.00 79.47  ? 91   TYR C C     1 
ATOM   3894  O  O     . TYR C 2  91   ? 24.180  4.102   -53.537  1.00 78.01  ? 91   TYR C O     1 
ATOM   3895  C  CB    . TYR C 2  91   ? 26.017  5.660   -51.400  1.00 85.56  ? 91   TYR C CB    1 
ATOM   3896  C  CG    . TYR C 2  91   ? 26.845  6.925   -51.375  1.00 95.92  ? 91   TYR C CG    1 
ATOM   3897  C  CD1   . TYR C 2  91   ? 26.273  8.158   -51.670  1.00 92.40  ? 91   TYR C CD1   1 
ATOM   3898  C  CD2   . TYR C 2  91   ? 28.204  6.886   -51.077  1.00 102.51 ? 91   TYR C CD2   1 
ATOM   3899  C  CE1   . TYR C 2  91   ? 27.025  9.316   -51.654  1.00 101.01 ? 91   TYR C CE1   1 
ATOM   3900  C  CE2   . TYR C 2  91   ? 28.964  8.039   -51.063  1.00 112.90 ? 91   TYR C CE2   1 
ATOM   3901  C  CZ    . TYR C 2  91   ? 28.370  9.251   -51.351  1.00 115.77 ? 91   TYR C CZ    1 
ATOM   3902  O  OH    . TYR C 2  91   ? 29.129  10.399  -51.335  1.00 129.43 ? 91   TYR C OH    1 
ATOM   3903  N  N     . GLU C 2  92   ? 23.364  3.838   -51.448  1.00 76.54  ? 92   GLU C N     1 
ATOM   3904  C  CA    . GLU C 2  92   ? 22.667  2.589   -51.735  1.00 73.85  ? 92   GLU C CA    1 
ATOM   3905  C  C     . GLU C 2  92   ? 21.474  2.861   -52.645  1.00 75.10  ? 92   GLU C C     1 
ATOM   3906  O  O     . GLU C 2  92   ? 21.146  2.062   -53.524  1.00 74.11  ? 92   GLU C O     1 
ATOM   3907  C  CB    . GLU C 2  92   ? 22.198  1.918   -50.439  1.00 71.95  ? 92   GLU C CB    1 
ATOM   3908  C  CG    . GLU C 2  92   ? 23.288  1.676   -49.402  1.00 74.80  ? 92   GLU C CG    1 
ATOM   3909  C  CD    . GLU C 2  92   ? 22.758  1.006   -48.141  1.00 69.47  ? 92   GLU C CD    1 
ATOM   3910  O  OE1   . GLU C 2  92   ? 21.537  0.751   -48.071  1.00 71.99  ? 92   GLU C OE1   1 
ATOM   3911  O  OE2   . GLU C 2  92   ? 23.561  0.733   -47.222  1.00 64.92  ? 92   GLU C OE2   1 
ATOM   3912  N  N     . LEU C 2  93   ? 20.840  4.008   -52.423  1.00 76.70  ? 93   LEU C N     1 
ATOM   3913  C  CA    . LEU C 2  93   ? 19.661  4.416   -53.177  1.00 78.30  ? 93   LEU C CA    1 
ATOM   3914  C  C     . LEU C 2  93   ? 20.025  4.925   -54.570  1.00 82.90  ? 93   LEU C C     1 
ATOM   3915  O  O     . LEU C 2  93   ? 19.505  4.436   -55.575  1.00 83.85  ? 93   LEU C O     1 
ATOM   3916  C  CB    . LEU C 2  93   ? 18.898  5.496   -52.408  1.00 79.49  ? 93   LEU C CB    1 
ATOM   3917  C  CG    . LEU C 2  93   ? 17.646  6.074   -53.068  1.00 88.63  ? 93   LEU C CG    1 
ATOM   3918  C  CD1   . LEU C 2  93   ? 16.597  4.994   -53.268  1.00 101.79 ? 93   LEU C CD1   1 
ATOM   3919  C  CD2   . LEU C 2  93   ? 17.089  7.219   -52.237  1.00 87.22  ? 93   LEU C CD2   1 
ATOM   3920  N  N     . SER C 2  94   ? 20.920  5.907   -54.621  1.00 83.98  ? 94   SER C N     1 
ATOM   3921  C  CA    . SER C 2  94   ? 21.324  6.527   -55.881  1.00 83.48  ? 94   SER C CA    1 
ATOM   3922  C  C     . SER C 2  94   ? 22.214  5.618   -56.729  1.00 83.29  ? 94   SER C C     1 
ATOM   3923  O  O     . SER C 2  94   ? 23.085  4.924   -56.204  1.00 78.39  ? 94   SER C O     1 
ATOM   3924  C  CB    . SER C 2  94   ? 22.050  7.847   -55.611  1.00 89.23  ? 94   SER C CB    1 
ATOM   3925  O  OG    . SER C 2  94   ? 21.220  8.751   -54.903  1.00 85.25  ? 94   SER C OG    1 
ATOM   3926  N  N     . PRO C 2  95   ? 22.000  5.633   -58.052  1.00 84.43  ? 95   PRO C N     1 
ATOM   3927  C  CA    . PRO C 2  95   ? 20.942  6.428   -58.683  1.00 86.51  ? 95   PRO C CA    1 
ATOM   3928  C  C     . PRO C 2  95   ? 19.635  5.652   -58.829  1.00 89.98  ? 95   PRO C C     1 
ATOM   3929  O  O     . PRO C 2  95   ? 19.659  4.430   -58.974  1.00 88.10  ? 95   PRO C O     1 
ATOM   3930  C  CB    . PRO C 2  95   ? 21.536  6.761   -60.049  1.00 88.46  ? 95   PRO C CB    1 
ATOM   3931  C  CG    . PRO C 2  95   ? 22.379  5.571   -60.368  1.00 93.11  ? 95   PRO C CG    1 
ATOM   3932  C  CD    . PRO C 2  95   ? 22.905  5.037   -59.051  1.00 85.22  ? 95   PRO C CD    1 
ATOM   3933  N  N     . ILE C 2  96   ? 18.509  6.356   -58.781  1.00 95.06  ? 96   ILE C N     1 
ATOM   3934  C  CA    . ILE C 2  96   ? 17.213  5.730   -59.010  1.00 93.97  ? 96   ILE C CA    1 
ATOM   3935  C  C     . ILE C 2  96   ? 16.896  5.728   -60.499  1.00 96.65  ? 96   ILE C C     1 
ATOM   3936  O  O     . ILE C 2  96   ? 16.486  6.747   -61.056  1.00 95.62  ? 96   ILE C O     1 
ATOM   3937  C  CB    . ILE C 2  96   ? 16.077  6.447   -58.255  1.00 99.08  ? 96   ILE C CB    1 
ATOM   3938  C  CG1   . ILE C 2  96   ? 16.368  6.496   -56.754  1.00 100.47 ? 96   ILE C CG1   1 
ATOM   3939  C  CG2   . ILE C 2  96   ? 14.747  5.753   -58.516  1.00 99.41  ? 96   ILE C CG2   1 
ATOM   3940  C  CD1   . ILE C 2  96   ? 15.321  7.245   -55.957  1.00 100.58 ? 96   ILE C CD1   1 
ATOM   3941  N  N     . GLU C 2  97   ? 17.096  4.583   -61.141  1.00 102.95 ? 97   GLU C N     1 
ATOM   3942  C  CA    . GLU C 2  97   ? 16.830  4.458   -62.568  1.00 109.65 ? 97   GLU C CA    1 
ATOM   3943  C  C     . GLU C 2  97   ? 15.625  3.567   -62.844  1.00 115.75 ? 97   GLU C C     1 
ATOM   3944  O  O     . GLU C 2  97   ? 15.320  2.658   -62.071  1.00 111.42 ? 97   GLU C O     1 
ATOM   3945  C  CB    . GLU C 2  97   ? 18.056  3.911   -63.298  1.00 112.00 ? 97   GLU C CB    1 
ATOM   3946  C  CG    . GLU C 2  97   ? 19.255  4.837   -63.274  1.00 110.82 ? 97   GLU C CG    1 
ATOM   3947  C  CD    . GLU C 2  97   ? 20.375  4.361   -64.177  1.00 118.40 ? 97   GLU C CD    1 
ATOM   3948  O  OE1   . GLU C 2  97   ? 20.214  3.304   -64.824  1.00 120.97 ? 97   GLU C OE1   1 
ATOM   3949  O  OE2   . GLU C 2  97   ? 21.417  5.047   -64.241  1.00 119.09 ? 97   GLU C OE2   1 
ATOM   3950  N  N     . ASP C 2  98   ? 14.943  3.838   -63.952  1.00 128.96 ? 98   ASP C N     1 
ATOM   3951  C  CA    . ASP C 2  98   ? 13.795  3.038   -64.361  1.00 131.26 ? 98   ASP C CA    1 
ATOM   3952  C  C     . ASP C 2  98   ? 14.241  1.835   -65.185  1.00 124.77 ? 98   ASP C C     1 
ATOM   3953  O  O     . ASP C 2  98   ? 15.436  1.616   -65.384  1.00 125.79 ? 98   ASP C O     1 
ATOM   3954  C  CB    . ASP C 2  98   ? 12.798  3.888   -65.155  1.00 133.36 ? 98   ASP C CB    1 
ATOM   3955  C  CG    . ASP C 2  98   ? 13.404  4.479   -66.415  1.00 129.31 ? 98   ASP C CG    1 
ATOM   3956  O  OD1   . ASP C 2  98   ? 14.611  4.803   -66.407  1.00 127.91 ? 98   ASP C OD1   1 
ATOM   3957  O  OD2   . ASP C 2  98   ? 12.670  4.620   -67.416  1.00 131.32 ? 98   ASP C OD2   1 
ATOM   3958  N  N     . PHE C 2  99   ? 13.273  1.060   -65.663  1.00 118.79 ? 99   PHE C N     1 
ATOM   3959  C  CA    . PHE C 2  99   ? 13.565  -0.144  -66.431  1.00 118.90 ? 99   PHE C CA    1 
ATOM   3960  C  C     . PHE C 2  99   ? 14.286  0.201   -67.729  1.00 114.53 ? 99   PHE C C     1 
ATOM   3961  O  O     . PHE C 2  99   ? 15.130  -0.559  -68.207  1.00 112.69 ? 99   PHE C O     1 
ATOM   3962  C  CB    . PHE C 2  99   ? 12.277  -0.915  -66.723  1.00 119.74 ? 99   PHE C CB    1 
ATOM   3963  C  CG    . PHE C 2  99   ? 12.503  -2.261  -67.349  1.00 123.92 ? 99   PHE C CG    1 
ATOM   3964  C  CD1   . PHE C 2  99   ? 13.096  -3.286  -66.627  1.00 124.96 ? 99   PHE C CD1   1 
ATOM   3965  C  CD2   . PHE C 2  99   ? 12.109  -2.508  -68.654  1.00 123.13 ? 99   PHE C CD2   1 
ATOM   3966  C  CE1   . PHE C 2  99   ? 13.302  -4.528  -67.199  1.00 122.39 ? 99   PHE C CE1   1 
ATOM   3967  C  CE2   . PHE C 2  99   ? 12.309  -3.746  -69.231  1.00 120.19 ? 99   PHE C CE2   1 
ATOM   3968  C  CZ    . PHE C 2  99   ? 12.907  -4.758  -68.503  1.00 118.59 ? 99   PHE C CZ    1 
ATOM   3969  N  N     . SER C 2  100  ? 13.949  1.359   -68.288  1.00 116.57 ? 100  SER C N     1 
ATOM   3970  C  CA    . SER C 2  100  ? 14.599  1.849   -69.498  1.00 121.10 ? 100  SER C CA    1 
ATOM   3971  C  C     . SER C 2  100  ? 16.050  2.227   -69.223  1.00 123.60 ? 100  SER C C     1 
ATOM   3972  O  O     . SER C 2  100  ? 16.943  1.954   -70.028  1.00 123.95 ? 100  SER C O     1 
ATOM   3973  C  CB    . SER C 2  100  ? 13.848  3.059   -70.062  1.00 119.39 ? 100  SER C CB    1 
ATOM   3974  O  OG    . SER C 2  100  ? 12.457  2.807   -70.141  1.00 126.21 ? 100  SER C OG    1 
ATOM   3975  N  N     . GLY C 2  101  ? 16.276  2.854   -68.074  1.00 124.07 ? 101  GLY C N     1 
ATOM   3976  C  CA    . GLY C 2  101  ? 17.567  3.436   -67.763  1.00 126.13 ? 101  GLY C CA    1 
ATOM   3977  C  C     . GLY C 2  101  ? 17.590  4.865   -68.264  1.00 128.23 ? 101  GLY C C     1 
ATOM   3978  O  O     . GLY C 2  101  ? 18.570  5.590   -68.086  1.00 130.91 ? 101  GLY C O     1 
ATOM   3979  N  N     . SER C 2  102  ? 16.488  5.254   -68.897  1.00 120.32 ? 102  SER C N     1 
ATOM   3980  C  CA    . SER C 2  102  ? 16.308  6.594   -69.433  1.00 119.25 ? 102  SER C CA    1 
ATOM   3981  C  C     . SER C 2  102  ? 16.481  7.663   -68.357  1.00 116.54 ? 102  SER C C     1 
ATOM   3982  O  O     . SER C 2  102  ? 17.326  8.553   -68.477  1.00 112.88 ? 102  SER C O     1 
ATOM   3983  C  CB    . SER C 2  102  ? 14.923  6.716   -70.075  1.00 120.03 ? 102  SER C CB    1 
ATOM   3984  O  OG    . SER C 2  102  ? 14.646  8.054   -70.458  1.00 129.15 ? 102  SER C OG    1 
ATOM   3985  N  N     . MET C 2  103  ? 15.673  7.564   -67.306  1.00 117.95 ? 103  MET C N     1 
ATOM   3986  C  CA    . MET C 2  103  ? 15.688  8.532   -66.215  1.00 113.92 ? 103  MET C CA    1 
ATOM   3987  C  C     . MET C 2  103  ? 16.559  8.058   -65.050  1.00 112.55 ? 103  MET C C     1 
ATOM   3988  O  O     . MET C 2  103  ? 16.547  6.880   -64.698  1.00 113.47 ? 103  MET C O     1 
ATOM   3989  C  CB    . MET C 2  103  ? 14.259  8.793   -65.738  1.00 115.76 ? 103  MET C CB    1 
ATOM   3990  C  CG    . MET C 2  103  ? 13.320  9.235   -66.856  1.00 118.15 ? 103  MET C CG    1 
ATOM   3991  S  SD    . MET C 2  103  ? 11.575  9.142   -66.415  1.00 116.79 ? 103  MET C SD    1 
ATOM   3992  C  CE    . MET C 2  103  ? 11.359  7.375   -66.221  1.00 116.94 ? 103  MET C CE    1 
ATOM   3993  N  N     . SER C 2  104  ? 17.305  8.985   -64.453  1.00 115.18 ? 104  SER C N     1 
ATOM   3994  C  CA    . SER C 2  104  ? 18.208  8.668   -63.346  1.00 115.70 ? 104  SER C CA    1 
ATOM   3995  C  C     . SER C 2  104  ? 18.169  9.746   -62.259  1.00 109.84 ? 104  SER C C     1 
ATOM   3996  O  O     . SER C 2  104  ? 18.617  10.870  -62.478  1.00 110.89 ? 104  SER C O     1 
ATOM   3997  C  CB    . SER C 2  104  ? 19.641  8.493   -63.867  1.00 114.69 ? 104  SER C CB    1 
ATOM   3998  O  OG    . SER C 2  104  ? 20.562  8.267   -62.814  1.00 103.61 ? 104  SER C OG    1 
ATOM   3999  N  N     . LEU C 2  105  ? 17.630  9.403   -61.092  1.00 102.26 ? 105  LEU C N     1 
ATOM   4000  C  CA    . LEU C 2  105  ? 17.595  10.332  -59.964  1.00 94.76  ? 105  LEU C CA    1 
ATOM   4001  C  C     . LEU C 2  105  ? 18.640  9.943   -58.918  1.00 95.51  ? 105  LEU C C     1 
ATOM   4002  O  O     . LEU C 2  105  ? 18.600  8.841   -58.369  1.00 99.23  ? 105  LEU C O     1 
ATOM   4003  C  CB    . LEU C 2  105  ? 16.195  10.370  -59.341  1.00 91.72  ? 105  LEU C CB    1 
ATOM   4004  C  CG    . LEU C 2  105  ? 15.917  11.419  -58.258  1.00 90.41  ? 105  LEU C CG    1 
ATOM   4005  C  CD1   . LEU C 2  105  ? 16.121  12.822  -58.797  1.00 100.66 ? 105  LEU C CD1   1 
ATOM   4006  C  CD2   . LEU C 2  105  ? 14.508  11.265  -57.691  1.00 88.11  ? 105  LEU C CD2   1 
ATOM   4007  N  N     . SER C 2  106  ? 19.582  10.844  -58.656  1.00 88.92  ? 106  SER C N     1 
ATOM   4008  C  CA    . SER C 2  106  ? 20.649  10.571  -57.698  1.00 81.42  ? 106  SER C CA    1 
ATOM   4009  C  C     . SER C 2  106  ? 20.797  11.709  -56.695  1.00 78.85  ? 106  SER C C     1 
ATOM   4010  O  O     . SER C 2  106  ? 20.731  12.883  -57.058  1.00 79.73  ? 106  SER C O     1 
ATOM   4011  C  CB    . SER C 2  106  ? 21.975  10.331  -58.422  1.00 78.32  ? 106  SER C CB    1 
ATOM   4012  O  OG    . SER C 2  106  ? 22.398  11.488  -59.120  1.00 72.08  ? 106  SER C OG    1 
ATOM   4013  N  N     . PHE C 2  107  ? 20.998  11.351  -55.430  1.00 80.32  ? 107  PHE C N     1 
ATOM   4014  C  CA    . PHE C 2  107  ? 21.085  12.329  -54.351  1.00 76.51  ? 107  PHE C CA    1 
ATOM   4015  C  C     . PHE C 2  107  ? 22.507  12.433  -53.808  1.00 76.27  ? 107  PHE C C     1 
ATOM   4016  O  O     . PHE C 2  107  ? 23.305  11.505  -53.952  1.00 77.25  ? 107  PHE C O     1 
ATOM   4017  C  CB    . PHE C 2  107  ? 20.120  11.961  -53.221  1.00 78.21  ? 107  PHE C CB    1 
ATOM   4018  C  CG    . PHE C 2  107  ? 18.724  11.654  -53.688  1.00 77.76  ? 107  PHE C CG    1 
ATOM   4019  C  CD1   . PHE C 2  107  ? 17.822  12.672  -53.943  1.00 80.28  ? 107  PHE C CD1   1 
ATOM   4020  C  CD2   . PHE C 2  107  ? 18.311  10.345  -53.866  1.00 78.15  ? 107  PHE C CD2   1 
ATOM   4021  C  CE1   . PHE C 2  107  ? 16.535  12.389  -54.370  1.00 77.41  ? 107  PHE C CE1   1 
ATOM   4022  C  CE2   . PHE C 2  107  ? 17.026  10.058  -54.292  1.00 76.67  ? 107  PHE C CE2   1 
ATOM   4023  C  CZ    . PHE C 2  107  ? 16.138  11.080  -54.543  1.00 73.94  ? 107  PHE C CZ    1 
ATOM   4024  N  N     . SER C 2  108  ? 22.815  13.560  -53.174  1.00 74.03  ? 108  SER C N     1 
ATOM   4025  C  CA    . SER C 2  108  ? 24.148  13.790  -52.630  1.00 72.77  ? 108  SER C CA    1 
ATOM   4026  C  C     . SER C 2  108  ? 24.180  14.943  -51.631  1.00 65.22  ? 108  SER C C     1 
ATOM   4027  O  O     . SER C 2  108  ? 23.318  15.824  -51.648  1.00 61.84  ? 108  SER C O     1 
ATOM   4028  C  CB    . SER C 2  108  ? 25.143  14.070  -53.761  1.00 74.08  ? 108  SER C CB    1 
ATOM   4029  O  OG    . SER C 2  108  ? 24.822  15.274  -54.442  1.00 74.56  ? 108  SER C OG    1 
ATOM   4030  N  N     . ASP C 2  109  ? 25.192  14.919  -50.767  1.00 60.93  ? 109  ASP C N     1 
ATOM   4031  C  CA    . ASP C 2  109  ? 25.475  15.999  -49.825  1.00 56.59  ? 109  ASP C CA    1 
ATOM   4032  C  C     . ASP C 2  109  ? 24.321  16.311  -48.876  1.00 57.06  ? 109  ASP C C     1 
ATOM   4033  O  O     . ASP C 2  109  ? 23.465  17.137  -49.190  1.00 57.34  ? 109  ASP C O     1 
ATOM   4034  C  CB    . ASP C 2  109  ? 25.861  17.274  -50.580  1.00 62.73  ? 109  ASP C CB    1 
ATOM   4035  C  CG    . ASP C 2  109  ? 26.324  18.378  -49.652  1.00 65.38  ? 109  ASP C CG    1 
ATOM   4036  O  OD1   . ASP C 2  109  ? 25.924  19.544  -49.856  1.00 66.35  ? 109  ASP C OD1   1 
ATOM   4037  O  OD2   . ASP C 2  109  ? 27.093  18.079  -48.717  1.00 67.43  ? 109  ASP C OD2   1 
ATOM   4038  N  N     . PRO C 2  110  ? 24.298  15.652  -47.708  1.00 56.24  ? 110  PRO C N     1 
ATOM   4039  C  CA    . PRO C 2  110  ? 23.351  15.991  -46.641  1.00 53.60  ? 110  PRO C CA    1 
ATOM   4040  C  C     . PRO C 2  110  ? 23.839  17.165  -45.795  1.00 51.35  ? 110  PRO C C     1 
ATOM   4041  O  O     . PRO C 2  110  ? 25.001  17.193  -45.393  1.00 49.67  ? 110  PRO C O     1 
ATOM   4042  C  CB    . PRO C 2  110  ? 23.293  14.710  -45.812  1.00 50.53  ? 110  PRO C CB    1 
ATOM   4043  C  CG    . PRO C 2  110  ? 24.651  14.114  -45.977  1.00 54.58  ? 110  PRO C CG    1 
ATOM   4044  C  CD    . PRO C 2  110  ? 25.093  14.455  -47.380  1.00 54.68  ? 110  PRO C CD    1 
ATOM   4045  N  N     . ARG C 2  111  ? 22.962  18.124  -45.528  1.00 49.52  ? 111  ARG C N     1 
ATOM   4046  C  CA    . ARG C 2  111  ? 23.348  19.300  -44.759  1.00 49.41  ? 111  ARG C CA    1 
ATOM   4047  C  C     . ARG C 2  111  ? 22.169  19.878  -43.976  1.00 51.11  ? 111  ARG C C     1 
ATOM   4048  O  O     . ARG C 2  111  ? 21.019  19.814  -44.419  1.00 50.15  ? 111  ARG C O     1 
ATOM   4049  C  CB    . ARG C 2  111  ? 23.947  20.361  -45.681  1.00 52.98  ? 111  ARG C CB    1 
ATOM   4050  C  CG    . ARG C 2  111  ? 23.065  20.750  -46.854  1.00 62.68  ? 111  ARG C CG    1 
ATOM   4051  C  CD    . ARG C 2  111  ? 23.853  21.574  -47.865  1.00 73.20  ? 111  ARG C CD    1 
ATOM   4052  N  NE    . ARG C 2  111  ? 23.012  22.115  -48.929  1.00 87.97  ? 111  ARG C NE    1 
ATOM   4053  C  CZ    . ARG C 2  111  ? 22.704  21.462  -50.045  1.00 76.92  ? 111  ARG C CZ    1 
ATOM   4054  N  NH1   . ARG C 2  111  ? 23.164  20.235  -50.247  1.00 73.30  ? 111  ARG C NH1   1 
ATOM   4055  N  NH2   . ARG C 2  111  ? 21.932  22.035  -50.957  1.00 79.42  ? 111  ARG C NH2   1 
ATOM   4056  N  N     . PHE C 2  112  ? 22.466  20.445  -42.810  1.00 51.15  ? 112  PHE C N     1 
ATOM   4057  C  CA    . PHE C 2  112  ? 21.437  20.910  -41.884  1.00 47.58  ? 112  PHE C CA    1 
ATOM   4058  C  C     . PHE C 2  112  ? 21.469  22.423  -41.681  1.00 43.61  ? 112  PHE C C     1 
ATOM   4059  O  O     . PHE C 2  112  ? 22.501  23.064  -41.863  1.00 40.82  ? 112  PHE C O     1 
ATOM   4060  C  CB    . PHE C 2  112  ? 21.591  20.212  -40.525  1.00 44.57  ? 112  PHE C CB    1 
ATOM   4061  C  CG    . PHE C 2  112  ? 21.408  18.713  -40.575  1.00 49.55  ? 112  PHE C CG    1 
ATOM   4062  C  CD1   . PHE C 2  112  ? 20.190  18.136  -40.248  1.00 48.56  ? 112  PHE C CD1   1 
ATOM   4063  C  CD2   . PHE C 2  112  ? 22.457  17.880  -40.935  1.00 49.42  ? 112  PHE C CD2   1 
ATOM   4064  C  CE1   . PHE C 2  112  ? 20.021  16.760  -40.285  1.00 47.66  ? 112  PHE C CE1   1 
ATOM   4065  C  CE2   . PHE C 2  112  ? 22.290  16.505  -40.975  1.00 43.41  ? 112  PHE C CE2   1 
ATOM   4066  C  CZ    . PHE C 2  112  ? 21.072  15.948  -40.648  1.00 42.57  ? 112  PHE C CZ    1 
ATOM   4067  N  N     . ASP C 2  113  ? 20.322  22.983  -41.309  1.00 43.03  ? 113  ASP C N     1 
ATOM   4068  C  CA    . ASP C 2  113  ? 20.241  24.363  -40.845  1.00 42.60  ? 113  ASP C CA    1 
ATOM   4069  C  C     . ASP C 2  113  ? 20.304  24.389  -39.324  1.00 42.50  ? 113  ASP C C     1 
ATOM   4070  O  O     . ASP C 2  113  ? 20.470  23.351  -38.687  1.00 45.26  ? 113  ASP C O     1 
ATOM   4071  C  CB    . ASP C 2  113  ? 18.952  25.033  -41.322  1.00 43.73  ? 113  ASP C CB    1 
ATOM   4072  C  CG    . ASP C 2  113  ? 19.039  25.523  -42.758  1.00 48.22  ? 113  ASP C CG    1 
ATOM   4073  O  OD1   . ASP C 2  113  ? 20.022  25.182  -43.452  1.00 52.25  ? 113  ASP C OD1   1 
ATOM   4074  O  OD2   . ASP C 2  113  ? 18.111  26.239  -43.196  1.00 49.33  ? 113  ASP C OD2   1 
ATOM   4075  N  N     . ASP C 2  114  ? 20.169  25.576  -38.742  1.00 40.48  ? 114  ASP C N     1 
ATOM   4076  C  CA    . ASP C 2  114  ? 20.109  25.698  -37.292  1.00 38.87  ? 114  ASP C CA    1 
ATOM   4077  C  C     . ASP C 2  114  ? 18.811  25.094  -36.786  1.00 37.26  ? 114  ASP C C     1 
ATOM   4078  O  O     . ASP C 2  114  ? 17.860  24.920  -37.547  1.00 36.69  ? 114  ASP C O     1 
ATOM   4079  C  CB    . ASP C 2  114  ? 20.220  27.158  -36.862  1.00 40.72  ? 114  ASP C CB    1 
ATOM   4080  C  CG    . ASP C 2  114  ? 21.521  27.794  -37.305  1.00 50.52  ? 114  ASP C CG    1 
ATOM   4081  O  OD1   . ASP C 2  114  ? 22.559  27.093  -37.295  1.00 51.94  ? 114  ASP C OD1   1 
ATOM   4082  O  OD2   . ASP C 2  114  ? 21.506  28.991  -37.666  1.00 57.35  ? 114  ASP C OD2   1 
ATOM   4083  N  N     . VAL C 2  115  ? 18.778  24.766  -35.502  1.00 38.53  ? 115  VAL C N     1 
ATOM   4084  C  CA    . VAL C 2  115  ? 17.594  24.163  -34.910  1.00 37.77  ? 115  VAL C CA    1 
ATOM   4085  C  C     . VAL C 2  115  ? 16.455  25.176  -34.905  1.00 37.16  ? 115  VAL C C     1 
ATOM   4086  O  O     . VAL C 2  115  ? 16.666  26.357  -34.622  1.00 35.46  ? 115  VAL C O     1 
ATOM   4087  C  CB    . VAL C 2  115  ? 17.871  23.664  -33.481  1.00 37.83  ? 115  VAL C CB    1 
ATOM   4088  C  CG1   . VAL C 2  115  ? 16.681  22.875  -32.956  1.00 36.09  ? 115  VAL C CG1   1 
ATOM   4089  C  CG2   . VAL C 2  115  ? 19.135  22.805  -33.457  1.00 36.75  ? 115  VAL C CG2   1 
ATOM   4090  N  N     . LYS C 2  116  ? 15.254  24.707  -35.232  1.00 37.73  ? 116  LYS C N     1 
ATOM   4091  C  CA    . LYS C 2  116  ? 14.088  25.571  -35.389  1.00 38.60  ? 116  LYS C CA    1 
ATOM   4092  C  C     . LYS C 2  116  ? 13.752  26.327  -34.111  1.00 35.89  ? 116  LYS C C     1 
ATOM   4093  O  O     . LYS C 2  116  ? 13.182  27.419  -34.155  1.00 33.00  ? 116  LYS C O     1 
ATOM   4094  C  CB    . LYS C 2  116  ? 12.875  24.749  -35.843  1.00 37.76  ? 116  LYS C CB    1 
ATOM   4095  C  CG    . LYS C 2  116  ? 13.088  23.982  -37.144  1.00 33.62  ? 116  LYS C CG    1 
ATOM   4096  C  CD    . LYS C 2  116  ? 11.771  23.486  -37.732  1.00 33.65  ? 116  LYS C CD    1 
ATOM   4097  C  CE    . LYS C 2  116  ? 10.845  24.648  -38.062  1.00 34.65  ? 116  LYS C CE    1 
ATOM   4098  N  NZ    . LYS C 2  116  ? 9.557   24.201  -38.658  1.00 39.92  ? 116  LYS C NZ    1 
ATOM   4099  N  N     . ALA C 2  117  ? 14.116  25.736  -32.978  1.00 36.43  ? 117  ALA C N     1 
ATOM   4100  C  CA    . ALA C 2  117  ? 13.869  26.333  -31.673  1.00 40.01  ? 117  ALA C CA    1 
ATOM   4101  C  C     . ALA C 2  117  ? 14.770  25.695  -30.619  1.00 40.71  ? 117  ALA C C     1 
ATOM   4102  O  O     . ALA C 2  117  ? 15.086  24.509  -30.710  1.00 37.58  ? 117  ALA C O     1 
ATOM   4103  C  CB    . ALA C 2  117  ? 12.402  26.180  -31.285  1.00 47.87  ? 117  ALA C CB    1 
ATOM   4104  N  N     . PRO C 2  118  ? 15.191  26.483  -29.614  1.00 44.12  ? 118  PRO C N     1 
ATOM   4105  C  CA    . PRO C 2  118  ? 16.035  25.983  -28.521  1.00 39.93  ? 118  PRO C CA    1 
ATOM   4106  C  C     . PRO C 2  118  ? 15.371  24.868  -27.708  1.00 39.15  ? 118  PRO C C     1 
ATOM   4107  O  O     . PRO C 2  118  ? 14.188  24.579  -27.891  1.00 38.44  ? 118  PRO C O     1 
ATOM   4108  C  CB    . PRO C 2  118  ? 16.254  27.225  -27.652  1.00 38.22  ? 118  PRO C CB    1 
ATOM   4109  C  CG    . PRO C 2  118  ? 16.049  28.377  -28.575  1.00 39.39  ? 118  PRO C CG    1 
ATOM   4110  C  CD    . PRO C 2  118  ? 14.983  27.939  -29.527  1.00 42.49  ? 118  PRO C CD    1 
ATOM   4111  N  N     . VAL C 2  119  ? 16.137  24.251  -26.817  1.00 35.27  ? 119  VAL C N     1 
ATOM   4112  C  CA    . VAL C 2  119  ? 15.640  23.151  -26.001  1.00 35.56  ? 119  VAL C CA    1 
ATOM   4113  C  C     . VAL C 2  119  ? 14.477  23.560  -25.100  1.00 35.02  ? 119  VAL C C     1 
ATOM   4114  O  O     . VAL C 2  119  ? 13.432  22.911  -25.094  1.00 32.62  ? 119  VAL C O     1 
ATOM   4115  C  CB    . VAL C 2  119  ? 16.770  22.565  -25.128  1.00 37.99  ? 119  VAL C CB    1 
ATOM   4116  C  CG1   . VAL C 2  119  ? 16.203  21.654  -24.047  1.00 37.72  ? 119  VAL C CG1   1 
ATOM   4117  C  CG2   . VAL C 2  119  ? 17.785  21.835  -25.992  1.00 38.83  ? 119  VAL C CG2   1 
ATOM   4118  N  N     . ASP C 2  120  ? 14.662  24.642  -24.352  1.00 40.58  ? 120  ASP C N     1 
ATOM   4119  C  CA    . ASP C 2  120  ? 13.674  25.081  -23.371  1.00 40.40  ? 120  ASP C CA    1 
ATOM   4120  C  C     . ASP C 2  120  ? 12.327  25.413  -24.005  1.00 35.82  ? 120  ASP C C     1 
ATOM   4121  O  O     . ASP C 2  120  ? 11.278  25.091  -23.449  1.00 33.59  ? 120  ASP C O     1 
ATOM   4122  C  CB    . ASP C 2  120  ? 14.195  26.297  -22.593  1.00 47.17  ? 120  ASP C CB    1 
ATOM   4123  C  CG    . ASP C 2  120  ? 14.484  27.494  -23.490  1.00 44.83  ? 120  ASP C CG    1 
ATOM   4124  O  OD1   . ASP C 2  120  ? 14.775  27.285  -24.688  1.00 44.72  ? 120  ASP C OD1   1 
ATOM   4125  O  OD2   . ASP C 2  120  ? 14.420  28.645  -22.999  1.00 39.15  ? 120  ASP C OD2   1 
ATOM   4126  N  N     . GLU C 2  121  ? 12.361  26.050  -25.172  1.00 36.63  ? 121  GLU C N     1 
ATOM   4127  C  CA    . GLU C 2  121  ? 11.141  26.472  -25.851  1.00 39.59  ? 121  GLU C CA    1 
ATOM   4128  C  C     . GLU C 2  121  ? 10.351  25.267  -26.334  1.00 36.93  ? 121  GLU C C     1 
ATOM   4129  O  O     . GLU C 2  121  ? 9.121   25.274  -26.339  1.00 35.11  ? 121  GLU C O     1 
ATOM   4130  C  CB    . GLU C 2  121  ? 11.475  27.400  -27.019  1.00 46.86  ? 121  GLU C CB    1 
ATOM   4131  C  CG    . GLU C 2  121  ? 10.259  28.028  -27.668  1.00 55.82  ? 121  GLU C CG    1 
ATOM   4132  C  CD    . GLU C 2  121  ? 10.629  29.046  -28.734  1.00 61.97  ? 121  GLU C CD    1 
ATOM   4133  O  OE1   . GLU C 2  121  ? 11.834  29.179  -29.042  1.00 55.30  ? 121  GLU C OE1   1 
ATOM   4134  O  OE2   . GLU C 2  121  ? 9.717   29.717  -29.261  1.00 68.51  ? 121  GLU C OE2   1 
ATOM   4135  N  N     . CYS C 2  122  ? 11.074  24.227  -26.728  1.00 34.82  ? 122  CYS C N     1 
ATOM   4136  C  CA    . CYS C 2  122  ? 10.444  22.991  -27.159  1.00 38.57  ? 122  CYS C CA    1 
ATOM   4137  C  C     . CYS C 2  122  ? 9.701   22.325  -25.993  1.00 39.03  ? 122  CYS C C     1 
ATOM   4138  O  O     . CYS C 2  122  ? 8.528   21.964  -26.128  1.00 35.68  ? 122  CYS C O     1 
ATOM   4139  C  CB    . CYS C 2  122  ? 11.485  22.045  -27.761  1.00 39.65  ? 122  CYS C CB    1 
ATOM   4140  S  SG    . CYS C 2  122  ? 12.150  22.610  -29.361  1.00 31.39  ? 122  CYS C SG    1 
ATOM   4141  N  N     . LYS C 2  123  ? 10.376  22.185  -24.849  1.00 38.24  ? 123  LYS C N     1 
ATOM   4142  C  CA    . LYS C 2  123  ? 9.756   21.626  -23.640  1.00 35.58  ? 123  LYS C CA    1 
ATOM   4143  C  C     . LYS C 2  123  ? 8.514   22.420  -23.228  1.00 36.60  ? 123  LYS C C     1 
ATOM   4144  O  O     . LYS C 2  123  ? 7.550   21.863  -22.697  1.00 37.17  ? 123  LYS C O     1 
ATOM   4145  C  CB    . LYS C 2  123  ? 10.746  21.605  -22.463  1.00 35.44  ? 123  LYS C CB    1 
ATOM   4146  C  CG    . LYS C 2  123  ? 11.821  20.519  -22.493  1.00 37.90  ? 123  LYS C CG    1 
ATOM   4147  C  CD    . LYS C 2  123  ? 12.608  20.504  -21.173  1.00 49.32  ? 123  LYS C CD    1 
ATOM   4148  C  CE    . LYS C 2  123  ? 13.600  19.344  -21.088  1.00 37.14  ? 123  LYS C CE    1 
ATOM   4149  N  NZ    . LYS C 2  123  ? 14.312  19.304  -19.779  1.00 35.33  ? 123  LYS C NZ    1 
ATOM   4150  N  N     . ASP C 2  124  ? 8.549   23.726  -23.477  1.00 37.82  ? 124  ASP C N     1 
ATOM   4151  C  CA    . ASP C 2  124  ? 7.503   24.634  -23.020  1.00 36.44  ? 124  ASP C CA    1 
ATOM   4152  C  C     . ASP C 2  124  ? 6.317   24.657  -23.978  1.00 35.53  ? 124  ASP C C     1 
ATOM   4153  O  O     . ASP C 2  124  ? 5.169   24.726  -23.550  1.00 38.45  ? 124  ASP C O     1 
ATOM   4154  C  CB    . ASP C 2  124  ? 8.074   26.047  -22.845  1.00 37.91  ? 124  ASP C CB    1 
ATOM   4155  C  CG    . ASP C 2  124  ? 7.056   27.036  -22.295  1.00 39.84  ? 124  ASP C CG    1 
ATOM   4156  O  OD1   . ASP C 2  124  ? 6.870   27.088  -21.061  1.00 38.98  ? 124  ASP C OD1   1 
ATOM   4157  O  OD2   . ASP C 2  124  ? 6.451   27.778  -23.095  1.00 42.74  ? 124  ASP C OD2   1 
ATOM   4158  N  N     . LYS C 2  125  ? 6.593   24.581  -25.275  1.00 33.28  ? 125  LYS C N     1 
ATOM   4159  C  CA    . LYS C 2  125  ? 5.538   24.722  -26.271  1.00 34.77  ? 125  LYS C CA    1 
ATOM   4160  C  C     . LYS C 2  125  ? 5.171   23.403  -26.940  1.00 34.30  ? 125  LYS C C     1 
ATOM   4161  O  O     . LYS C 2  125  ? 4.521   23.390  -27.985  1.00 34.06  ? 125  LYS C O     1 
ATOM   4162  C  CB    . LYS C 2  125  ? 5.953   25.750  -27.321  1.00 36.95  ? 125  LYS C CB    1 
ATOM   4163  C  CG    . LYS C 2  125  ? 6.032   27.163  -26.767  1.00 41.61  ? 125  LYS C CG    1 
ATOM   4164  C  CD    . LYS C 2  125  ? 6.259   28.184  -27.859  1.00 53.27  ? 125  LYS C CD    1 
ATOM   4165  C  CE    . LYS C 2  125  ? 6.316   29.585  -27.289  1.00 63.07  ? 125  LYS C CE    1 
ATOM   4166  N  NZ    . LYS C 2  125  ? 6.457   30.588  -28.377  1.00 70.44  ? 125  LYS C NZ    1 
ATOM   4167  N  N     . ASP C 2  126  ? 5.591   22.305  -26.318  1.00 35.85  ? 126  ASP C N     1 
ATOM   4168  C  CA    . ASP C 2  126  ? 5.281   20.944  -26.767  1.00 35.49  ? 126  ASP C CA    1 
ATOM   4169  C  C     . ASP C 2  126  ? 5.556   20.700  -28.260  1.00 33.59  ? 126  ASP C C     1 
ATOM   4170  O  O     . ASP C 2  126  ? 4.794   20.006  -28.938  1.00 30.09  ? 126  ASP C O     1 
ATOM   4171  C  CB    . ASP C 2  126  ? 3.820   20.598  -26.438  1.00 36.48  ? 126  ASP C CB    1 
ATOM   4172  C  CG    . ASP C 2  126  ? 3.670   19.884  -25.091  1.00 39.09  ? 126  ASP C CG    1 
ATOM   4173  O  OD1   . ASP C 2  126  ? 4.427   20.209  -24.149  1.00 38.30  ? 126  ASP C OD1   1 
ATOM   4174  O  OD2   . ASP C 2  126  ? 2.799   18.991  -24.978  1.00 44.49  ? 126  ASP C OD2   1 
ATOM   4175  N  N     . MET C 2  127  ? 6.653   21.264  -28.761  1.00 33.54  ? 127  MET C N     1 
ATOM   4176  C  CA    . MET C 2  127  ? 7.079   21.032  -30.140  1.00 32.28  ? 127  MET C CA    1 
ATOM   4177  C  C     . MET C 2  127  ? 8.325   20.155  -30.173  1.00 29.52  ? 127  MET C C     1 
ATOM   4178  O  O     . MET C 2  127  ? 8.957   19.940  -29.144  1.00 30.12  ? 127  MET C O     1 
ATOM   4179  C  CB    . MET C 2  127  ? 7.337   22.358  -30.861  1.00 33.70  ? 127  MET C CB    1 
ATOM   4180  C  CG    . MET C 2  127  ? 8.466   23.196  -30.288  1.00 34.17  ? 127  MET C CG    1 
ATOM   4181  S  SD    . MET C 2  127  ? 8.587   24.810  -31.093  1.00 52.73  ? 127  MET C SD    1 
ATOM   4182  C  CE    . MET C 2  127  ? 8.808   24.342  -32.808  1.00 41.87  ? 127  MET C CE    1 
ATOM   4183  N  N     . THR C 2  128  ? 8.675   19.648  -31.351  1.00 28.51  ? 128  THR C N     1 
ATOM   4184  C  CA    . THR C 2  128  ? 9.818   18.747  -31.474  1.00 28.72  ? 128  THR C CA    1 
ATOM   4185  C  C     . THR C 2  128  ? 11.114  19.506  -31.752  1.00 29.54  ? 128  THR C C     1 
ATOM   4186  O  O     . THR C 2  128  ? 11.180  20.348  -32.648  1.00 27.54  ? 128  THR C O     1 
ATOM   4187  C  CB    . THR C 2  128  ? 9.592   17.695  -32.586  1.00 26.20  ? 128  THR C CB    1 
ATOM   4188  O  OG1   . THR C 2  128  ? 8.637   16.727  -32.137  1.00 25.23  ? 128  THR C OG1   1 
ATOM   4189  C  CG2   . THR C 2  128  ? 10.889  16.981  -32.930  1.00 25.32  ? 128  THR C CG2   1 
ATOM   4190  N  N     . TYR C 2  129  ? 12.137  19.206  -30.955  1.00 31.62  ? 129  TYR C N     1 
ATOM   4191  C  CA    . TYR C 2  129  ? 13.470  19.756  -31.155  1.00 31.95  ? 129  TYR C CA    1 
ATOM   4192  C  C     . TYR C 2  129  ? 14.052  19.174  -32.430  1.00 30.90  ? 129  TYR C C     1 
ATOM   4193  O  O     . TYR C 2  129  ? 14.326  17.976  -32.509  1.00 28.25  ? 129  TYR C O     1 
ATOM   4194  C  CB    . TYR C 2  129  ? 14.368  19.448  -29.955  1.00 32.96  ? 129  TYR C CB    1 
ATOM   4195  C  CG    . TYR C 2  129  ? 15.726  20.111  -29.996  1.00 33.84  ? 129  TYR C CG    1 
ATOM   4196  C  CD1   . TYR C 2  129  ? 15.900  21.412  -29.536  1.00 34.01  ? 129  TYR C CD1   1 
ATOM   4197  C  CD2   . TYR C 2  129  ? 16.839  19.431  -30.475  1.00 30.69  ? 129  TYR C CD2   1 
ATOM   4198  C  CE1   . TYR C 2  129  ? 17.140  22.019  -29.564  1.00 35.59  ? 129  TYR C CE1   1 
ATOM   4199  C  CE2   . TYR C 2  129  ? 18.083  20.032  -30.507  1.00 30.16  ? 129  TYR C CE2   1 
ATOM   4200  C  CZ    . TYR C 2  129  ? 18.227  21.325  -30.052  1.00 34.43  ? 129  TYR C CZ    1 
ATOM   4201  O  OH    . TYR C 2  129  ? 19.463  21.931  -30.081  1.00 35.39  ? 129  TYR C OH    1 
ATOM   4202  N  N     . ALA C 2  130  ? 14.235  20.023  -33.433  1.00 31.30  ? 130  ALA C N     1 
ATOM   4203  C  CA    . ALA C 2  130  ? 14.633  19.537  -34.741  1.00 33.03  ? 130  ALA C CA    1 
ATOM   4204  C  C     . ALA C 2  130  ? 15.328  20.594  -35.580  1.00 33.20  ? 130  ALA C C     1 
ATOM   4205  O  O     . ALA C 2  130  ? 15.007  21.779  -35.503  1.00 31.92  ? 130  ALA C O     1 
ATOM   4206  C  CB    . ALA C 2  130  ? 13.418  18.998  -35.485  1.00 34.00  ? 130  ALA C CB    1 
ATOM   4207  N  N     . ALA C 2  131  ? 16.284  20.140  -36.383  1.00 36.91  ? 131  ALA C N     1 
ATOM   4208  C  CA    . ALA C 2  131  ? 16.990  20.993  -37.330  1.00 40.19  ? 131  ALA C CA    1 
ATOM   4209  C  C     . ALA C 2  131  ? 16.750  20.486  -38.753  1.00 41.38  ? 131  ALA C C     1 
ATOM   4210  O  O     . ALA C 2  131  ? 17.089  19.344  -39.072  1.00 36.97  ? 131  ALA C O     1 
ATOM   4211  C  CB    . ALA C 2  131  ? 18.475  21.026  -37.010  1.00 37.93  ? 131  ALA C CB    1 
ATOM   4212  N  N     . PRO C 2  132  ? 16.156  21.335  -39.609  1.00 41.48  ? 132  PRO C N     1 
ATOM   4213  C  CA    . PRO C 2  132  ? 15.727  20.952  -40.961  1.00 39.09  ? 132  PRO C CA    1 
ATOM   4214  C  C     . PRO C 2  132  ? 16.853  20.382  -41.825  1.00 36.22  ? 132  PRO C C     1 
ATOM   4215  O  O     . PRO C 2  132  ? 18.007  20.782  -41.683  1.00 35.51  ? 132  PRO C O     1 
ATOM   4216  C  CB    . PRO C 2  132  ? 15.200  22.269  -41.545  1.00 40.61  ? 132  PRO C CB    1 
ATOM   4217  C  CG    . PRO C 2  132  ? 15.794  23.348  -40.690  1.00 39.98  ? 132  PRO C CG    1 
ATOM   4218  C  CD    . PRO C 2  132  ? 15.878  22.752  -39.325  1.00 38.62  ? 132  PRO C CD    1 
ATOM   4219  N  N     . LEU C 2  133  ? 16.503  19.460  -42.716  1.00 37.77  ? 133  LEU C N     1 
ATOM   4220  C  CA    . LEU C 2  133  ? 17.489  18.758  -43.532  1.00 41.84  ? 133  LEU C CA    1 
ATOM   4221  C  C     . LEU C 2  133  ? 17.383  19.108  -45.015  1.00 47.36  ? 133  LEU C C     1 
ATOM   4222  O  O     . LEU C 2  133  ? 16.287  19.152  -45.575  1.00 46.55  ? 133  LEU C O     1 
ATOM   4223  C  CB    . LEU C 2  133  ? 17.339  17.245  -43.346  1.00 40.08  ? 133  LEU C CB    1 
ATOM   4224  C  CG    . LEU C 2  133  ? 18.172  16.307  -44.227  1.00 38.00  ? 133  LEU C CG    1 
ATOM   4225  C  CD1   . LEU C 2  133  ? 19.665  16.489  -43.994  1.00 44.05  ? 133  LEU C CD1   1 
ATOM   4226  C  CD2   . LEU C 2  133  ? 17.770  14.871  -43.971  1.00 37.21  ? 133  LEU C CD2   1 
ATOM   4227  N  N     . PHE C 2  134  ? 18.534  19.348  -45.641  1.00 50.93  ? 134  PHE C N     1 
ATOM   4228  C  CA    . PHE C 2  134  ? 18.612  19.656  -47.068  1.00 53.88  ? 134  PHE C CA    1 
ATOM   4229  C  C     . PHE C 2  134  ? 19.552  18.702  -47.803  1.00 54.67  ? 134  PHE C C     1 
ATOM   4230  O  O     . PHE C 2  134  ? 20.598  18.314  -47.279  1.00 52.83  ? 134  PHE C O     1 
ATOM   4231  C  CB    . PHE C 2  134  ? 19.081  21.097  -47.284  1.00 57.10  ? 134  PHE C CB    1 
ATOM   4232  C  CG    . PHE C 2  134  ? 18.094  22.137  -46.835  1.00 60.19  ? 134  PHE C CG    1 
ATOM   4233  C  CD1   . PHE C 2  134  ? 16.734  21.938  -46.985  1.00 56.89  ? 134  PHE C CD1   1 
ATOM   4234  C  CD2   . PHE C 2  134  ? 18.530  23.321  -46.264  1.00 69.62  ? 134  PHE C CD2   1 
ATOM   4235  C  CE1   . PHE C 2  134  ? 15.829  22.902  -46.573  1.00 61.92  ? 134  PHE C CE1   1 
ATOM   4236  C  CE2   . PHE C 2  134  ? 17.630  24.285  -45.847  1.00 69.93  ? 134  PHE C CE2   1 
ATOM   4237  C  CZ    . PHE C 2  134  ? 16.278  24.075  -46.001  1.00 71.01  ? 134  PHE C CZ    1 
ATOM   4238  N  N     . VAL C 2  135  ? 19.171  18.335  -49.024  1.00 56.47  ? 135  VAL C N     1 
ATOM   4239  C  CA    . VAL C 2  135  ? 19.993  17.481  -49.877  1.00 57.43  ? 135  VAL C CA    1 
ATOM   4240  C  C     . VAL C 2  135  ? 20.014  17.988  -51.314  1.00 58.49  ? 135  VAL C C     1 
ATOM   4241  O  O     . VAL C 2  135  ? 19.125  18.726  -51.736  1.00 56.73  ? 135  VAL C O     1 
ATOM   4242  C  CB    . VAL C 2  135  ? 19.489  16.029  -49.890  1.00 54.52  ? 135  VAL C CB    1 
ATOM   4243  C  CG1   . VAL C 2  135  ? 19.603  15.405  -48.507  1.00 53.76  ? 135  VAL C CG1   1 
ATOM   4244  C  CG2   . VAL C 2  135  ? 18.059  15.977  -50.393  1.00 56.45  ? 135  VAL C CG2   1 
ATOM   4245  N  N     . THR C 2  136  ? 21.029  17.575  -52.064  1.00 61.89  ? 136  THR C N     1 
ATOM   4246  C  CA    . THR C 2  136  ? 21.141  17.948  -53.467  1.00 64.87  ? 136  THR C CA    1 
ATOM   4247  C  C     . THR C 2  136  ? 20.661  16.804  -54.356  1.00 67.66  ? 136  THR C C     1 
ATOM   4248  O  O     . THR C 2  136  ? 21.267  15.733  -54.388  1.00 69.94  ? 136  THR C O     1 
ATOM   4249  C  CB    . THR C 2  136  ? 22.589  18.332  -53.835  1.00 61.08  ? 136  THR C CB    1 
ATOM   4250  O  OG1   . THR C 2  136  ? 22.996  19.464  -53.055  1.00 55.77  ? 136  THR C OG1   1 
ATOM   4251  C  CG2   . THR C 2  136  ? 22.692  18.683  -55.308  1.00 65.92  ? 136  THR C CG2   1 
ATOM   4252  N  N     . ALA C 2  137  ? 19.560  17.035  -55.063  1.00 69.50  ? 137  ALA C N     1 
ATOM   4253  C  CA    . ALA C 2  137  ? 18.995  16.034  -55.960  1.00 73.62  ? 137  ALA C CA    1 
ATOM   4254  C  C     . ALA C 2  137  ? 19.128  16.467  -57.415  1.00 79.25  ? 137  ALA C C     1 
ATOM   4255  O  O     . ALA C 2  137  ? 18.775  17.591  -57.769  1.00 76.99  ? 137  ALA C O     1 
ATOM   4256  C  CB    . ALA C 2  137  ? 17.536  15.777  -55.617  1.00 72.59  ? 137  ALA C CB    1 
ATOM   4257  N  N     . GLU C 2  138  ? 19.638  15.573  -58.255  1.00 83.17  ? 138  GLU C N     1 
ATOM   4258  C  CA    . GLU C 2  138  ? 19.767  15.857  -59.680  1.00 85.90  ? 138  GLU C CA    1 
ATOM   4259  C  C     . GLU C 2  138  ? 19.062  14.798  -60.525  1.00 89.55  ? 138  GLU C C     1 
ATOM   4260  O  O     . GLU C 2  138  ? 19.120  13.603  -60.228  1.00 85.19  ? 138  GLU C O     1 
ATOM   4261  C  CB    . GLU C 2  138  ? 21.241  15.957  -60.078  1.00 85.25  ? 138  GLU C CB    1 
ATOM   4262  C  CG    . GLU C 2  138  ? 22.056  14.705  -59.819  1.00 89.71  ? 138  GLU C CG    1 
ATOM   4263  C  CD    . GLU C 2  138  ? 23.512  14.874  -60.215  1.00 87.46  ? 138  GLU C CD    1 
ATOM   4264  O  OE1   . GLU C 2  138  ? 23.961  16.032  -60.354  1.00 83.32  ? 138  GLU C OE1   1 
ATOM   4265  O  OE2   . GLU C 2  138  ? 24.206  13.849  -60.392  1.00 87.84  ? 138  GLU C OE2   1 
ATOM   4266  N  N     . PHE C 2  139  ? 18.386  15.253  -61.575  1.00 91.59  ? 139  PHE C N     1 
ATOM   4267  C  CA    . PHE C 2  139  ? 17.651  14.366  -62.470  1.00 97.66  ? 139  PHE C CA    1 
ATOM   4268  C  C     . PHE C 2  139  ? 18.435  14.108  -63.753  1.00 97.85  ? 139  PHE C C     1 
ATOM   4269  O  O     . PHE C 2  139  ? 18.381  14.897  -64.697  1.00 100.54 ? 139  PHE C O     1 
ATOM   4270  C  CB    . PHE C 2  139  ? 16.276  14.958  -62.796  1.00 106.26 ? 139  PHE C CB    1 
ATOM   4271  C  CG    . PHE C 2  139  ? 15.508  14.184  -63.831  1.00 112.85 ? 139  PHE C CG    1 
ATOM   4272  C  CD1   . PHE C 2  139  ? 15.240  14.737  -65.073  1.00 116.16 ? 139  PHE C CD1   1 
ATOM   4273  C  CD2   . PHE C 2  139  ? 15.057  12.903  -63.563  1.00 117.20 ? 139  PHE C CD2   1 
ATOM   4274  C  CE1   . PHE C 2  139  ? 14.533  14.027  -66.028  1.00 121.26 ? 139  PHE C CE1   1 
ATOM   4275  C  CE2   . PHE C 2  139  ? 14.351  12.187  -64.513  1.00 126.89 ? 139  PHE C CE2   1 
ATOM   4276  C  CZ    . PHE C 2  139  ? 14.089  12.750  -65.747  1.00 123.72 ? 139  PHE C CZ    1 
ATOM   4277  N  N     . ILE C 2  140  ? 19.165  12.999  -63.782  1.00 100.81 ? 140  ILE C N     1 
ATOM   4278  C  CA    . ILE C 2  140  ? 19.947  12.629  -64.955  1.00 102.63 ? 140  ILE C CA    1 
ATOM   4279  C  C     . ILE C 2  140  ? 19.078  11.925  -65.995  1.00 108.67 ? 140  ILE C C     1 
ATOM   4280  O  O     . ILE C 2  140  ? 18.405  10.940  -65.690  1.00 114.18 ? 140  ILE C O     1 
ATOM   4281  C  CB    . ILE C 2  140  ? 21.128  11.709  -64.583  1.00 105.33 ? 140  ILE C CB    1 
ATOM   4282  C  CG1   . ILE C 2  140  ? 21.903  12.276  -63.392  1.00 102.82 ? 140  ILE C CG1   1 
ATOM   4283  C  CG2   . ILE C 2  140  ? 22.044  11.505  -65.780  1.00 108.47 ? 140  ILE C CG2   1 
ATOM   4284  C  CD1   . ILE C 2  140  ? 22.945  11.326  -62.836  1.00 97.87  ? 140  ILE C CD1   1 
ATOM   4285  N  N     . ASN C 2  141  ? 19.093  12.440  -67.221  1.00 105.91 ? 141  ASN C N     1 
ATOM   4286  C  CA    . ASN C 2  141  ? 18.396  11.800  -68.329  1.00 112.69 ? 141  ASN C CA    1 
ATOM   4287  C  C     . ASN C 2  141  ? 19.393  11.337  -69.387  1.00 114.68 ? 141  ASN C C     1 
ATOM   4288  O  O     . ASN C 2  141  ? 20.209  12.122  -69.863  1.00 113.15 ? 141  ASN C O     1 
ATOM   4289  C  CB    . ASN C 2  141  ? 17.367  12.751  -68.938  1.00 115.60 ? 141  ASN C CB    1 
ATOM   4290  C  CG    . ASN C 2  141  ? 16.362  12.037  -69.816  1.00 120.50 ? 141  ASN C CG    1 
ATOM   4291  O  OD1   . ASN C 2  141  ? 15.992  10.888  -69.546  1.00 122.11 ? 141  ASN C OD1   1 
ATOM   4292  N  ND2   . ASN C 2  141  ? 15.883  12.727  -70.854  1.00 127.68 ? 141  ASN C ND2   1 
ATOM   4293  N  N     . ASN C 2  142  ? 19.344  10.056  -69.736  1.00 114.87 ? 142  ASN C N     1 
ATOM   4294  C  CA    . ASN C 2  142  ? 20.329  9.487   -70.651  1.00 116.39 ? 142  ASN C CA    1 
ATOM   4295  C  C     . ASN C 2  142  ? 20.043  9.822   -72.110  1.00 116.09 ? 142  ASN C C     1 
ATOM   4296  O  O     . ASN C 2  142  ? 20.961  9.944   -72.922  1.00 117.59 ? 142  ASN C O     1 
ATOM   4297  C  CB    . ASN C 2  142  ? 20.403  7.969   -70.477  1.00 116.83 ? 142  ASN C CB    1 
ATOM   4298  C  CG    . ASN C 2  142  ? 20.722  7.563   -69.053  1.00 116.01 ? 142  ASN C CG    1 
ATOM   4299  O  OD1   . ASN C 2  142  ? 21.033  8.404   -68.212  1.00 114.50 ? 142  ASN C OD1   1 
ATOM   4300  N  ND2   . ASN C 2  142  ? 20.653  6.266   -68.776  1.00 117.22 ? 142  ASN C ND2   1 
ATOM   4301  N  N     . ASN C 2  143  ? 18.765  9.978   -72.436  1.00 115.45 ? 143  ASN C N     1 
ATOM   4302  C  CA    . ASN C 2  143  ? 18.354  10.247  -73.808  1.00 115.28 ? 143  ASN C CA    1 
ATOM   4303  C  C     . ASN C 2  143  ? 18.579  11.699  -74.212  1.00 116.56 ? 143  ASN C C     1 
ATOM   4304  O  O     . ASN C 2  143  ? 19.340  11.983  -75.137  1.00 114.74 ? 143  ASN C O     1 
ATOM   4305  C  CB    . ASN C 2  143  ? 16.885  9.882   -73.998  1.00 118.92 ? 143  ASN C CB    1 
ATOM   4306  C  CG    . ASN C 2  143  ? 16.536  8.551   -73.373  1.00 126.05 ? 143  ASN C CG    1 
ATOM   4307  O  OD1   . ASN C 2  143  ? 15.540  8.430   -72.661  1.00 131.62 ? 143  ASN C OD1   1 
ATOM   4308  N  ND2   . ASN C 2  143  ? 17.366  7.544   -73.623  1.00 127.63 ? 143  ASN C ND2   1 
ATOM   4309  N  N     . THR C 2  144  ? 17.905  12.615  -73.523  1.00 117.69 ? 144  THR C N     1 
ATOM   4310  C  CA    . THR C 2  144  ? 18.067  14.037  -73.798  1.00 113.36 ? 144  THR C CA    1 
ATOM   4311  C  C     . THR C 2  144  ? 19.468  14.492  -73.403  1.00 109.40 ? 144  THR C C     1 
ATOM   4312  O  O     . THR C 2  144  ? 19.998  15.456  -73.956  1.00 108.80 ? 144  THR C O     1 
ATOM   4313  C  CB    . THR C 2  144  ? 17.012  14.885  -73.059  1.00 115.24 ? 144  THR C CB    1 
ATOM   4314  O  OG1   . THR C 2  144  ? 17.077  14.617  -71.653  1.00 116.45 ? 144  THR C OG1   1 
ATOM   4315  C  CG2   . THR C 2  144  ? 15.616  14.560  -73.568  1.00 115.65 ? 144  THR C CG2   1 
ATOM   4316  N  N     . GLY C 2  145  ? 20.067  13.785  -72.450  1.00 109.17 ? 145  GLY C N     1 
ATOM   4317  C  CA    . GLY C 2  145  ? 21.426  14.068  -72.027  1.00 107.71 ? 145  GLY C CA    1 
ATOM   4318  C  C     . GLY C 2  145  ? 21.509  15.084  -70.902  1.00 109.02 ? 145  GLY C C     1 
ATOM   4319  O  O     . GLY C 2  145  ? 22.443  15.057  -70.102  1.00 110.21 ? 145  GLY C O     1 
ATOM   4320  N  N     . GLU C 2  146  ? 20.523  15.974  -70.836  1.00 106.93 ? 146  GLU C N     1 
ATOM   4321  C  CA    . GLU C 2  146  ? 20.539  17.082  -69.883  1.00 103.96 ? 146  GLU C CA    1 
ATOM   4322  C  C     . GLU C 2  146  ? 20.372  16.630  -68.433  1.00 105.34 ? 146  GLU C C     1 
ATOM   4323  O  O     . GLU C 2  146  ? 19.901  15.525  -68.162  1.00 104.48 ? 146  GLU C O     1 
ATOM   4324  C  CB    . GLU C 2  146  ? 19.445  18.097  -70.234  1.00 105.15 ? 146  GLU C CB    1 
ATOM   4325  C  CG    . GLU C 2  146  ? 18.027  17.544  -70.187  1.00 108.85 ? 146  GLU C CG    1 
ATOM   4326  C  CD    . GLU C 2  146  ? 16.972  18.614  -70.421  1.00 109.44 ? 146  GLU C CD    1 
ATOM   4327  O  OE1   . GLU C 2  146  ? 17.339  19.807  -70.497  1.00 101.92 ? 146  GLU C OE1   1 
ATOM   4328  O  OE2   . GLU C 2  146  ? 15.778  18.262  -70.527  1.00 118.55 ? 146  GLU C OE2   1 
ATOM   4329  N  N     . ILE C 2  147  ? 20.772  17.500  -67.507  1.00 104.45 ? 147  ILE C N     1 
ATOM   4330  C  CA    . ILE C 2  147  ? 20.653  17.236  -66.075  1.00 103.49 ? 147  ILE C CA    1 
ATOM   4331  C  C     . ILE C 2  147  ? 20.201  18.492  -65.327  1.00 96.26  ? 147  ILE C C     1 
ATOM   4332  O  O     . ILE C 2  147  ? 20.795  19.561  -65.475  1.00 91.20  ? 147  ILE C O     1 
ATOM   4333  C  CB    . ILE C 2  147  ? 21.989  16.731  -65.476  1.00 101.63 ? 147  ILE C CB    1 
ATOM   4334  C  CG1   . ILE C 2  147  ? 22.328  15.336  -66.012  1.00 100.94 ? 147  ILE C CG1   1 
ATOM   4335  C  CG2   . ILE C 2  147  ? 21.926  16.706  -63.956  1.00 101.01 ? 147  ILE C CG2   1 
ATOM   4336  C  CD1   . ILE C 2  147  ? 23.658  14.791  -65.524  1.00 102.01 ? 147  ILE C CD1   1 
ATOM   4337  N  N     . LYS C 2  148  ? 19.140  18.357  -64.535  1.00 96.56  ? 148  LYS C N     1 
ATOM   4338  C  CA    . LYS C 2  148  ? 18.626  19.460  -63.727  1.00 92.29  ? 148  LYS C CA    1 
ATOM   4339  C  C     . LYS C 2  148  ? 18.804  19.171  -62.239  1.00 90.57  ? 148  LYS C C     1 
ATOM   4340  O  O     . LYS C 2  148  ? 18.199  18.243  -61.701  1.00 89.95  ? 148  LYS C O     1 
ATOM   4341  C  CB    . LYS C 2  148  ? 17.150  19.717  -64.037  1.00 90.57  ? 148  LYS C CB    1 
ATOM   4342  C  CG    . LYS C 2  148  ? 16.868  20.043  -65.493  1.00 91.22  ? 148  LYS C CG    1 
ATOM   4343  C  CD    . LYS C 2  148  ? 15.388  20.293  -65.732  1.00 90.48  ? 148  LYS C CD    1 
ATOM   4344  C  CE    . LYS C 2  148  ? 15.117  20.566  -67.205  1.00 94.99  ? 148  LYS C CE    1 
ATOM   4345  N  NZ    . LYS C 2  148  ? 13.677  20.815  -67.490  1.00 108.43 ? 148  LYS C NZ    1 
ATOM   4346  N  N     . SER C 2  149  ? 19.631  19.974  -61.577  1.00 91.46  ? 149  SER C N     1 
ATOM   4347  C  CA    . SER C 2  149  ? 19.951  19.749  -60.172  1.00 86.35  ? 149  SER C CA    1 
ATOM   4348  C  C     . SER C 2  149  ? 19.502  20.915  -59.298  1.00 80.81  ? 149  SER C C     1 
ATOM   4349  O  O     . SER C 2  149  ? 19.761  22.077  -59.610  1.00 77.03  ? 149  SER C O     1 
ATOM   4350  C  CB    . SER C 2  149  ? 21.454  19.511  -60.006  1.00 89.09  ? 149  SER C CB    1 
ATOM   4351  O  OG    . SER C 2  149  ? 21.774  19.153  -58.673  1.00 87.47  ? 149  SER C OG    1 
ATOM   4352  N  N     . GLN C 2  150  ? 18.826  20.593  -58.200  1.00 80.24  ? 150  GLN C N     1 
ATOM   4353  C  CA    . GLN C 2  150  ? 18.346  21.604  -57.269  1.00 75.57  ? 150  GLN C CA    1 
ATOM   4354  C  C     . GLN C 2  150  ? 18.283  21.031  -55.858  1.00 70.71  ? 150  GLN C C     1 
ATOM   4355  O  O     . GLN C 2  150  ? 18.358  19.818  -55.668  1.00 71.25  ? 150  GLN C O     1 
ATOM   4356  C  CB    . GLN C 2  150  ? 16.975  22.125  -57.705  1.00 80.22  ? 150  GLN C CB    1 
ATOM   4357  C  CG    . GLN C 2  150  ? 15.875  21.078  -57.679  1.00 86.15  ? 150  GLN C CG    1 
ATOM   4358  C  CD    . GLN C 2  150  ? 14.695  21.433  -58.570  1.00 87.42  ? 150  GLN C CD    1 
ATOM   4359  O  OE1   . GLN C 2  150  ? 13.841  20.593  -58.849  1.00 82.70  ? 150  GLN C OE1   1 
ATOM   4360  N  NE2   . GLN C 2  150  ? 14.641  22.683  -59.019  1.00 87.74  ? 150  GLN C NE2   1 
ATOM   4361  N  N     . THR C 2  151  ? 18.156  21.908  -54.870  1.00 65.38  ? 151  THR C N     1 
ATOM   4362  C  CA    . THR C 2  151  ? 18.114  21.488  -53.474  1.00 63.65  ? 151  THR C CA    1 
ATOM   4363  C  C     . THR C 2  151  ? 16.683  21.181  -53.037  1.00 64.31  ? 151  THR C C     1 
ATOM   4364  O  O     . THR C 2  151  ? 15.772  21.963  -53.294  1.00 66.65  ? 151  THR C O     1 
ATOM   4365  C  CB    . THR C 2  151  ? 18.713  22.567  -52.553  1.00 59.40  ? 151  THR C CB    1 
ATOM   4366  O  OG1   . THR C 2  151  ? 20.087  22.784  -52.897  1.00 61.16  ? 151  THR C OG1   1 
ATOM   4367  C  CG2   . THR C 2  151  ? 18.621  22.142  -51.098  1.00 66.69  ? 151  THR C CG2   1 
ATOM   4368  N  N     . VAL C 2  152  ? 16.488  20.042  -52.378  1.00 62.33  ? 152  VAL C N     1 
ATOM   4369  C  CA    . VAL C 2  152  ? 15.156  19.633  -51.939  1.00 59.67  ? 152  VAL C CA    1 
ATOM   4370  C  C     . VAL C 2  152  ? 15.035  19.601  -50.411  1.00 57.81  ? 152  VAL C C     1 
ATOM   4371  O  O     . VAL C 2  152  ? 15.918  19.090  -49.720  1.00 56.10  ? 152  VAL C O     1 
ATOM   4372  C  CB    . VAL C 2  152  ? 14.788  18.241  -52.496  1.00 54.69  ? 152  VAL C CB    1 
ATOM   4373  C  CG1   . VAL C 2  152  ? 13.324  17.926  -52.221  1.00 59.82  ? 152  VAL C CG1   1 
ATOM   4374  C  CG2   . VAL C 2  152  ? 15.079  18.163  -53.987  1.00 65.32  ? 152  VAL C CG2   1 
ATOM   4375  N  N     . PHE C 2  153  ? 13.944  20.164  -49.892  1.00 57.69  ? 153  PHE C N     1 
ATOM   4376  C  CA    . PHE C 2  153  ? 13.641  20.103  -48.462  1.00 57.50  ? 153  PHE C CA    1 
ATOM   4377  C  C     . PHE C 2  153  ? 13.239  18.676  -48.107  1.00 57.32  ? 153  PHE C C     1 
ATOM   4378  O  O     . PHE C 2  153  ? 12.462  18.052  -48.827  1.00 56.00  ? 153  PHE C O     1 
ATOM   4379  C  CB    . PHE C 2  153  ? 12.530  21.101  -48.093  1.00 57.29  ? 153  PHE C CB    1 
ATOM   4380  C  CG    . PHE C 2  153  ? 12.131  21.082  -46.630  1.00 65.47  ? 153  PHE C CG    1 
ATOM   4381  C  CD1   . PHE C 2  153  ? 13.067  21.293  -45.630  1.00 62.92  ? 153  PHE C CD1   1 
ATOM   4382  C  CD2   . PHE C 2  153  ? 10.807  20.886  -46.262  1.00 71.05  ? 153  PHE C CD2   1 
ATOM   4383  C  CE1   . PHE C 2  153  ? 12.692  21.286  -44.291  1.00 60.29  ? 153  PHE C CE1   1 
ATOM   4384  C  CE2   . PHE C 2  153  ? 10.429  20.878  -44.927  1.00 71.08  ? 153  PHE C CE2   1 
ATOM   4385  C  CZ    . PHE C 2  153  ? 11.372  21.082  -43.942  1.00 63.37  ? 153  PHE C CZ    1 
ATOM   4386  N  N     . MET C 2  154  ? 13.783  18.158  -47.009  1.00 53.83  ? 154  MET C N     1 
ATOM   4387  C  CA    . MET C 2  154  ? 13.552  16.769  -46.619  1.00 50.98  ? 154  MET C CA    1 
ATOM   4388  C  C     . MET C 2  154  ? 12.716  16.644  -45.345  1.00 52.49  ? 154  MET C C     1 
ATOM   4389  O  O     . MET C 2  154  ? 12.220  15.563  -45.022  1.00 54.69  ? 154  MET C O     1 
ATOM   4390  C  CB    . MET C 2  154  ? 14.886  16.039  -46.436  1.00 49.04  ? 154  MET C CB    1 
ATOM   4391  C  CG    . MET C 2  154  ? 15.589  15.696  -47.737  1.00 47.95  ? 154  MET C CG    1 
ATOM   4392  S  SD    . MET C 2  154  ? 14.536  14.799  -48.896  1.00 46.41  ? 154  MET C SD    1 
ATOM   4393  C  CE    . MET C 2  154  ? 14.160  13.316  -47.967  1.00 45.16  ? 154  MET C CE    1 
ATOM   4394  N  N     . GLY C 2  155  ? 12.563  17.749  -44.623  1.00 50.91  ? 155  GLY C N     1 
ATOM   4395  C  CA    . GLY C 2  155  ? 11.753  17.755  -43.419  1.00 49.52  ? 155  GLY C CA    1 
ATOM   4396  C  C     . GLY C 2  155  ? 12.472  18.295  -42.199  1.00 44.79  ? 155  GLY C C     1 
ATOM   4397  O  O     . GLY C 2  155  ? 13.652  18.642  -42.257  1.00 42.06  ? 155  GLY C O     1 
ATOM   4398  N  N     . ASP C 2  156  ? 11.744  18.372  -41.090  1.00 45.07  ? 156  ASP C N     1 
ATOM   4399  C  CA    . ASP C 2  156  ? 12.331  18.737  -39.809  1.00 42.09  ? 156  ASP C CA    1 
ATOM   4400  C  C     . ASP C 2  156  ? 12.902  17.493  -39.135  1.00 38.10  ? 156  ASP C C     1 
ATOM   4401  O  O     . ASP C 2  156  ? 12.181  16.531  -38.868  1.00 34.85  ? 156  ASP C O     1 
ATOM   4402  C  CB    . ASP C 2  156  ? 11.292  19.415  -38.916  1.00 37.57  ? 156  ASP C CB    1 
ATOM   4403  C  CG    . ASP C 2  156  ? 10.704  20.661  -39.551  1.00 34.77  ? 156  ASP C CG    1 
ATOM   4404  O  OD1   . ASP C 2  156  ? 11.433  21.368  -40.279  1.00 36.29  ? 156  ASP C OD1   1 
ATOM   4405  O  OD2   . ASP C 2  156  ? 9.508   20.929  -39.326  1.00 34.83  ? 156  ASP C OD2   1 
ATOM   4406  N  N     . PHE C 2  157  ? 14.202  17.518  -38.862  1.00 36.27  ? 157  PHE C N     1 
ATOM   4407  C  CA    . PHE C 2  157  ? 14.913  16.337  -38.387  1.00 36.53  ? 157  PHE C CA    1 
ATOM   4408  C  C     . PHE C 2  157  ? 15.258  16.401  -36.899  1.00 36.20  ? 157  PHE C C     1 
ATOM   4409  O  O     . PHE C 2  157  ? 16.005  17.284  -36.468  1.00 33.54  ? 157  PHE C O     1 
ATOM   4410  C  CB    . PHE C 2  157  ? 16.189  16.146  -39.206  1.00 38.00  ? 157  PHE C CB    1 
ATOM   4411  C  CG    . PHE C 2  157  ? 16.888  14.848  -38.947  1.00 37.02  ? 157  PHE C CG    1 
ATOM   4412  C  CD1   . PHE C 2  157  ? 17.842  14.747  -37.949  1.00 35.62  ? 157  PHE C CD1   1 
ATOM   4413  C  CD2   . PHE C 2  157  ? 16.594  13.729  -39.704  1.00 34.74  ? 157  PHE C CD2   1 
ATOM   4414  C  CE1   . PHE C 2  157  ? 18.487  13.554  -37.710  1.00 35.20  ? 157  PHE C CE1   1 
ATOM   4415  C  CE2   . PHE C 2  157  ? 17.237  12.534  -39.472  1.00 33.58  ? 157  PHE C CE2   1 
ATOM   4416  C  CZ    . PHE C 2  157  ? 18.184  12.446  -38.474  1.00 34.74  ? 157  PHE C CZ    1 
ATOM   4417  N  N     . PRO C 2  158  ? 14.730  15.447  -36.116  1.00 33.69  ? 158  PRO C N     1 
ATOM   4418  C  CA    . PRO C 2  158  ? 14.964  15.353  -34.670  1.00 32.38  ? 158  PRO C CA    1 
ATOM   4419  C  C     . PRO C 2  158  ? 16.442  15.277  -34.297  1.00 32.38  ? 158  PRO C C     1 
ATOM   4420  O  O     . PRO C 2  158  ? 17.094  14.284  -34.607  1.00 32.32  ? 158  PRO C O     1 
ATOM   4421  C  CB    . PRO C 2  158  ? 14.256  14.051  -34.287  1.00 28.80  ? 158  PRO C CB    1 
ATOM   4422  C  CG    . PRO C 2  158  ? 13.228  13.856  -35.335  1.00 27.81  ? 158  PRO C CG    1 
ATOM   4423  C  CD    . PRO C 2  158  ? 13.821  14.391  -36.596  1.00 32.06  ? 158  PRO C CD    1 
ATOM   4424  N  N     . MET C 2  159  ? 16.954  16.309  -33.634  1.00 29.16  ? 159  MET C N     1 
ATOM   4425  C  CA    . MET C 2  159  ? 18.342  16.318  -33.177  1.00 29.10  ? 159  MET C CA    1 
ATOM   4426  C  C     . MET C 2  159  ? 18.456  15.863  -31.721  1.00 31.00  ? 159  MET C C     1 
ATOM   4427  O  O     . MET C 2  159  ? 17.485  15.915  -30.964  1.00 30.78  ? 159  MET C O     1 
ATOM   4428  C  CB    . MET C 2  159  ? 18.946  17.713  -33.341  1.00 30.74  ? 159  MET C CB    1 
ATOM   4429  C  CG    . MET C 2  159  ? 19.177  18.124  -34.788  1.00 30.88  ? 159  MET C CG    1 
ATOM   4430  S  SD    . MET C 2  159  ? 20.844  17.756  -35.362  1.00 32.32  ? 159  MET C SD    1 
ATOM   4431  C  CE    . MET C 2  159  ? 21.785  19.003  -34.487  1.00 23.37  ? 159  MET C CE    1 
ATOM   4432  N  N     . MET C 2  160  ? 19.646  15.411  -31.336  1.00 27.31  ? 160  MET C N     1 
ATOM   4433  C  CA    . MET C 2  160  ? 19.905  14.989  -29.962  1.00 25.38  ? 160  MET C CA    1 
ATOM   4434  C  C     . MET C 2  160  ? 20.546  16.115  -29.154  1.00 26.19  ? 160  MET C C     1 
ATOM   4435  O  O     . MET C 2  160  ? 21.434  16.808  -29.641  1.00 27.01  ? 160  MET C O     1 
ATOM   4436  C  CB    . MET C 2  160  ? 20.803  13.749  -29.937  1.00 25.41  ? 160  MET C CB    1 
ATOM   4437  C  CG    . MET C 2  160  ? 21.256  13.334  -28.540  1.00 27.55  ? 160  MET C CG    1 
ATOM   4438  S  SD    . MET C 2  160  ? 22.385  11.924  -28.546  1.00 34.27  ? 160  MET C SD    1 
ATOM   4439  C  CE    . MET C 2  160  ? 21.310  10.592  -29.078  1.00 32.21  ? 160  MET C CE    1 
ATOM   4440  N  N     . THR C 2  161  ? 20.086  16.291  -27.919  1.00 27.61  ? 161  THR C N     1 
ATOM   4441  C  CA    . THR C 2  161  ? 20.599  17.336  -27.037  1.00 29.14  ? 161  THR C CA    1 
ATOM   4442  C  C     . THR C 2  161  ? 22.012  17.042  -26.559  1.00 33.06  ? 161  THR C C     1 
ATOM   4443  O  O     . THR C 2  161  ? 22.621  16.053  -26.960  1.00 32.34  ? 161  THR C O     1 
ATOM   4444  C  CB    . THR C 2  161  ? 19.711  17.508  -25.797  1.00 30.41  ? 161  THR C CB    1 
ATOM   4445  O  OG1   . THR C 2  161  ? 19.707  16.289  -25.043  1.00 31.84  ? 161  THR C OG1   1 
ATOM   4446  C  CG2   . THR C 2  161  ? 18.289  17.854  -26.202  1.00 34.76  ? 161  THR C CG2   1 
ATOM   4447  N  N     . GLU C 2  162  ? 22.524  17.908  -25.689  1.00 36.93  ? 162  GLU C N     1 
ATOM   4448  C  CA    . GLU C 2  162  ? 23.813  17.676  -25.048  1.00 41.22  ? 162  GLU C CA    1 
ATOM   4449  C  C     . GLU C 2  162  ? 23.694  16.592  -23.984  1.00 38.99  ? 162  GLU C C     1 
ATOM   4450  O  O     . GLU C 2  162  ? 24.625  15.816  -23.765  1.00 36.42  ? 162  GLU C O     1 
ATOM   4451  C  CB    . GLU C 2  162  ? 24.354  18.963  -24.419  1.00 42.62  ? 162  GLU C CB    1 
ATOM   4452  C  CG    . GLU C 2  162  ? 24.841  19.996  -25.417  1.00 52.18  ? 162  GLU C CG    1 
ATOM   4453  C  CD    . GLU C 2  162  ? 25.659  21.097  -24.765  1.00 73.12  ? 162  GLU C CD    1 
ATOM   4454  O  OE1   . GLU C 2  162  ? 25.944  20.990  -23.553  1.00 71.78  ? 162  GLU C OE1   1 
ATOM   4455  O  OE2   . GLU C 2  162  ? 26.015  22.069  -25.465  1.00 94.07  ? 162  GLU C OE2   1 
ATOM   4456  N  N     . LYS C 2  163  ? 22.537  16.537  -23.331  1.00 35.90  ? 163  LYS C N     1 
ATOM   4457  C  CA    . LYS C 2  163  ? 22.282  15.537  -22.301  1.00 34.20  ? 163  LYS C CA    1 
ATOM   4458  C  C     . LYS C 2  163  ? 21.964  14.173  -22.915  1.00 31.01  ? 163  LYS C C     1 
ATOM   4459  O  O     . LYS C 2  163  ? 21.538  13.254  -22.217  1.00 30.49  ? 163  LYS C O     1 
ATOM   4460  C  CB    . LYS C 2  163  ? 21.137  15.988  -21.385  1.00 36.72  ? 163  LYS C CB    1 
ATOM   4461  C  CG    . LYS C 2  163  ? 21.364  17.329  -20.696  1.00 35.96  ? 163  LYS C CG    1 
ATOM   4462  C  CD    . LYS C 2  163  ? 20.221  17.660  -19.746  1.00 34.57  ? 163  LYS C CD    1 
ATOM   4463  C  CE    . LYS C 2  163  ? 18.889  17.700  -20.476  1.00 32.58  ? 163  LYS C CE    1 
ATOM   4464  N  NZ    . LYS C 2  163  ? 17.743  17.868  -19.537  1.00 31.45  ? 163  LYS C NZ    1 
ATOM   4465  N  N     . GLY C 2  164  ? 22.175  14.052  -24.223  1.00 28.39  ? 164  GLY C N     1 
ATOM   4466  C  CA    . GLY C 2  164  ? 22.012  12.788  -24.918  1.00 29.14  ? 164  GLY C CA    1 
ATOM   4467  C  C     . GLY C 2  164  ? 20.568  12.354  -25.080  1.00 28.54  ? 164  GLY C C     1 
ATOM   4468  O  O     . GLY C 2  164  ? 20.289  11.199  -25.396  1.00 27.48  ? 164  GLY C O     1 
ATOM   4469  N  N     . THR C 2  165  ? 19.643  13.280  -24.862  1.00 27.39  ? 165  THR C N     1 
ATOM   4470  C  CA    . THR C 2  165  ? 18.225  12.971  -24.983  1.00 27.17  ? 165  THR C CA    1 
ATOM   4471  C  C     . THR C 2  165  ? 17.632  13.562  -26.253  1.00 27.20  ? 165  THR C C     1 
ATOM   4472  O  O     . THR C 2  165  ? 18.280  14.337  -26.957  1.00 27.29  ? 165  THR C O     1 
ATOM   4473  C  CB    . THR C 2  165  ? 17.422  13.497  -23.778  1.00 28.90  ? 165  THR C CB    1 
ATOM   4474  O  OG1   . THR C 2  165  ? 17.185  14.900  -23.937  1.00 29.27  ? 165  THR C OG1   1 
ATOM   4475  C  CG2   . THR C 2  165  ? 18.176  13.254  -22.483  1.00 31.14  ? 165  THR C CG2   1 
ATOM   4476  N  N     . PHE C 2  166  ? 16.394  13.177  -26.539  1.00 26.01  ? 166  PHE C N     1 
ATOM   4477  C  CA    . PHE C 2  166  ? 15.621  13.800  -27.600  1.00 25.44  ? 166  PHE C CA    1 
ATOM   4478  C  C     . PHE C 2  166  ? 14.433  14.542  -26.998  1.00 26.10  ? 166  PHE C C     1 
ATOM   4479  O  O     . PHE C 2  166  ? 14.060  14.305  -25.848  1.00 25.71  ? 166  PHE C O     1 
ATOM   4480  C  CB    . PHE C 2  166  ? 15.132  12.763  -28.611  1.00 25.54  ? 166  PHE C CB    1 
ATOM   4481  C  CG    . PHE C 2  166  ? 16.195  12.278  -29.552  1.00 25.09  ? 166  PHE C CG    1 
ATOM   4482  C  CD1   . PHE C 2  166  ? 16.930  11.143  -29.261  1.00 25.76  ? 166  PHE C CD1   1 
ATOM   4483  C  CD2   . PHE C 2  166  ? 16.446  12.946  -30.737  1.00 25.67  ? 166  PHE C CD2   1 
ATOM   4484  C  CE1   . PHE C 2  166  ? 17.902  10.690  -30.130  1.00 27.97  ? 166  PHE C CE1   1 
ATOM   4485  C  CE2   . PHE C 2  166  ? 17.419  12.501  -31.609  1.00 27.02  ? 166  PHE C CE2   1 
ATOM   4486  C  CZ    . PHE C 2  166  ? 18.148  11.371  -31.306  1.00 29.85  ? 166  PHE C CZ    1 
ATOM   4487  N  N     . ILE C 2  167  ? 13.847  15.447  -27.773  1.00 26.08  ? 167  ILE C N     1 
ATOM   4488  C  CA    . ILE C 2  167  ? 12.643  16.148  -27.348  1.00 27.58  ? 167  ILE C CA    1 
ATOM   4489  C  C     . ILE C 2  167  ? 11.520  15.941  -28.357  1.00 25.86  ? 167  ILE C C     1 
ATOM   4490  O  O     . ILE C 2  167  ? 11.510  16.549  -29.428  1.00 26.02  ? 167  ILE C O     1 
ATOM   4491  C  CB    . ILE C 2  167  ? 12.883  17.659  -27.170  1.00 31.14  ? 167  ILE C CB    1 
ATOM   4492  C  CG1   . ILE C 2  167  ? 13.912  17.919  -26.067  1.00 33.22  ? 167  ILE C CG1   1 
ATOM   4493  C  CG2   . ILE C 2  167  ? 11.574  18.366  -26.849  1.00 37.00  ? 167  ILE C CG2   1 
ATOM   4494  C  CD1   . ILE C 2  167  ? 14.011  19.374  -25.660  1.00 39.47  ? 167  ILE C CD1   1 
ATOM   4495  N  N     . ILE C 2  168  ? 10.582  15.067  -28.014  1.00 27.48  ? 168  ILE C N     1 
ATOM   4496  C  CA    . ILE C 2  168  ? 9.433   14.812  -28.870  1.00 27.54  ? 168  ILE C CA    1 
ATOM   4497  C  C     . ILE C 2  168  ? 8.201   15.441  -28.238  1.00 29.93  ? 168  ILE C C     1 
ATOM   4498  O  O     . ILE C 2  168  ? 7.739   15.008  -27.182  1.00 30.73  ? 168  ILE C O     1 
ATOM   4499  C  CB    . ILE C 2  168  ? 9.202   13.297  -29.106  1.00 28.75  ? 168  ILE C CB    1 
ATOM   4500  C  CG1   . ILE C 2  168  ? 10.098  12.779  -30.234  1.00 28.99  ? 168  ILE C CG1   1 
ATOM   4501  C  CG2   . ILE C 2  168  ? 7.757   13.017  -29.496  1.00 29.31  ? 168  ILE C CG2   1 
ATOM   4502  C  CD1   . ILE C 2  168  ? 11.573  12.749  -29.914  1.00 32.70  ? 168  ILE C CD1   1 
ATOM   4503  N  N     . ASN C 2  169  ? 7.706   16.493  -28.881  1.00 33.21  ? 169  ASN C N     1 
ATOM   4504  C  CA    . ASN C 2  169  ? 6.464   17.149  -28.487  1.00 31.93  ? 169  ASN C CA    1 
ATOM   4505  C  C     . ASN C 2  169  ? 6.424   17.576  -27.020  1.00 33.52  ? 169  ASN C C     1 
ATOM   4506  O  O     . ASN C 2  169  ? 5.384   17.484  -26.368  1.00 35.74  ? 169  ASN C O     1 
ATOM   4507  C  CB    . ASN C 2  169  ? 5.281   16.231  -28.793  1.00 32.13  ? 169  ASN C CB    1 
ATOM   4508  C  CG    . ASN C 2  169  ? 5.300   15.720  -30.224  1.00 30.25  ? 169  ASN C CG    1 
ATOM   4509  O  OD1   . ASN C 2  169  ? 5.858   16.360  -31.115  1.00 30.51  ? 169  ASN C OD1   1 
ATOM   4510  N  ND2   . ASN C 2  169  ? 4.690   14.563  -30.449  1.00 25.90  ? 169  ASN C ND2   1 
ATOM   4511  N  N     . GLY C 2  170  ? 7.561   18.035  -26.503  1.00 35.96  ? 170  GLY C N     1 
ATOM   4512  C  CA    . GLY C 2  170  ? 7.613   18.632  -25.177  1.00 35.19  ? 170  GLY C CA    1 
ATOM   4513  C  C     . GLY C 2  170  ? 7.850   17.670  -24.028  1.00 36.67  ? 170  GLY C C     1 
ATOM   4514  O  O     . GLY C 2  170  ? 7.769   18.057  -22.859  1.00 36.82  ? 170  GLY C O     1 
ATOM   4515  N  N     . THR C 2  171  ? 8.133   16.414  -24.360  1.00 34.74  ? 171  THR C N     1 
ATOM   4516  C  CA    . THR C 2  171  ? 8.477   15.409  -23.360  1.00 32.27  ? 171  THR C CA    1 
ATOM   4517  C  C     . THR C 2  171  ? 9.812   14.765  -23.717  1.00 29.15  ? 171  THR C C     1 
ATOM   4518  O  O     . THR C 2  171  ? 10.007  14.304  -24.840  1.00 29.10  ? 171  THR C O     1 
ATOM   4519  C  CB    . THR C 2  171  ? 7.390   14.326  -23.240  1.00 35.66  ? 171  THR C CB    1 
ATOM   4520  O  OG1   . THR C 2  171  ? 7.138   13.756  -24.530  1.00 35.19  ? 171  THR C OG1   1 
ATOM   4521  C  CG2   . THR C 2  171  ? 6.094   14.925  -22.700  1.00 36.88  ? 171  THR C CG2   1 
ATOM   4522  N  N     . GLU C 2  172  ? 10.731  14.753  -22.760  1.00 25.34  ? 172  GLU C N     1 
ATOM   4523  C  CA    . GLU C 2  172  ? 12.080  14.249  -22.989  1.00 26.20  ? 172  GLU C CA    1 
ATOM   4524  C  C     . GLU C 2  172  ? 12.077  12.733  -23.194  1.00 31.14  ? 172  GLU C C     1 
ATOM   4525  O  O     . GLU C 2  172  ? 11.703  11.978  -22.297  1.00 34.75  ? 172  GLU C O     1 
ATOM   4526  C  CB    . GLU C 2  172  ? 12.979  14.636  -21.814  1.00 24.20  ? 172  GLU C CB    1 
ATOM   4527  C  CG    . GLU C 2  172  ? 14.424  14.924  -22.174  1.00 24.77  ? 172  GLU C CG    1 
ATOM   4528  C  CD    . GLU C 2  172  ? 15.146  15.676  -21.071  1.00 28.48  ? 172  GLU C CD    1 
ATOM   4529  O  OE1   . GLU C 2  172  ? 14.459  16.218  -20.180  1.00 28.31  ? 172  GLU C OE1   1 
ATOM   4530  O  OE2   . GLU C 2  172  ? 16.393  15.727  -21.098  1.00 30.45  ? 172  GLU C OE2   1 
ATOM   4531  N  N     . ARG C 2  173  ? 12.491  12.290  -24.380  1.00 29.85  ? 173  ARG C N     1 
ATOM   4532  C  CA    . ARG C 2  173  ? 12.515  10.862  -24.699  1.00 27.69  ? 173  ARG C CA    1 
ATOM   4533  C  C     . ARG C 2  173  ? 13.927  10.349  -24.965  1.00 27.11  ? 173  ARG C C     1 
ATOM   4534  O  O     . ARG C 2  173  ? 14.828  11.124  -25.288  1.00 28.05  ? 173  ARG C O     1 
ATOM   4535  C  CB    . ARG C 2  173  ? 11.626  10.563  -25.906  1.00 28.82  ? 173  ARG C CB    1 
ATOM   4536  C  CG    . ARG C 2  173  ? 10.144  10.534  -25.584  1.00 31.46  ? 173  ARG C CG    1 
ATOM   4537  C  CD    . ARG C 2  173  ? 9.344   9.914   -26.716  1.00 33.49  ? 173  ARG C CD    1 
ATOM   4538  N  NE    . ARG C 2  173  ? 7.931   9.777   -26.371  1.00 37.20  ? 173  ARG C NE    1 
ATOM   4539  C  CZ    . ARG C 2  173  ? 7.416   8.736   -25.725  1.00 38.48  ? 173  ARG C CZ    1 
ATOM   4540  N  NH1   . ARG C 2  173  ? 8.197   7.734   -25.345  1.00 36.02  ? 173  ARG C NH1   1 
ATOM   4541  N  NH2   . ARG C 2  173  ? 6.118   8.700   -25.457  1.00 39.27  ? 173  ARG C NH2   1 
ATOM   4542  N  N     . VAL C 2  174  ? 14.109  9.037   -24.833  1.00 27.25  ? 174  VAL C N     1 
ATOM   4543  C  CA    . VAL C 2  174  ? 15.423  8.415   -24.974  1.00 25.65  ? 174  VAL C CA    1 
ATOM   4544  C  C     . VAL C 2  174  ? 15.383  7.204   -25.906  1.00 24.36  ? 174  VAL C C     1 
ATOM   4545  O  O     . VAL C 2  174  ? 14.435  6.423   -25.879  1.00 27.22  ? 174  VAL C O     1 
ATOM   4546  C  CB    . VAL C 2  174  ? 15.978  7.982   -23.596  1.00 25.96  ? 174  VAL C CB    1 
ATOM   4547  C  CG1   . VAL C 2  174  ? 17.247  7.158   -23.746  1.00 27.49  ? 174  VAL C CG1   1 
ATOM   4548  C  CG2   . VAL C 2  174  ? 16.233  9.200   -22.722  1.00 28.91  ? 174  VAL C CG2   1 
ATOM   4549  N  N     . VAL C 2  175  ? 16.404  7.059   -26.744  1.00 22.02  ? 175  VAL C N     1 
ATOM   4550  C  CA    . VAL C 2  175  ? 16.513  5.880   -27.587  1.00 24.91  ? 175  VAL C CA    1 
ATOM   4551  C  C     . VAL C 2  175  ? 17.445  4.862   -26.957  1.00 26.69  ? 175  VAL C C     1 
ATOM   4552  O  O     . VAL C 2  175  ? 18.631  5.126   -26.774  1.00 28.44  ? 175  VAL C O     1 
ATOM   4553  C  CB    . VAL C 2  175  ? 17.022  6.221   -28.988  1.00 28.20  ? 175  VAL C CB    1 
ATOM   4554  C  CG1   . VAL C 2  175  ? 17.285  4.941   -29.776  1.00 29.48  ? 175  VAL C CG1   1 
ATOM   4555  C  CG2   . VAL C 2  175  ? 16.024  7.110   -29.704  1.00 32.65  ? 175  VAL C CG2   1 
ATOM   4556  N  N     . VAL C 2  176  ? 16.898  3.700   -26.626  1.00 31.74  ? 176  VAL C N     1 
ATOM   4557  C  CA    . VAL C 2  176  ? 17.672  2.630   -26.013  1.00 28.31  ? 176  VAL C CA    1 
ATOM   4558  C  C     . VAL C 2  176  ? 18.363  1.782   -27.078  1.00 29.00  ? 176  VAL C C     1 
ATOM   4559  O  O     . VAL C 2  176  ? 17.802  1.535   -28.146  1.00 27.32  ? 176  VAL C O     1 
ATOM   4560  C  CB    . VAL C 2  176  ? 16.774  1.739   -25.127  1.00 30.08  ? 176  VAL C CB    1 
ATOM   4561  C  CG1   . VAL C 2  176  ? 17.575  0.617   -24.482  1.00 32.65  ? 176  VAL C CG1   1 
ATOM   4562  C  CG2   . VAL C 2  176  ? 16.095  2.582   -24.059  1.00 30.40  ? 176  VAL C CG2   1 
ATOM   4563  N  N     . SER C 2  177  ? 19.589  1.357   -26.787  1.00 25.77  ? 177  SER C N     1 
ATOM   4564  C  CA    . SER C 2  177  ? 20.348  0.493   -27.683  1.00 26.35  ? 177  SER C CA    1 
ATOM   4565  C  C     . SER C 2  177  ? 19.755  -0.911  -27.711  1.00 27.94  ? 177  SER C C     1 
ATOM   4566  O  O     . SER C 2  177  ? 19.564  -1.524  -26.662  1.00 29.21  ? 177  SER C O     1 
ATOM   4567  C  CB    . SER C 2  177  ? 21.812  0.434   -27.251  1.00 24.25  ? 177  SER C CB    1 
ATOM   4568  O  OG    . SER C 2  177  ? 22.359  1.735   -27.137  1.00 27.32  ? 177  SER C OG    1 
ATOM   4569  N  N     . GLN C 2  178  ? 19.471  -1.420  -28.907  1.00 31.06  ? 178  GLN C N     1 
ATOM   4570  C  CA    . GLN C 2  178  ? 18.844  -2.733  -29.050  1.00 31.63  ? 178  GLN C CA    1 
