data_5UM4
# 
_entry.id   5UM4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5UM4         
WWPDB D_1000226110 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5UM4 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Meinke, G.'  1 ? 
'Bohm, A.'    2 ? 
'Noujaim, S.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Crystal structure of the F255A mutant Kir3.1 cytoplasmic pore domain' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Meinke, G.'  1 
primary 'Bohm, A.'    2 
primary 'Noujaim, S.' 3 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5UM4 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     80.070 
_cell.length_a_esd                 ? 
_cell.length_b                     80.070 
_cell.length_b_esd                 ? 
_cell.length_c                     85.040 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5UM4 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'G protein-activated inward rectifier potassium channel 1' 24046.418 1  ? F255A 
'unp residues 41-63; unp residues 190-370' ? 
2 water   nat water                                                      18.015    27 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'GIRK-1,Inward rectifier K(+) channel Kir3.1,Potassium channel,inwardly rectifying subfamily J member 3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GPDDHMKKRQRFVDKNGR(CME)NVQHGNLGSERAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSR
QTPEGEFLPLDQLELDVGASTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMT(CME)QA
RTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPDDHMKKRQRFVDKNGRCNVQHGNLGSERAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGASTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDE
VLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   ASP n 
1 4   ASP n 
1 5   HIS n 
1 6   MET n 
1 7   LYS n 
1 8   LYS n 
1 9   ARG n 
1 10  GLN n 
1 11  ARG n 
1 12  PHE n 
1 13  VAL n 
1 14  ASP n 
1 15  LYS n 
1 16  ASN n 
1 17  GLY n 
1 18  ARG n 
1 19  CME n 
1 20  ASN n 
1 21  VAL n 
1 22  GLN n 
1 23  HIS n 
1 24  GLY n 
1 25  ASN n 
1 26  LEU n 
1 27  GLY n 
1 28  SER n 
1 29  GLU n 
1 30  ARG n 
1 31  ALA n 
1 32  GLU n 
1 33  THR n 
1 34  LEU n 
1 35  MET n 
1 36  PHE n 
1 37  SER n 
1 38  GLU n 
1 39  HIS n 
1 40  ALA n 
1 41  VAL n 
1 42  ILE n 
1 43  SER n 
1 44  MET n 
1 45  ARG n 
1 46  ASP n 
1 47  GLY n 
1 48  LYS n 
1 49  LEU n 
1 50  THR n 
1 51  LEU n 
1 52  MET n 
1 53  PHE n 
1 54  ARG n 
1 55  VAL n 
1 56  GLY n 
1 57  ASN n 
1 58  LEU n 
1 59  ARG n 
1 60  ASN n 
1 61  SER n 
1 62  HIS n 
1 63  MET n 
1 64  VAL n 
1 65  SER n 
1 66  ALA n 
1 67  GLN n 
1 68  ILE n 
1 69  ARG n 
1 70  CYS n 
1 71  LYS n 
1 72  LEU n 
1 73  LEU n 
1 74  LYS n 
1 75  SER n 
1 76  ARG n 
1 77  GLN n 
1 78  THR n 
1 79  PRO n 
1 80  GLU n 
1 81  GLY n 
1 82  GLU n 
1 83  PHE n 
1 84  LEU n 
1 85  PRO n 
1 86  LEU n 
1 87  ASP n 
1 88  GLN n 
1 89  LEU n 
1 90  GLU n 
1 91  LEU n 
1 92  ASP n 
1 93  VAL n 
1 94  GLY n 
1 95  ALA n 
1 96  SER n 
1 97  THR n 
1 98  GLY n 
1 99  ALA n 
1 100 ASP n 
1 101 GLN n 
1 102 LEU n 
1 103 PHE n 
1 104 LEU n 
1 105 VAL n 
1 106 SER n 
1 107 PRO n 
1 108 LEU n 
1 109 THR n 
1 110 ILE n 
1 111 CYS n 
1 112 HIS n 
1 113 VAL n 
1 114 ILE n 
1 115 ASP n 
1 116 ALA n 
1 117 LYS n 
1 118 SER n 
1 119 PRO n 
1 120 PHE n 
1 121 TYR n 
1 122 ASP n 
1 123 LEU n 
1 124 SER n 
1 125 GLN n 
1 126 ARG n 
1 127 SER n 
1 128 MET n 
1 129 GLN n 
1 130 THR n 
1 131 GLU n 
1 132 GLN n 
1 133 PHE n 
1 134 GLU n 
1 135 VAL n 
1 136 VAL n 
1 137 VAL n 
1 138 ILE n 
1 139 LEU n 
1 140 GLU n 
1 141 GLY n 
1 142 ILE n 
1 143 VAL n 
1 144 GLU n 
1 145 THR n 
1 146 THR n 
1 147 GLY n 
1 148 MET n 
1 149 THR n 
1 150 CME n 
1 151 GLN n 
1 152 ALA n 
1 153 ARG n 
1 154 THR n 
1 155 SER n 
1 156 TYR n 
1 157 THR n 
1 158 GLU n 
1 159 ASP n 
1 160 GLU n 
1 161 VAL n 
1 162 LEU n 
1 163 TRP n 
1 164 GLY n 
1 165 HIS n 
1 166 ARG n 
1 167 PHE n 
1 168 PHE n 
1 169 PRO n 
1 170 VAL n 
1 171 ILE n 
1 172 SER n 
1 173 LEU n 
1 174 GLU n 
1 175 GLU n 
1 176 GLY n 
1 177 PHE n 
1 178 PHE n 
1 179 LYS n 
1 180 VAL n 
1 181 ASP n 
1 182 TYR n 
1 183 SER n 
1 184 GLN n 
1 185 PHE n 
1 186 HIS n 
1 187 ALA n 
1 188 THR n 
1 189 PHE n 
1 190 GLU n 
1 191 VAL n 
1 192 PRO n 
1 193 THR n 
1 194 PRO n 
1 195 PRO n 
1 196 TYR n 
1 197 SER n 
1 198 VAL n 
1 199 LYS n 
1 200 GLU n 
1 201 GLN n 
1 202 GLU n 
1 203 GLU n 
1 204 MET n 
1 205 LEU n 
1 206 LEU n 
1 207 MET n 
1 208 SER n 
1 209 SER n 
1 210 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  29  'Green anole' ? LOC100559481   ? ? ? ? ? ? 'Anolis carolinensis' 28377 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 30 210 Mouse         ? 'Kcnj3, Girk1' ? ? ? ? ? ? 'Mus musculus'        10090 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H9GIV0_ANOCA H9GIV0 ? 1 KKRQRFVDKNGRCNVQHGNLGSE 34  
2 UNP KCNJ3_MOUSE  P63250 ? 1 
;RAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLT
ICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATF
EVPTPPYSVKEQEEMLLMSSP
;
190 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5UM4 A 7  ? 29  ? H9GIV0 34  ? 56  ? 41  63  
2 2 5UM4 A 30 ? 210 ? P63250 190 ? 370 ? 190 370 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5UM4 GLY A 1  ? UNP H9GIV0 ?   ?   'expression tag'      35  1 
1 5UM4 PRO A 2  ? UNP H9GIV0 ?   ?   'expression tag'      36  2 
1 5UM4 ASP A 3  ? UNP H9GIV0 ?   ?   'expression tag'      37  3 
1 5UM4 ASP A 4  ? UNP H9GIV0 ?   ?   'expression tag'      38  4 
1 5UM4 HIS A 5  ? UNP H9GIV0 ?   ?   'expression tag'      39  5 
1 5UM4 MET A 6  ? UNP H9GIV0 ?   ?   'expression tag'      40  6 
2 5UM4 ALA A 95 ? UNP P63250 PHE 255 'engineered mutation' 255 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ? 'C4 H7 N O4'     133.103 
CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 
CYS 'L-peptide linking' y CYSTEINE                           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                             ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5UM4 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.84 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.76 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;The protein was concentrated to 10 mg/mL. Crystals grown by mixing equal amounts of protein and reservoir solution (25 mM Na/K phosphate pH 5.0, 40 mM NaCl, 35 % Peg 400), and allowed to equilibrate over 1 ml of reservoir solution.
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0003 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0003 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            61.610 
_reflns.entry_id                         5UM4 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.987 
_reflns.d_resolution_low                 85.040 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       10030 
_reflns.number_obs                       10030 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.500 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.064 
_reflns.pdbx_netI_over_av_sigmaI         7.500 
_reflns.pdbx_netI_over_sigmaI            21.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.067 
_reflns.pdbx_Rpim_I_all                  0.019 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         125290 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.500 2.640 ? 1.300  ? ? ? ? ? 100.000 ? ? ? ? 0.591 ? ? ? ? ? ? ? ? 13.200 0.591 ? ? ? 0.615 0.169 ? 1  1 ? ? 
2.640 2.800 ? 1.900  ? ? ? ? ? 100.000 ? ? ? ? 0.377 ? ? ? ? ? ? ? ? 13.200 0.377 ? ? ? 0.393 0.108 ? 2  1 ? ? 
2.800 2.990 ? 3.700  ? ? ? ? ? 100.000 ? ? ? ? 0.197 ? ? ? ? ? ? ? ? 13.100 0.197 ? ? ? 0.205 0.056 ? 3  1 ? ? 
2.990 3.230 ? 6.200  ? ? ? ? ? 100.000 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? 12.900 0.113 ? ? ? 0.118 0.033 ? 4  1 ? ? 
3.230 3.540 ? 9.000  ? ? ? ? ? 100.000 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 12.700 0.074 ? ? ? 0.077 0.022 ? 5  1 ? ? 
3.540 3.950 ? 11.000 ? ? ? ? ? 99.600  ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 12.300 0.055 ? ? ? 0.057 0.016 ? 6  1 ? ? 
3.950 4.560 ? 10.300 ? ? ? ? ? 99.600  ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 11.700 0.052 ? ? ? 0.054 0.016 ? 7  1 ? ? 
4.560 5.590 ? 10.200 ? ? ? ? ? 99.900  ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 11.000 0.056 ? ? ? 0.059 0.017 ? 8  1 ? ? 
5.590 7.910 ? 15.400 ? ? ? ? ? 100.000 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 11.600 0.040 ? ? ? 0.042 0.012 ? 9  1 ? ? 
2.5   2.64  ? 3.5    ? ? ? ? ? 89.900  ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 10.100 0.028 ? ? ? 0.030 0.009 ? 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                115.350 
_refine.B_iso_mean                               67.2839 
_refine.B_iso_min                                39.220 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5UM4 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.5000 
_refine.ls_d_res_low                             85.0400 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     17623 
_refine.ls_number_reflns_R_free                  888 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.2800 
_refine.ls_percent_reflns_R_free                 5.0400 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2263 
_refine.ls_R_factor_R_free                       0.2667 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2241 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.130 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1N9P 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 35.1300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4400 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.5000 
_refine_hist.d_res_low                        85.0400 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             27 
_refine_hist.number_atoms_total               1571 
_refine_hist.pdbx_number_residues_total       197 
_refine_hist.pdbx_B_iso_mean_solvent          62.61 
_refine_hist.pdbx_number_atoms_protein        1544 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 1581 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.137 ? 2138 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.060 ? 244  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006 ? 276  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 3.213 ? 1320 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5002 2.6568  2965 . 142 2823 97.0000 . . . 0.5106 0.0000 0.3724 . . . . . . 6 . . . 
'X-RAY DIFFRACTION' 2.6568 2.8620  2883 . 136 2747 95.0000 . . . 0.3422 0.0000 0.3306 . . . . . . 6 . . . 
'X-RAY DIFFRACTION' 2.8620 3.1500  2841 . 154 2687 93.0000 . . . 0.3180 0.0000 0.2785 . . . . . . 6 . . . 
'X-RAY DIFFRACTION' 3.1500 3.6058  2952 . 167 2785 98.0000 . . . 0.3030 0.0000 0.2385 . . . . . . 6 . . . 
'X-RAY DIFFRACTION' 3.6058 4.5429  3013 . 148 2865 98.0000 . . . 0.2161 0.0000 0.1798 . . . . . . 6 . . . 
'X-RAY DIFFRACTION' 4.5429 85.0892 2969 . 141 2828 97.0000 . . . 0.2298 0.0000 0.2048 . . . . . . 6 . . . 
# 
_struct.entry_id                     5UM4 
_struct.title                        'Crystal structure of the F255A mutant Kir3.1 cytoplasmic pore domain' 
_struct.pdbx_descriptor              'G protein-activated inward rectifier potassium channel 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5UM4 
_struct_keywords.text            'inward-rectifier K(+) channel, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLY A 94  ? GLY A 98  ? GLY A 254 GLY A 258 5 ? 5  
HELX_P HELX_P2 AA2 ARG A 126 ? GLU A 131 ? ARG A 286 GLU A 291 5 ? 6  
HELX_P HELX_P3 AA3 ASP A 181 ? PHE A 185 ? ASP A 341 PHE A 345 5 ? 5  
HELX_P HELX_P4 AA4 SER A 197 ? SER A 208 ? SER A 357 SER A 368 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A ARG 18  C ? ? ? 1_555 A CME 19  N ? ? A ARG 52  A CME 53  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale both ? A CME 19  C ? ? ? 1_555 A ASN 20  N ? ? A CME 53  A ASN 54  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale3 covale both ? A THR 149 C ? ? ? 1_555 A CME 150 N ? ? A THR 309 A CME 310 1_555 ? ? ? ? ? ? ? 1.315 ? 
covale4 covale both ? A CME 150 C ? ? ? 1_555 A GLN 151 N ? ? A CME 310 A GLN 311 1_555 ? ? ? ? ? ? ? 1.310 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 108 ? VAL A 113 ? LEU A 268 VAL A 273 
AA1 2 LYS A 48  ? VAL A 55  ? LYS A 208 VAL A 215 
AA1 3 ALA A 40  ? ARG A 45  ? ALA A 200 ARG A 205 
AA1 4 VAL A 161 ? TRP A 163 ? VAL A 321 TRP A 323 
AA2 1 PHE A 83  ? LEU A 91  ? PHE A 243 LEU A 251 
AA2 2 MET A 63  ? GLN A 77  ? MET A 223 GLN A 237 
AA2 3 GLN A 101 ? PHE A 103 ? GLN A 261 PHE A 263 
AA3 1 PHE A 83  ? LEU A 91  ? PHE A 243 LEU A 251 
AA3 2 MET A 63  ? GLN A 77  ? MET A 223 GLN A 237 
AA3 3 GLU A 134 ? VAL A 143 ? GLU A 294 VAL A 303 
AA3 4 THR A 149 ? THR A 157 ? THR A 309 THR A 317 
AA4 1 HIS A 165 ? PHE A 167 ? HIS A 325 PHE A 327 
AA4 2 THR A 188 ? GLU A 190 ? THR A 348 GLU A 350 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LEU A 108 ? O LEU A 268 N VAL A 55  ? N VAL A 215 
AA1 2 3 O MET A 52  ? O MET A 212 N VAL A 41  ? N VAL A 201 
AA1 3 4 N ALA A 40  ? N ALA A 200 O LEU A 162 ? O LEU A 322 
AA2 1 2 O LEU A 84  ? O LEU A 244 N ARG A 76  ? N ARG A 236 
AA2 2 3 N ALA A 66  ? N ALA A 226 O LEU A 102 ? O LEU A 262 
AA3 1 2 O LEU A 84  ? O LEU A 244 N ARG A 76  ? N ARG A 236 
AA3 2 3 N LEU A 73  ? N LEU A 233 O GLU A 134 ? O GLU A 294 
AA3 3 4 N VAL A 135 ? N VAL A 295 O TYR A 156 ? O TYR A 316 
AA4 1 2 N ARG A 166 ? N ARG A 326 O PHE A 189 ? O PHE A 349 
# 
_atom_sites.entry_id                    5UM4 
_atom_sites.fract_transf_matrix[1][1]   0.012489 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012489 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011759 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 9   ? 29.168 20.812 28.671  1.00 92.99  ? 43  ARG A N   1 
ATOM   2    C CA  . ARG A 1 9   ? 29.979 20.712 29.890  1.00 95.75  ? 43  ARG A CA  1 
ATOM   3    C C   . ARG A 1 9   ? 29.124 20.556 31.162  1.00 93.42  ? 43  ARG A C   1 
ATOM   4    O O   . ARG A 1 9   ? 28.735 19.442 31.530  1.00 87.88  ? 43  ARG A O   1 
ATOM   5    C CB  . ARG A 1 9   ? 30.885 21.942 30.022  1.00 92.82  ? 43  ARG A CB  1 
ATOM   6    N N   . GLN A 1 10  ? 28.857 21.681 31.830  1.00 89.45  ? 44  GLN A N   1 
ATOM   7    C CA  . GLN A 1 10  ? 27.913 21.772 32.936  1.00 83.75  ? 44  GLN A CA  1 
ATOM   8    C C   . GLN A 1 10  ? 26.725 22.639 32.524  1.00 77.08  ? 44  GLN A C   1 
ATOM   9    O O   . GLN A 1 10  ? 26.859 23.553 31.710  1.00 79.49  ? 44  GLN A O   1 
ATOM   10   C CB  . GLN A 1 10  ? 28.581 22.359 34.188  1.00 78.86  ? 44  GLN A CB  1 
ATOM   11   N N   . ARG A 1 11  ? 25.556 22.346 33.085  1.00 78.63  ? 45  ARG A N   1 
ATOM   12   C CA  . ARG A 1 11  ? 24.374 23.143 32.785  1.00 70.49  ? 45  ARG A CA  1 
ATOM   13   C C   . ARG A 1 11  ? 24.546 24.582 33.227  1.00 69.51  ? 45  ARG A C   1 
ATOM   14   O O   . ARG A 1 11  ? 25.312 24.885 34.142  1.00 76.54  ? 45  ARG A O   1 
ATOM   15   C CB  . ARG A 1 11  ? 23.159 22.609 33.511  1.00 65.93  ? 45  ARG A CB  1 
ATOM   16   C CG  . ARG A 1 11  ? 23.163 21.173 33.686  1.00 62.68  ? 45  ARG A CG  1 
ATOM   17   C CD  . ARG A 1 11  ? 21.924 20.799 34.349  1.00 60.89  ? 45  ARG A CD  1 
ATOM   18   N NE  . ARG A 1 11  ? 21.517 19.511 33.853  1.00 66.58  ? 45  ARG A NE  1 
ATOM   19   C CZ  . ARG A 1 11  ? 20.715 19.320 32.822  1.00 58.05  ? 45  ARG A CZ  1 
ATOM   20   N NH1 . ARG A 1 11  ? 20.186 20.338 32.177  1.00 64.24  ? 45  ARG A NH1 1 
ATOM   21   N NH2 . ARG A 1 11  ? 20.423 18.090 32.464  1.00 63.79  ? 45  ARG A NH2 1 
ATOM   22   N N   . PHE A 1 12  ? 23.792 25.471 32.588  1.00 66.90  ? 46  PHE A N   1 
ATOM   23   C CA  . PHE A 1 12  ? 23.517 26.787 33.138  1.00 68.85  ? 46  PHE A CA  1 
ATOM   24   C C   . PHE A 1 12  ? 22.405 26.726 34.158  1.00 70.16  ? 46  PHE A C   1 
ATOM   25   O O   . PHE A 1 12  ? 22.353 27.571 35.056  1.00 78.00  ? 46  PHE A O   1 
ATOM   26   C CB  . PHE A 1 12  ? 23.135 27.784 32.050  1.00 65.41  ? 46  PHE A CB  1 
ATOM   27   C CG  . PHE A 1 12  ? 23.888 27.593 30.751  1.00 80.70  ? 46  PHE A CG  1 
ATOM   28   C CD1 . PHE A 1 12  ? 25.099 28.244 30.524  1.00 78.95  ? 46  PHE A CD1 1 
ATOM   29   C CD2 . PHE A 1 12  ? 23.374 26.766 29.745  1.00 78.13  ? 46  PHE A CD2 1 
ATOM   30   C CE1 . PHE A 1 12  ? 25.781 28.072 29.320  1.00 83.07  ? 46  PHE A CE1 1 
ATOM   31   C CE2 . PHE A 1 12  ? 24.057 26.580 28.539  1.00 76.36  ? 46  PHE A CE2 1 
ATOM   32   C CZ  . PHE A 1 12  ? 25.262 27.236 28.327  1.00 84.08  ? 46  PHE A CZ  1 
ATOM   33   N N   . VAL A 1 13  ? 21.491 25.781 33.982  1.00 61.47  ? 47  VAL A N   1 
ATOM   34   C CA  . VAL A 1 13  ? 20.327 25.662 34.844  1.00 62.61  ? 47  VAL A CA  1 
ATOM   35   C C   . VAL A 1 13  ? 20.175 24.198 35.213  1.00 62.44  ? 47  VAL A C   1 
ATOM   36   O O   . VAL A 1 13  ? 20.162 23.330 34.336  1.00 60.30  ? 47  VAL A O   1 
ATOM   37   C CB  . VAL A 1 13  ? 19.057 26.203 34.157  1.00 61.88  ? 47  VAL A CB  1 
ATOM   38   C CG1 . VAL A 1 13  ? 17.849 26.118 35.080  1.00 58.18  ? 47  VAL A CG1 1 
ATOM   39   C CG2 . VAL A 1 13  ? 19.282 27.641 33.719  1.00 60.22  ? 47  VAL A CG2 1 
ATOM   40   N N   . ASP A 1 14  ? 20.086 23.924 36.512  1.00 64.58  ? 48  ASP A N   1 
ATOM   41   C CA  . ASP A 1 14  ? 19.863 22.576 37.003  1.00 67.36  ? 48  ASP A CA  1 
ATOM   42   C C   . ASP A 1 14  ? 18.438 22.125 36.706  1.00 65.11  ? 48  ASP A C   1 
ATOM   43   O O   . ASP A 1 14  ? 17.533 22.933 36.520  1.00 62.96  ? 48  ASP A O   1 
ATOM   44   C CB  . ASP A 1 14  ? 20.102 22.508 38.508  1.00 74.11  ? 48  ASP A CB  1 
ATOM   45   C CG  . ASP A 1 14  ? 21.467 21.977 38.853  1.00 77.77  ? 48  ASP A CG  1 
ATOM   46   O OD1 . ASP A 1 14  ? 22.068 21.280 38.001  1.00 80.93  ? 48  ASP A OD1 1 
ATOM   47   O OD2 . ASP A 1 14  ? 21.931 22.258 39.979  1.00 81.08  ? 48  ASP A OD2 1 
ATOM   48   N N   . LYS A 1 15  ? 18.237 20.807 36.685  1.00 67.39  ? 49  LYS A N   1 
ATOM   49   C CA  . LYS A 1 15  ? 16.885 20.291 36.514  1.00 62.53  ? 49  LYS A CA  1 
ATOM   50   C C   . LYS A 1 15  ? 15.984 20.705 37.664  1.00 63.89  ? 49  LYS A C   1 
ATOM   51   O O   . LYS A 1 15  ? 14.763 20.756 37.491  1.00 66.68  ? 49  LYS A O   1 
ATOM   52   C CB  . LYS A 1 15  ? 16.902 18.764 36.365  1.00 65.54  ? 49  LYS A CB  1 
ATOM   53   C CG  . LYS A 1 15  ? 17.800 18.249 35.223  1.00 58.82  ? 49  LYS A CG  1 
ATOM   54   C CD  . LYS A 1 15  ? 17.234 16.982 34.610  1.00 55.23  ? 49  LYS A CD  1 
ATOM   55   C CE  . LYS A 1 15  ? 17.202 17.100 33.106  1.00 66.32  ? 49  LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 15  ? 15.984 17.731 32.523  1.00 66.18  ? 49  LYS A NZ  1 
ATOM   57   N N   . ASN A 1 16  ? 16.569 20.985 38.834  1.00 72.76  ? 50  ASN A N   1 
ATOM   58   C CA  . ASN A 1 16  ? 15.879 21.664 39.932  1.00 71.55  ? 50  ASN A CA  1 
ATOM   59   C C   . ASN A 1 16  ? 15.262 22.978 39.474  1.00 68.50  ? 50  ASN A C   1 
ATOM   60   O O   . ASN A 1 16  ? 14.249 23.417 40.032  1.00 65.47  ? 50  ASN A O   1 
ATOM   61   C CB  . ASN A 1 16  ? 16.879 21.945 41.065  1.00 65.52  ? 50  ASN A CB  1 
ATOM   62   C CG  . ASN A 1 16  ? 16.424 21.409 42.414  1.00 88.72  ? 50  ASN A CG  1 
ATOM   63   O OD1 . ASN A 1 16  ? 15.314 21.694 42.884  1.00 98.45  ? 50  ASN A OD1 1 
ATOM   64   N ND2 . ASN A 1 16  ? 17.288 20.616 43.047  1.00 94.31  ? 50  ASN A ND2 1 
ATOM   65   N N   . GLY A 1 17  ? 15.880 23.625 38.480  1.00 63.55  ? 51  GLY A N   1 
ATOM   66   C CA  . GLY A 1 17  ? 15.635 25.018 38.177  1.00 60.08  ? 51  GLY A CA  1 
ATOM   67   C C   . GLY A 1 17  ? 16.617 25.976 38.815  1.00 65.14  ? 51  GLY A C   1 
ATOM   68   O O   . GLY A 1 17  ? 16.494 27.193 38.611  1.00 61.62  ? 51  GLY A O   1 
ATOM   69   N N   . ARG A 1 18  ? 17.569 25.467 39.594  1.00 66.68  ? 52  ARG A N   1 
ATOM   70   C CA  . ARG A 1 18  ? 18.605 26.274 40.219  1.00 66.13  ? 52  ARG A CA  1 
ATOM   71   C C   . ARG A 1 18  ? 19.626 26.718 39.180  1.00 63.56  ? 52  ARG A C   1 
ATOM   72   O O   . ARG A 1 18  ? 20.163 25.898 38.436  1.00 64.49  ? 52  ARG A O   1 
ATOM   73   C CB  . ARG A 1 18  ? 19.294 25.485 41.355  1.00 62.35  ? 52  ARG A CB  1 
HETATM 74   N N   . CME A 1 19  ? 19.882 28.022 39.144  1.00 64.48  ? 53  CME A N   1 
HETATM 75   C CA  . CME A 1 19  ? 20.834 28.628 38.242  1.00 68.42  ? 53  CME A CA  1 
HETATM 76   C CB  . CME A 1 19  ? 20.591 30.131 38.066  1.00 73.62  ? 53  CME A CB  1 
HETATM 77   S SG  . CME A 1 19  ? 19.237 30.487 36.996  1.00 86.22  ? 53  CME A SG  1 
