data_5ULW
# 
_entry.id   5ULW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ULW         
WWPDB D_1000226090 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5ULX 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ULW 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jain, R.'       1 ? 
'Aggarwal, A.K.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                43904 
_citation.page_last                 43904 
_citation.title                     
'Mechanism of error-free DNA synthesis across N1-methyl-deoxyadenosine by human DNA polymerase-iota.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/srep43904 
_citation.pdbx_database_id_PubMed   28272441 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jain, R.'        1 ? 
primary 'Choudhury, J.R.' 2 ? 
primary 'Buku, A.'        3 ? 
primary 'Johnson, R.E.'   4 ? 
primary 'Prakash, L.'     5 ? 
primary 'Prakash, S.'     6 ? 
primary 'Aggarwal, A.K.'  7 ? 
# 
_cell.entry_id           5ULW 
_cell.length_a           97.918 
_cell.length_b           97.918 
_cell.length_c           202.473 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5ULW 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*AP*GP*GP*AP*CP*CP*(DOC))-3')
;
2091.414  1  ?       ? ? ? 
2 polymer     syn 
;DNA (5'-D(*TP*(MA7)P*GP*GP*GP*TP*CP*CP*T)-3')
;
3355.217  1  ?       ? ? ? 
3 polymer     man 'DNA polymerase iota'                           47027.344 1  2.7.7.7 ? ? ? 
4 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"                     482.168   1  ?       ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                 24.305    1  ?       ? ? ? 
6 non-polymer syn 'CHLORIDE ION'                                  35.453    1  ?       ? ? ? 
7 water       nat water                                           18.015    87 ?       ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Eta2,RAD30 homolog B' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DA)(DG)(DG)(DA)(DC)(DC)(DOC)' AGGACCC P ? 
2 polydeoxyribonucleotide no yes '(DT)(DC)(DT)(MA7)(DG)(DG)(DG)(DT)(DC)(DC)(DT)' TCTAGGGTCCT T ? 
3 'polypeptide(L)'        no no  
;MELADVGAAASSQGVHDQVLPTPNASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMN
VRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNN
QSINLLDVLHIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIP
GIGYKTAKCLEALGINSVRDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNK
IEELLASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMVNVKMP
FHLTLLSVCFCNLKALNTAK
;
;MELADVGAAASSQGVHDQVLPTPNASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMN
VRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNN
QSINLLDVLHIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIP
GIGYKTAKCLEALGINSVRDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNK
IEELLASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMVNVKMP
FHLTLLSVCFCNLKALNTAK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DG  n 
1 3   DG  n 
1 4   DA  n 
1 5   DC  n 
1 6   DC  n 
1 7   DOC n 
2 1   DT  n 
2 2   DC  n 
2 3   DT  n 
2 4   MA7 n 
2 5   DG  n 
2 6   DG  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DT  n 
3 1   MET n 
3 2   GLU n 
3 3   LEU n 
3 4   ALA n 
3 5   ASP n 
3 6   VAL n 
3 7   GLY n 
3 8   ALA n 
3 9   ALA n 
3 10  ALA n 
3 11  SER n 
3 12  SER n 
3 13  GLN n 
3 14  GLY n 
3 15  VAL n 
3 16  HIS n 
3 17  ASP n 
3 18  GLN n 
3 19  VAL n 
3 20  LEU n 
3 21  PRO n 
3 22  THR n 
3 23  PRO n 
3 24  ASN n 
3 25  ALA n 
3 26  SER n 
3 27  SER n 
3 28  ARG n 
3 29  VAL n 
3 30  ILE n 
3 31  VAL n 
3 32  HIS n 
3 33  VAL n 
3 34  ASP n 
3 35  LEU n 
3 36  ASP n 
3 37  CYS n 
3 38  PHE n 
3 39  TYR n 
3 40  ALA n 
3 41  GLN n 
3 42  VAL n 
3 43  GLU n 
3 44  MET n 
3 45  ILE n 
3 46  SER n 
3 47  ASN n 
3 48  PRO n 
3 49  GLU n 
3 50  LEU n 
3 51  LYS n 
3 52  ASP n 
3 53  LYS n 
3 54  PRO n 
3 55  LEU n 
3 56  GLY n 
3 57  VAL n 
3 58  GLN n 
3 59  GLN n 
3 60  LYS n 
3 61  TYR n 
3 62  LEU n 
3 63  VAL n 
3 64  VAL n 
3 65  THR n 
3 66  CYS n 
3 67  ASN n 
3 68  TYR n 
3 69  GLU n 
3 70  ALA n 
3 71  ARG n 
3 72  LYS n 
3 73  LEU n 
3 74  GLY n 
3 75  VAL n 
3 76  LYS n 
3 77  LYS n 
3 78  LEU n 
3 79  MET n 
3 80  ASN n 
3 81  VAL n 
3 82  ARG n 
3 83  ASP n 
3 84  ALA n 
3 85  LYS n 
3 86  GLU n 
3 87  LYS n 
3 88  CYS n 
3 89  PRO n 
3 90  GLN n 
3 91  LEU n 
3 92  VAL n 
3 93  LEU n 
3 94  VAL n 
3 95  ASN n 
3 96  GLY n 
3 97  GLU n 
3 98  ASP n 
3 99  LEU n 
3 100 THR n 
3 101 ARG n 
3 102 TYR n 
3 103 ARG n 
3 104 GLU n 
3 105 MET n 
3 106 SER n 
3 107 TYR n 
3 108 LYS n 
3 109 VAL n 
3 110 THR n 
3 111 GLU n 
3 112 LEU n 
3 113 LEU n 
3 114 GLU n 
3 115 GLU n 
3 116 PHE n 
3 117 SER n 
3 118 PRO n 
3 119 VAL n 
3 120 VAL n 
3 121 GLU n 
3 122 ARG n 
3 123 LEU n 
3 124 GLY n 
3 125 PHE n 
3 126 ASP n 
3 127 GLU n 
3 128 ASN n 
3 129 PHE n 
3 130 VAL n 
3 131 ASP n 
3 132 LEU n 
3 133 THR n 
3 134 GLU n 
3 135 MET n 
3 136 VAL n 
3 137 GLU n 
3 138 LYS n 
3 139 ARG n 
3 140 LEU n 
3 141 GLN n 
3 142 GLN n 
3 143 LEU n 
3 144 GLN n 
3 145 SER n 
3 146 ASP n 
3 147 GLU n 
3 148 LEU n 
3 149 SER n 
3 150 ALA n 
3 151 VAL n 
3 152 THR n 
3 153 VAL n 
3 154 SER n 
3 155 GLY n 
3 156 HIS n 
3 157 VAL n 
3 158 TYR n 
3 159 ASN n 
3 160 ASN n 
3 161 GLN n 
3 162 SER n 
3 163 ILE n 
3 164 ASN n 
3 165 LEU n 
3 166 LEU n 
3 167 ASP n 
3 168 VAL n 
3 169 LEU n 
3 170 HIS n 
3 171 ILE n 
3 172 ARG n 
3 173 LEU n 
3 174 LEU n 
3 175 VAL n 
3 176 GLY n 
3 177 SER n 
3 178 GLN n 
3 179 ILE n 
3 180 ALA n 
3 181 ALA n 
3 182 GLU n 
3 183 MET n 
3 184 ARG n 
3 185 GLU n 
3 186 ALA n 
3 187 MET n 
3 188 TYR n 
3 189 ASN n 
3 190 GLN n 
3 191 LEU n 
3 192 GLY n 
3 193 LEU n 
3 194 THR n 
3 195 GLY n 
3 196 CYS n 
3 197 ALA n 
3 198 GLY n 
3 199 VAL n 
3 200 ALA n 
3 201 SER n 
3 202 ASN n 
3 203 LYS n 
3 204 LEU n 
3 205 LEU n 
3 206 ALA n 
3 207 LYS n 
3 208 LEU n 
3 209 VAL n 
3 210 SER n 
3 211 GLY n 
3 212 VAL n 
3 213 PHE n 
3 214 LYS n 
3 215 PRO n 
3 216 ASN n 
3 217 GLN n 
3 218 GLN n 
3 219 THR n 
3 220 VAL n 
3 221 LEU n 
3 222 LEU n 
3 223 PRO n 
3 224 GLU n 
3 225 SER n 
3 226 CYS n 
3 227 GLN n 
3 228 HIS n 
3 229 LEU n 
3 230 ILE n 
3 231 HIS n 
3 232 SER n 
3 233 LEU n 
3 234 ASN n 
3 235 HIS n 
3 236 ILE n 
3 237 LYS n 
3 238 GLU n 
3 239 ILE n 
3 240 PRO n 
3 241 GLY n 
3 242 ILE n 
3 243 GLY n 
3 244 TYR n 
3 245 LYS n 
3 246 THR n 
3 247 ALA n 
3 248 LYS n 
3 249 CYS n 
3 250 LEU n 
3 251 GLU n 
3 252 ALA n 
3 253 LEU n 
3 254 GLY n 
3 255 ILE n 
3 256 ASN n 
3 257 SER n 
3 258 VAL n 
3 259 ARG n 
3 260 ASP n 
3 261 LEU n 
3 262 GLN n 
3 263 THR n 
3 264 PHE n 
3 265 SER n 
3 266 PRO n 
3 267 LYS n 
3 268 ILE n 
3 269 LEU n 
3 270 GLU n 
3 271 LYS n 
3 272 GLU n 
3 273 LEU n 
3 274 GLY n 
3 275 ILE n 
3 276 SER n 
3 277 VAL n 
3 278 ALA n 
3 279 GLN n 
3 280 ARG n 
3 281 ILE n 
3 282 GLN n 
3 283 LYS n 
3 284 LEU n 
3 285 SER n 
3 286 PHE n 
3 287 GLY n 
3 288 GLU n 
3 289 ASP n 
3 290 ASN n 
3 291 SER n 
3 292 PRO n 
3 293 VAL n 
3 294 ILE n 
3 295 LEU n 
3 296 SER n 
3 297 GLY n 
3 298 PRO n 
3 299 PRO n 
3 300 GLN n 
3 301 SER n 
3 302 PHE n 
3 303 SER n 
3 304 GLU n 
3 305 GLU n 
3 306 ASP n 
3 307 SER n 
3 308 PHE n 
3 309 LYS n 
3 310 LYS n 
3 311 CYS n 
3 312 SER n 
3 313 SER n 
3 314 GLU n 
3 315 VAL n 
3 316 GLU n 
3 317 ALA n 
3 318 LYS n 
3 319 ASN n 
3 320 LYS n 
3 321 ILE n 
3 322 GLU n 
3 323 GLU n 
3 324 LEU n 
3 325 LEU n 
3 326 ALA n 
3 327 SER n 
3 328 LEU n 
3 329 LEU n 
3 330 ASN n 
3 331 ARG n 
3 332 VAL n 
3 333 CYS n 
3 334 GLN n 
3 335 ASP n 
3 336 GLY n 
3 337 ARG n 
3 338 LYS n 
3 339 PRO n 
3 340 HIS n 
3 341 THR n 
3 342 VAL n 
3 343 ARG n 
3 344 LEU n 
3 345 ILE n 
3 346 ILE n 
3 347 ARG n 
3 348 ARG n 
3 349 TYR n 
3 350 SER n 
3 351 SER n 
3 352 GLU n 
3 353 LYS n 
3 354 HIS n 
3 355 TYR n 
3 356 GLY n 
3 357 ARG n 
3 358 GLU n 
3 359 SER n 
3 360 ARG n 
3 361 GLN n 
3 362 CYS n 
3 363 PRO n 
3 364 ILE n 
3 365 PRO n 
3 366 SER n 
3 367 HIS n 
3 368 VAL n 
3 369 ILE n 
3 370 GLN n 
3 371 LYS n 
3 372 LEU n 
3 373 GLY n 
3 374 THR n 
3 375 GLY n 
3 376 ASN n 
3 377 TYR n 
3 378 ASP n 
3 379 VAL n 
3 380 MET n 
3 381 THR n 
3 382 PRO n 
3 383 MET n 
3 384 VAL n 
3 385 ASP n 
3 386 ILE n 
3 387 LEU n 
3 388 MET n 
3 389 LYS n 
3 390 LEU n 
3 391 PHE n 
3 392 ARG n 
3 393 ASN n 
3 394 MET n 
3 395 VAL n 
3 396 ASN n 
3 397 VAL n 
3 398 LYS n 
3 399 MET n 
3 400 PRO n 
3 401 PHE n 
3 402 HIS n 
3 403 LEU n 
3 404 THR n 
3 405 LEU n 
3 406 LEU n 
3 407 SER n 
3 408 VAL n 
3 409 CYS n 
3 410 PHE n 
3 411 CYS n 
3 412 ASN n 
3 413 LEU n 
3 414 LYS n 
3 415 ALA n 
3 416 LEU n 
3 417 ASN n 
3 418 THR n 
3 419 ALA n 
3 420 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   420 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLI, RAD30B' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 7  unidentified ? 32644 ? 
2 1 sample 1 11 unidentified ? 32644 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5ULW       5ULW   ? 1 ? 1  
2 PDB 5ULW       5ULW   ? 2 ? 1  
3 UNP POLI_HUMAN Q9UNA4 ? 3 
;MELADVGAAASSQGVHDQVLPTPNASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLGVKKLMN
VRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNN
QSINLLDVLHIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIP
GIGYKTAKCLEALGINSVRDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNK
IEELLASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQKLGTGNYDVMTPMVDILMKLFRNMVNVKMP
FHLTLLSVCFCNLKALNTAK
;
26 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ULW P 1 ? 7   ? 5ULW   867 ? 873 ? 867 873 
2 2 5ULW T 1 ? 11  ? 5ULW   837 ? 847 ? 837 847 
3 3 5ULW A 1 ? 420 ? Q9UNA4 26  ? 445 ? 1   420 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                           ? 'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P'   347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                    ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'    147.195 
MA7 'DNA linking'       n "1N-METHYLADENOSINE-5'-MONOPHOSPHATE"    ? 'C11 H17 N5 O6 P 1' 346.256 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                          ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'        119.119 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"              ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ULW 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.67 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.93 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM MES, pH 6.0, 18 % PEG 5KMME, 0.4 M Ammonium Sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-01-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5ULW 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.62 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       18059 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  14 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.085 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            27.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.62 
_reflns_shell.d_res_low                   2.71 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           1730 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        69.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5ULW 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     18014 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.959 
_refine.ls_d_res_high                            2.617 
_refine.ls_percent_reflns_obs                    99.78 
_refine.ls_R_factor_obs                          0.2074 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2038 
_refine.ls_R_factor_R_free                       0.2484 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.88 
_refine.ls_number_reflns_R_free                  1419 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2FLL 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.30 
_refine.pdbx_overall_phase_error                 25.81 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2775 
_refine_hist.pdbx_number_atoms_nucleic_acid   322 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             87 
_refine_hist.number_atoms_total               3215 
_refine_hist.d_res_high                       2.617 
_refine_hist.d_res_low                        48.959 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 3219 'X-RAY DIFFRACTION' ? 
f_angle_d          1.008  ? ? 4431 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.753 ? ? 1897 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.051  ? ? 533  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 511  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.6172 2.7107  1606 0.2298 99.00  0.3039 . . 122 . . . . 
'X-RAY DIFFRACTION' . 2.7107 2.8192  1599 0.2396 100.00 0.3045 . . 144 . . . . 
'X-RAY DIFFRACTION' . 2.8192 2.9475  1635 0.2410 100.00 0.2673 . . 130 . . . . 
'X-RAY DIFFRACTION' . 2.9475 3.1029  1637 0.2344 100.00 0.3602 . . 125 . . . . 
'X-RAY DIFFRACTION' . 3.1029 3.2973  1630 0.2255 100.00 0.2941 . . 147 . . . . 
'X-RAY DIFFRACTION' . 3.2973 3.5518  1638 0.2007 100.00 0.2539 . . 146 . . . . 
'X-RAY DIFFRACTION' . 3.5518 3.9091  1660 0.1892 100.00 0.2491 . . 143 . . . . 
'X-RAY DIFFRACTION' . 3.9091 4.4744  1659 0.1797 100.00 0.2327 . . 161 . . . . 
'X-RAY DIFFRACTION' . 4.4744 5.6360  1703 0.1909 100.00 0.2012 . . 139 . . . . 
'X-RAY DIFFRACTION' . 5.6360 48.9675 1828 0.2061 100.00 0.2294 . . 162 . . . . 
# 
_struct.entry_id                     5ULW 
_struct.title                        'Structure of human DNA polymerase iota bound to template 1-methyl-deoxyadenosine' 
_struct.pdbx_descriptor              'DNA polymerase iota/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ULW 
_struct_keywords.text            'human DNA polymerase iota N1-methyl-deoxyadenosine dTTP TLS, Thansferase-DNA complex' 
_struct_keywords.pdbx_keywords   Thansferase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS C 37  ? ASN C 47  ? CYS A 37  ASN A 47  1 ? 11 
HELX_P HELX_P2  AA2 PRO C 48  ? LYS C 51  ? PRO A 48  LYS A 51  5 ? 4  
HELX_P HELX_P3  AA3 ASN C 67  ? LEU C 73  ? ASN A 67  LEU A 73  1 ? 7  
HELX_P HELX_P4  AA4 VAL C 81  ? CYS C 88  ? VAL A 81  CYS A 88  1 ? 8  
HELX_P HELX_P5  AA5 LEU C 99  ? SER C 117 ? LEU A 99  SER A 117 1 ? 19 
HELX_P HELX_P6  AA6 LEU C 132 ? GLN C 142 ? LEU A 132 GLN A 142 1 ? 11 
HELX_P HELX_P7  AA7 GLN C 144 ? SER C 149 ? GLN A 144 SER A 149 1 ? 6  
HELX_P HELX_P8  AA8 ASN C 159 ? GLN C 161 ? ASN A 159 GLN A 161 5 ? 3  
HELX_P HELX_P9  AA9 ASP C 167 ? GLY C 192 ? ASP A 167 GLY A 192 1 ? 26 
HELX_P HELX_P10 AB1 ASN C 202 ? GLY C 211 ? ASN A 202 GLY A 211 1 ? 10 
HELX_P HELX_P11 AB2 LEU C 222 ? GLU C 224 ? LEU A 222 GLU A 224 5 ? 3  
HELX_P HELX_P12 AB3 SER C 225 ? SER C 232 ? SER A 225 SER A 232 1 ? 8  
HELX_P HELX_P13 AB4 HIS C 235 ? ILE C 239 ? HIS A 235 ILE A 239 5 ? 5  
HELX_P HELX_P14 AB5 GLY C 243 ? LEU C 253 ? GLY A 243 LEU A 253 1 ? 11 
HELX_P HELX_P15 AB6 SER C 257 ? PHE C 264 ? SER A 257 PHE A 264 1 ? 8  
HELX_P HELX_P16 AB7 SER C 265 ? PHE C 286 ? SER A 265 PHE A 286 1 ? 22 
HELX_P HELX_P17 AB8 SER C 313 ? GLY C 336 ? SER A 313 GLY A 336 1 ? 24 
HELX_P HELX_P18 AB9 PRO C 365 ? GLN C 370 ? PRO A 365 GLN A 370 1 ? 6  
HELX_P HELX_P19 AC1 VAL C 379 ? VAL C 395 ? VAL A 379 VAL A 395 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A DC  6   "O3'" ? ? ? 1_555 A DOC 7  P  ? ? P DC  872 P DOC 873 1_555 ? ? ? ? ? ? ?            1.592 ? 
covale2  covale both ? B DT  3   "O3'" ? ? ? 1_555 B MA7 4  P  ? ? T DT  839 T MA7 840 1_555 ? ? ? ? ? ? ?            1.621 ? 
covale3  covale both ? B MA7 4   "O3'" ? ? ? 1_555 B DG  5  P  ? ? T MA7 840 T DG  841 1_555 ? ? ? ? ? ? ?            1.588 ? 
metalc1  metalc ?    ? C ASP 34  OD1   ? ? ? 1_555 E MG  .  MG ? ? A ASP 34  A MG  502 1_555 ? ? ? ? ? ? ?            2.012 ? 
metalc2  metalc ?    ? C LEU 35  O     ? ? ? 1_555 E MG  .  MG ? ? A LEU 35  A MG  502 1_555 ? ? ? ? ? ? ?            2.135 ? 
metalc3  metalc ?    ? C ASP 126 OD2   ? ? ? 1_555 E MG  .  MG ? ? A ASP 126 A MG  502 1_555 ? ? ? ? ? ? ?            2.086 ? 
metalc4  metalc ?    ? D TTP .   O1A   ? ? ? 1_555 E MG  .  MG ? ? A TTP 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.417 ? 
metalc5  metalc ?    ? D TTP .   O1B   ? ? ? 1_555 E MG  .  MG ? ? A TTP 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.319 ? 
metalc6  metalc ?    ? D TTP .   O3G   ? ? ? 1_555 E MG  .  MG ? ? A TTP 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.472 ? 
hydrog1  hydrog ?    ? A DA  1   N1    ? ? ? 1_555 B DT  11 N3 ? ? P DA  867 T DT  847 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? A DA  1   N6    ? ? ? 1_555 B DT  11 O4 ? ? P DA  867 T DT  847 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? A DG  2   N1    ? ? ? 1_555 B DC  10 N3 ? ? P DG  868 T DC  846 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? A DG  2   N2    ? ? ? 1_555 B DC  10 O2 ? ? P DG  868 T DC  846 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? A DG  2   O6    ? ? ? 1_555 B DC  10 N4 ? ? P DG  868 T DC  846 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? A DG  3   N1    ? ? ? 1_555 B DC  9  N3 ? ? P DG  869 T DC  845 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? A DG  3   N2    ? ? ? 1_555 B DC  9  O2 ? ? P DG  869 T DC  845 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? A DG  3   O6    ? ? ? 1_555 B DC  9  N4 ? ? P DG  869 T DC  845 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? A DA  4   N1    ? ? ? 1_555 B DT  8  N3 ? ? P DA  870 T DT  844 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? A DA  4   N6    ? ? ? 1_555 B DT  8  O4 ? ? P DA  870 T DT  844 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? A DC  5   N3    ? ? ? 1_555 B DG  7  N1 ? ? P DC  871 T DG  843 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? A DC  5   N4    ? ? ? 1_555 B DG  7  O6 ? ? P DC  871 T DG  843 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? A DC  5   O2    ? ? ? 1_555 B DG  7  N2 ? ? P DC  871 T DG  843 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? A DC  6   N3    ? ? ? 1_555 B DG  6  N1 ? ? P DC  872 T DG  842 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? A DC  6   N4    ? ? ? 1_555 B DG  6  O6 ? ? P DC  872 T DG  842 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? A DC  6   O2    ? ? ? 1_555 B DG  6  N2 ? ? P DC  872 T DG  842 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? A DOC 7   N3    ? ? ? 1_555 B DG  5  N1 ? ? P DOC 873 T DG  841 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? A DOC 7   N4    ? ? ? 1_555 B DG  5  O6 ? ? P DOC 873 T DG  841 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? A DOC 7   O2    ? ? ? 1_555 B DG  5  N2 ? ? P DOC 873 T DG  841 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           214 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            214 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    215 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     215 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -3.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL C 120 ? LEU C 123 ? VAL A 120 LEU A 123 
AA1 2 GLU C 127 ? ASP C 131 ? GLU A 127 ASP A 131 
AA1 3 ILE C 30  ? LEU C 35  ? ILE A 30  LEU A 35  
AA1 4 GLY C 195 ? ALA C 200 ? GLY A 195 ALA A 200 
AA1 5 GLN C 218 ? VAL C 220 ? GLN A 218 VAL A 220 
AA1 6 HIS C 156 ? VAL C 157 ? HIS A 156 VAL A 157 
AA2 1 MET C 79  ? ASN C 80  ? MET A 79  ASN A 80  
AA2 2 LEU C 62  ? CYS C 66  ? LEU A 62  CYS A 66  
AA2 3 LEU C 55  ? GLN C 59  ? LEU A 55  GLN A 59  
AA2 4 VAL C 92  ? ASN C 95  ? VAL A 92  ASN A 95  
AA3 1 SER C 301 ? SER C 307 ? SER A 301 SER A 307 
AA3 2 LEU C 405 ? LEU C 413 ? LEU A 405 LEU A 413 
AA3 3 PRO C 339 ? ARG C 347 ? PRO A 339 ARG A 347 
AA3 4 ARG C 357 ? PRO C 363 ? ARG A 357 PRO A 363 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU C 121 ? N GLU A 121 O PHE C 129 ? O PHE A 129 
AA1 2 3 O ASN C 128 ? O ASN A 128 N VAL C 33  ? N VAL A 33  
AA1 3 4 N ASP C 34  ? N ASP A 34  O CYS C 196 ? O CYS A 196 
AA1 4 5 N VAL C 199 ? N VAL A 199 O THR C 219 ? O THR A 219 
AA1 5 6 O GLN C 218 ? O GLN A 218 N HIS C 156 ? N HIS A 156 
AA2 1 2 O MET C 79  ? O MET A 79  N VAL C 63  ? N VAL A 63  
AA2 2 3 O THR C 65  ? O THR A 65  N VAL C 57  ? N VAL A 57  
AA2 3 4 N GLN C 58  ? N GLN A 58  O VAL C 94  ? O VAL A 94  
AA3 1 2 N PHE C 302 ? N PHE A 302 O PHE C 410 ? O PHE A 410 
AA3 2 3 O CYS C 409 ? O CYS A 409 N ARG C 343 ? N ARG A 343 
AA3 3 4 N ILE C 346 ? N ILE A 346 O GLU C 358 ? O GLU A 358 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A TTP 501 ? 20 'binding site for residue TTP A 501' 
AC2 Software A MG  502 ? 4  'binding site for residue MG A 502'  
AC3 Software A CL  503 ? 1  'binding site for residue CL A 503'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 ASP C 34  ? ASP A 34  . ? 1_555 ? 
2  AC1 20 LEU C 35  ? LEU A 35  . ? 1_555 ? 
3  AC1 20 ASP C 36  ? ASP A 36  . ? 1_555 ? 
4  AC1 20 CYS C 37  ? CYS A 37  . ? 1_555 ? 
5  AC1 20 PHE C 38  ? PHE A 38  . ? 1_555 ? 
6  AC1 20 TYR C 39  ? TYR A 39  . ? 1_555 ? 
7  AC1 20 VAL C 64  ? VAL A 64  . ? 1_555 ? 
8  AC1 20 THR C 65  ? THR A 65  . ? 1_555 ? 
9  AC1 20 TYR C 68  ? TYR A 68  . ? 1_555 ? 
10 AC1 20 ARG C 71  ? ARG A 71  . ? 1_555 ? 
11 AC1 20 LYS C 77  ? LYS A 77  . ? 1_555 ? 
12 AC1 20 ASP C 126 ? ASP A 126 . ? 1_555 ? 
13 AC1 20 LYS C 214 ? LYS A 214 . ? 1_555 ? 
14 AC1 20 MG  E .   ? MG  A 502 . ? 1_555 ? 
15 AC1 20 HOH I .   ? HOH A 612 . ? 1_555 ? 
16 AC1 20 HOH I .   ? HOH A 627 . ? 1_555 ? 
17 AC1 20 HOH I .   ? HOH A 637 . ? 1_555 ? 
18 AC1 20 DOC A 7   ? DOC P 873 . ? 1_555 ? 
19 AC1 20 MA7 B 4   ? MA7 T 840 . ? 1_555 ? 
20 AC1 20 DG  B 5   ? DG  T 841 . ? 1_555 ? 
21 AC2 4  ASP C 34  ? ASP A 34  . ? 1_555 ? 
22 AC2 4  LEU C 35  ? LEU A 35  . ? 1_555 ? 
23 AC2 4  ASP C 126 ? ASP A 126 . ? 1_555 ? 
24 AC2 4  TTP D .   ? TTP A 501 . ? 1_555 ? 
25 AC3 1  ASN C 290 ? ASN A 290 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5ULW 
_atom_sites.fract_transf_matrix[1][1]   0.010213 
_atom_sites.fract_transf_matrix[1][2]   0.005896 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011793 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004939 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'"  . DA  A 1 1   ? 6.690   52.144 25.346  1.00 45.42  ? 867 DA  P "O5'"  1 
ATOM   2    C  "C5'"  . DA  A 1 1   ? 6.381   51.186 24.341  1.00 64.37  ? 867 DA  P "C5'"  1 
ATOM   3    C  "C4'"  . DA  A 1 1   ? 5.285   51.681 23.411  1.00 69.39  ? 867 DA  P "C4'"  1 
ATOM   4    O  "O4'"  . DA  A 1 1   ? 5.839   51.879 22.083  1.00 71.08  ? 867 DA  P "O4'"  1 
ATOM   5    C  "C3'"  . DA  A 1 1   ? 4.146   50.687 23.220  1.00 71.25  ? 867 DA  P "C3'"  1 
ATOM   6    O  "O3'"  . DA  A 1 1   ? 2.920   51.355 22.947  1.00 77.97  ? 867 DA  P "O3'"  1 
ATOM   7    C  "C2'"  . DA  A 1 1   ? 4.610   49.835 22.034  1.00 60.61  ? 867 DA  P "C2'"  1 
ATOM   8    C  "C1'"  . DA  A 1 1   ? 5.536   50.767 21.249  1.00 57.76  ? 867 DA  P "C1'"  1 
ATOM   9    N  N9     . DA  A 1 1   ? 6.783   50.106 20.838  1.00 55.56  ? 867 DA  P N9     1 
ATOM   10   C  C8     . DA  A 1 1   ? 7.657   49.425 21.643  1.00 56.95  ? 867 DA  P C8     1 
ATOM   11   N  N7     . DA  A 1 1   ? 8.687   48.908 20.993  1.00 56.69  ? 867 DA  P N7     1 
ATOM   12   C  C5     . DA  A 1 1   ? 8.471   49.271 19.674  1.00 44.97  ? 867 DA  P C5     1 
ATOM   13   C  C6     . DA  A 1 1   ? 9.208   49.030 18.496  1.00 52.33  ? 867 DA  P C6     1 
ATOM   14   N  N6     . DA  A 1 1   ? 10.356  48.339 18.483  1.00 52.73  ? 867 DA  P N6     1 
ATOM   15   N  N1     . DA  A 1 1   ? 8.719   49.525 17.325  1.00 49.33  ? 867 DA  P N1     1 
ATOM   16   C  C2     . DA  A 1 1   ? 7.571   50.221 17.357  1.00 52.31  ? 867 DA  P C2     1 
ATOM   17   N  N3     . DA  A 1 1   ? 6.788   50.513 18.410  1.00 50.15  ? 867 DA  P N3     1 
ATOM   18   C  C4     . DA  A 1 1   ? 7.301   50.001 19.550  1.00 52.55  ? 867 DA  P C4     1 
ATOM   19   P  P      . DG  A 1 2   ? 1.537   50.522 22.868  1.00 81.75  ? 868 DG  P P      1 
ATOM   20   O  OP1    . DG  A 1 2   ? 0.412   51.493 22.981  1.00 80.67  ? 868 DG  P OP1    1 
ATOM   21   O  OP2    . DG  A 1 2   ? 1.644   49.430 23.865  1.00 66.21  ? 868 DG  P OP2    1 
ATOM   22   O  "O5'"  . DG  A 1 2   ? 1.547   49.893 21.381  1.00 70.05  ? 868 DG  P "O5'"  1 
ATOM   23   C  "C5'"  . DG  A 1 2   ? 1.561   50.770 20.243  1.00 65.58  ? 868 DG  P "C5'"  1 
ATOM   24   C  "C4'"  . DG  A 1 2   ? 1.973   50.058 18.951  1.00 71.17  ? 868 DG  P "C4'"  1 
ATOM   25   O  "O4'"  . DG  A 1 2   ? 3.349   49.640 19.000  1.00 72.13  ? 868 DG  P "O4'"  1 
ATOM   26   C  "C3'"  . DG  A 1 2   ? 1.178   48.808 18.598  1.00 68.59  ? 868 DG  P "C3'"  1 
ATOM   27   O  "O3'"  . DG  A 1 2   ? 0.249   49.126 17.594  1.00 90.25  ? 868 DG  P "O3'"  1 
ATOM   28   C  "C2'"  . DG  A 1 2   ? 2.219   47.816 18.056  1.00 68.69  ? 868 DG  P "C2'"  1 
ATOM   29   C  "C1'"  . DG  A 1 2   ? 3.518   48.611 18.058  1.00 63.39  ? 868 DG  P "C1'"  1 
ATOM   30   N  N9     . DG  A 1 2   ? 4.657   47.814 18.465  1.00 53.15  ? 868 DG  P N9     1 
ATOM   31   C  C8     . DG  A 1 2   ? 4.937   47.354 19.731  1.00 54.31  ? 868 DG  P C8     1 
ATOM   32   N  N7     . DG  A 1 2   ? 6.034   46.655 19.801  1.00 54.95  ? 868 DG  P N7     1 
ATOM   33   C  C5     . DG  A 1 2   ? 6.501   46.639 18.498  1.00 55.76  ? 868 DG  P C5     1 
ATOM   34   C  C6     . DG  A 1 2   ? 7.655   46.030 17.959  1.00 63.14  ? 868 DG  P C6     1 
ATOM   35   O  O6     . DG  A 1 2   ? 8.530   45.357 18.559  1.00 57.43  ? 868 DG  P O6     1 
ATOM   36   N  N1     . DG  A 1 2   ? 7.754   46.261 16.574  1.00 57.48  ? 868 DG  P N1     1 
ATOM   37   C  C2     . DG  A 1 2   ? 6.844   46.989 15.823  1.00 51.99  ? 868 DG  P C2     1 
ATOM   38   N  N2     . DG  A 1 2   ? 7.099   47.099 14.505  1.00 49.95  ? 868 DG  P N2     1 
ATOM   39   N  N3     . DG  A 1 2   ? 5.764   47.560 16.325  1.00 48.83  ? 868 DG  P N3     1 
ATOM   40   C  C4     . DG  A 1 2   ? 5.659   47.350 17.661  1.00 53.64  ? 868 DG  P C4     1 
ATOM   41   P  P      . DG  A 1 3   ? -0.790  48.013 17.091  1.00 87.24  ? 869 DG  P P      1 
ATOM   42   O  OP1    . DG  A 1 3   ? -2.004  48.741 16.641  1.00 72.69  ? 869 DG  P OP1    1 
ATOM   43   O  OP2    . DG  A 1 3   ? -0.855  47.003 18.177  1.00 78.35  ? 869 DG  P OP2    1 
ATOM   44   O  "O5'"  . DG  A 1 3   ? -0.045  47.321 15.855  1.00 77.97  ? 869 DG  P "O5'"  1 
ATOM   45   C  "C5'"  . DG  A 1 3   ? 0.772   48.105 14.987  1.00 79.98  ? 869 DG  P "C5'"  1 
ATOM   46   C  "C4'"  . DG  A 1 3   ? 1.432   47.221 13.961  1.00 72.95  ? 869 DG  P "C4'"  1 
ATOM   47   O  "O4'"  . DG  A 1 3   ? 2.704   46.748 14.478  1.00 83.29  ? 869 DG  P "O4'"  1 
ATOM   48   C  "C3'"  . DG  A 1 3   ? 0.618   45.978 13.624  1.00 87.77  ? 869 DG  P "C3'"  1 
ATOM   49   O  "O3'"  . DG  A 1 3   ? 0.540   45.805 12.234  1.00 90.49  ? 869 DG  P "O3'"  1 
ATOM   50   C  "C2'"  . DG  A 1 3   ? 1.376   44.833 14.299  1.00 79.46  ? 869 DG  P "C2'"  1 
ATOM   51   C  "C1'"  . DG  A 1 3   ? 2.802   45.353 14.285  1.00 72.15  ? 869 DG  P "C1'"  1 
ATOM   52   N  N9     . DG  A 1 3   ? 3.627   44.787 15.348  1.00 54.97  ? 869 DG  P N9     1 
ATOM   53   C  C8     . DG  A 1 3   ? 3.337   44.744 16.699  1.00 58.73  ? 869 DG  P C8     1 
ATOM   54   N  N7     . DG  A 1 3   ? 4.266   44.168 17.409  1.00 59.90  ? 869 DG  P N7     1 
ATOM   55   C  C5     . DG  A 1 3   ? 5.235   43.803 16.459  1.00 57.08  ? 869 DG  P C5     1 
ATOM   56   C  C6     . DG  A 1 3   ? 6.480   43.138 16.625  1.00 55.45  ? 869 DG  P C6     1 
ATOM   57   O  O6     . DG  A 1 3   ? 6.998   42.723 17.676  1.00 54.51  ? 869 DG  P O6     1 
ATOM   58   N  N1     . DG  A 1 3   ? 7.133   42.958 15.405  1.00 56.51  ? 869 DG  P N1     1 
ATOM   59   C  C2     . DG  A 1 3   ? 6.646   43.373 14.183  1.00 53.83  ? 869 DG  P C2     1 
ATOM   60   N  N2     . DG  A 1 3   ? 7.420   43.117 13.110  1.00 51.70  ? 869 DG  P N2     1 
ATOM   61   N  N3     . DG  A 1 3   ? 5.491   44.002 14.023  1.00 53.64  ? 869 DG  P N3     1 
ATOM   62   C  C4     . DG  A 1 3   ? 4.844   44.176 15.194  1.00 50.42  ? 869 DG  P C4     1 
ATOM   63   P  P      . DA  A 1 4   ? -0.632  44.884 11.644  1.00 100.96 ? 870 DA  P P      1 
ATOM   64   O  OP1    . DA  A 1 4   ? -1.162  45.561 10.434  1.00 93.72  ? 870 DA  P OP1    1 
ATOM   65   O  OP2    . DA  A 1 4   ? -1.504  44.552 12.794  1.00 92.64  ? 870 DA  P OP2    1 
ATOM   66   O  "O5'"  . DA  A 1 4   ? 0.094   43.522 11.228  1.00 84.02  ? 870 DA  P "O5'"  1 
ATOM   67   C  "C5'"  . DA  A 1 4   ? 0.664   43.407 9.943   1.00 76.99  ? 870 DA  P "C5'"  1 
ATOM   68   C  "C4'"  . DA  A 1 4   ? 1.832   42.451 9.965   1.00 74.85  ? 870 DA  P "C4'"  1 
ATOM   69   O  "O4'"  . DA  A 1 4   ? 2.633   42.683 11.152  1.00 77.19  ? 870 DA  P "O4'"  1 
ATOM   70   C  "C3'"  . DA  A 1 4   ? 1.458   40.990 10.079  1.00 81.54  ? 870 DA  P "C3'"  1 
ATOM   71   O  "O3'"  . DA  A 1 4   ? 1.055   40.456 8.792   1.00 69.41  ? 870 DA  P "O3'"  1 
ATOM   72   C  "C2'"  . DA  A 1 4   ? 2.774   40.371 10.586  1.00 77.48  ? 870 DA  P "C2'"  1 
ATOM   73   C  "C1'"  . DA  A 1 4   ? 3.427   41.536 11.376  1.00 71.47  ? 870 DA  P "C1'"  1 
ATOM   74   N  N9     . DA  A 1 4   ? 3.544   41.291 12.817  1.00 56.35  ? 870 DA  P N9     1 
ATOM   75   C  C8     . DA  A 1 4   ? 2.634   41.598 13.794  1.00 63.04  ? 870 DA  P C8     1 
ATOM   76   N  N7     . DA  A 1 4   ? 3.022   41.245 15.013  1.00 56.06  ? 870 DA  P N7     1 
ATOM   77   C  C5     . DA  A 1 4   ? 4.272   40.665 14.808  1.00 51.24  ? 870 DA  P C5     1 
ATOM   78   C  C6     . DA  A 1 4   ? 5.206   40.083 15.690  1.00 52.89  ? 870 DA  P C6     1 
ATOM   79   N  N6     . DA  A 1 4   ? 5.019   40.002 17.010  1.00 60.13  ? 870 DA  P N6     1 
ATOM   80   N  N1     . DA  A 1 4   ? 6.351   39.597 15.163  1.00 52.25  ? 870 DA  P N1     1 
ATOM   81   C  C2     . DA  A 1 4   ? 6.533   39.688 13.832  1.00 55.76  ? 870 DA  P C2     1 
ATOM   82   N  N3     . DA  A 1 4   ? 5.726   40.203 12.904  1.00 44.19  ? 870 DA  P N3     1 
ATOM   83   C  C4     . DA  A 1 4   ? 4.605   40.681 13.464  1.00 46.37  ? 870 DA  P C4     1 
ATOM   84   P  P      . DC  A 1 5   ? 0.256   39.057 8.709   1.00 70.75  ? 871 DC  P P      1 
ATOM   85   O  OP1    . DC  A 1 5   ? -0.233  38.870 7.323   1.00 71.66  ? 871 DC  P OP1    1 
ATOM   86   O  OP2    . DC  A 1 5   ? -0.695  38.958 9.832   1.00 69.41  ? 871 DC  P OP2    1 
ATOM   87   O  "O5'"  . DC  A 1 5   ? 1.368   37.959 9.033   1.00 56.00  ? 871 DC  P "O5'"  1 
ATOM   88   C  "C5'"  . DC  A 1 5   ? 2.550   37.920 8.259   1.00 60.03  ? 871 DC  P "C5'"  1 
ATOM   89   C  "C4'"  . DC  A 1 5   ? 3.633   37.141 8.967   1.00 59.04  ? 871 DC  P "C4'"  1 
ATOM   90   O  "O4'"  . DC  A 1 5   ? 4.081   37.867 10.128  1.00 56.61  ? 871 DC  P "O4'"  1 
ATOM   91   C  "C3'"  . DC  A 1 5   ? 3.210   35.815 9.556   1.00 55.60  ? 871 DC  P "C3'"  1 
ATOM   92   O  "O3'"  . DC  A 1 5   ? 3.064   34.839 8.545   1.00 54.01  ? 871 DC  P "O3'"  1 
ATOM   93   C  "C2'"  . DC  A 1 5   ? 4.406   35.534 10.452  1.00 51.93  ? 871 DC  P "C2'"  1 
ATOM   94   C  "C1'"  . DC  A 1 5   ? 4.705   36.940 11.000  1.00 59.78  ? 871 DC  P "C1'"  1 
ATOM   95   N  N1     . DC  A 1 5   ? 4.202   37.139 12.383  1.00 49.48  ? 871 DC  P N1     1 
ATOM   96   C  C2     . DC  A 1 5   ? 5.009   36.722 13.459  1.00 47.30  ? 871 DC  P C2     1 
ATOM   97   O  O2     . DC  A 1 5   ? 6.131   36.225 13.219  1.00 49.00  ? 871 DC  P O2     1 
ATOM   98   N  N3     . DC  A 1 5   ? 4.558   36.889 14.725  1.00 44.13  ? 871 DC  P N3     1 
ATOM   99   C  C4     . DC  A 1 5   ? 3.353   37.428 14.935  1.00 50.32  ? 871 DC  P C4     1 
ATOM   100  N  N4     . DC  A 1 5   ? 2.955   37.565 16.203  1.00 43.67  ? 871 DC  P N4     1 
ATOM   101  C  C5     . DC  A 1 5   ? 2.504   37.847 13.851  1.00 45.00  ? 871 DC  P C5     1 
ATOM   102  C  C6     . DC  A 1 5   ? 2.971   37.688 12.600  1.00 45.73  ? 871 DC  P C6     1 
ATOM   103  P  P      . DC  A 1 6   ? 2.323   33.440 8.868   1.00 55.55  ? 872 DC  P P      1 
ATOM   104  O  OP1    . DC  A 1 6   ? 2.316   32.689 7.586   1.00 57.66  ? 872 DC  P OP1    1 
ATOM   105  O  OP2    . DC  A 1 6   ? 1.058   33.688 9.599   1.00 58.07  ? 872 DC  P OP2    1 
ATOM   106  O  "O5'"  . DC  A 1 6   ? 3.302   32.703 9.912   1.00 47.69  ? 872 DC  P "O5'"  1 
ATOM   107  C  "C5'"  . DC  A 1 6   ? 4.645   32.488 9.556   1.00 39.67  ? 872 DC  P "C5'"  1 
ATOM   108  C  "C4'"  . DC  A 1 6   ? 5.379   31.808 10.668  1.00 49.59  ? 872 DC  P "C4'"  1 
ATOM   109  O  "O4'"  . DC  A 1 6   ? 5.619   32.742 11.752  1.00 54.10  ? 872 DC  P "O4'"  1 
ATOM   110  C  "C3'"  . DC  A 1 6   ? 4.630   30.673 11.321  1.00 48.34  ? 872 DC  P "C3'"  1 
ATOM   111  O  "O3'"  . DC  A 1 6   ? 4.742   29.516 10.540  1.00 38.21  ? 872 DC  P "O3'"  1 
ATOM   112  C  "C2'"  . DC  A 1 6   ? 5.397   30.545 12.647  1.00 45.19  ? 872 DC  P "C2'"  1 
ATOM   113  C  "C1'"  . DC  A 1 6   ? 5.693   32.018 12.979  1.00 42.37  ? 872 DC  P "C1'"  1 
ATOM   114  N  N1     . DC  A 1 6   ? 4.719   32.623 13.918  1.00 43.69  ? 872 DC  P N1     1 
ATOM   115  C  C2     . DC  A 1 6   ? 4.887   32.448 15.290  1.00 41.87  ? 872 DC  P C2     1 
ATOM   116  O  O2     . DC  A 1 6   ? 5.850   31.778 15.694  1.00 45.74  ? 872 DC  P O2     1 
ATOM   117  N  N3     . DC  A 1 6   ? 3.987   33.003 16.137  1.00 41.18  ? 872 DC  P N3     1 
ATOM   118  C  C4     . DC  A 1 6   ? 2.973   33.732 15.655  1.00 44.77  ? 872 DC  P C4     1 
ATOM   119  N  N4     . DC  A 1 6   ? 2.105   34.278 16.531  1.00 44.46  ? 872 DC  P N4     1 
ATOM   120  C  C5     . DC  A 1 6   ? 2.791   33.927 14.258  1.00 44.42  ? 872 DC  P C5     1 
ATOM   121  C  C6     . DC  A 1 6   ? 3.677   33.362 13.431  1.00 46.11  ? 872 DC  P C6     1 
HETATM 122  N  N1     . DOC A 1 7   ? 3.971   28.457 16.178  1.00 43.24  ? 873 DOC P N1     1 
HETATM 123  C  C2     . DOC A 1 7   ? 3.545   28.659 17.583  1.00 41.92  ? 873 DOC P C2     1 
HETATM 124  N  N3     . DOC A 1 7   ? 2.448   29.606 17.876  1.00 43.70  ? 873 DOC P N3     1 
HETATM 125  C  C4     . DOC A 1 7   ? 1.813   30.315 16.802  1.00 39.34  ? 873 DOC P C4     1 
HETATM 126  C  C5     . DOC A 1 7   ? 2.225   30.108 15.399  1.00 40.65  ? 873 DOC P C5     1 
HETATM 127  C  C6     . DOC A 1 7   ? 3.321   29.163 15.093  1.00 42.67  ? 873 DOC P C6     1 
HETATM 128  O  O2     . DOC A 1 7   ? 4.085   28.066 18.459  1.00 45.47  ? 873 DOC P O2     1 
HETATM 129  N  N4     . DOC A 1 7   ? 0.759   31.243 17.107  1.00 34.35  ? 873 DOC P N4     1 
HETATM 130  C  "C1'"  . DOC A 1 7   ? 4.999   27.540 15.923  1.00 43.44  ? 873 DOC P "C1'"  1 
HETATM 131  C  "C2'"  . DOC A 1 7   ? 4.492   26.309 15.874  1.00 49.65  ? 873 DOC P "C2'"  1 
HETATM 132  C  "C3'"  . DOC A 1 7   ? 4.286   26.022 14.370  1.00 48.53  ? 873 DOC P "C3'"  1 
HETATM 133  C  "C4'"  . DOC A 1 7   ? 5.515   26.815 13.716  1.00 49.41  ? 873 DOC P "C4'"  1 
HETATM 134  O  "O4'"  . DOC A 1 7   ? 5.668   27.875 14.447  1.00 49.37  ? 873 DOC P "O4'"  1 
HETATM 135  C  "C5'"  . DOC A 1 7   ? 5.218   27.247 12.279  1.00 47.77  ? 873 DOC P "C5'"  1 
HETATM 136  O  "O5'"  . DOC A 1 7   ? 3.936   27.791 12.209  1.00 39.39  ? 873 DOC P "O5'"  1 
HETATM 137  P  P      . DOC A 1 7   ? 3.636   28.385 10.723  1.00 43.50  ? 873 DOC P P      1 
HETATM 138  O  OP1    . DOC A 1 7   ? 3.792   27.184 9.816   1.00 51.14  ? 873 DOC P OP1    1 
HETATM 139  O  OP2    . DOC A 1 7   ? 2.269   29.034 10.671  1.00 50.81  ? 873 DOC P OP2    1 
HETATM 140  H  H5     . DOC A 1 7   ? 1.806   30.577 14.714  1.00 48.78  ? 873 DOC P H5     1 
HETATM 141  H  H6     . DOC A 1 7   ? 3.591   29.025 14.214  1.00 51.21  ? 873 DOC P H6     1 
HETATM 142  H  HN41   . DOC A 1 7   ? 0.512   31.359 17.922  1.00 41.23  ? 873 DOC P HN41   1 
HETATM 143  H  HN42   . DOC A 1 7   ? 0.364   31.668 16.473  1.00 41.23  ? 873 DOC P HN42   1 
HETATM 144  H  "H1'"  . DOC A 1 7   ? 5.678   27.592 16.614  1.00 52.13  ? 873 DOC P "H1'"  1 
HETATM 145  H  "H2'"  . DOC A 1 7   ? 3.643   26.276 16.341  1.00 59.57  ? 873 DOC P "H2'"  1 
HETATM 146  H  "H2''" . DOC A 1 7   ? 5.118   25.673 16.254  1.00 59.57  ? 873 DOC P "H2''" 1 
HETATM 147  H  "H3'1" . DOC A 1 7   ? 4.353   25.072 14.188  1.00 58.23  ? 873 DOC P "H3'1" 1 
HETATM 148  H  "H3'2" . DOC A 1 7   ? 3.440   26.382 14.063  1.00 58.23  ? 873 DOC P "H3'2" 1 
HETATM 149  H  "H4'"  . DOC A 1 7   ? 6.317   26.271 13.748  1.00 59.30  ? 873 DOC P "H4'"  1 
HETATM 150  H  "H5'"  . DOC A 1 7   ? 5.867   27.906 11.989  1.00 57.33  ? 873 DOC P "H5'"  1 
HETATM 151  H  "H5''" . DOC A 1 7   ? 5.267   26.473 11.696  1.00 57.33  ? 873 DOC P "H5''" 1 
ATOM   152  O  "O5'"  . DT  B 2 3   ? -12.982 29.670 22.828  1.00 90.89  ? 839 DT  T "O5'"  1 
ATOM   153  C  "C5'"  . DT  B 2 3   ? -12.206 30.830 23.172  1.00 111.76 ? 839 DT  T "C5'"  1 
ATOM   154  C  "C4'"  . DT  B 2 3   ? -10.718 30.497 23.359  1.00 107.60 ? 839 DT  T "C4'"  1 
ATOM   155  O  "O4'"  . DT  B 2 3   ? -10.088 30.325 22.053  1.00 112.64 ? 839 DT  T "O4'"  1 
ATOM   156  C  "C3'"  . DT  B 2 3   ? -9.894  31.584 24.074  1.00 106.95 ? 839 DT  T "C3'"  1 
ATOM   157  O  "O3'"  . DT  B 2 3   ? -8.880  31.004 24.930  1.00 96.79  ? 839 DT  T "O3'"  1 
ATOM   158  C  "C2'"  . DT  B 2 3   ? -9.275  32.362 22.914  1.00 109.22 ? 839 DT  T "C2'"  1 
ATOM   159  C  "C1'"  . DT  B 2 3   ? -9.022  31.255 21.898  1.00 105.70 ? 839 DT  T "C1'"  1 
ATOM   160  N  N1     . DT  B 2 3   ? -8.981  31.755 20.460  1.00 110.39 ? 839 DT  T N1     1 
ATOM   161  C  C2     . DT  B 2 3   ? -8.447  30.947 19.464  1.00 116.65 ? 839 DT  T C2     1 
ATOM   162  O  O2     . DT  B 2 3   ? -8.010  29.823 19.666  1.00 106.23 ? 839 DT  T O2     1 
ATOM   163  N  N3     . DT  B 2 3   ? -8.456  31.504 18.206  1.00 120.84 ? 839 DT  T N3     1 
ATOM   164  C  C4     . DT  B 2 3   ? -8.924  32.759 17.847  1.00 119.29 ? 839 DT  T C4     1 
ATOM   165  O  O4     . DT  B 2 3   ? -8.888  33.169 16.686  1.00 122.27 ? 839 DT  T O4     1 
ATOM   166  C  C5     . DT  B 2 3   ? -9.458  33.552 18.932  1.00 112.80 ? 839 DT  T C5     1 
ATOM   167  C  C7     . DT  B 2 3   ? -9.994  34.926 18.662  1.00 114.52 ? 839 DT  T C7     1 
ATOM   168  C  C6     . DT  B 2 3   ? -9.457  33.022 20.169  1.00 107.34 ? 839 DT  T C6     1 
HETATM 169  C  C2     . MA7 B 2 4   ? -4.535  31.859 21.484  1.00 65.39  ? 840 MA7 T C2     1 
HETATM 170  C  C4     . MA7 B 2 4   ? -3.243  30.248 22.553  1.00 51.73  ? 840 MA7 T C4     1 
HETATM 171  C  C5     . MA7 B 2 4   ? -2.646  29.960 21.383  1.00 55.04  ? 840 MA7 T C5     1 
HETATM 172  C  C6     . MA7 B 2 4   ? -3.000  30.644 20.232  1.00 52.54  ? 840 MA7 T C6     1 
HETATM 173  C  C8     . MA7 B 2 4   ? -1.764  28.631 22.895  1.00 49.76  ? 840 MA7 T C8     1 
HETATM 174  P  P      . MA7 B 2 4   ? -7.842  31.949 25.740  1.00 112.95 ? 840 MA7 T P      1 
HETATM 175  O  OP1    . MA7 B 2 4   ? -8.240  32.053 27.183  1.00 104.55 ? 840 MA7 T OP1    1 
HETATM 176  O  OP2    . MA7 B 2 4   ? -7.640  33.354 25.161  1.00 101.30 ? 840 MA7 T OP2    1 
HETATM 177  O  "O5'"  . MA7 B 2 4   ? -6.410  31.157 25.622  1.00 79.67  ? 840 MA7 T "O5'"  1 
HETATM 178  N  N9     . MA7 B 2 4   ? -2.695  29.428 23.477  1.00 57.62  ? 840 MA7 T N9     1 
HETATM 179  N  N3     . MA7 B 2 4   ? -4.187  31.191 22.613  1.00 50.01  ? 840 MA7 T N3     1 
HETATM 180  N  N1     . MA7 B 2 4   ? -3.927  31.578 20.279  1.00 56.85  ? 840 MA7 T N1     1 
HETATM 181  N  N6     . MA7 B 2 4   ? -2.249  30.228 19.028  1.00 52.43  ? 840 MA7 T N6     1 
HETATM 182  N  N7     . MA7 B 2 4   ? -1.728  28.971 21.598  1.00 43.95  ? 840 MA7 T N7     1 
HETATM 183  C  CN     . MA7 B 2 4   ? -4.433  32.428 19.188  1.00 59.27  ? 840 MA7 T CN     1 
HETATM 184  C  "C2'"  . MA7 B 2 4   ? -2.919  30.749 25.702  1.00 59.33  ? 840 MA7 T "C2'"  1 
HETATM 185  C  "C5'"  . MA7 B 2 4   ? -6.200  30.203 26.596  1.00 73.83  ? 840 MA7 T "C5'"  1 
HETATM 186  C  "C4'"  . MA7 B 2 4   ? -4.840  29.636 26.504  1.00 69.91  ? 840 MA7 T "C4'"  1 
HETATM 187  O  "O4'"  . MA7 B 2 4   ? -4.407  29.182 24.936  1.00 61.82  ? 840 MA7 T "O4'"  1 
HETATM 188  C  "C1'"  . MA7 B 2 4   ? -3.096  29.376 24.886  1.00 63.23  ? 840 MA7 T "C1'"  1 
HETATM 189  C  "C3'"  . MA7 B 2 4   ? -3.876  30.471 26.916  1.00 54.62  ? 840 MA7 T "C3'"  1 
HETATM 190  O  "O3'"  . MA7 B 2 4   ? -3.144  29.678 27.891  1.00 57.96  ? 840 MA7 T "O3'"  1 
HETATM 191  H  H2     . MA7 B 2 4   ? -5.190  32.517 21.525  1.00 78.46  ? 840 MA7 T H2     1 
HETATM 192  H  H8     . MA7 B 2 4   ? -1.250  27.979 23.315  1.00 59.71  ? 840 MA7 T H8     1 
HETATM 193  H  H61    . MA7 B 2 4   ? -1.649  29.615 19.086  1.00 62.92  ? 840 MA7 T H61    1 
HETATM 194  H  H62    . MA7 B 2 4   ? -2.412  30.599 18.269  1.00 62.92  ? 840 MA7 T H62    1 
HETATM 195  H  HN1    . MA7 B 2 4   ? -5.024  33.104 19.555  1.00 71.13  ? 840 MA7 T HN1    1 
HETATM 196  H  HN2    . MA7 B 2 4   ? -4.922  31.882 18.554  1.00 71.13  ? 840 MA7 T HN2    1 
HETATM 197  H  HN3    . MA7 B 2 4   ? -3.688  32.858 18.739  1.00 71.13  ? 840 MA7 T HN3    1 
HETATM 198  H  "H2'"  . MA7 B 2 4   ? -3.225  31.508 25.181  1.00 71.19  ? 840 MA7 T "H2'"  1 
HETATM 199  H  "H2''" . MA7 B 2 4   ? -2.003  30.864 25.999  1.00 71.19  ? 840 MA7 T "H2''" 1 
HETATM 200  H  "H5'"  . MA7 B 2 4   ? -6.849  29.490 26.488  1.00 88.60  ? 840 MA7 T "H5'"  1 
HETATM 201  H  "H5''" . MA7 B 2 4   ? -6.315  30.608 27.470  1.00 88.60  ? 840 MA7 T "H5''" 1 
HETATM 202  H  "H4'"  . MA7 B 2 4   ? -4.805  28.844 27.063  1.00 83.89  ? 840 MA7 T "H4'"  1 
HETATM 203  H  "H1'"  . MA7 B 2 4   ? -2.636  28.654 25.343  1.00 75.87  ? 840 MA7 T "H1'"  1 
HETATM 204  H  "H3'"  . MA7 B 2 4   ? -4.236  31.288 27.296  1.00 65.55  ? 840 MA7 T "H3'"  1 
ATOM   205  P  P      . DG  B 2 5   ? -2.160  30.383 28.919  1.00 58.94  ? 841 DG  T P      1 
ATOM   206  O  OP1    . DG  B 2 5   ? -2.066  29.556 30.160  1.00 60.20  ? 841 DG  T OP1    1 
ATOM   207  O  OP2    . DG  B 2 5   ? -2.608  31.795 28.948  1.00 59.42  ? 841 DG  T OP2    1 
ATOM   208  O  "O5'"  . DG  B 2 5   ? -0.737  30.280 28.197  1.00 59.38  ? 841 DG  T "O5'"  1 
ATOM   209  C  "C5'"  . DG  B 2 5   ? 0.027   29.079 28.302  1.00 46.39  ? 841 DG  T "C5'"  1 
ATOM   210  C  "C4'"  . DG  B 2 5   ? 1.314   29.229 27.540  1.00 50.53  ? 841 DG  T "C4'"  1 
ATOM   211  O  "O4'"  . DG  B 2 5   ? 1.013   29.341 26.111  1.00 58.80  ? 841 DG  T "O4'"  1 
ATOM   212  C  "C3'"  . DG  B 2 5   ? 2.123   30.487 27.885  1.00 45.64  ? 841 DG  T "C3'"  1 
ATOM   213  O  "O3'"  . DG  B 2 5   ? 3.489   30.166 27.869  1.00 46.73  ? 841 DG  T "O3'"  1 
ATOM   214  C  "C2'"  . DG  B 2 5   ? 1.771   31.416 26.726  1.00 48.15  ? 841 DG  T "C2'"  1 
ATOM   215  C  "C1'"  . DG  B 2 5   ? 1.767   30.403 25.598  1.00 42.76  ? 841 DG  T "C1'"  1 
ATOM   216  N  N9     . DG  B 2 5   ? 1.174   30.882 24.358  1.00 49.40  ? 841 DG  T N9     1 
ATOM   217  C  C8     . DG  B 2 5   ? 0.219   31.861 24.221  1.00 45.99  ? 841 DG  T C8     1 
ATOM   218  N  N7     . DG  B 2 5   ? -0.095  32.105 22.984  1.00 40.93  ? 841 DG  T N7     1 
ATOM   219  C  C5     . DG  B 2 5   ? 0.710   31.244 22.251  1.00 41.80  ? 841 DG  T C5     1 
ATOM   220  C  C6     . DG  B 2 5   ? 0.796   31.048 20.849  1.00 42.05  ? 841 DG  T C6     1 
ATOM   221  O  O6     . DG  B 2 5   ? 0.156   31.623 19.951  1.00 43.62  ? 841 DG  T O6     1 
ATOM   222  N  N1     . DG  B 2 5   ? 1.716   30.055 20.522  1.00 39.06  ? 841 DG  T N1     1 
ATOM   223  C  C2     . DG  B 2 5   ? 2.467   29.356 21.437  1.00 45.02  ? 841 DG  T C2     1 
ATOM   224  N  N2     . DG  B 2 5   ? 3.319   28.450 20.942  1.00 36.60  ? 841 DG  T N2     1 
ATOM   225  N  N3     . DG  B 2 5   ? 2.397   29.538 22.748  1.00 42.32  ? 841 DG  T N3     1 
ATOM   226  C  C4     . DG  B 2 5   ? 1.494   30.483 23.081  1.00 42.56  ? 841 DG  T C4     1 
ATOM   227  P  P      . DG  B 2 6   ? 4.514   30.827 28.903  1.00 47.95  ? 842 DG  T P      1 
ATOM   228  O  OP1    . DG  B 2 6   ? 5.588   29.823 29.120  1.00 42.64  ? 842 DG  T OP1    1 
ATOM   229  O  OP2    . DG  B 2 6   ? 3.740   31.350 30.063  1.00 60.43  ? 842 DG  T OP2    1 
ATOM   230  O  "O5'"  . DG  B 2 6   ? 5.187   32.083 28.126  1.00 59.23  ? 842 DG  T "O5'"  1 
ATOM   231  C  "C5'"  . DG  B 2 6   ? 4.921   32.376 26.743  1.00 50.23  ? 842 DG  T "C5'"  1 
ATOM   232  C  "C4'"  . DG  B 2 6   ? 5.575   31.362 25.818  1.00 41.58  ? 842 DG  T "C4'"  1 
ATOM   233  O  "O4'"  . DG  B 2 6   ? 4.608   31.005 24.826  1.00 47.81  ? 842 DG  T "O4'"  1 
ATOM   234  C  "C3'"  . DG  B 2 6   ? 6.798   31.855 25.055  1.00 44.78  ? 842 DG  T "C3'"  1 
ATOM   235  O  "O3'"  . DG  B 2 6   ? 8.008   31.459 25.725  1.00 56.96  ? 842 DG  T "O3'"  1 
ATOM   236  C  "C2'"  . DG  B 2 6   ? 6.685   31.155 23.703  1.00 46.13  ? 842 DG  T "C2'"  1 
ATOM   237  C  "C1'"  . DG  B 2 6   ? 5.188   30.933 23.551  1.00 49.03  ? 842 DG  T "C1'"  1 
ATOM   238  N  N9     . DG  B 2 6   ? 4.511   31.903 22.725  1.00 42.55  ? 842 DG  T N9     1 
ATOM   239  C  C8     . DG  B 2 6   ? 3.653   32.873 23.159  1.00 38.10  ? 842 DG  T C8     1 
ATOM   240  N  N7     . DG  B 2 6   ? 3.174   33.602 22.194  1.00 43.62  ? 842 DG  T N7     1 
ATOM   241  C  C5     . DG  B 2 6   ? 3.761   33.085 21.044  1.00 44.90  ? 842 DG  T C5     1 
ATOM   242  C  C6     . DG  B 2 6   ? 3.608   33.472 19.690  1.00 43.52  ? 842 DG  T C6     1 
ATOM   243  O  O6     . DG  B 2 6   ? 2.911   34.379 19.234  1.00 52.32  ? 842 DG  T O6     1 
ATOM   244  N  N1     . DG  B 2 6   ? 4.367   32.684 18.833  1.00 41.67  ? 842 DG  T N1     1 
ATOM   245  C  C2     . DG  B 2 6   ? 5.170   31.640 19.240  1.00 49.11  ? 842 DG  T C2     1 
ATOM   246  N  N2     . DG  B 2 6   ? 5.835   30.996 18.269  1.00 42.07  ? 842 DG  T N2     1 
ATOM   247  N  N3     . DG  B 2 6   ? 5.319   31.261 20.522  1.00 45.16  ? 842 DG  T N3     1 
ATOM   248  C  C4     . DG  B 2 6   ? 4.587   32.030 21.357  1.00 40.71  ? 842 DG  T C4     1 
ATOM   249  P  P      . DG  B 2 7   ? 9.392   32.212 25.399  1.00 48.71  ? 843 DG  T P      1 
ATOM   250  O  OP1    . DG  B 2 7   ? 10.512  31.488 26.033  1.00 42.51  ? 843 DG  T OP1    1 
ATOM   251  O  OP2    . DG  B 2 7   ? 9.175   33.650 25.640  1.00 54.87  ? 843 DG  T OP2    1 