ATOM   4571  C  C     . GLN C 2  178  ? 19.869  -3.853  -29.226  1.00 33.89  ? 178  GLN C C     1 
ATOM   4572  O  O     . GLN C 2  178  ? 20.744  -3.778  -30.085  1.00 33.72  ? 178  GLN C O     1 
ATOM   4573  C  CB    . GLN C 2  178  ? 17.866  -2.734  -30.232  1.00 32.48  ? 178  GLN C CB    1 
ATOM   4574  C  CG    . GLN C 2  178  ? 17.180  -4.074  -30.476  1.00 36.28  ? 178  GLN C CG    1 
ATOM   4575  C  CD    . GLN C 2  178  ? 16.058  -3.996  -31.502  1.00 41.03  ? 178  GLN C CD    1 
ATOM   4576  O  OE1   . GLN C 2  178  ? 16.294  -4.051  -32.710  1.00 42.23  ? 178  GLN C OE1   1 
ATOM   4577  N  NE2   . GLN C 2  178  ? 14.826  -3.872  -31.021  1.00 43.62  ? 178  GLN C NE2   1 
ATOM   4578  N  N     . LEU C 2  179  ? 19.752  -4.890  -28.400  1.00 35.35  ? 179  LEU C N     1 
ATOM   4579  C  CA    . LEU C 2  179  ? 20.627  -6.056  -28.484  1.00 34.38  ? 179  LEU C CA    1 
ATOM   4580  C  C     . LEU C 2  179  ? 20.039  -7.117  -29.409  1.00 36.73  ? 179  LEU C C     1 
ATOM   4581  O  O     . LEU C 2  179  ? 19.177  -7.896  -29.003  1.00 38.21  ? 179  LEU C O     1 
ATOM   4582  C  CB    . LEU C 2  179  ? 20.867  -6.651  -27.092  1.00 34.35  ? 179  LEU C CB    1 
ATOM   4583  C  CG    . LEU C 2  179  ? 22.056  -6.128  -26.282  1.00 30.81  ? 179  LEU C CG    1 
ATOM   4584  C  CD1   . LEU C 2  179  ? 22.041  -6.684  -24.868  1.00 32.42  ? 179  LEU C CD1   1 
ATOM   4585  C  CD2   . LEU C 2  179  ? 23.348  -6.503  -26.970  1.00 32.81  ? 179  LEU C CD2   1 
ATOM   4586  N  N     . VAL C 2  180  ? 20.508  -7.146  -30.653  1.00 39.00  ? 180  VAL C N     1 
ATOM   4587  C  CA    . VAL C 2  180  ? 19.988  -8.090  -31.635  1.00 40.95  ? 180  VAL C CA    1 
ATOM   4588  C  C     . VAL C 2  180  ? 21.030  -9.087  -32.117  1.00 46.23  ? 180  VAL C C     1 
ATOM   4589  O  O     . VAL C 2  180  ? 22.226  -8.934  -31.878  1.00 43.51  ? 180  VAL C O     1 
ATOM   4590  C  CB    . VAL C 2  180  ? 19.418  -7.372  -32.874  1.00 39.80  ? 180  VAL C CB    1 
ATOM   4591  C  CG1   . VAL C 2  180  ? 18.048  -6.788  -32.577  1.00 39.04  ? 180  VAL C CG1   1 
ATOM   4592  C  CG2   . VAL C 2  180  ? 20.384  -6.305  -33.362  1.00 42.75  ? 180  VAL C CG2   1 
ATOM   4593  N  N     . ARG C 2  181  ? 20.544  -10.108 -32.809  1.00 54.04  ? 181  ARG C N     1 
ATOM   4594  C  CA    . ARG C 2  181  ? 21.378  -11.143 -33.392  1.00 52.78  ? 181  ARG C CA    1 
ATOM   4595  C  C     . ARG C 2  181  ? 22.100  -10.606 -34.621  1.00 49.76  ? 181  ARG C C     1 
ATOM   4596  O  O     . ARG C 2  181  ? 21.472  -10.061 -35.529  1.00 48.06  ? 181  ARG C O     1 
ATOM   4597  C  CB    . ARG C 2  181  ? 20.512  -12.347 -33.749  1.00 67.49  ? 181  ARG C CB    1 
ATOM   4598  C  CG    . ARG C 2  181  ? 21.203  -13.479 -34.472  1.00 77.91  ? 181  ARG C CG    1 
ATOM   4599  C  CD    . ARG C 2  181  ? 20.138  -14.395 -35.046  1.00 91.06  ? 181  ARG C CD    1 
ATOM   4600  N  NE    . ARG C 2  181  ? 20.457  -15.810 -34.899  1.00 112.59 ? 181  ARG C NE    1 
ATOM   4601  C  CZ    . ARG C 2  181  ? 19.546  -16.777 -34.931  1.00 142.67 ? 181  ARG C CZ    1 
ATOM   4602  N  NH1   . ARG C 2  181  ? 18.261  -16.478 -35.092  1.00 173.96 ? 181  ARG C NH1   1 
ATOM   4603  N  NH2   . ARG C 2  181  ? 19.915  -18.044 -34.795  1.00 152.16 ? 181  ARG C NH2   1 
ATOM   4604  N  N     . SER C 2  182  ? 23.420  -10.750 -34.641  1.00 53.68  ? 182  SER C N     1 
ATOM   4605  C  CA    . SER C 2  182  ? 24.224  -10.262 -35.756  1.00 57.49  ? 182  SER C CA    1 
ATOM   4606  C  C     . SER C 2  182  ? 24.078  -11.147 -36.986  1.00 60.46  ? 182  SER C C     1 
ATOM   4607  O  O     . SER C 2  182  ? 24.153  -12.372 -36.886  1.00 67.60  ? 182  SER C O     1 
ATOM   4608  C  CB    . SER C 2  182  ? 25.699  -10.171 -35.354  1.00 58.06  ? 182  SER C CB    1 
ATOM   4609  O  OG    . SER C 2  182  ? 26.523  -9.931  -36.482  1.00 61.29  ? 182  SER C OG    1 
ATOM   4610  N  N     . PRO C 2  183  ? 23.865  -10.524 -38.155  1.00 61.23  ? 183  PRO C N     1 
ATOM   4611  C  CA    . PRO C 2  183  ? 23.808  -11.244 -39.432  1.00 68.03  ? 183  PRO C CA    1 
ATOM   4612  C  C     . PRO C 2  183  ? 25.125  -11.955 -39.728  1.00 72.95  ? 183  PRO C C     1 
ATOM   4613  O  O     . PRO C 2  183  ? 26.186  -11.447 -39.367  1.00 74.44  ? 183  PRO C O     1 
ATOM   4614  C  CB    . PRO C 2  183  ? 23.536  -10.133 -40.452  1.00 68.02  ? 183  PRO C CB    1 
ATOM   4615  C  CG    . PRO C 2  183  ? 22.917  -9.030  -39.658  1.00 64.03  ? 183  PRO C CG    1 
ATOM   4616  C  CD    . PRO C 2  183  ? 23.580  -9.089  -38.316  1.00 57.70  ? 183  PRO C CD    1 
ATOM   4617  N  N     . GLY C 2  184  ? 25.053  -13.118 -40.364  1.00 73.06  ? 184  GLY C N     1 
ATOM   4618  C  CA    . GLY C 2  184  ? 26.239  -13.907 -40.644  1.00 78.36  ? 184  GLY C CA    1 
ATOM   4619  C  C     . GLY C 2  184  ? 25.914  -15.385 -40.706  1.00 83.02  ? 184  GLY C C     1 
ATOM   4620  O  O     . GLY C 2  184  ? 24.745  -15.764 -40.764  1.00 86.94  ? 184  GLY C O     1 
ATOM   4621  N  N     . VAL C 2  185  ? 26.945  -16.223 -40.691  1.00 77.00  ? 185  VAL C N     1 
ATOM   4622  C  CA    . VAL C 2  185  ? 26.752  -17.665 -40.751  1.00 74.72  ? 185  VAL C CA    1 
ATOM   4623  C  C     . VAL C 2  185  ? 27.156  -18.327 -39.439  1.00 74.43  ? 185  VAL C C     1 
ATOM   4624  O  O     . VAL C 2  185  ? 28.263  -18.121 -38.940  1.00 73.11  ? 185  VAL C O     1 
ATOM   4625  C  CB    . VAL C 2  185  ? 27.547  -18.288 -41.915  1.00 72.17  ? 185  VAL C CB    1 
ATOM   4626  C  CG1   . VAL C 2  185  ? 28.957  -17.716 -41.973  1.00 79.26  ? 185  VAL C CG1   1 
ATOM   4627  C  CG2   . VAL C 2  185  ? 27.571  -19.802 -41.795  1.00 80.97  ? 185  VAL C CG2   1 
ATOM   4628  N  N     . TYR C 2  186  ? 26.247  -19.117 -38.879  1.00 76.21  ? 186  TYR C N     1 
ATOM   4629  C  CA    . TYR C 2  186  ? 26.485  -19.752 -37.590  1.00 78.63  ? 186  TYR C CA    1 
ATOM   4630  C  C     . TYR C 2  186  ? 26.333  -21.266 -37.673  1.00 82.92  ? 186  TYR C C     1 
ATOM   4631  O  O     . TYR C 2  186  ? 25.635  -21.790 -38.542  1.00 84.40  ? 186  TYR C O     1 
ATOM   4632  C  CB    . TYR C 2  186  ? 25.540  -19.182 -36.530  1.00 80.66  ? 186  TYR C CB    1 
ATOM   4633  C  CG    . TYR C 2  186  ? 25.665  -17.684 -36.332  1.00 84.59  ? 186  TYR C CG    1 
ATOM   4634  C  CD1   . TYR C 2  186  ? 26.863  -17.116 -35.916  1.00 82.18  ? 186  TYR C CD1   1 
ATOM   4635  C  CD2   . TYR C 2  186  ? 24.580  -16.842 -36.547  1.00 87.78  ? 186  TYR C CD2   1 
ATOM   4636  C  CE1   . TYR C 2  186  ? 26.981  -15.748 -35.730  1.00 80.81  ? 186  TYR C CE1   1 
ATOM   4637  C  CE2   . TYR C 2  186  ? 24.687  -15.473 -36.364  1.00 90.27  ? 186  TYR C CE2   1 
ATOM   4638  C  CZ    . TYR C 2  186  ? 25.891  -14.931 -35.955  1.00 80.59  ? 186  TYR C CZ    1 
ATOM   4639  O  OH    . TYR C 2  186  ? 26.002  -13.570 -35.770  1.00 74.52  ? 186  TYR C OH    1 
ATOM   4640  N  N     . PHE C 2  187  ? 26.999  -21.961 -36.757  1.00 80.42  ? 187  PHE C N     1 
ATOM   4641  C  CA    . PHE C 2  187  ? 27.018  -23.415 -36.747  1.00 80.04  ? 187  PHE C CA    1 
ATOM   4642  C  C     . PHE C 2  187  ? 26.576  -23.934 -35.390  1.00 81.99  ? 187  PHE C C     1 
ATOM   4643  O  O     . PHE C 2  187  ? 26.930  -23.369 -34.357  1.00 82.44  ? 187  PHE C O     1 
ATOM   4644  C  CB    . PHE C 2  187  ? 28.415  -23.929 -37.090  1.00 78.76  ? 187  PHE C CB    1 
ATOM   4645  C  CG    . PHE C 2  187  ? 28.926  -23.436 -38.410  1.00 81.59  ? 187  PHE C CG    1 
ATOM   4646  C  CD1   . PHE C 2  187  ? 29.552  -22.204 -38.512  1.00 85.59  ? 187  PHE C CD1   1 
ATOM   4647  C  CD2   . PHE C 2  187  ? 28.771  -24.199 -39.552  1.00 85.44  ? 187  PHE C CD2   1 
ATOM   4648  C  CE1   . PHE C 2  187  ? 30.015  -21.747 -39.729  1.00 92.52  ? 187  PHE C CE1   1 
ATOM   4649  C  CE2   . PHE C 2  187  ? 29.234  -23.749 -40.772  1.00 91.64  ? 187  PHE C CE2   1 
ATOM   4650  C  CZ    . PHE C 2  187  ? 29.854  -22.520 -40.861  1.00 96.44  ? 187  PHE C CZ    1 
ATOM   4651  N  N     . ASP C 2  188  ? 25.799  -25.009 -35.395  1.00 85.26  ? 188  ASP C N     1 
ATOM   4652  C  CA    . ASP C 2  188  ? 25.268  -25.555 -34.154  1.00 92.59  ? 188  ASP C CA    1 
ATOM   4653  C  C     . ASP C 2  188  ? 25.407  -27.071 -34.118  1.00 102.39 ? 188  ASP C C     1 
ATOM   4654  O  O     . ASP C 2  188  ? 25.364  -27.731 -35.157  1.00 104.48 ? 188  ASP C O     1 
ATOM   4655  C  CB    . ASP C 2  188  ? 23.803  -25.152 -33.983  1.00 101.95 ? 188  ASP C CB    1 
ATOM   4656  C  CG    . ASP C 2  188  ? 23.245  -25.543 -32.629  1.00 113.19 ? 188  ASP C CG    1 
ATOM   4657  O  OD1   . ASP C 2  188  ? 23.896  -25.241 -31.606  1.00 107.71 ? 188  ASP C OD1   1 
ATOM   4658  O  OD2   . ASP C 2  188  ? 22.158  -26.159 -32.589  1.00 127.43 ? 188  ASP C OD2   1 
ATOM   4659  N  N     . GLU C 2  189  ? 25.576  -27.617 -32.918  1.00 108.68 ? 189  GLU C N     1 
ATOM   4660  C  CA    . GLU C 2  189  ? 25.715  -29.059 -32.744  1.00 111.95 ? 189  GLU C CA    1 
ATOM   4661  C  C     . GLU C 2  189  ? 24.543  -29.644 -31.963  1.00 114.48 ? 189  GLU C C     1 
ATOM   4662  O  O     . GLU C 2  189  ? 24.480  -29.531 -30.739  1.00 112.32 ? 189  GLU C O     1 
ATOM   4663  C  CB    . GLU C 2  189  ? 27.028  -29.393 -32.033  1.00 111.06 ? 189  GLU C CB    1 
ATOM   4664  C  CG    . GLU C 2  189  ? 27.241  -30.882 -31.797  1.00 112.67 ? 189  GLU C CG    1 
ATOM   4665  C  CD    . GLU C 2  189  ? 28.513  -31.180 -31.026  1.00 117.21 ? 189  GLU C CD    1 
ATOM   4666  O  OE1   . GLU C 2  189  ? 28.777  -32.371 -30.754  1.00 119.71 ? 189  GLU C OE1   1 
ATOM   4667  O  OE2   . GLU C 2  189  ? 29.248  -30.227 -30.692  1.00 115.38 ? 189  GLU C OE2   1 
ATOM   4668  N  N     . THR C 2  190  ? 23.614  -30.268 -32.679  1.00 118.22 ? 190  THR C N     1 
ATOM   4669  C  CA    . THR C 2  190  ? 22.479  -30.925 -32.046  1.00 123.17 ? 190  THR C CA    1 
ATOM   4670  C  C     . THR C 2  190  ? 22.761  -32.411 -31.840  1.00 128.97 ? 190  THR C C     1 
ATOM   4671  O  O     . THR C 2  190  ? 23.280  -33.086 -32.729  1.00 133.30 ? 190  THR C O     1 
ATOM   4672  C  CB    . THR C 2  190  ? 21.185  -30.754 -32.874  1.00 131.91 ? 190  THR C CB    1 
ATOM   4673  O  OG1   . THR C 2  190  ? 20.170  -31.627 -32.364  1.00 140.47 ? 190  THR C OG1   1 
ATOM   4674  C  CG2   . THR C 2  190  ? 21.432  -31.077 -34.343  1.00 125.54 ? 190  THR C CG2   1 
ATOM   4675  N  N     . ILE C 2  191  ? 22.427  -32.912 -30.655  1.00 131.37 ? 191  ILE C N     1 
ATOM   4676  C  CA    . ILE C 2  191  ? 22.612  -34.323 -30.341  1.00 136.12 ? 191  ILE C CA    1 
ATOM   4677  C  C     . ILE C 2  191  ? 21.309  -35.088 -30.552  1.00 139.17 ? 191  ILE C C     1 
ATOM   4678  O  O     . ILE C 2  191  ? 20.281  -34.749 -29.966  1.00 140.59 ? 191  ILE C O     1 
ATOM   4679  C  CB    . ILE C 2  191  ? 23.100  -34.522 -28.894  1.00 139.75 ? 191  ILE C CB    1 
ATOM   4680  C  CG1   . ILE C 2  191  ? 24.420  -33.779 -28.671  1.00 137.36 ? 191  ILE C CG1   1 
ATOM   4681  C  CG2   . ILE C 2  191  ? 23.256  -36.004 -28.580  1.00 146.84 ? 191  ILE C CG2   1 
ATOM   4682  C  CD1   . ILE C 2  191  ? 25.531  -34.214 -29.603  1.00 129.20 ? 191  ILE C CD1   1 
ATOM   4683  N  N     . ASP C 2  192  ? 21.361  -36.118 -31.390  1.00 141.53 ? 192  ASP C N     1 
ATOM   4684  C  CA    . ASP C 2  192  ? 20.168  -36.873 -31.765  1.00 150.30 ? 192  ASP C CA    1 
ATOM   4685  C  C     . ASP C 2  192  ? 19.583  -37.639 -30.578  1.00 154.03 ? 192  ASP C C     1 
ATOM   4686  O  O     . ASP C 2  192  ? 20.314  -38.104 -29.703  1.00 151.40 ? 192  ASP C O     1 
ATOM   4687  C  CB    . ASP C 2  192  ? 20.492  -37.836 -32.913  1.00 149.11 ? 192  ASP C CB    1 
ATOM   4688  C  CG    . ASP C 2  192  ? 19.249  -38.323 -33.639  1.00 156.32 ? 192  ASP C CG    1 
ATOM   4689  O  OD1   . ASP C 2  192  ? 19.317  -39.381 -34.301  1.00 153.46 ? 192  ASP C OD1   1 
ATOM   4690  O  OD2   . ASP C 2  192  ? 18.204  -37.645 -33.548  1.00 161.65 ? 192  ASP C OD2   1 
ATOM   4691  N  N     . LYS C 2  193  ? 18.259  -37.761 -30.558  1.00 161.01 ? 193  LYS C N     1 
ATOM   4692  C  CA    . LYS C 2  193  ? 17.554  -38.428 -29.468  1.00 152.61 ? 193  LYS C CA    1 
ATOM   4693  C  C     . LYS C 2  193  ? 17.644  -39.943 -29.596  1.00 142.63 ? 193  LYS C C     1 
ATOM   4694  O  O     . LYS C 2  193  ? 17.917  -40.647 -28.624  1.00 137.59 ? 193  LYS C O     1 
ATOM   4695  C  CB    . LYS C 2  193  ? 16.085  -37.996 -29.440  1.00 152.87 ? 193  LYS C CB    1 
ATOM   4696  C  CG    . LYS C 2  193  ? 15.872  -36.488 -29.456  1.00 155.88 ? 193  LYS C CG    1 
ATOM   4697  C  CD    . LYS C 2  193  ? 14.390  -36.140 -29.491  1.00 148.76 ? 193  LYS C CD    1 
ATOM   4698  C  CE    . LYS C 2  193  ? 14.173  -34.643 -29.655  1.00 138.68 ? 193  LYS C CE    1 
ATOM   4699  N  NZ    . LYS C 2  193  ? 14.763  -33.860 -28.534  1.00 137.50 ? 193  LYS C NZ    1 
ATOM   4700  N  N     . SER C 2  194  ? 17.412  -40.433 -30.809  1.00 143.51 ? 194  SER C N     1 
ATOM   4701  C  CA    . SER C 2  194  ? 17.371  -41.864 -31.074  1.00 141.18 ? 194  SER C CA    1 
ATOM   4702  C  C     . SER C 2  194  ? 18.756  -42.463 -31.317  1.00 138.67 ? 194  SER C C     1 
ATOM   4703  O  O     . SER C 2  194  ? 19.178  -43.370 -30.600  1.00 138.24 ? 194  SER C O     1 
ATOM   4704  C  CB    . SER C 2  194  ? 16.465  -42.144 -32.275  1.00 138.57 ? 194  SER C CB    1 
ATOM   4705  O  OG    . SER C 2  194  ? 16.816  -41.325 -33.376  1.00 140.29 ? 194  SER C OG    1 
ATOM   4706  N  N     . THR C 2  195  ? 19.462  -41.955 -32.324  1.00 141.25 ? 195  THR C N     1 
ATOM   4707  C  CA    . THR C 2  195  ? 20.749  -42.528 -32.716  1.00 136.35 ? 195  THR C CA    1 
ATOM   4708  C  C     . THR C 2  195  ? 21.895  -42.097 -31.799  1.00 139.53 ? 195  THR C C     1 
ATOM   4709  O  O     . THR C 2  195  ? 22.965  -42.706 -31.812  1.00 136.57 ? 195  THR C O     1 
ATOM   4710  C  CB    . THR C 2  195  ? 21.111  -42.155 -34.169  1.00 130.72 ? 195  THR C CB    1 
ATOM   4711  O  OG1   . THR C 2  195  ? 21.214  -40.731 -34.293  1.00 134.31 ? 195  THR C OG1   1 
ATOM   4712  C  CG2   . THR C 2  195  ? 20.051  -42.668 -35.128  1.00 134.63 ? 195  THR C CG2   1 
ATOM   4713  N  N     . ASP C 2  196  ? 21.659  -41.047 -31.014  1.00 146.56 ? 196  ASP C N     1 
ATOM   4714  C  CA    . ASP C 2  196  ? 22.650  -40.501 -30.081  1.00 146.25 ? 196  ASP C CA    1 
ATOM   4715  C  C     . ASP C 2  196  ? 23.981  -40.149 -30.752  1.00 140.63 ? 196  ASP C C     1 
ATOM   4716  O  O     . ASP C 2  196  ? 25.037  -40.211 -30.120  1.00 130.73 ? 196  ASP C O     1 
ATOM   4717  C  CB    . ASP C 2  196  ? 22.893  -41.479 -28.926  1.00 143.67 ? 196  ASP C CB    1 
ATOM   4718  C  CG    . ASP C 2  196  ? 21.672  -41.656 -28.041  1.00 137.66 ? 196  ASP C CG    1 
ATOM   4719  O  OD1   . ASP C 2  196  ? 20.920  -40.676 -27.855  1.00 136.18 ? 196  ASP C OD1   1 
ATOM   4720  O  OD2   . ASP C 2  196  ? 21.461  -42.777 -27.533  1.00 137.41 ? 196  ASP C OD2   1 
ATOM   4721  N  N     . LYS C 2  197  ? 23.927  -39.774 -32.027  1.00 139.19 ? 197  LYS C N     1 
ATOM   4722  C  CA    . LYS C 2  197  ? 25.126  -39.381 -32.760  1.00 132.94 ? 197  LYS C CA    1 
ATOM   4723  C  C     . LYS C 2  197  ? 25.189  -37.868 -32.926  1.00 131.43 ? 197  LYS C C     1 
ATOM   4724  O  O     . LYS C 2  197  ? 24.193  -37.168 -32.731  1.00 128.52 ? 197  LYS C O     1 
ATOM   4725  C  CB    . LYS C 2  197  ? 25.175  -40.055 -34.133  1.00 132.99 ? 197  LYS C CB    1 
ATOM   4726  C  CG    . LYS C 2  197  ? 24.168  -39.502 -35.131  1.00 136.80 ? 197  LYS C CG    1 
ATOM   4727  C  CD    . LYS C 2  197  ? 24.392  -40.068 -36.527  1.00 137.93 ? 197  LYS C CD    1 
ATOM   4728  C  CE    . LYS C 2  197  ? 24.173  -41.573 -36.562  1.00 126.74 ? 197  LYS C CE    1 
ATOM   4729  N  NZ    . LYS C 2  197  ? 24.358  -42.129 -37.932  1.00 121.70 ? 197  LYS C NZ    1 
ATOM   4730  N  N     . THR C 2  198  ? 26.365  -37.370 -33.296  1.00 128.71 ? 198  THR C N     1 
ATOM   4731  C  CA    . THR C 2  198  ? 26.570  -35.939 -33.465  1.00 129.79 ? 198  THR C CA    1 
ATOM   4732  C  C     . THR C 2  198  ? 26.077  -35.454 -34.824  1.00 125.41 ? 198  THR C C     1 
ATOM   4733  O  O     . THR C 2  198  ? 26.515  -35.937 -35.868  1.00 120.82 ? 198  THR C O     1 
ATOM   4734  C  CB    . THR C 2  198  ? 28.057  -35.562 -33.306  1.00 123.87 ? 198  THR C CB    1 
ATOM   4735  O  OG1   . THR C 2  198  ? 28.841  -36.283 -34.263  1.00 119.58 ? 198  THR C OG1   1 
ATOM   4736  C  CG2   . THR C 2  198  ? 28.543  -35.895 -31.904  1.00 121.58 ? 198  THR C CG2   1 
ATOM   4737  N  N     . LEU C 2  199  ? 25.154  -34.499 -34.796  1.00 130.49 ? 199  LEU C N     1 
ATOM   4738  C  CA    . LEU C 2  199  ? 24.650  -33.869 -36.009  1.00 124.55 ? 199  LEU C CA    1 
ATOM   4739  C  C     . LEU C 2  199  ? 25.039  -32.396 -36.021  1.00 119.52 ? 199  LEU C C     1 
ATOM   4740  O  O     . LEU C 2  199  ? 24.969  -31.720 -34.994  1.00 119.59 ? 199  LEU C O     1 
ATOM   4741  C  CB    . LEU C 2  199  ? 23.131  -34.015 -36.105  1.00 123.56 ? 199  LEU C CB    1 
ATOM   4742  C  CG    . LEU C 2  199  ? 22.570  -35.425 -35.921  1.00 128.18 ? 199  LEU C CG    1 
ATOM   4743  C  CD1   . LEU C 2  199  ? 21.057  -35.415 -36.057  1.00 134.97 ? 199  LEU C CD1   1 
ATOM   4744  C  CD2   . LEU C 2  199  ? 23.201  -36.391 -36.913  1.00 128.49 ? 199  LEU C CD2   1 
ATOM   4745  N  N     . HIS C 2  200  ? 25.445  -31.898 -37.184  1.00 112.82 ? 200  HIS C N     1 
ATOM   4746  C  CA    . HIS C 2  200  ? 25.876  -30.512 -37.300  1.00 106.43 ? 200  HIS C CA    1 
ATOM   4747  C  C     . HIS C 2  200  ? 24.961  -29.717 -38.230  1.00 105.36 ? 200  HIS C C     1 
ATOM   4748  O  O     . HIS C 2  200  ? 24.651  -30.156 -39.337  1.00 108.57 ? 200  HIS C O     1 
ATOM   4749  C  CB    . HIS C 2  200  ? 27.323  -30.448 -37.791  1.00 110.77 ? 200  HIS C CB    1 
ATOM   4750  C  CG    . HIS C 2  200  ? 28.330  -30.865 -36.763  1.00 112.42 ? 200  HIS C CG    1 
ATOM   4751  N  ND1   . HIS C 2  200  ? 28.363  -32.132 -36.222  1.00 116.76 ? 200  HIS C ND1   1 
ATOM   4752  C  CD2   . HIS C 2  200  ? 29.338  -30.180 -36.175  1.00 108.09 ? 200  HIS C CD2   1 
ATOM   4753  C  CE1   . HIS C 2  200  ? 29.351  -32.210 -35.346  1.00 114.77 ? 200  HIS C CE1   1 
ATOM   4754  N  NE2   . HIS C 2  200  ? 29.958  -31.038 -35.299  1.00 106.85 ? 200  HIS C NE2   1 
ATOM   4755  N  N     . SER C 2  201  ? 24.530  -28.547 -37.767  1.00 101.54 ? 201  SER C N     1 
ATOM   4756  C  CA    . SER C 2  201  ? 23.602  -27.712 -38.523  1.00 103.62 ? 201  SER C CA    1 
ATOM   4757  C  C     . SER C 2  201  ? 24.146  -26.307 -38.760  1.00 93.51  ? 201  SER C C     1 
ATOM   4758  O  O     . SER C 2  201  ? 24.835  -25.744 -37.909  1.00 87.51  ? 201  SER C O     1 
ATOM   4759  C  CB    . SER C 2  201  ? 22.257  -27.624 -37.800  1.00 108.76 ? 201  SER C CB    1 
ATOM   4760  O  OG    . SER C 2  201  ? 22.378  -26.905 -36.586  1.00 104.45 ? 201  SER C OG    1 
ATOM   4761  N  N     . VAL C 2  202  ? 23.823  -25.746 -39.921  1.00 95.72  ? 202  VAL C N     1 
ATOM   4762  C  CA    . VAL C 2  202  ? 24.235  -24.392 -40.271  1.00 95.07  ? 202  VAL C CA    1 
ATOM   4763  C  C     . VAL C 2  202  ? 23.011  -23.531 -40.569  1.00 102.39 ? 202  VAL C C     1 
ATOM   4764  O  O     . VAL C 2  202  ? 21.992  -24.033 -41.046  1.00 105.29 ? 202  VAL C O     1 
ATOM   4765  C  CB    . VAL C 2  202  ? 25.171  -24.377 -41.496  1.00 94.08  ? 202  VAL C CB    1 
ATOM   4766  C  CG1   . VAL C 2  202  ? 25.916  -23.057 -41.583  1.00 87.32  ? 202  VAL C CG1   1 
ATOM   4767  C  CG2   . VAL C 2  202  ? 26.150  -25.530 -41.435  1.00 105.36 ? 202  VAL C CG2   1 
ATOM   4768  N  N     . LYS C 2  203  ? 23.116  -22.236 -40.282  1.00 101.52 ? 203  LYS C N     1 
ATOM   4769  C  CA    . LYS C 2  203  ? 22.055  -21.283 -40.591  1.00 96.36  ? 203  LYS C CA    1 
ATOM   4770  C  C     . LYS C 2  203  ? 22.623  -19.945 -41.062  1.00 90.67  ? 203  LYS C C     1 
ATOM   4771  O  O     . LYS C 2  203  ? 23.345  -19.272 -40.328  1.00 87.02  ? 203  LYS C O     1 
ATOM   4772  C  CB    . LYS C 2  203  ? 21.150  -21.079 -39.372  1.00 90.34  ? 203  LYS C CB    1 
ATOM   4773  C  CG    . LYS C 2  203  ? 20.212  -22.249 -39.113  1.00 88.59  ? 203  LYS C CG    1 
ATOM   4774  C  CD    . LYS C 2  203  ? 19.678  -22.253 -37.696  1.00 81.04  ? 203  LYS C CD    1 
ATOM   4775  C  CE    . LYS C 2  203  ? 18.867  -23.510 -37.440  1.00 91.07  ? 203  LYS C CE    1 
ATOM   4776  N  NZ    . LYS C 2  203  ? 18.423  -23.614 -36.024  1.00 98.00  ? 203  LYS C NZ    1 
ATOM   4777  N  N     . VAL C 2  204  ? 22.297  -19.573 -42.297  1.00 90.48  ? 204  VAL C N     1 
ATOM   4778  C  CA    . VAL C 2  204  ? 22.745  -18.307 -42.872  1.00 86.11  ? 204  VAL C CA    1 
ATOM   4779  C  C     . VAL C 2  204  ? 21.670  -17.236 -42.732  1.00 92.69  ? 204  VAL C C     1 
ATOM   4780  O  O     . VAL C 2  204  ? 20.562  -17.391 -43.242  1.00 110.40 ? 204  VAL C O     1 
ATOM   4781  C  CB    . VAL C 2  204  ? 23.113  -18.460 -44.357  1.00 84.52  ? 204  VAL C CB    1 
ATOM   4782  C  CG1   . VAL C 2  204  ? 23.288  -17.095 -45.007  1.00 85.58  ? 204  VAL C CG1   1 
ATOM   4783  C  CG2   . VAL C 2  204  ? 24.372  -19.297 -44.505  1.00 78.78  ? 204  VAL C CG2   1 
ATOM   4784  N  N     . ILE C 2  205  ? 22.006  -16.146 -42.048  1.00 88.53  ? 205  ILE C N     1 
ATOM   4785  C  CA    . ILE C 2  205  ? 21.029  -15.107 -41.740  1.00 88.05  ? 205  ILE C CA    1 
ATOM   4786  C  C     . ILE C 2  205  ? 21.400  -13.768 -42.374  1.00 88.07  ? 205  ILE C C     1 
ATOM   4787  O  O     . ILE C 2  205  ? 22.450  -13.204 -42.070  1.00 85.26  ? 205  ILE C O     1 
ATOM   4788  C  CB    . ILE C 2  205  ? 20.888  -14.922 -40.217  1.00 85.30  ? 205  ILE C CB    1 
ATOM   4789  C  CG1   . ILE C 2  205  ? 21.098  -16.258 -39.501  1.00 90.54  ? 205  ILE C CG1   1 
ATOM   4790  C  CG2   . ILE C 2  205  ? 19.533  -14.316 -39.873  1.00 87.11  ? 205  ILE C CG2   1 
ATOM   4791  C  CD1   . ILE C 2  205  ? 21.294  -16.134 -38.015  1.00 94.05  ? 205  ILE C CD1   1 
ATOM   4792  N  N     . PRO C 2  206  ? 20.534  -13.254 -43.261  1.00 92.48  ? 206  PRO C N     1 
ATOM   4793  C  CA    . PRO C 2  206  ? 20.765  -11.961 -43.917  1.00 100.35 ? 206  PRO C CA    1 
ATOM   4794  C  C     . PRO C 2  206  ? 20.396  -10.774 -43.029  1.00 92.66  ? 206  PRO C C     1 
ATOM   4795  O  O     . PRO C 2  206  ? 19.923  -10.973 -41.913  1.00 95.37  ? 206  PRO C O     1 
ATOM   4796  C  CB    . PRO C 2  206  ? 19.847  -12.028 -45.139  1.00 106.44 ? 206  PRO C CB    1 
ATOM   4797  C  CG    . PRO C 2  206  ? 18.707  -12.874 -44.679  1.00 105.04 ? 206  PRO C CG    1 
ATOM   4798  C  CD    . PRO C 2  206  ? 19.305  -13.907 -43.749  1.00 93.84  ? 206  PRO C CD    1 
ATOM   4799  N  N     . SER C 2  207  ? 20.619  -9.557  -43.517  1.00 90.75  ? 207  SER C N     1 
ATOM   4800  C  CA    . SER C 2  207  ? 20.144  -8.369  -42.817  1.00 95.55  ? 207  SER C CA    1 
ATOM   4801  C  C     . SER C 2  207  ? 18.678  -8.150  -43.153  1.00 102.04 ? 207  SER C C     1 
ATOM   4802  O  O     . SER C 2  207  ? 17.909  -7.634  -42.341  1.00 108.98 ? 207  SER C O     1 
ATOM   4803  C  CB    . SER C 2  207  ? 20.962  -7.134  -43.192  1.00 103.62 ? 207  SER C CB    1 
ATOM   4804  O  OG    . SER C 2  207  ? 20.455  -5.981  -42.538  1.00 102.77 ? 207  SER C OG    1 
ATOM   4805  N  N     . ARG C 2  208  ? 18.306  -8.550  -44.364  1.00 100.30 ? 208  ARG C N     1 
ATOM   4806  C  CA    . ARG C 2  208  ? 16.925  -8.493  -44.818  1.00 105.15 ? 208  ARG C CA    1 
ATOM   4807  C  C     . ARG C 2  208  ? 16.733  -9.404  -46.025  1.00 104.42 ? 208  ARG C C     1 
ATOM   4808  O  O     . ARG C 2  208  ? 17.310  -9.172  -47.087  1.00 105.51 ? 208  ARG C O     1 
ATOM   4809  C  CB    . ARG C 2  208  ? 16.522  -7.053  -45.159  1.00 105.02 ? 208  ARG C CB    1 
ATOM   4810  C  CG    . ARG C 2  208  ? 17.533  -6.288  -46.009  1.00 108.15 ? 208  ARG C CG    1 
ATOM   4811  C  CD    . ARG C 2  208  ? 17.002  -4.917  -46.413  1.00 112.66 ? 208  ARG C CD    1 
ATOM   4812  N  NE    . ARG C 2  208  ? 18.029  -4.080  -47.028  1.00 103.56 ? 208  ARG C NE    1 
ATOM   4813  C  CZ    . ARG C 2  208  ? 18.260  -4.012  -48.336  1.00 98.53  ? 208  ARG C CZ    1 
ATOM   4814  N  NH1   . ARG C 2  208  ? 17.538  -4.734  -49.180  1.00 106.69 ? 208  ARG C NH1   1 
ATOM   4815  N  NH2   . ARG C 2  208  ? 19.216  -3.219  -48.801  1.00 89.57  ? 208  ARG C NH2   1 
ATOM   4816  N  N     . GLY C 2  209  ? 15.939  -10.456 -45.858  1.00 100.93 ? 209  GLY C N     1 
ATOM   4817  C  CA    . GLY C 2  209  ? 15.662  -11.349 -46.966  1.00 101.68 ? 209  GLY C CA    1 
ATOM   4818  C  C     . GLY C 2  209  ? 15.367  -12.790 -46.601  1.00 113.28 ? 209  GLY C C     1 
ATOM   4819  O  O     . GLY C 2  209  ? 14.921  -13.092 -45.491  1.00 108.25 ? 209  GLY C O     1 
ATOM   4820  N  N     . ALA C 2  210  ? 15.630  -13.680 -47.554  1.00 122.56 ? 210  ALA C N     1 
ATOM   4821  C  CA    . ALA C 2  210  ? 15.249  -15.085 -47.454  1.00 122.36 ? 210  ALA C CA    1 
ATOM   4822  C  C     . ALA C 2  210  ? 16.115  -15.864 -46.476  1.00 118.29 ? 210  ALA C C     1 
ATOM   4823  O  O     . ALA C 2  210  ? 17.084  -15.340 -45.927  1.00 112.57 ? 210  ALA C O     1 
ATOM   4824  C  CB    . ALA C 2  210  ? 15.302  -15.738 -48.829  1.00 119.77 ? 210  ALA C CB    1 
ATOM   4825  N  N     . TRP C 2  211  ? 15.752  -17.124 -46.267  1.00 124.65 ? 211  TRP C N     1 
ATOM   4826  C  CA    . TRP C 2  211  ? 16.486  -18.000 -45.366  1.00 132.53 ? 211  TRP C CA    1 
ATOM   4827  C  C     . TRP C 2  211  ? 17.230  -19.092 -46.127  1.00 137.60 ? 211  TRP C C     1 
ATOM   4828  O  O     . TRP C 2  211  ? 16.879  -19.424 -47.259  1.00 140.59 ? 211  TRP C O     1 
ATOM   4829  C  CB    . TRP C 2  211  ? 15.543  -18.629 -44.347  1.00 140.16 ? 211  TRP C CB    1 
ATOM   4830  C  CG    . TRP C 2  211  ? 15.326  -17.783 -43.147  1.00 144.69 ? 211  TRP C CG    1 
ATOM   4831  C  CD1   . TRP C 2  211  ? 15.244  -16.420 -43.101  1.00 144.96 ? 211  TRP C CD1   1 
ATOM   4832  C  CD2   . TRP C 2  211  ? 15.193  -18.240 -41.802  1.00 149.60 ? 211  TRP C CD2   1 
ATOM   4833  N  NE1   . TRP C 2  211  ? 15.055  -16.004 -41.808  1.00 154.47 ? 211  TRP C NE1   1 
ATOM   4834  C  CE2   . TRP C 2  211  ? 15.022  -17.105 -40.991  1.00 159.34 ? 211  TRP C CE2   1 
ATOM   4835  C  CE3   . TRP C 2  211  ? 15.195  -19.505 -41.206  1.00 150.54 ? 211  TRP C CE3   1 
ATOM   4836  C  CZ2   . TRP C 2  211  ? 14.857  -17.195 -39.614  1.00 175.43 ? 211  TRP C CZ2   1 
ATOM   4837  C  CZ3   . TRP C 2  211  ? 15.031  -19.591 -39.842  1.00 167.58 ? 211  TRP C CZ3   1 
ATOM   4838  C  CH2   . TRP C 2  211  ? 14.864  -18.445 -39.061  1.00 179.28 ? 211  TRP C CH2   1 
ATOM   4839  N  N     . LEU C 2  212  ? 18.254  -19.651 -45.487  1.00 140.62 ? 212  LEU C N     1 
ATOM   4840  C  CA    . LEU C 2  212  ? 19.135  -20.624 -46.126  1.00 120.27 ? 212  LEU C CA    1 
ATOM   4841  C  C     . LEU C 2  212  ? 19.932  -21.403 -45.080  1.00 109.07 ? 212  LEU C C     1 
ATOM   4842  O  O     . LEU C 2  212  ? 20.920  -20.901 -44.546  1.00 101.94 ? 212  LEU C O     1 
ATOM   4843  C  CB    . LEU C 2  212  ? 20.081  -19.914 -47.097  1.00 110.27 ? 212  LEU C CB    1 
ATOM   4844  C  CG    . LEU C 2  212  ? 21.027  -20.765 -47.940  1.00 99.01  ? 212  LEU C CG    1 
ATOM   4845  C  CD1   . LEU C 2  212  ? 20.241  -21.709 -48.834  1.00 110.11 ? 212  LEU C CD1   1 
ATOM   4846  C  CD2   . LEU C 2  212  ? 21.941  -19.873 -48.766  1.00 93.07  ? 212  LEU C CD2   1 
ATOM   4847  N  N     . GLU C 2  213  ? 19.499  -22.630 -44.794  1.00 115.81 ? 213  GLU C N     1 
ATOM   4848  C  CA    . GLU C 2  213  ? 20.123  -23.444 -43.750  1.00 114.96 ? 213  GLU C CA    1 
ATOM   4849  C  C     . GLU C 2  213  ? 20.586  -24.816 -44.251  1.00 116.47 ? 213  GLU C C     1 
ATOM   4850  O  O     . GLU C 2  213  ? 19.805  -25.574 -44.822  1.00 120.28 ? 213  GLU C O     1 
ATOM   4851  C  CB    . GLU C 2  213  ? 19.156  -23.619 -42.568  1.00 116.01 ? 213  GLU C CB    1 
ATOM   4852  C  CG    . GLU C 2  213  ? 17.710  -23.914 -42.962  1.00 123.78 ? 213  GLU C CG    1 
ATOM   4853  C  CD    . GLU C 2  213  ? 16.777  -24.033 -41.761  1.00 123.07 ? 213  GLU C CD    1 
ATOM   4854  O  OE1   . GLU C 2  213  ? 15.560  -23.795 -41.922  1.00 126.33 ? 213  GLU C OE1   1 
ATOM   4855  O  OE2   . GLU C 2  213  ? 17.256  -24.368 -40.656  1.00 119.66 ? 213  GLU C OE2   1 
ATOM   4856  N  N     . PHE C 2  214  ? 21.863  -25.124 -44.035  1.00 111.75 ? 214  PHE C N     1 
ATOM   4857  C  CA    . PHE C 2  214  ? 22.404  -26.440 -44.361  1.00 109.43 ? 214  PHE C CA    1 
ATOM   4858  C  C     . PHE C 2  214  ? 22.513  -27.300 -43.109  1.00 112.40 ? 214  PHE C C     1 
ATOM   4859  O  O     . PHE C 2  214  ? 23.212  -26.941 -42.161  1.00 109.04 ? 214  PHE C O     1 
ATOM   4860  C  CB    . PHE C 2  214  ? 23.777  -26.323 -45.024  1.00 103.99 ? 214  PHE C CB    1 
ATOM   4861  C  CG    . PHE C 2  214  ? 23.748  -25.652 -46.362  1.00 103.83 ? 214  PHE C CG    1 
ATOM   4862  C  CD1   . PHE C 2  214  ? 23.188  -26.286 -47.456  1.00 107.27 ? 214  PHE C CD1   1 
ATOM   4863  C  CD2   . PHE C 2  214  ? 24.293  -24.392 -46.530  1.00 100.79 ? 214  PHE C CD2   1 
ATOM   4864  C  CE1   . PHE C 2  214  ? 23.162  -25.671 -48.693  1.00 105.91 ? 214  PHE C CE1   1 
ATOM   4865  C  CE2   . PHE C 2  214  ? 24.272  -23.772 -47.763  1.00 102.23 ? 214  PHE C CE2   1 
ATOM   4866  C  CZ    . PHE C 2  214  ? 23.705  -24.412 -48.846  1.00 102.94 ? 214  PHE C CZ    1 
ATOM   4867  N  N     . ASP C 2  215  ? 21.823  -28.436 -43.111  1.00 121.42 ? 215  ASP C N     1 
ATOM   4868  C  CA    . ASP C 2  215  ? 21.849  -29.348 -41.973  1.00 128.36 ? 215  ASP C CA    1 
ATOM   4869  C  C     . ASP C 2  215  ? 22.336  -30.737 -42.386  1.00 128.42 ? 215  ASP C C     1 
ATOM   4870  O  O     . ASP C 2  215  ? 22.274  -31.107 -43.558  1.00 128.63 ? 215  ASP C O     1 
ATOM   4871  C  CB    . ASP C 2  215  ? 20.461  -29.445 -41.331  1.00 135.46 ? 215  ASP C CB    1 
ATOM   4872  C  CG    . ASP C 2  215  ? 19.912  -28.090 -40.911  1.00 136.01 ? 215  ASP C CG    1 
ATOM   4873  O  OD1   . ASP C 2  215  ? 20.719  -27.175 -40.637  1.00 127.37 ? 215  ASP C OD1   1 
ATOM   4874  O  OD2   . ASP C 2  215  ? 18.671  -27.940 -40.855  1.00 140.27 ? 215  ASP C OD2   1 
ATOM   4875  N  N     . VAL C 2  216  ? 22.824  -31.501 -41.414  1.00 129.30 ? 216  VAL C N     1 
ATOM   4876  C  CA    . VAL C 2  216  ? 23.310  -32.853 -41.670  1.00 133.28 ? 216  VAL C CA    1 
ATOM   4877  C  C     . VAL C 2  216  ? 22.435  -33.885 -40.961  1.00 136.68 ? 216  VAL C C     1 
ATOM   4878  O  O     . VAL C 2  216  ? 22.219  -33.802 -39.753  1.00 133.23 ? 216  VAL C O     1 
ATOM   4879  C  CB    . VAL C 2  216  ? 24.778  -33.018 -41.219  1.00 126.68 ? 216  VAL C CB    1 
ATOM   4880  C  CG1   . VAL C 2  216  ? 25.160  -34.485 -41.167  1.00 133.28 ? 216  VAL C CG1   1 
ATOM   4881  C  CG2   . VAL C 2  216  ? 25.705  -32.263 -42.152  1.00 123.66 ? 216  VAL C CG2   1 
ATOM   4882  N  N     . ASP C 2  217  ? 21.929  -34.852 -41.724  1.00 143.86 ? 217  ASP C N     1 
ATOM   4883  C  CA    . ASP C 2  217  ? 21.072  -35.906 -41.185  1.00 143.46 ? 217  ASP C CA    1 
ATOM   4884  C  C     . ASP C 2  217  ? 21.848  -36.931 -40.362  1.00 146.25 ? 217  ASP C C     1 
ATOM   4885  O  O     . ASP C 2  217  ? 23.075  -36.873 -40.262  1.00 150.56 ? 217  ASP C O     1 
ATOM   4886  C  CB    . ASP C 2  217  ? 20.336  -36.632 -42.318  1.00 136.98 ? 217  ASP C CB    1 
ATOM   4887  C  CG    . ASP C 2  217  ? 19.146  -35.855 -42.838  1.00 135.36 ? 217  ASP C CG    1 
ATOM   4888  O  OD1   . ASP C 2  217  ? 18.464  -35.193 -42.029  1.00 141.07 ? 217  ASP C OD1   1 
ATOM   4889  O  OD2   . ASP C 2  217  ? 18.886  -35.910 -44.057  1.00 133.08 ? 217  ASP C OD2   1 
ATOM   4890  N  N     . LYS C 2  218  ? 21.115  -37.873 -39.777  1.00 144.75 ? 218  LYS C N     1 
ATOM   4891  C  CA    . LYS C 2  218  ? 21.715  -39.030 -39.126  1.00 143.18 ? 218  LYS C CA    1 
ATOM   4892  C  C     . LYS C 2  218  ? 21.987  -40.090 -40.185  1.00 143.27 ? 218  LYS C C     1 
ATOM   4893  O  O     . LYS C 2  218  ? 22.653  -41.093 -39.929  1.00 142.43 ? 218  LYS C O     1 
ATOM   4894  C  CB    . LYS C 2  218  ? 20.798  -39.577 -38.030  1.00 139.61 ? 218  LYS C CB    1 
ATOM   4895  C  CG    . LYS C 2  218  ? 19.413  -39.961 -38.528  1.00 141.13 ? 218  LYS C CG    1 
ATOM   4896  C  CD    . LYS C 2  218  ? 18.480  -40.329 -37.384  1.00 140.83 ? 218  LYS C CD    1 
ATOM   4897  C  CE    . LYS C 2  218  ? 17.116  -40.760 -37.906  1.00 137.03 ? 218  LYS C CE    1 
ATOM   4898  N  NZ    . LYS C 2  218  ? 16.170  -41.105 -36.809  1.00 133.82 ? 218  LYS C NZ    1 
ATOM   4899  N  N     . ARG C 2  219  ? 21.459  -39.845 -41.381  1.00 143.33 ? 219  ARG C N     1 
ATOM   4900  C  CA    . ARG C 2  219  ? 21.635  -40.740 -42.516  1.00 146.22 ? 219  ARG C CA    1 
ATOM   4901  C  C     . ARG C 2  219  ? 22.890  -40.373 -43.305  1.00 150.09 ? 219  ARG C C     1 
ATOM   4902  O  O     . ARG C 2  219  ? 23.106  -40.874 -44.409  1.00 156.05 ? 219  ARG C O     1 
ATOM   4903  C  CB    . ARG C 2  219  ? 20.407  -40.690 -43.430  1.00 141.41 ? 219  ARG C CB    1 
ATOM   4904  C  CG    . ARG C 2  219  ? 19.072  -40.778 -42.700  1.00 138.46 ? 219  ARG C CG    1 
ATOM   4905  C  CD    . ARG C 2  219  ? 18.907  -42.111 -41.976  1.00 149.15 ? 219  ARG C CD    1 
ATOM   4906  N  NE    . ARG C 2  219  ? 17.608  -42.220 -41.316  1.00 150.52 ? 219  ARG C NE    1 
ATOM   4907  C  CZ    . ARG C 2  219  ? 17.186  -43.298 -40.661  1.00 154.80 ? 219  ARG C CZ    1 
ATOM   4908  N  NH1   . ARG C 2  219  ? 17.962  -44.372 -40.576  1.00 155.86 ? 219  ARG C NH1   1 
ATOM   4909  N  NH2   . ARG C 2  219  ? 15.987  -43.305 -40.093  1.00 153.35 ? 219  ARG C NH2   1 
ATOM   4910  N  N     . ASP C 2  220  ? 23.702  -39.489 -42.729  1.00 148.02 ? 220  ASP C N     1 
ATOM   4911  C  CA    . ASP C 2  220  ? 24.930  -38.996 -43.358  1.00 148.55 ? 220  ASP C CA    1 
ATOM   4912  C  C     . ASP C 2  220  ? 24.679  -38.357 -44.725  1.00 149.09 ? 220  ASP C C     1 
ATOM   4913  O  O     . ASP C 2  220  ? 25.552  -38.368 -45.592  1.00 148.32 ? 220  ASP C O     1 
ATOM   4914  C  CB    . ASP C 2  220  ? 25.959  -40.125 -43.490  1.00 148.51 ? 220  ASP C CB    1 
ATOM   4915  C  CG    . ASP C 2  220  ? 26.629  -40.463 -42.170  1.00 145.06 ? 220  ASP C CG    1 
ATOM   4916  O  OD1   . ASP C 2  220  ? 27.752  -41.012 -42.193  1.00 139.16 ? 220  ASP C OD1   1 
ATOM   4917  O  OD2   . ASP C 2  220  ? 26.038  -40.175 -41.108  1.00 144.17 ? 220  ASP C OD2   1 
ATOM   4918  N  N     . THR C 2  221  ? 23.485  -37.800 -44.909  1.00 150.45 ? 221  THR C N     1 
ATOM   4919  C  CA    . THR C 2  221  ? 23.148  -37.084 -46.135  1.00 145.63 ? 221  THR C CA    1 
ATOM   4920  C  C     . THR C 2  221  ? 22.850  -35.624 -45.822  1.00 145.66 ? 221  THR C C     1 
ATOM   4921  O  O     . THR C 2  221  ? 22.042  -35.321 -44.945  1.00 148.37 ? 221  THR C O     1 
ATOM   4922  C  CB    . THR C 2  221  ? 21.935  -37.711 -46.851  1.00 143.75 ? 221  THR C CB    1 
ATOM   4923  O  OG1   . THR C 2  221  ? 20.787  -37.650 -45.996  1.00 139.09 ? 221  THR C OG1   1 
ATOM   4924  C  CG2   . THR C 2  221  ? 22.218  -39.160 -47.209  1.00 143.92 ? 221  THR C CG2   1 
ATOM   4925  N  N     . VAL C 2  222  ? 23.501  -34.721 -46.545  1.00 134.81 ? 222  VAL C N     1 
ATOM   4926  C  CA    . VAL C 2  222  ? 23.385  -33.295 -46.267  1.00 132.47 ? 222  VAL C CA    1 
ATOM   4927  C  C     . VAL C 2  222  ? 22.213  -32.666 -47.020  1.00 134.58 ? 222  VAL C C     1 
ATOM   4928  O  O     . VAL C 2  222  ? 22.039  -32.892 -48.217  1.00 135.56 ? 222  VAL C O     1 
ATOM   4929  C  CB    . VAL C 2  222  ? 24.685  -32.562 -46.629  1.00 129.48 ? 222  VAL C CB    1 
ATOM   4930  C  CG1   . VAL C 2  222  ? 24.608  -31.103 -46.216  1.00 138.39 ? 222  VAL C CG1   1 
ATOM   4931  C  CG2   . VAL C 2  222  ? 25.867  -33.244 -45.960  1.00 128.05 ? 222  VAL C CG2   1 
ATOM   4932  N  N     . GLY C 2  223  ? 21.412  -31.877 -46.307  1.00 131.26 ? 223  GLY C N     1 
ATOM   4933  C  CA    . GLY C 2  223  ? 20.239  -31.247 -46.887  1.00 129.66 ? 223  GLY C CA    1 
ATOM   4934  C  C     . GLY C 2  223  ? 20.229  -29.737 -46.732  1.00 132.72 ? 223  GLY C C     1 
ATOM   4935  O  O     . GLY C 2  223  ? 21.155  -29.159 -46.163  1.00 131.52 ? 223  GLY C O     1 
ATOM   4936  N  N     . VAL C 2  224  ? 19.178  -29.096 -47.238  1.00 131.07 ? 224  VAL C N     1 
ATOM   4937  C  CA    . VAL C 2  224  ? 19.067  -27.640 -47.187  1.00 125.33 ? 224  VAL C CA    1 
ATOM   4938  C  C     . VAL C 2  224  ? 17.609  -27.180 -47.206  1.00 125.84 ? 224  VAL C C     1 
ATOM   4939  O  O     . VAL C 2  224  ? 16.817  -27.637 -48.029  1.00 128.61 ? 224  VAL C O     1 
ATOM   4940  C  CB    . VAL C 2  224  ? 19.826  -26.981 -48.364  1.00 121.72 ? 224  VAL C CB    1 
ATOM   4941  C  CG1   . VAL C 2  224  ? 19.502  -27.681 -49.677  1.00 130.49 ? 224  VAL C CG1   1 
ATOM   4942  C  CG2   . VAL C 2  224  ? 19.518  -25.490 -48.447  1.00 116.18 ? 224  VAL C CG2   1 
ATOM   4943  N  N     . ARG C 2  225  ? 17.257  -26.283 -46.288  1.00 133.03 ? 225  ARG C N     1 
ATOM   4944  C  CA    . ARG C 2  225  ? 15.916  -25.704 -46.260  1.00 134.23 ? 225  ARG C CA    1 
ATOM   4945  C  C     . ARG C 2  225  ? 15.953  -24.226 -46.648  1.00 127.50 ? 225  ARG C C     1 
ATOM   4946  O  O     . ARG C 2  225  ? 16.508  -23.396 -45.928  1.00 124.04 ? 225  ARG C O     1 
ATOM   4947  C  CB    . ARG C 2  225  ? 15.277  -25.873 -44.877  1.00 135.96 ? 225  ARG C CB    1 
ATOM   4948  C  CG    . ARG C 2  225  ? 15.088  -27.321 -44.441  1.00 128.96 ? 225  ARG C CG    1 
ATOM   4949  C  CD    . ARG C 2  225  ? 14.159  -27.416 -43.237  1.00 124.47 ? 225  ARG C CD    1 
ATOM   4950  N  NE    . ARG C 2  225  ? 12.977  -28.225 -43.526  1.00 125.21 ? 225  ARG C NE    1 
ATOM   4951  C  CZ    . ARG C 2  225  ? 11.788  -28.043 -42.960  1.00 131.34 ? 225  ARG C CZ    1 
ATOM   4952  N  NH1   . ARG C 2  225  ? 11.615  -27.070 -42.075  1.00 126.40 ? 225  ARG C NH1   1 
ATOM   4953  N  NH2   . ARG C 2  225  ? 10.770  -28.830 -43.283  1.00 136.17 ? 225  ARG C NH2   1 
ATOM   4954  N  N     . ILE C 2  226  ? 15.362  -23.904 -47.793  1.00 118.83 ? 226  ILE C N     1 
ATOM   4955  C  CA    . ILE C 2  226  ? 15.336  -22.530 -48.281  1.00 111.87 ? 226  ILE C CA    1 
ATOM   4956  C  C     . ILE C 2  226  ? 14.058  -21.834 -47.836  1.00 114.21 ? 226  ILE C C     1 
ATOM   4957  O  O     . ILE C 2  226  ? 12.974  -22.154 -48.317  1.00 112.94 ? 226  ILE C O     1 
ATOM   4958  C  CB    . ILE C 2  226  ? 15.445  -22.476 -49.814  1.00 103.67 ? 226  ILE C CB    1 
ATOM   4959  C  CG1   . ILE C 2  226  ? 16.705  -23.207 -50.277  1.00 98.47  ? 226  ILE C CG1   1 
ATOM   4960  C  CG2   . ILE C 2  226  ? 15.444  -21.036 -50.300  1.00 108.99 ? 226  ILE C CG2   1 
ATOM   4961  C  CD1   . ILE C 2  226  ? 16.869  -23.252 -51.775  1.00 96.85  ? 226  ILE C CD1   1 
ATOM   4962  N  N     . ASP C 2  227  ? 14.202  -20.883 -46.917  1.00 121.61 ? 227  ASP C N     1 
ATOM   4963  C  CA    . ASP C 2  227  ? 13.069  -20.186 -46.311  1.00 126.42 ? 227  ASP C CA    1 
ATOM   4964  C  C     . ASP C 2  227  ? 12.109  -21.184 -45.671  1.00 123.00 ? 227  ASP C C     1 
ATOM   4965  O  O     . ASP C 2  227  ? 10.901  -21.133 -45.899  1.00 123.09 ? 227  ASP C O     1 
ATOM   4966  C  CB    . ASP C 2  227  ? 12.337  -19.321 -47.344  1.00 129.08 ? 227  ASP C CB    1 
ATOM   4967  C  CG    . ASP C 2  227  ? 11.816  -18.019 -46.754  1.00 131.70 ? 227  ASP C CG    1 
ATOM   4968  O  OD1   . ASP C 2  227  ? 11.773  -17.898 -45.511  1.00 136.83 ? 227  ASP C OD1   1 
ATOM   4969  O  OD2   . ASP C 2  227  ? 11.444  -17.119 -47.537  1.00 124.74 ? 227  ASP C OD2   1 
ATOM   4970  N  N     . ARG C 2  228  ? 12.673  -22.096 -44.883  1.00 120.74 ? 228  ARG C N     1 
ATOM   4971  C  CA    . ARG C 2  228  ? 11.910  -23.096 -44.139  1.00 123.83 ? 228  ARG C CA    1 
ATOM   4972  C  C     . ARG C 2  228  ? 11.061  -24.010 -45.030  1.00 130.64 ? 228  ARG C C     1 
ATOM   4973  O  O     . ARG C 2  228  ? 10.009  -24.488 -44.608  1.00 131.27 ? 228  ARG C O     1 
ATOM   4974  C  CB    . ARG C 2  228  ? 11.017  -22.410 -43.100  1.00 118.20 ? 228  ARG C CB    1 
ATOM   4975  N  N     . LYS C 2  229  ? 11.517  -24.255 -46.257  1.00 131.23 ? 229  LYS C N     1 
ATOM   4976  C  CA    . LYS C 2  229  ? 10.878  -25.252 -47.115  1.00 132.70 ? 229  LYS C CA    1 
ATOM   4977  C  C     . LYS C 2  229  ? 11.402  -26.641 -46.754  1.00 134.07 ? 229  LYS C C     1 
ATOM   4978  O  O     . LYS C 2  229  ? 12.264  -26.775 -45.886  1.00 132.94 ? 229  LYS C O     1 
ATOM   4979  C  CB    . LYS C 2  229  ? 11.123  -24.957 -48.599  1.00 132.11 ? 229  LYS C CB    1 
ATOM   4980  C  CG    . LYS C 2  229  ? 10.443  -23.699 -49.130  1.00 134.08 ? 229  LYS C CG    1 
ATOM   4981  C  CD    . LYS C 2  229  ? 8.949   -23.687 -48.854  1.00 134.02 ? 229  LYS C CD    1 
ATOM   4982  C  CE    . LYS C 2  229  ? 8.297   -22.433 -49.425  1.00 126.01 ? 229  LYS C CE    1 
ATOM   4983  N  NZ    . LYS C 2  229  ? 8.931   -21.180 -48.925  1.00 121.75 ? 229  LYS C NZ    1 
ATOM   4984  N  N     . ARG C 2  230  ? 10.888  -27.669 -47.424  1.00 142.93 ? 230  ARG C N     1 
ATOM   4985  C  CA    . ARG C 2  230  ? 11.259  -29.051 -47.120  1.00 132.68 ? 230  ARG C CA    1 
ATOM   4986  C  C     . ARG C 2  230  ? 12.708  -29.340 -47.511  1.00 129.31 ? 230  ARG C C     1 
ATOM   4987  O  O     . ARG C 2  230  ? 13.275  -28.668 -48.372  1.00 134.86 ? 230  ARG C O     1 
ATOM   4988  C  CB    . ARG C 2  230  ? 10.318  -30.027 -47.830  1.00 130.11 ? 230  ARG C CB    1 
ATOM   4989  C  CG    . ARG C 2  230  ? 8.856   -29.592 -47.829  1.00 137.55 ? 230  ARG C CG    1 
ATOM   4990  C  CD    . ARG C 2  230  ? 8.281   -29.512 -46.420  1.00 138.43 ? 230  ARG C CD    1 
ATOM   4991  N  NE    . ARG C 2  230  ? 7.734   -30.792 -45.977  1.00 141.30 ? 230  ARG C NE    1 
ATOM   4992  C  CZ    . ARG C 2  230  ? 7.079   -30.967 -44.834  1.00 142.19 ? 230  ARG C CZ    1 
ATOM   4993  N  NH1   . ARG C 2  230  ? 6.889   -29.942 -44.014  1.00 138.17 ? 230  ARG C NH1   1 
ATOM   4994  N  NH2   . ARG C 2  230  ? 6.613   -32.166 -44.512  1.00 152.95 ? 230  ARG C NH2   1 
ATOM   4995  N  N     . ARG C 2  231  ? 13.299  -30.349 -46.878  1.00 123.73 ? 231  ARG C N     1 
ATOM   4996  C  CA    . ARG C 2  231  ? 14.712  -30.664 -47.071  1.00 122.34 ? 231  ARG C CA    1 
ATOM   4997  C  C     . ARG C 2  231  ? 14.994  -31.400 -48.380  1.00 120.05 ? 231  ARG C C     1 
ATOM   4998  O  O     . ARG C 2  231  ? 14.277  -32.328 -48.750  1.00 120.54 ? 231  ARG C O     1 
ATOM   4999  C  CB    . ARG C 2  231  ? 15.225  -31.496 -45.893  1.00 122.40 ? 231  ARG C CB    1 
ATOM   5000  C  CG    . ARG C 2  231  ? 16.500  -32.269 -46.184  1.00 120.17 ? 231  ARG C CG    1 
ATOM   5001  C  CD    . ARG C 2  231  ? 16.769  -33.300 -45.106  1.00 126.28 ? 231  ARG C CD    1 
ATOM   5002  N  NE    . ARG C 2  231  ? 17.290  -32.692 -43.887  1.00 133.30 ? 231  ARG C NE    1 
ATOM   5003  C  CZ    . ARG C 2  231  ? 18.581  -32.636 -43.581  1.00 132.56 ? 231  ARG C CZ    1 
ATOM   5004  N  NH1   . ARG C 2  231  ? 19.480  -33.161 -44.402  1.00 130.38 ? 231  ARG C NH1   1 
ATOM   5005  N  NH2   . ARG C 2  231  ? 18.971  -32.068 -42.450  1.00 131.93 ? 231  ARG C NH2   1 
ATOM   5006  N  N     . GLN C 2  232  ? 16.046  -30.972 -49.072  1.00 119.37 ? 232  GLN C N     1 
ATOM   5007  C  CA    . GLN C 2  232  ? 16.517  -31.648 -50.276  1.00 116.63 ? 232  GLN C CA    1 
ATOM   5008  C  C     . GLN C 2  232  ? 18.029  -31.832 -50.219  1.00 118.60 ? 232  GLN C C     1 
ATOM   5009  O  O     . GLN C 2  232  ? 18.722  -31.023 -49.605  1.00 120.09 ? 232  GLN C O     1 
ATOM   5010  C  CB    . GLN C 2  232  ? 16.128  -30.861 -51.527  1.00 118.25 ? 232  GLN C CB    1 
ATOM   5011  C  CG    . GLN C 2  232  ? 14.672  -31.000 -51.914  1.00 129.75 ? 232  GLN C CG    1 
ATOM   5012  C  CD    . GLN C 2  232  ? 14.424  -30.639 -53.363  1.00 136.79 ? 232  GLN C CD    1 
ATOM   5013  O  OE1   . GLN C 2  232  ? 13.356  -30.913 -53.906  1.00 141.20 ? 232  GLN C OE1   1 
ATOM   5014  N  NE2   . GLN C 2  232  ? 15.416  -30.025 -53.999  1.00 135.16 ? 232  GLN C NE2   1 
ATOM   5015  N  N     . PRO C 2  233  ? 18.542  -32.900 -50.856  1.00 118.24 ? 233  PRO C N     1 
ATOM   5016  C  CA    . PRO C 2  233  ? 19.985  -33.157 -50.917  1.00 118.50 ? 233  PRO C CA    1 
ATOM   5017  C  C     . PRO C 2  233  ? 20.775  -31.937 -51.381  1.00 119.69 ? 233  PRO C C     1 
ATOM   5018  O  O     . PRO C 2  233  ? 20.325  -31.208 -52.265  1.00 116.24 ? 233  PRO C O     1 
ATOM   5019  C  CB    . PRO C 2  233  ? 20.093  -34.294 -51.934  1.00 116.88 ? 233  PRO C CB    1 
ATOM   5020  C  CG    . PRO C 2  233  ? 18.809  -35.022 -51.799  1.00 126.68 ? 233  PRO C CG    1 
ATOM   5021  C  CD    . PRO C 2  233  ? 17.770  -33.968 -51.516  1.00 122.05 ? 233  PRO C CD    1 
ATOM   5022  N  N     . VAL C 2  234  ? 21.939  -31.723 -50.778  1.00 121.57 ? 234  VAL C N     1 
ATOM   5023  C  CA    . VAL C 2  234  ? 22.739  -30.534 -51.044  1.00 120.67 ? 234  VAL C CA    1 
ATOM   5024  C  C     . VAL C 2  234  ? 23.384  -30.585 -52.428  1.00 124.90 ? 234  VAL C C     1 
ATOM   5025  O  O     . VAL C 2  234  ? 23.859  -29.572 -52.940  1.00 124.24 ? 234  VAL C O     1 
ATOM   5026  C  CB    . VAL C 2  234  ? 23.833  -30.349 -49.969  1.00 118.96 ? 234  VAL C CB    1 
ATOM   5027  C  CG1   . VAL C 2  234  ? 25.010  -31.271 -50.239  1.00 129.71 ? 234  VAL C CG1   1 
ATOM   5028  C  CG2   . VAL C 2  234  ? 24.290  -28.899 -49.910  1.00 125.90 ? 234  VAL C CG2   1 
ATOM   5029  N  N     . THR C 2  235  ? 23.396  -31.768 -53.034  1.00 133.12 ? 235  THR C N     1 
ATOM   5030  C  CA    . THR C 2  235  ? 23.943  -31.923 -54.376  1.00 139.44 ? 235  THR C CA    1 
ATOM   5031  C  C     . THR C 2  235  ? 22.966  -31.388 -55.418  1.00 136.34 ? 235  THR C C     1 
ATOM   5032  O  O     . THR C 2  235  ? 23.371  -30.950 -56.496  1.00 139.28 ? 235  THR C O     1 
ATOM   5033  C  CB    . THR C 2  235  ? 24.275  -33.394 -54.690  1.00 152.00 ? 235  THR C CB    1 
ATOM   5034  O  OG1   . THR C 2  235  ? 23.138  -34.217 -54.401  1.00 154.79 ? 235  THR C OG1   1 
ATOM   5035  C  CG2   . THR C 2  235  ? 25.459  -33.862 -53.857  1.00 157.74 ? 235  THR C CG2   1 
ATOM   5036  N  N     . VAL C 2  236  ? 21.678  -31.426 -55.085  1.00 124.79 ? 236  VAL C N     1 
ATOM   5037  C  CA    . VAL C 2  236  ? 20.641  -30.878 -55.949  1.00 124.48 ? 236  VAL C CA    1 
ATOM   5038  C  C     . VAL C 2  236  ? 20.885  -29.392 -56.171  1.00 124.49 ? 236  VAL C C     1 
ATOM   5039  O  O     . VAL C 2  236  ? 20.668  -28.863 -57.262  1.00 124.06 ? 236  VAL C O     1 
ATOM   5040  C  CB    . VAL C 2  236  ? 19.237  -31.088 -55.347  1.00 121.81 ? 236  VAL C CB    1 
ATOM   5041  C  CG1   . VAL C 2  236  ? 18.166  -30.533 -56.277  1.00 132.17 ? 236  VAL C CG1   1 
ATOM   5042  C  CG2   . VAL C 2  236  ? 18.998  -32.564 -55.067  1.00 122.50 ? 236  VAL C CG2   1 
ATOM   5043  N  N     . LEU C 2  237  ? 21.350  -28.730 -55.119  1.00 130.05 ? 237  LEU C N     1 
ATOM   5044  C  CA    . LEU C 2  237  ? 21.675  -27.315 -55.176  1.00 140.01 ? 237  LEU C CA    1 
ATOM   5045  C  C     . LEU C 2  237  ? 22.948  -27.077 -55.983  1.00 130.41 ? 237  LEU C C     1 
ATOM   5046  O  O     . LEU C 2  237  ? 23.053  -26.099 -56.723  1.00 131.50 ? 237  LEU C O     1 
ATOM   5047  C  CB    . LEU C 2  237  ? 21.830  -26.751 -53.761  1.00 144.34 ? 237  LEU C CB    1 
ATOM   5048  C  CG    . LEU C 2  237  ? 21.959  -25.234 -53.608  1.00 131.99 ? 237  LEU C CG    1 
ATOM   5049  C  CD1   . LEU C 2  237  ? 20.759  -24.528 -54.221  1.00 127.89 ? 237  LEU C CD1   1 
ATOM   5050  C  CD2   . LEU C 2  237  ? 22.110  -24.859 -52.141  1.00 115.81 ? 237  LEU C CD2   1 
ATOM   5051  N  N     . LEU C 2  238  ? 23.913  -27.979 -55.842  1.00 128.24 ? 238  LEU C N     1 
ATOM   5052  C  CA    . LEU C 2  238  ? 25.200  -27.827 -56.512  1.00 131.75 ? 238  LEU C CA    1 
ATOM   5053  C  C     . LEU C 2  238  ? 25.084  -28.041 -58.019  1.00 135.60 ? 238  LEU C C     1 
ATOM   5054  O  O     . LEU C 2  238  ? 25.750  -27.362 -58.802  1.00 138.25 ? 238  LEU C O     1 
ATOM   5055  C  CB    . LEU C 2  238  ? 26.227  -28.795 -55.917  1.00 135.86 ? 238  LEU C CB    1 
ATOM   5056  C  CG    . LEU C 2  238  ? 26.644  -28.534 -54.467  1.00 136.89 ? 238  LEU C CG    1 
ATOM   5057  C  CD1   . LEU C 2  238  ? 27.425  -29.713 -53.909  1.00 140.74 ? 238  LEU C CD1   1 
ATOM   5058  C  CD2   . LEU C 2  238  ? 27.464  -27.255 -54.370  1.00 146.21 ? 238  LEU C CD2   1 
ATOM   5059  N  N     . LYS C 2  239  ? 24.233  -28.981 -58.422  1.00 135.61 ? 239  LYS C N     1 
ATOM   5060  C  CA    . LYS C 2  239  ? 24.024  -29.272 -59.839  1.00 145.12 ? 239  LYS C CA    1 
ATOM   5061  C  C     . LYS C 2  239  ? 23.099  -28.236 -60.475  1.00 147.08 ? 239  LYS C C     1 
ATOM   5062  O  O     . LYS C 2  239  ? 22.880  -28.245 -61.688  1.00 149.82 ? 239  LYS C O     1 
ATOM   5063  C  CB    . LYS C 2  239  ? 23.451  -30.683 -60.028  1.00 149.51 ? 239  LYS C CB    1 
ATOM   5064  C  CG    . LYS C 2  239  ? 24.372  -31.817 -59.569  1.00 146.61 ? 239  LYS C CG    1 
ATOM   5065  C  CD    . LYS C 2  239  ? 23.769  -33.187 -59.870  1.00 131.50 ? 239  LYS C CD    1 
ATOM   5066  C  CE    . LYS C 2  239  ? 24.703  -34.314 -59.459  1.00 121.31 ? 239  LYS C CE    1 
ATOM   5067  N  NZ    . LYS C 2  239  ? 24.089  -35.652 -59.675  1.00 119.68 ? 239  LYS C NZ    1 
ATOM   5068  N  N     . ALA C 2  240  ? 22.560  -27.346 -59.649  1.00 138.88 ? 240  ALA C N     1 
ATOM   5069  C  CA    . ALA C 2  240  ? 21.709  -26.265 -60.131  1.00 140.74 ? 240  ALA C CA    1 
ATOM   5070  C  C     . ALA C 2  240  ? 22.532  -25.016 -60.425  1.00 141.95 ? 240  ALA C C     1 
ATOM   5071  O  O     . ALA C 2  240  ? 22.228  -24.264 -61.352  1.00 145.03 ? 240  ALA C O     1 
ATOM   5072  C  CB    . ALA C 2  240  ? 20.620  -25.956 -59.119  1.00 144.76 ? 240  ALA C CB    1 
ATOM   5073  N  N     . LEU C 2  241  ? 23.573  -24.800 -59.625  1.00 137.69 ? 241  LEU C N     1 
ATOM   5074  C  CA    . LEU C 2  241  ? 24.470  -23.664 -59.811  1.00 138.10 ? 241  LEU C CA    1 
ATOM   5075  C  C     . LEU C 2  241  ? 25.171  -23.722 -61.163  1.00 143.55 ? 241  LEU C C     1 
ATOM   5076  O  O     . LEU C 2  241  ? 25.390  -22.694 -61.806  1.00 147.10 ? 241  LEU C O     1 
ATOM   5077  C  CB    . LEU C 2  241  ? 25.512  -23.611 -58.691  1.00 134.53 ? 241  LEU C CB    1 
ATOM   5078  C  CG    . LEU C 2  241  ? 25.151  -22.897 -57.387  1.00 135.08 ? 241  LEU C CG    1 
ATOM   5079  C  CD1   . LEU C 2  241  ? 26.256  -23.083 -56.358  1.00 134.28 ? 241  LEU C CD1   1 
ATOM   5080  C  CD2   . LEU C 2  241  ? 24.902  -21.417 -57.641  1.00 133.88 ? 241  LEU C CD2   1 
ATOM   5081  N  N     . GLY C 2  242  ? 25.521  -24.933 -61.585  1.00 146.08 ? 242  GLY C N     1 
ATOM   5082  C  CA    . GLY C 2  242  ? 26.253  -25.135 -62.822  1.00 148.26 ? 242  GLY C CA    1 
ATOM   5083  C  C     . GLY C 2  242  ? 27.503  -25.966 -62.603  1.00 146.15 ? 242  GLY C C     1 
ATOM   5084  O  O     . GLY C 2  242  ? 28.191  -26.336 -63.556  1.00 145.28 ? 242  GLY C O     1 
ATOM   5085  N  N     . TRP C 2  243  ? 27.795  -26.257 -61.339  1.00 144.87 ? 243  TRP C N     1 
ATOM   5086  C  CA    . TRP C 2  243  ? 28.940  -27.086 -60.983  1.00 144.68 ? 243  TRP C CA    1 
ATOM   5087  C  C     . TRP C 2  243  ? 28.767  -28.492 -61.553  1.00 146.16 ? 243  TRP C C     1 
ATOM   5088  O  O     . TRP C 2  243  ? 27.667  -29.041 -61.533  1.00 148.53 ? 243  TRP C O     1 
ATOM   5089  C  CB    . TRP C 2  243  ? 29.117  -27.130 -59.460  1.00 144.45 ? 243  TRP C CB    1 
ATOM   5090  C  CG    . TRP C 2  243  ? 29.468  -25.796 -58.858  1.00 152.89 ? 243  TRP C CG    1 
ATOM   5091  C  CD1   . TRP C 2  243  ? 28.621  -24.927 -58.227  1.00 150.79 ? 243  TRP C CD1   1 
ATOM   5092  C  CD2   . TRP C 2  243  ? 30.760  -25.178 -58.838  1.00 156.74 ? 243  TRP C CD2   1 
ATOM   5093  N  NE1   . TRP C 2  243  ? 29.308  -23.808 -57.815  1.00 151.11 ? 243  TRP C NE1   1 
ATOM   5094  C  CE2   . TRP C 2  243  ? 30.623  -23.938 -58.180  1.00 154.17 ? 243  TRP C CE2   1 
ATOM   5095  C  CE3   . TRP C 2  243  ? 32.021  -25.553 -59.315  1.00 150.19 ? 243  TRP C CE3   1 
ATOM   5096  C  CZ2   . TRP C 2  243  ? 31.698  -23.074 -57.986  1.00 149.72 ? 243  TRP C CZ2   1 
ATOM   5097  C  CZ3   . TRP C 2  243  ? 33.086  -24.693 -59.121  1.00 141.90 ? 243  TRP C CZ3   1 
ATOM   5098  C  CH2   . TRP C 2  243  ? 32.918  -23.469 -58.463  1.00 146.37 ? 243  TRP C CH2   1 
ATOM   5099  N  N     . THR C 2  244  ? 29.852  -29.060 -62.074  1.00 146.91 ? 244  THR C N     1 
ATOM   5100  C  CA    . THR C 2  244  ? 29.807  -30.379 -62.705  1.00 150.08 ? 244  THR C CA    1 
ATOM   5101  C  C     . THR C 2  244  ? 29.748  -31.493 -61.660  1.00 152.57 ? 244  THR C C     1 
ATOM   5102  O  O     . THR C 2  244  ? 30.195  -31.311 -60.528  1.00 152.87 ? 244  THR C O     1 
ATOM   5103  C  CB    . THR C 2  244  ? 31.028  -30.609 -63.620  1.00 147.79 ? 244  THR C CB    1 
ATOM   5104  O  OG1   . THR C 2  244  ? 32.198  -30.820 -62.821  1.00 148.21 ? 244  THR C OG1   1 
ATOM   5105  C  CG2   . THR C 2  244  ? 31.249  -29.411 -64.537  1.00 141.00 ? 244  THR C CG2   1 
ATOM   5106  N  N     . SER C 2  245  ? 29.201  -32.646 -62.042  1.00 152.53 ? 245  SER C N     1 
ATOM   5107  C  CA    . SER C 2  245  ? 29.056  -33.766 -61.113  1.00 151.84 ? 245  SER C CA    1 
ATOM   5108  C  C     . SER C 2  245  ? 30.415  -34.393 -60.804  1.00 152.30 ? 245  SER C C     1 
ATOM   5109  O  O     . SER C 2  245  ? 30.551  -35.176 -59.864  1.00 150.71 ? 245  SER C O     1 
ATOM   5110  C  CB    . SER C 2  245  ? 28.095  -34.820 -61.676  1.00 147.66 ? 245  SER C CB    1 
ATOM   5111  O  OG    . SER C 2  245  ? 26.797  -34.285 -61.879  1.00 133.97 ? 245  SER C OG    1 
ATOM   5112  N  N     . GLU C 2  246  ? 31.418  -34.035 -61.602  1.00 154.20 ? 246  GLU C N     1 
ATOM   5113  C  CA    . GLU C 2  246  ? 32.791  -34.466 -61.365  1.00 159.33 ? 246  GLU C CA    1 
ATOM   5114  C  C     . GLU C 2  246  ? 33.487  -33.548 -60.362  1.00 158.93 ? 246  GLU C C     1 
ATOM   5115  O  O     . GLU C 2  246  ? 34.401  -33.970 -59.654  1.00 163.52 ? 246  GLU C O     1 
ATOM   5116  C  CB    . GLU C 2  246  ? 33.581  -34.505 -62.676  1.00 159.90 ? 246  GLU C CB    1 
ATOM   5117  C  CG    . GLU C 2  246  ? 33.824  -35.905 -63.226  1.00 153.68 ? 246  GLU C CG    1 
ATOM   5118  C  CD    . GLU C 2  246  ? 32.556  -36.572 -63.725  1.00 153.03 ? 246  GLU C CD    1 
ATOM   5119  O  OE1   . GLU C 2  246  ? 31.603  -35.850 -64.085  1.00 158.74 ? 246  GLU C OE1   1 
ATOM   5120  O  OE2   . GLU C 2  246  ? 32.514  -37.820 -63.756  1.00 142.76 ? 246  GLU C OE2   1 
ATOM   5121  N  N     . GLN C 2  247  ? 33.056  -32.290 -60.311  1.00 152.63 ? 247  GLN C N     1 
ATOM   5122  C  CA    . GLN C 2  247  ? 33.601  -31.331 -59.353  1.00 151.93 ? 247  GLN C CA    1 
ATOM   5123  C  C     . GLN C 2  247  ? 33.044  -31.593 -57.956  1.00 155.72 ? 247  GLN C C     1 
ATOM   5124  O  O     . GLN C 2  247  ? 33.629  -31.173 -56.957  1.00 153.73 ? 247  GLN C O     1 
ATOM   5125  C  CB    . GLN C 2  247  ? 33.294  -29.891 -59.781  1.00 152.42 ? 247  GLN C CB    1 
ATOM   5126  C  CG    . GLN C 2  247  ? 34.218  -29.324 -60.857  1.00 151.69 ? 247  GLN C CG    1 
ATOM   5127  C  CD    . GLN C 2  247  ? 33.810  -27.924 -61.298  1.00 148.86 ? 247  GLN C CD    1 
ATOM   5128  O  OE1   . GLN C 2  247  ? 32.768  -27.737 -61.927  1.00 137.10 ? 247  GLN C OE1   1 
ATOM   5129  N  NE2   . GLN C 2  247  ? 34.630  -26.934 -60.961  1.00 154.85 ? 247  GLN C NE2   1 
ATOM   5130  N  N     . ILE C 2  248  ? 31.908  -32.286 -57.896  1.00 157.96 ? 248  ILE C N     1 
ATOM   5131  C  CA    . ILE C 2  248  ? 31.288  -32.658 -56.625  1.00 162.15 ? 248  ILE C CA    1 
ATOM   5132  C  C     . ILE C 2  248  ? 32.098  -33.762 -55.954  1.00 171.15 ? 248  ILE C C     1 
ATOM   5133  O  O     . ILE C 2  248  ? 32.214  -33.811 -54.728  1.00 176.65 ? 248  ILE C O     1 
ATOM   5134  C  CB    . ILE C 2  248  ? 29.827  -33.134 -56.814  1.00 151.56 ? 248  ILE C CB    1 
ATOM   5135  C  CG1   . ILE C 2  248  ? 29.017  -32.100 -57.597  1.00 154.76 ? 248  ILE C CG1   1 
ATOM   5136  C  CG2   . ILE C 2  248  ? 29.169  -33.414 -55.466  1.00 147.13 ? 248  ILE C CG2   1 
ATOM   5137  C  CD1   . ILE C 2  248  ? 27.554  -32.459 -57.754  1.00 150.93 ? 248  ILE C CD1   1 
ATOM   5138  N  N     . VAL C 2  249  ? 32.658  -34.645 -56.774  1.00 173.16 ? 249  VAL C N     1 
ATOM   5139  C  CA    . VAL C 2  249  ? 33.529  -35.709 -56.291  1.00 168.10 ? 249  VAL C CA    1 
ATOM   5140  C  C     . VAL C 2  249  ? 34.867  -35.133 -55.814  1.00 159.08 ? 249  VAL C C     1 
ATOM   5141  O  O     . VAL C 2  249  ? 35.493  -35.669 -54.901  1.00 156.82 ? 249  VAL C O     1 
ATOM   5142  C  CB    . VAL C 2  249  ? 33.787  -36.771 -57.390  1.00 164.03 ? 249  VAL C CB    1 
ATOM   5143  C  CG1   . VAL C 2  249  ? 34.471  -37.997 -56.805  1.00 161.01 ? 249  VAL C CG1   1 
ATOM   5144  C  CG2   . VAL C 2  249  ? 32.485  -37.171 -58.067  1.00 156.50 ? 249  VAL C CG2   1 
ATOM   5145  N  N     . GLU C 2  250  ? 35.289  -34.030 -56.429  1.00 156.38 ? 250  GLU C N     1 
ATOM   5146  C  CA    . GLU C 2  250  ? 36.588  -33.418 -56.138  1.00 159.32 ? 250  GLU C CA    1 
ATOM   5147  C  C     . GLU C 2  250  ? 36.622  -32.672 -54.804  1.00 163.42 ? 250  GLU C C     1 
ATOM   5148  O  O     . GLU C 2  250  ? 37.357  -33.046 -53.889  1.00 171.73 ? 250  GLU C O     1 
ATOM   5149  C  CB    . GLU C 2  250  ? 36.981  -32.454 -57.264  1.00 159.03 ? 250  GLU C CB    1 
ATOM   5150  C  CG    . GLU C 2  250  ? 38.305  -31.724 -57.040  1.00 162.90 ? 250  GLU C CG    1 
ATOM   5151  C  CD    . GLU C 2  250  ? 38.473  -30.513 -57.946  1.00 166.25 ? 250  GLU C CD    1 
ATOM   5152  O  OE1   . GLU C 2  250  ? 39.584  -29.943 -57.980  1.00 168.22 ? 250  GLU C OE1   1 
ATOM   5153  O  OE2   . GLU C 2  250  ? 37.493  -30.128 -58.619  1.00 162.95 ? 250  GLU C OE2   1 
ATOM   5154  N  N     . ARG C 2  251  ? 35.827  -31.611 -54.707  1.00 156.03 ? 251  ARG C N     1 
ATOM   5155  C  CA    . ARG C 2  251  ? 35.852  -30.710 -53.557  1.00 155.37 ? 251  ARG C CA    1 
ATOM   5156  C  C     . ARG C 2  251  ? 35.393  -31.377 -52.261  1.00 158.93 ? 251  ARG C C     1 
ATOM   5157  O  O     . ARG C 2  251  ? 36.020  -31.209 -51.216  1.00 157.47 ? 251  ARG C O     1 
ATOM   5158  C  CB    . ARG C 2  251  ? 34.982  -29.483 -53.843  1.00 150.85 ? 251  ARG C CB    1 
ATOM   5159  C  CG    . ARG C 2  251  ? 35.025  -28.402 -52.772  1.00 151.31 ? 251  ARG C CG    1 
ATOM   5160  C  CD    . ARG C 2  251  ? 36.351  -27.656 -52.777  1.00 145.39 ? 251  ARG C CD    1 
ATOM   5161  N  NE    . ARG C 2  251  ? 36.358  -26.552 -51.821  1.00 138.47 ? 251  ARG C NE    1 
ATOM   5162  C  CZ    . ARG C 2  251  ? 35.949  -25.319 -52.102  1.00 129.05 ? 251  ARG C CZ    1 
ATOM   5163  N  NH1   . ARG C 2  251  ? 35.500  -25.029 -53.315  1.00 123.40 ? 251  ARG C NH1   1 
ATOM   5164  N  NH2   . ARG C 2  251  ? 35.987  -24.374 -51.172  1.00 126.98 ? 251  ARG C NH2   1 
ATOM   5165  N  N     . PHE C 2  252  ? 34.303  -32.134 -52.334  1.00 164.14 ? 252  PHE C N     1 
ATOM   5166  C  CA    . PHE C 2  252  ? 33.712  -32.742 -51.145  1.00 165.93 ? 252  PHE C CA    1 
ATOM   5167  C  C     . PHE C 2  252  ? 33.947  -34.254 -51.101  1.00 157.14 ? 252  PHE C C     1 
ATOM   5168  O  O     . PHE C 2  252  ? 33.176  -34.993 -50.490  1.00 151.42 ? 252  PHE C O     1 
ATOM   5169  C  CB    . PHE C 2  252  ? 32.207  -32.443 -51.087  1.00 171.26 ? 252  PHE C CB    1 
ATOM   5170  C  CG    . PHE C 2  252  ? 31.869  -30.968 -51.090  1.00 175.32 ? 252  PHE C CG    1 
ATOM   5171  C  CD1   . PHE C 2  252  ? 31.853  -30.240 -49.908  1.00 166.30 ? 252  PHE C CD1   1 
ATOM   5172  C  CD2   . PHE C 2  252  ? 31.549  -30.316 -52.272  1.00 178.35 ? 252  PHE C CD2   1 
ATOM   5173  C  CE1   . PHE C 2  252  ? 31.537  -28.888 -49.909  1.00 155.62 ? 252  PHE C CE1   1 
ATOM   5174  C  CE2   . PHE C 2  252  ? 31.232  -28.965 -52.276  1.00 171.21 ? 252  PHE C CE2   1 
ATOM   5175  C  CZ    . PHE C 2  252  ? 31.225  -28.252 -51.093  1.00 153.86 ? 252  PHE C CZ    1 
ATOM   5176  N  N     . GLY C 2  253  ? 35.017  -34.710 -51.742  1.00 155.21 ? 253  GLY C N     1 
ATOM   5177  C  CA    . GLY C 2  253  ? 35.294  -36.132 -51.829  1.00 157.53 ? 253  GLY C CA    1 
ATOM   5178  C  C     . GLY C 2  253  ? 35.947  -36.741 -50.602  1.00 161.14 ? 253  GLY C C     1 
ATOM   5179  O  O     . GLY C 2  253  ? 35.903  -37.958 -50.413  1.00 165.08 ? 253  GLY C O     1 
ATOM   5180  N  N     . PHE C 2  254  ? 36.544  -35.899 -49.762  1.00 159.14 ? 254  PHE C N     1 
ATOM   5181  C  CA    . PHE C 2  254  ? 37.303  -36.376 -48.608  1.00 154.41 ? 254  PHE C CA    1 
ATOM   5182  C  C     . PHE C 2  254  ? 36.409  -36.921 -47.490  1.00 150.04 ? 254  PHE C C     1 
ATOM   5183  O  O     . PHE C 2  254  ? 36.903  -37.383 -46.461  1.00 143.20 ? 254  PHE C O     1 
ATOM   5184  C  CB    . PHE C 2  254  ? 38.208  -35.261 -48.064  1.00 150.35 ? 254  PHE C CB    1 
ATOM   5185  C  CG    . PHE C 2  254  ? 37.478  -33.998 -47.691  1.00 144.25 ? 254  PHE C CG    1 
ATOM   5186  C  CD1   . PHE C 2  254  ? 37.329  -32.969 -48.608  1.00 140.84 ? 254  PHE C CD1   1 
ATOM   5187  C  CD2   . PHE C 2  254  ? 36.958  -33.832 -46.418  1.00 145.76 ? 254  PHE C CD2   1 
ATOM   5188  C  CE1   . PHE C 2  254  ? 36.666  -31.804 -48.264  1.00 145.95 ? 254  PHE C CE1   1 
ATOM   5189  C  CE2   . PHE C 2  254  ? 36.293  -32.671 -46.070  1.00 145.00 ? 254  PHE C CE2   1 
ATOM   5190  C  CZ    . PHE C 2  254  ? 36.147  -31.656 -46.994  1.00 146.73 ? 254  PHE C CZ    1 
ATOM   5191  N  N     . SER C 2  255  ? 35.098  -36.873 -47.697  1.00 149.75 ? 255  SER C N     1 
ATOM   5192  C  CA    . SER C 2  255  ? 34.162  -37.448 -46.742  1.00 146.32 ? 255  SER C CA    1 
ATOM   5193  C  C     . SER C 2  255  ? 33.278  -38.492 -47.410  1.00 154.57 ? 255  SER C C     1 
ATOM   5194  O  O     . SER C 2  255  ? 33.058  -38.454 -48.621  1.00 150.31 ? 255  SER C O     1 
ATOM   5195  C  CB    . SER C 2  255  ? 33.293  -36.364 -46.114  1.00 144.27 ? 255  SER C CB    1 
ATOM   5196  O  OG    . SER C 2  255  ? 32.364  -35.853 -47.055  1.00 147.37 ? 255  SER C OG    1 
ATOM   5197  N  N     . GLU C 2  256  ? 32.769  -39.419 -46.607  1.00 162.67 ? 256  GLU C N     1 
ATOM   5198  C  CA    . GLU C 2  256  ? 31.877  -40.459 -47.098  1.00 165.42 ? 256  GLU C CA    1 
ATOM   5199  C  C     . GLU C 2  256  ? 30.424  -40.006 -46.960  1.00 162.02 ? 256  GLU C C     1 
ATOM   5200  O  O     . GLU C 2  256  ? 29.504  -40.672 -47.435  1.00 158.95 ? 256  GLU C O     1 
ATOM   5201  C  CB    . GLU C 2  256  ? 32.116  -41.767 -46.336  1.00 172.68 ? 256  GLU C CB    1 
ATOM   5202  C  CG    . GLU C 2  256  ? 31.525  -43.011 -46.990  1.00 173.26 ? 256  GLU C CG    1 
ATOM   5203  C  CD    . GLU C 2  256  ? 32.172  -43.345 -48.322  1.00 176.14 ? 256  GLU C CD    1 
ATOM   5204  O  OE1   . GLU C 2  256  ? 33.301  -42.876 -48.581  1.00 179.96 ? 256  GLU C OE1   1 
ATOM   5205  O  OE2   . GLU C 2  256  ? 31.549  -44.082 -49.114  1.00 168.55 ? 256  GLU C OE2   1 
ATOM   5206  N  N     . ILE C 2  257  ? 30.229  -38.861 -46.314  1.00 156.45 ? 257  ILE C N     1 
ATOM   5207  C  CA    . ILE C 2  257  ? 28.892  -38.315 -46.108  1.00 152.42 ? 257  ILE C CA    1 
ATOM   5208  C  C     . ILE C 2  257  ? 28.466  -37.430 -47.282  1.00 155.67 ? 257  ILE C C     1 
ATOM   5209  O  O     . ILE C 2  257  ? 27.287  -37.101 -47.427  1.00 154.92 ? 257  ILE C O     1 
ATOM   5210  C  CB    . ILE C 2  257  ? 28.812  -37.506 -44.796  1.00 147.42 ? 257  ILE C CB    1 
ATOM   5211  C  CG1   . ILE C 2  257  ? 29.705  -36.267 -44.870  1.00 148.88 ? 257  ILE C CG1   1 
ATOM   5212  C  CG2   . ILE C 2  257  ? 29.196  -38.377 -43.607  1.00 140.48 ? 257  ILE C CG2   1 
ATOM   5213  C  CD1   . ILE C 2  257  ? 28.937  -34.965 -44.867  1.00 154.83 ? 257  ILE C CD1   1 
ATOM   5214  N  N     . MET C 2  258  ? 29.428  -37.051 -48.120  1.00 154.96 ? 258  MET C N     1 
ATOM   5215  C  CA    . MET C 2  258  ? 29.138  -36.282 -49.328  1.00 152.88 ? 258  MET C CA    1 
ATOM   5216  C  C     . MET C 2  258  ? 29.116  -37.196 -50.545  1.00 148.14 ? 258  MET C C     1 
ATOM   5217  O  O     . MET C 2  258  ? 28.364  -36.970 -51.496  1.00 143.32 ? 258  MET C O     1 
ATOM   5218  C  CB    . MET C 2  258  ? 30.164  -35.165 -49.524  1.00 154.09 ? 258  MET C CB    1 
ATOM   5219  C  CG    . MET C 2  258  ? 30.025  -34.004 -48.549  1.00 155.19 ? 258  MET C CG    1 
ATOM   5220  S  SD    . MET C 2  258  ? 28.457  -33.128 -48.716  1.00 156.44 ? 258  MET C SD    1 
ATOM   5221  C  CE    . MET C 2  258  ? 28.543  -32.588 -50.422  1.00 154.19 ? 258  MET C CE    1 
ATOM   5222  N  N     . ARG C 2  259  ? 29.957  -38.226 -50.511  1.00 146.88 ? 259  ARG C N     1 
ATOM   5223  C  CA    . ARG C 2  259  ? 29.939  -39.260 -51.535  1.00 147.66 ? 259  ARG C CA    1 
ATOM   5224  C  C     . ARG C 2  259  ? 28.605  -39.992 -51.501  1.00 149.71 ? 259  ARG C C     1 
ATOM   5225  O  O     . ARG C 2  259  ? 28.036  -40.321 -52.540  1.00 149.95 ? 259  ARG C O     1 
ATOM   5226  C  CB    . ARG C 2  259  ? 31.091  -40.245 -51.335  1.00 149.97 ? 259  ARG C CB    1 
ATOM   5227  C  CG    . ARG C 2  259  ? 32.463  -39.646 -51.565  1.00 148.52 ? 259  ARG C CG    1 
ATOM   5228  C  CD    . ARG C 2  259  ? 32.603  -39.140 -52.988  1.00 150.37 ? 259  ARG C CD    1 
ATOM   5229  N  NE    . ARG C 2  259  ? 33.983  -38.785 -53.297  1.00 149.56 ? 259  ARG C NE    1 
ATOM   5230  C  CZ    . ARG C 2  259  ? 34.897  -39.652 -53.716  1.00 150.70 ? 259  ARG C CZ    1 
ATOM   5231  N  NH1   . ARG C 2  259  ? 34.577  -40.929 -53.878  1.00 152.14 ? 259  ARG C NH1   1 
ATOM   5232  N  NH2   . ARG C 2  259  ? 36.132  -39.244 -53.973  1.00 152.20 ? 259  ARG C NH2   1 
ATOM   5233  N  N     . SER C 2  260  ? 28.112  -40.236 -50.291  1.00 152.83 ? 260  SER C N     1 
ATOM   5234  C  CA    . SER C 2  260  ? 26.818  -40.876 -50.101  1.00 152.11 ? 260  SER C CA    1 
ATOM   5235  C  C     . SER C 2  260  ? 25.687  -39.934 -50.493  1.00 148.98 ? 260  SER C C     1 
ATOM   5236  O  O     . SER C 2  260  ? 24.571  -40.370 -50.773  1.00 146.90 ? 260  SER C O     1 
ATOM   5237  C  CB    . SER C 2  260  ? 26.648  -41.324 -48.649  1.00 151.69 ? 260  SER C CB    1 
ATOM   5238  O  OG    . SER C 2  260  ? 25.326  -41.766 -48.400  1.00 144.50 ? 260  SER C OG    1 
ATOM   5239  N  N     . THR C 2  261  ? 25.985  -38.638 -50.510  1.00 145.72 ? 261  THR C N     1 
ATOM   5240  C  CA    . THR C 2  261  ? 24.994  -37.628 -50.855  1.00 138.39 ? 261  THR C CA    1 
ATOM   5241  C  C     . THR C 2  261  ? 24.896  -37.474 -52.370  1.00 135.88 ? 261  THR C C     1 
ATOM   5242  O  O     . THR C 2  261  ? 23.804  -37.339 -52.920  1.00 137.32 ? 261  THR C O     1 
ATOM   5243  C  CB    . THR C 2  261  ? 25.330  -36.265 -50.214  1.00 138.59 ? 261  THR C CB    1 
ATOM   5244  O  OG1   . THR C 2  261  ? 25.514  -36.428 -48.802  1.00 134.71 ? 261  THR C OG1   1 
ATOM   5245  C  CG2   . THR C 2  261  ? 24.208  -35.269 -50.458  1.00 139.42 ? 261  THR C CG2   1 
ATOM   5246  N  N     . LEU C 2  262  ? 26.044  -37.503 -53.040  1.00 136.79 ? 262  LEU C N     1 
ATOM   5247  C  CA    . LEU C 2  262  ? 26.082  -37.431 -54.496  1.00 135.50 ? 262  LEU C CA    1 
ATOM   5248  C  C     . LEU C 2  262  ? 25.571  -38.731 -55.104  1.00 136.36 ? 262  LEU C C     1 