HETATM 78   S SD  . CME A 1 19  ? 17.470 30.326 38.117  1.00 87.52  ? 53  CME A SD  1 
HETATM 79   C CE  . CME A 1 19  ? 16.773 31.944 38.139  1.00 84.03  ? 53  CME A CE  1 
HETATM 80   C CZ  . CME A 1 19  ? 17.727 33.008 38.642  1.00 83.11  ? 53  CME A CZ  1 
HETATM 81   O OH  . CME A 1 19  ? 18.704 33.159 37.625  1.00 80.18  ? 53  CME A OH  1 
HETATM 82   C C   . CME A 1 19  ? 22.244 28.397 38.768  1.00 72.70  ? 53  CME A C   1 
HETATM 83   O O   . CME A 1 19  ? 22.557 28.562 39.944  1.00 78.12  ? 53  CME A O   1 
ATOM   84   N N   . ASN A 1 20  ? 23.132 28.016 37.858  1.00 71.68  ? 54  ASN A N   1 
ATOM   85   C CA  . ASN A 1 20  ? 24.440 27.503 38.244  1.00 74.49  ? 54  ASN A CA  1 
ATOM   86   C C   . ASN A 1 20  ? 25.565 28.496 38.101  1.00 78.32  ? 54  ASN A C   1 
ATOM   87   O O   . ASN A 1 20  ? 26.666 28.249 38.578  1.00 93.00  ? 54  ASN A O   1 
ATOM   88   C CB  . ASN A 1 20  ? 24.787 26.265 37.423  1.00 73.26  ? 54  ASN A CB  1 
ATOM   89   C CG  . ASN A 1 20  ? 23.919 25.090 37.776  1.00 76.60  ? 54  ASN A CG  1 
ATOM   90   O OD1 . ASN A 1 20  ? 23.484 24.955 38.919  1.00 77.11  ? 54  ASN A OD1 1 
ATOM   91   N ND2 . ASN A 1 20  ? 23.635 24.244 36.794  1.00 75.18  ? 54  ASN A ND2 1 
ATOM   92   N N   . VAL A 1 21  ? 25.317 29.615 37.431  1.00 85.08  ? 55  VAL A N   1 
ATOM   93   C CA  . VAL A 1 21  ? 26.385 30.595 37.280  1.00 95.13  ? 55  VAL A CA  1 
ATOM   94   C C   . VAL A 1 21  ? 26.544 31.349 38.597  1.00 91.43  ? 55  VAL A C   1 
ATOM   95   O O   . VAL A 1 21  ? 25.559 31.763 39.220  1.00 90.27  ? 55  VAL A O   1 
ATOM   96   C CB  . VAL A 1 21  ? 26.101 31.543 36.099  1.00 88.42  ? 55  VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 21  ? 27.122 32.651 36.065  1.00 86.23  ? 55  VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 21  ? 26.101 30.789 34.756  1.00 77.46  ? 55  VAL A CG2 1 
ATOM   99   N N   . GLN A 1 22  ? 27.790 31.504 39.033  1.00 92.04  ? 56  GLN A N   1 
ATOM   100  C CA  . GLN A 1 22  ? 28.112 32.244 40.242  1.00 95.97  ? 56  GLN A CA  1 
ATOM   101  C C   . GLN A 1 22  ? 28.650 33.621 39.873  1.00 97.52  ? 56  GLN A C   1 
ATOM   102  O O   . GLN A 1 22  ? 29.375 33.764 38.887  1.00 95.13  ? 56  GLN A O   1 
ATOM   103  C CB  . GLN A 1 22  ? 29.140 31.482 41.083  1.00 99.85  ? 56  GLN A CB  1 
ATOM   104  N N   . HIS A 1 23  ? 28.277 34.635 40.654  1.00 104.12 ? 57  HIS A N   1 
ATOM   105  C CA  . HIS A 1 23  ? 28.821 35.974 40.461  1.00 95.53  ? 57  HIS A CA  1 
ATOM   106  C C   . HIS A 1 23  ? 30.291 36.010 40.886  1.00 95.13  ? 57  HIS A C   1 
ATOM   107  O O   . HIS A 1 23  ? 30.825 35.055 41.458  1.00 102.91 ? 57  HIS A O   1 
ATOM   108  C CB  . HIS A 1 23  ? 28.007 36.998 41.252  1.00 97.25  ? 57  HIS A CB  1 
ATOM   109  C CG  . HIS A 1 23  ? 27.981 36.730 42.725  1.00 106.79 ? 57  HIS A CG  1 
ATOM   110  N ND1 . HIS A 1 23  ? 29.089 36.886 43.532  1.00 113.28 ? 57  HIS A ND1 1 
ATOM   111  C CD2 . HIS A 1 23  ? 26.987 36.295 43.535  1.00 115.35 ? 57  HIS A CD2 1 
ATOM   112  C CE1 . HIS A 1 23  ? 28.778 36.564 44.776  1.00 112.13 ? 57  HIS A CE1 1 
ATOM   113  N NE2 . HIS A 1 23  ? 27.507 36.206 44.806  1.00 115.14 ? 57  HIS A NE2 1 
ATOM   114  N N   . GLY A 1 24  ? 30.954 37.128 40.607  1.00 95.71  ? 58  GLY A N   1 
ATOM   115  C CA  . GLY A 1 24  ? 32.319 37.290 41.072  1.00 101.33 ? 58  GLY A CA  1 
ATOM   116  C C   . GLY A 1 24  ? 32.365 37.743 42.518  1.00 107.23 ? 58  GLY A C   1 
ATOM   117  O O   . GLY A 1 24  ? 31.865 37.052 43.413  1.00 104.68 ? 58  GLY A O   1 
ATOM   118  N N   . ASN A 1 25  ? 32.976 38.896 42.766  1.00 108.85 ? 59  ASN A N   1 
ATOM   119  C CA  . ASN A 1 25  ? 32.842 39.600 44.033  1.00 110.86 ? 59  ASN A CA  1 
ATOM   120  C C   . ASN A 1 25  ? 32.233 40.964 43.741  1.00 110.97 ? 59  ASN A C   1 
ATOM   121  O O   . ASN A 1 25  ? 32.544 41.587 42.718  1.00 106.45 ? 59  ASN A O   1 
ATOM   122  C CB  . ASN A 1 25  ? 34.188 39.745 44.761  1.00 109.77 ? 59  ASN A CB  1 
ATOM   123  N N   . LEU A 1 26  ? 31.347 41.416 44.626  1.00 106.94 ? 60  LEU A N   1 
ATOM   124  C CA  . LEU A 1 26  ? 30.509 42.572 44.342  1.00 107.57 ? 60  LEU A CA  1 
ATOM   125  C C   . LEU A 1 26  ? 30.989 43.848 45.016  1.00 106.20 ? 60  LEU A C   1 
ATOM   126  O O   . LEU A 1 26  ? 30.358 44.897 44.844  1.00 106.03 ? 60  LEU A O   1 
ATOM   127  C CB  . LEU A 1 26  ? 29.063 42.293 44.765  1.00 104.85 ? 60  LEU A CB  1 
ATOM   128  C CG  . LEU A 1 26  ? 28.296 41.202 44.012  1.00 107.92 ? 60  LEU A CG  1 
ATOM   129  C CD1 . LEU A 1 26  ? 28.662 41.175 42.529  1.00 99.68  ? 60  LEU A CD1 1 
ATOM   130  C CD2 . LEU A 1 26  ? 28.511 39.846 44.665  1.00 109.29 ? 60  LEU A CD2 1 
ATOM   131  N N   . GLY A 1 27  ? 32.076 43.791 45.774  1.00 98.21  ? 61  GLY A N   1 
ATOM   132  C CA  . GLY A 1 27  ? 32.430 44.901 46.630  1.00 91.93  ? 61  GLY A CA  1 
ATOM   133  C C   . GLY A 1 27  ? 31.449 45.013 47.788  1.00 92.15  ? 61  GLY A C   1 
ATOM   134  O O   . GLY A 1 27  ? 30.524 44.219 47.953  1.00 90.75  ? 61  GLY A O   1 
ATOM   135  N N   . SER A 1 28  ? 31.672 46.031 48.608  1.00 88.71  ? 62  SER A N   1 
ATOM   136  C CA  . SER A 1 28  ? 30.820 46.301 49.756  1.00 83.66  ? 62  SER A CA  1 
ATOM   137  C C   . SER A 1 28  ? 29.589 47.130 49.404  1.00 87.17  ? 62  SER A C   1 
ATOM   138  O O   . SER A 1 28  ? 28.716 47.304 50.263  1.00 85.16  ? 62  SER A O   1 
ATOM   139  C CB  . SER A 1 28  ? 31.629 47.008 50.856  1.00 75.95  ? 62  SER A CB  1 
ATOM   140  O OG  . SER A 1 28  ? 32.399 48.084 50.335  1.00 72.20  ? 62  SER A OG  1 
ATOM   141  N N   . GLU A 1 29  ? 29.496 47.634 48.170  1.00 84.51  ? 63  GLU A N   1 
ATOM   142  C CA  . GLU A 1 29  ? 28.384 48.488 47.769  1.00 81.89  ? 63  GLU A CA  1 
ATOM   143  C C   . GLU A 1 29  ? 27.057 47.775 48.003  1.00 81.09  ? 63  GLU A C   1 
ATOM   144  O O   . GLU A 1 29  ? 26.836 46.675 47.483  1.00 82.87  ? 63  GLU A O   1 
ATOM   145  C CB  . GLU A 1 29  ? 28.537 48.873 46.294  1.00 84.33  ? 63  GLU A CB  1 
ATOM   146  C CG  . GLU A 1 29  ? 29.993 49.058 45.877  1.00 90.97  ? 63  GLU A CG  1 
ATOM   147  C CD  . GLU A 1 29  ? 30.157 49.395 44.409  1.00 98.63  ? 63  GLU A CD  1 
ATOM   148  O OE1 . GLU A 1 29  ? 29.144 49.377 43.677  1.00 94.32  ? 63  GLU A OE1 1 
ATOM   149  O OE2 . GLU A 1 29  ? 31.302 49.691 43.993  1.00 98.69  ? 63  GLU A OE2 1 
ATOM   150  N N   . ARG A 1 30  ? 26.192 48.386 48.815  1.00 73.28  ? 190 ARG A N   1 
ATOM   151  C CA  . ARG A 1 30  ? 24.808 47.953 48.947  1.00 79.27  ? 190 ARG A CA  1 
ATOM   152  C C   . ARG A 1 30  ? 23.857 48.813 48.121  1.00 82.71  ? 190 ARG A C   1 
ATOM   153  O O   . ARG A 1 30  ? 22.634 48.699 48.279  1.00 87.43  ? 190 ARG A O   1 
ATOM   154  C CB  . ARG A 1 30  ? 24.376 47.950 50.415  1.00 73.57  ? 190 ARG A CB  1 
ATOM   155  N N   . ALA A 1 31  ? 24.393 49.673 47.255  1.00 72.71  ? 191 ALA A N   1 
ATOM   156  C CA  . ALA A 1 31  ? 23.593 50.438 46.311  1.00 74.37  ? 191 ALA A CA  1 
ATOM   157  C C   . ALA A 1 31  ? 23.443 49.659 45.003  1.00 82.68  ? 191 ALA A C   1 
ATOM   158  O O   . ALA A 1 31  ? 24.374 48.972 44.559  1.00 80.72  ? 191 ALA A O   1 
ATOM   159  C CB  . ALA A 1 31  ? 24.229 51.807 46.056  1.00 65.86  ? 191 ALA A CB  1 
ATOM   160  N N   . GLU A 1 32  ? 22.263 49.774 44.387  1.00 76.93  ? 192 GLU A N   1 
ATOM   161  C CA  . GLU A 1 32  ? 21.907 48.961 43.221  1.00 76.44  ? 192 GLU A CA  1 
ATOM   162  C C   . GLU A 1 32  ? 22.632 49.501 41.994  1.00 77.82  ? 192 GLU A C   1 
ATOM   163  O O   . GLU A 1 32  ? 22.122 50.349 41.266  1.00 86.36  ? 192 GLU A O   1 
ATOM   164  C CB  . GLU A 1 32  ? 20.393 48.932 43.025  1.00 69.66  ? 192 GLU A CB  1 
ATOM   165  C CG  . GLU A 1 32  ? 19.580 48.514 44.277  1.00 72.32  ? 192 GLU A CG  1 
ATOM   166  C CD  . GLU A 1 32  ? 19.727 47.020 44.658  1.00 76.39  ? 192 GLU A CD  1 
ATOM   167  O OE1 . GLU A 1 32  ? 18.898 46.510 45.459  1.00 72.18  ? 192 GLU A OE1 1 
ATOM   168  O OE2 . GLU A 1 32  ? 20.666 46.352 44.164  1.00 69.58  ? 192 GLU A OE2 1 
ATOM   169  N N   . THR A 1 33  ? 23.840 48.979 41.758  1.00 74.69  ? 193 THR A N   1 
ATOM   170  C CA  . THR A 1 33  ? 24.739 49.460 40.717  1.00 72.10  ? 193 THR A CA  1 
ATOM   171  C C   . THR A 1 33  ? 24.844 48.531 39.513  1.00 72.18  ? 193 THR A C   1 
ATOM   172  O O   . THR A 1 33  ? 25.191 48.998 38.423  1.00 65.81  ? 193 THR A O   1 
ATOM   173  C CB  . THR A 1 33  ? 26.135 49.690 41.328  1.00 81.45  ? 193 THR A CB  1 
ATOM   174  O OG1 . THR A 1 33  ? 26.152 50.962 41.986  1.00 81.18  ? 193 THR A OG1 1 
ATOM   175  C CG2 . THR A 1 33  ? 27.289 49.602 40.294  1.00 79.70  ? 193 THR A CG2 1 
ATOM   176  N N   . LEU A 1 34  ? 24.522 47.242 39.678  1.00 74.49  ? 194 LEU A N   1 
ATOM   177  C CA  . LEU A 1 34  ? 24.636 46.232 38.633  1.00 67.60  ? 194 LEU A CA  1 
ATOM   178  C C   . LEU A 1 34  ? 23.271 45.758 38.127  1.00 65.81  ? 194 LEU A C   1 
ATOM   179  O O   . LEU A 1 34  ? 23.128 44.625 37.666  1.00 65.94  ? 194 LEU A O   1 
ATOM   180  C CB  . LEU A 1 34  ? 25.468 45.059 39.142  1.00 64.88  ? 194 LEU A CB  1 
ATOM   181  C CG  . LEU A 1 34  ? 26.770 45.534 39.790  1.00 73.55  ? 194 LEU A CG  1 
ATOM   182  C CD1 . LEU A 1 34  ? 27.190 44.589 40.884  1.00 77.04  ? 194 LEU A CD1 1 
ATOM   183  C CD2 . LEU A 1 34  ? 27.883 45.679 38.753  1.00 72.43  ? 194 LEU A CD2 1 
ATOM   184  N N   . MET A 1 35  ? 22.256 46.617 38.207  1.00 63.16  ? 195 MET A N   1 
ATOM   185  C CA  . MET A 1 35  ? 20.965 46.299 37.611  1.00 61.89  ? 195 MET A CA  1 
ATOM   186  C C   . MET A 1 35  ? 20.951 46.621 36.115  1.00 63.13  ? 195 MET A C   1 
ATOM   187  O O   . MET A 1 35  ? 20.588 45.774 35.291  1.00 55.90  ? 195 MET A O   1 
ATOM   188  C CB  . MET A 1 35  ? 19.867 47.069 38.336  1.00 62.68  ? 195 MET A CB  1 
ATOM   189  C CG  . MET A 1 35  ? 18.459 46.805 37.807  1.00 67.46  ? 195 MET A CG  1 
ATOM   190  S SD  . MET A 1 35  ? 17.658 45.293 38.386  1.00 71.01  ? 195 MET A SD  1 
ATOM   191  C CE  . MET A 1 35  ? 17.610 44.320 36.883  1.00 66.34  ? 195 MET A CE  1 
ATOM   192  N N   . PHE A 1 36  ? 21.338 47.846 35.758  1.00 56.85  ? 196 PHE A N   1 
ATOM   193  C CA  . PHE A 1 36  ? 21.509 48.287 34.386  1.00 55.85  ? 196 PHE A CA  1 
ATOM   194  C C   . PHE A 1 36  ? 22.931 48.796 34.193  1.00 59.39  ? 196 PHE A C   1 
ATOM   195  O O   . PHE A 1 36  ? 23.576 49.256 35.136  1.00 63.75  ? 196 PHE A O   1 
ATOM   196  C CB  . PHE A 1 36  ? 20.521 49.411 34.015  1.00 56.13  ? 196 PHE A CB  1 
ATOM   197  C CG  . PHE A 1 36  ? 19.093 49.121 34.384  1.00 55.93  ? 196 PHE A CG  1 
ATOM   198  C CD1 . PHE A 1 36  ? 18.333 48.235 33.639  1.00 52.88  ? 196 PHE A CD1 1 
ATOM   199  C CD2 . PHE A 1 36  ? 18.506 49.739 35.471  1.00 54.08  ? 196 PHE A CD2 1 
ATOM   200  C CE1 . PHE A 1 36  ? 17.012 47.975 33.986  1.00 49.88  ? 196 PHE A CE1 1 
ATOM   201  C CE2 . PHE A 1 36  ? 17.191 49.487 35.809  1.00 54.14  ? 196 PHE A CE2 1 
ATOM   202  C CZ  . PHE A 1 36  ? 16.448 48.604 35.066  1.00 51.34  ? 196 PHE A CZ  1 
ATOM   203  N N   . SER A 1 37  ? 23.421 48.704 32.966  1.00 53.68  ? 197 SER A N   1 
ATOM   204  C CA  . SER A 1 37  ? 24.698 49.312 32.645  1.00 59.10  ? 197 SER A CA  1 
ATOM   205  C C   . SER A 1 37  ? 24.581 50.835 32.667  1.00 62.25  ? 197 SER A C   1 
ATOM   206  O O   . SER A 1 37  ? 23.499 51.411 32.495  1.00 59.60  ? 197 SER A O   1 
ATOM   207  C CB  . SER A 1 37  ? 25.183 48.835 31.277  1.00 57.37  ? 197 SER A CB  1 
ATOM   208  O OG  . SER A 1 37  ? 24.386 49.384 30.243  1.00 52.99  ? 197 SER A OG  1 
ATOM   209  N N   . GLU A 1 38  ? 25.714 51.496 32.883  1.00 61.93  ? 198 GLU A N   1 
ATOM   210  C CA  . GLU A 1 38  ? 25.691 52.953 32.893  1.00 63.62  ? 198 GLU A CA  1 
ATOM   211  C C   . GLU A 1 38  ? 25.500 53.526 31.497  1.00 58.35  ? 198 GLU A C   1 
ATOM   212  O O   . GLU A 1 38  ? 24.900 54.596 31.357  1.00 60.31  ? 198 GLU A O   1 
ATOM   213  C CB  . GLU A 1 38  ? 26.966 53.499 33.527  1.00 59.12  ? 198 GLU A CB  1 
ATOM   214  C CG  . GLU A 1 38  ? 26.791 53.863 34.967  1.00 70.08  ? 198 GLU A CG  1 
ATOM   215  C CD  . GLU A 1 38  ? 28.076 53.783 35.735  1.00 76.03  ? 198 GLU A CD  1 
ATOM   216  O OE1 . GLU A 1 38  ? 29.134 54.078 35.136  1.00 70.23  ? 198 GLU A OE1 1 
ATOM   217  O OE2 . GLU A 1 38  ? 28.026 53.400 36.931  1.00 81.86  ? 198 GLU A OE2 1 
ATOM   218  N N   . HIS A 1 39  ? 25.991 52.848 30.462  1.00 53.65  ? 199 HIS A N   1 
ATOM   219  C CA  . HIS A 1 39  ? 25.870 53.352 29.103  1.00 59.22  ? 199 HIS A CA  1 
ATOM   220  C C   . HIS A 1 39  ? 25.104 52.368 28.226  1.00 57.60  ? 199 HIS A C   1 
ATOM   221  O O   . HIS A 1 39  ? 25.098 51.159 28.473  1.00 52.95  ? 199 HIS A O   1 
ATOM   222  C CB  . HIS A 1 39  ? 27.244 53.613 28.477  1.00 57.55  ? 199 HIS A CB  1 
ATOM   223  C CG  . HIS A 1 39  ? 28.045 54.643 29.200  1.00 65.15  ? 199 HIS A CG  1 
ATOM   224  N ND1 . HIS A 1 39  ? 29.393 54.496 29.449  1.00 71.40  ? 199 HIS A ND1 1 
ATOM   225  C CD2 . HIS A 1 39  ? 27.691 55.836 29.735  1.00 68.71  ? 199 HIS A CD2 1 
ATOM   226  C CE1 . HIS A 1 39  ? 29.834 55.555 30.108  1.00 72.08  ? 199 HIS A CE1 1 
ATOM   227  N NE2 . HIS A 1 39  ? 28.822 56.383 30.292  1.00 71.58  ? 199 HIS A NE2 1 
ATOM   228  N N   . ALA A 1 40  ? 24.462 52.910 27.196  1.00 61.45  ? 200 ALA A N   1 
ATOM   229  C CA  . ALA A 1 40  ? 23.953 52.150 26.062  1.00 56.74  ? 200 ALA A CA  1 
ATOM   230  C C   . ALA A 1 40  ? 24.941 52.230 24.909  1.00 56.46  ? 200 ALA A C   1 
ATOM   231  O O   . ALA A 1 40  ? 25.856 53.058 24.899  1.00 58.65  ? 200 ALA A O   1 
ATOM   232  C CB  . ALA A 1 40  ? 22.587 52.674 25.603  1.00 52.44  ? 200 ALA A CB  1 
ATOM   233  N N   . VAL A 1 41  ? 24.752 51.353 23.926  1.00 54.12  ? 201 VAL A N   1 
ATOM   234  C CA  . VAL A 1 41  ? 25.539 51.404 22.700  1.00 53.92  ? 201 VAL A CA  1 
ATOM   235  C C   . VAL A 1 41  ? 24.632 51.150 21.502  1.00 54.53  ? 201 VAL A C   1 
ATOM   236  O O   . VAL A 1 41  ? 23.492 50.693 21.626  1.00 49.50  ? 201 VAL A O   1 
ATOM   237  C CB  . VAL A 1 41  ? 26.719 50.397 22.694  1.00 54.80  ? 201 VAL A CB  1 
ATOM   238  C CG1 . VAL A 1 41  ? 27.550 50.521 23.970  1.00 55.67  ? 201 VAL A CG1 1 
ATOM   239  C CG2 . VAL A 1 41  ? 26.218 48.979 22.527  1.00 45.63  ? 201 VAL A CG2 1 
ATOM   240  N N   . ILE A 1 42  ? 25.173 51.472 20.329  1.00 54.21  ? 202 ILE A N   1 
ATOM   241  C CA  . ILE A 1 42  ? 24.553 51.245 19.038  1.00 45.18  ? 202 ILE A CA  1 
ATOM   242  C C   . ILE A 1 42  ? 25.640 50.740 18.104  1.00 53.58  ? 202 ILE A C   1 
ATOM   243  O O   . ILE A 1 42  ? 26.637 51.434 17.883  1.00 58.62  ? 202 ILE A O   1 
ATOM   244  C CB  . ILE A 1 42  ? 23.921 52.525 18.480  1.00 52.44  ? 202 ILE A CB  1 
ATOM   245  C CG1 . ILE A 1 42  ? 22.808 53.021 19.413  1.00 48.27  ? 202 ILE A CG1 1 
ATOM   246  C CG2 . ILE A 1 42  ? 23.414 52.291 17.073  1.00 55.02  ? 202 ILE A CG2 1 
ATOM   247  C CD1 . ILE A 1 42  ? 22.077 54.226 18.897  1.00 40.91  ? 202 ILE A CD1 1 
ATOM   248  N N   . SER A 1 43  ? 25.469 49.531 17.580  1.00 57.97  ? 203 SER A N   1 
ATOM   249  C CA  . SER A 1 43  ? 26.428 48.902 16.677  1.00 53.04  ? 203 SER A CA  1 
ATOM   250  C C   . SER A 1 43  ? 25.782 47.630 16.153  1.00 57.71  ? 203 SER A C   1 
ATOM   251  O O   . SER A 1 43  ? 24.694 47.240 16.586  1.00 64.21  ? 203 SER A O   1 
ATOM   252  C CB  . SER A 1 43  ? 27.750 48.588 17.362  1.00 56.04  ? 203 SER A CB  1 
ATOM   253  O OG  . SER A 1 43  ? 27.524 47.873 18.567  1.00 65.35  ? 203 SER A OG  1 
ATOM   254  N N   . MET A 1 44  ? 26.464 46.985 15.219  1.00 60.26  ? 204 MET A N   1 
ATOM   255  C CA  . MET A 1 44  ? 25.834 45.939 14.427  1.00 61.49  ? 204 MET A CA  1 
ATOM   256  C C   . MET A 1 44  ? 25.830 44.633 15.194  1.00 62.37  ? 204 MET A C   1 
ATOM   257  O O   . MET A 1 44  ? 26.859 44.220 15.738  1.00 62.90  ? 204 MET A O   1 
ATOM   258  C CB  . MET A 1 44  ? 26.565 45.753 13.097  1.00 56.14  ? 204 MET A CB  1 
ATOM   259  C CG  . MET A 1 44  ? 26.718 47.027 12.298  1.00 56.38  ? 204 MET A CG  1 
ATOM   260  S SD  . MET A 1 44  ? 25.136 47.651 11.733  1.00 59.86  ? 204 MET A SD  1 
ATOM   261  C CE  . MET A 1 44  ? 24.600 46.286 10.721  1.00 52.92  ? 204 MET A CE  1 
ATOM   262  N N   . ARG A 1 45  ? 24.671 43.983 15.229  1.00 61.91  ? 205 ARG A N   1 
ATOM   263  C CA  . ARG A 1 45  ? 24.563 42.616 15.716  1.00 63.90  ? 205 ARG A CA  1 
ATOM   264  C C   . ARG A 1 45  ? 23.597 41.874 14.811  1.00 60.05  ? 205 ARG A C   1 
ATOM   265  O O   . ARG A 1 45  ? 22.553 42.417 14.440  1.00 62.01  ? 205 ARG A O   1 
ATOM   266  C CB  . ARG A 1 45  ? 24.076 42.532 17.182  1.00 64.59  ? 205 ARG A CB  1 
ATOM   267  C CG  . ARG A 1 45  ? 23.805 41.093 17.646  1.00 62.69  ? 205 ARG A CG  1 
ATOM   268  C CD  . ARG A 1 45  ? 23.069 41.047 18.968  1.00 66.22  ? 205 ARG A CD  1 
ATOM   269  N NE  . ARG A 1 45  ? 23.984 41.103 20.092  1.00 65.09  ? 205 ARG A NE  1 
ATOM   270  C CZ  . ARG A 1 45  ? 23.842 40.396 21.205  1.00 64.17  ? 205 ARG A CZ  1 
ATOM   271  N NH1 . ARG A 1 45  ? 22.817 39.562 21.338  1.00 61.80  ? 205 ARG A NH1 1 
ATOM   272  N NH2 . ARG A 1 45  ? 24.733 40.525 22.184  1.00 70.45  ? 205 ARG A NH2 1 
ATOM   273  N N   . ASP A 1 46  ? 23.960 40.643 14.449  1.00 63.94  ? 206 ASP A N   1 
ATOM   274  C CA  . ASP A 1 46  ? 23.160 39.808 13.554  1.00 62.58  ? 206 ASP A CA  1 
ATOM   275  C C   . ASP A 1 46  ? 22.742 40.579 12.306  1.00 62.31  ? 206 ASP A C   1 
ATOM   276  O O   . ASP A 1 46  ? 21.642 40.414 11.783  1.00 60.03  ? 206 ASP A O   1 
ATOM   277  C CB  . ASP A 1 46  ? 21.962 39.218 14.291  1.00 55.17  ? 206 ASP A CB  1 
ATOM   278  C CG  . ASP A 1 46  ? 22.396 38.270 15.392  1.00 66.81  ? 206 ASP A CG  1 
ATOM   279  O OD1 . ASP A 1 46  ? 23.264 37.418 15.114  1.00 64.85  ? 206 ASP A OD1 1 
ATOM   280  O OD2 . ASP A 1 46  ? 21.906 38.379 16.536  1.00 72.96  ? 206 ASP A OD2 1 
ATOM   281  N N   . GLY A 1 47  ? 23.637 41.450 11.844  1.00 63.41  ? 207 GLY A N   1 
ATOM   282  C CA  . GLY A 1 47  ? 23.404 42.246 10.659  1.00 63.97  ? 207 GLY A CA  1 
ATOM   283  C C   . GLY A 1 47  ? 22.437 43.400 10.803  1.00 59.36  ? 207 GLY A C   1 
ATOM   284  O O   . GLY A 1 47  ? 21.902 43.872 9.802   1.00 65.69  ? 207 GLY A O   1 
ATOM   285  N N   . LYS A 1 48  ? 22.188 43.883 12.010  1.00 65.85  ? 208 LYS A N   1 
ATOM   286  C CA  . LYS A 1 48  ? 21.233 44.968 12.174  1.00 58.89  ? 208 LYS A CA  1 
ATOM   287  C C   . LYS A 1 48  ? 21.780 45.986 13.157  1.00 59.09  ? 208 LYS A C   1 
ATOM   288  O O   . LYS A 1 48  ? 22.290 45.622 14.224  1.00 63.50  ? 208 LYS A O   1 
ATOM   289  C CB  . LYS A 1 48  ? 19.878 44.429 12.628  1.00 60.06  ? 208 LYS A CB  1 
ATOM   290  C CG  . LYS A 1 48  ? 19.249 43.475 11.607  1.00 64.08  ? 208 LYS A CG  1 
ATOM   291  C CD  . LYS A 1 48  ? 17.776 43.242 11.869  1.00 73.08  ? 208 LYS A CD  1 
ATOM   292  C CE  . LYS A 1 48  ? 16.925 43.579 10.647  1.00 75.64  ? 208 LYS A CE  1 
ATOM   293  N NZ  . LYS A 1 48  ? 16.797 42.406 9.737   1.00 87.95  ? 208 LYS A NZ  1 
ATOM   294  N N   . LEU A 1 49  ? 21.723 47.253 12.770  1.00 52.24  ? 209 LEU A N   1 
ATOM   295  C CA  . LEU A 1 49  ? 22.098 48.308 13.688  1.00 55.59  ? 209 LEU A CA  1 
ATOM   296  C C   . LEU A 1 49  ? 21.147 48.241 14.870  1.00 60.58  ? 209 LEU A C   1 
ATOM   297  O O   . LEU A 1 49  ? 19.924 48.324 14.698  1.00 59.19  ? 209 LEU A O   1 
ATOM   298  C CB  . LEU A 1 49  ? 22.044 49.669 12.998  1.00 48.18  ? 209 LEU A CB  1 
ATOM   299  C CG  . LEU A 1 49  ? 22.699 50.794 13.804  1.00 59.08  ? 209 LEU A CG  1 
ATOM   300  C CD1 . LEU A 1 49  ? 24.203 50.626 13.827  1.00 57.11  ? 209 LEU A CD1 1 
ATOM   301  C CD2 . LEU A 1 49  ? 22.316 52.191 13.313  1.00 56.07  ? 209 LEU A CD2 1 
ATOM   302  N N   . THR A 1 50  ? 21.706 48.043 16.059  1.00 51.90  ? 210 THR A N   1 
ATOM   303  C CA  . THR A 1 50  ? 20.926 47.687 17.231  1.00 53.50  ? 210 THR A CA  1 
ATOM   304  C C   . THR A 1 50  ? 21.293 48.593 18.400  1.00 51.04  ? 210 THR A C   1 
ATOM   305  O O   . THR A 1 50  ? 22.473 48.757 18.713  1.00 47.94  ? 210 THR A O   1 
ATOM   306  C CB  . THR A 1 50  ? 21.187 46.225 17.593  1.00 58.50  ? 210 THR A CB  1 
ATOM   307  O OG1 . THR A 1 50  ? 20.935 45.415 16.436  1.00 60.40  ? 210 THR A OG1 1 
ATOM   308  C CG2 . THR A 1 50  ? 20.294 45.772 18.740  1.00 48.70  ? 210 THR A CG2 1 
ATOM   309  N N   . LEU A 1 51  ? 20.288 49.192 19.027  1.00 50.70  ? 211 LEU A N   1 
ATOM   310  C CA  . LEU A 1 51  ? 20.517 49.917 20.268  1.00 47.53  ? 211 LEU A CA  1 
ATOM   311  C C   . LEU A 1 51  ? 20.640 48.900 21.392  1.00 48.63  ? 211 LEU A C   1 