ATOM   252  O  "O5'"  . DG  B 2 7   ? 9.545   32.060 23.815  1.00 55.13  ? 843 DG  T "O5'"  1 
ATOM   253  C  "C5'"  . DG  B 2 7   ? 10.370  32.965 23.087  1.00 40.83  ? 843 DG  T "C5'"  1 
ATOM   254  C  "C4'"  . DG  B 2 7   ? 10.260  32.683 21.619  1.00 45.85  ? 843 DG  T "C4'"  1 
ATOM   255  O  "O4'"  . DG  B 2 7   ? 8.873   32.568 21.250  1.00 46.15  ? 843 DG  T "O4'"  1 
ATOM   256  C  "C3'"  . DG  B 2 7   ? 10.802  33.782 20.732  1.00 51.65  ? 843 DG  T "C3'"  1 
ATOM   257  O  "O3'"  . DG  B 2 7   ? 12.185  33.592 20.551  1.00 56.14  ? 843 DG  T "O3'"  1 
ATOM   258  C  "C2'"  . DG  B 2 7   ? 10.045  33.572 19.431  1.00 42.62  ? 843 DG  T "C2'"  1 
ATOM   259  C  "C1'"  . DG  B 2 7   ? 8.707   33.010 19.913  1.00 43.53  ? 843 DG  T "C1'"  1 
ATOM   260  N  N9     . DG  B 2 7   ? 7.633   33.979 19.886  1.00 47.44  ? 843 DG  T N9     1 
ATOM   261  C  C8     . DG  B 2 7   ? 6.939   34.490 20.963  1.00 36.97  ? 843 DG  T C8     1 
ATOM   262  N  N7     . DG  B 2 7   ? 6.016   35.346 20.614  1.00 40.18  ? 843 DG  T N7     1 
ATOM   263  C  C5     . DG  B 2 7   ? 6.113   35.408 19.217  1.00 48.94  ? 843 DG  T C5     1 
ATOM   264  C  C6     . DG  B 2 7   ? 5.358   36.159 18.272  1.00 51.64  ? 843 DG  T C6     1 
ATOM   265  O  O6     . DG  B 2 7   ? 4.415   36.962 18.483  1.00 45.35  ? 843 DG  T O6     1 
ATOM   266  N  N1     . DG  B 2 7   ? 5.785   35.907 16.965  1.00 50.26  ? 843 DG  T N1     1 
ATOM   267  C  C2     . DG  B 2 7   ? 6.803   35.047 16.621  1.00 44.00  ? 843 DG  T C2     1 
ATOM   268  N  N2     . DG  B 2 7   ? 7.075   34.937 15.309  1.00 40.33  ? 843 DG  T N2     1 
ATOM   269  N  N3     . DG  B 2 7   ? 7.508   34.348 17.498  1.00 44.45  ? 843 DG  T N3     1 
ATOM   270  C  C4     . DG  B 2 7   ? 7.103   34.570 18.763  1.00 43.36  ? 843 DG  T C4     1 
ATOM   271  P  P      . DT  B 2 8   ? 13.097  34.857 20.230  1.00 45.61  ? 844 DT  T P      1 
ATOM   272  O  OP1    . DT  B 2 8   ? 14.511  34.451 20.439  1.00 49.70  ? 844 DT  T OP1    1 
ATOM   273  O  OP2    . DT  B 2 8   ? 12.516  35.992 20.984  1.00 52.78  ? 844 DT  T OP2    1 
ATOM   274  O  "O5'"  . DT  B 2 8   ? 12.807  35.118 18.691  1.00 49.18  ? 844 DT  T "O5'"  1 
ATOM   275  C  "C5'"  . DT  B 2 8   ? 13.318  34.221 17.696  1.00 51.93  ? 844 DT  T "C5'"  1 
ATOM   276  C  "C4'"  . DT  B 2 8   ? 12.944  34.743 16.339  1.00 45.81  ? 844 DT  T "C4'"  1 
ATOM   277  O  "O4'"  . DT  B 2 8   ? 11.524  34.897 16.308  1.00 49.87  ? 844 DT  T "O4'"  1 
ATOM   278  C  "C3'"  . DT  B 2 8   ? 13.481  36.128 16.076  1.00 49.72  ? 844 DT  T "C3'"  1 
ATOM   279  O  "O3'"  . DT  B 2 8   ? 14.663  36.021 15.383  1.00 58.88  ? 844 DT  T "O3'"  1 
ATOM   280  C  "C2'"  . DT  B 2 8   ? 12.433  36.788 15.204  1.00 58.01  ? 844 DT  T "C2'"  1 
ATOM   281  C  "C1'"  . DT  B 2 8   ? 11.172  36.010 15.515  1.00 52.58  ? 844 DT  T "C1'"  1 
ATOM   282  N  N1     . DT  B 2 8   ? 10.196  36.792 16.227  1.00 46.81  ? 844 DT  T N1     1 
ATOM   283  C  C2     . DT  B 2 8   ? 9.342   37.586 15.520  1.00 44.96  ? 844 DT  T C2     1 
ATOM   284  O  O2     . DT  B 2 8   ? 9.368   37.673 14.311  1.00 45.54  ? 844 DT  T O2     1 
ATOM   285  N  N3     . DT  B 2 8   ? 8.452   38.281 16.287  1.00 45.08  ? 844 DT  T N3     1 
ATOM   286  C  C4     . DT  B 2 8   ? 8.356   38.266 17.666  1.00 40.35  ? 844 DT  T C4     1 
ATOM   287  O  O4     . DT  B 2 8   ? 7.520   38.914 18.266  1.00 51.20  ? 844 DT  T O4     1 
ATOM   288  C  C5     . DT  B 2 8   ? 9.282   37.406 18.341  1.00 44.95  ? 844 DT  T C5     1 
ATOM   289  C  C7     . DT  B 2 8   ? 9.265   37.288 19.836  1.00 43.62  ? 844 DT  T C7     1 
ATOM   290  C  C6     . DT  B 2 8   ? 10.151  36.718 17.596  1.00 51.92  ? 844 DT  T C6     1 
ATOM   291  P  P      . DC  B 2 9   ? 15.638  37.280 15.322  1.00 72.00  ? 845 DC  T P      1 
ATOM   292  O  OP1    . DC  B 2 9   ? 16.901  36.760 14.751  1.00 80.29  ? 845 DC  T OP1    1 
ATOM   293  O  OP2    . DC  B 2 9   ? 15.607  37.967 16.641  1.00 64.94  ? 845 DC  T OP2    1 
ATOM   294  O  "O5'"  . DC  B 2 9   ? 14.907  38.267 14.309  1.00 62.30  ? 845 DC  T "O5'"  1 
ATOM   295  C  "C5'"  . DC  B 2 9   ? 14.622  37.849 12.991  1.00 50.64  ? 845 DC  T "C5'"  1 
ATOM   296  C  "C4'"  . DC  B 2 9   ? 13.718  38.872 12.322  1.00 46.40  ? 845 DC  T "C4'"  1 
ATOM   297  O  "O4'"  . DC  B 2 9   ? 12.532  39.048 13.136  1.00 58.06  ? 845 DC  T "O4'"  1 
ATOM   298  C  "C3'"  . DC  B 2 9   ? 14.330  40.273 12.164  1.00 52.76  ? 845 DC  T "C3'"  1 
ATOM   299  O  "O3'"  . DC  B 2 9   ? 14.188  40.706 10.825  1.00 58.65  ? 845 DC  T "O3'"  1 
ATOM   300  C  "C2'"  . DC  B 2 9   ? 13.513  41.147 13.125  1.00 47.51  ? 845 DC  T "C2'"  1 
ATOM   301  C  "C1'"  . DC  B 2 9   ? 12.190  40.411 13.165  1.00 47.35  ? 845 DC  T "C1'"  1 
ATOM   302  N  N1     . DC  B 2 9   ? 11.409  40.674 14.401  1.00 46.38  ? 845 DC  T N1     1 
ATOM   303  C  C2     . DC  B 2 9   ? 10.198  41.352 14.316  1.00 49.06  ? 845 DC  T C2     1 
ATOM   304  O  O2     . DC  B 2 9   ? 9.800   41.709 13.211  1.00 51.52  ? 845 DC  T O2     1 
ATOM   305  N  N3     . DC  B 2 9   ? 9.496   41.607 15.455  1.00 47.25  ? 845 DC  T N3     1 
ATOM   306  C  C4     . DC  B 2 9   ? 9.977   41.204 16.634  1.00 48.14  ? 845 DC  T C4     1 
ATOM   307  N  N4     . DC  B 2 9   ? 9.258   41.471 17.734  1.00 49.72  ? 845 DC  T N4     1 
ATOM   308  C  C5     . DC  B 2 9   ? 11.219  40.519 16.738  1.00 38.46  ? 845 DC  T C5     1 
ATOM   309  C  C6     . DC  B 2 9   ? 11.897  40.286 15.609  1.00 45.12  ? 845 DC  T C6     1 
ATOM   310  P  P      . DC  B 2 10  ? 14.773  42.131 10.349  1.00 63.86  ? 846 DC  T P      1 
ATOM   311  O  OP1    . DC  B 2 10  ? 15.290  41.938 8.968   1.00 62.55  ? 846 DC  T OP1    1 
ATOM   312  O  OP2    . DC  B 2 10  ? 15.589  42.743 11.429  1.00 55.02  ? 846 DC  T OP2    1 
ATOM   313  O  "O5'"  . DC  B 2 10  ? 13.472  43.011 10.205  1.00 49.80  ? 846 DC  T "O5'"  1 
ATOM   314  C  "C5'"  . DC  B 2 10  ? 12.513  42.649 9.271   1.00 49.72  ? 846 DC  T "C5'"  1 
ATOM   315  C  "C4'"  . DC  B 2 10  ? 11.343  43.588 9.364   1.00 46.48  ? 846 DC  T "C4'"  1 
ATOM   316  O  "O4'"  . DC  B 2 10  ? 10.813  43.562 10.714  1.00 52.75  ? 846 DC  T "O4'"  1 
ATOM   317  C  "C3'"  . DC  B 2 10  ? 11.670  45.052 9.061   1.00 50.99  ? 846 DC  T "C3'"  1 
ATOM   318  O  "O3'"  . DC  B 2 10  ? 10.707  45.553 8.165   1.00 60.94  ? 846 DC  T "O3'"  1 
ATOM   319  C  "C2'"  . DC  B 2 10  ? 11.582  45.750 10.434  1.00 54.48  ? 846 DC  T "C2'"  1 
ATOM   320  C  "C1'"  . DC  B 2 10  ? 10.554  44.886 11.146  1.00 47.73  ? 846 DC  T "C1'"  1 
ATOM   321  N  N1     . DC  B 2 10  ? 10.665  44.882 12.603  1.00 48.35  ? 846 DC  T N1     1 
ATOM   322  C  C2     . DC  B 2 10  ? 9.640   45.448 13.378  1.00 54.68  ? 846 DC  T C2     1 
ATOM   323  O  O2     . DC  B 2 10  ? 8.671   45.986 12.808  1.00 46.38  ? 846 DC  T O2     1 
ATOM   324  N  N3     . DC  B 2 10  ? 9.734   45.383 14.741  1.00 52.64  ? 846 DC  T N3     1 
ATOM   325  C  C4     . DC  B 2 10  ? 10.788  44.787 15.312  1.00 49.89  ? 846 DC  T C4     1 
ATOM   326  N  N4     . DC  B 2 10  ? 10.839  44.754 16.653  1.00 50.28  ? 846 DC  T N4     1 
ATOM   327  C  C5     . DC  B 2 10  ? 11.829  44.190 14.534  1.00 40.08  ? 846 DC  T C5     1 
ATOM   328  C  C6     . DC  B 2 10  ? 11.725  44.248 13.200  1.00 45.27  ? 846 DC  T C6     1 
ATOM   329  P  P      . DT  B 2 11  ? 10.991  46.887 7.323   1.00 57.49  ? 847 DT  T P      1 
ATOM   330  O  OP1    . DT  B 2 11  ? 10.410  46.695 5.964   1.00 62.71  ? 847 DT  T OP1    1 
ATOM   331  O  OP2    . DT  B 2 11  ? 12.448  47.148 7.367   1.00 64.33  ? 847 DT  T OP2    1 
ATOM   332  O  "O5'"  . DT  B 2 11  ? 10.192  47.993 8.164   1.00 54.78  ? 847 DT  T "O5'"  1 
ATOM   333  C  "C5'"  . DT  B 2 11  ? 8.780   48.075 8.049   1.00 49.08  ? 847 DT  T "C5'"  1 
ATOM   334  C  "C4'"  . DT  B 2 11  ? 8.203   49.116 9.008   1.00 62.68  ? 847 DT  T "C4'"  1 
ATOM   335  O  "O4'"  . DT  B 2 11  ? 8.497   48.730 10.367  1.00 52.90  ? 847 DT  T "O4'"  1 
ATOM   336  C  "C3'"  . DT  B 2 11  ? 8.753   50.542 8.852   1.00 72.05  ? 847 DT  T "C3'"  1 
ATOM   337  O  "O3'"  . DT  B 2 11  ? 7.814   51.369 8.113   1.00 55.35  ? 847 DT  T "O3'"  1 
ATOM   338  C  "C2'"  . DT  B 2 11  ? 8.972   51.039 10.309  1.00 64.16  ? 847 DT  T "C2'"  1 
ATOM   339  C  "C1'"  . DT  B 2 11  ? 8.461   49.876 11.179  1.00 57.92  ? 847 DT  T "C1'"  1 
ATOM   340  N  N1     . DT  B 2 11  ? 9.280   49.566 12.409  1.00 52.78  ? 847 DT  T N1     1 
ATOM   341  C  C2     . DT  B 2 11  ? 8.771   49.842 13.676  1.00 51.31  ? 847 DT  T C2     1 
ATOM   342  O  O2     . DT  B 2 11  ? 7.692   50.382 13.870  1.00 54.61  ? 847 DT  T O2     1 
ATOM   343  N  N3     . DT  B 2 11  ? 9.582   49.466 14.712  1.00 46.34  ? 847 DT  T N3     1 
ATOM   344  C  C4     . DT  B 2 11  ? 10.826  48.855 14.621  1.00 51.72  ? 847 DT  T C4     1 
ATOM   345  O  O4     . DT  B 2 11  ? 11.496  48.556 15.629  1.00 46.70  ? 847 DT  T O4     1 
ATOM   346  C  C5     . DT  B 2 11  ? 11.288  48.595 13.265  1.00 40.42  ? 847 DT  T C5     1 
ATOM   347  C  C7     . DT  B 2 11  ? 12.618  47.945 13.028  1.00 36.84  ? 847 DT  T C7     1 
ATOM   348  C  C6     . DT  B 2 11  ? 10.496  48.947 12.248  1.00 44.60  ? 847 DT  T C6     1 
ATOM   349  N  N      . SER C 3 26  ? 23.563  29.395 -7.174  1.00 78.86  ? 26  SER A N      1 
ATOM   350  C  CA     . SER C 3 26  ? 23.983  28.095 -6.654  1.00 81.58  ? 26  SER A CA     1 
ATOM   351  C  C      . SER C 3 26  ? 22.818  27.449 -5.902  1.00 77.56  ? 26  SER A C      1 
ATOM   352  O  O      . SER C 3 26  ? 22.132  28.115 -5.113  1.00 73.71  ? 26  SER A O      1 
ATOM   353  C  CB     . SER C 3 26  ? 25.214  28.237 -5.741  1.00 63.61  ? 26  SER A CB     1 
ATOM   354  N  N      . SER C 3 27  ? 22.592  26.159 -6.152  1.00 59.58  ? 27  SER A N      1 
ATOM   355  C  CA     . SER C 3 27  ? 21.465  25.472 -5.537  1.00 67.59  ? 27  SER A CA     1 
ATOM   356  C  C      . SER C 3 27  ? 21.831  24.965 -4.140  1.00 66.29  ? 27  SER A C      1 
ATOM   357  O  O      . SER C 3 27  ? 22.997  24.723 -3.811  1.00 62.06  ? 27  SER A O      1 
ATOM   358  C  CB     . SER C 3 27  ? 21.002  24.298 -6.400  1.00 52.43  ? 27  SER A CB     1 
ATOM   359  O  OG     . SER C 3 27  ? 21.776  23.150 -6.076  1.00 59.97  ? 27  SER A OG     1 
ATOM   360  N  N      . ARG C 3 28  ? 20.818  24.806 -3.313  1.00 51.25  ? 28  ARG A N      1 
ATOM   361  C  CA     . ARG C 3 28  ? 21.032  24.385 -1.948  1.00 47.45  ? 28  ARG A CA     1 
ATOM   362  C  C      . ARG C 3 28  ? 20.273  23.093 -1.694  1.00 38.73  ? 28  ARG A C      1 
ATOM   363  O  O      . ARG C 3 28  ? 19.328  22.756 -2.403  1.00 47.57  ? 28  ARG A O      1 
ATOM   364  C  CB     . ARG C 3 28  ? 20.575  25.476 -0.979  1.00 45.79  ? 28  ARG A CB     1 
ATOM   365  C  CG     . ARG C 3 28  ? 21.436  26.742 -0.992  1.00 43.21  ? 28  ARG A CG     1 
ATOM   366  C  CD     . ARG C 3 28  ? 20.806  27.804 -0.071  1.00 44.29  ? 28  ARG A CD     1 
ATOM   367  N  NE     . ARG C 3 28  ? 19.436  28.069 -0.505  1.00 41.37  ? 28  ARG A NE     1 
ATOM   368  C  CZ     . ARG C 3 28  ? 18.510  28.703 0.203   1.00 41.43  ? 28  ARG A CZ     1 
ATOM   369  N  NH1    . ARG C 3 28  ? 18.786  29.160 1.418   1.00 51.14  ? 28  ARG A NH1    1 
ATOM   370  N  NH2    . ARG C 3 28  ? 17.295  28.888 -0.315  1.00 44.41  ? 28  ARG A NH2    1 
ATOM   371  N  N      . VAL C 3 29  ? 20.678  22.376 -0.656  1.00 48.91  ? 29  VAL A N      1 
ATOM   372  C  CA     . VAL C 3 29  ? 19.892  21.277 -0.106  1.00 43.50  ? 29  VAL A CA     1 
ATOM   373  C  C      . VAL C 3 29  ? 19.537  21.647 1.328   1.00 40.60  ? 29  VAL A C      1 
ATOM   374  O  O      . VAL C 3 29  ? 20.414  21.753 2.194   1.00 43.34  ? 29  VAL A O      1 
ATOM   375  C  CB     . VAL C 3 29  ? 20.636  19.948 -0.178  1.00 38.40  ? 29  VAL A CB     1 
ATOM   376  C  CG1    . VAL C 3 29  ? 19.728  18.829 0.290   1.00 36.08  ? 29  VAL A CG1    1 
ATOM   377  C  CG2    . VAL C 3 29  ? 21.062  19.714 -1.611  1.00 38.14  ? 29  VAL A CG2    1 
ATOM   378  N  N      . ILE C 3 30  ? 18.262  21.891 1.558   1.00 37.67  ? 30  ILE A N      1 
ATOM   379  C  CA     . ILE C 3 30  ? 17.732  22.291 2.846   1.00 32.72  ? 30  ILE A CA     1 
ATOM   380  C  C      . ILE C 3 30  ? 16.854  21.169 3.356   1.00 34.40  ? 30  ILE A C      1 
ATOM   381  O  O      . ILE C 3 30  ? 16.206  20.462 2.575   1.00 43.78  ? 30  ILE A O      1 
ATOM   382  C  CB     . ILE C 3 30  ? 16.912  23.588 2.731   1.00 41.41  ? 30  ILE A CB     1 
ATOM   383  C  CG1    . ILE C 3 30  ? 17.753  24.676 2.077   1.00 40.84  ? 30  ILE A CG1    1 
ATOM   384  C  CG2    . ILE C 3 30  ? 16.380  24.001 4.081   1.00 35.15  ? 30  ILE A CG2    1 
ATOM   385  C  CD1    . ILE C 3 30  ? 19.148  24.744 2.620   1.00 43.05  ? 30  ILE A CD1    1 
ATOM   386  N  N      . VAL C 3 31  ? 16.822  21.005 4.676   1.00 37.07  ? 31  VAL A N      1 
ATOM   387  C  CA     . VAL C 3 31  ? 15.909  20.069 5.310   1.00 36.55  ? 31  VAL A CA     1 
ATOM   388  C  C      . VAL C 3 31  ? 15.059  20.812 6.333   1.00 35.08  ? 31  VAL A C      1 
ATOM   389  O  O      . VAL C 3 31  ? 15.547  21.692 7.049   1.00 34.51  ? 31  VAL A O      1 
ATOM   390  C  CB     . VAL C 3 31  ? 16.655  18.890 5.970   1.00 42.15  ? 31  VAL A CB     1 
ATOM   391  C  CG1    . VAL C 3 31  ? 17.612  19.403 7.024   1.00 36.71  ? 31  VAL A CG1    1 
ATOM   392  C  CG2    . VAL C 3 31  ? 15.632  17.899 6.571   1.00 32.77  ? 31  VAL A CG2    1 
ATOM   393  N  N      . HIS C 3 32  ? 13.781  20.454 6.387   1.00 34.87  ? 32  HIS A N      1 
ATOM   394  C  CA     . HIS C 3 32  ? 12.850  20.951 7.385   1.00 32.01  ? 32  HIS A CA     1 
ATOM   395  C  C      . HIS C 3 32  ? 12.412  19.783 8.253   1.00 39.51  ? 32  HIS A C      1 
ATOM   396  O  O      . HIS C 3 32  ? 11.782  18.841 7.753   1.00 39.51  ? 32  HIS A O      1 
ATOM   397  C  CB     . HIS C 3 32  ? 11.640  21.594 6.729   1.00 31.81  ? 32  HIS A CB     1 
ATOM   398  C  CG     . HIS C 3 32  ? 10.652  22.140 7.703   1.00 34.70  ? 32  HIS A CG     1 
ATOM   399  N  ND1    . HIS C 3 32  ? 9.411   21.579 7.896   1.00 38.82  ? 32  HIS A ND1    1 
ATOM   400  C  CD2    . HIS C 3 32  ? 10.722  23.202 8.541   1.00 35.05  ? 32  HIS A CD2    1 
ATOM   401  C  CE1    . HIS C 3 32  ? 8.755   22.274 8.812   1.00 36.74  ? 32  HIS A CE1    1 
ATOM   402  N  NE2    . HIS C 3 32  ? 9.528   23.266 9.215   1.00 30.76  ? 32  HIS A NE2    1 
ATOM   403  N  N      . VAL C 3 33  ? 12.760  19.835 9.542   1.00 36.37  ? 33  VAL A N      1 
ATOM   404  C  CA     . VAL C 3 33  ? 12.412  18.786 10.503  1.00 33.62  ? 33  VAL A CA     1 
ATOM   405  C  C      . VAL C 3 33  ? 11.253  19.290 11.346  1.00 33.26  ? 33  VAL A C      1 
ATOM   406  O  O      . VAL C 3 33  ? 11.320  20.398 11.891  1.00 35.29  ? 33  VAL A O      1 
ATOM   407  C  CB     . VAL C 3 33  ? 13.605  18.411 11.392  1.00 30.75  ? 33  VAL A CB     1 
ATOM   408  C  CG1    . VAL C 3 33  ? 13.218  17.258 12.313  1.00 26.09  ? 33  VAL A CG1    1 
ATOM   409  C  CG2    . VAL C 3 33  ? 14.813  18.075 10.532  1.00 22.42  ? 33  VAL A CG2    1 
ATOM   410  N  N      . ASP C 3 34  ? 10.191  18.494 11.463  1.00 30.23  ? 34  ASP A N      1 
ATOM   411  C  CA     . ASP C 3 34  ? 8.957   18.947 12.105  1.00 36.61  ? 34  ASP A CA     1 
ATOM   412  C  C      . ASP C 3 34  ? 8.364   17.798 12.901  1.00 37.34  ? 34  ASP A C      1 
ATOM   413  O  O      . ASP C 3 34  ? 7.927   16.802 12.317  1.00 40.71  ? 34  ASP A O      1 
ATOM   414  C  CB     . ASP C 3 34  ? 7.947   19.452 11.065  1.00 35.83  ? 34  ASP A CB     1 
ATOM   415  C  CG     . ASP C 3 34  ? 6.635   19.903 11.683  1.00 39.08  ? 34  ASP A CG     1 
ATOM   416  O  OD1    . ASP C 3 34  ? 6.386   19.597 12.874  1.00 39.38  ? 34  ASP A OD1    1 
ATOM   417  O  OD2    . ASP C 3 34  ? 5.846   20.555 10.960  1.00 41.30  ? 34  ASP A OD2    1 
ATOM   418  N  N      . LEU C 3 35  ? 8.332   17.937 14.225  1.00 38.01  ? 35  LEU A N      1 
ATOM   419  C  CA     . LEU C 3 35  ? 7.992   16.808 15.083  1.00 38.64  ? 35  LEU A CA     1 
ATOM   420  C  C      . LEU C 3 35  ? 6.487   16.543 15.110  1.00 38.28  ? 35  LEU A C      1 
ATOM   421  O  O      . LEU C 3 35  ? 5.664   17.440 14.898  1.00 36.00  ? 35  LEU A O      1 
ATOM   422  C  CB     . LEU C 3 35  ? 8.525   17.043 16.494  1.00 38.18  ? 35  LEU A CB     1 
ATOM   423  C  CG     . LEU C 3 35  ? 10.048  17.216 16.460  1.00 39.00  ? 35  LEU A CG     1 
ATOM   424  C  CD1    . LEU C 3 35  ? 10.678  17.053 17.819  1.00 35.03  ? 35  LEU A CD1    1 
ATOM   425  C  CD2    . LEU C 3 35  ? 10.638  16.244 15.497  1.00 36.95  ? 35  LEU A CD2    1 
ATOM   426  N  N      . ASP C 3 36  ? 6.145   15.274 15.345  1.00 34.42  ? 36  ASP A N      1 
ATOM   427  C  CA     . ASP C 3 36  ? 4.757   14.858 15.547  1.00 42.40  ? 36  ASP A CA     1 
ATOM   428  C  C      . ASP C 3 36  ? 4.170   15.409 16.855  1.00 42.43  ? 36  ASP A C      1 
ATOM   429  O  O      . ASP C 3 36  ? 4.785   15.299 17.928  1.00 36.70  ? 36  ASP A O      1 
ATOM   430  C  CB     . ASP C 3 36  ? 4.670   13.328 15.557  1.00 40.54  ? 36  ASP A CB     1 
ATOM   431  C  CG     . ASP C 3 36  ? 5.304   12.690 14.318  1.00 45.20  ? 36  ASP A CG     1 
ATOM   432  O  OD1    . ASP C 3 36  ? 5.234   13.298 13.226  1.00 39.98  ? 36  ASP A OD1    1 
ATOM   433  O  OD2    . ASP C 3 36  ? 5.863   11.570 14.446  1.00 42.29  ? 36  ASP A OD2    1 
ATOM   434  N  N      . CYS C 3 37  ? 2.965   15.989 16.757  1.00 39.30  ? 37  CYS A N      1 
ATOM   435  C  CA     . CYS C 3 37  ? 2.163   16.397 17.910  1.00 44.18  ? 37  CYS A CA     1 
ATOM   436  C  C      . CYS C 3 37  ? 3.024   16.669 19.148  1.00 46.00  ? 37  CYS A C      1 
ATOM   437  O  O      . CYS C 3 37  ? 2.899   16.001 20.184  1.00 38.29  ? 37  CYS A O      1 
ATOM   438  C  CB     . CYS C 3 37  ? 1.107   15.326 18.194  1.00 40.22  ? 37  CYS A CB     1 
ATOM   439  S  SG     . CYS C 3 37  ? 1.761   13.643 18.406  1.00 39.64  ? 37  CYS A SG     1 
ATOM   440  N  N      . PHE C 3 38  ? 3.885   17.684 19.049  1.00 50.64  ? 38  PHE A N      1 
ATOM   441  C  CA     . PHE C 3 38  ? 5.059   17.779 19.916  1.00 41.98  ? 38  PHE A CA     1 
ATOM   442  C  C      . PHE C 3 38  ? 4.700   17.759 21.405  1.00 45.12  ? 38  PHE A C      1 
ATOM   443  O  O      . PHE C 3 38  ? 5.278   16.998 22.192  1.00 40.91  ? 38  PHE A O      1 
ATOM   444  C  CB     . PHE C 3 38  ? 5.848   19.038 19.571  1.00 35.31  ? 38  PHE A CB     1 
ATOM   445  C  CG     . PHE C 3 38  ? 7.056   19.217 20.404  1.00 35.77  ? 38  PHE A CG     1 
ATOM   446  C  CD1    . PHE C 3 38  ? 7.995   18.202 20.504  1.00 37.96  ? 38  PHE A CD1    1 
ATOM   447  C  CD2    . PHE C 3 38  ? 7.246   20.378 21.116  1.00 38.80  ? 38  PHE A CD2    1 
ATOM   448  C  CE1    . PHE C 3 38  ? 9.135   18.362 21.281  1.00 40.84  ? 38  PHE A CE1    1 
ATOM   449  C  CE2    . PHE C 3 38  ? 8.376   20.542 21.904  1.00 42.57  ? 38  PHE A CE2    1 
ATOM   450  C  CZ     . PHE C 3 38  ? 9.321   19.530 21.985  1.00 37.33  ? 38  PHE A CZ     1 
ATOM   451  N  N      . TYR C 3 39  ? 3.779   18.622 21.829  1.00 46.88  ? 39  TYR A N      1 
ATOM   452  C  CA     . TYR C 3 39  ? 3.448   18.632 23.250  1.00 47.04  ? 39  TYR A CA     1 
ATOM   453  C  C      . TYR C 3 39  ? 2.873   17.282 23.660  1.00 46.96  ? 39  TYR A C      1 
ATOM   454  O  O      . TYR C 3 39  ? 3.304   16.672 24.654  1.00 45.07  ? 39  TYR A O      1 
ATOM   455  C  CB     . TYR C 3 39  ? 2.464   19.760 23.581  1.00 44.79  ? 39  TYR A CB     1 
ATOM   456  C  CG     . TYR C 3 39  ? 2.988   21.188 23.532  1.00 41.16  ? 39  TYR A CG     1 
ATOM   457  C  CD1    . TYR C 3 39  ? 4.308   21.487 23.125  1.00 43.90  ? 39  TYR A CD1    1 
ATOM   458  C  CD2    . TYR C 3 39  ? 2.159   22.246 23.905  1.00 43.64  ? 39  TYR A CD2    1 
ATOM   459  C  CE1    . TYR C 3 39  ? 4.771   22.798 23.088  1.00 31.14  ? 39  TYR A CE1    1 
ATOM   460  C  CE2    . TYR C 3 39  ? 2.606   23.553 23.880  1.00 42.84  ? 39  TYR A CE2    1 
ATOM   461  C  CZ     . TYR C 3 39  ? 3.905   23.824 23.474  1.00 42.04  ? 39  TYR A CZ     1 
ATOM   462  O  OH     . TYR C 3 39  ? 4.294   25.145 23.462  1.00 44.91  ? 39  TYR A OH     1 
ATOM   463  N  N      . ALA C 3 40  ? 1.898   16.795 22.893  1.00 40.99  ? 40  ALA A N      1 
ATOM   464  C  CA     . ALA C 3 40  ? 1.355   15.470 23.153  1.00 44.34  ? 40  ALA A CA     1 
ATOM   465  C  C      . ALA C 3 40  ? 2.468   14.437 23.242  1.00 47.58  ? 40  ALA A C      1 
ATOM   466  O  O      . ALA C 3 40  ? 2.497   13.625 24.171  1.00 49.02  ? 40  ALA A O      1 
ATOM   467  C  CB     . ALA C 3 40  ? 0.354   15.096 22.058  1.00 44.26  ? 40  ALA A CB     1 
ATOM   468  N  N      . GLN C 3 41  ? 3.404   14.467 22.283  1.00 44.40  ? 41  GLN A N      1 
ATOM   469  C  CA     . GLN C 3 41  ? 4.483   13.486 22.270  1.00 47.59  ? 41  GLN A CA     1 
ATOM   470  C  C      . GLN C 3 41  ? 5.327   13.576 23.540  1.00 48.00  ? 41  GLN A C      1 
ATOM   471  O  O      . GLN C 3 41  ? 5.749   12.550 24.088  1.00 50.28  ? 41  GLN A O      1 
ATOM   472  C  CB     . GLN C 3 41  ? 5.354   13.658 21.015  1.00 37.74  ? 41  GLN A CB     1 
ATOM   473  C  CG     . GLN C 3 41  ? 6.262   12.459 20.721  1.00 29.81  ? 41  GLN A CG     1 
ATOM   474  C  CD     . GLN C 3 41  ? 7.069   12.577 19.430  1.00 40.58  ? 41  GLN A CD     1 
ATOM   475  O  OE1    . GLN C 3 41  ? 8.031   11.834 19.237  1.00 36.83  ? 41  GLN A OE1    1 
ATOM   476  N  NE2    . GLN C 3 41  ? 6.696   13.517 18.547  1.00 41.51  ? 41  GLN A NE2    1 
ATOM   477  N  N      . VAL C 3 42  ? 5.580   14.785 24.040  1.00 43.73  ? 42  VAL A N      1 
ATOM   478  C  CA     . VAL C 3 42  ? 6.362   14.894 25.271  1.00 49.39  ? 42  VAL A CA     1 
ATOM   479  C  C      . VAL C 3 42  ? 5.576   14.319 26.446  1.00 53.48  ? 42  VAL A C      1 
ATOM   480  O  O      . VAL C 3 42  ? 6.127   13.615 27.300  1.00 50.52  ? 42  VAL A O      1 
ATOM   481  C  CB     . VAL C 3 42  ? 6.783   16.354 25.537  1.00 46.96  ? 42  VAL A CB     1 
ATOM   482  C  CG1    . VAL C 3 42  ? 7.603   16.453 26.815  1.00 38.03  ? 42  VAL A CG1    1 
ATOM   483  C  CG2    . VAL C 3 42  ? 7.567   16.921 24.363  1.00 38.67  ? 42  VAL A CG2    1 
ATOM   484  N  N      . GLU C 3 43  ? 4.276   14.613 26.508  1.00 49.91  ? 43  GLU A N      1 
ATOM   485  C  CA     . GLU C 3 43  ? 3.459   14.078 27.588  1.00 45.30  ? 43  GLU A CA     1 
ATOM   486  C  C      . GLU C 3 43  ? 3.381   12.559 27.535  1.00 56.70  ? 43  GLU A C      1 
ATOM   487  O  O      . GLU C 3 43  ? 3.301   11.905 28.581  1.00 61.87  ? 43  GLU A O      1 
ATOM   488  C  CB     . GLU C 3 43  ? 2.057   14.683 27.535  1.00 51.54  ? 43  GLU A CB     1 
ATOM   489  C  CG     . GLU C 3 43  ? 2.024   16.210 27.677  1.00 54.15  ? 43  GLU A CG     1 
ATOM   490  C  CD     . GLU C 3 43  ? 2.715   16.707 28.938  1.00 57.77  ? 43  GLU A CD     1 
ATOM   491  O  OE1    . GLU C 3 43  ? 2.975   15.883 29.846  1.00 67.89  ? 43  GLU A OE1    1 
ATOM   492  O  OE2    . GLU C 3 43  ? 3.014   17.921 29.016  1.00 62.47  ? 43  GLU A OE2    1 
ATOM   493  N  N      . MET C 3 44  ? 3.414   11.974 26.338  1.00 56.72  ? 44  MET A N      1 
ATOM   494  C  CA     . MET C 3 44  ? 3.313   10.521 26.240  1.00 52.40  ? 44  MET A CA     1 
ATOM   495  C  C      . MET C 3 44  ? 4.625   9.837  26.590  1.00 51.93  ? 44  MET A C      1 
ATOM   496  O  O      . MET C 3 44  ? 4.644   8.639  26.882  1.00 52.92  ? 44  MET A O      1 
ATOM   497  C  CB     . MET C 3 44  ? 2.896   10.118 24.836  1.00 52.92  ? 44  MET A CB     1 
ATOM   498  C  CG     . MET C 3 44  ? 1.545   10.574 24.449  1.00 51.92  ? 44  MET A CG     1 
ATOM   499  S  SD     . MET C 3 44  ? 1.318   10.068 22.762  1.00 62.21  ? 44  MET A SD     1 
ATOM   500  C  CE     . MET C 3 44  ? -0.440  10.017 22.761  1.00 63.24  ? 44  MET A CE     1 
ATOM   501  N  N      . ILE C 3 45  ? 5.737   10.558 26.524  1.00 50.14  ? 45  ILE A N      1 
ATOM   502  C  CA     . ILE C 3 45  ? 6.970   9.941  26.980  1.00 55.71  ? 45  ILE A CA     1 
ATOM   503  C  C      . ILE C 3 45  ? 7.068   10.000 28.498  1.00 60.16  ? 45  ILE A C      1 
ATOM   504  O  O      . ILE C 3 45  ? 7.596   9.074  29.115  1.00 68.44  ? 45  ILE A O      1 
ATOM   505  C  CB     . ILE C 3 45  ? 8.181   10.579 26.291  1.00 46.63  ? 45  ILE A CB     1 
ATOM   506  C  CG1    . ILE C 3 45  ? 8.108   10.268 24.792  1.00 42.83  ? 45  ILE A CG1    1 
ATOM   507  C  CG2    . ILE C 3 45  ? 9.473   10.062 26.914  1.00 46.20  ? 45  ILE A CG2    1 
ATOM   508  C  CD1    . ILE C 3 45  ? 8.891   11.235 23.904  1.00 40.33  ? 45  ILE A CD1    1 
ATOM   509  N  N      . SER C 3 46  ? 6.539   11.053 29.131  1.00 59.41  ? 46  SER A N      1 
ATOM   510  C  CA     . SER C 3 46  ? 6.526   11.109 30.590  1.00 68.82  ? 46  SER A CA     1 
ATOM   511  C  C      . SER C 3 46  ? 5.747   9.936  31.167  1.00 70.44  ? 46  SER A C      1 
ATOM   512  O  O      . SER C 3 46  ? 6.321   9.049  31.808  1.00 73.40  ? 46  SER A O      1 
ATOM   513  C  CB     . SER C 3 46  ? 5.921   12.429 31.083  1.00 69.90  ? 46  SER A CB     1 
ATOM   514  O  OG     . SER C 3 46  ? 6.541   13.557 30.508  1.00 73.05  ? 46  SER A OG     1 
ATOM   515  N  N      . ASN C 3 47  ? 4.430   9.923  30.943  1.00 65.21  ? 47  ASN A N      1 
ATOM   516  C  CA     . ASN C 3 47  ? 3.532   8.876  31.415  1.00 64.78  ? 47  ASN A CA     1 
ATOM   517  C  C      . ASN C 3 47  ? 3.115   7.972  30.260  1.00 65.82  ? 47  ASN A C      1 
ATOM   518  O  O      . ASN C 3 47  ? 2.141   8.275  29.546  1.00 61.67  ? 47  ASN A O      1 
ATOM   519  C  CB     . ASN C 3 47  ? 2.299   9.490  32.087  1.00 66.97  ? 47  ASN A CB     1 
ATOM   520  C  CG     . ASN C 3 47  ? 1.274   8.434  32.508  1.00 74.65  ? 47  ASN A CG     1 
ATOM   521  O  OD1    . ASN C 3 47  ? 1.543   7.225  32.462  1.00 67.74  ? 47  ASN A OD1    1 
ATOM   522  N  ND2    . ASN C 3 47  ? 0.093   8.889  32.919  1.00 75.30  ? 47  ASN A ND2    1 
ATOM   523  N  N      . PRO C 3 48  ? 3.798   6.850  30.047  1.00 66.44  ? 48  PRO A N      1 
ATOM   524  C  CA     . PRO C 3 48  ? 3.391   5.929  28.976  1.00 62.02  ? 48  PRO A CA     1 
ATOM   525  C  C      . PRO C 3 48  ? 1.945   5.492  29.048  1.00 70.33  ? 48  PRO A C      1 
ATOM   526  O  O      . PRO C 3 48  ? 1.405   5.073  28.018  1.00 79.76  ? 48  PRO A O      1 
ATOM   527  C  CB     . PRO C 3 48  ? 4.333   4.741  29.165  1.00 56.15  ? 48  PRO A CB     1 
ATOM   528  C  CG     . PRO C 3 48  ? 5.563   5.366  29.786  1.00 73.04  ? 48  PRO A CG     1 
ATOM   529  C  CD     . PRO C 3 48  ? 5.054   6.442  30.695  1.00 63.39  ? 48  PRO A CD     1 
ATOM   530  N  N      . GLU C 3 49  ? 1.291   5.566  30.212  1.00 73.64  ? 49  GLU A N      1 
ATOM   531  C  CA     . GLU C 3 49  ? -0.107  5.138  30.289  1.00 81.53  ? 49  GLU A CA     1 
ATOM   532  C  C      . GLU C 3 49  ? -0.993  5.880  29.289  1.00 73.82  ? 49  GLU A C      1 
ATOM   533  O  O      . GLU C 3 49  ? -2.127  5.450  29.042  1.00 75.80  ? 49  GLU A O      1 
ATOM   534  C  CB     . GLU C 3 49  ? -0.645  5.312  31.717  1.00 74.72  ? 49  GLU A CB     1 
ATOM   535  N  N      . LEU C 3 50  ? -0.491  6.966  28.691  1.00 76.73  ? 50  LEU A N      1 
ATOM   536  C  CA     . LEU C 3 50  ? -1.257  7.741  27.721  1.00 73.39  ? 50  LEU A CA     1 
ATOM   537  C  C      . LEU C 3 50  ? -1.105  7.222  26.287  1.00 74.48  ? 50  LEU A C      1 
ATOM   538  O  O      . LEU C 3 50  ? -1.953  7.530  25.436  1.00 76.26  ? 50  LEU A O      1 
ATOM   539  C  CB     . LEU C 3 50  ? -0.847  9.217  27.812  1.00 73.31  ? 50  LEU A CB     1 
ATOM   540  C  CG     . LEU C 3 50  ? -0.978  9.876  29.199  1.00 73.37  ? 50  LEU A CG     1 
ATOM   541  C  CD1    . LEU C 3 50  ? -0.001  11.034 29.403  1.00 61.01  ? 50  LEU A CD1    1 
ATOM   542  C  CD2    . LEU C 3 50  ? -2.404  10.356 29.418  1.00 69.55  ? 50  LEU A CD2    1 
ATOM   543  N  N      . LYS C 3 51  ? -0.054  6.453  25.990  1.00 75.41  ? 51  LYS A N      1 
ATOM   544  C  CA     . LYS C 3 51  ? -0.006  5.757  24.709  1.00 81.43  ? 51  LYS A CA     1 
ATOM   545  C  C      . LYS C 3 51  ? -1.267  4.923  24.544  1.00 87.10  ? 51  LYS A C      1 
ATOM   546  O  O      . LYS C 3 51  ? -1.833  4.416  25.519  1.00 87.53  ? 51  LYS A O      1 
ATOM   547  C  CB     . LYS C 3 51  ? 1.226   4.847  24.610  1.00 75.82  ? 51  LYS A CB     1 
ATOM   548  C  CG     . LYS C 3 51  ? 2.562   5.561  24.470  1.00 70.71  ? 51  LYS A CG     1 
ATOM   549  N  N      . ASP C 3 52  ? -1.721  4.781  23.302  1.00 86.92  ? 52  ASP A N      1 
ATOM   550  C  CA     . ASP C 3 52  ? -2.875  3.959  22.963  1.00 86.84  ? 52  ASP A CA     1 
ATOM   551  C  C      . ASP C 3 52  ? -4.182  4.633  23.342  1.00 80.12  ? 52  ASP A C      1 
ATOM   552  O  O      . ASP C 3 52  ? -5.254  4.127  22.985  1.00 93.41  ? 52  ASP A O      1 
ATOM   553  C  CB     . ASP C 3 52  ? -2.811  2.579  23.632  1.00 93.98  ? 52  ASP A CB     1 
ATOM   554  C  CG     . ASP C 3 52  ? -1.410  1.997  23.618  1.00 103.47 ? 52  ASP A CG     1 
ATOM   555  O  OD1    . ASP C 3 52  ? -0.729  2.138  22.576  1.00 110.27 ? 52  ASP A OD1    1 
ATOM   556  O  OD2    . ASP C 3 52  ? -0.989  1.425  24.650  1.00 100.32 ? 52  ASP A OD2    1 
ATOM   557  N  N      . LYS C 3 53  ? -4.135  5.745  24.070  1.00 75.70  ? 53  LYS A N      1 
ATOM   558  C  CA     . LYS C 3 53  ? -5.303  6.545  24.372  1.00 72.09  ? 53  LYS A CA     1 
ATOM   559  C  C      . LYS C 3 53  ? -5.264  7.837  23.567  1.00 74.24  ? 53  LYS A C      1 
ATOM   560  O  O      . LYS C 3 53  ? -4.202  8.458  23.451  1.00 71.40  ? 53  LYS A O      1 
ATOM   561  C  CB     . LYS C 3 53  ? -5.376  6.878  25.870  1.00 70.39  ? 53  LYS A CB     1 
ATOM   562  N  N      . PRO C 3 54  ? -6.386  8.261  22.993  1.00 69.69  ? 54  PRO A N      1 
ATOM   563  C  CA     . PRO C 3 54  ? -6.412  9.575  22.341  1.00 63.94  ? 54  PRO A CA     1 
ATOM   564  C  C      . PRO C 3 54  ? -6.121  10.652 23.371  1.00 69.01  ? 54  PRO A C      1 
ATOM   565  O  O      . PRO C 3 54  ? -6.672  10.631 24.474  1.00 68.79  ? 54  PRO A O      1 
ATOM   566  C  CB     . PRO C 3 54  ? -7.840  9.672  21.801  1.00 69.80  ? 54  PRO A CB     1 
ATOM   567  C  CG     . PRO C 3 54  ? -8.634  8.783  22.724  1.00 71.42  ? 54  PRO A CG     1 
ATOM   568  C  CD     . PRO C 3 54  ? -7.721  7.645  23.059  1.00 67.45  ? 54  PRO A CD     1 
ATOM   569  N  N      . LEU C 3 55  ? -5.249  11.599 23.007  1.00 60.74  ? 55  LEU A N      1 
ATOM   570  C  CA     . LEU C 3 55  ? -4.656  12.524 23.970  1.00 57.03  ? 55  LEU A CA     1 
ATOM   571  C  C      . LEU C 3 55  ? -4.634  13.952 23.441  1.00 62.78  ? 55  LEU A C      1 
ATOM   572  O  O      . LEU C 3 55  ? -4.141  14.210 22.333  1.00 56.37  ? 55  LEU A O      1 
ATOM   573  C  CB     . LEU C 3 55  ? -3.228  12.102 24.338  1.00 58.82  ? 55  LEU A CB     1 
ATOM   574  C  CG     . LEU C 3 55  ? -2.563  13.047 25.346  1.00 60.55  ? 55  LEU A CG     1 
ATOM   575  C  CD1    . LEU C 3 55  ? -3.552  13.344 26.484  1.00 63.31  ? 55  LEU A CD1    1 
ATOM   576  C  CD2    . LEU C 3 55  ? -1.264  12.463 25.902  1.00 52.68  ? 55  LEU A CD2    1 
ATOM   577  N  N      . GLY C 3 56  ? -5.136  14.873 24.251  1.00 55.38  ? 56  GLY A N      1 
ATOM   578  C  CA     . GLY C 3 56  ? -5.048  16.294 23.943  1.00 53.59  ? 56  GLY A CA     1 
ATOM   579  C  C      . GLY C 3 56  ? -4.317  17.031 25.042  1.00 57.88  ? 56  GLY A C      1 
ATOM   580  O  O      . GLY C 3 56  ? -4.432  16.686 26.213  1.00 58.93  ? 56  GLY A O      1 
ATOM   581  N  N      . VAL C 3 57  ? -3.547  18.044 24.655  1.00 55.94  ? 57  VAL A N      1 
ATOM   582  C  CA     . VAL C 3 57  ? -2.855  18.894 25.617  1.00 46.77  ? 57  VAL A CA     1 
ATOM   583  C  C      . VAL C 3 57  ? -3.626  20.205 25.713  1.00 45.84  ? 57  VAL A C      1 
ATOM   584  O  O      . VAL C 3 57  ? -3.805  20.930 24.721  1.00 50.81  ? 57  VAL A O      1 
ATOM   585  C  CB     . VAL C 3 57  ? -1.384  19.110 25.234  1.00 51.10  ? 57  VAL A CB     1 
ATOM   586  C  CG1    . VAL C 3 57  ? -0.696  19.961 26.280  1.00 43.34  ? 57  VAL A CG1    1 
ATOM   587  C  CG2    . VAL C 3 57  ? -0.678  17.768 25.126  1.00 42.33  ? 57  VAL A CG2    1 
ATOM   588  N  N      . GLN C 3 58  ? -4.096  20.494 26.911  1.00 45.81  ? 58  GLN A N      1 
ATOM   589  C  CA     . GLN C 3 58  ? -5.018  21.583 27.164  1.00 48.46  ? 58  GLN A CA     1 
ATOM   590  C  C      . GLN C 3 58  ? -4.289  22.766 27.771  1.00 52.64  ? 58  GLN A C      1 
ATOM   591  O  O      . GLN C 3 58  ? -3.356  22.599 28.569  1.00 54.42  ? 58  GLN A O      1 
ATOM   592  C  CB     . GLN C 3 58  ? -6.116  21.140 28.116  1.00 59.21  ? 58  GLN A CB     1 
ATOM   593  C  CG     . GLN C 3 58  ? -7.149  22.178 28.389  1.00 62.96  ? 58  GLN A CG     1 
ATOM   594  C  CD     . GLN C 3 58  ? -8.138  21.693 29.418  1.00 77.32  ? 58  GLN A CD     1 
ATOM   595  O  OE1    . GLN C 3 58  ? -9.330  22.011 29.351  1.00 71.68  ? 58  GLN A OE1    1 
ATOM   596  N  NE2    . GLN C 3 58  ? -7.648  20.899 30.382  1.00 71.39  ? 58  GLN A NE2    1 
ATOM   597  N  N      . GLN C 3 59  ? -4.718  23.956 27.369  1.00 49.46  ? 59  GLN A N      1 
ATOM   598  C  CA     . GLN C 3 59  ? -4.255  25.220 27.920  1.00 50.39  ? 59  GLN A CA     1 
ATOM   599  C  C      . GLN C 3 59  ? -5.490  26.087 28.062  1.00 56.64  ? 59  GLN A C      1 
ATOM   600  O  O      . GLN C 3 59  ? -6.085  26.483 27.052  1.00 60.62  ? 59  GLN A O      1 
ATOM   601  C  CB     . GLN C 3 59  ? -3.222  25.894 27.002  1.00 51.82  ? 59  GLN A CB     1 
ATOM   602  C  CG     . GLN C 3 59  ? -1.859  25.185 26.908  1.00 48.83  ? 59  GLN A CG     1 
ATOM   603  C  CD     . GLN C 3 59  ? -0.918  25.866 25.921  1.00 48.94  ? 59  GLN A CD     1 
ATOM   604  O  OE1    . GLN C 3 59  ? -1.364  26.474 24.950  1.00 42.89  ? 59  GLN A OE1    1 
ATOM   605  N  NE2    . GLN C 3 59  ? 0.385   25.791 26.184  1.00 43.45  ? 59  GLN A NE2    1 
ATOM   606  N  N      . LYS C 3 60  ? -5.901  26.357 29.301  1.00 52.57  ? 60  LYS A N      1 
ATOM   607  C  CA     . LYS C 3 60  ? -7.140  27.102 29.550  1.00 59.68  ? 60  LYS A CA     1 
ATOM   608  C  C      . LYS C 3 60  ? -8.270  26.330 28.874  1.00 65.24  ? 60  LYS A C      1 
ATOM   609  O  O      . LYS C 3 60  ? -8.411  25.124 29.142  1.00 66.16  ? 60  LYS A O      1 
ATOM   610  C  CB     . LYS C 3 60  ? -6.949  28.547 29.074  1.00 63.83  ? 60  LYS A CB     1 
ATOM   611  C  CG     . LYS C 3 60  ? -6.850  29.628 30.151  1.00 62.48  ? 60  LYS A CG     1 
ATOM   612  C  CD     . LYS C 3 60  ? -5.878  29.241 31.237  1.00 59.58  ? 60  LYS A CD     1 
ATOM   613  C  CE     . LYS C 3 60  ? -5.254  30.439 31.924  1.00 58.07  ? 60  LYS A CE     1 
ATOM   614  N  NZ     . LYS C 3 60  ? -4.097  29.944 32.749  1.00 71.04  ? 60  LYS A NZ     1 
ATOM   615  N  N      . TYR C 3 61  ? -9.071  26.942 27.992  1.00 64.19  ? 61  TYR A N      1 
ATOM   616  C  CA     . TYR C 3 61  ? -10.191 26.286 27.322  1.00 65.15  ? 61  TYR A CA     1 
ATOM   617  C  C      . TYR C 3 61  ? -9.853  25.877 25.889  1.00 76.99  ? 61  TYR A C      1 
ATOM   618  O  O      . TYR C 3 61  ? -10.723 25.890 25.013  1.00 73.65  ? 61  TYR A O      1 
ATOM   619  C  CB     . TYR C 3 61  ? -11.420 27.195 27.319  1.00 61.62  ? 61  TYR A CB     1 
ATOM   620  N  N      . LEU C 3 62  ? -8.598  25.517 25.624  1.00 72.68  ? 62  LEU A N      1 
ATOM   621  C  CA     . LEU C 3 62  ? -8.154  25.232 24.261  1.00 73.40  ? 62  LEU A CA     1 
ATOM   622  C  C      . LEU C 3 62  ? -7.368  23.926 24.238  1.00 63.24  ? 62  LEU A C      1 
ATOM   623  O  O      . LEU C 3 62  ? -6.465  23.729 25.054  1.00 59.75  ? 62  LEU A O      1 
ATOM   624  C  CB     . LEU C 3 62  ? -7.299  26.387 23.713  1.00 60.87  ? 62  LEU A CB     1 
ATOM   625  C  CG     . LEU C 3 62  ? -6.842  26.318 22.260  1.00 68.93  ? 62  LEU A CG     1 
ATOM   626  C  CD1    . LEU C 3 62  ? -8.038  26.303 21.300  1.00 75.58  ? 62  LEU A CD1    1 
ATOM   627  C  CD2    . LEU C 3 62  ? -5.900  27.472 21.932  1.00 63.73  ? 62  LEU A CD2    1 
ATOM   628  N  N      . VAL C 3 63  ? -7.721  23.026 23.323  1.00 62.61  ? 63  VAL A N      1 
ATOM   629  C  CA     . VAL C 3 63  ? -6.908  21.840 23.048  1.00 68.37  ? 63  VAL A CA     1 
ATOM   630  C  C      . VAL C 3 63  ? -5.891  22.240 21.983  1.00 60.81  ? 63  VAL A C      1 
ATOM   631  O  O      . VAL C 3 63  ? -6.193  22.270 20.782  1.00 62.55  ? 63  VAL A O      1 
ATOM   632  C  CB     . VAL C 3 63  ? -7.751  20.652 22.596  1.00 66.63  ? 63  VAL A CB     1 
ATOM   633  C  CG1    . VAL C 3 63  ? -6.831  19.514 22.199  1.00 61.47  ? 63  VAL A CG1    1 
ATOM   634  C  CG2    . VAL C 3 63  ? -8.689  20.219 23.712  1.00 71.20  ? 63  VAL A CG2    1 
ATOM   635  N  N      . VAL C 3 64  ? -4.678  22.556 22.427  1.00 52.01  ? 64  VAL A N      1 
ATOM   636  C  CA     A VAL C 3 64  ? -3.704  23.170 21.528  0.64 52.14  ? 64  VAL A CA     1 
ATOM   637  C  CA     B VAL C 3 64  ? -3.705  23.171 21.536  0.36 52.53  ? 64  VAL A CA     1 
ATOM   638  C  C      . VAL C 3 64  ? -3.200  22.148 20.520  1.00 52.21  ? 64  VAL A C      1 
ATOM   639  O  O      . VAL C 3 64  ? -3.070  22.444 19.326  1.00 53.29  ? 64  VAL A O      1 
ATOM   640  C  CB     A VAL C 3 64  ? -2.545  23.802 22.325  0.64 51.88  ? 64  VAL A CB     1 
ATOM   641  C  CB     B VAL C 3 64  ? -2.574  23.803 22.372  0.36 51.93  ? 64  VAL A CB     1 
ATOM   642  C  CG1    A VAL C 3 64  ? -1.561  24.453 21.382  0.64 50.06  ? 64  VAL A CG1    1 
ATOM   643  C  CG1    B VAL C 3 64  ? -1.743  22.733 23.085  0.36 45.73  ? 64  VAL A CG1    1 
ATOM   644  C  CG2    A VAL C 3 64  ? -3.057  24.833 23.302  0.64 49.91  ? 64  VAL A CG2    1 
ATOM   645  C  CG2    B VAL C 3 64  ? -1.720  24.732 21.531  0.36 49.07  ? 64  VAL A CG2    1 
ATOM   646  N  N      . THR C 3 65  ? -2.938  20.927 20.973  1.00 52.07  ? 65  THR A N      1 
ATOM   647  C  CA     . THR C 3 65  ? -2.542  19.849 20.082  1.00 52.91  ? 65  THR A CA     1 
ATOM   648  C  C      . THR C 3 65  ? -3.056  18.536 20.658  1.00 51.04  ? 65  THR A C      1 
ATOM   649  O  O      . THR C 3 65  ? -3.364  18.442 21.850  1.00 47.22  ? 65  THR A O      1 
ATOM   650  C  CB     . THR C 3 65  ? -1.018  19.800 19.900  1.00 44.97  ? 65  THR A CB     1 
ATOM   651  O  OG1    . THR C 3 65  ? -0.686  18.754 18.985  1.00 50.71  ? 65  THR A OG1    1 
ATOM   652  C  CG2    . THR C 3 65  ? -0.343  19.495 21.228  1.00 42.31  ? 65  THR A CG2    1 
ATOM   653  N  N      . CYS C 3 66  ? -3.110  17.512 19.806  1.00 56.76  ? 66  CYS A N      1 
ATOM   654  C  CA     . CYS C 3 66  ? -3.518  16.173 20.222  1.00 55.84  ? 66  CYS A CA     1 
ATOM   655  C  C      . CYS C 3 66  ? -2.698  15.150 19.457  1.00 54.26  ? 66  CYS A C      1 
ATOM   656  O  O      . CYS C 3 66  ? -2.144  15.449 18.393  1.00 48.04  ? 66  CYS A O      1 
ATOM   657  C  CB     . CYS C 3 66  ? -5.006  15.914 19.983  1.00 45.97  ? 66  CYS A CB     1 
ATOM   658  S  SG     . CYS C 3 66  ? -5.533  16.292 18.332  1.00 55.77  ? 66  CYS A SG     1 
ATOM   659  N  N      . ASN C 3 67  ? -2.616  13.941 20.024  1.00 48.60  ? 67  ASN A N      1 
ATOM   660  C  CA     . ASN C 3 67  ? -1.860  12.858 19.411  1.00 52.50  ? 67  ASN A CA     1 
ATOM   661  C  C      . ASN C 3 67  ? -2.639  12.307 18.221  1.00 55.03  ? 67  ASN A C      1 
ATOM   662  O  O      . ASN C 3 67  ? -3.809  12.631 18.009  1.00 61.06  ? 67  ASN A O      1 
ATOM   663  C  CB     . ASN C 3 67  ? -1.562  11.746 20.426  1.00 56.45  ? 67  ASN A CB     1 
ATOM   664  C  CG     . ASN C 3 67  ? -2.810  10.961 20.829  1.00 54.91  ? 67  ASN A CG     1 
ATOM   665  O  OD1    . ASN C 3 67  ? -3.933  11.414 20.638  1.00 61.59  ? 67  ASN A OD1    1 
ATOM   666  N  ND2    . ASN C 3 67  ? -2.614  9.784  21.367  1.00 51.25  ? 67  ASN A ND2    1 
ATOM   667  N  N      . TYR C 3 68  ? -1.973  11.479 17.418  1.00 55.77  ? 68  TYR A N      1 
ATOM   668  C  CA     . TYR C 3 68  ? -2.617  11.069 16.178  1.00 55.63  ? 68  TYR A CA     1 
ATOM   669  C  C      . TYR C 3 68  ? -3.744  10.091 16.445  1.00 60.79  ? 68  TYR A C      1 
ATOM   670  O  O      . TYR C 3 68  ? -4.736  10.088 15.708  1.00 62.13  ? 68  TYR A O      1 
ATOM   671  C  CB     . TYR C 3 68  ? -1.581  10.524 15.194  1.00 52.65  ? 68  TYR A CB     1 
ATOM   672  C  CG     . TYR C 3 68  ? -0.866  11.674 14.529  1.00 53.23  ? 68  TYR A CG     1 
ATOM   673  C  CD1    . TYR C 3 68  ? 0.100   12.405 15.216  1.00 51.58  ? 68  TYR A CD1    1 
ATOM   674  C  CD2    . TYR C 3 68  ? -1.198  12.077 13.247  1.00 43.75  ? 68  TYR A CD2    1 
ATOM   675  C  CE1    . TYR C 3 68  ? 0.743   13.496 14.615  1.00 46.27  ? 68  TYR A CE1    1 
ATOM   676  C  CE2    . TYR C 3 68  ? -0.560  13.162 12.637  1.00 49.20  ? 68  TYR A CE2    1 
ATOM   677  C  CZ     . TYR C 3 68  ? 0.407   13.873 13.330  1.00 46.54  ? 68  TYR A CZ     1 
ATOM   678  O  OH     . TYR C 3 68  ? 1.030   14.961 12.750  1.00 42.47  ? 68  TYR A OH     1 
ATOM   679  N  N      . GLU C 3 69  ? -3.641  9.301  17.522  1.00 67.05  ? 69  GLU A N      1 
ATOM   680  C  CA     . GLU C 3 69  ? -4.783  8.498  17.955  1.00 62.37  ? 69  GLU A CA     1 
ATOM   681  C  C      . GLU C 3 69  ? -6.035  9.365  18.106  1.00 62.79  ? 69  GLU A C      1 
ATOM   682  O  O      . GLU C 3 69  ? -7.129  8.977  17.678  1.00 69.80  ? 69  GLU A O      1 
ATOM   683  C  CB     . GLU C 3 69  ? -4.434  7.776  19.258  1.00 62.40  ? 69  GLU A CB     1 
ATOM   684  C  CG     . GLU C 3 69  ? -5.507  6.835  19.782  1.00 68.04  ? 69  GLU A CG     1 
ATOM   685  N  N      . ALA C 3 70  ? -5.881  10.575 18.643  1.00 58.05  ? 70  ALA A N      1 
ATOM   686  C  CA     . ALA C 3 70  ? -7.031  11.463 18.779  1.00 57.10  ? 70  ALA A CA     1 
ATOM   687  C  C      . ALA C 3 70  ? -7.434  12.096 17.450  1.00 59.96  ? 70  ALA A C      1 
ATOM   688  O  O      . ALA C 3 70  ? -8.610  12.395 17.237  1.00 68.35  ? 70  ALA A O      1 
ATOM   689  C  CB     . ALA C 3 70  ? -6.737  12.544 19.810  1.00 65.47  ? 70  ALA A CB     1 
ATOM   690  N  N      . ARG C 3 71  ? -6.490  12.352 16.550  1.00 62.94  ? 71  ARG A N      1 
ATOM   691  C  CA     . ARG C 3 71  ? -6.901  12.969 15.290  1.00 63.96  ? 71  ARG A CA     1 
ATOM   692  C  C      . ARG C 3 71  ? -7.677  11.984 14.421  1.00 72.40  ? 71  ARG A C      1 
ATOM   693  O  O      . ARG C 3 71  ? -8.448  12.395 13.545  1.00 70.93  ? 71  ARG A O      1 
ATOM   694  C  CB     . ARG C 3 71  ? -5.689  13.516 14.535  1.00 61.42  ? 71  ARG A CB     1 
ATOM   695  C  CG     . ARG C 3 71  ? -4.919  14.593 15.281  1.00 62.23  ? 71  ARG A CG     1 
ATOM   696  C  CD     . ARG C 3 71  ? -3.734  15.150 14.482  1.00 58.31  ? 71  ARG A CD     1 
ATOM   697  N  NE     . ARG C 3 71  ? -2.702  15.653 15.400  1.00 54.67  ? 71  ARG A NE     1 
ATOM   698  C  CZ     . ARG C 3 71  ? -1.681  16.431 15.053  1.00 45.11  ? 71  ARG A CZ     1 
ATOM   699  N  NH1    . ARG C 3 71  ? -1.528  16.811 13.806  1.00 41.48  ? 71  ARG A NH1    1 
ATOM   700  N  NH2    . ARG C 3 71  ? -0.801  16.826 15.967  1.00 50.79  ? 71  ARG A NH2    1 
ATOM   701  N  N      . LYS C 3 72  ? -7.484  10.683 14.649  1.00 77.27  ? 72  LYS A N      1 
ATOM   702  C  CA     . LYS C 3 72  ? -8.316  9.682  13.988  1.00 75.73  ? 72  LYS A CA     1 
ATOM   703  C  C      . LYS C 3 72  ? -9.781  9.863  14.365  1.00 77.45  ? 72  LYS A C      1 
ATOM   704  O  O      . LYS C 3 72  ? -10.668 9.789  13.503  1.00 74.09  ? 72  LYS A O      1 
ATOM   705  C  CB     . LYS C 3 72  ? -7.825  8.278  14.355  1.00 71.07  ? 72  LYS A CB     1 
ATOM   706  C  CG     . LYS C 3 72  ? -6.608  7.837  13.561  1.00 60.63  ? 72  LYS A CG     1 
ATOM   707  C  CD     . LYS C 3 72  ? -6.015  6.514  14.037  1.00 70.63  ? 72  LYS A CD     1 
ATOM   708  C  CE     . LYS C 3 72  ? -4.765  6.180  13.197  1.00 82.07  ? 72  LYS A CE     1 
ATOM   709  N  NZ     . LYS C 3 72  ? -4.004  4.982  13.661  1.00 68.00  ? 72  LYS A NZ     1 
ATOM   710  N  N      . LEU C 3 73  ? -10.045 10.123 15.653  1.00 78.36  ? 73  LEU A N      1 
ATOM   711  C  CA     . LEU C 3 73  ? -11.385 10.346 16.187  1.00 60.11  ? 73  LEU A CA     1 
ATOM   712  C  C      . LEU C 3 73  ? -11.984 11.695 15.803  1.00 74.64  ? 73  LEU A C      1 
ATOM   713  O  O      . LEU C 3 73  ? -13.060 12.032 16.307  1.00 84.18  ? 73  LEU A O      1 
ATOM   714  C  CB     . LEU C 3 73  ? -11.372 10.232 17.713  1.00 51.22  ? 73  LEU A CB     1 
ATOM   715  C  CG     . LEU C 3 73  ? -10.864 8.946  18.378  1.00 70.31  ? 73  LEU A CG     1 
ATOM   716  N  N      . GLY C 3 74  ? -11.322 12.494 14.964  1.00 75.87  ? 74  GLY A N      1 
ATOM   717  C  CA     . GLY C 3 74  ? -11.859 13.780 14.552  1.00 79.11  ? 74  GLY A CA     1 
ATOM   718  C  C      . GLY C 3 74  ? -11.432 14.985 15.378  1.00 81.87  ? 74  GLY A C      1 
ATOM   719  O  O      . GLY C 3 74  ? -11.779 16.117 15.004  1.00 74.42  ? 74  GLY A O      1 
ATOM   720  N  N      . VAL C 3 75  ? -10.711 14.787 16.491  1.00 72.42  ? 75  VAL A N      1 
ATOM   721  C  CA     . VAL C 3 75  ? -10.129 15.919 17.213  1.00 70.11  ? 75  VAL A CA     1 
ATOM   722  C  C      . VAL C 3 75  ? -9.111  16.625 16.328  1.00 78.31  ? 75  VAL A C      1 
ATOM   723  O  O      . VAL C 3 75  ? -8.282  15.980 15.671  1.00 80.55  ? 75  VAL A O      1 
ATOM   724  C  CB     . VAL C 3 75  ? -9.446  15.469 18.516  1.00 69.70  ? 75  VAL A CB     1 
ATOM   725  C  CG1    . VAL C 3 75  ? -9.121  16.676 19.380  1.00 68.57  ? 75  VAL A CG1    1 
ATOM   726  C  CG2    . VAL C 3 75  ? -10.284 14.440 19.268  1.00 80.11  ? 75  VAL A CG2    1 
ATOM   727  N  N      . LYS C 3 76  ? -9.144  17.958 16.323  1.00 75.26  ? 76  LYS A N      1 
ATOM   728  C  CA     . LYS C 3 76  ? -8.206  18.748 15.535  1.00 76.16  ? 76  LYS A CA     1 
ATOM   729  C  C      . LYS C 3 76  ? -7.418  19.695 16.437  1.00 74.26  ? 76  LYS A C      1 
ATOM   730  O  O      . LYS C 3 76  ? -7.844  20.039 17.545  1.00 71.85  ? 76  LYS A O      1 
ATOM   731  C  CB     . LYS C 3 76  ? -8.921  19.551 14.427  1.00 75.75  ? 76  LYS A CB     1 
ATOM   732  C  CG     . LYS C 3 76  ? -9.721  18.714 13.409  1.00 78.68  ? 76  LYS A CG     1 
ATOM   733  C  CD     . LYS C 3 76  ? -8.842  17.754 12.594  1.00 72.21  ? 76  LYS A CD     1 
ATOM   734  N  N      . LYS C 3 77  ? -6.250  20.111 15.945  1.00 66.66  ? 77  LYS A N      1 