ATOM   5249  O  O     . LEU C 2  262  ? 25.089  -38.757 -56.236  1.00 135.17 ? 262  LEU C O     1 
ATOM   5250  C  CB    . LEU C 2  262  ? 27.502  -37.138 -54.985  1.00 133.69 ? 262  LEU C CB    1 
ATOM   5251  C  CG    . LEU C 2  262  ? 27.690  -37.041 -56.501  1.00 130.87 ? 262  LEU C CG    1 
ATOM   5252  C  CD1   . LEU C 2  262  ? 26.824  -35.932 -57.071  1.00 132.62 ? 262  LEU C CD1   1 
ATOM   5253  C  CD2   . LEU C 2  262  ? 29.147  -36.822 -56.851  1.00 136.73 ? 262  LEU C CD2   1 
ATOM   5254  N  N     . GLU C 2  263  ? 25.674  -39.809 -54.334  1.00 143.33 ? 263  GLU C N     1 
ATOM   5255  C  CA    . GLU C 2  263  ? 25.226  -41.119 -54.782  1.00 155.67 ? 263  GLU C CA    1 
ATOM   5256  C  C     . GLU C 2  263  ? 23.706  -41.222 -54.712  1.00 153.93 ? 263  GLU C C     1 
ATOM   5257  O  O     . GLU C 2  263  ? 23.056  -41.578 -55.694  1.00 160.81 ? 263  GLU C O     1 
ATOM   5258  C  CB    . GLU C 2  263  ? 25.871  -42.224 -53.943  1.00 163.65 ? 263  GLU C CB    1 
ATOM   5259  C  CG    . GLU C 2  263  ? 25.829  -43.612 -54.575  1.00 172.31 ? 263  GLU C CG    1 
ATOM   5260  C  CD    . GLU C 2  263  ? 24.478  -44.292 -54.425  1.00 168.78 ? 263  GLU C CD    1 
ATOM   5261  O  OE1   . GLU C 2  263  ? 23.753  -43.978 -53.455  1.00 157.96 ? 263  GLU C OE1   1 
ATOM   5262  O  OE2   . GLU C 2  263  ? 24.137  -45.136 -55.281  1.00 172.37 ? 263  GLU C OE2   1 
ATOM   5263  N  N     . LYS C 2  264  ? 23.138  -40.898 -53.553  1.00 141.10 ? 264  LYS C N     1 
ATOM   5264  C  CA    . LYS C 2  264  ? 21.693  -40.981 -53.361  1.00 136.55 ? 264  LYS C CA    1 
ATOM   5265  C  C     . LYS C 2  264  ? 20.956  -39.864 -54.099  1.00 134.42 ? 264  LYS C C     1 
ATOM   5266  O  O     . LYS C 2  264  ? 19.749  -39.685 -53.927  1.00 130.11 ? 264  LYS C O     1 
ATOM   5267  C  CB    . LYS C 2  264  ? 21.354  -40.939 -51.873  1.00 132.73 ? 264  LYS C CB    1 
ATOM   5268  C  CG    . LYS C 2  264  ? 21.916  -42.106 -51.083  1.00 125.09 ? 264  LYS C CG    1 
ATOM   5269  C  CD    . LYS C 2  264  ? 21.759  -41.871 -49.597  1.00 131.37 ? 264  LYS C CD    1 
ATOM   5270  C  CE    . LYS C 2  264  ? 22.402  -42.977 -48.786  1.00 140.22 ? 264  LYS C CE    1 
ATOM   5271  N  NZ    . LYS C 2  264  ? 22.426  -42.631 -47.339  1.00 156.92 ? 264  LYS C NZ    1 
ATOM   5272  N  N     . ASP C 2  265  ? 21.695  -39.119 -54.917  1.00 135.04 ? 265  ASP C N     1 
ATOM   5273  C  CA    . ASP C 2  265  ? 21.140  -38.049 -55.735  1.00 134.68 ? 265  ASP C CA    1 
ATOM   5274  C  C     . ASP C 2  265  ? 20.017  -38.552 -56.632  1.00 135.87 ? 265  ASP C C     1 
ATOM   5275  O  O     . ASP C 2  265  ? 20.181  -39.532 -57.362  1.00 131.28 ? 265  ASP C O     1 
ATOM   5276  C  CB    . ASP C 2  265  ? 22.241  -37.412 -56.585  1.00 133.93 ? 265  ASP C CB    1 
ATOM   5277  C  CG    . ASP C 2  265  ? 21.694  -36.509 -57.669  1.00 125.94 ? 265  ASP C CG    1 
ATOM   5278  O  OD1   . ASP C 2  265  ? 20.799  -35.690 -57.371  1.00 123.64 ? 265  ASP C OD1   1 
ATOM   5279  O  OD2   . ASP C 2  265  ? 22.158  -36.620 -58.823  1.00 124.89 ? 265  ASP C OD2   1 
ATOM   5280  N  N     . ASN C 2  266  ? 18.877  -37.871 -56.571  1.00 139.33 ? 266  ASN C N     1 
ATOM   5281  C  CA    . ASN C 2  266  ? 17.718  -38.237 -57.373  1.00 141.04 ? 266  ASN C CA    1 
ATOM   5282  C  C     . ASN C 2  266  ? 17.993  -38.033 -58.863  1.00 142.02 ? 266  ASN C C     1 
ATOM   5283  O  O     . ASN C 2  266  ? 18.275  -38.989 -59.588  1.00 142.60 ? 266  ASN C O     1 
ATOM   5284  C  CB    . ASN C 2  266  ? 16.493  -37.425 -56.938  1.00 130.89 ? 266  ASN C CB    1 
ATOM   5285  C  CG    . ASN C 2  266  ? 15.185  -38.016 -57.439  1.00 116.35 ? 266  ASN C CG    1 
ATOM   5286  O  OD1   . ASN C 2  266  ? 15.131  -38.635 -58.501  1.00 119.61 ? 266  ASN C OD1   1 
ATOM   5287  N  ND2   . ASN C 2  266  ? 14.121  -37.824 -56.671  1.00 103.77 ? 266  ASN C ND2   1 
ATOM   5288  N  N     . THR C 2  267  ? 17.915  -36.786 -59.313  1.00 135.03 ? 267  THR C N     1 
ATOM   5289  C  CA    . THR C 2  267  ? 18.123  -36.473 -60.722  1.00 129.29 ? 267  THR C CA    1 
ATOM   5290  C  C     . THR C 2  267  ? 19.489  -35.836 -60.953  1.00 124.74 ? 267  THR C C     1 
ATOM   5291  O  O     . THR C 2  267  ? 20.057  -35.225 -60.050  1.00 122.77 ? 267  THR C O     1 
ATOM   5292  C  CB    . THR C 2  267  ? 17.022  -35.532 -61.255  1.00 127.72 ? 267  THR C CB    1 
ATOM   5293  O  OG1   . THR C 2  267  ? 17.116  -34.259 -60.603  1.00 128.30 ? 267  THR C OG1   1 
ATOM   5294  C  CG2   . THR C 2  267  ? 15.646  -36.124 -60.997  1.00 133.65 ? 267  THR C CG2   1 
ATOM   5295  N  N     . VAL C 2  268  ? 20.019  -35.994 -62.160  1.00 123.82 ? 268  VAL C N     1 
ATOM   5296  C  CA    . VAL C 2  268  ? 21.253  -35.322 -62.544  1.00 126.26 ? 268  VAL C CA    1 
ATOM   5297  C  C     . VAL C 2  268  ? 20.974  -34.464 -63.780  1.00 129.13 ? 268  VAL C C     1 
ATOM   5298  O  O     . VAL C 2  268  ? 20.124  -34.807 -64.605  1.00 122.83 ? 268  VAL C O     1 
ATOM   5299  C  CB    . VAL C 2  268  ? 22.401  -36.334 -62.811  1.00 121.72 ? 268  VAL C CB    1 
ATOM   5300  C  CG1   . VAL C 2  268  ? 22.094  -37.204 -64.020  1.00 122.11 ? 268  VAL C CG1   1 
ATOM   5301  C  CG2   . VAL C 2  268  ? 23.736  -35.618 -62.981  1.00 118.63 ? 268  VAL C CG2   1 
ATOM   5302  N  N     . GLY C 2  269  ? 21.664  -33.331 -63.887  1.00 135.29 ? 269  GLY C N     1 
ATOM   5303  C  CA    . GLY C 2  269  ? 21.451  -32.404 -64.985  1.00 135.80 ? 269  GLY C CA    1 
ATOM   5304  C  C     . GLY C 2  269  ? 21.192  -30.981 -64.520  1.00 138.93 ? 269  GLY C C     1 
ATOM   5305  O  O     . GLY C 2  269  ? 20.508  -30.757 -63.520  1.00 136.37 ? 269  GLY C O     1 
ATOM   5306  N  N     . THR C 2  270  ? 21.742  -30.015 -65.250  1.00 143.93 ? 270  THR C N     1 
ATOM   5307  C  CA    . THR C 2  270  ? 21.577  -28.606 -64.905  1.00 146.29 ? 270  THR C CA    1 
ATOM   5308  C  C     . THR C 2  270  ? 20.112  -28.185 -65.044  1.00 149.28 ? 270  THR C C     1 
ATOM   5309  O  O     . THR C 2  270  ? 19.592  -27.445 -64.209  1.00 152.16 ? 270  THR C O     1 
ATOM   5310  C  CB    . THR C 2  270  ? 22.471  -27.700 -65.780  1.00 140.39 ? 270  THR C CB    1 
ATOM   5311  O  OG1   . THR C 2  270  ? 23.827  -28.158 -65.714  1.00 131.58 ? 270  THR C OG1   1 
ATOM   5312  C  CG2   . THR C 2  270  ? 22.411  -26.258 -65.299  1.00 138.50 ? 270  THR C CG2   1 
ATOM   5313  N  N     . ASP C 2  271  ? 19.448  -28.674 -66.087  1.00 152.58 ? 271  ASP C N     1 
ATOM   5314  C  CA    . ASP C 2  271  ? 18.028  -28.397 -66.294  1.00 150.49 ? 271  ASP C CA    1 
ATOM   5315  C  C     . ASP C 2  271  ? 17.148  -29.042 -65.224  1.00 153.05 ? 271  ASP C C     1 
ATOM   5316  O  O     . ASP C 2  271  ? 16.223  -28.413 -64.711  1.00 150.31 ? 271  ASP C O     1 
ATOM   5317  C  CB    . ASP C 2  271  ? 17.578  -28.880 -67.676  1.00 145.96 ? 271  ASP C CB    1 
ATOM   5318  C  CG    . ASP C 2  271  ? 17.654  -27.794 -68.733  1.00 138.92 ? 271  ASP C CG    1 
ATOM   5319  O  OD1   . ASP C 2  271  ? 17.890  -28.130 -69.913  1.00 132.76 ? 271  ASP C OD1   1 
ATOM   5320  O  OD2   . ASP C 2  271  ? 17.476  -26.606 -68.388  1.00 135.47 ? 271  ASP C OD2   1 
ATOM   5321  N  N     . GLU C 2  272  ? 17.440  -30.296 -64.892  1.00 159.48 ? 272  GLU C N     1 
ATOM   5322  C  CA    . GLU C 2  272  ? 16.579  -31.081 -64.009  1.00 162.33 ? 272  GLU C CA    1 
ATOM   5323  C  C     . GLU C 2  272  ? 16.761  -30.721 -62.534  1.00 153.86 ? 272  GLU C C     1 
ATOM   5324  O  O     . GLU C 2  272  ? 15.997  -31.171 -61.678  1.00 148.41 ? 272  GLU C O     1 
ATOM   5325  C  CB    . GLU C 2  272  ? 16.836  -32.577 -64.214  1.00 155.04 ? 272  GLU C CB    1 
ATOM   5326  C  CG    . GLU C 2  272  ? 16.851  -33.006 -65.675  1.00 158.21 ? 272  GLU C CG    1 
ATOM   5327  C  CD    . GLU C 2  272  ? 15.573  -32.637 -66.407  1.00 169.19 ? 272  GLU C CD    1 
ATOM   5328  O  OE1   . GLU C 2  272  ? 14.487  -32.717 -65.792  1.00 171.13 ? 272  GLU C OE1   1 
ATOM   5329  O  OE2   . GLU C 2  272  ? 15.654  -32.260 -67.597  1.00 172.94 ? 272  GLU C OE2   1 
ATOM   5330  N  N     . ALA C 2  273  ? 17.778  -29.917 -62.241  1.00 147.19 ? 273  ALA C N     1 
ATOM   5331  C  CA    . ALA C 2  273  ? 18.022  -29.461 -60.877  1.00 137.40 ? 273  ALA C CA    1 
ATOM   5332  C  C     . ALA C 2  273  ? 17.297  -28.148 -60.615  1.00 139.03 ? 273  ALA C C     1 
ATOM   5333  O  O     . ALA C 2  273  ? 16.695  -27.959 -59.558  1.00 137.21 ? 273  ALA C O     1 
ATOM   5334  C  CB    . ALA C 2  273  ? 19.511  -29.305 -60.628  1.00 132.15 ? 273  ALA C CB    1 
ATOM   5335  N  N     . LEU C 2  274  ? 17.362  -27.248 -61.592  1.00 141.74 ? 274  LEU C N     1 
ATOM   5336  C  CA    . LEU C 2  274  ? 16.692  -25.956 -61.506  1.00 142.06 ? 274  LEU C CA    1 
ATOM   5337  C  C     . LEU C 2  274  ? 15.179  -26.133 -61.479  1.00 139.39 ? 274  LEU C C     1 
ATOM   5338  O  O     . LEU C 2  274  ? 14.485  -25.526 -60.661  1.00 137.47 ? 274  LEU C O     1 
ATOM   5339  C  CB    . LEU C 2  274  ? 17.098  -25.066 -62.682  1.00 148.91 ? 274  LEU C CB    1 
ATOM   5340  C  CG    . LEU C 2  274  ? 18.576  -24.686 -62.769  1.00 148.31 ? 274  LEU C CG    1 
ATOM   5341  C  CD1   . LEU C 2  274  ? 18.881  -24.026 -64.102  1.00 146.15 ? 274  LEU C CD1   1 
ATOM   5342  C  CD2   . LEU C 2  274  ? 18.951  -23.770 -61.619  1.00 149.14 ? 274  LEU C CD2   1 
ATOM   5343  N  N     . LEU C 2  275  ? 14.680  -26.969 -62.385  1.00 140.14 ? 275  LEU C N     1 
ATOM   5344  C  CA    . LEU C 2  275  ? 13.265  -27.322 -62.422  1.00 144.98 ? 275  LEU C CA    1 
ATOM   5345  C  C     . LEU C 2  275  ? 12.826  -27.952 -61.103  1.00 148.68 ? 275  LEU C C     1 
ATOM   5346  O  O     . LEU C 2  275  ? 11.703  -27.738 -60.647  1.00 150.05 ? 275  LEU C O     1 
ATOM   5347  C  CB    . LEU C 2  275  ? 12.980  -28.281 -63.581  1.00 144.61 ? 275  LEU C CB    1 
ATOM   5348  C  CG    . LEU C 2  275  ? 13.134  -27.736 -65.003  1.00 144.76 ? 275  LEU C CG    1 
ATOM   5349  C  CD1   . LEU C 2  275  ? 13.106  -28.869 -66.016  1.00 151.61 ? 275  LEU C CD1   1 
ATOM   5350  C  CD2   . LEU C 2  275  ? 12.048  -26.717 -65.307  1.00 148.35 ? 275  LEU C CD2   1 
ATOM   5351  N  N     . ASP C 2  276  ? 13.720  -28.725 -60.494  1.00 148.54 ? 276  ASP C N     1 
ATOM   5352  C  CA    . ASP C 2  276  ? 13.427  -29.396 -59.233  1.00 151.85 ? 276  ASP C CA    1 
ATOM   5353  C  C     . ASP C 2  276  ? 13.273  -28.391 -58.097  1.00 147.64 ? 276  ASP C C     1 
ATOM   5354  O  O     . ASP C 2  276  ? 12.310  -28.448 -57.335  1.00 143.80 ? 276  ASP C O     1 
ATOM   5355  C  CB    . ASP C 2  276  ? 14.525  -30.408 -58.897  1.00 149.72 ? 276  ASP C CB    1 
ATOM   5356  C  CG    . ASP C 2  276  ? 14.211  -31.222 -57.655  1.00 154.50 ? 276  ASP C CG    1 
ATOM   5357  O  OD1   . ASP C 2  276  ? 13.014  -31.425 -57.360  1.00 154.84 ? 276  ASP C OD1   1 
ATOM   5358  O  OD2   . ASP C 2  276  ? 15.161  -31.663 -56.976  1.00 161.24 ? 276  ASP C OD2   1 
ATOM   5359  N  N     . ILE C 2  277  ? 14.226  -27.471 -57.990  1.00 145.53 ? 277  ILE C N     1 
ATOM   5360  C  CA    . ILE C 2  277  ? 14.194  -26.452 -56.947  1.00 142.38 ? 277  ILE C CA    1 
ATOM   5361  C  C     . ILE C 2  277  ? 12.993  -25.526 -57.119  1.00 140.60 ? 277  ILE C C     1 
ATOM   5362  O  O     . ILE C 2  277  ? 12.330  -25.160 -56.147  1.00 141.23 ? 277  ILE C O     1 
ATOM   5363  C  CB    . ILE C 2  277  ? 15.492  -25.619 -56.941  1.00 137.90 ? 277  ILE C CB    1 
ATOM   5364  C  CG1   . ILE C 2  277  ? 16.695  -26.525 -56.676  1.00 144.11 ? 277  ILE C CG1   1 
ATOM   5365  C  CG2   . ILE C 2  277  ? 15.419  -24.513 -55.898  1.00 136.79 ? 277  ILE C CG2   1 
ATOM   5366  C  CD1   . ILE C 2  277  ? 18.005  -25.783 -56.553  1.00 149.51 ? 277  ILE C CD1   1 
ATOM   5367  N  N     . TYR C 2  278  ? 12.709  -25.163 -58.365  1.00 140.31 ? 278  TYR C N     1 
ATOM   5368  C  CA    . TYR C 2  278  ? 11.582  -24.293 -58.676  1.00 139.56 ? 278  TYR C CA    1 
ATOM   5369  C  C     . TYR C 2  278  ? 10.252  -24.936 -58.280  1.00 140.38 ? 278  TYR C C     1 
ATOM   5370  O  O     . TYR C 2  278  ? 9.347   -24.258 -57.793  1.00 141.76 ? 278  TYR C O     1 
ATOM   5371  C  CB    . TYR C 2  278  ? 11.578  -23.946 -60.167  1.00 137.41 ? 278  TYR C CB    1 
ATOM   5372  C  CG    . TYR C 2  278  ? 10.476  -22.997 -60.578  1.00 136.89 ? 278  TYR C CG    1 
ATOM   5373  C  CD1   . TYR C 2  278  ? 10.682  -21.627 -60.592  1.00 135.96 ? 278  TYR C CD1   1 
ATOM   5374  C  CD2   . TYR C 2  278  ? 9.230   -23.475 -60.957  1.00 141.39 ? 278  TYR C CD2   1 
ATOM   5375  C  CE1   . TYR C 2  278  ? 9.675   -20.760 -60.968  1.00 139.45 ? 278  TYR C CE1   1 
ATOM   5376  C  CE2   . TYR C 2  278  ? 8.220   -22.617 -61.330  1.00 140.44 ? 278  TYR C CE2   1 
ATOM   5377  C  CZ    . TYR C 2  278  ? 8.447   -21.261 -61.336  1.00 138.47 ? 278  TYR C CZ    1 
ATOM   5378  O  OH    . TYR C 2  278  ? 7.441   -20.402 -61.712  1.00 140.94 ? 278  TYR C OH    1 
ATOM   5379  N  N     . ARG C 2  279  ? 10.145  -26.245 -58.489  1.00 139.30 ? 279  ARG C N     1 
ATOM   5380  C  CA    . ARG C 2  279  ? 8.913   -26.981 -58.212  1.00 143.89 ? 279  ARG C CA    1 
ATOM   5381  C  C     . ARG C 2  279  ? 8.641   -27.156 -56.718  1.00 148.58 ? 279  ARG C C     1 
ATOM   5382  O  O     . ARG C 2  279  ? 7.534   -27.524 -56.322  1.00 154.26 ? 279  ARG C O     1 
ATOM   5383  C  CB    . ARG C 2  279  ? 8.958   -28.357 -58.885  1.00 144.64 ? 279  ARG C CB    1 
ATOM   5384  C  CG    . ARG C 2  279  ? 8.578   -28.359 -60.359  1.00 145.81 ? 279  ARG C CG    1 
ATOM   5385  C  CD    . ARG C 2  279  ? 8.864   -29.711 -61.000  1.00 148.95 ? 279  ARG C CD    1 
ATOM   5386  N  NE    . ARG C 2  279  ? 10.292  -29.925 -61.226  1.00 153.55 ? 279  ARG C NE    1 
ATOM   5387  C  CZ    . ARG C 2  279  ? 10.813  -31.028 -61.756  1.00 158.73 ? 279  ARG C CZ    1 
ATOM   5388  N  NH1   . ARG C 2  279  ? 10.025  -32.031 -62.117  1.00 168.13 ? 279  ARG C NH1   1 
ATOM   5389  N  NH2   . ARG C 2  279  ? 12.125  -31.129 -61.923  1.00 158.43 ? 279  ARG C NH2   1 
ATOM   5390  N  N     . LYS C 2  280  ? 9.650   -26.896 -55.892  1.00 144.80 ? 280  LYS C N     1 
ATOM   5391  C  CA    . LYS C 2  280  ? 9.521   -27.072 -54.448  1.00 145.71 ? 280  LYS C CA    1 
ATOM   5392  C  C     . LYS C 2  280  ? 9.462   -25.727 -53.729  1.00 138.94 ? 280  LYS C C     1 
ATOM   5393  O  O     . LYS C 2  280  ? 9.031   -25.642 -52.578  1.00 133.80 ? 280  LYS C O     1 
ATOM   5394  C  CB    . LYS C 2  280  ? 10.685  -27.906 -53.910  1.00 140.94 ? 280  LYS C CB    1 
ATOM   5395  C  CG    . LYS C 2  280  ? 10.872  -29.241 -54.620  1.00 138.78 ? 280  LYS C CG    1 
ATOM   5396  C  CD    . LYS C 2  280  ? 9.985   -30.333 -54.040  1.00 130.64 ? 280  LYS C CD    1 
ATOM   5397  C  CE    . LYS C 2  280  ? 10.274  -31.674 -54.697  1.00 104.78 ? 280  LYS C CE    1 
ATOM   5398  N  NZ    . LYS C 2  280  ? 9.587   -32.793 -54.004  1.00 87.96  ? 280  LYS C NZ    1 
ATOM   5399  N  N     . LEU C 2  281  ? 9.900   -24.677 -54.415  1.00 138.52 ? 281  LEU C N     1 
ATOM   5400  C  CA    . LEU C 2  281  ? 9.907   -23.339 -53.839  1.00 139.81 ? 281  LEU C CA    1 
ATOM   5401  C  C     . LEU C 2  281  ? 8.576   -22.637 -54.089  1.00 144.16 ? 281  LEU C C     1 
ATOM   5402  O  O     . LEU C 2  281  ? 7.965   -22.098 -53.164  1.00 146.22 ? 281  LEU C O     1 
ATOM   5403  C  CB    . LEU C 2  281  ? 11.061  -22.512 -54.417  1.00 144.91 ? 281  LEU C CB    1 
ATOM   5404  C  CG    . LEU C 2  281  ? 11.695  -21.419 -53.548  1.00 152.00 ? 281  LEU C CG    1 
ATOM   5405  C  CD1   . LEU C 2  281  ? 12.990  -20.936 -54.183  1.00 157.62 ? 281  LEU C CD1   1 
ATOM   5406  C  CD2   . LEU C 2  281  ? 10.751  -20.244 -53.308  1.00 152.05 ? 281  LEU C CD2   1 
ATOM   5407  N  N     . ARG C 2  282  ? 8.134   -22.641 -55.343  1.00 146.36 ? 282  ARG C N     1 
ATOM   5408  C  CA    . ARG C 2  282  ? 6.909   -21.943 -55.724  1.00 144.30 ? 282  ARG C CA    1 
ATOM   5409  C  C     . ARG C 2  282  ? 6.006   -22.776 -56.628  1.00 138.34 ? 282  ARG C C     1 
ATOM   5410  O  O     . ARG C 2  282  ? 5.980   -22.572 -57.841  1.00 134.60 ? 282  ARG C O     1 
ATOM   5411  C  CB    . ARG C 2  282  ? 7.248   -20.627 -56.422  1.00 135.20 ? 282  ARG C CB    1 
ATOM   5412  C  CG    . ARG C 2  282  ? 7.929   -19.610 -55.530  1.00 131.39 ? 282  ARG C CG    1 
ATOM   5413  C  CD    . ARG C 2  282  ? 8.463   -18.443 -56.336  1.00 124.00 ? 282  ARG C CD    1 
ATOM   5414  N  NE    . ARG C 2  282  ? 9.112   -17.456 -55.480  1.00 122.24 ? 282  ARG C NE    1 
ATOM   5415  C  CZ    . ARG C 2  282  ? 8.531   -16.340 -55.055  1.00 118.43 ? 282  ARG C CZ    1 
ATOM   5416  N  NH1   . ARG C 2  282  ? 7.286   -16.061 -55.416  1.00 121.89 ? 282  ARG C NH1   1 
ATOM   5417  N  NH2   . ARG C 2  282  ? 9.196   -15.500 -54.273  1.00 113.57 ? 282  ARG C NH2   1 
ATOM   5418  N  N     . PRO C 2  283  ? 5.259   -23.720 -56.036  1.00 142.77 ? 283  PRO C N     1 
ATOM   5419  C  CA    . PRO C 2  283  ? 4.252   -24.473 -56.790  1.00 153.34 ? 283  PRO C CA    1 
ATOM   5420  C  C     . PRO C 2  283  ? 3.086   -23.576 -57.204  1.00 154.43 ? 283  PRO C C     1 
ATOM   5421  O  O     . PRO C 2  283  ? 2.819   -22.572 -56.542  1.00 151.76 ? 283  PRO C O     1 
ATOM   5422  C  CB    . PRO C 2  283  ? 3.796   -25.550 -55.795  1.00 158.38 ? 283  PRO C CB    1 
ATOM   5423  C  CG    . PRO C 2  283  ? 4.889   -25.618 -54.766  1.00 149.14 ? 283  PRO C CG    1 
ATOM   5424  C  CD    . PRO C 2  283  ? 5.402   -24.221 -54.659  1.00 148.20 ? 283  PRO C CD    1 
ATOM   5425  N  N     . GLY C 2  284  ? 2.405   -23.935 -58.287  1.00 154.35 ? 284  GLY C N     1 
ATOM   5426  C  CA    . GLY C 2  284  ? 1.289   -23.146 -58.778  1.00 148.93 ? 284  GLY C CA    1 
ATOM   5427  C  C     . GLY C 2  284  ? 1.704   -22.180 -59.869  1.00 139.96 ? 284  GLY C C     1 
ATOM   5428  O  O     . GLY C 2  284  ? 0.924   -21.322 -60.284  1.00 129.11 ? 284  GLY C O     1 
ATOM   5429  N  N     . GLU C 2  285  ? 2.944   -22.318 -60.330  1.00 142.22 ? 285  GLU C N     1 
ATOM   5430  C  CA    . GLU C 2  285  ? 3.495   -21.442 -61.360  1.00 136.35 ? 285  GLU C CA    1 
ATOM   5431  C  C     . GLU C 2  285  ? 4.252   -22.253 -62.410  1.00 132.81 ? 285  GLU C C     1 
ATOM   5432  O  O     . GLU C 2  285  ? 4.953   -23.205 -62.069  1.00 140.90 ? 285  GLU C O     1 
ATOM   5433  C  CB    . GLU C 2  285  ? 4.419   -20.396 -60.729  1.00 137.12 ? 285  GLU C CB    1 
ATOM   5434  C  CG    . GLU C 2  285  ? 3.792   -19.613 -59.584  1.00 136.31 ? 285  GLU C CG    1 
ATOM   5435  C  CD    . GLU C 2  285  ? 4.797   -19.245 -58.511  1.00 134.48 ? 285  GLU C CD    1 
ATOM   5436  O  OE1   . GLU C 2  285  ? 5.961   -18.953 -58.857  1.00 135.79 ? 285  GLU C OE1   1 
ATOM   5437  O  OE2   . GLU C 2  285  ? 4.423   -19.259 -57.318  1.00 131.37 ? 285  GLU C OE2   1 
ATOM   5438  N  N     . PRO C 2  286  ? 4.112   -21.877 -63.692  1.00 128.56 ? 286  PRO C N     1 
ATOM   5439  C  CA    . PRO C 2  286  ? 4.781   -22.584 -64.792  1.00 132.25 ? 286  PRO C CA    1 
ATOM   5440  C  C     . PRO C 2  286  ? 6.307   -22.502 -64.711  1.00 140.41 ? 286  PRO C C     1 
ATOM   5441  O  O     . PRO C 2  286  ? 6.856   -21.406 -64.595  1.00 131.77 ? 286  PRO C O     1 
ATOM   5442  C  CB    . PRO C 2  286  ? 4.256   -21.865 -66.040  1.00 126.55 ? 286  PRO C CB    1 
ATOM   5443  C  CG    . PRO C 2  286  ? 3.826   -20.522 -65.554  1.00 120.12 ? 286  PRO C CG    1 
ATOM   5444  C  CD    . PRO C 2  286  ? 3.292   -20.755 -64.178  1.00 125.45 ? 286  PRO C CD    1 
ATOM   5445  N  N     . PRO C 2  287  ? 6.985   -23.660 -64.770  1.00 156.18 ? 287  PRO C N     1 
ATOM   5446  C  CA    . PRO C 2  287  ? 8.443   -23.773 -64.644  1.00 150.71 ? 287  PRO C CA    1 
ATOM   5447  C  C     . PRO C 2  287  ? 9.205   -23.692 -65.968  1.00 142.91 ? 287  PRO C C     1 
ATOM   5448  O  O     . PRO C 2  287  ? 9.440   -24.718 -66.604  1.00 144.94 ? 287  PRO C O     1 
ATOM   5449  C  CB    . PRO C 2  287  ? 8.620   -25.155 -64.011  1.00 157.65 ? 287  PRO C CB    1 
ATOM   5450  C  CG    . PRO C 2  287  ? 7.475   -25.951 -64.556  1.00 155.49 ? 287  PRO C CG    1 
ATOM   5451  C  CD    . PRO C 2  287  ? 6.334   -24.983 -64.784  1.00 158.49 ? 287  PRO C CD    1 
ATOM   5452  N  N     . THR C 2  288  ? 9.589   -22.487 -66.374  1.00 140.30 ? 288  THR C N     1 
ATOM   5453  C  CA    . THR C 2  288  ? 10.430  -22.315 -67.554  1.00 139.78 ? 288  THR C CA    1 
ATOM   5454  C  C     . THR C 2  288  ? 11.875  -22.651 -67.195  1.00 151.64 ? 288  THR C C     1 
ATOM   5455  O  O     . THR C 2  288  ? 12.256  -22.585 -66.027  1.00 161.25 ? 288  THR C O     1 
ATOM   5456  C  CB    . THR C 2  288  ? 10.358  -20.872 -68.106  1.00 134.62 ? 288  THR C CB    1 
ATOM   5457  O  OG1   . THR C 2  288  ? 9.008   -20.395 -68.048  1.00 135.17 ? 288  THR C OG1   1 
ATOM   5458  C  CG2   . THR C 2  288  ? 10.857  -20.809 -69.545  1.00 132.36 ? 288  THR C CG2   1 
ATOM   5459  N  N     . LYS C 2  289  ? 12.680  -23.013 -68.191  1.00 151.78 ? 289  LYS C N     1 
ATOM   5460  C  CA    . LYS C 2  289  ? 14.112  -23.185 -67.973  1.00 146.15 ? 289  LYS C CA    1 
ATOM   5461  C  C     . LYS C 2  289  ? 14.747  -21.828 -67.680  1.00 134.46 ? 289  LYS C C     1 
ATOM   5462  O  O     . LYS C 2  289  ? 15.874  -21.746 -67.192  1.00 131.85 ? 289  LYS C O     1 
ATOM   5463  C  CB    . LYS C 2  289  ? 14.784  -23.839 -69.185  1.00 143.78 ? 289  LYS C CB    1 
ATOM   5464  C  CG    . LYS C 2  289  ? 14.330  -25.263 -69.482  1.00 145.79 ? 289  LYS C CG    1 
ATOM   5465  C  CD    . LYS C 2  289  ? 15.221  -25.912 -70.536  1.00 145.00 ? 289  LYS C CD    1 
ATOM   5466  C  CE    . LYS C 2  289  ? 14.780  -27.334 -70.867  1.00 138.63 ? 289  LYS C CE    1 
ATOM   5467  N  NZ    . LYS C 2  289  ? 13.561  -27.367 -71.728  1.00 134.09 ? 289  LYS C NZ    1 
ATOM   5468  N  N     . GLU C 2  290  ? 14.004  -20.765 -67.978  1.00 133.02 ? 290  GLU C N     1 
ATOM   5469  C  CA    . GLU C 2  290  ? 14.478  -19.400 -67.794  1.00 131.54 ? 290  GLU C CA    1 
ATOM   5470  C  C     . GLU C 2  290  ? 13.870  -18.735 -66.559  1.00 135.74 ? 290  GLU C C     1 
ATOM   5471  O  O     . GLU C 2  290  ? 14.326  -17.675 -66.129  1.00 133.83 ? 290  GLU C O     1 
ATOM   5472  C  CB    . GLU C 2  290  ? 14.167  -18.571 -69.040  1.00 130.03 ? 290  GLU C CB    1 
ATOM   5473  C  CG    . GLU C 2  290  ? 14.792  -19.130 -70.303  1.00 128.39 ? 290  GLU C CG    1 
ATOM   5474  C  CD    . GLU C 2  290  ? 16.302  -19.203 -70.211  1.00 122.86 ? 290  GLU C CD    1 
ATOM   5475  O  OE1   . GLU C 2  290  ? 16.908  -18.264 -69.652  1.00 125.30 ? 290  GLU C OE1   1 
ATOM   5476  O  OE2   . GLU C 2  290  ? 16.885  -20.198 -70.690  1.00 120.17 ? 290  GLU C OE2   1 
ATOM   5477  N  N     . SER C 2  291  ? 12.843  -19.362 -65.993  1.00 144.49 ? 291  SER C N     1 
ATOM   5478  C  CA    . SER C 2  291  ? 12.190  -18.836 -64.799  1.00 144.18 ? 291  SER C CA    1 
ATOM   5479  C  C     . SER C 2  291  ? 12.737  -19.497 -63.537  1.00 146.75 ? 291  SER C C     1 
ATOM   5480  O  O     . SER C 2  291  ? 12.532  -19.004 -62.428  1.00 148.73 ? 291  SER C O     1 
ATOM   5481  C  CB    . SER C 2  291  ? 10.674  -19.036 -64.881  1.00 146.72 ? 291  SER C CB    1 
ATOM   5482  O  OG    . SER C 2  291  ? 10.337  -20.414 -64.851  1.00 145.87 ? 291  SER C OG    1 
ATOM   5483  N  N     . ALA C 2  292  ? 13.427  -20.620 -63.710  1.00 150.99 ? 292  ALA C N     1 
ATOM   5484  C  CA    . ALA C 2  292  ? 14.037  -21.319 -62.585  1.00 144.79 ? 292  ALA C CA    1 
ATOM   5485  C  C     . ALA C 2  292  ? 15.482  -20.871 -62.402  1.00 140.38 ? 292  ALA C C     1 
ATOM   5486  O  O     . ALA C 2  292  ? 16.046  -20.981 -61.315  1.00 137.30 ? 292  ALA C O     1 
ATOM   5487  C  CB    . ALA C 2  292  ? 13.964  -22.822 -62.789  1.00 149.55 ? 292  ALA C CB    1 
ATOM   5488  N  N     . GLN C 2  293  ? 16.075  -20.367 -63.479  1.00 138.86 ? 293  GLN C N     1 
ATOM   5489  C  CA    . GLN C 2  293  ? 17.430  -19.831 -63.444  1.00 139.05 ? 293  GLN C CA    1 
ATOM   5490  C  C     . GLN C 2  293  ? 17.434  -18.422 -62.861  1.00 137.88 ? 293  GLN C C     1 
ATOM   5491  O  O     . GLN C 2  293  ? 18.407  -17.993 -62.241  1.00 133.95 ? 293  GLN C O     1 
ATOM   5492  C  CB    . GLN C 2  293  ? 18.034  -19.821 -64.851  1.00 147.63 ? 293  GLN C CB    1 
ATOM   5493  C  CG    . GLN C 2  293  ? 19.407  -19.166 -64.954  1.00 152.03 ? 293  GLN C CG    1 
ATOM   5494  C  CD    . GLN C 2  293  ? 20.534  -20.091 -64.536  1.00 154.10 ? 293  GLN C CD    1 
ATOM   5495  O  OE1   . GLN C 2  293  ? 20.459  -21.304 -64.727  1.00 158.64 ? 293  GLN C OE1   1 
ATOM   5496  N  NE2   . GLN C 2  293  ? 21.588  -19.520 -63.961  1.00 151.62 ? 293  GLN C NE2   1 
ATOM   5497  N  N     . THR C 2  294  ? 16.327  -17.715 -63.056  1.00 141.24 ? 294  THR C N     1 
ATOM   5498  C  CA    . THR C 2  294  ? 16.238  -16.298 -62.720  1.00 143.25 ? 294  THR C CA    1 
ATOM   5499  C  C     . THR C 2  294  ? 16.112  -16.034 -61.217  1.00 147.04 ? 294  THR C C     1 
ATOM   5500  O  O     . THR C 2  294  ? 16.853  -15.219 -60.662  1.00 145.12 ? 294  THR C O     1 
ATOM   5501  C  CB    . THR C 2  294  ? 15.047  -15.641 -63.444  1.00 143.89 ? 294  THR C CB    1 
ATOM   5502  O  OG1   . THR C 2  294  ? 15.158  -15.877 -64.853  1.00 132.07 ? 294  THR C OG1   1 
ATOM   5503  C  CG2   . THR C 2  294  ? 15.020  -14.143 -63.185  1.00 151.04 ? 294  THR C CG2   1 
ATOM   5504  N  N     . LEU C 2  295  ? 15.180  -16.722 -60.560  1.00 153.94 ? 295  LEU C N     1 
ATOM   5505  C  CA    . LEU C 2  295  ? 14.900  -16.458 -59.149  1.00 153.61 ? 295  LEU C CA    1 
ATOM   5506  C  C     . LEU C 2  295  ? 16.000  -16.978 -58.225  1.00 147.03 ? 295  LEU C C     1 
ATOM   5507  O  O     . LEU C 2  295  ? 16.127  -16.523 -57.087  1.00 140.91 ? 295  LEU C O     1 
ATOM   5508  C  CB    . LEU C 2  295  ? 13.543  -17.054 -58.741  1.00 163.54 ? 295  LEU C CB    1 
ATOM   5509  C  CG    . LEU C 2  295  ? 13.223  -18.553 -58.830  1.00 162.07 ? 295  LEU C CG    1 
ATOM   5510  C  CD1   . LEU C 2  295  ? 13.749  -19.332 -57.630  1.00 160.57 ? 295  LEU C CD1   1 
ATOM   5511  C  CD2   . LEU C 2  295  ? 11.721  -18.733 -58.954  1.00 162.25 ? 295  LEU C CD2   1 
ATOM   5512  N  N     . LEU C 2  296  ? 16.789  -17.934 -58.708  1.00 145.53 ? 296  LEU C N     1 
ATOM   5513  C  CA    . LEU C 2  296  ? 17.911  -18.442 -57.930  1.00 141.35 ? 296  LEU C CA    1 
ATOM   5514  C  C     . LEU C 2  296  ? 18.975  -17.358 -57.783  1.00 133.57 ? 296  LEU C C     1 
ATOM   5515  O  O     . LEU C 2  296  ? 19.645  -17.268 -56.756  1.00 127.19 ? 296  LEU C O     1 
ATOM   5516  C  CB    . LEU C 2  296  ? 18.504  -19.697 -58.576  1.00 138.26 ? 296  LEU C CB    1 
ATOM   5517  C  CG    . LEU C 2  296  ? 18.164  -21.033 -57.905  1.00 142.30 ? 296  LEU C CG    1 
ATOM   5518  C  CD1   . LEU C 2  296  ? 16.715  -21.434 -58.151  1.00 151.12 ? 296  LEU C CD1   1 
ATOM   5519  C  CD2   . LEU C 2  296  ? 19.113  -22.127 -58.364  1.00 144.57 ? 296  LEU C CD2   1 
ATOM   5520  N  N     . GLU C 2  297  ? 19.118  -16.531 -58.814  1.00 133.45 ? 297  GLU C N     1 
ATOM   5521  C  CA    . GLU C 2  297  ? 20.036  -15.401 -58.758  1.00 129.06 ? 297  GLU C CA    1 
ATOM   5522  C  C     . GLU C 2  297  ? 19.499  -14.308 -57.843  1.00 127.23 ? 297  GLU C C     1 
ATOM   5523  O  O     . GLU C 2  297  ? 20.236  -13.741 -57.042  1.00 129.24 ? 297  GLU C O     1 
ATOM   5524  C  CB    . GLU C 2  297  ? 20.281  -14.824 -60.153  1.00 137.97 ? 297  GLU C CB    1 
ATOM   5525  C  CG    . GLU C 2  297  ? 20.895  -15.791 -61.149  1.00 142.35 ? 297  GLU C CG    1 
ATOM   5526  C  CD    . GLU C 2  297  ? 21.252  -15.112 -62.457  1.00 147.50 ? 297  GLU C CD    1 
ATOM   5527  O  OE1   . GLU C 2  297  ? 21.252  -13.863 -62.496  1.00 151.67 ? 297  GLU C OE1   1 
ATOM   5528  O  OE2   . GLU C 2  297  ? 21.531  -15.825 -63.445  1.00 142.69 ? 297  GLU C OE2   1 
ATOM   5529  N  N     . ASN C 2  298  ? 18.209  -14.015 -57.966  1.00 125.41 ? 298  ASN C N     1 
ATOM   5530  C  CA    . ASN C 2  298  ? 17.615  -12.906 -57.230  1.00 126.93 ? 298  ASN C CA    1 
ATOM   5531  C  C     . ASN C 2  298  ? 17.452  -13.172 -55.734  1.00 127.07 ? 298  ASN C C     1 
ATOM   5532  O  O     . ASN C 2  298  ? 17.551  -12.250 -54.927  1.00 131.05 ? 298  ASN C O     1 
ATOM   5533  C  CB    . ASN C 2  298  ? 16.258  -12.540 -57.836  1.00 122.28 ? 298  ASN C CB    1 
ATOM   5534  C  CG    . ASN C 2  298  ? 16.376  -12.011 -59.253  1.00 120.31 ? 298  ASN C CG    1 
ATOM   5535  O  OD1   . ASN C 2  298  ? 17.422  -11.497 -59.653  1.00 120.18 ? 298  ASN C OD1   1 
ATOM   5536  N  ND2   . ASN C 2  298  ? 15.299  -12.133 -60.020  1.00 120.81 ? 298  ASN C ND2   1 
ATOM   5537  N  N     . LEU C 2  299  ? 17.209  -14.425 -55.361  1.00 121.26 ? 299  LEU C N     1 
ATOM   5538  C  CA    . LEU C 2  299  ? 16.918  -14.743 -53.965  1.00 114.96 ? 299  LEU C CA    1 
ATOM   5539  C  C     . LEU C 2  299  ? 18.146  -14.719 -53.058  1.00 115.45 ? 299  LEU C C     1 
ATOM   5540  O  O     . LEU C 2  299  ? 18.008  -14.629 -51.838  1.00 110.53 ? 299  LEU C O     1 
ATOM   5541  C  CB    . LEU C 2  299  ? 16.238  -16.110 -53.857  1.00 114.98 ? 299  LEU C CB    1 
ATOM   5542  C  CG    . LEU C 2  299  ? 14.715  -16.120 -54.006  1.00 124.41 ? 299  LEU C CG    1 
ATOM   5543  C  CD1   . LEU C 2  299  ? 14.149  -17.493 -53.678  1.00 133.69 ? 299  LEU C CD1   1 
ATOM   5544  C  CD2   . LEU C 2  299  ? 14.084  -15.052 -53.127  1.00 120.59 ? 299  LEU C CD2   1 
ATOM   5545  N  N     . PHE C 2  300  ? 19.341  -14.800 -53.638  1.00 113.17 ? 300  PHE C N     1 
ATOM   5546  C  CA    . PHE C 2  300  ? 20.551  -14.900 -52.823  1.00 112.68 ? 300  PHE C CA    1 
ATOM   5547  C  C     . PHE C 2  300  ? 21.798  -14.242 -53.426  1.00 111.82 ? 300  PHE C C     1 
ATOM   5548  O  O     . PHE C 2  300  ? 22.897  -14.412 -52.898  1.00 106.88 ? 300  PHE C O     1 
ATOM   5549  C  CB    . PHE C 2  300  ? 20.863  -16.376 -52.536  1.00 113.53 ? 300  PHE C CB    1 
ATOM   5550  C  CG    . PHE C 2  300  ? 19.809  -17.083 -51.721  1.00 117.15 ? 300  PHE C CG    1 
ATOM   5551  C  CD1   . PHE C 2  300  ? 19.763  -16.936 -50.343  1.00 114.93 ? 300  PHE C CD1   1 
ATOM   5552  C  CD2   . PHE C 2  300  ? 18.874  -17.903 -52.331  1.00 117.60 ? 300  PHE C CD2   1 
ATOM   5553  C  CE1   . PHE C 2  300  ? 18.801  -17.585 -49.590  1.00 119.04 ? 300  PHE C CE1   1 
ATOM   5554  C  CE2   . PHE C 2  300  ? 17.911  -18.557 -51.583  1.00 115.31 ? 300  PHE C CE2   1 
ATOM   5555  C  CZ    . PHE C 2  300  ? 17.875  -18.397 -50.211  1.00 118.53 ? 300  PHE C CZ    1 
ATOM   5556  N  N     . PHE C 2  301  ? 21.642  -13.496 -54.517  1.00 115.89 ? 301  PHE C N     1 
ATOM   5557  C  CA    . PHE C 2  301  ? 22.801  -12.890 -55.178  1.00 111.79 ? 301  PHE C CA    1 
ATOM   5558  C  C     . PHE C 2  301  ? 22.542  -11.484 -55.724  1.00 110.42 ? 301  PHE C C     1 
ATOM   5559  O  O     . PHE C 2  301  ? 23.381  -10.929 -56.434  1.00 102.19 ? 301  PHE C O     1 
ATOM   5560  C  CB    . PHE C 2  301  ? 23.290  -13.787 -56.320  1.00 114.85 ? 301  PHE C CB    1 
ATOM   5561  C  CG    . PHE C 2  301  ? 23.717  -15.156 -55.876  1.00 113.68 ? 301  PHE C CG    1 
ATOM   5562  C  CD1   . PHE C 2  301  ? 24.899  -15.333 -55.179  1.00 110.50 ? 301  PHE C CD1   1 
ATOM   5563  C  CD2   . PHE C 2  301  ? 22.940  -16.267 -56.163  1.00 119.83 ? 301  PHE C CD2   1 
ATOM   5564  C  CE1   . PHE C 2  301  ? 25.295  -16.590 -54.771  1.00 111.03 ? 301  PHE C CE1   1 
ATOM   5565  C  CE2   . PHE C 2  301  ? 23.333  -17.528 -55.759  1.00 127.84 ? 301  PHE C CE2   1 
ATOM   5566  C  CZ    . PHE C 2  301  ? 24.513  -17.689 -55.061  1.00 118.53 ? 301  PHE C CZ    1 
ATOM   5567  N  N     . LYS C 2  302  ? 21.391  -10.908 -55.390  1.00 118.66 ? 302  LYS C N     1 
ATOM   5568  C  CA    . LYS C 2  302  ? 21.048  -9.568  -55.861  1.00 121.23 ? 302  LYS C CA    1 
ATOM   5569  C  C     . LYS C 2  302  ? 20.820  -8.595  -54.706  1.00 117.85 ? 302  LYS C C     1 
ATOM   5570  O  O     . LYS C 2  302  ? 20.268  -8.968  -53.674  1.00 113.48 ? 302  LYS C O     1 
ATOM   5571  C  CB    . LYS C 2  302  ? 19.806  -9.618  -56.757  1.00 129.28 ? 302  LYS C CB    1 
ATOM   5572  C  CG    . LYS C 2  302  ? 20.102  -9.930  -58.218  1.00 129.02 ? 302  LYS C CG    1 
ATOM   5573  C  CD    . LYS C 2  302  ? 20.815  -8.765  -58.888  1.00 130.25 ? 302  LYS C CD    1 
ATOM   5574  C  CE    . LYS C 2  302  ? 19.949  -7.514  -58.860  1.00 135.78 ? 302  LYS C CE    1 
ATOM   5575  N  NZ    . LYS C 2  302  ? 20.657  -6.329  -59.414  1.00 145.38 ? 302  LYS C NZ    1 
ATOM   5576  N  N     . GLU C 2  303  ? 21.232  -7.343  -54.900  1.00 118.78 ? 303  GLU C N     1 
ATOM   5577  C  CA    . GLU C 2  303  ? 21.140  -6.307  -53.870  1.00 115.56 ? 303  GLU C CA    1 
ATOM   5578  C  C     . GLU C 2  303  ? 19.704  -5.935  -53.508  1.00 115.50 ? 303  GLU C C     1 
ATOM   5579  O  O     . GLU C 2  303  ? 19.471  -5.174  -52.568  1.00 117.86 ? 303  GLU C O     1 
ATOM   5580  C  CB    . GLU C 2  303  ? 21.880  -5.044  -54.322  1.00 113.36 ? 303  GLU C CB    1 
ATOM   5581  C  CG    . GLU C 2  303  ? 23.392  -5.173  -54.370  1.00 115.92 ? 303  GLU C CG    1 
ATOM   5582  C  CD    . GLU C 2  303  ? 24.074  -3.852  -54.683  1.00 122.58 ? 303  GLU C CD    1 
ATOM   5583  O  OE1   . GLU C 2  303  ? 23.411  -2.960  -55.253  1.00 127.93 ? 303  GLU C OE1   1 
ATOM   5584  O  OE2   . GLU C 2  303  ? 25.269  -3.702  -54.349  1.00 120.97 ? 303  GLU C OE2   1 
ATOM   5585  N  N     . LYS C 2  304  ? 18.747  -6.474  -54.255  1.00 116.51 ? 304  LYS C N     1 
ATOM   5586  C  CA    . LYS C 2  304  ? 17.353  -6.078  -54.113  1.00 119.32 ? 304  LYS C CA    1 
ATOM   5587  C  C     . LYS C 2  304  ? 16.568  -6.997  -53.182  1.00 109.53 ? 304  LYS C C     1 
ATOM   5588  O  O     . LYS C 2  304  ? 15.892  -6.531  -52.265  1.00 114.78 ? 304  LYS C O     1 
ATOM   5589  C  CB    . LYS C 2  304  ? 16.688  -6.030  -55.490  1.00 119.46 ? 304  LYS C CB    1 
ATOM   5590  C  CG    . LYS C 2  304  ? 17.343  -5.038  -56.439  1.00 122.47 ? 304  LYS C CG    1 
ATOM   5591  C  CD    . LYS C 2  304  ? 16.856  -5.214  -57.863  1.00 130.94 ? 304  LYS C CD    1 
ATOM   5592  C  CE    . LYS C 2  304  ? 17.600  -4.285  -58.807  1.00 134.54 ? 304  LYS C CE    1 
ATOM   5593  N  NZ    . LYS C 2  304  ? 17.210  -4.505  -60.227  1.00 145.25 ? 304  LYS C NZ    1 
ATOM   5594  N  N     . ARG C 2  305  ? 16.662  -8.300  -53.415  1.00 108.87 ? 305  ARG C N     1 
ATOM   5595  C  CA    . ARG C 2  305  ? 15.886  -9.265  -52.646  1.00 106.69 ? 305  ARG C CA    1 
ATOM   5596  C  C     . ARG C 2  305  ? 16.687  -9.837  -51.479  1.00 108.17 ? 305  ARG C C     1 
ATOM   5597  O  O     . ARG C 2  305  ? 16.118  -10.371 -50.526  1.00 113.97 ? 305  ARG C O     1 
ATOM   5598  C  CB    . ARG C 2  305  ? 15.402  -10.396 -53.557  1.00 113.45 ? 305  ARG C CB    1 
ATOM   5599  C  CG    . ARG C 2  305  ? 14.644  -9.922  -54.787  1.00 112.30 ? 305  ARG C CG    1 
ATOM   5600  C  CD    . ARG C 2  305  ? 13.142  -9.950  -54.567  1.00 108.50 ? 305  ARG C CD    1 
ATOM   5601  N  NE    . ARG C 2  305  ? 12.634  -11.316 -54.468  1.00 103.34 ? 305  ARG C NE    1 
ATOM   5602  C  CZ    . ARG C 2  305  ? 11.350  -11.630 -54.336  1.00 105.29 ? 305  ARG C CZ    1 
ATOM   5603  N  NH1   . ARG C 2  305  ? 10.432  -10.675 -54.287  1.00 105.43 ? 305  ARG C NH1   1 
ATOM   5604  N  NH2   . ARG C 2  305  ? 10.982  -12.900 -54.253  1.00 109.26 ? 305  ARG C NH2   1 
ATOM   5605  N  N     . TYR C 2  306  ? 18.008  -9.717  -51.557  1.00 109.37 ? 306  TYR C N     1 
ATOM   5606  C  CA    . TYR C 2  306  ? 18.895  -10.267 -50.537  1.00 112.02 ? 306  TYR C CA    1 
ATOM   5607  C  C     . TYR C 2  306  ? 19.983  -9.264  -50.184  1.00 109.20 ? 306  TYR C C     1 
ATOM   5608  O  O     . TYR C 2  306  ? 20.532  -8.602  -51.062  1.00 111.49 ? 306  TYR C O     1 
ATOM   5609  C  CB    . TYR C 2  306  ? 19.523  -11.577 -51.019  1.00 115.62 ? 306  TYR C CB    1 
ATOM   5610  C  CG    . TYR C 2  306  ? 20.071  -12.457 -49.916  1.00 113.79 ? 306  TYR C CG    1 
ATOM   5611  C  CD1   . TYR C 2  306  ? 21.407  -12.387 -49.534  1.00 111.40 ? 306  TYR C CD1   1 
ATOM   5612  C  CD2   . TYR C 2  306  ? 19.251  -13.368 -49.263  1.00 114.71 ? 306  TYR C CD2   1 
ATOM   5613  C  CE1   . TYR C 2  306  ? 21.906  -13.200 -48.526  1.00 113.93 ? 306  TYR C CE1   1 
ATOM   5614  C  CE2   . TYR C 2  306  ? 19.740  -14.181 -48.258  1.00 112.67 ? 306  TYR C CE2   1 
ATOM   5615  C  CZ    . TYR C 2  306  ? 21.066  -14.095 -47.892  1.00 107.03 ? 306  TYR C CZ    1 
ATOM   5616  O  OH    . TYR C 2  306  ? 21.551  -14.906 -46.890  1.00 92.77  ? 306  TYR C OH    1 
ATOM   5617  N  N     . ASP C 2  307  ? 20.299  -9.146  -48.902  1.00 104.63 ? 307  ASP C N     1 
ATOM   5618  C  CA    . ASP C 2  307  ? 21.320  -8.194  -48.498  1.00 98.57  ? 307  ASP C CA    1 
ATOM   5619  C  C     . ASP C 2  307  ? 21.987  -8.552  -47.181  1.00 90.65  ? 307  ASP C C     1 
ATOM   5620  O  O     . ASP C 2  307  ? 21.358  -8.539  -46.125  1.00 87.71  ? 307  ASP C O     1 
ATOM   5621  C  CB    . ASP C 2  307  ? 20.722  -6.790  -48.407  1.00 105.06 ? 307  ASP C CB    1 
ATOM   5622  C  CG    . ASP C 2  307  ? 21.757  -5.735  -48.061  1.00 105.44 ? 307  ASP C CG    1 
ATOM   5623  O  OD1   . ASP C 2  307  ? 22.948  -5.935  -48.380  1.00 104.11 ? 307  ASP C OD1   1 
ATOM   5624  O  OD2   . ASP C 2  307  ? 21.375  -4.703  -47.470  1.00 113.63 ? 307  ASP C OD2   1 
ATOM   5625  N  N     . LEU C 2  308  ? 23.270  -8.883  -47.265  1.00 90.35  ? 308  LEU C N     1 
ATOM   5626  C  CA    . LEU C 2  308  ? 24.123  -8.936  -46.094  1.00 88.88  ? 308  LEU C CA    1 
ATOM   5627  C  C     . LEU C 2  308  ? 24.660  -7.535  -45.855  1.00 95.43  ? 308  LEU C C     1 
ATOM   5628  O  O     . LEU C 2  308  ? 25.270  -6.945  -46.746  1.00 96.16  ? 308  LEU C O     1 
ATOM   5629  C  CB    . LEU C 2  308  ? 25.275  -9.922  -46.288  1.00 94.18  ? 308  LEU C CB    1 
ATOM   5630  C  CG    . LEU C 2  308  ? 24.949  -11.387 -46.576  1.00 100.91 ? 308  LEU C CG    1 
ATOM   5631  C  CD1   . LEU C 2  308  ? 26.225  -12.177 -46.841  1.00 94.71  ? 308  LEU C CD1   1 
ATOM   5632  C  CD2   . LEU C 2  308  ? 24.170  -11.995 -45.421  1.00 106.19 ? 308  LEU C CD2   1 
ATOM   5633  N  N     . ALA C 2  309  ? 24.435  -7.000  -44.661  1.00 97.08  ? 309  ALA C N     1 
ATOM   5634  C  CA    . ALA C 2  309  ? 24.957  -5.684  -44.316  1.00 95.26  ? 309  ALA C CA    1 
ATOM   5635  C  C     . ALA C 2  309  ? 26.481  -5.716  -44.264  1.00 89.19  ? 309  ALA C C     1 
ATOM   5636  O  O     . ALA C 2  309  ? 27.095  -6.747  -44.547  1.00 90.29  ? 309  ALA C O     1 
ATOM   5637  C  CB    . ALA C 2  309  ? 24.386  -5.216  -42.990  1.00 94.32  ? 309  ALA C CB    1 
ATOM   5638  N  N     . ARG C 2  310  ? 27.090  -4.586  -43.914  1.00 86.86  ? 310  ARG C N     1 
ATOM   5639  C  CA    . ARG C 2  310  ? 28.537  -4.536  -43.732  1.00 90.00  ? 310  ARG C CA    1 
ATOM   5640  C  C     . ARG C 2  310  ? 28.962  -5.594  -42.721  1.00 90.10  ? 310  ARG C C     1 
ATOM   5641  O  O     . ARG C 2  310  ? 29.950  -6.295  -42.923  1.00 83.28  ? 310  ARG C O     1 
ATOM   5642  C  CB    . ARG C 2  310  ? 28.989  -3.143  -43.281  1.00 88.95  ? 310  ARG C CB    1 
ATOM   5643  C  CG    . ARG C 2  310  ? 29.023  -2.114  -44.403  1.00 100.19 ? 310  ARG C CG    1 
ATOM   5644  C  CD    . ARG C 2  310  ? 29.429  -0.732  -43.904  1.00 108.59 ? 310  ARG C CD    1 
ATOM   5645  N  NE    . ARG C 2  310  ? 29.278  0.295   -44.934  1.00 117.61 ? 310  ARG C NE    1 
ATOM   5646  C  CZ    . ARG C 2  310  ? 28.112  0.817   -45.303  1.00 107.57 ? 310  ARG C CZ    1 
ATOM   5647  N  NH1   . ARG C 2  310  ? 26.989  0.401   -44.733  1.00 102.12 ? 310  ARG C NH1   1 
ATOM   5648  N  NH2   . ARG C 2  310  ? 28.067  1.749   -46.247  1.00 96.44  ? 310  ARG C NH2   1 
ATOM   5649  N  N     . VAL C 2  311  ? 28.193  -5.714  -41.643  1.00 91.64  ? 311  VAL C N     1 
ATOM   5650  C  CA    . VAL C 2  311  ? 28.410  -6.755  -40.646  1.00 88.85  ? 311  VAL C CA    1 
ATOM   5651  C  C     . VAL C 2  311  ? 27.940  -8.107  -41.182  1.00 80.67  ? 311  VAL C C     1 
ATOM   5652  O  O     . VAL C 2  311  ? 28.561  -9.137  -40.924  1.00 82.68  ? 311  VAL C O     1 
ATOM   5653  C  CB    . VAL C 2  311  ? 27.680  -6.427  -39.318  1.00 88.27  ? 311  VAL C CB    1 
ATOM   5654  C  CG1   . VAL C 2  311  ? 26.215  -6.073  -39.573  1.00 92.18  ? 311  VAL C CG1   1 
ATOM   5655  C  CG2   . VAL C 2  311  ? 27.804  -7.580  -38.330  1.00 79.44  ? 311  VAL C CG2   1 
ATOM   5656  N  N     . GLY C 2  312  ? 26.849  -8.092  -41.944  1.00 79.40  ? 312  GLY C N     1 
ATOM   5657  C  CA    . GLY C 2  312  ? 26.323  -9.295  -42.562  1.00 78.28  ? 312  GLY C CA    1 
ATOM   5658  C  C     . GLY C 2  312  ? 27.311  -9.890  -43.545  1.00 83.21  ? 312  GLY C C     1 
ATOM   5659  O  O     . GLY C 2  312  ? 27.303  -11.093 -43.803  1.00 86.48  ? 312  GLY C O     1 
ATOM   5660  N  N     . ARG C 2  313  ? 28.167  -9.038  -44.099  1.00 85.95  ? 313  ARG C N     1 
ATOM   5661  C  CA    . ARG C 2  313  ? 29.228  -9.487  -44.989  1.00 83.85  ? 313  ARG C CA    1 
ATOM   5662  C  C     . ARG C 2  313  ? 30.490  -9.807  -44.196  1.00 82.99  ? 313  ARG C C     1 
ATOM   5663  O  O     . ARG C 2  313  ? 31.127  -10.835 -44.414  1.00 83.32  ? 313  ARG C O     1 
ATOM   5664  C  CB    . ARG C 2  313  ? 29.526  -8.427  -46.048  1.00 83.83  ? 313  ARG C CB    1 
ATOM   5665  C  CG    . ARG C 2  313  ? 30.706  -8.750  -46.951  1.00 91.29  ? 313  ARG C CG    1 
ATOM   5666  C  CD    . ARG C 2  313  ? 30.353  -9.811  -47.984  1.00 94.10  ? 313  ARG C CD    1 
ATOM   5667  N  NE    . ARG C 2  313  ? 30.669  -11.158 -47.522  1.00 93.77  ? 313  ARG C NE    1 
ATOM   5668  C  CZ    . ARG C 2  313  ? 30.373  -12.270 -48.188  1.00 99.03  ? 313  ARG C CZ    1 
ATOM   5669  N  NH1   . ARG C 2  313  ? 29.742  -12.204 -49.354  1.00 106.17 ? 313  ARG C NH1   1 
ATOM   5670  N  NH2   . ARG C 2  313  ? 30.707  -13.450 -47.683  1.00 99.81  ? 313  ARG C NH2   1 
ATOM   5671  N  N     . TYR C 2  314  ? 30.832  -8.923  -43.264  1.00 82.30  ? 314  TYR C N     1 
ATOM   5672  C  CA    . TYR C 2  314  ? 32.049  -9.055  -42.471  1.00 83.36  ? 314  TYR C CA    1 
ATOM   5673  C  C     . TYR C 2  314  ? 32.042  -10.297 -41.579  1.00 84.36  ? 314  TYR C C     1 
ATOM   5674  O  O     . TYR C 2  314  ? 33.070  -10.956 -41.425  1.00 81.78  ? 314  TYR C O     1 
ATOM   5675  C  CB    . TYR C 2  314  ? 32.253  -7.795  -41.626  1.00 80.18  ? 314  TYR C CB    1 
ATOM   5676  C  CG    . TYR C 2  314  ? 33.351  -7.882  -40.592  1.00 83.31  ? 314  TYR C CG    1 
ATOM   5677  C  CD1   . TYR C 2  314  ? 34.652  -8.201  -40.954  1.00 85.22  ? 314  TYR C CD1   1 
ATOM   5678  C  CD2   . TYR C 2  314  ? 33.088  -7.615  -39.254  1.00 85.45  ? 314  TYR C CD2   1 
ATOM   5679  C  CE1   . TYR C 2  314  ? 35.657  -8.272  -40.008  1.00 88.75  ? 314  TYR C CE1   1 
ATOM   5680  C  CE2   . TYR C 2  314  ? 34.085  -7.682  -38.302  1.00 89.49  ? 314  TYR C CE2   1 
ATOM   5681  C  CZ    . TYR C 2  314  ? 35.368  -8.011  -38.684  1.00 89.92  ? 314  TYR C CZ    1 
ATOM   5682  O  OH    . TYR C 2  314  ? 36.364  -8.080  -37.737  1.00 91.06  ? 314  TYR C OH    1 
ATOM   5683  N  N     . LYS C 2  315  ? 30.885  -10.619 -41.006  1.00 86.78  ? 315  LYS C N     1 
ATOM   5684  C  CA    . LYS C 2  315  ? 30.774  -11.750 -40.086  1.00 82.00  ? 315  LYS C CA    1 
ATOM   5685  C  C     . LYS C 2  315  ? 30.962  -13.084 -40.803  1.00 83.94  ? 315  LYS C C     1 
ATOM   5686  O  O     . LYS C 2  315  ? 31.634  -13.981 -40.294  1.00 87.69  ? 315  LYS C O     1 
ATOM   5687  C  CB    . LYS C 2  315  ? 29.423  -11.732 -39.369  1.00 84.00  ? 315  LYS C CB    1 
ATOM   5688  C  CG    . LYS C 2  315  ? 29.441  -12.457 -38.040  1.00 78.00  ? 315  LYS C CG    1 
ATOM   5689  C  CD    . LYS C 2  315  ? 30.480  -11.842 -37.124  1.00 66.71  ? 315  LYS C CD    1 
ATOM   5690  C  CE    . LYS C 2  315  ? 30.763  -12.730 -35.931  1.00 63.54  ? 315  LYS C CE    1 
ATOM   5691  N  NZ    . LYS C 2  315  ? 31.692  -12.063 -34.974  1.00 55.67  ? 315  LYS C NZ    1 
ATOM   5692  N  N     . VAL C 2  316  ? 30.361  -13.210 -41.982  1.00 83.02  ? 316  VAL C N     1 
ATOM   5693  C  CA    . VAL C 2  316  ? 30.521  -14.406 -42.806  1.00 87.70  ? 316  VAL C CA    1 
ATOM   5694  C  C     . VAL C 2  316  ? 31.978  -14.577 -43.228  1.00 87.89  ? 316  VAL C C     1 
ATOM   5695  O  O     . VAL C 2  316  ? 32.508  -15.691 -43.246  1.00 91.43  ? 316  VAL C O     1 
ATOM   5696  C  CB    . VAL C 2  316  ? 29.634  -14.351 -44.068  1.00 92.89  ? 316  VAL C CB    1 
ATOM   5697  C  CG1   . VAL C 2  316  ? 29.884  -15.565 -44.959  1.00 92.34  ? 316  VAL C CG1   1 
ATOM   5698  C  CG2   . VAL C 2  316  ? 28.168  -14.259 -43.683  1.00 94.76  ? 316  VAL C CG2   1 
ATOM   5699  N  N     . ASN C 2  317  ? 32.620  -13.461 -43.558  1.00 87.43  ? 317  ASN C N     1 
ATOM   5700  C  CA    . ASN C 2  317  ? 34.002  -13.475 -44.020  1.00 83.23  ? 317  ASN C CA    1 
ATOM   5701  C  C     . ASN C 2  317  ? 34.971  -13.930 -42.941  1.00 84.03  ? 317  ASN C C     1 
ATOM   5702  O  O     . ASN C 2  317  ? 35.876  -14.715 -43.210  1.00 93.59  ? 317  ASN C O     1 
ATOM   5703  C  CB    . ASN C 2  317  ? 34.404  -12.093 -44.533  1.00 78.90  ? 317  ASN C CB    1 
ATOM   5704  C  CG    . ASN C 2  317  ? 33.723  -11.743 -45.840  1.00 89.00  ? 317  ASN C CG    1 
ATOM   5705  O  OD1   . ASN C 2  317  ? 32.746  -12.381 -46.231  1.00 89.13  ? 317  ASN C OD1   1 
ATOM   5706  N  ND2   . ASN C 2  317  ? 34.238  -10.730 -46.527  1.00 97.20  ? 317  ASN C ND2   1 
ATOM   5707  N  N     . LYS C 2  318  ? 34.778  -13.439 -41.721  1.00 81.01  ? 318  LYS C N     1 
ATOM   5708  C  CA    . LYS C 2  318  ? 35.606  -13.865 -40.600  1.00 84.66  ? 318  LYS C CA    1 
ATOM   5709  C  C     . LYS C 2  318  ? 35.457  -15.360 -40.340  1.00 83.78  ? 318  LYS C C     1 
ATOM   5710  O  O     . LYS C 2  318  ? 36.440  -16.065 -40.108  1.00 82.10  ? 318  LYS C O     1 
ATOM   5711  C  CB    . LYS C 2  318  ? 35.249  -13.088 -39.333  1.00 83.34  ? 318  LYS C CB    1 
ATOM   5712  C  CG    . LYS C 2  318  ? 35.890  -11.723 -39.220  1.00 79.75  ? 318  LYS C CG    1 
ATOM   5713  C  CD    . LYS C 2  318  ? 36.028  -11.332 -37.759  1.00 72.71  ? 318  LYS C CD    1 
ATOM   5714  C  CE    . LYS C 2  318  ? 34.713  -11.505 -37.016  1.00 69.92  ? 318  LYS C CE    1 
ATOM   5715  N  NZ    . LYS C 2  318  ? 34.866  -11.303 -35.551  1.00 64.30  ? 318  LYS C NZ    1 
ATOM   5716  N  N     . LYS C 2  319  ? 34.218  -15.835 -40.383  1.00 81.30  ? 319  LYS C N     1 
ATOM   5717  C  CA    . LYS C 2  319  ? 33.916  -17.226 -40.080  1.00 82.67  ? 319  LYS C CA    1 
ATOM   5718  C  C     . LYS C 2  319  ? 34.479  -18.165 -41.143  1.00 89.50  ? 319  LYS C C     1 
ATOM   5719  O  O     . LYS C 2  319  ? 34.828  -19.305 -40.850  1.00 100.92 ? 319  LYS C O     1 
ATOM   5720  C  CB    . LYS C 2  319  ? 32.405  -17.421 -39.944  1.00 80.29  ? 319  LYS C CB    1 
ATOM   5721  C  CG    . LYS C 2  319  ? 32.011  -18.759 -39.355  1.00 86.31  ? 319  LYS C CG    1 
ATOM   5722  C  CD    . LYS C 2  319  ? 32.733  -18.996 -38.041  1.00 86.04  ? 319  LYS C CD    1 
ATOM   5723  C  CE    . LYS C 2  319  ? 32.477  -20.393 -37.511  1.00 92.38  ? 319  LYS C CE    1 
ATOM   5724  N  NZ    . LYS C 2  319  ? 33.248  -20.663 -36.266  1.00 92.75  ? 319  LYS C NZ    1 
ATOM   5725  N  N     . LEU C 2  320  ? 34.578  -17.677 -42.376  1.00 88.36  ? 320  LEU C N     1 
ATOM   5726  C  CA    . LEU C 2  320  ? 35.074  -18.491 -43.481  1.00 96.41  ? 320  LEU C CA    1 
ATOM   5727  C  C     . LEU C 2  320  ? 36.529  -18.177 -43.813  1.00 92.61  ? 320  LEU C C     1 
ATOM   5728  O  O     . LEU C 2  320  ? 37.276  -19.052 -44.246  1.00 97.86  ? 320  LEU C O     1 
ATOM   5729  C  CB    . LEU C 2  320  ? 34.199  -18.294 -44.719  1.00 106.84 ? 320  LEU C CB    1 
ATOM   5730  C  CG    . LEU C 2  320  ? 32.765  -18.806 -44.577  1.00 106.03 ? 320  LEU C CG    1 
ATOM   5731  C  CD1   . LEU C 2  320  ? 31.958  -18.539 -45.840  1.00 102.54 ? 320  LEU C CD1   1 
ATOM   5732  C  CD2   . LEU C 2  320  ? 32.770  -20.293 -44.237  1.00 105.85 ? 320  LEU C CD2   1 
ATOM   5733  N  N     . GLY C 2  321  ? 36.922  -16.923 -43.615  1.00 90.08  ? 321  GLY C N     1 
ATOM   5734  C  CA    . GLY C 2  321  ? 38.303  -16.516 -43.805  1.00 93.91  ? 321  GLY C CA    1 
ATOM   5735  C  C     . GLY C 2  321  ? 38.718  -16.329 -45.250  1.00 99.11  ? 321  GLY C C     1 
ATOM   5736  O  O     . GLY C 2  321  ? 39.750  -16.843 -45.677  1.00 104.37 ? 321  GLY C O     1 
ATOM   5737  N  N     . LEU C 2  322  ? 37.913  -15.591 -46.004  1.00 97.08  ? 322  LEU C N     1 
ATOM   5738  C  CA    . LEU C 2  322  ? 38.247  -15.258 -47.382  1.00 94.14  ? 322  LEU C CA    1 
ATOM   5739  C  C     . LEU C 2  322  ? 38.111  -13.755 -47.593  1.00 88.92  ? 322  LEU C C     1 
ATOM   5740  O  O     . LEU C 2  322  ? 37.232  -13.123 -47.006  1.00 94.78  ? 322  LEU C O     1 
ATOM   5741  C  CB    . LEU C 2  322  ? 37.355  -16.033 -48.355  1.00 101.90 ? 322  LEU C CB    1 
ATOM   5742  C  CG    . LEU C 2  322  ? 35.886  -16.218 -47.961  1.00 105.98 ? 322  LEU C CG    1 
ATOM   5743  C  CD1   . LEU C 2  322  ? 35.020  -15.067 -48.464  1.00 110.06 ? 322  LEU C CD1   1 
ATOM   5744  C  CD2   . LEU C 2  322  ? 35.356  -17.557 -48.459  1.00 114.89 ? 322  LEU C CD2   1 
ATOM   5745  N  N     . HIS C 2  323  ? 38.992  -13.190 -48.417  1.00 85.25  ? 323  HIS C N     1 
ATOM   5746  C  CA    . HIS C 2  323  ? 39.036  -11.748 -48.648  1.00 84.89  ? 323  HIS C CA    1 
ATOM   5747  C  C     . HIS C 2  323  ? 39.268  -10.997 -47.341  1.00 88.63  ? 323  HIS C C     1 
ATOM   5748  O  O     . HIS C 2  323  ? 38.804  -9.870  -47.175  1.00 99.86  ? 323  HIS C O     1 
ATOM   5749  C  CB    . HIS C 2  323  ? 37.742  -11.255 -49.304  1.00 88.16  ? 323  HIS C CB    1 
ATOM   5750  C  CG    . HIS C 2  323  ? 37.399  -11.959 -50.580  1.00 94.63  ? 323  HIS C CG    1 
ATOM   5751  N  ND1   . HIS C 2  323  ? 37.472  -11.343 -51.810  1.00 99.47  ? 323  HIS C ND1   1 
ATOM   5752  C  CD2   . HIS C 2  323  ? 36.973  -13.222 -50.816  1.00 99.36  ? 323  HIS C CD2   1 
ATOM   5753  C  CE1   . HIS C 2  323  ? 37.108  -12.197 -52.750  1.00 105.07 ? 323  HIS C CE1   1 
ATOM   5754  N  NE2   . HIS C 2  323  ? 36.800  -13.344 -52.173  1.00 108.96 ? 323  HIS C NE2   1 
ATOM   5755  N  N     . VAL C 2  324  ? 40.001  -11.625 -46.426  1.00 87.13  ? 324  VAL C N     1 
ATOM   5756  C  CA    . VAL C 2  324  ? 40.150  -11.131 -45.059  1.00 91.29  ? 324  VAL C CA    1 
ATOM   5757  C  C     . VAL C 2  324  ? 40.851  -9.768  -44.985  1.00 94.25  ? 324  VAL C C     1 
ATOM   5758  O  O     . VAL C 2  324  ? 40.759  -9.069  -43.974  1.00 92.70  ? 324  VAL C O     1 
ATOM   5759  C  CB    . VAL C 2  324  ? 40.926  -12.156 -44.190  1.00 84.16  ? 324  VAL C CB    1 
ATOM   5760  C  CG1   . VAL C 2  324  ? 42.409  -12.152 -44.541  1.00 92.27  ? 324  VAL C CG1   1 
ATOM   5761  C  CG2   . VAL C 2  324  ? 40.716  -11.884 -42.704  1.00 75.63  ? 324  VAL C CG2   1 
ATOM   5762  N  N     . GLY C 2  325  ? 41.536  -9.385  -46.058  1.00 95.31  ? 325  GLY C N     1 
ATOM   5763  C  CA    . GLY C 2  325  ? 42.242  -8.115  -46.089  1.00 94.13  ? 325  GLY C CA    1 
ATOM   5764  C  C     . GLY C 2  325  ? 41.551  -7.057  -46.929  1.00 96.28  ? 325  GLY C C     1 
ATOM   5765  O  O     . GLY C 2  325  ? 41.695  -5.861  -46.675  1.00 99.07  ? 325  GLY C O     1 
ATOM   5766  N  N     . GLU C 2  326  ? 40.799  -7.506  -47.930  1.00 97.73  ? 326  GLU C N     1 
ATOM   5767  C  CA    . GLU C 2  326  ? 40.117  -6.621  -48.874  1.00 102.33 ? 326  GLU C CA    1 
ATOM   5768  C  C     . GLU C 2  326  ? 39.023  -5.781  -48.209  1.00 109.17 ? 326  GLU C C     1 
ATOM   5769  O  O     . GLU C 2  326  ? 38.243  -6.302  -47.412  1.00 117.62 ? 326  GLU C O     1 
ATOM   5770  C  CB    . GLU C 2  326  ? 39.522  -7.453  -50.017  1.00 110.39 ? 326  GLU C CB    1 
ATOM   5771  C  CG    . GLU C 2  326  ? 38.687  -6.669  -51.018  1.00 116.25 ? 326  GLU C CG    1 
ATOM   5772  C  CD    . GLU C 2  326  ? 38.123  -7.543  -52.122  1.00 124.12 ? 326  GLU C CD    1 
ATOM   5773  O  OE1   . GLU C 2  326  ? 38.452  -8.748  -52.160  1.00 120.62 ? 326  GLU C OE1   1 
ATOM   5774  O  OE2   . GLU C 2  326  ? 37.348  -7.024  -52.954  1.00 136.40 ? 326  GLU C OE2   1 
ATOM   5775  N  N     . PRO C 2  327  ? 38.962  -4.476  -48.540  1.00 110.47 ? 327  PRO C N     1 
ATOM   5776  C  CA    . PRO C 2  327  ? 37.963  -3.550  -47.982  1.00 111.20 ? 327  PRO C CA    1 
ATOM   5777  C  C     . PRO C 2  327  ? 36.512  -3.976  -48.230  1.00 111.63 ? 327  PRO C C     1 
ATOM   5778  O  O     . PRO C 2  327  ? 36.253  -4.820  -49.086  1.00 115.88 ? 327  PRO C O     1 
ATOM   5779  C  CB    . PRO C 2  327  ? 38.267  -2.227  -48.700  1.00 112.27 ? 327  PRO C CB    1 
ATOM   5780  C  CG    . PRO C 2  327  ? 39.108  -2.599  -49.884  1.00 110.36 ? 327  PRO C CG    1 
ATOM   5781  C  CD    . PRO C 2  327  ? 39.898  -3.785  -49.442  1.00 106.48 ? 327  PRO C CD    1 
ATOM   5782  N  N     . ILE C 2  328  ? 35.583  -3.384  -47.484  1.00 112.03 ? 328  ILE C N     1 
ATOM   5783  C  CA    . ILE C 2  328  ? 34.171  -3.763  -47.536  1.00 117.54 ? 328  ILE C CA    1 
ATOM   5784  C  C     . ILE C 2  328  ? 33.442  -3.161  -48.741  1.00 117.73 ? 328  ILE C C     1 
ATOM   5785  O  O     . ILE C 2  328  ? 33.090  -1.981  -48.735  1.00 116.40 ? 328  ILE C O     1 
ATOM   5786  C  CB    . ILE C 2  328  ? 33.423  -3.332  -46.244  1.00 114.27 ? 328  ILE C CB    1 
ATOM   5787  C  CG1   . ILE C 2  328  ? 34.204  -3.736  -44.988  1.00 114.94 ? 328  ILE C CG1   1 
ATOM   5788  C  CG2   . ILE C 2  328  ? 32.010  -3.909  -46.217  1.00 112.58 ? 328  ILE C CG2   1 
ATOM   5789  C  CD1   . ILE C 2  328  ? 35.091  -2.636  -44.416  1.00 98.20  ? 328  ILE C CD1   1 
ATOM   5790  N  N     . THR C 2  329  ? 33.210  -3.977  -49.768  1.00 117.13 ? 329  THR C N     1 
ATOM   5791  C  CA    . THR C 2  329  ? 32.485  -3.525  -50.956  1.00 113.03 ? 329  THR C CA    1 
ATOM   5792  C  C     . THR C 2  329  ? 31.250  -4.383  -51.235  1.00 108.75 ? 329  THR C C     1 
ATOM   5793  O  O     . THR C 2  329  ? 30.207  -3.870  -51.643  1.00 108.69 ? 329  THR C O     1 
ATOM   5794  C  CB    . THR C 2  329  ? 33.394  -3.519  -52.208  1.00 110.24 ? 329  THR C CB    1 
ATOM   5795  O  OG1   . THR C 2  329  ? 32.598  -3.316  -53.383  1.00 108.26 ? 329  THR C OG1   1 
ATOM   5796  C  CG2   . THR C 2  329  ? 34.154  -4.829  -52.334  1.00 112.21 ? 329  THR C CG2   1 
ATOM   5797  N  N     . SER C 2  330  ? 31.373  -5.685  -51.001  1.00 105.03 ? 330  SER C N     1 
ATOM   5798  C  CA    . SER C 2  330  ? 30.281  -6.621  -51.243  1.00 101.71 ? 330  SER C CA    1 
ATOM   5799  C  C     . SER C 2  330  ? 29.205  -6.537  -50.163  1.00 105.65 ? 330  SER C C     1 
ATOM   5800  O  O     . SER C 2  330  ? 29.475  -6.768  -48.986  1.00 107.68 ? 330  SER C O     1 
ATOM   5801  C  CB    . SER C 2  330  ? 30.819  -8.053  -51.328  1.00 96.90  ? 330  SER C CB    1 
ATOM   5802  O  OG    . SER C 2  330  ? 29.764  -8.990  -51.474  1.00 99.20  ? 330  SER C OG    1 
ATOM   5803  N  N     . SER C 2  331  ? 27.987  -6.197  -50.568  1.00 108.13 ? 331  SER C N     1 
ATOM   5804  C  CA    . SER C 2  331  ? 26.844  -6.221  -49.664  1.00 104.18 ? 331  SER C CA    1 
ATOM   5805  C  C     . SER C 2  331  ? 26.015  -7.465  -49.952  1.00 105.32 ? 331  SER C C     1 
ATOM   5806  O  O     . SER C 2  331  ? 24.895  -7.611  -49.460  1.00 105.93 ? 331  SER C O     1 
ATOM   5807  C  CB    . SER C 2  331  ? 25.988  -4.961  -49.824  1.00 96.05  ? 331  SER C CB    1 
ATOM   5808  O  OG    . SER C 2  331  ? 26.755  -3.783  -49.637  1.00 85.08  ? 331  SER C OG    1 
ATOM   5809  N  N     . THR C 2  332  ? 26.585  -8.365  -50.749  1.00 105.72 ? 332  THR C N     1 
ATOM   5810  C  CA    . THR C 2  332  ? 25.839  -9.488  -51.305  1.00 108.00 ? 332  THR C CA    1 
ATOM   5811  C  C     . THR C 2  332  ? 26.499  -10.846 -51.056  1.00 102.25 ? 332  THR C C     1 
ATOM   5812  O  O     . THR C 2  332  ? 27.725  -10.962 -51.024  1.00 99.11  ? 332  THR C O     1 
ATOM   5813  C  CB    . THR C 2  332  ? 25.649  -9.316  -52.828  1.00 111.74 ? 332  THR C CB    1 
ATOM   5814  O  OG1   . THR C 2  332  ? 25.386  -7.940  -53.133  1.00 117.41 ? 332  THR C OG1   1 
ATOM   5815  C  CG2   . THR C 2  332  ? 24.499  -10.169 -53.328  1.00 109.84 ? 332  THR C CG2   1 
ATOM   5816  N  N     . LEU C 2  333  ? 25.668  -11.870 -50.884  1.00 100.35 ? 333  LEU C N     1 
ATOM   5817  C  CA    . LEU C 2  333  ? 26.125  -13.250 -50.785  1.00 101.92 ? 333  LEU C CA    1 
ATOM   5818  C  C     . LEU C 2  333  ? 26.659  -13.723 -52.135  1.00 108.81 ? 333  LEU C C     1 
ATOM   5819  O  O     . LEU C 2  333  ? 26.162  -13.304 -53.180  1.00 109.15 ? 333  LEU C O     1 
ATOM   5820  C  CB    . LEU C 2  333  ? 24.981  -14.152 -50.317  1.00 103.18 ? 333  LEU C CB    1 
ATOM   5821  C  CG    . LEU C 2  333  ? 25.299  -15.587 -49.900  1.00 107.25 ? 333  LEU C CG    1 
ATOM   5822  C  CD1   . LEU C 2  333  ? 26.149  -15.597 -48.640  1.00 111.89 ? 333  LEU C CD1   1 
ATOM   5823  C  CD2   . LEU C 2  333  ? 24.012  -16.376 -49.693  1.00 109.77 ? 333  LEU C CD2   1 
ATOM   5824  N  N     . THR C 2  334  ? 27.672  -14.586 -52.117  1.00 110.34 ? 334  THR C N     1 
ATOM   5825  C  CA    . THR C 2  334  ? 28.261  -15.096 -53.355  1.00 109.34 ? 334  THR C CA    1 
ATOM   5826  C  C     . THR C 2  334  ? 28.287  -16.622 -53.376  1.00 106.23 ? 334  THR C C     1 
ATOM   5827  O  O     . THR C 2  334  ? 28.136  -17.267 -52.339  1.00 102.55 ? 334  THR C O     1 
ATOM   5828  C  CB    . THR C 2  334  ? 29.699  -14.576 -53.563  1.00 106.91 ? 334  THR C CB    1 
ATOM   5829  O  OG1   . THR C 2  334  ? 30.584  -15.221 -52.640  1.00 104.54 ? 334  THR C OG1   1 
ATOM   5830  C  CG2   . THR C 2  334  ? 29.765  -13.065 -53.366  1.00 108.97 ? 334  THR C CG2   1 
ATOM   5831  N  N     . GLU C 2  335  ? 28.478  -17.191 -54.563  1.00 112.56 ? 335  GLU C N     1 
ATOM   5832  C  CA    . GLU C 2  335  ? 28.530  -18.641 -54.718  1.00 117.22 ? 335  GLU C CA    1 
ATOM   5833  C  C     . GLU C 2  335  ? 29.702  -19.232 -53.944  1.00 111.74 ? 335  GLU C C     1 
ATOM   5834  O  O     . GLU C 2  335  ? 29.609  -20.334 -53.402  1.00 106.74 ? 335  GLU C O     1 
ATOM   5835  C  CB    . GLU C 2  335  ? 28.639  -19.026 -56.193  1.00 131.99 ? 335  GLU C CB    1 
ATOM   5836  C  CG    . GLU C 2  335  ? 27.501  -18.525 -57.063  1.00 124.53 ? 335  GLU C CG    1 
ATOM   5837  C  CD    . GLU C 2  335  ? 27.568  -19.080 -58.473  1.00 130.18 ? 335  GLU C CD    1 
ATOM   5838  O  OE1   . GLU C 2  335  ? 27.963  -20.256 -58.630  1.00 140.74 ? 335  GLU C OE1   1 
ATOM   5839  O  OE2   . GLU C 2  335  ? 27.237  -18.340 -59.423  1.00 114.52 ? 335  GLU C OE2   1 
ATOM   5840  N  N     . GLU C 2  336  ? 30.803  -18.487 -53.908  1.00 111.55 ? 336  GLU C N     1 
ATOM   5841  C  CA    . GLU C 2  336  ? 32.004  -18.901 -53.189  1.00 109.71 ? 336  GLU C CA    1 
ATOM   5842  C  C     . GLU C 2  336  ? 31.719  -19.111 -51.710  1.00 102.48 ? 336  GLU C C     1 
ATOM   5843  O  O     . GLU C 2  336  ? 32.224  -20.050 -51.093  1.00 99.89  ? 336  GLU C O     1 
ATOM   5844  C  CB    . GLU C 2  336  ? 33.111  -17.862 -53.355  1.00 109.91 ? 336  GLU C CB    1 
ATOM   5845  C  CG    . GLU C 2  336  ? 34.311  -18.102 -52.458  1.00 113.58 ? 336  GLU C CG    1 
ATOM   5846  C  CD    . GLU C 2  336  ? 35.107  -16.837 -52.208  1.00 120.45 ? 336  GLU C CD    1 
ATOM   5847  O  OE1   . GLU C 2  336  ? 36.177  -16.923 -51.569  1.00 129.85 ? 336  GLU C OE1   1 
ATOM   5848  O  OE2   . GLU C 2  336  ? 34.661  -15.756 -52.649  1.00 115.92 ? 336  GLU C OE2   1 
ATOM   5849  N  N     . ASP C 2  337  ? 30.905  -18.224 -51.152  1.00 104.71 ? 337  ASP C N     1 
ATOM   5850  C  CA    . ASP C 2  337  ? 30.511  -18.314 -49.755  1.00 104.99 ? 337  ASP C CA    1 
ATOM   5851  C  C     . ASP C 2  337  ? 29.679  -19.568 -49.506  1.00 106.04 ? 337  ASP C C     1 
ATOM   5852  O  O     . ASP C 2  337  ? 29.777  -20.189 -48.448  1.00 109.34 ? 337  ASP C O     1 
ATOM   5853  C  CB    . ASP C 2  337  ? 29.725  -17.070 -49.343  1.00 106.94 ? 337  ASP C CB    1 
ATOM   5854  C  CG    . ASP C 2  337  ? 30.454  -15.786 -49.676  1.00 106.61 ? 337  ASP C CG    1 
ATOM   5855  O  OD1   . ASP C 2  337  ? 31.691  -15.740 -49.516  1.00 108.36 ? 337  ASP C OD1   1 
ATOM   5856  O  OD2   . ASP C 2  337  ? 29.793  -14.818 -50.105  1.00 111.04 ? 337  ASP C OD2   1 
ATOM   5857  N  N     . VAL C 2  338  ? 28.864  -19.934 -50.490  1.00 104.50 ? 338  VAL C N     1 
ATOM   5858  C  CA    . VAL C 2  338  ? 27.986  -21.093 -50.378  1.00 103.37 ? 338  VAL C CA    1 
ATOM   5859  C  C     . VAL C 2  338  ? 28.778  -22.381 -50.221  1.00 107.31 ? 338  VAL C C     1 
ATOM   5860  O  O     . VAL C 2  338  ? 28.533  -23.168 -49.310  1.00 104.72 ? 338  VAL C O     1 
ATOM   5861  C  CB    . VAL C 2  338  ? 27.073  -21.228 -51.609  1.00 103.35 ? 338  VAL C CB    1 
ATOM   5862  C  CG1   . VAL C 2  338  ? 26.151  -22.429 -51.455  1.00 107.08 ? 338  VAL C CG1   1 
ATOM   5863  C  CG2   . VAL C 2  338  ? 26.277  -19.950 -51.824  1.00 110.67 ? 338  VAL C CG2   1 
ATOM   5864  N  N     . VAL C 2  339  ? 29.729  -22.581 -51.125  1.00 115.38 ? 339  VAL C N     1 
ATOM   5865  C  CA    . VAL C 2  339  ? 30.557  -23.779 -51.132  1.00 119.13 ? 339  VAL C CA    1 
ATOM   5866  C  C     . VAL C 2  339  ? 31.437  -23.856 -49.886  1.00 114.16 ? 339  VAL C C     1 
ATOM   5867  O  O     . VAL C 2  339  ? 31.545  -24.909 -49.254  1.00 113.77 ? 339  VAL C O     1 
ATOM   5868  C  CB    . VAL C 2  339  ? 31.443  -23.832 -52.390  1.00 134.09 ? 339  VAL C CB    1 
ATOM   5869  C  CG1   . VAL C 2  339  ? 32.274  -25.104 -52.407  1.00 138.13 ? 339  VAL C CG1   1 
ATOM   5870  C  CG2   . VAL C 2  339  ? 30.583  -23.732 -53.646  1.00 140.93 ? 339  VAL C CG2   1 
ATOM   5871  N  N     . ALA C 2  340  ? 32.054  -22.732 -49.530  1.00 112.15 ? 340  ALA C N     1 
ATOM   5872  C  CA    . ALA C 2  340  ? 32.938  -22.674 -48.369  1.00 110.35 ? 340  ALA C CA    1 
ATOM   5873  C  C     . ALA C 2  340  ? 32.167  -22.896 -47.071  1.00 108.18 ? 340  ALA C C     1 
ATOM   5874  O  O     . ALA C 2  340  ? 32.748  -23.237 -46.040  1.00 106.10 ? 340  ALA C O     1 
ATOM   5875  C  CB    . ALA C 2  340  ? 33.675  -21.341 -48.329  1.00 111.64 ? 340  ALA C CB    1 
ATOM   5876  N  N     . THR C 2  341  ? 30.854  -22.699 -47.134  1.00 112.50 ? 341  THR C N     1 
ATOM   5877  C  CA    . THR C 2  341  ? 29.969  -22.968 -46.006  1.00 118.55 ? 341  THR C CA    1 
ATOM   5878  C  C     . THR C 2  341  ? 29.677  -24.460 -45.898  1.00 117.37 ? 341  THR C C     1 
ATOM   5879  O  O     . THR C 2  341  ? 29.724  -25.036 -44.811  1.00 118.28 ? 341  THR C O     1 
ATOM   5880  C  CB    . THR C 2  341  ? 28.638  -22.203 -46.133  1.00 116.75 ? 341  THR C CB    1 
ATOM   5881  O  OG1   . THR C 2  341  ? 28.897  -20.798 -46.233  1.00 117.36 ? 341  THR C OG1   1 
ATOM   5882  C  CG2   . THR C 2  341  ? 27.746  -22.469 -44.928  1.00 112.79 ? 341  THR C CG2   1 
ATOM   5883  N  N     . ILE C 2  342  ? 29.366  -25.078 -47.035  1.00 109.95 ? 342  ILE C N     1 
ATOM   5884  C  CA    . ILE C 2  342  ? 29.147  -26.517 -47.092  1.00 109.55 ? 342  ILE C CA    1 
ATOM   5885  C  C     . ILE C 2  342  ? 30.419  -27.245 -46.657  1.00 111.67 ? 342  ILE C C     1 
ATOM   5886  O  O     . ILE C 2  342  ? 30.360  -28.287 -46.004  1.00 110.34 ? 342  ILE C O     1 
ATOM   5887  C  CB    . ILE C 2  342  ? 28.739  -26.979 -48.510  1.00 110.77 ? 342  ILE C CB    1 
ATOM   5888  C  CG1   . ILE C 2  342  ? 27.594  -26.123 -49.056  1.00 103.37 ? 342  ILE C CG1   1 
ATOM   5889  C  CG2   . ILE C 2  342  ? 28.329  -28.440 -48.501  1.00 129.33 ? 342  ILE C CG2   1 
ATOM   5890  C  CD1   . ILE C 2  342  ? 27.259  -26.410 -50.507  1.00 112.22 ? 342  ILE C CD1   1 
ATOM   5891  N  N     . GLU C 2  343  ? 31.566  -26.672 -47.018  1.00 111.91 ? 343  GLU C N     1 
ATOM   5892  C  CA    . GLU C 2  343  ? 32.874  -27.208 -46.645  1.00 116.69 ? 343  GLU C CA    1 
ATOM   5893  C  C     . GLU C 2  343  ? 33.082  -27.122 -45.137  1.00 111.75 ? 343  GLU C C     1 
ATOM   5894  O  O     . GLU C 2  343  ? 33.637  -28.030 -44.517  1.00 116.47 ? 343  GLU C O     1 
ATOM   5895  C  CB    . GLU C 2  343  ? 33.987  -26.450 -47.383  1.00 130.85 ? 343  GLU C CB    1 
ATOM   5896  C  CG    . GLU C 2  343  ? 35.409  -26.927 -47.088  1.00 141.77 ? 343  GLU C CG    1 
ATOM   5897  C  CD    . GLU C 2  343  ? 36.473  -26.111 -47.818  1.00 142.63 ? 343  GLU C CD    1 
ATOM   5898  O  OE1   . GLU C 2  343  ? 36.104  -25.204 -48.597  1.00 140.67 ? 343  GLU C OE1   1 
ATOM   5899  O  OE2   . GLU C 2  343  ? 37.678  -26.377 -47.611  1.00 127.56 ? 343  GLU C OE2   1 
ATOM   5900  N  N     . TYR C 2  344  ? 32.620  -26.022 -44.556  1.00 105.18 ? 344  TYR C N     1 
ATOM   5901  C  CA    . TYR C 2  344  ? 32.726  -25.796 -43.122  1.00 101.56 ? 344  TYR C CA    1 
ATOM   5902  C  C     . TYR C 2  344  ? 31.850  -26.780 -42.353  1.00 97.79  ? 344  TYR C C     1 
ATOM   5903  O  O     . TYR C 2  344  ? 32.137  -27.118 -41.206  1.00 96.36  ? 344  TYR C O     1 
ATOM   5904  C  CB    . TYR C 2  344  ? 32.330  -24.356 -42.789  1.00 105.26 ? 344  TYR C CB    1 
ATOM   5905  C  CG    . TYR C 2  344  ? 33.025  -23.780 -41.579  1.00 99.29  ? 344  TYR C CG    1 
ATOM   5906  C  CD1   . TYR C 2  344  ? 34.027  -22.831 -41.720  1.00 98.60  ? 344  TYR C CD1   1 
ATOM   5907  C  CD2   . TYR C 2  344  ? 32.679  -24.181 -40.297  1.00 95.06  ? 344  TYR C CD2   1 
ATOM   5908  C  CE1   . TYR C 2  344  ? 34.665  -22.303 -40.620  1.00 96.45  ? 344  TYR C CE1   1 
ATOM   5909  C  CE2   . TYR C 2  344  ? 33.308  -23.654 -39.190  1.00 93.64  ? 344  TYR C CE2   1 
ATOM   5910  C  CZ    . TYR C 2  344  ? 34.302  -22.716 -39.358  1.00 96.02  ? 344  TYR C CZ    1 
ATOM   5911  O  OH    . TYR C 2  344  ? 34.938  -22.184 -38.262  1.00 99.15  ? 344  TYR C OH    1 
ATOM   5912  N  N     . LEU C 2  345  ? 30.786  -27.242 -43.004  1.00 98.60  ? 345  LEU C N     1 
ATOM   5913  C  CA    . LEU C 2  345  ? 29.808  -28.128 -42.380  1.00 101.54 ? 345  LEU C CA    1 
ATOM   5914  C  C     . LEU C 2  345  ? 30.282  -29.575 -42.286  1.00 106.47 ? 345  LEU C C     1 
ATOM   5915  O  O     . LEU C 2  345  ? 30.154  -30.214 -41.241  1.00 110.75 ? 345  LEU C O     1 
ATOM   5916  C  CB    . LEU C 2  345  ? 28.488  -28.076 -43.152  1.00 104.54 ? 345  LEU C CB    1 
ATOM   5917  C  CG    . LEU C 2  345  ? 27.424  -29.114 -42.785  1.00 110.07 ? 345  LEU C CG    1 
ATOM   5918  C  CD1   . LEU C 2  345  ? 27.058  -29.026 -41.310  1.00 109.22 ? 345  LEU C CD1   1 
ATOM   5919  C  CD2   . LEU C 2  345  ? 26.185  -28.942 -43.652  1.00 126.58 ? 345  LEU C CD2   1 
ATOM   5920  N  N     . VAL C 2  346  ? 30.818  -30.089 -43.387  1.00 108.57 ? 346  VAL C N     1 
ATOM   5921  C  CA    . VAL C 2  346  ? 31.204  -31.492 -43.470  1.00 108.35 ? 346  VAL C CA    1 
ATOM   5922  C  C     . VAL C 2  346  ? 32.413  -31.819 -42.586  1.00 110.21 ? 346  VAL C C     1 
ATOM   5923  O  O     . VAL C 2  346  ? 32.400  -32.809 -41.851  1.00 110.16 ? 346  VAL C O     1 
ATOM   5924  C  CB    . VAL C 2  346  ? 31.499  -31.891 -44.933  1.00 115.37 ? 346  VAL C CB    1 
ATOM   5925  C  CG1   . VAL C 2  346  ? 32.315  -30.815 -45.637  1.00 114.49 ? 346  VAL C CG1   1 
ATOM   5926  C  CG2   . VAL C 2  346  ? 32.198  -33.232 -44.994  1.00 127.70 ? 346  VAL C CG2   1 