ATOM   312  O O   . LEU A 1 51  ? 19.857 47.953 21.460  1.00 46.49  ? 211 LEU A O   1 
ATOM   313  C CB  . LEU A 1 51  ? 19.378 50.893 20.531  1.00 45.85  ? 211 LEU A CB  1 
ATOM   314  C CG  . LEU A 1 51  ? 19.239 51.496 21.925  1.00 50.21  ? 211 LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 51  ? 20.459 52.307 22.343  1.00 47.58  ? 211 LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 51  ? 18.017 52.349 21.927  1.00 51.30  ? 211 LEU A CD2 1 
ATOM   317  N N   . MET A 1 52  ? 21.664 49.039 22.229  1.00 45.94  ? 212 MET A N   1 
ATOM   318  C CA  . MET A 1 52  ? 21.912 48.001 23.219  1.00 50.58  ? 212 MET A CA  1 
ATOM   319  C C   . MET A 1 52  ? 22.259 48.585 24.584  1.00 52.77  ? 212 MET A C   1 
ATOM   320  O O   . MET A 1 52  ? 22.914 49.624 24.689  1.00 51.43  ? 212 MET A O   1 
ATOM   321  C CB  . MET A 1 52  ? 23.024 47.059 22.761  1.00 47.62  ? 212 MET A CB  1 
ATOM   322  C CG  . MET A 1 52  ? 22.585 46.072 21.653  1.00 52.65  ? 212 MET A CG  1 
ATOM   323  S SD  . MET A 1 52  ? 23.951 45.342 20.688  1.00 54.96  ? 212 MET A SD  1 
ATOM   324  C CE  . MET A 1 52  ? 24.222 43.806 21.489  1.00 61.73  ? 212 MET A CE  1 
ATOM   325  N N   . PHE A 1 53  ? 21.792 47.907 25.626  1.00 49.89  ? 213 PHE A N   1 
ATOM   326  C CA  . PHE A 1 53  ? 22.217 48.162 26.994  1.00 50.63  ? 213 PHE A CA  1 
ATOM   327  C C   . PHE A 1 53  ? 22.100 46.843 27.742  1.00 51.58  ? 213 PHE A C   1 
ATOM   328  O O   . PHE A 1 53  ? 21.490 45.888 27.256  1.00 53.41  ? 213 PHE A O   1 
ATOM   329  C CB  . PHE A 1 53  ? 21.382 49.260 27.654  1.00 48.05  ? 213 PHE A CB  1 
ATOM   330  C CG  . PHE A 1 53  ? 19.965 48.873 27.843  1.00 47.00  ? 213 PHE A CG  1 
ATOM   331  C CD1 . PHE A 1 53  ? 19.574 48.172 28.981  1.00 51.26  ? 213 PHE A CD1 1 
ATOM   332  C CD2 . PHE A 1 53  ? 19.023 49.179 26.884  1.00 42.64  ? 213 PHE A CD2 1 
ATOM   333  C CE1 . PHE A 1 53  ? 18.274 47.787 29.156  1.00 49.00  ? 213 PHE A CE1 1 
ATOM   334  C CE2 . PHE A 1 53  ? 17.718 48.797 27.050  1.00 48.95  ? 213 PHE A CE2 1 
ATOM   335  C CZ  . PHE A 1 53  ? 17.336 48.105 28.185  1.00 50.29  ? 213 PHE A CZ  1 
ATOM   336  N N   . ARG A 1 54  ? 22.675 46.794 28.933  1.00 48.30  ? 214 ARG A N   1 
ATOM   337  C CA  . ARG A 1 54  ? 22.863 45.532 29.631  1.00 50.28  ? 214 ARG A CA  1 
ATOM   338  C C   . ARG A 1 54  ? 22.095 45.535 30.943  1.00 54.79  ? 214 ARG A C   1 
ATOM   339  O O   . ARG A 1 54  ? 22.091 46.530 31.674  1.00 54.86  ? 214 ARG A O   1 
ATOM   340  C CB  . ARG A 1 54  ? 24.346 45.278 29.878  1.00 55.43  ? 214 ARG A CB  1 
ATOM   341  C CG  . ARG A 1 54  ? 24.648 44.055 30.696  1.00 60.97  ? 214 ARG A CG  1 
ATOM   342  C CD  . ARG A 1 54  ? 26.152 43.958 30.928  1.00 63.94  ? 214 ARG A CD  1 
ATOM   343  N NE  . ARG A 1 54  ? 26.816 43.058 29.988  1.00 62.18  ? 214 ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 54  ? 28.027 43.254 29.474  1.00 60.64  ? 214 ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 54  ? 28.741 44.333 29.785  1.00 57.50  ? 214 ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 54  ? 28.525 42.355 28.645  1.00 58.70  ? 214 ARG A NH2 1 
ATOM   347  N N   . VAL A 1 55  ? 21.419 44.428 31.221  1.00 58.99  ? 215 VAL A N   1 
ATOM   348  C CA  . VAL A 1 55  ? 20.578 44.283 32.399  1.00 47.58  ? 215 VAL A CA  1 
ATOM   349  C C   . VAL A 1 55  ? 21.241 43.260 33.303  1.00 57.58  ? 215 VAL A C   1 
ATOM   350  O O   . VAL A 1 55  ? 21.755 42.241 32.824  1.00 57.29  ? 215 VAL A O   1 
ATOM   351  C CB  . VAL A 1 55  ? 19.139 43.865 32.027  1.00 50.73  ? 215 VAL A CB  1 
ATOM   352  C CG1 . VAL A 1 55  ? 18.399 43.270 33.237  1.00 52.39  ? 215 VAL A CG1 1 
ATOM   353  C CG2 . VAL A 1 55  ? 18.364 45.063 31.491  1.00 48.98  ? 215 VAL A CG2 1 
ATOM   354  N N   . GLY A 1 56  ? 21.261 43.553 34.605  1.00 59.51  ? 216 GLY A N   1 
ATOM   355  C CA  . GLY A 1 56  ? 21.878 42.676 35.575  1.00 56.23  ? 216 GLY A CA  1 
ATOM   356  C C   . GLY A 1 56  ? 20.873 42.111 36.547  1.00 63.74  ? 216 GLY A C   1 
ATOM   357  O O   . GLY A 1 56  ? 20.047 41.267 36.191  1.00 72.64  ? 216 GLY A O   1 
ATOM   358  N N   . ASN A 1 57  ? 20.933 42.582 37.780  1.00 67.32  ? 217 ASN A N   1 
ATOM   359  C CA  . ASN A 1 57  ? 20.012 42.175 38.829  1.00 69.21  ? 217 ASN A CA  1 
ATOM   360  C C   . ASN A 1 57  ? 20.182 43.158 39.982  1.00 71.61  ? 217 ASN A C   1 
ATOM   361  O O   . ASN A 1 57  ? 21.049 44.036 39.946  1.00 70.34  ? 217 ASN A O   1 
ATOM   362  C CB  . ASN A 1 57  ? 20.267 40.735 39.279  1.00 64.15  ? 217 ASN A CB  1 
ATOM   363  C CG  . ASN A 1 57  ? 18.988 39.946 39.408  1.00 68.72  ? 217 ASN A CG  1 
ATOM   364  O OD1 . ASN A 1 57  ? 18.045 40.411 40.026  1.00 75.02  ? 217 ASN A OD1 1 
ATOM   365  N ND2 . ASN A 1 57  ? 18.938 38.761 38.812  1.00 65.69  ? 217 ASN A ND2 1 
ATOM   366  N N   . LEU A 1 58  ? 19.334 43.024 40.996  1.00 67.37  ? 218 LEU A N   1 
ATOM   367  C CA  . LEU A 1 58  ? 19.541 43.814 42.202  1.00 73.48  ? 218 LEU A CA  1 
ATOM   368  C C   . LEU A 1 58  ? 20.114 42.948 43.313  1.00 71.89  ? 218 LEU A C   1 
ATOM   369  O O   . LEU A 1 58  ? 19.682 41.806 43.516  1.00 72.63  ? 218 LEU A O   1 
ATOM   370  C CB  . LEU A 1 58  ? 18.255 44.493 42.688  1.00 73.19  ? 218 LEU A CB  1 
ATOM   371  C CG  . LEU A 1 58  ? 17.400 45.265 41.693  1.00 71.71  ? 218 LEU A CG  1 
ATOM   372  C CD1 . LEU A 1 58  ? 15.895 45.103 41.970  1.00 75.61  ? 218 LEU A CD1 1 
ATOM   373  C CD2 . LEU A 1 58  ? 17.812 46.721 41.636  1.00 64.30  ? 218 LEU A CD2 1 
ATOM   374  N N   . ARG A 1 59  ? 21.065 43.547 44.040  1.00 77.67  ? 219 ARG A N   1 
ATOM   375  C CA  . ARG A 1 59  ? 21.774 42.843 45.108  1.00 74.52  ? 219 ARG A CA  1 
ATOM   376  C C   . ARG A 1 59  ? 20.817 42.403 46.211  1.00 76.52  ? 219 ARG A C   1 
ATOM   377  O O   . ARG A 1 59  ? 20.815 41.235 46.617  1.00 75.32  ? 219 ARG A O   1 
ATOM   378  C CB  . ARG A 1 59  ? 22.887 43.735 45.681  1.00 78.30  ? 219 ARG A CB  1 
ATOM   379  C CG  . ARG A 1 59  ? 23.462 44.798 44.721  1.00 82.36  ? 219 ARG A CG  1 
ATOM   380  C CD  . ARG A 1 59  ? 24.803 45.387 45.224  1.00 82.66  ? 219 ARG A CD  1 
ATOM   381  N NE  . ARG A 1 59  ? 25.448 46.242 44.218  1.00 85.79  ? 219 ARG A NE  1 
ATOM   382  C CZ  . ARG A 1 59  ? 26.766 46.314 44.022  1.00 86.74  ? 219 ARG A CZ  1 
ATOM   383  N NH1 . ARG A 1 59  ? 27.587 45.583 44.757  1.00 87.05  ? 219 ARG A NH1 1 
ATOM   384  N NH2 . ARG A 1 59  ? 27.269 47.109 43.082  1.00 85.18  ? 219 ARG A NH2 1 
ATOM   385  N N   . ASN A 1 60  ? 19.972 43.318 46.688  1.00 77.28  ? 220 ASN A N   1 
ATOM   386  C CA  . ASN A 1 60  ? 19.144 43.084 47.866  1.00 85.66  ? 220 ASN A CA  1 
ATOM   387  C C   . ASN A 1 60  ? 17.774 42.475 47.549  1.00 88.68  ? 220 ASN A C   1 
ATOM   388  O O   . ASN A 1 60  ? 17.057 42.083 48.481  1.00 88.17  ? 220 ASN A O   1 
ATOM   389  C CB  . ASN A 1 60  ? 18.956 44.399 48.647  1.00 89.26  ? 220 ASN A CB  1 
ATOM   390  C CG  . ASN A 1 60  ? 20.288 45.051 49.050  1.00 94.88  ? 220 ASN A CG  1 
ATOM   391  O OD1 . ASN A 1 60  ? 20.790 45.953 48.368  1.00 89.89  ? 220 ASN A OD1 1 
ATOM   392  N ND2 . ASN A 1 60  ? 20.860 44.591 50.159  1.00 94.81  ? 220 ASN A ND2 1 
ATOM   393  N N   . SER A 1 61  ? 17.387 42.399 46.272  1.00 80.40  ? 221 SER A N   1 
ATOM   394  C CA  . SER A 1 61  ? 16.101 41.840 45.861  1.00 78.49  ? 221 SER A CA  1 
ATOM   395  C C   . SER A 1 61  ? 16.287 41.010 44.580  1.00 84.64  ? 221 SER A C   1 
ATOM   396  O O   . SER A 1 61  ? 15.640 41.238 43.552  1.00 81.37  ? 221 SER A O   1 
ATOM   397  C CB  . SER A 1 61  ? 15.076 42.959 45.673  1.00 80.00  ? 221 SER A CB  1 
ATOM   398  O OG  . SER A 1 61  ? 14.306 43.184 46.842  1.00 87.40  ? 221 SER A OG  1 
ATOM   399  N N   . HIS A 1 62  ? 17.183 40.018 44.656  1.00 77.79  ? 222 HIS A N   1 
ATOM   400  C CA  . HIS A 1 62  ? 17.568 39.215 43.499  1.00 73.05  ? 222 HIS A CA  1 
ATOM   401  C C   . HIS A 1 62  ? 16.351 38.615 42.808  1.00 77.58  ? 222 HIS A C   1 
ATOM   402  O O   . HIS A 1 62  ? 15.512 37.966 43.444  1.00 81.62  ? 222 HIS A O   1 
ATOM   403  C CB  . HIS A 1 62  ? 18.522 38.105 43.930  1.00 66.57  ? 222 HIS A CB  1 
ATOM   404  C CG  . HIS A 1 62  ? 18.967 37.222 42.807  1.00 77.42  ? 222 HIS A CG  1 
ATOM   405  N ND1 . HIS A 1 62  ? 18.259 36.108 42.406  1.00 77.57  ? 222 HIS A ND1 1 
ATOM   406  C CD2 . HIS A 1 62  ? 20.046 37.294 41.990  1.00 80.21  ? 222 HIS A CD2 1 
ATOM   407  C CE1 . HIS A 1 62  ? 18.886 35.528 41.396  1.00 77.69  ? 222 HIS A CE1 1 
ATOM   408  N NE2 . HIS A 1 62  ? 19.968 36.234 41.117  1.00 73.21  ? 222 HIS A NE2 1 
ATOM   409  N N   . MET A 1 63  ? 16.264 38.831 41.498  1.00 68.63  ? 223 MET A N   1 
ATOM   410  C CA  . MET A 1 63  ? 15.095 38.457 40.713  1.00 76.60  ? 223 MET A CA  1 
ATOM   411  C C   . MET A 1 63  ? 15.392 37.227 39.862  1.00 75.14  ? 223 MET A C   1 
ATOM   412  O O   . MET A 1 63  ? 16.534 36.985 39.469  1.00 73.46  ? 223 MET A O   1 
ATOM   413  C CB  . MET A 1 63  ? 14.644 39.624 39.820  1.00 73.38  ? 223 MET A CB  1 
ATOM   414  C CG  . MET A 1 63  ? 13.915 40.732 40.564  1.00 69.66  ? 223 MET A CG  1 
ATOM   415  S SD  . MET A 1 63  ? 14.220 42.350 39.834  1.00 78.74  ? 223 MET A SD  1 
ATOM   416  C CE  . MET A 1 63  ? 12.582 43.000 39.571  1.00 64.60  ? 223 MET A CE  1 
ATOM   417  N N   . VAL A 1 64  ? 14.349 36.449 39.589  1.00 77.29  ? 224 VAL A N   1 
ATOM   418  C CA  . VAL A 1 64  ? 14.320 35.245 38.767  1.00 78.08  ? 224 VAL A CA  1 
ATOM   419  C C   . VAL A 1 64  ? 14.184 35.584 37.290  1.00 71.81  ? 224 VAL A C   1 
ATOM   420  O O   . VAL A 1 64  ? 14.830 34.984 36.431  1.00 66.38  ? 224 VAL A O   1 
ATOM   421  C CB  . VAL A 1 64  ? 13.166 34.326 39.227  1.00 77.71  ? 224 VAL A CB  1 
ATOM   422  C CG1 . VAL A 1 64  ? 13.602 33.512 40.420  1.00 80.31  ? 224 VAL A CG1 1 
ATOM   423  C CG2 . VAL A 1 64  ? 11.869 35.133 39.542  1.00 77.70  ? 224 VAL A CG2 1 
ATOM   424  N N   . SER A 1 65  ? 13.222 36.455 37.073  1.00 66.50  ? 225 SER A N   1 
ATOM   425  C CA  . SER A 1 65  ? 12.614 36.646 35.777  1.00 67.61  ? 225 SER A CA  1 
ATOM   426  C C   . SER A 1 65  ? 11.940 38.007 35.802  1.00 69.17  ? 225 SER A C   1 
ATOM   427  O O   . SER A 1 65  ? 11.379 38.399 36.825  1.00 73.83  ? 225 SER A O   1 
ATOM   428  C CB  . SER A 1 65  ? 11.603 35.516 35.488  1.00 63.27  ? 225 SER A CB  1 
ATOM   429  O OG  . SER A 1 65  ? 10.340 35.780 36.080  1.00 59.51  ? 225 SER A OG  1 
ATOM   430  N N   . ALA A 1 66  ? 12.010 38.733 34.694  1.00 58.51  ? 226 ALA A N   1 
ATOM   431  C CA  . ALA A 1 66  ? 11.352 40.022 34.665  1.00 61.16  ? 226 ALA A CA  1 
ATOM   432  C C   . ALA A 1 66  ? 10.847 40.286 33.257  1.00 64.27  ? 226 ALA A C   1 
ATOM   433  O O   . ALA A 1 66  ? 11.284 39.660 32.286  1.00 60.66  ? 226 ALA A O   1 
ATOM   434  C CB  . ALA A 1 66  ? 12.296 41.136 35.134  1.00 59.80  ? 226 ALA A CB  1 
ATOM   435  N N   . GLN A 1 67  ? 9.907  41.214 33.156  1.00 58.27  ? 227 GLN A N   1 
ATOM   436  C CA  . GLN A 1 67  ? 9.500  41.733 31.872  1.00 55.69  ? 227 GLN A CA  1 
ATOM   437  C C   . GLN A 1 67  ? 9.968  43.175 31.807  1.00 59.50  ? 227 GLN A C   1 
ATOM   438  O O   . GLN A 1 67  ? 9.822  43.927 32.778  1.00 64.63  ? 227 GLN A O   1 
ATOM   439  C CB  . GLN A 1 67  ? 7.995  41.590 31.659  1.00 57.46  ? 227 GLN A CB  1 
ATOM   440  C CG  . GLN A 1 67  ? 7.142  42.700 32.191  1.00 60.28  ? 227 GLN A CG  1 
ATOM   441  C CD  . GLN A 1 67  ? 6.581  43.549 31.079  1.00 80.19  ? 227 GLN A CD  1 
ATOM   442  O OE1 . GLN A 1 67  ? 6.703  43.205 29.883  1.00 73.40  ? 227 GLN A OE1 1 
ATOM   443  N NE2 . GLN A 1 67  ? 5.932  44.657 31.453  1.00 78.07  ? 227 GLN A NE2 1 
ATOM   444  N N   . ILE A 1 68  ? 10.589 43.536 30.690  1.00 53.75  ? 228 ILE A N   1 
ATOM   445  C CA  . ILE A 1 68  ? 11.202 44.841 30.534  1.00 51.07  ? 228 ILE A CA  1 
ATOM   446  C C   . ILE A 1 68  ? 10.518 45.573 29.391  1.00 54.48  ? 228 ILE A C   1 
ATOM   447  O O   . ILE A 1 68  ? 10.095 44.969 28.401  1.00 56.06  ? 228 ILE A O   1 
ATOM   448  C CB  . ILE A 1 68  ? 12.717 44.710 30.284  1.00 55.44  ? 228 ILE A CB  1 
ATOM   449  C CG1 . ILE A 1 68  ? 13.407 46.057 30.463  1.00 50.04  ? 228 ILE A CG1 1 
ATOM   450  C CG2 . ILE A 1 68  ? 12.990 44.124 28.906  1.00 45.88  ? 228 ILE A CG2 1 
ATOM   451  C CD1 . ILE A 1 68  ? 14.907 45.977 30.244  1.00 52.75  ? 228 ILE A CD1 1 
ATOM   452  N N   . ARG A 1 69  ? 10.407 46.887 29.530  1.00 50.02  ? 229 ARG A N   1 
ATOM   453  C CA  . ARG A 1 69  ? 9.974  47.687 28.405  1.00 53.60  ? 229 ARG A CA  1 
ATOM   454  C C   . ARG A 1 69  ? 10.685 49.024 28.459  1.00 52.34  ? 229 ARG A C   1 
ATOM   455  O O   . ARG A 1 69  ? 11.175 49.441 29.510  1.00 54.54  ? 229 ARG A O   1 
ATOM   456  C CB  . ARG A 1 69  ? 8.465  47.859 28.400  1.00 51.88  ? 229 ARG A CB  1 
ATOM   457  C CG  . ARG A 1 69  ? 7.937  48.035 29.735  1.00 56.40  ? 229 ARG A CG  1 
ATOM   458  C CD  . ARG A 1 69  ? 6.456  47.884 29.751  1.00 63.49  ? 229 ARG A CD  1 
ATOM   459  N NE  . ARG A 1 69  ? 5.915  48.658 30.860  1.00 68.56  ? 229 ARG A NE  1 
ATOM   460  C CZ  . ARG A 1 69  ? 6.038  48.324 32.138  1.00 68.49  ? 229 ARG A CZ  1 
ATOM   461  N NH1 . ARG A 1 69  ? 6.694  47.216 32.491  1.00 68.09  ? 229 ARG A NH1 1 
ATOM   462  N NH2 . ARG A 1 69  ? 5.504  49.112 33.064  1.00 69.20  ? 229 ARG A NH2 1 
ATOM   463  N N   . CYS A 1 70  ? 10.745 49.683 27.303  1.00 43.88  ? 230 CYS A N   1 
ATOM   464  C CA  . CYS A 1 70  ? 11.432 50.953 27.140  1.00 49.77  ? 230 CYS A CA  1 
ATOM   465  C C   . CYS A 1 70  ? 10.526 51.959 26.466  1.00 49.46  ? 230 CYS A C   1 
ATOM   466  O O   . CYS A 1 70  ? 9.709  51.602 25.615  1.00 54.43  ? 230 CYS A O   1 
ATOM   467  C CB  . CYS A 1 70  ? 12.688 50.811 26.305  1.00 48.12  ? 230 CYS A CB  1 
ATOM   468  S SG  . CYS A 1 70  ? 13.699 49.511 26.910  1.00 57.91  ? 230 CYS A SG  1 
ATOM   469  N N   . LYS A 1 71  ? 10.673 53.210 26.870  1.00 49.11  ? 231 LYS A N   1 
ATOM   470  C CA  . LYS A 1 71  ? 10.060 54.344 26.214  1.00 47.98  ? 231 LYS A CA  1 
ATOM   471  C C   . LYS A 1 71  ? 11.163 55.297 25.788  1.00 50.63  ? 231 LYS A C   1 
ATOM   472  O O   . LYS A 1 71  ? 12.297 55.225 26.269  1.00 56.50  ? 231 LYS A O   1 
ATOM   473  C CB  . LYS A 1 71  ? 9.077  55.051 27.140  1.00 51.92  ? 231 LYS A CB  1 
ATOM   474  C CG  . LYS A 1 71  ? 8.034  54.131 27.720  1.00 48.92  ? 231 LYS A CG  1 
ATOM   475  C CD  . LYS A 1 71  ? 6.845  54.041 26.815  1.00 49.80  ? 231 LYS A CD  1 
ATOM   476  C CE  . LYS A 1 71  ? 5.710  53.331 27.500  1.00 51.69  ? 231 LYS A CE  1 
ATOM   477  N NZ  . LYS A 1 71  ? 4.454  53.403 26.676  1.00 60.36  ? 231 LYS A NZ  1 
ATOM   478  N N   . LEU A 1 72  ? 10.840 56.169 24.847  1.00 55.92  ? 232 LEU A N   1 
ATOM   479  C CA  . LEU A 1 72  ? 11.728 57.248 24.451  1.00 50.37  ? 232 LEU A CA  1 
ATOM   480  C C   . LEU A 1 72  ? 11.025 58.548 24.788  1.00 53.81  ? 232 LEU A C   1 
ATOM   481  O O   . LEU A 1 72  ? 9.889  58.769 24.356  1.00 55.09  ? 232 LEU A O   1 
ATOM   482  C CB  . LEU A 1 72  ? 12.076 57.182 22.967  1.00 52.95  ? 232 LEU A CB  1 
ATOM   483  C CG  . LEU A 1 72  ? 13.074 58.272 22.570  1.00 52.69  ? 232 LEU A CG  1 
ATOM   484  C CD1 . LEU A 1 72  ? 14.478 57.900 22.998  1.00 50.78  ? 232 LEU A CD1 1 
ATOM   485  C CD2 . LEU A 1 72  ? 13.019 58.496 21.087  1.00 53.56  ? 232 LEU A CD2 1 
ATOM   486  N N   . LEU A 1 73  ? 11.674 59.379 25.591  1.00 53.61  ? 233 LEU A N   1 
ATOM   487  C CA  . LEU A 1 73  ? 11.134 60.674 25.956  1.00 55.10  ? 233 LEU A CA  1 
ATOM   488  C C   . LEU A 1 73  ? 11.829 61.707 25.095  1.00 59.15  ? 233 LEU A C   1 
ATOM   489  O O   . LEU A 1 73  ? 13.056 61.673 24.974  1.00 61.49  ? 233 LEU A O   1 
ATOM   490  C CB  . LEU A 1 73  ? 11.375 60.996 27.431  1.00 54.96  ? 233 LEU A CB  1 
ATOM   491  C CG  . LEU A 1 73  ? 10.885 60.107 28.575  1.00 60.59  ? 233 LEU A CG  1 
ATOM   492  C CD1 . LEU A 1 73  ? 10.548 60.947 29.815  1.00 59.02  ? 233 LEU A CD1 1 
ATOM   493  C CD2 . LEU A 1 73  ? 9.736  59.225 28.175  1.00 52.07  ? 233 LEU A CD2 1 
ATOM   494  N N   . LYS A 1 74  ? 11.055 62.628 24.523  1.00 60.84  ? 234 LYS A N   1 
ATOM   495  C CA  . LYS A 1 74  ? 11.631 63.688 23.700  1.00 63.27  ? 234 LYS A CA  1 
ATOM   496  C C   . LYS A 1 74  ? 10.546 64.675 23.283  1.00 60.79  ? 234 LYS A C   1 
ATOM   497  O O   . LYS A 1 74  ? 9.378  64.311 23.130  1.00 59.12  ? 234 LYS A O   1 
ATOM   498  C CB  . LYS A 1 74  ? 12.349 63.115 22.462  1.00 55.71  ? 234 LYS A CB  1 
ATOM   499  C CG  . LYS A 1 74  ? 11.488 62.877 21.221  1.00 61.20  ? 234 LYS A CG  1 
ATOM   500  C CD  . LYS A 1 74  ? 12.381 62.392 20.060  1.00 62.89  ? 234 LYS A CD  1 
ATOM   501  C CE  . LYS A 1 74  ? 11.792 62.702 18.700  1.00 65.03  ? 234 LYS A CE  1 
ATOM   502  N NZ  . LYS A 1 74  ? 12.726 62.301 17.595  1.00 76.03  ? 234 LYS A NZ  1 
ATOM   503  N N   . SER A 1 75  ? 10.945 65.931 23.122  1.00 60.40  ? 235 SER A N   1 
ATOM   504  C CA  . SER A 1 75  ? 10.054 66.920 22.544  1.00 60.69  ? 235 SER A CA  1 
ATOM   505  C C   . SER A 1 75  ? 9.978  66.733 21.033  1.00 57.75  ? 235 SER A C   1 
ATOM   506  O O   . SER A 1 75  ? 10.967 66.431 20.367  1.00 51.78  ? 235 SER A O   1 
ATOM   507  C CB  . SER A 1 75  ? 10.528 68.332 22.874  1.00 62.60  ? 235 SER A CB  1 
ATOM   508  O OG  . SER A 1 75  ? 10.853 68.418 24.245  1.00 68.38  ? 235 SER A OG  1 
ATOM   509  N N   . ARG A 1 76  ? 8.785  66.878 20.499  1.00 57.66  ? 236 ARG A N   1 
ATOM   510  C CA  . ARG A 1 76  ? 8.634  66.856 19.069  1.00 66.23  ? 236 ARG A CA  1 
ATOM   511  C C   . ARG A 1 76  ? 7.522  67.830 18.740  1.00 67.73  ? 236 ARG A C   1 
ATOM   512  O O   . ARG A 1 76  ? 6.891  68.410 19.634  1.00 63.43  ? 236 ARG A O   1 
ATOM   513  C CB  . ARG A 1 76  ? 8.375  65.435 18.561  1.00 66.00  ? 236 ARG A CB  1 
ATOM   514  C CG  . ARG A 1 76  ? 7.023  64.867 18.921  1.00 61.08  ? 236 ARG A CG  1 
ATOM   515  C CD  . ARG A 1 76  ? 6.919  63.416 18.478  1.00 51.10  ? 236 ARG A CD  1 
ATOM   516  N NE  . ARG A 1 76  ? 5.555  62.940 18.651  1.00 48.82  ? 236 ARG A NE  1 
ATOM   517  C CZ  . ARG A 1 76  ? 4.601  63.076 17.741  1.00 61.21  ? 236 ARG A CZ  1 
ATOM   518  N NH1 . ARG A 1 76  ? 4.861  63.655 16.572  1.00 58.82  ? 236 ARG A NH1 1 
ATOM   519  N NH2 . ARG A 1 76  ? 3.384  62.629 17.998  1.00 62.50  ? 236 ARG A NH2 1 
ATOM   520  N N   . GLN A 1 77  ? 7.322  68.039 17.443  1.00 69.31  ? 237 GLN A N   1 
ATOM   521  C CA  . GLN A 1 77  ? 6.214  68.834 16.946  1.00 66.84  ? 237 GLN A CA  1 
ATOM   522  C C   . GLN A 1 77  ? 5.331  67.957 16.087  1.00 63.87  ? 237 GLN A C   1 
ATOM   523  O O   . GLN A 1 77  ? 5.825  67.083 15.366  1.00 64.23  ? 237 GLN A O   1 
ATOM   524  C CB  . GLN A 1 77  ? 6.687  70.028 16.147  1.00 69.75  ? 237 GLN A CB  1 
ATOM   525  C CG  . GLN A 1 77  ? 5.700  71.166 16.202  1.00 74.90  ? 237 GLN A CG  1 
ATOM   526  C CD  . GLN A 1 77  ? 6.235  72.420 15.560  1.00 79.12  ? 237 GLN A CD  1 
ATOM   527  O OE1 . GLN A 1 77  ? 5.778  72.819 14.490  1.00 75.06  ? 237 GLN A OE1 1 
ATOM   528  N NE2 . GLN A 1 77  ? 7.205  73.059 16.215  1.00 87.38  ? 237 GLN A NE2 1 
ATOM   529  N N   . THR A 1 78  ? 4.041  68.163 16.192  1.00 63.41  ? 238 THR A N   1 
ATOM   530  C CA  . THR A 1 78  ? 3.211  67.368 15.312  1.00 68.91  ? 238 THR A CA  1 
ATOM   531  C C   . THR A 1 78  ? 3.081  68.061 13.969  1.00 69.20  ? 238 THR A C   1 
ATOM   532  O O   . THR A 1 78  ? 3.261  69.279 13.878  1.00 68.86  ? 238 THR A O   1 
ATOM   533  C CB  . THR A 1 78  ? 1.839  67.150 15.939  1.00 68.28  ? 238 THR A CB  1 
ATOM   534  O OG1 . THR A 1 78  ? 1.137  68.392 16.007  1.00 68.02  ? 238 THR A OG1 1 
ATOM   535  C CG2 . THR A 1 78  ? 1.996  66.575 17.341  1.00 68.97  ? 238 THR A CG2 1 
ATOM   536  N N   . PRO A 1 79  ? 2.792  67.310 12.897  1.00 71.76  ? 239 PRO A N   1 
ATOM   537  C CA  . PRO A 1 79  ? 2.498  67.955 11.603  1.00 66.68  ? 239 PRO A CA  1 
ATOM   538  C C   . PRO A 1 79  ? 1.504  69.092 11.730  1.00 74.68  ? 239 PRO A C   1 
ATOM   539  O O   . PRO A 1 79  ? 1.571  70.063 10.965  1.00 83.68  ? 239 PRO A O   1 
ATOM   540  C CB  . PRO A 1 79  ? 1.930  66.805 10.765  1.00 64.46  ? 239 PRO A CB  1 
ATOM   541  C CG  . PRO A 1 79  ? 2.569  65.584 11.337  1.00 65.36  ? 239 PRO A CG  1 
ATOM   542  C CD  . PRO A 1 79  ? 2.688  65.842 12.815  1.00 67.59  ? 239 PRO A CD  1 
ATOM   543  N N   . GLU A 1 80  ? 0.583  68.997 12.698  1.00 73.12  ? 240 GLU A N   1 
ATOM   544  C CA  . GLU A 1 80  ? -0.335 70.057 13.086  1.00 67.75  ? 240 GLU A CA  1 