ATOM   735  C  CA     . LYS C 3 77  ? -5.419  21.050 16.688  1.00 67.67  ? 77  LYS A CA     1 
ATOM   736  C  C      . LYS C 3 77  ? -6.173  22.350 16.909  1.00 68.82  ? 77  LYS A C      1 
ATOM   737  O  O      . LYS C 3 77  ? -6.763  22.906 15.979  1.00 72.60  ? 77  LYS A O      1 
ATOM   738  C  CB     . LYS C 3 77  ? -4.104  21.318 15.938  1.00 56.29  ? 77  LYS A CB     1 
ATOM   739  C  CG     . LYS C 3 77  ? -3.173  20.125 15.948  1.00 56.89  ? 77  LYS A CG     1 
ATOM   740  C  CD     . LYS C 3 77  ? -1.928  20.320 15.128  1.00 43.59  ? 77  LYS A CD     1 
ATOM   741  C  CE     . LYS C 3 77  ? -2.225  20.811 13.739  1.00 56.46  ? 77  LYS A CE     1 
ATOM   742  N  NZ     . LYS C 3 77  ? -0.982  20.787 12.889  1.00 67.97  ? 77  LYS A NZ     1 
ATOM   743  N  N      . LEU C 3 78  ? -6.182  22.821 18.151  1.00 67.41  ? 78  LEU A N      1 
ATOM   744  C  CA     . LEU C 3 78  ? -6.680  24.150 18.484  1.00 74.89  ? 78  LEU A CA     1 
ATOM   745  C  C      . LEU C 3 78  ? -8.200  24.257 18.542  1.00 71.28  ? 78  LEU A C      1 
ATOM   746  O  O      . LEU C 3 78  ? -8.739  25.361 18.410  1.00 69.23  ? 78  LEU A O      1 
ATOM   747  C  CB     . LEU C 3 78  ? -6.143  25.191 17.495  1.00 70.91  ? 78  LEU A CB     1 
ATOM   748  C  CG     . LEU C 3 78  ? -4.664  25.528 17.693  1.00 70.22  ? 78  LEU A CG     1 
ATOM   749  C  CD1    . LEU C 3 78  ? -4.124  26.388 16.558  1.00 60.88  ? 78  LEU A CD1    1 
ATOM   750  C  CD2    . LEU C 3 78  ? -4.515  26.245 19.027  1.00 64.03  ? 78  LEU A CD2    1 
ATOM   751  N  N      . MET C 3 79  ? -8.926  23.165 18.745  1.00 72.15  ? 79  MET A N      1 
ATOM   752  C  CA     . MET C 3 79  ? -10.351 23.289 19.006  1.00 78.50  ? 79  MET A CA     1 
ATOM   753  C  C      . MET C 3 79  ? -10.592 23.321 20.509  1.00 65.37  ? 79  MET A C      1 
ATOM   754  O  O      . MET C 3 79  ? -9.835  22.734 21.286  1.00 74.56  ? 79  MET A O      1 
ATOM   755  C  CB     . MET C 3 79  ? -11.142 22.154 18.355  1.00 79.45  ? 79  MET A CB     1 
ATOM   756  C  CG     . MET C 3 79  ? -10.764 20.751 18.786  1.00 75.32  ? 79  MET A CG     1 
ATOM   757  S  SD     . MET C 3 79  ? -11.933 19.565 18.068  1.00 84.22  ? 79  MET A SD     1 
ATOM   758  C  CE     . MET C 3 79  ? -12.002 20.164 16.373  1.00 55.13  ? 79  MET A CE     1 
ATOM   759  N  N      . ASN C 3 80  ? -11.634 24.038 20.921  1.00 67.33  ? 80  ASN A N      1 
ATOM   760  C  CA     . ASN C 3 80  ? -11.831 24.240 22.348  1.00 73.40  ? 80  ASN A CA     1 
ATOM   761  C  C      . ASN C 3 80  ? -12.175 22.917 23.016  1.00 74.20  ? 80  ASN A C      1 
ATOM   762  O  O      . ASN C 3 80  ? -12.448 21.911 22.360  1.00 82.51  ? 80  ASN A O      1 
ATOM   763  C  CB     . ASN C 3 80  ? -12.917 25.281 22.608  1.00 74.83  ? 80  ASN A CB     1 
ATOM   764  C  CG     . ASN C 3 80  ? -14.257 24.861 22.081  1.00 86.61  ? 80  ASN A CG     1 
ATOM   765  O  OD1    . ASN C 3 80  ? -15.028 24.193 22.778  1.00 93.80  ? 80  ASN A OD1    1 
ATOM   766  N  ND2    . ASN C 3 80  ? -14.559 25.256 20.844  1.00 83.51  ? 80  ASN A ND2    1 
ATOM   767  N  N      . VAL C 3 81  ? -12.144 22.916 24.346  1.00 73.91  ? 81  VAL A N      1 
ATOM   768  C  CA     . VAL C 3 81  ? -12.328 21.661 25.067  1.00 73.42  ? 81  VAL A CA     1 
ATOM   769  C  C      . VAL C 3 81  ? -13.710 21.081 24.796  1.00 77.04  ? 81  VAL A C      1 
ATOM   770  O  O      . VAL C 3 81  ? -13.855 19.874 24.570  1.00 80.34  ? 81  VAL A O      1 
ATOM   771  C  CB     . VAL C 3 81  ? -12.078 21.863 26.569  1.00 64.85  ? 81  VAL A CB     1 
ATOM   772  C  CG1    . VAL C 3 81  ? -12.136 20.534 27.281  1.00 76.20  ? 81  VAL A CG1    1 
ATOM   773  C  CG2    . VAL C 3 81  ? -10.731 22.523 26.786  1.00 67.14  ? 81  VAL A CG2    1 
ATOM   774  N  N      . ARG C 3 82  ? -14.745 21.927 24.794  1.00 82.82  ? 82  ARG A N      1 
ATOM   775  C  CA     . ARG C 3 82  ? -16.100 21.432 24.554  1.00 81.01  ? 82  ARG A CA     1 
ATOM   776  C  C      . ARG C 3 82  ? -16.186 20.703 23.219  1.00 82.97  ? 82  ARG A C      1 
ATOM   777  O  O      . ARG C 3 82  ? -16.518 19.513 23.170  1.00 90.57  ? 82  ARG A O      1 
ATOM   778  C  CB     . ARG C 3 82  ? -17.108 22.584 24.608  1.00 73.22  ? 82  ARG A CB     1 
ATOM   779  N  N      . ASP C 3 83  ? -15.878 21.401 22.122  1.00 81.19  ? 83  ASP A N      1 
ATOM   780  C  CA     . ASP C 3 83  ? -15.919 20.779 20.800  1.00 82.41  ? 83  ASP A CA     1 
ATOM   781  C  C      . ASP C 3 83  ? -15.181 19.448 20.784  1.00 83.07  ? 83  ASP A C      1 
ATOM   782  O  O      . ASP C 3 83  ? -15.587 18.515 20.081  1.00 84.10  ? 83  ASP A O      1 
ATOM   783  C  CB     . ASP C 3 83  ? -15.321 21.723 19.755  1.00 77.27  ? 83  ASP A CB     1 
ATOM   784  C  CG     . ASP C 3 83  ? -16.147 22.979 19.568  1.00 78.69  ? 83  ASP A CG     1 
ATOM   785  O  OD1    . ASP C 3 83  ? -17.373 22.912 19.782  1.00 82.04  ? 83  ASP A OD1    1 
ATOM   786  O  OD2    . ASP C 3 83  ? -15.577 24.031 19.210  1.00 75.95  ? 83  ASP A OD2    1 
ATOM   787  N  N      . ALA C 3 84  ? -14.101 19.339 21.563  1.00 85.04  ? 84  ALA A N      1 
ATOM   788  C  CA     . ALA C 3 84  ? -13.257 18.148 21.511  1.00 86.93  ? 84  ALA A CA     1 
ATOM   789  C  C      . ALA C 3 84  ? -13.868 16.992 22.296  1.00 90.68  ? 84  ALA A C      1 
ATOM   790  O  O      . ALA C 3 84  ? -13.813 15.837 21.858  1.00 95.15  ? 84  ALA A O      1 
ATOM   791  C  CB     . ALA C 3 84  ? -11.859 18.473 22.035  1.00 88.29  ? 84  ALA A CB     1 
ATOM   792  N  N      . LYS C 3 85  ? -14.436 17.274 23.470  1.00 85.54  ? 85  LYS A N      1 
ATOM   793  C  CA     . LYS C 3 85  ? -15.104 16.211 24.210  1.00 85.01  ? 85  LYS A CA     1 
ATOM   794  C  C      . LYS C 3 85  ? -16.396 15.798 23.512  1.00 84.02  ? 85  LYS A C      1 
ATOM   795  O  O      . LYS C 3 85  ? -16.756 14.614 23.509  1.00 86.74  ? 85  LYS A O      1 
ATOM   796  C  CB     . LYS C 3 85  ? -15.358 16.652 25.652  1.00 82.69  ? 85  LYS A CB     1 
ATOM   797  C  CG     . LYS C 3 85  ? -14.089 16.760 26.502  1.00 63.31  ? 85  LYS A CG     1 
ATOM   798  N  N      . GLU C 3 86  ? -17.089 16.754 22.883  1.00 85.88  ? 86  GLU A N      1 
ATOM   799  C  CA     . GLU C 3 86  ? -18.281 16.418 22.107  1.00 91.29  ? 86  GLU A CA     1 
ATOM   800  C  C      . GLU C 3 86  ? -17.932 15.514 20.933  1.00 85.61  ? 86  GLU A C      1 
ATOM   801  O  O      . GLU C 3 86  ? -18.656 14.557 20.644  1.00 93.68  ? 86  GLU A O      1 
ATOM   802  C  CB     . GLU C 3 86  ? -18.980 17.687 21.609  1.00 81.04  ? 86  GLU A CB     1 
ATOM   803  N  N      . LYS C 3 87  ? -16.826 15.804 20.242  1.00 89.31  ? 87  LYS A N      1 
ATOM   804  C  CA     . LYS C 3 87  ? -16.384 14.948 19.143  1.00 88.80  ? 87  LYS A CA     1 
ATOM   805  C  C      . LYS C 3 87  ? -15.760 13.657 19.661  1.00 86.71  ? 87  LYS A C      1 
ATOM   806  O  O      . LYS C 3 87  ? -15.882 12.603 19.028  1.00 99.24  ? 87  LYS A O      1 
ATOM   807  C  CB     . LYS C 3 87  ? -15.383 15.696 18.265  1.00 84.78  ? 87  LYS A CB     1 
ATOM   808  C  CG     . LYS C 3 87  ? -15.382 15.276 16.811  1.00 79.82  ? 87  LYS A CG     1 
ATOM   809  C  CD     . LYS C 3 87  ? -15.981 16.372 15.948  1.00 74.66  ? 87  LYS A CD     1 
ATOM   810  C  CE     . LYS C 3 87  ? -15.631 16.185 14.481  1.00 78.43  ? 87  LYS A CE     1 
ATOM   811  N  N      . CYS C 3 88  ? -15.074 13.722 20.800  1.00 83.12  ? 88  CYS A N      1 
ATOM   812  C  CA     . CYS C 3 88  ? -14.419 12.565 21.404  1.00 82.21  ? 88  CYS A CA     1 
ATOM   813  C  C      . CYS C 3 88  ? -14.641 12.638 22.907  1.00 86.99  ? 88  CYS A C      1 
ATOM   814  O  O      . CYS C 3 88  ? -13.857 13.257 23.637  1.00 86.63  ? 88  CYS A O      1 
ATOM   815  C  CB     . CYS C 3 88  ? -12.933 12.519 21.062  1.00 80.70  ? 88  CYS A CB     1 
ATOM   816  S  SG     . CYS C 3 88  ? -11.992 11.275 21.977  1.00 79.25  ? 88  CYS A SG     1 
ATOM   817  N  N      . PRO C 3 89  ? -15.720 12.032 23.399  1.00 95.85  ? 89  PRO A N      1 
ATOM   818  C  CA     . PRO C 3 89  ? -15.997 12.092 24.843  1.00 90.39  ? 89  PRO A CA     1 
ATOM   819  C  C      . PRO C 3 89  ? -14.985 11.360 25.703  1.00 89.59  ? 89  PRO A C      1 
ATOM   820  O  O      . PRO C 3 89  ? -14.878 11.689 26.889  1.00 90.39  ? 89  PRO A O      1 
ATOM   821  C  CB     . PRO C 3 89  ? -17.392 11.461 24.951  1.00 97.04  ? 89  PRO A CB     1 
ATOM   822  C  CG     . PRO C 3 89  ? -18.015 11.728 23.596  1.00 94.98  ? 89  PRO A CG     1 
ATOM   823  C  CD     . PRO C 3 89  ? -16.887 11.585 22.619  1.00 90.64  ? 89  PRO A CD     1 
ATOM   824  N  N      . GLN C 3 90  ? -14.239 10.387 25.167  1.00 83.16  ? 90  GLN A N      1 
ATOM   825  C  CA     . GLN C 3 90  ? -13.253 9.663  25.968  1.00 83.99  ? 90  GLN A CA     1 
ATOM   826  C  C      . GLN C 3 90  ? -11.848 10.251 25.863  1.00 81.80  ? 90  GLN A C      1 
ATOM   827  O  O      . GLN C 3 90  ? -10.906 9.683  26.427  1.00 78.52  ? 90  GLN A O      1 
ATOM   828  C  CB     . GLN C 3 90  ? -13.224 8.179  25.586  1.00 92.07  ? 90  GLN A CB     1 
ATOM   829  C  CG     . GLN C 3 90  ? -12.589 7.857  24.234  1.00 83.57  ? 90  GLN A CG     1 
ATOM   830  C  CD     . GLN C 3 90  ? -13.456 8.283  23.073  1.00 86.65  ? 90  GLN A CD     1 
ATOM   831  O  OE1    . GLN C 3 90  ? -14.189 9.273  23.160  1.00 94.81  ? 90  GLN A OE1    1 
ATOM   832  N  NE2    . GLN C 3 90  ? -13.390 7.531  21.977  1.00 83.83  ? 90  GLN A NE2    1 
ATOM   833  N  N      . LEU C 3 91  ? -11.697 11.376 25.168  1.00 76.66  ? 91  LEU A N      1 
ATOM   834  C  CA     . LEU C 3 91  ? -10.411 12.057 25.063  1.00 82.24  ? 91  LEU A CA     1 
ATOM   835  C  C      . LEU C 3 91  ? -9.804  12.346 26.434  1.00 76.62  ? 91  LEU A C      1 
ATOM   836  O  O      . LEU C 3 91  ? -10.476 12.839 27.342  1.00 79.42  ? 91  LEU A O      1 
ATOM   837  C  CB     . LEU C 3 91  ? -10.590 13.368 24.298  1.00 79.70  ? 91  LEU A CB     1 
ATOM   838  C  CG     . LEU C 3 91  ? -9.365  14.235 24.025  1.00 72.94  ? 91  LEU A CG     1 
ATOM   839  C  CD1    . LEU C 3 91  ? -8.392  13.500 23.126  1.00 67.41  ? 91  LEU A CD1    1 
ATOM   840  C  CD2    . LEU C 3 91  ? -9.818  15.538 23.387  1.00 72.41  ? 91  LEU A CD2    1 
ATOM   841  N  N      . VAL C 3 92  ? -8.516  12.055 26.567  1.00 67.77  ? 92  VAL A N      1 
ATOM   842  C  CA     . VAL C 3 92  ? -7.753  12.373 27.767  1.00 62.41  ? 92  VAL A CA     1 
ATOM   843  C  C      . VAL C 3 92  ? -7.092  13.738 27.596  1.00 67.32  ? 92  VAL A C      1 
ATOM   844  O  O      . VAL C 3 92  ? -6.405  13.980 26.597  1.00 71.76  ? 92  VAL A O      1 
ATOM   845  C  CB     . VAL C 3 92  ? -6.699  11.291 28.039  1.00 66.27  ? 92  VAL A CB     1 
ATOM   846  C  CG1    . VAL C 3 92  ? -6.018  11.534 29.395  1.00 64.96  ? 92  VAL A CG1    1 
ATOM   847  C  CG2    . VAL C 3 92  ? -7.330  9.913  27.974  1.00 73.70  ? 92  VAL A CG2    1 
ATOM   848  N  N      . LEU C 3 93  ? -7.271  14.619 28.585  1.00 68.12  ? 93  LEU A N      1 
ATOM   849  C  CA     . LEU C 3 93  ? -6.715  15.968 28.581  1.00 59.83  ? 93  LEU A CA     1 
ATOM   850  C  C      . LEU C 3 93  ? -5.627  16.071 29.642  1.00 57.69  ? 93  LEU A C      1 
ATOM   851  O  O      . LEU C 3 93  ? -5.818  15.611 30.766  1.00 61.41  ? 93  LEU A O      1 
ATOM   852  C  CB     . LEU C 3 93  ? -7.808  17.005 28.838  1.00 58.50  ? 93  LEU A CB     1 
ATOM   853  C  CG     . LEU C 3 93  ? -8.884  17.042 27.759  1.00 65.83  ? 93  LEU A CG     1 
ATOM   854  C  CD1    . LEU C 3 93  ? -9.861  18.214 27.918  1.00 68.71  ? 93  LEU A CD1    1 
ATOM   855  C  CD2    . LEU C 3 93  ? -8.210  17.104 26.413  1.00 70.80  ? 93  LEU A CD2    1 
ATOM   856  N  N      . VAL C 3 94  ? -4.480  16.651 29.274  1.00 59.08  ? 94  VAL A N      1 
ATOM   857  C  CA     . VAL C 3 94  ? -3.380  16.957 30.189  1.00 55.79  ? 94  VAL A CA     1 
ATOM   858  C  C      . VAL C 3 94  ? -3.107  18.448 30.093  1.00 58.33  ? 94  VAL A C      1 
ATOM   859  O  O      . VAL C 3 94  ? -3.370  19.077 29.061  1.00 57.04  ? 94  VAL A O      1 
ATOM   860  C  CB     . VAL C 3 94  ? -2.082  16.176 29.876  1.00 55.13  ? 94  VAL A CB     1 
ATOM   861  C  CG1    . VAL C 3 94  ? -0.988  16.550 30.850  1.00 47.67  ? 94  VAL A CG1    1 
ATOM   862  C  CG2    . VAL C 3 94  ? -2.336  14.702 29.905  1.00 61.84  ? 94  VAL A CG2    1 
ATOM   863  N  N      . ASN C 3 95  ? -2.560  19.018 31.159  1.00 46.86  ? 95  ASN A N      1 
ATOM   864  C  CA     . ASN C 3 95  ? -2.351  20.453 31.156  1.00 49.97  ? 95  ASN A CA     1 
ATOM   865  C  C      . ASN C 3 95  ? -1.002  20.789 30.542  1.00 54.36  ? 95  ASN A C      1 
ATOM   866  O  O      . ASN C 3 95  ? 0.035   20.265 30.975  1.00 52.18  ? 95  ASN A O      1 
ATOM   867  C  CB     . ASN C 3 95  ? -2.454  21.035 32.560  1.00 50.37  ? 95  ASN A CB     1 
ATOM   868  C  CG     . ASN C 3 95  ? -2.655  22.535 32.533  1.00 53.71  ? 95  ASN A CG     1 
ATOM   869  O  OD1    . ASN C 3 95  ? -1.714  23.286 32.762  1.00 62.08  ? 95  ASN A OD1    1 
ATOM   870  N  ND2    . ASN C 3 95  ? -3.876  22.981 32.202  1.00 54.41  ? 95  ASN A ND2    1 
ATOM   871  N  N      . GLY C 3 96  ? -1.024  21.680 29.544  1.00 44.15  ? 96  GLY A N      1 
ATOM   872  C  CA     . GLY C 3 96  ? 0.203   22.133 28.919  1.00 53.53  ? 96  GLY A CA     1 
ATOM   873  C  C      . GLY C 3 96  ? 0.440   23.624 29.055  1.00 56.02  ? 96  GLY A C      1 
ATOM   874  O  O      . GLY C 3 96  ? 0.951   24.262 28.133  1.00 46.49  ? 96  GLY A O      1 
ATOM   875  N  N      . GLU C 3 97  ? 0.066   24.207 30.198  1.00 62.40  ? 97  GLU A N      1 
ATOM   876  C  CA     . GLU C 3 97  ? 0.269   25.642 30.386  1.00 58.84  ? 97  GLU A CA     1 
ATOM   877  C  C      . GLU C 3 97  ? 1.707   25.983 30.747  1.00 52.70  ? 97  GLU A C      1 
ATOM   878  O  O      . GLU C 3 97  ? 2.148   27.121 30.545  1.00 57.30  ? 97  GLU A O      1 
ATOM   879  C  CB     . GLU C 3 97  ? -0.676  26.154 31.461  1.00 54.72  ? 97  GLU A CB     1 
ATOM   880  C  CG     . GLU C 3 97  ? -2.102  25.823 31.127  1.00 64.38  ? 97  GLU A CG     1 
ATOM   881  C  CD     . GLU C 3 97  ? -3.098  26.513 32.017  1.00 67.25  ? 97  GLU A CD     1 
ATOM   882  O  OE1    . GLU C 3 97  ? -2.719  26.931 33.140  1.00 62.05  ? 97  GLU A OE1    1 
ATOM   883  O  OE2    . GLU C 3 97  ? -4.259  26.628 31.566  1.00 62.27  ? 97  GLU A OE2    1 
ATOM   884  N  N      . ASP C 3 98  ? 2.439   25.031 31.272  1.00 46.80  ? 98  ASP A N      1 
ATOM   885  C  CA     . ASP C 3 98  ? 3.823   25.225 31.660  1.00 50.97  ? 98  ASP A CA     1 
ATOM   886  C  C      . ASP C 3 98  ? 4.686   24.597 30.569  1.00 56.60  ? 98  ASP A C      1 
ATOM   887  O  O      . ASP C 3 98  ? 4.677   23.378 30.383  1.00 55.19  ? 98  ASP A O      1 
ATOM   888  C  CB     . ASP C 3 98  ? 4.058   24.603 33.035  1.00 48.70  ? 98  ASP A CB     1 
ATOM   889  C  CG     . ASP C 3 98  ? 5.505   24.486 33.383  1.00 55.23  ? 98  ASP A CG     1 
ATOM   890  O  OD1    . ASP C 3 98  ? 6.325   25.138 32.711  1.00 60.74  ? 98  ASP A OD1    1 
ATOM   891  O  OD2    . ASP C 3 98  ? 5.824   23.744 34.338  1.00 64.13  ? 98  ASP A OD2    1 
ATOM   892  N  N      . LEU C 3 99  ? 5.415   25.435 29.839  1.00 51.35  ? 99  LEU A N      1 
ATOM   893  C  CA     . LEU C 3 99  ? 6.176   24.995 28.685  1.00 42.28  ? 99  LEU A CA     1 
ATOM   894  C  C      . LEU C 3 99  ? 7.544   24.470 29.049  1.00 45.70  ? 99  LEU A C      1 
ATOM   895  O  O      . LEU C 3 99  ? 8.332   24.178 28.148  1.00 48.15  ? 99  LEU A O      1 
ATOM   896  C  CB     . LEU C 3 99  ? 6.340   26.134 27.692  1.00 36.69  ? 99  LEU A CB     1 
ATOM   897  C  CG     . LEU C 3 99  ? 5.064   26.796 27.211  1.00 48.44  ? 99  LEU A CG     1 
ATOM   898  C  CD1    . LEU C 3 99  ? 5.344   27.823 26.101  1.00 44.54  ? 99  LEU A CD1    1 
ATOM   899  C  CD2    . LEU C 3 99  ? 4.099   25.750 26.732  1.00 43.76  ? 99  LEU A CD2    1 
ATOM   900  N  N      . THR C 3 100 ? 7.851   24.332 30.341  1.00 47.00  ? 100 THR A N      1 
ATOM   901  C  CA     . THR C 3 100 ? 9.226   24.050 30.743  1.00 35.78  ? 100 THR A CA     1 
ATOM   902  C  C      . THR C 3 100 ? 9.741   22.757 30.116  1.00 43.67  ? 100 THR A C      1 
ATOM   903  O  O      . THR C 3 100 ? 10.867  22.701 29.598  1.00 43.23  ? 100 THR A O      1 
ATOM   904  C  CB     . THR C 3 100 ? 9.307   24.007 32.272  1.00 35.67  ? 100 THR A CB     1 
ATOM   905  O  OG1    . THR C 3 100 ? 9.183   25.337 32.779  1.00 37.94  ? 100 THR A OG1    1 
ATOM   906  C  CG2    . THR C 3 100 ? 10.632  23.434 32.740  1.00 25.18  ? 100 THR A CG2    1 
ATOM   907  N  N      . ARG C 3 101 ? 8.919   21.706 30.147  1.00 46.43  ? 101 ARG A N      1 
ATOM   908  C  CA     . ARG C 3 101 ? 9.338   20.409 29.628  1.00 47.43  ? 101 ARG A CA     1 
ATOM   909  C  C      . ARG C 3 101 ? 9.461   20.436 28.110  1.00 49.84  ? 101 ARG A C      1 
ATOM   910  O  O      . ARG C 3 101 ? 10.427  19.909 27.543  1.00 45.62  ? 101 ARG A O      1 
ATOM   911  C  CB     . ARG C 3 101 ? 8.345   19.338 30.059  1.00 47.63  ? 101 ARG A CB     1 
ATOM   912  C  CG     . ARG C 3 101 ? 8.996   18.116 30.640  1.00 66.02  ? 101 ARG A CG     1 
ATOM   913  C  CD     . ARG C 3 101 ? 7.976   16.982 30.888  1.00 86.17  ? 101 ARG A CD     1 
ATOM   914  N  NE     . ARG C 3 101 ? 6.683   17.441 31.406  1.00 81.41  ? 101 ARG A NE     1 
ATOM   915  C  CZ     . ARG C 3 101 ? 5.892   16.696 32.173  1.00 90.16  ? 101 ARG A CZ     1 
ATOM   916  N  NH1    . ARG C 3 101 ? 6.274   15.472 32.516  1.00 89.33  ? 101 ARG A NH1    1 
ATOM   917  N  NH2    . ARG C 3 101 ? 4.731   17.175 32.613  1.00 95.94  ? 101 ARG A NH2    1 
ATOM   918  N  N      . TYR C 3 102 ? 8.477   21.024 27.428  1.00 44.58  ? 102 TYR A N      1 
ATOM   919  C  CA     . TYR C 3 102 ? 8.571   21.118 25.976  1.00 41.85  ? 102 TYR A CA     1 
ATOM   920  C  C      . TYR C 3 102 ? 9.771   21.956 25.568  1.00 46.63  ? 102 TYR A C      1 
ATOM   921  O  O      . TYR C 3 102 ? 10.474  21.626 24.604  1.00 45.43  ? 102 TYR A O      1 
ATOM   922  C  CB     . TYR C 3 102 ? 7.307   21.722 25.395  1.00 36.42  ? 102 TYR A CB     1 
ATOM   923  C  CG     . TYR C 3 102 ? 6.044   21.216 26.026  1.00 43.31  ? 102 TYR A CG     1 
ATOM   924  C  CD1    . TYR C 3 102 ? 5.872   19.856 26.312  1.00 39.65  ? 102 TYR A CD1    1 
ATOM   925  C  CD2    . TYR C 3 102 ? 5.017   22.097 26.344  1.00 40.41  ? 102 TYR A CD2    1 
ATOM   926  C  CE1    . TYR C 3 102 ? 4.715   19.397 26.902  1.00 34.00  ? 102 TYR A CE1    1 
ATOM   927  C  CE2    . TYR C 3 102 ? 3.869   21.650 26.924  1.00 43.79  ? 102 TYR A CE2    1 
ATOM   928  C  CZ     . TYR C 3 102 ? 3.723   20.302 27.206  1.00 42.72  ? 102 TYR A CZ     1 
ATOM   929  O  OH     . TYR C 3 102 ? 2.553   19.886 27.792  1.00 52.52  ? 102 TYR A OH     1 
ATOM   930  N  N      . ARG C 3 103 ? 10.034  23.038 26.306  1.00 46.60  ? 103 ARG A N      1 
ATOM   931  C  CA     . ARG C 3 103 ? 11.181  23.886 25.992  1.00 40.65  ? 103 ARG A CA     1 
ATOM   932  C  C      . ARG C 3 103 ? 12.493  23.132 26.190  1.00 48.26  ? 103 ARG A C      1 
ATOM   933  O  O      . ARG C 3 103 ? 13.407  23.225 25.360  1.00 47.01  ? 103 ARG A O      1 
ATOM   934  C  CB     . ARG C 3 103 ? 11.144  25.161 26.837  1.00 38.71  ? 103 ARG A CB     1 
ATOM   935  C  CG     . ARG C 3 103 ? 12.234  26.170 26.481  1.00 47.70  ? 103 ARG A CG     1 
ATOM   936  C  CD     . ARG C 3 103 ? 12.237  27.408 27.403  1.00 53.41  ? 103 ARG A CD     1 
ATOM   937  N  NE     . ARG C 3 103 ? 11.017  28.212 27.308  1.00 54.15  ? 103 ARG A NE     1 
ATOM   938  C  CZ     . ARG C 3 103 ? 10.108  28.316 28.280  1.00 57.41  ? 103 ARG A CZ     1 
ATOM   939  N  NH1    . ARG C 3 103 ? 10.302  27.666 29.436  1.00 47.21  ? 103 ARG A NH1    1 
ATOM   940  N  NH2    . ARG C 3 103 ? 9.016   29.085 28.095  1.00 44.97  ? 103 ARG A NH2    1 
ATOM   941  N  N      . GLU C 3 104 ? 12.609  22.353 27.266  1.00 49.91  ? 104 GLU A N      1 
ATOM   942  C  CA     . GLU C 3 104 ? 13.847  21.602 27.425  1.00 46.62  ? 104 GLU A CA     1 
ATOM   943  C  C      . GLU C 3 104 ? 14.061  20.665 26.250  1.00 43.38  ? 104 GLU A C      1 
ATOM   944  O  O      . GLU C 3 104 ? 15.175  20.558 25.721  1.00 47.99  ? 104 GLU A O      1 
ATOM   945  C  CB     . GLU C 3 104 ? 13.842  20.827 28.729  1.00 52.05  ? 104 GLU A CB     1 
ATOM   946  C  CG     . GLU C 3 104 ? 13.473  21.669 29.916  1.00 61.14  ? 104 GLU A CG     1 
ATOM   947  C  CD     . GLU C 3 104 ? 13.523  20.852 31.193  1.00 65.02  ? 104 GLU A CD     1 
ATOM   948  O  OE1    . GLU C 3 104 ? 14.044  21.376 32.202  1.00 72.58  ? 104 GLU A OE1    1 
ATOM   949  O  OE2    . GLU C 3 104 ? 13.068  19.678 31.163  1.00 68.00  ? 104 GLU A OE2    1 
ATOM   950  N  N      . MET C 3 105 ? 12.998  19.988 25.815  1.00 42.97  ? 105 MET A N      1 
ATOM   951  C  CA     . MET C 3 105 ? 13.123  19.025 24.725  1.00 40.19  ? 105 MET A CA     1 
ATOM   952  C  C      . MET C 3 105 ? 13.371  19.722 23.393  1.00 40.47  ? 105 MET A C      1 
ATOM   953  O  O      . MET C 3 105 ? 14.187  19.272 22.576  1.00 41.70  ? 105 MET A O      1 
ATOM   954  C  CB     . MET C 3 105 ? 11.862  18.171 24.653  1.00 40.53  ? 105 MET A CB     1 
ATOM   955  C  CG     . MET C 3 105 ? 12.083  16.812 24.012  1.00 58.79  ? 105 MET A CG     1 
ATOM   956  S  SD     . MET C 3 105 ? 13.073  15.762 25.090  1.00 66.25  ? 105 MET A SD     1 
ATOM   957  C  CE     . MET C 3 105 ? 12.845  16.651 26.638  1.00 42.83  ? 105 MET A CE     1 
ATOM   958  N  N      . SER C 3 106 ? 12.670  20.823 23.157  1.00 37.95  ? 106 SER A N      1 
ATOM   959  C  CA     . SER C 3 106 ? 12.898  21.601 21.952  1.00 33.02  ? 106 SER A CA     1 
ATOM   960  C  C      . SER C 3 106 ? 14.381  21.893 21.730  1.00 41.04  ? 106 SER A C      1 
ATOM   961  O  O      . SER C 3 106 ? 14.856  21.860 20.588  1.00 47.40  ? 106 SER A O      1 
ATOM   962  C  CB     . SER C 3 106 ? 12.107  22.896 22.043  1.00 34.92  ? 106 SER A CB     1 
ATOM   963  O  OG     . SER C 3 106 ? 12.083  23.559 20.794  1.00 41.86  ? 106 SER A OG     1 
ATOM   964  N  N      . TYR C 3 107 ? 15.135  22.198 22.796  1.00 37.57  ? 107 TYR A N      1 
ATOM   965  C  CA     . TYR C 3 107 ? 16.541  22.530 22.596  1.00 35.62  ? 107 TYR A CA     1 
ATOM   966  C  C      . TYR C 3 107 ? 17.433  21.301 22.554  1.00 38.11  ? 107 TYR A C      1 
ATOM   967  O  O      . TYR C 3 107 ? 18.512  21.355 21.956  1.00 36.62  ? 107 TYR A O      1 
ATOM   968  C  CB     . TYR C 3 107 ? 17.050  23.505 23.664  1.00 34.78  ? 107 TYR A CB     1 
ATOM   969  C  CG     . TYR C 3 107 ? 16.669  24.942 23.354  1.00 34.19  ? 107 TYR A CG     1 
ATOM   970  C  CD1    . TYR C 3 107 ? 17.411  25.696 22.426  1.00 33.74  ? 107 TYR A CD1    1 
ATOM   971  C  CD2    . TYR C 3 107 ? 15.554  25.536 23.966  1.00 30.61  ? 107 TYR A CD2    1 
ATOM   972  C  CE1    . TYR C 3 107 ? 17.051  27.012 22.120  1.00 31.66  ? 107 TYR A CE1    1 
ATOM   973  C  CE2    . TYR C 3 107 ? 15.189  26.841 23.677  1.00 36.25  ? 107 TYR A CE2    1 
ATOM   974  C  CZ     . TYR C 3 107 ? 15.939  27.572 22.747  1.00 41.44  ? 107 TYR A CZ     1 
ATOM   975  O  OH     . TYR C 3 107 ? 15.564  28.867 22.468  1.00 42.87  ? 107 TYR A OH     1 
ATOM   976  N  N      . LYS C 3 108 ? 17.019  20.184 23.147  1.00 41.88  ? 108 LYS A N      1 
ATOM   977  C  CA     . LYS C 3 108 ? 17.768  18.957 22.904  1.00 38.00  ? 108 LYS A CA     1 
ATOM   978  C  C      . LYS C 3 108 ? 17.711  18.605 21.430  1.00 40.97  ? 108 LYS A C      1 
ATOM   979  O  O      . LYS C 3 108 ? 18.740  18.266 20.826  1.00 43.79  ? 108 LYS A O      1 
ATOM   980  C  CB     . LYS C 3 108 ? 17.235  17.813 23.781  1.00 44.18  ? 108 LYS A CB     1 
ATOM   981  C  CG     . LYS C 3 108 ? 17.713  17.954 25.225  1.00 47.95  ? 108 LYS A CG     1 
ATOM   982  C  CD     . LYS C 3 108 ? 17.042  17.032 26.192  1.00 39.10  ? 108 LYS A CD     1 
ATOM   983  C  CE     . LYS C 3 108 ? 17.755  17.124 27.543  1.00 41.66  ? 108 LYS A CE     1 
ATOM   984  N  NZ     . LYS C 3 108 ? 17.213  16.223 28.622  1.00 44.04  ? 108 LYS A NZ     1 
ATOM   985  N  N      . VAL C 3 109 ? 16.523  18.739 20.815  1.00 36.87  ? 109 VAL A N      1 
ATOM   986  C  CA     . VAL C 3 109 ? 16.384  18.441 19.392  1.00 35.58  ? 109 VAL A CA     1 
ATOM   987  C  C      . VAL C 3 109 ? 17.299  19.334 18.569  1.00 39.75  ? 109 VAL A C      1 
ATOM   988  O  O      . VAL C 3 109 ? 18.050  18.854 17.714  1.00 37.60  ? 109 VAL A O      1 
ATOM   989  C  CB     . VAL C 3 109 ? 14.926  18.582 18.941  1.00 36.41  ? 109 VAL A CB     1 
ATOM   990  C  CG1    . VAL C 3 109 ? 14.882  18.439 17.433  1.00 38.83  ? 109 VAL A CG1    1 
ATOM   991  C  CG2    . VAL C 3 109 ? 14.079  17.510 19.613  1.00 35.04  ? 109 VAL A CG2    1 
ATOM   992  N  N      . THR C 3 110 ? 17.268  20.648 18.826  1.00 38.93  ? 110 THR A N      1 
ATOM   993  C  CA     . THR C 3 110 ? 18.086  21.556 18.030  1.00 33.80  ? 110 THR A CA     1 
ATOM   994  C  C      . THR C 3 110 ? 19.560  21.254 18.218  1.00 35.82  ? 110 THR A C      1 
ATOM   995  O  O      . THR C 3 110 ? 20.330  21.264 17.255  1.00 41.08  ? 110 THR A O      1 
ATOM   996  C  CB     . THR C 3 110 ? 17.805  23.019 18.388  1.00 33.97  ? 110 THR A CB     1 
ATOM   997  O  OG1    . THR C 3 110 ? 16.436  23.338 18.123  1.00 36.40  ? 110 THR A OG1    1 
ATOM   998  C  CG2    . THR C 3 110 ? 18.694  23.949 17.579  1.00 31.74  ? 110 THR A CG2    1 
ATOM   999  N  N      . GLU C 3 111 ? 19.973  20.993 19.455  1.00 39.94  ? 111 GLU A N      1 
ATOM   1000 C  CA     . GLU C 3 111 ? 21.387  20.760 19.708  1.00 37.80  ? 111 GLU A CA     1 
ATOM   1001 C  C      . GLU C 3 111 ? 21.844  19.498 19.017  1.00 40.38  ? 111 GLU A C      1 
ATOM   1002 O  O      . GLU C 3 111 ? 22.981  19.426 18.538  1.00 42.86  ? 111 GLU A O      1 
ATOM   1003 C  CB     . GLU C 3 111 ? 21.664  20.671 21.204  1.00 40.34  ? 111 GLU A CB     1 
ATOM   1004 C  CG     . GLU C 3 111 ? 21.426  21.950 21.950  1.00 38.09  ? 111 GLU A CG     1 
ATOM   1005 C  CD     . GLU C 3 111 ? 21.867  21.851 23.393  1.00 51.80  ? 111 GLU A CD     1 
ATOM   1006 O  OE1    . GLU C 3 111 ? 22.767  21.028 23.671  1.00 51.28  ? 111 GLU A OE1    1 
ATOM   1007 O  OE2    . GLU C 3 111 ? 21.327  22.595 24.243  1.00 48.41  ? 111 GLU A OE2    1 
ATOM   1008 N  N      . LEU C 3 112 ? 20.975  18.487 18.957  1.00 38.81  ? 112 LEU A N      1 
ATOM   1009 C  CA     . LEU C 3 112 ? 21.318  17.282 18.211  1.00 40.56  ? 112 LEU A CA     1 
ATOM   1010 C  C      . LEU C 3 112 ? 21.511  17.610 16.734  1.00 40.49  ? 112 LEU A C      1 
ATOM   1011 O  O      . LEU C 3 112 ? 22.529  17.250 16.130  1.00 41.16  ? 112 LEU A O      1 
ATOM   1012 C  CB     . LEU C 3 112 ? 20.238  16.215 18.420  1.00 35.09  ? 112 LEU A CB     1 
ATOM   1013 C  CG     . LEU C 3 112 ? 20.270  15.002 17.486  1.00 40.04  ? 112 LEU A CG     1 
ATOM   1014 C  CD1    . LEU C 3 112 ? 21.677  14.421 17.421  1.00 43.01  ? 112 LEU A CD1    1 
ATOM   1015 C  CD2    . LEU C 3 112 ? 19.286  13.932 17.936  1.00 41.72  ? 112 LEU A CD2    1 
ATOM   1016 N  N      . LEU C 3 113 ? 20.557  18.331 16.143  1.00 38.25  ? 113 LEU A N      1 
ATOM   1017 C  CA     . LEU C 3 113 ? 20.688  18.700 14.740  1.00 35.40  ? 113 LEU A CA     1 
ATOM   1018 C  C      . LEU C 3 113 ? 21.939  19.536 14.498  1.00 37.87  ? 113 LEU A C      1 
ATOM   1019 O  O      . LEU C 3 113 ? 22.598  19.377 13.468  1.00 45.11  ? 113 LEU A O      1 
ATOM   1020 C  CB     . LEU C 3 113 ? 19.436  19.436 14.281  1.00 36.11  ? 113 LEU A CB     1 
ATOM   1021 C  CG     . LEU C 3 113 ? 18.175  18.574 14.353  1.00 31.53  ? 113 LEU A CG     1 
ATOM   1022 C  CD1    . LEU C 3 113 ? 16.977  19.349 13.832  1.00 32.13  ? 113 LEU A CD1    1 
ATOM   1023 C  CD2    . LEU C 3 113 ? 18.377  17.291 13.576  1.00 29.70  ? 113 LEU A CD2    1 
ATOM   1024 N  N      . GLU C 3 114 ? 22.310  20.397 15.445  1.00 39.43  ? 114 GLU A N      1 
ATOM   1025 C  CA     . GLU C 3 114 ? 23.535  21.177 15.304  1.00 40.52  ? 114 GLU A CA     1 
ATOM   1026 C  C      . GLU C 3 114 ? 24.780  20.303 15.194  1.00 45.04  ? 114 GLU A C      1 
ATOM   1027 O  O      . GLU C 3 114 ? 25.805  20.775 14.702  1.00 47.99  ? 114 GLU A O      1 
ATOM   1028 C  CB     . GLU C 3 114 ? 23.670  22.153 16.468  1.00 39.14  ? 114 GLU A CB     1 
ATOM   1029 C  CG     . GLU C 3 114 ? 23.059  23.499 16.165  1.00 43.08  ? 114 GLU A CG     1 
ATOM   1030 C  CD     . GLU C 3 114 ? 22.691  24.315 17.391  1.00 46.48  ? 114 GLU A CD     1 
ATOM   1031 O  OE1    . GLU C 3 114 ? 22.909  23.859 18.539  1.00 51.95  ? 114 GLU A OE1    1 
ATOM   1032 O  OE2    . GLU C 3 114 ? 22.165  25.434 17.194  1.00 52.70  ? 114 GLU A OE2    1 
ATOM   1033 N  N      . GLU C 3 115 ? 24.719  19.043 15.633  1.00 45.09  ? 115 GLU A N      1 
ATOM   1034 C  CA     . GLU C 3 115 ? 25.865  18.153 15.480  1.00 45.43  ? 115 GLU A CA     1 
ATOM   1035 C  C      . GLU C 3 115 ? 26.134  17.863 14.012  1.00 53.37  ? 115 GLU A C      1 
ATOM   1036 O  O      . GLU C 3 115 ? 27.291  17.755 13.592  1.00 52.02  ? 115 GLU A O      1 
ATOM   1037 C  CB     . GLU C 3 115 ? 25.619  16.848 16.228  1.00 47.89  ? 115 GLU A CB     1 
ATOM   1038 C  CG     . GLU C 3 115 ? 26.384  16.690 17.516  1.00 57.67  ? 115 GLU A CG     1 
ATOM   1039 C  CD     . GLU C 3 115 ? 26.493  15.236 17.905  1.00 59.24  ? 115 GLU A CD     1 
ATOM   1040 O  OE1    . GLU C 3 115 ? 25.562  14.725 18.562  1.00 56.03  ? 115 GLU A OE1    1 
ATOM   1041 O  OE2    . GLU C 3 115 ? 27.491  14.594 17.506  1.00 67.26  ? 115 GLU A OE2    1 
ATOM   1042 N  N      . PHE C 3 116 ? 25.067  17.713 13.226  1.00 56.20  ? 116 PHE A N      1 
ATOM   1043 C  CA     . PHE C 3 116 ? 25.185  17.437 11.799  1.00 46.97  ? 116 PHE A CA     1 
ATOM   1044 C  C      . PHE C 3 116 ? 25.769  18.631 11.056  1.00 50.31  ? 116 PHE A C      1 
ATOM   1045 O  O      . PHE C 3 116 ? 26.782  18.517 10.362  1.00 57.87  ? 116 PHE A O      1 
ATOM   1046 C  CB     . PHE C 3 116 ? 23.807  17.082 11.249  1.00 42.07  ? 116 PHE A CB     1 
ATOM   1047 C  CG     . PHE C 3 116 ? 23.317  15.734 11.682  1.00 46.73  ? 116 PHE A CG     1 
ATOM   1048 C  CD1    . PHE C 3 116 ? 22.823  15.539 12.965  1.00 44.77  ? 116 PHE A CD1    1 
ATOM   1049 C  CD2    . PHE C 3 116 ? 23.346  14.658 10.804  1.00 37.60  ? 116 PHE A CD2    1 
ATOM   1050 C  CE1    . PHE C 3 116 ? 22.356  14.300 13.367  1.00 38.94  ? 116 PHE A CE1    1 
ATOM   1051 C  CE2    . PHE C 3 116 ? 22.884  13.410 11.190  1.00 46.46  ? 116 PHE A CE2    1 
ATOM   1052 C  CZ     . PHE C 3 116 ? 22.383  13.225 12.485  1.00 43.30  ? 116 PHE A CZ     1 
ATOM   1053 N  N      . SER C 3 117 ? 25.129  19.787 11.175  1.00 47.76  ? 117 SER A N      1 
ATOM   1054 C  CA     . SER C 3 117 ? 25.640  21.012 10.611  1.00 43.90  ? 117 SER A CA     1 
ATOM   1055 C  C      . SER C 3 117 ? 25.348  22.115 11.618  1.00 46.37  ? 117 SER A C      1 
ATOM   1056 O  O      . SER C 3 117 ? 24.235  22.171 12.169  1.00 45.61  ? 117 SER A O      1 
ATOM   1057 C  CB     . SER C 3 117 ? 25.010  21.323 9.247   1.00 51.01  ? 117 SER A CB     1 
ATOM   1058 O  OG     . SER C 3 117 ? 25.417  22.611 8.763   1.00 57.32  ? 117 SER A OG     1 
ATOM   1059 N  N      . PRO C 3 118 ? 26.323  22.983 11.911  1.00 50.06  ? 118 PRO A N      1 
ATOM   1060 C  CA     . PRO C 3 118 ? 26.167  23.958 13.011  1.00 42.37  ? 118 PRO A CA     1 
ATOM   1061 C  C      . PRO C 3 118 ? 25.062  24.983 12.806  1.00 52.88  ? 118 PRO A C      1 
ATOM   1062 O  O      . PRO C 3 118 ? 24.539  25.534 13.791  1.00 50.76  ? 118 PRO A O      1 
ATOM   1063 C  CB     . PRO C 3 118 ? 27.543  24.642 13.048  1.00 51.29  ? 118 PRO A CB     1 
ATOM   1064 C  CG     . PRO C 3 118 ? 28.211  24.285 11.713  1.00 42.14  ? 118 PRO A CG     1 
ATOM   1065 C  CD     . PRO C 3 118 ? 27.705  22.931 11.401  1.00 39.35  ? 118 PRO A CD     1 
ATOM   1066 N  N      . VAL C 3 119 ? 24.710  25.274 11.557  1.00 47.70  ? 119 VAL A N      1 
ATOM   1067 C  CA     . VAL C 3 119 ? 23.817  26.378 11.232  1.00 44.74  ? 119 VAL A CA     1 
ATOM   1068 C  C      . VAL C 3 119 ? 22.394  25.828 11.213  1.00 45.44  ? 119 VAL A C      1 
ATOM   1069 O  O      . VAL C 3 119 ? 21.925  25.320 10.195  1.00 54.22  ? 119 VAL A O      1 
ATOM   1070 C  CB     . VAL C 3 119 ? 24.199  27.016 9.892   1.00 54.03  ? 119 VAL A CB     1 
ATOM   1071 C  CG1    . VAL C 3 119 ? 23.160  28.034 9.434   1.00 42.43  ? 119 VAL A CG1    1 
ATOM   1072 C  CG2    . VAL C 3 119 ? 25.591  27.647 9.978   1.00 42.26  ? 119 VAL A CG2    1 
ATOM   1073 N  N      . VAL C 3 120 ? 21.686  25.946 12.328  1.00 47.01  ? 120 VAL A N      1 
ATOM   1074 C  CA     . VAL C 3 120 ? 20.344  25.389 12.452  1.00 33.26  ? 120 VAL A CA     1 
ATOM   1075 C  C      . VAL C 3 120 ? 19.399  26.508 12.831  1.00 36.11  ? 120 VAL A C      1 
ATOM   1076 O  O      . VAL C 3 120 ? 19.692  27.284 13.744  1.00 38.97  ? 120 VAL A O      1 
ATOM   1077 C  CB     . VAL C 3 120 ? 20.288  24.254 13.487  1.00 39.18  ? 120 VAL A CB     1 
ATOM   1078 C  CG1    . VAL C 3 120 ? 18.841  23.852 13.746  1.00 35.60  ? 120 VAL A CG1    1 
ATOM   1079 C  CG2    . VAL C 3 120 ? 21.113  23.058 13.012  1.00 36.77  ? 120 VAL A CG2    1 
ATOM   1080 N  N      . GLU C 3 121 ? 18.271  26.594 12.128  1.00 43.36  ? 121 GLU A N      1 
ATOM   1081 C  CA     . GLU C 3 121 ? 17.294  27.653 12.323  1.00 42.07  ? 121 GLU A CA     1 
ATOM   1082 C  C      . GLU C 3 121 ? 16.057  27.083 13.017  1.00 41.54  ? 121 GLU A C      1 
ATOM   1083 O  O      . GLU C 3 121 ? 15.399  26.184 12.487  1.00 36.60  ? 121 GLU A O      1 
ATOM   1084 C  CB     . GLU C 3 121 ? 16.936  28.291 10.980  1.00 34.88  ? 121 GLU A CB     1 
ATOM   1085 C  CG     . GLU C 3 121 ? 15.838  29.360 11.078  1.00 40.50  ? 121 GLU A CG     1 
ATOM   1086 C  CD     . GLU C 3 121 ? 15.865  30.382 9.933   1.00 45.94  ? 121 GLU A CD     1 
ATOM   1087 O  OE1    . GLU C 3 121 ? 16.810  30.363 9.105   1.00 42.91  ? 121 GLU A OE1    1 
ATOM   1088 O  OE2    . GLU C 3 121 ? 14.930  31.210 9.862   1.00 43.75  ? 121 GLU A OE2    1 
ATOM   1089 N  N      . ARG C 3 122 ? 15.736  27.604 14.193  1.00 34.53  ? 122 ARG A N      1 
ATOM   1090 C  CA     . ARG C 3 122 ? 14.504  27.200 14.836  1.00 33.10  ? 122 ARG A CA     1 
ATOM   1091 C  C      . ARG C 3 122 ? 13.339  27.962 14.241  1.00 38.14  ? 122 ARG A C      1 
ATOM   1092 O  O      . ARG C 3 122 ? 13.483  29.092 13.772  1.00 41.66  ? 122 ARG A O      1 
ATOM   1093 C  CB     . ARG C 3 122 ? 14.538  27.469 16.338  1.00 37.60  ? 122 ARG A CB     1 
ATOM   1094 C  CG     . ARG C 3 122 ? 15.777  27.000 17.057  1.00 39.27  ? 122 ARG A CG     1 
ATOM   1095 C  CD     . ARG C 3 122 ? 15.676  27.366 18.543  1.00 34.27  ? 122 ARG A CD     1 
ATOM   1096 N  NE     . ARG C 3 122 ? 15.292  26.191 19.296  1.00 38.98  ? 122 ARG A NE     1 
ATOM   1097 C  CZ     . ARG C 3 122 ? 14.218  26.083 20.065  1.00 37.05  ? 122 ARG A CZ     1 
ATOM   1098 N  NH1    . ARG C 3 122 ? 13.372  27.092 20.244  1.00 35.69  ? 122 ARG A NH1    1 
ATOM   1099 N  NH2    . ARG C 3 122 ? 14.004  24.936 20.668  1.00 38.81  ? 122 ARG A NH2    1 
ATOM   1100 N  N      . LEU C 3 123 ? 12.170  27.339 14.292  1.00 27.53  ? 123 LEU A N      1 
ATOM   1101 C  CA     . LEU C 3 123 ? 10.908  28.000 13.984  1.00 26.39  ? 123 LEU A CA     1 
ATOM   1102 C  C      . LEU C 3 123 ? 9.893   27.418 14.964  1.00 34.09  ? 123 LEU A C      1 
ATOM   1103 O  O      . LEU C 3 123 ? 9.510   26.255 14.834  1.00 36.87  ? 123 LEU A O      1 
ATOM   1104 C  CB     . LEU C 3 123 ? 10.490  27.736 12.544  1.00 35.80  ? 123 LEU A CB     1 
ATOM   1105 C  CG     . LEU C 3 123 ? 9.299   28.589 12.116  1.00 36.43  ? 123 LEU A CG     1 
ATOM   1106 C  CD1    . LEU C 3 123 ? 9.651   30.075 12.331  1.00 31.41  ? 123 LEU A CD1    1 
ATOM   1107 C  CD2    . LEU C 3 123 ? 8.928   28.330 10.687  1.00 31.08  ? 123 LEU A CD2    1 
ATOM   1108 N  N      . GLY C 3 124 ? 9.474   28.194 15.944  1.00 35.33  ? 124 GLY A N      1 
ATOM   1109 C  CA     . GLY C 3 124 ? 8.687   27.595 17.008  1.00 34.75  ? 124 GLY A CA     1 
ATOM   1110 C  C      . GLY C 3 124 ? 9.516   26.569 17.783  1.00 40.70  ? 124 GLY A C      1 
ATOM   1111 O  O      . GLY C 3 124 ? 10.755  26.502 17.694  1.00 36.04  ? 124 GLY A O      1 
ATOM   1112 N  N      . PHE C 3 125 ? 8.802   25.749 18.558  1.00 39.85  ? 125 PHE A N      1 
ATOM   1113 C  CA     . PHE C 3 125 ? 9.466   24.785 19.428  1.00 40.98  ? 125 PHE A CA     1 
ATOM   1114 C  C      . PHE C 3 125 ? 9.755   23.444 18.771  1.00 41.73  ? 125 PHE A C      1 
ATOM   1115 O  O      . PHE C 3 125 ? 10.556  22.687 19.319  1.00 45.39  ? 125 PHE A O      1 
ATOM   1116 C  CB     . PHE C 3 125 ? 8.646   24.493 20.695  1.00 43.69  ? 125 PHE A CB     1 
ATOM   1117 C  CG     . PHE C 3 125 ? 8.727   25.570 21.760  1.00 47.42  ? 125 PHE A CG     1 
ATOM   1118 C  CD1    . PHE C 3 125 ? 9.088   26.873 21.432  1.00 48.16  ? 125 PHE A CD1    1 
ATOM   1119 C  CD2    . PHE C 3 125 ? 8.420   25.274 23.089  1.00 41.79  ? 125 PHE A CD2    1 
ATOM   1120 C  CE1    . PHE C 3 125 ? 9.154   27.863 22.401  1.00 44.85  ? 125 PHE A CE1    1 
ATOM   1121 C  CE2    . PHE C 3 125 ? 8.476   26.253 24.064  1.00 50.22  ? 125 PHE A CE2    1 
ATOM   1122 C  CZ     . PHE C 3 125 ? 8.851   27.559 23.720  1.00 47.94  ? 125 PHE A CZ     1 
ATOM   1123 N  N      . ASP C 3 126 ? 9.127   23.092 17.640  1.00 40.61  ? 126 ASP A N      1 
ATOM   1124 C  CA     . ASP C 3 126 ? 9.390   21.756 17.110  1.00 37.51  ? 126 ASP A CA     1 
ATOM   1125 C  C      . ASP C 3 126 ? 9.733   21.744 15.628  1.00 34.74  ? 126 ASP A C      1 
ATOM   1126 O  O      . ASP C 3 126 ? 9.554   20.704 14.985  1.00 39.93  ? 126 ASP A O      1 
ATOM   1127 C  CB     . ASP C 3 126 ? 8.223   20.800 17.369  1.00 35.00  ? 126 ASP A CB     1 
ATOM   1128 C  CG     . ASP C 3 126 ? 7.089   20.989 16.393  1.00 41.41  ? 126 ASP A CG     1 
ATOM   1129 O  OD1    . ASP C 3 126 ? 6.838   22.152 15.977  1.00 45.24  ? 126 ASP A OD1    1 
ATOM   1130 O  OD2    . ASP C 3 126 ? 6.449   19.969 16.037  1.00 46.56  ? 126 ASP A OD2    1 
ATOM   1131 N  N      . GLU C 3 127 ? 10.244  22.846 15.068  1.00 33.16  ? 127 GLU A N      1 
ATOM   1132 C  CA     . GLU C 3 127 ? 10.704  22.840 13.679  1.00 36.13  ? 127 GLU A CA     1 
ATOM   1133 C  C      . GLU C 3 127 ? 12.117  23.409 13.583  1.00 33.88  ? 127 GLU A C      1 
ATOM   1134 O  O      . GLU C 3 127 ? 12.477  24.353 14.296  1.00 36.63  ? 127 GLU A O      1 
ATOM   1135 C  CB     . GLU C 3 127 ? 9.761   23.618 12.744  1.00 30.57  ? 127 GLU A CB     1 
ATOM   1136 C  CG     . GLU C 3 127 ? 8.347   23.064 12.658  1.00 34.42  ? 127 GLU A CG     1 
ATOM   1137 C  CD     . GLU C 3 127 ? 7.430   23.958 11.815  1.00 39.06  ? 127 GLU A CD     1 
ATOM   1138 O  OE1    . GLU C 3 127 ? 7.936   24.641 10.897  1.00 44.16  ? 127 GLU A OE1    1 
ATOM   1139 O  OE2    . GLU C 3 127 ? 6.205   23.990 12.071  1.00 37.68  ? 127 GLU A OE2    1 
ATOM   1140 N  N      . ASN C 3 128 ? 12.921  22.812 12.710  1.00 32.96  ? 128 ASN A N      1 
ATOM   1141 C  CA     . ASN C 3 128 ? 14.282  23.266 12.458  1.00 33.33  ? 128 ASN A CA     1 
ATOM   1142 C  C      . ASN C 3 128 ? 14.580  23.204 10.964  1.00 34.38  ? 128 ASN A C      1 
ATOM   1143 O  O      . ASN C 3 128 ? 14.245  22.221 10.287  1.00 35.45  ? 128 ASN A O      1 
ATOM   1144 C  CB     . ASN C 3 128 ? 15.298  22.405 13.219  1.00 27.81  ? 128 ASN A CB     1 
ATOM   1145 C  CG     . ASN C 3 128 ? 15.213  22.603 14.710  1.00 35.69  ? 128 ASN A CG     1 
ATOM   1146 O  OD1    . ASN C 3 128 ? 14.343  22.052 15.375  1.00 38.05  ? 128 ASN A OD1    1 
ATOM   1147 N  ND2    . ASN C 3 128 ? 16.129  23.390 15.249  1.00 39.89  ? 128 ASN A ND2    1 
ATOM   1148 N  N      . PHE C 3 129 ? 15.207  24.249 10.451  1.00 31.10  ? 129 PHE A N      1 
ATOM   1149 C  CA     . PHE C 3 129 ? 15.828  24.188 9.135   1.00 34.31  ? 129 PHE A CA     1 
ATOM   1150 C  C      . PHE C 3 129 ? 17.314  23.944 9.293   1.00 40.45  ? 129 PHE A C      1 
ATOM   1151 O  O      . PHE C 3 129 ? 17.960  24.530 10.167  1.00 38.39  ? 129 PHE A O      1 
ATOM   1152 C  CB     . PHE C 3 129 ? 15.618  25.474 8.344   1.00 31.20  ? 129 PHE A CB     1 
ATOM   1153 C  CG     . PHE C 3 129 ? 14.185  25.784 8.088   1.00 38.10  ? 129 PHE A CG     1 
ATOM   1154 C  CD1    . PHE C 3 129 ? 13.510  25.198 7.033   1.00 35.39  ? 129 PHE A CD1    1 
ATOM   1155 C  CD2    . PHE C 3 129 ? 13.499  26.639 8.915   1.00 36.21  ? 129 PHE A CD2    1 
ATOM   1156 C  CE1    . PHE C 3 129 ? 12.193  25.495 6.793   1.00 38.38  ? 129 PHE A CE1    1 
ATOM   1157 C  CE2    . PHE C 3 129 ? 12.176  26.918 8.687   1.00 35.17  ? 129 PHE A CE2    1 
ATOM   1158 C  CZ     . PHE C 3 129 ? 11.524  26.350 7.622   1.00 36.28  ? 129 PHE A CZ     1 
ATOM   1159 N  N      . VAL C 3 130 ? 17.857  23.083 8.444   1.00 39.36  ? 130 VAL A N      1 
ATOM   1160 C  CA     . VAL C 3 130 ? 19.287  22.826 8.423   1.00 36.06  ? 130 VAL A CA     1 
ATOM   1161 C  C      . VAL C 3 130 ? 19.720  22.883 6.971   1.00 40.08  ? 130 VAL A C      1 
ATOM   1162 O  O      . VAL C 3 130 ? 19.114  22.220 6.120   1.00 39.40  ? 130 VAL A O      1 
ATOM   1163 C  CB     . VAL C 3 130 ? 19.652  21.464 9.044   1.00 38.66  ? 130 VAL A CB     1 
ATOM   1164 C  CG1    . VAL C 3 130 ? 21.167  21.356 9.192   1.00 44.54  ? 130 VAL A CG1    1 
ATOM   1165 C  CG2    . VAL C 3 130 ? 18.990  21.283 10.381  1.00 38.01  ? 130 VAL A CG2    1 
ATOM   1166 N  N      . ASP C 3 131 ? 20.746  23.683 6.685   1.00 39.71  ? 131 ASP A N      1 
ATOM   1167 C  CA     . ASP C 3 131 ? 21.291  23.792 5.337   1.00 33.84  ? 131 ASP A CA     1 
ATOM   1168 C  C      . ASP C 3 131 ? 22.295  22.667 5.209   1.00 43.21  ? 131 ASP A C      1 
ATOM   1169 O  O      . ASP C 3 131 ? 23.383  22.717 5.793   1.00 46.84  ? 131 ASP A O      1 
ATOM   1170 C  CB     . ASP C 3 131 ? 21.915  25.164 5.098   1.00 39.53  ? 131 ASP A CB     1 
ATOM   1171 C  CG     . ASP C 3 131 ? 22.349  25.372 3.643   1.00 49.60  ? 131 ASP A CG     1 
ATOM   1172 O  OD1    . ASP C 3 131 ? 22.879  24.412 3.026   1.00 46.56  ? 131 ASP A OD1    1 
ATOM   1173 O  OD2    . ASP C 3 131 ? 22.154  26.492 3.109   1.00 50.86  ? 131 ASP A OD2    1 
ATOM   1174 N  N      . LEU C 3 132 ? 21.892  21.626 4.486   1.00 42.38  ? 132 LEU A N      1 
ATOM   1175 C  CA     . LEU C 3 132 ? 22.659  20.411 4.264   1.00 34.99  ? 132 LEU A CA     1 
ATOM   1176 C  C      . LEU C 3 132 ? 23.639  20.538 3.107   1.00 42.71  ? 132 LEU A C      1 
ATOM   1177 O  O      . LEU C 3 132 ? 24.310  19.557 2.760   1.00 41.93  ? 132 LEU A O      1 
ATOM   1178 C  CB     . LEU C 3 132 ? 21.702  19.248 3.983   1.00 35.82  ? 132 LEU A CB     1 
ATOM   1179 C  CG     . LEU C 3 132 ? 20.789  18.825 5.133   1.00 46.64  ? 132 LEU A CG     1 
ATOM   1180 C  CD1    . LEU C 3 132 ? 19.987  17.595 4.794   1.00 28.97  ? 132 LEU A CD1    1 
ATOM   1181 C  CD2    . LEU C 3 132 ? 21.619  18.596 6.396   1.00 35.37  ? 132 LEU A CD2    1 
ATOM   1182 N  N      . THR C 3 133 ? 23.719  21.709 2.480   1.00 42.38  ? 133 THR A N      1 
ATOM   1183 C  CA     . THR C 3 133 ? 24.418  21.803 1.204   1.00 46.06  ? 133 THR A CA     1 
ATOM   1184 C  C      . THR C 3 133 ? 25.871  21.348 1.332   1.00 46.53  ? 133 THR A C      1 
ATOM   1185 O  O      . THR C 3 133 ? 26.293  20.375 0.689   1.00 47.20  ? 133 THR A O      1 
ATOM   1186 C  CB     . THR C 3 133 ? 24.334  23.229 0.668   1.00 49.61  ? 133 THR A CB     1 
ATOM   1187 O  OG1    . THR C 3 133 ? 22.970  23.678 0.730   1.00 45.11  ? 133 THR A OG1    1 
ATOM   1188 C  CG2    . THR C 3 133 ? 24.802  23.257 -0.757  1.00 39.76  ? 133 THR A CG2    1 
ATOM   1189 N  N      . GLU C 3 134 ? 26.656  22.033 2.168   1.00 48.08  ? 134 GLU A N      1 
ATOM   1190 C  CA     . GLU C 3 134 ? 28.060  21.652 2.328   1.00 49.84  ? 134 GLU A CA     1 
ATOM   1191 C  C      . GLU C 3 134 ? 28.195  20.176 2.678   1.00 47.94  ? 134 GLU A C      1 
ATOM   1192 O  O      . GLU C 3 134 ? 29.037  19.465 2.108   1.00 51.01  ? 134 GLU A O      1 
ATOM   1193 C  CB     . GLU C 3 134 ? 28.744  22.509 3.398   1.00 48.65  ? 134 GLU A CB     1 
ATOM   1194 N  N      . MET C 3 135 ? 27.356  19.688 3.594   1.00 43.78  ? 135 MET A N      1 
ATOM   1195 C  CA     . MET C 3 135 ? 27.413  18.272 3.953   1.00 39.30  ? 135 MET A CA     1 
ATOM   1196 C  C      . MET C 3 135 ? 27.201  17.380 2.732   1.00 44.22  ? 135 MET A C      1 
ATOM   1197 O  O      . MET C 3 135 ? 27.946  16.415 2.512   1.00 44.44  ? 135 MET A O      1 
ATOM   1198 C  CB     . MET C 3 135 ? 26.374  17.978 5.029   1.00 35.55  ? 135 MET A CB     1 
ATOM   1199 C  CG     . MET C 3 135 ? 26.630  16.717 5.790   1.00 43.65  ? 135 MET A CG     1 
ATOM   1200 S  SD     . MET C 3 135 ? 25.581  16.537 7.263   1.00 58.56  ? 135 MET A SD     1 
ATOM   1201 C  CE     . MET C 3 135 ? 25.737  14.757 7.493   1.00 38.44  ? 135 MET A CE     1 
ATOM   1202 N  N      . VAL C 3 136 ? 26.202  17.706 1.907   1.00 47.81  ? 136 VAL A N      1 
ATOM   1203 C  CA     . VAL C 3 136 ? 25.898  16.890 0.732   1.00 47.59  ? 136 VAL A CA     1 
ATOM   1204 C  C      . VAL C 3 136 ? 27.089  16.849 -0.216  1.00 47.72  ? 136 VAL A C      1 
ATOM   1205 O  O      . VAL C 3 136 ? 27.477  15.783 -0.707  1.00 50.44  ? 136 VAL A O      1 
ATOM   1206 C  CB     . VAL C 3 136 ? 24.630  17.413 0.037   1.00 46.54  ? 136 VAL A CB     1 
ATOM   1207 C  CG1    . VAL C 3 136 ? 24.524  16.889 -1.374  1.00 40.21  ? 136 VAL A CG1    1 
ATOM   1208 C  CG2    . VAL C 3 136 ? 23.399  17.007 0.854   1.00 46.54  ? 136 VAL A CG2    1 
ATOM   1209 N  N      . GLU C 3 137 ? 27.703  18.001 -0.483  1.00 47.42  ? 137 GLU A N      1 
ATOM   1210 C  CA     . GLU C 3 137 ? 28.830  17.971 -1.408  1.00 54.62  ? 137 GLU A CA     1 
ATOM   1211 C  C      . GLU C 3 137 ? 29.976  17.150 -0.833  1.00 53.49  ? 137 GLU A C      1 
ATOM   1212 O  O      . GLU C 3 137 ? 30.586  16.343 -1.543  1.00 62.09  ? 137 GLU A O      1 
ATOM   1213 C  CB     . GLU C 3 137 ? 29.287  19.384 -1.774  1.00 52.04  ? 137 GLU A CB     1 
ATOM   1214 C  CG     . GLU C 3 137 ? 28.861  19.777 -3.200  1.00 61.71  ? 137 GLU A CG     1 
ATOM   1215 N  N      . LYS C 3 138 ? 30.254  17.308 0.461   1.00 51.80  ? 138 LYS A N      1 
ATOM   1216 C  CA     . LYS C 3 138 ? 31.320  16.530 1.088   1.00 52.99  ? 138 LYS A CA     1 
ATOM   1217 C  C      . LYS C 3 138 ? 31.117  15.029 0.886   1.00 60.70  ? 138 LYS A C      1 
ATOM   1218 O  O      . LYS C 3 138 ? 32.070  14.303 0.575   1.00 67.20  ? 138 LYS A O      1 