ATOM   5927  N  N     . ARG C 2  347  ? 33.441  -30.977 -42.652  1.00 113.46 ? 347  ARG C N     1 
ATOM   5928  C  CA    . ARG C 2  347  ? 34.660  -31.164 -41.866  1.00 116.34 ? 347  ARG C CA    1 
ATOM   5929  C  C     . ARG C 2  347  ? 34.381  -31.178 -40.367  1.00 115.90 ? 347  ARG C C     1 
ATOM   5930  O  O     . ARG C 2  347  ? 34.886  -32.032 -39.636  1.00 115.77 ? 347  ARG C O     1 
ATOM   5931  C  CB    . ARG C 2  347  ? 35.673  -30.062 -42.181  1.00 125.19 ? 347  ARG C CB    1 
ATOM   5932  C  CG    . ARG C 2  347  ? 36.121  -30.005 -43.631  1.00 131.16 ? 347  ARG C CG    1 
ATOM   5933  C  CD    . ARG C 2  347  ? 37.225  -28.974 -43.811  1.00 135.80 ? 347  ARG C CD    1 
ATOM   5934  N  NE    . ARG C 2  347  ? 37.660  -28.857 -45.200  1.00 142.61 ? 347  ARG C NE    1 
ATOM   5935  C  CZ    . ARG C 2  347  ? 38.629  -29.585 -45.745  1.00 143.96 ? 347  ARG C CZ    1 
ATOM   5936  N  NH1   . ARG C 2  347  ? 39.271  -30.493 -45.021  1.00 138.96 ? 347  ARG C NH1   1 
ATOM   5937  N  NH2   . ARG C 2  347  ? 38.955  -29.407 -47.018  1.00 143.55 ? 347  ARG C NH2   1 
ATOM   5938  N  N     . LEU C 2  348  ? 33.575  -30.220 -39.920  1.00 118.65 ? 348  LEU C N     1 
ATOM   5939  C  CA    . LEU C 2  348  ? 33.222  -30.084 -38.512  1.00 113.59 ? 348  LEU C CA    1 
ATOM   5940  C  C     . LEU C 2  348  ? 32.371  -31.260 -38.037  1.00 112.65 ? 348  LEU C C     1 
ATOM   5941  O  O     . LEU C 2  348  ? 32.259  -31.519 -36.838  1.00 110.89 ? 348  LEU C O     1 
ATOM   5942  C  CB    . LEU C 2  348  ? 32.481  -28.765 -38.284  1.00 107.19 ? 348  LEU C CB    1 
ATOM   5943  C  CG    . LEU C 2  348  ? 32.167  -28.349 -36.847  1.00 101.55 ? 348  LEU C CG    1 
ATOM   5944  C  CD1   . LEU C 2  348  ? 33.415  -28.397 -35.986  1.00 103.40 ? 348  LEU C CD1   1 
ATOM   5945  C  CD2   . LEU C 2  348  ? 31.551  -26.959 -36.829  1.00 103.48 ? 348  LEU C CD2   1 
ATOM   5946  N  N     . HIS C 2  349  ? 31.777  -31.973 -38.988  1.00 113.07 ? 349  HIS C N     1 
ATOM   5947  C  CA    . HIS C 2  349  ? 30.917  -33.107 -38.674  1.00 112.25 ? 349  HIS C CA    1 
ATOM   5948  C  C     . HIS C 2  349  ? 31.718  -34.389 -38.458  1.00 115.82 ? 349  HIS C C     1 
ATOM   5949  O  O     . HIS C 2  349  ? 31.275  -35.294 -37.749  1.00 110.60 ? 349  HIS C O     1 
ATOM   5950  C  CB    . HIS C 2  349  ? 29.891  -33.314 -39.789  1.00 118.13 ? 349  HIS C CB    1 
ATOM   5951  C  CG    . HIS C 2  349  ? 28.993  -34.493 -39.573  1.00 121.43 ? 349  HIS C CG    1 
ATOM   5952  N  ND1   . HIS C 2  349  ? 29.261  -35.738 -40.098  1.00 127.28 ? 349  HIS C ND1   1 
ATOM   5953  C  CD2   . HIS C 2  349  ? 27.835  -34.616 -38.882  1.00 126.27 ? 349  HIS C CD2   1 
ATOM   5954  C  CE1   . HIS C 2  349  ? 28.304  -36.578 -39.743  1.00 128.02 ? 349  HIS C CE1   1 
ATOM   5955  N  NE2   . HIS C 2  349  ? 27.428  -35.923 -39.005  1.00 129.07 ? 349  HIS C NE2   1 
ATOM   5956  N  N     . GLU C 2  350  ? 32.898  -34.463 -39.067  1.00 119.08 ? 350  GLU C N     1 
ATOM   5957  C  CA    . GLU C 2  350  ? 33.710  -35.675 -39.006  1.00 121.10 ? 350  GLU C CA    1 
ATOM   5958  C  C     . GLU C 2  350  ? 34.938  -35.528 -38.107  1.00 117.78 ? 350  GLU C C     1 
ATOM   5959  O  O     . GLU C 2  350  ? 35.812  -36.394 -38.096  1.00 120.78 ? 350  GLU C O     1 
ATOM   5960  C  CB    . GLU C 2  350  ? 34.139  -36.094 -40.416  1.00 129.94 ? 350  GLU C CB    1 
ATOM   5961  C  CG    . GLU C 2  350  ? 34.838  -35.002 -41.209  1.00 134.04 ? 350  GLU C CG    1 
ATOM   5962  C  CD    . GLU C 2  350  ? 35.074  -35.388 -42.660  1.00 137.15 ? 350  GLU C CD    1 
ATOM   5963  O  OE1   . GLU C 2  350  ? 34.639  -36.486 -43.067  1.00 140.28 ? 350  GLU C OE1   1 
ATOM   5964  O  OE2   . GLU C 2  350  ? 35.694  -34.590 -43.394  1.00 135.45 ? 350  GLU C OE2   1 
ATOM   5965  N  N     . GLY C 2  351  ? 35.007  -34.431 -37.359  1.00 113.49 ? 351  GLY C N     1 
ATOM   5966  C  CA    . GLY C 2  351  ? 36.025  -34.289 -36.333  1.00 108.13 ? 351  GLY C CA    1 
ATOM   5967  C  C     . GLY C 2  351  ? 37.168  -33.331 -36.618  1.00 102.35 ? 351  GLY C C     1 
ATOM   5968  O  O     . GLY C 2  351  ? 38.079  -33.199 -35.802  1.00 96.70  ? 351  GLY C O     1 
ATOM   5969  N  N     . GLN C 2  352  ? 37.132  -32.661 -37.765  1.00 107.89 ? 352  GLN C N     1 
ATOM   5970  C  CA    . GLN C 2  352  ? 38.173  -31.694 -38.097  1.00 110.50 ? 352  GLN C CA    1 
ATOM   5971  C  C     . GLN C 2  352  ? 38.112  -30.483 -37.175  1.00 108.49 ? 352  GLN C C     1 
ATOM   5972  O  O     . GLN C 2  352  ? 37.052  -30.136 -36.657  1.00 111.19 ? 352  GLN C O     1 
ATOM   5973  C  CB    . GLN C 2  352  ? 38.056  -31.244 -39.551  1.00 116.30 ? 352  GLN C CB    1 
ATOM   5974  C  CG    . GLN C 2  352  ? 38.214  -32.359 -40.562  1.00 123.93 ? 352  GLN C CG    1 
ATOM   5975  C  CD    . GLN C 2  352  ? 38.618  -31.838 -41.925  1.00 133.34 ? 352  GLN C CD    1 
ATOM   5976  O  OE1   . GLN C 2  352  ? 39.261  -30.793 -42.035  1.00 139.37 ? 352  GLN C OE1   1 
ATOM   5977  N  NE2   . GLN C 2  352  ? 38.240  -32.559 -42.973  1.00 135.46 ? 352  GLN C NE2   1 
ATOM   5978  N  N     . THR C 2  353  ? 39.256  -29.838 -36.979  1.00 109.77 ? 353  THR C N     1 
ATOM   5979  C  CA    . THR C 2  353  ? 39.342  -28.710 -36.062  1.00 113.65 ? 353  THR C CA    1 
ATOM   5980  C  C     . THR C 2  353  ? 39.713  -27.415 -36.784  1.00 114.20 ? 353  THR C C     1 
ATOM   5981  O  O     . THR C 2  353  ? 39.296  -26.329 -36.381  1.00 113.25 ? 353  THR C O     1 
ATOM   5982  C  CB    . THR C 2  353  ? 40.367  -28.980 -34.949  1.00 112.95 ? 353  THR C CB    1 
ATOM   5983  O  OG1   . THR C 2  353  ? 41.657  -29.207 -35.529  1.00 111.70 ? 353  THR C OG1   1 
ATOM   5984  C  CG2   . THR C 2  353  ? 39.960  -30.203 -34.143  1.00 107.83 ? 353  THR C CG2   1 
ATOM   5985  N  N     . THR C 2  354  ? 40.489  -27.536 -37.855  1.00 112.24 ? 354  THR C N     1 
ATOM   5986  C  CA    . THR C 2  354  ? 40.954  -26.367 -38.591  1.00 103.78 ? 354  THR C CA    1 
ATOM   5987  C  C     . THR C 2  354  ? 40.795  -26.571 -40.095  1.00 103.67 ? 354  THR C C     1 
ATOM   5988  O  O     . THR C 2  354  ? 40.835  -27.701 -40.584  1.00 106.06 ? 354  THR C O     1 
ATOM   5989  C  CB    . THR C 2  354  ? 42.428  -26.054 -38.269  1.00 101.05 ? 354  THR C CB    1 
ATOM   5990  O  OG1   . THR C 2  354  ? 42.701  -26.378 -36.899  1.00 103.31 ? 354  THR C OG1   1 
ATOM   5991  C  CG2   . THR C 2  354  ? 42.726  -24.587 -38.504  1.00 102.82 ? 354  THR C CG2   1 
ATOM   5992  N  N     . MET C 2  355  ? 40.609  -25.476 -40.825  1.00 103.76 ? 355  MET C N     1 
ATOM   5993  C  CA    . MET C 2  355  ? 40.403  -25.547 -42.267  1.00 112.08 ? 355  MET C CA    1 
ATOM   5994  C  C     . MET C 2  355  ? 40.833  -24.268 -42.975  1.00 121.20 ? 355  MET C C     1 
ATOM   5995  O  O     . MET C 2  355  ? 40.595  -23.162 -42.488  1.00 120.17 ? 355  MET C O     1 
ATOM   5996  C  CB    . MET C 2  355  ? 38.932  -25.832 -42.580  1.00 125.91 ? 355  MET C CB    1 
ATOM   5997  C  CG    . MET C 2  355  ? 38.570  -25.714 -44.053  1.00 131.27 ? 355  MET C CG    1 
ATOM   5998  S  SD    . MET C 2  355  ? 36.857  -25.212 -44.300  1.00 148.25 ? 355  MET C SD    1 
ATOM   5999  C  CE    . MET C 2  355  ? 36.880  -23.580 -43.562  1.00 129.75 ? 355  MET C CE    1 
ATOM   6000  N  N     . THR C 2  356  ? 41.462  -24.431 -44.134  1.00 128.83 ? 356  THR C N     1 
ATOM   6001  C  CA    . THR C 2  356  ? 41.802  -23.303 -44.988  1.00 123.12 ? 356  THR C CA    1 
ATOM   6002  C  C     . THR C 2  356  ? 40.950  -23.313 -46.252  1.00 126.44 ? 356  THR C C     1 
ATOM   6003  O  O     . THR C 2  356  ? 41.032  -24.239 -47.062  1.00 126.95 ? 356  THR C O     1 
ATOM   6004  C  CB    . THR C 2  356  ? 43.288  -23.319 -45.383  1.00 125.62 ? 356  THR C CB    1 
ATOM   6005  O  OG1   . THR C 2  356  ? 43.582  -24.528 -46.094  1.00 134.69 ? 356  THR C OG1   1 
ATOM   6006  C  CG2   . THR C 2  356  ? 44.166  -23.244 -44.149  1.00 122.83 ? 356  THR C CG2   1 
ATOM   6007  N  N     . VAL C 2  357  ? 40.119  -22.288 -46.409  1.00 127.43 ? 357  VAL C N     1 
ATOM   6008  C  CA    . VAL C 2  357  ? 39.354  -22.113 -47.636  1.00 133.32 ? 357  VAL C CA    1 
ATOM   6009  C  C     . VAL C 2  357  ? 40.318  -21.779 -48.771  1.00 129.75 ? 357  VAL C C     1 
ATOM   6010  O  O     . VAL C 2  357  ? 41.154  -20.886 -48.623  1.00 125.62 ? 357  VAL C O     1 
ATOM   6011  C  CB    . VAL C 2  357  ? 38.291  -20.997 -47.496  1.00 137.84 ? 357  VAL C CB    1 
ATOM   6012  C  CG1   . VAL C 2  357  ? 37.654  -20.684 -48.843  1.00 140.78 ? 357  VAL C CG1   1 
ATOM   6013  C  CG2   . VAL C 2  357  ? 37.228  -21.393 -46.479  1.00 130.55 ? 357  VAL C CG2   1 
ATOM   6014  N  N     . PRO C 2  358  ? 40.219  -22.511 -49.896  1.00 128.11 ? 358  PRO C N     1 
ATOM   6015  C  CA    . PRO C 2  358  ? 41.082  -22.290 -51.064  1.00 129.60 ? 358  PRO C CA    1 
ATOM   6016  C  C     . PRO C 2  358  ? 41.117  -20.828 -51.505  1.00 126.33 ? 358  PRO C C     1 
ATOM   6017  O  O     . PRO C 2  358  ? 40.140  -20.310 -52.047  1.00 124.25 ? 358  PRO C O     1 
ATOM   6018  C  CB    . PRO C 2  358  ? 40.450  -23.179 -52.146  1.00 123.22 ? 358  PRO C CB    1 
ATOM   6019  C  CG    . PRO C 2  358  ? 39.101  -23.569 -51.612  1.00 117.97 ? 358  PRO C CG    1 
ATOM   6020  C  CD    . PRO C 2  358  ? 39.252  -23.595 -50.132  1.00 120.44 ? 358  PRO C CD    1 
ATOM   6021  N  N     . GLY C 2  359  ? 42.248  -20.174 -51.260  1.00 119.80 ? 359  GLY C N     1 
ATOM   6022  C  CA    . GLY C 2  359  ? 42.388  -18.757 -51.534  1.00 116.61 ? 359  GLY C CA    1 
ATOM   6023  C  C     . GLY C 2  359  ? 42.090  -17.929 -50.300  1.00 121.14 ? 359  GLY C C     1 
ATOM   6024  O  O     . GLY C 2  359  ? 41.817  -16.733 -50.396  1.00 128.48 ? 359  GLY C O     1 
ATOM   6025  N  N     . GLY C 2  360  ? 42.146  -18.566 -49.133  1.00 117.35 ? 360  GLY C N     1 
ATOM   6026  C  CA    . GLY C 2  360  ? 41.844  -17.888 -47.885  1.00 119.04 ? 360  GLY C CA    1 
ATOM   6027  C  C     . GLY C 2  360  ? 42.702  -18.335 -46.715  1.00 123.31 ? 360  GLY C C     1 
ATOM   6028  O  O     . GLY C 2  360  ? 43.193  -19.463 -46.684  1.00 120.35 ? 360  GLY C O     1 
ATOM   6029  N  N     . VAL C 2  361  ? 42.869  -17.443 -45.742  1.00 127.01 ? 361  VAL C N     1 
ATOM   6030  C  CA    . VAL C 2  361  ? 43.716  -17.697 -44.580  1.00 128.10 ? 361  VAL C CA    1 
ATOM   6031  C  C     . VAL C 2  361  ? 43.119  -18.792 -43.690  1.00 122.62 ? 361  VAL C C     1 
ATOM   6032  O  O     . VAL C 2  361  ? 41.953  -19.158 -43.838  1.00 126.21 ? 361  VAL C O     1 
ATOM   6033  C  CB    . VAL C 2  361  ? 43.927  -16.402 -43.753  1.00 132.78 ? 361  VAL C CB    1 
ATOM   6034  C  CG1   . VAL C 2  361  ? 42.721  -16.128 -42.865  1.00 128.04 ? 361  VAL C CG1   1 
ATOM   6035  C  CG2   . VAL C 2  361  ? 45.210  -16.476 -42.926  1.00 132.08 ? 361  VAL C CG2   1 
ATOM   6036  N  N     . GLU C 2  362  ? 43.930  -19.314 -42.774  1.00 119.90 ? 362  GLU C N     1 
ATOM   6037  C  CA    . GLU C 2  362  ? 43.522  -20.404 -41.895  1.00 119.46 ? 362  GLU C CA    1 
ATOM   6038  C  C     . GLU C 2  362  ? 42.498  -19.948 -40.855  1.00 119.55 ? 362  GLU C C     1 
ATOM   6039  O  O     . GLU C 2  362  ? 42.662  -18.903 -40.223  1.00 116.66 ? 362  GLU C O     1 
ATOM   6040  C  CB    . GLU C 2  362  ? 44.750  -21.002 -41.208  1.00 119.89 ? 362  GLU C CB    1 
ATOM   6041  C  CG    . GLU C 2  362  ? 44.543  -22.407 -40.681  1.00 126.19 ? 362  GLU C CG    1 
ATOM   6042  C  CD    . GLU C 2  362  ? 45.851  -23.107 -40.365  1.00 119.77 ? 362  GLU C CD    1 
ATOM   6043  O  OE1   . GLU C 2  362  ? 46.897  -22.428 -40.325  1.00 105.62 ? 362  GLU C OE1   1 
ATOM   6044  O  OE2   . GLU C 2  362  ? 45.836  -24.339 -40.163  1.00 121.75 ? 362  GLU C OE2   1 
ATOM   6045  N  N     . VAL C 2  363  ? 41.442  -20.743 -40.688  1.00 121.45 ? 363  VAL C N     1 
ATOM   6046  C  CA    . VAL C 2  363  ? 40.330  -20.401 -39.799  1.00 113.75 ? 363  VAL C CA    1 
ATOM   6047  C  C     . VAL C 2  363  ? 39.959  -21.555 -38.868  1.00 105.01 ? 363  VAL C C     1 
ATOM   6048  O  O     . VAL C 2  363  ? 39.817  -22.693 -39.314  1.00 105.52 ? 363  VAL C O     1 
ATOM   6049  C  CB    . VAL C 2  363  ? 39.071  -20.005 -40.604  1.00 113.19 ? 363  VAL C CB    1 
ATOM   6050  C  CG1   . VAL C 2  363  ? 37.970  -19.499 -39.681  1.00 105.25 ? 363  VAL C CG1   1 
ATOM   6051  C  CG2   . VAL C 2  363  ? 39.415  -18.959 -41.639  1.00 112.84 ? 363  VAL C CG2   1 
ATOM   6052  N  N     . PRO C 2  364  ? 39.797  -21.264 -37.566  1.00 105.47 ? 364  PRO C N     1 
ATOM   6053  C  CA    . PRO C 2  364  ? 39.325  -22.277 -36.614  1.00 104.01 ? 364  PRO C CA    1 
ATOM   6054  C  C     . PRO C 2  364  ? 37.924  -22.776 -36.961  1.00 100.86 ? 364  PRO C C     1 
ATOM   6055  O  O     . PRO C 2  364  ? 37.070  -21.979 -37.347  1.00 99.64  ? 364  PRO C O     1 
ATOM   6056  C  CB    . PRO C 2  364  ? 39.329  -21.531 -35.274  1.00 109.11 ? 364  PRO C CB    1 
ATOM   6057  C  CG    . PRO C 2  364  ? 39.289  -20.079 -35.639  1.00 108.86 ? 364  PRO C CG    1 
ATOM   6058  C  CD    . PRO C 2  364  ? 40.081  -19.980 -36.905  1.00 109.29 ? 364  PRO C CD    1 
ATOM   6059  N  N     . VAL C 2  365  ? 37.697  -24.079 -36.826  1.00 100.95 ? 365  VAL C N     1 
ATOM   6060  C  CA    . VAL C 2  365  ? 36.414  -24.670 -37.193  1.00 100.12 ? 365  VAL C CA    1 
ATOM   6061  C  C     . VAL C 2  365  ? 35.683  -25.251 -35.989  1.00 99.30  ? 365  VAL C C     1 
ATOM   6062  O  O     . VAL C 2  365  ? 36.128  -26.231 -35.393  1.00 107.53 ? 365  VAL C O     1 
ATOM   6063  C  CB    . VAL C 2  365  ? 36.591  -25.772 -38.248  1.00 101.59 ? 365  VAL C CB    1 
ATOM   6064  C  CG1   . VAL C 2  365  ? 35.269  -26.474 -38.511  1.00 101.02 ? 365  VAL C CG1   1 
ATOM   6065  C  CG2   . VAL C 2  365  ? 37.147  -25.182 -39.527  1.00 109.07 ? 365  VAL C CG2   1 
ATOM   6066  N  N     . GLU C 2  366  ? 34.552  -24.643 -35.646  1.00 98.55  ? 366  GLU C N     1 
ATOM   6067  C  CA    . GLU C 2  366  ? 33.771  -25.063 -34.490  1.00 98.22  ? 366  GLU C CA    1 
ATOM   6068  C  C     . GLU C 2  366  ? 32.355  -24.500 -34.554  1.00 98.15  ? 366  GLU C C     1 
ATOM   6069  O  O     . GLU C 2  366  ? 32.068  -23.608 -35.352  1.00 96.42  ? 366  GLU C O     1 
ATOM   6070  C  CB    . GLU C 2  366  ? 34.454  -24.620 -33.197  1.00 94.21  ? 366  GLU C CB    1 
ATOM   6071  C  CG    . GLU C 2  366  ? 34.685  -23.125 -33.114  1.00 95.78  ? 366  GLU C CG    1 
ATOM   6072  C  CD    . GLU C 2  366  ? 35.483  -22.730 -31.890  1.00 100.60 ? 366  GLU C CD    1 
ATOM   6073  O  OE1   . GLU C 2  366  ? 35.784  -23.618 -31.067  1.00 103.79 ? 366  GLU C OE1   1 
ATOM   6074  O  OE2   . GLU C 2  366  ? 35.812  -21.533 -31.753  1.00 104.19 ? 366  GLU C OE2   1 
ATOM   6075  N  N     . THR C 2  367  ? 31.473  -25.027 -33.710  1.00 100.05 ? 367  THR C N     1 
ATOM   6076  C  CA    . THR C 2  367  ? 30.096  -24.554 -33.648  1.00 95.99  ? 367  THR C CA    1 
ATOM   6077  C  C     . THR C 2  367  ? 30.046  -23.176 -33.003  1.00 92.48  ? 367  THR C C     1 
ATOM   6078  O  O     . THR C 2  367  ? 30.842  -22.872 -32.115  1.00 94.38  ? 367  THR C O     1 
ATOM   6079  C  CB    . THR C 2  367  ? 29.198  -25.522 -32.859  1.00 100.58 ? 367  THR C CB    1 
ATOM   6080  O  OG1   . THR C 2  367  ? 29.582  -25.519 -31.478  1.00 89.87  ? 367  THR C OG1   1 
ATOM   6081  C  CG2   . THR C 2  367  ? 29.329  -26.933 -33.413  1.00 112.92 ? 367  THR C CG2   1 
ATOM   6082  N  N     . ASP C 2  368  ? 29.110  -22.345 -33.450  1.00 83.68  ? 368  ASP C N     1 
ATOM   6083  C  CA    . ASP C 2  368  ? 29.018  -20.975 -32.957  1.00 75.98  ? 368  ASP C CA    1 
ATOM   6084  C  C     . ASP C 2  368  ? 27.932  -20.798 -31.903  1.00 66.91  ? 368  ASP C C     1 
ATOM   6085  O  O     . ASP C 2  368  ? 26.857  -21.391 -31.992  1.00 68.29  ? 368  ASP C O     1 
ATOM   6086  C  CB    . ASP C 2  368  ? 28.772  -20.006 -34.114  1.00 79.30  ? 368  ASP C CB    1 
ATOM   6087  C  CG    . ASP C 2  368  ? 29.990  -19.835 -35.000  1.00 87.53  ? 368  ASP C CG    1 
ATOM   6088  O  OD1   . ASP C 2  368  ? 31.072  -20.337 -34.624  1.00 91.56  ? 368  ASP C OD1   1 
ATOM   6089  O  OD2   . ASP C 2  368  ? 29.868  -19.190 -36.064  1.00 96.90  ? 368  ASP C OD2   1 
ATOM   6090  N  N     . ASP C 2  369  ? 28.234  -19.971 -30.906  1.00 66.35  ? 369  ASP C N     1 
ATOM   6091  C  CA    . ASP C 2  369  ? 27.292  -19.621 -29.852  1.00 61.25  ? 369  ASP C CA    1 
ATOM   6092  C  C     . ASP C 2  369  ? 26.672  -18.260 -30.153  1.00 64.17  ? 369  ASP C C     1 
ATOM   6093  O  O     . ASP C 2  369  ? 27.368  -17.244 -30.195  1.00 63.26  ? 369  ASP C O     1 
ATOM   6094  C  CB    . ASP C 2  369  ? 27.992  -19.610 -28.490  1.00 59.54  ? 369  ASP C CB    1 
ATOM   6095  C  CG    . ASP C 2  369  ? 27.016  -19.627 -27.324  1.00 61.02  ? 369  ASP C CG    1 
ATOM   6096  O  OD1   . ASP C 2  369  ? 27.321  -19.008 -26.282  1.00 57.60  ? 369  ASP C OD1   1 
ATOM   6097  O  OD2   . ASP C 2  369  ? 25.951  -20.269 -27.445  1.00 68.72  ? 369  ASP C OD2   1 
ATOM   6098  N  N     . ILE C 2  370  ? 25.359  -18.256 -30.364  1.00 64.63  ? 370  ILE C N     1 
ATOM   6099  C  CA    . ILE C 2  370  ? 24.632  -17.064 -30.792  1.00 62.21  ? 370  ILE C CA    1 
ATOM   6100  C  C     . ILE C 2  370  ? 24.665  -15.951 -29.740  1.00 63.72  ? 370  ILE C C     1 
ATOM   6101  O  O     . ILE C 2  370  ? 24.662  -14.770 -30.082  1.00 73.80  ? 370  ILE C O     1 
ATOM   6102  C  CB    . ILE C 2  370  ? 23.161  -17.409 -31.136  1.00 72.66  ? 370  ILE C CB    1 
ATOM   6103  C  CG1   . ILE C 2  370  ? 22.418  -16.186 -31.682  1.00 106.01 ? 370  ILE C CG1   1 
ATOM   6104  C  CG2   . ILE C 2  370  ? 22.441  -17.982 -29.929  1.00 83.95  ? 370  ILE C CG2   1 
ATOM   6105  C  CD1   . ILE C 2  370  ? 20.907  -16.347 -31.702  1.00 147.86 ? 370  ILE C CD1   1 
ATOM   6106  N  N     . ASP C 2  371  ? 24.727  -16.326 -28.466  1.00 62.65  ? 371  ASP C N     1 
ATOM   6107  C  CA    . ASP C 2  371  ? 24.654  -15.356 -27.378  1.00 64.61  ? 371  ASP C CA    1 
ATOM   6108  C  C     . ASP C 2  371  ? 25.997  -14.675 -27.096  1.00 57.07  ? 371  ASP C C     1 
ATOM   6109  O  O     . ASP C 2  371  ? 26.067  -13.747 -26.288  1.00 54.26  ? 371  ASP C O     1 
ATOM   6110  C  CB    . ASP C 2  371  ? 24.131  -16.035 -26.106  1.00 77.36  ? 371  ASP C CB    1 
ATOM   6111  C  CG    . ASP C 2  371  ? 22.712  -16.564 -26.265  1.00 103.43 ? 371  ASP C CG    1 
ATOM   6112  O  OD1   . ASP C 2  371  ? 21.984  -16.043 -27.135  1.00 124.40 ? 371  ASP C OD1   1 
ATOM   6113  O  OD2   . ASP C 2  371  ? 22.325  -17.492 -25.519  1.00 115.98 ? 371  ASP C OD2   1 
ATOM   6114  N  N     . HIS C 2  372  ? 27.057  -15.130 -27.761  1.00 52.80  ? 372  HIS C N     1 
ATOM   6115  C  CA    . HIS C 2  372  ? 28.381  -14.529 -27.592  1.00 51.48  ? 372  HIS C CA    1 
ATOM   6116  C  C     . HIS C 2  372  ? 28.392  -13.108 -28.149  1.00 47.30  ? 372  HIS C C     1 
ATOM   6117  O  O     . HIS C 2  372  ? 27.860  -12.858 -29.229  1.00 45.72  ? 372  HIS C O     1 
ATOM   6118  C  CB    . HIS C 2  372  ? 29.457  -15.376 -28.280  1.00 52.30  ? 372  HIS C CB    1 
ATOM   6119  C  CG    . HIS C 2  372  ? 30.838  -15.154 -27.742  1.00 54.95  ? 372  HIS C CG    1 
ATOM   6120  N  ND1   . HIS C 2  372  ? 31.489  -13.945 -27.836  1.00 46.40  ? 372  HIS C ND1   1 
ATOM   6121  C  CD2   . HIS C 2  372  ? 31.692  -15.994 -27.107  1.00 60.34  ? 372  HIS C CD2   1 
ATOM   6122  C  CE1   . HIS C 2  372  ? 32.683  -14.046 -27.279  1.00 52.46  ? 372  HIS C CE1   1 
ATOM   6123  N  NE2   . HIS C 2  372  ? 32.831  -15.277 -26.829  1.00 57.25  ? 372  HIS C NE2   1 
ATOM   6124  N  N     . PHE C 2  373  ? 29.006  -12.180 -27.419  1.00 44.40  ? 373  PHE C N     1 
ATOM   6125  C  CA    . PHE C 2  373  ? 29.014  -10.775 -27.821  1.00 47.65  ? 373  PHE C CA    1 
ATOM   6126  C  C     . PHE C 2  373  ? 29.901  -10.531 -29.043  1.00 47.99  ? 373  PHE C C     1 
ATOM   6127  O  O     . PHE C 2  373  ? 30.093  -9.391  -29.465  1.00 48.89  ? 373  PHE C O     1 
ATOM   6128  C  CB    . PHE C 2  373  ? 29.456  -9.886  -26.654  1.00 44.58  ? 373  PHE C CB    1 
ATOM   6129  C  CG    . PHE C 2  373  ? 28.315  -9.370  -25.819  1.00 41.45  ? 373  PHE C CG    1 
ATOM   6130  C  CD1   . PHE C 2  373  ? 28.523  -8.385  -24.869  1.00 39.30  ? 373  PHE C CD1   1 
ATOM   6131  C  CD2   . PHE C 2  373  ? 27.033  -9.863  -25.989  1.00 40.59  ? 373  PHE C CD2   1 
ATOM   6132  C  CE1   . PHE C 2  373  ? 27.475  -7.901  -24.102  1.00 38.57  ? 373  PHE C CE1   1 
ATOM   6133  C  CE2   . PHE C 2  373  ? 25.981  -9.382  -25.225  1.00 37.77  ? 373  PHE C CE2   1 
ATOM   6134  C  CZ    . PHE C 2  373  ? 26.205  -8.401  -24.281  1.00 37.86  ? 373  PHE C CZ    1 
ATOM   6135  N  N     . GLY C 2  374  ? 30.453  -11.609 -29.593  1.00 44.73  ? 374  GLY C N     1 
ATOM   6136  C  CA    . GLY C 2  374  ? 31.129  -11.558 -30.875  1.00 44.17  ? 374  GLY C CA    1 
ATOM   6137  C  C     . GLY C 2  374  ? 30.125  -11.843 -31.974  1.00 45.41  ? 374  GLY C C     1 
ATOM   6138  O  O     . GLY C 2  374  ? 30.318  -11.464 -33.128  1.00 46.82  ? 374  GLY C O     1 
ATOM   6139  N  N     . ASN C 2  375  ? 29.037  -12.509 -31.602  1.00 43.76  ? 375  ASN C N     1 
ATOM   6140  C  CA    . ASN C 2  375  ? 27.991  -12.866 -32.548  1.00 45.34  ? 375  ASN C CA    1 
ATOM   6141  C  C     . ASN C 2  375  ? 26.684  -12.160 -32.211  1.00 45.42  ? 375  ASN C C     1 
ATOM   6142  O  O     . ASN C 2  375  ? 25.713  -12.229 -32.964  1.00 50.87  ? 375  ASN C O     1 
ATOM   6143  C  CB    . ASN C 2  375  ? 27.786  -14.378 -32.564  1.00 53.48  ? 375  ASN C CB    1 
ATOM   6144  C  CG    . ASN C 2  375  ? 29.083  -15.140 -32.752  1.00 55.34  ? 375  ASN C CG    1 
ATOM   6145  O  OD1   . ASN C 2  375  ? 29.953  -14.729 -33.518  1.00 55.32  ? 375  ASN C OD1   1 
ATOM   6146  N  ND2   . ASN C 2  375  ? 29.221  -16.256 -32.047  1.00 62.37  ? 375  ASN C ND2   1 
ATOM   6147  N  N     . ARG C 2  376  ? 26.672  -11.482 -31.068  1.00 43.23  ? 376  ARG C N     1 
ATOM   6148  C  CA    . ARG C 2  376  ? 25.527  -10.684 -30.648  1.00 47.72  ? 376  ARG C CA    1 
ATOM   6149  C  C     . ARG C 2  376  ? 25.802  -9.222  -30.982  1.00 46.87  ? 376  ARG C C     1 
ATOM   6150  O  O     . ARG C 2  376  ? 26.836  -8.683  -30.590  1.00 47.49  ? 376  ARG C O     1 
ATOM   6151  C  CB    . ARG C 2  376  ? 25.264  -10.859 -29.148  1.00 51.50  ? 376  ARG C CB    1 
ATOM   6152  C  CG    . ARG C 2  376  ? 23.898  -10.371 -28.677  1.00 63.48  ? 376  ARG C CG    1 
ATOM   6153  C  CD    . ARG C 2  376  ? 22.946  -11.540 -28.490  1.00 74.85  ? 376  ARG C CD    1 
ATOM   6154  N  NE    . ARG C 2  376  ? 21.603  -11.120 -28.097  1.00 75.15  ? 376  ARG C NE    1 
ATOM   6155  C  CZ    . ARG C 2  376  ? 21.155  -11.112 -26.845  1.00 78.39  ? 376  ARG C CZ    1 
ATOM   6156  N  NH1   . ARG C 2  376  ? 21.943  -11.501 -25.852  1.00 83.18  ? 376  ARG C NH1   1 
ATOM   6157  N  NH2   . ARG C 2  376  ? 19.917  -10.718 -26.587  1.00 75.93  ? 376  ARG C NH2   1 
ATOM   6158  N  N     . ARG C 2  377  ? 24.883  -8.583  -31.700  1.00 45.08  ? 377  ARG C N     1 
ATOM   6159  C  CA    . ARG C 2  377  ? 25.109  -7.221  -32.180  1.00 43.22  ? 377  ARG C CA    1 
ATOM   6160  C  C     . ARG C 2  377  ? 24.292  -6.175  -31.419  1.00 40.33  ? 377  ARG C C     1 
ATOM   6161  O  O     . ARG C 2  377  ? 23.105  -6.361  -31.149  1.00 38.60  ? 377  ARG C O     1 
ATOM   6162  C  CB    . ARG C 2  377  ? 24.805  -7.136  -33.677  1.00 43.72  ? 377  ARG C CB    1 
ATOM   6163  C  CG    . ARG C 2  377  ? 25.177  -5.811  -34.315  1.00 42.64  ? 377  ARG C CG    1 
ATOM   6164  C  CD    . ARG C 2  377  ? 25.450  -5.966  -35.801  1.00 46.69  ? 377  ARG C CD    1 
ATOM   6165  N  NE    . ARG C 2  377  ? 25.630  -4.670  -36.445  1.00 46.56  ? 377  ARG C NE    1 
ATOM   6166  C  CZ    . ARG C 2  377  ? 24.646  -3.974  -37.003  1.00 48.44  ? 377  ARG C CZ    1 
ATOM   6167  N  NH1   . ARG C 2  377  ? 23.410  -4.455  -37.002  1.00 48.24  ? 377  ARG C NH1   1 
ATOM   6168  N  NH2   . ARG C 2  377  ? 24.896  -2.798  -37.564  1.00 53.26  ? 377  ARG C NH2   1 
ATOM   6169  N  N     . LEU C 2  378  ? 24.954  -5.074  -31.075  1.00 37.78  ? 378  LEU C N     1 
ATOM   6170  C  CA    . LEU C 2  378  ? 24.335  -3.975  -30.345  1.00 34.22  ? 378  LEU C CA    1 
ATOM   6171  C  C     . LEU C 2  378  ? 24.058  -2.819  -31.300  1.00 35.22  ? 378  LEU C C     1 
ATOM   6172  O  O     . LEU C 2  378  ? 24.898  -1.938  -31.474  1.00 36.74  ? 378  LEU C O     1 
ATOM   6173  C  CB    . LEU C 2  378  ? 25.245  -3.525  -29.191  1.00 31.38  ? 378  LEU C CB    1 
ATOM   6174  C  CG    . LEU C 2  378  ? 24.741  -2.608  -28.065  1.00 28.22  ? 378  LEU C CG    1 
ATOM   6175  C  CD1   . LEU C 2  378  ? 24.909  -1.136  -28.403  1.00 29.63  ? 378  LEU C CD1   1 
ATOM   6176  C  CD2   . LEU C 2  378  ? 23.303  -2.916  -27.678  1.00 29.85  ? 378  LEU C CD2   1 
ATOM   6177  N  N     . ARG C 2  379  ? 22.890  -2.828  -31.936  1.00 34.86  ? 379  ARG C N     1 
ATOM   6178  C  CA    . ARG C 2  379  ? 22.525  -1.730  -32.824  1.00 34.01  ? 379  ARG C CA    1 
ATOM   6179  C  C     . ARG C 2  379  ? 22.216  -0.476  -32.011  1.00 32.85  ? 379  ARG C C     1 
ATOM   6180  O  O     . ARG C 2  379  ? 21.212  -0.403  -31.304  1.00 32.52  ? 379  ARG C O     1 
ATOM   6181  C  CB    . ARG C 2  379  ? 21.337  -2.108  -33.715  1.00 33.50  ? 379  ARG C CB    1 
ATOM   6182  C  CG    . ARG C 2  379  ? 20.154  -2.723  -32.992  1.00 32.49  ? 379  ARG C CG    1 
ATOM   6183  C  CD    . ARG C 2  379  ? 18.888  -2.658  -33.839  1.00 34.71  ? 379  ARG C CD    1 
ATOM   6184  N  NE    . ARG C 2  379  ? 18.985  -3.438  -35.070  1.00 37.39  ? 379  ARG C NE    1 
ATOM   6185  C  CZ    . ARG C 2  379  ? 18.009  -3.545  -35.967  1.00 36.97  ? 379  ARG C CZ    1 
ATOM   6186  N  NH1   . ARG C 2  379  ? 16.854  -2.922  -35.770  1.00 35.63  ? 379  ARG C NH1   1 
ATOM   6187  N  NH2   . ARG C 2  379  ? 18.188  -4.277  -37.060  1.00 40.48  ? 379  ARG C NH2   1 
ATOM   6188  N  N     . THR C 2  380  ? 23.099  0.511   -32.112  1.00 31.30  ? 380  THR C N     1 
ATOM   6189  C  CA    . THR C 2  380  ? 22.984  1.722   -31.311  1.00 29.80  ? 380  THR C CA    1 
ATOM   6190  C  C     . THR C 2  380  ? 21.874  2.656   -31.792  1.00 30.84  ? 380  THR C C     1 
ATOM   6191  O  O     . THR C 2  380  ? 21.050  2.291   -32.633  1.00 30.05  ? 380  THR C O     1 
ATOM   6192  C  CB    . THR C 2  380  ? 24.315  2.499   -31.292  1.00 27.10  ? 380  THR C CB    1 
ATOM   6193  O  OG1   . THR C 2  380  ? 25.046  2.227   -32.494  1.00 26.14  ? 380  THR C OG1   1 
ATOM   6194  C  CG2   . THR C 2  380  ? 25.157  2.083   -30.098  1.00 29.69  ? 380  THR C CG2   1 
ATOM   6195  N  N     . VAL C 2  381  ? 21.865  3.862   -31.235  1.00 30.98  ? 381  VAL C N     1 
ATOM   6196  C  CA    . VAL C 2  381  ? 20.879  4.877   -31.575  1.00 28.12  ? 381  VAL C CA    1 
ATOM   6197  C  C     . VAL C 2  381  ? 20.954  5.231   -33.052  1.00 27.62  ? 381  VAL C C     1 
ATOM   6198  O  O     . VAL C 2  381  ? 19.931  5.403   -33.712  1.00 31.06  ? 381  VAL C O     1 
ATOM   6199  C  CB    . VAL C 2  381  ? 21.084  6.150   -30.735  1.00 27.23  ? 381  VAL C CB    1 
ATOM   6200  C  CG1   . VAL C 2  381  ? 19.998  7.165   -31.030  1.00 25.13  ? 381  VAL C CG1   1 
ATOM   6201  C  CG2   . VAL C 2  381  ? 21.100  5.806   -29.261  1.00 29.53  ? 381  VAL C CG2   1 
ATOM   6202  N  N     . GLY C 2  382  ? 22.174  5.320   -33.569  1.00 27.37  ? 382  GLY C N     1 
ATOM   6203  C  CA    . GLY C 2  382  ? 22.393  5.690   -34.954  1.00 28.06  ? 382  GLY C CA    1 
ATOM   6204  C  C     . GLY C 2  382  ? 21.758  4.746   -35.957  1.00 28.19  ? 382  GLY C C     1 
ATOM   6205  O  O     . GLY C 2  382  ? 21.090  5.185   -36.892  1.00 29.37  ? 382  GLY C O     1 
ATOM   6206  N  N     . GLU C 2  383  ? 21.953  3.446   -35.763  1.00 30.64  ? 383  GLU C N     1 
ATOM   6207  C  CA    . GLU C 2  383  ? 21.450  2.463   -36.715  1.00 33.55  ? 383  GLU C CA    1 
ATOM   6208  C  C     . GLU C 2  383  ? 19.932  2.342   -36.663  1.00 35.34  ? 383  GLU C C     1 
ATOM   6209  O  O     . GLU C 2  383  ? 19.275  2.268   -37.702  1.00 36.81  ? 383  GLU C O     1 
ATOM   6210  C  CB    . GLU C 2  383  ? 22.079  1.099   -36.464  1.00 34.37  ? 383  GLU C CB    1 
ATOM   6211  C  CG    . GLU C 2  383  ? 21.565  0.024   -37.398  1.00 44.03  ? 383  GLU C CG    1 
ATOM   6212  C  CD    . GLU C 2  383  ? 22.094  -1.352  -37.041  1.00 54.41  ? 383  GLU C CD    1 
ATOM   6213  O  OE1   . GLU C 2  383  ? 23.107  -1.421  -36.310  1.00 56.63  ? 383  GLU C OE1   1 
ATOM   6214  O  OE2   . GLU C 2  383  ? 21.494  -2.359  -37.481  1.00 57.27  ? 383  GLU C OE2   1 
ATOM   6215  N  N     . LEU C 2  384  ? 19.383  2.324   -35.452  1.00 32.68  ? 384  LEU C N     1 
ATOM   6216  C  CA    . LEU C 2  384  ? 17.939  2.237   -35.255  1.00 31.00  ? 384  LEU C CA    1 
ATOM   6217  C  C     . LEU C 2  384  ? 17.193  3.340   -35.995  1.00 32.82  ? 384  LEU C C     1 
ATOM   6218  O  O     . LEU C 2  384  ? 16.155  3.094   -36.614  1.00 30.36  ? 384  LEU C O     1 
ATOM   6219  C  CB    . LEU C 2  384  ? 17.605  2.296   -33.767  1.00 30.57  ? 384  LEU C CB    1 
ATOM   6220  C  CG    . LEU C 2  384  ? 17.668  0.945   -33.061  1.00 34.85  ? 384  LEU C CG    1 
ATOM   6221  C  CD1   . LEU C 2  384  ? 17.586  1.121   -31.553  1.00 35.50  ? 384  LEU C CD1   1 
ATOM   6222  C  CD2   . LEU C 2  384  ? 16.549  0.038   -33.576  1.00 34.85  ? 384  LEU C CD2   1 
ATOM   6223  N  N     . ILE C 2  385  ? 17.729  4.553   -35.927  1.00 33.47  ? 385  ILE C N     1 
ATOM   6224  C  CA    . ILE C 2  385  ? 17.168  5.678   -36.659  1.00 30.14  ? 385  ILE C CA    1 
ATOM   6225  C  C     . ILE C 2  385  ? 17.456  5.520   -38.145  1.00 30.79  ? 385  ILE C C     1 
ATOM   6226  O  O     . ILE C 2  385  ? 16.602  5.793   -38.988  1.00 32.07  ? 385  ILE C O     1 
ATOM   6227  C  CB    . ILE C 2  385  ? 17.733  7.018   -36.152  1.00 27.34  ? 385  ILE C CB    1 
ATOM   6228  C  CG1   . ILE C 2  385  ? 17.239  7.297   -34.730  1.00 27.92  ? 385  ILE C CG1   1 
ATOM   6229  C  CG2   . ILE C 2  385  ? 17.330  8.153   -37.073  1.00 32.82  ? 385  ILE C CG2   1 
ATOM   6230  C  CD1   . ILE C 2  385  ? 17.745  8.599   -34.149  1.00 26.82  ? 385  ILE C CD1   1 
ATOM   6231  N  N     . GLN C 2  386  ? 18.663  5.063   -38.454  1.00 30.96  ? 386  GLN C N     1 
ATOM   6232  C  CA    . GLN C 2  386  ? 19.060  4.827   -39.834  1.00 33.08  ? 386  GLN C CA    1 
ATOM   6233  C  C     . GLN C 2  386  ? 18.119  3.856   -40.546  1.00 36.68  ? 386  GLN C C     1 
ATOM   6234  O  O     . GLN C 2  386  ? 17.661  4.134   -41.654  1.00 37.68  ? 386  GLN C O     1 
ATOM   6235  C  CB    . GLN C 2  386  ? 20.488  4.292   -39.891  1.00 37.57  ? 386  GLN C CB    1 
ATOM   6236  C  CG    . GLN C 2  386  ? 20.873  3.750   -41.255  1.00 43.67  ? 386  GLN C CG    1 
ATOM   6237  C  CD    . GLN C 2  386  ? 22.250  3.129   -41.267  1.00 51.59  ? 386  GLN C CD    1 
ATOM   6238  O  OE1   . GLN C 2  386  ? 23.201  3.715   -41.783  1.00 57.42  ? 386  GLN C OE1   1 
ATOM   6239  N  NE2   . GLN C 2  386  ? 22.367  1.936   -40.694  1.00 48.47  ? 386  GLN C NE2   1 
ATOM   6240  N  N     . ASN C 2  387  ? 17.838  2.722   -39.908  1.00 38.60  ? 387  ASN C N     1 
ATOM   6241  C  CA    . ASN C 2  387  ? 16.954  1.714   -40.490  1.00 37.33  ? 387  ASN C CA    1 
ATOM   6242  C  C     . ASN C 2  387  ? 15.580  2.287   -40.811  1.00 39.18  ? 387  ASN C C     1 
ATOM   6243  O  O     . ASN C 2  387  ? 15.031  2.042   -41.884  1.00 41.18  ? 387  ASN C O     1 
ATOM   6244  C  CB    . ASN C 2  387  ? 16.805  0.515   -39.550  1.00 44.27  ? 387  ASN C CB    1 
ATOM   6245  C  CG    . ASN C 2  387  ? 17.991  -0.427  -39.608  1.00 42.71  ? 387  ASN C CG    1 
ATOM   6246  O  OD1   . ASN C 2  387  ? 19.069  -0.062  -40.076  1.00 40.58  ? 387  ASN C OD1   1 
ATOM   6247  N  ND2   . ASN C 2  387  ? 17.797  -1.651  -39.127  1.00 52.30  ? 387  ASN C ND2   1 
ATOM   6248  N  N     . GLN C 2  388  ? 15.032  3.052   -39.873  1.00 38.29  ? 388  GLN C N     1 
ATOM   6249  C  CA    . GLN C 2  388  ? 13.739  3.696   -40.064  1.00 37.07  ? 388  GLN C CA    1 
ATOM   6250  C  C     . GLN C 2  388  ? 13.783  4.699   -41.202  1.00 36.69  ? 388  GLN C C     1 
ATOM   6251  O  O     . GLN C 2  388  ? 12.818  4.843   -41.949  1.00 38.30  ? 388  GLN C O     1 
ATOM   6252  C  CB    . GLN C 2  388  ? 13.294  4.386   -38.778  1.00 36.55  ? 388  GLN C CB    1 
ATOM   6253  C  CG    . GLN C 2  388  ? 12.634  3.452   -37.795  1.00 37.33  ? 388  GLN C CG    1 
ATOM   6254  C  CD    . GLN C 2  388  ? 11.331  2.891   -38.328  1.00 45.48  ? 388  GLN C CD    1 
ATOM   6255  O  OE1   . GLN C 2  388  ? 10.377  3.632   -38.568  1.00 53.70  ? 388  GLN C OE1   1 
ATOM   6256  N  NE2   . GLN C 2  388  ? 11.289  1.579   -38.532  1.00 49.31  ? 388  GLN C NE2   1 
ATOM   6257  N  N     . ILE C 2  389  ? 14.907  5.398   -41.318  1.00 34.46  ? 389  ILE C N     1 
ATOM   6258  C  CA    . ILE C 2  389  ? 15.121  6.334   -42.411  1.00 33.52  ? 389  ILE C CA    1 
ATOM   6259  C  C     . ILE C 2  389  ? 15.193  5.581   -43.733  1.00 38.95  ? 389  ILE C C     1 
ATOM   6260  O  O     . ILE C 2  389  ? 14.652  6.026   -44.743  1.00 42.45  ? 389  ILE C O     1 
ATOM   6261  C  CB    . ILE C 2  389  ? 16.406  7.159   -42.206  1.00 28.75  ? 389  ILE C CB    1 
ATOM   6262  C  CG1   . ILE C 2  389  ? 16.190  8.206   -41.113  1.00 29.13  ? 389  ILE C CG1   1 
ATOM   6263  C  CG2   . ILE C 2  389  ? 16.828  7.836   -43.499  1.00 29.56  ? 389  ILE C CG2   1 
ATOM   6264  C  CD1   . ILE C 2  389  ? 17.329  9.183   -40.968  1.00 31.60  ? 389  ILE C CD1   1 
ATOM   6265  N  N     . ARG C 2  390  ? 15.852  4.429   -43.714  1.00 45.83  ? 390  ARG C N     1 
ATOM   6266  C  CA    . ARG C 2  390  ? 15.945  3.590   -44.901  1.00 47.05  ? 390  ARG C CA    1 
ATOM   6267  C  C     . ARG C 2  390  ? 14.562  3.092   -45.316  1.00 48.07  ? 390  ARG C C     1 
ATOM   6268  O  O     . ARG C 2  390  ? 14.272  2.964   -46.505  1.00 50.79  ? 390  ARG C O     1 
ATOM   6269  C  CB    . ARG C 2  390  ? 16.890  2.412   -44.655  1.00 51.33  ? 390  ARG C CB    1 
ATOM   6270  C  CG    . ARG C 2  390  ? 17.076  1.489   -45.855  1.00 63.37  ? 390  ARG C CG    1 
ATOM   6271  C  CD    . ARG C 2  390  ? 18.188  0.469   -45.626  1.00 63.09  ? 390  ARG C CD    1 
ATOM   6272  N  NE    . ARG C 2  390  ? 19.496  1.105   -45.497  1.00 64.42  ? 390  ARG C NE    1 
ATOM   6273  C  CZ    . ARG C 2  390  ? 20.106  1.338   -44.339  1.00 60.99  ? 390  ARG C CZ    1 
ATOM   6274  N  NH1   . ARG C 2  390  ? 19.528  0.981   -43.199  1.00 56.08  ? 390  ARG C NH1   1 
ATOM   6275  N  NH2   . ARG C 2  390  ? 21.294  1.926   -44.320  1.00 61.20  ? 390  ARG C NH2   1 
ATOM   6276  N  N     . VAL C 2  391  ? 13.709  2.827   -44.329  1.00 45.45  ? 391  VAL C N     1 
ATOM   6277  C  CA    . VAL C 2  391  ? 12.341  2.390   -44.593  1.00 48.98  ? 391  VAL C CA    1 
ATOM   6278  C  C     . VAL C 2  391  ? 11.564  3.448   -45.374  1.00 51.61  ? 391  VAL C C     1 
ATOM   6279  O  O     . VAL C 2  391  ? 10.900  3.142   -46.367  1.00 54.59  ? 391  VAL C O     1 
ATOM   6280  C  CB    . VAL C 2  391  ? 11.587  2.064   -43.283  1.00 53.33  ? 391  VAL C CB    1 
ATOM   6281  C  CG1   . VAL C 2  391  ? 10.088  1.952   -43.538  1.00 70.82  ? 391  VAL C CG1   1 
ATOM   6282  C  CG2   . VAL C 2  391  ? 12.130  0.784   -42.653  1.00 52.98  ? 391  VAL C CG2   1 
ATOM   6283  N  N     . GLY C 2  392  ? 11.661  4.695   -44.926  1.00 52.99  ? 392  GLY C N     1 
ATOM   6284  C  CA    . GLY C 2  392  ? 10.967  5.794   -45.573  1.00 60.47  ? 392  GLY C CA    1 
ATOM   6285  C  C     . GLY C 2  392  ? 11.459  6.074   -46.981  1.00 62.39  ? 392  GLY C C     1 
ATOM   6286  O  O     . GLY C 2  392  ? 10.661  6.388   -47.867  1.00 64.92  ? 392  GLY C O     1 
ATOM   6287  N  N     . MET C 2  393  ? 12.770  5.962   -47.188  1.00 61.45  ? 393  MET C N     1 
ATOM   6288  C  CA    . MET C 2  393  ? 13.379  6.230   -48.491  1.00 62.44  ? 393  MET C CA    1 
ATOM   6289  C  C     . MET C 2  393  ? 12.973  5.174   -49.510  1.00 65.06  ? 393  MET C C     1 
ATOM   6290  O  O     . MET C 2  393  ? 12.919  5.439   -50.713  1.00 68.23  ? 393  MET C O     1 
ATOM   6291  C  CB    . MET C 2  393  ? 14.908  6.283   -48.385  1.00 54.47  ? 393  MET C CB    1 
ATOM   6292  C  CG    . MET C 2  393  ? 15.450  7.364   -47.456  1.00 51.04  ? 393  MET C CG    1 
ATOM   6293  S  SD    . MET C 2  393  ? 15.026  9.050   -47.943  1.00 50.31  ? 393  MET C SD    1 
ATOM   6294  C  CE    . MET C 2  393  ? 16.077  9.274   -49.374  1.00 55.29  ? 393  MET C CE    1 
ATOM   6295  N  N     . SER C 2  394  ? 12.706  3.969   -49.017  1.00 64.71  ? 394  SER C N     1 
ATOM   6296  C  CA    . SER C 2  394  ? 12.264  2.870   -49.866  1.00 71.63  ? 394  SER C CA    1 
ATOM   6297  C  C     . SER C 2  394  ? 10.819  3.086   -50.286  1.00 68.68  ? 394  SER C C     1 
ATOM   6298  O  O     . SER C 2  394  ? 10.389  2.628   -51.346  1.00 77.59  ? 394  SER C O     1 
ATOM   6299  C  CB    . SER C 2  394  ? 12.402  1.535   -49.136  1.00 76.05  ? 394  SER C CB    1 
ATOM   6300  O  OG    . SER C 2  394  ? 11.558  1.506   -47.996  1.00 74.24  ? 394  SER C OG    1 
ATOM   6301  N  N     . ARG C 2  395  ? 10.073  3.788   -49.442  1.00 64.62  ? 395  ARG C N     1 
ATOM   6302  C  CA    . ARG C 2  395  ? 8.674   4.065   -49.728  1.00 67.99  ? 395  ARG C CA    1 
ATOM   6303  C  C     . ARG C 2  395  ? 8.528   5.230   -50.699  1.00 73.75  ? 395  ARG C C     1 
ATOM   6304  O  O     . ARG C 2  395  ? 7.639   5.224   -51.549  1.00 81.47  ? 395  ARG C O     1 
ATOM   6305  C  CB    . ARG C 2  395  ? 7.905   4.360   -48.441  1.00 67.20  ? 395  ARG C CB    1 
ATOM   6306  C  CG    . ARG C 2  395  ? 7.632   3.139   -47.581  1.00 72.45  ? 395  ARG C CG    1 
ATOM   6307  C  CD    . ARG C 2  395  ? 6.495   3.418   -46.608  1.00 86.11  ? 395  ARG C CD    1 
ATOM   6308  N  NE    . ARG C 2  395  ? 6.187   2.269   -45.762  1.00 82.01  ? 395  ARG C NE    1 
ATOM   6309  C  CZ    . ARG C 2  395  ? 6.279   2.270   -44.435  1.00 76.24  ? 395  ARG C CZ    1 
ATOM   6310  N  NH1   . ARG C 2  395  ? 6.668   3.367   -43.794  1.00 69.65  ? 395  ARG C NH1   1 
ATOM   6311  N  NH2   . ARG C 2  395  ? 5.975   1.173   -43.749  1.00 74.97  ? 395  ARG C NH2   1 
ATOM   6312  N  N     . MET C 2  396  ? 9.405   6.223   -50.580  1.00 76.47  ? 396  MET C N     1 
ATOM   6313  C  CA    . MET C 2  396  ? 9.316   7.407   -51.427  1.00 82.83  ? 396  MET C CA    1 
ATOM   6314  C  C     . MET C 2  396  ? 10.072  7.205   -52.740  1.00 78.65  ? 396  MET C C     1 
ATOM   6315  O  O     . MET C 2  396  ? 9.929   7.997   -53.669  1.00 81.85  ? 396  MET C O     1 
ATOM   6316  C  CB    . MET C 2  396  ? 9.846   8.642   -50.693  1.00 70.70  ? 396  MET C CB    1 
ATOM   6317  C  CG    . MET C 2  396  ? 11.354  8.803   -50.741  1.00 66.06  ? 396  MET C CG    1 
ATOM   6318  S  SD    . MET C 2  396  ? 11.808  10.531  -50.966  1.00 61.05  ? 396  MET C SD    1 
ATOM   6319  C  CE    . MET C 2  396  ? 10.818  10.930  -52.404  1.00 66.82  ? 396  MET C CE    1 
ATOM   6320  N  N     . GLU C 2  397  ? 10.882  6.152   -52.807  1.00 73.06  ? 397  GLU C N     1 
ATOM   6321  C  CA    . GLU C 2  397  ? 11.509  5.752   -54.062  1.00 77.23  ? 397  GLU C CA    1 
ATOM   6322  C  C     . GLU C 2  397  ? 10.440  5.191   -54.992  1.00 80.84  ? 397  GLU C C     1 
ATOM   6323  O  O     . GLU C 2  397  ? 10.503  5.357   -56.211  1.00 85.57  ? 397  GLU C O     1 
ATOM   6324  C  CB    . GLU C 2  397  ? 12.605  4.709   -53.824  1.00 79.70  ? 397  GLU C CB    1 
ATOM   6325  C  CG    . GLU C 2  397  ? 13.323  4.260   -55.093  1.00 96.44  ? 397  GLU C CG    1 
ATOM   6326  C  CD    . GLU C 2  397  ? 14.149  2.994   -54.891  1.00 106.80 ? 397  GLU C CD    1 
ATOM   6327  O  OE1   . GLU C 2  397  ? 15.225  2.877   -55.521  1.00 128.31 ? 397  GLU C OE1   1 
ATOM   6328  O  OE2   . GLU C 2  397  ? 13.722  2.120   -54.104  1.00 92.68  ? 397  GLU C OE2   1 
ATOM   6329  N  N     . ARG C 2  398  ? 9.455   4.527   -54.393  1.00 79.13  ? 398  ARG C N     1 
ATOM   6330  C  CA    . ARG C 2  398  ? 8.336   3.936   -55.120  1.00 79.55  ? 398  ARG C CA    1 
ATOM   6331  C  C     . ARG C 2  398  ? 7.462   5.032   -55.722  1.00 83.41  ? 398  ARG C C     1 
ATOM   6332  O  O     . ARG C 2  398  ? 6.957   4.898   -56.837  1.00 96.17  ? 398  ARG C O     1 
ATOM   6333  C  CB    . ARG C 2  398  ? 7.506   3.042   -54.187  1.00 84.48  ? 398  ARG C CB    1 
ATOM   6334  C  CG    . ARG C 2  398  ? 7.122   1.677   -54.759  1.00 82.08  ? 398  ARG C CG    1 
ATOM   6335  C  CD    . ARG C 2  398  ? 6.124   0.955   -53.856  1.00 86.33  ? 398  ARG C CD    1 
ATOM   6336  N  NE    . ARG C 2  398  ? 4.834   1.640   -53.816  1.00 101.47 ? 398  ARG C NE    1 
ATOM   6337  C  CZ    . ARG C 2  398  ? 3.722   1.190   -54.390  1.00 102.02 ? 398  ARG C CZ    1 
ATOM   6338  N  NH1   . ARG C 2  398  ? 2.597   1.892   -54.298  1.00 98.75  ? 398  ARG C NH1   1 
ATOM   6339  N  NH2   . ARG C 2  398  ? 3.732   0.037   -55.050  1.00 93.70  ? 398  ARG C NH2   1 
ATOM   6340  N  N     . VAL C 2  399  ? 7.283   6.113   -54.969  1.00 83.60  ? 399  VAL C N     1 
ATOM   6341  C  CA    . VAL C 2  399  ? 6.562   7.283   -55.456  1.00 93.65  ? 399  VAL C CA    1 
ATOM   6342  C  C     . VAL C 2  399  ? 7.386   7.980   -56.538  1.00 93.99  ? 399  VAL C C     1 
ATOM   6343  O  O     . VAL C 2  399  ? 6.839   8.498   -57.514  1.00 98.52  ? 399  VAL C O     1 
ATOM   6344  C  CB    . VAL C 2  399  ? 6.238   8.270   -54.307  1.00 101.81 ? 399  VAL C CB    1 
ATOM   6345  C  CG1   . VAL C 2  399  ? 5.690   9.587   -54.849  1.00 96.47  ? 399  VAL C CG1   1 
ATOM   6346  C  CG2   . VAL C 2  399  ? 5.253   7.637   -53.323  1.00 99.45  ? 399  VAL C CG2   1 
ATOM   6347  N  N     . VAL C 2  400  ? 8.706   7.975   -56.365  1.00 87.90  ? 400  VAL C N     1 
ATOM   6348  C  CA    . VAL C 2  400  ? 9.611   8.513   -57.376  1.00 90.68  ? 400  VAL C CA    1 
ATOM   6349  C  C     . VAL C 2  400  ? 9.451   7.770   -58.699  1.00 95.69  ? 400  VAL C C     1 
ATOM   6350  O  O     . VAL C 2  400  ? 9.248   8.389   -59.744  1.00 97.85  ? 400  VAL C O     1 
ATOM   6351  C  CB    . VAL C 2  400  ? 11.093  8.441   -56.924  1.00 96.49  ? 400  VAL C CB    1 
ATOM   6352  C  CG1   . VAL C 2  400  ? 12.031  8.448   -58.129  1.00 96.24  ? 400  VAL C CG1   1 
ATOM   6353  C  CG2   . VAL C 2  400  ? 11.424  9.593   -55.986  1.00 102.11 ? 400  VAL C CG2   1 
ATOM   6354  N  N     . ARG C 2  401  ? 9.523   6.443   -58.649  1.00 94.54  ? 401  ARG C N     1 
ATOM   6355  C  CA    . ARG C 2  401  ? 9.469   5.633   -59.863  1.00 99.82  ? 401  ARG C CA    1 
ATOM   6356  C  C     . ARG C 2  401  ? 8.083   5.640   -60.498  1.00 101.98 ? 401  ARG C C     1 
ATOM   6357  O  O     . ARG C 2  401  ? 7.939   5.394   -61.696  1.00 104.01 ? 401  ARG C O     1 
ATOM   6358  C  CB    . ARG C 2  401  ? 9.912   4.197   -59.567  1.00 94.49  ? 401  ARG C CB    1 
ATOM   6359  C  CG    . ARG C 2  401  ? 11.416  4.050   -59.409  1.00 97.19  ? 401  ARG C CG    1 
ATOM   6360  C  CD    . ARG C 2  401  ? 11.823  2.611   -59.153  1.00 90.05  ? 401  ARG C CD    1 
ATOM   6361  N  NE    . ARG C 2  401  ? 13.272  2.444   -59.221  1.00 101.31 ? 401  ARG C NE    1 
ATOM   6362  C  CZ    . ARG C 2  401  ? 13.915  1.337   -58.866  1.00 105.71 ? 401  ARG C CZ    1 
ATOM   6363  N  NH1   . ARG C 2  401  ? 13.238  0.292   -58.408  1.00 107.78 ? 401  ARG C NH1   1 
ATOM   6364  N  NH2   . ARG C 2  401  ? 15.237  1.275   -58.965  1.00 109.93 ? 401  ARG C NH2   1 
ATOM   6365  N  N     . GLU C 2  402  ? 7.066   5.930   -59.695  1.00 104.47 ? 402  GLU C N     1 
ATOM   6366  C  CA    . GLU C 2  402  ? 5.707   6.038   -60.207  1.00 112.72 ? 402  GLU C CA    1 
ATOM   6367  C  C     . GLU C 2  402  ? 5.480   7.412   -60.831  1.00 109.69 ? 402  GLU C C     1 
ATOM   6368  O  O     . GLU C 2  402  ? 4.779   7.538   -61.834  1.00 114.68 ? 402  GLU C O     1 
ATOM   6369  C  CB    . GLU C 2  402  ? 4.688   5.780   -59.094  1.00 118.80 ? 402  GLU C CB    1 
ATOM   6370  C  CG    . GLU C 2  402  ? 3.241   5.744   -59.567  1.00 124.60 ? 402  GLU C CG    1 
ATOM   6371  C  CD    . GLU C 2  402  ? 2.984   4.677   -60.623  1.00 114.35 ? 402  GLU C CD    1 
ATOM   6372  O  OE1   . GLU C 2  402  ? 3.597   3.588   -60.548  1.00 106.11 ? 402  GLU C OE1   1 
ATOM   6373  O  OE2   . GLU C 2  402  ? 2.172   4.937   -61.537  1.00 116.24 ? 402  GLU C OE2   1 
ATOM   6374  N  N     . ARG C 2  403  ? 6.079   8.441   -60.238  1.00 108.94 ? 403  ARG C N     1 
ATOM   6375  C  CA    . ARG C 2  403  ? 5.968   9.796   -60.770  1.00 113.22 ? 403  ARG C CA    1 
ATOM   6376  C  C     . ARG C 2  403  ? 6.981   10.040  -61.893  1.00 121.69 ? 403  ARG C C     1 
ATOM   6377  O  O     . ARG C 2  403  ? 7.053   11.140  -62.440  1.00 137.17 ? 403  ARG C O     1 
ATOM   6378  C  CB    . ARG C 2  403  ? 6.157   10.837  -59.659  1.00 109.75 ? 403  ARG C CB    1 
ATOM   6379  C  CG    . ARG C 2  403  ? 4.967   10.995  -58.714  1.00 101.77 ? 403  ARG C CG    1 
ATOM   6380  C  CD    . ARG C 2  403  ? 5.193   12.159  -57.750  1.00 99.08  ? 403  ARG C CD    1 
ATOM   6381  N  NE    . ARG C 2  403  ? 4.065   12.373  -56.845  1.00 96.89  ? 403  ARG C NE    1 
ATOM   6382  C  CZ    . ARG C 2  403  ? 4.028   13.318  -55.910  1.00 94.86  ? 403  ARG C CZ    1 
ATOM   6383  N  NH1   . ARG C 2  403  ? 5.058   14.141  -55.753  1.00 87.12  ? 403  ARG C NH1   1 
ATOM   6384  N  NH2   . ARG C 2  403  ? 2.961   13.443  -55.130  1.00 96.95  ? 403  ARG C NH2   1 
ATOM   6385  N  N     . MET C 2  404  ? 7.762   9.018   -62.235  1.00 114.58 ? 404  MET C N     1 
ATOM   6386  C  CA    . MET C 2  404  ? 8.731   9.133   -63.325  1.00 114.68 ? 404  MET C CA    1 
ATOM   6387  C  C     . MET C 2  404  ? 8.134   8.706   -64.663  1.00 121.48 ? 404  MET C C     1 
ATOM   6388  O  O     . MET C 2  404  ? 8.503   9.237   -65.712  1.00 123.53 ? 404  MET C O     1 
ATOM   6389  C  CB    . MET C 2  404  ? 9.980   8.299   -63.037  1.00 105.46 ? 404  MET C CB    1 
ATOM   6390  C  CG    . MET C 2  404  ? 11.015  8.982   -62.156  1.00 106.64 ? 404  MET C CG    1 
ATOM   6391  S  SD    . MET C 2  404  ? 12.617  8.163   -62.263  1.00 122.06 ? 404  MET C SD    1 
ATOM   6392  C  CE    . MET C 2  404  ? 12.114  6.443   -62.245  1.00 127.63 ? 404  MET C CE    1 
ATOM   6393  N  N     . THR C 2  405  ? 7.215   7.747   -64.625  1.00 115.33 ? 405  THR C N     1 
ATOM   6394  C  CA    . THR C 2  405  ? 6.610   7.230   -65.846  1.00 115.76 ? 405  THR C CA    1 
ATOM   6395  C  C     . THR C 2  405  ? 5.372   8.031   -66.254  1.00 111.92 ? 405  THR C C     1 
ATOM   6396  O  O     . THR C 2  405  ? 5.035   8.103   -67.436  1.00 108.75 ? 405  THR C O     1 
ATOM   6397  C  CB    . THR C 2  405  ? 6.235   5.742   -65.694  1.00 119.93 ? 405  THR C CB    1 
ATOM   6398  O  OG1   . THR C 2  405  ? 5.305   5.586   -64.616  1.00 120.53 ? 405  THR C OG1   1 
ATOM   6399  C  CG2   . THR C 2  405  ? 7.476   4.906   -65.411  1.00 118.36 ? 405  THR C CG2   1 
ATOM   6400  N  N     . THR C 2  406  ? 4.708   8.643   -65.278  1.00 111.87 ? 406  THR C N     1 
ATOM   6401  C  CA    . THR C 2  406  ? 3.520   9.451   -65.548  1.00 117.84 ? 406  THR C CA    1 
ATOM   6402  C  C     . THR C 2  406  ? 3.866   10.743  -66.280  1.00 117.19 ? 406  THR C C     1 
ATOM   6403  O  O     . THR C 2  406  ? 3.445   10.962  -67.416  1.00 117.40 ? 406  THR C O     1 
ATOM   6404  C  CB    . THR C 2  406  ? 2.772   9.814   -64.249  1.00 123.31 ? 406  THR C CB    1 
ATOM   6405  O  OG1   . THR C 2  406  ? 2.314   8.619   -63.606  1.00 129.73 ? 406  THR C OG1   1 
ATOM   6406  C  CG2   . THR C 2  406  ? 1.576   10.711  -64.553  1.00 122.68 ? 406  THR C CG2   1 
ATOM   6407  N  N     . GLN C 2  407  ? 4.632   11.598  -65.611  1.00 119.82 ? 407  GLN C N     1 
ATOM   6408  C  CA    . GLN C 2  407  ? 5.017   12.893  -66.159  1.00 125.70 ? 407  GLN C CA    1 
ATOM   6409  C  C     . GLN C 2  407  ? 5.911   12.750  -67.389  1.00 129.53 ? 407  GLN C C     1 
ATOM   6410  O  O     . GLN C 2  407  ? 6.581   11.732  -67.569  1.00 128.29 ? 407  GLN C O     1 
ATOM   6411  C  CB    . GLN C 2  407  ? 5.726   13.721  -65.088  1.00 127.43 ? 407  GLN C CB    1 
ATOM   6412  C  CG    . GLN C 2  407  ? 4.957   13.810  -63.780  1.00 124.59 ? 407  GLN C CG    1 
ATOM   6413  C  CD    . GLN C 2  407  ? 5.868   13.978  -62.577  1.00 121.45 ? 407  GLN C CD    1 
ATOM   6414  O  OE1   . GLN C 2  407  ? 7.060   14.251  -62.721  1.00 120.57 ? 407  GLN C OE1   1 
ATOM   6415  N  NE2   . GLN C 2  407  ? 5.310   13.804  -61.382  1.00 117.78 ? 407  GLN C NE2   1 
ATOM   6416  N  N     . ASP C 2  408  ? 5.917   13.779  -68.230  1.00 135.63 ? 408  ASP C N     1 
ATOM   6417  C  CA    . ASP C 2  408  ? 6.722   13.780  -69.447  1.00 135.93 ? 408  ASP C CA    1 
ATOM   6418  C  C     . ASP C 2  408  ? 8.196   14.051  -69.156  1.00 129.99 ? 408  ASP C C     1 
ATOM   6419  O  O     . ASP C 2  408  ? 8.540   14.616  -68.121  1.00 128.31 ? 408  ASP C O     1 
ATOM   6420  C  CB    . ASP C 2  408  ? 6.182   14.814  -70.436  1.00 141.30 ? 408  ASP C CB    1 
ATOM   6421  C  CG    . ASP C 2  408  ? 5.735   16.093  -69.754  1.00 146.51 ? 408  ASP C CG    1 
ATOM   6422  O  OD1   . ASP C 2  408  ? 5.102   16.008  -68.679  1.00 144.33 ? 408  ASP C OD1   1 
ATOM   6423  O  OD2   . ASP C 2  408  ? 6.020   17.183  -70.290  1.00 153.53 ? 408  ASP C OD2   1 
ATOM   6424  N  N     . VAL C 2  409  ? 9.051   13.646  -70.090  1.00 126.30 ? 409  VAL C N     1 
ATOM   6425  C  CA    . VAL C 2  409  ? 10.504  13.723  -69.939  1.00 128.59 ? 409  VAL C CA    1 
ATOM   6426  C  C     . VAL C 2  409  ? 11.023  15.130  -69.637  1.00 134.23 ? 409  VAL C C     1 
ATOM   6427  O  O     . VAL C 2  409  ? 11.932  15.306  -68.822  1.00 135.51 ? 409  VAL C O     1 
ATOM   6428  C  CB    . VAL C 2  409  ? 11.211  13.200  -71.217  1.00 126.19 ? 409  VAL C CB    1 
ATOM   6429  C  CG1   . VAL C 2  409  ? 12.709  13.490  -71.176  1.00 122.76 ? 409  VAL C CG1   1 
ATOM   6430  C  CG2   . VAL C 2  409  ? 10.957  11.710  -71.393  1.00 134.79 ? 409  VAL C CG2   1 
ATOM   6431  N  N     . GLU C 2  410  ? 10.432  16.127  -70.286  1.00 138.06 ? 410  GLU C N     1 
ATOM   6432  C  CA    . GLU C 2  410  ? 10.967  17.487  -70.249  1.00 147.59 ? 410  GLU C CA    1 
ATOM   6433  C  C     . GLU C 2  410  ? 10.509  18.326  -69.054  1.00 146.98 ? 410  GLU C C     1 
ATOM   6434  O  O     . GLU C 2  410  ? 11.154  19.317  -68.708  1.00 145.42 ? 410  GLU C O     1 
ATOM   6435  C  CB    . GLU C 2  410  ? 10.608  18.218  -71.545  1.00 154.30 ? 410  GLU C CB    1 
ATOM   6436  C  CG    . GLU C 2  410  ? 11.464  17.807  -72.729  1.00 148.77 ? 410  GLU C CG    1 
ATOM   6437  C  CD    . GLU C 2  410  ? 12.935  18.097  -72.500  1.00 133.36 ? 410  GLU C CD    1 
ATOM   6438  O  OE1   . GLU C 2  410  ? 13.757  17.173  -72.673  1.00 126.17 ? 410  GLU C OE1   1 
ATOM   6439  O  OE2   . GLU C 2  410  ? 13.267  19.248  -72.143  1.00 129.14 ? 410  GLU C OE2   1 
ATOM   6440  N  N     . ALA C 2  411  ? 9.403   17.940  -68.428  1.00 142.64 ? 411  ALA C N     1 
ATOM   6441  C  CA    . ALA C 2  411  ? 8.860   18.717  -67.316  1.00 139.54 ? 411  ALA C CA    1 
ATOM   6442  C  C     . ALA C 2  411  ? 9.230   18.122  -65.960  1.00 129.57 ? 411  ALA C C     1 
ATOM   6443  O  O     . ALA C 2  411  ? 8.612   18.446  -64.945  1.00 119.32 ? 411  ALA C O     1 
ATOM   6444  C  CB    . ALA C 2  411  ? 7.349   18.831  -67.443  1.00 146.70 ? 411  ALA C CB    1 
ATOM   6445  N  N     . ILE C 2  412  ? 10.241  17.260  -65.944  1.00 130.29 ? 412  ILE C N     1 
ATOM   6446  C  CA    . ILE C 2  412  ? 10.629  16.578  -64.714  1.00 121.22 ? 412  ILE C CA    1 
ATOM   6447  C  C     . ILE C 2  412  ? 11.745  17.297  -63.960  1.00 109.50 ? 412  ILE C C     1 
ATOM   6448  O  O     . ILE C 2  412  ? 12.890  17.361  -64.413  1.00 102.16 ? 412  ILE C O     1 
ATOM   6449  C  CB    . ILE C 2  412  ? 11.067  15.125  -64.992  1.00 116.01 ? 412  ILE C CB    1 
ATOM   6450  C  CG1   . ILE C 2  412  ? 9.852   14.264  -65.336  1.00 117.75 ? 412  ILE C CG1   1 
ATOM   6451  C  CG2   . ILE C 2  412  ? 11.768  14.537  -63.779  1.00 108.55 ? 412  ILE C CG2   1 
ATOM   6452  C  CD1   . ILE C 2  412  ? 10.192  12.831  -65.685  1.00 118.19 ? 412  ILE C CD1   1 
ATOM   6453  N  N     . THR C 2  413  ? 11.381  17.860  -62.813  1.00 107.85 ? 413  THR C N     1 
ATOM   6454  C  CA    . THR C 2  413  ? 12.345  18.336  -61.833  1.00 98.04  ? 413  THR C CA    1 
ATOM   6455  C  C     . THR C 2  413  ? 12.329  17.352  -60.674  1.00 92.52  ? 413  THR C C     1 
ATOM   6456  O  O     . THR C 2  413  ? 11.346  16.635  -60.489  1.00 92.40  ? 413  THR C O     1 
ATOM   6457  C  CB    . THR C 2  413  ? 12.013  19.755  -61.319  1.00 98.40  ? 413  THR C CB    1 
ATOM   6458  O  OG1   . THR C 2  413  ? 10.851  19.707  -60.480  1.00 89.64  ? 413  THR C OG1   1 
ATOM   6459  C  CG2   . THR C 2  413  ? 11.768  20.710  -62.474  1.00 113.64 ? 413  THR C CG2   1 
ATOM   6460  N  N     . PRO C 2  414  ? 13.416  17.298  -59.892  1.00 88.58  ? 414  PRO C N     1 
ATOM   6461  C  CA    . PRO C 2  414  ? 13.338  16.487  -58.674  1.00 86.88  ? 414  PRO C CA    1 
ATOM   6462  C  C     . PRO C 2  414  ? 12.283  17.018  -57.702  1.00 89.46  ? 414  PRO C C     1 
ATOM   6463  O  O     . PRO C 2  414  ? 11.848  16.281  -56.820  1.00 96.37  ? 414  PRO C O     1 
ATOM   6464  C  CB    . PRO C 2  414  ? 14.747  16.601  -58.078  1.00 83.32  ? 414  PRO C CB    1 
ATOM   6465  C  CG    . PRO C 2  414  ? 15.367  17.782  -58.746  1.00 81.83  ? 414  PRO C CG    1 
ATOM   6466  C  CD    . PRO C 2  414  ? 14.768  17.833  -60.114  1.00 85.78  ? 414  PRO C CD    1 
ATOM   6467  N  N     . GLN C 2  415  ? 11.867  18.271  -57.876  1.00 86.68  ? 415  GLN C N     1 
ATOM   6468  C  CA    . GLN C 2  415  ? 10.844  18.867  -57.020  1.00 86.63  ? 415  GLN C CA    1 
ATOM   6469  C  C     . GLN C 2  415  ? 9.444   18.341  -57.337  1.00 86.51  ? 415  GLN C C     1 
ATOM   6470  O  O     . GLN C 2  415  ? 8.494   18.605  -56.600  1.00 82.76  ? 415  GLN C O     1 
ATOM   6471  C  CB    . GLN C 2  415  ? 10.864  20.396  -57.139  1.00 88.84  ? 415  GLN C CB    1 
ATOM   6472  C  CG    . GLN C 2  415  ? 12.000  21.078  -56.381  1.00 83.34  ? 415  GLN C CG    1 
ATOM   6473  C  CD    . GLN C 2  415  ? 11.907  20.889  -54.877  1.00 76.52  ? 415  GLN C CD    1 
ATOM   6474  O  OE1   . GLN C 2  415  ? 10.914  20.379  -54.364  1.00 79.11  ? 415  GLN C OE1   1 
ATOM   6475  N  NE2   . GLN C 2  415  ? 12.948  21.301  -54.163  1.00 73.82  ? 415  GLN C NE2   1 
ATOM   6476  N  N     . THR C 2  416  ? 9.321   17.597  -58.431  1.00 90.76  ? 416  THR C N     1 
ATOM   6477  C  CA    . THR C 2  416  ? 8.038   17.019  -58.815  1.00 99.88  ? 416  THR C CA    1 
ATOM   6478  C  C     . THR C 2  416  ? 8.029   15.507  -58.604  1.00 94.66  ? 416  THR C C     1 
ATOM   6479  O  O     . THR C 2  416  ? 6.968   14.896  -58.470  1.00 96.18  ? 416  THR C O     1 
ATOM   6480  C  CB    . THR C 2  416  ? 7.691   17.334  -60.285  1.00 106.26 ? 416  THR C CB    1 
ATOM   6481  O  OG1   . THR C 2  416  ? 8.806   17.011  -61.126  1.00 108.64 ? 416  THR C OG1   1 
ATOM   6482  C  CG2   . THR C 2  416  ? 7.352   18.811  -60.450  1.00 99.72  ? 416  THR C CG2   1 
ATOM   6483  N  N     . LEU C 2  417  ? 9.218   14.915  -58.565  1.00 88.15  ? 417  LEU C N     1 
ATOM   6484  C  CA    . LEU C 2  417  ? 9.367   13.479  -58.354  1.00 86.77  ? 417  LEU C CA    1 
ATOM   6485  C  C     . LEU C 2  417  ? 9.242   13.107  -56.883  1.00 87.21  ? 417  LEU C C     1 
ATOM   6486  O  O     . LEU C 2  417  ? 8.840   11.994  -56.539  1.00 89.37  ? 417  LEU C O     1 
ATOM   6487  C  CB    . LEU C 2  417  ? 10.724  13.001  -58.874  1.00 88.54  ? 417  LEU C CB    1 
ATOM   6488  C  CG    . LEU C 2  417  ? 11.078  13.262  -60.334  1.00 98.62  ? 417  LEU C CG    1 
ATOM   6489  C  CD1   . LEU C 2  417  ? 12.535  12.912  -60.584  1.00 103.61 ? 417  LEU C CD1   1 
ATOM   6490  C  CD2   . LEU C 2  417  ? 10.167  12.456  -61.239  1.00 107.75 ? 417  LEU C CD2   1 
ATOM   6491  N  N     . ILE C 2  418  ? 9.594   14.050  -56.018  1.00 82.11  ? 418  ILE C N     1 
ATOM   6492  C  CA    . ILE C 2  418  ? 9.824   13.752  -54.612  1.00 75.72  ? 418  ILE C CA    1 
ATOM   6493  C  C     . ILE C 2  418  ? 8.629   14.036  -53.703  1.00 64.64  ? 418  ILE C C     1 
ATOM   6494  O  O     . ILE C 2  418  ? 8.124   15.157  -53.641  1.00 63.10  ? 418  ILE C O     1 
ATOM   6495  C  CB    . ILE C 2  418  ? 11.050  14.537  -54.096  1.00 79.29  ? 418  ILE C CB    1 
ATOM   6496  C  CG1   . ILE C 2  418  ? 12.332  13.969  -54.712  1.00 75.76  ? 418  ILE C CG1   1 
ATOM   6497  C  CG2   . ILE C 2  418  ? 11.123  14.496  -52.582  1.00 69.15  ? 418  ILE C CG2   1 
ATOM   6498  C  CD1   . ILE C 2  418  ? 13.587  14.720  -54.328  1.00 77.23  ? 418  ILE C CD1   1 
ATOM   6499  N  N     . ASN C 2  419  ? 8.181   12.995  -53.009  1.00 64.21  ? 419  ASN C N     1 
ATOM   6500  C  CA    . ASN C 2  419  ? 7.217   13.132  -51.929  1.00 61.08  ? 419  ASN C CA    1 
ATOM   6501  C  C     . ASN C 2  419  ? 7.891   12.743  -50.618  1.00 56.57  ? 419  ASN C C     1 
ATOM   6502  O  O     . ASN C 2  419  ? 8.162   11.567  -50.381  1.00 54.44  ? 419  ASN C O     1 
ATOM   6503  C  CB    . ASN C 2  419  ? 5.983   12.263  -52.182  1.00 65.30  ? 419  ASN C CB    1 
ATOM   6504  C  CG    . ASN C 2  419  ? 4.789   12.682  -51.341  1.00 61.46  ? 419  ASN C CG    1 
ATOM   6505  O  OD1   . ASN C 2  419  ? 4.573   13.869  -51.099  1.00 63.06  ? 419  ASN C OD1   1 
ATOM   6506  N  ND2   . ASN C 2  419  ? 4.010   11.704  -50.887  1.00 59.97  ? 419  ASN C ND2   1 
ATOM   6507  N  N     . ILE C 2  420  ? 8.184   13.735  -49.781  1.00 53.08  ? 420  ILE C N     1 
ATOM   6508  C  CA    . ILE C 2  420  ? 8.879   13.496  -48.518  1.00 47.53  ? 420  ILE C CA    1 
ATOM   6509  C  C     . ILE C 2  420  ? 7.911   13.128  -47.404  1.00 44.16  ? 420  ILE C C     1 
ATOM   6510  O  O     . ILE C 2  420  ? 8.321   12.857  -46.276  1.00 41.52  ? 420  ILE C O     1 
ATOM   6511  C  CB    . ILE C 2  420  ? 9.691   14.727  -48.072  1.00 49.61  ? 420  ILE C CB    1 
ATOM   6512  C  CG1   . ILE C 2  420  ? 8.783   15.951  -47.969  1.00 59.52  ? 420  ILE C CG1   1 
ATOM   6513  C  CG2   . ILE C 2  420  ? 10.842  14.995  -49.028  1.00 53.91  ? 420  ILE C CG2   1 
ATOM   6514  C  CD1   . ILE C 2  420  ? 9.512   17.218  -47.580  1.00 65.25  ? 420  ILE C CD1   1 
ATOM   6515  N  N     . ARG C 2  421  ? 6.624   13.128  -47.726  1.00 48.55  ? 421  ARG C N     1 
ATOM   6516  C  CA    . ARG C 2  421  ? 5.592   12.768  -46.763  1.00 46.96  ? 421  ARG C CA    1 
ATOM   6517  C  C     . ARG C 2  421  ? 5.807   11.371  -46.157  1.00 43.07  ? 421  ARG C C     1 
ATOM   6518  O  O     . ARG C 2  421  ? 5.563   11.181  -44.968  1.00 39.66  ? 421  ARG C O     1 
ATOM   6519  C  CB    . ARG C 2  421  ? 4.208   12.873  -47.418  1.00 52.86  ? 421  ARG C CB    1 
ATOM   6520  C  CG    . ARG C 2  421  ? 3.033   12.638  -46.481  1.00 60.47  ? 421  ARG C CG    1 
ATOM   6521  C  CD    . ARG C 2  421  ? 1.798   13.413  -46.934  1.00 70.02  ? 421  ARG C CD    1 
ATOM   6522  N  NE    . ARG C 2  421  ? 1.783   13.645  -48.377  1.00 75.32  ? 421  ARG C NE    1 
ATOM   6523  C  CZ    . ARG C 2  421  ? 1.729   14.848  -48.944  1.00 78.29  ? 421  ARG C CZ    1 
ATOM   6524  N  NH1   . ARG C 2  421  ? 1.680   15.942  -48.191  1.00 80.39  ? 421  ARG C NH1   1 
ATOM   6525  N  NH2   . ARG C 2  421  ? 1.719   14.958  -50.268  1.00 82.88  ? 421  ARG C NH2   1 
ATOM   6526  N  N     . PRO C 2  422  ? 6.263   10.389  -46.959  1.00 45.35  ? 422  PRO C N     1 
ATOM   6527  C  CA    . PRO C 2  422  ? 6.616   9.125   -46.300  1.00 45.18  ? 422  PRO C CA    1 
ATOM   6528  C  C     . PRO C 2  422  ? 7.871   9.207   -45.422  1.00 45.26  ? 422  PRO C C     1 
ATOM   6529  O  O     . PRO C 2  422  ? 8.002   8.417   -44.488  1.00 45.05  ? 422  PRO C O     1 
ATOM   6530  C  CB    . PRO C 2  422  ? 6.845   8.171   -47.478  1.00 51.23  ? 422  PRO C CB    1 
ATOM   6531  C  CG    . PRO C 2  422  ? 6.033   8.739   -48.582  1.00 51.31  ? 422  PRO C CG    1 
ATOM   6532  C  CD    . PRO C 2  422  ? 6.154   10.221  -48.420  1.00 48.29  ? 422  PRO C CD    1 
ATOM   6533  N  N     . VAL C 2  423  ? 8.776   10.138  -45.719  1.00 44.76  ? 423  VAL C N     1 
ATOM   6534  C  CA    . VAL C 2  423  ? 10.016  10.273  -44.952  1.00 41.23  ? 423  VAL C CA    1 
ATOM   6535  C  C     . VAL C 2  423  ? 9.758   10.792  -43.539  1.00 39.48  ? 423  VAL C C     1 
ATOM   6536  O  O     . VAL C 2  423  ? 10.126  10.149  -42.556  1.00 35.77  ? 423  VAL C O     1 
ATOM   6537  C  CB    . VAL C 2  423  ? 11.021  11.215  -45.653  1.00 38.99  ? 423  VAL C CB    1 
ATOM   6538  C  CG1   . VAL C 2  423  ? 12.171  11.568  -44.720  1.00 34.84  ? 423  VAL C CG1   1 
ATOM   6539  C  CG2   . VAL C 2  423  ? 11.547  10.579  -46.926  1.00 44.17  ? 423  VAL C CG2   1 
ATOM   6540  N  N     . VAL C 2  424  ? 9.118   11.954  -43.448  1.00 42.17  ? 424  VAL C N     1 
ATOM   6541  C  CA    . VAL C 2  424  ? 8.842   12.597  -42.167  1.00 40.56  ? 424  VAL C CA    1 
ATOM   6542  C  C     . VAL C 2  424  ? 7.864   11.777  -41.326  1.00 39.51  ? 424  VAL C C     1 
ATOM   6543  O  O     . VAL C 2  424  ? 7.870   11.854  -40.100  1.00 37.76  ? 424  VAL C O     1 
ATOM   6544  C  CB    . VAL C 2  424  ? 8.276   14.016  -42.368  1.00 42.16  ? 424  VAL C CB    1 
ATOM   6545  C  CG1   . VAL C 2  424  ? 8.289   14.792  -41.058  1.00 40.87  ? 424  VAL C CG1   1 
ATOM   6546  C  CG2   . VAL C 2  424  ? 9.078   14.753  -43.423  1.00 48.03  ? 424  VAL C CG2   1 
ATOM   6547  N  N     . ALA C 2  425  ? 7.027   10.987  -41.990  1.00 41.51  ? 425  ALA C N     1 
ATOM   6548  C  CA    . ALA C 2  425  ? 6.068   10.139  -41.290  1.00 44.44  ? 425  ALA C CA    1 
ATOM   6549  C  C     . ALA C 2  425  ? 6.749   8.922   -40.670  1.00 43.53  ? 425  ALA C C     1 
ATOM   6550  O  O     . ALA C 2  425  ? 6.394   8.495   -39.569  1.00 44.71  ? 425  ALA C O     1 
ATOM   6551  C  CB    . ALA C 2  425  ? 4.959   9.698   -42.232  1.00 47.70  ? 425  ALA C CB    1 
ATOM   6552  N  N     . ALA C 2  426  ? 7.729   8.369   -41.378  1.00 40.75  ? 426  ALA C N     1 
ATOM   6553  C  CA    . ALA C 2  426  ? 8.407   7.157   -40.924  1.00 40.28  ? 426  ALA C CA    1 
ATOM   6554  C  C     . ALA C 2  426  ? 9.276   7.414   -39.695  1.00 37.48  ? 426  ALA C C     1 
ATOM   6555  O  O     . ALA C 2  426  ? 9.457   6.531   -38.855  1.00 36.76  ? 426  ALA C O     1 
ATOM   6556  C  CB    . ALA C 2  426  ? 9.246   6.568   -42.052  1.00 48.17  ? 426  ALA C CB    1 
ATOM   6557  N  N     . ILE C 2  427  ? 9.811   8.626   -39.595  1.00 36.26  ? 427  ILE C N     1 
ATOM   6558  C  CA    . ILE C 2  427  ? 10.629  9.004   -38.448  1.00 37.01  ? 427  ILE C CA    1 
ATOM   6559  C  C     . ILE C 2  427  ? 9.758   9.477   -37.285  1.00 37.63  ? 427  ILE C C     1 
ATOM   6560  O  O     . ILE C 2  427  ? 10.044  9.176   -36.123  1.00 36.38  ? 427  ILE C O     1 
ATOM   6561  C  CB    . ILE C 2  427  ? 11.645  10.103  -38.816  1.00 36.54  ? 427  ILE C CB    1 
ATOM   6562  C  CG1   . ILE C 2  427  ? 10.975  11.209  -39.634  1.00 36.28  ? 427  ILE C CG1   1 
ATOM   6563  C  CG2   . ILE C 2  427  ? 12.802  9.511   -39.604  1.00 33.01  ? 427  ILE C CG2   1 
ATOM   6564  C  CD1   . ILE C 2  427  ? 10.768  12.504  -38.871  1.00 34.28  ? 427  ILE C CD1   1 
ATOM   6565  N  N     . LYS C 2  428  ? 8.696   10.211  -37.607  1.00 37.01  ? 428  LYS C N     1 
ATOM   6566  C  CA    . LYS C 2  428  ? 7.724   10.652  -36.612  1.00 38.21  ? 428  LYS C CA    1 
ATOM   6567  C  C     . LYS C 2  428  ? 7.102   9.449   -35.918  1.00 39.53  ? 428  LYS C C     1 
ATOM   6568  O  O     . LYS C 2  428  ? 6.959   9.425   -34.695  1.00 38.78  ? 428  LYS C O     1 
ATOM   6569  C  CB    . LYS C 2  428  ? 6.635   11.509  -37.263  1.00 42.10  ? 428  LYS C CB    1 
ATOM   6570  C  CG    . LYS C 2  428  ? 5.373   11.660  -36.429  1.00 52.88  ? 428  LYS C CG    1 
ATOM   6571  C  CD    . LYS C 2  428  ? 4.211   12.176  -37.263  1.00 58.76  ? 428  LYS C CD    1 
ATOM   6572  C  CE    . LYS C 2  428  ? 2.914   12.171  -36.462  1.00 71.13  ? 428  LYS C CE    1 
ATOM   6573  N  NZ    . LYS C 2  428  ? 1.748   12.582  -37.296  1.00 70.33  ? 428  LYS C NZ    1 
ATOM   6574  N  N     . GLU C 2  429  ? 6.736   8.454   -36.718  1.00 42.92  ? 429  GLU C N     1 
ATOM   6575  C  CA    . GLU C 2  429  ? 6.164   7.217   -36.206  1.00 43.25  ? 429  GLU C CA    1 
ATOM   6576  C  C     . GLU C 2  429  ? 7.130   6.522   -35.255  1.00 41.72  ? 429  GLU C C     1 
ATOM   6577  O  O     . GLU C 2  429  ? 6.735   6.040   -34.198  1.00 41.36  ? 429  GLU C O     1 
ATOM   6578  C  CB    . GLU C 2  429  ? 5.799   6.279   -37.357  1.00 45.32  ? 429  GLU C CB    1 
ATOM   6579  C  CG    . GLU C 2  429  ? 5.271   4.929   -36.907  1.00 52.78  ? 429  GLU C CG    1 
ATOM   6580  C  CD    . GLU C 2  429  ? 5.344   3.879   -37.999  1.00 60.99  ? 429  GLU C CD    1 
ATOM   6581  O  OE1   . GLU C 2  429  ? 6.019   4.126   -39.022  1.00 61.68  ? 429  GLU C OE1   1 
ATOM   6582  O  OE2   . GLU C 2  429  ? 4.725   2.806   -37.836  1.00 67.92  ? 429  GLU C OE2   1 
ATOM   6583  N  N     . PHE C 2  430  ? 8.402   6.490   -35.631  1.00 38.15  ? 430  PHE C N     1 
ATOM   6584  C  CA    . PHE C 2  430  ? 9.410   5.801   -34.840  1.00 37.71  ? 430  PHE C CA    1 
ATOM   6585  C  C     . PHE C 2  430  ? 9.522   6.384   -33.436  1.00 36.36  ? 430  PHE C C     1 
ATOM   6586  O  O     . PHE C 2  430  ? 9.505   5.648   -32.450  1.00 37.25  ? 430  PHE C O     1 
ATOM   6587  C  CB    . PHE C 2  430  ? 10.765  5.856   -35.542  1.00 40.54  ? 430  PHE C CB    1 
ATOM   6588  C  CG    . PHE C 2  430  ? 11.869  5.183   -34.778  1.00 43.49  ? 430  PHE C CG    1 
ATOM   6589  C  CD1   . PHE C 2  430  ? 11.815  3.828   -34.504  1.00 44.90  ? 430  PHE C CD1   1 
ATOM   6590  C  CD2   . PHE C 2  430  ? 12.961  5.904   -34.332  1.00 39.82  ? 430  PHE C CD2   1 
ATOM   6591  C  CE1   . PHE C 2  430  ? 12.830  3.206   -33.801  1.00 44.53  ? 430  PHE C CE1   1 
ATOM   6592  C  CE2   . PHE C 2  430  ? 13.978  5.286   -33.629  1.00 39.13  ? 430  PHE C CE2   1 
ATOM   6593  C  CZ    . PHE C 2  430  ? 13.912  3.936   -33.365  1.00 44.94  ? 430  PHE C CZ    1 
ATOM   6594  N  N     . PHE C 2  431  ? 9.628   7.705   -33.349  1.00 34.35  ? 431  PHE C N     1 
ATOM   6595  C  CA    . PHE C 2  431  ? 9.735   8.372   -32.058  1.00 35.78  ? 431  PHE C CA    1 
ATOM   6596  C  C     . PHE C 2  431  ? 8.420   8.334   -31.282  1.00 35.87  ? 431  PHE C C     1 
ATOM   6597  O  O     . PHE C 2  431  ? 8.396   8.566   -30.073  1.00 36.61  ? 431  PHE C O     1 
ATOM   6598  C  CB    . PHE C 2  431  ? 10.178  9.824   -32.237  1.00 35.19  ? 431  PHE C CB    1 
ATOM   6599  C  CG    . PHE C 2  431  ? 11.628  9.983   -32.586  1.00 33.67  ? 431  PHE C CG    1 
ATOM   6600  C  CD1   . PHE C 2  431  ? 12.607  9.819   -31.623  1.00 32.80  ? 431  PHE C CD1   1 
ATOM   6601  C  CD2   . PHE C 2  431  ? 12.011  10.319  -33.872  1.00 32.82  ? 431  PHE C CD2   1 
ATOM   6602  C  CE1   . PHE C 2  431  ? 13.944  9.975   -31.940  1.00 31.44  ? 431  PHE C CE1   1 
ATOM   6603  C  CE2   . PHE C 2  431  ? 13.346  10.478  -34.195  1.00 31.93  ? 431  PHE C CE2   1 
ATOM   6604  C  CZ    . PHE C 2  431  ? 14.314  10.305  -33.228  1.00 31.48  ? 431  PHE C CZ    1 