ATOM   545  C C   . GLU A 1 80  ? 0.358  71.193 13.795  1.00 70.77  ? 240 GLU A C   1 
ATOM   546  O O   . GLU A 1 80  ? -0.330 72.099 14.296  1.00 73.49  ? 240 GLU A O   1 
ATOM   547  C CB  . GLU A 1 80  ? -1.435 69.504 14.003  1.00 65.57  ? 240 GLU A CB  1 
ATOM   548  C CG  . GLU A 1 80  ? -2.400 68.521 13.334  1.00 64.32  ? 240 GLU A CG  1 
ATOM   549  C CD  . GLU A 1 80  ? -1.823 67.115 13.184  1.00 65.49  ? 240 GLU A CD  1 
ATOM   550  O OE1 . GLU A 1 80  ? -0.644 66.873 13.547  1.00 67.39  ? 240 GLU A OE1 1 
ATOM   551  O OE2 . GLU A 1 80  ? -2.559 66.240 12.696  1.00 66.22  ? 240 GLU A OE2 1 
ATOM   552  N N   . GLY A 1 81  ? 1.684  71.153 13.902  1.00 66.98  ? 241 GLY A N   1 
ATOM   553  C CA  . GLY A 1 81  ? 2.395  72.199 14.621  1.00 68.40  ? 241 GLY A CA  1 
ATOM   554  C C   . GLY A 1 81  ? 2.109  72.253 16.106  1.00 75.17  ? 241 GLY A C   1 
ATOM   555  O O   . GLY A 1 81  ? 2.207  73.329 16.701  1.00 82.03  ? 241 GLY A O   1 
ATOM   556  N N   . GLU A 1 82  ? 1.752  71.129 16.731  1.00 76.15  ? 242 GLU A N   1 
ATOM   557  C CA  . GLU A 1 82  ? 1.629  71.088 18.185  1.00 71.81  ? 242 GLU A CA  1 
ATOM   558  C C   . GLU A 1 82  ? 2.965  70.701 18.801  1.00 71.88  ? 242 GLU A C   1 
ATOM   559  O O   . GLU A 1 82  ? 3.664  69.819 18.292  1.00 72.56  ? 242 GLU A O   1 
ATOM   560  C CB  . GLU A 1 82  ? 0.559  70.098 18.639  1.00 72.26  ? 242 GLU A CB  1 
ATOM   561  C CG  . GLU A 1 82  ? 0.433  70.034 20.158  1.00 65.71  ? 242 GLU A CG  1 
ATOM   562  C CD  . GLU A 1 82  ? -0.709 69.152 20.610  1.00 70.32  ? 242 GLU A CD  1 
ATOM   563  O OE1 . GLU A 1 82  ? -1.258 68.411 19.768  1.00 73.64  ? 242 GLU A OE1 1 
ATOM   564  O OE2 . GLU A 1 82  ? -1.076 69.212 21.805  1.00 76.66  ? 242 GLU A OE2 1 
ATOM   565  N N   . PHE A 1 83  ? 3.326  71.379 19.888  1.00 71.81  ? 243 PHE A N   1 
ATOM   566  C CA  . PHE A 1 83  ? 4.578  71.115 20.584  1.00 66.17  ? 243 PHE A CA  1 
ATOM   567  C C   . PHE A 1 83  ? 4.308  70.153 21.732  1.00 67.74  ? 243 PHE A C   1 
ATOM   568  O O   . PHE A 1 83  ? 3.432  70.404 22.567  1.00 65.05  ? 243 PHE A O   1 
ATOM   569  C CB  . PHE A 1 83  ? 5.206  72.402 21.110  1.00 66.69  ? 243 PHE A CB  1 
ATOM   570  C CG  . PHE A 1 83  ? 6.576  72.204 21.656  1.00 66.32  ? 243 PHE A CG  1 
ATOM   571  C CD1 . PHE A 1 83  ? 7.583  71.706 20.846  1.00 67.76  ? 243 PHE A CD1 1 
ATOM   572  C CD2 . PHE A 1 83  ? 6.857  72.486 22.983  1.00 70.12  ? 243 PHE A CD2 1 
ATOM   573  C CE1 . PHE A 1 83  ? 8.856  71.510 21.345  1.00 70.80  ? 243 PHE A CE1 1 
ATOM   574  C CE2 . PHE A 1 83  ? 8.128  72.284 23.499  1.00 69.55  ? 243 PHE A CE2 1 
ATOM   575  C CZ  . PHE A 1 83  ? 9.130  71.796 22.678  1.00 71.75  ? 243 PHE A CZ  1 
ATOM   576  N N   . LEU A 1 84  ? 5.033  69.041 21.754  1.00 67.98  ? 244 LEU A N   1 
ATOM   577  C CA  . LEU A 1 84  ? 4.824  68.025 22.777  1.00 59.98  ? 244 LEU A CA  1 
ATOM   578  C C   . LEU A 1 84  ? 6.044  68.037 23.671  1.00 66.02  ? 244 LEU A C   1 
ATOM   579  O O   . LEU A 1 84  ? 7.053  67.391 23.348  1.00 69.00  ? 244 LEU A O   1 
ATOM   580  C CB  . LEU A 1 84  ? 4.613  66.643 22.159  1.00 58.29  ? 244 LEU A CB  1 
ATOM   581  C CG  . LEU A 1 84  ? 3.384  66.557 21.264  1.00 61.38  ? 244 LEU A CG  1 
ATOM   582  C CD1 . LEU A 1 84  ? 3.248  65.198 20.593  1.00 53.69  ? 244 LEU A CD1 1 
ATOM   583  C CD2 . LEU A 1 84  ? 2.157  66.886 22.104  1.00 61.96  ? 244 LEU A CD2 1 
ATOM   584  N N   . PRO A 1 85  ? 6.012  68.784 24.780  1.00 65.10  ? 245 PRO A N   1 
ATOM   585  C CA  . PRO A 1 85  ? 7.194  68.955 25.631  1.00 59.36  ? 245 PRO A CA  1 
ATOM   586  C C   . PRO A 1 85  ? 7.978  67.677 25.852  1.00 64.03  ? 245 PRO A C   1 
ATOM   587  O O   . PRO A 1 85  ? 9.133  67.587 25.436  1.00 72.83  ? 245 PRO A O   1 
ATOM   588  C CB  . PRO A 1 85  ? 6.592  69.477 26.939  1.00 68.90  ? 245 PRO A CB  1 
ATOM   589  C CG  . PRO A 1 85  ? 5.396  70.240 26.495  1.00 69.95  ? 245 PRO A CG  1 
ATOM   590  C CD  . PRO A 1 85  ? 4.844  69.514 25.297  1.00 66.25  ? 245 PRO A CD  1 
ATOM   591  N N   . LEU A 1 86  ? 7.388  66.674 26.484  1.00 62.43  ? 246 LEU A N   1 
ATOM   592  C CA  . LEU A 1 86  ? 8.017  65.361 26.528  1.00 65.53  ? 246 LEU A CA  1 
ATOM   593  C C   . LEU A 1 86  ? 6.977  64.366 26.054  1.00 67.87  ? 246 LEU A C   1 
ATOM   594  O O   . LEU A 1 86  ? 5.942  64.182 26.700  1.00 70.40  ? 246 LEU A O   1 
ATOM   595  C CB  . LEU A 1 86  ? 8.565  65.008 27.912  1.00 71.25  ? 246 LEU A CB  1 
ATOM   596  C CG  . LEU A 1 86  ? 7.681  64.591 29.076  1.00 75.29  ? 246 LEU A CG  1 
ATOM   597  C CD1 . LEU A 1 86  ? 8.508  64.312 30.322  1.00 69.67  ? 246 LEU A CD1 1 
ATOM   598  C CD2 . LEU A 1 86  ? 6.668  65.687 29.334  1.00 81.80  ? 246 LEU A CD2 1 
ATOM   599  N N   . ASP A 1 87  ? 7.224  63.798 24.884  1.00 66.03  ? 247 ASP A N   1 
ATOM   600  C CA  . ASP A 1 87  ? 6.362  62.801 24.283  1.00 61.19  ? 247 ASP A CA  1 
ATOM   601  C C   . ASP A 1 87  ? 6.960  61.435 24.570  1.00 58.44  ? 247 ASP A C   1 
ATOM   602  O O   . ASP A 1 87  ? 8.182  61.302 24.725  1.00 57.39  ? 247 ASP A O   1 
ATOM   603  C CB  . ASP A 1 87  ? 6.228  63.028 22.768  1.00 59.04  ? 247 ASP A CB  1 
ATOM   604  C CG  . ASP A 1 87  ? 5.048  62.275 22.169  1.00 63.41  ? 247 ASP A CG  1 
ATOM   605  O OD1 . ASP A 1 87  ? 4.077  62.000 22.914  1.00 74.50  ? 247 ASP A OD1 1 
ATOM   606  O OD2 . ASP A 1 87  ? 5.082  61.951 20.965  1.00 61.68  ? 247 ASP A OD2 1 
ATOM   607  N N   . GLN A 1 88  ? 6.092  60.423 24.646  1.00 56.44  ? 248 GLN A N   1 
ATOM   608  C CA  . GLN A 1 88  ? 6.503  59.048 24.924  1.00 58.58  ? 248 GLN A CA  1 
ATOM   609  C C   . GLN A 1 88  ? 6.250  58.170 23.712  1.00 53.82  ? 248 GLN A C   1 
ATOM   610  O O   . GLN A 1 88  ? 5.099  57.991 23.297  1.00 53.94  ? 248 GLN A O   1 
ATOM   611  C CB  . GLN A 1 88  ? 5.769  58.473 26.134  1.00 56.23  ? 248 GLN A CB  1 
ATOM   612  C CG  . GLN A 1 88  ? 6.587  58.524 27.381  1.00 56.43  ? 248 GLN A CG  1 
ATOM   613  C CD  . GLN A 1 88  ? 5.846  58.029 28.590  1.00 57.77  ? 248 GLN A CD  1 
ATOM   614  O OE1 . GLN A 1 88  ? 5.624  56.833 28.756  1.00 57.96  ? 248 GLN A OE1 1 
ATOM   615  N NE2 . GLN A 1 88  ? 5.414  58.955 29.421  1.00 58.78  ? 248 GLN A NE2 1 
ATOM   616  N N   . LEU A 1 89  ? 7.324  57.606 23.170  1.00 57.84  ? 249 LEU A N   1 
ATOM   617  C CA  . LEU A 1 89  ? 7.258  56.669 22.058  1.00 56.59  ? 249 LEU A CA  1 
ATOM   618  C C   . LEU A 1 89  ? 7.780  55.326 22.538  1.00 52.30  ? 249 LEU A C   1 
ATOM   619  O O   . LEU A 1 89  ? 8.678  55.265 23.373  1.00 56.89  ? 249 LEU A O   1 
ATOM   620  C CB  . LEU A 1 89  ? 8.074  57.170 20.841  1.00 52.89  ? 249 LEU A CB  1 
ATOM   621  C CG  . LEU A 1 89  ? 7.634  58.521 20.233  1.00 60.74  ? 249 LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 89  ? 8.306  59.714 20.916  1.00 65.00  ? 249 LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 89  ? 7.870  58.604 18.737  1.00 50.51  ? 249 LEU A CD2 1 
ATOM   624  N N   . GLU A 1 90  ? 7.210  54.245 22.030  1.00 54.90  ? 250 GLU A N   1 
ATOM   625  C CA  A GLU A 1 90  ? 7.663  52.937 22.471  0.50 56.01  ? 250 GLU A CA  1 
ATOM   626  C CA  B GLU A 1 90  ? 7.635  52.917 22.437  0.50 55.13  ? 250 GLU A CA  1 
ATOM   627  C C   . GLU A 1 90  ? 8.905  52.520 21.699  1.00 55.62  ? 250 GLU A C   1 
ATOM   628  O O   . GLU A 1 90  ? 9.144  52.952 20.570  1.00 50.69  ? 250 GLU A O   1 
ATOM   629  C CB  A GLU A 1 90  ? 6.566  51.876 22.325  0.50 56.88  ? 250 GLU A CB  1 
ATOM   630  C CB  B GLU A 1 90  ? 6.521  51.902 22.174  0.50 57.91  ? 250 GLU A CB  1 
ATOM   631  C CG  A GLU A 1 90  ? 5.764  51.605 23.637  0.50 58.04  ? 250 GLU A CG  1 
ATOM   632  C CG  B GLU A 1 90  ? 5.368  51.994 23.186  0.50 58.65  ? 250 GLU A CG  1 
ATOM   633  C CD  A GLU A 1 90  ? 6.333  50.476 24.512  0.50 56.25  ? 250 GLU A CD  1 
ATOM   634  C CD  B GLU A 1 90  ? 4.654  53.335 23.133  0.50 58.08  ? 250 GLU A CD  1 
ATOM   635  O OE1 A GLU A 1 90  ? 5.668  50.107 25.504  0.50 57.64  ? 250 GLU A OE1 1 
ATOM   636  O OE1 B GLU A 1 90  ? 4.267  53.751 22.020  0.50 56.73  ? 250 GLU A OE1 1 
ATOM   637  O OE2 A GLU A 1 90  ? 7.433  49.959 24.226  0.50 54.96  ? 250 GLU A OE2 1 
ATOM   638  O OE2 B GLU A 1 90  ? 4.507  53.979 24.195  0.50 55.83  ? 250 GLU A OE2 1 
ATOM   639  N N   . LEU A 1 91  ? 9.728  51.714 22.360  1.00 58.30  ? 251 LEU A N   1 
ATOM   640  C CA  . LEU A 1 91  ? 10.946 51.155 21.787  1.00 52.25  ? 251 LEU A CA  1 
ATOM   641  C C   . LEU A 1 91  ? 10.807 49.650 21.896  1.00 49.61  ? 251 LEU A C   1 
ATOM   642  O O   . LEU A 1 91  ? 10.863 49.101 22.997  1.00 56.55  ? 251 LEU A O   1 
ATOM   643  C CB  . LEU A 1 91  ? 12.198 51.627 22.517  1.00 50.91  ? 251 LEU A CB  1 
ATOM   644  C CG  . LEU A 1 91  ? 12.710 53.016 22.159  1.00 58.77  ? 251 LEU A CG  1 
ATOM   645  C CD1 . LEU A 1 91  ? 13.669 53.517 23.251  1.00 56.08  ? 251 LEU A CD1 1 
ATOM   646  C CD2 . LEU A 1 91  ? 13.376 53.023 20.776  1.00 54.42  ? 251 LEU A CD2 1 
ATOM   647  N N   . ASP A 1 92  ? 10.596 48.998 20.771  1.00 45.22  ? 252 ASP A N   1 
ATOM   648  C CA  . ASP A 1 92  ? 10.454 47.560 20.753  1.00 44.50  ? 252 ASP A CA  1 
ATOM   649  C C   . ASP A 1 92  ? 11.744 46.909 21.232  1.00 46.89  ? 252 ASP A C   1 
ATOM   650  O O   . ASP A 1 92  ? 12.813 47.131 20.671  1.00 53.49  ? 252 ASP A O   1 
ATOM   651  C CB  . ASP A 1 92  ? 10.092 47.099 19.339  1.00 45.37  ? 252 ASP A CB  1 
ATOM   652  C CG  . ASP A 1 92  ? 9.610  45.654 19.285  1.00 50.92  ? 252 ASP A CG  1 
ATOM   653  O OD1 . ASP A 1 92  ? 9.986  44.821 20.161  1.00 52.97  ? 252 ASP A OD1 1 
ATOM   654  O OD2 . ASP A 1 92  ? 8.892  45.328 18.327  1.00 57.88  ? 252 ASP A OD2 1 
ATOM   655  N N   . VAL A 1 93  ? 11.649 46.137 22.306  1.00 45.23  ? 253 VAL A N   1 
ATOM   656  C CA  . VAL A 1 93  ? 12.747 45.292 22.760  1.00 46.92  ? 253 VAL A CA  1 
ATOM   657  C C   . VAL A 1 93  ? 12.224 43.865 22.813  1.00 48.35  ? 253 VAL A C   1 
ATOM   658  O O   . VAL A 1 93  ? 12.642 43.065 23.651  1.00 58.38  ? 253 VAL A O   1 
ATOM   659  C CB  . VAL A 1 93  ? 13.332 45.738 24.128  1.00 43.06  ? 253 VAL A CB  1 
ATOM   660  C CG1 . VAL A 1 93  ? 13.735 47.182 24.108  1.00 42.47  ? 253 VAL A CG1 1 
ATOM   661  C CG2 . VAL A 1 93  ? 12.365 45.503 25.213  1.00 45.45  ? 253 VAL A CG2 1 
ATOM   662  N N   . GLY A 1 94  ? 11.285 43.529 21.956  1.00 48.19  ? 254 GLY A N   1 
ATOM   663  C CA  . GLY A 1 94  ? 10.929 42.146 21.781  1.00 50.24  ? 254 GLY A CA  1 
ATOM   664  C C   . GLY A 1 94  ? 9.610  41.664 22.311  1.00 50.98  ? 254 GLY A C   1 
ATOM   665  O O   . GLY A 1 94  ? 9.441  40.454 22.434  1.00 61.84  ? 254 GLY A O   1 
ATOM   666  N N   . ALA A 1 95  ? 8.661  42.552 22.606  1.00 51.89  ? 255 ALA A N   1 
ATOM   667  C CA  . ALA A 1 95  ? 7.318  42.102 22.964  1.00 55.63  ? 255 ALA A CA  1 
ATOM   668  C C   . ALA A 1 95  ? 6.790  41.064 21.973  1.00 56.86  ? 255 ALA A C   1 
ATOM   669  O O   . ALA A 1 95  ? 6.360  39.975 22.368  1.00 59.82  ? 255 ALA A O   1 
ATOM   670  C CB  . ALA A 1 95  ? 6.364  43.291 23.050  1.00 45.51  ? 255 ALA A CB  1 
ATOM   671  N N   . SER A 1 96  ? 6.836  41.363 20.677  1.00 57.48  ? 256 SER A N   1 
ATOM   672  C CA  . SER A 1 96  ? 6.148  40.466 19.752  1.00 61.77  ? 256 SER A CA  1 
ATOM   673  C C   . SER A 1 96  ? 6.806  39.095 19.652  1.00 62.88  ? 256 SER A C   1 
ATOM   674  O O   . SER A 1 96  ? 6.186  38.178 19.108  1.00 65.19  ? 256 SER A O   1 
ATOM   675  C CB  . SER A 1 96  ? 6.042  41.098 18.365  1.00 50.10  ? 256 SER A CB  1 
ATOM   676  O OG  . SER A 1 96  ? 7.319  41.270 17.804  1.00 55.22  ? 256 SER A OG  1 
ATOM   677  N N   . THR A 1 97  ? 8.011  38.913 20.192  1.00 65.60  ? 257 THR A N   1 
ATOM   678  C CA  . THR A 1 97  ? 8.691  37.623 20.137  1.00 62.28  ? 257 THR A CA  1 
ATOM   679  C C   . THR A 1 97  ? 8.906  36.980 21.493  1.00 58.61  ? 257 THR A C   1 
ATOM   680  O O   . THR A 1 97  ? 9.472  35.885 21.550  1.00 62.40  ? 257 THR A O   1 
ATOM   681  C CB  . THR A 1 97  ? 10.059 37.751 19.466  1.00 63.31  ? 257 THR A CB  1 
ATOM   682  O OG1 . THR A 1 97  ? 11.019 38.133 20.456  1.00 61.92  ? 257 THR A OG1 1 
ATOM   683  C CG2 . THR A 1 97  ? 10.021 38.778 18.331  1.00 58.69  ? 257 THR A CG2 1 
ATOM   684  N N   . GLY A 1 98  ? 8.487  37.616 22.583  1.00 57.57  ? 258 GLY A N   1 
ATOM   685  C CA  . GLY A 1 98  ? 8.812  37.131 23.909  1.00 57.16  ? 258 GLY A CA  1 
ATOM   686  C C   . GLY A 1 98  ? 10.194 37.496 24.416  1.00 56.45  ? 258 GLY A C   1 
ATOM   687  O O   . GLY A 1 98  ? 10.528 37.149 25.558  1.00 56.19  ? 258 GLY A O   1 
ATOM   688  N N   . ALA A 1 99  ? 11.017 38.171 23.612  1.00 52.28  ? 259 ALA A N   1 
ATOM   689  C CA  . ALA A 1 99  ? 12.331 38.576 24.086  1.00 57.39  ? 259 ALA A CA  1 
ATOM   690  C C   . ALA A 1 99  ? 12.264 39.552 25.256  1.00 57.03  ? 259 ALA A C   1 
ATOM   691  O O   . ALA A 1 99  ? 13.284 39.778 25.914  1.00 58.25  ? 259 ALA A O   1 
ATOM   692  C CB  . ALA A 1 99  ? 13.140 39.186 22.942  1.00 44.08  ? 259 ALA A CB  1 
ATOM   693  N N   . ASP A 1 100 ? 11.114 40.154 25.519  1.00 54.44  ? 260 ASP A N   1 
ATOM   694  C CA  . ASP A 1 100 ? 11.023 41.111 26.613  1.00 57.47  ? 260 ASP A CA  1 
ATOM   695  C C   . ASP A 1 100 ? 10.679 40.451 27.935  1.00 56.96  ? 260 ASP A C   1 
ATOM   696  O O   . ASP A 1 100 ? 10.710 41.115 28.965  1.00 56.93  ? 260 ASP A O   1 
ATOM   697  C CB  . ASP A 1 100 ? 10.000 42.202 26.277  1.00 55.02  ? 260 ASP A CB  1 
ATOM   698  C CG  . ASP A 1 100 ? 8.577  41.683 26.249  1.00 60.35  ? 260 ASP A CG  1 
ATOM   699  O OD1 . ASP A 1 100 ? 8.373  40.508 25.860  1.00 66.94  ? 260 ASP A OD1 1 
ATOM   700  O OD2 . ASP A 1 100 ? 7.654  42.460 26.574  1.00 61.25  ? 260 ASP A OD2 1 
ATOM   701  N N   . GLN A 1 101 ? 10.366 39.167 27.934  1.00 56.25  ? 261 GLN A N   1 
ATOM   702  C CA  . GLN A 1 101 ? 10.332 38.388 29.161  1.00 53.26  ? 261 GLN A CA  1 
ATOM   703  C C   . GLN A 1 101 ? 11.736 37.845 29.395  1.00 52.95  ? 261 GLN A C   1 
ATOM   704  O O   . GLN A 1 101 ? 12.194 36.952 28.682  1.00 56.98  ? 261 GLN A O   1 
ATOM   705  C CB  . GLN A 1 101 ? 9.293  37.268 29.088  1.00 51.93  ? 261 GLN A CB  1 
ATOM   706  C CG  . GLN A 1 101 ? 7.991  37.653 28.421  1.00 48.56  ? 261 GLN A CG  1 
ATOM   707  C CD  . GLN A 1 101 ? 7.182  38.617 29.286  1.00 67.03  ? 261 GLN A CD  1 
ATOM   708  O OE1 . GLN A 1 101 ? 7.150  38.480 30.513  1.00 74.25  ? 261 GLN A OE1 1 
ATOM   709  N NE2 . GLN A 1 101 ? 6.538  39.610 28.653  1.00 67.67  ? 261 GLN A NE2 1 
ATOM   710  N N   . LEU A 1 102 ? 12.424 38.398 30.381  1.00 56.84  ? 262 LEU A N   1 
ATOM   711  C CA  . LEU A 1 102 ? 13.800 38.037 30.676  1.00 53.23  ? 262 LEU A CA  1 
ATOM   712  C C   . LEU A 1 102 ? 13.860 36.865 31.640  1.00 52.97  ? 262 LEU A C   1 
ATOM   713  O O   . LEU A 1 102 ? 13.085 36.787 32.596  1.00 57.66  ? 262 LEU A O   1 
ATOM   714  C CB  . LEU A 1 102 ? 14.554 39.218 31.284  1.00 54.86  ? 262 LEU A CB  1 
ATOM   715  C CG  . LEU A 1 102 ? 14.410 40.543 30.545  1.00 61.22  ? 262 LEU A CG  1 
ATOM   716  C CD1 . LEU A 1 102 ? 15.294 41.584 31.203  1.00 49.02  ? 262 LEU A CD1 1 
ATOM   717  C CD2 . LEU A 1 102 ? 14.711 40.410 29.018  1.00 57.90  ? 262 LEU A CD2 1 
ATOM   718  N N   . PHE A 1 103 ? 14.757 35.940 31.353  1.00 54.04  ? 263 PHE A N   1 
ATOM   719  C CA  . PHE A 1 103 ? 15.175 34.907 32.293  1.00 57.65  ? 263 PHE A CA  1 
ATOM   720  C C   . PHE A 1 103 ? 16.540 35.369 32.807  1.00 59.07  ? 263 PHE A C   1 
ATOM   721  O O   . PHE A 1 103 ? 17.546 35.291 32.102  1.00 63.10  ? 263 PHE A O   1 
ATOM   722  C CB  . PHE A 1 103 ? 15.208 33.537 31.606  1.00 53.39  ? 263 PHE A CB  1 
ATOM   723  C CG  . PHE A 1 103 ? 15.849 32.452 32.430  1.00 60.87  ? 263 PHE A CG  1 
ATOM   724  C CD1 . PHE A 1 103 ? 15.381 32.150 33.697  1.00 62.17  ? 263 PHE A CD1 1 
ATOM   725  C CD2 . PHE A 1 103 ? 16.931 31.740 31.943  1.00 64.02  ? 263 PHE A CD2 1 
ATOM   726  C CE1 . PHE A 1 103 ? 15.990 31.166 34.464  1.00 65.88  ? 263 PHE A CE1 1 
ATOM   727  C CE2 . PHE A 1 103 ? 17.532 30.745 32.710  1.00 62.75  ? 263 PHE A CE2 1 
ATOM   728  C CZ  . PHE A 1 103 ? 17.069 30.472 33.965  1.00 64.02  ? 263 PHE A CZ  1 
ATOM   729  N N   . LEU A 1 104 ? 16.580 35.898 34.023  1.00 58.59  ? 264 LEU A N   1 
ATOM   730  C CA  . LEU A 1 104 ? 17.797 36.548 34.514  1.00 59.95  ? 264 LEU A CA  1 
ATOM   731  C C   . LEU A 1 104 ? 18.826 35.531 35.006  1.00 63.63  ? 264 LEU A C   1 
ATOM   732  O O   . LEU A 1 104 ? 19.289 35.571 36.141  1.00 59.52  ? 264 LEU A O   1 
ATOM   733  C CB  . LEU A 1 104 ? 17.460 37.548 35.604  1.00 61.55  ? 264 LEU A CB  1 
ATOM   734  C CG  . LEU A 1 104 ? 16.411 38.538 35.100  1.00 61.31  ? 264 LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 104 ? 15.578 39.071 36.257  1.00 69.35  ? 264 LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 104 ? 17.051 39.650 34.314  1.00 54.33  ? 264 LEU A CD2 1 
ATOM   737  N N   . VAL A 1 105 ? 19.199 34.622 34.101  1.00 67.77  ? 265 VAL A N   1 
ATOM   738  C CA  . VAL A 1 105 ? 20.284 33.667 34.327  1.00 70.19  ? 265 VAL A CA  1 
ATOM   739  C C   . VAL A 1 105 ? 21.601 34.375 34.645  1.00 70.75  ? 265 VAL A C   1 
ATOM   740  O O   . VAL A 1 105 ? 22.476 33.805 35.300  1.00 75.38  ? 265 VAL A O   1 
ATOM   741  C CB  . VAL A 1 105 ? 20.427 32.766 33.090  1.00 72.34  ? 265 VAL A CB  1 
ATOM   742  C CG1 . VAL A 1 105 ? 20.794 33.611 31.860  1.00 69.98  ? 265 VAL A CG1 1 
ATOM   743  C CG2 . VAL A 1 105 ? 21.479 31.675 33.330  1.00 67.08  ? 265 VAL A CG2 1 
ATOM   744  N N   . SER A 1 106 ? 21.785 35.583 34.101  1.00 71.84  ? 266 SER A N   1 
ATOM   745  C CA  . SER A 1 106 ? 23.068 36.286 34.079  1.00 68.16  ? 266 SER A CA  1 
ATOM   746  C C   . SER A 1 106 ? 22.820 37.688 33.531  1.00 63.71  ? 266 SER A C   1 
ATOM   747  O O   . SER A 1 106 ? 21.674 38.008 33.206  1.00 67.77  ? 266 SER A O   1 
ATOM   748  C CB  . SER A 1 106 ? 24.075 35.518 33.210  1.00 71.42  ? 266 SER A CB  1 
ATOM   749  O OG  . SER A 1 106 ? 23.731 35.567 31.835  1.00 70.73  ? 266 SER A OG  1 
ATOM   750  N N   . PRO A 1 107 ? 23.825 38.558 33.424  1.00 65.81  ? 267 PRO A N   1 
ATOM   751  C CA  . PRO A 1 107 ? 23.610 39.823 32.702  1.00 65.01  ? 267 PRO A CA  1 
ATOM   752  C C   . PRO A 1 107 ? 23.176 39.593 31.261  1.00 66.94  ? 267 PRO A C   1 
ATOM   753  O O   . PRO A 1 107 ? 23.832 38.885 30.494  1.00 66.10  ? 267 PRO A O   1 
ATOM   754  C CB  . PRO A 1 107 ? 24.975 40.510 32.780  1.00 65.40  ? 267 PRO A CB  1 
ATOM   755  C CG  . PRO A 1 107 ? 25.527 40.028 34.063  1.00 67.36  ? 267 PRO A CG  1 
ATOM   756  C CD  . PRO A 1 107 ? 25.105 38.577 34.154  1.00 63.13  ? 267 PRO A CD  1 
ATOM   757  N N   . LEU A 1 108 ? 22.056 40.205 30.901  1.00 63.88  ? 268 LEU A N   1 
ATOM   758  C CA  . LEU A 1 108 ? 21.492 40.135 29.565  1.00 59.64  ? 268 LEU A CA  1 
ATOM   759  C C   . LEU A 1 108 ? 21.776 41.420 28.808  1.00 59.34  ? 268 LEU A C   1 
ATOM   760  O O   . LEU A 1 108 ? 21.818 42.510 29.398  1.00 56.33  ? 268 LEU A O   1 
ATOM   761  C CB  . LEU A 1 108 ? 19.981 39.931 29.627  1.00 55.50  ? 268 LEU A CB  1 
ATOM   762  C CG  . LEU A 1 108 ? 19.614 38.626 30.290  1.00 57.90  ? 268 LEU A CG  1 
ATOM   763  C CD1 . LEU A 1 108 ? 18.101 38.509 30.449  1.00 57.89  ? 268 LEU A CD1 1 
ATOM   764  C CD2 . LEU A 1 108 ? 20.175 37.533 29.431  1.00 57.30  ? 268 LEU A CD2 1 
ATOM   765  N N   . THR A 1 109 ? 21.939 41.276 27.485  1.00 53.82  ? 269 THR A N   1 
ATOM   766  C CA  . THR A 1 109 ? 22.026 42.393 26.553  1.00 42.34  ? 269 THR A CA  1 
ATOM   767  C C   . THR A 1 109 ? 20.668 42.626 25.909  1.00 50.76  ? 269 THR A C   1 
ATOM   768  O O   . THR A 1 109 ? 20.200 41.808 25.109  1.00 50.26  ? 269 THR A O   1 
ATOM   769  C CB  . THR A 1 109 ? 23.054 42.112 25.477  1.00 54.96  ? 269 THR A CB  1 
ATOM   770  O OG1 . THR A 1 109 ? 24.251 41.644 26.096  1.00 64.15  ? 269 THR A OG1 1 
ATOM   771  C CG2 . THR A 1 109 ? 23.317 43.378 24.686  1.00 55.77  ? 269 THR A CG2 1 
ATOM   772  N N   . ILE A 1 110 ? 20.051 43.747 26.238  1.00 50.02  ? 270 ILE A N   1 
ATOM   773  C CA  . ILE A 1 110 ? 18.771 44.110 25.652  1.00 49.11  ? 270 ILE A CA  1 
ATOM   774  C C   . ILE A 1 110 ? 19.026 44.759 24.303  1.00 52.22  ? 270 ILE A C   1 
ATOM   775  O O   . ILE A 1 110 ? 19.903 45.623 24.168  1.00 53.99  ? 270 ILE A O   1 
ATOM   776  C CB  . ILE A 1 110 ? 18.002 45.052 26.583  1.00 45.42  ? 270 ILE A CB  1 
ATOM   777  C CG1 . ILE A 1 110 ? 17.901 44.429 27.981  1.00 50.47  ? 270 ILE A CG1 1 
ATOM   778  C CG2 . ILE A 1 110 ? 16.643 45.311 26.037  1.00 47.98  ? 270 ILE A CG2 1 