ATOM   1219 C  CB     . LYS C 3 138 ? 31.401  16.873 2.575   1.00 51.29  ? 138 LYS A CB     1 
ATOM   1220 C  CG     . LYS C 3 138 ? 32.545  16.228 3.316   1.00 59.84  ? 138 LYS A CG     1 
ATOM   1221 N  N      . ARG C 3 139 ? 29.885  14.539 1.049   1.00 56.69  ? 139 ARG A N      1 
ATOM   1222 C  CA     . ARG C 3 139 ? 29.669  13.105 0.883   1.00 56.37  ? 139 ARG A CA     1 
ATOM   1223 C  C      . ARG C 3 139 ? 29.844  12.671 -0.565  1.00 58.71  ? 139 ARG A C      1 
ATOM   1224 O  O      . ARG C 3 139 ? 30.256  11.537 -0.830  1.00 64.48  ? 139 ARG A O      1 
ATOM   1225 C  CB     . ARG C 3 139 ? 28.282  12.704 1.368   1.00 50.04  ? 139 ARG A CB     1 
ATOM   1226 C  CG     . ARG C 3 139 ? 28.015  13.030 2.782   1.00 44.51  ? 139 ARG A CG     1 
ATOM   1227 C  CD     . ARG C 3 139 ? 26.848  12.190 3.265   1.00 50.57  ? 139 ARG A CD     1 
ATOM   1228 N  NE     . ARG C 3 139 ? 26.754  12.213 4.723   1.00 52.69  ? 139 ARG A NE     1 
ATOM   1229 C  CZ     . ARG C 3 139 ? 25.864  11.518 5.423   1.00 51.20  ? 139 ARG A CZ     1 
ATOM   1230 N  NH1    . ARG C 3 139 ? 24.984  10.737 4.799   1.00 53.22  ? 139 ARG A NH1    1 
ATOM   1231 N  NH2    . ARG C 3 139 ? 25.853  11.607 6.746   1.00 56.60  ? 139 ARG A NH2    1 
ATOM   1232 N  N      . LEU C 3 140 ? 29.492  13.532 -1.521  1.00 59.90  ? 140 LEU A N      1 
ATOM   1233 C  CA     . LEU C 3 140 ? 29.687  13.148 -2.915  1.00 56.81  ? 140 LEU A CA     1 
ATOM   1234 C  C      . LEU C 3 140 ? 31.169  13.122 -3.266  1.00 58.54  ? 140 LEU A C      1 
ATOM   1235 O  O      . LEU C 3 140 ? 31.627  12.216 -3.962  1.00 63.16  ? 140 LEU A O      1 
ATOM   1236 C  CB     . LEU C 3 140 ? 28.915  14.082 -3.837  1.00 48.95  ? 140 LEU A CB     1 
ATOM   1237 C  CG     . LEU C 3 140 ? 27.402  13.989 -3.647  1.00 50.32  ? 140 LEU A CG     1 
ATOM   1238 C  CD1    . LEU C 3 140 ? 26.717  15.139 -4.344  1.00 51.14  ? 140 LEU A CD1    1 
ATOM   1239 C  CD2    . LEU C 3 140 ? 26.864  12.659 -4.135  1.00 41.07  ? 140 LEU A CD2    1 
ATOM   1240 N  N      . GLN C 3 141 ? 31.947  14.072 -2.751  1.00 58.38  ? 141 GLN A N      1 
ATOM   1241 C  CA     . GLN C 3 141 ? 33.389  14.031 -2.963  1.00 63.06  ? 141 GLN A CA     1 
ATOM   1242 C  C      . GLN C 3 141 ? 34.014  12.735 -2.461  1.00 76.00  ? 141 GLN A C      1 
ATOM   1243 O  O      . GLN C 3 141 ? 35.151  12.429 -2.833  1.00 83.64  ? 141 GLN A O      1 
ATOM   1244 C  CB     . GLN C 3 141 ? 34.069  15.220 -2.274  1.00 72.58  ? 141 GLN A CB     1 
ATOM   1245 C  CG     . GLN C 3 141 ? 33.910  16.554 -2.996  1.00 61.93  ? 141 GLN A CG     1 
ATOM   1246 N  N      . GLN C 3 142 ? 33.311  11.969 -1.628  1.00 69.01  ? 142 GLN A N      1 
ATOM   1247 C  CA     . GLN C 3 142 ? 33.862  10.764 -1.026  1.00 69.70  ? 142 GLN A CA     1 
ATOM   1248 C  C      . GLN C 3 142 ? 33.364  9.484  -1.692  1.00 77.64  ? 142 GLN A C      1 
ATOM   1249 O  O      . GLN C 3 142 ? 33.735  8.388  -1.256  1.00 89.71  ? 142 GLN A O      1 
ATOM   1250 C  CB     . GLN C 3 142 ? 33.543  10.738 0.476   1.00 63.36  ? 142 GLN A CB     1 
ATOM   1251 N  N      . LEU C 3 143 ? 32.554  9.594  -2.743  1.00 80.29  ? 143 LEU A N      1 
ATOM   1252 C  CA     . LEU C 3 143 ? 31.938  8.440  -3.392  1.00 80.81  ? 143 LEU A CA     1 
ATOM   1253 C  C      . LEU C 3 143 ? 32.694  8.088  -4.666  1.00 89.94  ? 143 LEU A C      1 
ATOM   1254 O  O      . LEU C 3 143 ? 33.046  8.980  -5.447  1.00 86.75  ? 143 LEU A O      1 
ATOM   1255 C  CB     . LEU C 3 143 ? 30.472  8.720  -3.726  1.00 71.30  ? 143 LEU A CB     1 
ATOM   1256 C  CG     . LEU C 3 143 ? 29.435  7.787  -3.113  1.00 76.24  ? 143 LEU A CG     1 
ATOM   1257 C  CD1    . LEU C 3 143 ? 29.560  7.812  -1.598  1.00 83.36  ? 143 LEU A CD1    1 
ATOM   1258 C  CD2    . LEU C 3 143 ? 28.037  8.190  -3.537  1.00 67.08  ? 143 LEU A CD2    1 
ATOM   1259 N  N      . GLN C 3 144 ? 32.927  6.789  -4.876  1.00 102.42 ? 144 GLN A N      1 
ATOM   1260 C  CA     . GLN C 3 144 ? 33.515  6.295  -6.115  1.00 100.26 ? 144 GLN A CA     1 
ATOM   1261 C  C      . GLN C 3 144 ? 32.458  6.245  -7.223  1.00 100.12 ? 144 GLN A C      1 
ATOM   1262 O  O      . GLN C 3 144 ? 31.253  6.190  -6.963  1.00 100.92 ? 144 GLN A O      1 
ATOM   1263 C  CB     . GLN C 3 144 ? 34.134  4.911  -5.900  1.00 90.08  ? 144 GLN A CB     1 
ATOM   1264 N  N      . SER C 3 145 ? 32.924  6.264  -8.475  1.00 100.51 ? 145 SER A N      1 
ATOM   1265 C  CA     . SER C 3 145 ? 32.002  6.356  -9.607  1.00 93.18  ? 145 SER A CA     1 
ATOM   1266 C  C      . SER C 3 145 ? 30.960  5.246  -9.565  1.00 95.69  ? 145 SER A C      1 
ATOM   1267 O  O      . SER C 3 145 ? 29.755  5.509  -9.652  1.00 98.49  ? 145 SER A O      1 
ATOM   1268 C  CB     . SER C 3 145 ? 32.776  6.319  -10.923 1.00 90.12  ? 145 SER A CB     1 
ATOM   1269 N  N      . ASP C 3 146 ? 31.405  3.991  -9.449  1.00 101.33 ? 146 ASP A N      1 
ATOM   1270 C  CA     . ASP C 3 146 ? 30.458  2.887  -9.313  1.00 98.38  ? 146 ASP A CA     1 
ATOM   1271 C  C      . ASP C 3 146 ? 29.514  3.118  -8.140  1.00 103.30 ? 146 ASP A C      1 
ATOM   1272 O  O      . ASP C 3 146 ? 28.308  2.865  -8.244  1.00 103.51 ? 146 ASP A O      1 
ATOM   1273 C  CB     . ASP C 3 146 ? 31.204  1.564  -9.144  1.00 94.49  ? 146 ASP A CB     1 
ATOM   1274 N  N      . GLU C 3 147 ? 30.043  3.606  -7.015  1.00 105.98 ? 147 GLU A N      1 
ATOM   1275 C  CA     . GLU C 3 147 ? 29.201  3.896  -5.859  1.00 97.83  ? 147 GLU A CA     1 
ATOM   1276 C  C      . GLU C 3 147 ? 28.140  4.950  -6.165  1.00 94.99  ? 147 GLU A C      1 
ATOM   1277 O  O      . GLU C 3 147 ? 27.104  4.986  -5.486  1.00 93.71  ? 147 GLU A O      1 
ATOM   1278 C  CB     . GLU C 3 147 ? 30.070  4.350  -4.681  1.00 91.58  ? 147 GLU A CB     1 
ATOM   1279 N  N      . LEU C 3 148 ? 28.361  5.790  -7.183  1.00 91.34  ? 148 LEU A N      1 
ATOM   1280 C  CA     . LEU C 3 148 ? 27.475  6.926  -7.427  1.00 87.54  ? 148 LEU A CA     1 
ATOM   1281 C  C      . LEU C 3 148 ? 26.182  6.535  -8.131  1.00 90.01  ? 148 LEU A C      1 
ATOM   1282 O  O      . LEU C 3 148 ? 25.239  7.332  -8.154  1.00 81.85  ? 148 LEU A O      1 
ATOM   1283 C  CB     . LEU C 3 148 ? 28.196  7.996  -8.246  1.00 89.22  ? 148 LEU A CB     1 
ATOM   1284 C  CG     . LEU C 3 148 ? 27.423  9.287  -8.504  1.00 81.64  ? 148 LEU A CG     1 
ATOM   1285 C  CD1    . LEU C 3 148 ? 28.380  10.452 -8.626  1.00 74.55  ? 148 LEU A CD1    1 
ATOM   1286 C  CD2    . LEU C 3 148 ? 26.560  9.168  -9.764  1.00 92.90  ? 148 LEU A CD2    1 
ATOM   1287 N  N      . SER C 3 149 ? 26.116  5.344  -8.715  1.00 93.77  ? 149 SER A N      1 
ATOM   1288 C  CA     . SER C 3 149 ? 24.895  4.871  -9.353  1.00 86.25  ? 149 SER A CA     1 
ATOM   1289 C  C      . SER C 3 149 ? 24.025  4.049  -8.414  1.00 80.92  ? 149 SER A C      1 
ATOM   1290 O  O      . SER C 3 149 ? 22.878  3.735  -8.765  1.00 76.45  ? 149 SER A O      1 
ATOM   1291 C  CB     . SER C 3 149 ? 25.248  4.049  -10.600 1.00 94.41  ? 149 SER A CB     1 
ATOM   1292 O  OG     . SER C 3 149 ? 26.295  4.677  -11.335 1.00 98.06  ? 149 SER A OG     1 
ATOM   1293 N  N      . ALA C 3 150 ? 24.542  3.693  -7.239  1.00 73.12  ? 150 ALA A N      1 
ATOM   1294 C  CA     . ALA C 3 150 ? 23.755  3.004  -6.229  1.00 78.65  ? 150 ALA A CA     1 
ATOM   1295 C  C      . ALA C 3 150 ? 23.057  3.963  -5.272  1.00 70.77  ? 150 ALA A C      1 
ATOM   1296 O  O      . ALA C 3 150 ? 22.357  3.504  -4.365  1.00 58.55  ? 150 ALA A O      1 
ATOM   1297 C  CB     . ALA C 3 150 ? 24.642  2.040  -5.439  1.00 80.53  ? 150 ALA A CB     1 
ATOM   1298 N  N      . VAL C 3 151 ? 23.246  5.276  -5.447  1.00 71.71  ? 151 VAL A N      1 
ATOM   1299 C  CA     . VAL C 3 151 ? 22.565  6.257  -4.609  1.00 66.28  ? 151 VAL A CA     1 
ATOM   1300 C  C      . VAL C 3 151 ? 21.063  6.034  -4.680  1.00 57.84  ? 151 VAL A C      1 
ATOM   1301 O  O      . VAL C 3 151 ? 20.468  6.006  -5.764  1.00 59.77  ? 151 VAL A O      1 
ATOM   1302 C  CB     . VAL C 3 151 ? 22.930  7.687  -5.034  1.00 58.07  ? 151 VAL A CB     1 
ATOM   1303 C  CG1    . VAL C 3 151 ? 22.166  8.692  -4.187  1.00 52.78  ? 151 VAL A CG1    1 
ATOM   1304 C  CG2    . VAL C 3 151 ? 24.424  7.915  -4.923  1.00 55.82  ? 151 VAL A CG2    1 
ATOM   1305 N  N      . THR C 3 152 ? 20.444  5.882  -3.517  1.00 51.34  ? 152 THR A N      1 
ATOM   1306 C  CA     . THR C 3 152 ? 19.030  5.586  -3.415  1.00 55.75  ? 152 THR A CA     1 
ATOM   1307 C  C      . THR C 3 152 ? 18.366  6.651  -2.562  1.00 49.71  ? 152 THR A C      1 
ATOM   1308 O  O      . THR C 3 152 ? 18.990  7.219  -1.661  1.00 57.60  ? 152 THR A O      1 
ATOM   1309 C  CB     . THR C 3 152 ? 18.805  4.209  -2.790  1.00 62.54  ? 152 THR A CB     1 
ATOM   1310 O  OG1    . THR C 3 152 ? 17.433  3.831  -2.950  1.00 73.59  ? 152 THR A OG1    1 
ATOM   1311 C  CG2    . THR C 3 152 ? 19.145  4.244  -1.296  1.00 46.65  ? 152 THR A CG2    1 
ATOM   1312 N  N      . VAL C 3 153 ? 17.087  6.910  -2.837  1.00 44.38  ? 153 VAL A N      1 
ATOM   1313 C  CA     . VAL C 3 153 ? 16.340  7.819  -1.967  1.00 54.75  ? 153 VAL A CA     1 
ATOM   1314 C  C      . VAL C 3 153 ? 16.067  7.152  -0.619  1.00 47.25  ? 153 VAL A C      1 
ATOM   1315 O  O      . VAL C 3 153 ? 16.040  5.927  -0.487  1.00 46.97  ? 153 VAL A O      1 
ATOM   1316 C  CB     . VAL C 3 153 ? 15.021  8.271  -2.610  1.00 50.02  ? 153 VAL A CB     1 
ATOM   1317 C  CG1    . VAL C 3 153 ? 14.009  7.140  -2.506  1.00 49.43  ? 153 VAL A CG1    1 
ATOM   1318 C  CG2    . VAL C 3 153 ? 14.491  9.501  -1.888  1.00 35.45  ? 153 VAL A CG2    1 
ATOM   1319 N  N      . SER C 3 154 ? 15.824  7.983  0.390   1.00 43.99  ? 154 SER A N      1 
ATOM   1320 C  CA     . SER C 3 154 ? 15.355  7.531  1.693   1.00 41.04  ? 154 SER A CA     1 
ATOM   1321 C  C      . SER C 3 154 ? 13.985  8.155  1.945   1.00 39.20  ? 154 SER A C      1 
ATOM   1322 O  O      . SER C 3 154 ? 13.863  9.383  2.031   1.00 38.84  ? 154 SER A O      1 
ATOM   1323 C  CB     . SER C 3 154 ? 16.357  7.899  2.784   1.00 38.09  ? 154 SER A CB     1 
ATOM   1324 O  OG     . SER C 3 154 ? 16.274  6.979  3.863   1.00 56.86  ? 154 SER A OG     1 
ATOM   1325 N  N      . GLY C 3 155 ? 12.959  7.312  2.063   1.00 29.44  ? 155 GLY A N      1 
ATOM   1326 C  CA     . GLY C 3 155 ? 11.600  7.803  2.218   1.00 34.57  ? 155 GLY A CA     1 
ATOM   1327 C  C      . GLY C 3 155 ? 10.844  8.118  0.931   1.00 35.95  ? 155 GLY A C      1 
ATOM   1328 O  O      . GLY C 3 155 ? 11.131  7.562  -0.129  1.00 42.99  ? 155 GLY A O      1 
ATOM   1329 N  N      . HIS C 3 156 ? 9.885   9.029  1.002   1.00 37.44  ? 156 HIS A N      1 
ATOM   1330 C  CA     . HIS C 3 156 ? 9.023   9.345  -0.126  1.00 33.61  ? 156 HIS A CA     1 
ATOM   1331 C  C      . HIS C 3 156 ? 9.652   10.355 -1.078  1.00 36.28  ? 156 HIS A C      1 
ATOM   1332 O  O      . HIS C 3 156 ? 10.366  11.279 -0.675  1.00 43.55  ? 156 HIS A O      1 
ATOM   1333 C  CB     . HIS C 3 156 ? 7.698   9.929  0.342   1.00 41.66  ? 156 HIS A CB     1 
ATOM   1334 C  CG     . HIS C 3 156 ? 6.883   9.009  1.174   1.00 39.65  ? 156 HIS A CG     1 
ATOM   1335 N  ND1    . HIS C 3 156 ? 6.990   8.960  2.545   1.00 50.85  ? 156 HIS A ND1    1 
ATOM   1336 C  CD2    . HIS C 3 156 ? 5.916   8.131  0.835   1.00 44.15  ? 156 HIS A CD2    1 
ATOM   1337 C  CE1    . HIS C 3 156 ? 6.131   8.072  3.013   1.00 46.98  ? 156 HIS A CE1    1 
ATOM   1338 N  NE2    . HIS C 3 156 ? 5.462   7.560  1.996   1.00 38.81  ? 156 HIS A NE2    1 
ATOM   1339 N  N      . VAL C 3 157 ? 9.338   10.187 -2.357  1.00 40.78  ? 157 VAL A N      1 
ATOM   1340 C  CA     . VAL C 3 157 ? 9.619   11.184 -3.379  1.00 42.77  ? 157 VAL A CA     1 
ATOM   1341 C  C      . VAL C 3 157 ? 8.316   11.892 -3.690  1.00 36.91  ? 157 VAL A C      1 
ATOM   1342 O  O      . VAL C 3 157 ? 7.324   11.233 -4.017  1.00 48.45  ? 157 VAL A O      1 
ATOM   1343 C  CB     . VAL C 3 157 ? 10.197  10.535 -4.641  1.00 37.05  ? 157 VAL A CB     1 
ATOM   1344 C  CG1    . VAL C 3 157 ? 10.241  11.547 -5.746  1.00 36.74  ? 157 VAL A CG1    1 
ATOM   1345 C  CG2    . VAL C 3 157 ? 11.592  9.974  -4.349  1.00 28.49  ? 157 VAL A CG2    1 
ATOM   1346 N  N      . TYR C 3 158 ? 8.283   13.219 -3.535  1.00 38.79  ? 158 TYR A N      1 
ATOM   1347 C  CA     . TYR C 3 158 ? 7.015   13.929 -3.717  1.00 38.66  ? 158 TYR A CA     1 
ATOM   1348 C  C      . TYR C 3 158 ? 6.461   13.679 -5.112  1.00 41.78  ? 158 TYR A C      1 
ATOM   1349 O  O      . TYR C 3 158 ? 7.207   13.688 -6.103  1.00 32.81  ? 158 TYR A O      1 
ATOM   1350 C  CB     . TYR C 3 158 ? 7.160   15.436 -3.495  1.00 33.06  ? 158 TYR A CB     1 
ATOM   1351 C  CG     . TYR C 3 158 ? 5.854   16.178 -3.737  1.00 36.54  ? 158 TYR A CG     1 
ATOM   1352 C  CD1    . TYR C 3 158 ? 4.833   16.166 -2.782  1.00 34.47  ? 158 TYR A CD1    1 
ATOM   1353 C  CD2    . TYR C 3 158 ? 5.624   16.859 -4.938  1.00 36.10  ? 158 TYR A CD2    1 
ATOM   1354 C  CE1    . TYR C 3 158 ? 3.635   16.830 -2.997  1.00 33.47  ? 158 TYR A CE1    1 
ATOM   1355 C  CE2    . TYR C 3 158 ? 4.432   17.519 -5.174  1.00 35.33  ? 158 TYR A CE2    1 
ATOM   1356 C  CZ     . TYR C 3 158 ? 3.442   17.510 -4.205  1.00 41.27  ? 158 TYR A CZ     1 
ATOM   1357 O  OH     . TYR C 3 158 ? 2.255   18.179 -4.433  1.00 33.80  ? 158 TYR A OH     1 
ATOM   1358 N  N      . ASN C 3 159 ? 5.135   13.461 -5.176  1.00 37.75  ? 159 ASN A N      1 
ATOM   1359 C  CA     . ASN C 3 159 ? 4.420   13.227 -6.431  1.00 42.58  ? 159 ASN A CA     1 
ATOM   1360 C  C      . ASN C 3 159 ? 4.924   11.977 -7.144  1.00 45.40  ? 159 ASN A C      1 
ATOM   1361 O  O      . ASN C 3 159 ? 4.705   11.812 -8.347  1.00 45.69  ? 159 ASN A O      1 
ATOM   1362 C  CB     . ASN C 3 159 ? 4.526   14.429 -7.380  1.00 46.28  ? 159 ASN A CB     1 
ATOM   1363 C  CG     . ASN C 3 159 ? 3.397   14.466 -8.407  1.00 41.33  ? 159 ASN A CG     1 
ATOM   1364 O  OD1    . ASN C 3 159 ? 2.318   13.920 -8.181  1.00 44.88  ? 159 ASN A OD1    1 
ATOM   1365 N  ND2    . ASN C 3 159 ? 3.646   15.102 -9.532  1.00 38.53  ? 159 ASN A ND2    1 
ATOM   1366 N  N      . ASN C 3 160 ? 5.631   11.093 -6.439  1.00 40.67  ? 160 ASN A N      1 
ATOM   1367 C  CA     . ASN C 3 160 ? 6.058   9.836  -7.027  1.00 44.09  ? 160 ASN A CA     1 
ATOM   1368 C  C      . ASN C 3 160 ? 6.907   10.074 -8.271  1.00 46.91  ? 160 ASN A C      1 
ATOM   1369 O  O      . ASN C 3 160 ? 6.898   9.289  -9.213  1.00 44.74  ? 160 ASN A O      1 
ATOM   1370 C  CB     . ASN C 3 160 ? 4.846   8.967  -7.356  1.00 53.33  ? 160 ASN A CB     1 
ATOM   1371 C  CG     . ASN C 3 160 ? 5.204   7.502  -7.464  1.00 72.12  ? 160 ASN A CG     1 
ATOM   1372 O  OD1    . ASN C 3 160 ? 6.045   6.998  -6.708  1.00 79.05  ? 160 ASN A OD1    1 
ATOM   1373 N  ND2    . ASN C 3 160 ? 4.583   6.807  -8.419  1.00 75.49  ? 160 ASN A ND2    1 
ATOM   1374 N  N      . GLN C 3 161 ? 7.643   11.171 -8.284  1.00 43.10  ? 161 GLN A N      1 
ATOM   1375 C  CA     . GLN C 3 161 ? 8.361   11.565 -9.475  1.00 41.54  ? 161 GLN A CA     1 
ATOM   1376 C  C      . GLN C 3 161 ? 9.540   10.644 -9.709  1.00 43.99  ? 161 GLN A C      1 
ATOM   1377 O  O      . GLN C 3 161 ? 10.161  10.142 -8.776  1.00 48.52  ? 161 GLN A O      1 
ATOM   1378 C  CB     . GLN C 3 161 ? 8.848   13.008 -9.359  1.00 38.46  ? 161 GLN A CB     1 
ATOM   1379 C  CG     . GLN C 3 161 ? 9.678   13.432 -10.523 1.00 34.66  ? 161 GLN A CG     1 
ATOM   1380 C  CD     . GLN C 3 161 ? 10.240  14.815 -10.345 1.00 52.36  ? 161 GLN A CD     1 
ATOM   1381 O  OE1    . GLN C 3 161 ? 9.776   15.571 -9.483  1.00 53.90  ? 161 GLN A OE1    1 
ATOM   1382 N  NE2    . GLN C 3 161 ? 11.237  15.177 -11.170 1.00 48.03  ? 161 GLN A NE2    1 
ATOM   1383 N  N      . SER C 3 162 ? 9.853   10.439 -10.975 1.00 42.13  ? 162 SER A N      1 
ATOM   1384 C  CA     . SER C 3 162 ? 10.949  9.566  -11.339 1.00 46.79  ? 162 SER A CA     1 
ATOM   1385 C  C      . SER C 3 162 ? 12.281  10.249 -11.074 1.00 43.14  ? 162 SER A C      1 
ATOM   1386 O  O      . SER C 3 162 ? 12.458  11.442 -11.353 1.00 49.96  ? 162 SER A O      1 
ATOM   1387 C  CB     . SER C 3 162 ? 10.833  9.167  -12.813 1.00 44.66  ? 162 SER A CB     1 
ATOM   1388 O  OG     . SER C 3 162 ? 9.518   8.708  -13.094 1.00 61.92  ? 162 SER A OG     1 
ATOM   1389 N  N      . ILE C 3 163 ? 13.202  9.482  -10.547 1.00 37.74  ? 163 ILE A N      1 
ATOM   1390 C  CA     . ILE C 3 163 ? 14.562  9.914  -10.251 1.00 41.46  ? 163 ILE A CA     1 
ATOM   1391 C  C      . ILE C 3 163 ? 15.425  9.711  -11.482 1.00 44.89  ? 163 ILE A C      1 
ATOM   1392 O  O      . ILE C 3 163 ? 15.400  8.651  -12.118 1.00 44.01  ? 163 ILE A O      1 
ATOM   1393 C  CB     . ILE C 3 163 ? 15.138  9.108  -9.066  1.00 37.76  ? 163 ILE A CB     1 
ATOM   1394 C  CG1    . ILE C 3 163 ? 14.347  9.351  -7.784  1.00 40.87  ? 163 ILE A CG1    1 
ATOM   1395 C  CG2    . ILE C 3 163 ? 16.606  9.404  -8.882  1.00 25.46  ? 163 ILE A CG2    1 
ATOM   1396 C  CD1    . ILE C 3 163 ? 14.808  8.452  -6.649  1.00 51.18  ? 163 ILE A CD1    1 
ATOM   1397 N  N      . ASN C 3 164 ? 16.248  10.681 -11.773 1.00 45.59  ? 164 ASN A N      1 
ATOM   1398 C  CA     . ASN C 3 164 ? 17.201  10.570 -12.861 1.00 40.08  ? 164 ASN A CA     1 
ATOM   1399 C  C      . ASN C 3 164 ? 18.580  10.641 -12.222 1.00 37.53  ? 164 ASN A C      1 
ATOM   1400 O  O      . ASN C 3 164 ? 19.034  11.718 -11.836 1.00 39.61  ? 164 ASN A O      1 
ATOM   1401 C  CB     . ASN C 3 164 ? 16.972  11.684 -13.877 1.00 49.01  ? 164 ASN A CB     1 
ATOM   1402 C  CG     . ASN C 3 164 ? 17.806  11.519 -15.127 1.00 47.69  ? 164 ASN A CG     1 
ATOM   1403 O  OD1    . ASN C 3 164 ? 18.773  10.751 -15.150 1.00 39.96  ? 164 ASN A OD1    1 
ATOM   1404 N  ND2    . ASN C 3 164 ? 17.440  12.251 -16.183 1.00 54.07  ? 164 ASN A ND2    1 
ATOM   1405 N  N      . LEU C 3 165 ? 19.248  9.494  -12.111 1.00 39.64  ? 165 LEU A N      1 
ATOM   1406 C  CA     . LEU C 3 165 ? 20.518  9.456  -11.396 1.00 42.09  ? 165 LEU A CA     1 
ATOM   1407 C  C      . LEU C 3 165 ? 21.609  10.235 -12.108 1.00 45.88  ? 165 LEU A C      1 
ATOM   1408 O  O      . LEU C 3 165 ? 22.673  10.447 -11.525 1.00 55.05  ? 165 LEU A O      1 
ATOM   1409 C  CB     . LEU C 3 165 ? 20.968  8.008  -11.175 1.00 45.31  ? 165 LEU A CB     1 
ATOM   1410 C  CG     . LEU C 3 165 ? 20.024  7.162  -10.307 1.00 45.95  ? 165 LEU A CG     1 
ATOM   1411 C  CD1    . LEU C 3 165 ? 20.100  5.696  -10.695 1.00 50.09  ? 165 LEU A CD1    1 
ATOM   1412 C  CD2    . LEU C 3 165 ? 20.350  7.329  -8.844  1.00 47.68  ? 165 LEU A CD2    1 
ATOM   1413 N  N      . LEU C 3 166 ? 21.385  10.673 -13.339 1.00 42.02  ? 166 LEU A N      1 
ATOM   1414 C  CA     . LEU C 3 166 ? 22.381  11.494 -14.012 1.00 42.69  ? 166 LEU A CA     1 
ATOM   1415 C  C      . LEU C 3 166 ? 22.151  12.959 -13.751 1.00 43.68  ? 166 LEU A C      1 
ATOM   1416 O  O      . LEU C 3 166 ? 22.991  13.786 -14.120 1.00 52.80  ? 166 LEU A O      1 
ATOM   1417 C  CB     . LEU C 3 166 ? 22.376  11.240 -15.528 1.00 47.73  ? 166 LEU A CB     1 
ATOM   1418 C  CG     . LEU C 3 166 ? 22.642  9.760  -15.827 1.00 44.65  ? 166 LEU A CG     1 
ATOM   1419 C  CD1    . LEU C 3 166 ? 22.440  9.460  -17.273 1.00 44.50  ? 166 LEU A CD1    1 
ATOM   1420 C  CD2    . LEU C 3 166 ? 24.056  9.409  -15.371 1.00 42.35  ? 166 LEU A CD2    1 
ATOM   1421 N  N      . ASP C 3 167 ? 21.034  13.292 -13.124 1.00 41.31  ? 167 ASP A N      1 
ATOM   1422 C  CA     . ASP C 3 167 ? 20.761  14.675 -12.772 1.00 49.18  ? 167 ASP A CA     1 
ATOM   1423 C  C      . ASP C 3 167 ? 21.500  15.018 -11.489 1.00 47.43  ? 167 ASP A C      1 
ATOM   1424 O  O      . ASP C 3 167 ? 21.195  14.472 -10.425 1.00 50.59  ? 167 ASP A O      1 
ATOM   1425 C  CB     . ASP C 3 167 ? 19.265  14.897 -12.602 1.00 42.48  ? 167 ASP A CB     1 
ATOM   1426 C  CG     . ASP C 3 167 ? 18.921  16.343 -12.493 1.00 39.93  ? 167 ASP A CG     1 
ATOM   1427 O  OD1    . ASP C 3 167 ? 19.702  17.068 -11.852 1.00 46.63  ? 167 ASP A OD1    1 
ATOM   1428 O  OD2    . ASP C 3 167 ? 17.891  16.761 -13.065 1.00 46.21  ? 167 ASP A OD2    1 
ATOM   1429 N  N      . VAL C 3 168 ? 22.461  15.929 -11.573 1.00 43.14  ? 168 VAL A N      1 
ATOM   1430 C  CA     . VAL C 3 168 ? 23.232  16.243 -10.376 1.00 43.36  ? 168 VAL A CA     1 
ATOM   1431 C  C      . VAL C 3 168 ? 22.318  16.733 -9.247  1.00 47.15  ? 168 VAL A C      1 
ATOM   1432 O  O      . VAL C 3 168 ? 22.553  16.435 -8.068  1.00 42.67  ? 168 VAL A O      1 
ATOM   1433 C  CB     . VAL C 3 168 ? 24.339  17.257 -10.699 1.00 38.28  ? 168 VAL A CB     1 
ATOM   1434 C  CG1    . VAL C 3 168 ? 23.730  18.573 -11.158 1.00 47.94  ? 168 VAL A CG1    1 
ATOM   1435 C  CG2    . VAL C 3 168 ? 25.204  17.462 -9.465  1.00 45.51  ? 168 VAL A CG2    1 
ATOM   1436 N  N      . LEU C 3 169 ? 21.253  17.474 -9.582  1.00 44.56  ? 169 LEU A N      1 
ATOM   1437 C  CA     . LEU C 3 169 ? 20.355  17.987 -8.545  1.00 43.72  ? 169 LEU A CA     1 
ATOM   1438 C  C      . LEU C 3 169 ? 19.605  16.862 -7.847  1.00 45.41  ? 169 LEU A C      1 
ATOM   1439 O  O      . LEU C 3 169 ? 19.344  16.933 -6.638  1.00 48.23  ? 169 LEU A O      1 
ATOM   1440 C  CB     . LEU C 3 169 ? 19.355  18.963 -9.145  1.00 41.38  ? 169 LEU A CB     1 
ATOM   1441 C  CG     . LEU C 3 169 ? 19.978  20.115 -9.906  1.00 55.86  ? 169 LEU A CG     1 
ATOM   1442 C  CD1    . LEU C 3 169 ? 18.890  20.916 -10.607 1.00 54.55  ? 169 LEU A CD1    1 
ATOM   1443 C  CD2    . LEU C 3 169 ? 20.762  20.974 -8.937  1.00 47.50  ? 169 LEU A CD2    1 
ATOM   1444 N  N      . HIS C 3 170 ? 19.214  15.839 -8.600  1.00 43.52  ? 170 HIS A N      1 
ATOM   1445 C  CA     . HIS C 3 170 ? 18.534  14.698 -8.008  1.00 43.60  ? 170 HIS A CA     1 
ATOM   1446 C  C      . HIS C 3 170 ? 19.459  13.961 -7.057  1.00 44.17  ? 170 HIS A C      1 
ATOM   1447 O  O      . HIS C 3 170 ? 19.050  13.557 -5.963  1.00 42.95  ? 170 HIS A O      1 
ATOM   1448 C  CB     . HIS C 3 170 ? 18.046  13.746 -9.109  1.00 41.10  ? 170 HIS A CB     1 
ATOM   1449 C  CG     . HIS C 3 170 ? 16.891  14.264 -9.918  1.00 38.63  ? 170 HIS A CG     1 
ATOM   1450 N  ND1    . HIS C 3 170 ? 15.932  13.429 -10.462 1.00 43.79  ? 170 HIS A ND1    1 
ATOM   1451 C  CD2    . HIS C 3 170 ? 16.547  15.519 -10.291 1.00 36.39  ? 170 HIS A CD2    1 
ATOM   1452 C  CE1    . HIS C 3 170 ? 15.035  14.151 -11.111 1.00 35.55  ? 170 HIS A CE1    1 
ATOM   1453 N  NE2    . HIS C 3 170 ? 15.388  15.422 -11.028 1.00 36.95  ? 170 HIS A NE2    1 
ATOM   1454 N  N      . ILE C 3 171 ? 20.706  13.739 -7.484  1.00 40.76  ? 171 ILE A N      1 
ATOM   1455 C  CA     . ILE C 3 171 ? 21.674  13.040 -6.644  1.00 48.97  ? 171 ILE A CA     1 
ATOM   1456 C  C      . ILE C 3 171 ? 21.882  13.805 -5.343  1.00 48.75  ? 171 ILE A C      1 
ATOM   1457 O  O      . ILE C 3 171 ? 21.930  13.221 -4.252  1.00 42.34  ? 171 ILE A O      1 
ATOM   1458 C  CB     . ILE C 3 171 ? 23.003  12.846 -7.401  1.00 49.82  ? 171 ILE A CB     1 
ATOM   1459 C  CG1    . ILE C 3 171 ? 22.836  11.859 -8.548  1.00 48.16  ? 171 ILE A CG1    1 
ATOM   1460 C  CG2    . ILE C 3 171 ? 24.072  12.318 -6.463  1.00 50.47  ? 171 ILE A CG2    1 
ATOM   1461 C  CD1    . ILE C 3 171 ? 22.619  10.436 -8.071  1.00 50.33  ? 171 ILE A CD1    1 
ATOM   1462 N  N      . ARG C 3 172 ? 22.017  15.131 -5.445  1.00 45.14  ? 172 ARG A N      1 
ATOM   1463 C  CA     . ARG C 3 172 ? 22.266  15.945 -4.263  1.00 44.55  ? 172 ARG A CA     1 
ATOM   1464 C  C      . ARG C 3 172 ? 21.069  15.912 -3.323  1.00 45.07  ? 172 ARG A C      1 
ATOM   1465 O  O      . ARG C 3 172 ? 21.242  15.824 -2.098  1.00 38.83  ? 172 ARG A O      1 
ATOM   1466 C  CB     . ARG C 3 172 ? 22.636  17.375 -4.681  1.00 41.65  ? 172 ARG A CB     1 
ATOM   1467 C  CG     . ARG C 3 172 ? 24.116  17.503 -5.123  1.00 45.26  ? 172 ARG A CG     1 
ATOM   1468 C  CD     . ARG C 3 172 ? 24.413  18.662 -6.075  1.00 50.03  ? 172 ARG A CD     1 
ATOM   1469 N  NE     . ARG C 3 172 ? 24.165  19.983 -5.502  1.00 56.67  ? 172 ARG A NE     1 
ATOM   1470 C  CZ     . ARG C 3 172 ? 25.029  20.639 -4.722  1.00 77.09  ? 172 ARG A CZ     1 
ATOM   1471 N  NH1    . ARG C 3 172 ? 26.201  20.083 -4.411  1.00 74.51  ? 172 ARG A NH1    1 
ATOM   1472 N  NH2    . ARG C 3 172 ? 24.718  21.847 -4.243  1.00 64.00  ? 172 ARG A NH2    1 
ATOM   1473 N  N      . LEU C 3 173 ? 19.847  15.923 -3.880  1.00 35.05  ? 173 LEU A N      1 
ATOM   1474 C  CA     . LEU C 3 173 ? 18.658  15.886 -3.036  1.00 36.76  ? 173 LEU A CA     1 
ATOM   1475 C  C      . LEU C 3 173 ? 18.415  14.485 -2.480  1.00 40.05  ? 173 LEU A C      1 
ATOM   1476 O  O      . LEU C 3 173 ? 17.812  14.345 -1.411  1.00 39.34  ? 173 LEU A O      1 
ATOM   1477 C  CB     . LEU C 3 173 ? 17.424  16.401 -3.795  1.00 29.99  ? 173 LEU A CB     1 
ATOM   1478 C  CG     . LEU C 3 173 ? 17.368  17.894 -4.130  1.00 32.24  ? 173 LEU A CG     1 
ATOM   1479 C  CD1    . LEU C 3 173 ? 16.354  18.163 -5.199  1.00 27.12  ? 173 LEU A CD1    1 
ATOM   1480 C  CD2    . LEU C 3 173 ? 17.048  18.767 -2.894  1.00 32.99  ? 173 LEU A CD2    1 
ATOM   1481 N  N      . LEU C 3 174 ? 18.887  13.434 -3.157  1.00 38.31  ? 174 LEU A N      1 
ATOM   1482 C  CA     . LEU C 3 174 ? 18.743  12.109 -2.563  1.00 38.53  ? 174 LEU A CA     1 
ATOM   1483 C  C      . LEU C 3 174 ? 19.675  11.955 -1.376  1.00 42.75  ? 174 LEU A C      1 
ATOM   1484 O  O      . LEU C 3 174 ? 19.265  11.445 -0.326  1.00 38.98  ? 174 LEU A O      1 
ATOM   1485 C  CB     . LEU C 3 174 ? 18.990  11.007 -3.590  1.00 50.77  ? 174 LEU A CB     1 
ATOM   1486 C  CG     . LEU C 3 174 ? 17.906  10.923 -4.686  1.00 59.48  ? 174 LEU A CG     1 
ATOM   1487 C  CD1    . LEU C 3 174 ? 17.923  9.573  -5.437  1.00 49.73  ? 174 LEU A CD1    1 
ATOM   1488 C  CD2    . LEU C 3 174 ? 16.533  11.201 -4.119  1.00 56.17  ? 174 LEU A CD2    1 
ATOM   1489 N  N      . VAL C 3 175 ? 20.925  12.416 -1.510  1.00 42.31  ? 175 VAL A N      1 
ATOM   1490 C  CA     . VAL C 3 175 ? 21.828  12.445 -0.358  1.00 44.02  ? 175 VAL A CA     1 
ATOM   1491 C  C      . VAL C 3 175 ? 21.210  13.274 0.761   1.00 42.73  ? 175 VAL A C      1 
ATOM   1492 O  O      . VAL C 3 175 ? 21.157  12.841 1.923   1.00 41.63  ? 175 VAL A O      1 
ATOM   1493 C  CB     . VAL C 3 175 ? 23.224  12.959 -0.771  1.00 40.99  ? 175 VAL A CB     1 
ATOM   1494 C  CG1    . VAL C 3 175 ? 24.135  13.083 0.418   1.00 42.15  ? 175 VAL A CG1    1 
ATOM   1495 C  CG2    . VAL C 3 175 ? 23.848  12.013 -1.793  1.00 44.51  ? 175 VAL A CG2    1 
ATOM   1496 N  N      . GLY C 3 176 ? 20.672  14.446 0.414   1.00 45.37  ? 176 GLY A N      1 
ATOM   1497 C  CA     . GLY C 3 176 ? 19.912  15.224 1.383   1.00 37.89  ? 176 GLY A CA     1 
ATOM   1498 C  C      . GLY C 3 176 ? 18.877  14.387 2.110   1.00 39.76  ? 176 GLY A C      1 
ATOM   1499 O  O      . GLY C 3 176 ? 18.659  14.556 3.312   1.00 43.96  ? 176 GLY A O      1 
ATOM   1500 N  N      . SER C 3 177 ? 18.241  13.451 1.400   1.00 39.97  ? 177 SER A N      1 
ATOM   1501 C  CA     . SER C 3 177 ? 17.209  12.644 2.036   1.00 36.84  ? 177 SER A CA     1 
ATOM   1502 C  C      . SER C 3 177 ? 17.832  11.595 2.943   1.00 38.06  ? 177 SER A C      1 
ATOM   1503 O  O      . SER C 3 177 ? 17.256  11.243 3.980   1.00 37.65  ? 177 SER A O      1 
ATOM   1504 C  CB     . SER C 3 177 ? 16.319  11.984 0.985   1.00 31.91  ? 177 SER A CB     1 
ATOM   1505 O  OG     . SER C 3 177 ? 16.851  10.736 0.606   1.00 36.46  ? 177 SER A OG     1 
ATOM   1506 N  N      . GLN C 3 178 ? 19.017  11.095 2.571   1.00 42.12  ? 178 GLN A N      1 
ATOM   1507 C  CA     . GLN C 3 178 ? 19.727  10.145 3.421   1.00 37.88  ? 178 GLN A CA     1 
ATOM   1508 C  C      . GLN C 3 178 ? 20.143  10.797 4.724   1.00 45.68  ? 178 GLN A C      1 
ATOM   1509 O  O      . GLN C 3 178 ? 19.971  10.213 5.804   1.00 34.21  ? 178 GLN A O      1 
ATOM   1510 C  CB     . GLN C 3 178 ? 20.949  9.586  2.706   1.00 33.65  ? 178 GLN A CB     1 
ATOM   1511 C  CG     . GLN C 3 178 ? 20.562  8.618  1.616   1.00 43.50  ? 178 GLN A CG     1 
ATOM   1512 C  CD     . GLN C 3 178 ? 21.717  8.268  0.701   1.00 61.22  ? 178 GLN A CD     1 
ATOM   1513 O  OE1    . GLN C 3 178 ? 22.870  8.624  0.977   1.00 64.67  ? 178 GLN A OE1    1 
ATOM   1514 N  NE2    . GLN C 3 178 ? 21.421  7.554  -0.396  1.00 63.86  ? 178 GLN A NE2    1 
ATOM   1515 N  N      . ILE C 3 179 ? 20.682  12.018 4.650   1.00 39.87  ? 179 ILE A N      1 
ATOM   1516 C  CA     . ILE C 3 179 ? 21.027  12.715 5.880   1.00 37.14  ? 179 ILE A CA     1 
ATOM   1517 C  C      . ILE C 3 179 ? 19.776  12.941 6.711   1.00 43.17  ? 179 ILE A C      1 
ATOM   1518 O  O      . ILE C 3 179 ? 19.791  12.807 7.944   1.00 36.16  ? 179 ILE A O      1 
ATOM   1519 C  CB     . ILE C 3 179 ? 21.750  14.035 5.578   1.00 40.37  ? 179 ILE A CB     1 
ATOM   1520 C  CG1    . ILE C 3 179 ? 23.105  13.763 4.941   1.00 40.15  ? 179 ILE A CG1    1 
ATOM   1521 C  CG2    . ILE C 3 179 ? 21.912  14.844 6.852   1.00 34.54  ? 179 ILE A CG2    1 
ATOM   1522 C  CD1    . ILE C 3 179 ? 23.639  14.952 4.171   1.00 41.63  ? 179 ILE A CD1    1 
ATOM   1523 N  N      . ALA C 3 180 ? 18.667  13.275 6.053   1.00 36.18  ? 180 ALA A N      1 
ATOM   1524 C  CA     . ALA C 3 180 ? 17.436  13.482 6.800   1.00 37.70  ? 180 ALA A CA     1 
ATOM   1525 C  C      . ALA C 3 180 ? 17.062  12.228 7.570   1.00 32.15  ? 180 ALA A C      1 
ATOM   1526 O  O      . ALA C 3 180 ? 16.715  12.296 8.746   1.00 34.56  ? 180 ALA A O      1 
ATOM   1527 C  CB     . ALA C 3 180 ? 16.295  13.902 5.869   1.00 32.48  ? 180 ALA A CB     1 
ATOM   1528 N  N      . ALA C 3 181 ? 17.107  11.069 6.916   1.00 37.26  ? 181 ALA A N      1 
ATOM   1529 C  CA     . ALA C 3 181 ? 16.783  9.830  7.614   1.00 38.20  ? 181 ALA A CA     1 
ATOM   1530 C  C      . ALA C 3 181 ? 17.657  9.648  8.858   1.00 43.14  ? 181 ALA A C      1 
ATOM   1531 O  O      . ALA C 3 181 ? 17.157  9.289  9.941   1.00 34.88  ? 181 ALA A O      1 
ATOM   1532 C  CB     . ALA C 3 181 ? 16.939  8.651  6.666   1.00 28.33  ? 181 ALA A CB     1 
ATOM   1533 N  N      . GLU C 3 182 ? 18.963  9.913  8.718   1.00 32.57  ? 182 GLU A N      1 
ATOM   1534 C  CA     . GLU C 3 182 ? 19.900  9.768  9.827   1.00 39.80  ? 182 GLU A CA     1 
ATOM   1535 C  C      . GLU C 3 182 ? 19.497  10.648 11.008  1.00 41.50  ? 182 GLU A C      1 
ATOM   1536 O  O      . GLU C 3 182 ? 19.343  10.158 12.135  1.00 40.49  ? 182 GLU A O      1 
ATOM   1537 C  CB     . GLU C 3 182 ? 21.317  10.088 9.348   1.00 36.37  ? 182 GLU A CB     1 
ATOM   1538 C  CG     . GLU C 3 182 ? 21.882  9.050  8.392   1.00 35.42  ? 182 GLU A CG     1 
ATOM   1539 C  CD     . GLU C 3 182 ? 23.184  9.486  7.733   1.00 52.85  ? 182 GLU A CD     1 
ATOM   1540 O  OE1    . GLU C 3 182 ? 23.824  10.427 8.270   1.00 45.74  ? 182 GLU A OE1    1 
ATOM   1541 O  OE2    . GLU C 3 182 ? 23.567  8.886  6.687   1.00 48.08  ? 182 GLU A OE2    1 
ATOM   1542 N  N      . MET C 3 183 ? 19.309  11.949 10.755  1.00 38.81  ? 183 MET A N      1 
ATOM   1543 C  CA     . MET C 3 183 ? 18.714  12.874 11.718  1.00 33.14  ? 183 MET A CA     1 
ATOM   1544 C  C      . MET C 3 183 ? 17.491  12.267 12.407  1.00 39.40  ? 183 MET A C      1 
ATOM   1545 O  O      . MET C 3 183 ? 17.417  12.197 13.640  1.00 35.07  ? 183 MET A O      1 
ATOM   1546 C  CB     . MET C 3 183 ? 18.318  14.182 11.008  1.00 30.48  ? 183 MET A CB     1 
ATOM   1547 C  CG     . MET C 3 183 ? 19.461  14.966 10.344  1.00 28.71  ? 183 MET A CG     1 
ATOM   1548 S  SD     . MET C 3 183 ? 18.883  16.548 9.644   1.00 36.32  ? 183 MET A SD     1 
ATOM   1549 C  CE     . MET C 3 183 ? 20.404  17.463 9.497   1.00 33.65  ? 183 MET A CE     1 
ATOM   1550 N  N      . ARG C 3 184 ? 16.495  11.852 11.628  1.00 28.88  ? 184 ARG A N      1 
ATOM   1551 C  CA     . ARG C 3 184 ? 15.299  11.320 12.268  1.00 34.97  ? 184 ARG A CA     1 
ATOM   1552 C  C      . ARG C 3 184 ? 15.633  10.080 13.085  1.00 36.88  ? 184 ARG A C      1 
ATOM   1553 O  O      . ARG C 3 184 ? 15.023  9.821  14.128  1.00 36.57  ? 184 ARG A O      1 
ATOM   1554 C  CB     . ARG C 3 184 ? 14.219  11.020 11.225  1.00 27.57  ? 184 ARG A CB     1 
ATOM   1555 C  CG     . ARG C 3 184 ? 13.568  12.276 10.632  1.00 36.02  ? 184 ARG A CG     1 
ATOM   1556 C  CD     . ARG C 3 184 ? 12.173  11.982 10.065  1.00 34.07  ? 184 ARG A CD     1 
ATOM   1557 N  NE     . ARG C 3 184 ? 12.254  10.885 9.121   1.00 37.12  ? 184 ARG A NE     1 
ATOM   1558 C  CZ     . ARG C 3 184 ? 11.579  9.748  9.217   1.00 41.43  ? 184 ARG A CZ     1 
ATOM   1559 N  NH1    . ARG C 3 184 ? 10.708  9.552  10.211  1.00 36.63  ? 184 ARG A NH1    1 
ATOM   1560 N  NH2    . ARG C 3 184 ? 11.774  8.810  8.297   1.00 38.09  ? 184 ARG A NH2    1 
ATOM   1561 N  N      . GLU C 3 185 ? 16.612  9.305  12.632  1.00 38.37  ? 185 GLU A N      1 
ATOM   1562 C  CA     . GLU C 3 185 ? 16.967  8.098  13.355  1.00 41.04  ? 185 GLU A CA     1 
ATOM   1563 C  C      . GLU C 3 185 ? 17.704  8.448  14.652  1.00 46.57  ? 185 GLU A C      1 
ATOM   1564 O  O      . GLU C 3 185 ? 17.490  7.819  15.695  1.00 39.13  ? 185 GLU A O      1 
ATOM   1565 C  CB     . GLU C 3 185 ? 17.777  7.199  12.425  1.00 38.56  ? 185 GLU A CB     1 
ATOM   1566 C  CG     . GLU C 3 185 ? 18.646  6.182  13.108  1.00 59.02  ? 185 GLU A CG     1 
ATOM   1567 C  CD     . GLU C 3 185 ? 17.920  4.895  13.430  1.00 75.64  ? 185 GLU A CD     1 
ATOM   1568 O  OE1    . GLU C 3 185 ? 16.698  4.966  13.742  1.00 70.68  ? 185 GLU A OE1    1 
ATOM   1569 O  OE2    . GLU C 3 185 ? 18.582  3.818  13.362  1.00 82.13  ? 185 GLU A OE2    1 
ATOM   1570 N  N      . ALA C 3 186 ? 18.508  9.507  14.623  1.00 40.94  ? 186 ALA A N      1 
ATOM   1571 C  CA     . ALA C 3 186 ? 19.158  9.987  15.838  1.00 35.76  ? 186 ALA A CA     1 
ATOM   1572 C  C      . ALA C 3 186 ? 18.148  10.542 16.851  1.00 42.61  ? 186 ALA A C      1 
ATOM   1573 O  O      . ALA C 3 186 ? 18.252  10.281 18.058  1.00 46.70  ? 186 ALA A O      1 
ATOM   1574 C  CB     . ALA C 3 186 ? 20.187  11.037 15.448  1.00 29.94  ? 186 ALA A CB     1 
ATOM   1575 N  N      . MET C 3 187 ? 17.168  11.315 16.393  1.00 41.28  ? 187 MET A N      1 
ATOM   1576 C  CA     . MET C 3 187 ? 16.196  11.870 17.325  1.00 41.32  ? 187 MET A CA     1 
ATOM   1577 C  C      . MET C 3 187 ? 15.342  10.783 17.956  1.00 40.90  ? 187 MET A C      1 
ATOM   1578 O  O      . MET C 3 187 ? 14.857  10.944 19.083  1.00 40.79  ? 187 MET A O      1 
ATOM   1579 C  CB     . MET C 3 187 ? 15.301  12.884 16.624  1.00 44.29  ? 187 MET A CB     1 
ATOM   1580 C  CG     . MET C 3 187 ? 15.910  14.257 16.462  1.00 44.33  ? 187 MET A CG     1 
ATOM   1581 S  SD     . MET C 3 187 ? 14.860  15.125 15.296  1.00 57.03  ? 187 MET A SD     1 
ATOM   1582 C  CE     . MET C 3 187 ? 13.280  14.646 15.978  1.00 50.32  ? 187 MET A CE     1 
ATOM   1583 N  N      . TYR C 3 188 ? 15.096  9.688  17.246  1.00 40.36  ? 188 TYR A N      1 
ATOM   1584 C  CA     . TYR C 3 188 ? 14.393  8.609  17.930  1.00 40.96  ? 188 TYR A CA     1 
ATOM   1585 C  C      . TYR C 3 188 ? 15.343  7.859  18.863  1.00 38.30  ? 188 TYR A C      1 
ATOM   1586 O  O      . TYR C 3 188 ? 14.995  7.552  20.004  1.00 44.61  ? 188 TYR A O      1 
ATOM   1587 C  CB     . TYR C 3 188 ? 13.742  7.655  16.925  1.00 33.20  ? 188 TYR A CB     1 
ATOM   1588 C  CG     . TYR C 3 188 ? 12.867  6.657  17.637  1.00 43.13  ? 188 TYR A CG     1 
ATOM   1589 C  CD1    . TYR C 3 188 ? 11.699  7.069  18.304  1.00 44.80  ? 188 TYR A CD1    1 
ATOM   1590 C  CD2    . TYR C 3 188 ? 13.219  5.324  17.695  1.00 29.54  ? 188 TYR A CD2    1 
ATOM   1591 C  CE1    . TYR C 3 188 ? 10.907  6.160  18.980  1.00 42.02  ? 188 TYR A CE1    1 
ATOM   1592 C  CE2    . TYR C 3 188 ? 12.443  4.422  18.363  1.00 35.14  ? 188 TYR A CE2    1 
ATOM   1593 C  CZ     . TYR C 3 188 ? 11.299  4.832  19.009  1.00 46.09  ? 188 TYR A CZ     1 
ATOM   1594 O  OH     . TYR C 3 188 ? 10.540  3.891  19.676  1.00 48.94  ? 188 TYR A OH     1 
ATOM   1595 N  N      . ASN C 3 189 ? 16.571  7.628  18.413  1.00 41.11  ? 189 ASN A N      1 
ATOM   1596 C  CA     A ASN C 3 189 ? 17.499  6.829  19.199  0.54 36.26  ? 189 ASN A CA     1 
ATOM   1597 C  CA     B ASN C 3 189 ? 17.545  6.852  19.174  0.46 36.11  ? 189 ASN A CA     1 
ATOM   1598 C  C      . ASN C 3 189 ? 18.013  7.594  20.419  1.00 44.96  ? 189 ASN A C      1 
ATOM   1599 O  O      . ASN C 3 189 ? 18.198  6.998  21.484  1.00 41.86  ? 189 ASN A O      1 
ATOM   1600 C  CB     A ASN C 3 189 ? 18.656  6.356  18.322  0.54 36.88  ? 189 ASN A CB     1 
ATOM   1601 C  CB     B ASN C 3 189 ? 18.742  6.545  18.287  0.46 37.00  ? 189 ASN A CB     1 
ATOM   1602 C  CG     A ASN C 3 189 ? 18.254  5.222  17.387  0.54 46.62  ? 189 ASN A CG     1 
ATOM   1603 C  CG     B ASN C 3 189 ? 19.276  5.164  18.501  0.46 44.75  ? 189 ASN A CG     1 
ATOM   1604 O  OD1    A ASN C 3 189 ? 17.273  4.518  17.642  0.54 44.74  ? 189 ASN A OD1    1 
ATOM   1605 O  OD1    B ASN C 3 189 ? 20.019  4.907  19.456  0.46 35.58  ? 189 ASN A OD1    1 
ATOM   1606 N  ND2    A ASN C 3 189 ? 19.019  5.031  16.300  0.54 42.70  ? 189 ASN A ND2    1 
ATOM   1607 N  ND2    B ASN C 3 189 ? 18.895  4.244  17.610  0.46 53.35  ? 189 ASN A ND2    1 
ATOM   1608 N  N      . GLN C 3 190 ? 18.253  8.896  20.300  1.00 39.69  ? 190 GLN A N      1 
ATOM   1609 C  CA     . GLN C 3 190 ? 18.841  9.592  21.441  1.00 35.67  ? 190 GLN A CA     1 
ATOM   1610 C  C      . GLN C 3 190 ? 17.816  10.327 22.302  1.00 37.08  ? 190 GLN A C      1 
ATOM   1611 O  O      . GLN C 3 190 ? 18.006  10.421 23.515  1.00 41.36  ? 190 GLN A O      1 
ATOM   1612 C  CB     . GLN C 3 190 ? 19.929  10.556 20.961  1.00 37.16  ? 190 GLN A CB     1 
ATOM   1613 C  CG     . GLN C 3 190 ? 21.123  9.863  20.286  1.00 38.45  ? 190 GLN A CG     1 
ATOM   1614 C  CD     . GLN C 3 190 ? 22.190  10.856 19.863  1.00 42.04  ? 190 GLN A CD     1 
ATOM   1615 O  OE1    . GLN C 3 190 ? 22.222  11.989 20.351  1.00 41.32  ? 190 GLN A OE1    1 
ATOM   1616 N  NE2    . GLN C 3 190 ? 23.055  10.448 18.938  1.00 38.20  ? 190 GLN A NE2    1 
ATOM   1617 N  N      . LEU C 3 191 ? 16.711  10.817 21.741  1.00 35.76  ? 191 LEU A N      1 
ATOM   1618 C  CA     . LEU C 3 191 ? 15.709  11.514 22.538  1.00 26.28  ? 191 LEU A CA     1 
ATOM   1619 C  C      . LEU C 3 191 ? 14.352  10.851 22.497  1.00 31.70  ? 191 LEU A C      1 
ATOM   1620 O  O      . LEU C 3 191 ? 13.410  11.399 23.072  1.00 39.19  ? 191 LEU A O      1 
ATOM   1621 C  CB     . LEU C 3 191 ? 15.552  12.969 22.072  1.00 32.80  ? 191 LEU A CB     1 
ATOM   1622 C  CG     . LEU C 3 191 ? 16.859  13.681 21.764  1.00 38.78  ? 191 LEU A CG     1 
ATOM   1623 C  CD1    . LEU C 3 191 ? 16.572  15.022 21.174  1.00 33.30  ? 191 LEU A CD1    1 
ATOM   1624 C  CD2    . LEU C 3 191 ? 17.676  13.810 23.031  1.00 34.45  ? 191 LEU A CD2    1 
ATOM   1625 N  N      . GLY C 3 192 ? 14.202  9.731  21.787  1.00 37.13  ? 192 GLY A N      1 
ATOM   1626 C  CA     . GLY C 3 192 ? 12.929  9.018  21.763  1.00 28.20  ? 192 GLY A CA     1 
ATOM   1627 C  C      . GLY C 3 192 ? 11.803  9.772  21.094  1.00 41.63  ? 192 GLY A C      1 
ATOM   1628 O  O      . GLY C 3 192 ? 10.631  9.569  21.445  1.00 46.42  ? 192 GLY A O      1 
ATOM   1629 N  N      . LEU C 3 193 ? 12.120  10.619 20.112  1.00 38.95  ? 193 LEU A N      1 
ATOM   1630 C  CA     . LEU C 3 193 ? 11.142  11.480 19.464  1.00 34.75  ? 193 LEU A CA     1 
ATOM   1631 C  C      . LEU C 3 193 ? 10.998  11.121 17.989  1.00 39.22  ? 193 LEU A C      1 
ATOM   1632 O  O      . LEU C 3 193 ? 11.997  10.950 17.286  1.00 44.70  ? 193 LEU A O      1 
ATOM   1633 C  CB     . LEU C 3 193 ? 11.563  12.937 19.615  1.00 35.19  ? 193 LEU A CB     1 
ATOM   1634 C  CG     . LEU C 3 193 ? 11.413  13.553 21.004  1.00 39.87  ? 193 LEU A CG     1 
ATOM   1635 C  CD1    . LEU C 3 193 ? 12.025  14.932 21.036  1.00 39.74  ? 193 LEU A CD1    1 
ATOM   1636 C  CD2    . LEU C 3 193 ? 9.927   13.613 21.412  1.00 38.88  ? 193 LEU A CD2    1 
ATOM   1637 N  N      . THR C 3 194 ? 9.761   11.031 17.517  1.00 36.67  ? 194 THR A N      1 
ATOM   1638 C  CA     . THR C 3 194 ? 9.477   10.870 16.100  1.00 41.95  ? 194 THR A CA     1 
ATOM   1639 C  C      . THR C 3 194 ? 9.019   12.199 15.495  1.00 42.20  ? 194 THR A C      1 
ATOM   1640 O  O      . THR C 3 194 ? 8.351   13.002 16.152  1.00 42.04  ? 194 THR A O      1 
ATOM   1641 C  CB     . THR C 3 194 ? 8.398   9.808  15.868  1.00 38.74  ? 194 THR A CB     1 
ATOM   1642 O  OG1    . THR C 3 194 ? 7.117   10.343 16.227  1.00 41.49  ? 194 THR A OG1    1 
ATOM   1643 C  CG2    . THR C 3 194 ? 8.670   8.572  16.691  1.00 34.05  ? 194 THR A CG2    1 
ATOM   1644 N  N      . GLY C 3 195 ? 9.370   12.410 14.224  1.00 41.37  ? 195 GLY A N      1 
ATOM   1645 C  CA     . GLY C 3 195 ? 8.936   13.577 13.472  1.00 41.94  ? 195 GLY A CA     1 
ATOM   1646 C  C      . GLY C 3 195 ? 9.108   13.375 11.977  1.00 41.82  ? 195 GLY A C      1 
ATOM   1647 O  O      . GLY C 3 195 ? 9.627   12.355 11.511  1.00 43.38  ? 195 GLY A O      1 
ATOM   1648 N  N      . CYS C 3 196 ? 8.646   14.360 11.219  1.00 36.98  ? 196 CYS A N      1 
ATOM   1649 C  CA     . CYS C 3 196 ? 8.807   14.361 9.767   1.00 40.33  ? 196 CYS A CA     1 
ATOM   1650 C  C      . CYS C 3 196 ? 9.947   15.284 9.323   1.00 39.68  ? 196 CYS A C      1 
ATOM   1651 O  O      . CYS C 3 196 ? 10.423  16.150 10.071  1.00 45.69  ? 196 CYS A O      1 
ATOM   1652 C  CB     . CYS C 3 196 ? 7.517   14.795 9.071   1.00 29.82  ? 196 CYS A CB     1 
ATOM   1653 S  SG     . CYS C 3 196 ? 6.045   13.920 9.582   1.00 44.38  ? 196 CYS A SG     1 
ATOM   1654 N  N      . ALA C 3 197 ? 10.382  15.083 8.084   1.00 33.49  ? 197 ALA A N      1 
ATOM   1655 C  CA     . ALA C 3 197 ? 11.402  15.916 7.471   1.00 35.83  ? 197 ALA A CA     1 
ATOM   1656 C  C      . ALA C 3 197 ? 11.034  16.128 6.015   1.00 32.74  ? 197 ALA A C      1 
ATOM   1657 O  O      . ALA C 3 197 ? 10.362  15.300 5.409   1.00 33.86  ? 197 ALA A O      1 
ATOM   1658 C  CB     . ALA C 3 197 ? 12.793  15.297 7.569   1.00 32.03  ? 197 ALA A CB     1 
ATOM   1659 N  N      . GLY C 3 198 ? 11.433  17.269 5.478   1.00 38.62  ? 198 GLY A N      1 
ATOM   1660 C  CA     . GLY C 3 198 ? 11.276  17.559 4.070   1.00 30.31  ? 198 GLY A CA     1 
ATOM   1661 C  C      . GLY C 3 198 ? 12.595  18.030 3.513   1.00 32.00  ? 198 GLY A C      1 
ATOM   1662 O  O      . GLY C 3 198 ? 13.292  18.839 4.143   1.00 40.18  ? 198 GLY A O      1 
ATOM   1663 N  N      . VAL C 3 199 ? 12.983  17.520 2.354   1.00 32.00  ? 199 VAL A N      1 
ATOM   1664 C  CA     . VAL C 3 199 ? 14.228  17.925 1.713   1.00 25.56  ? 199 VAL A CA     1 
ATOM   1665 C  C      . VAL C 3 199 ? 13.854  18.631 0.427   1.00 31.10  ? 199 VAL A C      1 
ATOM   1666 O  O      . VAL C 3 199 ? 13.029  18.127 -0.347  1.00 32.58  ? 199 VAL A O      1 
ATOM   1667 C  CB     . VAL C 3 199 ? 15.147  16.725 1.449   1.00 31.81  ? 199 VAL A CB     1 
ATOM   1668 C  CG1    . VAL C 3 199 ? 16.347  17.135 0.633   1.00 33.26  ? 199 VAL A CG1    1 
ATOM   1669 C  CG2    . VAL C 3 199 ? 15.588  16.103 2.784   1.00 32.28  ? 199 VAL A CG2    1 
ATOM   1670 N  N      . ALA C 3 200 ? 14.416  19.814 0.220   1.00 37.45  ? 200 ALA A N      1 
ATOM   1671 C  CA     . ALA C 3 200 ? 14.079  20.608 -0.955  1.00 31.56  ? 200 ALA A CA     1 
ATOM   1672 C  C      . ALA C 3 200 ? 15.203  21.605 -1.193  1.00 31.36  ? 200 ALA A C      1 
ATOM   1673 O  O      . ALA C 3 200 ? 16.253  21.554 -0.549  1.00 36.94  ? 200 ALA A O      1 
ATOM   1674 C  CB     . ALA C 3 200 ? 12.714  21.296 -0.797  1.00 26.88  ? 200 ALA A CB     1 
ATOM   1675 N  N      . SER C 3 201 ? 14.982  22.525 -2.115  1.00 40.77  ? 201 SER A N      1 
ATOM   1676 C  CA     . SER C 3 201 ? 16.073  23.368 -2.568  1.00 36.54  ? 201 SER A CA     1 
ATOM   1677 C  C      . SER C 3 201 ? 16.111  24.727 -1.874  1.00 35.95  ? 201 SER A C      1 
ATOM   1678 O  O      . SER C 3 201 ? 17.143  25.405 -1.938  1.00 41.72  ? 201 SER A O      1 
ATOM   1679 C  CB     . SER C 3 201 ? 15.968  23.532 -4.082  1.00 28.94  ? 201 SER A CB     1 
ATOM   1680 O  OG     . SER C 3 201 ? 15.072  24.584 -4.424  1.00 41.33  ? 201 SER A OG     1 
ATOM   1681 N  N      . ASN C 3 202 ? 15.009  25.144 -1.246  1.00 29.92  ? 202 ASN A N      1 
ATOM   1682 C  CA     . ASN C 3 202 ? 14.949  26.340 -0.425  1.00 33.06  ? 202 ASN A CA     1 
ATOM   1683 C  C      . ASN C 3 202 ? 14.093  26.055 0.811   1.00 44.17  ? 202 ASN A C      1 
ATOM   1684 O  O      . ASN C 3 202 ? 13.431  25.014 0.915   1.00 39.62  ? 202 ASN A O      1 
ATOM   1685 C  CB     . ASN C 3 202 ? 14.407  27.530 -1.216  1.00 36.96  ? 202 ASN A CB     1 
ATOM   1686 C  CG     . ASN C 3 202 ? 13.040  27.280 -1.795  1.00 42.44  ? 202 ASN A CG     1 
ATOM   1687 O  OD1    . ASN C 3 202 ? 12.109  26.891 -1.085  1.00 41.54  ? 202 ASN A OD1    1 
ATOM   1688 N  ND2    . ASN C 3 202 ? 12.905  27.499 -3.102  1.00 43.76  ? 202 ASN A ND2    1 
ATOM   1689 N  N      . LYS C 3 203 ? 14.112  26.994 1.763   1.00 37.22  ? 203 LYS A N      1 
ATOM   1690 C  CA     . LYS C 3 203 ? 13.395  26.792 3.019   1.00 38.37  ? 203 LYS A CA     1 
ATOM   1691 C  C      . LYS C 3 203 ? 11.903  26.586 2.788   1.00 38.88  ? 203 LYS A C      1 
ATOM   1692 O  O      . LYS C 3 203 ? 11.285  25.697 3.389   1.00 39.18  ? 203 LYS A O      1 
ATOM   1693 C  CB     . LYS C 3 203 ? 13.613  27.989 3.944   1.00 45.15  ? 203 LYS A CB     1 
ATOM   1694 C  CG     . LYS C 3 203 ? 14.974  28.028 4.602   1.00 44.12  ? 203 LYS A CG     1 
ATOM   1695 C  CD     . LYS C 3 203 ? 14.899  28.759 5.936   1.00 46.67  ? 203 LYS A CD     1 
ATOM   1696 C  CE     . LYS C 3 203 ? 15.108  30.256 5.794   1.00 48.47  ? 203 LYS A CE     1 
ATOM   1697 N  NZ     . LYS C 3 203 ? 14.690  30.885 7.072   1.00 47.13  ? 203 LYS A NZ     1 
ATOM   1698 N  N      . LEU C 3 204 ? 11.293  27.441 1.961   1.00 37.88  ? 204 LEU A N      1 
ATOM   1699 C  CA     . LEU C 3 204 ? 9.855   27.347 1.708   1.00 36.40  ? 204 LEU A CA     1 
ATOM   1700 C  C      . LEU C 3 204 ? 9.458   25.963 1.214   1.00 35.88  ? 204 LEU A C      1 
ATOM   1701 O  O      . LEU C 3 204 ? 8.520   25.346 1.735   1.00 36.19  ? 204 LEU A O      1 