ATOM   6605  N  N     . GLY C 2  432  ? 7.327   8.043   -31.976  1.00 36.34  ? 432  GLY C N     1 
ATOM   6606  C  CA    . GLY C 2  432  ? 6.020   8.083   -31.351  1.00 36.15  ? 432  GLY C CA    1 
ATOM   6607  C  C     . GLY C 2  432  ? 5.310   6.748   -31.247  1.00 38.04  ? 432  GLY C C     1 
ATOM   6608  O  O     . GLY C 2  432  ? 4.150   6.707   -30.843  1.00 43.06  ? 432  GLY C O     1 
ATOM   6609  N  N     . THR C 2  433  ? 5.990   5.660   -31.606  1.00 37.69  ? 433  THR C N     1 
ATOM   6610  C  CA    . THR C 2  433  ? 5.377   4.332   -31.551  1.00 37.04  ? 433  THR C CA    1 
ATOM   6611  C  C     . THR C 2  433  ? 6.316   3.224   -31.079  1.00 38.97  ? 433  THR C C     1 
ATOM   6612  O  O     . THR C 2  433  ? 5.992   2.497   -30.139  1.00 39.93  ? 433  THR C O     1 
ATOM   6613  C  CB    . THR C 2  433  ? 4.814   3.903   -32.929  1.00 39.93  ? 433  THR C CB    1 
ATOM   6614  O  OG1   . THR C 2  433  ? 3.741   4.771   -33.314  1.00 47.80  ? 433  THR C OG1   1 
ATOM   6615  C  CG2   . THR C 2  433  ? 4.294   2.473   -32.863  1.00 42.48  ? 433  THR C CG2   1 
ATOM   6616  N  N     . SER C 2  434  ? 7.464   3.097   -31.745  1.00 41.50  ? 434  SER C N     1 
ATOM   6617  C  CA    . SER C 2  434  ? 8.393   1.979   -31.537  1.00 44.46  ? 434  SER C CA    1 
ATOM   6618  C  C     . SER C 2  434  ? 8.770   1.770   -30.066  1.00 45.83  ? 434  SER C C     1 
ATOM   6619  O  O     . SER C 2  434  ? 8.756   2.708   -29.268  1.00 45.07  ? 434  SER C O     1 
ATOM   6620  C  CB    . SER C 2  434  ? 9.662   2.188   -32.371  1.00 38.70  ? 434  SER C CB    1 
ATOM   6621  O  OG    . SER C 2  434  ? 10.595  1.141   -32.166  1.00 36.98  ? 434  SER C OG    1 
ATOM   6622  N  N     . GLN C 2  435  ? 9.124   0.535   -29.720  1.00 45.27  ? 435  GLN C N     1 
ATOM   6623  C  CA    . GLN C 2  435  ? 9.378   0.158   -28.332  1.00 42.69  ? 435  GLN C CA    1 
ATOM   6624  C  C     . GLN C 2  435  ? 10.783  0.546   -27.867  1.00 39.75  ? 435  GLN C C     1 
ATOM   6625  O  O     . GLN C 2  435  ? 11.309  -0.025  -26.911  1.00 36.92  ? 435  GLN C O     1 
ATOM   6626  C  CB    . GLN C 2  435  ? 9.170   -1.350  -28.152  1.00 44.61  ? 435  GLN C CB    1 
ATOM   6627  C  CG    . GLN C 2  435  ? 7.803   -1.852  -28.603  1.00 49.37  ? 435  GLN C CG    1 
ATOM   6628  C  CD    . GLN C 2  435  ? 7.754   -3.359  -28.771  1.00 62.59  ? 435  GLN C CD    1 
ATOM   6629  O  OE1   . GLN C 2  435  ? 8.782   -4.010  -28.949  1.00 58.03  ? 435  GLN C OE1   1 
ATOM   6630  N  NE2   . GLN C 2  435  ? 6.553   -3.920  -28.715  1.00 74.06  ? 435  GLN C NE2   1 
ATOM   6631  N  N     . LEU C 2  436  ? 11.382  1.520   -28.545  1.00 36.15  ? 436  LEU C N     1 
ATOM   6632  C  CA    . LEU C 2  436  ? 12.736  1.964   -28.231  1.00 34.09  ? 436  LEU C CA    1 
ATOM   6633  C  C     . LEU C 2  436  ? 12.807  3.477   -28.081  1.00 33.01  ? 436  LEU C C     1 
ATOM   6634  O  O     . LEU C 2  436  ? 13.864  4.035   -27.787  1.00 32.07  ? 436  LEU C O     1 
ATOM   6635  C  CB    . LEU C 2  436  ? 13.704  1.491   -29.311  1.00 34.00  ? 436  LEU C CB    1 
ATOM   6636  C  CG    . LEU C 2  436  ? 13.810  -0.032  -29.373  1.00 36.87  ? 436  LEU C CG    1 
ATOM   6637  C  CD1   . LEU C 2  436  ? 14.485  -0.490  -30.651  1.00 41.62  ? 436  LEU C CD1   1 
ATOM   6638  C  CD2   . LEU C 2  436  ? 14.553  -0.549  -28.150  1.00 35.26  ? 436  LEU C CD2   1 
ATOM   6639  N  N     . SER C 2  437  ? 11.675  4.137   -28.302  1.00 33.60  ? 437  SER C N     1 
ATOM   6640  C  CA    . SER C 2  437  ? 11.547  5.555   -28.005  1.00 32.99  ? 437  SER C CA    1 
ATOM   6641  C  C     . SER C 2  437  ? 10.770  5.691   -26.701  1.00 32.67  ? 437  SER C C     1 
ATOM   6642  O  O     . SER C 2  437  ? 9.542   5.654   -26.691  1.00 33.44  ? 437  SER C O     1 
ATOM   6643  C  CB    . SER C 2  437  ? 10.853  6.299   -29.148  1.00 33.12  ? 437  SER C CB    1 
ATOM   6644  O  OG    . SER C 2  437  ? 10.733  7.680   -28.862  1.00 34.32  ? 437  SER C OG    1 
ATOM   6645  N  N     . GLN C 2  438  ? 11.499  5.843   -25.600  1.00 32.27  ? 438  GLN C N     1 
ATOM   6646  C  CA    . GLN C 2  438  ? 10.918  5.715   -24.268  1.00 34.07  ? 438  GLN C CA    1 
ATOM   6647  C  C     . GLN C 2  438  ? 10.825  7.030   -23.490  1.00 36.36  ? 438  GLN C C     1 
ATOM   6648  O  O     . GLN C 2  438  ? 11.515  8.007   -23.792  1.00 35.01  ? 438  GLN C O     1 
ATOM   6649  C  CB    . GLN C 2  438  ? 11.730  4.705   -23.455  1.00 34.10  ? 438  GLN C CB    1 
ATOM   6650  C  CG    . GLN C 2  438  ? 11.858  3.332   -24.110  1.00 33.24  ? 438  GLN C CG    1 
ATOM   6651  C  CD    . GLN C 2  438  ? 12.729  2.384   -23.308  1.00 32.42  ? 438  GLN C CD    1 
ATOM   6652  O  OE1   . GLN C 2  438  ? 13.269  2.755   -22.265  1.00 33.30  ? 438  GLN C OE1   1 
ATOM   6653  N  NE2   . GLN C 2  438  ? 12.868  1.153   -23.788  1.00 31.03  ? 438  GLN C NE2   1 
ATOM   6654  N  N     . PHE C 2  439  ? 9.958   7.033   -22.483  1.00 37.61  ? 439  PHE C N     1 
ATOM   6655  C  CA    . PHE C 2  439  ? 9.855   8.142   -21.544  1.00 35.07  ? 439  PHE C CA    1 
ATOM   6656  C  C     . PHE C 2  439  ? 11.073  8.153   -20.625  1.00 33.98  ? 439  PHE C C     1 
ATOM   6657  O  O     . PHE C 2  439  ? 11.261  7.234   -19.829  1.00 34.16  ? 439  PHE C O     1 
ATOM   6658  C  CB    . PHE C 2  439  ? 8.570   8.022   -20.726  1.00 40.17  ? 439  PHE C CB    1 
ATOM   6659  C  CG    . PHE C 2  439  ? 7.841   9.317   -20.543  1.00 41.53  ? 439  PHE C CG    1 
ATOM   6660  C  CD1   . PHE C 2  439  ? 7.283   9.971   -21.627  1.00 43.14  ? 439  PHE C CD1   1 
ATOM   6661  C  CD2   . PHE C 2  439  ? 7.695   9.871   -19.284  1.00 44.41  ? 439  PHE C CD2   1 
ATOM   6662  C  CE1   . PHE C 2  439  ? 6.605   11.162  -21.461  1.00 55.30  ? 439  PHE C CE1   1 
ATOM   6663  C  CE2   . PHE C 2  439  ? 7.018   11.060  -19.112  1.00 46.04  ? 439  PHE C CE2   1 
ATOM   6664  C  CZ    . PHE C 2  439  ? 6.474   11.707  -20.201  1.00 53.20  ? 439  PHE C CZ    1 
ATOM   6665  N  N     . MET C 2  440  ? 11.901  9.187   -20.739  1.00 30.30  ? 440  MET C N     1 
ATOM   6666  C  CA    . MET C 2  440  ? 13.142  9.261   -19.971  1.00 30.95  ? 440  MET C CA    1 
ATOM   6667  C  C     . MET C 2  440  ? 12.900  9.165   -18.472  1.00 28.51  ? 440  MET C C     1 
ATOM   6668  O  O     . MET C 2  440  ? 12.378  10.095  -17.855  1.00 28.76  ? 440  MET C O     1 
ATOM   6669  C  CB    . MET C 2  440  ? 13.898  10.554  -20.279  1.00 30.80  ? 440  MET C CB    1 
ATOM   6670  C  CG    . MET C 2  440  ? 15.166  10.722  -19.450  1.00 27.94  ? 440  MET C CG    1 
ATOM   6671  S  SD    . MET C 2  440  ? 16.038  12.272  -19.757  1.00 24.81  ? 440  MET C SD    1 
ATOM   6672  C  CE    . MET C 2  440  ? 17.365  12.166  -18.558  1.00 27.60  ? 440  MET C CE    1 
ATOM   6673  N  N     . ASP C 2  441  ? 13.283  8.028   -17.899  1.00 28.88  ? 441  ASP C N     1 
ATOM   6674  C  CA    . ASP C 2  441  ? 13.169  7.792   -16.464  1.00 30.52  ? 441  ASP C CA    1 
ATOM   6675  C  C     . ASP C 2  441  ? 13.893  8.893   -15.686  1.00 27.79  ? 441  ASP C C     1 
ATOM   6676  O  O     . ASP C 2  441  ? 15.109  8.845   -15.512  1.00 28.13  ? 441  ASP C O     1 
ATOM   6677  C  CB    . ASP C 2  441  ? 13.733  6.409   -16.112  1.00 35.58  ? 441  ASP C CB    1 
ATOM   6678  C  CG    . ASP C 2  441  ? 13.455  6.004   -14.675  1.00 37.86  ? 441  ASP C CG    1 
ATOM   6679  O  OD1   . ASP C 2  441  ? 14.108  5.051   -14.191  1.00 37.88  ? 441  ASP C OD1   1 
ATOM   6680  O  OD2   . ASP C 2  441  ? 12.593  6.641   -14.032  1.00 37.69  ? 441  ASP C OD2   1 
ATOM   6681  N  N     . GLN C 2  442  ? 13.132  9.880   -15.219  1.00 26.46  ? 442  GLN C N     1 
ATOM   6682  C  CA    . GLN C 2  442  ? 13.705  11.086  -14.627  1.00 25.60  ? 442  GLN C CA    1 
ATOM   6683  C  C     . GLN C 2  442  ? 13.473  11.230  -13.126  1.00 26.02  ? 442  GLN C C     1 
ATOM   6684  O  O     . GLN C 2  442  ? 13.373  12.349  -12.627  1.00 26.17  ? 442  GLN C O     1 
ATOM   6685  C  CB    . GLN C 2  442  ? 13.144  12.325  -15.326  1.00 27.26  ? 442  GLN C CB    1 
ATOM   6686  C  CG    . GLN C 2  442  ? 13.906  12.775  -16.553  1.00 27.73  ? 442  GLN C CG    1 
ATOM   6687  C  CD    . GLN C 2  442  ? 13.438  14.135  -17.036  1.00 29.63  ? 442  GLN C CD    1 
ATOM   6688  O  OE1   . GLN C 2  442  ? 12.435  14.663  -16.556  1.00 28.33  ? 442  GLN C OE1   1 
ATOM   6689  N  NE2   . GLN C 2  442  ? 14.163  14.708  -17.987  1.00 35.94  ? 442  GLN C NE2   1 
ATOM   6690  N  N     . ASN C 2  443  ? 13.389  10.117  -12.406  1.00 28.02  ? 443  ASN C N     1 
ATOM   6691  C  CA    . ASN C 2  443  ? 13.226  10.186  -10.958  1.00 27.59  ? 443  ASN C CA    1 
ATOM   6692  C  C     . ASN C 2  443  ? 14.398  10.907  -10.306  1.00 28.36  ? 443  ASN C C     1 
ATOM   6693  O  O     . ASN C 2  443  ? 14.216  11.712  -9.394   1.00 28.99  ? 443  ASN C O     1 
ATOM   6694  C  CB    . ASN C 2  443  ? 13.074  8.790   -10.358  1.00 30.44  ? 443  ASN C CB    1 
ATOM   6695  C  CG    . ASN C 2  443  ? 11.736  8.159   -10.684  1.00 32.23  ? 443  ASN C CG    1 
ATOM   6696  O  OD1   . ASN C 2  443  ? 10.711  8.506   -10.097  1.00 31.64  ? 443  ASN C OD1   1 
ATOM   6697  N  ND2   . ASN C 2  443  ? 11.741  7.219   -11.620  1.00 36.02  ? 443  ASN C ND2   1 
ATOM   6698  N  N     . ASN C 2  444  ? 15.600  10.613  -10.790  1.00 29.88  ? 444  ASN C N     1 
ATOM   6699  C  CA    . ASN C 2  444  ? 16.816  11.268  -10.329  1.00 31.14  ? 444  ASN C CA    1 
ATOM   6700  C  C     . ASN C 2  444  ? 17.864  11.205  -11.440  1.00 29.43  ? 444  ASN C C     1 
ATOM   6701  O  O     . ASN C 2  444  ? 17.686  10.455  -12.398  1.00 29.84  ? 444  ASN C O     1 
ATOM   6702  C  CB    . ASN C 2  444  ? 17.322  10.616  -9.036   1.00 31.44  ? 444  ASN C CB    1 
ATOM   6703  C  CG    . ASN C 2  444  ? 17.649  9.149   -9.209   1.00 28.53  ? 444  ASN C CG    1 
ATOM   6704  O  OD1   . ASN C 2  444  ? 18.696  8.797   -9.751   1.00 26.70  ? 444  ASN C OD1   1 
ATOM   6705  N  ND2   . ASN C 2  444  ? 16.758  8.281   -8.736   1.00 27.78  ? 444  ASN C ND2   1 
ATOM   6706  N  N     . PRO C 2  445  ? 18.940  12.010  -11.338  1.00 29.59  ? 445  PRO C N     1 
ATOM   6707  C  CA    . PRO C 2  445  ? 19.983  11.995  -12.372  1.00 28.96  ? 445  PRO C CA    1 
ATOM   6708  C  C     . PRO C 2  445  ? 20.468  10.597  -12.761  1.00 27.76  ? 445  PRO C C     1 
ATOM   6709  O  O     . PRO C 2  445  ? 20.519  10.293  -13.954  1.00 27.87  ? 445  PRO C O     1 
ATOM   6710  C  CB    . PRO C 2  445  ? 21.109  12.799  -11.725  1.00 32.10  ? 445  PRO C CB    1 
ATOM   6711  C  CG    . PRO C 2  445  ? 20.392  13.800  -10.905  1.00 35.82  ? 445  PRO C CG    1 
ATOM   6712  C  CD    . PRO C 2  445  ? 19.167  13.098  -10.367  1.00 34.82  ? 445  PRO C CD    1 
ATOM   6713  N  N     . LEU C 2  446  ? 20.803  9.767   -11.777  1.00 27.54  ? 446  LEU C N     1 
ATOM   6714  C  CA    . LEU C 2  446  ? 21.268  8.406   -12.035  1.00 30.53  ? 446  LEU C CA    1 
ATOM   6715  C  C     . LEU C 2  446  ? 20.257  7.611   -12.846  1.00 29.28  ? 446  LEU C C     1 
ATOM   6716  O  O     . LEU C 2  446  ? 20.619  6.906   -13.789  1.00 27.80  ? 446  LEU C O     1 
ATOM   6717  C  CB    . LEU C 2  446  ? 21.557  7.677   -10.721  1.00 28.54  ? 446  LEU C CB    1 
ATOM   6718  C  CG    . LEU C 2  446  ? 21.799  6.171   -10.837  1.00 26.33  ? 446  LEU C CG    1 
ATOM   6719  C  CD1   . LEU C 2  446  ? 23.036  5.884   -11.667  1.00 25.55  ? 446  LEU C CD1   1 
ATOM   6720  C  CD2   . LEU C 2  446  ? 21.905  5.527   -9.464   1.00 26.99  ? 446  LEU C CD2   1 
ATOM   6721  N  N     . SER C 2  447  ? 18.991  7.732   -12.465  1.00 29.69  ? 447  SER C N     1 
ATOM   6722  C  CA    . SER C 2  447  ? 17.902  7.037   -13.138  1.00 30.31  ? 447  SER C CA    1 
ATOM   6723  C  C     . SER C 2  447  ? 17.898  7.323   -14.635  1.00 28.83  ? 447  SER C C     1 
ATOM   6724  O  O     . SER C 2  447  ? 17.696  6.424   -15.450  1.00 28.44  ? 447  SER C O     1 
ATOM   6725  C  CB    . SER C 2  447  ? 16.561  7.433   -12.513  1.00 30.43  ? 447  SER C CB    1 
ATOM   6726  O  OG    . SER C 2  447  ? 15.596  7.720   -13.506  1.00 30.43  ? 447  SER C OG    1 
ATOM   6727  N  N     . GLY C 2  448  ? 18.134  8.580   -14.988  1.00 28.44  ? 448  GLY C N     1 
ATOM   6728  C  CA    . GLY C 2  448  ? 18.176  8.981   -16.380  1.00 28.32  ? 448  GLY C CA    1 
ATOM   6729  C  C     . GLY C 2  448  ? 19.436  8.503   -17.065  1.00 26.56  ? 448  GLY C C     1 
ATOM   6730  O  O     . GLY C 2  448  ? 19.399  8.052   -18.210  1.00 27.51  ? 448  GLY C O     1 
ATOM   6731  N  N     . LEU C 2  449  ? 20.557  8.599   -16.357  1.00 25.32  ? 449  LEU C N     1 
ATOM   6732  C  CA    . LEU C 2  449  ? 21.842  8.186   -16.908  1.00 25.59  ? 449  LEU C CA    1 
ATOM   6733  C  C     . LEU C 2  449  ? 21.845  6.697   -17.251  1.00 25.75  ? 449  LEU C C     1 
ATOM   6734  O  O     . LEU C 2  449  ? 22.266  6.311   -18.340  1.00 24.41  ? 449  LEU C O     1 
ATOM   6735  C  CB    . LEU C 2  449  ? 22.979  8.516   -15.933  1.00 26.66  ? 449  LEU C CB    1 
ATOM   6736  C  CG    . LEU C 2  449  ? 24.414  8.209   -16.375  1.00 25.29  ? 449  LEU C CG    1 
ATOM   6737  C  CD1   . LEU C 2  449  ? 24.664  8.703   -17.786  1.00 25.49  ? 449  LEU C CD1   1 
ATOM   6738  C  CD2   . LEU C 2  449  ? 25.423  8.836   -15.415  1.00 31.23  ? 449  LEU C CD2   1 
ATOM   6739  N  N     . THR C 2  450  ? 21.369  5.865   -16.330  1.00 32.31  ? 450  THR C N     1 
ATOM   6740  C  CA    . THR C 2  450  ? 21.358  4.424   -16.560  1.00 30.86  ? 450  THR C CA    1 
ATOM   6741  C  C     . THR C 2  450  ? 20.391  4.062   -17.682  1.00 29.13  ? 450  THR C C     1 
ATOM   6742  O  O     . THR C 2  450  ? 20.577  3.061   -18.375  1.00 27.68  ? 450  THR C O     1 
ATOM   6743  C  CB    . THR C 2  450  ? 20.967  3.633   -15.294  1.00 29.32  ? 450  THR C CB    1 
ATOM   6744  O  OG1   . THR C 2  450  ? 21.594  4.212   -14.143  1.00 30.46  ? 450  THR C OG1   1 
ATOM   6745  C  CG2   . THR C 2  450  ? 21.396  2.179   -15.426  1.00 25.76  ? 450  THR C CG2   1 
ATOM   6746  N  N     . HIS C 2  451  ? 19.361  4.886   -17.855  1.00 29.70  ? 451  HIS C N     1 
ATOM   6747  C  CA    . HIS C 2  451  ? 18.351  4.672   -18.885  1.00 27.16  ? 451  HIS C CA    1 
ATOM   6748  C  C     . HIS C 2  451  ? 18.971  4.787   -20.274  1.00 27.71  ? 451  HIS C C     1 
ATOM   6749  O  O     . HIS C 2  451  ? 18.600  4.055   -21.190  1.00 28.35  ? 451  HIS C O     1 
ATOM   6750  C  CB    . HIS C 2  451  ? 17.202  5.679   -18.719  1.00 29.75  ? 451  HIS C CB    1 
ATOM   6751  C  CG    . HIS C 2  451  ? 15.986  5.367   -19.540  1.00 29.08  ? 451  HIS C CG    1 
ATOM   6752  N  ND1   . HIS C 2  451  ? 14.736  5.186   -18.985  1.00 27.50  ? 451  HIS C ND1   1 
ATOM   6753  C  CD2   . HIS C 2  451  ? 15.828  5.219   -20.876  1.00 29.37  ? 451  HIS C CD2   1 
ATOM   6754  C  CE1   . HIS C 2  451  ? 13.863  4.931   -19.945  1.00 27.80  ? 451  HIS C CE1   1 
ATOM   6755  N  NE2   . HIS C 2  451  ? 14.501  4.944   -21.101  1.00 28.22  ? 451  HIS C NE2   1 
ATOM   6756  N  N     . LYS C 2  452  ? 19.918  5.704   -20.430  1.00 23.56  ? 452  LYS C N     1 
ATOM   6757  C  CA    . LYS C 2  452  ? 20.549  5.922   -21.726  1.00 22.87  ? 452  LYS C CA    1 
ATOM   6758  C  C     . LYS C 2  452  ? 21.518  4.793   -22.067  1.00 22.28  ? 452  LYS C C     1 
ATOM   6759  O  O     . LYS C 2  452  ? 21.802  4.540   -23.236  1.00 23.29  ? 452  LYS C O     1 
ATOM   6760  C  CB    . LYS C 2  452  ? 21.265  7.273   -21.742  1.00 23.75  ? 452  LYS C CB    1 
ATOM   6761  C  CG    . LYS C 2  452  ? 20.326  8.472   -21.654  1.00 27.08  ? 452  LYS C CG    1 
ATOM   6762  C  CD    . LYS C 2  452  ? 20.867  9.529   -20.701  1.00 29.54  ? 452  LYS C CD    1 
ATOM   6763  C  CE    . LYS C 2  452  ? 19.968  10.757  -20.637  1.00 29.10  ? 452  LYS C CE    1 
ATOM   6764  N  NZ    . LYS C 2  452  ? 20.489  11.790  -19.689  1.00 31.54  ? 452  LYS C NZ    1 
ATOM   6765  N  N     . ARG C 2  453  ? 22.009  4.107   -21.040  1.00 26.22  ? 453  ARG C N     1 
ATOM   6766  C  CA    . ARG C 2  453  ? 22.977  3.036   -21.236  1.00 25.25  ? 453  ARG C CA    1 
ATOM   6767  C  C     . ARG C 2  453  ? 22.324  1.658   -21.166  1.00 26.79  ? 453  ARG C C     1 
ATOM   6768  O  O     . ARG C 2  453  ? 23.015  0.641   -21.107  1.00 31.35  ? 453  ARG C O     1 
ATOM   6769  C  CB    . ARG C 2  453  ? 24.100  3.149   -20.201  1.00 26.49  ? 453  ARG C CB    1 
ATOM   6770  C  CG    . ARG C 2  453  ? 24.613  4.567   -20.035  1.00 27.19  ? 453  ARG C CG    1 
ATOM   6771  C  CD    . ARG C 2  453  ? 25.716  4.668   -18.992  1.00 24.98  ? 453  ARG C CD    1 
ATOM   6772  N  NE    . ARG C 2  453  ? 27.044  4.538   -19.583  1.00 21.80  ? 453  ARG C NE    1 
ATOM   6773  C  CZ    . ARG C 2  453  ? 27.718  3.397   -19.657  1.00 24.41  ? 453  ARG C CZ    1 
ATOM   6774  N  NH1   . ARG C 2  453  ? 27.187  2.284   -19.170  1.00 23.43  ? 453  ARG C NH1   1 
ATOM   6775  N  NH2   . ARG C 2  453  ? 28.920  3.370   -20.213  1.00 29.59  ? 453  ARG C NH2   1 
ATOM   6776  N  N     . ARG C 2  454  ? 20.993  1.624   -21.176  1.00 27.63  ? 454  ARG C N     1 
ATOM   6777  C  CA    . ARG C 2  454  ? 20.268  0.356   -21.149  1.00 25.99  ? 454  ARG C CA    1 
ATOM   6778  C  C     . ARG C 2  454  ? 20.516  -0.446  -22.417  1.00 24.22  ? 454  ARG C C     1 
ATOM   6779  O  O     . ARG C 2  454  ? 20.653  0.116   -23.505  1.00 23.92  ? 454  ARG C O     1 
ATOM   6780  C  CB    . ARG C 2  454  ? 18.760  0.582   -20.966  1.00 25.67  ? 454  ARG C CB    1 
ATOM   6781  C  CG    . ARG C 2  454  ? 18.261  0.419   -19.534  1.00 23.77  ? 454  ARG C CG    1 
ATOM   6782  C  CD    . ARG C 2  454  ? 16.741  0.514   -19.463  1.00 24.91  ? 454  ARG C CD    1 
ATOM   6783  N  NE    . ARG C 2  454  ? 16.275  0.915   -18.138  1.00 31.90  ? 454  ARG C NE    1 
ATOM   6784  C  CZ    . ARG C 2  454  ? 15.034  1.311   -17.875  1.00 34.74  ? 454  ARG C CZ    1 
ATOM   6785  N  NH1   . ARG C 2  454  ? 14.130  1.360   -18.845  1.00 41.65  ? 454  ARG C NH1   1 
ATOM   6786  N  NH2   . ARG C 2  454  ? 14.697  1.663   -16.642  1.00 36.99  ? 454  ARG C NH2   1 
ATOM   6787  N  N     . LEU C 2  455  ? 20.570  -1.764  -22.262  1.00 26.69  ? 455  LEU C N     1 
ATOM   6788  C  CA    . LEU C 2  455  ? 20.725  -2.676  -23.385  1.00 27.86  ? 455  LEU C CA    1 
ATOM   6789  C  C     . LEU C 2  455  ? 19.569  -3.670  -23.402  1.00 30.21  ? 455  LEU C C     1 
ATOM   6790  O  O     . LEU C 2  455  ? 19.517  -4.585  -22.582  1.00 32.32  ? 455  LEU C O     1 
ATOM   6791  C  CB    . LEU C 2  455  ? 22.062  -3.415  -23.303  1.00 28.17  ? 455  LEU C CB    1 
ATOM   6792  C  CG    . LEU C 2  455  ? 23.303  -2.537  -23.150  1.00 28.90  ? 455  LEU C CG    1 
ATOM   6793  C  CD1   . LEU C 2  455  ? 24.559  -3.378  -23.143  1.00 32.68  ? 455  LEU C CD1   1 
ATOM   6794  C  CD2   . LEU C 2  455  ? 23.348  -1.507  -24.268  1.00 30.58  ? 455  LEU C CD2   1 
ATOM   6795  N  N     . SER C 2  456  ? 18.640  -3.487  -24.335  1.00 30.42  ? 456  SER C N     1 
ATOM   6796  C  CA    . SER C 2  456  ? 17.451  -4.330  -24.397  1.00 29.52  ? 456  SER C CA    1 
ATOM   6797  C  C     . SER C 2  456  ? 17.454  -5.222  -25.626  1.00 31.19  ? 456  SER C C     1 
ATOM   6798  O  O     . SER C 2  456  ? 17.812  -4.791  -26.720  1.00 32.20  ? 456  SER C O     1 
ATOM   6799  C  CB    . SER C 2  456  ? 16.185  -3.471  -24.386  1.00 29.80  ? 456  SER C CB    1 
ATOM   6800  O  OG    . SER C 2  456  ? 15.024  -4.272  -24.517  1.00 31.64  ? 456  SER C OG    1 
ATOM   6801  N  N     . ALA C 2  457  ? 17.056  -6.474  -25.434  1.00 34.40  ? 457  ALA C N     1 
ATOM   6802  C  CA    . ALA C 2  457  ? 16.942  -7.417  -26.538  1.00 37.59  ? 457  ALA C CA    1 
ATOM   6803  C  C     . ALA C 2  457  ? 15.561  -7.321  -27.168  1.00 41.34  ? 457  ALA C C     1 
ATOM   6804  O  O     . ALA C 2  457  ? 15.300  -7.901  -28.225  1.00 46.50  ? 457  ALA C O     1 
ATOM   6805  C  CB    . ALA C 2  457  ? 17.212  -8.833  -26.060  1.00 47.54  ? 457  ALA C CB    1 
ATOM   6806  N  N     . LEU C 2  458  ? 14.679  -6.581  -26.506  1.00 39.91  ? 458  LEU C N     1 
ATOM   6807  C  CA    . LEU C 2  458  ? 13.309  -6.413  -26.966  1.00 41.41  ? 458  LEU C CA    1 
ATOM   6808  C  C     . LEU C 2  458  ? 13.229  -5.419  -28.120  1.00 43.42  ? 458  LEU C C     1 
ATOM   6809  O  O     . LEU C 2  458  ? 14.210  -4.754  -28.448  1.00 39.84  ? 458  LEU C O     1 
ATOM   6810  C  CB    . LEU C 2  458  ? 12.415  -5.952  -25.813  1.00 40.34  ? 458  LEU C CB    1 
ATOM   6811  C  CG    . LEU C 2  458  ? 12.460  -6.792  -24.534  1.00 41.06  ? 458  LEU C CG    1 
ATOM   6812  C  CD1   . LEU C 2  458  ? 11.540  -6.212  -23.473  1.00 41.76  ? 458  LEU C CD1   1 
ATOM   6813  C  CD2   . LEU C 2  458  ? 12.101  -8.242  -24.823  1.00 54.44  ? 458  LEU C CD2   1 
ATOM   6814  N  N     . GLY C 2  459  ? 12.056  -5.330  -28.738  1.00 52.21  ? 459  GLY C N     1 
ATOM   6815  C  CA    . GLY C 2  459  ? 11.831  -4.386  -29.817  1.00 49.39  ? 459  GLY C CA    1 
ATOM   6816  C  C     . GLY C 2  459  ? 11.694  -5.037  -31.182  1.00 51.17  ? 459  GLY C C     1 
ATOM   6817  O  O     . GLY C 2  459  ? 11.972  -6.226  -31.342  1.00 52.39  ? 459  GLY C O     1 
ATOM   6818  N  N     . PRO C 2  460  ? 11.257  -4.255  -32.180  1.00 50.98  ? 460  PRO C N     1 
ATOM   6819  C  CA    . PRO C 2  460  ? 11.121  -4.710  -33.569  1.00 50.17  ? 460  PRO C CA    1 
ATOM   6820  C  C     . PRO C 2  460  ? 12.456  -5.161  -34.154  1.00 50.84  ? 460  PRO C C     1 
ATOM   6821  O  O     . PRO C 2  460  ? 13.417  -4.396  -34.170  1.00 53.30  ? 460  PRO C O     1 
ATOM   6822  C  CB    . PRO C 2  460  ? 10.595  -3.468  -34.297  1.00 61.49  ? 460  PRO C CB    1 
ATOM   6823  C  CG    . PRO C 2  460  ? 9.975   -2.629  -33.226  1.00 55.23  ? 460  PRO C CG    1 
ATOM   6824  C  CD    . PRO C 2  460  ? 10.807  -2.863  -32.007  1.00 49.18  ? 460  PRO C CD    1 
ATOM   6825  N  N     . GLY C 2  461  ? 12.513  -6.400  -34.626  1.00 47.30  ? 461  GLY C N     1 
ATOM   6826  C  CA    . GLY C 2  461  ? 13.756  -6.956  -35.124  1.00 55.67  ? 461  GLY C CA    1 
ATOM   6827  C  C     . GLY C 2  461  ? 14.430  -7.779  -34.048  1.00 56.09  ? 461  GLY C C     1 
ATOM   6828  O  O     . GLY C 2  461  ? 15.213  -8.681  -34.340  1.00 65.24  ? 461  GLY C O     1 
ATOM   6829  N  N     . GLY C 2  462  ? 14.118  -7.464  -32.795  1.00 51.09  ? 462  GLY C N     1 
ATOM   6830  C  CA    . GLY C 2  462  ? 14.619  -8.227  -31.668  1.00 57.89  ? 462  GLY C CA    1 
ATOM   6831  C  C     . GLY C 2  462  ? 13.744  -9.434  -31.385  1.00 66.75  ? 462  GLY C C     1 
ATOM   6832  O  O     . GLY C 2  462  ? 13.334  -10.143 -32.305  1.00 85.57  ? 462  GLY C O     1 
ATOM   6833  N  N     . LEU C 2  463  ? 13.449  -9.661  -30.109  1.00 64.32  ? 463  LEU C N     1 
ATOM   6834  C  CA    . LEU C 2  463  ? 12.632  -10.799 -29.694  1.00 69.71  ? 463  LEU C CA    1 
ATOM   6835  C  C     . LEU C 2  463  ? 11.482  -10.373 -28.781  1.00 70.31  ? 463  LEU C C     1 
ATOM   6836  O  O     . LEU C 2  463  ? 11.593  -9.388  -28.054  1.00 67.39  ? 463  LEU C O     1 
ATOM   6837  C  CB    . LEU C 2  463  ? 13.504  -11.850 -28.995  1.00 81.68  ? 463  LEU C CB    1 
ATOM   6838  C  CG    . LEU C 2  463  ? 14.587  -11.397 -28.006  1.00 77.51  ? 463  LEU C CG    1 
ATOM   6839  C  CD1   . LEU C 2  463  ? 14.009  -11.043 -26.643  1.00 66.97  ? 463  LEU C CD1   1 
ATOM   6840  C  CD2   . LEU C 2  463  ? 15.665  -12.465 -27.866  1.00 143.72 ? 463  LEU C CD2   1 
ATOM   6841  N  N     . SER C 2  464  ? 10.376  -11.111 -28.833  1.00 81.42  ? 464  SER C N     1 
ATOM   6842  C  CA    . SER C 2  464  ? 9.268   -10.902 -27.904  1.00 88.66  ? 464  SER C CA    1 
ATOM   6843  C  C     . SER C 2  464  ? 9.643   -11.465 -26.530  1.00 86.67  ? 464  SER C C     1 
ATOM   6844  O  O     . SER C 2  464  ? 10.696  -12.086 -26.378  1.00 90.70  ? 464  SER C O     1 
ATOM   6845  C  CB    . SER C 2  464  ? 7.988   -11.558 -28.429  1.00 96.31  ? 464  SER C CB    1 
ATOM   6846  O  OG    . SER C 2  464  ? 6.928   -11.455 -27.492  1.00 88.20  ? 464  SER C OG    1 
ATOM   6847  N  N     . ARG C 2  465  ? 8.793   -11.250 -25.531  1.00 75.52  ? 465  ARG C N     1 
ATOM   6848  C  CA    . ARG C 2  465  ? 9.081   -11.743 -24.186  1.00 73.58  ? 465  ARG C CA    1 
ATOM   6849  C  C     . ARG C 2  465  ? 8.787   -13.238 -24.082  1.00 83.61  ? 465  ARG C C     1 
ATOM   6850  O  O     . ARG C 2  465  ? 9.532   -13.983 -23.444  1.00 79.53  ? 465  ARG C O     1 
ATOM   6851  C  CB    . ARG C 2  465  ? 8.278   -10.970 -23.136  1.00 64.04  ? 465  ARG C CB    1 
ATOM   6852  C  CG    . ARG C 2  465  ? 8.571   -11.387 -21.697  1.00 58.65  ? 465  ARG C CG    1 
ATOM   6853  C  CD    . ARG C 2  465  ? 7.837   -10.515 -20.685  1.00 53.94  ? 465  ARG C CD    1 
ATOM   6854  N  NE    . ARG C 2  465  ? 8.218   -9.109  -20.795  1.00 60.85  ? 465  ARG C NE    1 
ATOM   6855  C  CZ    . ARG C 2  465  ? 7.379   -8.127  -21.111  1.00 79.11  ? 465  ARG C CZ    1 
ATOM   6856  N  NH1   . ARG C 2  465  ? 6.099   -8.392  -21.343  1.00 90.19  ? 465  ARG C NH1   1 
ATOM   6857  N  NH2   . ARG C 2  465  ? 7.816   -6.877  -21.188  1.00 72.48  ? 465  ARG C NH2   1 
ATOM   6858  N  N     . GLU C 2  466  ? 7.704   -13.672 -24.722  1.00 86.07  ? 466  GLU C N     1 
ATOM   6859  C  CA    . GLU C 2  466  ? 7.299   -15.074 -24.688  1.00 97.99  ? 466  GLU C CA    1 
ATOM   6860  C  C     . GLU C 2  466  ? 8.224   -15.963 -25.514  1.00 106.45 ? 466  GLU C C     1 
ATOM   6861  O  O     . GLU C 2  466  ? 8.262   -17.179 -25.319  1.00 116.44 ? 466  GLU C O     1 
ATOM   6862  C  CB    . GLU C 2  466  ? 5.859   -15.229 -25.183  1.00 117.03 ? 466  GLU C CB    1 
ATOM   6863  C  CG    . GLU C 2  466  ? 4.800   -14.742 -24.204  1.00 136.46 ? 466  GLU C CG    1 
ATOM   6864  C  CD    . GLU C 2  466  ? 3.397   -15.173 -24.600  1.00 157.63 ? 466  GLU C CD    1 
ATOM   6865  O  OE1   . GLU C 2  466  ? 3.240   -15.739 -25.703  1.00 171.12 ? 466  GLU C OE1   1 
ATOM   6866  O  OE2   . GLU C 2  466  ? 2.454   -14.950 -23.808  1.00 151.32 ? 466  GLU C OE2   1 
ATOM   6867  N  N     . ARG C 2  467  ? 8.971   -15.354 -26.430  1.00 101.04 ? 467  ARG C N     1 
ATOM   6868  C  CA    . ARG C 2  467  ? 9.867   -16.104 -27.304  1.00 106.90 ? 467  ARG C CA    1 
ATOM   6869  C  C     . ARG C 2  467  ? 11.238  -16.327 -26.661  1.00 104.12 ? 467  ARG C C     1 
ATOM   6870  O  O     . ARG C 2  467  ? 12.087  -17.019 -27.223  1.00 111.00 ? 467  ARG C O     1 
ATOM   6871  C  CB    . ARG C 2  467  ? 10.033  -15.386 -28.649  1.00 109.21 ? 467  ARG C CB    1 
ATOM   6872  C  CG    . ARG C 2  467  ? 8.722   -14.992 -29.317  1.00 105.11 ? 467  ARG C CG    1 
ATOM   6873  C  CD    . ARG C 2  467  ? 8.938   -14.431 -30.719  1.00 112.96 ? 467  ARG C CD    1 
ATOM   6874  N  NE    . ARG C 2  467  ? 9.021   -15.483 -31.730  1.00 128.58 ? 467  ARG C NE    1 
ATOM   6875  C  CZ    . ARG C 2  467  ? 7.966   -16.018 -32.339  1.00 128.68 ? 467  ARG C CZ    1 
ATOM   6876  N  NH1   . ARG C 2  467  ? 6.744   -15.601 -32.038  1.00 130.85 ? 467  ARG C NH1   1 
ATOM   6877  N  NH2   . ARG C 2  467  ? 8.132   -16.970 -33.248  1.00 132.89 ? 467  ARG C NH2   1 
ATOM   6878  N  N     . ALA C 2  468  ? 11.448  -15.749 -25.483  1.00 81.36  ? 468  ALA C N     1 
ATOM   6879  C  CA    . ALA C 2  468  ? 12.744  -15.839 -24.814  1.00 71.96  ? 468  ALA C CA    1 
ATOM   6880  C  C     . ALA C 2  468  ? 12.835  -17.045 -23.881  1.00 68.03  ? 468  ALA C C     1 
ATOM   6881  O  O     . ALA C 2  468  ? 12.048  -17.178 -22.944  1.00 66.71  ? 468  ALA C O     1 
ATOM   6882  C  CB    . ALA C 2  468  ? 13.029  -14.556 -24.043  1.00 64.77  ? 468  ALA C CB    1 
ATOM   6883  N  N     . GLY C 2  469  ? 13.804  -17.917 -24.144  1.00 64.13  ? 469  GLY C N     1 
ATOM   6884  C  CA    . GLY C 2  469  ? 14.051  -19.070 -23.298  1.00 58.59  ? 469  GLY C CA    1 
ATOM   6885  C  C     . GLY C 2  469  ? 14.915  -18.694 -22.110  1.00 56.00  ? 469  GLY C C     1 
ATOM   6886  O  O     . GLY C 2  469  ? 15.076  -17.514 -21.805  1.00 59.05  ? 469  GLY C O     1 
ATOM   6887  N  N     . LEU C 2  470  ? 15.477  -19.695 -21.441  1.00 56.71  ? 470  LEU C N     1 
ATOM   6888  C  CA    . LEU C 2  470  ? 16.315  -19.453 -20.270  1.00 59.14  ? 470  LEU C CA    1 
ATOM   6889  C  C     . LEU C 2  470  ? 17.772  -19.174 -20.634  1.00 61.45  ? 470  LEU C C     1 
ATOM   6890  O  O     . LEU C 2  470  ? 18.586  -18.868 -19.763  1.00 59.15  ? 470  LEU C O     1 
ATOM   6891  C  CB    . LEU C 2  470  ? 16.249  -20.643 -19.314  1.00 56.97  ? 470  LEU C CB    1 
ATOM   6892  C  CG    . LEU C 2  470  ? 14.881  -20.919 -18.695  1.00 57.81  ? 470  LEU C CG    1 
ATOM   6893  C  CD1   . LEU C 2  470  ? 14.954  -22.113 -17.759  1.00 64.95  ? 470  LEU C CD1   1 
ATOM   6894  C  CD2   . LEU C 2  470  ? 14.363  -19.686 -17.969  1.00 53.31  ? 470  LEU C CD2   1 
ATOM   6895  N  N     . GLU C 2  471  ? 18.098  -19.276 -21.919  1.00 63.86  ? 471  GLU C N     1 
ATOM   6896  C  CA    . GLU C 2  471  ? 19.475  -19.099 -22.372  1.00 64.35  ? 471  GLU C CA    1 
ATOM   6897  C  C     . GLU C 2  471  ? 19.761  -17.646 -22.714  1.00 56.93  ? 471  GLU C C     1 
ATOM   6898  O  O     . GLU C 2  471  ? 20.868  -17.152 -22.512  1.00 58.48  ? 471  GLU C O     1 
ATOM   6899  C  CB    . GLU C 2  471  ? 19.764  -19.979 -23.592  1.00 69.43  ? 471  GLU C CB    1 
ATOM   6900  C  CG    . GLU C 2  471  ? 19.155  -21.368 -23.539  1.00 68.04  ? 471  GLU C CG    1 
ATOM   6901  C  CD    . GLU C 2  471  ? 17.732  -21.404 -24.067  1.00 73.52  ? 471  GLU C CD    1 
ATOM   6902  O  OE1   . GLU C 2  471  ? 17.117  -20.324 -24.198  1.00 69.11  ? 471  GLU C OE1   1 
ATOM   6903  O  OE2   . GLU C 2  471  ? 17.232  -22.511 -24.359  1.00 84.60  ? 471  GLU C OE2   1 
ATOM   6904  N  N     . VAL C 2  472  ? 18.753  -16.969 -23.244  1.00 56.99  ? 472  VAL C N     1 
ATOM   6905  C  CA    . VAL C 2  472  ? 18.912  -15.596 -23.686  1.00 65.03  ? 472  VAL C CA    1 
ATOM   6906  C  C     . VAL C 2  472  ? 19.091  -14.654 -22.506  1.00 50.72  ? 472  VAL C C     1 
ATOM   6907  O  O     . VAL C 2  472  ? 19.605  -13.550 -22.655  1.00 53.32  ? 472  VAL C O     1 
ATOM   6908  C  CB    . VAL C 2  472  ? 17.699  -15.141 -24.516  1.00 83.88  ? 472  VAL C CB    1 
ATOM   6909  C  CG1   . VAL C 2  472  ? 18.079  -13.988 -25.428  1.00 123.17 ? 472  VAL C CG1   1 
ATOM   6910  C  CG2   . VAL C 2  472  ? 17.149  -16.303 -25.328  1.00 92.94  ? 472  VAL C CG2   1 
ATOM   6911  N  N     . ARG C 2  473  ? 18.679  -15.106 -21.328  1.00 47.62  ? 473  ARG C N     1 
ATOM   6912  C  CA    . ARG C 2  473  ? 18.552  -14.225 -20.175  1.00 46.45  ? 473  ARG C CA    1 
ATOM   6913  C  C     . ARG C 2  473  ? 19.742  -14.269 -19.213  1.00 44.34  ? 473  ARG C C     1 
ATOM   6914  O  O     . ARG C 2  473  ? 20.168  -13.233 -18.711  1.00 43.20  ? 473  ARG C O     1 
ATOM   6915  C  CB    . ARG C 2  473  ? 17.268  -14.562 -19.414  1.00 51.01  ? 473  ARG C CB    1 
ATOM   6916  C  CG    . ARG C 2  473  ? 16.044  -14.714 -20.308  1.00 55.68  ? 473  ARG C CG    1 
ATOM   6917  C  CD    . ARG C 2  473  ? 14.859  -15.277 -19.533  1.00 55.50  ? 473  ARG C CD    1 
ATOM   6918  N  NE    . ARG C 2  473  ? 13.946  -14.232 -19.079  1.00 43.20  ? 473  ARG C NE    1 
ATOM   6919  C  CZ    . ARG C 2  473  ? 12.788  -13.948 -19.667  1.00 46.29  ? 473  ARG C CZ    1 
ATOM   6920  N  NH1   . ARG C 2  473  ? 12.395  -14.636 -20.731  1.00 50.39  ? 473  ARG C NH1   1 
ATOM   6921  N  NH2   . ARG C 2  473  ? 12.019  -12.980 -19.186  1.00 47.98  ? 473  ARG C NH2   1 
ATOM   6922  N  N     . ASP C 2  474  ? 20.275  -15.458 -18.954  1.00 43.93  ? 474  ASP C N     1 
ATOM   6923  C  CA    . ASP C 2  474  ? 21.327  -15.611 -17.948  1.00 43.78  ? 474  ASP C CA    1 
ATOM   6924  C  C     . ASP C 2  474  ? 22.684  -15.057 -18.394  1.00 41.89  ? 474  ASP C C     1 
ATOM   6925  O  O     . ASP C 2  474  ? 22.928  -14.847 -19.583  1.00 39.09  ? 474  ASP C O     1 
ATOM   6926  C  CB    . ASP C 2  474  ? 21.467  -17.083 -17.546  1.00 46.73  ? 474  ASP C CB    1 
ATOM   6927  C  CG    . ASP C 2  474  ? 21.424  -18.020 -18.734  1.00 59.83  ? 474  ASP C CG    1 
ATOM   6928  O  OD1   . ASP C 2  474  ? 21.692  -17.553 -19.861  1.00 61.14  ? 474  ASP C OD1   1 
ATOM   6929  O  OD2   . ASP C 2  474  ? 21.121  -19.219 -18.537  1.00 71.94  ? 474  ASP C OD2   1 
ATOM   6930  N  N     . VAL C 2  475  ? 23.561  -14.829 -17.419  1.00 39.51  ? 475  VAL C N     1 
ATOM   6931  C  CA    . VAL C 2  475  ? 24.846  -14.175 -17.649  1.00 38.75  ? 475  VAL C CA    1 
ATOM   6932  C  C     . VAL C 2  475  ? 25.812  -15.012 -18.481  1.00 39.89  ? 475  VAL C C     1 
ATOM   6933  O  O     . VAL C 2  475  ? 26.162  -16.130 -18.108  1.00 41.04  ? 475  VAL C O     1 
ATOM   6934  C  CB    . VAL C 2  475  ? 25.539  -13.828 -16.314  1.00 40.50  ? 475  VAL C CB    1 
ATOM   6935  C  CG1   . VAL C 2  475  ? 26.795  -13.014 -16.568  1.00 39.60  ? 475  VAL C CG1   1 
ATOM   6936  C  CG2   . VAL C 2  475  ? 24.594  -13.068 -15.403  1.00 38.87  ? 475  VAL C CG2   1 
ATOM   6937  N  N     . HIS C 2  476  ? 26.251  -14.448 -19.602  1.00 43.16  ? 476  HIS C N     1 
ATOM   6938  C  CA    . HIS C 2  476  ? 27.240  -15.087 -20.466  1.00 43.29  ? 476  HIS C CA    1 
ATOM   6939  C  C     . HIS C 2  476  ? 28.654  -14.581 -20.156  1.00 43.59  ? 476  HIS C C     1 
ATOM   6940  O  O     . HIS C 2  476  ? 28.837  -13.411 -19.830  1.00 42.16  ? 476  HIS C O     1 
ATOM   6941  C  CB    . HIS C 2  476  ? 26.891  -14.835 -21.936  1.00 44.85  ? 476  HIS C CB    1 
ATOM   6942  C  CG    . HIS C 2  476  ? 27.784  -15.546 -22.903  1.00 47.62  ? 476  HIS C CG    1 
ATOM   6943  N  ND1   . HIS C 2  476  ? 28.939  -14.983 -23.403  1.00 45.36  ? 476  HIS C ND1   1 
ATOM   6944  C  CD2   . HIS C 2  476  ? 27.696  -16.777 -23.458  1.00 53.89  ? 476  HIS C CD2   1 
ATOM   6945  C  CE1   . HIS C 2  476  ? 29.521  -15.834 -24.227  1.00 49.75  ? 476  HIS C CE1   1 
ATOM   6946  N  NE2   . HIS C 2  476  ? 28.787  -16.931 -24.280  1.00 55.25  ? 476  HIS C NE2   1 
ATOM   6947  N  N     . PRO C 2  477  ? 29.656  -15.468 -20.249  1.00 38.71  ? 477  PRO C N     1 
ATOM   6948  C  CA    . PRO C 2  477  ? 31.058  -15.114 -20.000  1.00 40.69  ? 477  PRO C CA    1 
ATOM   6949  C  C     . PRO C 2  477  ? 31.531  -13.859 -20.741  1.00 39.89  ? 477  PRO C C     1 
ATOM   6950  O  O     . PRO C 2  477  ? 32.279  -13.067 -20.170  1.00 39.65  ? 477  PRO C O     1 
ATOM   6951  C  CB    . PRO C 2  477  ? 31.824  -16.354 -20.492  1.00 46.87  ? 477  PRO C CB    1 
ATOM   6952  C  CG    . PRO C 2  477  ? 30.799  -17.225 -21.196  1.00 46.88  ? 477  PRO C CG    1 
ATOM   6953  C  CD    . PRO C 2  477  ? 29.510  -16.905 -20.515  1.00 40.14  ? 477  PRO C CD    1 
ATOM   6954  N  N     . SER C 2  478  ? 31.089  -13.669 -21.979  1.00 38.77  ? 478  SER C N     1 
ATOM   6955  C  CA    . SER C 2  478  ? 31.562  -12.549 -22.791  1.00 36.05  ? 478  SER C CA    1 
ATOM   6956  C  C     . SER C 2  478  ? 31.130  -11.192 -22.237  1.00 37.19  ? 478  SER C C     1 
ATOM   6957  O  O     . SER C 2  478  ? 31.710  -10.164 -22.586  1.00 36.62  ? 478  SER C O     1 
ATOM   6958  C  CB    . SER C 2  478  ? 31.082  -12.695 -24.236  1.00 37.00  ? 478  SER C CB    1 
ATOM   6959  O  OG    . SER C 2  478  ? 29.672  -12.660 -24.320  1.00 37.14  ? 478  SER C OG    1 
ATOM   6960  N  N     . HIS C 2  479  ? 30.131  -11.195 -21.357  1.00 44.74  ? 479  HIS C N     1 
ATOM   6961  C  CA    . HIS C 2  479  ? 29.601  -9.959  -20.774  1.00 38.83  ? 479  HIS C CA    1 
ATOM   6962  C  C     . HIS C 2  479  ? 30.604  -9.209  -19.905  1.00 36.72  ? 479  HIS C C     1 
ATOM   6963  O  O     . HIS C 2  479  ? 30.387  -8.043  -19.570  1.00 34.93  ? 479  HIS C O     1 
ATOM   6964  C  CB    . HIS C 2  479  ? 28.354  -10.247 -19.931  1.00 43.40  ? 479  HIS C CB    1 
ATOM   6965  C  CG    . HIS C 2  479  ? 27.117  -10.477 -20.738  1.00 43.57  ? 479  HIS C CG    1 
ATOM   6966  N  ND1   . HIS C 2  479  ? 27.112  -11.179 -21.921  1.00 47.20  ? 479  HIS C ND1   1 
ATOM   6967  C  CD2   . HIS C 2  479  ? 25.831  -10.106 -20.513  1.00 42.74  ? 479  HIS C CD2   1 
ATOM   6968  C  CE1   . HIS C 2  479  ? 25.885  -11.229 -22.397  1.00 45.69  ? 479  HIS C CE1   1 
ATOM   6969  N  NE2   . HIS C 2  479  ? 25.086  -10.587 -21.566  1.00 49.59  ? 479  HIS C NE2   1 
ATOM   6970  N  N     . TYR C 2  480  ? 31.683  -9.881  -19.521  1.00 33.80  ? 480  TYR C N     1 
ATOM   6971  C  CA    . TYR C 2  480  ? 32.686  -9.271  -18.657  1.00 34.58  ? 480  TYR C CA    1 
ATOM   6972  C  C     . TYR C 2  480  ? 33.280  -8.008  -19.282  1.00 34.38  ? 480  TYR C C     1 
ATOM   6973  O  O     . TYR C 2  480  ? 33.878  -8.060  -20.356  1.00 34.55  ? 480  TYR C O     1 
ATOM   6974  C  CB    . TYR C 2  480  ? 33.799  -10.269 -18.343  1.00 37.67  ? 480  TYR C CB    1 
ATOM   6975  C  CG    . TYR C 2  480  ? 34.839  -9.727  -17.391  1.00 39.66  ? 480  TYR C CG    1 
ATOM   6976  C  CD1   . TYR C 2  480  ? 36.044  -9.224  -17.860  1.00 40.29  ? 480  TYR C CD1   1 
ATOM   6977  C  CD2   . TYR C 2  480  ? 34.611  -9.711  -16.022  1.00 38.29  ? 480  TYR C CD2   1 
ATOM   6978  C  CE1   . TYR C 2  480  ? 36.997  -8.725  -16.989  1.00 40.35  ? 480  TYR C CE1   1 
ATOM   6979  C  CE2   . TYR C 2  480  ? 35.555  -9.212  -15.144  1.00 37.13  ? 480  TYR C CE2   1 
ATOM   6980  C  CZ    . TYR C 2  480  ? 36.746  -8.721  -15.632  1.00 39.78  ? 480  TYR C CZ    1 
ATOM   6981  O  OH    . TYR C 2  480  ? 37.688  -8.226  -14.761  1.00 44.55  ? 480  TYR C OH    1 
ATOM   6982  N  N     . GLY C 2  481  ? 33.103  -6.876  -18.605  1.00 35.61  ? 481  GLY C N     1 
ATOM   6983  C  CA    . GLY C 2  481  ? 33.664  -5.611  -19.050  1.00 37.02  ? 481  GLY C CA    1 
ATOM   6984  C  C     . GLY C 2  481  ? 32.832  -4.929  -20.118  1.00 36.78  ? 481  GLY C C     1 
ATOM   6985  O  O     . GLY C 2  481  ? 33.144  -3.815  -20.545  1.00 33.17  ? 481  GLY C O     1 
ATOM   6986  N  N     . ARG C 2  482  ? 31.765  -5.604  -20.538  1.00 34.53  ? 482  ARG C N     1 
ATOM   6987  C  CA    . ARG C 2  482  ? 30.892  -5.125  -21.606  1.00 33.00  ? 482  ARG C CA    1 
ATOM   6988  C  C     . ARG C 2  482  ? 29.489  -4.840  -21.080  1.00 32.97  ? 482  ARG C C     1 
ATOM   6989  O  O     . ARG C 2  482  ? 29.042  -3.690  -21.058  1.00 34.61  ? 482  ARG C O     1 
ATOM   6990  C  CB    . ARG C 2  482  ? 30.836  -6.150  -22.742  1.00 33.54  ? 482  ARG C CB    1 
ATOM   6991  C  CG    . ARG C 2  482  ? 32.169  -6.338  -23.451  1.00 37.04  ? 482  ARG C CG    1 
ATOM   6992  C  CD    . ARG C 2  482  ? 32.152  -7.488  -24.450  1.00 40.86  ? 482  ARG C CD    1 
ATOM   6993  N  NE    . ARG C 2  482  ? 33.458  -7.648  -25.085  1.00 39.02  ? 482  ARG C NE    1 
ATOM   6994  C  CZ    . ARG C 2  482  ? 34.471  -8.323  -24.551  1.00 39.72  ? 482  ARG C CZ    1 
ATOM   6995  N  NH1   . ARG C 2  482  ? 34.330  -8.913  -23.372  1.00 38.57  ? 482  ARG C NH1   1 
ATOM   6996  N  NH2   . ARG C 2  482  ? 35.627  -8.412  -25.194  1.00 41.35  ? 482  ARG C NH2   1 
ATOM   6997  N  N     . MET C 2  483  ? 28.798  -5.894  -20.657  1.00 31.56  ? 483  MET C N     1 
ATOM   6998  C  CA    . MET C 2  483  ? 27.464  -5.757  -20.081  1.00 32.98  ? 483  MET C CA    1 
ATOM   6999  C  C     . MET C 2  483  ? 27.439  -6.240  -18.635  1.00 30.56  ? 483  MET C C     1 
ATOM   7000  O  O     . MET C 2  483  ? 27.870  -7.351  -18.335  1.00 32.38  ? 483  MET C O     1 
ATOM   7001  C  CB    . MET C 2  483  ? 26.437  -6.526  -20.915  1.00 34.99  ? 483  MET C CB    1 
ATOM   7002  C  CG    . MET C 2  483  ? 25.051  -6.602  -20.287  1.00 37.37  ? 483  MET C CG    1 
ATOM   7003  S  SD    . MET C 2  483  ? 23.778  -7.123  -21.454  1.00 47.04  ? 483  MET C SD    1 
ATOM   7004  C  CE    . MET C 2  483  ? 22.466  -7.601  -20.335  1.00 48.30  ? 483  MET C CE    1 
ATOM   7005  N  N     . CYS C 2  484  ? 26.934  -5.397  -17.743  1.00 28.75  ? 484  CYS C N     1 
ATOM   7006  C  CA    . CYS C 2  484  ? 26.865  -5.729  -16.326  1.00 29.03  ? 484  CYS C CA    1 
ATOM   7007  C  C     . CYS C 2  484  ? 25.989  -6.946  -16.054  1.00 28.04  ? 484  CYS C C     1 
ATOM   7008  O  O     . CYS C 2  484  ? 24.904  -7.084  -16.618  1.00 28.65  ? 484  CYS C O     1 
ATOM   7009  C  CB    . CYS C 2  484  ? 26.347  -4.536  -15.528  1.00 29.57  ? 484  CYS C CB    1 
ATOM   7010  S  SG    . CYS C 2  484  ? 26.148  -4.854  -13.761  1.00 32.25  ? 484  CYS C SG    1 
ATOM   7011  N  N     . PRO C 2  485  ? 26.472  -7.844  -15.191  1.00 26.35  ? 485  PRO C N     1 
ATOM   7012  C  CA    . PRO C 2  485  ? 25.719  -9.026  -14.780  1.00 25.88  ? 485  PRO C CA    1 
ATOM   7013  C  C     . PRO C 2  485  ? 24.806  -8.741  -13.595  1.00 27.11  ? 485  PRO C C     1 
ATOM   7014  O  O     . PRO C 2  485  ? 23.980  -9.582  -13.255  1.00 31.69  ? 485  PRO C O     1 
ATOM   7015  C  CB    . PRO C 2  485  ? 26.818  -10.006 -14.390  1.00 25.95  ? 485  PRO C CB    1 
ATOM   7016  C  CG    . PRO C 2  485  ? 27.865  -9.125  -13.818  1.00 29.71  ? 485  PRO C CG    1 
ATOM   7017  C  CD    . PRO C 2  485  ? 27.843  -7.862  -14.652  1.00 29.00  ? 485  PRO C CD    1 
ATOM   7018  N  N     . ILE C 2  486  ? 24.951  -7.577  -12.973  1.00 27.22  ? 486  ILE C N     1 
ATOM   7019  C  CA    . ILE C 2  486  ? 24.151  -7.256  -11.798  1.00 29.10  ? 486  ILE C CA    1 
ATOM   7020  C  C     . ILE C 2  486  ? 22.898  -6.452  -12.154  1.00 29.14  ? 486  ILE C C     1 
ATOM   7021  O  O     . ILE C 2  486  ? 21.824  -6.694  -11.604  1.00 27.69  ? 486  ILE C O     1 
ATOM   7022  C  CB    . ILE C 2  486  ? 24.980  -6.481  -10.757  1.00 29.11  ? 486  ILE C CB    1 
ATOM   7023  C  CG1   . ILE C 2  486  ? 26.187  -7.310  -10.318  1.00 27.34  ? 486  ILE C CG1   1 
ATOM   7024  C  CG2   . ILE C 2  486  ? 24.139  -6.150  -9.540   1.00 28.25  ? 486  ILE C CG2   1 
ATOM   7025  C  CD1   . ILE C 2  486  ? 25.810  -8.598  -9.619   1.00 28.29  ? 486  ILE C CD1   1 
ATOM   7026  N  N     . GLU C 2  487  ? 23.029  -5.515  -13.089  1.00 30.93  ? 487  GLU C N     1 
ATOM   7027  C  CA    . GLU C 2  487  ? 21.919  -4.634  -13.443  1.00 31.41  ? 487  GLU C CA    1 
ATOM   7028  C  C     . GLU C 2  487  ? 20.926  -5.275  -14.412  1.00 30.06  ? 487  GLU C C     1 
ATOM   7029  O  O     . GLU C 2  487  ? 21.227  -5.478  -15.590  1.00 27.85  ? 487  GLU C O     1 
ATOM   7030  C  CB    . GLU C 2  487  ? 22.447  -3.331  -14.038  1.00 29.13  ? 487  GLU C CB    1 
ATOM   7031  C  CG    . GLU C 2  487  ? 21.364  -2.300  -14.284  1.00 29.19  ? 487  GLU C CG    1 
ATOM   7032  C  CD    . GLU C 2  487  ? 21.733  -0.931  -13.751  1.00 29.09  ? 487  GLU C CD    1 
ATOM   7033  O  OE1   . GLU C 2  487  ? 22.922  -0.555  -13.845  1.00 29.60  ? 487  GLU C OE1   1 
ATOM   7034  O  OE2   . GLU C 2  487  ? 20.834  -0.235  -13.232  1.00 30.21  ? 487  GLU C OE2   1 
ATOM   7035  N  N     . THR C 2  488  ? 19.741  -5.580  -13.891  1.00 34.11  ? 488  THR C N     1 
ATOM   7036  C  CA    . THR C 2  488  ? 18.635  -6.148  -14.659  1.00 33.53  ? 488  THR C CA    1 
ATOM   7037  C  C     . THR C 2  488  ? 17.380  -6.157  -13.777  1.00 32.68  ? 488  THR C C     1 
ATOM   7038  O  O     . THR C 2  488  ? 17.475  -6.354  -12.564  1.00 32.69  ? 488  THR C O     1 
ATOM   7039  C  CB    . THR C 2  488  ? 18.951  -7.578  -15.164  1.00 34.13  ? 488  THR C CB    1 
ATOM   7040  O  OG1   . THR C 2  488  ? 17.792  -8.138  -15.796  1.00 32.82  ? 488  THR C OG1   1 
ATOM   7041  C  CG2   . THR C 2  488  ? 19.382  -8.472  -14.020  1.00 34.23  ? 488  THR C CG2   1 
ATOM   7042  N  N     . PRO C 2  489  ? 16.201  -5.919  -14.375  1.00 32.22  ? 489  PRO C N     1 
ATOM   7043  C  CA    . PRO C 2  489  ? 14.958  -5.854  -13.592  1.00 32.04  ? 489  PRO C CA    1 
ATOM   7044  C  C     . PRO C 2  489  ? 14.592  -7.175  -12.914  1.00 32.89  ? 489  PRO C C     1 
ATOM   7045  O  O     . PRO C 2  489  ? 15.052  -8.231  -13.345  1.00 33.11  ? 489  PRO C O     1 
ATOM   7046  C  CB    . PRO C 2  489  ? 13.902  -5.473  -14.639  1.00 32.22  ? 489  PRO C CB    1 
ATOM   7047  C  CG    . PRO C 2  489  ? 14.508  -5.841  -15.956  1.00 33.53  ? 489  PRO C CG    1 
ATOM   7048  C  CD    . PRO C 2  489  ? 15.974  -5.604  -15.795  1.00 33.65  ? 489  PRO C CD    1 
ATOM   7049  N  N     . GLU C 2  490  ? 13.781  -7.108  -11.861  1.00 34.18  ? 490  GLU C N     1 
ATOM   7050  C  CA    . GLU C 2  490  ? 13.350  -8.305  -11.140  1.00 34.56  ? 490  GLU C CA    1 
ATOM   7051  C  C     . GLU C 2  490  ? 12.182  -8.996  -11.833  1.00 34.93  ? 490  GLU C C     1 
ATOM   7052  O  O     . GLU C 2  490  ? 11.993  -10.205 -11.695  1.00 34.16  ? 490  GLU C O     1 
ATOM   7053  C  CB    . GLU C 2  490  ? 12.948  -7.961  -9.704   1.00 36.53  ? 490  GLU C CB    1 
ATOM   7054  C  CG    . GLU C 2  490  ? 14.106  -7.665  -8.768   1.00 40.96  ? 490  GLU C CG    1 
ATOM   7055  C  CD    . GLU C 2  490  ? 13.649  -7.447  -7.336   1.00 44.56  ? 490  GLU C CD    1 
ATOM   7056  O  OE1   . GLU C 2  490  ? 13.397  -8.447  -6.631   1.00 47.41  ? 490  GLU C OE1   1 
ATOM   7057  O  OE2   . GLU C 2  490  ? 13.534  -6.276  -6.918   1.00 45.01  ? 490  GLU C OE2   1 
ATOM   7058  N  N     . GLY C 2  491  ? 11.400  -8.220  -12.576  1.00 36.69  ? 491  GLY C N     1 
ATOM   7059  C  CA    . GLY C 2  491  ? 10.168  -8.713  -13.163  1.00 35.56  ? 491  GLY C CA    1 
ATOM   7060  C  C     . GLY C 2  491  ? 10.367  -9.715  -14.280  1.00 32.67  ? 491  GLY C C     1 
ATOM   7061  O  O     . GLY C 2  491  ? 11.470  -10.218 -14.491  1.00 29.78  ? 491  GLY C O     1 
ATOM   7062  N  N     . PRO C 2  492  ? 9.291   -10.004 -15.022  1.00 37.03  ? 492  PRO C N     1 
ATOM   7063  C  CA    . PRO C 2  492  ? 9.346   -10.930 -16.157  1.00 35.04  ? 492  PRO C CA    1 
ATOM   7064  C  C     . PRO C 2  492  ? 10.211  -10.408 -17.299  1.00 36.84  ? 492  PRO C C     1 
ATOM   7065  O  O     . PRO C 2  492  ? 10.278  -11.035 -18.352  1.00 34.95  ? 492  PRO C O     1 
ATOM   7066  C  CB    . PRO C 2  492  ? 7.878   -11.043 -16.589  1.00 39.23  ? 492  PRO C CB    1 
ATOM   7067  C  CG    . PRO C 2  492  ? 7.246   -9.781  -16.111  1.00 47.61  ? 492  PRO C CG    1 
ATOM   7068  C  CD    . PRO C 2  492  ? 7.939   -9.456  -14.821  1.00 44.41  ? 492  PRO C CD    1 
ATOM   7069  N  N     . ASN C 2  493  ? 10.853  -9.265  -17.090  1.00 33.50  ? 493  ASN C N     1 
ATOM   7070  C  CA    . ASN C 2  493  ? 11.762  -8.710  -18.080  1.00 32.08  ? 493  ASN C CA    1 
ATOM   7071  C  C     . ASN C 2  493  ? 13.187  -9.198  -17.869  1.00 34.52  ? 493  ASN C C     1 
ATOM   7072  O  O     . ASN C 2  493  ? 14.073  -8.917  -18.678  1.00 35.26  ? 493  ASN C O     1 
ATOM   7073  C  CB    . ASN C 2  493  ? 11.733  -7.183  -18.043  1.00 32.94  ? 493  ASN C CB    1 
ATOM   7074  C  CG    . ASN C 2  493  ? 10.797  -6.597  -19.074  1.00 38.34  ? 493  ASN C CG    1 
ATOM   7075  O  OD1   . ASN C 2  493  ? 10.464  -7.247  -20.066  1.00 43.56  ? 493  ASN C OD1   1 
ATOM   7076  N  ND2   . ASN C 2  493  ? 10.373  -5.359  -18.852  1.00 35.60  ? 493  ASN C ND2   1 
ATOM   7077  N  N     . ILE C 2  494  ? 13.393  -9.943  -16.787  1.00 34.63  ? 494  ILE C N     1 
ATOM   7078  C  CA    . ILE C 2  494  ? 14.733  -10.288 -16.320  1.00 34.05  ? 494  ILE C CA    1 
ATOM   7079  C  C     . ILE C 2  494  ? 15.596  -10.947 -17.398  1.00 32.37  ? 494  ILE C C     1 
ATOM   7080  O  O     . ILE C 2  494  ? 15.125  -11.768 -18.185  1.00 31.83  ? 494  ILE C O     1 
ATOM   7081  C  CB    . ILE C 2  494  ? 14.663  -11.210 -15.075  1.00 35.00  ? 494  ILE C CB    1 
ATOM   7082  C  CG1   . ILE C 2  494  ? 16.034  -11.321 -14.407  1.00 33.69  ? 494  ILE C CG1   1 
ATOM   7083  C  CG2   . ILE C 2  494  ? 14.094  -12.575 -15.435  1.00 35.32  ? 494  ILE C CG2   1 
ATOM   7084  C  CD1   . ILE C 2  494  ? 16.017  -12.090 -13.096  1.00 32.56  ? 494  ILE C CD1   1 
ATOM   7085  N  N     . GLY C 2  495  ? 16.859  -10.537 -17.449  1.00 28.87  ? 495  GLY C N     1 
ATOM   7086  C  CA    . GLY C 2  495  ? 17.803  -11.079 -18.405  1.00 29.53  ? 495  GLY C CA    1 
ATOM   7087  C  C     . GLY C 2  495  ? 17.679  -10.502 -19.801  1.00 31.20  ? 495  GLY C C     1 
ATOM   7088  O  O     . GLY C 2  495  ? 18.543  -10.728 -20.646  1.00 31.21  ? 495  GLY C O     1 
ATOM   7089  N  N     . LEU C 2  496  ? 16.603  -9.761  -20.048  1.00 34.01  ? 496  LEU C N     1 
ATOM   7090  C  CA    . LEU C 2  496  ? 16.369  -9.172  -21.362  1.00 34.33  ? 496  LEU C CA    1 
ATOM   7091  C  C     . LEU C 2  496  ? 16.701  -7.680  -21.372  1.00 32.82  ? 496  LEU C C     1 
ATOM   7092  O  O     . LEU C 2  496  ? 16.771  -7.051  -22.430  1.00 31.63  ? 496  LEU C O     1 
ATOM   7093  C  CB    . LEU C 2  496  ? 14.921  -9.403  -21.794  1.00 34.49  ? 496  LEU C CB    1 
ATOM   7094  C  CG    . LEU C 2  496  ? 14.528  -10.875 -21.928  1.00 40.26  ? 496  LEU C CG    1 
ATOM   7095  C  CD1   . LEU C 2  496  ? 13.078  -11.011 -22.355  1.00 52.96  ? 496  LEU C CD1   1 
ATOM   7096  C  CD2   . LEU C 2  496  ? 15.450  -11.590 -22.906  1.00 48.30  ? 496  LEU C CD2   1 
ATOM   7097  N  N     . ILE C 2  497  ? 16.906  -7.122  -20.184  1.00 32.16  ? 497  ILE C N     1 
ATOM   7098  C  CA    . ILE C 2  497  ? 17.316  -5.731  -20.047  1.00 31.73  ? 497  ILE C CA    1 
ATOM   7099  C  C     . ILE C 2  497  ? 18.547  -5.641  -19.155  1.00 30.08  ? 497  ILE C C     1 
ATOM   7100  O  O     . ILE C 2  497  ? 18.566  -6.201  -18.061  1.00 31.10  ? 497  ILE C O     1 
ATOM   7101  C  CB    . ILE C 2  497  ? 16.189  -4.858  -19.457  1.00 35.22  ? 497  ILE C CB    1 
ATOM   7102  C  CG1   . ILE C 2  497  ? 14.923  -4.955  -20.315  1.00 34.46  ? 497  ILE C CG1   1 
ATOM   7103  C  CG2   . ILE C 2  497  ? 16.642  -3.411  -19.333  1.00 36.70  ? 497  ILE C CG2   1 
ATOM   7104  C  CD1   . ILE C 2  497  ? 13.763  -4.135  -19.783  1.00 35.56  ? 497  ILE C CD1   1 
ATOM   7105  N  N     . GLY C 2  498  ? 19.578  -4.946  -19.623  1.00 27.74  ? 498  GLY C N     1 
ATOM   7106  C  CA    . GLY C 2  498  ? 20.795  -4.791  -18.845  1.00 27.59  ? 498  GLY C CA    1 
ATOM   7107  C  C     . GLY C 2  498  ? 21.497  -3.472  -19.104  1.00 26.54  ? 498  GLY C C     1 
ATOM   7108  O  O     . GLY C 2  498  ? 21.237  -2.804  -20.106  1.00 25.78  ? 498  GLY C O     1 
ATOM   7109  N  N     . SER C 2  499  ? 22.389  -3.090  -18.197  1.00 27.20  ? 499  SER C N     1 
ATOM   7110  C  CA    . SER C 2  499  ? 23.150  -1.864  -18.367  1.00 27.63  ? 499  SER C CA    1 
ATOM   7111  C  C     . SER C 2  499  ? 24.495  -2.171  -19.021  1.00 28.05  ? 499  SER C C     1 
ATOM   7112  O  O     . SER C 2  499  ? 24.955  -3.313  -19.005  1.00 27.00  ? 499  SER C O     1 
ATOM   7113  C  CB    . SER C 2  499  ? 23.352  -1.159  -17.023  1.00 29.00  ? 499  SER C CB    1 
ATOM   7114  O  OG    . SER C 2  499  ? 23.687  0.213   -17.206  1.00 28.84  ? 499  SER C OG    1 
ATOM   7115  N  N     . LEU C 2  500  ? 25.114  -1.149  -19.603  1.00 29.71  ? 500  LEU C N     1 
ATOM   7116  C  CA    . LEU C 2  500  ? 26.414  -1.295  -20.250  1.00 27.01  ? 500  LEU C CA    1 
ATOM   7117  C  C     . LEU C 2  500  ? 27.539  -0.987  -19.272  1.00 26.80  ? 500  LEU C C     1 
ATOM   7118  O  O     . LEU C 2  500  ? 27.482  0.009   -18.548  1.00 26.18  ? 500  LEU C O     1 
ATOM   7119  C  CB    . LEU C 2  500  ? 26.508  -0.378  -21.465  1.00 24.89  ? 500  LEU C CB    1 
ATOM   7120  C  CG    . LEU C 2  500  ? 27.818  -0.446  -22.239  1.00 22.48  ? 500  LEU C CG    1 
ATOM   7121  C  CD1   . LEU C 2  500  ? 27.615  -1.142  -23.573  1.00 22.72  ? 500  LEU C CD1   1 
ATOM   7122  C  CD2   . LEU C 2  500  ? 28.389  0.942   -22.432  1.00 24.96  ? 500  LEU C CD2   1 
ATOM   7123  N  N     . SER C 2  501  ? 28.558  -1.843  -19.257  1.00 29.39  ? 501  SER C N     1 
ATOM   7124  C  CA    . SER C 2  501  ? 29.672  -1.710  -18.318  1.00 28.95  ? 501  SER C CA    1 
ATOM   7125  C  C     . SER C 2  501  ? 30.392  -0.371  -18.466  1.00 30.24  ? 501  SER C C     1 
ATOM   7126  O  O     . SER C 2  501  ? 30.407  0.219   -19.544  1.00 30.50  ? 501  SER C O     1 
ATOM   7127  C  CB    . SER C 2  501  ? 30.668  -2.859  -18.496  1.00 30.46  ? 501  SER C CB    1 
ATOM   7128  O  OG    . SER C 2  501  ? 30.099  -4.100  -18.112  1.00 31.56  ? 501  SER C OG    1 
ATOM   7129  N  N     . VAL C 2  502  ? 30.992  0.091   -17.372  1.00 28.35  ? 502  VAL C N     1 
ATOM   7130  C  CA    . VAL C 2  502  ? 31.550  1.439   -17.283  1.00 28.35  ? 502  VAL C CA    1 
ATOM   7131  C  C     . VAL C 2  502  ? 32.580  1.756   -18.357  1.00 26.93  ? 502  VAL C C     1 
ATOM   7132  O  O     . VAL C 2  502  ? 32.458  2.749   -19.069  1.00 26.87  ? 502  VAL C O     1 
ATOM   7133  C  CB    . VAL C 2  502  ? 32.204  1.678   -15.909  1.00 27.18  ? 502  VAL C CB    1 
ATOM   7134  C  CG1   . VAL C 2  502  ? 32.882  3.034   -15.873  1.00 29.04  ? 502  VAL C CG1   1 
ATOM   7135  C  CG2   . VAL C 2  502  ? 31.164  1.581   -14.809  1.00 30.71  ? 502  VAL C CG2   1 
ATOM   7136  N  N     . TYR C 2  503  ? 33.595  0.911   -18.470  1.00 31.27  ? 503  TYR C N     1 
ATOM   7137  C  CA    . TYR C 2  503  ? 34.704  1.182   -19.373  1.00 32.49  ? 503  TYR C CA    1 
ATOM   7138  C  C     . TYR C 2  503  ? 34.429  0.760   -20.813  1.00 33.24  ? 503  TYR C C     1 
ATOM   7139  O  O     . TYR C 2  503  ? 35.264  0.963   -21.692  1.00 32.53  ? 503  TYR C O     1 
ATOM   7140  C  CB    . TYR C 2  503  ? 35.965  0.486   -18.865  1.00 34.62  ? 503  TYR C CB    1 
ATOM   7141  C  CG    . TYR C 2  503  ? 36.454  1.015   -17.537  1.00 35.75  ? 503  TYR C CG    1 
ATOM   7142  C  CD1   . TYR C 2  503  ? 37.108  2.236   -17.455  1.00 37.68  ? 503  TYR C CD1   1 
ATOM   7143  C  CD2   . TYR C 2  503  ? 36.267  0.294   -16.367  1.00 35.61  ? 503  TYR C CD2   1 
ATOM   7144  C  CE1   . TYR C 2  503  ? 37.559  2.726   -16.244  1.00 40.31  ? 503  TYR C CE1   1 
ATOM   7145  C  CE2   . TYR C 2  503  ? 36.716  0.776   -15.151  1.00 37.20  ? 503  TYR C CE2   1 
ATOM   7146  C  CZ    . TYR C 2  503  ? 37.360  1.992   -15.096  1.00 40.99  ? 503  TYR C CZ    1 
ATOM   7147  O  OH    . TYR C 2  503  ? 37.809  2.480   -13.891  1.00 43.78  ? 503  TYR C OH    1 
ATOM   7148  N  N     . ALA C 2  504  ? 33.259  0.186   -21.058  1.00 31.12  ? 504  ALA C N     1 
ATOM   7149  C  CA    . ALA C 2  504  ? 32.940  -0.326  -22.384  1.00 31.65  ? 504  ALA C CA    1 
ATOM   7150  C  C     . ALA C 2  504  ? 32.573  0.786   -23.356  1.00 26.17  ? 504  ALA C C     1 
ATOM   7151  O  O     . ALA C 2  504  ? 32.152  1.866   -22.950  1.00 23.36  ? 504  ALA C O     1 
ATOM   7152  C  CB    . ALA C 2  504  ? 31.812  -1.335  -22.296  1.00 37.01  ? 504  ALA C CB    1 
ATOM   7153  N  N     . ARG C 2  505  ? 32.748  0.511   -24.644  1.00 29.50  ? 505  ARG C N     1 
ATOM   7154  C  CA    . ARG C 2  505  ? 32.303  1.412   -25.698  1.00 32.62  ? 505  ARG C CA    1 
ATOM   7155  C  C     . ARG C 2  505  ? 31.852  0.594   -26.906  1.00 35.52  ? 505  ARG C C     1 
ATOM   7156  O  O     . ARG C 2  505  ? 32.077  -0.616  -26.964  1.00 34.84  ? 505  ARG C O     1 
ATOM   7157  C  CB    . ARG C 2  505  ? 33.414  2.381   -26.102  1.00 35.88  ? 505  ARG C CB    1 
ATOM   7158  C  CG    . ARG C 2  505  ? 34.352  1.818   -27.154  1.00 40.18  ? 505  ARG C CG    1 
ATOM   7159  C  CD    . ARG C 2  505  ? 35.294  2.875   -27.698  1.00 47.44  ? 505  ARG C CD    1 
ATOM   7160  N  NE    . ARG C 2  505  ? 36.040  2.376   -28.850  1.00 55.64  ? 505  ARG C NE    1 
ATOM   7161  C  CZ    . ARG C 2  505  ? 37.125  2.961   -29.346  1.00 70.81  ? 505  ARG C CZ    1 
ATOM   7162  N  NH1   . ARG C 2  505  ? 37.597  4.067   -28.783  1.00 79.88  ? 505  ARG C NH1   1 
ATOM   7163  N  NH2   . ARG C 2  505  ? 37.743  2.442   -30.400  1.00 76.17  ? 505  ARG C NH2   1 
ATOM   7164  N  N     . VAL C 2  506  ? 31.220  1.254   -27.871  1.00 38.26  ? 506  VAL C N     1 
ATOM   7165  C  CA    . VAL C 2  506  ? 30.773  0.577   -29.083  1.00 36.63  ? 506  VAL C CA    1 
ATOM   7166  C  C     . VAL C 2  506  ? 31.736  0.818   -30.241  1.00 39.83  ? 506  VAL C C     1 
ATOM   7167  O  O     . VAL C 2  506  ? 32.213  1.936   -30.439  1.00 42.41  ? 506  VAL C O     1 
ATOM   7168  C  CB    . VAL C 2  506  ? 29.370  1.039   -29.507  1.00 33.87  ? 506  VAL C CB    1 
ATOM   7169  C  CG1   . VAL C 2  506  ? 28.776  0.058   -30.507  1.00 35.92  ? 506  VAL C CG1   1 
ATOM   7170  C  CG2   . VAL C 2  506  ? 28.468  1.176   -28.299  1.00 32.49  ? 506  VAL C CG2   1 
ATOM   7171  N  N     . ASN C 2  507  ? 32.026  -0.238  -30.995  1.00 43.92  ? 507  ASN C N     1 
ATOM   7172  C  CA    . ASN C 2  507  ? 32.861  -0.129  -32.186  1.00 44.99  ? 507  ASN C CA    1 
ATOM   7173  C  C     . ASN C 2  507  ? 31.989  0.141   -33.411  1.00 45.50  ? 507  ASN C C     1 
ATOM   7174  O  O     . ASN C 2  507  ? 30.796  -0.151  -33.389  1.00 46.60  ? 507  ASN C O     1 
ATOM   7175  C  CB    . ASN C 2  507  ? 33.698  -1.401  -32.378  1.00 48.34  ? 507  ASN C CB    1 
ATOM   7176  C  CG    . ASN C 2  507  ? 32.869  -2.587  -32.822  1.00 48.35  ? 507  ASN C CG    1 
ATOM   7177  O  OD1   . ASN C 2  507  ? 31.696  -2.704  -32.475  1.00 47.77  ? 507  ASN C OD1   1 
ATOM   7178  N  ND2   . ASN C 2  507  ? 33.478  -3.476  -33.596  1.00 49.69  ? 507  ASN C ND2   1 
ATOM   7179  N  N     . PRO C 2  508  ? 32.573  0.708   -34.482  1.00 47.45  ? 508  PRO C N     1 
ATOM   7180  C  CA    . PRO C 2  508  ? 31.807  1.076   -35.683  1.00 49.73  ? 508  PRO C CA    1 
ATOM   7181  C  C     . PRO C 2  508  ? 31.066  -0.075  -36.379  1.00 50.90  ? 508  PRO C C     1 
ATOM   7182  O  O     . PRO C 2  508  ? 30.389  0.171   -37.379  1.00 50.60  ? 508  PRO C O     1 
ATOM   7183  C  CB    . PRO C 2  508  ? 32.883  1.646   -36.611  1.00 57.76  ? 508  PRO C CB    1 
ATOM   7184  C  CG    . PRO C 2  508  ? 33.907  2.198   -35.685  1.00 55.02  ? 508  PRO C CG    1 
ATOM   7185  C  CD    . PRO C 2  508  ? 33.953  1.226   -34.541  1.00 50.14  ? 508  PRO C CD    1 
ATOM   7186  N  N     . PHE C 2  509  ? 31.182  -1.296  -35.866  1.00 51.03  ? 509  PHE C N     1 
ATOM   7187  C  CA    . PHE C 2  509  ? 30.498  -2.436  -36.469  1.00 53.54  ? 509  PHE C CA    1 
ATOM   7188  C  C     . PHE C 2  509  ? 29.314  -2.928  -35.635  1.00 54.88  ? 509  PHE C C     1 
ATOM   7189  O  O     . PHE C 2  509  ? 28.539  -3.772  -36.089  1.00 59.51  ? 509  PHE C O     1 
ATOM   7190  C  CB    . PHE C 2  509  ? 31.480  -3.584  -36.699  1.00 56.25  ? 509  PHE C CB    1 
ATOM   7191  C  CG    . PHE C 2  509  ? 32.073  -3.604  -38.080  1.00 63.86  ? 509  PHE C CG    1 
ATOM   7192  C  CD1   . PHE C 2  509  ? 33.262  -2.948  -38.351  1.00 64.95  ? 509  PHE C CD1   1 
ATOM   7193  C  CD2   . PHE C 2  509  ? 31.437  -4.277  -39.110  1.00 70.53  ? 509  PHE C CD2   1 
ATOM   7194  C  CE1   . PHE C 2  509  ? 33.805  -2.967  -39.624  1.00 68.49  ? 509  PHE C CE1   1 
ATOM   7195  C  CE2   . PHE C 2  509  ? 31.975  -4.298  -40.382  1.00 76.26  ? 509  PHE C CE2   1 
ATOM   7196  C  CZ    . PHE C 2  509  ? 33.160  -3.643  -40.640  1.00 76.15  ? 509  PHE C CZ    1 
ATOM   7197  N  N     . GLY C 2  510  ? 29.178  -2.407  -34.420  1.00 55.05  ? 510  GLY C N     1 
ATOM   7198  C  CA    . GLY C 2  510  ? 28.007  -2.689  -33.605  1.00 58.67  ? 510  GLY C CA    1 
ATOM   7199  C  C     . GLY C 2  510  ? 28.232  -3.623  -32.429  1.00 48.48  ? 510  GLY C C     1 
ATOM   7200  O  O     . GLY C 2  510  ? 27.284  -3.996  -31.735  1.00 44.86  ? 510  GLY C O     1 
ATOM   7201  N  N     . PHE C 2  511  ? 29.484  -4.007  -32.205  1.00 50.31  ? 511  PHE C N     1 
ATOM   7202  C  CA    . PHE C 2  511  ? 29.828  -4.885  -31.094  1.00 48.08  ? 511  PHE C CA    1 
ATOM   7203  C  C     . PHE C 2  511  ? 30.285  -4.055  -29.896  1.00 46.38  ? 511  PHE C C     1 
ATOM   7204  O  O     . PHE C 2  511  ? 30.427  -2.836  -29.992  1.00 44.39  ? 511  PHE C O     1 
ATOM   7205  C  CB    . PHE C 2  511  ? 30.915  -5.878  -31.510  1.00 45.11  ? 511  PHE C CB    1 
ATOM   7206  C  CG    . PHE C 2  511  ? 30.587  -6.646  -32.760  1.00 51.24  ? 511  PHE C CG    1 
ATOM   7207  C  CD1   . PHE C 2  511  ? 29.847  -7.814  -32.697  1.00 53.46  ? 511  PHE C CD1   1 
ATOM   7208  C  CD2   . PHE C 2  511  ? 31.012  -6.195  -33.998  1.00 54.65  ? 511  PHE C CD2   1 
ATOM   7209  C  CE1   . PHE C 2  511  ? 29.542  -8.522  -33.847  1.00 57.65  ? 511  PHE C CE1   1 
ATOM   7210  C  CE2   . PHE C 2  511  ? 30.709  -6.899  -35.152  1.00 65.42  ? 511  PHE C CE2   1 
ATOM   7211  C  CZ    . PHE C 2  511  ? 29.973  -8.064  -35.076  1.00 64.21  ? 511  PHE C CZ    1 
ATOM   7212  N  N     . ILE C 2  512  ? 30.509  -4.713  -28.764  1.00 43.11  ? 512  ILE C N     1 
ATOM   7213  C  CA    . ILE C 2  512  ? 30.892  -4.004  -27.549  1.00 37.73  ? 512  ILE C CA    1 
ATOM   7214  C  C     . ILE C 2  512  ? 32.346  -4.275  -27.169  1.00 38.32  ? 512  ILE C C     1 
ATOM   7215  O  O     . ILE C 2  512  ? 32.705  -5.395  -26.809  1.00 40.61  ? 512  ILE C O     1 
ATOM   7216  C  CB    . ILE C 2  512  ? 29.979  -4.386  -26.375  1.00 35.44  ? 512  ILE C CB    1 
ATOM   7217  C  CG1   . ILE C 2  512  ? 28.511  -4.228  -26.778  1.00 34.05  ? 512  ILE C CG1   1 
ATOM   7218  C  CG2   . ILE C 2  512  ? 30.299  -3.531  -25.164  1.00 32.58  ? 512  ILE C CG2   1 
ATOM   7219  C  CD1   . ILE C 2  512  ? 27.531  -4.493  -25.657  1.00 36.79  ? 512  ILE C CD1   1 
ATOM   7220  N  N     . GLU C 2  513  ? 33.178  -3.242  -27.258  1.00 36.84  ? 513  GLU C N     1 
ATOM   7221  C  CA    . GLU C 2  513  ? 34.587  -3.359  -26.895  1.00 39.02  ? 513  GLU C CA    1 
ATOM   7222  C  C     . GLU C 2  513  ? 34.815  -3.001  -25.430  1.00 36.96  ? 513  GLU C C     1 
ATOM   7223  O  O     . GLU C 2  513  ? 33.966  -2.376  -24.794  1.00 36.65  ? 513  GLU C O     1 
ATOM   7224  C  CB    . GLU C 2  513  ? 35.454  -2.468  -27.792  1.00 46.03  ? 513  GLU C CB    1 
ATOM   7225  C  CG    . GLU C 2  513  ? 35.614  -2.970  -29.222  1.00 50.07  ? 513  GLU C CG    1 
ATOM   7226  C  CD    . GLU C 2  513  ? 36.455  -2.034  -30.086  1.00 56.73  ? 513  GLU C CD    1 
ATOM   7227  O  OE1   . GLU C 2  513  ? 36.559  -0.835  -29.746  1.00 53.13  ? 513  GLU C OE1   1 
ATOM   7228  O  OE2   . GLU C 2  513  ? 37.012  -2.503  -31.103  1.00 63.58  ? 513  GLU C OE2   1 
ATOM   7229  N  N     . THR C 2  514  ? 35.960  -3.419  -24.901  1.00 37.32  ? 514  THR C N     1 
ATOM   7230  C  CA    . THR C 2  514  ? 36.353  -3.102  -23.532  1.00 35.93  ? 514  THR C CA    1 
ATOM   7231  C  C     . THR C 2  514  ? 37.872  -2.971  -23.464  1.00 41.19  ? 514  THR C C     1 
ATOM   7232  O  O     . THR C 2  514  ? 38.590  -3.736  -24.104  1.00 43.03  ? 514  THR C O     1 
ATOM   7233  C  CB    . THR C 2  514  ? 35.865  -4.175  -22.533  1.00 35.00  ? 514  THR C CB    1 
ATOM   7234  O  OG1   . THR C 2  514  ? 36.357  -3.881  -21.219  1.00 33.05  ? 514  THR C OG1   1 
ATOM   7235  C  CG2   . THR C 2  514  ? 36.338  -5.557  -22.952  1.00 36.90  ? 514  THR C CG2   1 
ATOM   7236  N  N     . PRO C 2  515  ? 38.371  -1.987  -22.701  1.00 45.60  ? 515  PRO C N     1 
ATOM   7237  C  CA    . PRO C 2  515  ? 39.817  -1.743  -22.656  1.00 45.31  ? 515  PRO C CA    1 
ATOM   7238  C  C     . PRO C 2  515  ? 40.584  -2.789  -21.848  1.00 44.60  ? 515  PRO C C     1 
ATOM   7239  O  O     . PRO C 2  515  ? 40.128  -3.206  -20.786  1.00 43.85  ? 515  PRO C O     1 
ATOM   7240  C  CB    . PRO C 2  515  ? 39.917  -0.362  -21.995  1.00 40.23  ? 515  PRO C CB    1 
ATOM   7241  C  CG    . PRO C 2  515  ? 38.702  -0.268  -21.145  1.00 40.20  ? 515  PRO C CG    1 
ATOM   7242  C  CD    . PRO C 2  515  ? 37.621  -1.033  -21.867  1.00 42.17  ? 515  PRO C CD    1 
ATOM   7243  N  N     . TYR C 2  516  ? 41.727  -3.220  -22.372  1.00 46.53  ? 516  TYR C N     1 
ATOM   7244  C  CA    . TYR C 2  516  ? 42.650  -4.072  -21.627  1.00 50.41  ? 516  TYR C CA    1 
ATOM   7245  C  C     . TYR C 2  516  ? 44.038  -3.449  -21.654  1.00 56.33  ? 516  TYR C C     1 
ATOM   7246  O  O     . TYR C 2  516  ? 44.424  -2.830  -22.645  1.00 59.82  ? 516  TYR C O     1 
ATOM   7247  C  CB    . TYR C 2  516  ? 42.701  -5.492  -22.206  1.00 51.80  ? 516  TYR C CB    1 
ATOM   7248  C  CG    . TYR C 2  516  ? 41.443  -6.311  -21.990  1.00 51.23  ? 516  TYR C CG    1 
ATOM   7249  C  CD1   . TYR C 2  516  ? 41.120  -6.811  -20.734  1.00 51.13  ? 516  TYR C CD1   1 
ATOM   7250  C  CD2   . TYR C 2  516  ? 40.588  -6.600  -23.048  1.00 50.25  ? 516  TYR C CD2   1 
ATOM   7251  C  CE1   . TYR C 2  516  ? 39.972  -7.563  -20.536  1.00 46.94  ? 516  TYR C CE1   1 
ATOM   7252  C  CE2   . TYR C 2  516  ? 39.441  -7.352  -22.859  1.00 46.19  ? 516  TYR C CE2   1 
ATOM   7253  C  CZ    . TYR C 2  516  ? 39.138  -7.830  -21.602  1.00 44.90  ? 516  TYR C CZ    1 
ATOM   7254  O  OH    . TYR C 2  516  ? 37.999  -8.576  -21.411  1.00 40.61  ? 516  TYR C OH    1 
ATOM   7255  N  N     . ARG C 2  517  ? 44.783  -3.595  -20.565  1.00 54.74  ? 517  ARG C N     1 
ATOM   7256  C  CA    . ARG C 2  517  ? 46.164  -3.137  -20.552  1.00 54.28  ? 517  ARG C CA    1 
ATOM   7257  C  C     . ARG C 2  517  ? 47.041  -4.146  -21.281  1.00 60.22  ? 517  ARG C C     1 
ATOM   7258  O  O     . ARG C 2  517  ? 46.791  -5.351  -21.227  1.00 57.96  ? 517  ARG C O     1 
ATOM   7259  C  CB    . ARG C 2  517  ? 46.662  -2.919  -19.125  1.00 50.91  ? 517  ARG C CB    1 
ATOM   7260  C  CG    . ARG C 2  517  ? 46.350  -1.539  -18.586  1.00 52.27  ? 517  ARG C CG    1 
ATOM   7261  C  CD    . ARG C 2  517  ? 47.195  -1.210  -17.367  1.00 59.83  ? 517  ARG C CD    1 
ATOM   7262  N  NE    . ARG C 2  517  ? 46.853  -2.040  -16.217  1.00 63.43  ? 517  ARG C NE    1 
ATOM   7263  C  CZ    . ARG C 2  517  ? 47.401  -1.908  -15.014  1.00 66.56  ? 517  ARG C CZ    1 
ATOM   7264  N  NH1   . ARG C 2  517  ? 48.321  -0.974  -14.802  1.00 70.03  ? 517  ARG C NH1   1 
ATOM   7265  N  NH2   . ARG C 2  517  ? 47.027  -2.708  -14.022  1.00 62.63  ? 517  ARG C NH2   1 
ATOM   7266  N  N     . LYS C 2  518  ? 48.064  -3.651  -21.971  1.00 64.10  ? 518  LYS C N     1 
ATOM   7267  C  CA    . LYS C 2  518  ? 48.908  -4.512  -22.791  1.00 63.88  ? 518  LYS C CA    1 
ATOM   7268  C  C     . LYS C 2  518  ? 50.148  -4.992  -22.040  1.00 64.33  ? 518  LYS C C     1 
ATOM   7269  O  O     . LYS C 2  518  ? 50.797  -4.232  -21.322  1.00 62.11  ? 518  LYS C O     1 
ATOM   7270  C  CB    . LYS C 2  518  ? 49.321  -3.787  -24.074  1.00 60.82  ? 518  LYS C CB    1 
ATOM   7271  C  CG    . LYS C 2  518  ? 49.906  -4.695  -25.146  1.00 66.88  ? 518  LYS C CG    1 
ATOM   7272  C  CD    . LYS C 2  518  ? 50.120  -3.935  -26.445  1.00 71.57  ? 518  LYS C CD    1 
ATOM   7273  C  CE    . LYS C 2  518  ? 50.580  -4.851  -27.573  1.00 79.62  ? 518  LYS C CE    1 
ATOM   7274  N  NZ    . LYS C 2  518  ? 50.760  -4.102  -28.854  1.00 77.34  ? 518  LYS C NZ    1 
ATOM   7275  N  N     . VAL C 2  519  ? 50.462  -6.270  -22.209  1.00 66.65  ? 519  VAL C N     1 
ATOM   7276  C  CA    . VAL C 2  519  ? 51.643  -6.860  -21.600  1.00 68.82  ? 519  VAL C CA    1 
ATOM   7277  C  C     . VAL C 2  519  ? 52.581  -7.364  -22.692  1.00 77.18  ? 519  VAL C C     1 
ATOM   7278  O  O     . VAL C 2  519  ? 52.214  -8.234  -23.483  1.00 80.44  ? 519  VAL C O     1 
ATOM   7279  C  CB    . VAL C 2  519  ? 51.268  -8.015  -20.643  1.00 67.77  ? 519  VAL C CB    1 
ATOM   7280  C  CG1   . VAL C 2  519  ? 52.506  -8.788  -20.218  1.00 77.78  ? 519  VAL C CG1   1 
ATOM   7281  C  CG2   . VAL C 2  519  ? 50.528  -7.480  -19.428  1.00 64.51  ? 519  VAL C CG2   1 