ATOM   779  C CD1 . ILE A 1 110 ? 17.432 42.992 28.023  1.00 45.57  ? 270 ILE A CD1 1 
ATOM   780  N N   . CYS A 1 111 ? 18.254 44.357 23.303  1.00 52.18  ? 271 CYS A N   1 
ATOM   781  C CA  . CYS A 1 111 ? 18.449 44.805 21.935  1.00 47.06  ? 271 CYS A CA  1 
ATOM   782  C C   . CYS A 1 111 ? 17.186 45.480 21.437  1.00 50.59  ? 271 CYS A C   1 
ATOM   783  O O   . CYS A 1 111 ? 16.106 44.885 21.480  1.00 56.09  ? 271 CYS A O   1 
ATOM   784  C CB  . CYS A 1 111 ? 18.801 43.627 21.047  1.00 49.67  ? 271 CYS A CB  1 
ATOM   785  S SG  . CYS A 1 111 ? 20.240 42.821 21.655  1.00 55.13  ? 271 CYS A SG  1 
ATOM   786  N N   . HIS A 1 112 ? 17.319 46.722 20.996  1.00 46.00  ? 272 HIS A N   1 
ATOM   787  C CA  . HIS A 1 112 ? 16.288 47.401 20.231  1.00 50.33  ? 272 HIS A CA  1 
ATOM   788  C C   . HIS A 1 112 ? 16.800 47.461 18.797  1.00 50.92  ? 272 HIS A C   1 
ATOM   789  O O   . HIS A 1 112 ? 17.578 48.348 18.440  1.00 54.92  ? 272 HIS A O   1 
ATOM   790  C CB  . HIS A 1 112 ? 15.977 48.802 20.758  1.00 48.42  ? 272 HIS A CB  1 
ATOM   791  C CG  . HIS A 1 112 ? 15.165 49.616 19.799  1.00 49.19  ? 272 HIS A CG  1 
ATOM   792  N ND1 . HIS A 1 112 ? 13.893 49.250 19.408  1.00 49.64  ? 272 HIS A ND1 1 
ATOM   793  C CD2 . HIS A 1 112 ? 15.463 50.733 19.095  1.00 54.27  ? 272 HIS A CD2 1 
ATOM   794  C CE1 . HIS A 1 112 ? 13.428 50.127 18.536  1.00 50.45  ? 272 HIS A CE1 1 
ATOM   795  N NE2 . HIS A 1 112 ? 14.359 51.042 18.332  1.00 51.04  ? 272 HIS A NE2 1 
ATOM   796  N N   . VAL A 1 113 ? 16.371 46.508 17.981  1.00 54.80  ? 273 VAL A N   1 
ATOM   797  C CA  . VAL A 1 113 ? 16.756 46.495 16.574  1.00 49.93  ? 273 VAL A CA  1 
ATOM   798  C C   . VAL A 1 113 ? 16.173 47.727 15.901  1.00 49.18  ? 273 VAL A C   1 
ATOM   799  O O   . VAL A 1 113 ? 14.956 47.938 15.911  1.00 55.14  ? 273 VAL A O   1 
ATOM   800  C CB  . VAL A 1 113 ? 16.269 45.202 15.916  1.00 46.90  ? 273 VAL A CB  1 
ATOM   801  C CG1 . VAL A 1 113 ? 16.242 45.327 14.417  1.00 52.30  ? 273 VAL A CG1 1 
ATOM   802  C CG2 . VAL A 1 113 ? 17.145 44.060 16.344  1.00 42.11  ? 273 VAL A CG2 1 
ATOM   803  N N   . ILE A 1 114 ? 17.033 48.560 15.328  1.00 47.33  ? 274 ILE A N   1 
ATOM   804  C CA  . ILE A 1 114 ? 16.571 49.802 14.721  1.00 52.15  ? 274 ILE A CA  1 
ATOM   805  C C   . ILE A 1 114 ? 16.046 49.509 13.318  1.00 49.95  ? 274 ILE A C   1 
ATOM   806  O O   . ILE A 1 114 ? 16.809 49.117 12.431  1.00 55.27  ? 274 ILE A O   1 
ATOM   807  C CB  . ILE A 1 114 ? 17.679 50.851 14.682  1.00 52.12  ? 274 ILE A CB  1 
ATOM   808  C CG1 . ILE A 1 114 ? 18.418 50.885 16.015  1.00 51.36  ? 274 ILE A CG1 1 
ATOM   809  C CG2 . ILE A 1 114 ? 17.070 52.201 14.391  1.00 59.43  ? 274 ILE A CG2 1 
ATOM   810  C CD1 . ILE A 1 114 ? 19.375 52.051 16.147  1.00 50.32  ? 274 ILE A CD1 1 
ATOM   811  N N   . ASP A 1 115 ? 14.746 49.698 13.118  1.00 51.90  ? 275 ASP A N   1 
ATOM   812  C CA  . ASP A 1 115 ? 14.112 49.496 11.814  1.00 48.80  ? 275 ASP A CA  1 
ATOM   813  C C   . ASP A 1 115 ? 13.188 50.675 11.508  1.00 53.98  ? 275 ASP A C   1 
ATOM   814  O O   . ASP A 1 115 ? 13.258 51.754 12.110  1.00 55.48  ? 275 ASP A O   1 
ATOM   815  C CB  . ASP A 1 115 ? 13.370 48.152 11.775  1.00 49.04  ? 275 ASP A CB  1 
ATOM   816  C CG  . ASP A 1 115 ? 12.152 48.111 12.713  1.00 64.54  ? 275 ASP A CG  1 
ATOM   817  O OD1 . ASP A 1 115 ? 11.815 49.126 13.357  1.00 57.31  ? 275 ASP A OD1 1 
ATOM   818  O OD2 . ASP A 1 115 ? 11.558 47.016 12.857  1.00 66.12  ? 275 ASP A OD2 1 
ATOM   819  N N   . ALA A 1 116 ? 12.262 50.471 10.571  1.00 56.98  ? 276 ALA A N   1 
ATOM   820  C CA  . ALA A 1 116 ? 11.404 51.576 10.150  1.00 61.84  ? 276 ALA A CA  1 
ATOM   821  C C   . ALA A 1 116 ? 10.408 51.962 11.235  1.00 64.74  ? 276 ALA A C   1 
ATOM   822  O O   . ALA A 1 116 ? 9.995  53.126 11.304  1.00 61.25  ? 276 ALA A O   1 
ATOM   823  C CB  . ALA A 1 116 ? 10.665 51.219 8.861   1.00 51.24  ? 276 ALA A CB  1 
ATOM   824  N N   . LYS A 1 117 ? 9.998  51.002 12.071  1.00 61.82  ? 277 LYS A N   1 
ATOM   825  C CA  . LYS A 1 117 ? 9.049  51.287 13.137  1.00 66.22  ? 277 LYS A CA  1 
ATOM   826  C C   . LYS A 1 117 ? 9.708  51.912 14.356  1.00 60.39  ? 277 LYS A C   1 
ATOM   827  O O   . LYS A 1 117 ? 8.992  52.298 15.277  1.00 59.57  ? 277 LYS A O   1 
ATOM   828  C CB  . LYS A 1 117 ? 8.299  50.015 13.575  1.00 65.00  ? 277 LYS A CB  1 
ATOM   829  C CG  . LYS A 1 117 ? 7.562  49.263 12.453  1.00 68.92  ? 277 LYS A CG  1 
ATOM   830  C CD  . LYS A 1 117 ? 6.528  50.146 11.723  1.00 76.52  ? 277 LYS A CD  1 
ATOM   831  C CE  . LYS A 1 117 ? 6.511  49.870 10.198  1.00 75.79  ? 277 LYS A CE  1 
ATOM   832  N NZ  . LYS A 1 117 ? 5.978  50.981 9.349   1.00 68.47  ? 277 LYS A NZ  1 
ATOM   833  N N   . SER A 1 118 ? 11.048 52.018 14.386  1.00 59.49  ? 278 SER A N   1 
ATOM   834  C CA  . SER A 1 118 ? 11.754 52.540 15.545  1.00 55.84  ? 278 SER A CA  1 
ATOM   835  C C   . SER A 1 118 ? 11.819 54.062 15.507  1.00 55.27  ? 278 SER A C   1 
ATOM   836  O O   . SER A 1 118 ? 11.901 54.661 14.437  1.00 62.86  ? 278 SER A O   1 
ATOM   837  C CB  . SER A 1 118 ? 13.174 52.003 15.601  1.00 54.86  ? 278 SER A CB  1 
ATOM   838  O OG  . SER A 1 118 ? 13.980 52.889 16.377  1.00 56.26  ? 278 SER A OG  1 
ATOM   839  N N   . PRO A 1 119 ? 11.814 54.717 16.665  1.00 55.97  ? 279 PRO A N   1 
ATOM   840  C CA  . PRO A 1 119 ? 12.069 56.164 16.684  1.00 53.47  ? 279 PRO A CA  1 
ATOM   841  C C   . PRO A 1 119 ? 13.512 56.510 16.424  1.00 51.36  ? 279 PRO A C   1 
ATOM   842  O O   . PRO A 1 119 ? 13.825 57.697 16.324  1.00 57.31  ? 279 PRO A O   1 
ATOM   843  C CB  . PRO A 1 119 ? 11.657 56.587 18.109  1.00 50.32  ? 279 PRO A CB  1 
ATOM   844  C CG  . PRO A 1 119 ? 10.957 55.410 18.695  1.00 52.73  ? 279 PRO A CG  1 
ATOM   845  C CD  . PRO A 1 119 ? 11.497 54.198 18.003  1.00 59.25  ? 279 PRO A CD  1 
ATOM   846  N N   . PHE A 1 120 ? 14.403 55.523 16.356  1.00 52.53  ? 280 PHE A N   1 
ATOM   847  C CA  . PHE A 1 120 ? 15.804 55.745 16.026  1.00 57.91  ? 280 PHE A CA  1 
ATOM   848  C C   . PHE A 1 120 ? 16.102 55.497 14.541  1.00 59.78  ? 280 PHE A C   1 
ATOM   849  O O   . PHE A 1 120 ? 17.276 55.454 14.149  1.00 55.16  ? 280 PHE A O   1 
ATOM   850  C CB  . PHE A 1 120 ? 16.674 54.871 16.933  1.00 58.57  ? 280 PHE A CB  1 
ATOM   851  C CG  . PHE A 1 120 ? 16.796 55.416 18.353  1.00 64.66  ? 280 PHE A CG  1 
ATOM   852  C CD1 . PHE A 1 120 ? 17.153 56.736 18.574  1.00 63.35  ? 280 PHE A CD1 1 
ATOM   853  C CD2 . PHE A 1 120 ? 16.507 54.630 19.454  1.00 59.11  ? 280 PHE A CD2 1 
ATOM   854  C CE1 . PHE A 1 120 ? 17.266 57.242 19.857  1.00 59.72  ? 280 PHE A CE1 1 
ATOM   855  C CE2 . PHE A 1 120 ? 16.603 55.147 20.728  1.00 57.31  ? 280 PHE A CE2 1 
ATOM   856  C CZ  . PHE A 1 120 ? 16.987 56.454 20.926  1.00 56.48  ? 280 PHE A CZ  1 
ATOM   857  N N   . TYR A 1 121 ? 15.056 55.365 13.712  1.00 56.68  ? 281 TYR A N   1 
ATOM   858  C CA  . TYR A 1 121 ? 15.208 55.099 12.282  1.00 63.13  ? 281 TYR A CA  1 
ATOM   859  C C   . TYR A 1 121 ? 16.222 56.039 11.634  1.00 62.13  ? 281 TYR A C   1 
ATOM   860  O O   . TYR A 1 121 ? 17.231 55.598 11.077  1.00 60.79  ? 281 TYR A O   1 
ATOM   861  C CB  . TYR A 1 121 ? 13.845 55.225 11.596  1.00 61.86  ? 281 TYR A CB  1 
ATOM   862  C CG  . TYR A 1 121 ? 13.783 54.651 10.194  1.00 58.73  ? 281 TYR A CG  1 
ATOM   863  C CD1 . TYR A 1 121 ? 14.341 53.414 9.906   1.00 60.17  ? 281 TYR A CD1 1 
ATOM   864  C CD2 . TYR A 1 121 ? 13.150 55.342 9.163   1.00 62.21  ? 281 TYR A CD2 1 
ATOM   865  C CE1 . TYR A 1 121 ? 14.273 52.868 8.624   1.00 65.10  ? 281 TYR A CE1 1 
ATOM   866  C CE2 . TYR A 1 121 ? 13.072 54.810 7.873   1.00 63.57  ? 281 TYR A CE2 1 
ATOM   867  C CZ  . TYR A 1 121 ? 13.637 53.573 7.613   1.00 70.55  ? 281 TYR A CZ  1 
ATOM   868  O OH  . TYR A 1 121 ? 13.570 53.037 6.344   1.00 68.55  ? 281 TYR A OH  1 
ATOM   869  N N   . ASP A 1 122 ? 15.967 57.345 11.705  1.00 63.61  ? 282 ASP A N   1 
ATOM   870  C CA  . ASP A 1 122 ? 16.861 58.354 11.159  1.00 66.13  ? 282 ASP A CA  1 
ATOM   871  C C   . ASP A 1 122 ? 17.945 58.797 12.140  1.00 68.34  ? 282 ASP A C   1 
ATOM   872  O O   . ASP A 1 122 ? 18.501 59.885 11.969  1.00 69.62  ? 282 ASP A O   1 
ATOM   873  C CB  . ASP A 1 122 ? 16.063 59.574 10.705  1.00 68.55  ? 282 ASP A CB  1 
ATOM   874  C CG  . ASP A 1 122 ? 16.731 60.312 9.549   1.00 82.44  ? 282 ASP A CG  1 
ATOM   875  O OD1 . ASP A 1 122 ? 17.916 60.015 9.237   1.00 79.48  ? 282 ASP A OD1 1 
ATOM   876  O OD2 . ASP A 1 122 ? 16.069 61.197 8.955   1.00 83.98  ? 282 ASP A OD2 1 
ATOM   877  N N   . LEU A 1 123 ? 18.254 58.000 13.165  1.00 69.31  ? 283 LEU A N   1 
ATOM   878  C CA  . LEU A 1 123 ? 19.359 58.341 14.057  1.00 68.22  ? 283 LEU A CA  1 
ATOM   879  C C   . LEU A 1 123 ? 20.669 57.874 13.431  1.00 67.65  ? 283 LEU A C   1 
ATOM   880  O O   . LEU A 1 123 ? 20.828 56.687 13.122  1.00 67.54  ? 283 LEU A O   1 
ATOM   881  C CB  . LEU A 1 123 ? 19.173 57.723 15.442  1.00 64.94  ? 283 LEU A CB  1 
ATOM   882  C CG  . LEU A 1 123 ? 20.222 58.195 16.460  1.00 66.85  ? 283 LEU A CG  1 
ATOM   883  C CD1 . LEU A 1 123 ? 19.918 59.605 16.962  1.00 65.01  ? 283 LEU A CD1 1 
ATOM   884  C CD2 . LEU A 1 123 ? 20.387 57.203 17.625  1.00 58.06  ? 283 LEU A CD2 1 
ATOM   885  N N   . SER A 1 124 ? 21.596 58.809 13.236  1.00 64.74  ? 284 SER A N   1 
ATOM   886  C CA  . SER A 1 124 ? 22.900 58.529 12.646  1.00 68.57  ? 284 SER A CA  1 
ATOM   887  C C   . SER A 1 124 ? 23.986 59.028 13.582  1.00 65.26  ? 284 SER A C   1 
ATOM   888  O O   . SER A 1 124 ? 23.742 59.870 14.447  1.00 66.24  ? 284 SER A O   1 
ATOM   889  C CB  . SER A 1 124 ? 23.083 59.215 11.285  1.00 61.09  ? 284 SER A CB  1 
ATOM   890  O OG  . SER A 1 124 ? 23.330 60.599 11.484  1.00 58.12  ? 284 SER A OG  1 
ATOM   891  N N   . GLN A 1 125 ? 25.208 58.534 13.365  1.00 65.91  ? 285 GLN A N   1 
ATOM   892  C CA  . GLN A 1 125 ? 26.333 58.990 14.174  1.00 64.38  ? 285 GLN A CA  1 
ATOM   893  C C   . GLN A 1 125 ? 26.455 60.509 14.178  1.00 66.17  ? 285 GLN A C   1 
ATOM   894  O O   . GLN A 1 125 ? 26.822 61.090 15.201  1.00 66.21  ? 285 GLN A O   1 
ATOM   895  C CB  . GLN A 1 125 ? 27.641 58.354 13.696  1.00 66.75  ? 285 GLN A CB  1 
ATOM   896  C CG  . GLN A 1 125 ? 28.780 58.520 14.708  1.00 67.42  ? 285 GLN A CG  1 
ATOM   897  C CD  . GLN A 1 125 ? 30.005 57.644 14.430  1.00 70.93  ? 285 GLN A CD  1 
ATOM   898  O OE1 . GLN A 1 125 ? 30.046 56.866 13.469  1.00 76.53  ? 285 GLN A OE1 1 
ATOM   899  N NE2 . GLN A 1 125 ? 31.010 57.770 15.287  1.00 75.33  ? 285 GLN A NE2 1 
ATOM   900  N N   . ARG A 1 126 ? 26.138 61.181 13.066  1.00 73.34  ? 286 ARG A N   1 
ATOM   901  C CA  . ARG A 1 126 ? 26.240 62.637 13.099  1.00 75.63  ? 286 ARG A CA  1 
ATOM   902  C C   . ARG A 1 126 ? 25.017 63.262 13.772  1.00 75.05  ? 286 ARG A C   1 
ATOM   903  O O   . ARG A 1 126 ? 25.159 63.985 14.764  1.00 77.28  ? 286 ARG A O   1 
ATOM   904  C CB  . ARG A 1 126 ? 26.465 63.204 11.698  1.00 79.01  ? 286 ARG A CB  1 
ATOM   905  C CG  . ARG A 1 126 ? 26.569 64.739 11.681  1.00 98.91  ? 286 ARG A CG  1 
ATOM   906  C CD  . ARG A 1 126 ? 27.087 65.317 10.344  1.00 103.09 ? 286 ARG A CD  1 
ATOM   907  N NE  . ARG A 1 126 ? 27.985 66.466 10.526  1.00 106.80 ? 286 ARG A NE  1 
ATOM   908  C CZ  . ARG A 1 126 ? 29.194 66.441 11.094  1.00 108.61 ? 286 ARG A CZ  1 
ATOM   909  N NH1 . ARG A 1 126 ? 29.733 65.312 11.543  1.00 108.36 ? 286 ARG A NH1 1 
ATOM   910  N NH2 . ARG A 1 126 ? 29.883 67.569 11.195  1.00 108.29 ? 286 ARG A NH2 1 
ATOM   911  N N   . SER A 1 127 ? 23.805 62.948 13.291  1.00 72.42  ? 287 SER A N   1 
ATOM   912  C CA  . SER A 1 127 ? 22.578 63.497 13.884  1.00 73.48  ? 287 SER A CA  1 
ATOM   913  C C   . SER A 1 127 ? 22.536 63.357 15.403  1.00 74.87  ? 287 SER A C   1 
ATOM   914  O O   . SER A 1 127 ? 21.826 64.119 16.069  1.00 76.47  ? 287 SER A O   1 
ATOM   915  C CB  . SER A 1 127 ? 21.331 62.829 13.273  1.00 71.27  ? 287 SER A CB  1 
ATOM   916  O OG  . SER A 1 127 ? 20.999 61.591 13.893  1.00 61.45  ? 287 SER A OG  1 
ATOM   917  N N   . MET A 1 128 ? 23.298 62.413 15.960  1.00 72.47  ? 288 MET A N   1 
ATOM   918  C CA  . MET A 1 128 ? 23.340 62.212 17.403  1.00 76.32  ? 288 MET A CA  1 
ATOM   919  C C   . MET A 1 128 ? 23.787 63.471 18.144  1.00 74.12  ? 288 MET A C   1 
ATOM   920  O O   . MET A 1 128 ? 23.210 63.832 19.176  1.00 71.24  ? 288 MET A O   1 
ATOM   921  C CB  . MET A 1 128 ? 24.274 61.044 17.727  1.00 69.89  ? 288 MET A CB  1 
ATOM   922  C CG  . MET A 1 128 ? 24.269 60.667 19.193  1.00 83.52  ? 288 MET A CG  1 
ATOM   923  S SD  . MET A 1 128 ? 23.292 59.192 19.537  1.00 84.82  ? 288 MET A SD  1 
ATOM   924  C CE  . MET A 1 128 ? 24.434 57.967 18.913  1.00 67.39  ? 288 MET A CE  1 
ATOM   925  N N   . GLN A 1 129 ? 24.800 64.163 17.622  1.00 76.19  ? 289 GLN A N   1 
ATOM   926  C CA  . GLN A 1 129 ? 25.347 65.330 18.308  1.00 77.47  ? 289 GLN A CA  1 
ATOM   927  C C   . GLN A 1 129 ? 24.389 66.511 18.373  1.00 73.96  ? 289 GLN A C   1 
ATOM   928  O O   . GLN A 1 129 ? 24.656 67.458 19.119  1.00 70.23  ? 289 GLN A O   1 
ATOM   929  C CB  . GLN A 1 129 ? 26.637 65.786 17.628  1.00 80.64  ? 289 GLN A CB  1 
ATOM   930  C CG  . GLN A 1 129 ? 27.493 64.649 17.123  1.00 83.31  ? 289 GLN A CG  1 
ATOM   931  C CD  . GLN A 1 129 ? 28.800 65.143 16.542  1.00 95.52  ? 289 GLN A CD  1 
ATOM   932  O OE1 . GLN A 1 129 ? 29.850 64.532 16.750  1.00 99.34  ? 289 GLN A OE1 1 
ATOM   933  N NE2 . GLN A 1 129 ? 28.747 66.261 15.816  1.00 94.85  ? 289 GLN A NE2 1 
ATOM   934  N N   . THR A 1 130 ? 23.273 66.477 17.659  1.00 72.50  ? 290 THR A N   1 
ATOM   935  C CA  . THR A 1 130 ? 22.287 67.534 17.808  1.00 70.48  ? 290 THR A CA  1 
ATOM   936  C C   . THR A 1 130 ? 20.981 67.046 18.413  1.00 70.34  ? 290 THR A C   1 
ATOM   937  O O   . THR A 1 130 ? 20.161 67.877 18.814  1.00 69.68  ? 290 THR A O   1 
ATOM   938  C CB  . THR A 1 130 ? 22.009 68.203 16.451  1.00 75.94  ? 290 THR A CB  1 
ATOM   939  O OG1 . THR A 1 130 ? 20.958 67.508 15.763  1.00 80.97  ? 290 THR A OG1 1 
ATOM   940  C CG2 . THR A 1 130 ? 23.253 68.199 15.585  1.00 78.92  ? 290 THR A CG2 1 
ATOM   941  N N   . GLU A 1 131 ? 20.797 65.736 18.576  1.00 72.47  ? 291 GLU A N   1 
ATOM   942  C CA  . GLU A 1 131 ? 19.554 65.216 19.128  1.00 75.32  ? 291 GLU A CA  1 
ATOM   943  C C   . GLU A 1 131 ? 19.540 65.323 20.650  1.00 69.99  ? 291 GLU A C   1 
ATOM   944  O O   . GLU A 1 131 ? 20.574 65.245 21.319  1.00 71.93  ? 291 GLU A O   1 
ATOM   945  C CB  . GLU A 1 131 ? 19.336 63.759 18.711  1.00 74.88  ? 291 GLU A CB  1 
ATOM   946  C CG  . GLU A 1 131 ? 18.916 63.572 17.246  1.00 77.07  ? 291 GLU A CG  1 
ATOM   947  C CD  . GLU A 1 131 ? 17.434 63.762 17.029  1.00 84.96  ? 291 GLU A CD  1 
ATOM   948  O OE1 . GLU A 1 131 ? 16.644 62.984 17.613  1.00 90.72  ? 291 GLU A OE1 1 
ATOM   949  O OE2 . GLU A 1 131 ? 17.061 64.698 16.289  1.00 86.32  ? 291 GLU A OE2 1 
ATOM   950  N N   . GLN A 1 132 ? 18.347 65.521 21.191  1.00 66.19  ? 292 GLN A N   1 
ATOM   951  C CA  . GLN A 1 132 ? 18.102 65.413 22.626  1.00 66.59  ? 292 GLN A CA  1 
ATOM   952  C C   . GLN A 1 132 ? 16.993 64.383 22.818  1.00 67.61  ? 292 GLN A C   1 
ATOM   953  O O   . GLN A 1 132 ? 15.827 64.653 22.516  1.00 69.10  ? 292 GLN A O   1 
ATOM   954  C CB  . GLN A 1 132 ? 17.717 66.754 23.213  1.00 61.53  ? 292 GLN A CB  1 
ATOM   955  C CG  . GLN A 1 132 ? 18.884 67.497 23.789  1.00 78.18  ? 292 GLN A CG  1 
ATOM   956  C CD  . GLN A 1 132 ? 18.447 68.778 24.447  1.00 83.83  ? 292 GLN A CD  1 
ATOM   957  O OE1 . GLN A 1 132 ? 17.403 69.330 24.105  1.00 84.08  ? 292 GLN A OE1 1 
ATOM   958  N NE2 . GLN A 1 132 ? 19.236 69.255 25.408  1.00 93.57  ? 292 GLN A NE2 1 
ATOM   959  N N   . PHE A 1 133 ? 17.340 63.194 23.290  1.00 60.76  ? 293 PHE A N   1 
ATOM   960  C CA  . PHE A 1 133 ? 16.321 62.216 23.641  1.00 61.78  ? 293 PHE A CA  1 
ATOM   961  C C   . PHE A 1 133 ? 16.641 61.616 25.003  1.00 54.28  ? 293 PHE A C   1 
ATOM   962  O O   . PHE A 1 133 ? 17.616 61.991 25.659  1.00 63.03  ? 293 PHE A O   1 
ATOM   963  C CB  . PHE A 1 133 ? 16.195 61.124 22.575  1.00 57.25  ? 293 PHE A CB  1 
ATOM   964  C CG  . PHE A 1 133 ? 17.494 60.446 22.218  1.00 59.02  ? 293 PHE A CG  1 
ATOM   965  C CD1 . PHE A 1 133 ? 18.021 59.452 23.029  1.00 54.39  ? 293 PHE A CD1 1 
ATOM   966  C CD2 . PHE A 1 133 ? 18.159 60.768 21.043  1.00 57.24  ? 293 PHE A CD2 1 
ATOM   967  C CE1 . PHE A 1 133 ? 19.190 58.810 22.689  1.00 54.54  ? 293 PHE A CE1 1 
ATOM   968  C CE2 . PHE A 1 133 ? 19.328 60.123 20.701  1.00 59.29  ? 293 PHE A CE2 1 
ATOM   969  C CZ  . PHE A 1 133 ? 19.843 59.141 21.532  1.00 54.89  ? 293 PHE A CZ  1 
ATOM   970  N N   . GLU A 1 134 ? 15.804 60.672 25.428  1.00 56.76  ? 294 GLU A N   1 
ATOM   971  C CA  . GLU A 1 134 ? 16.021 59.991 26.702  1.00 57.95  ? 294 GLU A CA  1 
ATOM   972  C C   . GLU A 1 134 ? 15.318 58.638 26.657  1.00 56.40  ? 294 GLU A C   1 
ATOM   973  O O   . GLU A 1 134 ? 14.082 58.582 26.589  1.00 51.03  ? 294 GLU A O   1 
ATOM   974  C CB  . GLU A 1 134 ? 15.518 60.843 27.862  1.00 54.88  ? 294 GLU A CB  1 
ATOM   975  C CG  . GLU A 1 134 ? 15.808 60.243 29.228  1.00 59.12  ? 294 GLU A CG  1 
ATOM   976  C CD  . GLU A 1 134 ? 15.747 61.267 30.353  1.00 59.41  ? 294 GLU A CD  1 
ATOM   977  O OE1 . GLU A 1 134 ? 16.008 62.453 30.103  1.00 65.44  ? 294 GLU A OE1 1 
ATOM   978  O OE2 . GLU A 1 134 ? 15.455 60.884 31.497  1.00 67.06  ? 294 GLU A OE2 1 
ATOM   979  N N   . VAL A 1 135 ? 16.106 57.566 26.707  1.00 53.46  ? 295 VAL A N   1 
ATOM   980  C CA  . VAL A 1 135 ? 15.590 56.205 26.743  1.00 49.03  ? 295 VAL A CA  1 
ATOM   981  C C   . VAL A 1 135 ? 15.314 55.857 28.195  1.00 54.26  ? 295 VAL A C   1 
ATOM   982  O O   . VAL A 1 135 ? 16.239 55.802 29.009  1.00 55.63  ? 295 VAL A O   1 
ATOM   983  C CB  . VAL A 1 135 ? 16.594 55.218 26.139  1.00 47.41  ? 295 VAL A CB  1 
ATOM   984  C CG1 . VAL A 1 135 ? 16.273 53.774 26.580  1.00 39.83  ? 295 VAL A CG1 1 
ATOM   985  C CG2 . VAL A 1 135 ? 16.649 55.370 24.619  1.00 51.74  ? 295 VAL A CG2 1 
ATOM   986  N N   . VAL A 1 136 ? 14.063 55.610 28.527  1.00 47.94  ? 296 VAL A N   1 
ATOM   987  C CA  . VAL A 1 136 ? 13.717 55.167 29.867  1.00 50.15  ? 296 VAL A CA  1 
ATOM   988  C C   . VAL A 1 136 ? 13.483 53.668 29.839  1.00 51.25  ? 296 VAL A C   1 
ATOM   989  O O   . VAL A 1 136 ? 12.850 53.139 28.914  1.00 48.80  ? 296 VAL A O   1 
ATOM   990  C CB  . VAL A 1 136 ? 12.486 55.917 30.394  1.00 51.69  ? 296 VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 136 ? 12.111 55.413 31.791  1.00 48.37  ? 296 VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 136 ? 12.766 57.399 30.393  1.00 48.77  ? 296 VAL A CG2 1 
ATOM   993  N N   . VAL A 1 137 ? 13.986 52.980 30.855  1.00 48.94  ? 297 VAL A N   1 
ATOM   994  C CA  . VAL A 1 137 ? 13.897 51.529 30.957  1.00 48.44  ? 297 VAL A CA  1 
ATOM   995  C C   . VAL A 1 137 ? 13.092 51.202 32.208  1.00 54.70  ? 297 VAL A C   1 
ATOM   996  O O   . VAL A 1 137 ? 13.408 51.693 33.298  1.00 54.42  ? 297 VAL A O   1 
ATOM   997  C CB  . VAL A 1 137 ? 15.301 50.889 30.998  1.00 49.52  ? 297 VAL A CB  1 
ATOM   998  C CG1 . VAL A 1 137 ? 15.221 49.370 31.041  1.00 43.83  ? 297 VAL A CG1 1 
ATOM   999  C CG2 . VAL A 1 137 ? 16.127 51.349 29.795  1.00 46.78  ? 297 VAL A CG2 1 
ATOM   1000 N N   . ILE A 1 138 ? 12.036 50.407 32.051  1.00 56.08  ? 298 ILE A N   1 
ATOM   1001 C CA  . ILE A 1 138 ? 11.202 49.971 33.167  1.00 53.23  ? 298 ILE A CA  1 
ATOM   1002 C C   . ILE A 1 138 ? 11.259 48.460 33.236  1.00 49.78  ? 298 ILE A C   1 
ATOM   1003 O O   . ILE A 1 138 ? 10.868 47.773 32.287  1.00 59.76  ? 298 ILE A O   1 
ATOM   1004 C CB  . ILE A 1 138 ? 9.745  50.424 33.028  1.00 52.97  ? 298 ILE A CB  1 
ATOM   1005 C CG1 . ILE A 1 138 ? 9.636  51.946 32.946  1.00 58.05  ? 298 ILE A CG1 1 
ATOM   1006 C CG2 . ILE A 1 138 ? 8.925  49.866 34.163  1.00 51.91  ? 298 ILE A CG2 1 
ATOM   1007 C CD1 . ILE A 1 138 ? 9.153  52.446 31.577  1.00 47.87  ? 298 ILE A CD1 1 
ATOM   1008 N N   . LEU A 1 139 ? 11.701 47.938 34.358  1.00 48.08  ? 299 LEU A N   1 
ATOM   1009 C CA  . LEU A 1 139 ? 11.830 46.505 34.523  1.00 48.29  ? 299 LEU A CA  1 
ATOM   1010 C C   . LEU A 1 139 ? 11.020 46.083 35.736  1.00 56.67  ? 299 LEU A C   1 
ATOM   1011 O O   . LEU A 1 139 ? 11.178 46.642 36.825  1.00 55.47  ? 299 LEU A O   1 
ATOM   1012 C CB  . LEU A 1 139 ? 13.298 46.109 34.660  1.00 49.41  ? 299 LEU A CB  1 