ATOM   1702 C  CB     . LEU C 3 204 ? 9.441   28.395 0.686   1.00 43.43  ? 204 LEU A CB     1 
ATOM   1703 C  CG     . LEU C 3 204 ? 8.106   28.186 -0.016  1.00 35.82  ? 204 LEU A CG     1 
ATOM   1704 C  CD1    . LEU C 3 204 ? 6.956   28.382 0.946   1.00 32.38  ? 204 LEU A CD1    1 
ATOM   1705 C  CD2    . LEU C 3 204 ? 8.005   29.184 -1.139  1.00 32.58  ? 204 LEU A CD2    1 
ATOM   1706 N  N      . LEU C 3 205 ? 10.155  25.461 0.196   1.00 33.51  ? 205 LEU A N      1 
ATOM   1707 C  CA     . LEU C 3 205 ? 9.809   24.156 -0.360  1.00 40.15  ? 205 LEU A CA     1 
ATOM   1708 C  C      . LEU C 3 205 ? 10.043  23.031 0.653   1.00 39.26  ? 205 LEU A C      1 
ATOM   1709 O  O      . LEU C 3 205 ? 9.215   22.112 0.780   1.00 37.87  ? 205 LEU A O      1 
ATOM   1710 C  CB     . LEU C 3 205 ? 10.599  23.937 -1.651  1.00 38.36  ? 205 LEU A CB     1 
ATOM   1711 C  CG     . LEU C 3 205 ? 10.241  24.948 -2.752  1.00 38.56  ? 205 LEU A CG     1 
ATOM   1712 C  CD1    . LEU C 3 205 ? 11.176  24.865 -3.952  1.00 31.46  ? 205 LEU A CD1    1 
ATOM   1713 C  CD2    . LEU C 3 205 ? 8.807   24.733 -3.180  1.00 30.17  ? 205 LEU A CD2    1 
ATOM   1714 N  N      . ALA C 3 206 ? 11.153  23.092 1.391   1.00 32.42  ? 206 ALA A N      1 
ATOM   1715 C  CA     . ALA C 3 206 ? 11.386  22.120 2.455   1.00 34.28  ? 206 ALA A CA     1 
ATOM   1716 C  C      . ALA C 3 206 ? 10.217  22.077 3.429   1.00 36.41  ? 206 ALA A C      1 
ATOM   1717 O  O      . ALA C 3 206 ? 9.760   20.996 3.814   1.00 33.64  ? 206 ALA A O      1 
ATOM   1718 C  CB     . ALA C 3 206 ? 12.675  22.450 3.200   1.00 30.94  ? 206 ALA A CB     1 
ATOM   1719 N  N      . LYS C 3 207 ? 9.713   23.239 3.841   1.00 37.11  ? 207 LYS A N      1 
ATOM   1720 C  CA     . LYS C 3 207 ? 8.663   23.218 4.849   1.00 41.70  ? 207 LYS A CA     1 
ATOM   1721 C  C      . LYS C 3 207 ? 7.314   22.828 4.260   1.00 37.73  ? 207 LYS A C      1 
ATOM   1722 O  O      . LYS C 3 207 ? 6.478   22.263 4.968   1.00 31.82  ? 207 LYS A O      1 
ATOM   1723 C  CB     . LYS C 3 207 ? 8.573   24.580 5.556   1.00 39.84  ? 207 LYS A CB     1 
ATOM   1724 C  CG     . LYS C 3 207 ? 7.411   24.688 6.567   1.00 34.23  ? 207 LYS A CG     1 
ATOM   1725 C  CD     . LYS C 3 207 ? 7.444   26.041 7.268   1.00 39.75  ? 207 LYS A CD     1 
ATOM   1726 C  CE     . LYS C 3 207 ? 6.186   26.333 8.029   1.00 40.08  ? 207 LYS A CE     1 
ATOM   1727 N  NZ     . LYS C 3 207 ? 6.154   25.670 9.328   1.00 41.26  ? 207 LYS A NZ     1 
ATOM   1728 N  N      . LEU C 3 208 ? 7.068   23.118 2.980   1.00 37.63  ? 208 LEU A N      1 
ATOM   1729 C  CA     . LEU C 3 208 ? 5.809   22.675 2.392   1.00 33.08  ? 208 LEU A CA     1 
ATOM   1730 C  C      . LEU C 3 208 ? 5.826   21.182 2.153   1.00 40.58  ? 208 LEU A C      1 
ATOM   1731 O  O      . LEU C 3 208 ? 4.796   20.513 2.317   1.00 45.68  ? 208 LEU A O      1 
ATOM   1732 C  CB     . LEU C 3 208 ? 5.523   23.399 1.088   1.00 33.12  ? 208 LEU A CB     1 
ATOM   1733 C  CG     . LEU C 3 208 ? 5.109   24.865 1.224   1.00 37.92  ? 208 LEU A CG     1 
ATOM   1734 C  CD1    . LEU C 3 208 ? 5.086   25.499 -0.170  1.00 28.84  ? 208 LEU A CD1    1 
ATOM   1735 C  CD2    . LEU C 3 208 ? 3.770   25.004 1.942   1.00 26.20  ? 208 LEU A CD2    1 
ATOM   1736 N  N      . VAL C 3 209 ? 6.986   20.630 1.792   1.00 29.49  ? 209 VAL A N      1 
ATOM   1737 C  CA     . VAL C 3 209 ? 7.012   19.204 1.506   1.00 35.79  ? 209 VAL A CA     1 
ATOM   1738 C  C      . VAL C 3 209 ? 7.141   18.358 2.767   1.00 34.01  ? 209 VAL A C      1 
ATOM   1739 O  O      . VAL C 3 209 ? 6.749   17.188 2.760   1.00 35.44  ? 209 VAL A O      1 
ATOM   1740 C  CB     . VAL C 3 209 ? 8.121   18.880 0.492   1.00 37.46  ? 209 VAL A CB     1 
ATOM   1741 C  CG1    . VAL C 3 209 ? 9.481   19.004 1.101   1.00 26.89  ? 209 VAL A CG1    1 
ATOM   1742 C  CG2    . VAL C 3 209 ? 7.871   17.489 -0.140  1.00 41.29  ? 209 VAL A CG2    1 
ATOM   1743 N  N      . SER C 3 210 ? 7.632   18.917 3.871   1.00 36.22  ? 210 SER A N      1 
ATOM   1744 C  CA     . SER C 3 210 ? 7.772   18.111 5.077   1.00 34.03  ? 210 SER A CA     1 
ATOM   1745 C  C      . SER C 3 210 ? 6.431   17.623 5.556   1.00 29.77  ? 210 SER A C      1 
ATOM   1746 O  O      . SER C 3 210 ? 6.371   16.575 6.197   1.00 31.79  ? 210 SER A O      1 
ATOM   1747 C  CB     . SER C 3 210 ? 8.483   18.885 6.200   1.00 39.62  ? 210 SER A CB     1 
ATOM   1748 O  OG     . SER C 3 210 ? 7.750   20.036 6.588   1.00 34.70  ? 210 SER A OG     1 
ATOM   1749 N  N      . GLY C 3 211 ? 5.352   18.315 5.202   1.00 36.87  ? 211 GLY A N      1 
ATOM   1750 C  CA     . GLY C 3 211 ? 4.031   17.929 5.649   1.00 35.46  ? 211 GLY A CA     1 
ATOM   1751 C  C      . GLY C 3 211 ? 3.276   16.962 4.761   1.00 36.93  ? 211 GLY A C      1 
ATOM   1752 O  O      . GLY C 3 211 ? 2.141   16.599 5.078   1.00 38.15  ? 211 GLY A O      1 
ATOM   1753 N  N      . VAL C 3 212 ? 3.856   16.511 3.649   1.00 36.78  ? 212 VAL A N      1 
ATOM   1754 C  CA     . VAL C 3 212 ? 3.056   15.759 2.692   1.00 31.20  ? 212 VAL A CA     1 
ATOM   1755 C  C      . VAL C 3 212 ? 2.677   14.395 3.268   1.00 37.34  ? 212 VAL A C      1 
ATOM   1756 O  O      . VAL C 3 212 ? 1.586   13.879 2.999   1.00 39.20  ? 212 VAL A O      1 
ATOM   1757 C  CB     . VAL C 3 212 ? 3.811   15.662 1.350   1.00 41.64  ? 212 VAL A CB     1 
ATOM   1758 C  CG1    . VAL C 3 212 ? 3.080   14.777 0.351   1.00 26.25  ? 212 VAL A CG1    1 
ATOM   1759 C  CG2    . VAL C 3 212 ? 4.035   17.060 0.768   1.00 33.87  ? 212 VAL A CG2    1 
ATOM   1760 N  N      . PHE C 3 213 ? 3.548   13.798 4.091   1.00 41.31  ? 213 PHE A N      1 
ATOM   1761 C  CA     . PHE C 3 213 ? 3.276   12.491 4.703   1.00 41.51  ? 213 PHE A CA     1 
ATOM   1762 C  C      . PHE C 3 213 ? 3.481   12.579 6.199   1.00 43.18  ? 213 PHE A C      1 
ATOM   1763 O  O      . PHE C 3 213 ? 4.621   12.703 6.660   1.00 40.30  ? 213 PHE A O      1 
ATOM   1764 C  CB     . PHE C 3 213 ? 4.174   11.390 4.140   1.00 48.23  ? 213 PHE A CB     1 
ATOM   1765 C  CG     . PHE C 3 213 ? 3.864   11.027 2.723   1.00 48.44  ? 213 PHE A CG     1 
ATOM   1766 C  CD1    . PHE C 3 213 ? 2.925   10.042 2.437   1.00 44.95  ? 213 PHE A CD1    1 
ATOM   1767 C  CD2    . PHE C 3 213 ? 4.500   11.671 1.677   1.00 38.60  ? 213 PHE A CD2    1 
ATOM   1768 C  CE1    . PHE C 3 213 ? 2.639   9.700  1.136   1.00 39.50  ? 213 PHE A CE1    1 
ATOM   1769 C  CE2    . PHE C 3 213 ? 4.225   11.321 0.366   1.00 42.69  ? 213 PHE A CE2    1 
ATOM   1770 C  CZ     . PHE C 3 213 ? 3.293   10.335 0.094   1.00 33.52  ? 213 PHE A CZ     1 
ATOM   1771 N  N      . LYS C 3 214 ? 2.387   12.449 6.943   1.00 48.04  ? 214 LYS A N      1 
ATOM   1772 C  CA     . LYS C 3 214 ? 2.410   12.502 8.395   1.00 39.85  ? 214 LYS A CA     1 
ATOM   1773 C  C      . LYS C 3 214 ? 1.642   11.327 8.980   1.00 44.62  ? 214 LYS A C      1 
ATOM   1774 O  O      . LYS C 3 214 ? 0.692   10.844 8.380   1.00 54.37  ? 214 LYS A O      1 
ATOM   1775 C  CB     . LYS C 3 214 ? 1.812   13.818 8.880   1.00 43.99  ? 214 LYS A CB     1 
ATOM   1776 C  CG     . LYS C 3 214 ? 2.689   15.022 8.573   1.00 53.48  ? 214 LYS A CG     1 
ATOM   1777 C  CD     . LYS C 3 214 ? 1.918   16.322 8.636   1.00 49.58  ? 214 LYS A CD     1 
ATOM   1778 C  CE     . LYS C 3 214 ? 1.180   16.464 9.939   1.00 44.74  ? 214 LYS A CE     1 
ATOM   1779 N  NZ     . LYS C 3 214 ? 0.510   17.792 9.974   1.00 53.04  ? 214 LYS A NZ     1 
ATOM   1780 N  N      . PRO C 3 215 ? 2.050   10.862 10.164  1.00 49.84  ? 215 PRO A N      1 
ATOM   1781 C  CA     . PRO C 3 215 ? 3.217   11.344 10.910  1.00 46.19  ? 215 PRO A CA     1 
ATOM   1782 C  C      . PRO C 3 215 ? 4.475   10.528 10.655  1.00 42.47  ? 215 PRO A C      1 
ATOM   1783 O  O      . PRO C 3 215 ? 4.410   9.524  9.941   1.00 43.61  ? 215 PRO A O      1 
ATOM   1784 C  CB     . PRO C 3 215 ? 2.780   11.162 12.343  1.00 38.66  ? 215 PRO A CB     1 
ATOM   1785 C  CG     . PRO C 3 215 ? 2.072   9.852  12.269  1.00 42.80  ? 215 PRO A CG     1 
ATOM   1786 C  CD     . PRO C 3 215 ? 1.250   9.941  10.986  1.00 39.35  ? 215 PRO A CD     1 
ATOM   1787 N  N      . ASN C 3 216 ? 5.600   10.972 11.217  1.00 40.41  ? 216 ASN A N      1 
ATOM   1788 C  CA     . ASN C 3 216 ? 6.815   10.164 11.288  1.00 43.41  ? 216 ASN A CA     1 
ATOM   1789 C  C      . ASN C 3 216 ? 7.207   9.607  9.922   1.00 37.06  ? 216 ASN A C      1 
ATOM   1790 O  O      . ASN C 3 216 ? 7.456   8.416  9.765   1.00 41.15  ? 216 ASN A O      1 
ATOM   1791 C  CB     . ASN C 3 216 ? 6.645   9.023  12.296  1.00 38.75  ? 216 ASN A CB     1 
ATOM   1792 C  CG     . ASN C 3 216 ? 7.976   8.391  12.703  1.00 42.79  ? 216 ASN A CG     1 
ATOM   1793 O  OD1    . ASN C 3 216 ? 9.049   9.003  12.611  1.00 45.88  ? 216 ASN A OD1    1 
ATOM   1794 N  ND2    . ASN C 3 216 ? 7.903   7.160  13.161  1.00 40.13  ? 216 ASN A ND2    1 
ATOM   1795 N  N      . GLN C 3 217 ? 7.257   10.476 8.920   1.00 37.54  ? 217 GLN A N      1 
ATOM   1796 C  CA     . GLN C 3 217 ? 7.785   10.088 7.623   1.00 40.56  ? 217 GLN A CA     1 
ATOM   1797 C  C      . GLN C 3 217 ? 8.524   11.277 7.029   1.00 34.53  ? 217 GLN A C      1 
ATOM   1798 O  O      . GLN C 3 217 ? 8.476   12.390 7.559   1.00 38.09  ? 217 GLN A O      1 
ATOM   1799 C  CB     . GLN C 3 217 ? 6.660   9.603  6.702   1.00 50.63  ? 217 GLN A CB     1 
ATOM   1800 C  CG     . GLN C 3 217 ? 5.577   8.756  7.403   1.00 40.10  ? 217 GLN A CG     1 
ATOM   1801 C  CD     . GLN C 3 217 ? 4.464   8.264  6.466   1.00 47.37  ? 217 GLN A CD     1 
ATOM   1802 O  OE1    . GLN C 3 217 ? 4.721   7.828  5.342   1.00 52.75  ? 217 GLN A OE1    1 
ATOM   1803 N  NE2    . GLN C 3 217 ? 3.218   8.338  6.935   1.00 45.47  ? 217 GLN A NE2    1 
ATOM   1804 N  N      . GLN C 3 218 ? 9.205   11.046 5.909   1.00 37.31  ? 218 GLN A N      1 
ATOM   1805 C  CA     . GLN C 3 218 ? 9.892   12.140 5.220   1.00 38.10  ? 218 GLN A CA     1 
ATOM   1806 C  C      . GLN C 3 218 ? 9.667   12.073 3.713   1.00 37.13  ? 218 GLN A C      1 
ATOM   1807 O  O      . GLN C 3 218 ? 9.403   11.004 3.151   1.00 35.68  ? 218 GLN A O      1 
ATOM   1808 C  CB     . GLN C 3 218 ? 11.392  12.133 5.490   1.00 36.89  ? 218 GLN A CB     1 
ATOM   1809 C  CG     . GLN C 3 218 ? 12.100  10.919 4.909   1.00 32.70  ? 218 GLN A CG     1 
ATOM   1810 C  CD     . GLN C 3 218 ? 13.506  10.792 5.444   1.00 37.01  ? 218 GLN A CD     1 
ATOM   1811 O  OE1    . GLN C 3 218 ? 13.712  10.500 6.629   1.00 42.55  ? 218 GLN A OE1    1 
ATOM   1812 N  NE2    . GLN C 3 218 ? 14.485  11.014 4.580   1.00 38.58  ? 218 GLN A NE2    1 
ATOM   1813 N  N      . THR C 3 219 ? 9.811   13.238 3.068   1.00 37.48  ? 219 THR A N      1 
ATOM   1814 C  CA     . THR C 3 219 ? 9.502   13.451 1.662   1.00 36.04  ? 219 THR A CA     1 
ATOM   1815 C  C      . THR C 3 219 ? 10.556  14.371 1.080   1.00 38.81  ? 219 THR A C      1 
ATOM   1816 O  O      . THR C 3 219 ? 10.974  15.335 1.741   1.00 34.43  ? 219 THR A O      1 
ATOM   1817 C  CB     . THR C 3 219 ? 8.125   14.086 1.480   1.00 40.68  ? 219 THR A CB     1 
ATOM   1818 O  OG1    . THR C 3 219 ? 7.165   13.423 2.315   1.00 36.76  ? 219 THR A OG1    1 
ATOM   1819 C  CG2    . THR C 3 219 ? 7.689   14.000 0.028   1.00 35.28  ? 219 THR A CG2    1 
ATOM   1820 N  N      . VAL C 3 220 ? 10.989  14.059 -0.150  1.00 34.41  ? 220 VAL A N      1 
ATOM   1821 C  CA     . VAL C 3 220 ? 11.976  14.848 -0.887  1.00 32.84  ? 220 VAL A CA     1 
ATOM   1822 C  C      . VAL C 3 220 ? 11.327  15.417 -2.139  1.00 37.62  ? 220 VAL A C      1 
ATOM   1823 O  O      . VAL C 3 220 ? 10.540  14.737 -2.812  1.00 41.05  ? 220 VAL A O      1 
ATOM   1824 C  CB     . VAL C 3 220 ? 13.222  14.015 -1.256  1.00 35.14  ? 220 VAL A CB     1 
ATOM   1825 C  CG1    . VAL C 3 220 ? 12.815  12.751 -1.985  1.00 38.62  ? 220 VAL A CG1    1 
ATOM   1826 C  CG2    . VAL C 3 220 ? 14.208  14.832 -2.053  1.00 31.07  ? 220 VAL A CG2    1 
ATOM   1827 N  N      . LEU C 3 221 ? 11.652  16.670 -2.458  1.00 40.77  ? 221 LEU A N      1 
ATOM   1828 C  CA     . LEU C 3 221 ? 11.036  17.358 -3.590  1.00 38.77  ? 221 LEU A CA     1 
ATOM   1829 C  C      . LEU C 3 221 ? 12.090  17.562 -4.658  1.00 32.94  ? 221 LEU A C      1 
ATOM   1830 O  O      . LEU C 3 221 ? 13.019  18.354 -4.468  1.00 35.68  ? 221 LEU A O      1 
ATOM   1831 C  CB     . LEU C 3 221 ? 10.426  18.698 -3.182  1.00 29.36  ? 221 LEU A CB     1 
ATOM   1832 C  CG     . LEU C 3 221 ? 9.825   19.567 -4.293  1.00 36.21  ? 221 LEU A CG     1 
ATOM   1833 C  CD1    . LEU C 3 221 ? 8.446   19.056 -4.762  1.00 26.29  ? 221 LEU A CD1    1 
ATOM   1834 C  CD2    . LEU C 3 221 ? 9.731   21.021 -3.838  1.00 39.51  ? 221 LEU A CD2    1 
ATOM   1835 N  N      . LEU C 3 222 ? 11.943  16.851 -5.783  1.00 40.35  ? 222 LEU A N      1 
ATOM   1836 C  CA     . LEU C 3 222 ? 12.791  17.134 -6.938  1.00 38.44  ? 222 LEU A CA     1 
ATOM   1837 C  C      . LEU C 3 222 ? 12.252  18.349 -7.685  1.00 35.19  ? 222 LEU A C      1 
ATOM   1838 O  O      . LEU C 3 222 ? 11.050  18.639 -7.636  1.00 37.84  ? 222 LEU A O      1 
ATOM   1839 C  CB     . LEU C 3 222 ? 12.857  15.934 -7.876  1.00 30.63  ? 222 LEU A CB     1 
ATOM   1840 C  CG     . LEU C 3 222 ? 13.117  14.589 -7.173  1.00 43.55  ? 222 LEU A CG     1 
ATOM   1841 C  CD1    . LEU C 3 222 ? 13.072  13.442 -8.148  1.00 37.88  ? 222 LEU A CD1    1 
ATOM   1842 C  CD2    . LEU C 3 222 ? 14.427  14.575 -6.373  1.00 34.43  ? 222 LEU A CD2    1 
ATOM   1843 N  N      . PRO C 3 223 ? 13.124  19.083 -8.359  1.00 35.89  ? 223 PRO A N      1 
ATOM   1844 C  CA     . PRO C 3 223 ? 12.709  20.379 -8.944  1.00 36.97  ? 223 PRO A CA     1 
ATOM   1845 C  C      . PRO C 3 223 ? 11.501  20.296 -9.879  1.00 38.62  ? 223 PRO A C      1 
ATOM   1846 O  O      . PRO C 3 223 ? 10.612  21.157 -9.827  1.00 38.20  ? 223 PRO A O      1 
ATOM   1847 C  CB     . PRO C 3 223 ? 13.966  20.832 -9.703  1.00 32.43  ? 223 PRO A CB     1 
ATOM   1848 C  CG     . PRO C 3 223 ? 15.122  20.057 -9.094  1.00 28.40  ? 223 PRO A CG     1 
ATOM   1849 C  CD     . PRO C 3 223 ? 14.550  18.770 -8.567  1.00 36.25  ? 223 PRO A CD     1 
ATOM   1850 N  N      . GLU C 3 224 ? 11.454  19.284 -10.753 1.00 40.74  ? 224 GLU A N      1 
ATOM   1851 C  CA     . GLU C 3 224 ? 10.339  19.144 -11.694 1.00 42.85  ? 224 GLU A CA     1 
ATOM   1852 C  C      . GLU C 3 224 ? 8.989   19.272 -11.019 1.00 39.94  ? 224 GLU A C      1 
ATOM   1853 O  O      . GLU C 3 224 ? 8.014   19.646 -11.677 1.00 44.30  ? 224 GLU A O      1 
ATOM   1854 C  CB     . GLU C 3 224 ? 10.387  17.791 -12.434 1.00 32.41  ? 224 GLU A CB     1 
ATOM   1855 C  CG     . GLU C 3 224 ? 11.479  17.688 -13.482 1.00 30.92  ? 224 GLU A CG     1 
ATOM   1856 C  CD     . GLU C 3 224 ? 12.893  17.573 -12.888 1.00 49.04  ? 224 GLU A CD     1 
ATOM   1857 O  OE1    . GLU C 3 224 ? 13.873  17.811 -13.629 1.00 53.84  ? 224 GLU A OE1    1 
ATOM   1858 O  OE2    . GLU C 3 224 ? 13.041  17.242 -11.690 1.00 45.23  ? 224 GLU A OE2    1 
ATOM   1859 N  N      . SER C 3 225 ? 8.896   18.934 -9.727  1.00 43.65  ? 225 SER A N      1 
ATOM   1860 C  CA     . SER C 3 225 ? 7.607   18.844 -9.051  1.00 35.56  ? 225 SER A CA     1 
ATOM   1861 C  C      . SER C 3 225 ? 7.305   20.068 -8.212  1.00 37.29  ? 225 SER A C      1 
ATOM   1862 O  O      . SER C 3 225 ? 6.286   20.099 -7.504  1.00 38.06  ? 225 SER A O      1 
ATOM   1863 C  CB     . SER C 3 225 ? 7.537   17.586 -8.193  1.00 36.64  ? 225 SER A CB     1 
ATOM   1864 O  OG     . SER C 3 225 ? 7.602   16.429 -9.015  1.00 40.06  ? 225 SER A OG     1 
ATOM   1865 N  N      . CYS C 3 226 ? 8.139   21.098 -8.307  1.00 32.26  ? 226 CYS A N      1 
ATOM   1866 C  CA     . CYS C 3 226 ? 7.934   22.270 -7.466  1.00 40.90  ? 226 CYS A CA     1 
ATOM   1867 C  C      . CYS C 3 226 ? 6.582   22.922 -7.740  1.00 41.69  ? 226 CYS A C      1 
ATOM   1868 O  O      . CYS C 3 226 ? 5.844   23.274 -6.812  1.00 42.60  ? 226 CYS A O      1 
ATOM   1869 C  CB     . CYS C 3 226 ? 9.060   23.272 -7.678  1.00 35.19  ? 226 CYS A CB     1 
ATOM   1870 S  SG     . CYS C 3 226 ? 8.582   24.886 -7.104  1.00 61.52  ? 226 CYS A SG     1 
ATOM   1871 N  N      . GLN C 3 227 ? 6.239   23.102 -9.011  1.00 44.62  ? 227 GLN A N      1 
ATOM   1872 C  CA     . GLN C 3 227 ? 4.957   23.730 -9.315  1.00 44.08  ? 227 GLN A CA     1 
ATOM   1873 C  C      . GLN C 3 227 ? 3.795   22.855 -8.857  1.00 42.63  ? 227 GLN A C      1 
ATOM   1874 O  O      . GLN C 3 227 ? 2.792   23.366 -8.341  1.00 39.61  ? 227 GLN A O      1 
ATOM   1875 C  CB     . GLN C 3 227 ? 4.855   24.043 -10.808 1.00 39.38  ? 227 GLN A CB     1 
ATOM   1876 C  CG     . GLN C 3 227 ? 5.887   25.064 -11.298 1.00 49.39  ? 227 GLN A CG     1 
ATOM   1877 C  CD     . GLN C 3 227 ? 5.737   26.427 -10.623 1.00 56.22  ? 227 GLN A CD     1 
ATOM   1878 O  OE1    . GLN C 3 227 ? 4.619   26.956 -10.505 1.00 54.44  ? 227 GLN A OE1    1 
ATOM   1879 N  NE2    . GLN C 3 227 ? 6.859   26.991 -10.154 1.00 45.76  ? 227 GLN A NE2    1 
ATOM   1880 N  N      . HIS C 3 228 ? 3.905   21.533 -9.034  1.00 35.20  ? 228 HIS A N      1 
ATOM   1881 C  CA     . HIS C 3 228 ? 2.849   20.656 -8.544  1.00 37.24  ? 228 HIS A CA     1 
ATOM   1882 C  C      . HIS C 3 228 ? 2.614   20.906 -7.062  1.00 40.44  ? 228 HIS A C      1 
ATOM   1883 O  O      . HIS C 3 228 ? 1.478   21.110 -6.621  1.00 40.27  ? 228 HIS A O      1 
ATOM   1884 C  CB     . HIS C 3 228 ? 3.199   19.184 -8.805  1.00 33.48  ? 228 HIS A CB     1 
ATOM   1885 C  CG     . HIS C 3 228 ? 2.079   18.227 -8.509  1.00 38.54  ? 228 HIS A CG     1 
ATOM   1886 N  ND1    . HIS C 3 228 ? 1.713   17.874 -7.226  1.00 44.84  ? 228 HIS A ND1    1 
ATOM   1887 C  CD2    . HIS C 3 228 ? 1.261   17.524 -9.332  1.00 45.37  ? 228 HIS A CD2    1 
ATOM   1888 C  CE1    . HIS C 3 228 ? 0.708   17.014 -7.269  1.00 37.01  ? 228 HIS A CE1    1 
ATOM   1889 N  NE2    . HIS C 3 228 ? 0.422   16.775 -8.537  1.00 42.16  ? 228 HIS A NE2    1 
ATOM   1890 N  N      . LEU C 3 229 ? 3.694   20.940 -6.284  1.00 39.13  ? 229 LEU A N      1 
ATOM   1891 C  CA     . LEU C 3 229 ? 3.561   21.140 -4.848  1.00 41.42  ? 229 LEU A CA     1 
ATOM   1892 C  C      . LEU C 3 229 ? 2.918   22.486 -4.533  1.00 39.81  ? 229 LEU A C      1 
ATOM   1893 O  O      . LEU C 3 229 ? 1.994   22.567 -3.706  1.00 32.82  ? 229 LEU A O      1 
ATOM   1894 C  CB     . LEU C 3 229 ? 4.930   21.034 -4.188  1.00 45.45  ? 229 LEU A CB     1 
ATOM   1895 C  CG     . LEU C 3 229 ? 4.952   21.323 -2.693  1.00 33.85  ? 229 LEU A CG     1 
ATOM   1896 C  CD1    . LEU C 3 229 ? 4.235   20.220 -1.986  1.00 31.34  ? 229 LEU A CD1    1 
ATOM   1897 C  CD2    . LEU C 3 229 ? 6.396   21.438 -2.255  1.00 29.58  ? 229 LEU A CD2    1 
ATOM   1898 N  N      . ILE C 3 230 ? 3.412   23.561 -5.164  1.00 35.24  ? 230 ILE A N      1 
ATOM   1899 C  CA     . ILE C 3 230 ? 2.884   24.897 -4.880  1.00 35.51  ? 230 ILE A CA     1 
ATOM   1900 C  C      . ILE C 3 230 ? 1.407   24.963 -5.248  1.00 38.25  ? 230 ILE A C      1 
ATOM   1901 O  O      . ILE C 3 230 ? 0.583   25.494 -4.493  1.00 45.18  ? 230 ILE A O      1 
ATOM   1902 C  CB     . ILE C 3 230 ? 3.706   25.981 -5.611  1.00 39.42  ? 230 ILE A CB     1 
ATOM   1903 C  CG1    . ILE C 3 230 ? 3.877   27.208 -4.734  1.00 49.37  ? 230 ILE A CG1    1 
ATOM   1904 C  CG2    . ILE C 3 230 ? 3.005   26.449 -6.832  1.00 33.30  ? 230 ILE A CG2    1 
ATOM   1905 C  CD1    . ILE C 3 230 ? 4.860   27.005 -3.553  1.00 50.69  ? 230 ILE A CD1    1 
ATOM   1906 N  N      . HIS C 3 231 ? 1.036   24.398 -6.389  1.00 37.15  ? 231 HIS A N      1 
ATOM   1907 C  CA     . HIS C 3 231 ? -0.370  24.449 -6.763  1.00 38.11  ? 231 HIS A CA     1 
ATOM   1908 C  C      . HIS C 3 231 ? -1.225  23.467 -5.990  1.00 44.47  ? 231 HIS A C      1 
ATOM   1909 O  O      . HIS C 3 231 ? -2.461  23.597 -6.027  1.00 44.96  ? 231 HIS A O      1 
ATOM   1910 C  CB     . HIS C 3 231 ? -0.516  24.236 -8.267  1.00 31.91  ? 231 HIS A CB     1 
ATOM   1911 C  CG     . HIS C 3 231 ? -0.095  25.445 -9.062  1.00 42.69  ? 231 HIS A CG     1 
ATOM   1912 N  ND1    . HIS C 3 231 ? -0.709  26.676 -8.916  1.00 32.72  ? 231 HIS A ND1    1 
ATOM   1913 C  CD2    . HIS C 3 231 ? 0.895   25.624 -9.977  1.00 34.19  ? 231 HIS A CD2    1 
ATOM   1914 C  CE1    . HIS C 3 231 ? -0.115  27.558 -9.705  1.00 37.77  ? 231 HIS A CE1    1 
ATOM   1915 N  NE2    . HIS C 3 231 ? 0.861   26.946 -10.359 1.00 31.64  ? 231 HIS A NE2    1 
ATOM   1916 N  N      . SER C 3 232 ? -0.609  22.513 -5.274  1.00 35.07  ? 232 SER A N      1 
ATOM   1917 C  CA     . SER C 3 232 ? -1.404  21.644 -4.416  1.00 38.08  ? 232 SER A CA     1 
ATOM   1918 C  C      . SER C 3 232 ? -2.109  22.431 -3.317  1.00 38.08  ? 232 SER A C      1 
ATOM   1919 O  O      . SER C 3 232 ? -3.093  21.938 -2.750  1.00 45.02  ? 232 SER A O      1 
ATOM   1920 C  CB     . SER C 3 232 ? -0.544  20.538 -3.798  1.00 38.86  ? 232 SER A CB     1 
ATOM   1921 O  OG     . SER C 3 232 ? 0.279   21.071 -2.760  1.00 42.14  ? 232 SER A OG     1 
ATOM   1922 N  N      . LEU C 3 233 ? -1.656  23.650 -3.025  1.00 43.22  ? 233 LEU A N      1 
ATOM   1923 C  CA     . LEU C 3 233 ? -2.289  24.444 -1.979  1.00 43.59  ? 233 LEU A CA     1 
ATOM   1924 C  C      . LEU C 3 233 ? -3.659  24.910 -2.434  1.00 56.04  ? 233 LEU A C      1 
ATOM   1925 O  O      . LEU C 3 233 ? -3.913  25.082 -3.633  1.00 50.91  ? 233 LEU A O      1 
ATOM   1926 C  CB     . LEU C 3 233 ? -1.435  25.654 -1.625  1.00 41.71  ? 233 LEU A CB     1 
ATOM   1927 C  CG     . LEU C 3 233 ? 0.028   25.340 -1.334  1.00 43.26  ? 233 LEU A CG     1 
ATOM   1928 C  CD1    . LEU C 3 233 ? 0.772   26.600 -0.925  1.00 38.18  ? 233 LEU A CD1    1 
ATOM   1929 C  CD2    . LEU C 3 233 ? 0.145   24.289 -0.260  1.00 37.55  ? 233 LEU A CD2    1 
ATOM   1930 N  N      . ASN C 3 234 ? -4.545  25.132 -1.463  1.00 56.86  ? 234 ASN A N      1 
ATOM   1931 C  CA     . ASN C 3 234 ? -5.904  25.536 -1.781  1.00 53.30  ? 234 ASN A CA     1 
ATOM   1932 C  C      . ASN C 3 234 ? -6.198  26.987 -1.432  1.00 61.11  ? 234 ASN A C      1 
ATOM   1933 O  O      . ASN C 3 234 ? -7.295  27.471 -1.737  1.00 66.36  ? 234 ASN A O      1 
ATOM   1934 C  CB     . ASN C 3 234 ? -6.909  24.607 -1.094  1.00 61.19  ? 234 ASN A CB     1 
ATOM   1935 C  CG     . ASN C 3 234 ? -6.938  23.223 -1.733  1.00 63.88  ? 234 ASN A CG     1 
ATOM   1936 O  OD1    . ASN C 3 234 ? -7.359  23.068 -2.884  1.00 65.97  ? 234 ASN A OD1    1 
ATOM   1937 N  ND2    . ASN C 3 234 ? -6.471  22.216 -0.997  1.00 61.20  ? 234 ASN A ND2    1 
ATOM   1938 N  N      . HIS C 3 235 ? -5.255  27.692 -0.812  1.00 70.39  ? 235 HIS A N      1 
ATOM   1939 C  CA     . HIS C 3 235 ? -5.384  29.135 -0.647  1.00 68.02  ? 235 HIS A CA     1 
ATOM   1940 C  C      . HIS C 3 235 ? -4.073  29.720 -0.139  1.00 67.33  ? 235 HIS A C      1 
ATOM   1941 O  O      . HIS C 3 235 ? -3.300  29.058 0.557   1.00 62.24  ? 235 HIS A O      1 
ATOM   1942 C  CB     . HIS C 3 235 ? -6.523  29.515 0.306   1.00 65.86  ? 235 HIS A CB     1 
ATOM   1943 C  CG     . HIS C 3 235 ? -6.868  30.974 0.257   1.00 76.34  ? 235 HIS A CG     1 
ATOM   1944 N  ND1    . HIS C 3 235 ? -6.140  31.938 0.928   1.00 81.78  ? 235 HIS A ND1    1 
ATOM   1945 C  CD2    . HIS C 3 235 ? -7.843  31.638 -0.412  1.00 73.28  ? 235 HIS A CD2    1 
ATOM   1946 C  CE1    . HIS C 3 235 ? -6.663  33.128 0.686   1.00 86.88  ? 235 HIS A CE1    1 
ATOM   1947 N  NE2    . HIS C 3 235 ? -7.694  32.974 -0.127  1.00 85.38  ? 235 HIS A NE2    1 
ATOM   1948 N  N      . ILE C 3 236 ? -3.870  31.001 -0.467  1.00 60.02  ? 236 ILE A N      1 
ATOM   1949 C  CA     . ILE C 3 236 ? -2.635  31.718 -0.164  1.00 59.62  ? 236 ILE A CA     1 
ATOM   1950 C  C      . ILE C 3 236 ? -2.324  31.749 1.333   1.00 62.40  ? 236 ILE A C      1 
ATOM   1951 O  O      . ILE C 3 236 ? -1.153  31.831 1.726   1.00 57.62  ? 236 ILE A O      1 
ATOM   1952 C  CB     . ILE C 3 236 ? -2.732  33.139 -0.741  1.00 63.71  ? 236 ILE A CB     1 
ATOM   1953 C  CG1    . ILE C 3 236 ? -2.867  33.092 -2.241  1.00 59.31  ? 236 ILE A CG1    1 
ATOM   1954 C  CG2    . ILE C 3 236 ? -1.486  33.910 -0.447  1.00 70.81  ? 236 ILE A CG2    1 
ATOM   1955 C  CD1    . ILE C 3 236 ? -2.595  34.424 -2.846  1.00 61.82  ? 236 ILE A CD1    1 
ATOM   1956 N  N      . LYS C 3 237 ? -3.346  31.718 2.196   1.00 59.87  ? 237 LYS A N      1 
ATOM   1957 C  CA     . LYS C 3 237 ? -3.066  31.618 3.625   1.00 55.52  ? 237 LYS A CA     1 
ATOM   1958 C  C      . LYS C 3 237 ? -2.098  30.482 3.930   1.00 55.15  ? 237 LYS A C      1 
ATOM   1959 O  O      . LYS C 3 237 ? -1.339  30.559 4.902   1.00 69.29  ? 237 LYS A O      1 
ATOM   1960 C  CB     . LYS C 3 237 ? -4.363  31.426 4.410   1.00 49.91  ? 237 LYS A CB     1 
ATOM   1961 N  N      . GLU C 3 238 ? -2.099  29.420 3.118   1.00 55.00  ? 238 GLU A N      1 
ATOM   1962 C  CA     . GLU C 3 238 ? -1.271  28.260 3.432   1.00 54.43  ? 238 GLU A CA     1 
ATOM   1963 C  C      . GLU C 3 238 ? 0.209   28.479 3.128   1.00 48.22  ? 238 GLU A C      1 
ATOM   1964 O  O      . GLU C 3 238 ? 1.026   27.637 3.516   1.00 49.95  ? 238 GLU A O      1 
ATOM   1965 C  CB     . GLU C 3 238 ? -1.789  27.024 2.689   1.00 59.96  ? 238 GLU A CB     1 
ATOM   1966 C  CG     . GLU C 3 238 ? -3.026  26.367 3.311   1.00 61.89  ? 238 GLU A CG     1 
ATOM   1967 C  CD     . GLU C 3 238 ? -3.834  25.543 2.284   1.00 72.43  ? 238 GLU A CD     1 
ATOM   1968 O  OE1    . GLU C 3 238 ? -3.271  24.603 1.674   1.00 65.70  ? 238 GLU A OE1    1 
ATOM   1969 O  OE2    . GLU C 3 238 ? -5.027  25.855 2.075   1.00 70.94  ? 238 GLU A OE2    1 
ATOM   1970 N  N      . ILE C 3 239 ? 0.572   29.590 2.494   1.00 36.57  ? 239 ILE A N      1 
ATOM   1971 C  CA     . ILE C 3 239 ? 1.964   29.909 2.183   1.00 43.87  ? 239 ILE A CA     1 
ATOM   1972 C  C      . ILE C 3 239 ? 2.624   30.551 3.397   1.00 57.90  ? 239 ILE A C      1 
ATOM   1973 O  O      . ILE C 3 239 ? 2.236   31.657 3.808   1.00 52.88  ? 239 ILE A O      1 
ATOM   1974 C  CB     . ILE C 3 239 ? 2.070   30.857 0.977   1.00 50.06  ? 239 ILE A CB     1 
ATOM   1975 C  CG1    . ILE C 3 239 ? 1.678   30.151 -0.326  1.00 44.93  ? 239 ILE A CG1    1 
ATOM   1976 C  CG2    . ILE C 3 239 ? 3.465   31.473 0.900   1.00 48.18  ? 239 ILE A CG2    1 
ATOM   1977 C  CD1    . ILE C 3 239 ? 1.915   30.970 -1.558  1.00 51.17  ? 239 ILE A CD1    1 
ATOM   1978 N  N      . PRO C 3 240 ? 3.629   29.916 3.989   1.00 58.97  ? 240 PRO A N      1 
ATOM   1979 C  CA     . PRO C 3 240 ? 4.371   30.580 5.066   1.00 58.98  ? 240 PRO A CA     1 
ATOM   1980 C  C      . PRO C 3 240 ? 4.881   31.939 4.608   1.00 53.55  ? 240 PRO A C      1 
ATOM   1981 O  O      . PRO C 3 240 ? 5.534   32.057 3.571   1.00 61.49  ? 240 PRO A O      1 
ATOM   1982 C  CB     . PRO C 3 240 ? 5.518   29.606 5.359   1.00 47.85  ? 240 PRO A CB     1 
ATOM   1983 C  CG     . PRO C 3 240 ? 5.000   28.280 4.926   1.00 50.31  ? 240 PRO A CG     1 
ATOM   1984 C  CD     . PRO C 3 240 ? 4.141   28.564 3.709   1.00 57.74  ? 240 PRO A CD     1 
ATOM   1985 N  N      . GLY C 3 241 ? 4.581   32.969 5.402   1.00 55.61  ? 241 GLY A N      1 
ATOM   1986 C  CA     . GLY C 3 241 ? 4.845   34.349 5.048   1.00 61.24  ? 241 GLY A CA     1 
ATOM   1987 C  C      . GLY C 3 241 ? 3.594   35.172 4.829   1.00 65.52  ? 241 GLY A C      1 
ATOM   1988 O  O      . GLY C 3 241 ? 3.659   36.407 4.872   1.00 68.90  ? 241 GLY A O      1 
ATOM   1989 N  N      . ILE C 3 242 ? 2.460   34.517 4.621   1.00 55.15  ? 242 ILE A N      1 
ATOM   1990 C  CA     . ILE C 3 242 ? 1.190   35.163 4.354   1.00 59.42  ? 242 ILE A CA     1 
ATOM   1991 C  C      . ILE C 3 242 ? 0.265   34.772 5.496   1.00 62.88  ? 242 ILE A C      1 
ATOM   1992 O  O      . ILE C 3 242 ? -0.078  33.590 5.650   1.00 59.74  ? 242 ILE A O      1 
ATOM   1993 C  CB     . ILE C 3 242 ? 0.624   34.742 2.987   1.00 64.50  ? 242 ILE A CB     1 
ATOM   1994 C  CG1    . ILE C 3 242 ? 1.685   34.929 1.907   1.00 56.06  ? 242 ILE A CG1    1 
ATOM   1995 C  CG2    . ILE C 3 242 ? -0.604  35.526 2.620   1.00 58.83  ? 242 ILE A CG2    1 
ATOM   1996 C  CD1    . ILE C 3 242 ? 1.269   34.507 0.540   1.00 57.30  ? 242 ILE A CD1    1 
ATOM   1997 N  N      . GLY C 3 243 ? -0.133  35.754 6.307   1.00 72.36  ? 243 GLY A N      1 
ATOM   1998 C  CA     . GLY C 3 243 ? -0.910  35.512 7.516   1.00 70.27  ? 243 GLY A CA     1 
ATOM   1999 C  C      . GLY C 3 243 ? -2.352  35.977 7.406   1.00 72.83  ? 243 GLY A C      1 
ATOM   2000 O  O      . GLY C 3 243 ? -2.926  36.057 6.313   1.00 78.74  ? 243 GLY A O      1 
ATOM   2001 N  N      . TYR C 3 244 ? -2.953  36.286 8.566   1.00 78.05  ? 244 TYR A N      1 
ATOM   2002 C  CA     . TYR C 3 244 ? -4.346  36.726 8.570   1.00 78.37  ? 244 TYR A CA     1 
ATOM   2003 C  C      . TYR C 3 244 ? -4.488  38.090 7.915   1.00 74.14  ? 244 TYR A C      1 
ATOM   2004 O  O      . TYR C 3 244 ? -5.451  38.328 7.180   1.00 81.67  ? 244 TYR A O      1 
ATOM   2005 C  CB     . TYR C 3 244 ? -4.919  36.753 9.992   1.00 79.61  ? 244 TYR A CB     1 
ATOM   2006 C  CG     . TYR C 3 244 ? -6.379  36.319 10.043  1.00 94.68  ? 244 TYR A CG     1 
ATOM   2007 C  CD1    . TYR C 3 244 ? -6.719  34.968 10.151  1.00 105.62 ? 244 TYR A CD1    1 
ATOM   2008 C  CD2    . TYR C 3 244 ? -7.415  37.248 9.954   1.00 98.04  ? 244 TYR A CD2    1 
ATOM   2009 C  CE1    . TYR C 3 244 ? -8.047  34.548 10.176  1.00 111.17 ? 244 TYR A CE1    1 
ATOM   2010 C  CE2    . TYR C 3 244 ? -8.751  36.837 9.981   1.00 111.72 ? 244 TYR A CE2    1 
ATOM   2011 C  CZ     . TYR C 3 244 ? -9.057  35.483 10.092  1.00 110.60 ? 244 TYR A CZ     1 
ATOM   2012 O  OH     . TYR C 3 244 ? -10.368 35.058 10.121  1.00 101.35 ? 244 TYR A OH     1 
ATOM   2013 N  N      . LYS C 3 245 ? -3.532  38.988 8.142   1.00 67.96  ? 245 LYS A N      1 
ATOM   2014 C  CA     . LYS C 3 245 ? -3.643  40.326 7.569   1.00 79.23  ? 245 LYS A CA     1 
ATOM   2015 C  C      . LYS C 3 245 ? -3.449  40.307 6.053   1.00 65.03  ? 245 LYS A C      1 
ATOM   2016 O  O      . LYS C 3 245 ? -4.312  40.776 5.304   1.00 74.80  ? 245 LYS A O      1 
ATOM   2017 C  CB     . LYS C 3 245 ? -2.643  41.273 8.235   1.00 75.71  ? 245 LYS A CB     1 
ATOM   2018 N  N      . THR C 3 246 ? -2.323  39.781 5.573   1.00 66.33  ? 246 THR A N      1 
ATOM   2019 C  CA     . THR C 3 246 ? -2.073  39.830 4.133   1.00 70.28  ? 246 THR A CA     1 
ATOM   2020 C  C      . THR C 3 246 ? -3.108  39.011 3.365   1.00 66.44  ? 246 THR A C      1 
ATOM   2021 O  O      . THR C 3 246 ? -3.588  39.434 2.306   1.00 61.02  ? 246 THR A O      1 
ATOM   2022 C  CB     . THR C 3 246 ? -0.662  39.339 3.809   1.00 61.48  ? 246 THR A CB     1 
ATOM   2023 O  OG1    . THR C 3 246 ? 0.197   39.528 4.940   1.00 62.22  ? 246 THR A OG1    1 
ATOM   2024 C  CG2    . THR C 3 246 ? -0.106  40.102 2.625   1.00 66.28  ? 246 THR A CG2    1 
ATOM   2025 N  N      . ALA C 3 247 ? -3.462  37.833 3.881   1.00 69.24  ? 247 ALA A N      1 
ATOM   2026 C  CA     . ALA C 3 247 ? -4.525  37.041 3.274   1.00 69.14  ? 247 ALA A CA     1 
ATOM   2027 C  C      . ALA C 3 247 ? -5.780  37.881 3.068   1.00 75.87  ? 247 ALA A C      1 
ATOM   2028 O  O      . ALA C 3 247 ? -6.222  38.094 1.932   1.00 75.31  ? 247 ALA A O      1 
ATOM   2029 C  CB     . ALA C 3 247 ? -4.831  35.818 4.140   1.00 64.99  ? 247 ALA A CB     1 
ATOM   2030 N  N      . LYS C 3 248 ? -6.362  38.377 4.168   1.00 75.26  ? 248 LYS A N      1 
ATOM   2031 C  CA     . LYS C 3 248 ? -7.563  39.203 4.068   1.00 66.59  ? 248 LYS A CA     1 
ATOM   2032 C  C      . LYS C 3 248 ? -7.355  40.359 3.100   1.00 65.53  ? 248 LYS A C      1 
ATOM   2033 O  O      . LYS C 3 248 ? -8.244  40.683 2.304   1.00 71.41  ? 248 LYS A O      1 
ATOM   2034 C  CB     . LYS C 3 248 ? -7.969  39.725 5.449   1.00 63.64  ? 248 LYS A CB     1 
ATOM   2035 N  N      . CYS C 3 249 ? -6.182  40.987 3.139   1.00 55.77  ? 249 CYS A N      1 
ATOM   2036 C  CA     . CYS C 3 249 ? -5.916  42.061 2.193   1.00 61.44  ? 249 CYS A CA     1 
ATOM   2037 C  C      . CYS C 3 249 ? -5.988  41.543 0.765   1.00 76.71  ? 249 CYS A C      1 
ATOM   2038 O  O      . CYS C 3 249 ? -6.659  42.137 -0.089  1.00 77.71  ? 249 CYS A O      1 
ATOM   2039 C  CB     . CYS C 3 249 ? -4.555  42.694 2.481   1.00 69.57  ? 249 CYS A CB     1 
ATOM   2040 S  SG     . CYS C 3 249 ? -3.983  43.906 1.252   1.00 90.24  ? 249 CYS A SG     1 
ATOM   2041 N  N      . LEU C 3 250 ? -5.328  40.409 0.497   1.00 79.18  ? 250 LEU A N      1 
ATOM   2042 C  CA     . LEU C 3 250 ? -5.278  39.869 -0.860  1.00 74.06  ? 250 LEU A CA     1 
ATOM   2043 C  C      . LEU C 3 250 ? -6.664  39.484 -1.369  1.00 68.29  ? 250 LEU A C      1 
ATOM   2044 O  O      . LEU C 3 250 ? -6.961  39.658 -2.556  1.00 62.77  ? 250 LEU A O      1 
ATOM   2045 C  CB     . LEU C 3 250 ? -4.330  38.669 -0.915  1.00 59.69  ? 250 LEU A CB     1 
ATOM   2046 C  CG     . LEU C 3 250 ? -2.855  39.041 -1.056  1.00 58.69  ? 250 LEU A CG     1 
ATOM   2047 C  CD1    . LEU C 3 250 ? -1.944  37.838 -0.879  1.00 60.75  ? 250 LEU A CD1    1 
ATOM   2048 C  CD2    . LEU C 3 250 ? -2.605  39.702 -2.386  1.00 64.94  ? 250 LEU A CD2    1 
ATOM   2049 N  N      . GLU C 3 251 ? -7.523  38.953 -0.494  1.00 63.76  ? 251 GLU A N      1 
ATOM   2050 C  CA     . GLU C 3 251 ? -8.876  38.601 -0.918  1.00 64.86  ? 251 GLU A CA     1 
ATOM   2051 C  C      . GLU C 3 251 ? -9.616  39.815 -1.458  1.00 78.15  ? 251 GLU A C      1 
ATOM   2052 O  O      . GLU C 3 251 ? -10.331 39.722 -2.464  1.00 78.51  ? 251 GLU A O      1 
ATOM   2053 C  CB     . GLU C 3 251 ? -9.651  37.989 0.242   1.00 64.52  ? 251 GLU A CB     1 
ATOM   2054 C  CG     . GLU C 3 251 ? -8.803  37.077 1.103   1.00 79.19  ? 251 GLU A CG     1 
ATOM   2055 C  CD     . GLU C 3 251 ? -9.622  36.026 1.816   1.00 96.14  ? 251 GLU A CD     1 
ATOM   2056 O  OE1    . GLU C 3 251 ? -10.849 35.965 1.557   1.00 100.96 ? 251 GLU A OE1    1 
ATOM   2057 O  OE2    . GLU C 3 251 ? -9.037  35.262 2.627   1.00 100.68 ? 251 GLU A OE2    1 
ATOM   2058 N  N      . ALA C 3 252 ? -9.459  40.965 -0.797  1.00 80.67  ? 252 ALA A N      1 
ATOM   2059 C  CA     . ALA C 3 252 ? -10.088 42.196 -1.255  1.00 76.07  ? 252 ALA A CA     1 
ATOM   2060 C  C      . ALA C 3 252 ? -9.715  42.536 -2.691  1.00 69.84  ? 252 ALA A C      1 
ATOM   2061 O  O      . ALA C 3 252 ? -10.448 43.287 -3.344  1.00 73.05  ? 252 ALA A O      1 
ATOM   2062 C  CB     . ALA C 3 252 ? -9.708  43.357 -0.329  1.00 74.34  ? 252 ALA A CB     1 
ATOM   2063 N  N      . LEU C 3 253 ? -8.594  42.016 -3.192  1.00 59.28  ? 253 LEU A N      1 
ATOM   2064 C  CA     . LEU C 3 253 ? -8.210  42.195 -4.585  1.00 66.15  ? 253 LEU A CA     1 
ATOM   2065 C  C      . LEU C 3 253 ? -8.587  41.001 -5.454  1.00 67.03  ? 253 LEU A C      1 
ATOM   2066 O  O      . LEU C 3 253 ? -8.075  40.881 -6.575  1.00 67.51  ? 253 LEU A O      1 
ATOM   2067 C  CB     . LEU C 3 253 ? -6.703  42.455 -4.708  1.00 67.09  ? 253 LEU A CB     1 
ATOM   2068 C  CG     . LEU C 3 253 ? -6.015  43.448 -3.764  1.00 69.84  ? 253 LEU A CG     1 
ATOM   2069 C  CD1    . LEU C 3 253 ? -5.602  42.764 -2.477  1.00 68.95  ? 253 LEU A CD1    1 
ATOM   2070 C  CD2    . LEU C 3 253 ? -4.806  44.084 -4.437  1.00 77.80  ? 253 LEU A CD2    1 
ATOM   2071 N  N      . GLY C 3 254 ? -9.452  40.113 -4.963  1.00 51.63  ? 254 GLY A N      1 
ATOM   2072 C  CA     . GLY C 3 254 ? -9.819  38.944 -5.740  1.00 67.40  ? 254 GLY A CA     1 
ATOM   2073 C  C      . GLY C 3 254 ? -8.678  37.997 -6.040  1.00 67.28  ? 254 GLY A C      1 
ATOM   2074 O  O      . GLY C 3 254 ? -8.657  37.367 -7.110  1.00 65.10  ? 254 GLY A O      1 
ATOM   2075 N  N      . ILE C 3 255 ? -7.713  37.899 -5.135  1.00 65.66  ? 255 ILE A N      1 
ATOM   2076 C  CA     . ILE C 3 255 ? -6.662  36.895 -5.196  1.00 57.67  ? 255 ILE A CA     1 
ATOM   2077 C  C      . ILE C 3 255 ? -7.024  35.812 -4.192  1.00 60.40  ? 255 ILE A C      1 
ATOM   2078 O  O      . ILE C 3 255 ? -7.075  36.058 -2.983  1.00 69.78  ? 255 ILE A O      1 
ATOM   2079 C  CB     . ILE C 3 255 ? -5.290  37.499 -4.902  1.00 56.17  ? 255 ILE A CB     1 
ATOM   2080 C  CG1    . ILE C 3 255 ? -5.045  38.675 -5.839  1.00 57.27  ? 255 ILE A CG1    1 
ATOM   2081 C  CG2    . ILE C 3 255 ? -4.197  36.448 -5.050  1.00 55.93  ? 255 ILE A CG2    1 
ATOM   2082 C  CD1    . ILE C 3 255 ? -3.658  39.264 -5.705  1.00 58.75  ? 255 ILE A CD1    1 
ATOM   2083 N  N      . ASN C 3 256 ? -7.316  34.615 -4.683  1.00 62.94  ? 256 ASN A N      1 
ATOM   2084 C  CA     . ASN C 3 256 ? -7.696  33.523 -3.801  1.00 63.28  ? 256 ASN A CA     1 
ATOM   2085 C  C      . ASN C 3 256 ? -6.886  32.261 -3.993  1.00 62.44  ? 256 ASN A C      1 
ATOM   2086 O  O      . ASN C 3 256 ? -6.764  31.487 -3.044  1.00 74.12  ? 256 ASN A O      1 
ATOM   2087 C  CB     . ASN C 3 256 ? -9.185  33.199 -3.969  1.00 60.09  ? 256 ASN A CB     1 
ATOM   2088 C  CG     . ASN C 3 256 ? -10.069 34.341 -3.509  1.00 74.69  ? 256 ASN A CG     1 
ATOM   2089 O  OD1    . ASN C 3 256 ? -10.203 34.592 -2.305  1.00 80.72  ? 256 ASN A OD1    1 
ATOM   2090 N  ND2    . ASN C 3 256 ? -10.647 35.063 -4.463  1.00 65.98  ? 256 ASN A ND2    1 
ATOM   2091 N  N      . SER C 3 257 ? -6.324  32.026 -5.162  1.00 58.56  ? 257 SER A N      1 
ATOM   2092 C  CA     . SER C 3 257 ? -5.511  30.855 -5.406  1.00 46.33  ? 257 SER A CA     1 
ATOM   2093 C  C      . SER C 3 257 ? -4.048  31.256 -5.547  1.00 46.98  ? 257 SER A C      1 
ATOM   2094 O  O      . SER C 3 257 ? -3.714  32.421 -5.784  1.00 46.41  ? 257 SER A O      1 
ATOM   2095 C  CB     . SER C 3 257 ? -5.989  30.133 -6.664  1.00 43.77  ? 257 SER A CB     1 
ATOM   2096 O  OG     . SER C 3 257 ? -5.539  30.813 -7.822  1.00 52.42  ? 257 SER A OG     1 
ATOM   2097 N  N      . VAL C 3 258 ? -3.168  30.265 -5.403  1.00 39.31  ? 258 VAL A N      1 
ATOM   2098 C  CA     . VAL C 3 258 ? -1.756  30.523 -5.646  1.00 38.06  ? 258 VAL A CA     1 
ATOM   2099 C  C      . VAL C 3 258 ? -1.546  31.058 -7.053  1.00 42.89  ? 258 VAL A C      1 
ATOM   2100 O  O      . VAL C 3 258 ? -0.688  31.921 -7.273  1.00 47.46  ? 258 VAL A O      1 
ATOM   2101 C  CB     . VAL C 3 258 ? -0.923  29.250 -5.389  1.00 40.68  ? 258 VAL A CB     1 
ATOM   2102 C  CG1    . VAL C 3 258 ? 0.519   29.469 -5.794  1.00 45.05  ? 258 VAL A CG1    1 
ATOM   2103 C  CG2    . VAL C 3 258 ? -1.006  28.862 -3.940  1.00 38.41  ? 258 VAL A CG2    1 
ATOM   2104 N  N      . ARG C 3 259 ? -2.317  30.570 -8.034  1.00 46.29  ? 259 ARG A N      1 
ATOM   2105 C  CA     . ARG C 3 259 ? -2.104  31.057 -9.391  1.00 48.47  ? 259 ARG A CA     1 
ATOM   2106 C  C      . ARG C 3 259 ? -2.588  32.493 -9.549  1.00 45.86  ? 259 ARG A C      1 
ATOM   2107 O  O      . ARG C 3 259 ? -1.976  33.262 -10.302 1.00 49.53  ? 259 ARG A O      1 
ATOM   2108 C  CB     . ARG C 3 259 ? -2.771  30.149 -10.432 1.00 43.88  ? 259 ARG A CB     1 
ATOM   2109 C  CG     . ARG C 3 259 ? -2.315  30.504 -11.872 1.00 42.12  ? 259 ARG A CG     1 
ATOM   2110 C  CD     . ARG C 3 259 ? -2.704  29.499 -12.944 1.00 37.36  ? 259 ARG A CD     1 
ATOM   2111 N  NE     . ARG C 3 259 ? -2.708  28.119 -12.473 1.00 40.54  ? 259 ARG A NE     1 
ATOM   2112 C  CZ     . ARG C 3 259 ? -1.711  27.244 -12.641 1.00 41.24  ? 259 ARG A CZ     1 
ATOM   2113 N  NH1    . ARG C 3 259 ? -0.590  27.593 -13.269 1.00 28.05  ? 259 ARG A NH1    1 
ATOM   2114 N  NH2    . ARG C 3 259 ? -1.837  26.003 -12.165 1.00 33.90  ? 259 ARG A NH2    1 
ATOM   2115 N  N      . ASP C 3 260 ? -3.674  32.872 -8.863  1.00 41.97  ? 260 ASP A N      1 
ATOM   2116 C  CA     . ASP C 3 260 ? -4.075  34.284 -8.814  1.00 51.12  ? 260 ASP A CA     1 
ATOM   2117 C  C      . ASP C 3 260 ? -2.901  35.172 -8.433  1.00 55.42  ? 260 ASP A C      1 
ATOM   2118 O  O      . ASP C 3 260 ? -2.535  36.097 -9.169  1.00 54.15  ? 260 ASP A O      1 
ATOM   2119 C  CB     . ASP C 3 260 ? -5.211  34.502 -7.805  1.00 52.36  ? 260 ASP A CB     1 
ATOM   2120 C  CG     . ASP C 3 260 ? -6.518  33.874 -8.240  1.00 55.63  ? 260 ASP A CG     1 
ATOM   2121 O  OD1    . ASP C 3 260 ? -6.771  33.773 -9.471  1.00 49.31  ? 260 ASP A OD1    1 
ATOM   2122 O  OD2    . ASP C 3 260 ? -7.287  33.482 -7.332  1.00 50.44  ? 260 ASP A OD2    1 
ATOM   2123 N  N      . LEU C 3 261 ? -2.296  34.897 -7.269  1.00 52.44  ? 261 LEU A N      1 
ATOM   2124 C  CA     . LEU C 3 261 ? -1.123  35.652 -6.841  1.00 52.48  ? 261 LEU A CA     1 
ATOM   2125 C  C      . LEU C 3 261 ? 0.009   35.537 -7.852  1.00 51.26  ? 261 LEU A C      1 
ATOM   2126 O  O      . LEU C 3 261 ? 0.716   36.517 -8.115  1.00 64.11  ? 261 LEU A O      1 
ATOM   2127 C  CB     . LEU C 3 261 ? -0.659  35.172 -5.469  1.00 59.65  ? 261 LEU A CB     1 
ATOM   2128 C  CG     . LEU C 3 261 ? 0.453   35.967 -4.774  1.00 59.03  ? 261 LEU A CG     1 
ATOM   2129 C  CD1    . LEU C 3 261 ? 0.015   37.392 -4.440  1.00 63.86  ? 261 LEU A CD1    1 
ATOM   2130 C  CD2    . LEU C 3 261 ? 0.871   35.254 -3.510  1.00 56.63  ? 261 LEU A CD2    1 
ATOM   2131 N  N      . GLN C 3 262 ? 0.192   34.352 -8.438  1.00 54.46  ? 262 GLN A N      1 
ATOM   2132 C  CA     . GLN C 3 262 ? 1.250   34.177 -9.431  1.00 59.42  ? 262 GLN A CA     1 
ATOM   2133 C  C      . GLN C 3 262 ? 1.058   35.125 -10.606 1.00 60.25  ? 262 GLN A C      1 
ATOM   2134 O  O      . GLN C 3 262 ? 2.012   35.767 -11.065 1.00 56.05  ? 262 GLN A O      1 
ATOM   2135 C  CB     . GLN C 3 262 ? 1.289   32.730 -9.928  1.00 58.71  ? 262 GLN A CB     1 
ATOM   2136 C  CG     . GLN C 3 262 ? 2.198   31.794 -9.152  1.00 53.13  ? 262 GLN A CG     1 
ATOM   2137 C  CD     . GLN C 3 262 ? 2.398   30.467 -9.885  1.00 53.38  ? 262 GLN A CD     1 
ATOM   2138 O  OE1    . GLN C 3 262 ? 1.914   30.292 -11.014 1.00 57.96  ? 262 GLN A OE1    1 
ATOM   2139 N  NE2    . GLN C 3 262 ? 3.119   29.532 -9.255  1.00 37.15  ? 262 GLN A NE2    1 
ATOM   2140 N  N      . THR C 3 263 ? -0.173  35.218 -11.109 1.00 58.82  ? 263 THR A N      1 
ATOM   2141 C  CA     . THR C 3 263 ? -0.466  36.008 -12.295 1.00 60.87  ? 263 THR A CA     1 
ATOM   2142 C  C      . THR C 3 263 ? -0.883  37.442 -11.976 1.00 62.98  ? 263 THR A C      1 
ATOM   2143 O  O      . THR C 3 263 ? -1.009  38.250 -12.901 1.00 65.32  ? 263 THR A O      1 
ATOM   2144 C  CB     . THR C 3 263 ? -1.568  35.326 -13.126 1.00 50.51  ? 263 THR A CB     1 
ATOM   2145 O  OG1    . THR C 3 263 ? -2.720  35.097 -12.306 1.00 54.70  ? 263 THR A OG1    1 
ATOM   2146 C  CG2    . THR C 3 263 ? -1.079  34.008 -13.705 1.00 45.73  ? 263 THR A CG2    1 
ATOM   2147 N  N      . PHE C 3 264 ? -1.101  37.784 -10.709 1.00 59.55  ? 264 PHE A N      1 
ATOM   2148 C  CA     . PHE C 3 264 ? -1.532  39.137 -10.404 1.00 61.19  ? 264 PHE A CA     1 
ATOM   2149 C  C      . PHE C 3 264 ? -0.467  40.151 -10.818 1.00 66.21  ? 264 PHE A C      1 
ATOM   2150 O  O      . PHE C 3 264 ? 0.712   39.821 -11.010 1.00 64.98  ? 264 PHE A O      1 
ATOM   2151 C  CB     . PHE C 3 264 ? -1.856  39.287 -8.922  1.00 66.55  ? 264 PHE A CB     1 
ATOM   2152 C  CG     . PHE C 3 264 ? -2.799  40.422 -8.633  1.00 72.30  ? 264 PHE A CG     1 
ATOM   2153 C  CD1    . PHE C 3 264 ? -2.312  41.675 -8.270  1.00 80.96  ? 264 PHE A CD1    1 
ATOM   2154 C  CD2    . PHE C 3 264 ? -4.173  40.240 -8.750  1.00 70.23  ? 264 PHE A CD2    1 
ATOM   2155 C  CE1    . PHE C 3 264 ? -3.176  42.718 -8.012  1.00 76.85  ? 264 PHE A CE1    1 
ATOM   2156 C  CE2    . PHE C 3 264 ? -5.045  41.270 -8.498  1.00 71.18  ? 264 PHE A CE2    1 
ATOM   2157 C  CZ     . PHE C 3 264 ? -4.549  42.513 -8.122  1.00 76.08  ? 264 PHE A CZ     1 
ATOM   2158 N  N      . SER C 3 265 ? -0.899  41.404 -10.957 1.00 65.79  ? 265 SER A N      1 
ATOM   2159 C  CA     . SER C 3 265 ? -0.015  42.419 -11.518 1.00 72.52  ? 265 SER A CA     1 
ATOM   2160 C  C      . SER C 3 265 ? 0.991   42.886 -10.477 1.00 68.71  ? 265 SER A C      1 
ATOM   2161 O  O      . SER C 3 265 ? 0.596   43.326 -9.389  1.00 68.15  ? 265 SER A O      1 
ATOM   2162 C  CB     . SER C 3 265 ? -0.795  43.613 -12.048 1.00 73.45  ? 265 SER A CB     1 
ATOM   2163 O  OG     . SER C 3 265 ? 0.098   44.573 -12.595 1.00 78.12  ? 265 SER A OG     1 
ATOM   2164 N  N      . PRO C 3 266 ? 2.289   42.833 -10.777 1.00 63.56  ? 266 PRO A N      1 
ATOM   2165 C  CA     . PRO C 3 266 ? 3.281   43.290 -9.793  1.00 62.79  ? 266 PRO A CA     1 
ATOM   2166 C  C      . PRO C 3 266 ? 2.993   44.690 -9.278  1.00 73.26  ? 266 PRO A C      1 
ATOM   2167 O  O      . PRO C 3 266 ? 2.811   44.889 -8.069  1.00 70.23  ? 266 PRO A O      1 
ATOM   2168 C  CB     . PRO C 3 266 ? 4.597   43.217 -10.580 1.00 57.02  ? 266 PRO A CB     1 
ATOM   2169 C  CG     . PRO C 3 266 ? 4.334   42.242 -11.694 1.00 54.85  ? 266 PRO A CG     1 
ATOM   2170 C  CD     . PRO C 3 266 ? 2.903   42.457 -12.062 1.00 59.40  ? 266 PRO A CD     1 
ATOM   2171 N  N      . LYS C 3 267 ? 2.913   45.666 -10.183 1.00 78.95  ? 267 LYS A N      1 
ATOM   2172 C  CA     . LYS C 3 267 ? 2.732   47.055 -9.775  1.00 78.93  ? 267 LYS A CA     1 
ATOM   2173 C  C      . LYS C 3 267 ? 1.567   47.199 -8.800  1.00 74.17  ? 267 LYS A C      1 
ATOM   2174 O  O      . LYS C 3 267 ? 1.711   47.786 -7.721  1.00 76.36  ? 267 LYS A O      1 
ATOM   2175 C  CB     . LYS C 3 267 ? 2.525   47.932 -11.012 1.00 81.35  ? 267 LYS A CB     1 
ATOM   2176 C  CG     . LYS C 3 267 ? 3.209   47.402 -12.272 1.00 78.52  ? 267 LYS A CG     1 
ATOM   2177 C  CD     . LYS C 3 267 ? 4.681   47.094 -12.031 1.00 81.20  ? 267 LYS A CD     1 
ATOM   2178 N  N      . ILE C 3 268 ? 0.402   46.656 -9.155  1.00 69.79  ? 268 ILE A N      1 
ATOM   2179 C  CA     . ILE C 3 268 ? -0.765  46.820 -8.292  1.00 77.40  ? 268 ILE A CA     1 
ATOM   2180 C  C      . ILE C 3 268 ? -0.494  46.232 -6.915  1.00 79.83  ? 268 ILE A C      1 
ATOM   2181 O  O      . ILE C 3 268 ? -0.995  46.735 -5.900  1.00 69.73  ? 268 ILE A O      1 
ATOM   2182 C  CB     . ILE C 3 268 ? -2.019  46.185 -8.933  1.00 73.34  ? 268 ILE A CB     1 
ATOM   2183 C  CG1    . ILE C 3 268 ? -2.379  46.863 -10.265 1.00 74.78  ? 268 ILE A CG1    1 
ATOM   2184 C  CG2    . ILE C 3 268 ? -3.194  46.261 -7.968  1.00 68.52  ? 268 ILE A CG2    1 
ATOM   2185 C  CD1    . ILE C 3 268 ? -1.375  46.637 -11.416 1.00 77.38  ? 268 ILE A CD1    1 