ATOM   7282  N  N     . VAL C 2  520  ? 53.783  -6.792  -22.741  1.00 82.12  ? 520  VAL C N     1 
ATOM   7283  C  CA    . VAL C 2  520  ? 54.807  -7.193  -23.705  1.00 89.04  ? 520  VAL C CA    1 
ATOM   7284  C  C     . VAL C 2  520  ? 55.302  -8.607  -23.402  1.00 96.12  ? 520  VAL C C     1 
ATOM   7285  O  O     . VAL C 2  520  ? 54.964  -9.562  -24.104  1.00 104.04 ? 520  VAL C O     1 
ATOM   7286  C  CB    . VAL C 2  520  ? 56.012  -6.227  -23.697  1.00 80.44  ? 520  VAL C CB    1 
ATOM   7287  C  CG1   . VAL C 2  520  ? 56.982  -6.570  -24.822  1.00 79.13  ? 520  VAL C CG1   1 
ATOM   7288  C  CG2   . VAL C 2  520  ? 55.545  -4.788  -23.811  1.00 77.64  ? 520  VAL C CG2   1 
ATOM   7289  N  N     . ASP C 2  521  ? 56.105  -8.733  -22.348  1.00 89.30  ? 521  ASP C N     1 
ATOM   7290  C  CA    . ASP C 2  521  ? 56.553  -10.039 -21.868  1.00 90.09  ? 521  ASP C CA    1 
ATOM   7291  C  C     . ASP C 2  521  ? 56.671  -10.045 -20.353  1.00 85.24  ? 521  ASP C C     1 
ATOM   7292  O  O     . ASP C 2  521  ? 57.755  -9.863  -19.798  1.00 87.01  ? 521  ASP C O     1 
ATOM   7293  C  CB    . ASP C 2  521  ? 57.886  -10.426 -22.500  1.00 92.28  ? 521  ASP C CB    1 
ATOM   7294  C  CG    . ASP C 2  521  ? 57.710  -11.178 -23.801  1.00 100.00 ? 521  ASP C CG    1 
ATOM   7295  O  OD1   . ASP C 2  521  ? 56.749  -11.974 -23.899  1.00 99.44  ? 521  ASP C OD1   1 
ATOM   7296  O  OD2   . ASP C 2  521  ? 58.523  -10.966 -24.724  1.00 111.03 ? 521  ASP C OD2   1 
ATOM   7297  N  N     . GLY C 2  522  ? 55.542  -10.256 -19.687  1.00 82.88  ? 522  GLY C N     1 
ATOM   7298  C  CA    . GLY C 2  522  ? 55.494  -10.190 -18.242  1.00 79.53  ? 522  GLY C CA    1 
ATOM   7299  C  C     . GLY C 2  522  ? 55.652  -8.764  -17.753  1.00 80.67  ? 522  GLY C C     1 
ATOM   7300  O  O     . GLY C 2  522  ? 55.908  -8.536  -16.575  1.00 80.88  ? 522  GLY C O     1 
ATOM   7301  N  N     . VAL C 2  523  ? 55.500  -7.803  -18.663  1.00 81.59  ? 523  VAL C N     1 
ATOM   7302  C  CA    . VAL C 2  523  ? 55.627  -6.387  -18.317  1.00 78.10  ? 523  VAL C CA    1 
ATOM   7303  C  C     . VAL C 2  523  ? 54.377  -5.583  -18.693  1.00 77.37  ? 523  VAL C C     1 
ATOM   7304  O  O     . VAL C 2  523  ? 54.113  -5.339  -19.874  1.00 69.67  ? 523  VAL C O     1 
ATOM   7305  C  CB    . VAL C 2  523  ? 56.844  -5.739  -19.003  1.00 69.15  ? 523  VAL C CB    1 
ATOM   7306  C  CG1   . VAL C 2  523  ? 57.069  -4.337  -18.457  1.00 64.29  ? 523  VAL C CG1   1 
ATOM   7307  C  CG2   . VAL C 2  523  ? 58.088  -6.594  -18.807  1.00 70.54  ? 523  VAL C CG2   1 
ATOM   7308  N  N     . VAL C 2  524  ? 53.619  -5.162  -17.683  1.00 74.50  ? 524  VAL C N     1 
ATOM   7309  C  CA    . VAL C 2  524  ? 52.388  -4.409  -17.910  1.00 64.53  ? 524  VAL C CA    1 
ATOM   7310  C  C     . VAL C 2  524  ? 52.669  -3.021  -18.454  1.00 63.75  ? 524  VAL C C     1 
ATOM   7311  O  O     . VAL C 2  524  ? 53.367  -2.228  -17.826  1.00 69.31  ? 524  VAL C O     1 
ATOM   7312  C  CB    . VAL C 2  524  ? 51.561  -4.263  -16.624  1.00 63.71  ? 524  VAL C CB    1 
ATOM   7313  C  CG1   . VAL C 2  524  ? 50.377  -3.332  -16.868  1.00 63.53  ? 524  VAL C CG1   1 
ATOM   7314  C  CG2   . VAL C 2  524  ? 51.088  -5.622  -16.144  1.00 66.12  ? 524  VAL C CG2   1 
ATOM   7315  N  N     . SER C 2  525  ? 52.108  -2.732  -19.622  1.00 63.12  ? 525  SER C N     1 
ATOM   7316  C  CA    . SER C 2  525  ? 52.297  -1.440  -20.264  1.00 65.60  ? 525  SER C CA    1 
ATOM   7317  C  C     . SER C 2  525  ? 51.129  -0.498  -20.011  1.00 64.56  ? 525  SER C C     1 
ATOM   7318  O  O     . SER C 2  525  ? 50.084  -0.909  -19.513  1.00 61.46  ? 525  SER C O     1 
ATOM   7319  C  CB    . SER C 2  525  ? 52.496  -1.623  -21.768  1.00 70.87  ? 525  SER C CB    1 
ATOM   7320  O  OG    . SER C 2  525  ? 52.388  -0.384  -22.445  1.00 74.79  ? 525  SER C OG    1 
ATOM   7321  N  N     . ASP C 2  526  ? 51.322  0.770   -20.359  1.00 67.50  ? 526  ASP C N     1 
ATOM   7322  C  CA    . ASP C 2  526  ? 50.262  1.764   -20.265  1.00 70.98  ? 526  ASP C CA    1 
ATOM   7323  C  C     . ASP C 2  526  ? 49.549  1.908   -21.609  1.00 73.41  ? 526  ASP C C     1 
ATOM   7324  O  O     . ASP C 2  526  ? 48.572  2.647   -21.728  1.00 75.29  ? 526  ASP C O     1 
ATOM   7325  C  CB    . ASP C 2  526  ? 50.822  3.112   -19.802  1.00 75.93  ? 526  ASP C CB    1 
ATOM   7326  C  CG    . ASP C 2  526  ? 51.025  3.174   -18.293  1.00 79.65  ? 526  ASP C CG    1 
ATOM   7327  O  OD1   . ASP C 2  526  ? 51.124  2.102   -17.657  1.00 76.72  ? 526  ASP C OD1   1 
ATOM   7328  O  OD2   . ASP C 2  526  ? 51.079  4.294   -17.738  1.00 77.40  ? 526  ASP C OD2   1 
ATOM   7329  N  N     . GLU C 2  527  ? 50.042  1.189   -22.615  1.00 74.11  ? 527  GLU C N     1 
ATOM   7330  C  CA    . GLU C 2  527  ? 49.402  1.151   -23.927  1.00 75.82  ? 527  GLU C CA    1 
ATOM   7331  C  C     . GLU C 2  527  ? 48.101  0.347   -23.858  1.00 67.43  ? 527  GLU C C     1 
ATOM   7332  O  O     . GLU C 2  527  ? 48.089  -0.807  -23.429  1.00 68.49  ? 527  GLU C O     1 
ATOM   7333  C  CB    . GLU C 2  527  ? 50.357  0.562   -24.972  1.00 83.85  ? 527  GLU C CB    1 
ATOM   7334  C  CG    . GLU C 2  527  ? 49.736  0.310   -26.344  1.00 93.04  ? 527  GLU C CG    1 
ATOM   7335  C  CD    . GLU C 2  527  ? 50.736  -0.261  -27.345  1.00 88.64  ? 527  GLU C CD    1 
ATOM   7336  O  OE1   . GLU C 2  527  ? 51.920  0.142   -27.310  1.00 87.08  ? 527  GLU C OE1   1 
ATOM   7337  O  OE2   . GLU C 2  527  ? 50.342  -1.123  -28.160  1.00 82.97  ? 527  GLU C OE2   1 
ATOM   7338  N  N     . ILE C 2  528  ? 47.007  0.973   -24.278  1.00 54.70  ? 528  ILE C N     1 
ATOM   7339  C  CA    . ILE C 2  528  ? 45.683  0.383   -24.135  1.00 48.04  ? 528  ILE C CA    1 
ATOM   7340  C  C     . ILE C 2  528  ? 45.015  0.150   -25.483  1.00 44.09  ? 528  ILE C C     1 
ATOM   7341  O  O     . ILE C 2  528  ? 45.047  1.014   -26.358  1.00 42.75  ? 528  ILE C O     1 
ATOM   7342  C  CB    . ILE C 2  528  ? 44.768  1.278   -23.285  1.00 47.24  ? 528  ILE C CB    1 
ATOM   7343  C  CG1   . ILE C 2  528  ? 45.515  1.784   -22.051  1.00 48.25  ? 528  ILE C CG1   1 
ATOM   7344  C  CG2   . ILE C 2  528  ? 43.504  0.531   -22.894  1.00 47.79  ? 528  ILE C CG2   1 
ATOM   7345  C  CD1   . ILE C 2  528  ? 44.724  2.764   -21.219  1.00 50.72  ? 528  ILE C CD1   1 
ATOM   7346  N  N     . VAL C 2  529  ? 44.406  -1.019  -25.645  1.00 44.41  ? 529  VAL C N     1 
ATOM   7347  C  CA    . VAL C 2  529  ? 43.682  -1.338  -26.866  1.00 45.30  ? 529  VAL C CA    1 
ATOM   7348  C  C     . VAL C 2  529  ? 42.321  -1.942  -26.522  1.00 46.91  ? 529  VAL C C     1 
ATOM   7349  O  O     . VAL C 2  529  ? 42.207  -2.761  -25.610  1.00 46.82  ? 529  VAL C O     1 
ATOM   7350  C  CB    . VAL C 2  529  ? 44.492  -2.304  -27.759  1.00 47.04  ? 529  VAL C CB    1 
ATOM   7351  C  CG1   . VAL C 2  529  ? 44.920  -3.536  -26.969  1.00 49.14  ? 529  VAL C CG1   1 
ATOM   7352  C  CG2   . VAL C 2  529  ? 43.703  -2.693  -29.002  1.00 50.49  ? 529  VAL C CG2   1 
ATOM   7353  N  N     . TYR C 2  530  ? 41.285  -1.512  -27.235  1.00 49.33  ? 530  TYR C N     1 
ATOM   7354  C  CA    . TYR C 2  530  ? 39.945  -2.041  -27.014  1.00 43.52  ? 530  TYR C CA    1 
ATOM   7355  C  C     . TYR C 2  530  ? 39.753  -3.357  -27.763  1.00 42.74  ? 530  TYR C C     1 
ATOM   7356  O  O     . TYR C 2  530  ? 40.076  -3.464  -28.946  1.00 42.66  ? 530  TYR C O     1 
ATOM   7357  C  CB    . TYR C 2  530  ? 38.878  -1.030  -27.445  1.00 42.29  ? 530  TYR C CB    1 
ATOM   7358  C  CG    . TYR C 2  530  ? 38.764  0.182   -26.550  1.00 43.41  ? 530  TYR C CG    1 
ATOM   7359  C  CD1   . TYR C 2  530  ? 39.364  1.383   -26.896  1.00 45.99  ? 530  TYR C CD1   1 
ATOM   7360  C  CD2   . TYR C 2  530  ? 38.056  0.125   -25.358  1.00 41.82  ? 530  TYR C CD2   1 
ATOM   7361  C  CE1   . TYR C 2  530  ? 39.261  2.492   -26.082  1.00 46.41  ? 530  TYR C CE1   1 
ATOM   7362  C  CE2   . TYR C 2  530  ? 37.949  1.229   -24.536  1.00 43.63  ? 530  TYR C CE2   1 
ATOM   7363  C  CZ    . TYR C 2  530  ? 38.553  2.411   -24.902  1.00 46.63  ? 530  TYR C CZ    1 
ATOM   7364  O  OH    . TYR C 2  530  ? 38.451  3.520   -24.090  1.00 46.61  ? 530  TYR C OH    1 
ATOM   7365  N  N     . LEU C 2  531  ? 39.222  -4.352  -27.062  1.00 43.53  ? 531  LEU C N     1 
ATOM   7366  C  CA    . LEU C 2  531  ? 38.987  -5.668  -27.639  1.00 44.01  ? 531  LEU C CA    1 
ATOM   7367  C  C     . LEU C 2  531  ? 37.512  -5.992  -27.760  1.00 44.10  ? 531  LEU C C     1 
ATOM   7368  O  O     . LEU C 2  531  ? 36.735  -5.764  -26.833  1.00 41.02  ? 531  LEU C O     1 
ATOM   7369  C  CB    . LEU C 2  531  ? 39.652  -6.754  -26.799  1.00 43.71  ? 531  LEU C CB    1 
ATOM   7370  C  CG    . LEU C 2  531  ? 41.124  -7.076  -27.036  1.00 51.87  ? 531  LEU C CG    1 
ATOM   7371  C  CD1   . LEU C 2  531  ? 42.029  -6.001  -26.442  1.00 58.14  ? 531  LEU C CD1   1 
ATOM   7372  C  CD2   . LEU C 2  531  ? 41.440  -8.454  -26.464  1.00 62.24  ? 531  LEU C CD2   1 
ATOM   7373  N  N     . THR C 2  532  ? 37.134  -6.555  -28.900  1.00 46.08  ? 532  THR C N     1 
ATOM   7374  C  CA    . THR C 2  532  ? 35.798  -7.100  -29.050  1.00 45.24  ? 532  THR C CA    1 
ATOM   7375  C  C     . THR C 2  532  ? 35.741  -8.432  -28.310  1.00 45.14  ? 532  THR C C     1 
ATOM   7376  O  O     . THR C 2  532  ? 36.716  -8.846  -27.682  1.00 44.29  ? 532  THR C O     1 
ATOM   7377  C  CB    . THR C 2  532  ? 35.416  -7.294  -30.524  1.00 46.89  ? 532  THR C CB    1 
ATOM   7378  O  OG1   . THR C 2  532  ? 36.016  -8.492  -31.029  1.00 44.20  ? 532  THR C OG1   1 
ATOM   7379  C  CG2   . THR C 2  532  ? 35.874  -6.100  -31.355  1.00 46.93  ? 532  THR C CG2   1 
ATOM   7380  N  N     . ALA C 2  533  ? 34.603  -9.105  -28.385  1.00 46.05  ? 533  ALA C N     1 
ATOM   7381  C  CA    . ALA C 2  533  ? 34.411  -10.336 -27.633  1.00 45.75  ? 533  ALA C CA    1 
ATOM   7382  C  C     . ALA C 2  533  ? 35.255  -11.487 -28.172  1.00 44.60  ? 533  ALA C C     1 
ATOM   7383  O  O     . ALA C 2  533  ? 36.029  -12.093 -27.433  1.00 44.73  ? 533  ALA C O     1 
ATOM   7384  C  CB    . ALA C 2  533  ? 32.948  -10.718 -27.631  1.00 48.85  ? 533  ALA C CB    1 
ATOM   7385  N  N     . ASP C 2  534  ? 35.107  -11.781 -29.461  1.00 45.46  ? 534  ASP C N     1 
ATOM   7386  C  CA    . ASP C 2  534  ? 35.755  -12.945 -30.063  1.00 47.30  ? 534  ASP C CA    1 
ATOM   7387  C  C     . ASP C 2  534  ? 37.262  -12.752 -30.221  1.00 45.48  ? 534  ASP C C     1 
ATOM   7388  O  O     . ASP C 2  534  ? 38.001  -13.716 -30.416  1.00 45.14  ? 534  ASP C O     1 
ATOM   7389  C  CB    . ASP C 2  534  ? 35.114  -13.271 -31.418  1.00 47.95  ? 534  ASP C CB    1 
ATOM   7390  C  CG    . ASP C 2  534  ? 34.961  -12.052 -32.305  1.00 47.19  ? 534  ASP C CG    1 
ATOM   7391  O  OD1   . ASP C 2  534  ? 35.623  -11.029 -32.036  1.00 44.41  ? 534  ASP C OD1   1 
ATOM   7392  O  OD2   . ASP C 2  534  ? 34.181  -12.120 -33.277  1.00 49.40  ? 534  ASP C OD2   1 
ATOM   7393  N  N     . GLU C 2  535  ? 37.708  -11.502 -30.133  1.00 45.63  ? 535  GLU C N     1 
ATOM   7394  C  CA    . GLU C 2  535  ? 39.132  -11.182 -30.150  1.00 45.23  ? 535  GLU C CA    1 
ATOM   7395  C  C     . GLU C 2  535  ? 39.778  -11.580 -28.825  1.00 45.20  ? 535  GLU C C     1 
ATOM   7396  O  O     . GLU C 2  535  ? 40.902  -12.086 -28.793  1.00 45.98  ? 535  GLU C O     1 
ATOM   7397  C  CB    . GLU C 2  535  ? 39.348  -9.690  -30.416  1.00 45.44  ? 535  GLU C CB    1 
ATOM   7398  C  CG    . GLU C 2  535  ? 38.937  -9.229  -31.809  1.00 47.82  ? 535  GLU C CG    1 
ATOM   7399  C  CD    . GLU C 2  535  ? 38.944  -7.713  -31.958  1.00 52.07  ? 535  GLU C CD    1 
ATOM   7400  O  OE1   . GLU C 2  535  ? 39.350  -7.019  -31.001  1.00 49.91  ? 535  GLU C OE1   1 
ATOM   7401  O  OE2   . GLU C 2  535  ? 38.538  -7.217  -33.032  1.00 55.68  ? 535  GLU C OE2   1 
ATOM   7402  N  N     . GLU C 2  536  ? 39.052  -11.347 -27.736  1.00 44.35  ? 536  GLU C N     1 
ATOM   7403  C  CA    . GLU C 2  536  ? 39.493  -11.732 -26.398  1.00 45.26  ? 536  GLU C CA    1 
ATOM   7404  C  C     . GLU C 2  536  ? 39.597  -13.251 -26.269  1.00 48.56  ? 536  GLU C C     1 
ATOM   7405  O  O     . GLU C 2  536  ? 40.452  -13.769 -25.545  1.00 47.11  ? 536  GLU C O     1 
ATOM   7406  C  CB    . GLU C 2  536  ? 38.530  -11.174 -25.346  1.00 44.74  ? 536  GLU C CB    1 
ATOM   7407  C  CG    . GLU C 2  536  ? 38.764  -11.696 -23.937  1.00 47.20  ? 536  GLU C CG    1 
ATOM   7408  C  CD    . GLU C 2  536  ? 37.695  -11.239 -22.960  1.00 46.39  ? 536  GLU C CD    1 
ATOM   7409  O  OE1   . GLU C 2  536  ? 37.123  -10.146 -23.169  1.00 46.05  ? 536  GLU C OE1   1 
ATOM   7410  O  OE2   . GLU C 2  536  ? 37.419  -11.981 -21.991  1.00 47.89  ? 536  GLU C OE2   1 
ATOM   7411  N  N     . ASP C 2  537  ? 38.721  -13.952 -26.987  1.00 52.26  ? 537  ASP C N     1 
ATOM   7412  C  CA    . ASP C 2  537  ? 38.679  -15.415 -26.984  1.00 53.24  ? 537  ASP C CA    1 
ATOM   7413  C  C     . ASP C 2  537  ? 39.990  -16.036 -27.471  1.00 52.41  ? 537  ASP C C     1 
ATOM   7414  O  O     . ASP C 2  537  ? 40.432  -17.057 -26.942  1.00 53.58  ? 537  ASP C O     1 
ATOM   7415  C  CB    . ASP C 2  537  ? 37.516  -15.923 -27.850  1.00 56.74  ? 537  ASP C CB    1 
ATOM   7416  C  CG    . ASP C 2  537  ? 36.205  -16.026 -27.081  1.00 57.10  ? 537  ASP C CG    1 
ATOM   7417  O  OD1   . ASP C 2  537  ? 36.068  -15.360 -26.033  1.00 58.06  ? 537  ASP C OD1   1 
ATOM   7418  O  OD2   . ASP C 2  537  ? 35.309  -16.777 -27.530  1.00 55.80  ? 537  ASP C OD2   1 
ATOM   7419  N  N     . ARG C 2  538  ? 40.605  -15.416 -28.476  1.00 52.76  ? 538  ARG C N     1 
ATOM   7420  C  CA    . ARG C 2  538  ? 41.860  -15.912 -29.041  1.00 53.46  ? 538  ARG C CA    1 
ATOM   7421  C  C     . ARG C 2  538  ? 43.076  -15.422 -28.257  1.00 52.67  ? 538  ARG C C     1 
ATOM   7422  O  O     . ARG C 2  538  ? 44.206  -15.488 -28.743  1.00 47.46  ? 538  ARG C O     1 
ATOM   7423  C  CB    . ARG C 2  538  ? 42.002  -15.489 -30.507  1.00 51.16  ? 538  ARG C CB    1 
ATOM   7424  C  CG    . ARG C 2  538  ? 40.941  -16.042 -31.454  1.00 53.32  ? 538  ARG C CG    1 
ATOM   7425  C  CD    . ARG C 2  538  ? 41.208  -15.632 -32.905  1.00 51.69  ? 538  ARG C CD    1 
ATOM   7426  N  NE    . ARG C 2  538  ? 41.234  -14.181 -33.089  1.00 51.12  ? 538  ARG C NE    1 
ATOM   7427  C  CZ    . ARG C 2  538  ? 42.344  -13.449 -33.135  1.00 50.47  ? 538  ARG C CZ    1 
ATOM   7428  N  NH1   . ARG C 2  538  ? 42.267  -12.135 -33.305  1.00 50.89  ? 538  ARG C NH1   1 
ATOM   7429  N  NH2   . ARG C 2  538  ? 43.531  -14.029 -33.008  1.00 49.85  ? 538  ARG C NH2   1 
ATOM   7430  N  N     . HIS C 2  539  ? 42.841  -14.921 -27.049  1.00 52.60  ? 539  HIS C N     1 
ATOM   7431  C  CA    . HIS C 2  539  ? 43.924  -14.441 -26.199  1.00 53.72  ? 539  HIS C CA    1 
ATOM   7432  C  C     . HIS C 2  539  ? 43.785  -14.938 -24.767  1.00 53.95  ? 539  HIS C C     1 
ATOM   7433  O  O     . HIS C 2  539  ? 42.944  -15.785 -24.466  1.00 52.20  ? 539  HIS C O     1 
ATOM   7434  C  CB    . HIS C 2  539  ? 43.980  -12.913 -26.208  1.00 53.50  ? 539  HIS C CB    1 
ATOM   7435  C  CG    . HIS C 2  539  ? 44.787  -12.345 -27.334  1.00 54.35  ? 539  HIS C CG    1 
ATOM   7436  N  ND1   . HIS C 2  539  ? 46.017  -11.755 -27.145  1.00 55.43  ? 539  HIS C ND1   1 
ATOM   7437  C  CD2   . HIS C 2  539  ? 44.539  -12.283 -28.664  1.00 53.51  ? 539  HIS C CD2   1 
ATOM   7438  C  CE1   . HIS C 2  539  ? 46.493  -11.350 -28.310  1.00 56.93  ? 539  HIS C CE1   1 
ATOM   7439  N  NE2   . HIS C 2  539  ? 45.616  -11.658 -29.247  1.00 55.41  ? 539  HIS C NE2   1 
ATOM   7440  N  N     . VAL C 2  540  ? 44.629  -14.401 -23.893  1.00 55.32  ? 540  VAL C N     1 
ATOM   7441  C  CA    . VAL C 2  540  ? 44.638  -14.762 -22.482  1.00 58.46  ? 540  VAL C CA    1 
ATOM   7442  C  C     . VAL C 2  540  ? 44.769  -13.502 -21.636  1.00 56.30  ? 540  VAL C C     1 
ATOM   7443  O  O     . VAL C 2  540  ? 45.720  -12.737 -21.790  1.00 55.97  ? 540  VAL C O     1 
ATOM   7444  C  CB    . VAL C 2  540  ? 45.783  -15.750 -22.165  1.00 66.55  ? 540  VAL C CB    1 
ATOM   7445  C  CG1   . VAL C 2  540  ? 46.233  -15.625 -20.718  1.00 63.49  ? 540  VAL C CG1   1 
ATOM   7446  C  CG2   . VAL C 2  540  ? 45.353  -17.181 -22.496  1.00 64.37  ? 540  VAL C CG2   1 
ATOM   7447  N  N     . VAL C 2  541  ? 43.802  -13.281 -20.752  1.00 57.59  ? 541  VAL C N     1 
ATOM   7448  C  CA    . VAL C 2  541  ? 43.755  -12.051 -19.974  1.00 59.22  ? 541  VAL C CA    1 
ATOM   7449  C  C     . VAL C 2  541  ? 43.983  -12.299 -18.487  1.00 62.79  ? 541  VAL C C     1 
ATOM   7450  O  O     . VAL C 2  541  ? 43.414  -13.222 -17.903  1.00 62.31  ? 541  VAL C O     1 
ATOM   7451  C  CB    . VAL C 2  541  ? 42.409  -11.332 -20.156  1.00 57.70  ? 541  VAL C CB    1 
ATOM   7452  C  CG1   . VAL C 2  541  ? 42.491  -9.912  -19.617  1.00 60.46  ? 541  VAL C CG1   1 
ATOM   7453  C  CG2   . VAL C 2  541  ? 42.011  -11.325 -21.625  1.00 59.33  ? 541  VAL C CG2   1 
ATOM   7454  N  N     . ALA C 2  542  ? 44.815  -11.458 -17.881  1.00 64.58  ? 542  ALA C N     1 
ATOM   7455  C  CA    . ALA C 2  542  ? 45.126  -11.567 -16.462  1.00 66.97  ? 542  ALA C CA    1 
ATOM   7456  C  C     . ALA C 2  542  ? 44.177  -10.723 -15.629  1.00 63.16  ? 542  ALA C C     1 
ATOM   7457  O  O     . ALA C 2  542  ? 43.716  -9.671  -16.069  1.00 61.25  ? 542  ALA C O     1 
ATOM   7458  C  CB    . ALA C 2  542  ? 46.566  -11.153 -16.198  1.00 76.56  ? 542  ALA C CB    1 
ATOM   7459  N  N     . GLN C 2  543  ? 43.890  -11.192 -14.422  1.00 65.42  ? 543  GLN C N     1 
ATOM   7460  C  CA    . GLN C 2  543  ? 43.031  -10.456 -13.512  1.00 63.99  ? 543  GLN C CA    1 
ATOM   7461  C  C     . GLN C 2  543  ? 43.694  -9.145  -13.109  1.00 60.73  ? 543  GLN C C     1 
ATOM   7462  O  O     . GLN C 2  543  ? 44.920  -9.045  -13.053  1.00 58.99  ? 543  GLN C O     1 
ATOM   7463  C  CB    . GLN C 2  543  ? 42.711  -11.298 -12.285  1.00 66.87  ? 543  GLN C CB    1 
ATOM   7464  C  CG    . GLN C 2  543  ? 41.544  -10.790 -11.478  1.00 72.34  ? 543  GLN C CG    1 
ATOM   7465  C  CD    . GLN C 2  543  ? 41.101  -11.793 -10.442  1.00 83.36  ? 543  GLN C CD    1 
ATOM   7466  O  OE1   . GLN C 2  543  ? 41.195  -13.002 -10.659  1.00 84.61  ? 543  GLN C OE1   1 
ATOM   7467  N  NE2   . GLN C 2  543  ? 40.625  -11.302 -9.303   1.00 90.11  ? 543  GLN C NE2   1 
ATOM   7468  N  N     . ALA C 2  544  ? 42.868  -8.144  -12.831  1.00 59.87  ? 544  ALA C N     1 
ATOM   7469  C  CA    . ALA C 2  544  ? 43.334  -6.783  -12.594  1.00 58.44  ? 544  ALA C CA    1 
ATOM   7470  C  C     . ALA C 2  544  ? 44.174  -6.645  -11.329  1.00 63.24  ? 544  ALA C C     1 
ATOM   7471  O  O     . ALA C 2  544  ? 45.154  -5.899  -11.304  1.00 60.75  ? 544  ALA C O     1 
ATOM   7472  C  CB    . ALA C 2  544  ? 42.146  -5.840  -12.529  1.00 59.79  ? 544  ALA C CB    1 
ATOM   7473  N  N     . ASN C 2  545  ? 43.783  -7.360  -10.280  1.00 67.88  ? 545  ASN C N     1 
ATOM   7474  C  CA    . ASN C 2  545  ? 44.415  -7.202  -8.977   1.00 72.50  ? 545  ASN C CA    1 
ATOM   7475  C  C     . ASN C 2  545  ? 45.662  -8.065  -8.797   1.00 80.56  ? 545  ASN C C     1 
ATOM   7476  O  O     . ASN C 2  545  ? 46.225  -8.122  -7.704   1.00 84.99  ? 545  ASN C O     1 
ATOM   7477  C  CB    . ASN C 2  545  ? 43.409  -7.509  -7.866   1.00 71.88  ? 545  ASN C CB    1 
ATOM   7478  C  CG    . ASN C 2  545  ? 42.971  -8.954  -7.862   1.00 76.74  ? 545  ASN C CG    1 
ATOM   7479  O  OD1   . ASN C 2  545  ? 43.009  -9.631  -8.889   1.00 75.19  ? 545  ASN C OD1   1 
ATOM   7480  N  ND2   . ASN C 2  545  ? 42.551  -9.439  -6.701   1.00 77.82  ? 545  ASN C ND2   1 
ATOM   7481  N  N     . SER C 2  546  ? 46.090  -8.738  -9.863   1.00 81.50  ? 546  SER C N     1 
ATOM   7482  C  CA    . SER C 2  546  ? 47.344  -9.487  -9.823   1.00 76.87  ? 546  SER C CA    1 
ATOM   7483  C  C     . SER C 2  546  ? 48.500  -8.526  -9.558   1.00 76.29  ? 546  SER C C     1 
ATOM   7484  O  O     . SER C 2  546  ? 48.711  -7.587  -10.323  1.00 75.61  ? 546  SER C O     1 
ATOM   7485  C  CB    . SER C 2  546  ? 47.571  -10.256 -11.128  1.00 69.84  ? 546  SER C CB    1 
ATOM   7486  O  OG    . SER C 2  546  ? 46.704  -11.373 -11.222  1.00 67.40  ? 546  SER C OG    1 
ATOM   7487  N  N     . PRO C 2  547  ? 49.241  -8.757  -8.463   1.00 75.66  ? 547  PRO C N     1 
ATOM   7488  C  CA    . PRO C 2  547  ? 50.316  -7.876  -7.987   1.00 73.75  ? 547  PRO C CA    1 
ATOM   7489  C  C     . PRO C 2  547  ? 51.330  -7.528  -9.075   1.00 76.20  ? 547  PRO C C     1 
ATOM   7490  O  O     . PRO C 2  547  ? 51.753  -8.399  -9.837   1.00 80.52  ? 547  PRO C O     1 
ATOM   7491  C  CB    . PRO C 2  547  ? 50.970  -8.695  -6.872   1.00 79.70  ? 547  PRO C CB    1 
ATOM   7492  C  CG    . PRO C 2  547  ? 49.900  -9.610  -6.401   1.00 76.87  ? 547  PRO C CG    1 
ATOM   7493  C  CD    . PRO C 2  547  ? 49.097  -9.955  -7.618   1.00 77.75  ? 547  PRO C CD    1 
ATOM   7494  N  N     . ILE C 2  548  ? 51.710  -6.257  -9.139   1.00 75.29  ? 548  ILE C N     1 
ATOM   7495  C  CA    . ILE C 2  548  ? 52.577  -5.764  -10.200  1.00 77.05  ? 548  ILE C CA    1 
ATOM   7496  C  C     . ILE C 2  548  ? 53.805  -5.049  -9.645   1.00 75.94  ? 548  ILE C C     1 
ATOM   7497  O  O     . ILE C 2  548  ? 53.688  -4.188  -8.773   1.00 77.80  ? 548  ILE C O     1 
ATOM   7498  C  CB    . ILE C 2  548  ? 51.811  -4.805  -11.135  1.00 74.15  ? 548  ILE C CB    1 
ATOM   7499  C  CG1   . ILE C 2  548  ? 50.650  -5.535  -11.810  1.00 74.70  ? 548  ILE C CG1   1 
ATOM   7500  C  CG2   . ILE C 2  548  ? 52.735  -4.210  -12.182  1.00 70.60  ? 548  ILE C CG2   1 
ATOM   7501  C  CD1   . ILE C 2  548  ? 49.844  -4.663  -12.739  1.00 75.77  ? 548  ILE C CD1   1 
ATOM   7502  N  N     . ASP C 2  549  ? 54.978  -5.420  -10.151  1.00 76.44  ? 549  ASP C N     1 
ATOM   7503  C  CA    . ASP C 2  549  ? 56.226  -4.735  -9.826   1.00 73.96  ? 549  ASP C CA    1 
ATOM   7504  C  C     . ASP C 2  549  ? 56.136  -3.249  -10.168  1.00 73.77  ? 549  ASP C C     1 
ATOM   7505  O  O     . ASP C 2  549  ? 55.472  -2.871  -11.133  1.00 76.54  ? 549  ASP C O     1 
ATOM   7506  C  CB    . ASP C 2  549  ? 57.394  -5.390  -10.572  1.00 78.26  ? 549  ASP C CB    1 
ATOM   7507  C  CG    . ASP C 2  549  ? 58.676  -4.583  -10.492  1.00 83.67  ? 549  ASP C CG    1 
ATOM   7508  O  OD1   . ASP C 2  549  ? 59.436  -4.589  -11.484  1.00 90.84  ? 549  ASP C OD1   1 
ATOM   7509  O  OD2   . ASP C 2  549  ? 58.929  -3.954  -9.443   1.00 90.29  ? 549  ASP C OD2   1 
ATOM   7510  N  N     . ALA C 2  550  ? 56.800  -2.419  -9.366   1.00 72.28  ? 550  ALA C N     1 
ATOM   7511  C  CA    . ALA C 2  550  ? 56.791  -0.968  -9.546   1.00 73.57  ? 550  ALA C CA    1 
ATOM   7512  C  C     . ALA C 2  550  ? 57.148  -0.579  -10.976  1.00 77.22  ? 550  ALA C C     1 
ATOM   7513  O  O     . ALA C 2  550  ? 56.591  0.368   -11.530  1.00 71.78  ? 550  ALA C O     1 
ATOM   7514  C  CB    . ALA C 2  550  ? 57.748  -0.307  -8.563   1.00 67.11  ? 550  ALA C CB    1 
ATOM   7515  N  N     . ASP C 2  551  ? 58.077  -1.319  -11.570  1.00 81.88  ? 551  ASP C N     1 
ATOM   7516  C  CA    . ASP C 2  551  ? 58.391  -1.149  -12.980  1.00 90.59  ? 551  ASP C CA    1 
ATOM   7517  C  C     . ASP C 2  551  ? 57.206  -1.609  -13.821  1.00 83.57  ? 551  ASP C C     1 
ATOM   7518  O  O     . ASP C 2  551  ? 56.634  -0.825  -14.579  1.00 86.18  ? 551  ASP C O     1 
ATOM   7519  C  CB    . ASP C 2  551  ? 59.659  -1.921  -13.352  1.00 104.42 ? 551  ASP C CB    1 
ATOM   7520  C  CG    . ASP C 2  551  ? 60.902  -1.382  -12.649  1.00 116.00 ? 551  ASP C CG    1 
ATOM   7521  O  OD1   . ASP C 2  551  ? 60.961  -0.158  -12.389  1.00 110.26 ? 551  ASP C OD1   1 
ATOM   7522  O  OD2   . ASP C 2  551  ? 61.818  -2.182  -12.356  1.00 128.83 ? 551  ASP C OD2   1 
ATOM   7523  N  N     . GLY C 2  552  ? 56.829  -2.876  -13.676  1.00 75.27  ? 552  GLY C N     1 
ATOM   7524  C  CA    . GLY C 2  552  ? 55.652  -3.383  -14.354  1.00 73.10  ? 552  GLY C CA    1 
ATOM   7525  C  C     . GLY C 2  552  ? 55.607  -4.886  -14.548  1.00 75.50  ? 552  GLY C C     1 
ATOM   7526  O  O     . GLY C 2  552  ? 54.854  -5.373  -15.389  1.00 83.22  ? 552  GLY C O     1 
ATOM   7527  N  N     . ARG C 2  553  ? 56.393  -5.624  -13.769  1.00 79.16  ? 553  ARG C N     1 
ATOM   7528  C  CA    . ARG C 2  553  ? 56.447  -7.079  -13.910  1.00 82.27  ? 553  ARG C CA    1 
ATOM   7529  C  C     . ARG C 2  553  ? 55.566  -7.824  -12.902  1.00 77.72  ? 553  ARG C C     1 
ATOM   7530  O  O     . ARG C 2  553  ? 55.304  -7.335  -11.805  1.00 77.26  ? 553  ARG C O     1 
ATOM   7531  C  CB    . ARG C 2  553  ? 57.897  -7.570  -13.798  1.00 83.20  ? 553  ARG C CB    1 
ATOM   7532  C  CG    . ARG C 2  553  ? 58.683  -7.474  -15.106  1.00 86.67  ? 553  ARG C CG    1 
ATOM   7533  C  CD    . ARG C 2  553  ? 60.132  -7.914  -14.948  1.00 95.50  ? 553  ARG C CD    1 
ATOM   7534  N  NE    . ARG C 2  553  ? 60.926  -6.939  -14.207  1.00 101.67 ? 553  ARG C NE    1 
ATOM   7535  C  CZ    . ARG C 2  553  ? 61.528  -5.889  -14.758  1.00 99.84  ? 553  ARG C CZ    1 
ATOM   7536  N  NH1   . ARG C 2  553  ? 61.423  -5.671  -16.063  1.00 99.20  ? 553  ARG C NH1   1 
ATOM   7537  N  NH2   . ARG C 2  553  ? 62.234  -5.058  -14.003  1.00 98.12  ? 553  ARG C NH2   1 
ATOM   7538  N  N     . PHE C 2  554  ? 55.111  -9.012  -13.288  1.00 76.78  ? 554  PHE C N     1 
ATOM   7539  C  CA    . PHE C 2  554  ? 54.273  -9.836  -12.420  1.00 78.42  ? 554  PHE C CA    1 
ATOM   7540  C  C     . PHE C 2  554  ? 55.050  -10.401 -11.241  1.00 79.44  ? 554  PHE C C     1 
ATOM   7541  O  O     . PHE C 2  554  ? 56.241  -10.680 -11.348  1.00 90.07  ? 554  PHE C O     1 
ATOM   7542  C  CB    . PHE C 2  554  ? 53.646  -10.985 -13.206  1.00 82.02  ? 554  PHE C CB    1 
ATOM   7543  C  CG    . PHE C 2  554  ? 52.385  -10.610 -13.921  1.00 89.02  ? 554  PHE C CG    1 
ATOM   7544  C  CD1   . PHE C 2  554  ? 51.593  -11.581 -14.507  1.00 93.96  ? 554  PHE C CD1   1 
ATOM   7545  C  CD2   . PHE C 2  554  ? 51.992  -9.286  -14.012  1.00 87.83  ? 554  PHE C CD2   1 
ATOM   7546  C  CE1   . PHE C 2  554  ? 50.428  -11.240 -15.166  1.00 92.51  ? 554  PHE C CE1   1 
ATOM   7547  C  CE2   . PHE C 2  554  ? 50.830  -8.939  -14.672  1.00 93.26  ? 554  PHE C CE2   1 
ATOM   7548  C  CZ    . PHE C 2  554  ? 50.047  -9.917  -15.250  1.00 93.95  ? 554  PHE C CZ    1 
ATOM   7549  N  N     . VAL C 2  555  ? 54.362  -10.581 -10.120  1.00 78.54  ? 555  VAL C N     1 
ATOM   7550  C  CA    . VAL C 2  555  ? 54.987  -11.130 -8.925   1.00 76.06  ? 555  VAL C CA    1 
ATOM   7551  C  C     . VAL C 2  555  ? 55.118  -12.648 -9.013   1.00 72.58  ? 555  VAL C C     1 
ATOM   7552  O  O     . VAL C 2  555  ? 56.189  -13.200 -8.766   1.00 82.39  ? 555  VAL C O     1 
ATOM   7553  C  CB    . VAL C 2  555  ? 54.197  -10.747 -7.662   1.00 72.82  ? 555  VAL C CB    1 
ATOM   7554  C  CG1   . VAL C 2  555  ? 54.546  -11.671 -6.503   1.00 68.94  ? 555  VAL C CG1   1 
ATOM   7555  C  CG2   . VAL C 2  555  ? 54.464  -9.292  -7.301   1.00 68.05  ? 555  VAL C CG2   1 
ATOM   7556  N  N     . GLU C 2  556  ? 54.034  -13.323 -9.374   1.00 73.77  ? 556  GLU C N     1 
ATOM   7557  C  CA    . GLU C 2  556  ? 54.077  -14.770 -9.523   1.00 76.88  ? 556  GLU C CA    1 
ATOM   7558  C  C     . GLU C 2  556  ? 54.041  -15.167 -10.992  1.00 81.06  ? 556  GLU C C     1 
ATOM   7559  O  O     . GLU C 2  556  ? 53.355  -14.534 -11.794  1.00 79.35  ? 556  GLU C O     1 
ATOM   7560  C  CB    . GLU C 2  556  ? 52.917  -15.423 -8.774   1.00 71.71  ? 556  GLU C CB    1 
ATOM   7561  C  CG    . GLU C 2  556  ? 52.894  -15.116 -7.291   1.00 76.32  ? 556  GLU C CG    1 
ATOM   7562  C  CD    . GLU C 2  556  ? 51.717  -15.758 -6.594   1.00 76.64  ? 556  GLU C CD    1 
ATOM   7563  O  OE1   . GLU C 2  556  ? 51.082  -16.646 -7.202   1.00 70.65  ? 556  GLU C OE1   1 
ATOM   7564  O  OE2   . GLU C 2  556  ? 51.424  -15.376 -5.442   1.00 87.01  ? 556  GLU C OE2   1 
ATOM   7565  N  N     . PRO C 2  557  ? 54.795  -16.216 -11.348  1.00 83.30  ? 557  PRO C N     1 
ATOM   7566  C  CA    . PRO C 2  557  ? 54.784  -16.765 -12.707  1.00 81.49  ? 557  PRO C CA    1 
ATOM   7567  C  C     . PRO C 2  557  ? 53.378  -17.203 -13.094  1.00 80.41  ? 557  PRO C C     1 
ATOM   7568  O  O     . PRO C 2  557  ? 52.809  -16.689 -14.056  1.00 78.37  ? 557  PRO C O     1 
ATOM   7569  C  CB    . PRO C 2  557  ? 55.735  -17.963 -12.612  1.00 95.30  ? 557  PRO C CB    1 
ATOM   7570  C  CG    . PRO C 2  557  ? 56.609  -17.663 -11.433  1.00 99.42  ? 557  PRO C CG    1 
ATOM   7571  C  CD    . PRO C 2  557  ? 55.722  -16.944 -10.466  1.00 87.91  ? 557  PRO C CD    1 
ATOM   7572  N  N     . ARG C 2  558  ? 52.823  -18.139 -12.332  1.00 82.68  ? 558  ARG C N     1 
ATOM   7573  C  CA    . ARG C 2  558  ? 51.436  -18.540 -12.506  1.00 85.88  ? 558  ARG C CA    1 
ATOM   7574  C  C     . ARG C 2  558  ? 50.516  -17.492 -11.893  1.00 92.78  ? 558  ARG C C     1 
ATOM   7575  O  O     . ARG C 2  558  ? 50.650  -17.152 -10.718  1.00 94.53  ? 558  ARG C O     1 
ATOM   7576  C  CB    . ARG C 2  558  ? 51.185  -19.907 -11.870  1.00 86.00  ? 558  ARG C CB    1 
ATOM   7577  C  CG    . ARG C 2  558  ? 52.122  -20.995 -12.348  1.00 93.64  ? 558  ARG C CG    1 
ATOM   7578  C  CD    . ARG C 2  558  ? 51.859  -22.292 -11.610  1.00 106.53 ? 558  ARG C CD    1 
ATOM   7579  N  NE    . ARG C 2  558  ? 52.863  -23.306 -11.910  1.00 120.38 ? 558  ARG C NE    1 
ATOM   7580  C  CZ    . ARG C 2  558  ? 52.901  -24.505 -11.340  1.00 121.83 ? 558  ARG C CZ    1 
ATOM   7581  N  NH1   . ARG C 2  558  ? 51.986  -24.841 -10.440  1.00 121.57 ? 558  ARG C NH1   1 
ATOM   7582  N  NH2   . ARG C 2  558  ? 53.853  -25.367 -11.670  1.00 120.58 ? 558  ARG C NH2   1 
ATOM   7583  N  N     . VAL C 2  559  ? 49.584  -16.981 -12.691  1.00 91.62  ? 559  VAL C N     1 
ATOM   7584  C  CA    . VAL C 2  559  ? 48.629  -15.984 -12.219  1.00 91.82  ? 559  VAL C CA    1 
ATOM   7585  C  C     . VAL C 2  559  ? 47.209  -16.363 -12.621  1.00 87.96  ? 559  VAL C C     1 
ATOM   7586  O  O     . VAL C 2  559  ? 47.013  -17.193 -13.510  1.00 83.84  ? 559  VAL C O     1 
ATOM   7587  C  CB    . VAL C 2  559  ? 48.955  -14.583 -12.769  1.00 87.03  ? 559  VAL C CB    1 
ATOM   7588  C  CG1   . VAL C 2  559  ? 50.045  -13.922 -11.936  1.00 90.57  ? 559  VAL C CG1   1 
ATOM   7589  C  CG2   . VAL C 2  559  ? 49.366  -14.669 -14.232  1.00 88.99  ? 559  VAL C CG2   1 
ATOM   7590  N  N     . LEU C 2  560  ? 46.223  -15.753 -11.967  1.00 87.79  ? 560  LEU C N     1 
ATOM   7591  C  CA    . LEU C 2  560  ? 44.826  -16.019 -12.290  1.00 85.56  ? 560  LEU C CA    1 
ATOM   7592  C  C     . LEU C 2  560  ? 44.518  -15.539 -13.699  1.00 80.89  ? 560  LEU C C     1 
ATOM   7593  O  O     . LEU C 2  560  ? 44.662  -14.358 -14.016  1.00 83.14  ? 560  LEU C O     1 
ATOM   7594  C  CB    . LEU C 2  560  ? 43.891  -15.360 -11.276  1.00 84.31  ? 560  LEU C CB    1 
ATOM   7595  C  CG    . LEU C 2  560  ? 43.688  -16.152 -9.981   1.00 84.20  ? 560  LEU C CG    1 
ATOM   7596  C  CD1   . LEU C 2  560  ? 42.723  -15.435 -9.049   1.00 81.85  ? 560  LEU C CD1   1 
ATOM   7597  C  CD2   . LEU C 2  560  ? 43.201  -17.565 -10.282  1.00 79.33  ? 560  LEU C CD2   1 
ATOM   7598  N  N     . VAL C 2  561  ? 44.100  -16.473 -14.544  1.00 79.78  ? 561  VAL C N     1 
ATOM   7599  C  CA    . VAL C 2  561  ? 43.926  -16.202 -15.962  1.00 76.07  ? 561  VAL C CA    1 
ATOM   7600  C  C     . VAL C 2  561  ? 42.511  -16.508 -16.428  1.00 70.41  ? 561  VAL C C     1 
ATOM   7601  O  O     . VAL C 2  561  ? 41.966  -17.577 -16.147  1.00 67.56  ? 561  VAL C O     1 
ATOM   7602  C  CB    . VAL C 2  561  ? 44.930  -17.018 -16.812  1.00 84.46  ? 561  VAL C CB    1 
ATOM   7603  C  CG1   . VAL C 2  561  ? 44.396  -17.248 -18.218  1.00 80.08  ? 561  VAL C CG1   1 
ATOM   7604  C  CG2   . VAL C 2  561  ? 46.290  -16.329 -16.848  1.00 83.78  ? 561  VAL C CG2   1 
ATOM   7605  N  N     . ARG C 2  562  ? 41.923  -15.551 -17.134  1.00 69.02  ? 562  ARG C N     1 
ATOM   7606  C  CA    . ARG C 2  562  ? 40.629  -15.743 -17.765  1.00 70.48  ? 562  ARG C CA    1 
ATOM   7607  C  C     . ARG C 2  562  ? 40.835  -16.345 -19.150  1.00 67.61  ? 562  ARG C C     1 
ATOM   7608  O  O     . ARG C 2  562  ? 41.791  -16.003 -19.847  1.00 69.45  ? 562  ARG C O     1 
ATOM   7609  C  CB    . ARG C 2  562  ? 39.870  -14.418 -17.847  1.00 65.96  ? 562  ARG C CB    1 
ATOM   7610  C  CG    . ARG C 2  562  ? 39.925  -13.609 -16.556  1.00 59.91  ? 562  ARG C CG    1 
ATOM   7611  C  CD    . ARG C 2  562  ? 38.924  -12.471 -16.552  1.00 53.14  ? 562  ARG C CD    1 
ATOM   7612  N  NE    . ARG C 2  562  ? 39.110  -11.561 -17.678  1.00 50.92  ? 562  ARG C NE    1 
ATOM   7613  C  CZ    . ARG C 2  562  ? 38.324  -11.526 -18.750  1.00 46.39  ? 562  ARG C CZ    1 
ATOM   7614  N  NH1   . ARG C 2  562  ? 38.564  -10.661 -19.726  1.00 47.18  ? 562  ARG C NH1   1 
ATOM   7615  N  NH2   . ARG C 2  562  ? 37.292  -12.353 -18.846  1.00 42.93  ? 562  ARG C NH2   1 
ATOM   7616  N  N     . ARG C 2  563  ? 39.939  -17.243 -19.546  1.00 62.89  ? 563  ARG C N     1 
ATOM   7617  C  CA    . ARG C 2  563  ? 40.117  -17.996 -20.781  1.00 59.91  ? 563  ARG C CA    1 
ATOM   7618  C  C     . ARG C 2  563  ? 38.798  -18.216 -21.522  1.00 56.45  ? 563  ARG C C     1 
ATOM   7619  O  O     . ARG C 2  563  ? 37.727  -18.186 -20.916  1.00 58.01  ? 563  ARG C O     1 
ATOM   7620  C  CB    . ARG C 2  563  ? 40.785  -19.340 -20.470  1.00 64.42  ? 563  ARG C CB    1 
ATOM   7621  C  CG    . ARG C 2  563  ? 40.998  -20.255 -21.664  1.00 72.72  ? 563  ARG C CG    1 
ATOM   7622  C  CD    . ARG C 2  563  ? 41.876  -21.432 -21.303  1.00 82.50  ? 563  ARG C CD    1 
ATOM   7623  N  NE    . ARG C 2  563  ? 43.173  -20.998 -20.791  1.00 82.08  ? 563  ARG C NE    1 
ATOM   7624  C  CZ    . ARG C 2  563  ? 44.158  -20.527 -21.549  1.00 79.84  ? 563  ARG C CZ    1 
ATOM   7625  N  NH1   . ARG C 2  563  ? 43.997  -20.417 -22.862  1.00 76.25  ? 563  ARG C NH1   1 
ATOM   7626  N  NH2   . ARG C 2  563  ? 45.305  -20.162 -20.994  1.00 84.16  ? 563  ARG C NH2   1 
ATOM   7627  N  N     . LYS C 2  564  ? 38.899  -18.408 -22.836  1.00 58.74  ? 564  LYS C N     1 
ATOM   7628  C  CA    . LYS C 2  564  ? 37.782  -18.773 -23.703  1.00 57.87  ? 564  LYS C CA    1 
ATOM   7629  C  C     . LYS C 2  564  ? 36.833  -19.783 -23.065  1.00 55.99  ? 564  LYS C C     1 
ATOM   7630  O  O     . LYS C 2  564  ? 37.265  -20.690 -22.351  1.00 51.91  ? 564  LYS C O     1 
ATOM   7631  C  CB    . LYS C 2  564  ? 38.324  -19.329 -25.027  1.00 60.22  ? 564  LYS C CB    1 
ATOM   7632  C  CG    . LYS C 2  564  ? 37.272  -19.742 -26.049  1.00 56.55  ? 564  LYS C CG    1 
ATOM   7633  C  CD    . LYS C 2  564  ? 37.922  -20.124 -27.377  1.00 56.74  ? 564  LYS C CD    1 
ATOM   7634  C  CE    . LYS C 2  564  ? 36.888  -20.520 -28.424  1.00 68.78  ? 564  LYS C CE    1 
ATOM   7635  N  NZ    . LYS C 2  564  ? 37.500  -20.746 -29.767  1.00 71.68  ? 564  LYS C NZ    1 
ATOM   7636  N  N     . ALA C 2  565  ? 35.540  -19.591 -23.322  1.00 56.20  ? 565  ALA C N     1 
ATOM   7637  C  CA    . ALA C 2  565  ? 34.467  -20.470 -22.854  1.00 56.25  ? 565  ALA C CA    1 
ATOM   7638  C  C     . ALA C 2  565  ? 34.276  -20.413 -21.337  1.00 58.52  ? 565  ALA C C     1 
ATOM   7639  O  O     . ALA C 2  565  ? 33.771  -21.358 -20.731  1.00 55.69  ? 565  ALA C O     1 
ATOM   7640  C  CB    . ALA C 2  565  ? 34.717  -21.910 -23.307  1.00 54.46  ? 565  ALA C CB    1 
ATOM   7641  N  N     . GLY C 2  566  ? 34.671  -19.297 -20.731  1.00 59.25  ? 566  GLY C N     1 
ATOM   7642  C  CA    . GLY C 2  566  ? 34.478  -19.087 -19.306  1.00 61.76  ? 566  GLY C CA    1 
ATOM   7643  C  C     . GLY C 2  566  ? 35.446  -19.837 -18.405  1.00 66.00  ? 566  GLY C C     1 
ATOM   7644  O  O     . GLY C 2  566  ? 35.295  -19.833 -17.183  1.00 68.89  ? 566  GLY C O     1 
ATOM   7645  N  N     . GLU C 2  567  ? 36.447  -20.473 -19.008  1.00 68.24  ? 567  GLU C N     1 
ATOM   7646  C  CA    . GLU C 2  567  ? 37.423  -21.273 -18.268  1.00 75.56  ? 567  GLU C CA    1 
ATOM   7647  C  C     . GLU C 2  567  ? 38.433  -20.395 -17.524  1.00 77.63  ? 567  GLU C C     1 
ATOM   7648  O  O     . GLU C 2  567  ? 38.793  -19.319 -17.998  1.00 73.89  ? 567  GLU C O     1 
ATOM   7649  C  CB    . GLU C 2  567  ? 38.151  -22.224 -19.227  1.00 84.25  ? 567  GLU C CB    1 
ATOM   7650  C  CG    . GLU C 2  567  ? 39.109  -23.209 -18.565  1.00 95.73  ? 567  GLU C CG    1 
ATOM   7651  C  CD    . GLU C 2  567  ? 39.853  -24.079 -19.575  1.00 99.74  ? 567  GLU C CD    1 
ATOM   7652  O  OE1   . GLU C 2  567  ? 39.666  -23.874 -20.794  1.00 98.10  ? 567  GLU C OE1   1 
ATOM   7653  O  OE2   . GLU C 2  567  ? 40.621  -24.970 -19.149  1.00 103.49 ? 567  GLU C OE2   1 
ATOM   7654  N  N     . VAL C 2  568  ? 38.875  -20.849 -16.353  1.00 76.88  ? 568  VAL C N     1 
ATOM   7655  C  CA    . VAL C 2  568  ? 39.903  -20.143 -15.586  1.00 75.23  ? 568  VAL C CA    1 
ATOM   7656  C  C     . VAL C 2  568  ? 40.979  -21.102 -15.082  1.00 75.81  ? 568  VAL C C     1 
ATOM   7657  O  O     . VAL C 2  568  ? 40.671  -22.178 -14.573  1.00 83.07  ? 568  VAL C O     1 
ATOM   7658  C  CB    . VAL C 2  568  ? 39.298  -19.390 -14.382  1.00 70.40  ? 568  VAL C CB    1 
ATOM   7659  C  CG1   . VAL C 2  568  ? 40.392  -18.819 -13.488  1.00 68.02  ? 568  VAL C CG1   1 
ATOM   7660  C  CG2   . VAL C 2  568  ? 38.377  -18.287 -14.859  1.00 80.35  ? 568  VAL C CG2   1 
ATOM   7661  N  N     . GLU C 2  569  ? 42.242  -20.708 -15.226  1.00 83.03  ? 569  GLU C N     1 
ATOM   7662  C  CA    . GLU C 2  569  ? 43.359  -21.535 -14.779  1.00 85.84  ? 569  GLU C CA    1 
ATOM   7663  C  C     . GLU C 2  569  ? 44.583  -20.693 -14.435  1.00 79.76  ? 569  GLU C C     1 
ATOM   7664  O  O     . GLU C 2  569  ? 44.650  -19.513 -14.772  1.00 80.18  ? 569  GLU C O     1 
ATOM   7665  C  CB    . GLU C 2  569  ? 43.723  -22.564 -15.852  1.00 82.05  ? 569  GLU C CB    1 
ATOM   7666  C  CG    . GLU C 2  569  ? 44.167  -21.947 -17.171  1.00 81.32  ? 569  GLU C CG    1 
ATOM   7667  C  CD    . GLU C 2  569  ? 44.615  -22.983 -18.183  1.00 85.40  ? 569  GLU C CD    1 
ATOM   7668  O  OE1   . GLU C 2  569  ? 44.618  -24.185 -17.844  1.00 92.21  ? 569  GLU C OE1   1 
ATOM   7669  O  OE2   . GLU C 2  569  ? 44.964  -22.595 -19.317  1.00 86.58  ? 569  GLU C OE2   1 
ATOM   7670  N  N     . TYR C 2  570  ? 45.547  -21.307 -13.758  1.00 80.64  ? 570  TYR C N     1 
ATOM   7671  C  CA    . TYR C 2  570  ? 46.820  -20.654 -13.489  1.00 80.73  ? 570  TYR C CA    1 
ATOM   7672  C  C     . TYR C 2  570  ? 47.737  -20.844 -14.691  1.00 80.41  ? 570  TYR C C     1 
ATOM   7673  O  O     . TYR C 2  570  ? 47.868  -21.951 -15.214  1.00 84.90  ? 570  TYR C O     1 
ATOM   7674  C  CB    . TYR C 2  570  ? 47.466  -21.213 -12.219  1.00 90.27  ? 570  TYR C CB    1 
ATOM   7675  C  CG    . TYR C 2  570  ? 46.692  -20.927 -10.947  1.00 87.05  ? 570  TYR C CG    1 
ATOM   7676  C  CD1   . TYR C 2  570  ? 47.003  -19.828 -10.155  1.00 89.55  ? 570  TYR C CD1   1 
ATOM   7677  C  CD2   . TYR C 2  570  ? 45.658  -21.758 -10.535  1.00 80.30  ? 570  TYR C CD2   1 
ATOM   7678  C  CE1   . TYR C 2  570  ? 46.304  -19.562 -8.991   1.00 78.29  ? 570  TYR C CE1   1 
ATOM   7679  C  CE2   . TYR C 2  570  ? 44.953  -21.499 -9.371   1.00 77.94  ? 570  TYR C CE2   1 
ATOM   7680  C  CZ    . TYR C 2  570  ? 45.281  -20.399 -8.604   1.00 75.60  ? 570  TYR C CZ    1 
ATOM   7681  O  OH    . TYR C 2  570  ? 44.586  -20.134 -7.446   1.00 71.66  ? 570  TYR C OH    1 
ATOM   7682  N  N     . VAL C 2  571  ? 48.363  -19.759 -15.136  1.00 77.33  ? 571  VAL C N     1 
ATOM   7683  C  CA    . VAL C 2  571  ? 49.157  -19.785 -16.358  1.00 77.03  ? 571  VAL C CA    1 
ATOM   7684  C  C     . VAL C 2  571  ? 50.423  -18.947 -16.198  1.00 76.51  ? 571  VAL C C     1 
ATOM   7685  O  O     . VAL C 2  571  ? 50.361  -17.834 -15.674  1.00 76.16  ? 571  VAL C O     1 
ATOM   7686  C  CB    . VAL C 2  571  ? 48.323  -19.278 -17.564  1.00 76.56  ? 571  VAL C CB    1 
ATOM   7687  C  CG1   . VAL C 2  571  ? 49.215  -18.792 -18.692  1.00 82.43  ? 571  VAL C CG1   1 
ATOM   7688  C  CG2   . VAL C 2  571  ? 47.378  -20.371 -18.056  1.00 77.71  ? 571  VAL C CG2   1 
ATOM   7689  N  N     . PRO C 2  572  ? 51.576  -19.495 -16.630  1.00 74.14  ? 572  PRO C N     1 
ATOM   7690  C  CA    . PRO C 2  572  ? 52.884  -18.829 -16.570  1.00 72.61  ? 572  PRO C CA    1 
ATOM   7691  C  C     . PRO C 2  572  ? 52.851  -17.389 -17.077  1.00 73.27  ? 572  PRO C C     1 
ATOM   7692  O  O     . PRO C 2  572  ? 52.141  -17.087 -18.037  1.00 72.56  ? 572  PRO C O     1 
ATOM   7693  C  CB    . PRO C 2  572  ? 53.770  -19.707 -17.470  1.00 79.39  ? 572  PRO C CB    1 
ATOM   7694  C  CG    . PRO C 2  572  ? 52.833  -20.669 -18.160  1.00 70.01  ? 572  PRO C CG    1 
ATOM   7695  C  CD    . PRO C 2  572  ? 51.685  -20.833 -17.231  1.00 72.32  ? 572  PRO C CD    1 
ATOM   7696  N  N     . SER C 2  573  ? 53.624  -16.520 -16.431  1.00 73.33  ? 573  SER C N     1 
ATOM   7697  C  CA    . SER C 2  573  ? 53.602  -15.086 -16.708  1.00 74.11  ? 573  SER C CA    1 
ATOM   7698  C  C     . SER C 2  573  ? 54.045  -14.744 -18.127  1.00 77.36  ? 573  SER C C     1 
ATOM   7699  O  O     . SER C 2  573  ? 53.710  -13.679 -18.645  1.00 76.63  ? 573  SER C O     1 
ATOM   7700  C  CB    . SER C 2  573  ? 54.483  -14.345 -15.698  1.00 72.33  ? 573  SER C CB    1 
ATOM   7701  O  OG    . SER C 2  573  ? 54.527  -12.955 -15.975  1.00 72.42  ? 573  SER C OG    1 
ATOM   7702  N  N     . SER C 2  574  ? 54.796  -15.647 -18.750  1.00 79.75  ? 574  SER C N     1 
ATOM   7703  C  CA    . SER C 2  574  ? 55.267  -15.435 -20.116  1.00 84.76  ? 574  SER C CA    1 
ATOM   7704  C  C     . SER C 2  574  ? 54.121  -15.560 -21.112  1.00 80.04  ? 574  SER C C     1 
ATOM   7705  O  O     . SER C 2  574  ? 54.184  -15.025 -22.219  1.00 81.54  ? 574  SER C O     1 
ATOM   7706  C  CB    . SER C 2  574  ? 56.373  -16.432 -20.474  1.00 102.11 ? 574  SER C CB    1 
ATOM   7707  O  OG    . SER C 2  574  ? 57.454  -16.365 -19.561  1.00 110.42 ? 574  SER C OG    1 
ATOM   7708  N  N     . GLU C 2  575  ? 53.075  -16.271 -20.708  1.00 77.91  ? 575  GLU C N     1 
ATOM   7709  C  CA    . GLU C 2  575  ? 51.941  -16.542 -21.579  1.00 85.48  ? 575  GLU C CA    1 
ATOM   7710  C  C     . GLU C 2  575  ? 50.819  -15.522 -21.347  1.00 80.75  ? 575  GLU C C     1 
ATOM   7711  O  O     . GLU C 2  575  ? 49.738  -15.625 -21.928  1.00 74.74  ? 575  GLU C O     1 
ATOM   7712  C  CB    . GLU C 2  575  ? 51.439  -17.970 -21.348  1.00 88.07  ? 575  GLU C CB    1 
ATOM   7713  C  CG    . GLU C 2  575  ? 50.763  -18.624 -22.542  1.00 92.04  ? 575  GLU C CG    1 
ATOM   7714  C  CD    . GLU C 2  575  ? 50.526  -20.112 -22.326  1.00 94.29  ? 575  GLU C CD    1 
ATOM   7715  O  OE1   . GLU C 2  575  ? 51.236  -20.710 -21.489  1.00 95.02  ? 575  GLU C OE1   1 
ATOM   7716  O  OE2   . GLU C 2  575  ? 49.628  -20.679 -22.985  1.00 98.40  ? 575  GLU C OE2   1 
ATOM   7717  N  N     . VAL C 2  576  ? 51.088  -14.533 -20.498  1.00 77.84  ? 576  VAL C N     1 
ATOM   7718  C  CA    . VAL C 2  576  ? 50.128  -13.468 -20.221  1.00 67.85  ? 576  VAL C CA    1 
ATOM   7719  C  C     . VAL C 2  576  ? 50.142  -12.401 -21.312  1.00 67.16  ? 576  VAL C C     1 
ATOM   7720  O  O     . VAL C 2  576  ? 51.133  -11.691 -21.488  1.00 75.79  ? 576  VAL C O     1 
ATOM   7721  C  CB    . VAL C 2  576  ? 50.411  -12.797 -18.865  1.00 69.23  ? 576  VAL C CB    1 
ATOM   7722  C  CG1   . VAL C 2  576  ? 49.478  -11.615 -18.650  1.00 70.26  ? 576  VAL C CG1   1 
ATOM   7723  C  CG2   . VAL C 2  576  ? 50.278  -13.805 -17.740  1.00 70.58  ? 576  VAL C CG2   1 
ATOM   7724  N  N     . ASP C 2  577  ? 49.033  -12.290 -22.037  1.00 64.93  ? 577  ASP C N     1 
ATOM   7725  C  CA    . ASP C 2  577  ? 48.926  -11.347 -23.148  1.00 65.50  ? 577  ASP C CA    1 
ATOM   7726  C  C     . ASP C 2  577  ? 48.477  -9.959  -22.690  1.00 61.26  ? 577  ASP C C     1 
ATOM   7727  O  O     . ASP C 2  577  ? 49.157  -8.962  -22.940  1.00 61.25  ? 577  ASP C O     1 
ATOM   7728  C  CB    . ASP C 2  577  ? 47.957  -11.883 -24.206  1.00 64.99  ? 577  ASP C CB    1 
ATOM   7729  C  CG    . ASP C 2  577  ? 48.499  -13.100 -24.935  1.00 72.77  ? 577  ASP C CG    1 
ATOM   7730  O  OD1   . ASP C 2  577  ? 49.686  -13.084 -25.324  1.00 77.71  ? 577  ASP C OD1   1 
ATOM   7731  O  OD2   . ASP C 2  577  ? 47.736  -14.074 -25.119  1.00 69.58  ? 577  ASP C OD2   1 
ATOM   7732  N  N     . TYR C 2  578  ? 47.326  -9.904  -22.026  1.00 61.78  ? 578  TYR C N     1 
ATOM   7733  C  CA    . TYR C 2  578  ? 46.768  -8.645  -21.536  1.00 55.87  ? 578  TYR C CA    1 
ATOM   7734  C  C     . TYR C 2  578  ? 46.283  -8.787  -20.098  1.00 54.60  ? 578  TYR C C     1 
ATOM   7735  O  O     . TYR C 2  578  ? 46.225  -9.893  -19.567  1.00 59.29  ? 578  TYR C O     1 
ATOM   7736  C  CB    . TYR C 2  578  ? 45.616  -8.182  -22.432  1.00 54.01  ? 578  TYR C CB    1 
ATOM   7737  C  CG    . TYR C 2  578  ? 46.028  -7.918  -23.859  1.00 56.40  ? 578  TYR C CG    1 
ATOM   7738  C  CD1   . TYR C 2  578  ? 46.457  -6.660  -24.253  1.00 56.53  ? 578  TYR C CD1   1 
ATOM   7739  C  CD2   . TYR C 2  578  ? 45.995  -8.928  -24.812  1.00 55.69  ? 578  TYR C CD2   1 
ATOM   7740  C  CE1   . TYR C 2  578  ? 46.840  -6.411  -25.553  1.00 57.72  ? 578  TYR C CE1   1 
ATOM   7741  C  CE2   . TYR C 2  578  ? 46.376  -8.689  -26.117  1.00 56.03  ? 578  TYR C CE2   1 
ATOM   7742  C  CZ    . TYR C 2  578  ? 46.798  -7.429  -26.482  1.00 58.17  ? 578  TYR C CZ    1 
ATOM   7743  O  OH    . TYR C 2  578  ? 47.179  -7.188  -27.781  1.00 55.60  ? 578  TYR C OH    1 
ATOM   7744  N  N     . MET C 2  579  ? 45.947  -7.665  -19.469  1.00 51.76  ? 579  MET C N     1 
ATOM   7745  C  CA    . MET C 2  579  ? 45.349  -7.688  -18.138  1.00 53.51  ? 579  MET C CA    1 
ATOM   7746  C  C     . MET C 2  579  ? 44.167  -6.722  -18.086  1.00 54.61  ? 579  MET C C     1 
ATOM   7747  O  O     . MET C 2  579  ? 44.026  -5.857  -18.952  1.00 54.90  ? 579  MET C O     1 
ATOM   7748  C  CB    . MET C 2  579  ? 46.378  -7.328  -17.065  1.00 55.08  ? 579  MET C CB    1 
ATOM   7749  C  CG    . MET C 2  579  ? 46.609  -5.836  -16.902  1.00 55.15  ? 579  MET C CG    1 
ATOM   7750  S  SD    . MET C 2  579  ? 47.539  -5.448  -15.410  1.00 62.76  ? 579  MET C SD    1 
ATOM   7751  C  CE    . MET C 2  579  ? 46.617  -6.372  -14.185  1.00 61.22  ? 579  MET C CE    1 
ATOM   7752  N  N     . ASP C 2  580  ? 43.316  -6.875  -17.074  1.00 57.44  ? 580  ASP C N     1 
ATOM   7753  C  CA    . ASP C 2  580  ? 42.127  -6.034  -16.937  1.00 53.04  ? 580  ASP C CA    1 
ATOM   7754  C  C     . ASP C 2  580  ? 42.512  -4.607  -16.540  1.00 48.61  ? 580  ASP C C     1 
ATOM   7755  O  O     . ASP C 2  580  ? 43.541  -4.391  -15.903  1.00 51.06  ? 580  ASP C O     1 
ATOM   7756  C  CB    . ASP C 2  580  ? 41.159  -6.633  -15.910  1.00 53.62  ? 580  ASP C CB    1 
ATOM   7757  C  CG    . ASP C 2  580  ? 40.691  -8.030  -16.289  1.00 57.21  ? 580  ASP C CG    1 
ATOM   7758  O  OD1   . ASP C 2  580  ? 40.604  -8.320  -17.501  1.00 53.04  ? 580  ASP C OD1   1 
ATOM   7759  O  OD2   . ASP C 2  580  ? 40.411  -8.839  -15.376  1.00 61.48  ? 580  ASP C OD2   1 
ATOM   7760  N  N     . VAL C 2  581  ? 41.691  -3.635  -16.930  1.00 44.78  ? 581  VAL C N     1 
ATOM   7761  C  CA    . VAL C 2  581  ? 41.947  -2.234  -16.604  1.00 44.33  ? 581  VAL C CA    1 
ATOM   7762  C  C     . VAL C 2  581  ? 41.771  -1.974  -15.114  1.00 42.52  ? 581  VAL C C     1 
ATOM   7763  O  O     . VAL C 2  581  ? 42.621  -1.351  -14.477  1.00 40.35  ? 581  VAL C O     1 
ATOM   7764  C  CB    . VAL C 2  581  ? 41.016  -1.286  -17.395  1.00 44.00  ? 581  VAL C CB    1 
ATOM   7765  C  CG1   . VAL C 2  581  ? 40.851  0.046   -16.670  1.00 40.11  ? 581  VAL C CG1   1 
ATOM   7766  C  CG2   . VAL C 2  581  ? 41.545  -1.076  -18.807  1.00 46.14  ? 581  VAL C CG2   1 
ATOM   7767  N  N     . SER C 2  582  ? 40.663  -2.458  -14.564  1.00 45.46  ? 582  SER C N     1 
ATOM   7768  C  CA    . SER C 2  582  ? 40.339  -2.225  -13.160  1.00 44.47  ? 582  SER C CA    1 
ATOM   7769  C  C     . SER C 2  582  ? 39.618  -3.441  -12.571  1.00 42.46  ? 582  SER C C     1 
ATOM   7770  O  O     . SER C 2  582  ? 39.007  -4.218  -13.309  1.00 40.88  ? 582  SER C O     1 
ATOM   7771  C  CB    . SER C 2  582  ? 39.482  -0.960  -13.021  1.00 42.42  ? 582  SER C CB    1 
ATOM   7772  O  OG    . SER C 2  582  ? 39.448  -0.485  -11.686  1.00 44.70  ? 582  SER C OG    1 
ATOM   7773  N  N     . PRO C 2  583  ? 39.716  -3.633  -11.244  1.00 41.61  ? 583  PRO C N     1 
ATOM   7774  C  CA    . PRO C 2  583  ? 38.929  -4.680  -10.584  1.00 38.49  ? 583  PRO C CA    1 
ATOM   7775  C  C     . PRO C 2  583  ? 37.439  -4.449  -10.794  1.00 37.95  ? 583  PRO C C     1 
ATOM   7776  O  O     . PRO C 2  583  ? 36.679  -5.400  -10.969  1.00 37.94  ? 583  PRO C O     1 
ATOM   7777  C  CB    . PRO C 2  583  ? 39.305  -4.528  -9.108   1.00 39.92  ? 583  PRO C CB    1 
ATOM   7778  C  CG    . PRO C 2  583  ? 40.653  -3.902  -9.125   1.00 40.22  ? 583  PRO C CG    1 
ATOM   7779  C  CD    . PRO C 2  583  ? 40.666  -2.992  -10.318  1.00 40.38  ? 583  PRO C CD    1 
ATOM   7780  N  N     . ARG C 2  584  ? 37.042  -3.180  -10.786  1.00 37.19  ? 584  ARG C N     1 
ATOM   7781  C  CA    . ARG C 2  584  ? 35.650  -2.778  -10.959  1.00 36.84  ? 584  ARG C CA    1 
ATOM   7782  C  C     . ARG C 2  584  ? 35.285  -2.618  -12.437  1.00 37.02  ? 584  ARG C C     1 
ATOM   7783  O  O     . ARG C 2  584  ? 34.578  -1.682  -12.813  1.00 35.70  ? 584  ARG C O     1 
ATOM   7784  C  CB    . ARG C 2  584  ? 35.389  -1.465  -10.212  1.00 36.88  ? 584  ARG C CB    1 
ATOM   7785  C  CG    . ARG C 2  584  ? 36.304  -0.314  -10.644  1.00 43.63  ? 584  ARG C CG    1 
ATOM   7786  C  CD    . ARG C 2  584  ? 36.012  0.975   -9.890   1.00 45.85  ? 584  ARG C CD    1 
ATOM   7787  N  NE    . ARG C 2  584  ? 36.453  2.150   -10.640  1.00 48.39  ? 584  ARG C NE    1 
ATOM   7788  C  CZ    . ARG C 2  584  ? 36.216  3.404   -10.272  1.00 53.51  ? 584  ARG C CZ    1 
ATOM   7789  N  NH1   . ARG C 2  584  ? 35.543  3.656   -9.156   1.00 51.55  ? 584  ARG C NH1   1 
ATOM   7790  N  NH2   . ARG C 2  584  ? 36.651  4.408   -11.020  1.00 51.68  ? 584  ARG C NH2   1 
ATOM   7791  N  N     . GLN C 2  585  ? 35.754  -3.539  -13.273  1.00 35.13  ? 585  GLN C N     1 
ATOM   7792  C  CA    . GLN C 2  585  ? 35.578  -3.408  -14.718  1.00 36.17  ? 585  GLN C CA    1 
ATOM   7793  C  C     . GLN C 2  585  ? 34.227  -3.910  -15.217  1.00 36.32  ? 585  GLN C C     1 
ATOM   7794  O  O     . GLN C 2  585  ? 33.564  -3.238  -16.005  1.00 36.17  ? 585  GLN C O     1 
ATOM   7795  C  CB    . GLN C 2  585  ? 36.692  -4.148  -15.459  1.00 38.34  ? 585  GLN C CB    1 
ATOM   7796  C  CG    . GLN C 2  585  ? 36.504  -4.192  -16.967  1.00 39.68  ? 585  GLN C CG    1 
ATOM   7797  C  CD    . GLN C 2  585  ? 37.812  -4.402  -17.700  1.00 43.62  ? 585  GLN C CD    1 
ATOM   7798  O  OE1   . GLN C 2  585  ? 38.862  -4.574  -17.078  1.00 47.64  ? 585  GLN C OE1   1 
ATOM   7799  N  NE2   . GLN C 2  585  ? 37.760  -4.376  -19.029  1.00 42.03  ? 585  GLN C NE2   1 
ATOM   7800  N  N     . MET C 2  586  ? 33.828  -5.090  -14.754  1.00 34.58  ? 586  MET C N     1 
ATOM   7801  C  CA    . MET C 2  586  ? 32.631  -5.770  -15.252  1.00 35.20  ? 586  MET C CA    1 
ATOM   7802  C  C     . MET C 2  586  ? 31.327  -5.061  -14.905  1.00 32.48  ? 586  MET C C     1 
ATOM   7803  O  O     . MET C 2  586  ? 30.273  -5.388  -15.449  1.00 29.65  ? 586  MET C O     1 
ATOM   7804  C  CB    . MET C 2  586  ? 32.584  -7.199  -14.703  1.00 33.17  ? 586  MET C CB    1 
ATOM   7805  C  CG    . MET C 2  586  ? 32.693  -7.277  -13.186  1.00 32.48  ? 586  MET C CG    1 
ATOM   7806  S  SD    . MET C 2  586  ? 32.785  -8.962  -12.553  1.00 32.79  ? 586  MET C SD    1 
ATOM   7807  C  CE    . MET C 2  586  ? 31.095  -9.215  -12.021  1.00 36.58  ? 586  MET C CE    1 
ATOM   7808  N  N     . VAL C 2  587  ? 31.402  -4.088  -14.004  1.00 34.44  ? 587  VAL C N     1 
ATOM   7809  C  CA    . VAL C 2  587  ? 30.205  -3.474  -13.438  1.00 35.52  ? 587  VAL C CA    1 
ATOM   7810  C  C     . VAL C 2  587  ? 29.648  -2.315  -14.259  1.00 34.34  ? 587  VAL C C     1 
ATOM   7811  O  O     . VAL C 2  587  ? 30.343  -1.725  -15.086  1.00 31.90  ? 587  VAL C O     1 
ATOM   7812  C  CB    . VAL C 2  587  ? 30.475  -2.966  -12.012  1.00 33.53  ? 587  VAL C CB    1 
ATOM   7813  C  CG1   . VAL C 2  587  ? 31.132  -4.060  -11.186  1.00 40.12  ? 587  VAL C CG1   1 
ATOM   7814  C  CG2   . VAL C 2  587  ? 31.349  -1.724  -12.043  1.00 30.78  ? 587  VAL C CG2   1 
ATOM   7815  N  N     . SER C 2  588  ? 28.379  -2.003  -14.016  1.00 31.48  ? 588  SER C N     1 
ATOM   7816  C  CA    . SER C 2  588  ? 27.731  -0.855  -14.632  1.00 29.85  ? 588  SER C CA    1 
ATOM   7817  C  C     . SER C 2  588  ? 27.938  0.367   -13.764  1.00 28.76  ? 588  SER C C     1 
ATOM   7818  O  O     . SER C 2  588  ? 28.606  0.301   -12.731  1.00 28.45  ? 588  SER C O     1 
ATOM   7819  C  CB    . SER C 2  588  ? 26.235  -1.100  -14.822  1.00 31.22  ? 588  SER C CB    1 
ATOM   7820  O  OG    . SER C 2  588  ? 25.543  -0.962  -13.593  1.00 32.02  ? 588  SER C OG    1 
ATOM   7821  N  N     . VAL C 2  589  ? 27.345  1.478   -14.181  1.00 27.25  ? 589  VAL C N     1 
ATOM   7822  C  CA    . VAL C 2  589  ? 27.439  2.716   -13.427  1.00 26.65  ? 589  VAL C CA    1 
ATOM   7823  C  C     . VAL C 2  589  ? 26.749  2.557   -12.077  1.00 26.89  ? 589  VAL C C     1 
ATOM   7824  O  O     . VAL C 2  589  ? 27.339  2.820   -11.028  1.00 26.02  ? 589  VAL C O     1 
ATOM   7825  C  CB    . VAL C 2  589  ? 26.807  3.892   -14.186  1.00 26.14  ? 589  VAL C CB    1 
ATOM   7826  C  CG1   . VAL C 2  589  ? 27.452  5.198   -13.755  1.00 29.25  ? 589  VAL C CG1   1 
ATOM   7827  C  CG2   . VAL C 2  589  ? 26.943  3.693   -15.688  1.00 24.02  ? 589  VAL C CG2   1 
ATOM   7828  N  N     . ALA C 2  590  ? 25.500  2.104   -12.119  1.00 27.49  ? 590  ALA C N     1 
ATOM   7829  C  CA    . ALA C 2  590  ? 24.691  1.934   -10.917  1.00 26.08  ? 590  ALA C CA    1 
ATOM   7830  C  C     . ALA C 2  590  ? 25.290  0.907   -9.966   1.00 26.08  ? 590  ALA C C     1 
ATOM   7831  O  O     . ALA C 2  590  ? 25.131  1.007   -8.749   1.00 25.31  ? 590  ALA C O     1 
ATOM   7832  C  CB    . ALA C 2  590  ? 23.270  1.536   -11.294  1.00 26.22  ? 590  ALA C CB    1 
ATOM   7833  N  N     . THR C 2  591  ? 25.984  -0.077  -10.524  1.00 27.64  ? 591  THR C N     1 
ATOM   7834  C  CA    . THR C 2  591  ? 26.545  -1.156  -9.722   1.00 28.16  ? 591  THR C CA    1 
ATOM   7835  C  C     . THR C 2  591  ? 27.684  -0.660  -8.843   1.00 26.09  ? 591  THR C C     1 
ATOM   7836  O  O     . THR C 2  591  ? 27.848  -1.102  -7.707   1.00 26.76  ? 591  THR C O     1 
ATOM   7837  C  CB    . THR C 2  591  ? 27.063  -2.304  -10.609  1.00 29.50  ? 591  THR C CB    1 
ATOM   7838  O  OG1   . THR C 2  591  ? 26.168  -2.501  -11.711  1.00 30.32  ? 591  THR C OG1   1 
ATOM   7839  C  CG2   . THR C 2  591  ? 27.172  -3.594  -9.803   1.00 29.15  ? 591  THR C CG2   1 
ATOM   7840  N  N     . ALA C 2  592  ? 28.464  0.269   -9.383   1.00 28.54  ? 592  ALA C N     1 
ATOM   7841  C  CA    . ALA C 2  592  ? 29.674  0.744   -8.724   1.00 30.49  ? 592  ALA C CA    1 
ATOM   7842  C  C     . ALA C 2  592  ? 29.384  1.492   -7.424   1.00 33.11  ? 592  ALA C C     1 
ATOM   7843  O  O     . ALA C 2  592  ? 30.187  1.457   -6.494   1.00 35.22  ? 592  ALA C O     1 
ATOM   7844  C  CB    . ALA C 2  592  ? 30.467  1.630   -9.669   1.00 31.07  ? 592  ALA C CB    1 
ATOM   7845  N  N     . MET C 2  593  ? 28.239  2.163   -7.356   1.00 31.43  ? 593  MET C N     1 
ATOM   7846  C  CA    . MET C 2  593  ? 27.910  3.001   -6.206   1.00 30.12  ? 593  MET C CA    1 
ATOM   7847  C  C     . MET C 2  593  ? 27.444  2.201   -4.994   1.00 31.19  ? 593  MET C C     1 
ATOM   7848  O  O     . MET C 2  593  ? 26.840  2.753   -4.072   1.00 30.15  ? 593  MET C O     1 
ATOM   7849  C  CB    . MET C 2  593  ? 26.838  4.016   -6.588   1.00 25.51  ? 593  MET C CB    1 
ATOM   7850  C  CG    . MET C 2  593  ? 27.380  5.276   -7.223   1.00 28.93  ? 593  MET C CG    1 
ATOM   7851  S  SD    . MET C 2  593  ? 26.093  6.207   -8.066   1.00 45.18  ? 593  MET C SD    1 
ATOM   7852  C  CE    . MET C 2  593  ? 25.751  5.116   -9.442   1.00 31.08  ? 593  MET C CE    1 
ATOM   7853  N  N     . ILE C 2  594  ? 27.734  0.904   -4.999   1.00 30.75  ? 594  ILE C N     1 
ATOM   7854  C  CA    . ILE C 2  594  ? 27.357  0.019   -3.907   1.00 28.98  ? 594  ILE C CA    1 
ATOM   7855  C  C     . ILE C 2  594  ? 28.584  -0.424  -3.119   1.00 27.55  ? 594  ILE C C     1 
ATOM   7856  O  O     . ILE C 2  594  ? 29.270  -1.367  -3.512   1.00 25.72  ? 594  ILE C O     1 
ATOM   7857  C  CB    . ILE C 2  594  ? 26.612  -1.219  -4.424   1.00 29.90  ? 594  ILE C CB    1 
ATOM   7858  C  CG1   . ILE C 2  594  ? 25.472  -0.798  -5.357   1.00 29.34  ? 594  ILE C CG1   1 
ATOM   7859  C  CG2   . ILE C 2  594  ? 26.082  -2.042  -3.262   1.00 31.66  ? 594  ILE C CG2   1 
ATOM   7860  C  CD1   . ILE C 2  594  ? 24.644  -1.953  -5.872   1.00 29.60  ? 594  ILE C CD1   1 
ATOM   7861  N  N     . PRO C 2  595  ? 28.854  0.256   -1.994   1.00 28.62  ? 595  PRO C N     1 
ATOM   7862  C  CA    . PRO C 2  595  ? 30.022  -0.008  -1.149   1.00 27.79  ? 595  PRO C CA    1 
ATOM   7863  C  C     . PRO C 2  595  ? 30.015  -1.425  -0.603   1.00 27.32  ? 595  PRO C C     1 
ATOM   7864  O  O     . PRO C 2  595  ? 28.962  -1.908  -0.196   1.00 27.66  ? 595  PRO C O     1 
ATOM   7865  C  CB    . PRO C 2  595  ? 29.879  1.017   -0.019   1.00 27.59  ? 595  PRO C CB    1 
ATOM   7866  C  CG    . PRO C 2  595  ? 28.430  1.358   0.003    1.00 27.93  ? 595  PRO C CG    1 
ATOM   7867  C  CD    . PRO C 2  595  ? 27.996  1.308   -1.425   1.00 27.69  ? 595  PRO C CD    1 
ATOM   7868  N  N     . PHE C 2  596  ? 31.179  -2.066  -0.605   1.00 32.57  ? 596  PHE C N     1 
ATOM   7869  C  CA    . PHE C 2  596  ? 31.316  -3.465  -0.217   1.00 33.87  ? 596  PHE C CA    1 
ATOM   7870  C  C     . PHE C 2  596  ? 30.371  -4.359  -1.019   1.00 34.82  ? 596  PHE C C     1 
ATOM   7871  O  O     . PHE C 2  596  ? 29.601  -5.128  -0.447   1.00 34.34  ? 596  PHE C O     1 
ATOM   7872  C  CB    . PHE C 2  596  ? 31.062  -3.643  1.285    1.00 34.41  ? 596  PHE C CB    1 
ATOM   7873  C  CG    . PHE C 2  596  ? 31.833  -2.690  2.150    1.00 33.58  ? 596  PHE C CG    1 
ATOM   7874  C  CD1   . PHE C 2  596  ? 33.208  -2.795  2.265    1.00 35.95  ? 596  PHE C CD1   1 
ATOM   7875  C  CD2   . PHE C 2  596  ? 31.181  -1.698  2.859    1.00 33.44  ? 596  PHE C CD2   1 
ATOM   7876  C  CE1   . PHE C 2  596  ? 33.921  -1.919  3.065    1.00 41.75  ? 596  PHE C CE1   1 
ATOM   7877  C  CE2   . PHE C 2  596  ? 31.887  -0.819  3.662    1.00 35.41  ? 596  PHE C CE2   1 
ATOM   7878  C  CZ    . PHE C 2  596  ? 33.258  -0.930  3.763    1.00 36.77  ? 596  PHE C CZ    1 
ATOM   7879  N  N     . LEU C 2  597  ? 30.428  -4.253  -2.344   1.00 34.52  ? 597  LEU C N     1 
ATOM   7880  C  CA    . LEU C 2  597  ? 29.590  -5.081  -3.206   1.00 35.16  ? 597  LEU C CA    1 
ATOM   7881  C  C     . LEU C 2  597  ? 29.943  -6.556  -3.035   1.00 37.27  ? 597  LEU C C     1 
ATOM   7882  O  O     . LEU C 2  597  ? 29.069  -7.424  -3.087   1.00 38.81  ? 597  LEU C O     1 
ATOM   7883  C  CB    . LEU C 2  597  ? 29.736  -4.672  -4.677   1.00 36.04  ? 597  LEU C CB    1 
ATOM   7884  C  CG    . LEU C 2  597  ? 28.839  -5.416  -5.676   1.00 35.54  ? 597  LEU C CG    1 
ATOM   7885  C  CD1   . LEU C 2  597  ? 27.378  -5.128  -5.379   1.00 34.81  ? 597  LEU C CD1   1 
ATOM   7886  C  CD2   . LEU C 2  597  ? 29.170  -5.064  -7.120   1.00 31.68  ? 597  LEU C CD2   1 
ATOM   7887  N  N     . GLU C 2  598  ? 31.225  -6.825  -2.792   1.00 41.86  ? 598  GLU C N     1 
ATOM   7888  C  CA    . GLU C 2  598  ? 31.747  -8.189  -2.719   1.00 40.49  ? 598  GLU C CA    1 
ATOM   7889  C  C     . GLU C 2  598  ? 31.330  -8.918  -1.442   1.00 40.26  ? 598  GLU C C     1 
ATOM   7890  O  O     . GLU C 2  598  ? 31.775  -10.035 -1.179   1.00 39.40  ? 598  GLU C O     1 
ATOM   7891  C  CB    . GLU C 2  598  ? 33.275  -8.172  -2.834   1.00 48.17  ? 598  GLU C CB    1 
ATOM   7892  C  CG    . GLU C 2  598  ? 33.989  -7.595  -1.619   1.00 56.18  ? 598  GLU C CG    1 
ATOM   7893  C  CD    . GLU C 2  598  ? 34.978  -6.488  -1.982   1.00 67.34  ? 598  GLU C CD    1 
ATOM   7894  O  OE1   . GLU C 2  598  ? 34.632  -5.629  -2.826   1.00 58.36  ? 598  GLU C OE1   1 
ATOM   7895  O  OE2   . GLU C 2  598  ? 36.103  -6.485  -1.431   1.00 71.50  ? 598  GLU C OE2   1 
ATOM   7896  N  N     . HIS C 2  599  ? 30.467  -8.280  -0.659   1.00 38.39  ? 599  HIS C N     1 
ATOM   7897  C  CA    . HIS C 2  599  ? 29.962  -8.855  0.580    1.00 37.50  ? 599  HIS C CA    1 
ATOM   7898  C  C     . HIS C 2  599  ? 28.468  -9.143  0.473    1.00 34.04  ? 599  HIS C C     1 
ATOM   7899  O  O     . HIS C 2  599  ? 27.878  -9.752  1.361    1.00 31.28  ? 599  HIS C O     1 
ATOM   7900  C  CB    . HIS C 2  599  ? 30.237  -7.914  1.757    1.00 36.31  ? 599  HIS C CB    1 
ATOM   7901  C  CG    . HIS C 2  599  ? 31.693  -7.706  2.042    1.00 36.88  ? 599  HIS C CG    1 
ATOM   7902  N  ND1   . HIS C 2  599  ? 32.430  -8.577  2.813    1.00 38.95  ? 599  HIS C ND1   1 
ATOM   7903  C  CD2   . HIS C 2  599  ? 32.544  -6.721  1.668    1.00 37.48  ? 599  HIS C CD2   1 
ATOM   7904  C  CE1   . HIS C 2  599  ? 33.674  -8.142  2.899    1.00 41.96  ? 599  HIS C CE1   1 
ATOM   7905  N  NE2   . HIS C 2  599  ? 33.770  -7.018  2.212    1.00 40.86  ? 599  HIS C NE2   1 
ATOM   7906  N  N     . ASP C 2  600  ? 27.857  -8.693  -0.617   1.00 31.44  ? 600  ASP C N     1 
ATOM   7907  C  CA    . ASP C 2  600  ? 26.432  -8.899  -0.825   1.00 27.91  ? 600  ASP C CA    1 
ATOM   7908  C  C     . ASP C 2  600  ? 26.175  -9.820  -2.005   1.00 26.40  ? 600  ASP C C     1 
ATOM   7909  O  O     . ASP C 2  600  ? 26.762  -9.655  -3.074   1.00 26.41  ? 600  ASP C O     1 
ATOM   7910  C  CB    . ASP C 2  600  ? 25.724  -7.565  -1.046   1.00 28.54  ? 600  ASP C CB    1 
ATOM   7911  C  CG    . ASP C 2  600  ? 25.956  -6.589  0.088    1.00 28.96  ? 600  ASP C CG    1 
ATOM   7912  O  OD1   . ASP C 2  600  ? 26.367  -7.037  1.182    1.00 27.73  ? 600  ASP C OD1   1 
ATOM   7913  O  OD2   . ASP C 2  600  ? 25.725  -5.377  -0.122   1.00 28.85  ? 600  ASP C OD2   1 
ATOM   7914  N  N     . ASP C 2  601  ? 25.284  -10.783 -1.798   1.00 27.65  ? 601  ASP C N     1 
ATOM   7915  C  CA    . ASP C 2  601  ? 24.914  -11.736 -2.833   1.00 29.02  ? 601  ASP C CA    1 
ATOM   7916  C  C     . ASP C 2  601  ? 24.313  -11.018 -4.031   1.00 27.95  ? 601  ASP C C     1 
ATOM   7917  O  O     . ASP C 2  601  ? 23.710  -9.959  -3.884   1.00 28.87  ? 601  ASP C O     1 
ATOM   7918  C  CB    . ASP C 2  601  ? 23.928  -12.764 -2.278   1.00 32.31  ? 601  ASP C CB    1 
ATOM   7919  C  CG    . ASP C 2  601  ? 23.879  -14.033 -3.106   1.00 32.86  ? 601  ASP C CG    1 
ATOM   7920  O  OD1   . ASP C 2  601  ? 23.853  -15.125 -2.501   1.00 33.04  ? 601  ASP C OD1   1 
ATOM   7921  O  OD2   . ASP C 2  601  ? 23.868  -13.941 -4.354   1.00 32.59  ? 601  ASP C OD2   1 
ATOM   7922  N  N     . ALA C 2  602  ? 24.476  -11.606 -5.211   1.00 27.80  ? 602  ALA C N     1 
ATOM   7923  C  CA    . ALA C 2  602  ? 24.017  -10.995 -6.451   1.00 28.94  ? 602  ALA C CA    1 
ATOM   7924  C  C     . ALA C 2  602  ? 22.531  -10.663 -6.421   1.00 28.50  ? 602  ALA C C     1 
ATOM   7925  O  O     . ALA C 2  602  ? 22.083  -9.749  -7.108   1.00 26.96  ? 602  ALA C O     1 
ATOM   7926  C  CB    . ALA C 2  602  ? 24.322  -11.905 -7.624   1.00 29.99  ? 602  ALA C CB    1 
ATOM   7927  N  N     . ASN C 2  603  ? 21.773  -11.407 -5.623   1.00 29.84  ? 603  ASN C N     1 
ATOM   7928  C  CA    . ASN C 2  603  ? 20.340  -11.175 -5.500   1.00 30.41  ? 603  ASN C CA    1 
ATOM   7929  C  C     . ASN C 2  603  ? 20.022  -9.821  -4.878   1.00 30.73  ? 603  ASN C C     1 
ATOM   7930  O  O     . ASN C 2  603  ? 19.378  -8.982  -5.505   1.00 30.99  ? 603  ASN C O     1 
ATOM   7931  C  CB    . ASN C 2  603  ? 19.688  -12.288 -4.677   1.00 33.76  ? 603  ASN C CB    1 
ATOM   7932  C  CG    . ASN C 2  603  ? 19.754  -13.636 -5.367   1.00 34.97  ? 603  ASN C CG    1 
ATOM   7933  O  OD1   . ASN C 2  603  ? 18.854  -14.008 -6.120   1.00 37.71  ? 603  ASN C OD1   1 
ATOM   7934  N  ND2   . ASN C 2  603  ? 20.827  -14.374 -5.114   1.00 35.76  ? 603  ASN C ND2   1 
ATOM   7935  N  N     . ARG C 2  604  ? 20.466  -9.609  -3.643   1.00 29.98  ? 604  ARG C N     1 
ATOM   7936  C  CA    . ARG C 2  604  ? 20.209  -8.342  -2.967   1.00 30.58  ? 604  ARG C CA    1 
ATOM   7937  C  C     . ARG C 2  604  ? 21.038  -7.220  -3.590   1.00 31.50  ? 604  ARG C C     1 
ATOM   7938  O  O     . ARG C 2  604  ? 20.676  -6.047  -3.502   1.00 32.93  ? 604  ARG C O     1 
ATOM   7939  C  CB    . ARG C 2  604  ? 20.501  -8.449  -1.470   1.00 28.21  ? 604  ARG C CB    1 
ATOM   7940  C  CG    . ARG C 2  604  ? 19.740  -9.561  -0.777   1.00 29.33  ? 604  ARG C CG    1 
ATOM   7941  C  CD    . ARG C 2  604  ? 18.248  -9.502  -1.067   1.00 29.65  ? 604  ARG C CD    1 
ATOM   7942  N  NE    . ARG C 2  604  ? 17.549  -8.576  -0.181   1.00 31.98  ? 604  ARG C NE    1 
ATOM   7943  C  CZ    . ARG C 2  604  ? 16.286  -8.728  0.206    1.00 34.53  ? 604  ARG C CZ    1 
ATOM   7944  N  NH1   . ARG C 2  604  ? 15.587  -9.774  -0.211   1.00 36.01  ? 604  ARG C NH1   1 
ATOM   7945  N  NH2   . ARG C 2  604  ? 15.723  -7.840  1.016    1.00 34.96  ? 604  ARG C NH2   1 
ATOM   7946  N  N     . ALA C 2  605  ? 22.149  -7.581  -4.225   1.00 30.94  ? 605  ALA C N     1 
ATOM   7947  C  CA    . ALA C 2  605  ? 22.955  -6.600  -4.938   1.00 30.19  ? 605  ALA C CA    1 
ATOM   7948  C  C     . ALA C 2  605  ? 22.186  -6.103  -6.151   1.00 29.76  ? 605  ALA C C     1 
ATOM   7949  O  O     . ALA C 2  605  ? 22.302  -4.945  -6.545   1.00 29.17  ? 605  ALA C O     1 
ATOM   7950  C  CB    . ALA C 2  605  ? 24.290  -7.194  -5.353   1.00 30.38  ? 605  ALA C CB    1 
ATOM   7951  N  N     . LEU C 2  606  ? 21.393  -6.994  -6.733   1.00 26.46  ? 606  LEU C N     1 
ATOM   7952  C  CA    . LEU C 2  606  ? 20.569  -6.660  -7.884   1.00 27.78  ? 606  LEU C CA    1 
ATOM   7953  C  C     . LEU C 2  606  ? 19.505  -5.631  -7.517   1.00 28.90  ? 606  LEU C C     1 
ATOM   7954  O  O     . LEU C 2  606  ? 19.392  -4.592  -8.166   1.00 28.64  ? 606  LEU C O     1 
ATOM   7955  C  CB    . LEU C 2  606  ? 19.921  -7.923  -8.446   1.00 26.33  ? 606  LEU C CB    1 
ATOM   7956  C  CG    . LEU C 2  606  ? 19.148  -7.831  -9.757   1.00 26.82  ? 606  LEU C CG    1 
ATOM   7957  C  CD1   . LEU C 2  606  ? 19.346  -9.114  -10.536  1.00 30.11  ? 606  LEU C CD1   1 
ATOM   7958  C  CD2   . LEU C 2  606  ? 17.668  -7.593  -9.496   1.00 29.78  ? 606  LEU C CD2   1 
ATOM   7959  N  N     . MET C 2  607  ? 18.725  -5.923  -6.479   1.00 27.58  ? 607  MET C N     1 