ATOM   1013 C CG  . LEU A 1 139 ? 13.614 44.629 34.820  1.00 53.53  ? 299 LEU A CG  1 
ATOM   1014 C CD1 . LEU A 1 139 ? 14.911 44.386 34.134  1.00 46.73  ? 299 LEU A CD1 1 
ATOM   1015 C CD2 . LEU A 1 139 ? 13.691 44.228 36.308  1.00 56.11  ? 299 LEU A CD2 1 
ATOM   1016 N N   . GLU A 1 140 ? 10.132 45.124 35.534  1.00 58.83  ? 300 GLU A N   1 
ATOM   1017 C CA  . GLU A 1 140 ? 9.309  44.582 36.599  1.00 59.46  ? 300 GLU A CA  1 
ATOM   1018 C C   . GLU A 1 140 ? 9.621  43.106 36.692  1.00 63.05  ? 300 GLU A C   1 
ATOM   1019 O O   . GLU A 1 140 ? 9.455  42.374 35.710  1.00 58.82  ? 300 GLU A O   1 
ATOM   1020 C CB  . GLU A 1 140 ? 7.826  44.791 36.328  1.00 61.75  ? 300 GLU A CB  1 
ATOM   1021 C CG  . GLU A 1 140 ? 7.386  46.222 36.404  1.00 70.33  ? 300 GLU A CG  1 
ATOM   1022 C CD  . GLU A 1 140 ? 5.958  46.378 35.954  1.00 77.24  ? 300 GLU A CD  1 
ATOM   1023 O OE1 . GLU A 1 140 ? 5.300  45.347 35.697  1.00 79.49  ? 300 GLU A OE1 1 
ATOM   1024 O OE2 . GLU A 1 140 ? 5.503  47.531 35.845  1.00 78.62  ? 300 GLU A OE2 1 
ATOM   1025 N N   . GLY A 1 141 ? 10.065 42.677 37.875  1.00 63.04  ? 301 GLY A N   1 
ATOM   1026 C CA  . GLY A 1 141 ? 10.608 41.348 38.059  1.00 68.03  ? 301 GLY A CA  1 
ATOM   1027 C C   . GLY A 1 141 ? 10.062 40.677 39.305  1.00 75.03  ? 301 GLY A C   1 
ATOM   1028 O O   . GLY A 1 141 ? 9.215  41.229 40.021  1.00 74.39  ? 301 GLY A O   1 
ATOM   1029 N N   . ILE A 1 142 ? 10.550 39.453 39.523  1.00 70.69  ? 302 ILE A N   1 
ATOM   1030 C CA  . ILE A 1 142 ? 10.072 38.571 40.578  1.00 74.03  ? 302 ILE A CA  1 
ATOM   1031 C C   . ILE A 1 142 ? 11.249 38.304 41.491  1.00 74.40  ? 302 ILE A C   1 
ATOM   1032 O O   . ILE A 1 142 ? 12.183 37.580 41.115  1.00 72.64  ? 302 ILE A O   1 
ATOM   1033 C CB  . ILE A 1 142 ? 9.499  37.263 40.023  1.00 73.22  ? 302 ILE A CB  1 
ATOM   1034 C CG1 . ILE A 1 142 ? 8.320  37.580 39.101  1.00 64.03  ? 302 ILE A CG1 1 
ATOM   1035 C CG2 . ILE A 1 142 ? 9.047  36.348 41.171  1.00 74.62  ? 302 ILE A CG2 1 
ATOM   1036 C CD1 . ILE A 1 142 ? 7.706  36.370 38.470  1.00 71.74  ? 302 ILE A CD1 1 
ATOM   1037 N N   . VAL A 1 143 ? 11.222 38.921 42.674  1.00 75.12  ? 303 VAL A N   1 
ATOM   1038 C CA  . VAL A 1 143 ? 12.175 38.594 43.727  1.00 81.03  ? 303 VAL A CA  1 
ATOM   1039 C C   . VAL A 1 143 ? 12.121 37.103 44.017  1.00 78.76  ? 303 VAL A C   1 
ATOM   1040 O O   . VAL A 1 143 ? 11.043 36.537 44.231  1.00 75.80  ? 303 VAL A O   1 
ATOM   1041 C CB  . VAL A 1 143 ? 11.874 39.433 44.979  1.00 83.58  ? 303 VAL A CB  1 
ATOM   1042 C CG1 . VAL A 1 143 ? 12.479 40.793 44.813  1.00 86.84  ? 303 VAL A CG1 1 
ATOM   1043 C CG2 . VAL A 1 143 ? 10.358 39.580 45.181  1.00 87.14  ? 303 VAL A CG2 1 
ATOM   1044 N N   . GLU A 1 144 ? 13.289 36.455 44.018  1.00 80.32  ? 304 GLU A N   1 
ATOM   1045 C CA  . GLU A 1 144 ? 13.304 35.006 44.175  1.00 80.16  ? 304 GLU A CA  1 
ATOM   1046 C C   . GLU A 1 144 ? 12.901 34.571 45.581  1.00 89.17  ? 304 GLU A C   1 
ATOM   1047 O O   . GLU A 1 144 ? 12.238 33.540 45.727  1.00 89.01  ? 304 GLU A O   1 
ATOM   1048 C CB  . GLU A 1 144 ? 14.677 34.445 43.826  1.00 79.45  ? 304 GLU A CB  1 
ATOM   1049 C CG  . GLU A 1 144 ? 14.724 32.930 43.869  1.00 78.82  ? 304 GLU A CG  1 
ATOM   1050 C CD  . GLU A 1 144 ? 16.073 32.374 43.460  1.00 91.60  ? 304 GLU A CD  1 
ATOM   1051 O OE1 . GLU A 1 144 ? 17.102 33.030 43.743  1.00 91.15  ? 304 GLU A OE1 1 
ATOM   1052 O OE2 . GLU A 1 144 ? 16.102 31.287 42.834  1.00 99.39  ? 304 GLU A OE2 1 
ATOM   1053 N N   . THR A 1 145 ? 13.270 35.324 46.610  1.00 91.88  ? 305 THR A N   1 
ATOM   1054 C CA  . THR A 1 145 ? 12.930 34.961 47.984  1.00 88.80  ? 305 THR A CA  1 
ATOM   1055 C C   . THR A 1 145 ? 11.443 34.816 48.151  1.00 86.69  ? 305 THR A C   1 
ATOM   1056 O O   . THR A 1 145 ? 10.969 33.871 48.740  1.00 86.22  ? 305 THR A O   1 
ATOM   1057 C CB  . THR A 1 145 ? 13.437 35.985 49.008  1.00 83.64  ? 305 THR A CB  1 
ATOM   1058 O OG1 . THR A 1 145 ? 12.548 37.092 49.063  1.00 80.84  ? 305 THR A OG1 1 
ATOM   1059 C CG2 . THR A 1 145 ? 14.785 36.483 48.640  1.00 87.43  ? 305 THR A CG2 1 
ATOM   1060 N N   . THR A 1 146 ? 10.714 35.807 47.688  1.00 85.24  ? 306 THR A N   1 
ATOM   1061 C CA  . THR A 1 146 ? 9.273  35.759 47.733  1.00 88.44  ? 306 THR A CA  1 
ATOM   1062 C C   . THR A 1 146 ? 8.837  35.678 46.280  1.00 92.57  ? 306 THR A C   1 
ATOM   1063 O O   . THR A 1 146 ? 9.368  34.871 45.550  1.00 94.17  ? 306 THR A O   1 
ATOM   1064 C CB  . THR A 1 146 ? 8.696  36.944 48.506  1.00 91.50  ? 306 THR A CB  1 
ATOM   1065 O OG1 . THR A 1 146 ? 7.292  37.057 48.276  1.00 92.88  ? 306 THR A OG1 1 
ATOM   1066 C CG2 . THR A 1 146 ? 9.381  38.205 48.124  1.00 91.72  ? 306 THR A CG2 1 
ATOM   1067 N N   . GLY A 1 147 ? 7.906  36.491 45.841  1.00 86.97  ? 307 GLY A N   1 
ATOM   1068 C CA  . GLY A 1 147 ? 7.472  36.449 44.471  1.00 82.53  ? 307 GLY A CA  1 
ATOM   1069 C C   . GLY A 1 147 ? 6.709  37.704 44.180  1.00 88.65  ? 307 GLY A C   1 
ATOM   1070 O O   . GLY A 1 147 ? 5.976  37.804 43.228  1.00 90.62  ? 307 GLY A O   1 
ATOM   1071 N N   . MET A 1 148 ? 6.899  38.674 45.035  1.00 88.24  ? 308 MET A N   1 
ATOM   1072 C CA  . MET A 1 148 ? 6.232  39.954 44.915  1.00 94.57  ? 308 MET A CA  1 
ATOM   1073 C C   . MET A 1 148 ? 6.848  40.761 43.773  1.00 88.58  ? 308 MET A C   1 
ATOM   1074 O O   . MET A 1 148 ? 7.911  40.422 43.238  1.00 80.41  ? 308 MET A O   1 
ATOM   1075 C CB  . MET A 1 148 ? 6.306  40.708 46.242  1.00 94.00  ? 308 MET A CB  1 
ATOM   1076 C CG  . MET A 1 148 ? 5.626  39.978 47.410  1.00 94.94  ? 308 MET A CG  1 
ATOM   1077 S SD  . MET A 1 148 ? 3.901  39.495 47.141  1.00 92.07  ? 308 MET A SD  1 
ATOM   1078 C CE  . MET A 1 148 ? 4.075  37.743 46.770  1.00 81.13  ? 308 MET A CE  1 
ATOM   1079 N N   . THR A 1 149 ? 6.153  41.837 43.393  1.00 92.89  ? 309 THR A N   1 
ATOM   1080 C CA  . THR A 1 149 ? 6.544  42.663 42.237  1.00 92.08  ? 309 THR A CA  1 
ATOM   1081 C C   . THR A 1 149 ? 7.406  43.873 42.586  1.00 81.76  ? 309 THR A C   1 
ATOM   1082 O O   . THR A 1 149 ? 7.017  44.742 43.370  1.00 80.88  ? 309 THR A O   1 
ATOM   1083 C CB  . THR A 1 149 ? 5.318  43.185 41.471  1.00 94.20  ? 309 THR A CB  1 
ATOM   1084 O OG1 . THR A 1 149 ? 4.316  43.614 42.408  1.00 92.24  ? 309 THR A OG1 1 
ATOM   1085 C CG2 . THR A 1 149 ? 4.769  42.106 40.526  1.00 80.94  ? 309 THR A CG2 1 
HETATM 1086 N N   . CME A 1 150 ? 8.549  43.950 41.940  1.00 75.68  ? 310 CME A N   1 
HETATM 1087 C CA  . CME A 1 150 ? 9.472  45.013 42.164  1.00 73.34  ? 310 CME A CA  1 
HETATM 1088 C CB  . CME A 1 150 ? 10.650 44.299 42.780  1.00 71.77  ? 310 CME A CB  1 
HETATM 1089 S SG  . CME A 1 150 ? 12.178 45.077 42.492  1.00 87.12  ? 310 CME A SG  1 
HETATM 1090 S SD  . CME A 1 150 ? 12.159 46.600 43.709  1.00 80.98  ? 310 CME A SD  1 
HETATM 1091 C CE  . CME A 1 150 ? 10.910 46.102 44.801  1.00 77.97  ? 310 CME A CE  1 
HETATM 1092 C CZ  . CME A 1 150 ? 11.400 46.430 46.185  1.00 77.93  ? 310 CME A CZ  1 
HETATM 1093 O OH  . CME A 1 150 ? 12.770 46.062 46.281  1.00 79.03  ? 310 CME A OH  1 
HETATM 1094 C C   . CME A 1 150 ? 9.776  45.669 40.862  1.00 67.53  ? 310 CME A C   1 
HETATM 1095 O O   . CME A 1 150 ? 9.880  45.008 39.846  1.00 65.16  ? 310 CME A O   1 
ATOM   1096 N N   . GLN A 1 151 ? 9.922  46.971 40.873  1.00 55.56  ? 311 GLN A N   1 
ATOM   1097 C CA  . GLN A 1 151 ? 10.194 47.697 39.652  1.00 55.84  ? 311 GLN A CA  1 
ATOM   1098 C C   . GLN A 1 151 ? 11.471 48.523 39.735  1.00 52.78  ? 311 GLN A C   1 
ATOM   1099 O O   . GLN A 1 151 ? 11.637 49.342 40.621  1.00 59.77  ? 311 GLN A O   1 
ATOM   1100 C CB  . GLN A 1 151 ? 9.008  48.597 39.285  1.00 55.57  ? 311 GLN A CB  1 
ATOM   1101 C CG  . GLN A 1 151 ? 9.299  49.491 38.098  1.00 55.54  ? 311 GLN A CG  1 
ATOM   1102 C CD  . GLN A 1 151 ? 8.075  50.243 37.601  1.00 64.44  ? 311 GLN A CD  1 
ATOM   1103 O OE1 . GLN A 1 151 ? 8.048  51.474 37.626  1.00 69.48  ? 311 GLN A OE1 1 
ATOM   1104 N NE2 . GLN A 1 151 ? 7.062  49.509 37.135  1.00 61.08  ? 311 GLN A NE2 1 
ATOM   1105 N N   . ALA A 1 152 ? 12.380 48.302 38.796  1.00 51.43  ? 312 ALA A N   1 
ATOM   1106 C CA  . ALA A 1 152 ? 13.605 49.078 38.689  1.00 47.58  ? 312 ALA A CA  1 
ATOM   1107 C C   . ALA A 1 152 ? 13.621 49.800 37.341  1.00 57.36  ? 312 ALA A C   1 
ATOM   1108 O O   . ALA A 1 152 ? 13.228 49.238 36.305  1.00 54.01  ? 312 ALA A O   1 
ATOM   1109 C CB  . ALA A 1 152 ? 14.842 48.181 38.853  1.00 39.22  ? 312 ALA A CB  1 
ATOM   1110 N N   . ARG A 1 153 ? 14.074 51.046 37.361  1.00 47.68  ? 313 ARG A N   1 
ATOM   1111 C CA  . ARG A 1 153 ? 14.024 51.917 36.207  1.00 52.95  ? 313 ARG A CA  1 
ATOM   1112 C C   . ARG A 1 153 ? 15.390 52.548 35.975  1.00 57.90  ? 313 ARG A C   1 
ATOM   1113 O O   . ARG A 1 153 ? 16.197 52.669 36.901  1.00 55.08  ? 313 ARG A O   1 
ATOM   1114 C CB  . ARG A 1 153 ? 12.953 52.995 36.395  1.00 51.31  ? 313 ARG A CB  1 
ATOM   1115 C CG  . ARG A 1 153 ? 11.547 52.426 36.469  1.00 55.44  ? 313 ARG A CG  1 
ATOM   1116 C CD  . ARG A 1 153 ? 10.558 53.537 36.610  1.00 61.38  ? 313 ARG A CD  1 
ATOM   1117 N NE  . ARG A 1 153 ? 10.980 54.444 37.666  1.00 72.77  ? 313 ARG A NE  1 
ATOM   1118 C CZ  . ARG A 1 153 ? 10.611 54.315 38.932  1.00 70.37  ? 313 ARG A CZ  1 
ATOM   1119 N NH1 . ARG A 1 153 ? 9.811  53.318 39.277  1.00 69.61  ? 313 ARG A NH1 1 
ATOM   1120 N NH2 . ARG A 1 153 ? 11.032 55.179 39.837  1.00 67.21  ? 313 ARG A NH2 1 
ATOM   1121 N N   . THR A 1 154 ? 15.657 52.944 34.726  1.00 50.45  ? 314 THR A N   1 
ATOM   1122 C CA  . THR A 1 154 ? 16.863 53.726 34.465  1.00 51.53  ? 314 THR A CA  1 
ATOM   1123 C C   . THR A 1 154 ? 16.658 54.584 33.221  1.00 52.72  ? 314 THR A C   1 
ATOM   1124 O O   . THR A 1 154 ? 15.589 54.591 32.600  1.00 50.07  ? 314 THR A O   1 
ATOM   1125 C CB  . THR A 1 154 ? 18.101 52.833 34.328  1.00 54.97  ? 314 THR A CB  1 
ATOM   1126 O OG1 . THR A 1 154 ? 19.284 53.625 34.494  1.00 56.22  ? 314 THR A OG1 1 
ATOM   1127 C CG2 . THR A 1 154 ? 18.150 52.154 32.962  1.00 52.87  ? 314 THR A CG2 1 
ATOM   1128 N N   . SER A 1 155 ? 17.722 55.284 32.847  1.00 50.15  ? 315 SER A N   1 
ATOM   1129 C CA  . SER A 1 155 ? 17.655 56.394 31.921  1.00 46.17  ? 315 SER A CA  1 
ATOM   1130 C C   . SER A 1 155 ? 18.958 56.449 31.148  1.00 52.25  ? 315 SER A C   1 
ATOM   1131 O O   . SER A 1 155 ? 20.027 56.276 31.735  1.00 57.11  ? 315 SER A O   1 
ATOM   1132 C CB  . SER A 1 155 ? 17.441 57.695 32.686  1.00 56.13  ? 315 SER A CB  1 
ATOM   1133 O OG  . SER A 1 155 ? 16.725 58.636 31.932  1.00 58.84  ? 315 SER A OG  1 
ATOM   1134 N N   . TYR A 1 156 ? 18.861 56.659 29.832  1.00 51.99  ? 316 TYR A N   1 
ATOM   1135 C CA  . TYR A 1 156 ? 20.001 56.964 28.971  1.00 50.80  ? 316 TYR A CA  1 
ATOM   1136 C C   . TYR A 1 156 ? 19.623 58.176 28.149  1.00 56.67  ? 316 TYR A C   1 
ATOM   1137 O O   . TYR A 1 156 ? 18.698 58.096 27.334  1.00 58.06  ? 316 TYR A O   1 
ATOM   1138 C CB  . TYR A 1 156 ? 20.364 55.817 28.025  1.00 52.31  ? 316 TYR A CB  1 
ATOM   1139 C CG  . TYR A 1 156 ? 20.564 54.493 28.714  1.00 51.85  ? 316 TYR A CG  1 
ATOM   1140 C CD1 . TYR A 1 156 ? 21.794 54.135 29.217  1.00 48.25  ? 316 TYR A CD1 1 
ATOM   1141 C CD2 . TYR A 1 156 ? 19.503 53.600 28.863  1.00 52.63  ? 316 TYR A CD2 1 
ATOM   1142 C CE1 . TYR A 1 156 ? 21.978 52.924 29.860  1.00 57.68  ? 316 TYR A CE1 1 
ATOM   1143 C CE2 . TYR A 1 156 ? 19.678 52.375 29.513  1.00 56.42  ? 316 TYR A CE2 1 
ATOM   1144 C CZ  . TYR A 1 156 ? 20.919 52.052 30.010  1.00 55.48  ? 316 TYR A CZ  1 
ATOM   1145 O OH  . TYR A 1 156 ? 21.113 50.856 30.651  1.00 51.78  ? 316 TYR A OH  1 
ATOM   1146 N N   . THR A 1 157 ? 20.310 59.293 28.386  1.00 59.51  ? 317 THR A N   1 
ATOM   1147 C CA  . THR A 1 157 ? 20.270 60.457 27.510  1.00 58.97  ? 317 THR A CA  1 
ATOM   1148 C C   . THR A 1 157 ? 21.252 60.261 26.362  1.00 56.77  ? 317 THR A C   1 
ATOM   1149 O O   . THR A 1 157 ? 22.050 59.320 26.356  1.00 54.77  ? 317 THR A O   1 
ATOM   1150 C CB  . THR A 1 157 ? 20.619 61.730 28.276  1.00 60.82  ? 317 THR A CB  1 
ATOM   1151 O OG1 . THR A 1 157 ? 21.863 61.538 28.961  1.00 61.01  ? 317 THR A OG1 1 
ATOM   1152 C CG2 . THR A 1 157 ? 19.546 62.046 29.294  1.00 61.79  ? 317 THR A CG2 1 
ATOM   1153 N N   . GLU A 1 158 ? 21.203 61.188 25.394  1.00 64.40  ? 318 GLU A N   1 
ATOM   1154 C CA  . GLU A 1 158 ? 21.969 61.022 24.154  1.00 63.36  ? 318 GLU A CA  1 
ATOM   1155 C C   . GLU A 1 158 ? 23.462 60.880 24.427  1.00 55.40  ? 318 GLU A C   1 
ATOM   1156 O O   . GLU A 1 158 ? 24.131 60.086 23.758  1.00 66.69  ? 318 GLU A O   1 
ATOM   1157 C CB  . GLU A 1 158 ? 21.698 62.183 23.186  1.00 56.31  ? 318 GLU A CB  1 
ATOM   1158 C CG  . GLU A 1 158 ? 22.094 63.576 23.706  1.00 63.24  ? 318 GLU A CG  1 
ATOM   1159 C CD  . GLU A 1 158 ? 21.088 64.162 24.700  1.00 67.79  ? 318 GLU A CD  1 
ATOM   1160 O OE1 . GLU A 1 158 ? 20.007 63.552 24.891  1.00 69.34  ? 318 GLU A OE1 1 
ATOM   1161 O OE2 . GLU A 1 158 ? 21.359 65.245 25.273  1.00 67.77  ? 318 GLU A OE2 1 
ATOM   1162 N N   . ASP A 1 159 ? 23.995 61.595 25.427  1.00 58.56  ? 319 ASP A N   1 
ATOM   1163 C CA  . ASP A 1 159 ? 25.410 61.479 25.788  1.00 59.46  ? 319 ASP A CA  1 
ATOM   1164 C C   . ASP A 1 159 ? 25.757 60.176 26.484  1.00 57.31  ? 319 ASP A C   1 
ATOM   1165 O O   . ASP A 1 159 ? 26.943 59.948 26.727  1.00 64.70  ? 319 ASP A O   1 
ATOM   1166 C CB  . ASP A 1 159 ? 25.856 62.644 26.676  1.00 59.32  ? 319 ASP A CB  1 
ATOM   1167 C CG  . ASP A 1 159 ? 24.914 62.895 27.834  1.00 68.72  ? 319 ASP A CG  1 
ATOM   1168 O OD1 . ASP A 1 159 ? 23.714 63.148 27.575  1.00 69.36  ? 319 ASP A OD1 1 
ATOM   1169 O OD2 . ASP A 1 159 ? 25.369 62.860 29.003  1.00 76.69  ? 319 ASP A OD2 1 
ATOM   1170 N N   . GLU A 1 160 ? 24.787 59.323 26.810  1.00 58.93  ? 320 GLU A N   1 
ATOM   1171 C CA  . GLU A 1 160 ? 25.066 58.016 27.394  1.00 57.24  ? 320 GLU A CA  1 
ATOM   1172 C C   . GLU A 1 160 ? 24.736 56.877 26.445  1.00 57.81  ? 320 GLU A C   1 
ATOM   1173 O O   . GLU A 1 160 ? 24.708 55.716 26.869  1.00 58.42  ? 320 GLU A O   1 
ATOM   1174 C CB  . GLU A 1 160 ? 24.304 57.841 28.701  1.00 58.99  ? 320 GLU A CB  1 
ATOM   1175 C CG  . GLU A 1 160 ? 24.881 58.653 29.829  1.00 63.20  ? 320 GLU A CG  1 
ATOM   1176 C CD  . GLU A 1 160 ? 23.818 59.260 30.701  1.00 64.04  ? 320 GLU A CD  1 
ATOM   1177 O OE1 . GLU A 1 160 ? 22.643 58.854 30.582  1.00 60.99  ? 320 GLU A OE1 1 
ATOM   1178 O OE2 . GLU A 1 160 ? 24.144 60.145 31.524  1.00 68.32  ? 320 GLU A OE2 1 
ATOM   1179 N N   . VAL A 1 161 ? 24.443 57.192 25.185  1.00 58.55  ? 321 VAL A N   1 
ATOM   1180 C CA  . VAL A 1 161 ? 24.386 56.230 24.095  1.00 51.99  ? 321 VAL A CA  1 
ATOM   1181 C C   . VAL A 1 161 ? 25.665 56.417 23.294  1.00 57.09  ? 321 VAL A C   1 
ATOM   1182 O O   . VAL A 1 161 ? 25.925 57.512 22.784  1.00 60.78  ? 321 VAL A O   1 
ATOM   1183 C CB  . VAL A 1 161 ? 23.149 56.454 23.208  1.00 55.19  ? 321 VAL A CB  1 
ATOM   1184 C CG1 . VAL A 1 161 ? 23.040 55.369 22.160  1.00 54.29  ? 321 VAL A CG1 1 
ATOM   1185 C CG2 . VAL A 1 161 ? 21.878 56.547 24.031  1.00 49.00  ? 321 VAL A CG2 1 
ATOM   1186 N N   . LEU A 1 162 ? 26.464 55.363 23.183  1.00 59.91  ? 322 LEU A N   1 
ATOM   1187 C CA  . LEU A 1 162 ? 27.770 55.425 22.540  1.00 51.25  ? 322 LEU A CA  1 
ATOM   1188 C C   . LEU A 1 162 ? 27.687 54.734 21.188  1.00 61.70  ? 322 LEU A C   1 
ATOM   1189 O O   . LEU A 1 162 ? 27.776 53.502 21.095  1.00 56.41  ? 322 LEU A O   1 
ATOM   1190 C CB  . LEU A 1 162 ? 28.837 54.777 23.406  1.00 58.86  ? 322 LEU A CB  1 
ATOM   1191 C CG  . LEU A 1 162 ? 28.762 55.039 24.900  1.00 65.93  ? 322 LEU A CG  1 
ATOM   1192 C CD1 . LEU A 1 162 ? 29.858 54.245 25.616  1.00 62.70  ? 322 LEU A CD1 1 
ATOM   1193 C CD2 . LEU A 1 162 ? 28.864 56.540 25.157  1.00 58.81  ? 322 LEU A CD2 1 
ATOM   1194 N N   . TRP A 1 163 ? 27.543 55.546 20.140  1.00 67.21  ? 323 TRP A N   1 
ATOM   1195 C CA  . TRP A 1 163 ? 27.581 55.051 18.771  1.00 58.18  ? 323 TRP A CA  1 
ATOM   1196 C C   . TRP A 1 163 ? 28.889 54.334 18.490  1.00 57.18  ? 323 TRP A C   1 
ATOM   1197 O O   . TRP A 1 163 ? 29.965 54.840 18.804  1.00 61.44  ? 323 TRP A O   1 
ATOM   1198 C CB  . TRP A 1 163 ? 27.419 56.203 17.794  1.00 62.43  ? 323 TRP A CB  1 
ATOM   1199 C CG  . TRP A 1 163 ? 27.214 55.715 16.401  1.00 67.52  ? 323 TRP A CG  1 
ATOM   1200 C CD1 . TRP A 1 163 ? 28.158 55.208 15.549  1.00 63.49  ? 323 TRP A CD1 1 
ATOM   1201 C CD2 . TRP A 1 163 ? 25.974 55.653 15.710  1.00 64.37  ? 323 TRP A CD2 1 
ATOM   1202 N NE1 . TRP A 1 163 ? 27.576 54.835 14.368  1.00 62.25  ? 323 TRP A NE1 1 
ATOM   1203 C CE2 . TRP A 1 163 ? 26.234 55.104 14.434  1.00 64.47  ? 323 TRP A CE2 1 
ATOM   1204 C CE3 . TRP A 1 163 ? 24.662 56.006 16.045  1.00 57.05  ? 323 TRP A CE3 1 
ATOM   1205 C CZ2 . TRP A 1 163 ? 25.233 54.914 13.486  1.00 64.63  ? 323 TRP A CZ2 1 
ATOM   1206 C CZ3 . TRP A 1 163 ? 23.665 55.819 15.104  1.00 63.02  ? 323 TRP A CZ3 1 
ATOM   1207 C CH2 . TRP A 1 163 ? 23.957 55.278 13.835  1.00 66.90  ? 323 TRP A CH2 1 
ATOM   1208 N N   . GLY A 1 164 ? 28.796 53.157 17.890  1.00 55.60  ? 324 GLY A N   1 
ATOM   1209 C CA  . GLY A 1 164 ? 29.992 52.426 17.543  1.00 58.63  ? 324 GLY A CA  1 
ATOM   1210 C C   . GLY A 1 164 ? 30.649 51.705 18.691  1.00 63.90  ? 324 GLY A C   1 
ATOM   1211 O O   . GLY A 1 164 ? 31.862 51.495 18.670  1.00 72.43  ? 324 GLY A O   1 
ATOM   1212 N N   . HIS A 1 165 ? 29.891 51.293 19.691  1.00 67.35  ? 325 HIS A N   1 
ATOM   1213 C CA  . HIS A 1 165 ? 30.477 50.536 20.777  1.00 65.54  ? 325 HIS A CA  1 
ATOM   1214 C C   . HIS A 1 165 ? 29.803 49.180 20.898  1.00 63.66  ? 325 HIS A C   1 
ATOM   1215 O O   . HIS A 1 165 ? 28.682 48.961 20.426  1.00 55.46  ? 325 HIS A O   1 
ATOM   1216 C CB  . HIS A 1 165 ? 30.383 51.292 22.102  1.00 61.70  ? 325 HIS A CB  1 
ATOM   1217 C CG  . HIS A 1 165 ? 31.452 52.321 22.277  1.00 71.67  ? 325 HIS A CG  1 
ATOM   1218 N ND1 . HIS A 1 165 ? 32.463 52.199 23.205  1.00 74.51  ? 325 HIS A ND1 1 
ATOM   1219 C CD2 . HIS A 1 165 ? 31.677 53.487 21.625  1.00 72.27  ? 325 HIS A CD2 1 
ATOM   1220 C CE1 . HIS A 1 165 ? 33.258 53.252 23.126  1.00 75.78  ? 325 HIS A CE1 1 
ATOM   1221 N NE2 . HIS A 1 165 ? 32.807 54.046 22.171  1.00 76.48  ? 325 HIS A NE2 1 
ATOM   1222 N N   . ARG A 1 166 ? 30.526 48.278 21.548  1.00 62.76  ? 326 ARG A N   1 
ATOM   1223 C CA  . ARG A 1 166 ? 30.046 46.955 21.883  1.00 57.53  ? 326 ARG A CA  1 
ATOM   1224 C C   . ARG A 1 166 ? 30.438 46.674 23.329  1.00 67.39  ? 326 ARG A C   1 
ATOM   1225 O O   . ARG A 1 166 ? 31.462 47.160 23.818  1.00 72.63  ? 326 ARG A O   1 
ATOM   1226 C CB  . ARG A 1 166 ? 30.617 45.913 20.926  1.00 64.19  ? 326 ARG A CB  1 
ATOM   1227 C CG  . ARG A 1 166 ? 30.335 44.480 21.297  1.00 69.87  ? 326 ARG A CG  1 
ATOM   1228 C CD  . ARG A 1 166 ? 31.033 43.575 20.325  1.00 67.99  ? 326 ARG A CD  1 
ATOM   1229 N NE  . ARG A 1 166 ? 30.575 43.828 18.970  1.00 74.43  ? 326 ARG A NE  1 
ATOM   1230 C CZ  . ARG A 1 166 ? 31.212 43.405 17.887  1.00 77.02  ? 326 ARG A CZ  1 
ATOM   1231 N NH1 . ARG A 1 166 ? 32.346 42.729 18.029  1.00 71.86  ? 326 ARG A NH1 1 
ATOM   1232 N NH2 . ARG A 1 166 ? 30.717 43.662 16.675  1.00 73.59  ? 326 ARG A NH2 1 
ATOM   1233 N N   . PHE A 1 167 ? 29.592 45.929 24.025  1.00 57.37  ? 327 PHE A N   1 
ATOM   1234 C CA  . PHE A 1 167 ? 29.872 45.587 25.401  1.00 60.21  ? 327 PHE A CA  1 
ATOM   1235 C C   . PHE A 1 167 ? 30.920 44.480 25.455  1.00 68.95  ? 327 PHE A C   1 
ATOM   1236 O O   . PHE A 1 167 ? 30.935 43.581 24.601  1.00 62.07  ? 327 PHE A O   1 
ATOM   1237 C CB  . PHE A 1 167 ? 28.587 45.142 26.106  1.00 59.23  ? 327 PHE A CB  1 
ATOM   1238 C CG  . PHE A 1 167 ? 27.674 46.278 26.503  1.00 58.68  ? 327 PHE A CG  1 
ATOM   1239 C CD1 . PHE A 1 167 ? 27.928 47.023 27.659  1.00 59.35  ? 327 PHE A CD1 1 
ATOM   1240 C CD2 . PHE A 1 167 ? 26.537 46.577 25.752  1.00 47.35  ? 327 PHE A CD2 1 
ATOM   1241 C CE1 . PHE A 1 167 ? 27.081 48.066 28.051  1.00 55.74  ? 327 PHE A CE1 1 
ATOM   1242 C CE2 . PHE A 1 167 ? 25.692 47.625 26.132  1.00 55.63  ? 327 PHE A CE2 1 
ATOM   1243 C CZ  . PHE A 1 167 ? 25.964 48.372 27.292  1.00 53.31  ? 327 PHE A CZ  1 
ATOM   1244 N N   . PHE A 1 168 ? 31.818 44.570 26.450  1.00 66.63  ? 328 PHE A N   1 
ATOM   1245 C CA  . PHE A 1 168 ? 32.692 43.454 26.787  1.00 61.18  ? 328 PHE A CA  1 
ATOM   1246 C C   . PHE A 1 168 ? 31.845 42.288 27.271  1.00 65.43  ? 328 PHE A C   1 