ATOM   2186 N  N      . LEU C 3 269 ? 0.304   45.162 -6.859  1.00 86.23  ? 269 LEU A N      1 
ATOM   2187 C  CA     . LEU C 3 269 ? 0.537   44.466 -5.598  1.00 79.31  ? 269 LEU A CA     1 
ATOM   2188 C  C      . LEU C 3 269 ? 1.439   45.283 -4.680  1.00 71.79  ? 269 LEU A C      1 
ATOM   2189 O  O      . LEU C 3 269 ? 1.209   45.347 -3.465  1.00 76.41  ? 269 LEU A O      1 
ATOM   2190 C  CB     . LEU C 3 269 ? 1.136   43.089 -5.890  1.00 59.38  ? 269 LEU A CB     1 
ATOM   2191 C  CG     . LEU C 3 269 ? 1.061   42.026 -4.813  1.00 69.64  ? 269 LEU A CG     1 
ATOM   2192 C  CD1    . LEU C 3 269 ? -0.380  41.780 -4.359  1.00 60.04  ? 269 LEU A CD1    1 
ATOM   2193 C  CD2    . LEU C 3 269 ? 1.701   40.763 -5.364  1.00 70.58  ? 269 LEU A CD2    1 
ATOM   2194 N  N      . GLU C 3 270 ? 2.467   45.921 -5.250  1.00 69.95  ? 270 GLU A N      1 
ATOM   2195 C  CA     . GLU C 3 270 ? 3.317   46.813 -4.468  1.00 72.53  ? 270 GLU A CA     1 
ATOM   2196 C  C      . GLU C 3 270 ? 2.502   47.928 -3.825  1.00 71.83  ? 270 GLU A C      1 
ATOM   2197 O  O      . GLU C 3 270 ? 2.710   48.259 -2.653  1.00 75.77  ? 270 GLU A O      1 
ATOM   2198 C  CB     . GLU C 3 270 ? 4.419   47.399 -5.351  1.00 72.15  ? 270 GLU A CB     1 
ATOM   2199 C  CG     . GLU C 3 270 ? 5.324   46.361 -5.989  1.00 78.08  ? 270 GLU A CG     1 
ATOM   2200 C  CD     . GLU C 3 270 ? 6.270   46.968 -7.013  1.00 86.39  ? 270 GLU A CD     1 
ATOM   2201 O  OE1    . GLU C 3 270 ? 6.922   46.205 -7.773  1.00 76.71  ? 270 GLU A OE1    1 
ATOM   2202 O  OE2    . GLU C 3 270 ? 6.356   48.217 -7.048  1.00 87.19  ? 270 GLU A OE2    1 
ATOM   2203 N  N      . LYS C 3 271 ? 1.545   48.499 -4.565  1.00 76.75  ? 271 LYS A N      1 
ATOM   2204 C  CA     . LYS C 3 271 ? 0.827   49.669 -4.069  1.00 75.04  ? 271 LYS A CA     1 
ATOM   2205 C  C      . LYS C 3 271 ? -0.028  49.334 -2.849  1.00 82.29  ? 271 LYS A C      1 
ATOM   2206 O  O      . LYS C 3 271 ? -0.180  50.165 -1.945  1.00 92.52  ? 271 LYS A O      1 
ATOM   2207 C  CB     . LYS C 3 271 ? -0.026  50.277 -5.184  1.00 80.81  ? 271 LYS A CB     1 
ATOM   2208 N  N      . GLU C 3 272 ? -0.590  48.124 -2.794  1.00 81.31  ? 272 GLU A N      1 
ATOM   2209 C  CA     . GLU C 3 272 ? -1.451  47.773 -1.667  1.00 80.67  ? 272 GLU A CA     1 
ATOM   2210 C  C      . GLU C 3 272 ? -0.672  47.196 -0.496  1.00 84.55  ? 272 GLU A C      1 
ATOM   2211 O  O      . GLU C 3 272 ? -1.195  47.146 0.625   1.00 88.60  ? 272 GLU A O      1 
ATOM   2212 C  CB     . GLU C 3 272 ? -2.526  46.770 -2.097  1.00 84.46  ? 272 GLU A CB     1 
ATOM   2213 C  CG     . GLU C 3 272 ? -3.757  47.402 -2.715  1.00 87.68  ? 272 GLU A CG     1 
ATOM   2214 C  CD     . GLU C 3 272 ? -3.412  48.322 -3.877  1.00 98.57  ? 272 GLU A CD     1 
ATOM   2215 O  OE1    . GLU C 3 272 ? -2.233  48.326 -4.300  1.00 94.23  ? 272 GLU A OE1    1 
ATOM   2216 O  OE2    . GLU C 3 272 ? -4.315  49.040 -4.364  1.00 98.74  ? 272 GLU A OE2    1 
ATOM   2217 N  N      . LEU C 3 273 ? 0.561   46.751 -0.724  1.00 82.39  ? 273 LEU A N      1 
ATOM   2218 C  CA     . LEU C 3 273 ? 1.318   46.055 0.305   1.00 85.37  ? 273 LEU A CA     1 
ATOM   2219 C  C      . LEU C 3 273 ? 2.731   46.591 0.476   1.00 79.82  ? 273 LEU A C      1 
ATOM   2220 O  O      . LEU C 3 273 ? 3.420   46.194 1.427   1.00 74.01  ? 273 LEU A O      1 
ATOM   2221 C  CB     . LEU C 3 273 ? 1.355   44.549 -0.004  1.00 81.86  ? 273 LEU A CB     1 
ATOM   2222 C  CG     . LEU C 3 273 ? -0.018  43.864 -0.099  1.00 86.12  ? 273 LEU A CG     1 
ATOM   2223 C  CD1    . LEU C 3 273 ? 0.103   42.352 -0.240  1.00 69.69  ? 273 LEU A CD1    1 
ATOM   2224 C  CD2    . LEU C 3 273 ? -0.887  44.229 1.108   1.00 81.43  ? 273 LEU A CD2    1 
ATOM   2225 N  N      . GLY C 3 274 ? 3.168   47.504 -0.386  1.00 71.41  ? 274 GLY A N      1 
ATOM   2226 C  CA     . GLY C 3 274 ? 4.514   48.015 -0.309  1.00 58.35  ? 274 GLY A CA     1 
ATOM   2227 C  C      . GLY C 3 274 ? 5.439   47.102 -1.064  1.00 67.71  ? 274 GLY A C      1 
ATOM   2228 O  O      . GLY C 3 274 ? 5.236   45.891 -1.064  1.00 74.24  ? 274 GLY A O      1 
ATOM   2229 N  N      . ILE C 3 275 ? 6.453   47.661 -1.716  1.00 61.42  ? 275 ILE A N      1 
ATOM   2230 C  CA     . ILE C 3 275 ? 7.325   46.838 -2.546  1.00 71.16  ? 275 ILE A CA     1 
ATOM   2231 C  C      . ILE C 3 275 ? 7.847   45.635 -1.769  1.00 75.25  ? 275 ILE A C      1 
ATOM   2232 O  O      . ILE C 3 275 ? 8.107   44.569 -2.345  1.00 69.66  ? 275 ILE A O      1 
ATOM   2233 C  CB     . ILE C 3 275 ? 8.484   47.680 -3.096  1.00 73.79  ? 275 ILE A CB     1 
ATOM   2234 C  CG1    . ILE C 3 275 ? 9.211   46.890 -4.192  1.00 74.27  ? 275 ILE A CG1    1 
ATOM   2235 C  CG2    . ILE C 3 275 ? 9.440   48.056 -1.953  1.00 65.00  ? 275 ILE A CG2    1 
ATOM   2236 C  CD1    . ILE C 3 275 ? 9.802   47.740 -5.327  1.00 73.78  ? 275 ILE A CD1    1 
ATOM   2237 N  N      . SER C 3 276 ? 8.029   45.788 -0.457  1.00 74.24  ? 276 SER A N      1 
ATOM   2238 C  CA     . SER C 3 276 ? 8.564   44.690 0.336   1.00 80.82  ? 276 SER A CA     1 
ATOM   2239 C  C      . SER C 3 276 ? 7.635   43.490 0.259   1.00 69.96  ? 276 SER A C      1 
ATOM   2240 O  O      . SER C 3 276 ? 7.862   42.556 -0.520  1.00 67.02  ? 276 SER A O      1 
ATOM   2241 C  CB     . SER C 3 276 ? 8.756   45.105 1.800   1.00 74.68  ? 276 SER A CB     1 
ATOM   2242 O  OG     . SER C 3 276 ? 9.219   44.012 2.586   1.00 68.43  ? 276 SER A OG     1 
ATOM   2243 N  N      . VAL C 3 277 ? 6.579   43.532 1.068   1.00 60.99  ? 277 VAL A N      1 
ATOM   2244 C  CA     . VAL C 3 277 ? 5.643   42.419 1.146   1.00 69.47  ? 277 VAL A CA     1 
ATOM   2245 C  C      . VAL C 3 277 ? 5.246   41.947 -0.250  1.00 73.93  ? 277 VAL A C      1 
ATOM   2246 O  O      . VAL C 3 277 ? 5.105   40.742 -0.498  1.00 70.11  ? 277 VAL A O      1 
ATOM   2247 C  CB     . VAL C 3 277 ? 4.426   42.828 1.996   1.00 67.50  ? 277 VAL A CB     1 
ATOM   2248 C  CG1    . VAL C 3 277 ? 3.461   41.665 2.164   1.00 66.31  ? 277 VAL A CG1    1 
ATOM   2249 C  CG2    . VAL C 3 277 ? 4.898   43.334 3.353   1.00 73.70  ? 277 VAL A CG2    1 
ATOM   2250 N  N      . ALA C 3 278 ? 5.091   42.879 -1.192  1.00 73.95  ? 278 ALA A N      1 
ATOM   2251 C  CA     . ALA C 3 278 ? 4.649   42.494 -2.527  1.00 64.89  ? 278 ALA A CA     1 
ATOM   2252 C  C      . ALA C 3 278 ? 5.631   41.529 -3.169  1.00 60.03  ? 278 ALA A C      1 
ATOM   2253 O  O      . ALA C 3 278 ? 5.266   40.401 -3.515  1.00 66.88  ? 278 ALA A O      1 
ATOM   2254 C  CB     . ALA C 3 278 ? 4.448   43.727 -3.409  1.00 67.71  ? 278 ALA A CB     1 
ATOM   2255 N  N      . GLN C 3 279 ? 6.886   41.940 -3.337  1.00 59.97  ? 279 GLN A N      1 
ATOM   2256 C  CA     . GLN C 3 279 ? 7.788   41.110 -4.135  1.00 64.22  ? 279 GLN A CA     1 
ATOM   2257 C  C      . GLN C 3 279 ? 8.105   39.789 -3.446  1.00 65.21  ? 279 GLN A C      1 
ATOM   2258 O  O      . GLN C 3 279 ? 8.172   38.745 -4.105  1.00 70.36  ? 279 GLN A O      1 
ATOM   2259 C  CB     . GLN C 3 279 ? 9.071   41.853 -4.435  1.00 56.96  ? 279 GLN A CB     1 
ATOM   2260 C  CG     . GLN C 3 279 ? 8.848   43.203 -4.978  1.00 65.67  ? 279 GLN A CG     1 
ATOM   2261 C  CD     . GLN C 3 279 ? 10.129  43.759 -5.478  1.00 82.52  ? 279 GLN A CD     1 
ATOM   2262 O  OE1    . GLN C 3 279 ? 10.223  44.945 -5.778  1.00 90.64  ? 279 GLN A OE1    1 
ATOM   2263 N  NE2    . GLN C 3 279 ? 11.146  42.898 -5.582  1.00 73.01  ? 279 GLN A NE2    1 
ATOM   2264 N  N      . ARG C 3 280 ? 8.317   39.807 -2.129  1.00 54.41  ? 280 ARG A N      1 
ATOM   2265 C  CA     . ARG C 3 280 ? 8.635   38.563 -1.441  1.00 55.86  ? 280 ARG A CA     1 
ATOM   2266 C  C      . ARG C 3 280 ? 7.502   37.562 -1.607  1.00 56.31  ? 280 ARG A C      1 
ATOM   2267 O  O      . ARG C 3 280 ? 7.726   36.412 -2.002  1.00 57.13  ? 280 ARG A O      1 
ATOM   2268 C  CB     . ARG C 3 280 ? 8.920   38.818 0.039   1.00 57.15  ? 280 ARG A CB     1 
ATOM   2269 C  CG     . ARG C 3 280 ? 9.447   37.602 0.799   1.00 55.19  ? 280 ARG A CG     1 
ATOM   2270 C  CD     . ARG C 3 280 ? 8.850   37.566 2.211   1.00 69.62  ? 280 ARG A CD     1 
ATOM   2271 N  NE     . ARG C 3 280 ? 8.892   38.890 2.835   1.00 85.91  ? 280 ARG A NE     1 
ATOM   2272 C  CZ     . ARG C 3 280 ? 7.884   39.440 3.513   1.00 86.10  ? 280 ARG A CZ     1 
ATOM   2273 N  NH1    . ARG C 3 280 ? 6.735   38.776 3.651   1.00 74.98  ? 280 ARG A NH1    1 
ATOM   2274 N  NH2    . ARG C 3 280 ? 8.022   40.659 4.042   1.00 72.40  ? 280 ARG A NH2    1 
ATOM   2275 N  N      . ILE C 3 281 ? 6.265   37.981 -1.343  1.00 49.53  ? 281 ILE A N      1 
ATOM   2276 C  CA     . ILE C 3 281 ? 5.203   36.984 -1.403  1.00 61.94  ? 281 ILE A CA     1 
ATOM   2277 C  C      . ILE C 3 281 ? 4.915   36.574 -2.844  1.00 57.94  ? 281 ILE A C      1 
ATOM   2278 O  O      . ILE C 3 281 ? 4.504   35.431 -3.098  1.00 47.69  ? 281 ILE A O      1 
ATOM   2279 C  CB     . ILE C 3 281 ? 3.918   37.456 -0.702  1.00 62.74  ? 281 ILE A CB     1 
ATOM   2280 C  CG1    . ILE C 3 281 ? 3.169   38.479 -1.557  1.00 58.83  ? 281 ILE A CG1    1 
ATOM   2281 C  CG2    . ILE C 3 281 ? 4.219   37.983 0.686   1.00 61.20  ? 281 ILE A CG2    1 
ATOM   2282 C  CD1    . ILE C 3 281 ? 1.781   38.764 -0.983  1.00 61.60  ? 281 ILE A CD1    1 
ATOM   2283 N  N      . GLN C 3 282 ? 5.123   37.463 -3.815  1.00 48.38  ? 282 GLN A N      1 
ATOM   2284 C  CA     . GLN C 3 282 ? 4.885   37.021 -5.180  1.00 50.27  ? 282 GLN A CA     1 
ATOM   2285 C  C      . GLN C 3 282 ? 5.907   35.969 -5.581  1.00 46.57  ? 282 GLN A C      1 
ATOM   2286 O  O      . GLN C 3 282 ? 5.549   34.975 -6.216  1.00 52.47  ? 282 GLN A O      1 
ATOM   2287 C  CB     . GLN C 3 282 ? 4.881   38.200 -6.159  1.00 53.23  ? 282 GLN A CB     1 
ATOM   2288 C  CG     . GLN C 3 282 ? 4.559   37.778 -7.586  1.00 53.43  ? 282 GLN A CG     1 
ATOM   2289 C  CD     . GLN C 3 282 ? 3.916   38.875 -8.430  1.00 70.28  ? 282 GLN A CD     1 
ATOM   2290 O  OE1    . GLN C 3 282 ? 4.481   39.308 -9.440  1.00 73.44  ? 282 GLN A OE1    1 
ATOM   2291 N  NE2    . GLN C 3 282 ? 2.718   39.305 -8.039  1.00 66.44  ? 282 GLN A NE2    1 
ATOM   2292 N  N      . LYS C 3 283 ? 7.178   36.149 -5.193  1.00 49.79  ? 283 LYS A N      1 
ATOM   2293 C  CA     . LYS C 3 283 ? 8.176   35.107 -5.443  1.00 46.33  ? 283 LYS A CA     1 
ATOM   2294 C  C      . LYS C 3 283 ? 7.800   33.816 -4.728  1.00 49.31  ? 283 LYS A C      1 
ATOM   2295 O  O      . LYS C 3 283 ? 7.930   32.721 -5.289  1.00 47.76  ? 283 LYS A O      1 
ATOM   2296 C  CB     . LYS C 3 283 ? 9.566   35.556 -5.001  1.00 53.49  ? 283 LYS A CB     1 
ATOM   2297 C  CG     . LYS C 3 283 ? 10.155  36.740 -5.735  1.00 64.14  ? 283 LYS A CG     1 
ATOM   2298 C  CD     . LYS C 3 283 ? 11.626  36.923 -5.342  1.00 63.73  ? 283 LYS A CD     1 
ATOM   2299 C  CE     . LYS C 3 283 ? 12.491  37.357 -6.536  1.00 83.47  ? 283 LYS A CE     1 
ATOM   2300 N  NZ     . LYS C 3 283 ? 12.745  38.837 -6.575  1.00 88.62  ? 283 LYS A NZ     1 
ATOM   2301 N  N      . LEU C 3 284 ? 7.326   33.926 -3.488  1.00 39.21  ? 284 LEU A N      1 
ATOM   2302 C  CA     . LEU C 3 284 ? 6.859   32.749 -2.779  1.00 42.52  ? 284 LEU A CA     1 
ATOM   2303 C  C      . LEU C 3 284 ? 5.826   31.998 -3.607  1.00 54.04  ? 284 LEU A C      1 
ATOM   2304 O  O      . LEU C 3 284 ? 5.917   30.772 -3.776  1.00 49.99  ? 284 LEU A O      1 
ATOM   2305 C  CB     . LEU C 3 284 ? 6.287   33.157 -1.423  1.00 50.93  ? 284 LEU A CB     1 
ATOM   2306 C  CG     . LEU C 3 284 ? 7.294   33.579 -0.345  1.00 45.66  ? 284 LEU A CG     1 
ATOM   2307 C  CD1    . LEU C 3 284 ? 6.603   33.837 0.979   1.00 42.93  ? 284 LEU A CD1    1 
ATOM   2308 C  CD2    . LEU C 3 284 ? 8.350   32.501 -0.179  1.00 42.57  ? 284 LEU A CD2    1 
ATOM   2309 N  N      . SER C 3 285 ? 4.852   32.720 -4.168  1.00 51.51  ? 285 SER A N      1 
ATOM   2310 C  CA     . SER C 3 285 ? 3.794   32.048 -4.906  1.00 48.52  ? 285 SER A CA     1 
ATOM   2311 C  C      . SER C 3 285 ? 4.347   31.176 -6.019  1.00 44.49  ? 285 SER A C      1 
ATOM   2312 O  O      . SER C 3 285 ? 3.666   30.226 -6.424  1.00 41.50  ? 285 SER A O      1 
ATOM   2313 C  CB     . SER C 3 285 ? 2.783   33.066 -5.467  1.00 48.30  ? 285 SER A CB     1 
ATOM   2314 O  OG     . SER C 3 285 ? 3.384   33.948 -6.391  1.00 54.48  ? 285 SER A OG     1 
ATOM   2315 N  N      . PHE C 3 286 ? 5.575   31.443 -6.485  1.00 41.85  ? 286 PHE A N      1 
ATOM   2316 C  CA     . PHE C 3 286 ? 6.239   30.608 -7.489  1.00 44.83  ? 286 PHE A CA     1 
ATOM   2317 C  C      . PHE C 3 286 ? 7.130   29.520 -6.900  1.00 48.08  ? 286 PHE A C      1 
ATOM   2318 O  O      . PHE C 3 286 ? 7.809   28.826 -7.672  1.00 49.18  ? 286 PHE A O      1 
ATOM   2319 C  CB     . PHE C 3 286 ? 7.113   31.449 -8.427  1.00 42.46  ? 286 PHE A CB     1 
ATOM   2320 C  CG     . PHE C 3 286 ? 6.349   32.219 -9.432  1.00 44.93  ? 286 PHE A CG     1 
ATOM   2321 C  CD1    . PHE C 3 286 ? 6.058   31.665 -10.675 1.00 46.67  ? 286 PHE A CD1    1 
ATOM   2322 C  CD2    . PHE C 3 286 ? 5.900   33.502 -9.138  1.00 47.75  ? 286 PHE A CD2    1 
ATOM   2323 C  CE1    . PHE C 3 286 ? 5.330   32.379 -11.611 1.00 46.95  ? 286 PHE A CE1    1 
ATOM   2324 C  CE2    . PHE C 3 286 ? 5.176   34.231 -10.072 1.00 48.97  ? 286 PHE A CE2    1 
ATOM   2325 C  CZ     . PHE C 3 286 ? 4.889   33.665 -11.310 1.00 49.90  ? 286 PHE A CZ     1 
ATOM   2326 N  N      . GLY C 3 287 ? 7.171   29.367 -5.571  1.00 42.48  ? 287 GLY A N      1 
ATOM   2327 C  CA     . GLY C 3 287 ? 8.077   28.405 -4.973  1.00 40.20  ? 287 GLY A CA     1 
ATOM   2328 C  C      . GLY C 3 287 ? 9.499   28.888 -4.786  1.00 42.46  ? 287 GLY A C      1 
ATOM   2329 O  O      . GLY C 3 287 ? 10.347  28.101 -4.357  1.00 43.13  ? 287 GLY A O      1 
ATOM   2330 N  N      . GLU C 3 288 ? 9.777   30.161 -5.069  1.00 46.66  ? 288 GLU A N      1 
ATOM   2331 C  CA     . GLU C 3 288 ? 11.126  30.709 -5.081  1.00 46.27  ? 288 GLU A CA     1 
ATOM   2332 C  C      . GLU C 3 288 ? 11.390  31.395 -3.748  1.00 50.34  ? 288 GLU A C      1 
ATOM   2333 O  O      . GLU C 3 288 ? 10.582  32.212 -3.300  1.00 51.19  ? 288 GLU A O      1 
ATOM   2334 C  CB     . GLU C 3 288 ? 11.281  31.693 -6.239  1.00 56.82  ? 288 GLU A CB     1 
ATOM   2335 C  CG     . GLU C 3 288 ? 12.639  32.390 -6.316  1.00 75.30  ? 288 GLU A CG     1 
ATOM   2336 C  CD     . GLU C 3 288 ? 12.640  33.536 -7.326  1.00 84.27  ? 288 GLU A CD     1 
ATOM   2337 O  OE1    . GLU C 3 288 ? 11.655  33.612 -8.106  1.00 77.60  ? 288 GLU A OE1    1 
ATOM   2338 O  OE2    . GLU C 3 288 ? 13.606  34.352 -7.333  1.00 81.76  ? 288 GLU A OE2    1 
ATOM   2339 N  N      . ASP C 3 289 ? 12.515  31.059 -3.110  1.00 49.94  ? 289 ASP A N      1 
ATOM   2340 C  CA     . ASP C 3 289 ? 12.769  31.529 -1.748  1.00 45.52  ? 289 ASP A CA     1 
ATOM   2341 C  C      . ASP C 3 289 ? 14.273  31.530 -1.514  1.00 44.82  ? 289 ASP A C      1 
ATOM   2342 O  O      . ASP C 3 289 ? 14.852  30.474 -1.232  1.00 42.38  ? 289 ASP A O      1 
ATOM   2343 C  CB     . ASP C 3 289 ? 12.063  30.654 -0.727  1.00 47.88  ? 289 ASP A CB     1 
ATOM   2344 C  CG     . ASP C 3 289 ? 12.467  30.987 0.703   1.00 52.00  ? 289 ASP A CG     1 
ATOM   2345 O  OD1    . ASP C 3 289 ? 12.780  32.184 0.937   1.00 45.29  ? 289 ASP A OD1    1 
ATOM   2346 O  OD2    . ASP C 3 289 ? 12.476  30.053 1.562   1.00 44.26  ? 289 ASP A OD2    1 
ATOM   2347 N  N      . ASN C 3 290 ? 14.885  32.715 -1.591  1.00 40.27  ? 290 ASN A N      1 
ATOM   2348 C  CA     . ASN C 3 290 ? 16.333  32.809 -1.460  1.00 46.49  ? 290 ASN A CA     1 
ATOM   2349 C  C      . ASN C 3 290 ? 16.803  33.005 -0.013  1.00 52.06  ? 290 ASN A C      1 
ATOM   2350 O  O      . ASN C 3 290 ? 18.017  32.986 0.241   1.00 51.09  ? 290 ASN A O      1 
ATOM   2351 C  CB     . ASN C 3 290 ? 16.864  33.937 -2.343  1.00 48.86  ? 290 ASN A CB     1 
ATOM   2352 C  CG     . ASN C 3 290 ? 16.259  35.307 -1.979  1.00 74.61  ? 290 ASN A CG     1 
ATOM   2353 O  OD1    . ASN C 3 290 ? 15.928  35.580 -0.816  1.00 68.47  ? 290 ASN A OD1    1 
ATOM   2354 N  ND2    . ASN C 3 290 ? 16.116  36.171 -2.982  1.00 83.08  ? 290 ASN A ND2    1 
ATOM   2355 N  N      . SER C 3 291 ? 15.885  33.166 0.939   1.00 42.55  ? 291 SER A N      1 
ATOM   2356 C  CA     . SER C 3 291 ? 16.274  33.446 2.318   1.00 47.80  ? 291 SER A CA     1 
ATOM   2357 C  C      . SER C 3 291 ? 17.210  32.358 2.844   1.00 41.49  ? 291 SER A C      1 
ATOM   2358 O  O      . SER C 3 291 ? 17.007  31.162 2.580   1.00 41.83  ? 291 SER A O      1 
ATOM   2359 C  CB     . SER C 3 291 ? 15.039  33.559 3.223   1.00 33.30  ? 291 SER A CB     1 
ATOM   2360 O  OG     . SER C 3 291 ? 14.572  32.261 3.559   1.00 49.08  ? 291 SER A OG     1 
ATOM   2361 N  N      . PRO C 3 292 ? 18.250  32.731 3.569   1.00 43.19  ? 292 PRO A N      1 
ATOM   2362 C  CA     . PRO C 3 292 ? 19.196  31.744 4.101   1.00 44.02  ? 292 PRO A CA     1 
ATOM   2363 C  C      . PRO C 3 292 ? 18.728  31.146 5.422   1.00 43.53  ? 292 PRO A C      1 
ATOM   2364 O  O      . PRO C 3 292 ? 17.908  31.715 6.146   1.00 37.79  ? 292 PRO A O      1 
ATOM   2365 C  CB     . PRO C 3 292 ? 20.463  32.573 4.324   1.00 37.87  ? 292 PRO A CB     1 
ATOM   2366 C  CG     . PRO C 3 292 ? 19.881  33.941 4.739   1.00 44.81  ? 292 PRO A CG     1 
ATOM   2367 C  CD     . PRO C 3 292 ? 18.610  34.120 3.921   1.00 34.70  ? 292 PRO A CD     1 
ATOM   2368 N  N      . VAL C 3 293 ? 19.259  29.964 5.706   1.00 37.26  ? 293 VAL A N      1 
ATOM   2369 C  CA     . VAL C 3 293 ? 19.083  29.339 7.007   1.00 40.67  ? 293 VAL A CA     1 
ATOM   2370 C  C      . VAL C 3 293 ? 19.993  30.073 7.978   1.00 41.15  ? 293 VAL A C      1 
ATOM   2371 O  O      . VAL C 3 293 ? 21.220  30.016 7.843   1.00 43.26  ? 293 VAL A O      1 
ATOM   2372 C  CB     . VAL C 3 293 ? 19.403  27.835 6.959   1.00 44.75  ? 293 VAL A CB     1 
ATOM   2373 C  CG1    . VAL C 3 293 ? 19.293  27.206 8.343   1.00 37.51  ? 293 VAL A CG1    1 
ATOM   2374 C  CG2    . VAL C 3 293 ? 18.482  27.118 5.991   1.00 37.83  ? 293 VAL A CG2    1 
ATOM   2375 N  N      . ILE C 3 294 ? 19.385  30.800 8.930   1.00 35.03  ? 294 ILE A N      1 
ATOM   2376 C  CA     . ILE C 3 294 ? 20.091  31.568 9.954   1.00 50.58  ? 294 ILE A CA     1 
ATOM   2377 C  C      . ILE C 3 294 ? 20.323  30.708 11.193  1.00 44.83  ? 294 ILE A C      1 
ATOM   2378 O  O      . ILE C 3 294 ? 19.446  29.934 11.595  1.00 46.99  ? 294 ILE A O      1 
ATOM   2379 C  CB     . ILE C 3 294 ? 19.299  32.831 10.340  1.00 54.75  ? 294 ILE A CB     1 
ATOM   2380 C  CG1    . ILE C 3 294 ? 19.211  33.789 9.159   1.00 50.90  ? 294 ILE A CG1    1 
ATOM   2381 C  CG2    . ILE C 3 294 ? 19.961  33.515 11.537  1.00 56.58  ? 294 ILE A CG2    1 
ATOM   2382 C  CD1    . ILE C 3 294 ? 20.511  33.855 8.392   1.00 54.69  ? 294 ILE A CD1    1 
ATOM   2383 N  N      . LEU C 3 295 ? 21.484  30.879 11.831  1.00 48.68  ? 295 LEU A N      1 
ATOM   2384 C  CA     . LEU C 3 295 ? 21.768  30.195 13.098  1.00 44.51  ? 295 LEU A CA     1 
ATOM   2385 C  C      . LEU C 3 295 ? 20.937  30.823 14.208  1.00 36.35  ? 295 LEU A C      1 
ATOM   2386 O  O      . LEU C 3 295 ? 21.090  32.008 14.511  1.00 42.46  ? 295 LEU A O      1 
ATOM   2387 C  CB     . LEU C 3 295 ? 23.254  30.268 13.436  1.00 34.29  ? 295 LEU A CB     1 
ATOM   2388 C  CG     . LEU C 3 295 ? 23.684  29.804 14.834  1.00 44.92  ? 295 LEU A CG     1 
ATOM   2389 C  CD1    . LEU C 3 295 ? 23.735  28.261 14.992  1.00 48.42  ? 295 LEU A CD1    1 
ATOM   2390 C  CD2    . LEU C 3 295 ? 25.036  30.406 15.161  1.00 54.53  ? 295 LEU A CD2    1 
ATOM   2391 N  N      . SER C 3 296 ? 20.050  30.033 14.818  1.00 40.90  ? 296 SER A N      1 
ATOM   2392 C  CA     . SER C 3 296 ? 19.175  30.571 15.855  1.00 40.47  ? 296 SER A CA     1 
ATOM   2393 C  C      . SER C 3 296 ? 19.950  30.869 17.134  1.00 44.40  ? 296 SER A C      1 
ATOM   2394 O  O      . SER C 3 296 ? 19.740  31.916 17.764  1.00 38.92  ? 296 SER A O      1 
ATOM   2395 C  CB     . SER C 3 296 ? 18.033  29.595 16.138  1.00 40.88  ? 296 SER A CB     1 
ATOM   2396 O  OG     . SER C 3 296 ? 17.002  29.757 15.195  1.00 45.88  ? 296 SER A OG     1 
ATOM   2397 N  N      . GLY C 3 297 ? 20.838  29.952 17.541  1.00 42.97  ? 297 GLY A N      1 
ATOM   2398 C  CA     . GLY C 3 297 ? 21.612  30.119 18.754  1.00 46.02  ? 297 GLY A CA     1 
ATOM   2399 C  C      . GLY C 3 297 ? 20.737  30.299 19.987  1.00 44.20  ? 297 GLY A C      1 
ATOM   2400 O  O      . GLY C 3 297 ? 19.591  29.841 20.043  1.00 46.79  ? 297 GLY A O      1 
ATOM   2401 N  N      . PRO C 3 298 ? 21.260  30.968 21.006  1.00 47.78  ? 298 PRO A N      1 
ATOM   2402 C  CA     . PRO C 3 298 ? 20.501  31.133 22.233  1.00 44.87  ? 298 PRO A CA     1 
ATOM   2403 C  C      . PRO C 3 298 ? 19.300  32.024 21.998  1.00 44.08  ? 298 PRO A C      1 
ATOM   2404 O  O      . PRO C 3 298 ? 19.294  32.850 21.074  1.00 50.63  ? 298 PRO A O      1 
ATOM   2405 C  CB     . PRO C 3 298 ? 21.509  31.791 23.182  1.00 52.73  ? 298 PRO A CB     1 
ATOM   2406 C  CG     . PRO C 3 298 ? 22.843  31.469 22.577  1.00 51.20  ? 298 PRO A CG     1 
ATOM   2407 C  CD     . PRO C 3 298 ? 22.607  31.541 21.124  1.00 46.35  ? 298 PRO A CD     1 
ATOM   2408 N  N      . PRO C 3 299 ? 18.267  31.873 22.811  1.00 48.72  ? 299 PRO A N      1 
ATOM   2409 C  CA     . PRO C 3 299 ? 17.064  32.706 22.668  1.00 49.16  ? 299 PRO A CA     1 
ATOM   2410 C  C      . PRO C 3 299 ? 17.378  34.194 22.706  1.00 58.89  ? 299 PRO A C      1 
ATOM   2411 O  O      . PRO C 3 299 ? 18.331  34.640 23.354  1.00 56.25  ? 299 PRO A O      1 
ATOM   2412 C  CB     . PRO C 3 299 ? 16.210  32.301 23.872  1.00 42.51  ? 299 PRO A CB     1 
ATOM   2413 C  CG     . PRO C 3 299 ? 16.743  30.963 24.283  1.00 46.34  ? 299 PRO A CG     1 
ATOM   2414 C  CD     . PRO C 3 299 ? 18.185  30.926 23.929  1.00 44.65  ? 299 PRO A CD     1 
ATOM   2415 N  N      . GLN C 3 300 ? 16.551  34.965 21.998  1.00 58.51  ? 300 GLN A N      1 
ATOM   2416 C  CA     . GLN C 3 300 ? 16.632  36.412 22.059  1.00 52.97  ? 300 GLN A CA     1 
ATOM   2417 C  C      . GLN C 3 300 ? 15.752  37.001 23.151  1.00 55.39  ? 300 GLN A C      1 
ATOM   2418 O  O      . GLN C 3 300 ? 15.816  38.208 23.384  1.00 63.34  ? 300 GLN A O      1 
ATOM   2419 C  CB     . GLN C 3 300 ? 16.252  37.029 20.709  1.00 53.95  ? 300 GLN A CB     1 
ATOM   2420 C  CG     . GLN C 3 300 ? 17.083  36.531 19.532  1.00 69.22  ? 300 GLN A CG     1 
ATOM   2421 C  CD     . GLN C 3 300 ? 18.566  36.832 19.691  1.00 74.26  ? 300 GLN A CD     1 
ATOM   2422 O  OE1    . GLN C 3 300 ? 18.944  37.893 20.191  1.00 67.58  ? 300 GLN A OE1    1 
ATOM   2423 N  NE2    . GLN C 3 300 ? 19.415  35.892 19.271  1.00 80.04  ? 300 GLN A NE2    1 
ATOM   2424 N  N      . SER C 3 301 ? 14.932  36.193 23.821  1.00 58.88  ? 301 SER A N      1 
ATOM   2425 C  CA     . SER C 3 301 ? 14.064  36.730 24.860  1.00 57.50  ? 301 SER A CA     1 
ATOM   2426 C  C      . SER C 3 301 ? 13.500  35.594 25.700  1.00 61.02  ? 301 SER A C      1 
ATOM   2427 O  O      . SER C 3 301 ? 13.379  34.452 25.241  1.00 57.36  ? 301 SER A O      1 
ATOM   2428 C  CB     . SER C 3 301 ? 12.933  37.578 24.270  1.00 46.99  ? 301 SER A CB     1 
ATOM   2429 O  OG     . SER C 3 301 ? 12.017  36.779 23.549  1.00 60.21  ? 301 SER A OG     1 
ATOM   2430 N  N      . PHE C 3 302 ? 13.198  35.924 26.953  1.00 60.70  ? 302 PHE A N      1 
ATOM   2431 C  CA     . PHE C 3 302 ? 12.561  35.022 27.904  1.00 54.05  ? 302 PHE A CA     1 
ATOM   2432 C  C      . PHE C 3 302 ? 11.270  35.683 28.372  1.00 64.45  ? 302 PHE A C      1 
ATOM   2433 O  O      . PHE C 3 302 ? 11.276  36.863 28.743  1.00 62.69  ? 302 PHE A O      1 
ATOM   2434 C  CB     . PHE C 3 302 ? 13.467  34.735 29.106  1.00 52.43  ? 302 PHE A CB     1 
ATOM   2435 C  CG     . PHE C 3 302 ? 14.677  33.889 28.796  1.00 64.03  ? 302 PHE A CG     1 
ATOM   2436 C  CD1    . PHE C 3 302 ? 15.812  34.447 28.231  1.00 64.67  ? 302 PHE A CD1    1 
ATOM   2437 C  CD2    . PHE C 3 302 ? 14.701  32.537 29.128  1.00 67.68  ? 302 PHE A CD2    1 
ATOM   2438 C  CE1    . PHE C 3 302 ? 16.937  33.661 27.972  1.00 69.53  ? 302 PHE A CE1    1 
ATOM   2439 C  CE2    . PHE C 3 302 ? 15.825  31.752 28.876  1.00 69.52  ? 302 PHE A CE2    1 
ATOM   2440 C  CZ     . PHE C 3 302 ? 16.942  32.311 28.297  1.00 64.47  ? 302 PHE A CZ     1 
ATOM   2441 N  N      . SER C 3 303 ? 10.169  34.935 28.355  1.00 60.18  ? 303 SER A N      1 
ATOM   2442 C  CA     . SER C 3 303 ? 8.894   35.489 28.783  1.00 50.37  ? 303 SER A CA     1 
ATOM   2443 C  C      . SER C 3 303 ? 8.018   34.395 29.373  1.00 57.14  ? 303 SER A C      1 
ATOM   2444 O  O      . SER C 3 303 ? 8.145   33.217 29.030  1.00 60.86  ? 303 SER A O      1 
ATOM   2445 C  CB     . SER C 3 303 ? 8.160   36.166 27.623  1.00 48.94  ? 303 SER A CB     1 
ATOM   2446 O  OG     . SER C 3 303 ? 7.600   35.209 26.749  1.00 61.69  ? 303 SER A OG     1 
ATOM   2447 N  N      . GLU C 3 304 ? 7.130   34.804 30.274  1.00 62.15  ? 304 GLU A N      1 
ATOM   2448 C  CA     . GLU C 3 304 ? 6.001   33.990 30.689  1.00 51.40  ? 304 GLU A CA     1 
ATOM   2449 C  C      . GLU C 3 304 ? 4.770   34.872 30.696  1.00 54.11  ? 304 GLU A C      1 
ATOM   2450 O  O      . GLU C 3 304 ? 4.864   36.100 30.739  1.00 56.94  ? 304 GLU A O      1 
ATOM   2451 C  CB     . GLU C 3 304 ? 6.215   33.379 32.062  1.00 59.75  ? 304 GLU A CB     1 
ATOM   2452 C  CG     . GLU C 3 304 ? 7.630   32.949 32.264  1.00 64.58  ? 304 GLU A CG     1 
ATOM   2453 C  CD     . GLU C 3 304 ? 7.711   31.655 33.007  1.00 66.25  ? 304 GLU A CD     1 
ATOM   2454 O  OE1    . GLU C 3 304 ? 8.713   30.930 32.806  1.00 70.61  ? 304 GLU A OE1    1 
ATOM   2455 O  OE2    . GLU C 3 304 ? 6.759   31.361 33.770  1.00 65.24  ? 304 GLU A OE2    1 
ATOM   2456 N  N      . GLU C 3 305 ? 3.609   34.234 30.640  1.00 54.28  ? 305 GLU A N      1 
ATOM   2457 C  CA     . GLU C 3 305 ? 2.374   34.995 30.655  1.00 59.03  ? 305 GLU A CA     1 
ATOM   2458 C  C      . GLU C 3 305 ? 1.266   34.163 31.277  1.00 61.71  ? 305 GLU A C      1 
ATOM   2459 O  O      . GLU C 3 305 ? 1.422   32.967 31.534  1.00 70.68  ? 305 GLU A O      1 
ATOM   2460 C  CB     . GLU C 3 305 ? 1.988   35.460 29.249  1.00 63.23  ? 305 GLU A CB     1 
ATOM   2461 C  CG     . GLU C 3 305 ? 2.027   34.385 28.203  1.00 57.56  ? 305 GLU A CG     1 
ATOM   2462 C  CD     . GLU C 3 305 ? 1.675   34.913 26.843  1.00 51.29  ? 305 GLU A CD     1 
ATOM   2463 O  OE1    . GLU C 3 305 ? 2.589   35.394 26.143  1.00 59.26  ? 305 GLU A OE1    1 
ATOM   2464 O  OE2    . GLU C 3 305 ? 0.484   34.851 26.477  1.00 57.03  ? 305 GLU A OE2    1 
ATOM   2465 N  N      . ASP C 3 306 ? 0.145   34.828 31.530  1.00 69.32  ? 306 ASP A N      1 
ATOM   2466 C  CA     . ASP C 3 306 ? -1.041  34.199 32.081  1.00 71.39  ? 306 ASP A CA     1 
ATOM   2467 C  C      . ASP C 3 306 ? -2.262  34.954 31.591  1.00 68.91  ? 306 ASP A C      1 
ATOM   2468 O  O      . ASP C 3 306 ? -2.261  36.189 31.558  1.00 71.30  ? 306 ASP A O      1 
ATOM   2469 C  CB     . ASP C 3 306 ? -1.025  34.194 33.615  1.00 72.14  ? 306 ASP A CB     1 
ATOM   2470 C  CG     . ASP C 3 306 ? -1.971  33.156 34.202  1.00 81.00  ? 306 ASP A CG     1 
ATOM   2471 O  OD1    . ASP C 3 306 ? -3.015  32.857 33.574  1.00 78.77  ? 306 ASP A OD1    1 
ATOM   2472 O  OD2    . ASP C 3 306 ? -1.658  32.628 35.287  1.00 82.80  ? 306 ASP A OD2    1 
ATOM   2473 N  N      . SER C 3 307 ? -3.300  34.209 31.219  1.00 63.04  ? 307 SER A N      1 
ATOM   2474 C  CA     . SER C 3 307 ? -4.594  34.788 30.900  1.00 76.22  ? 307 SER A CA     1 
ATOM   2475 C  C      . SER C 3 307 ? -5.610  34.350 31.947  1.00 80.25  ? 307 SER A C      1 
ATOM   2476 O  O      . SER C 3 307 ? -5.428  33.329 32.621  1.00 74.92  ? 307 SER A O      1 
ATOM   2477 C  CB     . SER C 3 307 ? -5.060  34.391 29.493  1.00 70.96  ? 307 SER A CB     1 
ATOM   2478 O  OG     . SER C 3 307 ? -4.461  33.179 29.084  1.00 69.12  ? 307 SER A OG     1 
ATOM   2479 N  N      . PHE C 3 308 ? -6.676  35.138 32.084  1.00 76.28  ? 308 PHE A N      1 
ATOM   2480 C  CA     . PHE C 3 308 ? -7.688  34.884 33.101  1.00 82.97  ? 308 PHE A CA     1 
ATOM   2481 C  C      . PHE C 3 308 ? -9.006  35.504 32.657  1.00 88.44  ? 308 PHE A C      1 
ATOM   2482 O  O      . PHE C 3 308 ? -9.083  36.184 31.629  1.00 88.14  ? 308 PHE A O      1 
ATOM   2483 C  CB     . PHE C 3 308 ? -7.250  35.432 34.462  1.00 81.75  ? 308 PHE A CB     1 
ATOM   2484 C  CG     . PHE C 3 308 ? -6.173  36.474 34.373  1.00 84.80  ? 308 PHE A CG     1 
ATOM   2485 C  CD1    . PHE C 3 308 ? -6.417  37.683 33.733  1.00 88.32  ? 308 PHE A CD1    1 
ATOM   2486 C  CD2    . PHE C 3 308 ? -4.918  36.247 34.922  1.00 81.97  ? 308 PHE A CD2    1 
ATOM   2487 C  CE1    . PHE C 3 308 ? -5.433  38.644 33.642  1.00 86.83  ? 308 PHE A CE1    1 
ATOM   2488 C  CE2    . PHE C 3 308 ? -3.927  37.207 34.836  1.00 78.51  ? 308 PHE A CE2    1 
ATOM   2489 C  CZ     . PHE C 3 308 ? -4.186  38.409 34.196  1.00 82.70  ? 308 PHE A CZ     1 
ATOM   2490 N  N      . LYS C 3 309 ? -10.052 35.245 33.451  1.00 83.98  ? 309 LYS A N      1 
ATOM   2491 C  CA     . LYS C 3 309 ? -11.357 35.846 33.187  1.00 84.98  ? 309 LYS A CA     1 
ATOM   2492 C  C      . LYS C 3 309 ? -11.301 37.362 33.354  1.00 91.60  ? 309 LYS A C      1 
ATOM   2493 O  O      . LYS C 3 309 ? -11.713 38.115 32.459  1.00 81.84  ? 309 LYS A O      1 
ATOM   2494 C  CB     . LYS C 3 309 ? -12.411 35.231 34.111  1.00 81.96  ? 309 LYS A CB     1 
ATOM   2495 N  N      . LYS C 3 310 ? -10.788 37.825 34.497  1.00 83.44  ? 310 LYS A N      1 
ATOM   2496 C  CA     . LYS C 3 310 ? -10.566 39.244 34.762  1.00 84.77  ? 310 LYS A CA     1 
ATOM   2497 C  C      . LYS C 3 310 ? -9.632  39.379 35.962  1.00 93.23  ? 310 LYS A C      1 
ATOM   2498 O  O      . LYS C 3 310 ? -9.484  38.452 36.767  1.00 84.83  ? 310 LYS A O      1 
ATOM   2499 C  CB     . LYS C 3 310 ? -11.885 39.989 35.013  1.00 94.22  ? 310 LYS A CB     1 
ATOM   2500 C  CG     . LYS C 3 310 ? -11.803 41.511 34.930  1.00 91.07  ? 310 LYS A CG     1 
ATOM   2501 C  CD     . LYS C 3 310 ? -12.697 42.047 33.827  1.00 71.83  ? 310 LYS A CD     1 
ATOM   2502 C  CE     . LYS C 3 310 ? -11.918 42.249 32.533  1.00 89.56  ? 310 LYS A CE     1 
ATOM   2503 N  NZ     . LYS C 3 310 ? -12.794 42.075 31.330  1.00 85.01  ? 310 LYS A NZ     1 
ATOM   2504 N  N      . CYS C 3 311 ? -8.984  40.547 36.054  1.00 97.72  ? 311 CYS A N      1 
ATOM   2505 C  CA     . CYS C 3 311 ? -8.125  40.903 37.180  1.00 97.55  ? 311 CYS A CA     1 
ATOM   2506 C  C      . CYS C 3 311 ? -8.106  42.412 37.398  1.00 101.85 ? 311 CYS A C      1 
ATOM   2507 O  O      . CYS C 3 311 ? -7.175  43.094 36.957  1.00 98.53  ? 311 CYS A O      1 
ATOM   2508 C  CB     . CYS C 3 311 ? -6.691  40.410 36.971  1.00 92.27  ? 311 CYS A CB     1 
ATOM   2509 S  SG     . CYS C 3 311 ? -5.483  41.213 38.104  1.00 103.94 ? 311 CYS A SG     1 
ATOM   2510 N  N      . SER C 3 312 ? -9.120  42.950 38.074  1.00 107.04 ? 312 SER A N      1 
ATOM   2511 C  CA     . SER C 3 312 ? -9.121  44.358 38.443  1.00 106.56 ? 312 SER A CA     1 
ATOM   2512 C  C      . SER C 3 312 ? -8.652  44.593 39.877  1.00 107.70 ? 312 SER A C      1 
ATOM   2513 O  O      . SER C 3 312 ? -8.841  45.694 40.404  1.00 105.62 ? 312 SER A O      1 
ATOM   2514 C  CB     . SER C 3 312 ? -10.505 44.967 38.227  1.00 102.59 ? 312 SER A CB     1 
ATOM   2515 O  OG     . SER C 3 312 ? -10.451 45.996 37.249  1.00 95.95  ? 312 SER A OG     1 
ATOM   2516 N  N      . SER C 3 313 ? -8.042  43.589 40.518  1.00 110.52 ? 313 SER A N      1 
ATOM   2517 C  CA     . SER C 3 313 ? -7.383  43.773 41.816  1.00 110.48 ? 313 SER A CA     1 
ATOM   2518 C  C      . SER C 3 313 ? -5.909  44.087 41.567  1.00 109.99 ? 313 SER A C      1 
ATOM   2519 O  O      . SER C 3 313 ? -5.036  43.215 41.572  1.00 108.98 ? 313 SER A O      1 
ATOM   2520 C  CB     . SER C 3 313 ? -7.565  42.546 42.705  1.00 107.66 ? 313 SER A CB     1 
ATOM   2521 O  OG     . SER C 3 313 ? -7.689  41.354 41.937  1.00 107.93 ? 313 SER A OG     1 
ATOM   2522 N  N      . GLU C 3 314 ? -5.636  45.378 41.343  1.00 107.02 ? 314 GLU A N      1 
ATOM   2523 C  CA     . GLU C 3 314 ? -4.282  45.810 41.005  1.00 102.03 ? 314 GLU A CA     1 
ATOM   2524 C  C      . GLU C 3 314 ? -3.284  45.436 42.098  1.00 102.36 ? 314 GLU A C      1 
ATOM   2525 O  O      . GLU C 3 314 ? -2.078  45.346 41.837  1.00 104.85 ? 314 GLU A O      1 
ATOM   2526 C  CB     . GLU C 3 314 ? -4.266  47.320 40.729  1.00 101.61 ? 314 GLU A CB     1 
ATOM   2527 C  CG     . GLU C 3 314 ? -4.569  47.742 39.256  1.00 109.89 ? 314 GLU A CG     1 
ATOM   2528 C  CD     . GLU C 3 314 ? -5.883  47.186 38.694  1.00 108.73 ? 314 GLU A CD     1 
ATOM   2529 O  OE1    . GLU C 3 314 ? -6.294  47.573 37.567  1.00 96.81  ? 314 GLU A OE1    1 
ATOM   2530 O  OE2    . GLU C 3 314 ? -6.500  46.352 39.385  1.00 114.54 ? 314 GLU A OE2    1 
ATOM   2531 N  N      . VAL C 3 315 ? -3.763  45.200 43.321  1.00 100.96 ? 315 VAL A N      1 
ATOM   2532 C  CA     . VAL C 3 315 ? -2.912  44.571 44.327  1.00 103.84 ? 315 VAL A CA     1 
ATOM   2533 C  C      . VAL C 3 315 ? -2.773  43.081 44.041  1.00 102.38 ? 315 VAL A C      1 
ATOM   2534 O  O      . VAL C 3 315 ? -1.728  42.479 44.322  1.00 97.62  ? 315 VAL A O      1 
ATOM   2535 C  CB     . VAL C 3 315 ? -3.465  44.826 45.743  1.00 102.33 ? 315 VAL A CB     1 
ATOM   2536 N  N      . GLU C 3 316 ? -3.814  42.458 43.477  1.00 106.61 ? 316 GLU A N      1 
ATOM   2537 C  CA     . GLU C 3 316 ? -3.707  41.055 43.084  1.00 106.93 ? 316 GLU A CA     1 
ATOM   2538 C  C      . GLU C 3 316 ? -2.861  40.900 41.822  1.00 104.98 ? 316 GLU A C      1 
ATOM   2539 O  O      . GLU C 3 316 ? -2.056  39.965 41.718  1.00 95.18  ? 316 GLU A O      1 
ATOM   2540 C  CB     . GLU C 3 316 ? -5.102  40.456 42.887  1.00 104.44 ? 316 GLU A CB     1 
ATOM   2541 N  N      . ALA C 3 317 ? -3.022  41.810 40.855  1.00 102.72 ? 317 ALA A N      1 
ATOM   2542 C  CA     . ALA C 3 317 ? -2.117  41.837 39.712  1.00 92.53  ? 317 ALA A CA     1 
ATOM   2543 C  C      . ALA C 3 317 ? -0.662  41.814 40.169  1.00 89.57  ? 317 ALA A C      1 
ATOM   2544 O  O      . ALA C 3 317 ? 0.173   41.125 39.572  1.00 92.80  ? 317 ALA A O      1 
ATOM   2545 C  CB     . ALA C 3 317 ? -2.395  43.064 38.842  1.00 86.05  ? 317 ALA A CB     1 
ATOM   2546 N  N      . LYS C 3 318 ? -0.343  42.541 41.243  1.00 85.32  ? 318 LYS A N      1 
ATOM   2547 C  CA     . LYS C 3 318 ? 1.021   42.520 41.767  1.00 90.57  ? 318 LYS A CA     1 
ATOM   2548 C  C      . LYS C 3 318 ? 1.429   41.114 42.200  1.00 93.84  ? 318 LYS A C      1 
ATOM   2549 O  O      . LYS C 3 318 ? 2.606   40.742 42.095  1.00 89.16  ? 318 LYS A O      1 
ATOM   2550 C  CB     . LYS C 3 318 ? 1.158   43.505 42.931  1.00 85.04  ? 318 LYS A CB     1 
ATOM   2551 N  N      . ASN C 3 319 ? 0.476   40.316 42.695  1.00 94.72  ? 319 ASN A N      1 
ATOM   2552 C  CA     . ASN C 3 319 ? 0.804   38.943 43.073  1.00 94.41  ? 319 ASN A CA     1 
ATOM   2553 C  C      . ASN C 3 319 ? 1.102   38.100 41.838  1.00 87.08  ? 319 ASN A C      1 
ATOM   2554 O  O      . ASN C 3 319 ? 2.108   37.381 41.793  1.00 85.39  ? 319 ASN A O      1 
ATOM   2555 C  CB     . ASN C 3 319 ? -0.330  38.327 43.899  1.00 82.38  ? 319 ASN A CB     1 
ATOM   2556 N  N      . LYS C 3 320 ? 0.240   38.190 40.817  1.00 89.26  ? 320 LYS A N      1 
ATOM   2557 C  CA     . LYS C 3 320 ? 0.454   37.441 39.580  1.00 91.55  ? 320 LYS A CA     1 
ATOM   2558 C  C      . LYS C 3 320 ? 1.814   37.772 38.975  1.00 87.60  ? 320 LYS A C      1 
ATOM   2559 O  O      . LYS C 3 320 ? 2.576   36.878 38.583  1.00 73.90  ? 320 LYS A O      1 
ATOM   2560 C  CB     . LYS C 3 320 ? -0.672  37.749 38.589  1.00 72.63  ? 320 LYS A CB     1 
ATOM   2561 N  N      . ILE C 3 321 ? 2.133   39.068 38.913  1.00 86.02  ? 321 ILE A N      1 
ATOM   2562 C  CA     . ILE C 3 321 ? 3.409   39.538 38.386  1.00 73.23  ? 321 ILE A CA     1 
ATOM   2563 C  C      . ILE C 3 321 ? 4.569   38.971 39.191  1.00 74.78  ? 321 ILE A C      1 
ATOM   2564 O  O      . ILE C 3 321 ? 5.629   38.647 38.641  1.00 75.83  ? 321 ILE A O      1 
ATOM   2565 C  CB     . ILE C 3 321 ? 3.413   41.077 38.370  1.00 69.46  ? 321 ILE A CB     1 
ATOM   2566 C  CG1    . ILE C 3 321 ? 2.518   41.579 37.234  1.00 63.73  ? 321 ILE A CG1    1 
ATOM   2567 C  CG2    . ILE C 3 321 ? 4.831   41.634 38.290  1.00 68.41  ? 321 ILE A CG2    1 
ATOM   2568 C  CD1    . ILE C 3 321 ? 2.573   43.053 37.025  1.00 56.14  ? 321 ILE A CD1    1 
ATOM   2569 N  N      . GLU C 3 322 ? 4.397   38.844 40.506  1.00 79.86  ? 322 GLU A N      1 
ATOM   2570 C  CA     . GLU C 3 322 ? 5.459   38.253 41.311  1.00 78.47  ? 322 GLU A CA     1 
ATOM   2571 C  C      . GLU C 3 322 ? 5.666   36.788 40.938  1.00 79.73  ? 322 GLU A C      1 
ATOM   2572 O  O      . GLU C 3 322 ? 6.806   36.304 40.902  1.00 74.23  ? 322 GLU A O      1 
ATOM   2573 C  CB     . GLU C 3 322 ? 5.144   38.410 42.800  1.00 75.35  ? 322 GLU A CB     1 
ATOM   2574 N  N      . GLU C 3 323 ? 4.577   36.073 40.621  1.00 77.84  ? 323 GLU A N      1 
ATOM   2575 C  CA     . GLU C 3 323 ? 4.688   34.660 40.256  1.00 79.58  ? 323 GLU A CA     1 
ATOM   2576 C  C      . GLU C 3 323 ? 5.380   34.492 38.906  1.00 75.65  ? 323 GLU A C      1 
ATOM   2577 O  O      . GLU C 3 323 ? 6.334   33.711 38.776  1.00 64.49  ? 323 GLU A O      1 
ATOM   2578 C  CB     . GLU C 3 323 ? 3.302   34.007 40.239  1.00 73.13  ? 323 GLU A CB     1 
ATOM   2579 N  N      . LEU C 3 324 ? 4.902   35.214 37.885  1.00 73.27  ? 324 LEU A N      1 
ATOM   2580 C  CA     . LEU C 3 324 ? 5.580   35.223 36.592  1.00 69.85  ? 324 LEU A CA     1 
ATOM   2581 C  C      . LEU C 3 324 ? 7.065   35.500 36.771  1.00 72.56  ? 324 LEU A C      1 
ATOM   2582 O  O      . LEU C 3 324 ? 7.914   34.707 36.349  1.00 76.78  ? 324 LEU A O      1 
ATOM   2583 C  CB     . LEU C 3 324 ? 4.954   36.268 35.655  1.00 67.05  ? 324 LEU A CB     1 
ATOM   2584 C  CG     . LEU C 3 324 ? 3.511   36.081 35.157  1.00 64.95  ? 324 LEU A CG     1 
ATOM   2585 C  CD1    . LEU C 3 324 ? 2.987   37.317 34.435  1.00 57.01  ? 324 LEU A CD1    1 
ATOM   2586 C  CD2    . LEU C 3 324 ? 3.399   34.876 34.252  1.00 57.38  ? 324 LEU A CD2    1 
ATOM   2587 N  N      . LEU C 3 325 ? 7.395   36.614 37.427  1.00 76.61  ? 325 LEU A N      1 
ATOM   2588 C  CA     . LEU C 3 325 ? 8.793   37.015 37.558  1.00 78.28  ? 325 LEU A CA     1 
ATOM   2589 C  C      . LEU C 3 325 ? 9.626   35.959 38.278  1.00 79.78  ? 325 LEU A C      1 
ATOM   2590 O  O      . LEU C 3 325 ? 10.817  35.787 37.971  1.00 69.32  ? 325 LEU A O      1 
ATOM   2591 C  CB     . LEU C 3 325 ? 8.873   38.360 38.278  1.00 77.06  ? 325 LEU A CB     1 
ATOM   2592 C  CG     . LEU C 3 325 ? 10.219  38.763 38.882  1.00 81.74  ? 325 LEU A CG     1 
ATOM   2593 C  CD1    . LEU C 3 325 ? 11.294  38.911 37.819  1.00 81.63  ? 325 LEU A CD1    1 
ATOM   2594 C  CD2    . LEU C 3 325 ? 10.052  40.056 39.658  1.00 89.05  ? 325 LEU A CD2    1 
ATOM   2595 N  N      . ALA C 3 326 ? 9.018   35.231 39.217  1.00 79.39  ? 326 ALA A N      1 
ATOM   2596 C  CA     . ALA C 3 326 ? 9.758   34.239 39.990  1.00 79.24  ? 326 ALA A CA     1 
ATOM   2597 C  C      . ALA C 3 326 ? 10.397  33.200 39.079  1.00 80.49  ? 326 ALA A C      1 
ATOM   2598 O  O      . ALA C 3 326 ? 11.621  33.014 39.088  1.00 78.14  ? 326 ALA A O      1 
ATOM   2599 C  CB     . ALA C 3 326 ? 8.832   33.573 41.007  1.00 82.80  ? 326 ALA A CB     1 
ATOM   2600 N  N      . SER C 3 327 ? 9.578   32.514 38.273  1.00 74.73  ? 327 SER A N      1 
ATOM   2601 C  CA     . SER C 3 327 ? 10.113  31.485 37.385  1.00 76.36  ? 327 SER A CA     1 
ATOM   2602 C  C      . SER C 3 327 ? 11.117  32.070 36.397  1.00 73.07  ? 327 SER A C      1 
ATOM   2603 O  O      . SER C 3 327 ? 12.189  31.493 36.173  1.00 77.11  ? 327 SER A O      1 
ATOM   2604 C  CB     . SER C 3 327 ? 8.976   30.778 36.641  1.00 77.04  ? 327 SER A CB     1 
ATOM   2605 O  OG     . SER C 3 327 ? 9.433   29.565 36.053  1.00 72.35  ? 327 SER A OG     1 
ATOM   2606 N  N      . LEU C 3 328 ? 10.790  33.215 35.791  1.00 64.64  ? 328 LEU A N      1 
ATOM   2607 C  CA     . LEU C 3 328 ? 11.706  33.793 34.811  1.00 70.23  ? 328 LEU A CA     1 
ATOM   2608 C  C      . LEU C 3 328 ? 13.095  33.980 35.400  1.00 74.52  ? 328 LEU A C      1 
ATOM   2609 O  O      . LEU C 3 328 ? 14.099  33.759 34.715  1.00 72.98  ? 328 LEU A O      1 
ATOM   2610 C  CB     . LEU C 3 328 ? 11.164  35.119 34.283  1.00 65.16  ? 328 LEU A CB     1 
ATOM   2611 C  CG     . LEU C 3 328 ? 10.024  34.957 33.278  1.00 58.76  ? 328 LEU A CG     1 
ATOM   2612 C  CD1    . LEU C 3 328 ? 9.184   36.202 33.238  1.00 56.62  ? 328 LEU A CD1    1 
ATOM   2613 C  CD2    . LEU C 3 328 ? 10.577  34.627 31.887  1.00 62.47  ? 328 LEU A CD2    1 
ATOM   2614 N  N      . LEU C 3 329 ? 13.174  34.367 36.676  1.00 83.33  ? 329 LEU A N      1 
ATOM   2615 C  CA     . LEU C 3 329 ? 14.473  34.529 37.322  1.00 72.46  ? 329 LEU A CA     1 
ATOM   2616 C  C      . LEU C 3 329 ? 15.273  33.233 37.268  1.00 79.69  ? 329 LEU A C      1 
ATOM   2617 O  O      . LEU C 3 329 ? 16.439  33.224 36.849  1.00 69.62  ? 329 LEU A O      1 
ATOM   2618 C  CB     . LEU C 3 329 ? 14.273  35.001 38.763  1.00 79.03  ? 329 LEU A CB     1 
ATOM   2619 C  CG     . LEU C 3 329 ? 13.457  36.299 38.905  1.00 81.34  ? 329 LEU A CG     1 
ATOM   2620 C  CD1    . LEU C 3 329 ? 13.286  36.666 40.372  1.00 80.11  ? 329 LEU A CD1    1 
ATOM   2621 C  CD2    . LEU C 3 329 ? 14.074  37.474 38.126  1.00 65.98  ? 329 LEU A CD2    1 
ATOM   2622 N  N      . ASN C 3 330 ? 14.647  32.118 37.666  1.00 81.68  ? 330 ASN A N      1 
ATOM   2623 C  CA     . ASN C 3 330 ? 15.322  30.825 37.603  1.00 84.46  ? 330 ASN A CA     1 
ATOM   2624 C  C      . ASN C 3 330 ? 15.751  30.494 36.180  1.00 80.54  ? 330 ASN A C      1 
ATOM   2625 O  O      . ASN C 3 330 ? 16.873  30.025 35.954  1.00 85.64  ? 330 ASN A O      1 
ATOM   2626 C  CB     . ASN C 3 330 ? 14.409  29.727 38.155  1.00 85.29  ? 330 ASN A CB     1 
ATOM   2627 N  N      . ARG C 3 331 ? 14.873  30.738 35.204  1.00 77.42  ? 331 ARG A N      1 
ATOM   2628 C  CA     . ARG C 3 331 ? 15.198  30.421 33.817  1.00 77.57  ? 331 ARG A CA     1 
ATOM   2629 C  C      . ARG C 3 331 ? 16.359  31.270 33.310  1.00 80.94  ? 331 ARG A C      1 
ATOM   2630 O  O      . ARG C 3 331 ? 17.356  30.735 32.807  1.00 82.54  ? 331 ARG A O      1 
ATOM   2631 C  CB     . ARG C 3 331 ? 13.962  30.612 32.931  1.00 71.89  ? 331 ARG A CB     1 
ATOM   2632 C  CG     . ARG C 3 331 ? 12.864  29.598 33.173  1.00 62.16  ? 331 ARG A CG     1 
ATOM   2633 C  CD     . ARG C 3 331 ? 11.665  29.868 32.282  1.00 61.51  ? 331 ARG A CD     1 
ATOM   2634 N  NE     . ARG C 3 331 ? 12.085  30.216 30.935  1.00 65.28  ? 331 ARG A NE     1 
ATOM   2635 C  CZ     . ARG C 3 331 ? 11.292  30.783 30.026  1.00 65.97  ? 331 ARG A CZ     1 
ATOM   2636 N  NH1    . ARG C 3 331 ? 10.021  31.060 30.323  1.00 60.30  ? 331 ARG A NH1    1 
ATOM   2637 N  NH2    . ARG C 3 331 ? 11.774  31.081 28.821  1.00 56.08  ? 331 ARG A NH2    1 
ATOM   2638 N  N      . VAL C 3 332 ? 16.244  32.599 33.424  1.00 82.06  ? 332 VAL A N      1 
ATOM   2639 C  CA     . VAL C 3 332 ? 17.271  33.484 32.874  1.00 85.69  ? 332 VAL A CA     1 
ATOM   2640 C  C      . VAL C 3 332 ? 18.602  33.248 33.572  1.00 90.63  ? 332 VAL A C      1 
ATOM   2641 O  O      . VAL C 3 332 ? 19.663  33.210 32.934  1.00 94.88  ? 332 VAL A O      1 
ATOM   2642 C  CB     . VAL C 3 332 ? 16.836  34.958 32.974  1.00 82.29  ? 332 VAL A CB     1 
ATOM   2643 C  CG1    . VAL C 3 332 ? 17.995  35.862 32.605  1.00 83.00  ? 332 VAL A CG1    1 
ATOM   2644 C  CG2    . VAL C 3 332 ? 15.644  35.229 32.063  1.00 73.56  ? 332 VAL A CG2    1 
ATOM   2645 N  N      . CYS C 3 333 ? 18.569  33.085 34.894  1.00 84.19  ? 333 CYS A N      1 
ATOM   2646 C  CA     . CYS C 3 333 ? 19.783  32.726 35.618  1.00 100.42 ? 333 CYS A CA     1 
ATOM   2647 C  C      . CYS C 3 333 ? 20.459  31.509 34.985  1.00 104.51 ? 333 CYS A C      1 
ATOM   2648 O  O      . CYS C 3 333 ? 21.634  31.569 34.602  1.00 103.24 ? 333 CYS A O      1 
ATOM   2649 C  CB     . CYS C 3 333 ? 19.450  32.489 37.098  1.00 100.14 ? 333 CYS A CB     1 
ATOM   2650 S  SG     . CYS C 3 333 ? 20.327  31.114 37.926  1.00 119.47 ? 333 CYS A SG     1 
ATOM   2651 N  N      . GLN C 3 334 ? 19.714  30.408 34.824  1.00 105.45 ? 334 GLN A N      1 
ATOM   2652 C  CA     . GLN C 3 334 ? 20.298  29.178 34.290  1.00 98.89  ? 334 GLN A CA     1 
ATOM   2653 C  C      . GLN C 3 334 ? 21.032  29.424 32.969  1.00 95.18  ? 334 GLN A C      1 
ATOM   2654 O  O      . GLN C 3 334 ? 22.098  28.843 32.725  1.00 84.35  ? 334 GLN A O      1 
ATOM   2655 C  CB     . GLN C 3 334 ? 19.206  28.116 34.124  1.00 84.77  ? 334 GLN A CB     1 
ATOM   2656 N  N      . ASP C 3 335 ? 20.487  30.301 32.114  1.00 99.44  ? 335 ASP A N      1 
ATOM   2657 C  CA     . ASP C 3 335 ? 21.063  30.518 30.784  1.00 99.55  ? 335 ASP A CA     1 
ATOM   2658 C  C      . ASP C 3 335 ? 22.502  31.022 30.860  1.00 100.98 ? 335 ASP A C      1 
ATOM   2659 O  O      . ASP C 3 335 ? 23.318  30.690 29.990  1.00 99.44  ? 335 ASP A O      1 
ATOM   2660 C  CB     . ASP C 3 335 ? 20.176  31.491 29.990  1.00 93.51  ? 335 ASP A CB     1 
ATOM   2661 C  CG     . ASP C 3 335 ? 20.816  31.974 28.684  1.00 96.25  ? 335 ASP A CG     1 
ATOM   2662 O  OD1    . ASP C 3 335 ? 21.621  31.234 28.065  1.00 95.79  ? 335 ASP A OD1    1 
ATOM   2663 O  OD2    . ASP C 3 335 ? 20.492  33.110 28.272  1.00 97.70  ? 335 ASP A OD2    1 
ATOM   2664 N  N      . GLY C 3 336 ? 22.836  31.811 31.886  1.00 98.83  ? 336 GLY A N      1 
ATOM   2665 C  CA     . GLY C 3 336 ? 24.178  32.339 32.032  1.00 94.13  ? 336 GLY A CA     1 
ATOM   2666 C  C      . GLY C 3 336 ? 24.448  33.648 31.317  1.00 89.42  ? 336 GLY A C      1 
ATOM   2667 O  O      . GLY C 3 336 ? 25.602  34.096 31.292  1.00 88.37  ? 336 GLY A O      1 
ATOM   2668 N  N      . ARG C 3 337 ? 23.440  34.255 30.705  1.00 92.35  ? 337 ARG A N      1 