ATOM   7960  C  CA    . MET C 2  607  ? 17.700  -4.995  -6.014   1.00 28.05  ? 607  MET C CA    1 
ATOM   7961  C  C     . MET C 2  607  ? 18.343  -3.681  -5.590   1.00 27.85  ? 607  MET C C     1 
ATOM   7962  O  O     . MET C 2  607  ? 17.793  -2.608  -5.825   1.00 29.87  ? 607  MET C O     1 
ATOM   7963  C  CB    . MET C 2  607  ? 16.906  -5.589  -4.849   1.00 28.70  ? 607  MET C CB    1 
ATOM   7964  C  CG    . MET C 2  607  ? 16.408  -7.013  -5.072   1.00 35.98  ? 607  MET C CG    1 
ATOM   7965  S  SD    . MET C 2  607  ? 15.550  -7.683  -3.627   1.00 48.75  ? 607  MET C SD    1 
ATOM   7966  C  CE    . MET C 2  607  ? 15.333  -9.395  -4.110   1.00 43.35  ? 607  MET C CE    1 
ATOM   7967  N  N     . GLY C 2  608  ? 19.519  -3.776  -4.978   1.00 25.21  ? 608  GLY C N     1 
ATOM   7968  C  CA    . GLY C 2  608  ? 20.240  -2.601  -4.524   1.00 27.02  ? 608  GLY C CA    1 
ATOM   7969  C  C     . GLY C 2  608  ? 20.584  -1.657  -5.660   1.00 26.91  ? 608  GLY C C     1 
ATOM   7970  O  O     . GLY C 2  608  ? 20.596  -0.439  -5.488   1.00 27.41  ? 608  GLY C O     1 
ATOM   7971  N  N     . ALA C 2  609  ? 20.863  -2.225  -6.828   1.00 26.20  ? 609  ALA C N     1 
ATOM   7972  C  CA    . ALA C 2  609  ? 21.156  -1.432  -8.015   1.00 26.55  ? 609  ALA C CA    1 
ATOM   7973  C  C     . ALA C 2  609  ? 19.882  -0.835  -8.597   1.00 27.19  ? 609  ALA C C     1 
ATOM   7974  O  O     . ALA C 2  609  ? 19.832  0.353   -8.910   1.00 28.73  ? 609  ALA C O     1 
ATOM   7975  C  CB    . ALA C 2  609  ? 21.866  -2.278  -9.057   1.00 25.95  ? 609  ALA C CB    1 
ATOM   7976  N  N     . ASN C 2  610  ? 18.855  -1.666  -8.740   1.00 25.52  ? 610  ASN C N     1 
ATOM   7977  C  CA    . ASN C 2  610  ? 17.586  -1.225  -9.304   1.00 26.67  ? 610  ASN C CA    1 
ATOM   7978  C  C     . ASN C 2  610  ? 16.929  -0.118  -8.487   1.00 27.54  ? 610  ASN C C     1 
ATOM   7979  O  O     . ASN C 2  610  ? 16.338  0.804   -9.043   1.00 26.64  ? 610  ASN C O     1 
ATOM   7980  C  CB    . ASN C 2  610  ? 16.621  -2.406  -9.429   1.00 27.87  ? 610  ASN C CB    1 
ATOM   7981  C  CG    . ASN C 2  610  ? 16.857  -3.222  -10.680  1.00 29.73  ? 610  ASN C CG    1 
ATOM   7982  O  OD1   . ASN C 2  610  ? 17.419  -2.727  -11.657  1.00 28.59  ? 610  ASN C OD1   1 
ATOM   7983  N  ND2   . ASN C 2  610  ? 16.415  -4.477  -10.663  1.00 31.32  ? 610  ASN C ND2   1 
ATOM   7984  N  N     . MET C 2  611  ? 17.033  -0.213  -7.167   1.00 25.38  ? 611  MET C N     1 
ATOM   7985  C  CA    . MET C 2  611  ? 16.356  0.733   -6.287   1.00 24.69  ? 611  MET C CA    1 
ATOM   7986  C  C     . MET C 2  611  ? 17.000  2.113   -6.317   1.00 25.62  ? 611  MET C C     1 
ATOM   7987  O  O     . MET C 2  611  ? 16.337  3.116   -6.050   1.00 27.44  ? 611  MET C O     1 
ATOM   7988  C  CB    . MET C 2  611  ? 16.329  0.205   -4.854   1.00 25.85  ? 611  MET C CB    1 
ATOM   7989  C  CG    . MET C 2  611  ? 15.399  -0.982  -4.648   1.00 29.29  ? 611  MET C CG    1 
ATOM   7990  S  SD    . MET C 2  611  ? 15.323  -1.459  -2.916   1.00 39.12  ? 611  MET C SD    1 
ATOM   7991  C  CE    . MET C 2  611  ? 17.067  -1.468  -2.525   1.00 30.42  ? 611  MET C CE    1 
ATOM   7992  N  N     . GLN C 2  612  ? 18.286  2.167   -6.647   1.00 25.63  ? 612  GLN C N     1 
ATOM   7993  C  CA    . GLN C 2  612  ? 18.995  3.442   -6.676   1.00 27.04  ? 612  GLN C CA    1 
ATOM   7994  C  C     . GLN C 2  612  ? 18.430  4.369   -7.746   1.00 24.92  ? 612  GLN C C     1 
ATOM   7995  O  O     . GLN C 2  612  ? 18.441  5.590   -7.587   1.00 25.28  ? 612  GLN C O     1 
ATOM   7996  C  CB    . GLN C 2  612  ? 20.492  3.223   -6.899   1.00 28.06  ? 612  GLN C CB    1 
ATOM   7997  C  CG    . GLN C 2  612  ? 21.269  2.948   -5.627   1.00 29.32  ? 612  GLN C CG    1 
ATOM   7998  C  CD    . GLN C 2  612  ? 22.744  2.730   -5.891   1.00 30.81  ? 612  GLN C CD    1 
ATOM   7999  O  OE1   . GLN C 2  612  ? 23.587  3.519   -5.465   1.00 31.45  ? 612  GLN C OE1   1 
ATOM   8000  N  NE2   . GLN C 2  612  ? 23.063  1.656   -6.605   1.00 33.44  ? 612  GLN C NE2   1 
ATOM   8001  N  N     . ARG C 2  613  ? 17.932  3.782   -8.831   1.00 25.97  ? 613  ARG C N     1 
ATOM   8002  C  CA    . ARG C 2  613  ? 17.267  4.549   -9.879   1.00 29.01  ? 613  ARG C CA    1 
ATOM   8003  C  C     . ARG C 2  613  ? 15.915  5.056   -9.389   1.00 27.14  ? 613  ARG C C     1 
ATOM   8004  O  O     . ARG C 2  613  ? 15.350  5.999   -9.940   1.00 25.70  ? 613  ARG C O     1 
ATOM   8005  C  CB    . ARG C 2  613  ? 17.069  3.708   -11.149  1.00 31.60  ? 613  ARG C CB    1 
ATOM   8006  C  CG    . ARG C 2  613  ? 18.342  3.259   -11.851  1.00 29.55  ? 613  ARG C CG    1 
ATOM   8007  C  CD    . ARG C 2  613  ? 18.053  2.783   -13.280  1.00 31.15  ? 613  ARG C CD    1 
ATOM   8008  N  NE    . ARG C 2  613  ? 17.014  1.757   -13.344  1.00 34.88  ? 613  ARG C NE    1 
ATOM   8009  C  CZ    . ARG C 2  613  ? 17.251  0.454   -13.458  1.00 33.00  ? 613  ARG C CZ    1 
ATOM   8010  N  NH1   . ARG C 2  613  ? 18.496  0.005   -13.522  1.00 30.33  ? 613  ARG C NH1   1 
ATOM   8011  N  NH2   . ARG C 2  613  ? 16.242  -0.404  -13.509  1.00 31.51  ? 613  ARG C NH2   1 
ATOM   8012  N  N     . GLN C 2  614  ? 15.400  4.413   -8.349   1.00 26.20  ? 614  GLN C N     1 
ATOM   8013  C  CA    . GLN C 2  614  ? 14.071  4.720   -7.841   1.00 24.85  ? 614  GLN C CA    1 
ATOM   8014  C  C     . GLN C 2  614  ? 14.133  5.711   -6.677   1.00 26.48  ? 614  GLN C C     1 
ATOM   8015  O  O     . GLN C 2  614  ? 13.153  5.901   -5.964   1.00 27.08  ? 614  GLN C O     1 
ATOM   8016  C  CB    . GLN C 2  614  ? 13.361  3.430   -7.409   1.00 26.74  ? 614  GLN C CB    1 
ATOM   8017  C  CG    . GLN C 2  614  ? 13.366  2.329   -8.479   1.00 27.55  ? 614  GLN C CG    1 
ATOM   8018  C  CD    . GLN C 2  614  ? 12.829  0.995   -7.973   1.00 28.62  ? 614  GLN C CD    1 
ATOM   8019  O  OE1   . GLN C 2  614  ? 12.546  0.834   -6.786   1.00 31.31  ? 614  GLN C OE1   1 
ATOM   8020  N  NE2   . GLN C 2  614  ? 12.690  0.031   -8.878   1.00 28.72  ? 614  GLN C NE2   1 
ATOM   8021  N  N     . ALA C 2  615  ? 15.283  6.349   -6.493   1.00 23.17  ? 615  ALA C N     1 
ATOM   8022  C  CA    . ALA C 2  615  ? 15.449  7.299   -5.399   1.00 24.04  ? 615  ALA C CA    1 
ATOM   8023  C  C     . ALA C 2  615  ? 14.752  8.623   -5.704   1.00 23.35  ? 615  ALA C C     1 
ATOM   8024  O  O     . ALA C 2  615  ? 14.508  8.946   -6.864   1.00 23.66  ? 615  ALA C O     1 
ATOM   8025  C  CB    . ALA C 2  615  ? 16.924  7.527   -5.119   1.00 25.53  ? 615  ALA C CB    1 
ATOM   8026  N  N     . VAL C 2  616  ? 14.446  9.389   -4.659   1.00 23.44  ? 616  VAL C N     1 
ATOM   8027  C  CA    . VAL C 2  616  ? 13.717  10.651  -4.805   1.00 25.47  ? 616  VAL C CA    1 
ATOM   8028  C  C     . VAL C 2  616  ? 14.492  11.847  -4.246   1.00 26.54  ? 616  VAL C C     1 
ATOM   8029  O  O     . VAL C 2  616  ? 14.996  11.794  -3.124   1.00 28.06  ? 616  VAL C O     1 
ATOM   8030  C  CB    . VAL C 2  616  ? 12.343  10.572  -4.105   1.00 27.42  ? 616  VAL C CB    1 
ATOM   8031  C  CG1   . VAL C 2  616  ? 11.603  11.905  -4.192   1.00 26.88  ? 616  VAL C CG1   1 
ATOM   8032  C  CG2   . VAL C 2  616  ? 11.518  9.455   -4.706   1.00 30.45  ? 616  VAL C CG2   1 
ATOM   8033  N  N     . PRO C 2  617  ? 14.585  12.933  -5.031   1.00 25.22  ? 617  PRO C N     1 
ATOM   8034  C  CA    . PRO C 2  617  ? 15.237  14.171  -4.590   1.00 25.44  ? 617  PRO C CA    1 
ATOM   8035  C  C     . PRO C 2  617  ? 14.586  14.787  -3.358   1.00 26.82  ? 617  PRO C C     1 
ATOM   8036  O  O     . PRO C 2  617  ? 13.370  14.962  -3.318   1.00 26.93  ? 617  PRO C O     1 
ATOM   8037  C  CB    . PRO C 2  617  ? 15.086  15.096  -5.800   1.00 26.59  ? 617  PRO C CB    1 
ATOM   8038  C  CG    . PRO C 2  617  ? 13.955  14.523  -6.587   1.00 26.55  ? 617  PRO C CG    1 
ATOM   8039  C  CD    . PRO C 2  617  ? 14.078  13.045  -6.409   1.00 25.75  ? 617  PRO C CD    1 
ATOM   8040  N  N     . LEU C 2  618  ? 15.407  15.122  -2.371   1.00 27.55  ? 618  LEU C N     1 
ATOM   8041  C  CA    . LEU C 2  618  ? 14.923  15.680  -1.117   1.00 31.42  ? 618  LEU C CA    1 
ATOM   8042  C  C     . LEU C 2  618  ? 15.007  17.207  -1.133   1.00 35.27  ? 618  LEU C C     1 
ATOM   8043  O  O     . LEU C 2  618  ? 15.458  17.792  -2.118   1.00 38.18  ? 618  LEU C O     1 
ATOM   8044  C  CB    . LEU C 2  618  ? 15.729  15.104  0.047    1.00 34.24  ? 618  LEU C CB    1 
ATOM   8045  C  CG    . LEU C 2  618  ? 16.003  13.600  -0.045   1.00 33.21  ? 618  LEU C CG    1 
ATOM   8046  C  CD1   . LEU C 2  618  ? 16.946  13.138  1.055    1.00 34.44  ? 618  LEU C CD1   1 
ATOM   8047  C  CD2   . LEU C 2  618  ? 14.707  12.817  0.007    1.00 30.34  ? 618  LEU C CD2   1 
ATOM   8048  N  N     . VAL C 2  619  ? 14.571  17.847  -0.049   1.00 37.66  ? 619  VAL C N     1 
ATOM   8049  C  CA    . VAL C 2  619  ? 14.594  19.306  0.048    1.00 39.32  ? 619  VAL C CA    1 
ATOM   8050  C  C     . VAL C 2  619  ? 16.020  19.821  -0.073   1.00 38.85  ? 619  VAL C C     1 
ATOM   8051  O  O     . VAL C 2  619  ? 16.291  20.771  -0.808   1.00 37.16  ? 619  VAL C O     1 
ATOM   8052  C  CB    . VAL C 2  619  ? 13.987  19.804  1.373    1.00 39.56  ? 619  VAL C CB    1 
ATOM   8053  C  CG1   . VAL C 2  619  ? 13.861  21.318  1.361    1.00 34.65  ? 619  VAL C CG1   1 
ATOM   8054  C  CG2   . VAL C 2  619  ? 12.633  19.166  1.605    1.00 37.89  ? 619  VAL C CG2   1 
ATOM   8055  N  N     . ARG C 2  620  ? 16.928  19.191  0.663    1.00 41.01  ? 620  ARG C N     1 
ATOM   8056  C  CA    . ARG C 2  620  ? 18.354  19.400  0.450    1.00 46.63  ? 620  ARG C CA    1 
ATOM   8057  C  C     . ARG C 2  620  ? 19.082  18.067  0.586    1.00 44.00  ? 620  ARG C C     1 
ATOM   8058  O  O     . ARG C 2  620  ? 18.701  17.217  1.390    1.00 40.25  ? 620  ARG C O     1 
ATOM   8059  C  CB    . ARG C 2  620  ? 18.923  20.440  1.418    1.00 62.40  ? 620  ARG C CB    1 
ATOM   8060  C  CG    . ARG C 2  620  ? 18.973  20.035  2.883    1.00 70.35  ? 620  ARG C CG    1 
ATOM   8061  C  CD    . ARG C 2  620  ? 19.633  21.148  3.693    1.00 85.38  ? 620  ARG C CD    1 
ATOM   8062  N  NE    . ARG C 2  620  ? 19.811  20.814  5.104    1.00 96.43  ? 620  ARG C NE    1 
ATOM   8063  C  CZ    . ARG C 2  620  ? 20.389  21.621  5.991    1.00 98.59  ? 620  ARG C CZ    1 
ATOM   8064  N  NH1   . ARG C 2  620  ? 20.514  21.243  7.258    1.00 98.97  ? 620  ARG C NH1   1 
ATOM   8065  N  NH2   . ARG C 2  620  ? 20.847  22.810  5.611    1.00 99.25  ? 620  ARG C NH2   1 
ATOM   8066  N  N     . SER C 2  621  ? 20.133  17.897  -0.210   1.00 40.10  ? 621  SER C N     1 
ATOM   8067  C  CA    . SER C 2  621  ? 20.786  16.603  -0.376   1.00 33.85  ? 621  SER C CA    1 
ATOM   8068  C  C     . SER C 2  621  ? 22.097  16.478  0.405    1.00 32.20  ? 621  SER C C     1 
ATOM   8069  O  O     . SER C 2  621  ? 22.949  17.364  0.350    1.00 30.63  ? 621  SER C O     1 
ATOM   8070  C  CB    . SER C 2  621  ? 21.048  16.354  -1.865   1.00 32.43  ? 621  SER C CB    1 
ATOM   8071  O  OG    . SER C 2  621  ? 20.281  17.230  -2.678   1.00 27.73  ? 621  SER C OG    1 
ATOM   8072  N  N     . GLU C 2  622  ? 22.252  15.374  1.133    1.00 33.36  ? 622  GLU C N     1 
ATOM   8073  C  CA    . GLU C 2  622  ? 23.503  15.076  1.831    1.00 34.75  ? 622  GLU C CA    1 
ATOM   8074  C  C     . GLU C 2  622  ? 24.304  14.019  1.072    1.00 35.14  ? 622  GLU C C     1 
ATOM   8075  O  O     . GLU C 2  622  ? 23.754  13.010  0.625    1.00 32.30  ? 622  GLU C O     1 
ATOM   8076  C  CB    . GLU C 2  622  ? 23.240  14.589  3.261    1.00 39.03  ? 622  GLU C CB    1 
ATOM   8077  C  CG    . GLU C 2  622  ? 22.775  15.666  4.236    1.00 44.35  ? 622  GLU C CG    1 
ATOM   8078  C  CD    . GLU C 2  622  ? 22.629  15.149  5.668    1.00 50.16  ? 622  GLU C CD    1 
ATOM   8079  O  OE1   . GLU C 2  622  ? 22.925  13.959  5.915    1.00 38.82  ? 622  GLU C OE1   1 
ATOM   8080  O  OE2   . GLU C 2  622  ? 22.213  15.935  6.547    1.00 64.45  ? 622  GLU C OE2   1 
ATOM   8081  N  N     . ALA C 2  623  ? 25.604  14.251  0.929    1.00 36.40  ? 623  ALA C N     1 
ATOM   8082  C  CA    . ALA C 2  623  ? 26.492  13.273  0.310    1.00 31.51  ? 623  ALA C CA    1 
ATOM   8083  C  C     . ALA C 2  623  ? 26.747  12.105  1.257    1.00 28.27  ? 623  ALA C C     1 
ATOM   8084  O  O     . ALA C 2  623  ? 26.946  12.305  2.452    1.00 27.32  ? 623  ALA C O     1 
ATOM   8085  C  CB    . ALA C 2  623  ? 27.808  13.927  -0.093   1.00 32.93  ? 623  ALA C CB    1 
ATOM   8086  N  N     . PRO C 2  624  ? 26.745  10.876  0.723    1.00 29.35  ? 624  PRO C N     1 
ATOM   8087  C  CA    . PRO C 2  624  ? 26.997  9.686   1.542    1.00 29.15  ? 624  PRO C CA    1 
ATOM   8088  C  C     . PRO C 2  624  ? 28.378  9.703   2.191    1.00 31.21  ? 624  PRO C C     1 
ATOM   8089  O  O     . PRO C 2  624  ? 29.374  9.903   1.495    1.00 31.66  ? 624  PRO C O     1 
ATOM   8090  C  CB    . PRO C 2  624  ? 26.879  8.533   0.535    1.00 28.38  ? 624  PRO C CB    1 
ATOM   8091  C  CG    . PRO C 2  624  ? 27.066  9.163   -0.808   1.00 26.30  ? 624  PRO C CG    1 
ATOM   8092  C  CD    . PRO C 2  624  ? 26.472  10.530  -0.681   1.00 27.18  ? 624  PRO C CD    1 
ATOM   8093  N  N     . LEU C 2  625  ? 28.426  9.501   3.507    1.00 32.52  ? 625  LEU C N     1 
ATOM   8094  C  CA    . LEU C 2  625  ? 29.691  9.439   4.239    1.00 29.27  ? 625  LEU C CA    1 
ATOM   8095  C  C     . LEU C 2  625  ? 30.605  8.377   3.640    1.00 30.50  ? 625  LEU C C     1 
ATOM   8096  O  O     . LEU C 2  625  ? 31.767  8.644   3.335    1.00 30.57  ? 625  LEU C O     1 
ATOM   8097  C  CB    . LEU C 2  625  ? 29.449  9.155   5.726    1.00 26.52  ? 625  LEU C CB    1 
ATOM   8098  C  CG    . LEU C 2  625  ? 29.298  10.373  6.641    1.00 27.61  ? 625  LEU C CG    1 
ATOM   8099  C  CD1   . LEU C 2  625  ? 28.755  9.961   7.997    1.00 30.06  ? 625  LEU C CD1   1 
ATOM   8100  C  CD2   . LEU C 2  625  ? 30.627  11.093  6.800    1.00 29.46  ? 625  LEU C CD2   1 
ATOM   8101  N  N     . VAL C 2  626  ? 30.070  7.175   3.464    1.00 29.47  ? 626  VAL C N     1 
ATOM   8102  C  CA    . VAL C 2  626  ? 30.800  6.107   2.796    1.00 29.17  ? 626  VAL C CA    1 
ATOM   8103  C  C     . VAL C 2  626  ? 30.560  6.161   1.292    1.00 30.34  ? 626  VAL C C     1 
ATOM   8104  O  O     . VAL C 2  626  ? 29.423  6.065   0.834    1.00 32.39  ? 626  VAL C O     1 
ATOM   8105  C  CB    . VAL C 2  626  ? 30.391  4.726   3.325    1.00 27.87  ? 626  VAL C CB    1 
ATOM   8106  C  CG1   . VAL C 2  626  ? 31.104  3.630   2.550    1.00 25.23  ? 626  VAL C CG1   1 
ATOM   8107  C  CG2   . VAL C 2  626  ? 30.691  4.619   4.811    1.00 30.31  ? 626  VAL C CG2   1 
ATOM   8108  N  N     . GLY C 2  627  ? 31.635  6.321   0.527    1.00 31.54  ? 627  GLY C N     1 
ATOM   8109  C  CA    . GLY C 2  627  ? 31.533  6.390   -0.918   1.00 32.52  ? 627  GLY C CA    1 
ATOM   8110  C  C     . GLY C 2  627  ? 32.289  5.269   -1.602   1.00 31.67  ? 627  GLY C C     1 
ATOM   8111  O  O     . GLY C 2  627  ? 32.871  4.411   -0.940   1.00 30.82  ? 627  GLY C O     1 
ATOM   8112  N  N     . THR C 2  628  ? 32.268  5.273   -2.932   1.00 30.84  ? 628  THR C N     1 
ATOM   8113  C  CA    . THR C 2  628  ? 32.976  4.272   -3.723   1.00 31.77  ? 628  THR C CA    1 
ATOM   8114  C  C     . THR C 2  628  ? 33.841  4.937   -4.788   1.00 33.08  ? 628  THR C C     1 
ATOM   8115  O  O     . THR C 2  628  ? 34.561  4.267   -5.530   1.00 34.31  ? 628  THR C O     1 
ATOM   8116  C  CB    . THR C 2  628  ? 32.008  3.298   -4.414   1.00 31.18  ? 628  THR C CB    1 
ATOM   8117  O  OG1   . THR C 2  628  ? 31.365  3.958   -5.511   1.00 32.48  ? 628  THR C OG1   1 
ATOM   8118  C  CG2   . THR C 2  628  ? 30.954  2.796   -3.438   1.00 31.61  ? 628  THR C CG2   1 
ATOM   8119  N  N     . GLY C 2  629  ? 33.757  6.261   -4.862   1.00 36.91  ? 629  GLY C N     1 
ATOM   8120  C  CA    . GLY C 2  629  ? 34.522  7.021   -5.834   1.00 40.21  ? 629  GLY C CA    1 
ATOM   8121  C  C     . GLY C 2  629  ? 33.735  7.327   -7.097   1.00 39.81  ? 629  GLY C C     1 
ATOM   8122  O  O     . GLY C 2  629  ? 33.981  8.330   -7.769   1.00 49.73  ? 629  GLY C O     1 
ATOM   8123  N  N     . MET C 2  630  ? 32.776  6.463   -7.415   1.00 35.13  ? 630  MET C N     1 
ATOM   8124  C  CA    . MET C 2  630  ? 31.970  6.605   -8.626   1.00 32.63  ? 630  MET C CA    1 
ATOM   8125  C  C     . MET C 2  630  ? 31.000  7.782   -8.535   1.00 30.64  ? 630  MET C C     1 
ATOM   8126  O  O     . MET C 2  630  ? 30.553  8.311   -9.554   1.00 30.19  ? 630  MET C O     1 
ATOM   8127  C  CB    . MET C 2  630  ? 31.201  5.310   -8.896   1.00 32.39  ? 630  MET C CB    1 
ATOM   8128  C  CG    . MET C 2  630  ? 30.363  5.322   -10.158  1.00 30.84  ? 630  MET C CG    1 
ATOM   8129  S  SD    . MET C 2  630  ? 31.351  5.653   -11.624  1.00 31.23  ? 630  MET C SD    1 
ATOM   8130  C  CE    . MET C 2  630  ? 32.507  4.287   -11.554  1.00 33.76  ? 630  MET C CE    1 
ATOM   8131  N  N     . GLU C 2  631  ? 30.696  8.191   -7.307   1.00 32.07  ? 631  GLU C N     1 
ATOM   8132  C  CA    . GLU C 2  631  ? 29.710  9.237   -7.036   1.00 32.30  ? 631  GLU C CA    1 
ATOM   8133  C  C     . GLU C 2  631  ? 29.981  10.535  -7.793   1.00 32.89  ? 631  GLU C C     1 
ATOM   8134  O  O     . GLU C 2  631  ? 29.051  11.236  -8.193   1.00 32.38  ? 631  GLU C O     1 
ATOM   8135  C  CB    . GLU C 2  631  ? 29.654  9.536   -5.535   1.00 31.98  ? 631  GLU C CB    1 
ATOM   8136  C  CG    . GLU C 2  631  ? 29.300  8.340   -4.662   1.00 32.87  ? 631  GLU C CG    1 
ATOM   8137  C  CD    . GLU C 2  631  ? 30.496  7.454   -4.369   1.00 34.93  ? 631  GLU C CD    1 
ATOM   8138  O  OE1   . GLU C 2  631  ? 31.641  7.915   -4.562   1.00 34.95  ? 631  GLU C OE1   1 
ATOM   8139  O  OE2   . GLU C 2  631  ? 30.292  6.293   -3.954   1.00 34.86  ? 631  GLU C OE2   1 
ATOM   8140  N  N     . LEU C 2  632  ? 31.257  10.846  -7.991   1.00 37.78  ? 632  LEU C N     1 
ATOM   8141  C  CA    . LEU C 2  632  ? 31.647  12.092  -8.640   1.00 35.82  ? 632  LEU C CA    1 
ATOM   8142  C  C     . LEU C 2  632  ? 31.297  12.108  -10.123  1.00 33.67  ? 632  LEU C C     1 
ATOM   8143  O  O     . LEU C 2  632  ? 30.430  12.869  -10.554  1.00 31.31  ? 632  LEU C O     1 
ATOM   8144  C  CB    . LEU C 2  632  ? 33.145  12.332  -8.466   1.00 36.49  ? 632  LEU C CB    1 
ATOM   8145  C  CG    . LEU C 2  632  ? 33.686  13.516  -9.266   1.00 42.39  ? 632  LEU C CG    1 
ATOM   8146  C  CD1   . LEU C 2  632  ? 33.015  14.822  -8.847   1.00 37.95  ? 632  LEU C CD1   1 
ATOM   8147  C  CD2   . LEU C 2  632  ? 35.196  13.605  -9.128   1.00 61.26  ? 632  LEU C CD2   1 
ATOM   8148  N  N     . ARG C 2  633  ? 31.985  11.268  -10.892  1.00 32.54  ? 633  ARG C N     1 
ATOM   8149  C  CA    . ARG C 2  633  ? 31.824  11.207  -12.343  1.00 30.54  ? 633  ARG C CA    1 
ATOM   8150  C  C     . ARG C 2  633  ? 30.376  10.991  -12.772  1.00 30.49  ? 633  ARG C C     1 
ATOM   8151  O  O     . ARG C 2  633  ? 29.951  11.477  -13.821  1.00 32.52  ? 633  ARG C O     1 
ATOM   8152  C  CB    . ARG C 2  633  ? 32.698  10.094  -12.923  1.00 30.75  ? 633  ARG C CB    1 
ATOM   8153  C  CG    . ARG C 2  633  ? 34.167  10.450  -13.022  1.00 35.22  ? 633  ARG C CG    1 
ATOM   8154  C  CD    . ARG C 2  633  ? 34.380  11.631  -13.953  1.00 35.07  ? 633  ARG C CD    1 
ATOM   8155  N  NE    . ARG C 2  633  ? 33.748  11.429  -15.254  1.00 34.64  ? 633  ARG C NE    1 
ATOM   8156  C  CZ    . ARG C 2  633  ? 34.332  10.829  -16.285  1.00 34.16  ? 633  ARG C CZ    1 
ATOM   8157  N  NH1   . ARG C 2  633  ? 35.569  10.363  -16.171  1.00 33.85  ? 633  ARG C NH1   1 
ATOM   8158  N  NH2   . ARG C 2  633  ? 33.679  10.692  -17.431  1.00 31.51  ? 633  ARG C NH2   1 
ATOM   8159  N  N     . ALA C 2  634  ? 29.623  10.258  -11.962  1.00 28.45  ? 634  ALA C N     1 
ATOM   8160  C  CA    . ALA C 2  634  ? 28.223  9.999   -12.261  1.00 25.93  ? 634  ALA C CA    1 
ATOM   8161  C  C     . ALA C 2  634  ? 27.427  11.297  -12.273  1.00 25.48  ? 634  ALA C C     1 
ATOM   8162  O  O     . ALA C 2  634  ? 26.666  11.564  -13.202  1.00 24.57  ? 634  ALA C O     1 
ATOM   8163  C  CB    . ALA C 2  634  ? 27.636  9.024   -11.250  1.00 27.79  ? 634  ALA C CB    1 
ATOM   8164  N  N     . ALA C 2  635  ? 27.618  12.098  -11.230  1.00 26.66  ? 635  ALA C N     1 
ATOM   8165  C  CA    . ALA C 2  635  ? 26.876  13.340  -11.053  1.00 27.37  ? 635  ALA C CA    1 
ATOM   8166  C  C     . ALA C 2  635  ? 27.121  14.313  -12.202  1.00 28.26  ? 635  ALA C C     1 
ATOM   8167  O  O     . ALA C 2  635  ? 26.212  15.025  -12.627  1.00 28.29  ? 635  ALA C O     1 
ATOM   8168  C  CB    . ALA C 2  635  ? 27.247  13.985  -9.725   1.00 27.81  ? 635  ALA C CB    1 
ATOM   8169  N  N     . ILE C 2  636  ? 28.356  14.333  -12.694  1.00 29.39  ? 636  ILE C N     1 
ATOM   8170  C  CA    . ILE C 2  636  ? 28.756  15.210  -13.788  1.00 29.49  ? 636  ILE C CA    1 
ATOM   8171  C  C     . ILE C 2  636  ? 28.189  14.742  -15.126  1.00 28.78  ? 636  ILE C C     1 
ATOM   8172  O  O     . ILE C 2  636  ? 27.533  15.505  -15.835  1.00 29.31  ? 636  ILE C O     1 
ATOM   8173  C  CB    . ILE C 2  636  ? 30.295  15.296  -13.892  1.00 30.74  ? 636  ILE C CB    1 
ATOM   8174  C  CG1   . ILE C 2  636  ? 30.896  15.779  -12.569  1.00 31.57  ? 636  ILE C CG1   1 
ATOM   8175  C  CG2   . ILE C 2  636  ? 30.714  16.209  -15.032  1.00 31.42  ? 636  ILE C CG2   1 
ATOM   8176  C  CD1   . ILE C 2  636  ? 32.413  15.849  -12.578  1.00 29.20  ? 636  ILE C CD1   1 
ATOM   8177  N  N     . ASP C 2  637  ? 28.436  13.479  -15.460  1.00 29.47  ? 637  ASP C N     1 
ATOM   8178  C  CA    . ASP C 2  637  ? 27.998  12.913  -16.734  1.00 31.20  ? 637  ASP C CA    1 
ATOM   8179  C  C     . ASP C 2  637  ? 26.479  12.862  -16.856  1.00 27.85  ? 637  ASP C C     1 
ATOM   8180  O  O     . ASP C 2  637  ? 25.942  12.782  -17.959  1.00 25.96  ? 637  ASP C O     1 
ATOM   8181  C  CB    . ASP C 2  637  ? 28.579  11.507  -16.922  1.00 35.67  ? 637  ASP C CB    1 
ATOM   8182  C  CG    . ASP C 2  637  ? 30.092  11.515  -17.133  1.00 38.84  ? 637  ASP C CG    1 
ATOM   8183  O  OD1   . ASP C 2  637  ? 30.782  12.360  -16.516  1.00 37.93  ? 637  ASP C OD1   1 
ATOM   8184  O  OD2   . ASP C 2  637  ? 30.586  10.672  -17.919  1.00 35.38  ? 637  ASP C OD2   1 
ATOM   8185  N  N     . ALA C 2  638  ? 25.794  12.908  -15.717  1.00 28.24  ? 638  ALA C N     1 
ATOM   8186  C  CA    . ALA C 2  638  ? 24.334  12.866  -15.688  1.00 30.31  ? 638  ALA C CA    1 
ATOM   8187  C  C     . ALA C 2  638  ? 23.712  14.006  -16.492  1.00 33.38  ? 638  ALA C C     1 
ATOM   8188  O  O     . ALA C 2  638  ? 22.609  13.870  -17.025  1.00 34.77  ? 638  ALA C O     1 
ATOM   8189  C  CB    . ALA C 2  638  ? 23.835  12.904  -14.255  1.00 30.91  ? 638  ALA C CB    1 
ATOM   8190  N  N     . GLY C 2  639  ? 24.424  15.127  -16.568  1.00 35.07  ? 639  GLY C N     1 
ATOM   8191  C  CA    . GLY C 2  639  ? 23.977  16.276  -17.336  1.00 34.48  ? 639  GLY C CA    1 
ATOM   8192  C  C     . GLY C 2  639  ? 22.893  17.068  -16.634  1.00 35.91  ? 639  GLY C C     1 
ATOM   8193  O  O     . GLY C 2  639  ? 22.358  18.034  -17.179  1.00 34.46  ? 639  GLY C O     1 
ATOM   8194  N  N     . ASP C 2  640  ? 22.568  16.654  -15.415  1.00 37.63  ? 640  ASP C N     1 
ATOM   8195  C  CA    . ASP C 2  640  ? 21.544  17.327  -14.633  1.00 39.95  ? 640  ASP C CA    1 
ATOM   8196  C  C     . ASP C 2  640  ? 22.191  18.195  -13.562  1.00 35.69  ? 640  ASP C C     1 
ATOM   8197  O  O     . ASP C 2  640  ? 21.513  18.738  -12.691  1.00 35.29  ? 640  ASP C O     1 
ATOM   8198  C  CB    . ASP C 2  640  ? 20.583  16.307  -14.018  1.00 50.27  ? 640  ASP C CB    1 
ATOM   8199  C  CG    . ASP C 2  640  ? 19.672  15.661  -15.057  1.00 59.40  ? 640  ASP C CG    1 
ATOM   8200  O  OD1   . ASP C 2  640  ? 20.108  15.519  -16.223  1.00 53.55  ? 640  ASP C OD1   1 
ATOM   8201  O  OD2   . ASP C 2  640  ? 18.521  15.309  -14.708  1.00 62.50  ? 640  ASP C OD2   1 
ATOM   8202  N  N     . VAL C 2  641  ? 23.512  18.313  -13.637  1.00 34.80  ? 641  VAL C N     1 
ATOM   8203  C  CA    . VAL C 2  641  ? 24.241  19.322  -12.881  1.00 34.84  ? 641  VAL C CA    1 
ATOM   8204  C  C     . VAL C 2  641  ? 24.850  20.301  -13.885  1.00 35.20  ? 641  VAL C C     1 
ATOM   8205  O  O     . VAL C 2  641  ? 24.868  20.021  -15.084  1.00 35.80  ? 641  VAL C O     1 
ATOM   8206  C  CB    . VAL C 2  641  ? 25.332  18.704  -11.993  1.00 33.96  ? 641  VAL C CB    1 
ATOM   8207  C  CG1   . VAL C 2  641  ? 24.744  17.596  -11.136  1.00 33.56  ? 641  VAL C CG1   1 
ATOM   8208  C  CG2   . VAL C 2  641  ? 26.474  18.174  -12.840  1.00 30.55  ? 641  VAL C CG2   1 
ATOM   8209  N  N     . VAL C 2  642  ? 25.333  21.448  -13.414  1.00 36.43  ? 642  VAL C N     1 
ATOM   8210  C  CA    . VAL C 2  642  ? 25.862  22.473  -14.320  1.00 34.22  ? 642  VAL C CA    1 
ATOM   8211  C  C     . VAL C 2  642  ? 27.390  22.594  -14.246  1.00 34.47  ? 642  VAL C C     1 
ATOM   8212  O  O     . VAL C 2  642  ? 27.955  22.947  -13.209  1.00 32.71  ? 642  VAL C O     1 
ATOM   8213  C  CB    . VAL C 2  642  ? 25.230  23.852  -14.038  1.00 34.36  ? 642  VAL C CB    1 
ATOM   8214  C  CG1   . VAL C 2  642  ? 25.757  24.894  -15.016  1.00 34.81  ? 642  VAL C CG1   1 
ATOM   8215  C  CG2   . VAL C 2  642  ? 23.715  23.769  -14.114  1.00 32.14  ? 642  VAL C CG2   1 
ATOM   8216  N  N     . VAL C 2  643  ? 28.045  22.304  -15.368  1.00 35.49  ? 643  VAL C N     1 
ATOM   8217  C  CA    . VAL C 2  643  ? 29.503  22.297  -15.456  1.00 33.63  ? 643  VAL C CA    1 
ATOM   8218  C  C     . VAL C 2  643  ? 30.006  23.545  -16.178  1.00 33.84  ? 643  VAL C C     1 
ATOM   8219  O  O     . VAL C 2  643  ? 29.305  24.098  -17.021  1.00 36.07  ? 643  VAL C O     1 
ATOM   8220  C  CB    . VAL C 2  643  ? 30.005  21.038  -16.197  1.00 34.33  ? 643  VAL C CB    1 
ATOM   8221  C  CG1   . VAL C 2  643  ? 31.490  20.827  -15.964  1.00 34.55  ? 643  VAL C CG1   1 
ATOM   8222  C  CG2   . VAL C 2  643  ? 29.227  19.815  -15.748  1.00 35.17  ? 643  VAL C CG2   1 
ATOM   8223  N  N     . ALA C 2  644  ? 31.214  23.993  -15.848  1.00 32.91  ? 644  ALA C N     1 
ATOM   8224  C  CA    . ALA C 2  644  ? 31.801  25.150  -16.517  1.00 35.95  ? 644  ALA C CA    1 
ATOM   8225  C  C     . ALA C 2  644  ? 32.449  24.760  -17.844  1.00 38.21  ? 644  ALA C C     1 
ATOM   8226  O  O     . ALA C 2  644  ? 33.319  23.891  -17.886  1.00 38.75  ? 644  ALA C O     1 
ATOM   8227  C  CB    . ALA C 2  644  ? 32.818  25.820  -15.613  1.00 34.70  ? 644  ALA C CB    1 
ATOM   8228  N  N     . GLU C 2  645  ? 32.024  25.401  -18.928  1.00 40.23  ? 645  GLU C N     1 
ATOM   8229  C  CA    . GLU C 2  645  ? 32.601  25.123  -20.238  1.00 42.79  ? 645  GLU C CA    1 
ATOM   8230  C  C     . GLU C 2  645  ? 34.052  25.564  -20.285  1.00 43.13  ? 645  GLU C C     1 
ATOM   8231  O  O     . GLU C 2  645  ? 34.958  24.743  -20.398  1.00 43.21  ? 645  GLU C O     1 
ATOM   8232  C  CB    . GLU C 2  645  ? 31.812  25.819  -21.344  1.00 45.49  ? 645  GLU C CB    1 
ATOM   8233  C  CG    . GLU C 2  645  ? 30.408  25.293  -21.525  1.00 53.65  ? 645  GLU C CG    1 
ATOM   8234  C  CD    . GLU C 2  645  ? 29.799  25.729  -22.839  1.00 56.65  ? 645  GLU C CD    1 
ATOM   8235  O  OE1   . GLU C 2  645  ? 30.558  26.191  -23.716  1.00 62.53  ? 645  GLU C OE1   1 
ATOM   8236  O  OE2   . GLU C 2  645  ? 28.565  25.612  -22.992  1.00 59.84  ? 645  GLU C OE2   1 
ATOM   8237  N  N     . GLU C 2  646  ? 34.258  26.872  -20.193  1.00 44.53  ? 646  GLU C N     1 
ATOM   8238  C  CA    . GLU C 2  646  ? 35.596  27.445  -20.197  1.00 47.07  ? 646  GLU C CA    1 
ATOM   8239  C  C     . GLU C 2  646  ? 35.906  28.056  -18.832  1.00 43.68  ? 646  GLU C C     1 
ATOM   8240  O  O     . GLU C 2  646  ? 34.998  28.482  -18.121  1.00 45.86  ? 646  GLU C O     1 
ATOM   8241  C  CB    . GLU C 2  646  ? 35.720  28.495  -21.304  1.00 58.29  ? 646  GLU C CB    1 
ATOM   8242  C  CG    . GLU C 2  646  ? 35.244  28.009  -22.669  1.00 67.88  ? 646  GLU C CG    1 
ATOM   8243  C  CD    . GLU C 2  646  ? 35.109  29.133  -23.686  1.00 82.30  ? 646  GLU C CD    1 
ATOM   8244  O  OE1   . GLU C 2  646  ? 35.578  30.258  -23.406  1.00 76.00  ? 646  GLU C OE1   1 
ATOM   8245  O  OE2   . GLU C 2  646  ? 34.527  28.890  -24.766  1.00 87.65  ? 646  GLU C OE2   1 
ATOM   8246  N  N     . SER C 2  647  ? 37.186  28.086  -18.467  1.00 40.89  ? 647  SER C N     1 
ATOM   8247  C  CA    . SER C 2  647  ? 37.615  28.639  -17.182  1.00 38.96  ? 647  SER C CA    1 
ATOM   8248  C  C     . SER C 2  647  ? 37.324  30.135  -17.070  1.00 37.36  ? 647  SER C C     1 
ATOM   8249  O  O     . SER C 2  647  ? 37.201  30.832  -18.078  1.00 37.06  ? 647  SER C O     1 
ATOM   8250  C  CB    . SER C 2  647  ? 39.111  28.389  -16.968  1.00 39.85  ? 647  SER C CB    1 
ATOM   8251  O  OG    . SER C 2  647  ? 39.406  27.004  -16.903  1.00 42.09  ? 647  SER C OG    1 
ATOM   8252  N  N     . GLY C 2  648  ? 37.215  30.621  -15.837  1.00 33.10  ? 648  GLY C N     1 
ATOM   8253  C  CA    . GLY C 2  648  ? 36.959  32.028  -15.589  1.00 31.61  ? 648  GLY C CA    1 
ATOM   8254  C  C     . GLY C 2  648  ? 36.716  32.342  -14.125  1.00 31.08  ? 648  GLY C C     1 
ATOM   8255  O  O     . GLY C 2  648  ? 37.331  31.744  -13.242  1.00 33.57  ? 648  GLY C O     1 
ATOM   8256  N  N     . VAL C 2  649  ? 35.813  33.283  -13.867  1.00 36.05  ? 649  VAL C N     1 
ATOM   8257  C  CA    . VAL C 2  649  ? 35.506  33.693  -12.503  1.00 40.02  ? 649  VAL C CA    1 
ATOM   8258  C  C     . VAL C 2  649  ? 34.061  34.202  -12.408  1.00 42.38  ? 649  VAL C C     1 
ATOM   8259  O  O     . VAL C 2  649  ? 33.562  34.869  -13.318  1.00 43.54  ? 649  VAL C O     1 
ATOM   8260  C  CB    . VAL C 2  649  ? 36.499  34.776  -12.014  1.00 38.48  ? 649  VAL C CB    1 
ATOM   8261  C  CG1   . VAL C 2  649  ? 36.551  35.949  -12.995  1.00 41.76  ? 649  VAL C CG1   1 
ATOM   8262  C  CG2   . VAL C 2  649  ? 36.154  35.241  -10.605  1.00 39.89  ? 649  VAL C CG2   1 
ATOM   8263  N  N     . ILE C 2  650  ? 33.388  33.869  -11.311  1.00 38.71  ? 650  ILE C N     1 
ATOM   8264  C  CA    . ILE C 2  650  ? 31.985  34.227  -11.131  1.00 37.47  ? 650  ILE C CA    1 
ATOM   8265  C  C     . ILE C 2  650  ? 31.811  35.740  -11.063  1.00 39.49  ? 650  ILE C C     1 
ATOM   8266  O  O     . ILE C 2  650  ? 32.202  36.370  -10.081  1.00 40.89  ? 650  ILE C O     1 
ATOM   8267  C  CB    . ILE C 2  650  ? 31.400  33.589  -9.856   1.00 37.70  ? 650  ILE C CB    1 
ATOM   8268  C  CG1   . ILE C 2  650  ? 31.788  32.110  -9.774   1.00 40.25  ? 650  ILE C CG1   1 
ATOM   8269  C  CG2   . ILE C 2  650  ? 29.887  33.772  -9.809   1.00 36.30  ? 650  ILE C CG2   1 
ATOM   8270  C  CD1   . ILE C 2  650  ? 31.427  31.310  -11.015  1.00 39.74  ? 650  ILE C CD1   1 
ATOM   8271  N  N     . GLU C 2  651  ? 31.223  36.314  -12.112  1.00 42.30  ? 651  GLU C N     1 
ATOM   8272  C  CA    . GLU C 2  651  ? 31.026  37.761  -12.205  1.00 45.90  ? 651  GLU C CA    1 
ATOM   8273  C  C     . GLU C 2  651  ? 29.774  38.199  -11.441  1.00 46.80  ? 651  GLU C C     1 
ATOM   8274  O  O     . GLU C 2  651  ? 29.768  39.241  -10.783  1.00 52.99  ? 651  GLU C O     1 
ATOM   8275  C  CB    . GLU C 2  651  ? 30.934  38.193  -13.675  1.00 47.32  ? 651  GLU C CB    1 
ATOM   8276  C  CG    . GLU C 2  651  ? 30.874  39.699  -13.903  1.00 44.97  ? 651  GLU C CG    1 
ATOM   8277  C  CD    . GLU C 2  651  ? 30.877  40.080  -15.377  1.00 45.33  ? 651  GLU C CD    1 
ATOM   8278  O  OE1   . GLU C 2  651  ? 31.948  40.005  -16.014  1.00 43.78  ? 651  GLU C OE1   1 
ATOM   8279  O  OE2   . GLU C 2  651  ? 29.808  40.462  -15.899  1.00 48.28  ? 651  GLU C OE2   1 
ATOM   8280  N  N     . GLU C 2  652  ? 28.715  37.400  -11.531  1.00 42.32  ? 652  GLU C N     1 
ATOM   8281  C  CA    . GLU C 2  652  ? 27.493  37.656  -10.777  1.00 41.46  ? 652  GLU C CA    1 
ATOM   8282  C  C     . GLU C 2  652  ? 26.714  36.367  -10.554  1.00 41.97  ? 652  GLU C C     1 
ATOM   8283  O  O     . GLU C 2  652  ? 26.471  35.607  -11.491  1.00 39.50  ? 652  GLU C O     1 
ATOM   8284  C  CB    . GLU C 2  652  ? 26.615  38.683  -11.493  1.00 42.40  ? 652  GLU C CB    1 
ATOM   8285  C  CG    . GLU C 2  652  ? 25.220  38.819  -10.900  1.00 48.87  ? 652  GLU C CG    1 
ATOM   8286  C  CD    . GLU C 2  652  ? 24.539  40.116  -11.294  1.00 57.38  ? 652  GLU C CD    1 
ATOM   8287  O  OE1   . GLU C 2  652  ? 25.044  41.191  -10.904  1.00 76.12  ? 652  GLU C OE1   1 
ATOM   8288  O  OE2   . GLU C 2  652  ? 23.507  40.060  -11.997  1.00 53.16  ? 652  GLU C OE2   1 
ATOM   8289  N  N     . VAL C 2  653  ? 26.322  36.126  -9.308   1.00 44.54  ? 653  VAL C N     1 
ATOM   8290  C  CA    . VAL C 2  653  ? 25.560  34.932  -8.973   1.00 41.92  ? 653  VAL C CA    1 
ATOM   8291  C  C     . VAL C 2  653  ? 24.176  35.300  -8.423   1.00 42.53  ? 653  VAL C C     1 
ATOM   8292  O  O     . VAL C 2  653  ? 24.019  36.270  -7.679   1.00 43.95  ? 653  VAL C O     1 
ATOM   8293  C  CB    . VAL C 2  653  ? 26.324  34.044  -7.951   1.00 40.75  ? 653  VAL C CB    1 
ATOM   8294  C  CG1   . VAL C 2  653  ? 26.540  34.779  -6.627   1.00 44.55  ? 653  VAL C CG1   1 
ATOM   8295  C  CG2   . VAL C 2  653  ? 25.599  32.720  -7.732   1.00 39.16  ? 653  VAL C CG2   1 
ATOM   8296  N  N     . SER C 2  654  ? 23.170  34.535  -8.832   1.00 40.87  ? 654  SER C N     1 
ATOM   8297  C  CA    . SER C 2  654  ? 21.825  34.649  -8.284   1.00 37.93  ? 654  SER C CA    1 
ATOM   8298  C  C     . SER C 2  654  ? 21.241  33.249  -8.160   1.00 40.58  ? 654  SER C C     1 
ATOM   8299  O  O     . SER C 2  654  ? 21.807  32.293  -8.689   1.00 41.35  ? 654  SER C O     1 
ATOM   8300  C  CB    . SER C 2  654  ? 20.940  35.524  -9.169   1.00 34.70  ? 654  SER C CB    1 
ATOM   8301  O  OG    . SER C 2  654  ? 19.631  35.622  -8.636   1.00 33.74  ? 654  SER C OG    1 
ATOM   8302  N  N     . ALA C 2  655  ? 20.120  33.116  -7.457   1.00 41.62  ? 655  ALA C N     1 
ATOM   8303  C  CA    . ALA C 2  655  ? 19.427  31.831  -7.387   1.00 39.93  ? 655  ALA C CA    1 
ATOM   8304  C  C     . ALA C 2  655  ? 18.866  31.496  -8.762   1.00 39.34  ? 655  ALA C C     1 
ATOM   8305  O  O     . ALA C 2  655  ? 18.637  30.329  -9.097   1.00 34.12  ? 655  ALA C O     1 
ATOM   8306  C  CB    . ALA C 2  655  ? 18.320  31.868  -6.348   1.00 38.10  ? 655  ALA C CB    1 
ATOM   8307  N  N     . ASP C 2  656  ? 18.672  32.549  -9.552   1.00 39.07  ? 656  ASP C N     1 
ATOM   8308  C  CA    . ASP C 2  656  ? 18.116  32.465  -10.895  1.00 38.48  ? 656  ASP C CA    1 
ATOM   8309  C  C     . ASP C 2  656  ? 19.158  32.048  -11.930  1.00 40.67  ? 656  ASP C C     1 
ATOM   8310  O  O     . ASP C 2  656  ? 18.932  31.112  -12.701  1.00 40.45  ? 656  ASP C O     1 
ATOM   8311  C  CB    . ASP C 2  656  ? 17.506  33.812  -11.282  1.00 37.79  ? 656  ASP C CB    1 
ATOM   8312  C  CG    . ASP C 2  656  ? 16.445  34.271  -10.298  1.00 40.81  ? 656  ASP C CG    1 
ATOM   8313  O  OD1   . ASP C 2  656  ? 15.510  33.487  -10.024  1.00 38.47  ? 656  ASP C OD1   1 
ATOM   8314  O  OD2   . ASP C 2  656  ? 16.548  35.408  -9.788   1.00 40.71  ? 656  ASP C OD2   1 
ATOM   8315  N  N     . TYR C 2  657  ? 20.298  32.737  -11.950  1.00 36.92  ? 657  TYR C N     1 
ATOM   8316  C  CA    . TYR C 2  657  ? 21.338  32.419  -12.926  1.00 36.82  ? 657  TYR C CA    1 
ATOM   8317  C  C     . TYR C 2  657  ? 22.755  32.731  -12.447  1.00 36.58  ? 657  TYR C C     1 
ATOM   8318  O  O     . TYR C 2  657  ? 22.961  33.586  -11.589  1.00 35.86  ? 657  TYR C O     1 
ATOM   8319  C  CB    . TYR C 2  657  ? 21.065  33.159  -14.243  1.00 37.07  ? 657  TYR C CB    1 
ATOM   8320  C  CG    . TYR C 2  657  ? 21.264  34.662  -14.180  1.00 43.96  ? 657  TYR C CG    1 
ATOM   8321  C  CD1   . TYR C 2  657  ? 22.503  35.228  -14.462  1.00 48.11  ? 657  TYR C CD1   1 
ATOM   8322  C  CD2   . TYR C 2  657  ? 20.216  35.519  -13.850  1.00 45.40  ? 657  TYR C CD2   1 
ATOM   8323  C  CE1   . TYR C 2  657  ? 22.700  36.597  -14.409  1.00 57.91  ? 657  TYR C CE1   1 
ATOM   8324  C  CE2   . TYR C 2  657  ? 20.408  36.900  -13.795  1.00 60.98  ? 657  TYR C CE2   1 
ATOM   8325  C  CZ    . TYR C 2  657  ? 21.654  37.430  -14.075  1.00 61.11  ? 657  TYR C CZ    1 
ATOM   8326  O  OH    . TYR C 2  657  ? 21.856  38.795  -14.022  1.00 45.11  ? 657  TYR C OH    1 
ATOM   8327  N  N     . ILE C 2  658  ? 23.724  32.025  -13.025  1.00 36.05  ? 658  ILE C N     1 
ATOM   8328  C  CA    . ILE C 2  658  ? 25.140  32.244  -12.748  1.00 36.92  ? 658  ILE C CA    1 
ATOM   8329  C  C     . ILE C 2  658  ? 25.848  32.765  -13.995  1.00 38.05  ? 658  ILE C C     1 
ATOM   8330  O  O     . ILE C 2  658  ? 25.706  32.196  -15.077  1.00 36.96  ? 658  ILE C O     1 
ATOM   8331  C  CB    . ILE C 2  658  ? 25.848  30.950  -12.285  1.00 39.12  ? 658  ILE C CB    1 
ATOM   8332  C  CG1   . ILE C 2  658  ? 25.327  30.496  -10.924  1.00 41.86  ? 658  ILE C CG1   1 
ATOM   8333  C  CG2   . ILE C 2  658  ? 27.350  31.158  -12.212  1.00 39.53  ? 658  ILE C CG2   1 
ATOM   8334  C  CD1   . ILE C 2  658  ? 26.040  29.268  -10.391  1.00 38.52  ? 658  ILE C CD1   1 
ATOM   8335  N  N     . THR C 2  659  ? 26.608  33.844  -13.838  1.00 39.36  ? 659  THR C N     1 
ATOM   8336  C  CA    . THR C 2  659  ? 27.379  34.408  -14.940  1.00 38.59  ? 659  THR C CA    1 
ATOM   8337  C  C     . THR C 2  659  ? 28.878  34.183  -14.742  1.00 38.25  ? 659  THR C C     1 
ATOM   8338  O  O     . THR C 2  659  ? 29.391  34.297  -13.629  1.00 37.67  ? 659  THR C O     1 
ATOM   8339  C  CB    . THR C 2  659  ? 27.106  35.919  -15.094  1.00 38.90  ? 659  THR C CB    1 
ATOM   8340  O  OG1   . THR C 2  659  ? 25.693  36.147  -15.166  1.00 38.73  ? 659  THR C OG1   1 
ATOM   8341  C  CG2   . THR C 2  659  ? 27.765  36.463  -16.350  1.00 44.54  ? 659  THR C CG2   1 
ATOM   8342  N  N     . VAL C 2  660  ? 29.579  33.856  -15.823  1.00 37.46  ? 660  VAL C N     1 
ATOM   8343  C  CA    . VAL C 2  660  ? 31.021  33.657  -15.749  1.00 35.70  ? 660  VAL C CA    1 
ATOM   8344  C  C     . VAL C 2  660  ? 31.748  34.473  -16.814  1.00 41.13  ? 660  VAL C C     1 
ATOM   8345  O  O     . VAL C 2  660  ? 31.499  34.314  -18.009  1.00 42.35  ? 660  VAL C O     1 
ATOM   8346  C  CB    . VAL C 2  660  ? 31.395  32.174  -15.905  1.00 31.84  ? 660  VAL C CB    1 
ATOM   8347  C  CG1   . VAL C 2  660  ? 32.892  32.019  -16.087  1.00 33.43  ? 660  VAL C CG1   1 
ATOM   8348  C  CG2   . VAL C 2  660  ? 30.928  31.387  -14.696  1.00 32.22  ? 660  VAL C CG2   1 
ATOM   8349  N  N     . MET C 2  661  ? 32.635  35.358  -16.367  1.00 42.11  ? 661  MET C N     1 
ATOM   8350  C  CA    . MET C 2  661  ? 33.501  36.116  -17.265  1.00 38.90  ? 661  MET C CA    1 
ATOM   8351  C  C     . MET C 2  661  ? 34.696  35.255  -17.656  1.00 39.82  ? 661  MET C C     1 
ATOM   8352  O  O     . MET C 2  661  ? 35.397  34.731  -16.792  1.00 37.75  ? 661  MET C O     1 
ATOM   8353  C  CB    . MET C 2  661  ? 33.967  37.418  -16.604  1.00 39.48  ? 661  MET C CB    1 
ATOM   8354  C  CG    . MET C 2  661  ? 34.848  38.317  -17.479  1.00 44.48  ? 661  MET C CG    1 
ATOM   8355  S  SD    . MET C 2  661  ? 33.936  39.322  -18.671  1.00 49.14  ? 661  MET C SD    1 
ATOM   8356  C  CE    . MET C 2  661  ? 35.199  40.476  -19.205  1.00 40.56  ? 661  MET C CE    1 
ATOM   8357  N  N     . HIS C 2  662  ? 34.919  35.104  -18.958  1.00 45.85  ? 662  HIS C N     1 
ATOM   8358  C  CA    . HIS C 2  662  ? 35.976  34.230  -19.467  1.00 46.79  ? 662  HIS C CA    1 
ATOM   8359  C  C     . HIS C 2  662  ? 37.311  34.951  -19.621  1.00 44.82  ? 662  HIS C C     1 
ATOM   8360  O  O     . HIS C 2  662  ? 37.390  36.176  -19.530  1.00 41.19  ? 662  HIS C O     1 
ATOM   8361  C  CB    . HIS C 2  662  ? 35.565  33.618  -20.813  1.00 48.56  ? 662  HIS C CB    1 
ATOM   8362  C  CG    . HIS C 2  662  ? 34.439  32.635  -20.717  1.00 49.05  ? 662  HIS C CG    1 
ATOM   8363  N  ND1   . HIS C 2  662  ? 33.452  32.539  -21.675  1.00 51.94  ? 662  HIS C ND1   1 
ATOM   8364  C  CD2   . HIS C 2  662  ? 34.148  31.698  -19.784  1.00 44.36  ? 662  HIS C CD2   1 
ATOM   8365  C  CE1   . HIS C 2  662  ? 32.600  31.592  -21.334  1.00 57.06  ? 662  HIS C CE1   1 
ATOM   8366  N  NE2   . HIS C 2  662  ? 33.000  31.063  -20.190  1.00 48.81  ? 662  HIS C NE2   1 
ATOM   8367  N  N     . ASP C 2  663  ? 38.358  34.172  -19.866  1.00 42.72  ? 663  ASP C N     1 
ATOM   8368  C  CA    . ASP C 2  663  ? 39.702  34.712  -20.011  1.00 40.38  ? 663  ASP C CA    1 
ATOM   8369  C  C     . ASP C 2  663  ? 39.839  35.559  -21.278  1.00 41.71  ? 663  ASP C C     1 
ATOM   8370  O  O     . ASP C 2  663  ? 40.518  36.583  -21.268  1.00 44.69  ? 663  ASP C O     1 
ATOM   8371  C  CB    . ASP C 2  663  ? 40.734  33.577  -20.013  1.00 38.66  ? 663  ASP C CB    1 
ATOM   8372  C  CG    . ASP C 2  663  ? 40.875  32.907  -18.651  1.00 34.66  ? 663  ASP C CG    1 
ATOM   8373  O  OD1   . ASP C 2  663  ? 40.747  33.604  -17.623  1.00 32.37  ? 663  ASP C OD1   1 
ATOM   8374  O  OD2   . ASP C 2  663  ? 41.113  31.681  -18.608  1.00 29.80  ? 663  ASP C OD2   1 
ATOM   8375  N  N     . ASN C 2  664  ? 39.183  35.143  -22.358  1.00 40.95  ? 664  ASN C N     1 
ATOM   8376  C  CA    . ASN C 2  664  ? 39.262  35.869  -23.625  1.00 42.40  ? 664  ASN C CA    1 
ATOM   8377  C  C     . ASN C 2  664  ? 38.443  37.160  -23.632  1.00 41.89  ? 664  ASN C C     1 
ATOM   8378  O  O     . ASN C 2  664  ? 38.587  37.989  -24.532  1.00 40.54  ? 664  ASN C O     1 
ATOM   8379  C  CB    . ASN C 2  664  ? 38.815  34.973  -24.786  1.00 44.19  ? 664  ASN C CB    1 
ATOM   8380  C  CG    . ASN C 2  664  ? 37.406  34.438  -24.608  1.00 44.63  ? 664  ASN C CG    1 
ATOM   8381  O  OD1   . ASN C 2  664  ? 36.678  34.851  -23.705  1.00 44.86  ? 664  ASN C OD1   1 
ATOM   8382  N  ND2   . ASN C 2  664  ? 37.016  33.509  -25.473  1.00 44.64  ? 664  ASN C ND2   1 
ATOM   8383  N  N     . GLY C 2  665  ? 37.575  37.315  -22.635  1.00 42.25  ? 665  GLY C N     1 
ATOM   8384  C  CA    . GLY C 2  665  ? 36.772  38.517  -22.495  1.00 44.87  ? 665  GLY C CA    1 
ATOM   8385  C  C     . GLY C 2  665  ? 35.281  38.324  -22.712  1.00 44.56  ? 665  GLY C C     1 
ATOM   8386  O  O     . GLY C 2  665  ? 34.481  39.200  -22.382  1.00 49.37  ? 665  GLY C O     1 
ATOM   8387  N  N     . THR C 2  666  ? 34.903  37.182  -23.272  1.00 41.82  ? 666  THR C N     1 
ATOM   8388  C  CA    . THR C 2  666  ? 33.498  36.906  -23.539  1.00 41.04  ? 666  THR C CA    1 
ATOM   8389  C  C     . THR C 2  666  ? 32.782  36.486  -22.262  1.00 40.93  ? 666  THR C C     1 
ATOM   8390  O  O     . THR C 2  666  ? 33.408  35.990  -21.328  1.00 40.34  ? 666  THR C O     1 
ATOM   8391  C  CB    . THR C 2  666  ? 33.331  35.806  -24.608  1.00 41.82  ? 666  THR C CB    1 
ATOM   8392  O  OG1   . THR C 2  666  ? 33.853  34.567  -24.114  1.00 48.50  ? 666  THR C OG1   1 
ATOM   8393  C  CG2   . THR C 2  666  ? 34.066  36.188  -25.885  1.00 43.43  ? 666  THR C CG2   1 
ATOM   8394  N  N     . ARG C 2  667  ? 31.471  36.701  -22.224  1.00 42.06  ? 667  ARG C N     1 
ATOM   8395  C  CA    . ARG C 2  667  ? 30.656  36.278  -21.093  1.00 41.94  ? 667  ARG C CA    1 
ATOM   8396  C  C     . ARG C 2  667  ? 29.684  35.182  -21.508  1.00 43.73  ? 667  ARG C C     1 
ATOM   8397  O  O     . ARG C 2  667  ? 29.022  35.283  -22.542  1.00 45.50  ? 667  ARG C O     1 
ATOM   8398  C  CB    . ARG C 2  667  ? 29.873  37.456  -20.500  1.00 38.53  ? 667  ARG C CB    1 
ATOM   8399  C  CG    . ARG C 2  667  ? 30.727  38.517  -19.840  1.00 40.96  ? 667  ARG C CG    1 
ATOM   8400  C  CD    . ARG C 2  667  ? 29.899  39.435  -18.944  1.00 39.53  ? 667  ARG C CD    1 
ATOM   8401  N  NE    . ARG C 2  667  ? 28.920  40.224  -19.689  1.00 42.48  ? 667  ARG C NE    1 
ATOM   8402  C  CZ    . ARG C 2  667  ? 28.091  41.105  -19.135  1.00 40.42  ? 667  ARG C CZ    1 
ATOM   8403  N  NH1   . ARG C 2  667  ? 28.119  41.318  -17.825  1.00 36.41  ? 667  ARG C NH1   1 
ATOM   8404  N  NH2   . ARG C 2  667  ? 27.230  41.775  -19.890  1.00 44.20  ? 667  ARG C NH2   1 
ATOM   8405  N  N     . ARG C 2  668  ? 29.605  34.131  -20.700  1.00 43.17  ? 668  ARG C N     1 
ATOM   8406  C  CA    . ARG C 2  668  ? 28.563  33.129  -20.864  1.00 43.12  ? 668  ARG C CA    1 
ATOM   8407  C  C     . ARG C 2  668  ? 27.783  32.999  -19.567  1.00 39.65  ? 668  ARG C C     1 
ATOM   8408  O  O     . ARG C 2  668  ? 28.357  32.996  -18.478  1.00 35.29  ? 668  ARG C O     1 
ATOM   8409  C  CB    . ARG C 2  668  ? 29.147  31.775  -21.278  1.00 55.84  ? 668  ARG C CB    1 
ATOM   8410  C  CG    . ARG C 2  668  ? 28.096  30.750  -21.703  1.00 54.19  ? 668  ARG C CG    1 
ATOM   8411  C  CD    . ARG C 2  668  ? 28.714  29.413  -22.098  1.00 59.96  ? 668  ARG C CD    1 
ATOM   8412  N  NE    . ARG C 2  668  ? 29.845  29.567  -23.008  1.00 75.99  ? 668  ARG C NE    1 
ATOM   8413  C  CZ    . ARG C 2  668  ? 29.734  29.806  -24.311  1.00 83.43  ? 668  ARG C CZ    1 
ATOM   8414  N  NH1   . ARG C 2  668  ? 28.534  29.928  -24.867  1.00 84.67  ? 668  ARG C NH1   1 
ATOM   8415  N  NH2   . ARG C 2  668  ? 30.825  29.928  -25.056  1.00 85.22  ? 668  ARG C NH2   1 
ATOM   8416  N  N     . THR C 2  669  ? 26.466  32.905  -19.692  1.00 37.08  ? 669  THR C N     1 
ATOM   8417  C  CA    . THR C 2  669  ? 25.605  32.787  -18.531  1.00 35.61  ? 669  THR C CA    1 
ATOM   8418  C  C     . THR C 2  669  ? 24.847  31.468  -18.571  1.00 39.68  ? 669  THR C C     1 
ATOM   8419  O  O     . THR C 2  669  ? 24.180  31.156  -19.555  1.00 50.63  ? 669  THR C O     1 
ATOM   8420  C  CB    . THR C 2  669  ? 24.614  33.957  -18.448  1.00 42.48  ? 669  THR C CB    1 
ATOM   8421  O  OG1   . THR C 2  669  ? 25.328  35.167  -18.166  1.00 39.01  ? 669  THR C OG1   1 
ATOM   8422  C  CG2   . THR C 2  669  ? 23.597  33.712  -17.356  1.00 40.93  ? 669  THR C CG2   1 
ATOM   8423  N  N     . TYR C 2  670  ? 24.967  30.688  -17.504  1.00 37.34  ? 670  TYR C N     1 
ATOM   8424  C  CA    . TYR C 2  670  ? 24.197  29.462  -17.379  1.00 33.12  ? 670  TYR C CA    1 
ATOM   8425  C  C     . TYR C 2  670  ? 22.924  29.763  -16.596  1.00 31.09  ? 670  TYR C C     1 
ATOM   8426  O  O     . TYR C 2  670  ? 22.966  30.437  -15.569  1.00 33.41  ? 670  TYR C O     1 
ATOM   8427  C  CB    . TYR C 2  670  ? 25.019  28.373  -16.691  1.00 31.71  ? 670  TYR C CB    1 
ATOM   8428  C  CG    . TYR C 2  670  ? 26.372  28.137  -17.320  1.00 29.40  ? 670  TYR C CG    1 
ATOM   8429  C  CD1   . TYR C 2  670  ? 26.503  27.954  -18.689  1.00 30.85  ? 670  TYR C CD1   1 
ATOM   8430  C  CD2   . TYR C 2  670  ? 27.520  28.113  -16.544  1.00 26.21  ? 670  TYR C CD2   1 
ATOM   8431  C  CE1   . TYR C 2  670  ? 27.740  27.739  -19.266  1.00 33.11  ? 670  TYR C CE1   1 
ATOM   8432  C  CE2   . TYR C 2  670  ? 28.761  27.899  -17.108  1.00 28.15  ? 670  TYR C CE2   1 
ATOM   8433  C  CZ    . TYR C 2  670  ? 28.868  27.714  -18.472  1.00 32.46  ? 670  TYR C CZ    1 
ATOM   8434  O  OH    . TYR C 2  670  ? 30.107  27.502  -19.038  1.00 33.43  ? 670  TYR C OH    1 
ATOM   8435  N  N     . ARG C 2  671  ? 21.789  29.281  -17.085  1.00 29.23  ? 671  ARG C N     1 
ATOM   8436  C  CA    . ARG C 2  671  ? 20.528  29.536  -16.405  1.00 33.54  ? 671  ARG C CA    1 
ATOM   8437  C  C     . ARG C 2  671  ? 20.075  28.313  -15.613  1.00 34.17  ? 671  ARG C C     1 
ATOM   8438  O  O     . ARG C 2  671  ? 20.062  27.194  -16.127  1.00 34.23  ? 671  ARG C O     1 
ATOM   8439  C  CB    . ARG C 2  671  ? 19.456  29.954  -17.409  1.00 36.77  ? 671  ARG C CB    1 
ATOM   8440  C  CG    . ARG C 2  671  ? 19.685  31.323  -18.036  1.00 33.37  ? 671  ARG C CG    1 
ATOM   8441  C  CD    . ARG C 2  671  ? 18.473  31.729  -18.847  1.00 38.03  ? 671  ARG C CD    1 
ATOM   8442  N  NE    . ARG C 2  671  ? 17.254  31.631  -18.049  1.00 40.88  ? 671  ARG C NE    1 
ATOM   8443  C  CZ    . ARG C 2  671  ? 16.025  31.632  -18.552  1.00 43.07  ? 671  ARG C CZ    1 
ATOM   8444  N  NH1   . ARG C 2  671  ? 15.842  31.726  -19.861  1.00 49.28  ? 671  ARG C NH1   1 
ATOM   8445  N  NH2   . ARG C 2  671  ? 14.977  31.535  -17.746  1.00 43.37  ? 671  ARG C NH2   1 
ATOM   8446  N  N     . MET C 2  672  ? 19.704  28.542  -14.358  1.00 34.62  ? 672  MET C N     1 
ATOM   8447  C  CA    . MET C 2  672  ? 19.317  27.468  -13.452  1.00 34.67  ? 672  MET C CA    1 
ATOM   8448  C  C     . MET C 2  672  ? 17.934  26.911  -13.770  1.00 34.23  ? 672  MET C C     1 
ATOM   8449  O  O     . MET C 2  672  ? 17.023  27.661  -14.113  1.00 32.86  ? 672  MET C O     1 
ATOM   8450  C  CB    . MET C 2  672  ? 19.342  27.966  -12.001  1.00 35.57  ? 672  MET C CB    1 
ATOM   8451  C  CG    . MET C 2  672  ? 20.676  28.514  -11.532  1.00 37.30  ? 672  MET C CG    1 
ATOM   8452  S  SD    . MET C 2  672  ? 21.884  27.216  -11.212  1.00 46.10  ? 672  MET C SD    1 
ATOM   8453  C  CE    . MET C 2  672  ? 23.240  27.756  -12.249  1.00 39.34  ? 672  MET C CE    1 
ATOM   8454  N  N     . ARG C 2  673  ? 17.780  25.594  -13.657  1.00 32.26  ? 673  ARG C N     1 
ATOM   8455  C  CA    . ARG C 2  673  ? 16.452  24.994  -13.658  1.00 31.59  ? 673  ARG C CA    1 
ATOM   8456  C  C     . ARG C 2  673  ? 15.897  25.056  -12.235  1.00 30.40  ? 673  ARG C C     1 
ATOM   8457  O  O     . ARG C 2  673  ? 16.431  24.419  -11.326  1.00 31.30  ? 673  ARG C O     1 
ATOM   8458  C  CB    . ARG C 2  673  ? 16.482  23.547  -14.174  1.00 32.78  ? 673  ARG C CB    1 
ATOM   8459  C  CG    . ARG C 2  673  ? 16.243  23.403  -15.680  1.00 31.98  ? 673  ARG C CG    1 
ATOM   8460  C  CD    . ARG C 2  673  ? 15.673  22.031  -16.045  1.00 36.42  ? 673  ARG C CD    1 
ATOM   8461  N  NE    . ARG C 2  673  ? 16.588  20.936  -15.738  1.00 50.36  ? 673  ARG C NE    1 
ATOM   8462  C  CZ    . ARG C 2  673  ? 16.316  19.652  -15.946  1.00 47.92  ? 673  ARG C CZ    1 
ATOM   8463  N  NH1   . ARG C 2  673  ? 15.149  19.292  -16.464  1.00 43.78  ? 673  ARG C NH1   1 
ATOM   8464  N  NH2   . ARG C 2  673  ? 17.215  18.726  -15.635  1.00 43.53  ? 673  ARG C NH2   1 
ATOM   8465  N  N     . LYS C 2  674  ? 14.842  25.843  -12.043  1.00 27.50  ? 674  LYS C N     1 
ATOM   8466  C  CA    . LYS C 2  674  ? 14.255  26.026  -10.718  1.00 27.29  ? 674  LYS C CA    1 
ATOM   8467  C  C     . LYS C 2  674  ? 12.831  25.483  -10.638  1.00 28.87  ? 674  LYS C C     1 
ATOM   8468  O  O     . LYS C 2  674  ? 11.930  25.975  -11.317  1.00 29.22  ? 674  LYS C O     1 
ATOM   8469  C  CB    . LYS C 2  674  ? 14.265  27.504  -10.330  1.00 26.09  ? 674  LYS C CB    1 
ATOM   8470  C  CG    . LYS C 2  674  ? 15.625  28.173  -10.452  1.00 28.88  ? 674  LYS C CG    1 
ATOM   8471  C  CD    . LYS C 2  674  ? 16.661  27.535  -9.543   1.00 32.09  ? 674  LYS C CD    1 
ATOM   8472  C  CE    . LYS C 2  674  ? 16.317  27.706  -8.069   1.00 34.66  ? 674  LYS C CE    1 
ATOM   8473  N  NZ    . LYS C 2  674  ? 17.407  27.184  -7.184   1.00 34.63  ? 674  LYS C NZ    1 
ATOM   8474  N  N     . PHE C 2  675  ? 12.646  24.468  -9.798   1.00 28.52  ? 675  PHE C N     1 
ATOM   8475  C  CA    . PHE C 2  675  ? 11.342  23.855  -9.561   1.00 28.38  ? 675  PHE C CA    1 
ATOM   8476  C  C     . PHE C 2  675  ? 10.655  23.403  -10.846  1.00 26.32  ? 675  PHE C C     1 
ATOM   8477  O  O     . PHE C 2  675  ? 9.468   23.668  -11.055  1.00 25.70  ? 675  PHE C O     1 
ATOM   8478  C  CB    . PHE C 2  675  ? 10.432  24.819  -8.799   1.00 30.89  ? 675  PHE C CB    1 
ATOM   8479  C  CG    . PHE C 2  675  ? 10.921  25.150  -7.416   1.00 34.32  ? 675  PHE C CG    1 
ATOM   8480  C  CD1   . PHE C 2  675  ? 10.889  24.200  -6.410   1.00 33.75  ? 675  PHE C CD1   1 
ATOM   8481  C  CD2   . PHE C 2  675  ? 11.401  26.414  -7.118   1.00 36.98  ? 675  PHE C CD2   1 
ATOM   8482  C  CE1   . PHE C 2  675  ? 11.335  24.501  -5.135   1.00 38.15  ? 675  PHE C CE1   1 
ATOM   8483  C  CE2   . PHE C 2  675  ? 11.847  26.720  -5.843   1.00 40.36  ? 675  PHE C CE2   1 
ATOM   8484  C  CZ    . PHE C 2  675  ? 11.813  25.762  -4.853   1.00 42.29  ? 675  PHE C CZ    1 
ATOM   8485  N  N     . ALA C 2  676  ? 11.410  22.720  -11.701  1.00 24.56  ? 676  ALA C N     1 
ATOM   8486  C  CA    . ALA C 2  676  ? 10.856  22.150  -12.923  1.00 24.77  ? 676  ALA C CA    1 
ATOM   8487  C  C     . ALA C 2  676  ? 10.289  20.775  -12.632  1.00 23.30  ? 676  ALA C C     1 
ATOM   8488  O  O     . ALA C 2  676  ? 10.936  19.958  -11.981  1.00 23.58  ? 676  ALA C O     1 
ATOM   8489  C  CB    . ALA C 2  676  ? 11.912  22.065  -14.010  1.00 29.18  ? 676  ALA C CB    1 
ATOM   8490  N  N     . ARG C 2  677  ? 9.072   20.522  -13.096  1.00 24.42  ? 677  ARG C N     1 
ATOM   8491  C  CA    . ARG C 2  677  ? 8.492   19.200  -12.940  1.00 24.70  ? 677  ARG C CA    1 
ATOM   8492  C  C     . ARG C 2  677  ? 9.244   18.203  -13.805  1.00 24.88  ? 677  ARG C C     1 
ATOM   8493  O  O     . ARG C 2  677  ? 9.602   18.499  -14.946  1.00 23.34  ? 677  ARG C O     1 
ATOM   8494  C  CB    . ARG C 2  677  ? 7.008   19.200  -13.299  1.00 27.38  ? 677  ARG C CB    1 
ATOM   8495  C  CG    . ARG C 2  677  ? 6.331   17.869  -13.029  1.00 28.37  ? 677  ARG C CG    1 
ATOM   8496  C  CD    . ARG C 2  677  ? 4.862   17.896  -13.394  1.00 30.88  ? 677  ARG C CD    1 
ATOM   8497  N  NE    . ARG C 2  677  ? 4.198   16.648  -13.028  1.00 31.36  ? 677  ARG C NE    1 
ATOM   8498  C  CZ    . ARG C 2  677  ? 4.155   15.569  -13.803  1.00 34.39  ? 677  ARG C CZ    1 
ATOM   8499  N  NH1   . ARG C 2  677  ? 4.742   15.585  -14.994  1.00 34.59  ? 677  ARG C NH1   1 
ATOM   8500  N  NH2   . ARG C 2  677  ? 3.527   14.476  -13.385  1.00 40.27  ? 677  ARG C NH2   1 
ATOM   8501  N  N     . SER C 2  678  ? 9.489   17.025  -13.243  1.00 26.96  ? 678  SER C N     1 
ATOM   8502  C  CA    . SER C 2  678  ? 10.182  15.959  -13.951  1.00 28.28  ? 678  SER C CA    1 
ATOM   8503  C  C     . SER C 2  678  ? 9.200   15.145  -14.781  1.00 28.44  ? 678  SER C C     1 
ATOM   8504  O  O     . SER C 2  678  ? 8.007   15.439  -14.802  1.00 30.72  ? 678  SER C O     1 
ATOM   8505  C  CB    . SER C 2  678  ? 10.911  15.051  -12.961  1.00 30.49  ? 678  SER C CB    1 
ATOM   8506  O  OG    . SER C 2  678  ? 9.988   14.448  -12.065  1.00 30.49  ? 678  SER C OG    1 
ATOM   8507  N  N     . ASN C 2  679  ? 9.705   14.121  -15.461  1.00 28.25  ? 679  ASN C N     1 
ATOM   8508  C  CA    . ASN C 2  679  ? 8.847   13.196  -16.189  1.00 29.06  ? 679  ASN C CA    1 
ATOM   8509  C  C     . ASN C 2  679  ? 8.126   12.235  -15.247  1.00 30.70  ? 679  ASN C C     1 
ATOM   8510  O  O     . ASN C 2  679  ? 7.217   11.514  -15.659  1.00 32.79  ? 679  ASN C O     1 
ATOM   8511  C  CB    . ASN C 2  679  ? 9.658   12.402  -17.217  1.00 27.76  ? 679  ASN C CB    1 
ATOM   8512  C  CG    . ASN C 2  679  ? 10.046  13.232  -18.421  1.00 26.80  ? 679  ASN C CG    1 
ATOM   8513  O  OD1   . ASN C 2  679  ? 11.213  13.292  -18.802  1.00 28.50  ? 679  ASN C OD1   1 
ATOM   8514  N  ND2   . ASN C 2  679  ? 9.065   13.880  -19.028  1.00 27.53  ? 679  ASN C ND2   1 
ATOM   8515  N  N     . HIS C 2  680  ? 8.538   12.221  -13.984  1.00 29.76  ? 680  HIS C N     1 
ATOM   8516  C  CA    . HIS C 2  680  ? 7.949   11.320  -13.004  1.00 29.64  ? 680  HIS C CA    1 
ATOM   8517  C  C     . HIS C 2  680  ? 7.446   12.064  -11.771  1.00 29.50  ? 680  HIS C C     1 
ATOM   8518  O  O     . HIS C 2  680  ? 7.225   11.463  -10.722  1.00 30.52  ? 680  HIS C O     1 
ATOM   8519  C  CB    . HIS C 2  680  ? 8.961   10.252  -12.588  1.00 31.78  ? 680  HIS C CB    1 
ATOM   8520  C  CG    . HIS C 2  680  ? 9.152   9.168   -13.603  1.00 35.19  ? 680  HIS C CG    1 
ATOM   8521  N  ND1   . HIS C 2  680  ? 9.274   9.423   -14.951  1.00 36.54  ? 680  HIS C ND1   1 
ATOM   8522  C  CD2   . HIS C 2  680  ? 9.240   7.823   -13.465  1.00 36.78  ? 680  HIS C CD2   1 
ATOM   8523  C  CE1   . HIS C 2  680  ? 9.431   8.284   -15.601  1.00 37.62  ? 680  HIS C CE1   1 
ATOM   8524  N  NE2   . HIS C 2  680  ? 9.413   7.298   -14.723  1.00 35.87  ? 680  HIS C NE2   1 
ATOM   8525  N  N     . GLY C 2  681  ? 7.266   13.373  -11.901  1.00 30.04  ? 681  GLY C N     1 
ATOM   8526  C  CA    . GLY C 2  681  ? 6.681   14.167  -10.836  1.00 29.45  ? 681  GLY C CA    1 
ATOM   8527  C  C     . GLY C 2  681  ? 7.613   14.526  -9.692   1.00 28.35  ? 681  GLY C C     1 
ATOM   8528  O  O     . GLY C 2  681  ? 7.165   15.034  -8.663   1.00 30.04  ? 681  GLY C O     1 
ATOM   8529  N  N     . THR C 2  682  ? 8.906   14.260  -9.857   1.00 28.43  ? 682  THR C N     1 
ATOM   8530  C  CA    . THR C 2  682  ? 9.896   14.696  -8.875   1.00 25.51  ? 682  THR C CA    1 
ATOM   8531  C  C     . THR C 2  682  ? 10.333  16.124  -9.193   1.00 23.81  ? 682  THR C C     1 
ATOM   8532  O  O     . THR C 2  682  ? 9.951   16.678  -10.222  1.00 24.59  ? 682  THR C O     1 
ATOM   8533  C  CB    . THR C 2  682  ? 11.118  13.765  -8.836   1.00 23.90  ? 682  THR C CB    1 
ATOM   8534  O  OG1   . THR C 2  682  ? 11.446  13.348  -10.166  1.00 24.99  ? 682  THR C OG1   1 
ATOM   8535  C  CG2   . THR C 2  682  ? 10.817  12.534  -7.995   1.00 25.55  ? 682  THR C CG2   1 
ATOM   8536  N  N     . CYS C 2  683  ? 11.129  16.719  -8.310   1.00 21.86  ? 683  CYS C N     1 
ATOM   8537  C  CA    . CYS C 2  683  ? 11.436  18.143  -8.405   1.00 21.83  ? 683  CYS C CA    1 
ATOM   8538  C  C     . CYS C 2  683  ? 12.865  18.446  -8.856   1.00 25.77  ? 683  CYS C C     1 
ATOM   8539  O  O     . CYS C 2  683  ? 13.747  18.661  -8.027   1.00 29.76  ? 683  CYS C O     1 
ATOM   8540  C  CB    . CYS C 2  683  ? 11.178  18.809  -7.055   1.00 22.11  ? 683  CYS C CB    1 
ATOM   8541  S  SG    . CYS C 2  683  ? 11.116  20.604  -7.116   1.00 30.08  ? 683  CYS C SG    1 
ATOM   8542  N  N     . ALA C 2  684  ? 13.086  18.482  -10.168  1.00 25.45  ? 684  ALA C N     1 
ATOM   8543  C  CA    . ALA C 2  684  ? 14.393  18.852  -10.706  1.00 25.30  ? 684  ALA C CA    1 
ATOM   8544  C  C     . ALA C 2  684  ? 14.694  20.314  -10.389  1.00 29.08  ? 684  ALA C C     1 
ATOM   8545  O  O     . ALA C 2  684  ? 14.212  21.217  -11.072  1.00 29.77  ? 684  ALA C O     1 
ATOM   8546  C  CB    . ALA C 2  684  ? 14.450  18.605  -12.209  1.00 25.94  ? 684  ALA C CB    1 
ATOM   8547  N  N     . ASN C 2  685  ? 15.488  20.536  -9.344   1.00 32.74  ? 685  ASN C N     1 
ATOM   8548  C  CA    . ASN C 2  685  ? 15.818  21.884  -8.883   1.00 35.21  ? 685  ASN C CA    1 
ATOM   8549  C  C     . ASN C 2  685  ? 17.324  22.076  -8.704   1.00 34.90  ? 685  ASN C C     1 
ATOM   8550  O  O     . ASN C 2  685  ? 17.962  21.342  -7.952   1.00 36.31  ? 685  ASN C O     1 
ATOM   8551  C  CB    . ASN C 2  685  ? 15.095  22.184  -7.565   1.00 35.82  ? 685  ASN C CB    1 
ATOM   8552  C  CG    . ASN C 2  685  ? 15.150  23.656  -7.187   1.00 32.89  ? 685  ASN C CG    1 
ATOM   8553  O  OD1   . ASN C 2  685  ? 15.241  24.529  -8.050   1.00 32.27  ? 685  ASN C OD1   1 
ATOM   8554  N  ND2   . ASN C 2  685  ? 15.090  23.937  -5.890   1.00 30.73  ? 685  ASN C ND2   1 
ATOM   8555  N  N     . GLN C 2  686  ? 17.887  23.067  -9.390   1.00 32.74  ? 686  GLN C N     1 
ATOM   8556  C  CA    . GLN C 2  686  ? 19.326  23.313  -9.347   1.00 31.20  ? 686  GLN C CA    1 
ATOM   8557  C  C     . GLN C 2  686  ? 19.664  24.558  -8.535   1.00 32.01  ? 686  GLN C C     1 
ATOM   8558  O  O     . GLN C 2  686  ? 18.914  25.532  -8.540   1.00 30.90  ? 686  GLN C O     1 
ATOM   8559  C  CB    . GLN C 2  686  ? 19.879  23.443  -10.765  1.00 30.47  ? 686  GLN C CB    1 
ATOM   8560  C  CG    . GLN C 2  686  ? 19.694  22.190  -11.603  1.00 31.43  ? 686  GLN C CG    1 
ATOM   8561  C  CD    . GLN C 2  686  ? 20.006  22.406  -13.077  1.00 31.15  ? 686  GLN C CD    1 
ATOM   8562  O  OE1   . GLN C 2  686  ? 19.893  23.519  -13.594  1.00 30.54  ? 686  GLN C OE1   1 
ATOM   8563  N  NE2   . GLN C 2  686  ? 20.402  21.336  -13.761  1.00 34.00  ? 686  GLN C NE2   1 
ATOM   8564  N  N     . CYS C 2  687  ? 20.791  24.517  -7.829   1.00 35.49  ? 687  CYS C N     1 
ATOM   8565  C  CA    . CYS C 2  687  ? 21.219  25.654  -7.020   1.00 38.45  ? 687  CYS C CA    1 
ATOM   8566  C  C     . CYS C 2  687  ? 22.736  25.857  -7.059   1.00 39.60  ? 687  CYS C C     1 
ATOM   8567  O  O     . CYS C 2  687  ? 23.499  24.891  -7.026   1.00 36.86  ? 687  CYS C O     1 
ATOM   8568  C  CB    . CYS C 2  687  ? 20.748  25.485  -5.574   1.00 40.27  ? 687  CYS C CB    1 
ATOM   8569  S  SG    . CYS C 2  687  ? 19.642  26.799  -5.014   1.00 50.78  ? 687  CYS C SG    1 
ATOM   8570  N  N     . PRO C 2  688  ? 23.170  27.126  -7.135   1.00 39.92  ? 688  PRO C N     1 
ATOM   8571  C  CA    . PRO C 2  688  ? 24.576  27.542  -7.207   1.00 37.95  ? 688  PRO C CA    1 
ATOM   8572  C  C     . PRO C 2  688  ? 25.444  27.026  -6.059   1.00 39.21  ? 688  PRO C C     1 
ATOM   8573  O  O     . PRO C 2  688  ? 25.005  27.014  -4.910   1.00 38.29  ? 688  PRO C O     1 
ATOM   8574  C  CB    . PRO C 2  688  ? 24.485  29.070  -7.159   1.00 41.48  ? 688  PRO C CB    1 
ATOM   8575  C  CG    . PRO C 2  688  ? 23.153  29.377  -7.733   1.00 43.61  ? 688  PRO C CG    1 
ATOM   8576  C  CD    . PRO C 2  688  ? 22.255  28.275  -7.256   1.00 40.50  ? 688  PRO C CD    1 
ATOM   8577  N  N     . ILE C 2  689  ? 26.664  26.606  -6.388   1.00 42.85  ? 689  ILE C N     1 
ATOM   8578  C  CA    . ILE C 2  689  ? 27.660  26.196  -5.399   1.00 42.24  ? 689  ILE C CA    1 
ATOM   8579  C  C     . ILE C 2  689  ? 28.573  27.355  -5.031   1.00 42.21  ? 689  ILE C C     1 
ATOM   8580  O  O     . ILE C 2  689  ? 28.696  27.728  -3.866   1.00 42.71  ? 689  ILE C O     1 
ATOM   8581  C  CB    . ILE C 2  689  ? 28.543  25.040  -5.917   1.00 38.46  ? 689  ILE C CB    1 
ATOM   8582  C  CG1   . ILE C 2  689  ? 27.733  23.753  -6.059   1.00 40.15  ? 689  ILE C CG1   1 
ATOM   8583  C  CG2   . ILE C 2  689  ? 29.736  24.817  -4.992   1.00 34.19  ? 689  ILE C CG2   1 
ATOM   8584  C  CD1   . ILE C 2  689  ? 28.565  22.573  -6.523   1.00 43.23  ? 689  ILE C CD1   1 
ATOM   8585  N  N     . VAL C 2  690  ? 29.206  27.919  -6.052   1.00 44.15  ? 690  VAL C N     1 
ATOM   8586  C  CA    . VAL C 2  690  ? 30.228  28.940  -5.888   1.00 43.42  ? 690  VAL C CA    1 
ATOM   8587  C  C     . VAL C 2  690  ? 29.686  30.288  -5.404   1.00 47.83  ? 690  VAL C C     1 
ATOM   8588  O  O     . VAL C 2  690  ? 28.572  30.682  -5.746   1.00 47.97  ? 690  VAL C O     1 
ATOM   8589  C  CB    . VAL C 2  690  ? 30.976  29.145  -7.213   1.00 41.95  ? 690  VAL C CB    1 
ATOM   8590  C  CG1   . VAL C 2  690  ? 31.852  27.942  -7.501   1.00 45.27  ? 690  VAL C CG1   1 
ATOM   8591  C  CG2   . VAL C 2  690  ? 29.983  29.353  -8.349   1.00 37.46  ? 690  VAL C CG2   1 
ATOM   8592  N  N     . ASP C 2  691  ? 30.487  30.981  -4.596   1.00 46.99  ? 691  ASP C N     1 
ATOM   8593  C  CA    . ASP C 2  691  ? 30.188  32.348  -4.170   1.00 53.06  ? 691  ASP C CA    1 
ATOM   8594  C  C     . ASP C 2  691  ? 30.652  33.329  -5.245   1.00 46.53  ? 691  ASP C C     1 
ATOM   8595  O  O     . ASP C 2  691  ? 31.409  32.958  -6.140   1.00 41.49  ? 691  ASP C O     1 
ATOM   8596  C  CB    . ASP C 2  691  ? 30.868  32.666  -2.831   1.00 61.52  ? 691  ASP C CB    1 
ATOM   8597  C  CG    . ASP C 2  691  ? 29.872  32.893  -1.692   1.00 74.55  ? 691  ASP C CG    1 
ATOM   8598  O  OD1   . ASP C 2  691  ? 28.765  33.416  -1.950   1.00 77.45  ? 691  ASP C OD1   1 
ATOM   8599  O  OD2   . ASP C 2  691  ? 30.207  32.558  -0.533   1.00 75.12  ? 691  ASP C OD2   1 
ATOM   8600  N  N     . ALA C 2  692  ? 30.202  34.577  -5.158   1.00 50.06  ? 692  ALA C N     1 
ATOM   8601  C  CA    . ALA C 2  692  ? 30.574  35.587  -6.147   1.00 41.87  ? 692  ALA C CA    1 
ATOM   8602  C  C     . ALA C 2  692  ? 32.071  35.888  -6.105   1.00 42.01  ? 692  ALA C C     1 
ATOM   8603  O  O     . ALA C 2  692  ? 32.634  36.144  -5.041   1.00 45.40  ? 692  ALA C O     1 
ATOM   8604  C  CB    . ALA C 2  692  ? 29.769  36.863  -5.931   1.00 41.18  ? 692  ALA C CB    1 
ATOM   8605  N  N     . GLY C 2  693  ? 32.708  35.852  -7.270   1.00 39.86  ? 693  GLY C N     1 
ATOM   8606  C  CA    . GLY C 2  693  ? 34.123  36.154  -7.372   1.00 39.51  ? 693  GLY C CA    1 
ATOM   8607  C  C     . GLY C 2  693  ? 35.022  34.948  -7.184   1.00 36.78  ? 693  GLY C C     1 
ATOM   8608  O  O     . GLY C 2  693  ? 36.246  35.078  -7.144   1.00 36.30  ? 693  GLY C O     1 
ATOM   8609  N  N     . ASP C 2  694  ? 34.425  33.770  -7.061   1.00 36.06  ? 694  ASP C N     1 
ATOM   8610  C  CA    . ASP C 2  694  ? 35.213  32.553  -6.935   1.00 36.49  ? 694  ASP C CA    1 
ATOM   8611  C  C     . ASP C 2  694  ? 35.920  32.241  -8.250   1.00 33.33  ? 694  ASP C C     1 
ATOM   8612  O  O     . ASP C 2  694  ? 35.293  32.198  -9.307   1.00 31.85  ? 694  ASP C O     1 
ATOM   8613  C  CB    . ASP C 2  694  ? 34.332  31.372  -6.512   1.00 39.94  ? 694  ASP C CB    1 
ATOM   8614  C  CG    . ASP C 2  694  ? 33.903  31.449  -5.054   1.00 41.08  ? 694  ASP C CG    1 
ATOM   8615  O  OD1   . ASP C 2  694  ? 34.510  32.229  -4.291   1.00 46.41  ? 694  ASP C OD1   1 
ATOM   8616  O  OD2   . ASP C 2  694  ? 32.965  30.717  -4.671   1.00 37.20  ? 694  ASP C OD2   1 
ATOM   8617  N  N     . ARG C 2  695  ? 37.232  32.042  -8.184   1.00 32.04  ? 695  ARG C N     1 
ATOM   8618  C  CA    . ARG C 2  695  ? 37.983  31.611  -9.357   1.00 34.59  ? 695  ARG C CA    1 
ATOM   8619  C  C     . ARG C 2  695  ? 37.661  30.157  -9.670   1.00 37.09  ? 695  ARG C C     1 
ATOM   8620  O  O     . ARG C 2  695  ? 37.990  29.262  -8.894   1.00 38.57  ? 695  ARG C O     1 
ATOM   8621  C  CB    . ARG C 2  695  ? 39.490  31.785  -9.144   1.00 37.88  ? 695  ARG C CB    1 
ATOM   8622  C  CG    . ARG C 2  695  ? 40.353  31.101  -10.205  1.00 39.12  ? 695  ARG C CG    1 
ATOM   8623  C  CD    . ARG C 2  695  ? 40.166  31.742  -11.577  1.00 39.68  ? 695  ARG C CD    1 
ATOM   8624  N  NE    . ARG C 2  695  ? 40.902  31.043  -12.629  1.00 39.95  ? 695  ARG C NE    1 
ATOM   8625  C  CZ    . ARG C 2  695  ? 41.018  31.487  -13.877  1.00 37.60  ? 695  ARG C CZ    1 
ATOM   8626  N  NH1   . ARG C 2  695  ? 40.450  32.633  -14.229  1.00 34.68  ? 695  ARG C NH1   1 
ATOM   8627  N  NH2   . ARG C 2  695  ? 41.703  30.788  -14.774  1.00 35.41  ? 695  ARG C NH2   1 
ATOM   8628  N  N     . VAL C 2  696  ? 37.013  29.926  -10.807  1.00 40.67  ? 696  VAL C N     1 
ATOM   8629  C  CA    . VAL C 2  696  ? 36.644  28.573  -11.213  1.00 45.23  ? 696  VAL C CA    1 
ATOM   8630  C  C     . VAL C 2  696  ? 37.300  28.170  -12.527  1.00 46.74  ? 696  VAL C C     1 
ATOM   8631  O  O     . VAL C 2  696  ? 37.491  28.997  -13.417  1.00 45.69  ? 696  VAL C O     1 
ATOM   8632  C  CB    . VAL C 2  696  ? 35.124  28.422  -11.356  1.00 44.19  ? 696  VAL C CB    1 
ATOM   8633  C  CG1   . VAL C 2  696  ? 34.475  28.314  -9.985   1.00 44.16  ? 696  VAL C CG1   1 
ATOM   8634  C  CG2   . VAL C 2  696  ? 34.543  29.584  -12.149  1.00 41.77  ? 696  VAL C CG2   1 
ATOM   8635  N  N     . GLU C 2  697  ? 37.632  26.889  -12.647  1.00 45.06  ? 697  GLU C N     1 
ATOM   8636  C  CA    . GLU C 2  697  ? 38.322  26.382  -13.827  1.00 43.88  ? 697  GLU C CA    1 
ATOM   8637  C  C     . GLU C 2  697  ? 37.407  25.508  -14.679  1.00 39.54  ? 697  GLU C C     1 