ATOM   1247 O O   . PHE A 1 168 ? 30.784 42.497 27.866  1.00 66.68  ? 328 PHE A O   1 
ATOM   1248 C CB  . PHE A 1 168 ? 33.667 43.830 27.900  1.00 68.14  ? 328 PHE A CB  1 
ATOM   1249 C CG  . PHE A 1 168 ? 34.895 44.514 27.423  1.00 72.61  ? 328 PHE A CG  1 
ATOM   1250 C CD1 . PHE A 1 168 ? 35.951 43.777 26.907  1.00 71.88  ? 328 PHE A CD1 1 
ATOM   1251 C CD2 . PHE A 1 168 ? 34.996 45.897 27.483  1.00 69.83  ? 328 PHE A CD2 1 
ATOM   1252 C CE1 . PHE A 1 168 ? 37.087 44.401 26.458  1.00 68.58  ? 328 PHE A CE1 1 
ATOM   1253 C CE2 . PHE A 1 168 ? 36.127 46.535 27.042  1.00 73.43  ? 328 PHE A CE2 1 
ATOM   1254 C CZ  . PHE A 1 168 ? 37.182 45.787 26.526  1.00 77.75  ? 328 PHE A CZ  1 
ATOM   1255 N N   . PRO A 1 169 ? 32.293 41.054 27.073  1.00 65.79  ? 329 PRO A N   1 
ATOM   1256 C CA  . PRO A 1 169 ? 31.589 39.932 27.687  1.00 66.17  ? 329 PRO A CA  1 
ATOM   1257 C C   . PRO A 1 169 ? 31.812 39.957 29.187  1.00 68.34  ? 329 PRO A C   1 
ATOM   1258 O O   . PRO A 1 169 ? 32.705 40.637 29.699  1.00 64.77  ? 329 PRO A O   1 
ATOM   1259 C CB  . PRO A 1 169 ? 32.222 38.694 27.037  1.00 65.54  ? 329 PRO A CB  1 
ATOM   1260 C CG  . PRO A 1 169 ? 33.055 39.209 25.924  1.00 62.51  ? 329 PRO A CG  1 
ATOM   1261 C CD  . PRO A 1 169 ? 33.469 40.598 26.327  1.00 68.92  ? 329 PRO A CD  1 
ATOM   1262 N N   . VAL A 1 170 ? 30.957 39.236 29.904  1.00 72.69  ? 330 VAL A N   1 
ATOM   1263 C CA  . VAL A 1 170 ? 31.118 39.153 31.349  1.00 67.61  ? 330 VAL A CA  1 
ATOM   1264 C C   . VAL A 1 170 ? 31.027 37.702 31.794  1.00 69.43  ? 330 VAL A C   1 
ATOM   1265 O O   . VAL A 1 170 ? 30.860 37.435 32.984  1.00 74.47  ? 330 VAL A O   1 
ATOM   1266 C CB  . VAL A 1 170 ? 30.077 40.012 32.107  1.00 68.71  ? 330 VAL A CB  1 
ATOM   1267 C CG1 . VAL A 1 170 ? 30.146 41.474 31.705  1.00 68.20  ? 330 VAL A CG1 1 
ATOM   1268 C CG2 . VAL A 1 170 ? 28.667 39.482 31.916  1.00 69.85  ? 330 VAL A CG2 1 
ATOM   1269 N N   . ILE A 1 171 ? 31.152 36.751 30.872  1.00 69.31  ? 331 ILE A N   1 
ATOM   1270 C CA  . ILE A 1 171 ? 30.838 35.361 31.183  1.00 76.83  ? 331 ILE A CA  1 
ATOM   1271 C C   . ILE A 1 171 ? 32.020 34.430 30.915  1.00 82.01  ? 331 ILE A C   1 
ATOM   1272 O O   . ILE A 1 171 ? 32.747 34.588 29.925  1.00 81.76  ? 331 ILE A O   1 
ATOM   1273 C CB  . ILE A 1 171 ? 29.600 34.903 30.399  1.00 72.74  ? 331 ILE A CB  1 
ATOM   1274 C CG1 . ILE A 1 171 ? 28.378 35.695 30.864  1.00 74.61  ? 331 ILE A CG1 1 
ATOM   1275 C CG2 . ILE A 1 171 ? 29.368 33.408 30.598  1.00 75.34  ? 331 ILE A CG2 1 
ATOM   1276 C CD1 . ILE A 1 171 ? 27.547 34.995 31.911  1.00 69.62  ? 331 ILE A CD1 1 
ATOM   1277 N N   . SER A 1 172 ? 32.199 33.457 31.821  1.00 87.61  ? 332 SER A N   1 
ATOM   1278 C CA  . SER A 1 172 ? 33.088 32.309 31.657  1.00 89.62  ? 332 SER A CA  1 
ATOM   1279 C C   . SER A 1 172 ? 32.476 31.109 32.388  1.00 90.66  ? 332 SER A C   1 
ATOM   1280 O O   . SER A 1 172 ? 31.492 31.237 33.120  1.00 89.39  ? 332 SER A O   1 
ATOM   1281 C CB  . SER A 1 172 ? 34.495 32.619 32.178  1.00 87.62  ? 332 SER A CB  1 
ATOM   1282 O OG  . SER A 1 172 ? 34.865 33.950 31.859  1.00 83.27  ? 332 SER A OG  1 
ATOM   1283 N N   . LEU A 1 173 ? 33.073 29.935 32.193  1.00 90.20  ? 333 LEU A N   1 
ATOM   1284 C CA  . LEU A 1 173 ? 32.511 28.686 32.721  1.00 87.99  ? 333 LEU A CA  1 
ATOM   1285 C C   . LEU A 1 173 ? 32.522 28.594 34.242  1.00 92.57  ? 333 LEU A C   1 
ATOM   1286 O O   . LEU A 1 173 ? 32.724 27.513 34.802  1.00 87.24  ? 333 LEU A O   1 
ATOM   1287 C CB  . LEU A 1 173 ? 33.275 27.503 32.154  1.00 90.27  ? 333 LEU A CB  1 
ATOM   1288 C CG  . LEU A 1 173 ? 33.725 27.745 30.716  1.00 93.25  ? 333 LEU A CG  1 
ATOM   1289 C CD1 . LEU A 1 173 ? 34.863 26.811 30.361  1.00 89.30  ? 333 LEU A CD1 1 
ATOM   1290 C CD2 . LEU A 1 173 ? 32.545 27.576 29.750  1.00 97.41  ? 333 LEU A CD2 1 
ATOM   1291 N N   . LYS A 1 179 ? 30.680 31.523 35.084  1.00 81.40  ? 339 LYS A N   1 
ATOM   1292 C CA  . LYS A 1 179 ? 31.201 32.605 35.918  1.00 87.80  ? 339 LYS A CA  1 
ATOM   1293 C C   . LYS A 1 179 ? 31.001 33.995 35.304  1.00 82.27  ? 339 LYS A C   1 
ATOM   1294 O O   . LYS A 1 179 ? 31.423 34.256 34.177  1.00 74.65  ? 339 LYS A O   1 
ATOM   1295 C CB  . LYS A 1 179 ? 32.691 32.392 36.202  1.00 85.14  ? 339 LYS A CB  1 
ATOM   1296 C CG  . LYS A 1 179 ? 33.235 33.262 37.341  1.00 81.52  ? 339 LYS A CG  1 
ATOM   1297 C CD  . LYS A 1 179 ? 32.486 32.984 38.641  1.00 89.71  ? 339 LYS A CD  1 
ATOM   1298 C CE  . LYS A 1 179 ? 33.317 33.262 39.902  1.00 97.36  ? 339 LYS A CE  1 
ATOM   1299 N NZ  . LYS A 1 179 ? 32.565 32.875 41.144  1.00 92.70  ? 339 LYS A NZ  1 
ATOM   1300 N N   . VAL A 1 180 ? 30.384 34.886 36.082  1.00 80.15  ? 340 VAL A N   1 
ATOM   1301 C CA  . VAL A 1 180 ? 30.117 36.260 35.674  1.00 76.47  ? 340 VAL A CA  1 
ATOM   1302 C C   . VAL A 1 180 ? 31.196 37.172 36.245  1.00 73.08  ? 340 VAL A C   1 
ATOM   1303 O O   . VAL A 1 180 ? 31.352 37.284 37.466  1.00 78.65  ? 340 VAL A O   1 
ATOM   1304 C CB  . VAL A 1 180 ? 28.721 36.726 36.121  1.00 77.71  ? 340 VAL A CB  1 
ATOM   1305 C CG1 . VAL A 1 180 ? 28.577 38.230 35.926  1.00 72.57  ? 340 VAL A CG1 1 
ATOM   1306 C CG2 . VAL A 1 180 ? 27.656 36.014 35.338  1.00 71.46  ? 340 VAL A CG2 1 
ATOM   1307 N N   . ASP A 1 181 ? 31.920 37.847 35.359  1.00 73.01  ? 341 ASP A N   1 
ATOM   1308 C CA  . ASP A 1 181 ? 32.911 38.844 35.744  1.00 70.92  ? 341 ASP A CA  1 
ATOM   1309 C C   . ASP A 1 181 ? 32.197 40.185 35.874  1.00 72.94  ? 341 ASP A C   1 
ATOM   1310 O O   . ASP A 1 181 ? 32.243 41.043 34.986  1.00 75.13  ? 341 ASP A O   1 
ATOM   1311 C CB  . ASP A 1 181 ? 34.033 38.886 34.711  1.00 75.90  ? 341 ASP A CB  1 
ATOM   1312 C CG  . ASP A 1 181 ? 35.106 39.901 35.050  1.00 80.71  ? 341 ASP A CG  1 
ATOM   1313 O OD1 . ASP A 1 181 ? 35.077 40.463 36.167  1.00 81.19  ? 341 ASP A OD1 1 
ATOM   1314 O OD2 . ASP A 1 181 ? 35.992 40.124 34.203  1.00 87.85  ? 341 ASP A OD2 1 
ATOM   1315 N N   . TYR A 1 182 ? 31.523 40.369 37.013  1.00 69.15  ? 342 TYR A N   1 
ATOM   1316 C CA  . TYR A 1 182 ? 30.744 41.588 37.226  1.00 69.92  ? 342 TYR A CA  1 
ATOM   1317 C C   . TYR A 1 182 ? 31.577 42.854 37.147  1.00 72.29  ? 342 TYR A C   1 
ATOM   1318 O O   . TYR A 1 182 ? 31.006 43.950 37.161  1.00 70.95  ? 342 TYR A O   1 
ATOM   1319 C CB  . TYR A 1 182 ? 30.029 41.545 38.575  1.00 70.75  ? 342 TYR A CB  1 
ATOM   1320 C CG  . TYR A 1 182 ? 28.612 41.090 38.432  1.00 72.33  ? 342 TYR A CG  1 
ATOM   1321 C CD1 . TYR A 1 182 ? 27.671 41.900 37.824  1.00 72.88  ? 342 TYR A CD1 1 
ATOM   1322 C CD2 . TYR A 1 182 ? 28.222 39.834 38.858  1.00 72.96  ? 342 TYR A CD2 1 
ATOM   1323 C CE1 . TYR A 1 182 ? 26.369 41.477 37.661  1.00 68.30  ? 342 TYR A CE1 1 
ATOM   1324 C CE2 . TYR A 1 182 ? 26.922 39.401 38.699  1.00 75.92  ? 342 TYR A CE2 1 
ATOM   1325 C CZ  . TYR A 1 182 ? 26.001 40.225 38.091  1.00 72.28  ? 342 TYR A CZ  1 
ATOM   1326 O OH  . TYR A 1 182 ? 24.698 39.808 37.923  1.00 80.50  ? 342 TYR A OH  1 
ATOM   1327 N N   . SER A 1 183 ? 32.901 42.736 37.068  1.00 73.28  ? 343 SER A N   1 
ATOM   1328 C CA  . SER A 1 183 ? 33.744 43.916 37.003  1.00 75.21  ? 343 SER A CA  1 
ATOM   1329 C C   . SER A 1 183 ? 33.724 44.548 35.623  1.00 77.10  ? 343 SER A C   1 
ATOM   1330 O O   . SER A 1 183 ? 34.012 45.742 35.502  1.00 77.69  ? 343 SER A O   1 
ATOM   1331 C CB  . SER A 1 183 ? 35.182 43.570 37.409  1.00 68.07  ? 343 SER A CB  1 
ATOM   1332 O OG  . SER A 1 183 ? 35.768 42.633 36.523  1.00 75.10  ? 343 SER A OG  1 
ATOM   1333 N N   . GLN A 1 184 ? 33.379 43.776 34.594  1.00 78.42  ? 344 GLN A N   1 
ATOM   1334 C CA  . GLN A 1 184 ? 33.243 44.249 33.222  1.00 72.27  ? 344 GLN A CA  1 
ATOM   1335 C C   . GLN A 1 184 ? 31.804 44.637 32.859  1.00 68.42  ? 344 GLN A C   1 
ATOM   1336 O O   . GLN A 1 184 ? 31.514 44.860 31.677  1.00 71.18  ? 344 GLN A O   1 
ATOM   1337 C CB  . GLN A 1 184 ? 33.752 43.173 32.255  1.00 69.97  ? 344 GLN A CB  1 
ATOM   1338 C CG  . GLN A 1 184 ? 35.263 42.979 32.267  1.00 75.77  ? 344 GLN A CG  1 
ATOM   1339 C CD  . GLN A 1 184 ? 36.017 44.196 31.725  1.00 84.93  ? 344 GLN A CD  1 
ATOM   1340 O OE1 . GLN A 1 184 ? 36.406 44.238 30.549  1.00 85.19  ? 344 GLN A OE1 1 
ATOM   1341 N NE2 . GLN A 1 184 ? 36.231 45.190 32.585  1.00 80.26  ? 344 GLN A NE2 1 
ATOM   1342 N N   . PHE A 1 185 ? 30.917 44.748 33.855  1.00 66.56  ? 345 PHE A N   1 
ATOM   1343 C CA  . PHE A 1 185 ? 29.490 44.923 33.606  1.00 62.17  ? 345 PHE A CA  1 
ATOM   1344 C C   . PHE A 1 185 ? 29.192 46.130 32.722  1.00 62.39  ? 345 PHE A C   1 
ATOM   1345 O O   . PHE A 1 185 ? 28.352 46.041 31.820  1.00 66.66  ? 345 PHE A O   1 
ATOM   1346 C CB  . PHE A 1 185 ? 28.759 45.054 34.930  1.00 60.00  ? 345 PHE A CB  1 
ATOM   1347 C CG  . PHE A 1 185 ? 27.270 45.126 34.803  1.00 62.25  ? 345 PHE A CG  1 
ATOM   1348 C CD1 . PHE A 1 185 ? 26.535 43.998 34.495  1.00 62.21  ? 345 PHE A CD1 1 
ATOM   1349 C CD2 . PHE A 1 185 ? 26.599 46.313 35.044  1.00 64.98  ? 345 PHE A CD2 1 
ATOM   1350 C CE1 . PHE A 1 185 ? 25.166 44.057 34.404  1.00 62.17  ? 345 PHE A CE1 1 
ATOM   1351 C CE2 . PHE A 1 185 ? 25.219 46.384 34.952  1.00 62.29  ? 345 PHE A CE2 1 
ATOM   1352 C CZ  . PHE A 1 185 ? 24.501 45.256 34.632  1.00 61.68  ? 345 PHE A CZ  1 
ATOM   1353 N N   . HIS A 1 186 ? 29.860 47.267 32.963  1.00 61.18  ? 346 HIS A N   1 
ATOM   1354 C CA  . HIS A 1 186 ? 29.584 48.517 32.253  1.00 61.29  ? 346 HIS A CA  1 
ATOM   1355 C C   . HIS A 1 186 ? 30.524 48.780 31.083  1.00 65.39  ? 346 HIS A C   1 
ATOM   1356 O O   . HIS A 1 186 ? 30.256 49.689 30.281  1.00 64.24  ? 346 HIS A O   1 
ATOM   1357 C CB  . HIS A 1 186 ? 29.664 49.707 33.208  1.00 58.61  ? 346 HIS A CB  1 
ATOM   1358 C CG  . HIS A 1 186 ? 28.858 49.539 34.458  1.00 64.88  ? 346 HIS A CG  1 
ATOM   1359 N ND1 . HIS A 1 186 ? 27.634 50.147 34.639  1.00 65.40  ? 346 HIS A ND1 1 
ATOM   1360 C CD2 . HIS A 1 186 ? 29.110 48.851 35.599  1.00 63.95  ? 346 HIS A CD2 1 
ATOM   1361 C CE1 . HIS A 1 186 ? 27.160 49.828 35.831  1.00 66.32  ? 346 HIS A CE1 1 
ATOM   1362 N NE2 . HIS A 1 186 ? 28.039 49.048 36.435  1.00 62.23  ? 346 HIS A NE2 1 
ATOM   1363 N N   . ALA A 1 187 ? 31.596 48.003 30.952  1.00 63.56  ? 347 ALA A N   1 
ATOM   1364 C CA  . ALA A 1 187 ? 32.644 48.324 29.996  1.00 68.40  ? 347 ALA A CA  1 
ATOM   1365 C C   . ALA A 1 187 ? 32.194 48.074 28.561  1.00 65.84  ? 347 ALA A C   1 
ATOM   1366 O O   . ALA A 1 187 ? 31.609 47.034 28.245  1.00 64.43  ? 347 ALA A O   1 
ATOM   1367 C CB  . ALA A 1 187 ? 33.894 47.505 30.306  1.00 72.26  ? 347 ALA A CB  1 
ATOM   1368 N N   . THR A 1 188 ? 32.481 49.027 27.692  1.00 63.46  ? 348 THR A N   1 
ATOM   1369 C CA  . THR A 1 188 ? 32.285 48.867 26.266  1.00 68.37  ? 348 THR A CA  1 
ATOM   1370 C C   . THR A 1 188 ? 33.615 49.068 25.553  1.00 66.51  ? 348 THR A C   1 
ATOM   1371 O O   . THR A 1 188 ? 34.627 49.411 26.167  1.00 69.28  ? 348 THR A O   1 
ATOM   1372 C CB  . THR A 1 188 ? 31.248 49.860 25.745  1.00 66.04  ? 348 THR A CB  1 
ATOM   1373 O OG1 . THR A 1 188 ? 31.847 51.163 25.688  1.00 73.40  ? 348 THR A OG1 1 
ATOM   1374 C CG2 . THR A 1 188 ? 30.036 49.896 26.660  1.00 58.31  ? 348 THR A CG2 1 
ATOM   1375 N N   . PHE A 1 189 ? 33.611 48.838 24.244  1.00 63.44  ? 349 PHE A N   1 
ATOM   1376 C CA  . PHE A 1 189 ? 34.761 49.172 23.413  1.00 68.69  ? 349 PHE A CA  1 
ATOM   1377 C C   . PHE A 1 189 ? 34.285 49.472 22.001  1.00 70.68  ? 349 PHE A C   1 
ATOM   1378 O O   . PHE A 1 189 ? 33.184 49.085 21.600  1.00 66.84  ? 349 PHE A O   1 
ATOM   1379 C CB  . PHE A 1 189 ? 35.819 48.057 23.396  1.00 69.81  ? 349 PHE A CB  1 
ATOM   1380 C CG  . PHE A 1 189 ? 35.335 46.751 22.844  1.00 63.62  ? 349 PHE A CG  1 
ATOM   1381 C CD1 . PHE A 1 189 ? 34.758 45.807 23.681  1.00 64.18  ? 349 PHE A CD1 1 
ATOM   1382 C CD2 . PHE A 1 189 ? 35.500 46.445 21.499  1.00 65.43  ? 349 PHE A CD2 1 
ATOM   1383 C CE1 . PHE A 1 189 ? 34.323 44.595 23.183  1.00 66.66  ? 349 PHE A CE1 1 
ATOM   1384 C CE2 . PHE A 1 189 ? 35.068 45.230 20.984  1.00 61.69  ? 349 PHE A CE2 1 
ATOM   1385 C CZ  . PHE A 1 189 ? 34.475 44.302 21.828  1.00 65.72  ? 349 PHE A CZ  1 
ATOM   1386 N N   . GLU A 1 190 ? 35.136 50.174 21.254  1.00 72.29  ? 350 GLU A N   1 
ATOM   1387 C CA  . GLU A 1 190 ? 34.799 50.609 19.907  1.00 71.45  ? 350 GLU A CA  1 
ATOM   1388 C C   . GLU A 1 190 ? 34.939 49.469 18.906  1.00 70.81  ? 350 GLU A C   1 
ATOM   1389 O O   . GLU A 1 190 ? 35.879 48.670 18.985  1.00 73.91  ? 350 GLU A O   1 
ATOM   1390 C CB  . GLU A 1 190 ? 35.690 51.779 19.499  1.00 76.96  ? 350 GLU A CB  1 
ATOM   1391 C CG  . GLU A 1 190 ? 35.596 52.978 20.448  1.00 85.73  ? 350 GLU A CG  1 
ATOM   1392 C CD  . GLU A 1 190 ? 36.504 54.145 20.039  1.00 96.42  ? 350 GLU A CD  1 
ATOM   1393 O OE1 . GLU A 1 190 ? 37.587 53.891 19.466  1.00 99.87  ? 350 GLU A OE1 1 
ATOM   1394 O OE2 . GLU A 1 190 ? 36.130 55.316 20.279  1.00 91.33  ? 350 GLU A OE2 1 
ATOM   1395 N N   . VAL A 1 191 ? 33.987 49.388 17.978  1.00 70.56  ? 351 VAL A N   1 
ATOM   1396 C CA  . VAL A 1 191 ? 34.032 48.437 16.863  1.00 60.82  ? 351 VAL A CA  1 
ATOM   1397 C C   . VAL A 1 191 ? 33.776 49.196 15.579  1.00 67.20  ? 351 VAL A C   1 
ATOM   1398 O O   . VAL A 1 191 ? 33.158 50.276 15.590  1.00 64.50  ? 351 VAL A O   1 
ATOM   1399 C CB  . VAL A 1 191 ? 32.988 47.304 17.022  1.00 64.60  ? 351 VAL A CB  1 
ATOM   1400 C CG1 . VAL A 1 191 ? 33.482 46.256 17.995  1.00 73.43  ? 351 VAL A CG1 1 
ATOM   1401 C CG2 . VAL A 1 191 ? 31.643 47.862 17.455  1.00 68.65  ? 351 VAL A CG2 1 
ATOM   1402 N N   . PRO A 1 192 ? 34.235 48.653 14.428  1.00 78.45  ? 352 PRO A N   1 
ATOM   1403 C CA  . PRO A 1 192 ? 33.892 49.252 13.131  1.00 68.11  ? 352 PRO A CA  1 
ATOM   1404 C C   . PRO A 1 192 ? 32.392 49.296 12.915  1.00 65.66  ? 352 PRO A C   1 
ATOM   1405 O O   . PRO A 1 192 ? 31.743 48.255 12.757  1.00 69.26  ? 352 PRO A O   1 
ATOM   1406 C CB  . PRO A 1 192 ? 34.577 48.326 12.121  1.00 71.28  ? 352 PRO A CB  1 
ATOM   1407 C CG  . PRO A 1 192 ? 35.707 47.720 12.891  1.00 74.38  ? 352 PRO A CG  1 
ATOM   1408 C CD  . PRO A 1 192 ? 35.192 47.537 14.285  1.00 76.41  ? 352 PRO A CD  1 
ATOM   1409 N N   . THR A 1 193 ? 31.849 50.508 12.882  1.00 60.34  ? 353 THR A N   1 
ATOM   1410 C CA  . THR A 1 193 ? 30.413 50.706 12.809  1.00 62.90  ? 353 THR A CA  1 
ATOM   1411 C C   . THR A 1 193 ? 30.103 51.830 11.824  1.00 62.40  ? 353 THR A C   1 
ATOM   1412 O O   . THR A 1 193 ? 30.552 52.972 12.015  1.00 63.59  ? 353 THR A O   1 
ATOM   1413 C CB  . THR A 1 193 ? 29.880 50.996 14.223  1.00 66.82  ? 353 THR A CB  1 
ATOM   1414 O OG1 . THR A 1 193 ? 29.822 49.765 14.959  1.00 62.58  ? 353 THR A OG1 1 
ATOM   1415 C CG2 . THR A 1 193 ? 28.479 51.649 14.199  1.00 57.22  ? 353 THR A CG2 1 
ATOM   1416 N N   . PRO A 1 194 ? 29.357 51.529 10.765  1.00 63.05  ? 354 PRO A N   1 
ATOM   1417 C CA  . PRO A 1 194 ? 29.001 52.557 9.766   1.00 61.30  ? 354 PRO A CA  1 
ATOM   1418 C C   . PRO A 1 194 ? 28.355 53.754 10.435  1.00 68.75  ? 354 PRO A C   1 
ATOM   1419 O O   . PRO A 1 194 ? 27.603 53.604 11.409  1.00 68.74  ? 354 PRO A O   1 
ATOM   1420 C CB  . PRO A 1 194 ? 28.002 51.839 8.849   1.00 54.70  ? 354 PRO A CB  1 
ATOM   1421 C CG  . PRO A 1 194 ? 28.315 50.373 9.002   1.00 59.59  ? 354 PRO A CG  1 
ATOM   1422 C CD  . PRO A 1 194 ? 28.854 50.191 10.411  1.00 67.53  ? 354 PRO A CD  1 
ATOM   1423 N N   . PRO A 1 195 ? 28.625 54.963 9.950   1.00 70.47  ? 355 PRO A N   1 
ATOM   1424 C CA  . PRO A 1 195 ? 28.169 56.162 10.655  1.00 64.44  ? 355 PRO A CA  1 
ATOM   1425 C C   . PRO A 1 195 ? 26.770 56.607 10.284  1.00 67.06  ? 355 PRO A C   1 
ATOM   1426 O O   . PRO A 1 195 ? 26.325 57.642 10.789  1.00 71.14  ? 355 PRO A O   1 
ATOM   1427 C CB  . PRO A 1 195 ? 29.193 57.205 10.207  1.00 74.45  ? 355 PRO A CB  1 
ATOM   1428 C CG  . PRO A 1 195 ? 29.505 56.809 8.792   1.00 74.79  ? 355 PRO A CG  1 
ATOM   1429 C CD  . PRO A 1 195 ? 29.372 55.298 8.722   1.00 74.50  ? 355 PRO A CD  1 
ATOM   1430 N N   . TYR A 1 196 ? 26.078 55.883 9.421   1.00 63.61  ? 356 TYR A N   1 
ATOM   1431 C CA  . TYR A 1 196 ? 24.833 56.401 8.885   1.00 66.54  ? 356 TYR A CA  1 
ATOM   1432 C C   . TYR A 1 196 ? 23.627 55.775 9.577   1.00 67.70  ? 356 TYR A C   1 
ATOM   1433 O O   . TYR A 1 196 ? 23.695 54.686 10.149  1.00 65.43  ? 356 TYR A O   1 
ATOM   1434 C CB  . TYR A 1 196 ? 24.762 56.175 7.375   1.00 69.82  ? 356 TYR A CB  1 
ATOM   1435 C CG  . TYR A 1 196 ? 25.274 54.840 6.905   1.00 72.86  ? 356 TYR A CG  1 
ATOM   1436 C CD1 . TYR A 1 196 ? 24.592 53.664 7.211   1.00 69.60  ? 356 TYR A CD1 1 
ATOM   1437 C CD2 . TYR A 1 196 ? 26.433 54.755 6.125   1.00 75.57  ? 356 TYR A CD2 1 
ATOM   1438 C CE1 . TYR A 1 196 ? 25.058 52.431 6.765   1.00 74.55  ? 356 TYR A CE1 1 
ATOM   1439 C CE2 . TYR A 1 196 ? 26.907 53.538 5.676   1.00 70.97  ? 356 TYR A CE2 1 
ATOM   1440 C CZ  . TYR A 1 196 ? 26.218 52.379 5.999   1.00 77.32  ? 356 TYR A CZ  1 
ATOM   1441 O OH  . TYR A 1 196 ? 26.689 51.166 5.563   1.00 76.44  ? 356 TYR A OH  1 
ATOM   1442 N N   . SER A 1 197 ? 22.510 56.489 9.511   1.00 66.39  ? 357 SER A N   1 
ATOM   1443 C CA  . SER A 1 197 ? 21.264 55.999 10.066  1.00 64.37  ? 357 SER A CA  1 
ATOM   1444 C C   . SER A 1 197 ? 20.755 54.813 9.259   1.00 64.57  ? 357 SER A C   1 
ATOM   1445 O O   . SER A 1 197 ? 21.214 54.542 8.148   1.00 70.87  ? 357 SER A O   1 
ATOM   1446 C CB  . SER A 1 197 ? 20.218 57.107 10.073  1.00 68.17  ? 357 SER A CB  1 
ATOM   1447 O OG  . SER A 1 197 ? 19.692 57.294 8.779   1.00 64.82  ? 357 SER A OG  1 
ATOM   1448 N N   . VAL A 1 198 ? 19.773 54.108 9.830   1.00 63.04  ? 358 VAL A N   1 
ATOM   1449 C CA  . VAL A 1 198 ? 19.149 52.988 9.128   1.00 64.58  ? 358 VAL A CA  1 
ATOM   1450 C C   . VAL A 1 198 ? 18.216 53.491 8.026   1.00 67.66  ? 358 VAL A C   1 
ATOM   1451 O O   . VAL A 1 198 ? 18.069 52.839 6.979   1.00 60.87  ? 358 VAL A O   1 
ATOM   1452 C CB  . VAL A 1 198 ? 18.429 52.069 10.135  1.00 52.87  ? 358 VAL A CB  1 
ATOM   1453 C CG1 . VAL A 1 198 ? 17.619 50.998 9.444   1.00 50.28  ? 358 VAL A CG1 1 
ATOM   1454 C CG2 . VAL A 1 198 ? 19.448 51.400 11.016  1.00 56.87  ? 358 VAL A CG2 1 
ATOM   1455 N N   . LYS A 1 199 ? 17.580 54.651 8.233   1.00 60.95  ? 359 LYS A N   1 
ATOM   1456 C CA  . LYS A 1 199 ? 16.849 55.289 7.146   1.00 64.23  ? 359 LYS A CA  1 
ATOM   1457 C C   . LYS A 1 199 ? 17.781 55.580 5.974   1.00 73.12  ? 359 LYS A C   1 
ATOM   1458 O O   . LYS A 1 199 ? 17.431 55.345 4.810   1.00 66.45  ? 359 LYS A O   1 
ATOM   1459 C CB  . LYS A 1 199 ? 16.185 56.574 7.637   1.00 62.79  ? 359 LYS A CB  1 
ATOM   1460 C CG  . LYS A 1 199 ? 15.302 57.261 6.589   1.00 65.62  ? 359 LYS A CG  1 
ATOM   1461 C CD  . LYS A 1 199 ? 14.335 58.210 7.262   1.00 69.21  ? 359 LYS A CD  1 
ATOM   1462 C CE  . LYS A 1 199 ? 13.834 59.294 6.335   1.00 68.94  ? 359 LYS A CE  1 
ATOM   1463 N NZ  . LYS A 1 199 ? 13.236 60.423 7.138   1.00 79.00  ? 359 LYS A NZ  1 
ATOM   1464 N N   . GLU A 1 200 ? 18.990 56.065 6.272   1.00 69.38  ? 360 GLU A N   1 
ATOM   1465 C CA  . GLU A 1 200 ? 19.953 56.340 5.221   1.00 62.10  ? 360 GLU A CA  1 
ATOM   1466 C C   . GLU A 1 200 ? 20.389 55.055 4.535   1.00 68.64  ? 360 GLU A C   1 
ATOM   1467 O O   . GLU A 1 200 ? 20.427 54.989 3.303   1.00 71.89  ? 360 GLU A O   1 
ATOM   1468 C CB  . GLU A 1 200 ? 21.137 57.098 5.801   1.00 60.73  ? 360 GLU A CB  1 
ATOM   1469 C CG  . GLU A 1 200 ? 20.826 58.566 6.048   1.00 56.17  ? 360 GLU A CG  1 
ATOM   1470 C CD  . GLU A 1 200 ? 21.862 59.256 6.913   1.00 58.33  ? 360 GLU A CD  1 
ATOM   1471 O OE1 . GLU A 1 200 ? 22.821 58.600 7.370   1.00 60.58  ? 360 GLU A OE1 1 
ATOM   1472 O OE2 . GLU A 1 200 ? 21.732 60.474 7.124   1.00 69.34  ? 360 GLU A OE2 1 
ATOM   1473 N N   . GLN A 1 201 ? 20.672 54.007 5.309   1.00 67.05  ? 361 GLN A N   1 
ATOM   1474 C CA  . GLN A 1 201 ? 21.169 52.770 4.713   1.00 70.43  ? 361 GLN A CA  1 
ATOM   1475 C C   . GLN A 1 201 ? 20.131 52.123 3.799   1.00 69.99  ? 361 GLN A C   1 
ATOM   1476 O O   . GLN A 1 201 ? 20.486 51.495 2.799   1.00 70.09  ? 361 GLN A O   1 
ATOM   1477 C CB  . GLN A 1 201 ? 21.602 51.790 5.804   1.00 71.81  ? 361 GLN A CB  1 
ATOM   1478 C CG  . GLN A 1 201 ? 22.013 50.422 5.269   1.00 79.58  ? 361 GLN A CG  1 
ATOM   1479 C CD  . GLN A 1 201 ? 21.258 49.268 5.926   1.00 94.10  ? 361 GLN A CD  1 
ATOM   1480 O OE1 . GLN A 1 201 ? 21.396 49.020 7.131   1.00 97.88  ? 361 GLN A OE1 1 
ATOM   1481 N NE2 . GLN A 1 201 ? 20.452 48.559 5.134   1.00 90.61  ? 361 GLN A NE2 1 