ATOM   2669 C  CA     . ARG C 3 337 ? 23.541  35.595 30.151  1.00 86.54  ? 337 ARG A CA     1 
ATOM   2670 C  C      . ARG C 3 337 ? 22.599  36.502 30.928  1.00 85.23  ? 337 ARG A C      1 
ATOM   2671 O  O      . ARG C 3 337 ? 21.710  36.033 31.648  1.00 84.49  ? 337 ARG A O      1 
ATOM   2672 C  CB     . ARG C 3 337 ? 23.192  35.621 28.656  1.00 83.26  ? 337 ARG A CB     1 
ATOM   2673 C  CG     . ARG C 3 337 ? 23.841  34.516 27.832  1.00 82.75  ? 337 ARG A CG     1 
ATOM   2674 C  CD     . ARG C 3 337 ? 22.809  33.862 26.911  1.00 86.82  ? 337 ARG A CD     1 
ATOM   2675 N  NE     . ARG C 3 337 ? 22.471  34.699 25.763  1.00 78.51  ? 337 ARG A NE     1 
ATOM   2676 C  CZ     . ARG C 3 337 ? 21.308  34.654 25.117  1.00 76.29  ? 337 ARG A CZ     1 
ATOM   2677 N  NH1    . ARG C 3 337 ? 20.350  33.821 25.517  1.00 64.42  ? 337 ARG A NH1    1 
ATOM   2678 N  NH2    . ARG C 3 337 ? 21.099  35.450 24.070  1.00 74.28  ? 337 ARG A NH2    1 
ATOM   2679 N  N      . LYS C 3 338 ? 22.791  37.808 30.774  1.00 75.21  ? 338 LYS A N      1 
ATOM   2680 C  CA     . LYS C 3 338 ? 22.030  38.740 31.582  1.00 79.87  ? 338 LYS A CA     1 
ATOM   2681 C  C      . LYS C 3 338 ? 21.152  39.628 30.716  1.00 74.67  ? 338 LYS A C      1 
ATOM   2682 O  O      . LYS C 3 338 ? 21.619  40.173 29.702  1.00 70.56  ? 338 LYS A O      1 
ATOM   2683 C  CB     . LYS C 3 338 ? 22.966  39.606 32.445  1.00 94.96  ? 338 LYS A CB     1 
ATOM   2684 N  N      . PRO C 3 339 ? 19.883  39.801 31.072  1.00 70.35  ? 339 PRO A N      1 
ATOM   2685 C  CA     . PRO C 3 339 ? 19.018  40.736 30.344  1.00 76.98  ? 339 PRO A CA     1 
ATOM   2686 C  C      . PRO C 3 339 ? 19.225  42.176 30.801  1.00 72.94  ? 339 PRO A C      1 
ATOM   2687 O  O      . PRO C 3 339 ? 19.305  42.467 31.996  1.00 75.67  ? 339 PRO A O      1 
ATOM   2688 C  CB     . PRO C 3 339 ? 17.607  40.246 30.691  1.00 72.09  ? 339 PRO A CB     1 
ATOM   2689 C  CG     . PRO C 3 339 ? 17.764  39.651 32.064  1.00 70.51  ? 339 PRO A CG     1 
ATOM   2690 C  CD     . PRO C 3 339 ? 19.152  39.043 32.104  1.00 67.62  ? 339 PRO A CD     1 
ATOM   2691 N  N      . HIS C 3 340 ? 19.308  43.084 29.833  1.00 65.86  ? 340 HIS A N      1 
ATOM   2692 C  CA     . HIS C 3 340 ? 19.474  44.501 30.113  1.00 59.71  ? 340 HIS A CA     1 
ATOM   2693 C  C      . HIS C 3 340 ? 18.217  45.303 29.800  1.00 61.66  ? 340 HIS A C      1 
ATOM   2694 O  O      . HIS C 3 340 ? 18.277  46.535 29.750  1.00 72.14  ? 340 HIS A O      1 
ATOM   2695 C  CB     . HIS C 3 340 ? 20.673  45.053 29.333  1.00 69.05  ? 340 HIS A CB     1 
ATOM   2696 C  CG     . HIS C 3 340 ? 22.005  44.575 29.844  1.00 79.22  ? 340 HIS A CG     1 
ATOM   2697 N  ND1    . HIS C 3 340 ? 22.866  45.383 30.560  1.00 79.99  ? 340 HIS A ND1    1 
ATOM   2698 C  CD2    . HIS C 3 340 ? 22.618  43.369 29.751  1.00 75.48  ? 340 HIS A CD2    1 
ATOM   2699 C  CE1    . HIS C 3 340 ? 23.952  44.699 30.878  1.00 69.28  ? 340 HIS A CE1    1 
ATOM   2700 N  NE2    . HIS C 3 340 ? 23.825  43.473 30.401  1.00 70.52  ? 340 HIS A NE2    1 
ATOM   2701 N  N      . THR C 3 341 ? 17.089  44.636 29.564  1.00 58.80  ? 341 THR A N      1 
ATOM   2702 C  CA     . THR C 3 341 ? 15.799  45.301 29.428  1.00 57.13  ? 341 THR A CA     1 
ATOM   2703 C  C      . THR C 3 341 ? 14.719  44.372 29.963  1.00 58.31  ? 341 THR A C      1 
ATOM   2704 O  O      . THR C 3 341 ? 14.853  43.151 29.899  1.00 63.73  ? 341 THR A O      1 
ATOM   2705 C  CB     . THR C 3 341 ? 15.492  45.676 27.977  1.00 56.72  ? 341 THR A CB     1 
ATOM   2706 O  OG1    . THR C 3 341 ? 16.507  46.553 27.490  1.00 63.96  ? 341 THR A OG1    1 
ATOM   2707 C  CG2    . THR C 3 341 ? 14.135  46.358 27.867  1.00 51.69  ? 341 THR A CG2    1 
ATOM   2708 N  N      . VAL C 3 342 ? 13.663  44.957 30.522  1.00 58.60  ? 342 VAL A N      1 
ATOM   2709 C  CA     . VAL C 3 342 ? 12.499  44.211 30.981  1.00 54.83  ? 342 VAL A CA     1 
ATOM   2710 C  C      . VAL C 3 342 ? 11.267  44.854 30.358  1.00 61.26  ? 342 VAL A C      1 
ATOM   2711 O  O      . VAL C 3 342 ? 11.268  46.045 30.026  1.00 61.99  ? 342 VAL A O      1 
ATOM   2712 C  CB     . VAL C 3 342 ? 12.384  44.175 32.526  1.00 62.35  ? 342 VAL A CB     1 
ATOM   2713 C  CG1    . VAL C 3 342 ? 11.538  45.339 33.035  1.00 60.14  ? 342 VAL A CG1    1 
ATOM   2714 C  CG2    . VAL C 3 342 ? 11.807  42.846 32.990  1.00 62.38  ? 342 VAL A CG2    1 
ATOM   2715 N  N      . ARG C 3 343 ? 10.217  44.052 30.178  1.00 60.82  ? 343 ARG A N      1 
ATOM   2716 C  CA     . ARG C 3 343 ? 8.981   44.527 29.572  1.00 64.21  ? 343 ARG A CA     1 
ATOM   2717 C  C      . ARG C 3 343 ? 7.794   43.894 30.280  1.00 62.04  ? 343 ARG A C      1 
ATOM   2718 O  O      . ARG C 3 343 ? 7.849   42.737 30.699  1.00 67.76  ? 343 ARG A O      1 
ATOM   2719 C  CB     . ARG C 3 343 ? 8.920   44.216 28.065  1.00 57.89  ? 343 ARG A CB     1 
ATOM   2720 C  CG     . ARG C 3 343 ? 7.575   44.516 27.414  1.00 60.04  ? 343 ARG A CG     1 
ATOM   2721 C  CD     . ARG C 3 343 ? 7.668   44.669 25.876  1.00 65.09  ? 343 ARG A CD     1 
ATOM   2722 N  NE     . ARG C 3 343 ? 8.556   43.673 25.277  1.00 79.29  ? 343 ARG A NE     1 
ATOM   2723 C  CZ     . ARG C 3 343 ? 9.585   43.958 24.483  1.00 76.03  ? 343 ARG A CZ     1 
ATOM   2724 N  NH1    . ARG C 3 343 ? 9.850   45.214 24.153  1.00 77.96  ? 343 ARG A NH1    1 
ATOM   2725 N  NH2    . ARG C 3 343 ? 10.346  42.981 24.008  1.00 73.30  ? 343 ARG A NH2    1 
ATOM   2726 N  N      . LEU C 3 344 ? 6.729   44.675 30.426  1.00 65.53  ? 344 LEU A N      1 
ATOM   2727 C  CA     . LEU C 3 344 ? 5.448   44.203 30.927  1.00 64.47  ? 344 LEU A CA     1 
ATOM   2728 C  C      . LEU C 3 344 ? 4.390   44.404 29.849  1.00 66.51  ? 344 LEU A C      1 
ATOM   2729 O  O      . LEU C 3 344 ? 4.405   45.418 29.135  1.00 63.54  ? 344 LEU A O      1 
ATOM   2730 C  CB     . LEU C 3 344 ? 5.054   44.935 32.212  1.00 60.75  ? 344 LEU A CB     1 
ATOM   2731 N  N      . ILE C 3 345 ? 3.489   43.420 29.719  1.00 65.17  ? 345 ILE A N      1 
ATOM   2732 C  CA     . ILE C 3 345 ? 2.460   43.410 28.685  1.00 62.66  ? 345 ILE A CA     1 
ATOM   2733 C  C      . ILE C 3 345 ? 1.129   43.111 29.349  1.00 63.79  ? 345 ILE A C      1 
ATOM   2734 O  O      . ILE C 3 345 ? 1.069   42.341 30.311  1.00 69.46  ? 345 ILE A O      1 
ATOM   2735 C  CB     . ILE C 3 345 ? 2.755   42.367 27.576  1.00 66.20  ? 345 ILE A CB     1 
ATOM   2736 C  CG1    . ILE C 3 345 ? 4.172   42.536 27.014  1.00 60.93  ? 345 ILE A CG1    1 
ATOM   2737 C  CG2    . ILE C 3 345 ? 1.708   42.436 26.453  1.00 68.29  ? 345 ILE A CG2    1 
ATOM   2738 C  CD1    . ILE C 3 345 ? 5.238   41.828 27.823  1.00 62.74  ? 345 ILE A CD1    1 
ATOM   2739 N  N      . ILE C 3 346 ? 0.053   43.711 28.830  1.00 59.26  ? 346 ILE A N      1 
ATOM   2740 C  CA     . ILE C 3 346 ? -1.291  43.535 29.379  1.00 76.97  ? 346 ILE A CA     1 
ATOM   2741 C  C      . ILE C 3 346 ? -2.295  43.511 28.232  1.00 79.66  ? 346 ILE A C      1 
ATOM   2742 O  O      . ILE C 3 346 ? -1.982  43.872 27.097  1.00 81.57  ? 346 ILE A O      1 
ATOM   2743 C  CB     . ILE C 3 346 ? -1.681  44.648 30.383  1.00 74.12  ? 346 ILE A CB     1 
ATOM   2744 C  CG1    . ILE C 3 346 ? -1.839  45.986 29.649  1.00 74.15  ? 346 ILE A CG1    1 
ATOM   2745 C  CG2    . ILE C 3 346 ? -0.670  44.741 31.522  1.00 65.32  ? 346 ILE A CG2    1 
ATOM   2746 C  CD1    . ILE C 3 346 ? -2.552  47.051 30.441  1.00 77.24  ? 346 ILE A CD1    1 
ATOM   2747 N  N      . ARG C 3 347 ? -3.522  43.082 28.540  1.00 85.56  ? 347 ARG A N      1 
ATOM   2748 C  CA     . ARG C 3 347 ? -4.628  43.086 27.587  1.00 89.37  ? 347 ARG A CA     1 
ATOM   2749 C  C      . ARG C 3 347 ? -5.867  43.630 28.292  1.00 95.98  ? 347 ARG A C      1 
ATOM   2750 O  O      . ARG C 3 347 ? -6.188  43.201 29.406  1.00 91.46  ? 347 ARG A O      1 
ATOM   2751 C  CB     . ARG C 3 347 ? -4.886  41.674 27.029  1.00 84.92  ? 347 ARG A CB     1 
ATOM   2752 C  CG     . ARG C 3 347 ? -5.640  41.602 25.694  1.00 81.74  ? 347 ARG A CG     1 
ATOM   2753 C  CD     . ARG C 3 347 ? -5.601  40.175 25.120  1.00 83.00  ? 347 ARG A CD     1 
ATOM   2754 N  NE     . ARG C 3 347 ? -5.861  39.162 26.147  1.00 89.59  ? 347 ARG A NE     1 
ATOM   2755 C  CZ     . ARG C 3 347 ? -5.481  37.885 26.074  1.00 91.04  ? 347 ARG A CZ     1 
ATOM   2756 N  NH1    . ARG C 3 347 ? -5.768  37.056 27.072  1.00 86.61  ? 347 ARG A NH1    1 
ATOM   2757 N  NH2    . ARG C 3 347 ? -4.807  37.432 25.019  1.00 83.10  ? 347 ARG A NH2    1 
ATOM   2758 N  N      . ARG C 3 348 ? -6.546  44.585 27.662  1.00 99.38  ? 348 ARG A N      1 
ATOM   2759 C  CA     . ARG C 3 348 ? -7.681  45.253 28.285  1.00 103.74 ? 348 ARG A CA     1 
ATOM   2760 C  C      . ARG C 3 348 ? -8.963  44.449 28.075  1.00 110.55 ? 348 ARG A C      1 
ATOM   2761 O  O      . ARG C 3 348 ? -9.084  43.657 27.134  1.00 104.57 ? 348 ARG A O      1 
ATOM   2762 C  CB     . ARG C 3 348 ? -7.847  46.673 27.734  1.00 94.71  ? 348 ARG A CB     1 
ATOM   2763 N  N      . TYR C 3 349 ? -9.927  44.673 28.972  1.00 104.94 ? 349 TYR A N      1 
ATOM   2764 C  CA     . TYR C 3 349 ? -11.196 43.954 28.934  1.00 103.79 ? 349 TYR A CA     1 
ATOM   2765 C  C      . TYR C 3 349 ? -11.897 44.126 27.587  1.00 110.65 ? 349 TYR A C      1 
ATOM   2766 O  O      . TYR C 3 349 ? -11.926 45.221 27.018  1.00 108.66 ? 349 TYR A O      1 
ATOM   2767 C  CB     . TYR C 3 349 ? -12.102 44.443 30.061  1.00 94.82  ? 349 TYR A CB     1 
ATOM   2768 N  N      . SER C 3 350 ? -12.480 43.031 27.091  1.00 114.03 ? 350 SER A N      1 
ATOM   2769 C  CA     . SER C 3 350 ? -13.164 42.994 25.790  1.00 106.55 ? 350 SER A CA     1 
ATOM   2770 C  C      . SER C 3 350 ? -12.367 43.671 24.674  1.00 96.04  ? 350 SER A C      1 
ATOM   2771 O  O      . SER C 3 350 ? -12.934 44.099 23.670  1.00 98.41  ? 350 SER A O      1 
ATOM   2772 C  CB     . SER C 3 350 ? -14.548 43.641 25.890  1.00 102.61 ? 350 SER A CB     1 
ATOM   2773 O  OG     . SER C 3 350 ? -15.143 43.756 24.606  1.00 108.18 ? 350 SER A OG     1 
ATOM   2774 N  N      . GLY C 3 356 ? -4.928  43.754 20.400  1.00 79.11  ? 356 GLY A N      1 
ATOM   2775 C  CA     . GLY C 3 356 ? -5.290  44.760 21.382  1.00 88.19  ? 356 GLY A CA     1 
ATOM   2776 C  C      . GLY C 3 356 ? -4.512  44.643 22.686  1.00 99.31  ? 356 GLY A C      1 
ATOM   2777 O  O      . GLY C 3 356 ? -5.084  44.707 23.782  1.00 95.94  ? 356 GLY A O      1 
ATOM   2778 N  N      . ARG C 3 357 ? -3.200  44.459 22.572  1.00 88.46  ? 357 ARG A N      1 
ATOM   2779 C  CA     . ARG C 3 357 ? -2.313  44.394 23.724  1.00 88.92  ? 357 ARG A CA     1 
ATOM   2780 C  C      . ARG C 3 357 ? -1.519  45.691 23.846  1.00 89.05  ? 357 ARG A C      1 
ATOM   2781 O  O      . ARG C 3 357 ? -1.393  46.462 22.888  1.00 78.68  ? 357 ARG A O      1 
ATOM   2782 C  CB     . ARG C 3 357 ? -1.348  43.204 23.619  1.00 89.98  ? 357 ARG A CB     1 
ATOM   2783 C  CG     . ARG C 3 357 ? -1.997  41.827 23.567  1.00 91.22  ? 357 ARG A CG     1 
ATOM   2784 C  CD     . ARG C 3 357 ? -1.053  40.815 22.926  1.00 96.53  ? 357 ARG A CD     1 
ATOM   2785 N  NE     . ARG C 3 357 ? -0.824  39.617 23.738  1.00 91.07  ? 357 ARG A NE     1 
ATOM   2786 C  CZ     . ARG C 3 357 ? -1.340  38.418 23.469  1.00 99.76  ? 357 ARG A CZ     1 
ATOM   2787 N  NH1    . ARG C 3 357 ? -1.069  37.379 24.259  1.00 87.89  ? 357 ARG A NH1    1 
ATOM   2788 N  NH2    . ARG C 3 357 ? -2.129  38.256 22.409  1.00 106.87 ? 357 ARG A NH2    1 
ATOM   2789 N  N      . GLU C 3 358 ? -0.983  45.922 25.048  1.00 81.19  ? 358 GLU A N      1 
ATOM   2790 C  CA     . GLU C 3 358 ? -0.141  47.074 25.335  1.00 81.45  ? 358 GLU A CA     1 
ATOM   2791 C  C      . GLU C 3 358 ? 1.111   46.608 26.067  1.00 78.07  ? 358 GLU A C      1 
ATOM   2792 O  O      . GLU C 3 358 ? 1.089   45.578 26.748  1.00 74.44  ? 358 GLU A O      1 
ATOM   2793 C  CB     . GLU C 3 358 ? -0.891  48.129 26.175  1.00 85.96  ? 358 GLU A CB     1 
ATOM   2794 C  CG     . GLU C 3 358 ? -2.142  48.723 25.511  1.00 87.78  ? 358 GLU A CG     1 
ATOM   2795 C  CD     . GLU C 3 358 ? -2.944  49.614 26.462  1.00 92.36  ? 358 GLU A CD     1 
ATOM   2796 O  OE1    . GLU C 3 358 ? -4.189  49.479 26.525  1.00 92.78  ? 358 GLU A OE1    1 
ATOM   2797 O  OE2    . GLU C 3 358 ? -2.320  50.441 27.160  1.00 97.20  ? 358 GLU A OE2    1 
ATOM   2798 N  N      . SER C 3 359 ? 2.206   47.368 25.914  1.00 73.79  ? 359 SER A N      1 
ATOM   2799 C  CA     . SER C 3 359 ? 3.484   47.054 26.548  1.00 61.95  ? 359 SER A CA     1 
ATOM   2800 C  C      . SER C 3 359 ? 4.176   48.333 26.999  1.00 65.66  ? 359 SER A C      1 
ATOM   2801 O  O      . SER C 3 359 ? 3.976   49.404 26.414  1.00 66.10  ? 359 SER A O      1 
ATOM   2802 C  CB     . SER C 3 359 ? 4.418   46.280 25.600  1.00 59.25  ? 359 SER A CB     1 
ATOM   2803 O  OG     . SER C 3 359 ? 4.403   46.844 24.296  1.00 60.27  ? 359 SER A OG     1 
ATOM   2804 N  N      . ARG C 3 360 ? 5.003   48.199 28.039  1.00 57.77  ? 360 ARG A N      1 
ATOM   2805 C  CA     . ARG C 3 360 ? 5.860   49.266 28.543  1.00 64.11  ? 360 ARG A CA     1 
ATOM   2806 C  C      . ARG C 3 360 ? 7.174   48.648 28.991  1.00 71.41  ? 360 ARG A C      1 
ATOM   2807 O  O      . ARG C 3 360 ? 7.170   47.704 29.786  1.00 74.94  ? 360 ARG A O      1 
ATOM   2808 C  CB     . ARG C 3 360 ? 5.209   50.009 29.721  1.00 65.87  ? 360 ARG A CB     1 
ATOM   2809 C  CG     . ARG C 3 360 ? 4.834   51.454 29.452  1.00 58.00  ? 360 ARG A CG     1 
ATOM   2810 C  CD     . ARG C 3 360 ? 3.883   51.570 28.278  1.00 63.16  ? 360 ARG A CD     1 
ATOM   2811 N  NE     . ARG C 3 360 ? 2.924   52.651 28.462  1.00 68.12  ? 360 ARG A NE     1 
ATOM   2812 C  CZ     . ARG C 3 360 ? 1.911   52.905 27.641  1.00 67.74  ? 360 ARG A CZ     1 
ATOM   2813 N  NH1    . ARG C 3 360 ? 1.716   52.153 26.562  1.00 66.98  ? 360 ARG A NH1    1 
ATOM   2814 N  NH2    . ARG C 3 360 ? 1.093   53.914 27.904  1.00 78.07  ? 360 ARG A NH2    1 
ATOM   2815 N  N      . GLN C 3 361 ? 8.294   49.176 28.505  1.00 73.88  ? 361 GLN A N      1 
ATOM   2816 C  CA     . GLN C 3 361 ? 9.595   48.651 28.898  1.00 74.86  ? 361 GLN A CA     1 
ATOM   2817 C  C      . GLN C 3 361 ? 10.486  49.751 29.473  1.00 76.12  ? 361 GLN A C      1 
ATOM   2818 O  O      . GLN C 3 361 ? 10.158  50.944 29.463  1.00 66.64  ? 361 GLN A O      1 
ATOM   2819 C  CB     . GLN C 3 361 ? 10.292  47.973 27.716  1.00 70.54  ? 361 GLN A CB     1 
ATOM   2820 C  CG     . GLN C 3 361 ? 10.307  48.828 26.474  1.00 68.55  ? 361 GLN A CG     1 
ATOM   2821 C  CD     . GLN C 3 361 ? 10.952  48.113 25.309  1.00 72.44  ? 361 GLN A CD     1 
ATOM   2822 O  OE1    . GLN C 3 361 ? 10.264  47.651 24.400  1.00 80.47  ? 361 GLN A OE1    1 
ATOM   2823 N  NE2    . GLN C 3 361 ? 12.281  48.022 25.324  1.00 70.02  ? 361 GLN A NE2    1 
ATOM   2824 N  N      . CYS C 3 362 ? 11.634  49.314 29.977  1.00 67.03  ? 362 CYS A N      1 
ATOM   2825 C  CA     . CYS C 3 362 ? 12.655  50.186 30.539  1.00 68.95  ? 362 CYS A CA     1 
ATOM   2826 C  C      . CYS C 3 362 ? 13.942  49.381 30.665  1.00 65.30  ? 362 CYS A C      1 
ATOM   2827 O  O      . CYS C 3 362 ? 13.903  48.144 30.700  1.00 62.50  ? 362 CYS A O      1 
ATOM   2828 C  CB     . CYS C 3 362 ? 12.234  50.715 31.916  1.00 75.67  ? 362 CYS A CB     1 
ATOM   2829 S  SG     . CYS C 3 362 ? 12.618  49.543 33.246  1.00 65.37  ? 362 CYS A SG     1 
ATOM   2830 N  N      . PRO C 3 363 ? 15.093  50.042 30.750  1.00 62.72  ? 363 PRO A N      1 
ATOM   2831 C  CA     . PRO C 3 363 ? 16.326  49.293 31.007  1.00 55.83  ? 363 PRO A CA     1 
ATOM   2832 C  C      . PRO C 3 363 ? 16.310  48.744 32.420  1.00 63.42  ? 363 PRO A C      1 
ATOM   2833 O  O      . PRO C 3 363 ? 15.486  49.119 33.257  1.00 63.21  ? 363 PRO A O      1 
ATOM   2834 C  CB     . PRO C 3 363 ? 17.436  50.331 30.819  1.00 53.93  ? 363 PRO A CB     1 
ATOM   2835 C  CG     . PRO C 3 363 ? 16.787  51.468 30.076  1.00 55.54  ? 363 PRO A CG     1 
ATOM   2836 C  CD     . PRO C 3 363 ? 15.353  51.468 30.501  1.00 55.76  ? 363 PRO A CD     1 
ATOM   2837 N  N      . ILE C 3 364 ? 17.242  47.840 32.677  1.00 71.21  ? 364 ILE A N      1 
ATOM   2838 C  CA     . ILE C 3 364 ? 17.357  47.142 33.951  1.00 69.93  ? 364 ILE A CA     1 
ATOM   2839 C  C      . ILE C 3 364 ? 18.518  47.768 34.725  1.00 74.53  ? 364 ILE A C      1 
ATOM   2840 O  O      . ILE C 3 364 ? 19.645  47.772 34.207  1.00 86.59  ? 364 ILE A O      1 
ATOM   2841 C  CB     . ILE C 3 364 ? 17.583  45.640 33.739  1.00 72.67  ? 364 ILE A CB     1 
ATOM   2842 C  CG1    . ILE C 3 364 ? 16.286  44.974 33.247  1.00 71.90  ? 364 ILE A CG1    1 
ATOM   2843 C  CG2    . ILE C 3 364 ? 18.166  44.997 34.998  1.00 74.78  ? 364 ILE A CG2    1 
ATOM   2844 C  CD1    . ILE C 3 364 ? 16.324  43.443 33.189  1.00 56.28  ? 364 ILE A CD1    1 
ATOM   2845 N  N      . PRO C 3 365 ? 18.296  48.303 35.924  1.00 75.96  ? 365 PRO A N      1 
ATOM   2846 C  CA     . PRO C 3 365 ? 19.389  48.972 36.643  1.00 77.77  ? 365 PRO A CA     1 
ATOM   2847 C  C      . PRO C 3 365 ? 20.620  48.083 36.738  1.00 85.04  ? 365 PRO A C      1 
ATOM   2848 O  O      . PRO C 3 365 ? 20.522  46.880 36.993  1.00 79.61  ? 365 PRO A O      1 
ATOM   2849 C  CB     . PRO C 3 365 ? 18.785  49.254 38.021  1.00 85.13  ? 365 PRO A CB     1 
ATOM   2850 C  CG     . PRO C 3 365 ? 17.314  49.361 37.757  1.00 83.22  ? 365 PRO A CG     1 
ATOM   2851 C  CD     . PRO C 3 365 ? 17.025  48.365 36.669  1.00 76.47  ? 365 PRO A CD     1 
ATOM   2852 N  N      . SER C 3 366 ? 21.792  48.696 36.541  1.00 87.15  ? 366 SER A N      1 
ATOM   2853 C  CA     . SER C 3 366 ? 23.019  47.923 36.367  1.00 85.12  ? 366 SER A CA     1 
ATOM   2854 C  C      . SER C 3 366 ? 23.289  47.026 37.569  1.00 90.37  ? 366 SER A C      1 
ATOM   2855 O  O      . SER C 3 366 ? 23.538  45.825 37.416  1.00 90.91  ? 366 SER A O      1 
ATOM   2856 C  CB     . SER C 3 366 ? 24.200  48.861 36.112  1.00 87.23  ? 366 SER A CB     1 
ATOM   2857 O  OG     . SER C 3 366 ? 25.326  48.148 35.626  1.00 81.61  ? 366 SER A OG     1 
ATOM   2858 N  N      . HIS C 3 367 ? 23.254  47.591 38.777  1.00 96.90  ? 367 HIS A N      1 
ATOM   2859 C  CA     . HIS C 3 367 ? 23.539  46.777 39.954  1.00 95.19  ? 367 HIS A CA     1 
ATOM   2860 C  C      . HIS C 3 367 ? 22.516  45.657 40.115  1.00 92.71  ? 367 HIS A C      1 
ATOM   2861 O  O      . HIS C 3 367 ? 22.841  44.595 40.662  1.00 91.17  ? 367 HIS A O      1 
ATOM   2862 C  CB     . HIS C 3 367 ? 23.591  47.662 41.209  1.00 101.39 ? 367 HIS A CB     1 
ATOM   2863 C  CG     . HIS C 3 367 ? 22.244  48.049 41.736  1.00 98.93  ? 367 HIS A CG     1 
ATOM   2864 N  ND1    . HIS C 3 367 ? 21.570  47.295 42.675  1.00 100.48 ? 367 HIS A ND1    1 
ATOM   2865 C  CD2    . HIS C 3 367 ? 21.438  49.098 41.445  1.00 95.81  ? 367 HIS A CD2    1 
ATOM   2866 C  CE1    . HIS C 3 367 ? 20.407  47.862 42.938  1.00 97.45  ? 367 HIS A CE1    1 
ATOM   2867 N  NE2    . HIS C 3 367 ? 20.301  48.956 42.203  1.00 102.94 ? 367 HIS A NE2    1 
ATOM   2868 N  N      . VAL C 3 368 ? 21.281  45.873 39.642  1.00 94.23  ? 368 VAL A N      1 
ATOM   2869 C  CA     . VAL C 3 368 ? 20.246  44.842 39.726  1.00 89.90  ? 368 VAL A CA     1 
ATOM   2870 C  C      . VAL C 3 368 ? 20.610  43.659 38.847  1.00 94.38  ? 368 VAL A C      1 
ATOM   2871 O  O      . VAL C 3 368 ? 20.295  42.505 39.172  1.00 95.51  ? 368 VAL A O      1 
ATOM   2872 C  CB     . VAL C 3 368 ? 18.870  45.415 39.333  1.00 86.34  ? 368 VAL A CB     1 
ATOM   2873 C  CG1    . VAL C 3 368 ? 17.769  44.410 39.646  1.00 78.79  ? 368 VAL A CG1    1 
ATOM   2874 C  CG2    . VAL C 3 368 ? 18.613  46.741 40.033  1.00 90.64  ? 368 VAL A CG2    1 
ATOM   2875 N  N      . ILE C 3 369 ? 21.269  43.922 37.718  1.00 96.27  ? 369 ILE A N      1 
ATOM   2876 C  CA     . ILE C 3 369 ? 21.763  42.866 36.850  1.00 85.31  ? 369 ILE A CA     1 
ATOM   2877 C  C      . ILE C 3 369 ? 22.711  41.928 37.583  1.00 83.62  ? 369 ILE A C      1 
ATOM   2878 O  O      . ILE C 3 369 ? 22.848  40.770 37.195  1.00 89.96  ? 369 ILE A O      1 
ATOM   2879 C  CB     . ILE C 3 369 ? 22.417  43.505 35.598  1.00 84.59  ? 369 ILE A CB     1 
ATOM   2880 C  CG1    . ILE C 3 369 ? 21.354  44.243 34.753  1.00 77.78  ? 369 ILE A CG1    1 
ATOM   2881 C  CG2    . ILE C 3 369 ? 23.134  42.471 34.744  1.00 87.30  ? 369 ILE A CG2    1 
ATOM   2882 C  CD1    . ILE C 3 369 ? 21.924  44.922 33.504  1.00 71.42  ? 369 ILE A CD1    1 
ATOM   2883 N  N      . GLN C 3 370 ? 23.310  42.379 38.681  1.00 97.26  ? 370 GLN A N      1 
ATOM   2884 C  CA     . GLN C 3 370 ? 24.252  41.561 39.436  1.00 100.22 ? 370 GLN A CA     1 
ATOM   2885 C  C      . GLN C 3 370 ? 23.613  40.328 40.073  1.00 98.29  ? 370 GLN A C      1 
ATOM   2886 O  O      . GLN C 3 370 ? 23.694  40.157 41.292  1.00 94.03  ? 370 GLN A O      1 
ATOM   2887 C  CB     . GLN C 3 370 ? 24.913  42.407 40.527  1.00 91.61  ? 370 GLN A CB     1 
ATOM   2888 N  N      . LYS C 3 371 ? 22.982  39.467 39.273  1.00 101.19 ? 371 LYS A N      1 
ATOM   2889 C  CA     . LYS C 3 371 ? 22.456  38.203 39.784  1.00 102.08 ? 371 LYS A CA     1 
ATOM   2890 C  C      . LYS C 3 371 ? 21.753  37.385 38.702  1.00 91.13  ? 371 LYS A C      1 
ATOM   2891 O  O      . LYS C 3 371 ? 21.230  36.300 38.983  1.00 91.27  ? 371 LYS A O      1 
ATOM   2892 C  CB     . LYS C 3 371 ? 21.496  38.457 40.951  1.00 98.24  ? 371 LYS A CB     1 
ATOM   2893 N  N      . ASP C 3 378 ? 18.115  39.032 46.971  1.00 80.47  ? 378 ASP A N      1 
ATOM   2894 C  CA     . ASP C 3 378 ? 16.720  39.411 46.761  1.00 92.56  ? 378 ASP A CA     1 
ATOM   2895 C  C      . ASP C 3 378 ? 16.618  40.406 45.615  1.00 94.27  ? 378 ASP A C      1 
ATOM   2896 O  O      . ASP C 3 378 ? 16.659  41.622 45.818  1.00 91.58  ? 378 ASP A O      1 
ATOM   2897 C  CB     . ASP C 3 378 ? 16.105  40.004 48.038  1.00 89.55  ? 378 ASP A CB     1 
ATOM   2898 C  CG     . ASP C 3 378 ? 14.753  40.688 47.787  1.00 98.51  ? 378 ASP A CG     1 
ATOM   2899 O  OD1    . ASP C 3 378 ? 14.047  40.320 46.821  1.00 93.38  ? 378 ASP A OD1    1 
ATOM   2900 O  OD2    . ASP C 3 378 ? 14.401  41.602 48.563  1.00 101.41 ? 378 ASP A OD2    1 
ATOM   2901 N  N      . VAL C 3 379 ? 16.489  39.881 44.396  1.00 93.00  ? 379 VAL A N      1 
ATOM   2902 C  CA     . VAL C 3 379 ? 16.293  40.741 43.234  1.00 88.70  ? 379 VAL A CA     1 
ATOM   2903 C  C      . VAL C 3 379 ? 14.818  40.948 42.918  1.00 78.10  ? 379 VAL A C      1 
ATOM   2904 O  O      . VAL C 3 379 ? 14.481  41.823 42.106  1.00 77.86  ? 379 VAL A O      1 
ATOM   2905 C  CB     . VAL C 3 379 ? 17.047  40.157 42.024  1.00 81.04  ? 379 VAL A CB     1 
ATOM   2906 C  CG1    . VAL C 3 379 ? 18.411  39.628 42.460  1.00 75.01  ? 379 VAL A CG1    1 
ATOM   2907 C  CG2    . VAL C 3 379 ? 16.239  39.058 41.378  1.00 82.41  ? 379 VAL A CG2    1 
ATOM   2908 N  N      . MET C 3 380 ? 13.928  40.188 43.548  1.00 75.57  ? 380 MET A N      1 
ATOM   2909 C  CA     . MET C 3 380 ? 12.497  40.289 43.289  1.00 91.00  ? 380 MET A CA     1 
ATOM   2910 C  C      . MET C 3 380 ? 11.960  41.672 43.607  1.00 94.33  ? 380 MET A C      1 
ATOM   2911 O  O      . MET C 3 380 ? 11.575  42.420 42.704  1.00 85.61  ? 380 MET A O      1 
ATOM   2912 C  CB     . MET C 3 380 ? 11.733  39.260 44.119  1.00 91.98  ? 380 MET A CB     1 
ATOM   2913 C  CG     . MET C 3 380 ? 11.871  37.850 43.627  1.00 96.61  ? 380 MET A CG     1 
ATOM   2914 S  SD     . MET C 3 380 ? 10.373  37.294 42.797  1.00 91.32  ? 380 MET A SD     1 
ATOM   2915 C  CE     . MET C 3 380 ? 10.552  35.525 43.037  1.00 100.11 ? 380 MET A CE     1 
ATOM   2916 N  N      . THR C 3 381 ? 11.915  41.996 44.904  1.00 105.40 ? 381 THR A N      1 
ATOM   2917 C  CA     . THR C 3 381 ? 11.417  43.252 45.463  1.00 100.28 ? 381 THR A CA     1 
ATOM   2918 C  C      . THR C 3 381 ? 11.862  44.454 44.628  1.00 91.51  ? 381 THR A C      1 
ATOM   2919 O  O      . THR C 3 381 ? 11.047  45.349 44.350  1.00 85.74  ? 381 THR A O      1 
ATOM   2920 C  CB     . THR C 3 381 ? 11.866  43.397 46.926  1.00 99.33  ? 381 THR A CB     1 
ATOM   2921 O  OG1    . THR C 3 381 ? 13.253  43.034 47.056  1.00 95.03  ? 381 THR A OG1    1 
ATOM   2922 C  CG2    . THR C 3 381 ? 11.021  42.491 47.832  1.00 94.37  ? 381 THR A CG2    1 
ATOM   2923 N  N      . PRO C 3 382 ? 13.132  44.518 44.207  1.00 91.14  ? 382 PRO A N      1 
ATOM   2924 C  CA     . PRO C 3 382 ? 13.515  45.568 43.245  1.00 85.43  ? 382 PRO A CA     1 
ATOM   2925 C  C      . PRO C 3 382 ? 12.701  45.503 41.965  1.00 89.80  ? 382 PRO A C      1 
ATOM   2926 O  O      . PRO C 3 382 ? 12.051  46.486 41.578  1.00 87.30  ? 382 PRO A O      1 
ATOM   2927 C  CB     . PRO C 3 382 ? 15.007  45.283 42.992  1.00 72.16  ? 382 PRO A CB     1 
ATOM   2928 C  CG     . PRO C 3 382 ? 15.464  44.437 44.125  1.00 76.44  ? 382 PRO A CG     1 
ATOM   2929 C  CD     . PRO C 3 382 ? 14.267  43.655 44.570  1.00 84.85  ? 382 PRO A CD     1 
ATOM   2930 N  N      . MET C 3 383 ? 12.714  44.342 41.304  1.00 85.14  ? 383 MET A N      1 
ATOM   2931 C  CA     . MET C 3 383 ? 12.016  44.187 40.032  1.00 82.50  ? 383 MET A CA     1 
ATOM   2932 C  C      . MET C 3 383 ? 10.531  44.480 40.166  1.00 83.75  ? 383 MET A C      1 
ATOM   2933 O  O      . MET C 3 383 ? 9.906   44.993 39.227  1.00 78.12  ? 383 MET A O      1 
ATOM   2934 C  CB     . MET C 3 383 ? 12.225  42.774 39.496  1.00 80.63  ? 383 MET A CB     1 
ATOM   2935 C  CG     . MET C 3 383 ? 13.610  42.535 38.966  1.00 80.96  ? 383 MET A CG     1 
ATOM   2936 S  SD     . MET C 3 383 ? 13.848  43.533 37.488  1.00 85.01  ? 383 MET A SD     1 
ATOM   2937 C  CE     . MET C 3 383 ? 15.559  43.170 37.121  1.00 72.10  ? 383 MET A CE     1 
ATOM   2938 N  N      . VAL C 3 384 ? 9.943   44.158 41.323  1.00 83.28  ? 384 VAL A N      1 
ATOM   2939 C  CA     . VAL C 3 384 ? 8.495   44.287 41.458  1.00 86.45  ? 384 VAL A CA     1 
ATOM   2940 C  C      . VAL C 3 384 ? 8.093   45.753 41.467  1.00 91.30  ? 384 VAL A C      1 
ATOM   2941 O  O      . VAL C 3 384 ? 7.044   46.128 40.920  1.00 83.18  ? 384 VAL A O      1 
ATOM   2942 C  CB     . VAL C 3 384 ? 7.985   43.555 42.712  1.00 86.12  ? 384 VAL A CB     1 
ATOM   2943 C  CG1    . VAL C 3 384 ? 6.590   43.017 42.445  1.00 88.87  ? 384 VAL A CG1    1 
ATOM   2944 C  CG2    . VAL C 3 384 ? 8.943   42.447 43.128  1.00 83.46  ? 384 VAL A CG2    1 
ATOM   2945 N  N      . ASP C 3 385 ? 8.914   46.611 42.086  1.00 85.24  ? 385 ASP A N      1 
ATOM   2946 C  CA     . ASP C 3 385 ? 8.612   48.038 42.052  1.00 88.34  ? 385 ASP A CA     1 
ATOM   2947 C  C      . ASP C 3 385 ? 8.722   48.569 40.628  1.00 88.65  ? 385 ASP A C      1 
ATOM   2948 O  O      . ASP C 3 385 ? 7.864   49.340 40.177  1.00 89.29  ? 385 ASP A O      1 
ATOM   2949 C  CB     . ASP C 3 385 ? 9.528   48.808 43.006  1.00 79.12  ? 385 ASP A CB     1 
ATOM   2950 N  N      . ILE C 3 386 ? 9.752   48.131 39.892  1.00 85.06  ? 386 ILE A N      1 
ATOM   2951 C  CA     . ILE C 3 386 ? 9.908   48.513 38.486  1.00 75.12  ? 386 ILE A CA     1 
ATOM   2952 C  C      . ILE C 3 386 ? 8.664   48.138 37.697  1.00 77.12  ? 386 ILE A C      1 
ATOM   2953 O  O      . ILE C 3 386 ? 8.035   48.978 37.038  1.00 74.31  ? 386 ILE A O      1 
ATOM   2954 C  CB     . ILE C 3 386 ? 11.153  47.841 37.876  1.00 86.95  ? 386 ILE A CB     1 
ATOM   2955 C  CG1    . ILE C 3 386 ? 12.399  48.096 38.729  1.00 83.86  ? 386 ILE A CG1    1 
ATOM   2956 C  CG2    . ILE C 3 386 ? 11.353  48.287 36.427  1.00 71.12  ? 386 ILE A CG2    1 
ATOM   2957 C  CD1    . ILE C 3 386 ? 13.657  47.498 38.136  1.00 80.00  ? 386 ILE A CD1    1 
ATOM   2958 N  N      . LEU C 3 387 ? 8.311   46.852 37.730  1.00 77.22  ? 387 LEU A N      1 
ATOM   2959 C  CA     . LEU C 3 387 ? 7.208   46.376 36.904  1.00 82.02  ? 387 LEU A CA     1 
ATOM   2960 C  C      . LEU C 3 387 ? 5.902   47.065 37.280  1.00 82.92  ? 387 LEU A C      1 
ATOM   2961 O  O      . LEU C 3 387 ? 5.126   47.472 36.403  1.00 71.82  ? 387 LEU A O      1 
ATOM   2962 C  CB     . LEU C 3 387 ? 7.096   44.854 37.018  1.00 76.43  ? 387 LEU A CB     1 
ATOM   2963 C  CG     . LEU C 3 387 ? 8.166   44.100 36.217  1.00 76.22  ? 387 LEU A CG     1 
ATOM   2964 C  CD1    . LEU C 3 387 ? 8.616   42.838 36.929  1.00 74.22  ? 387 LEU A CD1    1 
ATOM   2965 C  CD2    . LEU C 3 387 ? 7.659   43.780 34.806  1.00 71.01  ? 387 LEU A CD2    1 
ATOM   2966 N  N      . MET C 3 388 ? 5.661   47.249 38.580  1.00 85.91  ? 388 MET A N      1 
ATOM   2967 C  CA     . MET C 3 388 ? 4.430   47.901 39.012  1.00 84.49  ? 388 MET A CA     1 
ATOM   2968 C  C      . MET C 3 388 ? 4.370   49.349 38.535  1.00 84.32  ? 388 MET A C      1 
ATOM   2969 O  O      . MET C 3 388 ? 3.335   49.803 38.024  1.00 76.36  ? 388 MET A O      1 
ATOM   2970 C  CB     . MET C 3 388 ? 4.301   47.815 40.532  1.00 87.38  ? 388 MET A CB     1 
ATOM   2971 C  CG     . MET C 3 388 ? 3.977   46.415 41.052  1.00 80.71  ? 388 MET A CG     1 
ATOM   2972 S  SD     . MET C 3 388 ? 2.705   45.531 40.107  1.00 91.99  ? 388 MET A SD     1 
ATOM   2973 C  CE     . MET C 3 388 ? 1.571   46.831 39.623  1.00 80.03  ? 388 MET A CE     1 
ATOM   2974 N  N      . LYS C 3 389 ? 5.467   50.096 38.693  1.00 76.65  ? 389 LYS A N      1 
ATOM   2975 C  CA     . LYS C 3 389 ? 5.498   51.447 38.145  1.00 73.03  ? 389 LYS A CA     1 
ATOM   2976 C  C      . LYS C 3 389 ? 5.155   51.416 36.664  1.00 82.53  ? 389 LYS A C      1 
ATOM   2977 O  O      . LYS C 3 389 ? 4.335   52.210 36.183  1.00 81.39  ? 389 LYS A O      1 
ATOM   2978 C  CB     . LYS C 3 389 ? 6.866   52.086 38.380  1.00 66.67  ? 389 LYS A CB     1 
ATOM   2979 N  N      . LEU C 3 390 ? 5.771   50.478 35.928  1.00 85.47  ? 390 LEU A N      1 
ATOM   2980 C  CA     . LEU C 3 390 ? 5.390   50.221 34.540  1.00 82.55  ? 390 LEU A CA     1 
ATOM   2981 C  C      . LEU C 3 390 ? 3.927   49.808 34.438  1.00 79.04  ? 390 LEU A C      1 
ATOM   2982 O  O      . LEU C 3 390 ? 3.221   50.206 33.503  1.00 66.91  ? 390 LEU A O      1 
ATOM   2983 C  CB     . LEU C 3 390 ? 6.289   49.137 33.945  1.00 83.83  ? 390 LEU A CB     1 
ATOM   2984 C  CG     . LEU C 3 390 ? 7.770   49.491 33.798  1.00 84.76  ? 390 LEU A CG     1 
ATOM   2985 C  CD1    . LEU C 3 390 ? 8.644   48.239 33.644  1.00 78.36  ? 390 LEU A CD1    1 
ATOM   2986 C  CD2    . LEU C 3 390 ? 7.948   50.423 32.616  1.00 75.65  ? 390 LEU A CD2    1 
ATOM   2987 N  N      . PHE C 3 391 ? 3.456   49.005 35.394  1.00 74.81  ? 391 PHE A N      1 
ATOM   2988 C  CA     . PHE C 3 391 ? 2.034   48.691 35.456  1.00 80.14  ? 391 PHE A CA     1 
ATOM   2989 C  C      . PHE C 3 391 ? 1.195   49.961 35.511  1.00 86.04  ? 391 PHE A C      1 
ATOM   2990 O  O      . PHE C 3 391 ? 0.321   50.181 34.661  1.00 80.50  ? 391 PHE A O      1 
ATOM   2991 C  CB     . PHE C 3 391 ? 1.739   47.808 36.672  1.00 86.70  ? 391 PHE A CB     1 
ATOM   2992 C  CG     . PHE C 3 391 ? 0.328   47.281 36.703  1.00 90.80  ? 391 PHE A CG     1 
ATOM   2993 C  CD1    . PHE C 3 391 ? -0.677  47.980 37.350  1.00 95.16  ? 391 PHE A CD1    1 
ATOM   2994 C  CD2    . PHE C 3 391 ? 0.002   46.098 36.057  1.00 82.03  ? 391 PHE A CD2    1 
ATOM   2995 C  CE1    . PHE C 3 391 ? -1.979  47.497 37.359  1.00 100.93 ? 391 PHE A CE1    1 
ATOM   2996 C  CE2    . PHE C 3 391 ? -1.294  45.611 36.064  1.00 85.80  ? 391 PHE A CE2    1 
ATOM   2997 C  CZ     . PHE C 3 391 ? -2.284  46.307 36.712  1.00 94.10  ? 391 PHE A CZ     1 
ATOM   2998 N  N      . ARG C 3 392 ? 1.452   50.815 36.512  1.00 85.36  ? 392 ARG A N      1 
ATOM   2999 C  CA     . ARG C 3 392 ? 0.584   51.966 36.739  1.00 85.16  ? 392 ARG A CA     1 
ATOM   3000 C  C      . ARG C 3 392 ? 0.727   53.010 35.643  1.00 83.68  ? 392 ARG A C      1 
ATOM   3001 O  O      . ARG C 3 392 ? -0.248  53.702 35.323  1.00 87.01  ? 392 ARG A O      1 
ATOM   3002 C  CB     . ARG C 3 392 ? 0.865   52.589 38.106  1.00 79.47  ? 392 ARG A CB     1 
ATOM   3003 C  CG     . ARG C 3 392 ? 0.369   51.746 39.269  1.00 82.86  ? 392 ARG A CG     1 
ATOM   3004 C  CD     . ARG C 3 392 ? 0.801   52.321 40.605  1.00 84.58  ? 392 ARG A CD     1 
ATOM   3005 N  NE     . ARG C 3 392 ? 2.251   52.250 40.819  1.00 80.66  ? 392 ARG A NE     1 
ATOM   3006 C  CZ     . ARG C 3 392 ? 2.844   51.419 41.678  1.00 79.59  ? 392 ARG A CZ     1 
ATOM   3007 N  NH1    . ARG C 3 392 ? 2.117   50.579 42.405  1.00 76.79  ? 392 ARG A NH1    1 
ATOM   3008 N  NH2    . ARG C 3 392 ? 4.164   51.429 41.819  1.00 70.18  ? 392 ARG A NH2    1 
ATOM   3009 N  N      . ASN C 3 393 ? 1.916   53.146 35.055  1.00 74.15  ? 393 ASN A N      1 
ATOM   3010 C  CA     . ASN C 3 393 ? 2.034   54.063 33.929  1.00 85.03  ? 393 ASN A CA     1 
ATOM   3011 C  C      . ASN C 3 393 ? 1.146   53.628 32.771  1.00 84.80  ? 393 ASN A C      1 
ATOM   3012 O  O      . ASN C 3 393 ? 0.797   54.444 31.909  1.00 83.18  ? 393 ASN A O      1 
ATOM   3013 C  CB     . ASN C 3 393 ? 3.484   54.168 33.466  1.00 82.58  ? 393 ASN A CB     1 
ATOM   3014 C  CG     . ASN C 3 393 ? 3.600   54.815 32.106  1.00 83.33  ? 393 ASN A CG     1 
ATOM   3015 O  OD1    . ASN C 3 393 ? 4.205   54.257 31.194  1.00 79.14  ? 393 ASN A OD1    1 
ATOM   3016 N  ND2    . ASN C 3 393 ? 2.991   55.986 31.952  1.00 85.82  ? 393 ASN A ND2    1 
ATOM   3017 N  N      . MET C 3 394 ? 0.756   52.357 32.740  1.00 83.02  ? 394 MET A N      1 
ATOM   3018 C  CA     . MET C 3 394 ? -0.073  51.848 31.658  1.00 86.70  ? 394 MET A CA     1 
ATOM   3019 C  C      . MET C 3 394 ? -1.552  51.809 32.025  1.00 88.68  ? 394 MET A C      1 
ATOM   3020 O  O      . MET C 3 394 ? -2.409  51.954 31.142  1.00 78.72  ? 394 MET A O      1 
ATOM   3021 C  CB     . MET C 3 394 ? 0.416   50.449 31.257  1.00 83.21  ? 394 MET A CB     1 
ATOM   3022 C  CG     . MET C 3 394 ? -0.124  49.926 29.930  1.00 87.81  ? 394 MET A CG     1 
ATOM   3023 S  SD     . MET C 3 394 ? 0.912   48.571 29.322  1.00 83.85  ? 394 MET A SD     1 
ATOM   3024 C  CE     . MET C 3 394 ? 1.618   47.977 30.860  1.00 65.00  ? 394 MET A CE     1 
ATOM   3025 N  N      . VAL C 3 395 ? -1.875  51.643 33.306  1.00 86.85  ? 395 VAL A N      1 
ATOM   3026 C  CA     . VAL C 3 395 ? -3.255  51.481 33.741  1.00 87.78  ? 395 VAL A CA     1 
ATOM   3027 C  C      . VAL C 3 395 ? -3.521  52.361 34.965  1.00 94.70  ? 395 VAL A C      1 
ATOM   3028 O  O      . VAL C 3 395 ? -2.640  52.586 35.805  1.00 82.55  ? 395 VAL A O      1 
ATOM   3029 C  CB     . VAL C 3 395 ? -3.561  49.987 34.021  1.00 88.33  ? 395 VAL A CB     1 
ATOM   3030 C  CG1    . VAL C 3 395 ? -3.193  49.599 35.448  1.00 88.08  ? 395 VAL A CG1    1 
ATOM   3031 C  CG2    . VAL C 3 395 ? -5.016  49.654 33.694  1.00 89.51  ? 395 VAL A CG2    1 
ATOM   3032 N  N      . ASN C 3 396 ? -4.759  52.875 35.053  1.00 102.55 ? 396 ASN A N      1 
ATOM   3033 C  CA     . ASN C 3 396 ? -5.164  53.828 36.089  1.00 89.20  ? 396 ASN A CA     1 
ATOM   3034 C  C      . ASN C 3 396 ? -5.745  53.072 37.279  1.00 90.49  ? 396 ASN A C      1 
ATOM   3035 O  O      . ASN C 3 396 ? -6.884  52.594 37.212  1.00 85.88  ? 396 ASN A O      1 
ATOM   3036 C  CB     . ASN C 3 396 ? -6.184  54.821 35.536  1.00 78.98  ? 396 ASN A CB     1 
ATOM   3037 N  N      . VAL C 3 397 ? -4.970  52.983 38.368  1.00 83.04  ? 397 VAL A N      1 
ATOM   3038 C  CA     . VAL C 3 397 ? -5.398  52.292 39.591  1.00 80.64  ? 397 VAL A CA     1 
ATOM   3039 C  C      . VAL C 3 397 ? -6.529  53.041 40.292  1.00 89.42  ? 397 VAL A C      1 
ATOM   3040 O  O      . VAL C 3 397 ? -7.659  53.105 39.801  1.00 103.50 ? 397 VAL A O      1 
ATOM   3041 C  CB     . VAL C 3 397 ? -4.211  52.082 40.578  1.00 89.26  ? 397 VAL A CB     1 
ATOM   3042 C  CG1    . VAL C 3 397 ? -3.399  50.853 40.208  1.00 83.54  ? 397 VAL A CG1    1 
ATOM   3043 C  CG2    . VAL C 3 397 ? -3.315  53.317 40.624  1.00 85.71  ? 397 VAL A CG2    1 
ATOM   3044 N  N      . LEU C 3 403 ? -8.445  43.748 32.043  1.00 85.98  ? 403 LEU A N      1 
ATOM   3045 C  CA     . LEU C 3 403 ? -7.595  42.951 32.925  1.00 92.43  ? 403 LEU A CA     1 
ATOM   3046 C  C      . LEU C 3 403 ? -7.592  41.447 32.570  1.00 93.05  ? 403 LEU A C      1 
ATOM   3047 O  O      . LEU C 3 403 ? -7.794  40.604 33.441  1.00 91.32  ? 403 LEU A O      1 
ATOM   3048 C  CB     . LEU C 3 403 ? -8.046  43.139 34.373  1.00 82.20  ? 403 LEU A CB     1 
ATOM   3049 N  N      . THR C 3 404 ? -7.347  41.109 31.303  1.00 93.14  ? 404 THR A N      1 
ATOM   3050 C  CA     . THR C 3 404 ? -7.523  39.745 30.815  1.00 86.46  ? 404 THR A CA     1 
ATOM   3051 C  C      . THR C 3 404 ? -6.219  39.018 30.495  1.00 90.31  ? 404 THR A C      1 
ATOM   3052 O  O      . THR C 3 404 ? -6.270  37.911 29.939  1.00 86.56  ? 404 THR A O      1 
ATOM   3053 C  CB     . THR C 3 404 ? -8.415  39.750 29.569  1.00 85.60  ? 404 THR A CB     1 
ATOM   3054 O  OG1    . THR C 3 404 ? -8.524  38.416 29.067  1.00 95.52  ? 404 THR A OG1    1 
ATOM   3055 C  CG2    . THR C 3 404 ? -7.815  40.625 28.490  1.00 81.73  ? 404 THR A CG2    1 
ATOM   3056 N  N      . LEU C 3 405 ? -5.061  39.598 30.818  1.00 90.57  ? 405 LEU A N      1 
ATOM   3057 C  CA     . LEU C 3 405 ? -3.772  38.967 30.545  1.00 79.02  ? 405 LEU A CA     1 
ATOM   3058 C  C      . LEU C 3 405 ? -2.652  39.767 31.192  1.00 82.53  ? 405 LEU A C      1 
ATOM   3059 O  O      . LEU C 3 405 ? -2.732  40.993 31.295  1.00 89.24  ? 405 LEU A O      1 
ATOM   3060 C  CB     . LEU C 3 405 ? -3.503  38.853 29.047  1.00 78.85  ? 405 LEU A CB     1 
ATOM   3061 C  CG     . LEU C 3 405 ? -2.087  38.357 28.761  1.00 77.74  ? 405 LEU A CG     1 
ATOM   3062 C  CD1    . LEU C 3 405 ? -2.150  36.961 28.169  1.00 82.15  ? 405 LEU A CD1    1 
ATOM   3063 C  CD2    . LEU C 3 405 ? -1.349  39.315 27.831  1.00 78.83  ? 405 LEU A CD2    1 
ATOM   3064 N  N      . LEU C 3 406 ? -1.595  39.061 31.591  1.00 76.90  ? 406 LEU A N      1 
ATOM   3065 C  CA     . LEU C 3 406 ? -0.401  39.668 32.171  1.00 72.49  ? 406 LEU A CA     1 
ATOM   3066 C  C      . LEU C 3 406 ? 0.821   38.862 31.755  1.00 74.11  ? 406 LEU A C      1 
ATOM   3067 O  O      . LEU C 3 406 ? 0.825   37.635 31.881  1.00 75.29  ? 406 LEU A O      1 
ATOM   3068 C  CB     . LEU C 3 406 ? -0.479  39.730 33.701  1.00 71.43  ? 406 LEU A CB     1 
ATOM   3069 C  CG     . LEU C 3 406 ? -1.263  40.878 34.325  1.00 78.06  ? 406 LEU A CG     1 
ATOM   3070 C  CD1    . LEU C 3 406 ? -1.000  40.931 35.830  1.00 83.06  ? 406 LEU A CD1    1 
ATOM   3071 C  CD2    . LEU C 3 406 ? -0.890  42.189 33.665  1.00 76.20  ? 406 LEU A CD2    1 
ATOM   3072 N  N      . SER C 3 407 ? 1.861   39.551 31.285  1.00 72.76  ? 407 SER A N      1 
ATOM   3073 C  CA     . SER C 3 407 ? 3.050   38.908 30.738  1.00 58.90  ? 407 SER A CA     1 
ATOM   3074 C  C      . SER C 3 407 ? 4.289   39.717 31.107  1.00 65.68  ? 407 SER A C      1 
ATOM   3075 O  O      . SER C 3 407 ? 4.258   40.952 31.099  1.00 72.89  ? 407 SER A O      1 
ATOM   3076 C  CB     . SER C 3 407 ? 2.930   38.771 29.212  1.00 57.43  ? 407 SER A CB     1 
ATOM   3077 O  OG     . SER C 3 407 ? 4.004   38.021 28.657  1.00 66.35  ? 407 SER A OG     1 
ATOM   3078 N  N      . VAL C 3 408 ? 5.378   39.018 31.426  1.00 59.10  ? 408 VAL A N      1 
ATOM   3079 C  CA     . VAL C 3 408 ? 6.670   39.640 31.697  1.00 60.90  ? 408 VAL A CA     1 
ATOM   3080 C  C      . VAL C 3 408 ? 7.700   39.070 30.731  1.00 64.07  ? 408 VAL A C      1 
ATOM   3081 O  O      . VAL C 3 408 ? 7.794   37.850 30.558  1.00 59.38  ? 408 VAL A O      1 
ATOM   3082 C  CB     . VAL C 3 408 ? 7.120   39.426 33.157  1.00 69.21  ? 408 VAL A CB     1 
ATOM   3083 C  CG1    . VAL C 3 408 ? 8.556   39.869 33.351  1.00 57.27  ? 408 VAL A CG1    1 
ATOM   3084 C  CG2    . VAL C 3 408 ? 6.201   40.185 34.101  1.00 75.83  ? 408 VAL A CG2    1 
ATOM   3085 N  N      . CYS C 3 409 ? 8.472   39.958 30.108  1.00 61.46  ? 409 CYS A N      1 
ATOM   3086 C  CA     . CYS C 3 409 ? 9.480   39.591 29.128  1.00 56.06  ? 409 CYS A CA     1 
ATOM   3087 C  C      . CYS C 3 409 ? 10.849  40.113 29.551  1.00 61.81  ? 409 CYS A C      1 
ATOM   3088 O  O      . CYS C 3 409 ? 10.978  41.252 30.006  1.00 60.60  ? 409 CYS A O      1 
ATOM   3089 C  CB     . CYS C 3 409 ? 9.114   40.141 27.746  1.00 61.95  ? 409 CYS A CB     1 
ATOM   3090 S  SG     . CYS C 3 409 ? 10.370  39.832 26.462  1.00 61.62  ? 409 CYS A SG     1 
ATOM   3091 N  N      . PHE C 3 410 ? 11.870  39.278 29.387  1.00 61.37  ? 410 PHE A N      1 
ATOM   3092 C  CA     . PHE C 3 410 ? 13.262  39.673 29.564  1.00 63.26  ? 410 PHE A CA     1 
ATOM   3093 C  C      . PHE C 3 410 ? 13.975  39.606 28.226  1.00 59.37  ? 410 PHE A C      1 
ATOM   3094 O  O      . PHE C 3 410 ? 14.098  38.523 27.649  1.00 66.07  ? 410 PHE A O      1 
ATOM   3095 C  CB     . PHE C 3 410 ? 13.972  38.762 30.554  1.00 56.94  ? 410 PHE A CB     1 
ATOM   3096 C  CG     . PHE C 3 410 ? 13.700  39.104 31.953  1.00 69.64  ? 410 PHE A CG     1 
ATOM   3097 C  CD1    . PHE C 3 410 ? 14.366  40.150 32.559  1.00 68.33  ? 410 PHE A CD1    1 
ATOM   3098 C  CD2    . PHE C 3 410 ? 12.751  38.404 32.666  1.00 68.41  ? 410 PHE A CD2    1 
ATOM   3099 C  CE1    . PHE C 3 410 ? 14.096  40.474 33.862  1.00 72.05  ? 410 PHE A CE1    1 
ATOM   3100 C  CE2    . PHE C 3 410 ? 12.479  38.720 33.966  1.00 66.30  ? 410 PHE A CE2    1 
ATOM   3101 C  CZ     . PHE C 3 410 ? 13.151  39.754 34.570  1.00 70.90  ? 410 PHE A CZ     1 
ATOM   3102 N  N      . CYS C 3 411 ? 14.472  40.743 27.753  1.00 50.19  ? 411 CYS A N      1 
ATOM   3103 C  CA     . CYS C 3 411 ? 15.149  40.785 26.464  1.00 61.59  ? 411 CYS A CA     1 
ATOM   3104 C  C      . CYS C 3 411 ? 16.431  41.587 26.624  1.00 65.76  ? 411 CYS A C      1 
ATOM   3105 O  O      . CYS C 3 411 ? 16.796  41.981 27.737  1.00 66.07  ? 411 CYS A O      1 
ATOM   3106 C  CB     . CYS C 3 411 ? 14.231  41.358 25.379  1.00 59.16  ? 411 CYS A CB     1 
ATOM   3107 S  SG     . CYS C 3 411 ? 13.377  42.844 25.882  1.00 61.72  ? 411 CYS A SG     1 
ATOM   3108 N  N      . ASN C 3 412 ? 17.124  41.808 25.500  1.00 64.81  ? 412 ASN A N      1 
ATOM   3109 C  CA     . ASN C 3 412 ? 18.400  42.515 25.487  1.00 62.60  ? 412 ASN A CA     1 
ATOM   3110 C  C      . ASN C 3 412 ? 19.448  41.732 26.281  1.00 72.42  ? 412 ASN A C      1 
ATOM   3111 O  O      . ASN C 3 412 ? 20.069  42.241 27.217  1.00 73.30  ? 412 ASN A O      1 
ATOM   3112 C  CB     . ASN C 3 412 ? 18.232  43.937 26.035  1.00 78.05  ? 412 ASN A CB     1 
ATOM   3113 C  CG     . ASN C 3 412 ? 19.171  44.935 25.389  1.00 71.19  ? 412 ASN A CG     1 
ATOM   3114 O  OD1    . ASN C 3 412 ? 20.314  44.613 25.041  1.00 67.93  ? 412 ASN A OD1    1 
ATOM   3115 N  ND2    . ASN C 3 412 ? 18.685  46.160 25.216  1.00 69.18  ? 412 ASN A ND2    1 
ATOM   3116 N  N      . LEU C 3 413 ? 19.627  40.469 25.907  1.00 75.19  ? 413 LEU A N      1 
ATOM   3117 C  CA     . LEU C 3 413 ? 20.526  39.570 26.617  1.00 70.21  ? 413 LEU A CA     1 
ATOM   3118 C  C      . LEU C 3 413 ? 21.977  39.786 26.193  1.00 76.28  ? 413 LEU A C      1 
ATOM   3119 O  O      . LEU C 3 413 ? 22.264  40.166 25.052  1.00 77.72  ? 413 LEU A O      1 
ATOM   3120 C  CB     . LEU C 3 413 ? 20.116  38.116 26.374  1.00 64.69  ? 413 LEU A CB     1 
ATOM   3121 C  CG     . LEU C 3 413 ? 18.909  37.595 27.169  1.00 68.94  ? 413 LEU A CG     1 
ATOM   3122 C  CD1    . LEU C 3 413 ? 17.652  38.404 26.907  1.00 63.49  ? 413 LEU A CD1    1 
ATOM   3123 C  CD2    . LEU C 3 413 ? 18.664  36.122 26.866  1.00 74.27  ? 413 LEU A CD2    1 
ATOM   3124 N  N      . LYS C 3 414 ? 22.896  39.539 27.131  1.00 79.64  ? 414 LYS A N      1 
ATOM   3125 C  CA     . LYS C 3 414 ? 24.323  39.734 26.884  1.00 69.89  ? 414 LYS A CA     1 
ATOM   3126 C  C      . LYS C 3 414 ? 25.195  38.774 27.676  1.00 76.74  ? 414 LYS A C      1 
ATOM   3127 O  O      . LYS C 3 414 ? 26.371  38.594 27.362  1.00 86.29  ? 414 LYS A O      1 
ATOM   3128 C  CB     . LYS C 3 414 ? 24.721  41.168 27.213  1.00 71.56  ? 414 LYS A CB     1 
ATOM   3129 C  CG     . LYS C 3 414 ? 24.027  42.201 26.360  1.00 72.32  ? 414 LYS A CG     1 
ATOM   3130 C  CD     . LYS C 3 414 ? 24.429  43.596 26.779  1.00 84.60  ? 414 LYS A CD     1 
ATOM   3131 C  CE     . LYS C 3 414 ? 23.846  44.633 25.840  1.00 81.24  ? 414 LYS A CE     1 
ATOM   3132 N  NZ     . LYS C 3 414 ? 24.064  45.996 26.377  1.00 90.05  ? 414 LYS A NZ     1 
HETATM 3133 P  PA     . TTP D 4 .   ? 2.975   22.246 15.265  1.00 45.48  ? 501 TTP A PA     1 
HETATM 3134 O  O1A    . TTP D 4 .   ? 4.262   21.703 14.678  1.00 44.26  ? 501 TTP A O1A    1 
HETATM 3135 O  O2A    . TTP D 4 .   ? 2.222   23.196 14.355  1.00 44.94  ? 501 TTP A O2A    1 
HETATM 3136 O  O3A    . TTP D 4 .   ? 1.916   21.109 15.601  1.00 48.80  ? 501 TTP A O3A    1 
HETATM 3137 P  PB     . TTP D 4 .   ? 2.237   19.688 16.253  1.00 47.80  ? 501 TTP A PB     1 
HETATM 3138 O  O1B    . TTP D 4 .   ? 3.699   19.267 16.254  1.00 41.50  ? 501 TTP A O1B    1 
HETATM 3139 O  O2B    . TTP D 4 .   ? 1.612   19.629 17.622  1.00 51.34  ? 501 TTP A O2B    1 
HETATM 3140 O  O3B    . TTP D 4 .   ? 1.286   18.881 15.245  1.00 53.48  ? 501 TTP A O3B    1 
HETATM 3141 P  PG     . TTP D 4 .   ? 1.786   18.181 13.882  1.00 45.50  ? 501 TTP A PG     1 
HETATM 3142 O  O1G    . TTP D 4 .   ? 1.966   16.716 14.209  1.00 45.87  ? 501 TTP A O1G    1 
HETATM 3143 O  O2G    . TTP D 4 .   ? 0.684   18.373 12.859  1.00 50.52  ? 501 TTP A O2G    1 
HETATM 3144 O  O3G    . TTP D 4 .   ? 3.077   18.771 13.349  1.00 43.85  ? 501 TTP A O3G    1 
HETATM 3145 O  "O5'"  . TTP D 4 .   ? 3.192   22.920 16.719  1.00 45.98  ? 501 TTP A "O5'"  1 
HETATM 3146 C  "C5'"  . TTP D 4 .   ? 4.223   22.486 17.608  1.00 39.43  ? 501 TTP A "C5'"  1 
HETATM 3147 C  "C4'"  . TTP D 4 .   ? 3.778   22.662 19.067  1.00 46.18  ? 501 TTP A "C4'"  1 
HETATM 3148 O  "O4'"  . TTP D 4 .   ? 3.696   24.053 19.447  1.00 46.69  ? 501 TTP A "O4'"  1 
HETATM 3149 C  "C3'"  . TTP D 4 .   ? 2.402   22.042 19.371  1.00 45.70  ? 501 TTP A "C3'"  1 
HETATM 3150 O  "O3'"  . TTP D 4 .   ? 2.499   20.736 19.955  1.00 41.57  ? 501 TTP A "O3'"  1 
HETATM 3151 C  "C2'"  . TTP D 4 .   ? 1.717   23.010 20.325  1.00 44.77  ? 501 TTP A "C2'"  1 