ATOM   8638  O  O     . GLU C 2  697  ? 36.380  25.029  -14.204  1.00 37.92  ? 697  GLU C O     1 
ATOM   8639  C  CB    . GLU C 2  697  ? 39.572  25.610  -13.407  1.00 48.04  ? 697  GLU C CB    1 
ATOM   8640  C  CG    . GLU C 2  697  ? 40.592  26.477  -12.675  1.00 53.69  ? 697  GLU C CG    1 
ATOM   8641  C  CD    . GLU C 2  697  ? 41.383  25.715  -11.619  1.00 72.47  ? 697  GLU C CD    1 
ATOM   8642  O  OE1   . GLU C 2  697  ? 41.561  24.485  -11.765  1.00 79.17  ? 697  GLU C OE1   1 
ATOM   8643  O  OE2   . GLU C 2  697  ? 41.810  26.355  -10.632  1.00 71.82  ? 697  GLU C OE2   1 
ATOM   8644  N  N     . ALA C 2  698  ? 37.776  25.324  -15.943  1.00 40.32  ? 698  ALA C N     1 
ATOM   8645  C  CA    . ALA C 2  698  ? 36.946  24.590  -16.894  1.00 39.83  ? 698  ALA C CA    1 
ATOM   8646  C  C     . ALA C 2  698  ? 36.718  23.144  -16.462  1.00 38.39  ? 698  ALA C C     1 
ATOM   8647  O  O     . ALA C 2  698  ? 37.661  22.429  -16.122  1.00 37.00  ? 698  ALA C O     1 
ATOM   8648  C  CB    . ALA C 2  698  ? 37.574  24.632  -18.278  1.00 42.14  ? 698  ALA C CB    1 
ATOM   8649  N  N     . GLY C 2  699  ? 35.459  22.720  -16.479  1.00 35.97  ? 699  GLY C N     1 
ATOM   8650  C  CA    . GLY C 2  699  ? 35.104  21.368  -16.090  1.00 37.75  ? 699  GLY C CA    1 
ATOM   8651  C  C     . GLY C 2  699  ? 34.632  21.246  -14.652  1.00 36.44  ? 699  GLY C C     1 
ATOM   8652  O  O     . GLY C 2  699  ? 34.289  20.155  -14.197  1.00 37.65  ? 699  GLY C O     1 
ATOM   8653  N  N     . GLN C 2  700  ? 34.604  22.363  -13.934  1.00 35.37  ? 700  GLN C N     1 
ATOM   8654  C  CA    . GLN C 2  700  ? 34.199  22.353  -12.531  1.00 33.33  ? 700  GLN C CA    1 
ATOM   8655  C  C     . GLN C 2  700  ? 32.686  22.490  -12.375  1.00 31.01  ? 700  GLN C C     1 
ATOM   8656  O  O     . GLN C 2  700  ? 32.037  23.241  -13.103  1.00 30.48  ? 700  GLN C O     1 
ATOM   8657  C  CB    . GLN C 2  700  ? 34.913  23.472  -11.767  1.00 37.99  ? 700  GLN C CB    1 
ATOM   8658  C  CG    . GLN C 2  700  ? 34.644  23.499  -10.268  1.00 39.51  ? 700  GLN C CG    1 
ATOM   8659  C  CD    . GLN C 2  700  ? 35.376  24.633  -9.563   1.00 45.26  ? 700  GLN C CD    1 
ATOM   8660  O  OE1   . GLN C 2  700  ? 36.088  25.418  -10.194  1.00 39.67  ? 700  GLN C OE1   1 
ATOM   8661  N  NE2   . GLN C 2  700  ? 35.199  24.726  -8.247   1.00 57.14  ? 700  GLN C NE2   1 
ATOM   8662  N  N     . VAL C 2  701  ? 32.127  21.745  -11.430  1.00 28.82  ? 701  VAL C N     1 
ATOM   8663  C  CA    . VAL C 2  701  ? 30.712  21.854  -11.119  1.00 31.62  ? 701  VAL C CA    1 
ATOM   8664  C  C     . VAL C 2  701  ? 30.454  23.173  -10.410  1.00 28.11  ? 701  VAL C C     1 
ATOM   8665  O  O     . VAL C 2  701  ? 30.885  23.371  -9.276   1.00 29.42  ? 701  VAL C O     1 
ATOM   8666  C  CB    . VAL C 2  701  ? 30.230  20.681  -10.243  1.00 33.48  ? 701  VAL C CB    1 
ATOM   8667  C  CG1   . VAL C 2  701  ? 28.768  20.863  -9.865   1.00 39.04  ? 701  VAL C CG1   1 
ATOM   8668  C  CG2   . VAL C 2  701  ? 30.440  19.351  -10.971  1.00 28.70  ? 701  VAL C CG2   1 
ATOM   8669  N  N     . ILE C 2  702  ? 29.756  24.076  -11.087  1.00 28.80  ? 702  ILE C N     1 
ATOM   8670  C  CA    . ILE C 2  702  ? 29.493  25.395  -10.533  1.00 33.85  ? 702  ILE C CA    1 
ATOM   8671  C  C     . ILE C 2  702  ? 28.158  25.418  -9.798   1.00 38.88  ? 702  ILE C C     1 
ATOM   8672  O  O     . ILE C 2  702  ? 27.913  26.289  -8.959   1.00 41.99  ? 702  ILE C O     1 
ATOM   8673  C  CB    . ILE C 2  702  ? 29.489  26.476  -11.630  1.00 36.31  ? 702  ILE C CB    1 
ATOM   8674  C  CG1   . ILE C 2  702  ? 28.193  26.412  -12.439  1.00 37.93  ? 702  ILE C CG1   1 
ATOM   8675  C  CG2   . ILE C 2  702  ? 30.696  26.314  -12.529  1.00 34.52  ? 702  ILE C CG2   1 
ATOM   8676  C  CD1   . ILE C 2  702  ? 27.871  27.683  -13.183  1.00 34.27  ? 702  ILE C CD1   1 
ATOM   8677  N  N     . ALA C 2  703  ? 27.307  24.447  -10.116  1.00 39.29  ? 703  ALA C N     1 
ATOM   8678  C  CA    . ALA C 2  703  ? 25.968  24.365  -9.546   1.00 42.24  ? 703  ALA C CA    1 
ATOM   8679  C  C     . ALA C 2  703  ? 25.349  23.007  -9.858   1.00 48.50  ? 703  ALA C C     1 
ATOM   8680  O  O     . ALA C 2  703  ? 25.061  22.698  -11.014  1.00 51.45  ? 703  ALA C O     1 
ATOM   8681  C  CB    . ALA C 2  703  ? 25.087  25.484  -10.082  1.00 37.63  ? 703  ALA C CB    1 
ATOM   8682  N  N     . ASP C 2  704  ? 25.152  22.189  -8.830   1.00 46.10  ? 704  ASP C N     1 
ATOM   8683  C  CA    . ASP C 2  704  ? 24.548  20.876  -9.017   1.00 41.88  ? 704  ASP C CA    1 
ATOM   8684  C  C     . ASP C 2  704  ? 23.027  20.947  -8.938   1.00 40.15  ? 704  ASP C C     1 
ATOM   8685  O  O     . ASP C 2  704  ? 22.455  22.007  -8.678   1.00 39.15  ? 704  ASP C O     1 
ATOM   8686  C  CB    . ASP C 2  704  ? 25.091  19.877  -7.988   1.00 40.52  ? 704  ASP C CB    1 
ATOM   8687  C  CG    . ASP C 2  704  ? 25.082  20.419  -6.569   1.00 40.51  ? 704  ASP C CG    1 
ATOM   8688  O  OD1   . ASP C 2  704  ? 24.385  21.423  -6.319   1.00 46.23  ? 704  ASP C OD1   1 
ATOM   8689  O  OD2   . ASP C 2  704  ? 25.776  19.837  -5.705   1.00 38.88  ? 704  ASP C OD2   1 
ATOM   8690  N  N     . GLY C 2  705  ? 22.376  19.811  -9.163   1.00 38.89  ? 705  GLY C N     1 
ATOM   8691  C  CA    . GLY C 2  705  ? 20.924  19.755  -9.164   1.00 40.64  ? 705  GLY C CA    1 
ATOM   8692  C  C     . GLY C 2  705  ? 20.335  18.739  -8.200   1.00 41.73  ? 705  GLY C C     1 
ATOM   8693  O  O     . GLY C 2  705  ? 20.844  18.551  -7.095   1.00 41.23  ? 705  GLY C O     1 
ATOM   8694  N  N     . PRO C 2  706  ? 19.255  18.068  -8.622   1.00 36.91  ? 706  PRO C N     1 
ATOM   8695  C  CA    . PRO C 2  706  ? 18.542  17.082  -7.805   1.00 39.49  ? 706  PRO C CA    1 
ATOM   8696  C  C     . PRO C 2  706  ? 19.433  15.915  -7.390   1.00 43.48  ? 706  PRO C C     1 
ATOM   8697  O  O     . PRO C 2  706  ? 20.163  15.383  -8.222   1.00 40.66  ? 706  PRO C O     1 
ATOM   8698  C  CB    . PRO C 2  706  ? 17.421  16.611  -8.732   1.00 40.30  ? 706  PRO C CB    1 
ATOM   8699  C  CG    . PRO C 2  706  ? 17.916  16.907  -10.114  1.00 35.93  ? 706  PRO C CG    1 
ATOM   8700  C  CD    . PRO C 2  706  ? 18.690  18.177  -9.977   1.00 35.02  ? 706  PRO C CD    1 
ATOM   8701  N  N     . CYS C 2  707  ? 19.367  15.533  -6.117   1.00 49.90  ? 707  CYS C N     1 
ATOM   8702  C  CA    . CYS C 2  707  ? 20.151  14.420  -5.586   1.00 49.46  ? 707  CYS C CA    1 
ATOM   8703  C  C     . CYS C 2  707  ? 21.645  14.613  -5.830   1.00 52.40  ? 707  CYS C C     1 
ATOM   8704  O  O     . CYS C 2  707  ? 22.346  13.670  -6.203   1.00 52.34  ? 707  CYS C O     1 
ATOM   8705  C  CB    . CYS C 2  707  ? 19.701  13.092  -6.202   1.00 46.21  ? 707  CYS C CB    1 
ATOM   8706  S  SG    . CYS C 2  707  ? 17.918  12.876  -6.319   1.00 38.35  ? 707  CYS C SG    1 
ATOM   8707  N  N     . THR C 2  708  ? 22.132  15.834  -5.632   1.00 49.32  ? 708  THR C N     1 
ATOM   8708  C  CA    . THR C 2  708  ? 23.551  16.103  -5.837   1.00 42.41  ? 708  THR C CA    1 
ATOM   8709  C  C     . THR C 2  708  ? 24.105  17.136  -4.846   1.00 39.90  ? 708  THR C C     1 
ATOM   8710  O  O     . THR C 2  708  ? 23.581  18.243  -4.727   1.00 34.96  ? 708  THR C O     1 
ATOM   8711  C  CB    . THR C 2  708  ? 23.825  16.579  -7.280   1.00 41.86  ? 708  THR C CB    1 
ATOM   8712  O  OG1   . THR C 2  708  ? 23.030  15.818  -8.201   1.00 42.46  ? 708  THR C OG1   1 
ATOM   8713  C  CG2   . THR C 2  708  ? 25.295  16.393  -7.624   1.00 38.69  ? 708  THR C CG2   1 
ATOM   8714  N  N     . ASP C 2  709  ? 25.161  16.746  -4.133   1.00 36.65  ? 709  ASP C N     1 
ATOM   8715  C  CA    . ASP C 2  709  ? 25.849  17.613  -3.174   1.00 32.80  ? 709  ASP C CA    1 
ATOM   8716  C  C     . ASP C 2  709  ? 27.313  17.761  -3.562   1.00 31.73  ? 709  ASP C C     1 
ATOM   8717  O  O     . ASP C 2  709  ? 28.052  16.778  -3.594   1.00 30.84  ? 709  ASP C O     1 
ATOM   8718  C  CB    . ASP C 2  709  ? 25.738  17.055  -1.747   1.00 33.04  ? 709  ASP C CB    1 
ATOM   8719  C  CG    . ASP C 2  709  ? 26.559  17.850  -0.734   1.00 30.69  ? 709  ASP C CG    1 
ATOM   8720  O  OD1   . ASP C 2  709  ? 26.706  19.075  -0.912   1.00 36.40  ? 709  ASP C OD1   1 
ATOM   8721  O  OD2   . ASP C 2  709  ? 27.051  17.254  0.249    1.00 28.50  ? 709  ASP C OD2   1 
ATOM   8722  N  N     . ASP C 2  710  ? 27.715  18.995  -3.856   1.00 36.20  ? 710  ASP C N     1 
ATOM   8723  C  CA    . ASP C 2  710  ? 29.090  19.317  -4.233   1.00 36.85  ? 710  ASP C CA    1 
ATOM   8724  C  C     . ASP C 2  710  ? 29.533  18.526  -5.461   1.00 34.62  ? 710  ASP C C     1 
ATOM   8725  O  O     . ASP C 2  710  ? 30.692  18.132  -5.574   1.00 34.94  ? 710  ASP C O     1 
ATOM   8726  C  CB    . ASP C 2  710  ? 30.048  19.064  -3.060   1.00 41.23  ? 710  ASP C CB    1 
ATOM   8727  C  CG    . ASP C 2  710  ? 31.064  20.186  -2.880   1.00 49.39  ? 710  ASP C CG    1 
ATOM   8728  O  OD1   . ASP C 2  710  ? 32.187  19.908  -2.404   1.00 49.86  ? 710  ASP C OD1   1 
ATOM   8729  O  OD2   . ASP C 2  710  ? 30.734  21.345  -3.214   1.00 56.24  ? 710  ASP C OD2   1 
ATOM   8730  N  N     . GLY C 2  711  ? 28.602  18.300  -6.382   1.00 32.45  ? 711  GLY C N     1 
ATOM   8731  C  CA    . GLY C 2  711  ? 28.905  17.586  -7.606   1.00 32.37  ? 711  GLY C CA    1 
ATOM   8732  C  C     . GLY C 2  711  ? 29.052  16.094  -7.390   1.00 32.81  ? 711  GLY C C     1 
ATOM   8733  O  O     . GLY C 2  711  ? 29.764  15.419  -8.132   1.00 32.83  ? 711  GLY C O     1 
ATOM   8734  N  N     . GLU C 2  712  ? 28.380  15.575  -6.368   1.00 31.03  ? 712  GLU C N     1 
ATOM   8735  C  CA    . GLU C 2  712  ? 28.414  14.143  -6.088   1.00 33.03  ? 712  GLU C CA    1 
ATOM   8736  C  C     . GLU C 2  712  ? 27.009  13.572  -5.888   1.00 36.77  ? 712  GLU C C     1 
ATOM   8737  O  O     . GLU C 2  712  ? 26.126  14.246  -5.363   1.00 36.49  ? 712  GLU C O     1 
ATOM   8738  C  CB    . GLU C 2  712  ? 29.285  13.857  -4.859   1.00 34.26  ? 712  GLU C CB    1 
ATOM   8739  C  CG    . GLU C 2  712  ? 30.753  13.592  -5.188   1.00 35.14  ? 712  GLU C CG    1 
ATOM   8740  C  CD    . GLU C 2  712  ? 31.515  12.947  -4.038   1.00 35.18  ? 712  GLU C CD    1 
ATOM   8741  O  OE1   . GLU C 2  712  ? 31.238  13.285  -2.869   1.00 34.79  ? 712  GLU C OE1   1 
ATOM   8742  O  OE2   . GLU C 2  712  ? 32.390  12.096  -4.305   1.00 34.10  ? 712  GLU C OE2   1 
ATOM   8743  N  N     . MET C 2  713  ? 26.813  12.328  -6.316   1.00 33.96  ? 713  MET C N     1 
ATOM   8744  C  CA    . MET C 2  713  ? 25.521  11.655  -6.203   1.00 31.63  ? 713  MET C CA    1 
ATOM   8745  C  C     . MET C 2  713  ? 25.030  11.549  -4.762   1.00 31.28  ? 713  MET C C     1 
ATOM   8746  O  O     . MET C 2  713  ? 25.579  10.796  -3.959   1.00 32.18  ? 713  MET C O     1 
ATOM   8747  C  CB    . MET C 2  713  ? 25.598  10.258  -6.821   1.00 29.75  ? 713  MET C CB    1 
ATOM   8748  C  CG    . MET C 2  713  ? 25.668  10.258  -8.334   1.00 29.64  ? 713  MET C CG    1 
ATOM   8749  S  SD    . MET C 2  713  ? 24.210  11.021  -9.060   1.00 36.02  ? 713  MET C SD    1 
ATOM   8750  C  CE    . MET C 2  713  ? 22.919  10.008  -8.350   1.00 33.90  ? 713  MET C CE    1 
ATOM   8751  N  N     . ALA C 2  714  ? 23.990  12.307  -4.440   1.00 30.62  ? 714  ALA C N     1 
ATOM   8752  C  CA    . ALA C 2  714  ? 23.407  12.269  -3.107   1.00 29.40  ? 714  ALA C CA    1 
ATOM   8753  C  C     . ALA C 2  714  ? 21.988  11.717  -3.165   1.00 30.98  ? 714  ALA C C     1 
ATOM   8754  O  O     . ALA C 2  714  ? 21.017  12.470  -3.126   1.00 31.11  ? 714  ALA C O     1 
ATOM   8755  C  CB    . ALA C 2  714  ? 23.419  13.652  -2.482   1.00 30.73  ? 714  ALA C CB    1 
ATOM   8756  N  N     . LEU C 2  715  ? 21.875  10.397  -3.251   1.00 26.23  ? 715  LEU C N     1 
ATOM   8757  C  CA    . LEU C 2  715  ? 20.580  9.750   -3.413   1.00 22.70  ? 715  LEU C CA    1 
ATOM   8758  C  C     . LEU C 2  715  ? 19.828  9.566   -2.104   1.00 24.73  ? 715  LEU C C     1 
ATOM   8759  O  O     . LEU C 2  715  ? 18.765  8.950   -2.088   1.00 27.35  ? 715  LEU C O     1 
ATOM   8760  C  CB    . LEU C 2  715  ? 20.751  8.391   -4.087   1.00 22.97  ? 715  LEU C CB    1 
ATOM   8761  C  CG    . LEU C 2  715  ? 21.069  8.442   -5.579   1.00 24.18  ? 715  LEU C CG    1 
ATOM   8762  C  CD1   . LEU C 2  715  ? 21.256  7.041   -6.141   1.00 28.37  ? 715  LEU C CD1   1 
ATOM   8763  C  CD2   . LEU C 2  715  ? 19.972  9.186   -6.321   1.00 24.33  ? 715  LEU C CD2   1 
ATOM   8764  N  N     . GLY C 2  716  ? 20.370  10.090  -1.009   1.00 30.90  ? 716  GLY C N     1 
ATOM   8765  C  CA    . GLY C 2  716  ? 19.708  9.955   0.277    1.00 32.33  ? 716  GLY C CA    1 
ATOM   8766  C  C     . GLY C 2  716  ? 20.363  10.688  1.432    1.00 32.40  ? 716  GLY C C     1 
ATOM   8767  O  O     . GLY C 2  716  ? 20.993  11.728  1.249    1.00 33.25  ? 716  GLY C O     1 
ATOM   8768  N  N     . LYS C 2  717  ? 20.211  10.137  2.633    1.00 31.33  ? 717  LYS C N     1 
ATOM   8769  C  CA    . LYS C 2  717  ? 20.774  10.744  3.833    1.00 31.56  ? 717  LYS C CA    1 
ATOM   8770  C  C     . LYS C 2  717  ? 21.620  9.757   4.634    1.00 31.15  ? 717  LYS C C     1 
ATOM   8771  O  O     . LYS C 2  717  ? 21.401  8.545   4.580    1.00 28.18  ? 717  LYS C O     1 
ATOM   8772  C  CB    . LYS C 2  717  ? 19.661  11.302  4.726    1.00 31.46  ? 717  LYS C CB    1 
ATOM   8773  C  CG    . LYS C 2  717  ? 18.887  12.469  4.132    1.00 29.80  ? 717  LYS C CG    1 
ATOM   8774  C  CD    . LYS C 2  717  ? 19.793  13.657  3.881    1.00 32.47  ? 717  LYS C CD    1 
ATOM   8775  C  CE    . LYS C 2  717  ? 18.993  14.917  3.578    1.00 38.15  ? 717  LYS C CE    1 
ATOM   8776  N  NZ    . LYS C 2  717  ? 18.209  15.379  4.763    1.00 35.48  ? 717  LYS C NZ    1 
ATOM   8777  N  N     . ASN C 2  718  ? 22.586  10.294  5.373    1.00 34.69  ? 718  ASN C N     1 
ATOM   8778  C  CA    . ASN C 2  718  ? 23.381  9.509   6.311    1.00 34.71  ? 718  ASN C CA    1 
ATOM   8779  C  C     . ASN C 2  718  ? 22.674  9.427   7.655    1.00 34.96  ? 718  ASN C C     1 
ATOM   8780  O  O     . ASN C 2  718  ? 22.570  10.420  8.373    1.00 37.46  ? 718  ASN C O     1 
ATOM   8781  C  CB    . ASN C 2  718  ? 24.772  10.116  6.478    1.00 33.91  ? 718  ASN C CB    1 
ATOM   8782  C  CG    . ASN C 2  718  ? 25.491  10.287  5.159    1.00 34.65  ? 718  ASN C CG    1 
ATOM   8783  O  OD1   . ASN C 2  718  ? 26.261  9.422   4.745    1.00 34.10  ? 718  ASN C OD1   1 
ATOM   8784  N  ND2   . ASN C 2  718  ? 25.237  11.402  4.484    1.00 34.24  ? 718  ASN C ND2   1 
ATOM   8785  N  N     . LEU C 2  719  ? 22.190  8.239   7.994    1.00 35.82  ? 719  LEU C N     1 
ATOM   8786  C  CA    . LEU C 2  719  ? 21.305  8.084   9.140    1.00 35.94  ? 719  LEU C CA    1 
ATOM   8787  C  C     . LEU C 2  719  ? 21.937  7.310   10.291   1.00 34.78  ? 719  LEU C C     1 
ATOM   8788  O  O     . LEU C 2  719  ? 22.802  6.458   10.088   1.00 33.55  ? 719  LEU C O     1 
ATOM   8789  C  CB    . LEU C 2  719  ? 20.010  7.404   8.697    1.00 35.31  ? 719  LEU C CB    1 
ATOM   8790  C  CG    . LEU C 2  719  ? 18.794  8.325   8.569    1.00 35.20  ? 719  LEU C CG    1 
ATOM   8791  C  CD1   . LEU C 2  719  ? 19.157  9.655   7.921    1.00 35.98  ? 719  LEU C CD1   1 
ATOM   8792  C  CD2   . LEU C 2  719  ? 17.685  7.635   7.788    1.00 33.43  ? 719  LEU C CD2   1 
ATOM   8793  N  N     . LEU C 2  720  ? 21.494  7.622   11.503   1.00 37.86  ? 720  LEU C N     1 
ATOM   8794  C  CA    . LEU C 2  720  ? 22.013  6.987   12.705   1.00 38.37  ? 720  LEU C CA    1 
ATOM   8795  C  C     . LEU C 2  720  ? 21.329  5.642   12.935   1.00 36.10  ? 720  LEU C C     1 
ATOM   8796  O  O     . LEU C 2  720  ? 20.230  5.578   13.487   1.00 36.65  ? 720  LEU C O     1 
ATOM   8797  C  CB    . LEU C 2  720  ? 21.822  7.910   13.910   1.00 39.93  ? 720  LEU C CB    1 
ATOM   8798  C  CG    . LEU C 2  720  ? 22.546  7.546   15.206   1.00 40.20  ? 720  LEU C CG    1 
ATOM   8799  C  CD1   . LEU C 2  720  ? 23.992  7.186   14.919   1.00 42.58  ? 720  LEU C CD1   1 
ATOM   8800  C  CD2   . LEU C 2  720  ? 22.471  8.700   16.193   1.00 43.48  ? 720  LEU C CD2   1 
ATOM   8801  N  N     . VAL C 2  721  ? 21.992  4.570   12.512   1.00 35.40  ? 721  VAL C N     1 
ATOM   8802  C  CA    . VAL C 2  721  ? 21.394  3.239   12.511   1.00 35.08  ? 721  VAL C CA    1 
ATOM   8803  C  C     . VAL C 2  721  ? 21.545  2.513   13.851   1.00 35.90  ? 721  VAL C C     1 
ATOM   8804  O  O     . VAL C 2  721  ? 22.411  2.844   14.663   1.00 38.16  ? 721  VAL C O     1 
ATOM   8805  C  CB    . VAL C 2  721  ? 22.011  2.362   11.388   1.00 35.02  ? 721  VAL C CB    1 
ATOM   8806  C  CG1   . VAL C 2  721  ? 23.371  1.830   11.817   1.00 33.83  ? 721  VAL C CG1   1 
ATOM   8807  C  CG2   . VAL C 2  721  ? 21.072  1.218   10.998   1.00 34.03  ? 721  VAL C CG2   1 
ATOM   8808  N  N     . ALA C 2  722  ? 20.675  1.532   14.073   1.00 34.62  ? 722  ALA C N     1 
ATOM   8809  C  CA    . ALA C 2  722  ? 20.763  0.636   15.219   1.00 36.10  ? 722  ALA C CA    1 
ATOM   8810  C  C     . ALA C 2  722  ? 20.240  -0.749  14.826   1.00 36.32  ? 722  ALA C C     1 
ATOM   8811  O  O     . ALA C 2  722  ? 19.084  -0.893  14.423   1.00 34.68  ? 722  ALA C O     1 
ATOM   8812  C  CB    . ALA C 2  722  ? 19.985  1.194   16.399   1.00 36.63  ? 722  ALA C CB    1 
ATOM   8813  N  N     . ILE C 2  723  ? 21.095  -1.762  14.939   1.00 35.01  ? 723  ILE C N     1 
ATOM   8814  C  CA    . ILE C 2  723  ? 20.737  -3.120  14.536   1.00 32.85  ? 723  ILE C CA    1 
ATOM   8815  C  C     . ILE C 2  723  ? 20.126  -3.909  15.690   1.00 32.68  ? 723  ILE C C     1 
ATOM   8816  O  O     . ILE C 2  723  ? 20.827  -4.619  16.408   1.00 32.74  ? 723  ILE C O     1 
ATOM   8817  C  CB    . ILE C 2  723  ? 21.958  -3.893  13.999   1.00 30.67  ? 723  ILE C CB    1 
ATOM   8818  C  CG1   . ILE C 2  723  ? 22.728  -3.044  12.987   1.00 29.96  ? 723  ILE C CG1   1 
ATOM   8819  C  CG2   . ILE C 2  723  ? 21.523  -5.211  13.371   1.00 31.02  ? 723  ILE C CG2   1 
ATOM   8820  C  CD1   . ILE C 2  723  ? 21.918  -2.645  11.776   1.00 29.77  ? 723  ILE C CD1   1 
ATOM   8821  N  N     . MET C 2  724  ? 18.815  -3.780  15.864   1.00 31.93  ? 724  MET C N     1 
ATOM   8822  C  CA    . MET C 2  724  ? 18.118  -4.488  16.931   1.00 33.91  ? 724  MET C CA    1 
ATOM   8823  C  C     . MET C 2  724  ? 16.615  -4.574  16.674   1.00 34.43  ? 724  MET C C     1 
ATOM   8824  O  O     . MET C 2  724  ? 16.007  -3.625  16.176   1.00 33.73  ? 724  MET C O     1 
ATOM   8825  C  CB    . MET C 2  724  ? 18.372  -3.807  18.281   1.00 34.82  ? 724  MET C CB    1 
ATOM   8826  C  CG    . MET C 2  724  ? 17.887  -2.363  18.362   1.00 35.28  ? 724  MET C CG    1 
ATOM   8827  S  SD    . MET C 2  724  ? 17.823  -1.749  20.055   1.00 42.89  ? 724  MET C SD    1 
ATOM   8828  C  CE    . MET C 2  724  ? 16.616  -2.858  20.773   1.00 38.63  ? 724  MET C CE    1 
ATOM   8829  N  N     . PRO C 2  725  ? 16.013  -5.725  17.005   1.00 33.62  ? 725  PRO C N     1 
ATOM   8830  C  CA    . PRO C 2  725  ? 14.553  -5.867  17.004   1.00 31.96  ? 725  PRO C CA    1 
ATOM   8831  C  C     . PRO C 2  725  ? 13.929  -4.977  18.072   1.00 31.40  ? 725  PRO C C     1 
ATOM   8832  O  O     . PRO C 2  725  ? 14.356  -5.039  19.222   1.00 32.47  ? 725  PRO C O     1 
ATOM   8833  C  CB    . PRO C 2  725  ? 14.340  -7.349  17.328   1.00 32.78  ? 725  PRO C CB    1 
ATOM   8834  C  CG    . PRO C 2  725  ? 15.637  -8.014  16.987   1.00 32.18  ? 725  PRO C CG    1 
ATOM   8835  C  CD    . PRO C 2  725  ? 16.692  -7.000  17.289   1.00 34.19  ? 725  PRO C CD    1 
ATOM   8836  N  N     . TRP C 2  726  ? 12.943  -4.161  17.717   1.00 29.90  ? 726  TRP C N     1 
ATOM   8837  C  CA    . TRP C 2  726  ? 12.410  -3.215  18.688   1.00 34.20  ? 726  TRP C CA    1 
ATOM   8838  C  C     . TRP C 2  726  ? 10.890  -3.243  18.770   1.00 33.10  ? 726  TRP C C     1 
ATOM   8839  O  O     . TRP C 2  726  ? 10.199  -2.680  17.922   1.00 33.43  ? 726  TRP C O     1 
ATOM   8840  C  CB    . TRP C 2  726  ? 12.890  -1.796  18.366   1.00 37.21  ? 726  TRP C CB    1 
ATOM   8841  C  CG    . TRP C 2  726  ? 12.694  -0.830  19.501   1.00 39.90  ? 726  TRP C CG    1 
ATOM   8842  C  CD1   . TRP C 2  726  ? 13.586  -0.537  20.493   1.00 39.64  ? 726  TRP C CD1   1 
ATOM   8843  C  CD2   . TRP C 2  726  ? 11.531  -0.034  19.763   1.00 39.75  ? 726  TRP C CD2   1 
ATOM   8844  N  NE1   . TRP C 2  726  ? 13.049  0.392   21.353   1.00 47.39  ? 726  TRP C NE1   1 
ATOM   8845  C  CE2   . TRP C 2  726  ? 11.788  0.716   20.926   1.00 42.01  ? 726  TRP C CE2   1 
ATOM   8846  C  CE3   . TRP C 2  726  ? 10.299  0.117   19.122   1.00 38.41  ? 726  TRP C CE3   1 
ATOM   8847  C  CZ2   . TRP C 2  726  ? 10.856  1.602   21.466   1.00 44.36  ? 726  TRP C CZ2   1 
ATOM   8848  C  CZ3   . TRP C 2  726  ? 9.374   0.991   19.662   1.00 41.92  ? 726  TRP C CZ3   1 
ATOM   8849  C  CH2   . TRP C 2  726  ? 9.657   1.724   20.821   1.00 44.87  ? 726  TRP C CH2   1 
ATOM   8850  N  N     . GLU C 2  727  ? 10.387  -3.913  19.803   1.00 33.01  ? 727  GLU C N     1 
ATOM   8851  C  CA    . GLU C 2  727  ? 8.964   -3.929  20.137   1.00 35.24  ? 727  GLU C CA    1 
ATOM   8852  C  C     . GLU C 2  727  ? 8.081   -4.324  18.949   1.00 33.38  ? 727  GLU C C     1 
ATOM   8853  O  O     . GLU C 2  727  ? 6.933   -3.892  18.843   1.00 33.37  ? 727  GLU C O     1 
ATOM   8854  C  CB    . GLU C 2  727  ? 8.537   -2.561  20.689   1.00 38.59  ? 727  GLU C CB    1 
ATOM   8855  C  CG    . GLU C 2  727  ? 9.505   -1.940  21.710   1.00 38.96  ? 727  GLU C CG    1 
ATOM   8856  C  CD    . GLU C 2  727  ? 9.266   -2.387  23.148   1.00 41.13  ? 727  GLU C CD    1 
ATOM   8857  O  OE1   . GLU C 2  727  ? 9.033   -1.512  24.014   1.00 41.24  ? 727  GLU C OE1   1 
ATOM   8858  O  OE2   . GLU C 2  727  ? 9.332   -3.606  23.415   1.00 41.51  ? 727  GLU C OE2   1 
ATOM   8859  N  N     . GLY C 2  728  ? 8.633   -5.139  18.054   1.00 30.06  ? 728  GLY C N     1 
ATOM   8860  C  CA    . GLY C 2  728  ? 7.879   -5.706  16.948   1.00 29.93  ? 728  GLY C CA    1 
ATOM   8861  C  C     . GLY C 2  728  ? 7.490   -4.763  15.821   1.00 32.14  ? 728  GLY C C     1 
ATOM   8862  O  O     . GLY C 2  728  ? 6.838   -5.179  14.866   1.00 30.73  ? 728  GLY C O     1 
ATOM   8863  N  N     . HIS C 2  729  ? 7.882   -3.497  15.918   1.00 32.58  ? 729  HIS C N     1 
ATOM   8864  C  CA    . HIS C 2  729  ? 7.506   -2.504  14.911   1.00 31.84  ? 729  HIS C CA    1 
ATOM   8865  C  C     . HIS C 2  729  ? 8.424   -2.527  13.699   1.00 30.72  ? 729  HIS C C     1 
ATOM   8866  O  O     . HIS C 2  729  ? 8.200   -1.808  12.725   1.00 29.63  ? 729  HIS C O     1 
ATOM   8867  C  CB    . HIS C 2  729  ? 7.498   -1.103  15.517   1.00 28.66  ? 729  HIS C CB    1 
ATOM   8868  C  CG    . HIS C 2  729  ? 6.227   -0.768  16.231   1.00 28.68  ? 729  HIS C CG    1 
ATOM   8869  N  ND1   . HIS C 2  729  ? 5.089   -0.371  15.570   1.00 31.24  ? 729  HIS C ND1   1 
ATOM   8870  C  CD2   . HIS C 2  729  ? 5.921   -0.772  17.550   1.00 29.98  ? 729  HIS C CD2   1 
ATOM   8871  C  CE1   . HIS C 2  729  ? 4.129   -0.143  16.450   1.00 35.05  ? 729  HIS C CE1   1 
ATOM   8872  N  NE2   . HIS C 2  729  ? 4.608   -0.376  17.658   1.00 33.84  ? 729  HIS C NE2   1 
ATOM   8873  N  N     . ASN C 2  730  ? 9.464   -3.345  13.773   1.00 30.43  ? 730  ASN C N     1 
ATOM   8874  C  CA    . ASN C 2  730  ? 10.367  -3.531  12.651   1.00 29.30  ? 730  ASN C CA    1 
ATOM   8875  C  C     . ASN C 2  730  ? 10.253  -4.951  12.101   1.00 28.80  ? 730  ASN C C     1 
ATOM   8876  O  O     . ASN C 2  730  ? 11.029  -5.358  11.237   1.00 28.39  ? 730  ASN C O     1 
ATOM   8877  C  CB    . ASN C 2  730  ? 11.807  -3.222  13.066   1.00 27.62  ? 730  ASN C CB    1 
ATOM   8878  C  CG    . ASN C 2  730  ? 12.176  -3.843  14.399   1.00 28.52  ? 730  ASN C CG    1 
ATOM   8879  O  OD1   . ASN C 2  730  ? 11.460  -4.697  14.918   1.00 28.28  ? 730  ASN C OD1   1 
ATOM   8880  N  ND2   . ASN C 2  730  ? 13.300  -3.414  14.959   1.00 30.35  ? 730  ASN C ND2   1 
ATOM   8881  N  N     . TYR C 2  731  ? 9.266   -5.689  12.607   1.00 30.86  ? 731  TYR C N     1 
ATOM   8882  C  CA    . TYR C 2  731  ? 9.014   -7.084  12.228   1.00 32.78  ? 731  TYR C CA    1 
ATOM   8883  C  C     . TYR C 2  731  ? 8.803   -7.280  10.727   1.00 34.19  ? 731  TYR C C     1 
ATOM   8884  O  O     . TYR C 2  731  ? 8.025   -6.561  10.100   1.00 34.83  ? 731  TYR C O     1 
ATOM   8885  C  CB    . TYR C 2  731  ? 7.797   -7.613  13.000   1.00 32.58  ? 731  TYR C CB    1 
ATOM   8886  C  CG    . TYR C 2  731  ? 7.276   -8.971  12.558   1.00 34.10  ? 731  TYR C CG    1 
ATOM   8887  C  CD1   . TYR C 2  731  ? 8.096   -10.093 12.566   1.00 35.94  ? 731  TYR C CD1   1 
ATOM   8888  C  CD2   . TYR C 2  731  ? 5.952   -9.135  12.166   1.00 32.50  ? 731  TYR C CD2   1 
ATOM   8889  C  CE1   . TYR C 2  731  ? 7.620   -11.335 12.176   1.00 33.75  ? 731  TYR C CE1   1 
ATOM   8890  C  CE2   . TYR C 2  731  ? 5.468   -10.376 11.776   1.00 31.87  ? 731  TYR C CE2   1 
ATOM   8891  C  CZ    . TYR C 2  731  ? 6.307   -11.471 11.785   1.00 32.14  ? 731  TYR C CZ    1 
ATOM   8892  O  OH    . TYR C 2  731  ? 5.835   -12.704 11.401   1.00 33.72  ? 731  TYR C OH    1 
ATOM   8893  N  N     . GLU C 2  732  ? 9.500   -8.272  10.175   1.00 36.06  ? 732  GLU C N     1 
ATOM   8894  C  CA    . GLU C 2  732  ? 9.501   -8.564  8.740    1.00 36.29  ? 732  GLU C CA    1 
ATOM   8895  C  C     . GLU C 2  732  ? 9.884   -7.345  7.904    1.00 35.98  ? 732  GLU C C     1 
ATOM   8896  O  O     . GLU C 2  732  ? 9.050   -6.769  7.206    1.00 34.84  ? 732  GLU C O     1 
ATOM   8897  C  CB    . GLU C 2  732  ? 8.138   -9.103  8.289    1.00 35.44  ? 732  GLU C CB    1 
ATOM   8898  C  CG    . GLU C 2  732  ? 8.035   -10.629 8.225    1.00 36.45  ? 732  GLU C CG    1 
ATOM   8899  C  CD    . GLU C 2  732  ? 8.719   -11.230 6.999    1.00 37.87  ? 732  GLU C CD    1 
ATOM   8900  O  OE1   . GLU C 2  732  ? 9.927   -10.976 6.797    1.00 40.20  ? 732  GLU C OE1   1 
ATOM   8901  O  OE2   . GLU C 2  732  ? 8.044   -11.958 6.237    1.00 33.31  ? 732  GLU C OE2   1 
ATOM   8902  N  N     . ASP C 2  733  ? 11.154  -6.959  8.001    1.00 37.27  ? 733  ASP C N     1 
ATOM   8903  C  CA    . ASP C 2  733  ? 11.749  -5.904  7.178    1.00 38.05  ? 733  ASP C CA    1 
ATOM   8904  C  C     . ASP C 2  733  ? 11.092  -4.532  7.344    1.00 35.43  ? 733  ASP C C     1 
ATOM   8905  O  O     . ASP C 2  733  ? 11.284  -3.644  6.516    1.00 35.64  ? 733  ASP C O     1 
ATOM   8906  C  CB    . ASP C 2  733  ? 11.718  -6.313  5.701    1.00 38.89  ? 733  ASP C CB    1 
ATOM   8907  C  CG    . ASP C 2  733  ? 12.177  -7.746  5.481    1.00 38.41  ? 733  ASP C CG    1 
ATOM   8908  O  OD1   . ASP C 2  733  ? 12.746  -8.347  6.417    1.00 35.60  ? 733  ASP C OD1   1 
ATOM   8909  O  OD2   . ASP C 2  733  ? 11.966  -8.273  4.368    1.00 38.53  ? 733  ASP C OD2   1 
ATOM   8910  N  N     . ALA C 2  734  ? 10.327  -4.353  8.415    1.00 34.65  ? 734  ALA C N     1 
ATOM   8911  C  CA    . ALA C 2  734  ? 9.714   -3.059  8.690    1.00 33.78  ? 734  ALA C CA    1 
ATOM   8912  C  C     . ALA C 2  734  ? 10.749  -2.100  9.270    1.00 34.37  ? 734  ALA C C     1 
ATOM   8913  O  O     . ALA C 2  734  ? 11.759  -2.530  9.824    1.00 34.76  ? 734  ALA C O     1 
ATOM   8914  C  CB    . ALA C 2  734  ? 8.536   -3.217  9.633    1.00 31.78  ? 734  ALA C CB    1 
ATOM   8915  N  N     . ILE C 2  735  ? 10.491  -0.801  9.144    1.00 31.00  ? 735  ILE C N     1 
ATOM   8916  C  CA    . ILE C 2  735  ? 11.474  0.216   9.515    1.00 30.33  ? 735  ILE C CA    1 
ATOM   8917  C  C     . ILE C 2  735  ? 10.924  1.232   10.519   1.00 29.72  ? 735  ILE C C     1 
ATOM   8918  O  O     . ILE C 2  735  ? 9.803   1.717   10.378   1.00 30.74  ? 735  ILE C O     1 
ATOM   8919  C  CB    . ILE C 2  735  ? 11.986  0.963   8.262    1.00 30.22  ? 735  ILE C CB    1 
ATOM   8920  C  CG1   . ILE C 2  735  ? 12.657  -0.020  7.298    1.00 30.00  ? 735  ILE C CG1   1 
ATOM   8921  C  CG2   . ILE C 2  735  ? 12.948  2.079   8.645    1.00 26.99  ? 735  ILE C CG2   1 
ATOM   8922  C  CD1   . ILE C 2  735  ? 13.233  0.624   6.056    1.00 29.30  ? 735  ILE C CD1   1 
ATOM   8923  N  N     . ILE C 2  736  ? 11.721  1.538   11.537   1.00 29.89  ? 736  ILE C N     1 
ATOM   8924  C  CA    . ILE C 2  736  ? 11.339  2.514   12.550   1.00 30.84  ? 736  ILE C CA    1 
ATOM   8925  C  C     . ILE C 2  736  ? 12.115  3.812   12.341   1.00 33.89  ? 736  ILE C C     1 
ATOM   8926  O  O     . ILE C 2  736  ? 13.294  3.780   11.993   1.00 33.99  ? 736  ILE C O     1 
ATOM   8927  C  CB    . ILE C 2  736  ? 11.597  1.976   13.969   1.00 32.58  ? 736  ILE C CB    1 
ATOM   8928  C  CG1   . ILE C 2  736  ? 11.250  0.488   14.040   1.00 30.03  ? 736  ILE C CG1   1 
ATOM   8929  C  CG2   . ILE C 2  736  ? 10.806  2.772   14.996   1.00 33.46  ? 736  ILE C CG2   1 
ATOM   8930  C  CD1   . ILE C 2  736  ? 11.493  -0.139  15.394   1.00 37.20  ? 736  ILE C CD1   1 
ATOM   8931  N  N     . LEU C 2  737  ? 11.456  4.950   12.547   1.00 34.83  ? 737  LEU C N     1 
ATOM   8932  C  CA    . LEU C 2  737  ? 12.097  6.245   12.316   1.00 34.54  ? 737  LEU C CA    1 
ATOM   8933  C  C     . LEU C 2  737  ? 12.045  7.182   13.514   1.00 35.40  ? 737  LEU C C     1 
ATOM   8934  O  O     . LEU C 2  737  ? 11.073  7.195   14.267   1.00 36.20  ? 737  LEU C O     1 
ATOM   8935  C  CB    . LEU C 2  737  ? 11.464  6.952   11.116   1.00 33.68  ? 737  LEU C CB    1 
ATOM   8936  C  CG    . LEU C 2  737  ? 11.823  6.412   9.733    1.00 34.48  ? 737  LEU C CG    1 
ATOM   8937  C  CD1   . LEU C 2  737  ? 11.411  7.406   8.649    1.00 39.41  ? 737  LEU C CD1   1 
ATOM   8938  C  CD2   . LEU C 2  737  ? 13.311  6.093   9.649    1.00 34.84  ? 737  LEU C CD2   1 
ATOM   8939  N  N     . SER C 2  738  ? 13.107  7.964   13.677   1.00 37.36  ? 738  SER C N     1 
ATOM   8940  C  CA    . SER C 2  738  ? 13.116  9.053   14.641   1.00 38.57  ? 738  SER C CA    1 
ATOM   8941  C  C     . SER C 2  738  ? 12.271  10.190  14.094   1.00 37.71  ? 738  SER C C     1 
ATOM   8942  O  O     . SER C 2  738  ? 12.329  10.494  12.903   1.00 37.07  ? 738  SER C O     1 
ATOM   8943  C  CB    . SER C 2  738  ? 14.544  9.527   14.921   1.00 39.38  ? 738  SER C CB    1 
ATOM   8944  O  OG    . SER C 2  738  ? 14.559  10.610  15.835   1.00 44.32  ? 738  SER C OG    1 
ATOM   8945  N  N     . ASN C 2  739  ? 11.487  10.820  14.963   1.00 39.39  ? 739  ASN C N     1 
ATOM   8946  C  CA    . ASN C 2  739  ? 10.616  11.910  14.543   1.00 39.03  ? 739  ASN C CA    1 
ATOM   8947  C  C     . ASN C 2  739  ? 11.417  13.127  14.105   1.00 40.19  ? 739  ASN C C     1 
ATOM   8948  O  O     . ASN C 2  739  ? 10.879  14.043  13.488   1.00 40.34  ? 739  ASN C O     1 
ATOM   8949  C  CB    . ASN C 2  739  ? 9.651   12.289  15.666   1.00 41.89  ? 739  ASN C CB    1 
ATOM   8950  C  CG    . ASN C 2  739  ? 8.392   12.952  15.148   1.00 39.48  ? 739  ASN C CG    1 
ATOM   8951  O  OD1   . ASN C 2  739  ? 8.165   13.016  13.939   1.00 36.27  ? 739  ASN C OD1   1 
ATOM   8952  N  ND2   . ASN C 2  739  ? 7.560   13.441  16.060   1.00 45.20  ? 739  ASN C ND2   1 
ATOM   8953  N  N     . ARG C 2  740  ? 12.707  13.115  14.434   1.00 42.64  ? 740  ARG C N     1 
ATOM   8954  C  CA    . ARG C 2  740  ? 13.656  14.140  14.009   1.00 44.24  ? 740  ARG C CA    1 
ATOM   8955  C  C     . ARG C 2  740  ? 13.665  14.297  12.491   1.00 43.04  ? 740  ARG C C     1 
ATOM   8956  O  O     . ARG C 2  740  ? 13.855  15.397  11.972   1.00 41.83  ? 740  ARG C O     1 
ATOM   8957  C  CB    . ARG C 2  740  ? 15.067  13.792  14.496   1.00 51.23  ? 740  ARG C CB    1 
ATOM   8958  C  CG    . ARG C 2  740  ? 16.121  14.859  14.218   1.00 49.37  ? 740  ARG C CG    1 
ATOM   8959  C  CD    . ARG C 2  740  ? 17.527  14.326  14.447   1.00 44.53  ? 740  ARG C CD    1 
ATOM   8960  N  NE    . ARG C 2  740  ? 17.949  13.426  13.375   1.00 42.82  ? 740  ARG C NE    1 
ATOM   8961  C  CZ    . ARG C 2  740  ? 18.656  13.808  12.316   1.00 46.49  ? 740  ARG C CZ    1 
ATOM   8962  N  NH1   . ARG C 2  740  ? 19.025  15.077  12.196   1.00 47.74  ? 740  ARG C NH1   1 
ATOM   8963  N  NH2   . ARG C 2  740  ? 19.001  12.924  11.385   1.00 45.61  ? 740  ARG C NH2   1 
ATOM   8964  N  N     . LEU C 2  741  ? 13.457  13.189  11.787   1.00 43.84  ? 741  LEU C N     1 
ATOM   8965  C  CA    . LEU C 2  741  ? 13.493  13.177  10.329   1.00 40.35  ? 741  LEU C CA    1 
ATOM   8966  C  C     . LEU C 2  741  ? 12.259  13.856  9.730    1.00 42.68  ? 741  LEU C C     1 
ATOM   8967  O  O     . LEU C 2  741  ? 12.254  14.237  8.558    1.00 42.03  ? 741  LEU C O     1 
ATOM   8968  C  CB    . LEU C 2  741  ? 13.609  11.741  9.820    1.00 37.52  ? 741  LEU C CB    1 
ATOM   8969  C  CG    . LEU C 2  741  ? 14.668  10.898  10.531   1.00 38.76  ? 741  LEU C CG    1 
ATOM   8970  C  CD1   . LEU C 2  741  ? 14.689  9.480   9.989    1.00 37.87  ? 741  LEU C CD1   1 
ATOM   8971  C  CD2   . LEU C 2  741  ? 16.044  11.538  10.415   1.00 42.01  ? 741  LEU C CD2   1 
ATOM   8972  N  N     . VAL C 2  742  ? 11.214  13.997  10.539   1.00 41.78  ? 742  VAL C N     1 
ATOM   8973  C  CA    . VAL C 2  742  ? 10.014  14.715  10.130   1.00 37.58  ? 742  VAL C CA    1 
ATOM   8974  C  C     . VAL C 2  742  ? 10.118  16.197  10.488   1.00 39.95  ? 742  VAL C C     1 
ATOM   8975  O  O     . VAL C 2  742  ? 9.800   17.069  9.679    1.00 40.65  ? 742  VAL C O     1 
ATOM   8976  C  CB    . VAL C 2  742  ? 8.760   14.117  10.788   1.00 35.57  ? 742  VAL C CB    1 
ATOM   8977  C  CG1   . VAL C 2  742  ? 7.525   14.923  10.415   1.00 44.03  ? 742  VAL C CG1   1 
ATOM   8978  C  CG2   . VAL C 2  742  ? 8.601   12.665  10.387   1.00 37.61  ? 742  VAL C CG2   1 
ATOM   8979  N  N     . GLU C 2  743  ? 10.579  16.465  11.706   1.00 41.67  ? 743  GLU C N     1 
ATOM   8980  C  CA    . GLU C 2  743  ? 10.701  17.825  12.223   1.00 45.58  ? 743  GLU C CA    1 
ATOM   8981  C  C     . GLU C 2  743  ? 11.754  18.640  11.471   1.00 41.72  ? 743  GLU C C     1 
ATOM   8982  O  O     . GLU C 2  743  ? 11.595  19.844  11.271   1.00 38.21  ? 743  GLU C O     1 
ATOM   8983  C  CB    . GLU C 2  743  ? 11.037  17.790  13.722   1.00 52.64  ? 743  GLU C CB    1 
ATOM   8984  C  CG    . GLU C 2  743  ? 10.040  17.010  14.581   1.00 51.85  ? 743  GLU C CG    1 
ATOM   8985  C  CD    . GLU C 2  743  ? 10.526  16.789  16.009   1.00 49.81  ? 743  GLU C CD    1 
ATOM   8986  O  OE1   . GLU C 2  743  ? 11.721  17.027  16.282   1.00 48.00  ? 743  GLU C OE1   1 
ATOM   8987  O  OE2   . GLU C 2  743  ? 9.711   16.379  16.862   1.00 49.77  ? 743  GLU C OE2   1 
ATOM   8988  N  N     . GLU C 2  744  ? 12.825  17.972  11.055   1.00 39.34  ? 744  GLU C N     1 
ATOM   8989  C  CA    . GLU C 2  744  ? 13.937  18.637  10.383   1.00 41.80  ? 744  GLU C CA    1 
ATOM   8990  C  C     . GLU C 2  744  ? 13.887  18.475  8.866    1.00 39.83  ? 744  GLU C C     1 
ATOM   8991  O  O     . GLU C 2  744  ? 14.835  18.839  8.171    1.00 37.27  ? 744  GLU C O     1 
ATOM   8992  C  CB    . GLU C 2  744  ? 15.276  18.103  10.905   1.00 44.91  ? 744  GLU C CB    1 
ATOM   8993  C  CG    . GLU C 2  744  ? 15.643  18.556  12.313   1.00 54.40  ? 744  GLU C CG    1 
ATOM   8994  C  CD    . GLU C 2  744  ? 17.043  18.119  12.732   1.00 65.98  ? 744  GLU C CD    1 
ATOM   8995  O  OE1   . GLU C 2  744  ? 17.693  17.365  11.974   1.00 68.67  ? 744  GLU C OE1   1 
ATOM   8996  O  OE2   . GLU C 2  744  ? 17.495  18.532  13.822   1.00 81.96  ? 744  GLU C OE2   1 
ATOM   8997  N  N     . ASP C 2  745  ? 12.786  17.924  8.361    1.00 38.05  ? 745  ASP C N     1 
ATOM   8998  C  CA    . ASP C 2  745  ? 12.609  17.709  6.923    1.00 37.87  ? 745  ASP C CA    1 
ATOM   8999  C  C     . ASP C 2  745  ? 13.745  16.883  6.317    1.00 36.05  ? 745  ASP C C     1 
ATOM   9000  O  O     . ASP C 2  745  ? 14.091  17.058  5.149    1.00 35.15  ? 745  ASP C O     1 
ATOM   9001  C  CB    . ASP C 2  745  ? 12.497  19.051  6.182    1.00 40.43  ? 745  ASP C CB    1 
ATOM   9002  C  CG    . ASP C 2  745  ? 11.128  19.695  6.331    1.00 41.07  ? 745  ASP C CG    1 
ATOM   9003  O  OD1   . ASP C 2  745  ? 10.131  18.950  6.434    1.00 39.11  ? 745  ASP C OD1   1 
ATOM   9004  O  OD2   . ASP C 2  745  ? 11.055  20.944  6.338    1.00 50.00  ? 745  ASP C OD2   1 
ATOM   9005  N  N     . VAL C 2  746  ? 14.318  15.986  7.113    1.00 36.60  ? 746  VAL C N     1 
ATOM   9006  C  CA    . VAL C 2  746  ? 15.475  15.202  6.685    1.00 37.98  ? 746  VAL C CA    1 
ATOM   9007  C  C     . VAL C 2  746  ? 15.142  14.287  5.511    1.00 36.17  ? 746  VAL C C     1 
ATOM   9008  O  O     . VAL C 2  746  ? 15.921  14.163  4.565    1.00 37.81  ? 746  VAL C O     1 
ATOM   9009  C  CB    . VAL C 2  746  ? 16.034  14.346  7.840    1.00 39.91  ? 746  VAL C CB    1 
ATOM   9010  C  CG1   . VAL C 2  746  ? 17.273  13.579  7.389    1.00 38.82  ? 746  VAL C CG1   1 
ATOM   9011  C  CG2   . VAL C 2  746  ? 16.355  15.222  9.039    1.00 43.66  ? 746  VAL C CG2   1 
ATOM   9012  N  N     . LEU C 2  747  ? 13.980  13.649  5.577    1.00 30.61  ? 747  LEU C N     1 
ATOM   9013  C  CA    . LEU C 2  747  ? 13.543  12.746  4.521    1.00 28.38  ? 747  LEU C CA    1 
ATOM   9014  C  C     . LEU C 2  747  ? 12.324  13.288  3.785    1.00 29.77  ? 747  LEU C C     1 
ATOM   9015  O  O     . LEU C 2  747  ? 11.463  12.525  3.351    1.00 32.29  ? 747  LEU C O     1 
ATOM   9016  C  CB    . LEU C 2  747  ? 13.235  11.364  5.100    1.00 28.13  ? 747  LEU C CB    1 
ATOM   9017  C  CG    . LEU C 2  747  ? 14.430  10.444  5.339    1.00 25.13  ? 747  LEU C CG    1 
ATOM   9018  C  CD1   . LEU C 2  747  ? 14.091  9.383   6.366    1.00 25.42  ? 747  LEU C CD1   1 
ATOM   9019  C  CD2   . LEU C 2  747  ? 14.847  9.805   4.030    1.00 23.33  ? 747  LEU C CD2   1 
ATOM   9020  N  N     . THR C 2  748  ? 12.258  14.607  3.643    1.00 30.79  ? 748  THR C N     1 
ATOM   9021  C  CA    . THR C 2  748  ? 11.136  15.249  2.967    1.00 33.24  ? 748  THR C CA    1 
ATOM   9022  C  C     . THR C 2  748  ? 11.475  15.547  1.504    1.00 34.36  ? 748  THR C C     1 
ATOM   9023  O  O     . THR C 2  748  ? 12.602  15.924  1.187    1.00 34.76  ? 748  THR C O     1 
ATOM   9024  C  CB    . THR C 2  748  ? 10.733  16.548  3.691    1.00 34.89  ? 748  THR C CB    1 
ATOM   9025  O  OG1   . THR C 2  748  ? 10.447  16.254  5.064    1.00 36.66  ? 748  THR C OG1   1 
ATOM   9026  C  CG2   . THR C 2  748  ? 9.507   17.173  3.051    1.00 32.78  ? 748  THR C CG2   1 
ATOM   9027  N  N     . SER C 2  749  ? 10.504  15.365  0.615    1.00 29.26  ? 749  SER C N     1 
ATOM   9028  C  CA    . SER C 2  749  ? 10.717  15.613  -0.808   1.00 28.51  ? 749  SER C CA    1 
ATOM   9029  C  C     . SER C 2  749  ? 9.695   16.591  -1.377   1.00 27.95  ? 749  SER C C     1 
ATOM   9030  O  O     . SER C 2  749  ? 8.744   16.969  -0.697   1.00 31.00  ? 749  SER C O     1 
ATOM   9031  C  CB    . SER C 2  749  ? 10.662  14.302  -1.586   1.00 26.76  ? 749  SER C CB    1 
ATOM   9032  O  OG    . SER C 2  749  ? 9.392   13.693  -1.451   1.00 23.86  ? 749  SER C OG    1 
ATOM   9033  N  N     . ILE C 2  750  ? 9.904   17.001  -2.625   1.00 28.14  ? 750  ILE C N     1 
ATOM   9034  C  CA    . ILE C 2  750  ? 8.975   17.884  -3.323   1.00 28.65  ? 750  ILE C CA    1 
ATOM   9035  C  C     . ILE C 2  750  ? 8.405   17.166  -4.543   1.00 29.55  ? 750  ILE C C     1 
ATOM   9036  O  O     . ILE C 2  750  ? 9.132   16.467  -5.247   1.00 30.82  ? 750  ILE C O     1 
ATOM   9037  C  CB    . ILE C 2  750  ? 9.656   19.193  -3.772   1.00 27.83  ? 750  ILE C CB    1 
ATOM   9038  C  CG1   . ILE C 2  750  ? 10.509  19.775  -2.643   1.00 27.34  ? 750  ILE C CG1   1 
ATOM   9039  C  CG2   . ILE C 2  750  ? 8.622   20.199  -4.249   1.00 29.30  ? 750  ILE C CG2   1 
ATOM   9040  C  CD1   . ILE C 2  750  ? 11.271  21.025  -3.035   1.00 29.68  ? 750  ILE C CD1   1 
ATOM   9041  N  N     . HIS C 2  751  ? 7.110   17.330  -4.793   1.00 27.86  ? 751  HIS C N     1 
ATOM   9042  C  CA    . HIS C 2  751  ? 6.471   16.656  -5.919   1.00 27.33  ? 751  HIS C CA    1 
ATOM   9043  C  C     . HIS C 2  751  ? 5.514   17.577  -6.668   1.00 26.12  ? 751  HIS C C     1 
ATOM   9044  O  O     . HIS C 2  751  ? 4.657   18.224  -6.068   1.00 26.75  ? 751  HIS C O     1 
ATOM   9045  C  CB    . HIS C 2  751  ? 5.732   15.406  -5.438   1.00 28.06  ? 751  HIS C CB    1 
ATOM   9046  C  CG    . HIS C 2  751  ? 6.616   14.418  -4.746   1.00 30.01  ? 751  HIS C CG    1 
ATOM   9047  N  ND1   . HIS C 2  751  ? 7.286   13.416  -5.416   1.00 31.67  ? 751  HIS C ND1   1 
ATOM   9048  C  CD2   . HIS C 2  751  ? 6.951   14.284  -3.441   1.00 30.77  ? 751  HIS C CD2   1 
ATOM   9049  C  CE1   . HIS C 2  751  ? 7.992   12.709  -4.555   1.00 32.26  ? 751  HIS C CE1   1 
ATOM   9050  N  NE2   . HIS C 2  751  ? 7.807   13.214  -3.348   1.00 32.81  ? 751  HIS C NE2   1 
ATOM   9051  N  N     . ILE C 2  752  ? 5.677   17.639  -7.985   1.00 23.42  ? 752  ILE C N     1 
ATOM   9052  C  CA    . ILE C 2  752  ? 4.842   18.492  -8.817   1.00 25.64  ? 752  ILE C CA    1 
ATOM   9053  C  C     . ILE C 2  752  ? 3.928   17.653  -9.702   1.00 27.24  ? 752  ILE C C     1 
ATOM   9054  O  O     . ILE C 2  752  ? 4.341   16.628  -10.243  1.00 26.76  ? 752  ILE C O     1 
ATOM   9055  C  CB    . ILE C 2  752  ? 5.689   19.425  -9.706   1.00 25.29  ? 752  ILE C CB    1 
ATOM   9056  C  CG1   . ILE C 2  752  ? 6.845   20.028  -8.907   1.00 26.08  ? 752  ILE C CG1   1 
ATOM   9057  C  CG2   . ILE C 2  752  ? 4.826   20.524  -10.299  1.00 25.78  ? 752  ILE C CG2   1 
ATOM   9058  C  CD1   . ILE C 2  752  ? 7.736   20.945  -9.723   1.00 26.13  ? 752  ILE C CD1   1 
ATOM   9059  N  N     . GLU C 2  753  ? 2.681   18.094  -9.836   1.00 32.23  ? 753  GLU C N     1 
ATOM   9060  C  CA    . GLU C 2  753  ? 1.722   17.467  -10.740  1.00 33.82  ? 753  GLU C CA    1 
ATOM   9061  C  C     . GLU C 2  753  ? 1.278   18.447  -11.824  1.00 30.62  ? 753  GLU C C     1 
ATOM   9062  O  O     . GLU C 2  753  ? 1.149   19.643  -11.568  1.00 29.08  ? 753  GLU C O     1 
ATOM   9063  C  CB    . GLU C 2  753  ? 0.505   16.953  -9.963   1.00 39.18  ? 753  GLU C CB    1 
ATOM   9064  C  CG    . GLU C 2  753  ? 0.674   15.568  -9.358   1.00 46.25  ? 753  GLU C CG    1 
ATOM   9065  C  CD    . GLU C 2  753  ? 0.516   14.451  -10.383  1.00 50.43  ? 753  GLU C CD    1 
ATOM   9066  O  OE1   . GLU C 2  753  ? -0.019  14.712  -11.483  1.00 48.62  ? 753  GLU C OE1   1 
ATOM   9067  O  OE2   . GLU C 2  753  ? 0.936   13.310  -10.089  1.00 54.92  ? 753  GLU C OE2   1 
ATOM   9068  N  N     . GLU C 2  754  ? 1.052   17.940  -13.032  1.00 32.67  ? 754  GLU C N     1 
ATOM   9069  C  CA    . GLU C 2  754  ? 0.555   18.778  -14.119  1.00 32.49  ? 754  GLU C CA    1 
ATOM   9070  C  C     . GLU C 2  754  ? -0.882  18.420  -14.485  1.00 34.78  ? 754  GLU C C     1 
ATOM   9071  O  O     . GLU C 2  754  ? -1.151  17.361  -15.057  1.00 36.39  ? 754  GLU C O     1 
ATOM   9072  C  CB    . GLU C 2  754  ? 1.446   18.662  -15.358  1.00 30.97  ? 754  GLU C CB    1 
ATOM   9073  C  CG    . GLU C 2  754  ? 0.989   19.547  -16.514  1.00 29.89  ? 754  GLU C CG    1 
ATOM   9074  C  CD    . GLU C 2  754  ? 1.686   19.222  -17.822  1.00 30.57  ? 754  GLU C CD    1 
ATOM   9075  O  OE1   . GLU C 2  754  ? 1.164   18.375  -18.579  1.00 38.61  ? 754  GLU C OE1   1 
ATOM   9076  O  OE2   . GLU C 2  754  ? 2.752   19.814  -18.096  1.00 36.58  ? 754  GLU C OE2   1 
ATOM   9077  N  N     . HIS C 2  755  ? -1.801  19.316  -14.150  1.00 29.90  ? 755  HIS C N     1 
ATOM   9078  C  CA    . HIS C 2  755  ? -3.203  19.143  -14.489  1.00 27.18  ? 755  HIS C CA    1 
ATOM   9079  C  C     . HIS C 2  755  ? -3.533  20.036  -15.667  1.00 26.00  ? 755  HIS C C     1 
ATOM   9080  O  O     . HIS C 2  755  ? -3.126  21.194  -15.701  1.00 26.15  ? 755  HIS C O     1 
ATOM   9081  C  CB    . HIS C 2  755  ? -4.088  19.472  -13.294  1.00 27.67  ? 755  HIS C CB    1 
ATOM   9082  C  CG    . HIS C 2  755  ? -3.704  18.735  -12.050  1.00 35.54  ? 755  HIS C CG    1 
ATOM   9083  N  ND1   . HIS C 2  755  ? -3.926  17.386  -11.888  1.00 46.70  ? 755  HIS C ND1   1 
ATOM   9084  C  CD2   . HIS C 2  755  ? -3.094  19.156  -10.917  1.00 37.90  ? 755  HIS C CD2   1 
ATOM   9085  C  CE1   . HIS C 2  755  ? -3.476  17.007  -10.705  1.00 49.36  ? 755  HIS C CE1   1 
ATOM   9086  N  NE2   . HIS C 2  755  ? -2.966  18.062  -10.096  1.00 46.25  ? 755  HIS C NE2   1 
ATOM   9087  N  N     . GLU C 2  756  ? -4.265  19.496  -16.635  1.00 29.03  ? 756  GLU C N     1 
ATOM   9088  C  CA    . GLU C 2  756  ? -4.475  20.187  -17.900  1.00 31.82  ? 756  GLU C CA    1 
ATOM   9089  C  C     . GLU C 2  756  ? -5.924  20.098  -18.375  1.00 31.60  ? 756  GLU C C     1 
ATOM   9090  O  O     . GLU C 2  756  ? -6.554  19.049  -18.271  1.00 32.46  ? 756  GLU C O     1 
ATOM   9091  C  CB    . GLU C 2  756  ? -3.535  19.607  -18.958  1.00 34.27  ? 756  GLU C CB    1 
ATOM   9092  C  CG    . GLU C 2  756  ? -3.413  20.429  -20.225  1.00 33.95  ? 756  GLU C CG    1 
ATOM   9093  C  CD    . GLU C 2  756  ? -2.427  19.824  -21.210  1.00 35.41  ? 756  GLU C CD    1 
ATOM   9094  O  OE1   . GLU C 2  756  ? -2.661  18.683  -21.662  1.00 37.01  ? 756  GLU C OE1   1 
ATOM   9095  O  OE2   . GLU C 2  756  ? -1.413  20.483  -21.525  1.00 33.58  ? 756  GLU C OE2   1 
ATOM   9096  N  N     . ILE C 2  757  ? -6.450  21.201  -18.896  1.00 32.14  ? 757  ILE C N     1 
ATOM   9097  C  CA    . ILE C 2  757  ? -7.794  21.194  -19.458  1.00 32.35  ? 757  ILE C CA    1 
ATOM   9098  C  C     . ILE C 2  757  ? -7.908  22.206  -20.593  1.00 34.09  ? 757  ILE C C     1 
ATOM   9099  O  O     . ILE C 2  757  ? -7.144  23.170  -20.657  1.00 33.93  ? 757  ILE C O     1 
ATOM   9100  C  CB    . ILE C 2  757  ? -8.862  21.487  -18.385  1.00 34.25  ? 757  ILE C CB    1 
ATOM   9101  C  CG1   . ILE C 2  757  ? -10.237 21.010  -18.864  1.00 37.40  ? 757  ILE C CG1   1 
ATOM   9102  C  CG2   . ILE C 2  757  ? -8.872  22.964  -18.017  1.00 35.30  ? 757  ILE C CG2   1 
ATOM   9103  C  CD1   . ILE C 2  757  ? -11.368 21.307  -17.913  1.00 43.72  ? 757  ILE C CD1   1 
ATOM   9104  N  N     . ASP C 2  758  ? -8.865  21.977  -21.487  1.00 37.45  ? 758  ASP C N     1 
ATOM   9105  C  CA    . ASP C 2  758  ? -9.026  22.803  -22.677  1.00 40.66  ? 758  ASP C CA    1 
ATOM   9106  C  C     . ASP C 2  758  ? -10.481 23.175  -22.944  1.00 42.58  ? 758  ASP C C     1 
ATOM   9107  O  O     . ASP C 2  758  ? -11.396 22.629  -22.333  1.00 43.05  ? 758  ASP C O     1 
ATOM   9108  C  CB    . ASP C 2  758  ? -8.446  22.075  -23.891  1.00 42.74  ? 758  ASP C CB    1 
ATOM   9109  C  CG    . ASP C 2  758  ? -8.925  20.635  -23.991  1.00 45.54  ? 758  ASP C CG    1 
ATOM   9110  O  OD1   . ASP C 2  758  ? -9.453  20.116  -22.983  1.00 45.19  ? 758  ASP C OD1   1 
ATOM   9111  O  OD2   . ASP C 2  758  ? -8.765  20.022  -25.069  1.00 50.37  ? 758  ASP C OD2   1 
ATOM   9112  N  N     . ALA C 2  759  ? -10.678 24.112  -23.865  1.00 44.33  ? 759  ALA C N     1 
ATOM   9113  C  CA    . ALA C 2  759  ? -12.011 24.511  -24.295  1.00 46.08  ? 759  ALA C CA    1 
ATOM   9114  C  C     . ALA C 2  759  ? -12.195 24.201  -25.777  1.00 45.40  ? 759  ALA C C     1 
ATOM   9115  O  O     . ALA C 2  759  ? -11.383 24.608  -26.608  1.00 42.88  ? 759  ALA C O     1 
ATOM   9116  C  CB    . ALA C 2  759  ? -12.240 25.985  -24.024  1.00 57.98  ? 759  ALA C CB    1 
ATOM   9117  N  N     . ARG C 2  760  ? -13.268 23.487  -26.104  1.00 49.16  ? 760  ARG C N     1 
ATOM   9118  C  CA    . ARG C 2  760  ? -13.499 23.044  -27.474  1.00 51.12  ? 760  ARG C CA    1 
ATOM   9119  C  C     . ARG C 2  760  ? -14.741 23.660  -28.102  1.00 52.64  ? 760  ARG C C     1 
ATOM   9120  O  O     . ARG C 2  760  ? -15.496 24.380  -27.449  1.00 52.24  ? 760  ARG C O     1 
ATOM   9121  C  CB    . ARG C 2  760  ? -13.624 21.522  -27.525  1.00 53.58  ? 760  ARG C CB    1 
ATOM   9122  C  CG    . ARG C 2  760  ? -12.547 20.781  -26.767  1.00 55.64  ? 760  ARG C CG    1 
ATOM   9123  C  CD    . ARG C 2  760  ? -12.749 19.282  -26.863  1.00 63.77  ? 760  ARG C CD    1 
ATOM   9124  N  NE    . ARG C 2  760  ? -12.174 18.605  -25.707  1.00 66.43  ? 760  ARG C NE    1 
ATOM   9125  C  CZ    . ARG C 2  760  ? -12.826 18.398  -24.569  1.00 66.62  ? 760  ARG C CZ    1 
ATOM   9126  N  NH1   . ARG C 2  760  ? -14.082 18.809  -24.439  1.00 64.42  ? 760  ARG C NH1   1 
ATOM   9127  N  NH2   . ARG C 2  760  ? -12.226 17.779  -23.562  1.00 66.16  ? 760  ARG C NH2   1 
ATOM   9128  N  N     . ASP C 2  761  ? -14.944 23.357  -29.380  1.00 53.34  ? 761  ASP C N     1 
ATOM   9129  C  CA    . ASP C 2  761  ? -16.156 23.744  -30.091  1.00 61.11  ? 761  ASP C CA    1 
ATOM   9130  C  C     . ASP C 2  761  ? -17.113 22.561  -30.196  1.00 69.45  ? 761  ASP C C     1 
ATOM   9131  O  O     . ASP C 2  761  ? -16.817 21.568  -30.862  1.00 73.43  ? 761  ASP C O     1 
ATOM   9132  C  CB    . ASP C 2  761  ? -15.818 24.273  -31.485  1.00 57.56  ? 761  ASP C CB    1 
ATOM   9133  C  CG    . ASP C 2  761  ? -14.929 25.504  -31.441  1.00 57.52  ? 761  ASP C CG    1 
ATOM   9134  O  OD1   . ASP C 2  761  ? -14.943 26.210  -30.410  1.00 62.13  ? 761  ASP C OD1   1 
ATOM   9135  O  OD2   . ASP C 2  761  ? -14.220 25.769  -32.437  1.00 54.61  ? 761  ASP C OD2   1 
ATOM   9136  N  N     . THR C 2  762  ? -18.261 22.666  -29.538  1.00 78.36  ? 762  THR C N     1 
ATOM   9137  C  CA    . THR C 2  762  ? -19.253 21.601  -29.588  1.00 82.04  ? 762  THR C CA    1 
ATOM   9138  C  C     . THR C 2  762  ? -20.354 21.948  -30.589  1.00 79.21  ? 762  THR C C     1 
ATOM   9139  O  O     . THR C 2  762  ? -20.220 22.889  -31.375  1.00 71.12  ? 762  THR C O     1 
ATOM   9140  C  CB    . THR C 2  762  ? -19.868 21.332  -28.199  1.00 85.58  ? 762  THR C CB    1 
ATOM   9141  O  OG1   . THR C 2  762  ? -20.872 20.315  -28.304  1.00 99.37  ? 762  THR C OG1   1 
ATOM   9142  C  CG2   . THR C 2  762  ? -20.487 22.599  -27.633  1.00 74.13  ? 762  THR C CG2   1 
ATOM   9143  N  N     . LYS C 2  763  ? -21.433 21.172  -30.568  1.00 87.60  ? 763  LYS C N     1 
ATOM   9144  C  CA    . LYS C 2  763  ? -22.565 21.400  -31.461  1.00 84.83  ? 763  LYS C CA    1 
ATOM   9145  C  C     . LYS C 2  763  ? -23.622 22.260  -30.784  1.00 82.90  ? 763  LYS C C     1 
ATOM   9146  O  O     . LYS C 2  763  ? -24.628 22.628  -31.392  1.00 82.62  ? 763  LYS C O     1 
ATOM   9147  C  CB    . LYS C 2  763  ? -23.179 20.071  -31.907  1.00 95.00  ? 763  LYS C CB    1 
ATOM   9148  C  CG    . LYS C 2  763  ? -22.253 19.231  -32.762  1.00 94.05  ? 763  LYS C CG    1 
ATOM   9149  C  CD    . LYS C 2  763  ? -21.848 19.982  -34.019  1.00 91.68  ? 763  LYS C CD    1 
ATOM   9150  C  CE    . LYS C 2  763  ? -20.701 19.287  -34.727  1.00 95.10  ? 763  LYS C CE    1 
ATOM   9151  N  NZ    . LYS C 2  763  ? -19.454 19.325  -33.913  1.00 98.17  ? 763  LYS C NZ    1 
ATOM   9152  N  N     . LEU C 2  764  ? -23.386 22.570  -29.515  1.00 83.65  ? 764  LEU C N     1 
ATOM   9153  C  CA    . LEU C 2  764  ? -24.309 23.378  -28.734  1.00 84.34  ? 764  LEU C CA    1 
ATOM   9154  C  C     . LEU C 2  764  ? -23.709 24.755  -28.497  1.00 82.64  ? 764  LEU C C     1 
ATOM   9155  O  O     . LEU C 2  764  ? -24.284 25.594  -27.803  1.00 81.07  ? 764  LEU C O     1 
ATOM   9156  C  CB    . LEU C 2  764  ? -24.625 22.687  -27.409  1.00 90.59  ? 764  LEU C CB    1 
ATOM   9157  C  CG    . LEU C 2  764  ? -25.191 21.276  -27.574  1.00 90.29  ? 764  LEU C CG    1 
ATOM   9158  C  CD1   . LEU C 2  764  ? -24.818 20.399  -26.396  1.00 84.18  ? 764  LEU C CD1   1 
ATOM   9159  C  CD2   . LEU C 2  764  ? -26.701 21.343  -27.740  1.00 93.54  ? 764  LEU C CD2   1 
ATOM   9160  N  N     . GLY C 2  765  ? -22.543 24.974  -29.092  1.00 83.35  ? 765  GLY C N     1 
ATOM   9161  C  CA    . GLY C 2  765  ? -21.814 26.215  -28.933  1.00 82.91  ? 765  GLY C CA    1 
ATOM   9162  C  C     . GLY C 2  765  ? -20.334 25.933  -28.782  1.00 79.03  ? 765  GLY C C     1 
ATOM   9163  O  O     . GLY C 2  765  ? -19.753 25.179  -29.562  1.00 80.30  ? 765  GLY C O     1 
ATOM   9164  N  N     . ALA C 2  766  ? -19.726 26.536  -27.768  1.00 72.75  ? 766  ALA C N     1 
ATOM   9165  C  CA    . ALA C 2  766  ? -18.311 26.330  -27.495  1.00 65.19  ? 766  ALA C CA    1 
ATOM   9166  C  C     . ALA C 2  766  ? -18.032 26.499  -26.012  1.00 64.94  ? 766  ALA C C     1 
ATOM   9167  O  O     . ALA C 2  766  ? -18.578 27.394  -25.368  1.00 65.35  ? 766  ALA C O     1 
ATOM   9168  C  CB    . ALA C 2  766  ? -17.465 27.293  -28.307  1.00 57.84  ? 766  ALA C CB    1 
ATOM   9169  N  N     . GLU C 2  767  ? -17.182 25.632  -25.473  1.00 62.86  ? 767  GLU C N     1 
ATOM   9170  C  CA    . GLU C 2  767  ? -16.818 25.705  -24.067  1.00 60.40  ? 767  GLU C CA    1 
ATOM   9171  C  C     . GLU C 2  767  ? -16.090 27.014  -23.777  1.00 57.55  ? 767  GLU C C     1 
ATOM   9172  O  O     . GLU C 2  767  ? -15.106 27.341  -24.439  1.00 56.62  ? 767  GLU C O     1 
ATOM   9173  C  CB    . GLU C 2  767  ? -15.937 24.515  -23.674  1.00 62.88  ? 767  GLU C CB    1 
ATOM   9174  C  CG    . GLU C 2  767  ? -16.287 23.206  -24.372  1.00 57.44  ? 767  GLU C CG    1 
ATOM   9175  C  CD    . GLU C 2  767  ? -15.433 22.044  -23.888  1.00 53.21  ? 767  GLU C CD    1 
ATOM   9176  O  OE1   . GLU C 2  767  ? -14.245 22.266  -23.574  1.00 52.88  ? 767  GLU C OE1   1 
ATOM   9177  O  OE2   . GLU C 2  767  ? -15.954 20.912  -23.809  1.00 54.37  ? 767  GLU C OE2   1 
ATOM   9178  N  N     . GLU C 2  768  ? -16.577 27.769  -22.797  1.00 54.89  ? 768  GLU C N     1 
ATOM   9179  C  CA    . GLU C 2  768  ? -15.874 28.977  -22.375  1.00 55.23  ? 768  GLU C CA    1 
ATOM   9180  C  C     . GLU C 2  768  ? -15.393 28.846  -20.933  1.00 53.14  ? 768  GLU C C     1 
ATOM   9181  O  O     . GLU C 2  768  ? -16.099 28.327  -20.068  1.00 54.06  ? 768  GLU C O     1 
ATOM   9182  C  CB    . GLU C 2  768  ? -16.755 30.226  -22.533  1.00 67.65  ? 768  GLU C CB    1 
ATOM   9183  C  CG    . GLU C 2  768  ? -17.902 30.359  -21.533  1.00 75.07  ? 768  GLU C CG    1 
ATOM   9184  C  CD    . GLU C 2  768  ? -18.083 31.786  -21.033  1.00 74.24  ? 768  GLU C CD    1 
ATOM   9185  O  OE1   . GLU C 2  768  ? -17.065 32.494  -20.870  1.00 67.31  ? 768  GLU C OE1   1 
ATOM   9186  O  OE2   . GLU C 2  768  ? -19.242 32.198  -20.805  1.00 78.17  ? 768  GLU C OE2   1 
ATOM   9187  N  N     . ILE C 2  769  ? -14.171 29.304  -20.690  1.00 51.36  ? 769  ILE C N     1 
ATOM   9188  C  CA    . ILE C 2  769  ? -13.597 29.276  -19.355  1.00 48.26  ? 769  ILE C CA    1 
ATOM   9189  C  C     . ILE C 2  769  ? -13.888 30.591  -18.650  1.00 51.84  ? 769  ILE C C     1 
ATOM   9190  O  O     . ILE C 2  769  ? -13.404 31.647  -19.057  1.00 53.79  ? 769  ILE C O     1 
ATOM   9191  C  CB    . ILE C 2  769  ? -12.083 29.019  -19.401  1.00 43.77  ? 769  ILE C CB    1 
ATOM   9192  C  CG1   . ILE C 2  769  ? -11.806 27.676  -20.078  1.00 39.42  ? 769  ILE C CG1   1 
ATOM   9193  C  CG2   . ILE C 2  769  ? -11.491 29.056  -18.003  1.00 40.55  ? 769  ILE C CG2   1 
ATOM   9194  C  CD1   . ILE C 2  769  ? -10.351 27.315  -20.142  1.00 41.67  ? 769  ILE C CD1   1 
ATOM   9195  N  N     . THR C 2  770  ? -14.694 30.524  -17.597  1.00 51.17  ? 770  THR C N     1 
ATOM   9196  C  CA    . THR C 2  770  ? -15.151 31.726  -16.915  1.00 54.84  ? 770  THR C CA    1 
ATOM   9197  C  C     . THR C 2  770  ? -15.162 31.550  -15.403  1.00 54.27  ? 770  THR C C     1 
ATOM   9198  O  O     . THR C 2  770  ? -14.920 30.457  -14.892  1.00 48.47  ? 770  THR C O     1 
ATOM   9199  C  CB    . THR C 2  770  ? -16.561 32.129  -17.387  1.00 58.56  ? 770  THR C CB    1 
ATOM   9200  O  OG1   . THR C 2  770  ? -16.911 33.405  -16.835  1.00 62.90  ? 770  THR C OG1   1 
ATOM   9201  C  CG2   . THR C 2  770  ? -17.583 31.089  -16.958  1.00 52.17  ? 770  THR C CG2   1 
ATOM   9202  N  N     . ARG C 2  771  ? -15.440 32.640  -14.696  1.00 59.54  ? 771  ARG C N     1 
ATOM   9203  C  CA    . ARG C 2  771  ? -15.508 32.620  -13.241  1.00 59.34  ? 771  ARG C CA    1 
ATOM   9204  C  C     . ARG C 2  771  ? -16.936 32.320  -12.787  1.00 62.74  ? 771  ARG C C     1 
ATOM   9205  O  O     . ARG C 2  771  ? -17.206 32.172  -11.594  1.00 63.88  ? 771  ARG C O     1 
ATOM   9206  C  CB    . ARG C 2  771  ? -15.033 33.957  -12.660  1.00 52.40  ? 771  ARG C CB    1 
ATOM   9207  C  CG    . ARG C 2  771  ? -14.688 33.911  -11.180  1.00 52.34  ? 771  ARG C CG    1 
ATOM   9208  C  CD    . ARG C 2  771  ? -14.664 35.298  -10.568  1.00 55.80  ? 771  ARG C CD    1 
ATOM   9209  N  NE    . ARG C 2  771  ? -14.286 35.253  -9.159   1.00 58.73  ? 771  ARG C NE    1 
ATOM   9210  C  CZ    . ARG C 2  771  ? -15.130 34.986  -8.168   1.00 64.75  ? 771  ARG C CZ    1 
ATOM   9211  N  NH1   . ARG C 2  771  ? -16.406 34.740  -8.431   1.00 70.53  ? 771  ARG C NH1   1 
ATOM   9212  N  NH2   . ARG C 2  771  ? -14.698 34.963  -6.914   1.00 69.41  ? 771  ARG C NH2   1 
ATOM   9213  N  N     . ASP C 2  772  ? -17.849 32.221  -13.749  1.00 63.73  ? 772  ASP C N     1 
ATOM   9214  C  CA    . ASP C 2  772  ? -19.261 32.012  -13.451  1.00 63.15  ? 772  ASP C CA    1 
ATOM   9215  C  C     . ASP C 2  772  ? -19.676 30.563  -13.693  1.00 63.55  ? 772  ASP C C     1 
ATOM   9216  O  O     . ASP C 2  772  ? -20.013 30.182  -14.814  1.00 64.75  ? 772  ASP C O     1 
ATOM   9217  C  CB    . ASP C 2  772  ? -20.128 32.956  -14.291  1.00 67.77  ? 772  ASP C CB    1 
ATOM   9218  C  CG    . ASP C 2  772  ? -21.565 33.026  -13.801  1.00 69.56  ? 772  ASP C CG    1 
ATOM   9219  O  OD1   . ASP C 2  772  ? -22.403 32.235  -14.286  1.00 75.25  ? 772  ASP C OD1   1 
ATOM   9220  O  OD2   . ASP C 2  772  ? -21.857 33.877  -12.934  1.00 67.82  ? 772  ASP C OD2   1 
ATOM   9221  N  N     . ILE C 2  773  ? -19.647 29.763  -12.631  1.00 68.34  ? 773  ILE C N     1 
ATOM   9222  C  CA    . ILE C 2  773  ? -20.078 28.370  -12.692  1.00 71.14  ? 773  ILE C CA    1 
ATOM   9223  C  C     . ILE C 2  773  ? -21.426 28.196  -11.993  1.00 72.99  ? 773  ILE C C     1 
ATOM   9224  O  O     . ILE C 2  773  ? -21.588 28.607  -10.843  1.00 79.07  ? 773  ILE C O     1 
ATOM   9225  C  CB    . ILE C 2  773  ? -19.036 27.425  -12.054  1.00 73.17  ? 773  ILE C CB    1 
ATOM   9226  C  CG1   . ILE C 2  773  ? -17.719 27.480  -12.830  1.00 72.21  ? 773  ILE C CG1   1 
ATOM   9227  C  CG2   . ILE C 2  773  ? -19.558 25.993  -12.009  1.00 78.73  ? 773  ILE C CG2   1 
ATOM   9228  C  CD1   . ILE C 2  773  ? -16.674 26.502  -12.333  1.00 65.91  ? 773  ILE C CD1   1 
ATOM   9229  N  N     . PRO C 2  774  ? -22.399 27.591  -12.697  1.00 72.26  ? 774  PRO C N     1 
ATOM   9230  C  CA    . PRO C 2  774  ? -23.774 27.365  -12.231  1.00 81.00  ? 774  PRO C CA    1 
ATOM   9231  C  C     . PRO C 2  774  ? -23.866 26.762  -10.824  1.00 86.36  ? 774  PRO C C     1 
ATOM   9232  O  O     . PRO C 2  774  ? -23.227 25.747  -10.549  1.00 86.31  ? 774  PRO C O     1 
ATOM   9233  C  CB    . PRO C 2  774  ? -24.330 26.391  -13.273  1.00 80.42  ? 774  PRO C CB    1 
ATOM   9234  C  CG    . PRO C 2  774  ? -23.573 26.712  -14.512  1.00 70.49  ? 774  PRO C CG    1 
ATOM   9235  C  CD    . PRO C 2  774  ? -22.196 27.094  -14.070  1.00 64.37  ? 774  PRO C CD    1 
ATOM   9236  N  N     . ASN C 2  775  ? -24.651 27.400  -9.957   1.00 87.05  ? 775  ASN C N     1 
ATOM   9237  C  CA    . ASN C 2  775  ? -24.901 26.934  -8.588   1.00 87.74  ? 775  ASN C CA    1 
ATOM   9238  C  C     . ASN C 2  775  ? -23.646 26.662  -7.757   1.00 78.03  ? 775  ASN C C     1 
ATOM   9239  O  O     . ASN C 2  775  ? -23.515 25.606  -7.136   1.00 72.88  ? 775  ASN C O     1 
ATOM   9240  C  CB    . ASN C 2  775  ? -25.774 25.677  -8.618   1.00 98.84  ? 775  ASN C CB    1 
ATOM   9241  C  CG    . ASN C 2  775  ? -27.125 25.923  -9.265   1.00 104.34 ? 775  ASN C CG    1 
ATOM   9242  O  OD1   . ASN C 2  775  ? -27.723 26.988  -9.096   1.00 105.36 ? 775  ASN C OD1   1 
ATOM   9243  N  ND2   . ASN C 2  775  ? -27.609 24.940  -10.018  1.00 113.32 ? 775  ASN C ND2   1 
ATOM   9244  N  N     . ILE C 2  776  ? -22.731 27.627  -7.749   1.00 75.75  ? 776  ILE C N     1 
ATOM   9245  C  CA    . ILE C 2  776  ? -21.538 27.568  -6.908   1.00 71.13  ? 776  ILE C CA    1 
ATOM   9246  C  C     . ILE C 2  776  ? -21.371 28.880  -6.135   1.00 69.32  ? 776  ILE C C     1 
ATOM   9247  O  O     . ILE C 2  776  ? -21.328 29.956  -6.732   1.00 67.39  ? 776  ILE C O     1 
ATOM   9248  C  CB    . ILE C 2  776  ? -20.270 27.295  -7.742   1.00 68.17  ? 776  ILE C CB    1 
ATOM   9249  C  CG1   . ILE C 2  776  ? -20.388 25.962  -8.486   1.00 69.61  ? 776  ILE C CG1   1 
ATOM   9250  C  CG2   . ILE C 2  776  ? -19.037 27.302  -6.855   1.00 71.19  ? 776  ILE C CG2   1 
ATOM   9251  C  CD1   . ILE C 2  776  ? -20.446 24.751  -7.575   1.00 73.18  ? 776  ILE C CD1   1 
ATOM   9252  N  N     . SER C 2  777  ? -21.278 28.786  -4.810   1.00 71.45  ? 777  SER C N     1 
ATOM   9253  C  CA    . SER C 2  777  ? -21.179 29.967  -3.953   1.00 71.05  ? 777  SER C CA    1 
ATOM   9254  C  C     . SER C 2  777  ? -19.899 30.753  -4.208   1.00 73.34  ? 777  SER C C     1 
ATOM   9255  O  O     . SER C 2  777  ? -18.987 30.268  -4.873   1.00 72.28  ? 777  SER C O     1 
ATOM   9256  C  CB    . SER C 2  777  ? -21.242 29.566  -2.480   1.00 72.00  ? 777  SER C CB    1 
ATOM   9257  O  OG    . SER C 2  777  ? -20.003 29.028  -2.050   1.00 71.77  ? 777  SER C OG    1 
ATOM   9258  N  N     . ASP C 2  778  ? -19.831 31.966  -3.667   1.00 76.85  ? 778  ASP C N     1 
ATOM   9259  C  CA    . ASP C 2  778  ? -18.643 32.802  -3.819   1.00 81.82  ? 778  ASP C CA    1 
ATOM   9260  C  C     . ASP C 2  778  ? -17.557 32.410  -2.815   1.00 81.63  ? 778  ASP C C     1 
ATOM   9261  O  O     . ASP C 2  778  ? -16.518 33.070  -2.717   1.00 83.81  ? 778  ASP C O     1 
ATOM   9262  C  CB    . ASP C 2  778  ? -19.002 34.283  -3.663   1.00 92.82  ? 778  ASP C CB    1 
ATOM   9263  C  CG    . ASP C 2  778  ? -19.950 34.773  -4.749   1.00 90.48  ? 778  ASP C CG    1 
ATOM   9264  O  OD1   . ASP C 2  778  ? -19.954 34.181  -5.851   1.00 86.14  ? 778  ASP C OD1   1 
ATOM   9265  O  OD2   . ASP C 2  778  ? -20.693 35.749  -4.501   1.00 88.25  ? 778  ASP C OD2   1 
ATOM   9266  N  N     . GLU C 2  779  ? -17.805 31.329  -2.077   1.00 82.05  ? 779  GLU C N     1 
ATOM   9267  C  CA    . GLU C 2  779  ? -16.829 30.790  -1.132   1.00 85.19  ? 779  GLU C CA    1 
ATOM   9268  C  C     . GLU C 2  779  ? -15.926 29.760  -1.810   1.00 81.01  ? 779  GLU C C     1 
ATOM   9269  O  O     . GLU C 2  779  ? -14.729 29.680  -1.526   1.00 82.61  ? 779  GLU C O     1 
ATOM   9270  C  CB    . GLU C 2  779  ? -17.529 30.157  0.073    1.00 86.40  ? 779  GLU C CB    1 
ATOM   9271  C  CG    . GLU C 2  779  ? -18.372 31.122  0.893    1.00 96.98  ? 779  GLU C CG    1 
ATOM   9272  C  CD    . GLU C 2  779  ? -18.808 30.530  2.225    1.00 119.81 ? 779  GLU C CD    1 
ATOM   9273  O  OE1   . GLU C 2  779  ? -18.234 29.499  2.636    1.00 126.80 ? 779  GLU C OE1   1 
ATOM   9274  O  OE2   . GLU C 2  779  ? -19.726 31.095  2.857    1.00 135.62 ? 779  GLU C OE2   1 
ATOM   9275  N  N     . VAL C 2  780  ? -16.510 28.978  -2.713   1.00 75.82  ? 780  VAL C N     1 
ATOM   9276  C  CA    . VAL C 2  780  ? -15.761 27.994  -3.486   1.00 69.20  ? 780  VAL C CA    1 
ATOM   9277  C  C     . VAL C 2  780  ? -15.009 28.677  -4.633   1.00 69.82  ? 780  VAL C C     1 
ATOM   9278  O  O     . VAL C 2  780  ? -13.957 28.208  -5.069   1.00 75.80  ? 780  VAL C O     1 
ATOM   9279  C  CB    . VAL C 2  780  ? -16.691 26.896  -4.047   1.00 62.28  ? 780  VAL C CB    1 
ATOM   9280  C  CG1   . VAL C 2  780  ? -15.885 25.794  -4.723   1.00 55.59  ? 780  VAL C CG1   1 
ATOM   9281  C  CG2   . VAL C 2  780  ? -17.549 26.309  -2.937   1.00 65.93  ? 780  VAL C CG2   1 
ATOM   9282  N  N     . LEU C 2  781  ? -15.546 29.798  -5.107   1.00 71.34  ? 781  LEU C N     1 
ATOM   9283  C  CA    . LEU C 2  781  ? -14.916 30.558  -6.183   1.00 65.12  ? 781  LEU C CA    1 
ATOM   9284  C  C     . LEU C 2  781  ? -13.874 31.544  -5.647   1.00 63.74  ? 781  LEU C C     1 
ATOM   9285  O  O     . LEU C 2  781  ? -13.268 32.299  -6.411   1.00 63.05  ? 781  LEU C O     1 
ATOM   9286  C  CB    . LEU C 2  781  ? -15.974 31.315  -6.987   1.00 61.02  ? 781  LEU C CB    1 
ATOM   9287  C  CG    . LEU C 2  781  ? -17.143 30.512  -7.557   1.00 59.04  ? 781  LEU C CG    1 
ATOM   9288  C  CD1   . LEU C 2  781  ? -18.157 31.445  -8.189   1.00 62.91  ? 781  LEU C CD1   1 
ATOM   9289  C  CD2   . LEU C 2  781  ? -16.660 29.493  -8.569   1.00 53.46  ? 781  LEU C CD2   1 
ATOM   9290  N  N     . ALA C 2  782  ? -13.667 31.520  -4.333   1.00 64.78  ? 782  ALA C N     1 
ATOM   9291  C  CA    . ALA C 2  782  ? -12.841 32.513  -3.647   1.00 64.88  ? 782  ALA C CA    1 
ATOM   9292  C  C     . ALA C 2  782  ? -11.391 32.552  -4.132   1.00 62.44  ? 782  ALA C C     1 
ATOM   9293  O  O     . ALA C 2  782  ? -10.794 33.624  -4.223   1.00 61.91  ? 782  ALA C O     1 
ATOM   9294  C  CB    . ALA C 2  782  ? -12.878 32.267  -2.143   1.00 68.52  ? 782  ALA C CB    1 
ATOM   9295  N  N     . ASP C 2  783  ? -10.830 31.389  -4.447   1.00 58.15  ? 783  ASP C N     1 
ATOM   9296  C  CA    . ASP C 2  783  ? -9.421  31.300  -4.821   1.00 55.43  ? 783  ASP C CA    1 
ATOM   9297  C  C     . ASP C 2  783  ? -9.183  31.517  -6.317   1.00 49.71  ? 783  ASP C C     1 
ATOM   9298  O  O     . ASP C 2  783  ? -8.078  31.297  -6.812   1.00 43.90  ? 783  ASP C O     1 
ATOM   9299  C  CB    . ASP C 2  783  ? -8.847  29.942  -4.399   1.00 54.58  ? 783  ASP C CB    1 
ATOM   9300  C  CG    . ASP C 2  783  ? -8.615  29.840  -2.899   1.00 59.84  ? 783  ASP C CG    1 
ATOM   9301  O  OD1   . ASP C 2  783  ? -8.815  28.743  -2.337   1.00 61.74  ? 783  ASP C OD1   1 
ATOM   9302  O  OD2   . ASP C 2  783  ? -8.229  30.855  -2.282   1.00 65.15  ? 783  ASP C OD2   1 
ATOM   9303  N  N     . LEU C 2  784  ? -10.214 31.957  -7.031   1.00 50.61  ? 784  LEU C N     1 
ATOM   9304  C  CA    . LEU C 2  784  ? -10.113 32.161  -8.474   1.00 46.94  ? 784  LEU C CA    1 
ATOM   9305  C  C     . LEU C 2  784  ? -9.950  33.637  -8.829   1.00 48.37  ? 784  LEU C C     1 
ATOM   9306  O  O     . LEU C 2  784  ? -10.369 34.513  -8.074   1.00 50.66  ? 784  LEU C O     1 
ATOM   9307  C  CB    . LEU C 2  784  ? -11.348 31.596  -9.175   1.00 46.11  ? 784  LEU C CB    1 
ATOM   9308  C  CG    . LEU C 2  784  ? -11.733 30.171  -8.783   1.00 44.62  ? 784  LEU C CG    1 
ATOM   9309  C  CD1   . LEU C 2  784  ? -12.925 29.697  -9.594   1.00 57.02  ? 784  LEU C CD1   1 
ATOM   9310  C  CD2   . LEU C 2  784  ? -10.554 29.247  -8.974   1.00 39.58  ? 784  LEU C CD2   1 
ATOM   9311  N  N     . ASP C 2  785  ? -9.344  33.908  -9.983   1.00 46.81  ? 785  ASP C N     1 
ATOM   9312  C  CA    . ASP C 2  785  ? -9.244  35.277  -10.486  1.00 47.05  ? 785  ASP C CA    1 
ATOM   9313  C  C     . ASP C 2  785  ? -10.488 35.642  -11.294  1.00 45.37  ? 785  ASP C C     1 
ATOM   9314  O  O     . ASP C 2  785  ? -11.552 35.061  -11.097  1.00 45.88  ? 785  ASP C O     1 
ATOM   9315  C  CB    . ASP C 2  785  ? -7.977  35.464  -11.332  1.