ATOM   1482 N N   . GLU A 1 202 ? 18.844 52.249 4.131   1.00 74.91  ? 362 GLU A N   1 
ATOM   1483 C CA  . GLU A 1 202 ? 17.813 51.721 3.244   1.00 69.67  ? 362 GLU A CA  1 
ATOM   1484 C C   . GLU A 1 202 ? 17.651 52.613 2.022   1.00 70.98  ? 362 GLU A C   1 
ATOM   1485 O O   . GLU A 1 202 ? 17.296 52.132 0.940   1.00 65.18  ? 362 GLU A O   1 
ATOM   1486 C CB  . GLU A 1 202 ? 16.486 51.556 3.999   1.00 65.02  ? 362 GLU A CB  1 
ATOM   1487 C CG  . GLU A 1 202 ? 16.505 50.361 4.994   1.00 79.21  ? 362 GLU A CG  1 
ATOM   1488 C CD  . GLU A 1 202 ? 15.259 50.244 5.892   1.00 79.83  ? 362 GLU A CD  1 
ATOM   1489 O OE1 . GLU A 1 202 ? 14.199 50.814 5.543   1.00 71.75  ? 362 GLU A OE1 1 
ATOM   1490 O OE2 . GLU A 1 202 ? 15.351 49.573 6.955   1.00 83.33  ? 362 GLU A OE2 1 
ATOM   1491 N N   . GLU A 1 203 ? 17.926 53.908 2.183   1.00 70.98  ? 363 GLU A N   1 
ATOM   1492 C CA  . GLU A 1 203 ? 17.972 54.820 1.051   1.00 71.52  ? 363 GLU A CA  1 
ATOM   1493 C C   . GLU A 1 203 ? 19.129 54.478 0.118   1.00 73.55  ? 363 GLU A C   1 
ATOM   1494 O O   . GLU A 1 203 ? 18.959 54.455 -1.107  1.00 73.59  ? 363 GLU A O   1 
ATOM   1495 C CB  . GLU A 1 203 ? 18.099 56.255 1.551   1.00 68.68  ? 363 GLU A CB  1 
ATOM   1496 C CG  . GLU A 1 203 ? 16.831 56.895 2.036   1.00 63.33  ? 363 GLU A CG  1 
ATOM   1497 C CD  . GLU A 1 203 ? 17.131 58.228 2.699   1.00 78.73  ? 363 GLU A CD  1 
ATOM   1498 O OE1 . GLU A 1 203 ? 18.343 58.516 2.881   1.00 74.68  ? 363 GLU A OE1 1 
ATOM   1499 O OE2 . GLU A 1 203 ? 16.177 58.976 3.042   1.00 78.69  ? 363 GLU A OE2 1 
ATOM   1500 N N   . MET A 1 204 ? 20.313 54.211 0.676   1.00 71.68  ? 364 MET A N   1 
ATOM   1501 C CA  . MET A 1 204 ? 21.454 53.840 -0.155  1.00 73.84  ? 364 MET A CA  1 
ATOM   1502 C C   . MET A 1 204 ? 21.210 52.554 -0.930  1.00 80.74  ? 364 MET A C   1 
ATOM   1503 O O   . MET A 1 204 ? 21.837 52.338 -1.974  1.00 83.86  ? 364 MET A O   1 
ATOM   1504 C CB  . MET A 1 204 ? 22.704 53.664 0.693   1.00 71.16  ? 364 MET A CB  1 
ATOM   1505 C CG  . MET A 1 204 ? 23.206 54.926 1.323   1.00 69.49  ? 364 MET A CG  1 
ATOM   1506 S SD  . MET A 1 204 ? 24.871 54.673 1.938   1.00 82.44  ? 364 MET A SD  1 
ATOM   1507 C CE  . MET A 1 204 ? 24.901 55.728 3.378   1.00 81.35  ? 364 MET A CE  1 
ATOM   1508 N N   . LEU A 1 205 ? 20.331 51.687 -0.440  1.00 77.85  ? 365 LEU A N   1 
ATOM   1509 C CA  . LEU A 1 205 ? 20.116 50.427 -1.127  1.00 76.97  ? 365 LEU A CA  1 
ATOM   1510 C C   . LEU A 1 205 ? 18.994 50.517 -2.134  1.00 75.37  ? 365 LEU A C   1 
ATOM   1511 O O   . LEU A 1 205 ? 18.993 49.769 -3.116  1.00 85.95  ? 365 LEU A O   1 
ATOM   1512 C CB  . LEU A 1 205 ? 19.858 49.311 -0.118  1.00 74.28  ? 365 LEU A CB  1 
ATOM   1513 C CG  . LEU A 1 205 ? 21.149 48.929 0.616   1.00 80.15  ? 365 LEU A CG  1 
ATOM   1514 C CD1 . LEU A 1 205 ? 21.099 47.471 1.064   1.00 84.31  ? 365 LEU A CD1 1 
ATOM   1515 C CD2 . LEU A 1 205 ? 22.415 49.216 -0.230  1.00 75.06  ? 365 LEU A CD2 1 
ATOM   1516 N N   . LEU A 1 206 ? 18.049 51.427 -1.930  1.00 68.60  ? 366 LEU A N   1 
ATOM   1517 C CA  . LEU A 1 206 ? 17.185 51.805 -3.035  1.00 74.65  ? 366 LEU A CA  1 
ATOM   1518 C C   . LEU A 1 206 ? 18.019 52.417 -4.159  1.00 84.37  ? 366 LEU A C   1 
ATOM   1519 O O   . LEU A 1 206 ? 17.814 52.107 -5.338  1.00 84.36  ? 366 LEU A O   1 
ATOM   1520 C CB  . LEU A 1 206 ? 16.120 52.772 -2.533  1.00 73.06  ? 366 LEU A CB  1 
ATOM   1521 C CG  . LEU A 1 206 ? 14.720 52.726 -3.133  1.00 81.40  ? 366 LEU A CG  1 
ATOM   1522 C CD1 . LEU A 1 206 ? 13.806 53.672 -2.339  1.00 77.02  ? 366 LEU A CD1 1 
ATOM   1523 C CD2 . LEU A 1 206 ? 14.732 53.087 -4.625  1.00 76.03  ? 366 LEU A CD2 1 
ATOM   1524 N N   . MET A 1 207 ? 18.981 53.235 -3.773  1.00 80.44  ? 367 MET A N   1 
ATOM   1525 C CA  . MET A 1 207 ? 19.830 53.904 -4.717  1.00 76.63  ? 367 MET A CA  1 
ATOM   1526 C C   . MET A 1 207 ? 20.754 52.950 -5.421  1.00 85.48  ? 367 MET A C   1 
ATOM   1527 O O   . MET A 1 207 ? 20.825 52.962 -6.623  1.00 88.72  ? 367 MET A O   1 
ATOM   1528 C CB  . MET A 1 207 ? 20.647 55.002 -4.042  1.00 72.27  ? 367 MET A CB  1 
ATOM   1529 C CG  . MET A 1 207 ? 19.911 56.314 -3.914  1.00 76.67  ? 367 MET A CG  1 
ATOM   1530 S SD  . MET A 1 207 ? 20.617 57.494 -2.773  1.00 74.11  ? 367 MET A SD  1 
ATOM   1531 C CE  . MET A 1 207 ? 22.268 56.889 -2.650  1.00 71.51  ? 367 MET A CE  1 
ATOM   1532 N N   . SER A 1 208 ? 21.447 52.098 -4.693  1.00 81.83  ? 368 SER A N   1 
ATOM   1533 C CA  . SER A 1 208 ? 22.401 51.189 -5.322  1.00 87.41  ? 368 SER A CA  1 
ATOM   1534 C C   . SER A 1 208 ? 21.866 49.851 -5.761  1.00 84.90  ? 368 SER A C   1 
ATOM   1535 O O   . SER A 1 208 ? 22.522 48.858 -5.635  1.00 88.90  ? 368 SER A O   1 
ATOM   1536 C CB  . SER A 1 208 ? 23.651 51.006 -4.470  1.00 100.57 ? 368 SER A CB  1 
ATOM   1537 O OG  . SER A 1 208 ? 24.432 52.176 -4.424  1.00 100.33 ? 368 SER A OG  1 
ATOM   1538 N N   . SER A 1 209 ? 20.637 49.845 -6.211  1.00 85.23  ? 369 SER A N   1 
ATOM   1539 C CA  . SER A 1 209 ? 20.015 48.637 -6.648  1.00 94.79  ? 369 SER A CA  1 
ATOM   1540 C C   . SER A 1 209 ? 20.015 48.581 -8.141  1.00 99.65  ? 369 SER A C   1 
ATOM   1541 O O   . SER A 1 209 ? 19.254 49.295 -8.750  1.00 100.93 ? 369 SER A O   1 
ATOM   1542 C CB  . SER A 1 209 ? 18.560 48.645 -6.207  1.00 98.41  ? 369 SER A CB  1 
ATOM   1543 O OG  . SER A 1 209 ? 17.777 49.517 -7.005  1.00 95.16  ? 369 SER A OG  1 
ATOM   1544 N N   . PRO A 1 210 ? 20.793 47.702 -8.744  1.00 102.15 ? 370 PRO A N   1 
ATOM   1545 C CA  . PRO A 1 210 ? 20.784 47.614 -10.200 1.00 100.00 ? 370 PRO A CA  1 
ATOM   1546 C C   . PRO A 1 210 ? 19.422 47.154 -10.649 1.00 97.67  ? 370 PRO A C   1 
ATOM   1547 O O   . PRO A 1 210 ? 18.932 46.223 -10.026 1.00 101.35 ? 370 PRO A O   1 
ATOM   1548 C CB  . PRO A 1 210 ? 21.816 46.540 -10.484 1.00 97.17  ? 370 PRO A CB  1 
ATOM   1549 C CG  . PRO A 1 210 ? 22.771 46.651 -9.356  1.00 96.55  ? 370 PRO A CG  1 
ATOM   1550 C CD  . PRO A 1 210 ? 21.914 46.952 -8.161  1.00 98.52  ? 370 PRO A CD  1 
HETATM 1551 O O   . HOH B 2 .   ? 16.381 47.932 7.796   1.00 80.00  ? 401 HOH A O   1 
HETATM 1552 O O   . HOH B 2 .   ? 27.641 45.578 18.214  1.00 65.68  ? 402 HOH A O   1 
HETATM 1553 O O   . HOH B 2 .   ? -3.102 66.891 19.852  1.00 61.61  ? 403 HOH A O   1 
HETATM 1554 O O   . HOH B 2 .   ? 9.171  48.392 24.925  1.00 51.12  ? 404 HOH A O   1 
HETATM 1555 O O   . HOH B 2 .   ? 19.463 54.576 13.002  1.00 56.15  ? 405 HOH A O   1 
HETATM 1556 O O   . HOH B 2 .   ? 21.789 53.499 33.707  1.00 56.61  ? 406 HOH A O   1 
HETATM 1557 O O   . HOH B 2 .   ? 11.036 49.195 15.917  1.00 56.41  ? 407 HOH A O   1 
HETATM 1558 O O   . HOH B 2 .   ? 25.501 40.964 28.384  1.00 58.26  ? 408 HOH A O   1 
HETATM 1559 O O   . HOH B 2 .   ? 15.396 42.233 21.669  1.00 61.32  ? 409 HOH A O   1 
HETATM 1560 O O   . HOH B 2 .   ? 29.022 58.988 29.299  1.00 71.12  ? 410 HOH A O   1 
HETATM 1561 O O   . HOH B 2 .   ? 16.513 42.218 23.903  1.00 55.40  ? 411 HOH A O   1 
HETATM 1562 O O   . HOH B 2 .   ? 15.418 60.466 18.087  1.00 65.84  ? 412 HOH A O   1 
HETATM 1563 O O   . HOH B 2 .   ? 14.313 52.270 39.929  1.00 57.69  ? 413 HOH A O   1 
HETATM 1564 O O   . HOH B 2 .   ? 20.492 18.947 37.474  1.00 67.59  ? 414 HOH A O   1 
HETATM 1565 O O   . HOH B 2 .   ? 2.289  60.561 21.106  1.00 62.22  ? 415 HOH A O   1 
HETATM 1566 O O   . HOH B 2 .   ? 18.087 39.388 47.397  1.00 76.76  ? 416 HOH A O   1 
HETATM 1567 O O   . HOH B 2 .   ? 17.745 51.312 39.052  1.00 68.53  ? 417 HOH A O   1 
HETATM 1568 O O   . HOH B 2 .   ? 22.668 46.094 41.735  1.00 72.31  ? 418 HOH A O   1 
HETATM 1569 O O   . HOH B 2 .   ? 13.933 44.867 18.625  1.00 49.46  ? 419 HOH A O   1 
HETATM 1570 O O   . HOH B 2 .   ? 26.692 40.449 24.682  1.00 65.43  ? 420 HOH A O   1 
HETATM 1571 O O   . HOH B 2 .   ? 19.344 30.354 41.092  1.00 67.88  ? 421 HOH A O   1 
HETATM 1572 O O   . HOH B 2 .   ? 10.449 60.614 16.251  1.00 53.06  ? 422 HOH A O   1 
HETATM 1573 O O   . HOH B 2 .   ? 21.787 39.696 42.493  1.00 64.00  ? 423 HOH A O   1 
HETATM 1574 O O   . HOH B 2 .   ? 22.165 50.101 37.837  1.00 56.74  ? 424 HOH A O   1 
HETATM 1575 O O   . HOH B 2 .   ? 18.623 65.585 26.990  1.00 61.71  ? 425 HOH A O   1 
HETATM 1576 O O   . HOH B 2 .   ? 10.329 32.757 43.002  1.00 62.21  ? 426 HOH A O   1 
HETATM 1577 O O   . HOH B 2 .   ? 16.153 46.622 10.138  1.00 65.24  ? 427 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   35  ?   ?   ?   A . n 
A 1 2   PRO 2   36  ?   ?   ?   A . n 
A 1 3   ASP 3   37  ?   ?   ?   A . n 
A 1 4   ASP 4   38  ?   ?   ?   A . n 
A 1 5   HIS 5   39  ?   ?   ?   A . n 
A 1 6   MET 6   40  ?   ?   ?   A . n 
A 1 7   LYS 7   41  ?   ?   ?   A . n 
A 1 8   LYS 8   42  ?   ?   ?   A . n 
A 1 9   ARG 9   43  43  ARG ARG A . n 
A 1 10  GLN 10  44  44  GLN GLN A . n 
A 1 11  ARG 11  45  45  ARG ARG A . n 
A 1 12  PHE 12  46  46  PHE PHE A . n 
A 1 13  VAL 13  47  47  VAL VAL A . n 
A 1 14  ASP 14  48  48  ASP ASP A . n 
A 1 15  LYS 15  49  49  LYS LYS A . n 
A 1 16  ASN 16  50  50  ASN ASN A . n 
A 1 17  GLY 17  51  51  GLY GLY A . n 
A 1 18  ARG 18  52  52  ARG ALA A . n 
A 1 19  CME 19  53  53  CME CME A . n 
A 1 20  ASN 20  54  54  ASN ASN A . n 
A 1 21  VAL 21  55  55  VAL VAL A . n 
A 1 22  GLN 22  56  56  GLN GLN A . n 
A 1 23  HIS 23  57  57  HIS HIS A . n 
A 1 24  GLY 24  58  58  GLY GLY A . n 
A 1 25  ASN 25  59  59  ASN ASN A . n 
A 1 26  LEU 26  60  60  LEU LEU A . n 
A 1 27  GLY 27  61  61  GLY GLY A . n 
A 1 28  SER 28  62  62  SER SER A . n 
A 1 29  GLU 29  63  63  GLU GLU A . n 
A 1 30  ARG 30  190 190 ARG ARG A . n 
A 1 31  ALA 31  191 191 ALA ALA A . n 
A 1 32  GLU 32  192 192 GLU GLU A . n 
A 1 33  THR 33  193 193 THR THR A . n 
A 1 34  LEU 34  194 194 LEU LEU A . n 
A 1 35  MET 35  195 195 MET MET A . n 
A 1 36  PHE 36  196 196 PHE PHE A . n 
A 1 37  SER 37  197 197 SER SER A . n 
A 1 38  GLU 38  198 198 GLU GLU A . n 
A 1 39  HIS 39  199 199 HIS HIS A . n 
A 1 40  ALA 40  200 200 ALA ALA A . n 
A 1 41  VAL 41  201 201 VAL VAL A . n 
A 1 42  ILE 42  202 202 ILE ILE A . n 
A 1 43  SER 43  203 203 SER SER A . n 
A 1 44  MET 44  204 204 MET MET A . n 
A 1 45  ARG 45  205 205 ARG ARG A . n 
A 1 46  ASP 46  206 206 ASP ASP A . n 
A 1 47  GLY 47  207 207 GLY GLY A . n 
A 1 48  LYS 48  208 208 LYS LYS A . n 
A 1 49  LEU 49  209 209 LEU LEU A . n 
A 1 50  THR 50  210 210 THR THR A . n 
A 1 51  LEU 51  211 211 LEU LEU A . n 
A 1 52  MET 52  212 212 MET MET A . n 
A 1 53  PHE 53  213 213 PHE PHE A . n 
A 1 54  ARG 54  214 214 ARG ARG A . n 
A 1 55  VAL 55  215 215 VAL VAL A . n 
A 1 56  GLY 56  216 216 GLY GLY A . n 
A 1 57  ASN 57  217 217 ASN ASN A . n 
A 1 58  LEU 58  218 218 LEU LEU A . n 
A 1 59  ARG 59  219 219 ARG ARG A . n 
A 1 60  ASN 60  220 220 ASN ASN A . n 
A 1 61  SER 61  221 221 SER SER A . n 
A 1 62  HIS 62  222 222 HIS HIS A . n 
A 1 63  MET 63  223 223 MET MET A . n 
A 1 64  VAL 64  224 224 VAL VAL A . n 
A 1 65  SER 65  225 225 SER SER A . n 
A 1 66  ALA 66  226 226 ALA ALA A . n 
A 1 67  GLN 67  227 227 GLN GLN A . n 
A 1 68  ILE 68  228 228 ILE ILE A . n 
A 1 69  ARG 69  229 229 ARG ARG A . n 
A 1 70  CYS 70  230 230 CYS CYS A . n 
A 1 71  LYS 71  231 231 LYS LYS A . n 
A 1 72  LEU 72  232 232 LEU LEU A . n 
A 1 73  LEU 73  233 233 LEU LEU A . n 
A 1 74  LYS 74  234 234 LYS LYS A . n 
A 1 75  SER 75  235 235 SER SER A . n 
A 1 76  ARG 76  236 236 ARG ARG A . n 
A 1 77  GLN 77  237 237 GLN GLN A . n 
A 1 78  THR 78  238 238 THR THR A . n 
A 1 79  PRO 79  239 239 PRO PRO A . n 
A 1 80  GLU 80  240 240 GLU GLU A . n 
A 1 81  GLY 81  241 241 GLY GLY A . n 
A 1 82  GLU 82  242 242 GLU GLU A . n 
A 1 83  PHE 83  243 243 PHE PHE A . n 
A 1 84  LEU 84  244 244 LEU LEU A . n 
A 1 85  PRO 85  245 245 PRO PRO A . n 
A 1 86  LEU 86  246 246 LEU LEU A . n 
A 1 87  ASP 87  247 247 ASP ASP A . n 
A 1 88  GLN 88  248 248 GLN GLN A . n 
A 1 89  LEU 89  249 249 LEU LEU A . n 
A 1 90  GLU 90  250 250 GLU GLU A . n 
A 1 91  LEU 91  251 251 LEU LEU A . n 
A 1 92  ASP 92  252 252 ASP ASP A . n 
A 1 93  VAL 93  253 253 VAL VAL A . n 
A 1 94  GLY 94  254 254 GLY GLY A . n 
A 1 95  ALA 95  255 255 ALA ALA A . n 
A 1 96  SER 96  256 256 SER SER A . n 
A 1 97  THR 97  257 257 THR THR A . n 
A 1 98  GLY 98  258 258 GLY GLY A . n 
A 1 99  ALA 99  259 259 ALA ALA A . n 
A 1 100 ASP 100 260 260 ASP ASP A . n 
A 1 101 GLN 101 261 261 GLN GLN A . n 
A 1 102 LEU 102 262 262 LEU LEU A . n 
A 1 103 PHE 103 263 263 PHE PHE A . n 
A 1 104 LEU 104 264 264 LEU LEU A . n 
A 1 105 VAL 105 265 265 VAL VAL A . n 
A 1 106 SER 106 266 266 SER SER A . n 
A 1 107 PRO 107 267 267 PRO PRO A . n 
A 1 108 LEU 108 268 268 LEU LEU A . n 
A 1 109 THR 109 269 269 THR THR A . n 
A 1 110 ILE 110 270 270 ILE ILE A . n 
A 1 111 CYS 111 271 271 CYS CYS A . n 
A 1 112 HIS 112 272 272 HIS HIS A . n 
A 1 113 VAL 113 273 273 VAL VAL A . n 
A 1 114 ILE 114 274 274 ILE ILE A . n 
A 1 115 ASP 115 275 275 ASP ASP A . n 
A 1 116 ALA 116 276 276 ALA ALA A . n 
A 1 117 LYS 117 277 277 LYS LYS A . n 
A 1 118 SER 118 278 278 SER SER A . n 
A 1 119 PRO 119 279 279 PRO PRO A . n 
A 1 120 PHE 120 280 280 PHE PHE A . n 
A 1 121 TYR 121 281 281 TYR TYR A . n 
A 1 122 ASP 122 282 282 ASP ASP A . n 
A 1 123 LEU 123 283 283 LEU LEU A . n 
A 1 124 SER 124 284 284 SER SER A . n 
A 1 125 GLN 125 285 285 GLN GLN A . n 
A 1 126 ARG 126 286 286 ARG ARG A . n 
A 1 127 SER 127 287 287 SER SER A . n 
A 1 128 MET 128 288 288 MET MET A . n 
A 1 129 GLN 129 289 289 GLN GLN A . n 
A 1 130 THR 130 290 290 THR THR A . n 
A 1 131 GLU 131 291 291 GLU GLU A . n 
A 1 132 GLN 132 292 292 GLN GLN A . n 
A 1 133 PHE 133 293 293 PHE PHE A . n 
A 1 134 GLU 134 294 294 GLU GLU A . n 
A 1 135 VAL 135 295 295 VAL VAL A . n 
A 1 136 VAL 136 296 296 VAL VAL A . n 
A 1 137 VAL 137 297 297 VAL VAL A . n 
A 1 138 ILE 138 298 298 ILE ILE A . n 
A 1 139 LEU 139 299 299 LEU LEU A . n 
A 1 140 GLU 140 300 300 GLU GLU A . n 
A 1 141 GLY 141 301 301 GLY GLY A . n 
A 1 142 ILE 142 302 302 ILE ILE A . n 
A 1 143 VAL 143 303 303 VAL VAL A . n 
A 1 144 GLU 144 304 304 GLU GLU A . n 
A 1 145 THR 145 305 305 THR THR A . n 
A 1 146 THR 146 306 306 THR THR A . n 
A 1 147 GLY 147 307 307 GLY GLY A . n 
A 1 148 MET 148 308 308 MET MET A . n 
A 1 149 THR 149 309 309 THR THR A . n 
A 1 150 CME 150 310 310 CME CME A . n 
A 1 151 GLN 151 311 311 GLN GLN A . n 
A 1 152 ALA 152 312 312 ALA ALA A . n 
A 1 153 ARG 153 313 313 ARG ARG A . n 
A 1 154 THR 154 314 314 THR THR A . n 
A 1 155 SER 155 315 315 SER SER A . n 
A 1 156 TYR 156 316 316 TYR TYR A . n 
A 1 157 THR 157 317 317 THR THR A . n 
A 1 158 GLU 158 318 318 GLU GLU A . n 
A 1 159 ASP 159 319 319 ASP ASP A . n 
A 1 160 GLU 160 320 320 GLU GLU A . n 
A 1 161 VAL 161 321 321 VAL VAL A . n 
A 1 162 LEU 162 322 322 LEU LEU A . n 
A 1 163 TRP 163 323 323 TRP TRP A . n 
A 1 164 GLY 164 324 324 GLY GLY A . n 
A 1 165 HIS 165 325 325 HIS HIS A . n 
A 1 166 ARG 166 326 326 ARG ARG A . n 
A 1 167 PHE 167 327 327 PHE PHE A . n 
A 1 168 PHE 168 328 328 PHE PHE A . n 
A 1 169 PRO 169 329 329 PRO PRO A . n 
A 1 170 VAL 170 330 330 VAL VAL A . n 
A 1 171 ILE 171 331 331 ILE ILE A . n 
A 1 172 SER 172 332 332 SER SER A . n 
A 1 173 LEU 173 333 333 LEU LEU A . n 
A 1 174 GLU 174 334 ?   ?   ?   A . n 
A 1 175 GLU 175 335 ?   ?   ?   A . n 
A 1 176 GLY 176 336 ?   ?   ?   A . n 
A 1 177 PHE 177 337 ?   ?   ?   A . n 
A 1 178 PHE 178 338 ?   ?   ?   A . n 
A 1 179 LYS 179 339 339 LYS LYS A . n 
A 1 180 VAL 180 340 340 VAL VAL A . n 
A 1 181 ASP 181 341 341 ASP ASP A . n 
A 1 182 TYR 182 342 342 TYR TYR A . n 
A 1 183 SER 183 343 343 SER SER A . n 
A 1 184 GLN 184 344 344 GLN GLN A . n 
A 1 185 PHE 185 345 345 PHE PHE A . n 
A 1 186 HIS 186 346 346 HIS HIS A . n 
A 1 187 ALA 187 347 347 ALA ALA A . n 
A 1 188 THR 188 348 348 THR THR A . n 
A 1 189 PHE 189 349 349 PHE PHE A . n 
A 1 190 GLU 190 350 350 GLU GLU A . n 
A 1 191 VAL 191 351 351 VAL VAL A . n 
A 1 192 PRO 192 352 352 PRO PRO A . n 
A 1 193 THR 193 353 353 THR THR A . n 
A 1 194 PRO 194 354 354 PRO PRO A . n 
A 1 195 PRO 195 355 355 PRO PRO A . n 
A 1 196 TYR 196 356 356 TYR TYR A . n 
A 1 197 SER 197 357 357 SER SER A . n 
A 1 198 VAL 198 358 358 VAL VAL A . n 
A 1 199 LYS 199 359 359 LYS LYS A . n 
A 1 200 GLU 200 360 360 GLU GLU A . n 
A 1 201 GLN 201 361 361 GLN GLN A . n 
A 1 202 GLU 202 362 362 GLU GLU A . n 
A 1 203 GLU 203 363 363 GLU GLU A . n 
A 1 204 MET 204 364 364 MET MET A . n 
A 1 205 LEU 205 365 365 LEU LEU A . n 
A 1 206 LEU 206 366 366 LEU LEU A . n 
A 1 207 MET 207 367 367 MET MET A . n 
A 1 208 SER 208 368 368 SER SER A . n 
A 1 209 SER 209 369 369 SER SER A . n 
A 1 210 PRO 210 370 370 PRO PRO A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  401 9  HOH HOH A . 
B 2 HOH 2  402 27 HOH HOH A . 
B 2 HOH 3  403 8  HOH HOH A . 
B 2 HOH 4  404 18 HOH HOH A . 
B 2 HOH 5  405 12 HOH HOH A . 
B 2 HOH 6  406 14 HOH HOH A . 
B 2 HOH 7  407 2  HOH HOH A . 
B 2 HOH 8  408 7  HOH HOH A . 
B 2 HOH 9  409 13 HOH HOH A . 
B 2 HOH 10 410 22 HOH HOH A . 
B 2 HOH 11 411 3  HOH HOH A . 
B 2 HOH 12 412 4  HOH HOH A . 
B 2 HOH 13 413 5  HOH HOH A . 
B 2 HOH 14 414 16 HOH HOH A . 
B 2 HOH 15 415 19 HOH HOH A . 
B 2 HOH 16 416 20 HOH HOH A . 
B 2 HOH 17 417 24 HOH HOH A . 
B 2 HOH 18 418 25 HOH HOH A . 
B 2 HOH 19 419 6  HOH HOH A . 
B 2 HOH 20 420 15 HOH HOH A . 
B 2 HOH 21 421 26 HOH HOH A . 
B 2 HOH 22 422 23 HOH HOH A . 
B 2 HOH 23 423 11 HOH HOH A . 
B 2 HOH 24 424 17 HOH HOH A . 
B 2 HOH 25 425 1  HOH HOH A . 
B 2 HOH 26 426 21 HOH HOH A . 
B 2 HOH 27 427 10 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CME 19  A CME 53  ? CYS 'modified residue' 
2 A CME 150 A CME 310 ? CYS 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_phasing_MR.entry_id                     5UM4 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          6.530 
_pdbx_phasing_MR.d_res_low_rotation           85.040 
_pdbx_phasing_MR.d_res_high_translation       6.530 
_pdbx_phasing_MR.d_res_low_translation        85.040 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? 3.3.22 1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.6.1  2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .      3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22   4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? MOSFLM      ? ? ? .      5 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .      6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE2 A GLU 362 ? ? O A HOH 401 ? ? 2.11 
2 1 O   A SER 332 ? ? N A LYS 339 ? ? 2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 221 ? ? -140.47 56.68   
2 1 LYS A 234 ? ? -174.57 148.89  
3 1 THR A 306 ? ? -112.93 -130.90 
4 1 TYR A 342 ? ? -59.03  -8.19   
5 1 SER A 368 ? ? -89.97  35.13   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 43  ? CG  ? A ARG 9  CG  
2  1 Y 1 A ARG 43  ? CD  ? A ARG 9  CD  
3  1 Y 1 A ARG 43  ? NE  ? A ARG 9  NE  
4  1 Y 1 A ARG 43  ? CZ  ? A ARG 9  CZ  
5  1 Y 1 A ARG 43  ? NH1 ? A ARG 9  NH1 
6  1 Y 1 A ARG 43  ? NH2 ? A ARG 9  NH2 
7  1 Y 1 A GLN 44  ? CG  ? A GLN 10 CG  
8  1 Y 1 A GLN 44  ? CD  ? A GLN 10 CD  
9  1 Y 1 A GLN 44  ? OE1 ? A GLN 10 OE1 
10 1 Y 1 A GLN 44  ? NE2 ? A GLN 10 NE2 
11 1 Y 1 A ARG 52  ? CG  ? A ARG 18 CG  
12 1 Y 1 A ARG 52  ? CD  ? A ARG 18 CD  
13 1 Y 1 A ARG 52  ? NE  ? A ARG 18 NE  
14 1 Y 1 A ARG 52  ? CZ  ? A ARG 18 CZ  
15 1 Y 1 A ARG 52  ? NH1 ? A ARG 18 NH1 
16 1 Y 1 A ARG 52  ? NH2 ? A ARG 18 NH2 
17 1 Y 1 A GLN 56  ? CG  ? A GLN 22 CG  
18 1 Y 1 A GLN 56  ? CD  ? A GLN 22 CD  
19 1 Y 1 A GLN 56  ? OE1 ? A GLN 22 OE1 
20 1 Y 1 A GLN 56  ? NE2 ? A GLN 22 NE2 
21 1 Y 1 A ASN 59  ? CG  ? A ASN 25 CG  
22 1 Y 1 A ASN 59  ? OD1 ? A ASN 25 OD1 
23 1 Y 1 A ASN 59  ? ND2 ? A ASN 25 ND2 
24 1 Y 1 A ARG 190 ? CG  ? A ARG 30 CG  
25 1 Y 1 A ARG 190 ? CD  ? A ARG 30 CD  
26 1 Y 1 A ARG 190 ? NE  ? A ARG 30 NE  
27 1 Y 1 A ARG 190 ? CZ  ? A ARG 30 CZ  
28 1 Y 1 A ARG 190 ? NH1 ? A ARG 30 NH1 
29 1 Y 1 A ARG 190 ? NH2 ? A ARG 30 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 35  ? A GLY 1   
2  1 Y 1 A PRO 36  ? A PRO 2   
3  1 Y 1 A ASP 37  ? A ASP 3   
4  1 Y 1 A ASP 38  ? A ASP 4   
5  1 Y 1 A HIS 39  ? A HIS 5   
6  1 Y 1 A MET 40  ? A MET 6   
7  1 Y 1 A LYS 41  ? A LYS 7   
8  1 Y 1 A LYS 42  ? A LYS 8   
9  1 Y 1 A GLU 334 ? A GLU 174 
10 1 Y 1 A GLU 335 ? A GLU 175 
11 1 Y 1 A GLY 336 ? A GLY 176 
12 1 Y 1 A PHE 337 ? A PHE 177 
13 1 Y 1 A PHE 338 ? A PHE 178 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#