HETATM 3152 C  "C1'"  . TTP D 4 .   ? 2.515   24.303 20.210  1.00 40.82  ? 501 TTP A "C1'"  1 
HETATM 3153 N  N1     . TTP D 4 .   ? 1.687   25.290 19.519  1.00 44.72  ? 501 TTP A N1     1 
HETATM 3154 C  C2     . TTP D 4 .   ? 0.961   26.184 20.316  1.00 46.30  ? 501 TTP A C2     1 
HETATM 3155 O  O2     . TTP D 4 .   ? 1.065   26.123 21.560  1.00 52.54  ? 501 TTP A O2     1 
HETATM 3156 N  N3     . TTP D 4 .   ? 0.178   27.106 19.775  1.00 48.41  ? 501 TTP A N3     1 
HETATM 3157 C  C4     . TTP D 4 .   ? 0.036   27.214 18.461  1.00 43.10  ? 501 TTP A C4     1 
HETATM 3158 O  O4     . TTP D 4 .   ? -0.712  28.092 17.971  1.00 48.18  ? 501 TTP A O4     1 
HETATM 3159 C  C5     . TTP D 4 .   ? 0.766   26.286 17.584  1.00 42.17  ? 501 TTP A C5     1 
HETATM 3160 C  C5M    . TTP D 4 .   ? 0.587   26.429 16.091  1.00 37.11  ? 501 TTP A C5M    1 
HETATM 3161 C  C6     . TTP D 4 .   ? 1.587   25.330 18.177  1.00 39.21  ? 501 TTP A C6     1 
HETATM 3162 H  "H5'1" . TTP D 4 .   ? 4.452   21.435 17.419  1.00 47.32  ? 501 TTP A "H5'1" 1 
HETATM 3163 H  "H5'2" . TTP D 4 .   ? 5.130   23.067 17.429  1.00 47.32  ? 501 TTP A "H5'2" 1 
HETATM 3164 H  "H4'"  . TTP D 4 .   ? 4.519   22.162 19.706  1.00 55.42  ? 501 TTP A "H4'"  1 
HETATM 3165 H  "H3'"  . TTP D 4 .   ? 1.822   21.994 18.439  1.00 54.84  ? 501 TTP A "H3'"  1 
HETATM 3166 H  "HO3'" . TTP D 4 .   ? 1.612   20.395 20.131  1.00 49.88  ? 501 TTP A "HO3'" 1 
HETATM 3167 H  "H2'1" . TTP D 4 .   ? 0.677   23.171 20.031  1.00 53.72  ? 501 TTP A "H2'1" 1 
HETATM 3168 H  "H2'2" . TTP D 4 .   ? 1.745   22.629 21.348  1.00 53.72  ? 501 TTP A "H2'2" 1 
HETATM 3169 H  "H1'"  . TTP D 4 .   ? 2.776   24.659 21.216  1.00 48.98  ? 501 TTP A "H1'"  1 
HETATM 3170 H  HN3    . TTP D 4 .   ? -0.339  27.760 20.397  1.00 58.09  ? 501 TTP A HN3    1 
HETATM 3171 H  HM51   . TTP D 4 .   ? -0.083  27.224 15.890  1.00 44.53  ? 501 TTP A HM51   1 
HETATM 3172 H  HM52   . TTP D 4 .   ? 0.196   25.528 15.695  1.00 44.53  ? 501 TTP A HM52   1 
HETATM 3173 H  HM53   . TTP D 4 .   ? 1.524   26.634 15.642  1.00 44.53  ? 501 TTP A HM53   1 
HETATM 3174 H  H6     . TTP D 4 .   ? 2.142   24.629 17.566  1.00 47.05  ? 501 TTP A H6     1 
HETATM 3175 MG MG     . MG  E 5 .   ? 5.166   19.471 14.469  1.00 41.28  ? 502 MG  A MG     1 
HETATM 3176 CL CL     . CL  F 6 .   ? 14.907  38.298 -2.988  1.00 96.54  ? 503 CL  A CL     1 
HETATM 3177 O  O      . HOH G 7 .   ? 6.174   26.761 19.074  1.00 41.83  ? 901 HOH P O      1 
HETATM 3178 O  O      . HOH G 7 .   ? 8.569   31.966 16.159  1.00 41.08  ? 902 HOH P O      1 
HETATM 3179 O  O      . HOH H 7 .   ? -0.479  29.821 31.749  1.00 57.76  ? 901 HOH T O      1 
HETATM 3180 O  O      . HOH H 7 .   ? 5.526   28.138 30.640  1.00 47.54  ? 902 HOH T O      1 
HETATM 3181 O  O      . HOH H 7 .   ? 15.395  32.324 19.531  1.00 43.41  ? 903 HOH T O      1 
HETATM 3182 O  O      . HOH H 7 .   ? 7.268   29.280 20.341  1.00 44.32  ? 904 HOH T O      1 
HETATM 3183 O  O      . HOH H 7 .   ? 9.711   29.487 19.737  1.00 43.30  ? 905 HOH T O      1 
HETATM 3184 O  O      . HOH I 7 .   ? 5.426   15.828 -10.235 1.00 55.24  ? 601 HOH A O      1 
HETATM 3185 O  O      . HOH I 7 .   ? -8.534  35.388 29.687  1.00 75.91  ? 602 HOH A O      1 
HETATM 3186 O  O      . HOH I 7 .   ? 24.278  24.491 8.442   1.00 57.64  ? 603 HOH A O      1 
HETATM 3187 O  O      . HOH I 7 .   ? 0.578   17.258 -3.254  1.00 43.23  ? 604 HOH A O      1 
HETATM 3188 O  O      . HOH I 7 .   ? 7.249   24.492 15.982  1.00 35.01  ? 605 HOH A O      1 
HETATM 3189 O  O      . HOH I 7 .   ? 8.685   5.008  20.734  1.00 44.41  ? 606 HOH A O      1 
HETATM 3190 O  O      . HOH I 7 .   ? 17.756  33.323 17.927  1.00 46.29  ? 607 HOH A O      1 
HETATM 3191 O  O      . HOH I 7 .   ? 3.577   14.715 12.121  1.00 43.11  ? 608 HOH A O      1 
HETATM 3192 O  O      . HOH I 7 .   ? 15.668  26.873 -5.140  1.00 47.76  ? 609 HOH A O      1 
HETATM 3193 O  O      . HOH I 7 .   ? 21.355  25.100 20.044  1.00 43.00  ? 610 HOH A O      1 
HETATM 3194 O  O      . HOH I 7 .   ? 10.664  30.305 16.559  1.00 47.42  ? 611 HOH A O      1 
HETATM 3195 O  O      . HOH I 7 .   ? 2.366   26.916 23.548  1.00 51.92  ? 612 HOH A O      1 
HETATM 3196 O  O      . HOH I 7 .   ? 9.284   15.066 -6.545  1.00 35.21  ? 613 HOH A O      1 
HETATM 3197 O  O      . HOH I 7 .   ? -1.862  33.950 26.790  1.00 50.99  ? 614 HOH A O      1 
HETATM 3198 O  O      . HOH I 7 .   ? 15.319  29.490 1.672   1.00 44.31  ? 615 HOH A O      1 
HETATM 3199 O  O      . HOH I 7 .   ? -4.188  26.063 -11.185 1.00 38.75  ? 616 HOH A O      1 
HETATM 3200 O  O      . HOH I 7 .   ? 16.828  30.095 20.612  1.00 40.26  ? 617 HOH A O      1 
HETATM 3201 O  O      . HOH I 7 .   ? 1.012   25.331 4.659   1.00 51.51  ? 618 HOH A O      1 
HETATM 3202 O  O      . HOH I 7 .   ? 12.108  29.292 20.689  1.00 41.98  ? 619 HOH A O      1 
HETATM 3203 O  O      . HOH I 7 .   ? 14.552  30.068 -4.357  1.00 41.98  ? 620 HOH A O      1 
HETATM 3204 O  O      . HOH I 7 .   ? 12.626  10.763 14.461  1.00 39.44  ? 621 HOH A O      1 
HETATM 3205 O  O      . HOH I 7 .   ? 20.473  27.254 16.378  1.00 34.99  ? 622 HOH A O      1 
HETATM 3206 O  O      . HOH I 7 .   ? 12.521  24.583 17.410  1.00 32.30  ? 623 HOH A O      1 
HETATM 3207 O  O      . HOH I 7 .   ? 16.047  18.407 -12.170 1.00 41.96  ? 624 HOH A O      1 
HETATM 3208 O  O      . HOH I 7 .   ? 10.223  28.111 -8.449  1.00 53.67  ? 625 HOH A O      1 
HETATM 3209 O  O      . HOH I 7 .   ? 5.591   19.688 8.058   1.00 43.69  ? 626 HOH A O      1 
HETATM 3210 O  O      . HOH I 7 .   ? 3.061   20.456 11.316  1.00 55.18  ? 627 HOH A O      1 
HETATM 3211 O  O      . HOH I 7 .   ? -3.037  28.012 -8.170  1.00 50.21  ? 628 HOH A O      1 
HETATM 3212 O  O      . HOH I 7 .   ? 17.176  11.131 25.944  1.00 45.71  ? 629 HOH A O      1 
HETATM 3213 O  O      . HOH I 7 .   ? -9.162  31.598 -7.508  1.00 40.00  ? 630 HOH A O      1 
HETATM 3214 O  O      . HOH I 7 .   ? 20.737  29.046 3.683   1.00 36.75  ? 631 HOH A O      1 
HETATM 3215 O  O      . HOH I 7 .   ? 24.288  27.058 1.592   1.00 50.43  ? 632 HOH A O      1 
HETATM 3216 O  O      . HOH I 7 .   ? 17.591  4.936  5.032   1.00 48.28  ? 633 HOH A O      1 
HETATM 3217 O  O      . HOH I 7 .   ? 6.550   14.072 5.163   1.00 37.03  ? 634 HOH A O      1 
HETATM 3218 O  O      . HOH I 7 .   ? 12.293  11.492 1.320   1.00 41.93  ? 635 HOH A O      1 
HETATM 3219 O  O      . HOH I 7 .   ? 5.537   20.679 -11.097 1.00 44.39  ? 636 HOH A O      1 
HETATM 3220 O  O      . HOH I 7 .   ? 5.182   16.998 11.998  1.00 41.23  ? 637 HOH A O      1 
HETATM 3221 O  O      . HOH I 7 .   ? 25.571  24.173 3.704   1.00 49.16  ? 638 HOH A O      1 
HETATM 3222 O  O      . HOH I 7 .   ? 19.663  21.356 26.117  1.00 49.81  ? 639 HOH A O      1 
HETATM 3223 O  O      . HOH I 7 .   ? -6.969  37.421 -9.372  1.00 46.57  ? 640 HOH A O      1 
HETATM 3224 O  O      . HOH I 7 .   ? 17.512  21.425 27.090  1.00 42.32  ? 641 HOH A O      1 
HETATM 3225 O  O      . HOH I 7 .   ? 3.172   13.110 -3.131  1.00 35.72  ? 642 HOH A O      1 
HETATM 3226 O  O      . HOH I 7 .   ? 21.525  6.307  15.659  1.00 50.22  ? 643 HOH A O      1 
HETATM 3227 O  O      . HOH I 7 .   ? 0.121   9.605  18.074  1.00 51.81  ? 644 HOH A O      1 
HETATM 3228 O  O      . HOH I 7 .   ? 2.677   14.940 -12.254 1.00 40.91  ? 645 HOH A O      1 
HETATM 3229 O  O      . HOH I 7 .   ? 6.906   50.259 -0.520  1.00 51.07  ? 646 HOH A O      1 
HETATM 3230 O  O      . HOH I 7 .   ? 8.332   22.497 -11.010 1.00 44.75  ? 647 HOH A O      1 
HETATM 3231 O  O      . HOH I 7 .   ? 13.132  22.059 18.137  1.00 36.26  ? 648 HOH A O      1 
HETATM 3232 O  O      . HOH I 7 .   ? 25.883  21.195 5.611   1.00 49.91  ? 649 HOH A O      1 
HETATM 3233 O  O      . HOH I 7 .   ? 15.982  5.424  -5.111  1.00 49.93  ? 650 HOH A O      1 
HETATM 3234 O  O      . HOH I 7 .   ? 11.940  34.995 0.976   1.00 47.15  ? 651 HOH A O      1 
HETATM 3235 O  O      . HOH I 7 .   ? 13.122  4.388  2.263   1.00 47.57  ? 652 HOH A O      1 
HETATM 3236 O  O      . HOH I 7 .   ? 9.419   8.166  5.380   1.00 42.96  ? 653 HOH A O      1 
HETATM 3237 O  O      . HOH I 7 .   ? -5.077  32.779 -11.686 1.00 56.06  ? 654 HOH A O      1 
HETATM 3238 O  O      . HOH I 7 .   ? 5.838   27.271 22.060  1.00 47.98  ? 655 HOH A O      1 
HETATM 3239 O  O      . HOH I 7 .   ? 20.493  5.172  11.494  1.00 68.40  ? 656 HOH A O      1 
HETATM 3240 O  O      . HOH I 7 .   ? 25.506  20.589 19.656  1.00 47.83  ? 657 HOH A O      1 
HETATM 3241 O  O      . HOH I 7 .   ? 1.811   20.851 2.124   1.00 47.39  ? 658 HOH A O      1 
HETATM 3242 O  O      . HOH I 7 .   ? -4.851  37.516 -10.585 1.00 48.53  ? 659 HOH A O      1 
HETATM 3243 O  O      . HOH I 7 .   ? 22.769  6.122  20.055  1.00 53.31  ? 660 HOH A O      1 
HETATM 3244 O  O      . HOH I 7 .   ? 8.263   7.365  -2.951  1.00 48.01  ? 661 HOH A O      1 
HETATM 3245 O  O      . HOH I 7 .   ? 21.903  8.144  17.242  1.00 44.99  ? 662 HOH A O      1 
HETATM 3246 O  O      . HOH I 7 .   ? 10.824  30.738 4.105   1.00 51.40  ? 663 HOH A O      1 
HETATM 3247 O  O      . HOH I 7 .   ? -0.958  8.499  19.053  1.00 55.34  ? 664 HOH A O      1 
HETATM 3248 O  O      . HOH I 7 .   ? 10.399  6.391  6.776   1.00 52.82  ? 665 HOH A O      1 
HETATM 3249 O  O      . HOH I 7 .   ? 13.035  6.791  6.179   1.00 48.79  ? 666 HOH A O      1 
HETATM 3250 O  O      . HOH I 7 .   ? 20.981  18.540 24.657  1.00 44.75  ? 667 HOH A O      1 
HETATM 3251 O  O      . HOH I 7 .   ? 1.063   13.069 -11.037 1.00 47.35  ? 668 HOH A O      1 
HETATM 3252 O  O      . HOH I 7 .   ? 14.015  30.024 18.894  1.00 40.11  ? 669 HOH A O      1 
HETATM 3253 O  O      . HOH I 7 .   ? 0.377   20.269 0.595   1.00 55.60  ? 670 HOH A O      1 
HETATM 3254 O  O      . HOH I 7 .   ? 17.532  29.349 -3.728  1.00 55.42  ? 671 HOH A O      1 
HETATM 3255 O  O      . HOH I 7 .   ? 26.274  13.189 14.436  1.00 55.88  ? 672 HOH A O      1 
HETATM 3256 O  O      . HOH I 7 .   ? 18.800  28.106 -6.703  1.00 66.28  ? 673 HOH A O      1 
HETATM 3257 O  O      . HOH I 7 .   ? -4.204  33.842 -15.520 1.00 52.40  ? 674 HOH A O      1 
HETATM 3258 O  O      . HOH I 7 .   ? 3.066   25.332 6.143   1.00 54.99  ? 675 HOH A O      1 
HETATM 3259 O  O      . HOH I 7 .   ? 6.133   7.648  -2.107  1.00 47.03  ? 676 HOH A O      1 
HETATM 3260 O  O      . HOH I 7 .   ? -2.391  34.823 -16.443 1.00 53.97  ? 677 HOH A O      1 
HETATM 3261 O  O      . HOH I 7 .   ? 16.849  27.290 -7.251  1.00 64.86  ? 678 HOH A O      1 
HETATM 3262 O  O      . HOH I 7 .   ? 2.713   9.772  16.943  1.00 51.65  ? 679 HOH A O      1 
HETATM 3263 O  O      . HOH I 7 .   ? 26.483  12.907 12.416  1.00 52.53  ? 680 HOH A O      1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   867 867 DA  DA  P . n 
A 1 2   DG  2   868 868 DG  DG  P . n 
A 1 3   DG  3   869 869 DG  DG  P . n 
A 1 4   DA  4   870 870 DA  DA  P . n 
A 1 5   DC  5   871 871 DC  DC  P . n 
A 1 6   DC  6   872 872 DC  DC  P . n 
A 1 7   DOC 7   873 873 DOC DOC P . n 
B 2 1   DT  1   837 ?   ?   ?   T . n 
B 2 2   DC  2   838 ?   ?   ?   T . n 
B 2 3   DT  3   839 839 DT  DT  T . n 
B 2 4   MA7 4   840 840 MA7 MA7 T . n 
B 2 5   DG  5   841 841 DG  DG  T . n 
B 2 6   DG  6   842 842 DG  DG  T . n 
B 2 7   DG  7   843 843 DG  DG  T . n 
B 2 8   DT  8   844 844 DT  DT  T . n 
B 2 9   DC  9   845 845 DC  DC  T . n 
B 2 10  DC  10  846 846 DC  DC  T . n 
B 2 11  DT  11  847 847 DT  DT  T . n 
C 3 1   MET 1   1   ?   ?   ?   A . n 
C 3 2   GLU 2   2   ?   ?   ?   A . n 
C 3 3   LEU 3   3   ?   ?   ?   A . n 
C 3 4   ALA 4   4   ?   ?   ?   A . n 
C 3 5   ASP 5   5   ?   ?   ?   A . n 
C 3 6   VAL 6   6   ?   ?   ?   A . n 
C 3 7   GLY 7   7   ?   ?   ?   A . n 
C 3 8   ALA 8   8   ?   ?   ?   A . n 
C 3 9   ALA 9   9   ?   ?   ?   A . n 
C 3 10  ALA 10  10  ?   ?   ?   A . n 
C 3 11  SER 11  11  ?   ?   ?   A . n 
C 3 12  SER 12  12  ?   ?   ?   A . n 
C 3 13  GLN 13  13  ?   ?   ?   A . n 
C 3 14  GLY 14  14  ?   ?   ?   A . n 
C 3 15  VAL 15  15  ?   ?   ?   A . n 
C 3 16  HIS 16  16  ?   ?   ?   A . n 
C 3 17  ASP 17  17  ?   ?   ?   A . n 
C 3 18  GLN 18  18  ?   ?   ?   A . n 
C 3 19  VAL 19  19  ?   ?   ?   A . n 
C 3 20  LEU 20  20  ?   ?   ?   A . n 
C 3 21  PRO 21  21  ?   ?   ?   A . n 
C 3 22  THR 22  22  ?   ?   ?   A . n 
C 3 23  PRO 23  23  ?   ?   ?   A . n 
C 3 24  ASN 24  24  ?   ?   ?   A . n 
C 3 25  ALA 25  25  ?   ?   ?   A . n 
C 3 26  SER 26  26  26  SER SER A . n 
C 3 27  SER 27  27  27  SER SER A . n 
C 3 28  ARG 28  28  28  ARG ARG A . n 
C 3 29  VAL 29  29  29  VAL VAL A . n 
C 3 30  ILE 30  30  30  ILE ILE A . n 
C 3 31  VAL 31  31  31  VAL VAL A . n 
C 3 32  HIS 32  32  32  HIS HIS A . n 
C 3 33  VAL 33  33  33  VAL VAL A . n 
C 3 34  ASP 34  34  34  ASP ASP A . n 
C 3 35  LEU 35  35  35  LEU LEU A . n 
C 3 36  ASP 36  36  36  ASP ASP A . n 
C 3 37  CYS 37  37  37  CYS CYS A . n 
C 3 38  PHE 38  38  38  PHE PHE A . n 
C 3 39  TYR 39  39  39  TYR TYR A . n 
C 3 40  ALA 40  40  40  ALA ALA A . n 
C 3 41  GLN 41  41  41  GLN GLN A . n 
C 3 42  VAL 42  42  42  VAL VAL A . n 
C 3 43  GLU 43  43  43  GLU GLU A . n 
C 3 44  MET 44  44  44  MET MET A . n 
C 3 45  ILE 45  45  45  ILE ILE A . n 
C 3 46  SER 46  46  46  SER SER A . n 
C 3 47  ASN 47  47  47  ASN ASN A . n 
C 3 48  PRO 48  48  48  PRO PRO A . n 
C 3 49  GLU 49  49  49  GLU GLU A . n 
C 3 50  LEU 50  50  50  LEU LEU A . n 
C 3 51  LYS 51  51  51  LYS LYS A . n 
C 3 52  ASP 52  52  52  ASP ASP A . n 
C 3 53  LYS 53  53  53  LYS LYS A . n 
C 3 54  PRO 54  54  54  PRO PRO A . n 
C 3 55  LEU 55  55  55  LEU LEU A . n 
C 3 56  GLY 56  56  56  GLY GLY A . n 
C 3 57  VAL 57  57  57  VAL VAL A . n 
C 3 58  GLN 58  58  58  GLN GLN A . n 
C 3 59  GLN 59  59  59  GLN GLN A . n 
C 3 60  LYS 60  60  60  LYS LYS A . n 
C 3 61  TYR 61  61  61  TYR TYR A . n 
C 3 62  LEU 62  62  62  LEU LEU A . n 
C 3 63  VAL 63  63  63  VAL VAL A . n 
C 3 64  VAL 64  64  64  VAL VAL A . n 
C 3 65  THR 65  65  65  THR THR A . n 
C 3 66  CYS 66  66  66  CYS CYS A . n 
C 3 67  ASN 67  67  67  ASN ASN A . n 
C 3 68  TYR 68  68  68  TYR TYR A . n 
C 3 69  GLU 69  69  69  GLU GLU A . n 
C 3 70  ALA 70  70  70  ALA ALA A . n 
C 3 71  ARG 71  71  71  ARG ARG A . n 
C 3 72  LYS 72  72  72  LYS LYS A . n 
C 3 73  LEU 73  73  73  LEU LEU A . n 
C 3 74  GLY 74  74  74  GLY GLY A . n 
C 3 75  VAL 75  75  75  VAL VAL A . n 
C 3 76  LYS 76  76  76  LYS LYS A . n 
C 3 77  LYS 77  77  77  LYS LYS A . n 
C 3 78  LEU 78  78  78  LEU LEU A . n 
C 3 79  MET 79  79  79  MET MET A . n 
C 3 80  ASN 80  80  80  ASN ASN A . n 
C 3 81  VAL 81  81  81  VAL VAL A . n 
C 3 82  ARG 82  82  82  ARG ARG A . n 
C 3 83  ASP 83  83  83  ASP ASP A . n 
C 3 84  ALA 84  84  84  ALA ALA A . n 
C 3 85  LYS 85  85  85  LYS LYS A . n 
C 3 86  GLU 86  86  86  GLU GLU A . n 
C 3 87  LYS 87  87  87  LYS LYS A . n 
C 3 88  CYS 88  88  88  CYS CYS A . n 
C 3 89  PRO 89  89  89  PRO PRO A . n 
C 3 90  GLN 90  90  90  GLN GLN A . n 
C 3 91  LEU 91  91  91  LEU LEU A . n 
C 3 92  VAL 92  92  92  VAL VAL A . n 
C 3 93  LEU 93  93  93  LEU LEU A . n 
C 3 94  VAL 94  94  94  VAL VAL A . n 
C 3 95  ASN 95  95  95  ASN ASN A . n 
C 3 96  GLY 96  96  96  GLY GLY A . n 
C 3 97  GLU 97  97  97  GLU GLU A . n 
C 3 98  ASP 98  98  98  ASP ASP A . n 
C 3 99  LEU 99  99  99  LEU LEU A . n 
C 3 100 THR 100 100 100 THR THR A . n 
C 3 101 ARG 101 101 101 ARG ARG A . n 
C 3 102 TYR 102 102 102 TYR TYR A . n 
C 3 103 ARG 103 103 103 ARG ARG A . n 
C 3 104 GLU 104 104 104 GLU GLU A . n 
C 3 105 MET 105 105 105 MET MET A . n 
C 3 106 SER 106 106 106 SER SER A . n 
C 3 107 TYR 107 107 107 TYR TYR A . n 
C 3 108 LYS 108 108 108 LYS LYS A . n 
C 3 109 VAL 109 109 109 VAL VAL A . n 
C 3 110 THR 110 110 110 THR THR A . n 
C 3 111 GLU 111 111 111 GLU GLU A . n 
C 3 112 LEU 112 112 112 LEU LEU A . n 
C 3 113 LEU 113 113 113 LEU LEU A . n 
C 3 114 GLU 114 114 114 GLU GLU A . n 
C 3 115 GLU 115 115 115 GLU GLU A . n 
C 3 116 PHE 116 116 116 PHE PHE A . n 
C 3 117 SER 117 117 117 SER SER A . n 
C 3 118 PRO 118 118 118 PRO PRO A . n 
C 3 119 VAL 119 119 119 VAL VAL A . n 
C 3 120 VAL 120 120 120 VAL VAL A . n 
C 3 121 GLU 121 121 121 GLU GLU A . n 
C 3 122 ARG 122 122 122 ARG ARG A . n 
C 3 123 LEU 123 123 123 LEU LEU A . n 
C 3 124 GLY 124 124 124 GLY GLY A . n 
C 3 125 PHE 125 125 125 PHE PHE A . n 
C 3 126 ASP 126 126 126 ASP ASP A . n 
C 3 127 GLU 127 127 127 GLU GLU A . n 
C 3 128 ASN 128 128 128 ASN ASN A . n 
C 3 129 PHE 129 129 129 PHE PHE A . n 
C 3 130 VAL 130 130 130 VAL VAL A . n 
C 3 131 ASP 131 131 131 ASP ASP A . n 
C 3 132 LEU 132 132 132 LEU LEU A . n 
C 3 133 THR 133 133 133 THR THR A . n 
C 3 134 GLU 134 134 134 GLU GLU A . n 
C 3 135 MET 135 135 135 MET MET A . n 
C 3 136 VAL 136 136 136 VAL VAL A . n 
C 3 137 GLU 137 137 137 GLU GLU A . n 
C 3 138 LYS 138 138 138 LYS LYS A . n 
C 3 139 ARG 139 139 139 ARG ARG A . n 
C 3 140 LEU 140 140 140 LEU LEU A . n 
C 3 141 GLN 141 141 141 GLN GLN A . n 
C 3 142 GLN 142 142 142 GLN GLN A . n 
C 3 143 LEU 143 143 143 LEU LEU A . n 
C 3 144 GLN 144 144 144 GLN GLN A . n 
C 3 145 SER 145 145 145 SER SER A . n 
C 3 146 ASP 146 146 146 ASP ASP A . n 
C 3 147 GLU 147 147 147 GLU GLU A . n 
C 3 148 LEU 148 148 148 LEU LEU A . n 
C 3 149 SER 149 149 149 SER SER A . n 
C 3 150 ALA 150 150 150 ALA ALA A . n 
C 3 151 VAL 151 151 151 VAL VAL A . n 
C 3 152 THR 152 152 152 THR THR A . n 
C 3 153 VAL 153 153 153 VAL VAL A . n 
C 3 154 SER 154 154 154 SER SER A . n 
C 3 155 GLY 155 155 155 GLY GLY A . n 
C 3 156 HIS 156 156 156 HIS HIS A . n 
C 3 157 VAL 157 157 157 VAL VAL A . n 
C 3 158 TYR 158 158 158 TYR TYR A . n 
C 3 159 ASN 159 159 159 ASN ASN A . n 
C 3 160 ASN 160 160 160 ASN ASN A . n 
C 3 161 GLN 161 161 161 GLN GLN A . n 
C 3 162 SER 162 162 162 SER SER A . n 
C 3 163 ILE 163 163 163 ILE ILE A . n 
C 3 164 ASN 164 164 164 ASN ASN A . n 
C 3 165 LEU 165 165 165 LEU LEU A . n 
C 3 166 LEU 166 166 166 LEU LEU A . n 
C 3 167 ASP 167 167 167 ASP ASP A . n 
C 3 168 VAL 168 168 168 VAL VAL A . n 
C 3 169 LEU 169 169 169 LEU LEU A . n 
C 3 170 HIS 170 170 170 HIS HIS A . n 
C 3 171 ILE 171 171 171 ILE ILE A . n 
C 3 172 ARG 172 172 172 ARG ARG A . n 
C 3 173 LEU 173 173 173 LEU LEU A . n 
C 3 174 LEU 174 174 174 LEU LEU A . n 
C 3 175 VAL 175 175 175 VAL VAL A . n 
C 3 176 GLY 176 176 176 GLY GLY A . n 
C 3 177 SER 177 177 177 SER SER A . n 
C 3 178 GLN 178 178 178 GLN GLN A . n 
C 3 179 ILE 179 179 179 ILE ILE A . n 
C 3 180 ALA 180 180 180 ALA ALA A . n 
C 3 181 ALA 181 181 181 ALA ALA A . n 
C 3 182 GLU 182 182 182 GLU GLU A . n 
C 3 183 MET 183 183 183 MET MET A . n 
C 3 184 ARG 184 184 184 ARG ARG A . n 
C 3 185 GLU 185 185 185 GLU GLU A . n 
C 3 186 ALA 186 186 186 ALA ALA A . n 
C 3 187 MET 187 187 187 MET MET A . n 
C 3 188 TYR 188 188 188 TYR TYR A . n 
C 3 189 ASN 189 189 189 ASN ASN A . n 
C 3 190 GLN 190 190 190 GLN GLN A . n 
C 3 191 LEU 191 191 191 LEU LEU A . n 
C 3 192 GLY 192 192 192 GLY GLY A . n 
C 3 193 LEU 193 193 193 LEU LEU A . n 
C 3 194 THR 194 194 194 THR THR A . n 
C 3 195 GLY 195 195 195 GLY GLY A . n 
C 3 196 CYS 196 196 196 CYS CYS A . n 
C 3 197 ALA 197 197 197 ALA ALA A . n 
C 3 198 GLY 198 198 198 GLY GLY A . n 
C 3 199 VAL 199 199 199 VAL VAL A . n 
C 3 200 ALA 200 200 200 ALA ALA A . n 
C 3 201 SER 201 201 201 SER SER A . n 
C 3 202 ASN 202 202 202 ASN ASN A . n 
C 3 203 LYS 203 203 203 LYS LYS A . n 
C 3 204 LEU 204 204 204 LEU LEU A . n 
C 3 205 LEU 205 205 205 LEU LEU A . n 
C 3 206 ALA 206 206 206 ALA ALA A . n 
C 3 207 LYS 207 207 207 LYS LYS A . n 
C 3 208 LEU 208 208 208 LEU LEU A . n 
C 3 209 VAL 209 209 209 VAL VAL A . n 
C 3 210 SER 210 210 210 SER SER A . n 
C 3 211 GLY 211 211 211 GLY GLY A . n 
C 3 212 VAL 212 212 212 VAL VAL A . n 
C 3 213 PHE 213 213 213 PHE PHE A . n 
C 3 214 LYS 214 214 214 LYS LYS A . n 
C 3 215 PRO 215 215 215 PRO PRO A . n 
C 3 216 ASN 216 216 216 ASN ASN A . n 
C 3 217 GLN 217 217 217 GLN GLN A . n 
C 3 218 GLN 218 218 218 GLN GLN A . n 
C 3 219 THR 219 219 219 THR THR A . n 
C 3 220 VAL 220 220 220 VAL VAL A . n 
C 3 221 LEU 221 221 221 LEU LEU A . n 
C 3 222 LEU 222 222 222 LEU LEU A . n 
C 3 223 PRO 223 223 223 PRO PRO A . n 
C 3 224 GLU 224 224 224 GLU GLU A . n 
C 3 225 SER 225 225 225 SER SER A . n 
C 3 226 CYS 226 226 226 CYS CYS A . n 
C 3 227 GLN 227 227 227 GLN GLN A . n 
C 3 228 HIS 228 228 228 HIS HIS A . n 
C 3 229 LEU 229 229 229 LEU LEU A . n 
C 3 230 ILE 230 230 230 ILE ILE A . n 
C 3 231 HIS 231 231 231 HIS HIS A . n 
C 3 232 SER 232 232 232 SER SER A . n 
C 3 233 LEU 233 233 233 LEU LEU A . n 
C 3 234 ASN 234 234 234 ASN ASN A . n 
C 3 235 HIS 235 235 235 HIS HIS A . n 
C 3 236 ILE 236 236 236 ILE ILE A . n 
C 3 237 LYS 237 237 237 LYS LYS A . n 
C 3 238 GLU 238 238 238 GLU GLU A . n 
C 3 239 ILE 239 239 239 ILE ILE A . n 
C 3 240 PRO 240 240 240 PRO PRO A . n 
C 3 241 GLY 241 241 241 GLY GLY A . n 
C 3 242 ILE 242 242 242 ILE ILE A . n 
C 3 243 GLY 243 243 243 GLY GLY A . n 
C 3 244 TYR 244 244 244 TYR TYR A . n 
C 3 245 LYS 245 245 245 LYS LYS A . n 
C 3 246 THR 246 246 246 THR THR A . n 
C 3 247 ALA 247 247 247 ALA ALA A . n 
C 3 248 LYS 248 248 248 LYS LYS A . n 
C 3 249 CYS 249 249 249 CYS CYS A . n 
C 3 250 LEU 250 250 250 LEU LEU A . n 
C 3 251 GLU 251 251 251 GLU GLU A . n 
C 3 252 ALA 252 252 252 ALA ALA A . n 
C 3 253 LEU 253 253 253 LEU LEU A . n 
C 3 254 GLY 254 254 254 GLY GLY A . n 
C 3 255 ILE 255 255 255 ILE ILE A . n 
C 3 256 ASN 256 256 256 ASN ASN A . n 
C 3 257 SER 257 257 257 SER SER A . n 
C 3 258 VAL 258 258 258 VAL VAL A . n 
C 3 259 ARG 259 259 259 ARG ARG A . n 
C 3 260 ASP 260 260 260 ASP ASP A . n 
C 3 261 LEU 261 261 261 LEU LEU A . n 
C 3 262 GLN 262 262 262 GLN GLN A . n 
C 3 263 THR 263 263 263 THR THR A . n 
C 3 264 PHE 264 264 264 PHE PHE A . n 
C 3 265 SER 265 265 265 SER SER A . n 
C 3 266 PRO 266 266 266 PRO PRO A . n 
C 3 267 LYS 267 267 267 LYS LYS A . n 
C 3 268 ILE 268 268 268 ILE ILE A . n 
C 3 269 LEU 269 269 269 LEU LEU A . n 
C 3 270 GLU 270 270 270 GLU GLU A . n 
C 3 271 LYS 271 271 271 LYS LYS A . n 
C 3 272 GLU 272 272 272 GLU GLU A . n 
C 3 273 LEU 273 273 273 LEU LEU A . n 
C 3 274 GLY 274 274 274 GLY GLY A . n 
C 3 275 ILE 275 275 275 ILE ILE A . n 
C 3 276 SER 276 276 276 SER SER A . n 
C 3 277 VAL 277 277 277 VAL VAL A . n 
C 3 278 ALA 278 278 278 ALA ALA A . n 
C 3 279 GLN 279 279 279 GLN GLN A . n 
C 3 280 ARG 280 280 280 ARG ARG A . n 
C 3 281 ILE 281 281 281 ILE ILE A . n 
C 3 282 GLN 282 282 282 GLN GLN A . n 
C 3 283 LYS 283 283 283 LYS LYS A . n 
C 3 284 LEU 284 284 284 LEU LEU A . n 
C 3 285 SER 285 285 285 SER SER A . n 
C 3 286 PHE 286 286 286 PHE PHE A . n 
C 3 287 GLY 287 287 287 GLY GLY A . n 
C 3 288 GLU 288 288 288 GLU GLU A . n 
C 3 289 ASP 289 289 289 ASP ASP A . n 
C 3 290 ASN 290 290 290 ASN ASN A . n 
C 3 291 SER 291 291 291 SER SER A . n 
C 3 292 PRO 292 292 292 PRO PRO A . n 
C 3 293 VAL 293 293 293 VAL VAL A . n 
C 3 294 ILE 294 294 294 ILE ILE A . n 
C 3 295 LEU 295 295 295 LEU LEU A . n 
C 3 296 SER 296 296 296 SER SER A . n 
C 3 297 GLY 297 297 297 GLY GLY A . n 
C 3 298 PRO 298 298 298 PRO PRO A . n 
C 3 299 PRO 299 299 299 PRO PRO A . n 
C 3 300 GLN 300 300 300 GLN GLN A . n 
C 3 301 SER 301 301 301 SER SER A . n 
C 3 302 PHE 302 302 302 PHE PHE A . n 
C 3 303 SER 303 303 303 SER SER A . n 
C 3 304 GLU 304 304 304 GLU GLU A . n 
C 3 305 GLU 305 305 305 GLU GLU A . n 
C 3 306 ASP 306 306 306 ASP ASP A . n 
C 3 307 SER 307 307 307 SER SER A . n 
C 3 308 PHE 308 308 308 PHE PHE A . n 
C 3 309 LYS 309 309 309 LYS LYS A . n 
C 3 310 LYS 310 310 310 LYS LYS A . n 
C 3 311 CYS 311 311 311 CYS CYS A . n 
C 3 312 SER 312 312 312 SER SER A . n 
C 3 313 SER 313 313 313 SER SER A . n 
C 3 314 GLU 314 314 314 GLU GLU A . n 
C 3 315 VAL 315 315 315 VAL VAL A . n 
C 3 316 GLU 316 316 316 GLU GLU A . n 
C 3 317 ALA 317 317 317 ALA ALA A . n 
C 3 318 LYS 318 318 318 LYS LYS A . n 
C 3 319 ASN 319 319 319 ASN ASN A . n 
C 3 320 LYS 320 320 320 LYS LYS A . n 
C 3 321 ILE 321 321 321 ILE ILE A . n 
C 3 322 GLU 322 322 322 GLU GLU A . n 
C 3 323 GLU 323 323 323 GLU GLU A . n 
C 3 324 LEU 324 324 324 LEU LEU A . n 
C 3 325 LEU 325 325 325 LEU LEU A . n 
C 3 326 ALA 326 326 326 ALA ALA A . n 
C 3 327 SER 327 327 327 SER SER A . n 
C 3 328 LEU 328 328 328 LEU LEU A . n 
C 3 329 LEU 329 329 329 LEU LEU A . n 
C 3 330 ASN 330 330 330 ASN ASN A . n 
C 3 331 ARG 331 331 331 ARG ARG A . n 
C 3 332 VAL 332 332 332 VAL VAL A . n 
C 3 333 CYS 333 333 333 CYS CYS A . n 
C 3 334 GLN 334 334 334 GLN GLN A . n 
C 3 335 ASP 335 335 335 ASP ASP A . n 
C 3 336 GLY 336 336 336 GLY GLY A . n 
C 3 337 ARG 337 337 337 ARG ARG A . n 
C 3 338 LYS 338 338 338 LYS LYS A . n 
C 3 339 PRO 339 339 339 PRO PRO A . n 
C 3 340 HIS 340 340 340 HIS HIS A . n 
C 3 341 THR 341 341 341 THR THR A . n 
C 3 342 VAL 342 342 342 VAL VAL A . n 
C 3 343 ARG 343 343 343 ARG ARG A . n 
C 3 344 LEU 344 344 344 LEU LEU A . n 
C 3 345 ILE 345 345 345 ILE ILE A . n 
C 3 346 ILE 346 346 346 ILE ILE A . n 
C 3 347 ARG 347 347 347 ARG ARG A . n 
C 3 348 ARG 348 348 348 ARG ARG A . n 
C 3 349 TYR 349 349 349 TYR TYR A . n 
C 3 350 SER 350 350 350 SER SER A . n 
C 3 351 SER 351 351 ?   ?   ?   A . n 
C 3 352 GLU 352 352 ?   ?   ?   A . n 
C 3 353 LYS 353 353 ?   ?   ?   A . n 
C 3 354 HIS 354 354 ?   ?   ?   A . n 
C 3 355 TYR 355 355 ?   ?   ?   A . n 
C 3 356 GLY 356 356 356 GLY GLY A . n 
C 3 357 ARG 357 357 357 ARG ARG A . n 
C 3 358 GLU 358 358 358 GLU GLU A . n 
C 3 359 SER 359 359 359 SER SER A . n 
C 3 360 ARG 360 360 360 ARG ARG A . n 
C 3 361 GLN 361 361 361 GLN GLN A . n 
C 3 362 CYS 362 362 362 CYS CYS A . n 
C 3 363 PRO 363 363 363 PRO PRO A . n 
C 3 364 ILE 364 364 364 ILE ILE A . n 
C 3 365 PRO 365 365 365 PRO PRO A . n 
C 3 366 SER 366 366 366 SER SER A . n 
C 3 367 HIS 367 367 367 HIS HIS A . n 
C 3 368 VAL 368 368 368 VAL VAL A . n 
C 3 369 ILE 369 369 369 ILE ILE A . n 
C 3 370 GLN 370 370 370 GLN GLN A . n 
C 3 371 LYS 371 371 371 LYS LYS A . n 
C 3 372 LEU 372 372 ?   ?   ?   A . n 
C 3 373 GLY 373 373 ?   ?   ?   A . n 
C 3 374 THR 374 374 ?   ?   ?   A . n 
C 3 375 GLY 375 375 ?   ?   ?   A . n 
C 3 376 ASN 376 376 ?   ?   ?   A . n 
C 3 377 TYR 377 377 ?   ?   ?   A . n 
C 3 378 ASP 378 378 378 ASP ASP A . n 
C 3 379 VAL 379 379 379 VAL VAL A . n 
C 3 380 MET 380 380 380 MET MET A . n 
C 3 381 THR 381 381 381 THR THR A . n 
C 3 382 PRO 382 382 382 PRO PRO A . n 
C 3 383 MET 383 383 383 MET MET A . n 
C 3 384 VAL 384 384 384 VAL VAL A . n 
C 3 385 ASP 385 385 385 ASP ASP A . n 
C 3 386 ILE 386 386 386 ILE ILE A . n 
C 3 387 LEU 387 387 387 LEU LEU A . n 
C 3 388 MET 388 388 388 MET MET A . n 
C 3 389 LYS 389 389 389 LYS LYS A . n 
C 3 390 LEU 390 390 390 LEU LEU A . n 
C 3 391 PHE 391 391 391 PHE PHE A . n 
C 3 392 ARG 392 392 392 ARG ARG A . n 
C 3 393 ASN 393 393 393 ASN ASN A . n 
C 3 394 MET 394 394 394 MET MET A . n 
C 3 395 VAL 395 395 395 VAL VAL A . n 
C 3 396 ASN 396 396 396 ASN ASN A . n 
C 3 397 VAL 397 397 397 VAL VAL A . n 
C 3 398 LYS 398 398 ?   ?   ?   A . n 
C 3 399 MET 399 399 ?   ?   ?   A . n 
C 3 400 PRO 400 400 ?   ?   ?   A . n 
C 3 401 PHE 401 401 ?   ?   ?   A . n 
C 3 402 HIS 402 402 ?   ?   ?   A . n 
C 3 403 LEU 403 403 403 LEU LEU A . n 
C 3 404 THR 404 404 404 THR THR A . n 
C 3 405 LEU 405 405 405 LEU LEU A . n 
C 3 406 LEU 406 406 406 LEU LEU A . n 
C 3 407 SER 407 407 407 SER SER A . n 
C 3 408 VAL 408 408 408 VAL VAL A . n 
C 3 409 CYS 409 409 409 CYS CYS A . n 
C 3 410 PHE 410 410 410 PHE PHE A . n 
C 3 411 CYS 411 411 411 CYS CYS A . n 
C 3 412 ASN 412 412 412 ASN ASN A . n 
C 3 413 LEU 413 413 413 LEU LEU A . n 
C 3 414 LYS 414 414 414 LYS LYS A . n 
C 3 415 ALA 415 415 ?   ?   ?   A . n 
C 3 416 LEU 416 416 ?   ?   ?   A . n 
C 3 417 ASN 417 417 ?   ?   ?   A . n 
C 3 418 THR 418 418 ?   ?   ?   A . n 
C 3 419 ALA 419 419 ?   ?   ?   A . n 
C 3 420 LYS 420 420 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 TTP 1  501 1  TTP TTP A . 
E 5 MG  1  502 1  MG  MG  A . 
F 6 CL  1  503 1  CL  CL  A . 
G 7 HOH 1  901 20 HOH HOH P . 
G 7 HOH 2  902 29 HOH HOH P . 
H 7 HOH 1  901 28 HOH HOH T . 
H 7 HOH 2  902 13 HOH HOH T . 
H 7 HOH 3  903 41 HOH HOH T . 
H 7 HOH 4  904 50 HOH HOH T . 
H 7 HOH 5  905 56 HOH HOH T . 
I 7 HOH 1  601 83 HOH HOH A . 
I 7 HOH 2  602 66 HOH HOH A . 
I 7 HOH 3  603 80 HOH HOH A . 
I 7 HOH 4  604 24 HOH HOH A . 
I 7 HOH 5  605 18 HOH HOH A . 
I 7 HOH 6  606 42 HOH HOH A . 
I 7 HOH 7  607 10 HOH HOH A . 
I 7 HOH 8  608 8  HOH HOH A . 
I 7 HOH 9  609 47 HOH HOH A . 
I 7 HOH 10 610 32 HOH HOH A . 
I 7 HOH 11 611 92 HOH HOH A . 
I 7 HOH 12 612 43 HOH HOH A . 
I 7 HOH 13 613 2  HOH HOH A . 
I 7 HOH 14 614 14 HOH HOH A . 
I 7 HOH 15 615 73 HOH HOH A . 
I 7 HOH 16 616 17 HOH HOH A . 
I 7 HOH 17 617 40 HOH HOH A . 
I 7 HOH 18 618 53 HOH HOH A . 
I 7 HOH 19 619 82 HOH HOH A . 
I 7 HOH 20 620 21 HOH HOH A . 
I 7 HOH 21 621 46 HOH HOH A . 
I 7 HOH 22 622 1  HOH HOH A . 
I 7 HOH 23 623 7  HOH HOH A . 
I 7 HOH 24 624 23 HOH HOH A . 
I 7 HOH 25 625 63 HOH HOH A . 
I 7 HOH 26 626 60 HOH HOH A . 
I 7 HOH 27 627 51 HOH HOH A . 
I 7 HOH 28 628 88 HOH HOH A . 
I 7 HOH 29 629 36 HOH HOH A . 
I 7 HOH 30 630 22 HOH HOH A . 
I 7 HOH 31 631 5  HOH HOH A . 
I 7 HOH 32 632 67 HOH HOH A . 
I 7 HOH 33 633 26 HOH HOH A . 
I 7 HOH 34 634 4  HOH HOH A . 
I 7 HOH 35 635 11 HOH HOH A . 
I 7 HOH 36 636 86 HOH HOH A . 
I 7 HOH 37 637 19 HOH HOH A . 
I 7 HOH 38 638 91 HOH HOH A . 
I 7 HOH 39 639 62 HOH HOH A . 
I 7 HOH 40 640 12 HOH HOH A . 
I 7 HOH 41 641 64 HOH HOH A . 
I 7 HOH 42 642 65 HOH HOH A . 
I 7 HOH 43 643 33 HOH HOH A . 
I 7 HOH 44 644 75 HOH HOH A . 
I 7 HOH 45 645 3  HOH HOH A . 
I 7 HOH 46 646 59 HOH HOH A . 
I 7 HOH 47 647 49 HOH HOH A . 
I 7 HOH 48 648 6  HOH HOH A . 
I 7 HOH 49 649 15 HOH HOH A . 
I 7 HOH 50 650 27 HOH HOH A . 
I 7 HOH 51 651 16 HOH HOH A . 
I 7 HOH 52 652 35 HOH HOH A . 
I 7 HOH 53 653 44 HOH HOH A . 
I 7 HOH 54 654 57 HOH HOH A . 
I 7 HOH 55 655 81 HOH HOH A . 
I 7 HOH 56 656 84 HOH HOH A . 
I 7 HOH 57 657 48 HOH HOH A . 
I 7 HOH 58 658 30 HOH HOH A . 
I 7 HOH 59 659 9  HOH HOH A . 
I 7 HOH 60 660 85 HOH HOH A . 
I 7 HOH 61 661 68 HOH HOH A . 
I 7 HOH 62 662 34 HOH HOH A . 
I 7 HOH 63 663 71 HOH HOH A . 
I 7 HOH 64 664 77 HOH HOH A . 
I 7 HOH 65 665 45 HOH HOH A . 
I 7 HOH 66 666 31 HOH HOH A . 
I 7 HOH 67 667 25 HOH HOH A . 
I 7 HOH 68 668 38 HOH HOH A . 
I 7 HOH 69 669 39 HOH HOH A . 
I 7 HOH 70 670 37 HOH HOH A . 
I 7 HOH 71 671 72 HOH HOH A . 
I 7 HOH 72 672 78 HOH HOH A . 
I 7 HOH 73 673 58 HOH HOH A . 
I 7 HOH 74 674 52 HOH HOH A . 
I 7 HOH 75 675 54 HOH HOH A . 
I 7 HOH 76 676 69 HOH HOH A . 
I 7 HOH 77 677 61 HOH HOH A . 
I 7 HOH 78 678 55 HOH HOH A . 
I 7 HOH 79 679 76 HOH HOH A . 
I 7 HOH 80 680 79 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5040  ? 
1 MORE         -32   ? 
1 'SSA (A^2)'  18430 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? C ASP 34  ? A ASP 34  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O   ? C LEU 35  ? A LEU 35  ? 1_555 94.4  ? 
2  OD1 ? C ASP 34  ? A ASP 34  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 OD2 ? C ASP 126 ? A ASP 126 ? 1_555 102.0 ? 
3  O   ? C LEU 35  ? A LEU 35  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 OD2 ? C ASP 126 ? A ASP 126 ? 1_555 86.1  ? 
4  OD1 ? C ASP 34  ? A ASP 34  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A ? D TTP .   ? A TTP 501 ? 1_555 103.7 ? 
5  O   ? C LEU 35  ? A LEU 35  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A ? D TTP .   ? A TTP 501 ? 1_555 161.5 ? 
6  OD2 ? C ASP 126 ? A ASP 126 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A ? D TTP .   ? A TTP 501 ? 1_555 86.8  ? 
7  OD1 ? C ASP 34  ? A ASP 34  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B ? D TTP .   ? A TTP 501 ? 1_555 177.5 ? 
8  O   ? C LEU 35  ? A LEU 35  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B ? D TTP .   ? A TTP 501 ? 1_555 84.8  ? 
9  OD2 ? C ASP 126 ? A ASP 126 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B ? D TTP .   ? A TTP 501 ? 1_555 80.3  ? 
10 O1A ? D TTP .   ? A TTP 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B ? D TTP .   ? A TTP 501 ? 1_555 77.2  ? 
11 OD1 ? C ASP 34  ? A ASP 34  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O3G ? D TTP .   ? A TTP 501 ? 1_555 99.8  ? 
12 O   ? C LEU 35  ? A LEU 35  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O3G ? D TTP .   ? A TTP 501 ? 1_555 91.1  ? 
13 OD2 ? C ASP 126 ? A ASP 126 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O3G ? D TTP .   ? A TTP 501 ? 1_555 158.1 ? 
14 O1A ? D TTP .   ? A TTP 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O3G ? D TTP .   ? A TTP 501 ? 1_555 89.1  ? 
15 O1B ? D TTP .   ? A TTP 501 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O3G ? D TTP .   ? A TTP 501 ? 1_555 77.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-04-19 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2019-12-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support 
2 3 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_audit_support.funding_organization' 
2 3 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.10.1_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .                    4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 644 ? ? O A HOH 664 ? ? 1.83 
2 1 ND2 A ASN 159 ? ? O A HOH 601 ? ? 2.05 
3 1 O   A HOH 672 ? ? O A HOH 680 ? ? 2.05 
4 1 O   A PHE 308 ? ? O A HOH 602 ? ? 2.17 
5 1 O   A HOH 658 ? ? O A HOH 670 ? ? 2.18 
6 1 O   A HOH 673 ? ? O A HOH 678 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    "O5'" 
_pdbx_validate_symm_contact.auth_asym_id_1    P 
_pdbx_validate_symm_contact.auth_comp_id_1    DA 
_pdbx_validate_symm_contact.auth_seq_id_1     867 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    "O3'" 
_pdbx_validate_symm_contact.auth_asym_id_2    T 
_pdbx_validate_symm_contact.auth_comp_id_2    DT 
_pdbx_validate_symm_contact.auth_seq_id_2     847 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   10_665 
_pdbx_validate_symm_contact.dist              1.73 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            T 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DT 
_pdbx_validate_rmsd_bond.auth_seq_id_1             844 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            T 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DT 
_pdbx_validate_rmsd_bond.auth_seq_id_2             844 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.374 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.045 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 37  ? ? 24.98   63.94   
2 1 ASP A 52  ? ? 75.74   -8.95   
3 1 LYS A 60  ? ? 57.49   -125.33 
4 1 SER A 276 ? ? -60.93  -81.07  
5 1 CYS A 311 ? ? -151.01 81.38   
6 1 GLN A 370 ? ? -65.06  57.05   
7 1 MET A 380 ? ? -60.70  -70.03  
8 1 LEU A 405 ? ? -172.21 148.82  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 T DT  839 ? P   ? B DT  3   P   
2   1 Y 1 T DT  839 ? OP1 ? B DT  3   OP1 
3   1 Y 1 T DT  839 ? OP2 ? B DT  3   OP2 
4   1 Y 1 A SER 26  ? OG  ? C SER 26  OG  
5   1 Y 1 A GLU 49  ? CG  ? C GLU 49  CG  
6   1 Y 1 A GLU 49  ? CD  ? C GLU 49  CD  
7   1 Y 1 A GLU 49  ? OE1 ? C GLU 49  OE1 
8   1 Y 1 A GLU 49  ? OE2 ? C GLU 49  OE2 
9   1 Y 1 A LYS 51  ? CD  ? C LYS 51  CD  
10  1 Y 1 A LYS 51  ? CE  ? C LYS 51  CE  
11  1 Y 1 A LYS 51  ? NZ  ? C LYS 51  NZ  
12  1 Y 1 A LYS 53  ? CG  ? C LYS 53  CG  
13  1 Y 1 A LYS 53  ? CD  ? C LYS 53  CD  
14  1 Y 1 A LYS 53  ? CE  ? C LYS 53  CE  
15  1 Y 1 A LYS 53  ? NZ  ? C LYS 53  NZ  
16  1 Y 1 A TYR 61  ? CG  ? C TYR 61  CG  
17  1 Y 1 A TYR 61  ? CD1 ? C TYR 61  CD1 
18  1 Y 1 A TYR 61  ? CD2 ? C TYR 61  CD2 
19  1 Y 1 A TYR 61  ? CE1 ? C TYR 61  CE1 
20  1 Y 1 A TYR 61  ? CE2 ? C TYR 61  CE2 
21  1 Y 1 A TYR 61  ? CZ  ? C TYR 61  CZ  
22  1 Y 1 A TYR 61  ? OH  ? C TYR 61  OH  
23  1 Y 1 A GLU 69  ? CD  ? C GLU 69  CD  
24  1 Y 1 A GLU 69  ? OE1 ? C GLU 69  OE1 
25  1 Y 1 A GLU 69  ? OE2 ? C GLU 69  OE2 
26  1 Y 1 A LEU 73  ? CD1 ? C LEU 73  CD1 
27  1 Y 1 A LEU 73  ? CD2 ? C LEU 73  CD2 
28  1 Y 1 A LYS 76  ? CE  ? C LYS 76  CE  
29  1 Y 1 A LYS 76  ? NZ  ? C LYS 76  NZ  
30  1 Y 1 A ARG 82  ? CG  ? C ARG 82  CG  
31  1 Y 1 A ARG 82  ? CD  ? C ARG 82  CD  
32  1 Y 1 A ARG 82  ? NE  ? C ARG 82  NE  
33  1 Y 1 A ARG 82  ? CZ  ? C ARG 82  CZ  
34  1 Y 1 A ARG 82  ? NH1 ? C ARG 82  NH1 
35  1 Y 1 A ARG 82  ? NH2 ? C ARG 82  NH2 
36  1 Y 1 A LYS 85  ? CD  ? C LYS 85  CD  
37  1 Y 1 A LYS 85  ? CE  ? C LYS 85  CE  
38  1 Y 1 A LYS 85  ? NZ  ? C LYS 85  NZ  
39  1 Y 1 A GLU 86  ? CG  ? C GLU 86  CG  
40  1 Y 1 A GLU 86  ? CD  ? C GLU 86  CD  
41  1 Y 1 A GLU 86  ? OE1 ? C GLU 86  OE1 
42  1 Y 1 A GLU 86  ? OE2 ? C GLU 86  OE2 
43  1 Y 1 A LYS 87  ? NZ  ? C LYS 87  NZ  
44  1 Y 1 A GLU 134 ? CG  ? C GLU 134 CG  
45  1 Y 1 A GLU 134 ? CD  ? C GLU 134 CD  
46  1 Y 1 A GLU 134 ? OE1 ? C GLU 134 OE1 
47  1 Y 1 A GLU 134 ? OE2 ? C GLU 134 OE2 
48  1 Y 1 A GLU 137 ? CD  ? C GLU 137 CD  
49  1 Y 1 A GLU 137 ? OE1 ? C GLU 137 OE1 
50  1 Y 1 A GLU 137 ? OE2 ? C GLU 137 OE2 
51  1 Y 1 A LYS 138 ? CD  ? C LYS 138 CD  
52  1 Y 1 A LYS 138 ? CE  ? C LYS 138 CE  
53  1 Y 1 A LYS 138 ? NZ  ? C LYS 138 NZ  
54  1 Y 1 A GLN 141 ? CD  ? C GLN 141 CD  
55  1 Y 1 A GLN 141 ? OE1 ? C GLN 141 OE1 
56  1 Y 1 A GLN 141 ? NE2 ? C GLN 141 NE2 
57  1 Y 1 A GLN 142 ? CG  ? C GLN 142 CG  
58  1 Y 1 A GLN 142 ? CD  ? C GLN 142 CD  
59  1 Y 1 A GLN 142 ? OE1 ? C GLN 142 OE1 
60  1 Y 1 A GLN 142 ? NE2 ? C GLN 142 NE2 
61  1 Y 1 A GLN 144 ? CG  ? C GLN 144 CG  
62  1 Y 1 A GLN 144 ? CD  ? C GLN 144 CD  
63  1 Y 1 A GLN 144 ? OE1 ? C GLN 144 OE1 
64  1 Y 1 A GLN 144 ? NE2 ? C GLN 144 NE2 
65  1 Y 1 A SER 145 ? OG  ? C SER 145 OG  
66  1 Y 1 A ASP 146 ? CG  ? C ASP 146 CG  
67  1 Y 1 A ASP 146 ? OD1 ? C ASP 146 OD1 
68  1 Y 1 A ASP 146 ? OD2 ? C ASP 146 OD2 
69  1 Y 1 A GLU 147 ? CG  ? C GLU 147 CG  
70  1 Y 1 A GLU 147 ? CD  ? C GLU 147 CD  
71  1 Y 1 A GLU 147 ? OE1 ? C GLU 147 OE1 
72  1 Y 1 A GLU 147 ? OE2 ? C GLU 147 OE2 
73  1 Y 1 A LYS 237 ? CG  ? C LYS 237 CG  
74  1 Y 1 A LYS 237 ? CD  ? C LYS 237 CD  
75  1 Y 1 A LYS 237 ? CE  ? C LYS 237 CE  
76  1 Y 1 A LYS 237 ? NZ  ? C LYS 237 NZ  
77  1 Y 1 A LYS 245 ? CG  ? C LYS 245 CG  
78  1 Y 1 A LYS 245 ? CD  ? C LYS 245 CD  
79  1 Y 1 A LYS 245 ? CE  ? C LYS 245 CE  
80  1 Y 1 A LYS 245 ? NZ  ? C LYS 245 NZ  
81  1 Y 1 A LYS 248 ? CG  ? C LYS 248 CG  
82  1 Y 1 A LYS 248 ? CD  ? C LYS 248 CD  
83  1 Y 1 A LYS 248 ? CE  ? C LYS 248 CE  
84  1 Y 1 A LYS 248 ? NZ  ? C LYS 248 NZ  
85  1 Y 1 A LYS 267 ? CE  ? C LYS 267 CE  
86  1 Y 1 A LYS 267 ? NZ  ? C LYS 267 NZ  
87  1 Y 1 A LYS 271 ? CG  ? C LYS 271 CG  
88  1 Y 1 A LYS 271 ? CD  ? C LYS 271 CD  
89  1 Y 1 A LYS 271 ? CE  ? C LYS 271 CE  
90  1 Y 1 A LYS 271 ? NZ  ? C LYS 271 NZ  
91  1 Y 1 A LYS 309 ? CG  ? C LYS 309 CG  
92  1 Y 1 A LYS 309 ? CD  ? C LYS 309 CD  
93  1 Y 1 A LYS 309 ? CE  ? C LYS 309 CE  
94  1 Y 1 A LYS 309 ? NZ  ? C LYS 309 NZ  
95  1 Y 1 A VAL 315 ? CG1 ? C VAL 315 CG1 
96  1 Y 1 A VAL 315 ? CG2 ? C VAL 315 CG2 
97  1 Y 1 A GLU 316 ? CG  ? C GLU 316 CG  
98  1 Y 1 A GLU 316 ? CD  ? C GLU 316 CD  
99  1 Y 1 A GLU 316 ? OE1 ? C GLU 316 OE1 
100 1 Y 1 A GLU 316 ? OE2 ? C GLU 316 OE2 
101 1 Y 1 A LYS 318 ? CG  ? C LYS 318 CG  
102 1 Y 1 A LYS 318 ? CD  ? C LYS 318 CD  
103 1 Y 1 A LYS 318 ? CE  ? C LYS 318 CE  
104 1 Y 1 A LYS 318 ? NZ  ? C LYS 318 NZ  
105 1 Y 1 A ASN 319 ? CG  ? C ASN 319 CG  
106 1 Y 1 A ASN 319 ? OD1 ? C ASN 319 OD1 
107 1 Y 1 A ASN 319 ? ND2 ? C ASN 319 ND2 
108 1 Y 1 A LYS 320 ? CG  ? C LYS 320 CG  
109 1 Y 1 A LYS 320 ? CD  ? C LYS 320 CD  
110 1 Y 1 A LYS 320 ? CE  ? C LYS 320 CE  
111 1 Y 1 A LYS 320 ? NZ  ? C LYS 320 NZ  
112 1 Y 1 A GLU 322 ? CG  ? C GLU 322 CG  
113 1 Y 1 A GLU 322 ? CD  ? C GLU 322 CD  
114 1 Y 1 A GLU 322 ? OE1 ? C GLU 322 OE1 
115 1 Y 1 A GLU 322 ? OE2 ? C GLU 322 OE2 
116 1 Y 1 A GLU 323 ? CG  ? C GLU 323 CG  
117 1 Y 1 A GLU 323 ? CD  ? C GLU 323 CD  
118 1 Y 1 A GLU 323 ? OE1 ? C GLU 323 OE1 
119 1 Y 1 A GLU 323 ? OE2 ? C GLU 323 OE2 
120 1 Y 1 A ASN 330 ? CG  ? C ASN 330 CG  
121 1 Y 1 A ASN 330 ? OD1 ? C ASN 330 OD1 
122 1 Y 1 A ASN 330 ? ND2 ? C ASN 330 ND2 
123 1 Y 1 A GLN 334 ? CG  ? C GLN 334 CG  
124 1 Y 1 A GLN 334 ? CD  ? C GLN 334 CD  
125 1 Y 1 A GLN 334 ? OE1 ? C GLN 334 OE1 
126 1 Y 1 A GLN 334 ? NE2 ? C GLN 334 NE2 
127 1 Y 1 A LYS 338 ? CG  ? C LYS 338 CG  
128 1 Y 1 A LYS 338 ? CD  ? C LYS 338 CD  
129 1 Y 1 A LYS 338 ? CE  ? C LYS 338 CE  
130 1 Y 1 A LYS 338 ? NZ  ? C LYS 338 NZ  
131 1 Y 1 A LEU 344 ? CG  ? C LEU 344 CG  
132 1 Y 1 A LEU 344 ? CD1 ? C LEU 344 CD1 
133 1 Y 1 A LEU 344 ? CD2 ? C LEU 344 CD2 
134 1 Y 1 A ARG 348 ? CG  ? C ARG 348 CG  
135 1 Y 1 A ARG 348 ? CD  ? C ARG 348 CD  
136 1 Y 1 A ARG 348 ? NE  ? C ARG 348 NE  
137 1 Y 1 A ARG 348 ? CZ  ? C ARG 348 CZ  
138 1 Y 1 A ARG 348 ? NH1 ? C ARG 348 NH1 
139 1 Y 1 A ARG 348 ? NH2 ? C ARG 348 NH2 
140 1 Y 1 A TYR 349 ? CG  ? C TYR 349 CG  
141 1 Y 1 A TYR 349 ? CD1 ? C TYR 349 CD1 
142 1 Y 1 A TYR 349 ? CD2 ? C TYR 349 CD2 
143 1 Y 1 A TYR 349 ? CE1 ? C TYR 349 CE1 
144 1 Y 1 A TYR 349 ? CE2 ? C TYR 349 CE2 
145 1 Y 1 A TYR 349 ? CZ  ? C TYR 349 CZ  
146 1 Y 1 A TYR 349 ? OH  ? C TYR 349 OH  
147 1 Y 1 A GLN 370 ? CG  ? C GLN 370 CG  
148 1 Y 1 A GLN 370 ? CD  ? C GLN 370 CD  
149 1 Y 1 A GLN 370 ? OE1 ? C GLN 370 OE1 
150 1 Y 1 A GLN 370 ? NE2 ? C GLN 370 NE2 
151 1 Y 1 A LYS 371 ? CG  ? C LYS 371 CG  
152 1 Y 1 A LYS 371 ? CD  ? C LYS 371 CD  
153 1 Y 1 A LYS 371 ? CE  ? C LYS 371 CE  
154 1 Y 1 A LYS 371 ? NZ  ? C LYS 371 NZ  
155 1 Y 1 A ASP 385 ? CG  ? C ASP 385 CG  
156 1 Y 1 A ASP 385 ? OD1 ? C ASP 385 OD1 
157 1 Y 1 A ASP 385 ? OD2 ? C ASP 385 OD2 
158 1 Y 1 A LYS 389 ? CG  ? C LYS 389 CG  
159 1 Y 1 A LYS 389 ? CD  ? C LYS 389 CD  
160 1 Y 1 A LYS 389 ? CE  ? C LYS 389 CE  
161 1 Y 1 A LYS 389 ? NZ  ? C LYS 389 NZ  
162 1 Y 1 A ASN 396 ? CG  ? C ASN 396 CG  
163 1 Y 1 A ASN 396 ? OD1 ? C ASN 396 OD1 
164 1 Y 1 A ASN 396 ? ND2 ? C ASN 396 ND2 
165 1 Y 1 A LEU 403 ? CG  ? C LEU 403 CG  
166 1 Y 1 A LEU 403 ? CD1 ? C LEU 403 CD1 
167 1 Y 1 A LEU 403 ? CD2 ? C LEU 403 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 T DT  837 ? B DT  1   
2  1 Y 1 T DC  838 ? B DC  2   
3  1 Y 1 A MET 1   ? C MET 1   
4  1 Y 1 A GLU 2   ? C GLU 2   
5  1 Y 1 A LEU 3   ? C LEU 3   
6  1 Y 1 A ALA 4   ? C ALA 4   
7  1 Y 1 A ASP 5   ? C ASP 5   
8  1 Y 1 A VAL 6   ? C VAL 6   
9  1 Y 1 A GLY 7   ? C GLY 7   
10 1 Y 1 A ALA 8   ? C ALA 8   
11 1 Y 1 A ALA 9   ? C ALA 9   
12 1 Y 1 A ALA 10  ? C ALA 10  
13 1 Y 1 A SER 11  ? C SER 11  
14 1 Y 1 A SER 12  ? C SER 12  
15 1 Y 1 A GLN 13  ? C GLN 13  
16 1 Y 1 A GLY 14  ? C GLY 14  
17 1 Y 1 A VAL 15  ? C VAL 15  
18 1 Y 1 A HIS 16  ? C HIS 16  
19 1 Y 1 A ASP 17  ? C ASP 17  
20 1 Y 1 A GLN 18  ? C GLN 18  
21 1 Y 1 A VAL 19  ? C VAL 19  
22 1 Y 1 A LEU 20  ? C LEU 20  
23 1 Y 1 A PRO 21  ? C PRO 21  
24 1 Y 1 A THR 22  ? C THR 22  
25 1 Y 1 A PRO 23  ? C PRO 23  
26 1 Y 1 A ASN 24  ? C ASN 24  
27 1 Y 1 A ALA 25  ? C ALA 25  
28 1 Y 1 A SER 351 ? C SER 351 
29 1 Y 1 A GLU 352 ? C GLU 352 
30 1 Y 1 A LYS 353 ? C LYS 353 
31 1 Y 1 A HIS 354 ? C HIS 354 
32 1 Y 1 A TYR 355 ? C TYR 355 
33 1 Y 1 A LEU 372 ? C LEU 372 
34 1 Y 1 A GLY 373 ? C GLY 373 
35 1 Y 1 A THR 374 ? C THR 374 
36 1 Y 1 A GLY 375 ? C GLY 375 
37 1 Y 1 A ASN 376 ? C ASN 376 
38 1 Y 1 A TYR 377 ? C TYR 377 
39 1 Y 1 A LYS 398 ? C LYS 398 
40 1 Y 1 A MET 399 ? C MET 399 
41 1 Y 1 A PRO 400 ? C PRO 400 
42 1 Y 1 A PHE 401 ? C PHE 401 
43 1 Y 1 A HIS 402 ? C HIS 402 
44 1 Y 1 A ALA 415 ? C ALA 415 
45 1 Y 1 A LEU 416 ? C LEU 416 
46 1 Y 1 A ASN 417 ? C ASN 417 
47 1 Y 1 A THR 418 ? C THR 418 
48 1 Y 1 A ALA 419 ? C ALA 419 
49 1 Y 1 A LYS 420 ? C LYS 420 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5ULW 'double helix'        
5ULW 'a-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA  1 1_555 B DT 11 1_555 0.415  -0.136 0.402  7.579  -7.931  3.271  1 P_DA867:DT847_T  P 867 ? T 847 ? 20 1 
1 A DG  2 1_555 B DC 10 1_555 0.309  -0.101 0.263  4.472  -9.076  4.028  2 P_DG868:DC846_T  P 868 ? T 846 ? 19 1 
1 A DG  3 1_555 B DC 9  1_555 0.022  -0.311 -0.056 1.307  -1.107  -3.576 3 P_DG869:DC845_T  P 869 ? T 845 ? 19 1 
1 A DA  4 1_555 B DT 8  1_555 0.387  -0.187 0.444  11.736 -9.325  2.036  4 P_DA870:DT844_T  P 870 ? T 844 ? 20 1 
1 A DC  5 1_555 B DG 7  1_555 -0.189 -0.213 -0.065 11.219 -13.003 0.594  5 P_DC871:DG843_T  P 871 ? T 843 ? 19 1 
1 A DC  6 1_555 B DG 6  1_555 0.111  -0.287 0.299  3.664  -16.074 -1.494 6 P_DC872:DG842_T  P 872 ? T 842 ? 19 1 
1 A DOC 7 1_555 B DG 5  1_555 0.043  -0.089 0.012  -8.853 -0.398  2.735  7 P_DOC873:DG841_T P 873 ? T 841 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 1 1_555 B DT 11 1_555 A DG  2 1_555 B DC 10 1_555 0.738  -0.702 3.472 0.191  -2.786 31.899 -0.734 -1.301 3.523 -5.057 
-0.347 32.018 1 PP_DA867DG868:DC846DT847_TT  P 867 ? T 847 ? P 868 ? T 846 ? 
1 A DG 2 1_555 B DC 10 1_555 A DG  3 1_555 B DC 9  1_555 0.052  -0.908 3.375 3.165  0.236  33.261 -1.621 0.450  3.359 0.411  
-5.514 33.408 2 PP_DG868DG869:DC845DC846_TT  P 868 ? T 846 ? P 869 ? T 845 ? 
1 A DG 3 1_555 B DC 9  1_555 A DA  4 1_555 B DT 8  1_555 -0.017 -0.659 3.078 -5.189 1.934  31.750 -1.509 -0.834 2.999 3.502  9.396 
32.217 3 PP_DG869DA870:DT844DC845_TT  P 869 ? T 845 ? P 870 ? T 844 ? 
1 A DA 4 1_555 B DT 8  1_555 A DC  5 1_555 B DG 7  1_555 0.610  -1.307 3.289 1.739  1.253  31.935 -2.597 -0.792 3.265 2.274  
-3.156 32.005 4 PP_DA870DC871:DG843DT844_TT  P 870 ? T 844 ? P 871 ? T 843 ? 
1 A DC 5 1_555 B DG 7  1_555 A DC  6 1_555 B DG 6  1_555 -0.363 -1.899 3.373 -3.701 8.762  31.887 -4.731 0.038  2.791 15.523 6.556 
33.240 5 PP_DC871DC872:DG842DG843_TT  P 871 ? T 843 ? P 872 ? T 842 ? 
1 A DC 6 1_555 B DG 6  1_555 A DOC 7 1_555 B DG 5  1_555 -0.462 -1.449 3.672 3.097  0.842  25.762 -3.482 1.975  3.544 1.879  
-6.913 25.958 6 PP_DC872DOC873:DG841DG842_TT P 872 ? T 842 ? P 873 ? T 841 ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01-ES021452 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "THYMIDINE-5'-TRIPHOSPHATE" TTP 
5 'MAGNESIUM ION'             MG  
6 'CHLORIDE ION'              CL  
7 water                       HOH 
#